4B7KA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-ser peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
338
Chain Sequence
GSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 105
structure length 338
sequence length 338
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7kA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7kA01
4JAAA 3D8CA 3KCXA 2WA3A 4B7KA 1H2LA 2Y0IA 2WA4A 4AI8A 4QU2A 1IZ3A 2YDEA 2YC0A 1YCIA 4NR1A 1MZFA 3OD4A 1MZEA 2ILMA 2XUMA 2CGOA 3P3PA 4Z1VA 4BIOA 3KCYA 2CGNA 1H2MA 3P3NA 1H2KA 4Z2WA 1H2NA 4B7EA 5JWPA 2W0XA
chains in the Genus database with same CATH superfamily
3QO7A 4JGYC 4GUNA 5DAVA 5A6XA 2ZX2A 5F3CA 3EQEA 1OKQA 1J3QA 4UBGA 3DYMA 2Q7GA 1MOFA 3MIFA 3T4VA 3N9OA 4BISA 1CZVA 3WW3A 1JOPA 1FT9A 4DOUA 1W0NA 2UXCB 1OZ0A 1KP2A 5D5PA 4DW0A 1C57A 4MG2A 3O1UA 4ZOLB 4I2OA 4QQ2A 1NKGA 5CBFA 1AR82 3RYIB 2J1TA 4QKDA 5FZIA 2OUHA 3AK0A 1PM7A 4BAYA 4CDUC 2YGLA 3THPA 2X0LA 2Y0PA 4HVQA 3LD8A 4W6WA 3SH3A 1AL21 1DFQA 1C5HA 4LBJA 4ZPIA 5EZYB 4LBOA 4DR3B 2OA2A 2GALA 3HBKA 3GCWA 4LKDA 3I2FA 2WZPP 4QQOA 1RYYA 5L3DA 2ZHLA 2QEXV 2W3JA 3AB0A 4XHBA 5FZGA 1Z2GA 1K73W 1RMU3 5C70A 1V55B 5J1XA 1XNRO 1YI2V 4GMP3 5IK7A 1D0HA 4BW9A 1N3PA 4RS5A 3O1SA 4GALA 1CIWA 3BOPA 1PO13 1UN1A 4ATFA 4F83A 1KP3A 1WB8A 3SPJA 3CPWU 3MUZ1 4LH7A 3X2QC 2VOKA 2HYXA 5FLIA 5KR7A 1H2KA 1TME1 1SCRA 3BFRA 4DK0A 1VEWA 1OF3A 4U2AA 5HBAA 3ACFA 5E88A 1UX6A 5DG1A 4Y20B 3BVOA 1KC8W 4DUZO 2RCVA 2LQTA 3G6JB 3VBRA 2QDRA 3CMAV 4WM7B 2YI8A 3LSEA 3I5DA 4CP9A 1RM1C 2RJKA 4P9IA 3SCGA 5LY1A 4L97A 5BMVA 2XJQA 2VZTA 4QGMA 3E35A 1ENRA 4CCOA 5IAXA 4WF9V 3VBSB 3SISA 1SC5B 4KH9A 3NO8A 2IXLA 4BIOA 5LASA 1W2UA 2VBBA 1S3JA 3IDAA 4KFMA 1QF3A 1AYN2 5T5PA 1GO3F 4BLJA 1OC1A 1I5XA 5FP8A 5DUWA 1IS3A 3NKTA 1G9BA 1UJWB 1KQRA 3AFKA 3VQYA 4M0NA 3AK1A 4LHKA 1XNBA 3JD73 2PQQA 3MF9A 3H9AA 4WCEV 1C3HA 4GX2A 3GXUA 5IW0A 2JE7A 1HN0A 2CWSA 3ZLIA 2C6SA 1GM9A 4F4LA 1BBT2 1SESA 3D6EA 3K79A 1X7NA 2YGMA 5CU1A 2HWE2 3EVKA 1AXZA 4Y20A 4QM9A 3DTUB 2V4AA 4COZA 2QM4A 1JTZX 3WNXA 3OPZA 4UVBA 2QZ2A 5EC2C 4CCDA 1LOFA 4J7JA 5F3IA 1W6NB 2XLGA 2ZZQA 3ORJA 4JKKA 2XXZA 2F4VB 4QX3A 4HNAA 2HWF3 4B3TO 2GZWA 1ULDA 2YHJA 1WJZA 2Z0AA 4CDXA 1D2SA 3OPWA 1L8DA 5C9AC 1Q82W 5AFEA 3R4UA 5FPBA 4ES9A 2D2CB 3U07A 1H8EG 1NCQC 1SPPB 3T1HO 1COV3 4R4ZA 1WWYA 4CS2A 2VU9A 4JGZC 5EBWC 1XE7A 5IWAO 4GKJO 4AHYA 4YPJA 4G28B 4BDVB 3PLQA 2WNOA 1AYM3 1R1A2 3K03A 1KJLA 1F7YA 1PO12 1XILA 2R063 4Y22A 2A0LA 4LBKA 1EV13 1H8VA 2F4PA 1W06A 3DUIA 3J26N 2O1QA 2RM21 1HP8A 1JU3A 4Y1YA 1FJGO 1A6CA 1N0JA 2XKPA 2X10A 3HKBA 1HW5A 5E89A 1ZBA2 3D5OA 4COUA 4QXKA 3W5NA 1UL9A 3KCCA 3FAVA 1KDKA 1QGLA 3W58A 1GU3A 3K3OA 1ASJ2 4YG6A 1Q8IA 1SHWB 4ZS3A 4JI4O 1R64A 4XF1A 4ASUG 5GZEA 1XSQA 1QNMA 1YIJV 4M4RA 3VGIA 3O0XA 4FLYA 3WR0A 5A6QA 3N9NA 1TMF1 3DXRB 3V0AB 3L9JT 3JBG3 2WDBA 2LGWA 2PAEA 2EXJA 1ZZ6A 5AC93 2YEVB 3JD72 2XASA 1LGCA 1H30A 5A3WA 1NA1B 1AX2A 3AG2B 1OUXA 2MEV1 5IFTA 5GLUA 2OS2A 3ABLC 3UT5A 2W1SA 1BBT3 5G05L 3K2OA 1RUF2 1ZL8B 4P9OA 1NBMG 1XREA 4FMTA 3PJQA 1RM1B 1QNWA 1Y74B 3B94A 2HWE3 5EZWA 1AVBA 3ILRA 1CZTA 1UZWA 4GB33 3BCCH 4U36A 2QE7G 3N2GA 3MPBA 2ZT9B 5CA1A 3R65A 4MT8A 5JJJB 1NTZH 5ACA2 3HNMA 4ABMA 3U0ZA 4DV6O 4MGTA 2FB5A 1F23A 2ZGOA 5CA6A 2W6IG 1EUUA 5FO8B 3VDDA 3K5LA 3OB8A 3RMXA 1NXMA 1P4RA 1VMJA 2RE9A 4KG8A 3O1MA 4LNUB 2RS51 1COV2 1YQ5A 1F4AA 4GCZA 2UXXA 2WC2A 3R66A 1IBMO 4CH5A 3ABMC 4BH9A 4QX1A 3BA8A 1AYM2 2VW0A 2ZXQA 3UETA 2AH2A 4O2BA 3U14A 4R9DA 3DC6A 2R062 1NLSA 1X82A 4MTXA 2WWUA 3WG4A 4OUEA 3RGBA 3K5NA 1I1EA 2OVUA 1NR1A 1F5JA 5F32A 4MH0E 1W28A 1EV12 5ITZA 1FFTB 2B46X 3RMYA 2WA3A 5AVPA 1OLQA 1VALA 4LOTA 1ZBA3 3M2MA 4OZXA 2RR13 5EBLC 4IV1C 2ZINA 1TMF2 2D3RA 2VULA 2VVFA 5LW9A 3BODA 3FKSG 1EZJA 4BXSV 2D93A 4MW3A 1A34A 4P30A 3W9AA 3LDBA 4XUPA 3N4MA 1U96A 4CUBA 2JDPA 4IEYA 2HWB2 1GZCA 1UW8A 4LOSA 3TBDA 3VBBA 1AUYA 4U7NA 4YW3A 4YFWA 2E7TA 1YQ2A 5AC92 3ASNB 3SPGA 2PY5A 3ZIXA 1UY2A 4CU6A 2R70A 4EEQA 3LIHA 5FYVA 4C0BA 4ZKTB 5CFCC 2EIGA 4WM8B 2D3PA 1MSWD 3NL1A 4DUVA 2OQ6A 1RUF3 3NV2A 4ZY9A 3K46A 1FKAO 4JPRA 3V0AA 3WDWA 3VB9A 2FMLA 2VS0A 4LF5O 2FCVA 2X6AA 1QR8A 2XHKA 5TSWA 5LEJA 5C3OA 1OOPB 3J8F2 3THCA 4U3JA 5DDJ2 4Z92B 5FQ0B 2YYOA 2ZGQA 5L3GA 1MS1A 5KXBA 1P7BA 2NNUA 1ZX5A 1QVGU 1NA1C 2PYTA 2IJHA 2VZQA 4XJZA 1W8OA 4TT3G 2AGSA 3F2ZA 2AZ2A 1A32A 3AEIA 3VDCA 4KMQA 1RVF1 1E5HA 4OFGA 2A73B 4I3PA 5FIXA 2PN5A 3MIEA 3AZXA 2DVBA 1ZYBA 4LBEC 4E4EA 1POV3 1AJKA 3CCJV 3VN4A 2HJDA 3F7VC 1E5IA 4XZUG 5AG2A 1XBFA 3EFFK 4DRVA 3CBNA 1JOJA 4LPLA 2P7TC 4NJ4A 5B1AC 4BK5A 1RB8G 3K06A 4JTNA 3DSQA 1AI4A 3KV9A 3T08A 1DGSA 3WP5A 1KDMA 2R9AA 2K46A 1RUG1 2VZPA 1C8M3 3OUJA 2R043 4OZOA 1M5IA 4W6YA 2ZGRA 3ZO0B 4K20A 3M3EA 2RS31 3VHOA 2RR12 4HANA 1HR0B 1YXWA 1FS0G 1LJ7A 4ZXKA 3W20A 1YVWA 3T1HB 2FL4A 2RG4A 1YHFA 1Y9QA 2VRZA 1AVMA 3LSQA 4CC6A 1NQTA 1N3QA 2VW2A 2KG7A 4V2WA 2GH2A 4JDNA 2EXIA 3WF2A 5SV8A 1Q8QA 4GZRB 3VQWA 2CV6A 4GWMA 3A0HZ 3QH6A 4XUOA 1UX7A 1RINA 1SZBA 3H1KH 3IC7A 2ZCWA 3BTAA 4UFHA 5FLXN 2GN7A 4K21A 5IY5B 3WUDA 1V55C 5L9RA 5DZGA 4KUMA 2JDYA 3OSDA 1JH5A 1EN5A 1NJIW 1N4CA 2QQLA 4TLGA 1Z5WA 3APBA 4F6RA 4K0KB 5GALA 1IS4A 2X8KA 4JI8O 3RWNA 1QNYA 2F4VO 4FFFA 3FN9A 1UU5A 1O9HA 2GMEA 1RUH3 1D5AA 1FI2A 1RUOA 3I3EA 4ZZ8A 1KJRA 5H2FZ 1E79G 3LGRA 2EJRA 3RFRA 3KD4A 4N43C 2B4KA 2HH9A 2XONA 2IJIA 1SKVA 1JQ0A 3VKMA 5JOYA 3ZHVA 5AFBA 4CH4A 4QAWA 5L3CA 4WFGA 4AFCA 3ZPOA 3K5MA 5IJ0B 3OCPA 3VBUC 5IAVA 2TNFA 2VQAA 4DY3A 2ADQB 2XL7A 3AVSA 2ORZA 2D6OX 1FNYA 4LFBB 1ACCA 2PXJA 4NTYA 1W04A 1SETA 1XBLA 5J2UB 5BY5A 1NR7A 1HX6A 4O65A 3VQVA 3C90A 3USUA 1JFFB 4GX1A 4GLXA 2WNUB 1C8M2 3F5TA 5EK0A 4XMIA 1UMZA 1FMD3 1W6QA 4X1YB 2BEOA 1LTEA 5LMNO 1TME2 2P06A 2V4DA 4DMIA 2PLV1 3H0OA 2E7AA 4NPRA 1M4WA 3ZS8C 5FR3A 1VBE3 4JGYA 2ZDIA 2DDUA 2WJSA 4LT5A 4QU1A 1Z7S3 1REDA 4RQEA 4MSVA 1PPJH 4NHXA 2VZUA 1DP0A 4AGGA 1I94O 1Y3TA 1H9PA 5LA0A 5T52A 2HWC1 3RYKA 5BXZA 3E8HA 2Q8OA 1WCQA 1MQTB 5F5AA 2FDHA 1KECA 4MADA 4CPBD 4UVAA 4PELA 1DTOA 4X1IB 1TUEB 4PDLA 1LOBA 2XMLA 3PHMA 3EYPA 4WFFA 4ZI7A 1D2DA 3I3QA 1J84A 1HB1A 4I5SA 2XJUA 5LBCA 1YSCA 4JHZA 1OCRC 1KGYA 4DR7O 4X6RB 5FMBA 1WLEA 3C3TA 4LCUC 2ZKLA 1BVP1 4GWJA 5KUKA 1B6QA 2F17A 4FM2A 5FXVA 3OM3B 4IW3A 5G04L 5ISLA 5C8CC 5LOVB 3POFA 5DMYA 1W6PB 3AC0A 2UURA 2Y34A 4XABA 4FFBA 5EZYA 1VBD3 1UAIA 4LBMA 5A7NA 2P2KA 4XFIA 5B3SC 4RD7A 2O8QA 2B7YA 2JJ2G 3ZHSA 1MS0A 4WFHA 2BVBA 2MEV2 2WS92 4JVAA 2NZ9A 3CC2V 3LOBA 4ZBMA 1OSGA 3FBMA 4Y3OA 1J95A 4IEXA 4KL1A 2IU0A 3WB1A 2FKXA 2ILMA 4DR1O 4FO9A 5DN2A 5GW7A 5EYYA 2NYYA 3IIIA 2NP0A 3WDXA 3EO6A 3FB7C 1EAH1 2VECA 1FMD2 4AAXA 3THDA 4JGZB 1ND3B 5LBBA 3MDPA 2VTXJ 2X6CA 2K9ZA 3CX5F 3NAPB 4NPMA 1W8ZA 1N8RW 1MNGA 2PGGA 1BHGA 1VBE2 1K3EA 1JUHA 1NUKA 5I0TA 3OPTA 2W0FC 1RVF2 1AR4A 2BVVA 2ITCC 4MO3M 2VNOA 4N21A 1XMQB 4CEWB 2MNGA 2VCCA 5A7OA 3VHNA 1OHHG 2CTRA 4IEWA 4ZZ5A 2AHYA 3EXAA 3PUHA 2DURA 2VVEA 2VXRA 1GKBA 3DXRA 1WW4A 2PELA 2DWEC 5T55A 1GM7A 5LL6Y 2R16A 3I4IA 5H6QA 4CDWB 2B5HA 2PMWB 3NJYA 4E9KA 5LRRA 5KX5B 1K3IA 1HNXB 2UYAA 2GC0A 3NVCA 2GTSA 4AVBA 4CEYB 3OMAB 5FTTC 1ASJ3 3ZKUA 1VE0A 2HJFC 4O9GA 2LROA 3PMEA 1BK0A 5JVDB 1OI6A 4OI1A 1RITA 5EJZB 1HB4A 3SH5A 2OCCB 2L9LA 1V9U1 2WABA 4EV0A 5LZ6A 3MV11 5FZAA 2WZEA 3OD4A 2XUMA 1E1RG 1LOFC 4NAMA 3LNNA 1QDOA 1K5MB 1VQKV 2QKCA 4KBBA 2DTYA 4YYOA 4A5UB 3SEEA 1ULFA 4YIOA 3MF6A 5K0UA 4QKNA 4QGNA 4RQPC 3JSLA 5BR8O 1YQ8A 5BMVB 4K1ZA 2A7WA 1CAUA 1PK6A 2Q67A 4PV1B 2JIJA 2B9ZA 2HG5C 1PZ9A 3LIGA 4AF9A 3ASNC 4OPHA 1CR7A 5GTHZ 4O61A 5JOZA 1S0CA 3ZRWA 2UXCO 4GB32 5GTIZ 4I0XB 1EPWA 1L3JA 4CEYA 4YJ3B 5D8AB 5FMDA 2ZGNA 4RYDA 5T5OA 2JG8A 2BNNA 4QX7A 1BCCH 2QWRB 1MG1A 1TA8A 2HKOA 5IK4A 3PU3A 2D6NA 5JSRA 1XUQA 2Q1ZB 5C4WC 1ND3C 2PYLA 2FTKA 1RUI3 2WSVA 4G3YC 1SQPH 4GKKO 4WM8C 4QPGA 3VKFC 2OZJA 3I2GA 4LA2A 2BTQA 2HEYF 4FM0A 1PNLA 2WFF3 3K5OA 4XE9A 3VD9A 5L3BA 3UKTA 4NB5A 2IBZH 2VMCA 2CU5A 4ASMB 2D3OW 1FOD1 1K34A 1EAH2 5EYXA 4EB6B 1NZIA 5FP3A 2HEPA 4WFBV 3L74H 2LUWA 1YJ9V 1GZTA 1UKRA 4CDXB 2EAKA 3TGUH 1HLCA 2P3KA 4QQHA 5L3EA 1DGWX 1P7GA 4WFEA 3AMPA 4JHTA 3VZLA 4WBBA 1DDLA 1OQEA 4OYUA 4QPKA 4UXAA 2EILB 2D44A 3CXHF 1CX4A 2KA3A 2P4VA 1QJU3 3KG2A 5F6LB 5HI0A 4KWJA 3RI8A 1RUG3 1TG7A 4XJWA 5C8CB 2Q0OC 3KHCA 1NX9A 4LMFA 3IDEA 1US6A 2QTSA 1W6OB 4EQVA 5IJ9A 5KMGA 4WM7C 5FPLA 1W6MB 1QLNA 2BWCA 2QTOA 2ZA9A 3KVAA 5LXTA 2D5FA 2VMIA 1FFXA 3FFZA 3ON7A 1RUJ3 3HQXA 4IEZA 1PO22 2ZR3A 4DUYO 3MZHA 4A3ZA 4DV0O 2W52A 4NIDA 3AG4C 5KHHA 3A4UA 3NV1A 4URTA 1IURA 3NKGA 4CPBA 4LULA 4OCTA 4JI6B 3E6DA 4YZ2A 2IZWA 5A1FA 4N9IA 3G6EV 1LR1A 1QXPA 4AWDA 4O9EA 2HVJC 4TXWA 1AR72 1GWMA 3WQBA 4XBFA 3ACHA 2ERFA 3N36A 2RJLA 3GZUC 3CWBH 2XR4A 2HLDG 4YM0A 4EN6B 4XURA 4B4RA 4I4TB 1UY1A 4X1KB 5BPXA 1AR61 1GNYA 3ELNA 2WPDG 2IH3C 4XQWA 2VQEB 3OR6C 4Q1PA 1FV3A 5CIRA 2Q8DA 2BSKB 2A1XA 4BE3A 1GUIA 3JZVA 4ORFA 1FX5A 3ZMZA 4GKXA 4MHRA 2Z42A 3ZFFC 4CCNA 1LECA 4J1XA 4W4KA 2EICA 4NXNB 2LJ2A 1RJ7A 3H1MA 1H8TB 4I3GA 5IK5A 4FPCA 4MVZA 1GN4A 3ASIA 1DGWA 1AR81 2WFF2 3FLRA 5JDBA 2IC1A 3MW2A 3SYQA 3GDBA 4RN5A 2DCYA 4JI1B 4H7MA 3T4ZA 1EAH3 3VDAA 1QY4A 1N0NA 3FL7A 3I2JA 3N9QA 3WQ7A 3SH4A 4RHV3 3N9LA 2BYVE 1V9PA 5CBGA 1TVGA 2SLIA 4RFRB 2Q8VA 2YMZA 1SLIA 2D43A 1VPHA 2E75B 4K0KO 3ZRSA 4DV1B 4GULA 4QDSA 1XMQO 3I2DA 1S5LZ 1RUG2 3ZXFA 1JHNA 1KQSU 4QPIA 2V09A 2A7AA 2R6QA 2WLQA 1AR5A 4YVWC 4E2GA 3BN6A 1UKGA 3N9MA 4LF6B 4OI2A 3BTZA 1HB2A 1I5YA 1WLTA 3N2KA 1PKXA 2UXBB 4DR2B 4DXWA 2FZ1A 4GX5A 3K48A 1VBA1 1FPN2 3QLQA 2RHPA 1LOEA 1U0AA 3FC0A 1Q86W 2DN9A 4JTCB 3W59A 2UXNA 2JS5A 2JGDA 2EAAA 2Y48A 4A44A 4PDWC 3QVNA 1GZ9A 1VP7A 1P8JA 4RQPA 2YS8A 5F5IA 5KMGB 1CAVB 2RS52 2LM3A 5C9AB 5KLVH 1J1TA 3WF3A 1S5JA 4D6QA 3CMEV 1XYNA 4FPFA 3VBOC 5EIBD 2BNMA 4FT8A 1WP7A 5K9YA 2J1EA 2UY9A 2OYZA 1ZTEA 5APAA 1DQ1A 2H3OA 1RTVA 2Z79A 3RZJA 4B29A 1SZXA 1KMIZ 1VBB2 1GN6A 4RO2A 1X33A 4YJ2B 1C1LA 3P1IA 2Y6GA 2P67A 1CIYA 2EILC 1V6IA 2B1IA 4LKFA 1AR62 2Z4FA 1V6NA 5FO7B 2YC0A 3EB7A 3SPIA 1P84F 4FLZA 1RUE2 1CPNA 3VL8A 3HVDA 2BBVA 1PGSA 4FLTA 4Y4RA 2X05A 4YY3B 4I4TA 1C5IA 3QH7A 1KEXA 1VBE1 4X8AA 2YICA 3KMHA 5L7OB 2J1VA 5BNNB 3L2YA 1C28A 1XPWA 2G38A 1TNFA 4JV4A 1N1SA 2CGPA 2WN3A 3KZIZ 3O0WA 4I0AA 1FMD1 3NXSA 2XAFA 1H2MA 3P3NA 2FZ2A 2LW7A 2YIDA 5EPAA 1L0LH 4RS5B 2ZE8A 3BB6A 2Q6AA 3I59A 4XQ4A 1QOSA 3CRAA 4MGYE 3WFVA 4AEDC 1ZLZA 2CTWA 5IJRA 2H0BA 4OXSA 4B3NA 2RJ2A 3E5XA 1Z7S2 4R50A 5ANNA 3E1F1 1S2EA 1QJU1 4GJYA 1IPKA 3JD2A 4TOIA 3RYPA 2P6JA 1Z0HA 1JUIA 2RDRA 4AVCA 3TK1A 3POBA 4W8JA 2Q68A 2W68A 1OF4A 3K77A 5L36A 3ACIA 1SQXH 2A6ZA 2WZR3 1W0OA 4XW3A 1FOD2 5C7GA 4ES8A 4QPIB 2MPFA 2XWJB 2AHZA 3LEKA 1YJLA 5IDJA 2EIDA 4LITA 4KP4A 3ZYFA 2BOBC 1OLMA 4LLFA 5FZ1A 2QKAA 5CFCB 2WO7A 2ARBA 1UOFA 2JK5C 1SBFA 1JCHA 2ETNA 4ZHQB 4K8ZA 2VMGA 1RMU2 3ES1A 3QF7A 5CG9A 4B1MA 2X53S 4B3MO 4X20B 5CZKA 4UI9L 1WCDJ 4UWDA 1VBD2 2LALA 2Y69C 2IFWA 3KVBA 2B9VA 4COYA 4M01A 4IHJB 3THTA 2DYRC 3VKLA 1S0JA 1VRH2 5FXXA 4CDQC 4INDA 3MICA 3ZN6A 1IXBA 3JD1A 3K3WA 1LEDA 3JD71 1O8SA 5FPXA 3CJIC 3MIGA 2BW8A 4BU2A 4CEWA 2AREA 5LY2A 1PK6C 1PNGA 3BY6A 5EJ3A 5A7WA 2BWAA 4Y26A 2Q4PA 1SLBA 2BV4A 5L73A 2RS12 2QGNA 1GK9A 4V1PA 1YJKA 3ZDVA 4QWNA 4LQRA 2LTNA 1UFIA 1YNAA 1R1ZA 1UXXX 1MQTA 1ZZ9A 5CYYA 5DN6G 4QJFB 2JENA 4BQ4A 1G9DA 5J2TB 2B1GA 2K1EA 2ZGSA 4AILC 4TWTA 4KU8A 4DV0B 2XNDG 1OCOC 1V9U3 5EIYB 5HCFA 2VNVA 4PIYA 3ZR6A 2YIBA 4CP0A 4ZHQA 4EROA 4LBQA 5CA1B 4C0HA 3J7HA 3J7NA 1ZVFA 4Y1UA 4DUWA 1WBFA 1WD3A 1LHNA 1RVF3 1V54C 1G9FA 3WG2A 1H2SB 2Q1MA 2YIAA 3HKBB 3O0VA 2N04A 3UL2A 4I0BA 3T4DA 1NTMH 2P4KA 3OTOO 1OHFA 3WVJA 2R0FA 2QWPB 1W8TA 1M56B 2JWPA 1PVC2 5CKMA 3WXPA 2Q30A 1R3KC 2WO3A 4B3RO 5E1RA 1K5MC 3I2KA 1NG0A 4LFCO 1E5SA 1QJX1 2BERA 3AYEA 1QHTA 1MS9A 4KHPB 1MZ6A 4E4SA 3P32A 4XILA 5IVBA 2QQPA 4META 5IYYA 4IV1B 5LP6B 1RUF1 2P3IA 3B00A 3UM7A 2LW8A 2EIEA 4ITCA 5JPNB 1NOVA 2WNVC 3BAAA 2D98A 1W6MA 3LPFA 4B3SB 4LFAO 1GP4A 1NS1A 3RVYA 1U5ZA 4WZFA 3LDRA 2D6PA 3WINE 3S3WA 3VZJA 2JGUA 4LIUA 1FFXB 1WLDA 3M1HA 4RAIA 1NLQA 5JQGB 2GC1A 5H9CA 4NRPA 3G67A 4BQ2A 5F5QA 3CC4V 2PLV2 1HRI3 2DV9A 3SCFA 2PYJA 3SQOA 4Q4X1 4DV7O 3LUTB 1YI9A 1S0DA 2LRPA 3WP3A 1S2BA 4L2NA 4FIPC 4Z82A 4YZ4A 4Y24A 3SDLA 5CADA 1H2LA 4I30A 2W9XA 4COVA 2V73A 3STZC 1B35A 2DW4A 3H8OA 3LQCA 1ULOA 3UQ8A 3CF6E 4PJ0Z 3M3OA 2WLPA 4FPOB 2E32A 4AEKA 1YI7A 4EE2A 2EIJB 3WHUA 2OW4A 3VV1A 4P00B 4DV3O 2X29A 5CFDC 2RMU1 1QVFU 1V9U2 1VBD1 2F6BA 4JASA 3SYOA 2O57A 1A8MA 3FFQA 1O3TA 3ITQA 5D21A 2ZX3A 3BUCA 4QDQA 1FJGB 3N7JA 5F7UA 5DZFA 5C8CA 3MYXA 2G19A 1W8WA 1QLEC 5LHHA 3T2PA 1X9TA 1YUDA 3WV6A 3LA3A 4CZZA 1AP6A 1I3HA 4CUGA 4UXNA 1UYZA 2VVDA 2ZEXA 4KNCA 3S6PA 4QX8A 1WA8A 1J59A 5D2AA 1GICA 3W21A 4L92A 4ARXA 5FZDA 1CPMA 2DWRA 1WB7A 1VF5B 1W05A 3H8RA 4HAMA 3ETEA 3NAPA 5JLVA 4YHHO 2AXTZ 5J98B 1VF6A 5LBQA 4NROA 2HWC3 2QQWA 3AP9A 5GLWA 4YVSA 2P17A 1ZZBA 1W9SA 2KSDA 1F4HA 5FZFA 4QDRA 3RSJA 4K6BA 3HD8B 5I0DA 5IWFA 3N2KB 4XAEA 3C3VA 2JB8A 5AC91 4I7ZB 5LGUA 2ZAAA 1N1VA 3ST7A 4P9XA 2XAQA 5J36A 5D5QA 3OOXA 1SQVH 4QX5A 1AX1A 2PLV3 4QGPA 4UT5A 1FPN1 1XEQA 2VQTA 5FY4A 2VOTA 1VQ7V 1S0FA 4ZIBA 4LE3A 2DF7A 3ZXEA 3LCPA 4AGVA 1PNMA 3ASOC 4U3JB 3K9AA 4FZ0A 1LNQA 1G8WA 4JTDB 4XDOA 3HBZA 4J11A 5FNVB 1DLCA 4W65A 2CTPA 5JQGA 5T3NA 2WYFA 4HLTA 1AR73 2DOSA 2VPVA 4QB1A 2DYSC 3ZXGA 5JVDA 3AP4A 3B93A 1DQ2A 4YVSC 1RUD2 4YJ2A 5FZ3A 5H6RA 1YTFB 4MXVA 3GALA 5A3NA 1NXD1 4NR1A 5H9PA 1DF0A 4XF4A 2E51A 2QWOB 4JI8B 4LIVA 1R093 4PA7A 1ORQC 4KU7A 3LSUA 5B3SB 3KCXA 2YXHA 4DXSA 3BTYA 1M1KW 1AXYA 1RHI1 3V0BA 3VBOA 3A0BZ 2CH7A 2GBOA 1ZWIC 4A7YA 1JA8A 4TV9B 2RMKB 1EUTA 2GDFA 3H1IH 2MHFA 1RSOB 4JKLA 3KQ4B 3POJA 4N8MA 1GLHA 3ZM8A 4Q29A 4XUNA 1ZBE2 2IM9A 4FLXA 1OCCC 5J2UA 1EPZA 5E6HA 3KS7A 3U75A 1MS8A 4RHV2 2WLLA 4Y5Z0 1QDCA 3J8F3 4RA0A 4FPGA 4J42A 2E9QA 3IAQA 5IYDO 1YFUA 2Q73A 4U3FH 3OGRA 3OGJA 2HKXA 4HSLA 3B7MA 1GOGA 4Q20A 4Q5OA 3LE0A 2Y0IA 3T09A 4OHWA 2WQZC 5H5NA 4TN7A 1X59A 2E33A 4J41A 2W92A 1FXVA 1IQDC 1AP5A 2KKWA 4JGYB 3VDDB 2ETEA 3NSTA 4UCVA 1JX9A 3H3ZA 2UU9B 3J81N 2Y6LA 1J58A 5CMUA 1PO21 1YYNA 1ZM1A 4YGBA 2VCMA 1W9WA 2IFRA 5CA0A 1R3LC 4CH3A 2ZAHA 4OX9O 4A7KA 3JAWB 5HCHA 1R081 4JKMA 2JRIA 2PF4E 3HN3A 3AXDA 1W2BU 4P9WA 3OJBA 2ZKNA 1H0BA 3MD0A 2AW9A 3PVBB 2F43G 3OT7A 1LGNA 4CXXA 3WZ1A 4AI2A 4AI0A 2BTOA 3ZMNA 3CRRA 1DZQA 2PHRA 5ACA1 3ZIWA 1OA4A 2R32A 4GH4A 3K75B 4UAPA 1K8AW 3H7JA 4GJZA 3BTXA 5BXXA 5KHJA 3WW4A 2HWD2 4ZHNA 3O1TA 4YSFA 1YRZA 1ZX3A 1PZ8A 4XPVA 4OPAA 1PO11 1TUBB 2NQYA 1PIV2 4BQYA 3JASB 1UD1A 1VAVA 1UPSA 3MO4A 3ETDA 4DS0A 3B9CA 2PTMA 3J4UH 2ZE5A 3IDCB 4Q0UA 2CDOA 3I2IA 4LF9B 1JZ3A 3ZJZA 4BW5A 4PF1A 4YLZA 1CAXA 4RGKA 5FZHA 2AENA 1W0PA 2JG9C 2R30A 5CA0B 1Y9GA 2AZ5A 4J6GA 3LEGA 3JATA 3OBZA 2WLIA 4TV8B 4NE9A 4B3MB 5KXEA 1ZREA 4HVOA 4FOYA 4DR5O 4Y1XA 4WVZA 2AR6A 5C6CA 1ZBE3 4CDWC 1DQ4A 5JWPA 1MS4A 1HV0A 2W1UA 4CP1A 1VAMA 1R1BA 3ZYIB 5FFOC 2A9HA 4CDQA 5DAWA 3H3LA 1RUH2 5JZGC 4LF8O 1NYWA 1OOPA 1NY72 4LK7A 5FY5A 3ZKYA 1C4RA 2JDZA 1CZSA 4AOCA 1NZ6A 4DYLA 3ASOB 2Y8KA 4YG3A 4DNYA 2ZPXA 4LHNA 4Q27A 4W6XA 5D1IA 3OEHG 5DQ0A 2VO5A 1JMKC 1OCOB 2YV8A 1V6OA 1LHWA 4OQ8A 3H1HH 4DV6B 1AYN1 1OBNA 4UFKA 2ZEZA 3UCSC 4M4PA 3C3SA 3N27A 1MACA 3ICXA 1QJEA 2GP5A 3D4KA 2M6YA 2Y26A 4COWA 5FCCA 1N32O 5JSPA 4AFDA 2YB7A 1W6PA 1PGW2 2FDKA 2PI4A 4Q4V2 4K3UA 4XIKA 4A41A 1YIFA 4DR4O 3ABUA 5IVVA 3VBSC 2VL4A 3E6BA 1S0BA 3INAA 3NNGA 2YU2A 2N05A 1XNKA 3LB9A 4B3RB 5GLVA 5E1AC 2HYKA 4OX9B 1O9GA 5JOXA 2FHRA 4AHZA 5FDBA 4MXWA 2CAUA 5BNOA 3CKHA 1CAWB 2OXBA 3HKEA 1PIV3 4QHBA 2LP7A 4PDVA 2RDNA 3F7YC 5C4WB 1QJZA 1GZWB 4S2FA 4UBHA 3BU0A 2AUYA 3FHAA 1S0GA 1VRH3 3PN1A 1S55A 2DBNA 5ABJC 1IBMB 3OGGA 1LUWA 4QQPA 3R4SA 2WNUA 2LFSA 5LMNB 4IE4A 4TLFA 4GWIA 1NQDA 5F2SA 3HR9A 4QQLA 3H1LH 4HYOA 4OI4A 3RWKX 3RYIA 2XKOA 3GJAA 3MLKA 1MVEA 2P22C 2OCHA 3QOPA 2BGPA 2X5IC 4B1LA 1LEMA 1BL8A 2YEVA 2FD8A 3WY6A 2TEPA 1QJY2 4NTWA 2UXBO 2BRTA 4KWKA 3S57A 3WNOA 1AILA 4IYIA 5FZ4A 1RUC1 3WU2Z 4EN7B 5JZGA 3HKCB 3GZEA 4LORA 2JKBA 2FQPA 4IV1A 1WW7A 1HQNA 3RI9A 1GWLA 2AEYA 1OPOA 4CU7A 2GUZA 2ZABA 3WUCA 4FSJA 4KGQA 3GZTB 1FYJA 4UW5A 1VQMV 4DV1O 3VKNA 3EMRA 3VBFA 4WVMA 3WG1A 2VBDA 4YZ1A 2RM22 4O4LA 4IEUA 5JXGA 2UUBO 4CA9A 1UYXA 5CEHA 1PVC3 1W2TA 1WUVA 1RIRA 4ZS2A 1GNZA 4CSWA 3QG5A 1KBHA 3M70A 4Q8LA 1DLLA 5LOVA 2ATFA 2K0GA 4Q4V3 1K45A 4E8CA 1C1FA 4V2VA 4NHYA 5IYCO 3PVOA 1W99A 5LHGA 4BIZA 3Q8AA 3DPRA 4X89A 1HNXO 3UJQA 3VBSA 4JI5B 2WT0A 3E97A 5JR7B 4MV2A 3WDYA 1EFRG 1VLNA 1G7YA 3K4AA 1O4TA 4IE6A 2OQ7A 4FBFA 3K08A 3IFXA 4A7ZA 4BQXA 1MZ5A 4I9WA 2XWBB 2HWF1 1HRI2 1FATA 5FBZA 3CCLV 2VXJA 4EN8B 1NA1A 3RPQA 3K0DA 1SDDB 1GANA 3JB4C 1SACA 3LA2A 4PLMA 1ZRDA 4K8FA 2TBVA 2DFBA 2RDQA 4PDRA 1YZBA 5KC5A 1Q43A 5LATA 2UU8A 2G4IA 2TUNA 1BHAA 3TYJA 2XUEA 3GGLA 3Q8CA 5DUXA 1XNDA 4CH6A 2EF6A 3IPVB 2QSAA 1SBDA 4LJHA 1IKPA 1BEV1 3NR7A 3OBRA 1HR0O 4EFBA 3ZMVA 2WZ8A 3VBHB 5C93A 1DYPA 3ABTA 2E7QA 2WL1A 3OE7G 4NIHA 1Y76A 1OH3A 2R041 3ZN6B 2ZM6O 1QOTA 4LF9O 4AI3A 4IL7A 1POV0 4IEVA 4XUTA 1JZ8A 3CEIA 4AI9A 2VUAA 3ZYRA 4A42A 4CC5A 1URFA 4TQFA 2NN4A 3AX4A 2Z5WA 1XMOB 1O3QA 1FXHA 3ZMUA 3B8NA 2IXKA 5FYUA 4MTGA 5EFUA 4U7OA 1JXNA 1QOOA 1FXKB 1NVPD 5E79Z 4NIIA 5BNQA 5LEKA 3B4SA 2WLLB 5FREA 5A32B 3I2HA 4DXZA 3RWRD 4R8HA 1LRHA 5CVRA 2A6XA 5FY1A 1O59A 2CDPA 5JAXA 4Y33A 1BQ0A 3KSCA 5LBFA 1LAJA 5FZCA 5DUUA 2FYUH 1Y4WA 3VZMA 1RUE1 4FPKA 3RZHA 4LBQD 3CCMV 3DF0A 1XNAA 1QKQA 3CL1A 4MVTA 1VQ4V 5J3UA 1AI7A 1OA3A 4ZU7A 2UUCB 4FP2A 1JJOA 5JCOC 4XUQA 2ZGPA 1QEXA 1SZTA 4UF0B 2CYFA 4FXGB 4DXTA 1HXS1 4BOWA 1WAZA 4LO6B 4B7KA 3SXWA 1DQ6A 1THZA 3SGIA 3W7UA 4JRLA 1AL23 4DV2O 3GHNA 1DQ5A 1YJNV 4ATEA 1W9TA 4R7CA 4MYEA 4MGZE 3FB8C 5IT6A 4NAOA 2A3XA 4XXPA 5LP6A 2ZJCA 3KT4A 1AZDA 5FAXA 2C4XA 2OX0A 3V65A 5B1BC 2Y60A 3GNEA 4RQPB 2Z5UA 2X5IB 2QE3A 3GWKC 4CS4A 1KXGA 3AKTA 3HKDA 1RUNA 1QJU2 2EULA 4E27A 4S2HA 1XOYA 4CCLA 4NHMA 3RNSA 2ZHKA 1MABG 1H8TA 3ZYBA 1MZEA 1WZXA 2QVSB 1XNQO 3A7QA 2ID4A 2VUCA 1K5QA 2RR11 4W4ZA 3KF5A 1R092 2OCCC 5K8SA 1R1A1 4AFAA 1GYKA 5B66Z 1NTKH 1S5HC 2PA7A 1UF2C 1H6XA 2HP8A 4A2UA 4QHZA 1EYBA 3FYIB 2CGOA 2W08A 1ALYA 1ZZCA 4LF4B 2XVLA 2Y33A 3JD4A 1OD3A 4I0WB 3CRMA 1I5PA 1SA0A 3E5QA 4UVCA 1UZVA 4E2LA 3NV3A 3UYJA 5LMUB 3CB2A 3SJQC 1YFWA 5DXDA 3AG1B 4XDJA 4OI0A 4JYAB 4YM1A 4NRQA 5KHKA 4P14A 1CPYA 3WW1A 1X4TA 1ST8A 2DYCA 1RHI3 1GTOA 3GM8A 4I50A 3KT1A 4C1WA 4I01A 1TEIA 4FFIA 1IG0A 1W2OA 1W8HA 1HXS2 5LK7B 2EBOA 1ODMA 1MPXA 3OGIB 4LFCB 2L35A 4Q4V1 3G4SV 4XFFA 2JG8B 3I59B 5KXDA 2VOWA 2OIGA 4JV5O 4O4JB 1K97A 1GV9A 1XDCA 1JYWA 3FLTA 1HWYA 1PVC1 2VUJA 1WLWA 1CX1A 4LR4A 1DGLA 1OJHA 3GBWA 1BBT1 2VW1A 3K04A 4DRRA 4LF6O 4IUGA 3TOJA 3ZRVA 2PAKA 3OUIA 2K2SA 3TN91 1V00A 3MFAA 4GMP0 3DPRC 2DCJA 4RFT0 4QXBA 2IJKA 4DV3B 2I07B 1Z78A 2XHNA 2V1DA 3A0NA 3OUHA 2ZZJA 4XJUA 3FHQA 3ZVXA 1WBLA 4BQ3A 1ZRFA 4JCKA 2GDSA 3AKQA 4M3CB 2C9AA 3RVHA 3U37A 4RUFA 1QXRA 3D36C 1SERA 1PGL1 4X65B 2ENRA 4MTFA 5B4XA 3ZFGC 1MS3A 2XAGA 1LCLA 4AYUA 3ZYJB 2Y6KA 4GX0A 2A5ZA 3H7YA 4IGPA 1YJWV 5FYIA 4DO0A 2ZKOA 3O1VA 1AX0A 2P5OA 2P6HA 5T5JA 2IWGB 1UPIA 1VMHA 4Q0PA 3A0RA 1D7PM 1P49A 1VRH1 2UUAB 2UWAA 3GCXA 1PVXA 3QACA 3DKQA 1KITA 1KD7A 2CNAA 3APQA 5CFDA 4XAAA 2GSMB 1NCQA 5FY0A 1PIV1 5DECA 2DTWA 4XBLA 2YZ4A 1AYM1 3ZCCA 5KHGA 5LHIA 2HHHB 1F31A 4MVUA 1RC6A 3FUQA 5T50A 3M8AA 1V6LA 3CCEV 4B7EA 3D36A 3NAPC 3VZOA 5CBLA 4FOVA 2H0VA 5LWBA 4MOAA 3FB5C 2VMHA 2ZACA 5L3FA 5FZOB 1AR93 2WINB 1N36O 1R6TA 1Y6XA 2G1MA 5LGTA 2E5LO 2HWB1 3KCYA 1BKZA 3B40A 5FUIA 2EIKC 4AQYB 3E8GA 3AMQA 5HPOA 3ATGA 2N74A 4UFZA 3MEPA 4MVMA 1BS3A 5GKAC 4HN0A 2R1BA 3LSSA 3SYPA 2GMMA 5DZEA 2H8PC 2WS93 3T1YB 5BNNC 3MPPG 2RJZA 3JCUZ 5EBMC 3SLIA 4PD4F 4UCTA 3E22B 2NM1A 2WRAA 2QDOA 5TISZ 4LFAB 3H1YA 4AHCA 4NRMA 1U5IA 2MK3A 3A2FA 3T2OA 3WG3A 1KYOF 3JARB 4YW5A 2XJPA 3OUSA 3RG0A 3H8XA 2QKDA 3PNAA 4O4IA 2F23A 4XF9A 4X62O 1W8NA 4FPPA 1O7FA 1PM4A 2XH6A 1ONAA 5C33A 1CESA 2JD4A 1JVMA 4DO2A 4R4XA 4IL6Z 2WNVA 3HPLC 4BYYA 2UUBB 1V0AA 3CCSV 3HT2A 1S76D 2EALA 4Q6GA 4HZFA 1ZBE1 1JJ2U 4S2GA 2E53A 2PHTA 1FPOA 1MZFA 1Y67A 4FFBB 5IWAB 4GKJB 3PL0A 2NMNA 4BCUA 3UO3A 3ZPYA 2PFWA 1QU7A 2GP3A 4FFGA 3T0DA 1SDWA 5B1BB 1S72V 5HCAA 4HMZA 1YIPA 5A3MA 4CUCA 2JJ1G 2XB6C 4RR3C 1LODA 1H38A 4HZ3A 4CP2A 3FMGA 4DV7B 3N3HA 1UZYA 2WZR2 4UCUA 1VQLV 4JI5O 1VMGA 1GOHA 3POWA 4ZKIA 3ETQA 3JAKA 2XBO1 2XJSA 1N3OA 1SG3A 3Q9OA 1M06G 3SCHA 3VBFB 4LKEA 3ROUA 1G8MA 2PHFA 1KUQA 1XL4A 3BU7A 2Y0OA 4PJYA 5C9AA 4NXMO 1OA2A 4NMIA 2BDRA 1RXFA 2E74B 1W2AX 2BJSA 2JB4A 3FLPA 4C1XA 1US2A 1BQZA 3WDUA 4CDUA 2XVKA 1BMV2 3ENRA 5BNPB 4G27B 5KAFZ 4AG4A 2VCAA 5DUVA 5F2VO 2DCZA 4ET7A 3E6CC 4LFBO 4B8EA 2VOXA 5I0SA 1R083 4DIQA 4EKWA 2VWJA 4AEDB 1BZWA 3Q4HA 1KKCA 4XFGA 1NH2B 4YXWG 4CUAA 4XDPA 3CD6V 2Y64A 4QMAA 4YW4A 1CWPA 1SPPA 4ZU5A 5FY9A 4RS5C 4JI0O 1XSRA 1JPXA 4LA3A 2O8OA 1K5JA 3W7SA 2RS11 4HG6B 4X1IA 2Q8EA 1CAWA 1XHXA 1BEV3 1OCCB 3P6BA 2R073 1YQ6A 5FUNA 3SYCA 2ZXWB 1PMIA 1LR5A 5FWJA 5C3RA 3WNNA 4P9YA 3WD5A 3OW2U 1Y43B 4MGIE 2QQMA 1Y66A 4XDLA 4X20A 1IXMA 1HNZB 3RYHB 2WS91 1ROPA 1ZSPA 3A8TA 4AK3A 5C3PA 1SF9A 2ZIMA 1VBC1 3FAVB 2VQEO 4UFMA 4WM7A 1WMEA 1IBKB 1NQJA 2B42B 3PVEA 4HK8A 4YGCA 1Q6UA 1RUI2 4JQRA 1WMDA 1D5NA 1Y7BA 4Z07A 1IOAA 1AR91 3SMHA 4AZZA 2YY1A 2I45A 1GAXA 2W0XA 3VDDC 2JICA 3KWVA 1QCEA 1SS3A 4HVRA 4N53C 4XTMA 1UOGA 5I93A 4NIGA 1X36A 3B02A 3BALA 5J2TA 3GVMA 2VMEA 2JG9A 5DPNA 4LBNA 1F9KA 1HKDA 1W6OA 3L70H 1CAUB 1PK6B 5KAIZ 4EN0A 4C8DA 5HV0A 2ZGMA 1NAEA 2IJJA 4TQDA 1S1AA 3DL3A 5FNVA 5SV5A 4CCJA 2IVJA 1VQOV 3JALB 4L11A 4NHKA 4FVMA 5JOWA 3OBTA 1JZ7A 2OPKA 3C7HA 4MLOA 1YFXA 3JD0A 1QQCA 2VWKA 4QE7A 4UW3A 2WQ8A 3VDBA 3H01A 3D3QA 1CJDA 3OTOB 5LRSA 3QNEA 1UYPA 1NCRC 3OY8B 2XOKG 4PCRA 3AZWA 2Y6FA 3VHRA 3ZFFA 3UT0A 5GONA 1V6MA 3MUY1 4QU2A 1R082 1OURA 1YCIA 3PUSA 5LCWL 1NU1H 2BTQB 3KGLA 1NE6A 4K7JA 5F5CA 2YROA 4LR3A 1IKQA 4K40A 1PHMA 1H8TC 1UQXA 3N7KA 3NNFA 2RVAA 3BYWA 5IT9N 3NNLA 1NT2B 3VD5A 1FV2A 4Y22B 1BQPA 1YLLA 2NN8A 3E2EA 3P5BA 2DUPA 2Q0AA 2WSSG 1MQTC 2A6WA 4Z2AA 5IJ9B 1HNWB 2RDCA 5LXTB 1JYCA 4MS2A 4LEJA 3H9VA 2EVXA 4YZ3A 1W9YA 5FUPA 4O4LB 5FJKA 3U10A 2OTJV 1G6NA 1NLRA 5FZBA 2RDSA 1UY3A 1KS4A 4UB6Z 2YUEA 4YVWB 5FKCA 3RQ0A 5GLZA 1IBLO 4CU8A 1UXZA 1VR3A 1IVSA 1UWWA 4JC1A 3PJSK 3O5SA 1XOUA 2VTXA 4IT5A 3K57A 1LOCA 4PA3A 4BWAA 1REEA 1OKOA 1VBC2 5T5LA 3ES4A 4Q0QA 3CZJA 2DMXA 5K1XA 5ABJA 2LGQA 2Z69A 2WKKA 2F66C 2CH7B 3ZSLA 1DYKA 4FTBA 1PP9H 3CDZB 3U1XA 4X6QB 5H9SA 3VLBB 3PIJA 5A32A 4TV9A 4CDWA 5A1LA 4FOWA 4AVVA 2QWQB 4GH4B 1CAVA 2O0OA 3NRUA 4LWSA 1UY0A 4AE2A 4QXCA 4S2DA 3ZHTA 4JI7O 3WW2A 2NPIA 5FXWA 3Q8EA 4QPJA 5EHDA 2EX3A 2ZBJA 1J3PA 5FO9B 4Q8KA 3VUOA 4HKWA 2JS3A 3AMMA 1H8HG 1WA4A 1FAFA 4X8NA 1GNHA 1LHOA 5A1AA 3KV6A 3IZOA 1ENVA 2GU9A 4D69A 5C8WA 4H33A 5I91A 4P9JA 1CXZB 5CN0A 4CEYC 2VUDA 1Y9MA 4Y1VA 3C7EA 3ZFFB 2J1SA 2QM7A 4AQ2A 3CSXA 3APOA 3DYOA 3T30A 1LHVA 1WD4A 4XFHA 2ITDC 3MFCA 3VBHA 4H55A 2YXYA 4YFZA 4FTEA 2QUOA 4BK4A 2ZCEA 4BLIA 1SQQH 2JECA 1Y76B 1VARA 1BJQA 1HXS3 4YW6A 2JKXA 2HJIA 1JZ2A 4Z1VA 1GR3A 1L7QA 3LFIA 3AG3C 5IYZB 4ZU4A 1STMA 3AYCA 4NXMB 1AR63 3HNBM 4AVTA 3UK9A 5F2WA 1G9CA 4Q4Y1 4LWSB 4P5HA 5BYNA 1RUE3 2QQKA 1WW5A 3D82A 4K35A 2D40A 4IE5A 2RQ6A 5F39A 3QBQA 2BTVC 3AZVA 2JGDB 2AZ0A 1H1IA 3NWKA 2FMDA 2M7WA 1LU1A 4IE7A 3WDVA 4UV8A 4PT6A 1K42A 4X8PA 3ETGA 5FP9A 1W3XA 1K4DC 4Q2FA 1UOBA 4AQYO 4YWAA 4J25A 4I9QA 3A0KA 2A6VA 1YEWA 4R8CA 5HXMA 3M7AA 1WMXA 1LKNA 4X1YA 1PM9A 4LP8A 2BP6A 3C7OA 3PURA 4TUYA 2D97A 4ZONA 2Y38A 5C71A 5B1NA 4WBNB 3RS6A 2L6LA 3PIGA 1XI1A 3LDDA 4RGGA 2DBIA 4Q0VA 3JD3A 4SLIA 4XFAA 2GNBA 4NWWA 3IN9A 3RYCB 4PLOA 3ILFA 4JAAA 5F9TA 1D4M1 2JDAA 3FJSA 2B5UA 2BSKA 3ZBHA 2P3YA 3Q8BA 4EB6A 4XVHA 2VQUA 1Q6HA 1DIWA 3V64A 2CSGA 2JE9A 5EYPA 3ZEDA 5J96B 1ULEA 3DC5A 2ZOEB 3RYFB 3MHHC 4LXLA 3TNPB 2FCUA 1XNTA 1EM1A 3VBHC 1VF7A 4DW1A 2ZNJA 1U12A 5BNOB 5ITZB 3ZIAG 1ZUQA 2XPJA 4JYCA 5C8YA 1FOD3 2LS6A 1DF4A 4ISQA 3WG7C 1SLCA 2XBO2 1IBKO 2WFF1 5GZGA 1WNSA 3J8F1 3W7TA 2PHUA 5JPMB 3CQOA 1AJNA 1LUVA 1R3JC 5CA3A 4G9SB 3S0MA 4K9SA 2WLKA 1SFNA 4BMBA 5B1OA 1D0GA 3WF1A 4WBNA 2BZDA 5BNPA 3J7MA 2WA4A 3MW4A 4HKLA 2UU9O 1F2NA 1X8EA 3ABKB 1XRUA 3D3IA 3TB0A 4Y5SA 3CCVV 2OTLV 3WF4A 1WGPA 4X64B 3T1YO 5E8AA 5EYPB 2F4LA 5FPRA 2WNVB 3AKRA 5EV7A 3RYFA 1X8MA 2RNBA 3OFNG 1ND2B 2BUKA 1U5YA 4CZSA 3H1JH 4H2AA 5CAZA 1XC6A 3AYAA 4CU9A 1TNRA 2JDIG 2F95B 2GMPA 1MS5A 1UO9A 2ZGUA 1L7RA 3VBRC 3A23A 5LBEA 5CNAA 5C5TA 2CDYA 3K4DA 4D6SA 3WQ1A 4CBCA 5CBHA 4DV2B 5FQ0A 4PHZA 2WT2A 3CMGA 4H0LB 4HXCA 1VQ5V 1L7LA 4JZGA 4DB5A 2W39A 1JI6A 4ASLA 5C4WA 3JASA 4M0HA 2VZVA 5FJHA 4DEVA 4JAUA 1CN1A 3R6SA 3ZFEA 3DN7A 3MLJA 3POYA 2WT1A 4AQ6A 5EP9A 5DAXA 2EZOA 4ZXEA 3WLUA 1HJFA 4OUSA 5EWSA 2FBEA 2PHXA 3N35A 5LA9A 2BQPA 2LO1A 1EP0A 3T1MA 3ZXAC 4ARYA 3FD9A 3JQXA 3ZDSA 2WWJA 3ZMTA 2QNKA 2J1UA 1C8NA 3ZXJA 2AGAA 2OUJA 2CAZC 4FFKA 3Q4HB 1DGRA 4O7XA 2JDMA 5JJNB 3FX3A 2GC3A 2QM8A 2HVKC 4LF7B 3ZRXA 2W94A 3ZOIA 3JB8A 4KI5M 3VZKA 1MMMA 3SR2C 5FLJA 4FQZA 5JXIA 2R0HA 5ERLA 2Q7EA 1OQDA 4R6ZA 1IPJA 1LGBA 2KXLA 3HN1A 1OD5A 3V56A 1JFFA 1JOBA 1HDJA 5GONB 1SQ4A 2X7RB 3K9SA 5BV6A 4FCAA 1QQP3 5C5UA 1OCZB 1FYUA 1AROP 1DCSA 2EIMB 4D94A 4KBZA 1SFPA 1WP8A 3BGAA 5J37A 4YW7A 1WW6A 2IW5A 3R0RA 4XHXA 4XETA 2QCSB 4GIQA 1VBA3 3WB2A 1E5RA 5KXCA 2WBKA 1DF5A 3LWCA 1W8UA 3TWIA 2RMU3 4IERA 4LH6A 4IGQA 1IBLB 4EYUA 3TEWA 2GTAA 4DR1B 3ZXLA 2DQ3A 1IX9A 3HJRA 1ZRRA 3IB3A 4N90A 1VQPV 3ZRWB 2FMYA 2R072 2XTAA 3BIEA 2ADEA 4L87A 5FYHA 1F35A 2QBXA 3RZGA 3LSDA 2ARHA 2ZHNA 2W1QA 2VJXA 4N23A 3CIHA 3ZN1A 3HKEB 5C3SA 1DZTA 2YFZA 4QKBA 2VM9A 3POSA 4AQTA 4RHV1 1KRIA 5JR2A 1S4CA 3MLLA 1WA8B 4OHZA 2DYSB 3B9IA 2DU1A 1I6XA 4WFAV 1Z5VA 4NUBA 3QD6A 4Q4X3 3J7LA 1JYTA 2WN2A 3VL9A 3SITA 1AB3A 1HRI1 3CNAA 2ZE6A 4YW1A 1JHJA 4PA6A 2CGNA 1AR83 2ARAA 3ZMOA 3ZHUA 1IG3A 3O1OA 1BSMA 3CJXA 4DXRA 4CCCA 3CHXA 2ZDIC 2IU3A 4W50A 3CS5A 4LBLA 3IT8A 4D7SA 1N36B 2ADDA 4KWUA 2XVGA 2J7MA 5LA6A 2Y4TA 4L0PA 2XT9A 1PMHX 4O2AA 3VHPA 3AL5A 4J7ZA 4F6EA 1OT5A 4WVVA 4MW8A 4G2KA 1OLRA 2VOVA 2QQOA 2YU1A 3RJRA 4IEQA 3MV01 4Y1ZA 5FYZA 1QHDA 4O4HA 3EHKA 4XMAA 5CB4A 4GT1A 5FMOL 4JYYA 4QM8A 1R6NA 2NR5A 2IXHA 1ZAUA 4YGDA 4LBQB 1YTFD 4CS3A 2H94A 3BEHA 1B35C 2PHDA 3B5LB 2HEWF 3WP6A 1GKFA 4FI9A 2YIBD 4FFHA 4Z8BA 1BT8A 4R9BA 2HBTA 2KM2A 2JIGA 5FYTA 5CKQA 1B06A 5A3TA 1XE0A 4BQ1A 3OEAA 3CO2A 3TEZA 3ZSJA 2C1FA 2C2AA 2ZEWA 1US3A 4HKOA 1FNZA 1RUJ1 4OQ9A 2QZ3A 3MHSC 2WAOA 2CHHA 3QCWA 4NVPA 2ARXA 3CC7V 3WEZA 1LNSA 1GMMA 1PGW1 4D3WA 4PI0A 3DPRB 2HLEA 3Q8FA 2ET7A 2ZD9A 3AXEA 4RR3A 2FCTA 4WM8A 5A3OA 3ZFGB 1B3QA 4TZDA 1RL3A 3ZYPA 5I8YA 4X1KA 1E57A 4FPLA 5LMUO 1RUD3 2B8MA 1MEC1 2ZS6B 2WQ4A 3W7WA 5FZ8A 1ZA4A 1L1FA 2VR4A 4YVSB 4AEJA 3T4HB 4IDZA 1EN4A 4JZ2A 2G9FA 5A6YA 1W0KG 3JAMN 5CB4B 1Q6IA 3IIAA 4P5YA 4GA9A 1RUH1 2HEVF 2WYSA 3BA9A 4LHLA 1K7DA 1IZ3A 2IXIA 2RV9A 3JALA 1LULA 1PD3A 4D6TH 3TCUA 4QB6A 3PUIA 3GHMA 4BQ5A 2VMDA 4TWKA 1J83A 4BQWA 5H9QA 1WPBA 2Y6JA 4E4DX 4BA6A 5FYSA 1QU0A 1QH6A 1OPMA 1UIJA 3RT3C 1B04A 4OVEA 4IXLA 3LNMB 3RZMA 1LOGA 5IVFA 5DG2A 2X09A 1VIWB 2HWF2 1PL4A 1S2KA 2YC4A 5E16A 1GH6A 5FP4A 4AVAA 4EZ4A 1M57C 3B2EE 4RR3B 1Q8VA 4IYHA 4NKGB 5F3GA 5A7SA 1DK1A 5JSOA 4DV5B 1G1XB 2VG9A 3AP6A 4QGLA 5JMOA 1FXKC 4MGKE 3M99B 3PTYA 2WZR1 4ONUA 3O65A 4LF8B 1H9WA 3AMHA 2ZNIA 1R091 2YXSA 2JEUA 3B01A 2CWMA 4PF5A 1IS6A 4JI2O 3VKOA 3CZUA 3CYOA 2JVDA 4E2QA 4LKSA 3VBUB 3ZMSA 4J9ZB 1RUD1 3ACGA 1UPGA 2D3SA 1Y74A 4TSVA 3B77A 5EJ1B 2JIZG 1TZOA 1JU4A 4DUYB 2AEZA 4O4HB 4BIUA 3S5QA 2VE1A 1EZVH 4YZ5A 5A33B 1GP5A 5A3LA 2BOJA 2BNOA 3H50A 1GQPA 5IHRA 4FK5C 3RDIA 2R1DA 3FUOA 1OUSA 5I8TA 4IGGA 1WPXA 2J42A 3WNMA 3SYAA 4I09A 2VQ0A 4UFLA 2HHHO 4LLOA 4JYAO 3KT7A 1QJY1 1OCRB 3A21A 1X9PA 4FAHA 2HWD3 2YFUA 5I0RA 1JMUB 5J7MA 4O2BB 2HFEC 3DKWA 1ZZ8A 4LO5B 4YM2A 4P02B 1XE8A 5IUQA 4H7LA 4YGEA 1HW7A 4X66B 2BBAA 4R52A 2UWBA 3BHPA 4QKFA 2Q9LA 2QFEA 4LHSA 3GYDA 1HRV3 3NMBA 4JTOA 4D6RA 1QH7A 3AG1C 4IEPA 1T6BX 3FE5A 1M9NA 1N1YA 4NOTA 1PL0A 4FZ1A 2KG7B 2A70A 3ZSMA 3E5UA 4YNIA 2MW2B 2A71A 3B8MA 1DG6A 3ZXDA 2WNUC 3CCQV 1T6GC 2YUAA 2YC2A 3JARA 2UXDO 4RQFA 3E8BA 3TXSA 2YPJA 1LESA 3CCRV 2W2IA 3T2TA 4GD4A 3ZHRA 2EZPA 1KFXL 4ASKA 4OHVA 3GB7C 2VNGA 3ZN5A 4B4QA 2Q69A 1XYOA 4QPGB 5FZ6A 5BR8B 5DAQA 3IMNA 1N1TA 3E86A 1DYOA 1ND2C 1N34O 4PA9A 1NT0A 5GLTA 4D0QA 3ML0A 4IGOA 3PJYA 2WIIB 4Q4W2 4XFCA 3WNLA 1M4UA 3BIWE 3MBWA 1F4MA 4DPNA 2C24A 1CAXB 4CRQA 2QQUA 3LPGA 2VZSA 4RSUA 1K92A 4BPZA 5FZOA 2Q7HA 3DXTA 4JAVA 1XXNA 1GFF2 2RS32 3T2QA 3S30A 2UUAO 4JGSA 1BHBA 5HXVA 3HOBA 2CTQA 5GZFA 2BGOA 1YO8A 2WO1A 3C8XA 4JI2B 3DECA 1A78A 2JEXA 1ZZ7A 1OQ1A 2DU0A 3D0JA 4J9YB 1N32B 5FYYA 1KKDA 5JMCA 2XJVA 2D6LX 4Q1RA 3HKDB 4L99A 4N53B 4OGQB 4AL9A 3HQUA 2GH8A 3UKNA 3M3QA 5DM6V 2V5DA 4CDUB 4X88A 3NJZA 2JX9A 2JG8C 4Y5TA 2OT5A 3O1RA 1J1LA 2UYBA 1JYVA 4GB31 1RP3B 4C91A 1AF9A 3RZZA 3NNMA 4H37A 3URFA 4MZUA 3T0BA 4O4IB 2VCBA 4JX0A 2HWE1 1JR9A 3PMSA 1HRV2 4AEDA 2P6CA 1F4NA 4QPGC 1QJX3 4HPKA 4HONA 5LK5A 1HDKA 5DDJ3 5KBFA 2E63A 4E4HA 2F1MA 4XACA 1URXA 3I55V 4Z2WA 4H44B 2UXDB 1YC61 3G80A 2BPA2 1QLEB 2XDVA 5I0UA 4AI1A 2HWD1 3SPCA 2ATKC 5F37A 2DFCA 1IGOA 1QJY3 2VY0A 2QJVA 1G6UA 1ENQA 2ZGLA 3WQ0A 4P9GA 4KHPO 1RSOA 4GKYA 3USSA 3UGHA 4TSFG 3T2MA 5J09A 2CTVA 3ZX6A 3N9PA 4FPYA 3RYHA 2R72A 2XGXA 1ZRIA 1BCXA 5GZDA 5CFCA 1J3RA 5T54A 2KB1A 1MR5A 4CXYA 4MVOA 2PUSA 4UB8Z 4DRXB 1GZWA 5FXZA 3BRCA 1HJGA 3A22A 5FPZA 1AJPA 3K51A 2DUQA 1H6YA 2RM23 3AVRA 2R042 3PU8A 1EV11 5FL7G 3ZR5A 5BZBA 2C5DA 4NWVA 4OMCA 2WLHA 3E83A 3KQRA 4I55A 3CU7A 4BR6A 4K8XA 4IESA 1NY71 3BPZA 5B4NA 2NLRA 4OLLA 3E8FA 4FPEA 3ACLA 4KQ7A 3HMYA 3RZLA 1GQHA 2WLNA 1XQNA 4BXFA 4AEMA 2JE8A 3JAWA 3HKCA 3LDCA 3JYCA 4P9PA 4X9QA 2V4VA 2BE3A 1WMFA 2I2SA 1LHUA 4DINB 4QX2A 1VJ2A 1RUI1 4IEOA 2BOCC 2ZR2A 1VMFA 1ENXA 3OUFA 3I97A 2QQVA 4GH4C 4AGRA 4MVSA 4XDKA 5FMCA 3BI3A 3ZFEB 1HB3A 1VBA2 3TNQA 2EIBA 3MDSA 4FP3A 1BGYH 3FYEB 1B35B 3DGEA 5EXOA 3AMNA 1QJX2 3HR0A 1H4GA 1OLME 1VQ8V 1OXCA 1W03A 3IBMA 1R3IC 3NJVA 2WR9A 1O6UA 1CD3G 4E8DA 2JJ6A 3D3AA 3I3BA 3RW0A 1H2GA 2QJ1A 4HNAB 4QNHB 2IXCA 5IE9A 3SHRA 4F6RB 3AK3A 2WLJA 3GZAA 2OKXA 1V70A 1NH2D 5LA6B 4LF5B 5K1PA 3OGVA 4YARA 2BOIA 4DK1A 4F7ZA 1I0HA 3I54A 2WLIB 1ND2A 5KA6A 3FBYA 4XF3A 4EZHA 4XCBA 3HWJA 3C2UA 4YY3O 3UNPA 2VZOA 1WN7A 1ZRCA 3AZYA 2GC2A 4MXWB 4Q4X2 5CB7A 5BNPC 1CGPA 1I08A 3ZSEA 5JCTA 4HETA 1F8VA 5FYBA 1HNWO 2GV9A 2ZM6B 2E26A 4A6SA 1IS5A 5B2GB 3G6BA 3I56V 3OGSA 4IV3C 4UUJC 4JDOA 4H14A 1XB9A 1BK1A 2JDUA 4IE0A 2ORXA 1BEV2 1TME3 2LW1A 3SEPA 1N33O 1I94B 1CP9A 1ASJ1 1AHSA 3E22A 4MTOA 3KHBA 3NJXA 1XQ8A 4KWLA 4KXRA 2VMFA 4GWNA 4JI7B 1GBGA 4AW7A 5LA2A 3CXCU 3FZ3A 4PIZA 5CG8A 2IH1C 3LA7A 3SJCC 2OWOA 4FPHA 5C3QA 3TEYA 5DDJ1 5JXJA 4K1YA 1GMGA 3GBGA 3UV9A 3NNJA 2WNEA 1APNA 3F95A 3WNKA 3POGA 2X6BA 1GOFA 3AJYA 4GYCB 3ABZA 3WOGA 1YFYA 2R9IA 4XIOA 5HFLA 1JZ4A 5FPVA 2DYRB 2B39A 3F5WC 4X66O 3MAQA 3AZZA 1O5UA 1XNCA 2UWCA 1AL22 5EC1C 4BWOA 3LDKA 3KF3A 2WLMA 3SKJE 3CE2A 1Q56A 4JF3A 4MVQA 1XU1A 2SBAA 4JGZA 1XNRB 2XAJA 4I02A 5FY8A 3C7GA 3SJBC 4BHPA 3NQHA 5JIUA 3FB6C 2QR4A 3WB0A 1EN6A 2EINB 4GKKB 2D6KA 3PDQA 1A8DA 4G4FA 3JBG2 4DR3O 2IVIB 1BE3H 3CRCA 5J9PC 4ISRA 3S3XA 3M3IA 1POQA 4M3CF 1SA0B 2ZX0A 4GXLA 1KU9A 4PI2A 5GJ6A 1NCRA 4D8MA 4LNUA 1RPRA 3SC7X 4LO7A 3ZSKA 1U5XA 4UW4A 4GZ9A 5H9RA 3SJAC 4D7TA 1M93A 4TYSA 5I8SA 1GWKA 1S0IA 1VRBA 4XBQA 3B09A 3LFMA 1PX3A 5GZCA 3I8TA 1TE1B 1MA1A 3JSNA 4FLVA 5JZGB 4JI6O 3OBAA 1W59A 5ABJB 1FXZA 3FHIB 2P5BA 1U97A 4DEQA 1QQP1 3ZFEC 5JCOA 5BUVA 3JUUA 1PMJX 1K33A 5L7OC 1IDSA 4KGGA 1KFUL 1RHI2 3SNMA 2EXHA 4B3TB 3HQRA 3OD0A 1KB9F 4CTEA 1H1AA 2VC9A 1QXJA 4M3CE 4YIPA 1GQGA 3WT3A 1H2NA 2P37A 1UYYA 3IAPA 1SBEA 1K5SA 2BCCH 4LO4B 1K5MA 2P4EA 1Q81W 3ZFGA 5IVCA 5FK7A 2DVFA 3BPSA 1HRV1 5FZMA 1QIQA 2ZMLA 1HQWA 1NZCA 3HT1A 3K3NA 4J7KA 2XG3A 4XDQA 3BABA 4IIJB 1NVPB 4NXNO 3RZKA 1F15A 4CE8A 5HCBA 1YWKA 3VQXA 4AQSA 3O14A 3K4ZA 3DV8A 1Y4MA 4OHYA 1AXKA 1S77D 1PGL2 1BYHA 5K0UC 3M7MX 3JBG1 3I49A 1TQ5A 1TMF3 5B1AB 4YHHB 3VBOB 5JH7B 3UGGA 1SLAA 4YJ3A 4IV3B 2P1BA 2ZMKA 4LK6A 2W95A 3STLC 3MIDA 2ZGTA 1G86A 3C7FA 4YW2A 5FK8A 2QWNB 5EIBC 3S5AA 2CAVA 4FM1A 3IAYA 3CCUV 4EN9B 1RFYA 5L19A 3X2QB 3I7DA 3M4FA 4GAZA 4QPWA 2ODMA 1DBNA 3KV5A 2Q1FA 1VF6C 1BMV1 4RWUA 3IJ4A 1JYNA 5D8AC 4XJ8A 1YITV 1V6JA 2AYHA 1BZKA 4QT6A 2UY8A 4IIJA 4XTPA 3WP4A 4YG0A 4EWEA 4C7UA 3DEMA 5FPUA 2VZ3A 4L8JA 2CL2A 1UMHA 4P9LA 2DJVA 4TUYB 5FYMA 3KKYA 4N43A 5A70A 2CY6A 5DABA 1SRYA 4UCRA 1TVKB 3JATB 3OYWA 4DV4B 1LB2A 4IETA 2W5FA 3SPHA 1AI6A 4JI4B 4JDMA 2A06H 1NE4A 1COV1 4YM3A 1VQ9V 3JCIA 3T0AA 5CISA 1YF2A 3G71V 4HL0A 4LC1A 5LGNA 4K8RB 1IPSA 5ANQA 5J48A 3JCZA 2HR3A 4JQTA 2YI9A 1DHKB 2J1RA 4XJ9A 3GJBA 4R9AA 1AR92 2YG0A 3MIBA 4FPJA 5FV3A 4F8AA 1WLCA 1K9MW 1WA6X 1SMVA 2C0ZA 2CK3G 1Q5OA 5D8AA 3HB3B 2DVAA 4UCOA 1XHZA 5C8YB 5K7PA 3IMMA 3HPNA 4H3WA 3USUB 1O3RA 2Q4SA 1OCZC 1M56C 2YSUB 5A7PA 1JS9A 2E6VA 3OMIB 3MW3A 1T5EA 1V54B 4DFSA 3RYRA 4L8QA 4Q4W3 3IC9A 1H1MA 2DWDC 4BZ4A 4MHUA 4IQPA 4AI8A 4Y4YA 5IFPA 3OGCC 5IY5C 4MGQA 1TVKA 3TRSB 4UFJA 4JI3O 3H3UA 1NCQB 1LU2A 3AG4B 4D7YA 4P2ZA 2PI5A 1BMFG 1GM8A 3KZ4C 2QTWB 2EINC 1REFA 1ZA7A 3DXUA 3V0BB 1E1QG 1COWG 1Q8OA 2RS33 3POIA 1VB2A 1RXGA 1MEC3 3W7XA 1D4M3 3CJHA 2Y4UA 1DZRA 5FZLA 3O12A 1N33B 1RJ8A 3AK2A 2W46A 3O9OA 4Q0SA 3LAGA 4E4ZA 1HNZO 1RUJ2 3KB5A 1HIXA 3ABLB 1RUC2 4QE9A 5FZKA 3PUQA 2G9GA 2N7GA 2W91A 3AG2C 2C9KA 5BNNA 2FDGA 4PBOA 5FMOS 3AKPA 2XHBA 4A45A 1IHMA 1DLBA 4UCSA 3UO2A 2BU9A 4RL7A 3MGUA 4HK9A 4JI1O 4H13B 2XBO3 4N9HA 1AR1B 1W0JG 1QJFA 2E5LB 4CDXC 4GMP1 1M57B 4R9CA 2ZEYA 4Q4Y3 3AYDA 2ET1A 2GNDA 1R6KA 3OEBA 3THOA 2D5HA 5LYJB 1EY2A 5A9GA 1FD9A 1W6QB 1GRJA 2ARCA 4FXKB 3U4SA 4HBNA 4ZOLA 3EBRA 2E76B 4N43B 4BB3A 4XOGA 3H42B 4XCAA 3OYWB 3WX5A 1PNKA 1OVSA 2DCKA 2XAHA 2XL9A 4XYXA 3RBZA 1CEZA 5FZ0A 3BKZA 4X65O 4PA4A 4QIWF 2GHYA 4QXHA 2GN3A 4K3AA 1ZNPA 4QX0A 5FP7A 4AHXA 3FX7A 1K12A 1FAYA 5GM0A 1W9FA 4AFMA 3MI8A 2JEMA 1WCUA 5FPOA 4NHLA 3JQWA 3AG7A 4BMEA 2ZE7A 1O4ZA 2J22A 3I2OA 4JI3B 4N53A 1UU4A 4CEWC 4JTAB 2KQXA 4Z1MG 3R05A 2NLJC 3UJOA 1TUBA 1HV1A 3T1LA 4MX3A 1PZ7A 2YBKA 3ETPA 3GBFA 3JXSA 5A7QA 2WWWA 3TN92 4ZI7B 3MHZA 1TGOA 2HBUA 3VBFC 4J1WA 4O4JA 3S7EA 1SCSA 1I5ZA 4DR2O 1HQLA 5KA5A 2P90A 3J80N 3WF0A 2PHLA 4FVVA 1J5EB 2G9ZA 4DR4B 5FOJB 2R9RB 4DR7B 4X64O 1W2NA 1B09A 3WNPA 1Q90D 4XEZA 1GP6A 2CE4A 2D7FA 1LENA 3T3YA 3IKWA 2AC1A 2IXJA 3BCWA 3ZHQA 4KG0A 4YRDA 1WCKA 2V7QG 4XXAA 2Y6HA 3AFGA 3ECQA 5F6KA 2ZX1A 4UOJA 5FKBA 1I9RA 3L75H 2Q5ZA 4BM8A 2PAMA 1VB4A 2FDJA 4FOQA 3X29B 5KX5A 4AR2A 3OEEG 4CXWA 5KHIA 1ENSA 3VD3A 2OT7A 2RS53 4HOOA 3W5MA 2YDEA 3K58A 2YXLA 1RPOA 5DAPA 5JI7A 1DU3D 4NN0A 3UKMA 5L9BA 3D8CA 4JRAA 3SKVA 1T2XA 1D2QA 1AJOA 1ODNA 3AKSA 2ZQMA 4Q4Y2 4WVMB 3TETA 2XLFA 4LF7O 3WSOA 2JD9A 3O1PA 1CONA 5JUVA 5LB6A 1ND3A 4CVUA 3H1WA 3CRQA 3POEA 4M00A 1QBZA 4XQDA 1OOPC 1BVVA 4PBPA 1O8PA 5CFDB 3JU9A 5FOBB 2VBPA 3PVNA 2XLAA 4XC9A 3L73H 4I55B 2MEV3 3E89A 4MGSA 3I3DA 1W6NA 5LYJA 1Z7S1 1YDXA 2QQNA 4NYKA 2KD7A 1QR9A 2EIJC 1MVQA 1GN2A 1Q3EA 2VD7A 4QPIC 1KS5A 4XJAA 5KC6A 4NIAA 3VZNA 3QO5A 4HPKB 2F93B 4I0XA 2IUWA 4MVRA 1PNFA 1PX4A 5DEDA 2YBSA 4DUXA 5M0TA 4LNVA 4AVSA 3PTRB 5FRAA 5A3UA 5L7OA 4LO8A 3IGAC 3TN93 2H6CA 3M8LA 3LEMA 3PUAA 1JYIA 1D4VB 4NO4A 4DR6B 1WKYA 1JW6A 1X50A 2GAUA 2JXAA 4HFSA 3FWEA 1G9AA 3K0GA 1SLLA 4XF0A 2ZGKA 1KD1W 4IHJA 3VOUA 2DVDA 3KGZA 3CEWA 4QPYA 2VTFA 4YVWA 2OYQA 2ADPA 3GF6A 2XQXA 1SQBH 5FY7A 3VBRB 3R4DB 4FAGA 2OIEA 1UCXA 1S0EA 4URAA 4CCKA 5L9VA 5FZ7A 1XNQB 5A7WB 1JBCA 4B08A 1XU2A 2QDNA 5IVYA 2VH9A 4J10A 2A3YA 2PQSA 2ZIOA 3VD4A 2H6BA 5FBJA 2WAAA 1YQCA 1VQ6V 2WWSA 4HN1A 1UOJA 4DV5O 4PIXA 2GUZB 1LOAA 2X5IA 3ZN4A 3LDEA 1AL0G 3ALQA 1VIBA 2VQFO 3AP7A 3RRDA 5F1RA 5A80A 1VBC3 4PQQA 1QWRA 4OULA 1CVNA 5EQUA 2PZSA 4WZCA 1ZL8A 1WCSA 1R1A3 1W39A 2P34A 4AAPA 5HV4A 3QTCA 3UGFA 3JAKB 1ULGA 3N7LA 1DQ0A 4AFBA 3N7MA 2VAUA 2BGCA 3DCQA 2AACA 1UZZA 2R071 2GNTA 3J7AU 1XMOO 1W90A 2FDIA 5IATA 2RS13 1CQ9A 3QO8A 2ES3A 2BFUL 4N7UA 3LZZA 1SQFA 5KWRA 4JV5B 3TAYA 1RGSA 3U4XA 2VZ1A 1SEFA 5IVJA 1N47A 3KM5A 1TAEA 2QQJA 4O2AB 3TEXA 5JIAA 1C8M1 2Q5TA 1BLZA 1CJPA 3UKVA 4ICGA 3MIHA 4CP9B 4MSWC 2CUGA 4UYBA 4EWDA 5A6ZA 5KUMA 3L71H 4I50B 4LUMA 2Y69B 3OR7C 4PLNA 1V6KA 5F8PA 4RGAA 3CJIB 4EFEA 2Z2SB 4GQ7A 4FQ4A 2YBPA 1PV0A 5JH7A 4RUEA 1POV1 3NV4A 3P3PA 3OAAG 4BIFA 3AL6A 3OF1A 1AI5A 1VP6A 2W87A 5LP6C 5FYCA 3DYPA 2YPDA 1YHQV 3IPVA 2E3CA 4FLWA 3OY8A 3KLSA 1UU6A 4HSJA 4UFIA 2NMOA 3P30A 5A3PA 1YXBA 3ZN0A 2QQIA 2A3QA 1RMU1 1HN1A 4QD2A 1UMIA 2WFPA 1F5FA 5K4LA 3DGTA 2LFRA 1G4YB 2JDKA 4LUKA 5ACA3 1W8FA 3LF7A 2DCTA 5K0UB 3J9SA 4DQAA 3CJHB 3KV4A 5FZ9A 3WDTA 3OMNB 3WG7B 4NTXA 1M90W 2VNRA 3B3QE 2UUCO 4LTAA 5FZEA 4UV9A 3CJIA 3L72H 3OG2A 2A79B 2ZTNA 1SFYA 2DQ0A 3UT5B 2V5YA 1EBOA 1ULCA 1FXKA 3K59A 3EXUA 2WUHA 1VAKA 1GN3A 2W1WA 2JG9B 1PO23 1JODA 5BNOC 3HEIA 3S7IA 1UY4A 3UESA 5JI9A 2DVGA 4UW6A 2VGDA 1JZ5A 2V72A 3N2GB 1K4CC 4E2SA 2Q8CA 2XQRA 2P3JA 3RVZA 5IYBO 1GSLA 3TJTA 4DV4O 3GWOA 3M3CA 1OFNA 3AM2A 4Q4W1 5CKNA 5FWEA 1L0NH 1OV9A 3VD7A 1ZBA1 1JN2P 3ZYGA 1UZ0A 1H4HA 3RJ2X 4UF0A 1JOYA 4Q26A 3U11A 2EXKA 4CCEA 2B45X 1BXHA 2XJRA 4A6OA 2HWB3 4OMDA 3BOWA 4C90A 4TV8A 1DGRN 3G7DA 2GSYA 4LE4A 3D0SA 5HFMA 4BJ0A 3CP1A 1NCRB 5FLHA 3RYCA 2XJTA 4EJRA 4IV3A 4W4LA 3I3MA 2XOMA 3ABMB 1OVPA 3ABKC 2ZXWC 1JZ6A 5IJ0A 3B69A 3ZXKA 1O4YA 5A33A 2GNMA 5JVVA 1I7FA 3LEIA 4AHWA 3IDBB 2O14A 3OTFA 2OPWA 2A75A 4OHXA 4DRXA 1Q8PA 4DR6O 1VBB1 2JDHA 2KR2A 2EA7A 2ZMNA 2A3WA 4B3SO 4JZRA 4QHOA 4DY5A 2R49A 1AR71 1IQAA 2HWC2 2I74A 4XZPA 3H8UA 1OFSA 2WAMA 2RN9A 2D6MA 4FTSA 1NI8A 3WCSA 3EHBB 2W47A 2K9PA 4PDMA 5BY1A 1MEC2 4PDWB 5B5EZ 1D4M2 2PHWA 4L9BA 3CLPA 1AJQA 2OZ6A 3ME2A 5AVAA 5IVEA 4OUMA 2J1AA 5JJEB 5A2QN 3ILNA 2ZHMA 1FPN3 1Q7YW 1RUC3 3IM0A 4F3JA 3LKJA 1A3KA 1NKDA 4TTGA 4QB2A 1N34B 1J5EO 2EJ7A 5IK8A 4FLUA 4NPLA 4DR5B 4SBVA 3RN4A 3VBUA 1MSDA 4P08A 4DZGA 1UNBA 1W3VA 2DUOA 2A6YA 4CDQB 4XFBA 4WVWA 2E31A 2DE0X 3HNYM 2EIMC 2Z3YA 3HIFA 2WO2A 1VBB3 1SLTA 3AJZA 4HT1T 1F51A 1JYXA 2B9UA 4N7IA 4FJCC 2FDFA 3O7OA 1SQGA 3TXQA 2R061 4PDWA 1VQNV 2QKSA 3L2HA 1ULPA 4CYDA 3AP5A 3HAGA 4CCMA 4JYBA 5JXHA 4EWAA 4B4PA 3L9DA 1XYPA 3WHTA 3T1CA 4AXOA 1R73A 4X62B 1O3SA 1O5LA 1QQP2 4PQ9A 3ZX7A 2VZRA 4LF4O 2EIKB 4J80A 3ZYHA 2BFUS 4M3CA 5FPAA 2WSUA 2C26A 1Q8SA 4A3XA 4JI0B 1O91A 3BVCA 3AG3B 4DUZB 4MUVA 1XL6A 2RMU2 3EJKA 2R7EB 1UIKA 1S0VA 3U78A 1QMJA 3IWZA 5IYZA 2ZX4A 4WV8A 2QA4V 2W6JG 1OMIA 1OH4A 5F3EA 5LA1A 4A4AA 3NW4A 3WCRA 2OIIA 2JDNA 4XBNA 3LOIA 1AYN3 2VQFB 1XJAA
chains in the Genus database with same CATH topology
4FPYA 3SLIA 2XGXA 4JGYC 1BCXA 5GZDA 2ZX2A 2NM1A 5CFCA 1J3RA 4RS5B 5T54A 1MR5A 3EQEA 3BB6A 3H1YA 1OKQA 1U5IA 1J3QA 4UBGA 3I59A 1GZWA 4XQ4A 3WG3A 3MIFA 4YW5A 2XJPA 5FPZA 3RG0A 1QOSA 3WW3A 4MGYE 4AEDC 2QKDA 1FT9A 3PNAA 4DOUA 3K51A 4XF9A 2H0BA 2DUQA 2RM23 4B3NA 3E5XA 1Z7S2 2R042 1EV11 1O7FA 2XH6A 1ONAA 1C57A 1QJU1 1IPKA 5C33A 4I2OA 2C5DA 1CESA 4QQ2A 2JD4A 1AR82 4NWVA 3RYPA 1Z0HA 4R4XA 2WNVA 2OUHA 1JUIA 3AK0A 4BYYA 3KQRA 4AVCA 1PM7A 3CU7A 3HT2A 4CDUC 2YGLA 2EALA 4HZFA 4IESA 1ZBE1 4S2GA 2W68A 1NY71 3THPA 2E53A 3BPZA 4HVQA 2PHTA 1MZFA 4C5WA 2NLRA 4W6WA 4OLLA 1AL21 3SH3A 1DFQA 1C5HA 4LBJA 5L36A 4LBOA 2OA2A 2WZR3 2A6ZA 2NMNA 4BCUA 1W0OA 4FPEA 3ZPYA 4XW3A 1FOD2 3ACLA 2PFWA 2GALA 4KQ7A 4ES8A 3HMYA 4QPIB 2MPFA 2XWJB 1SDWA 2WZPP 1GQHA 5HCAA 4HMZA 4QQOA 2ZHLA 1YJLA 1YIPA 5A3MA 1XQNA 4AEMA 2XB6C 4RR3C 1LODA 3AB0A 4XHBA 4CP2A 3FMGA 1RMU3 3N3HA 1UZYA 2WZR2 4LLFA 3POWA 1WMFA 4GMP3 5IK7A 5CFCB 1D0HA 2I2SA 1N3PA 3ETQA 4RS5A 1LHUA 4GALA 4DINB 2XBO1 2XJSA 1VJ2A 1RUI1 2ARBA 4IEOA 1N3OA 3Q9OA 1CIWA 1M06G 3BOPA 1PO13 3SCHA 1UN1A 3VBFB 4ATFA 1ENXA 1SBFA 4F83A 3ROUA 4GH4C 2PHFA 4AGRA 2VMGA 1RMU2 3ES1A 3BU7A 2Y0OA 4PJYA 5C9AA 2VOKA 5CG9A 5FLIA 3ZFEB 1OA2A 2X53S 1VBA2 3TNQA 1H2KA 1TME1 1SCRA 4FP3A 1WCDJ 1B35B 1VBD2 2LALA 3FLPA 3AMNA 5EXOA 2IFWA 4C1XA 1QJX2 4U2AA 5HBAA 5E88A 3WDUA 4CDUA 4COYA 1UX6A 2XVKA 4M01A 5DG1A 4Y20B 1BMV2 1H4GA 3THTA 1DS0A 4M25A 3VKLA 1S0JA 1VRH2 3ENRA 4CDQC 4INDA 3IBMA 3G6JB 3MICA 5BNPB 3ZN6A 3VBRA 4AG4A 2QDRA 4WM7B 1LEDA 3LSEA 3JD71 5DUVA 5FPXA 1CD3G 2JJ6A 3CJIC 3MIGA 2DCZA 2RJKA 4P9IA 3SCGA 3E6CC 3PVJA 2BW8A 4L97A 4B8EA 2IXCA 2VOXA 5I0SA 3SHRA 2XJQA 2AREA 4CEWA 1PK6C 1PNGA 1R083 5EJ3A 2BWAA 4QGMA 4Y26A 1SLBA 5L73A 2RS12 1ENRA 4V1PA 1YJKA 4AEDB 3GZAA 1BZWA 2LTNA 1V70A 3VBSB 3SISA 4XFGA 1YNAA 4KH9A 4YARA 4F7ZA 3NO8A 2IXLA 4BIOA 1R1ZA 1W2UA 3I54A 1MQTA 1ZZ9A 4QMAA 4YW4A 4ZU5A 1ND2A 1QF3A 1AYN2 3FBYA 4XF3A 5T5PA 4RS5C 2JENA 3HWJA 4BLJA 1G9DA 3C2UA 2ZGSA 4TWTA 4LA3A 4KU8A 2O8OA 5DUWA 1IS3A 3NKTA 4Y0EA 1G9BA 1ZRCA 3AZYA 2GC2A 2RS11 4MXWB 4Q4X2 5CB7A 1KQRA 3AFKA 1CAWA 5BNPC 1CGPA 4M0NA 1BEV3 4LHKA 1V9U3 3ZSEA 5JCTA 4HETA 1XNBA 1F8VA 3JD73 2PQQA 2R073 5HCFA 3MF9A 4PIYA 3H9AA 1IS5A 1PMIA 5B2GB 1C3HA 1LR5A 4CP0A 4EROA 4LBQA 2JE7A 4P9YA 3WD5A 4C0HA 2CWSA 1Y43B 4MGIE 4IV3C 4JDOA 1ZVFA 4Y1UA 1BBT2 1WBFA 4H14A 2OG5A 1BK1A 1LHNA