4B7KA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-ser peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
338
Chain Sequence
GSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 338
sequence length 338
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7kA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7kA01
1IZ3A 2YC0A 4NR1A 2XUMA 3P3PA 1H2KA 4JAAA 2W0XA 2YDEA 2CGNA 3KCXA 4BIOA 2Y0IA 2WA3A 2ILMA 4B7EA 1H2NA 2CGOA 4B7KA 3D8CA 3OD4A 4Z1VA 1H2LA 4AI8A 1MZFA 4Z2WA 1H2MA 3KCYA 1YCIA 4QU2A 3P3NA 1MZEA 5JWPA 2WA4A
chains in the Genus database with same CATH superfamily
5LXTA 4JI4O 4S2GA 1N4CA 4BYYA 2P1BA 4JI6B 2R30A 4W8JA 2Y4TA 4GX0A 2D44A 4NWVA 4JAVA 1IGOA 1LU2A 2XKPA 1JXNA 4META 1PX3A 4U3FH 4YG3A 1AJKA 4M0NA 2XNDG 2YBSA 3AKSA 4L97A 3HKBB 1ND2B 2VZRA 2GAUA 2IFRA 1VLNA 4N43C 2IUWA 3K5NA 1BVP1 1EBOA 3JBG1 3LF7A 4NRQA 1NI8A 3UKNA 1FATA 3SH4A 1GBGA 1GP6A 1DQ6A 1ODMA 1ZBA3 5B4NA 4GH4B 5JXHA 3V64A 2B42B 3J8F2 3PVEA 3ZYGA 4A41A 2WT1A 5JCTA 1GRJA 1IQDC 3MPBA 1DF4A 4HANA 4LULA 2NP0A 1W8FA 1CIYA 1ZZ6A 3CCLV 1IURA 4OI1A 3U37A 3WG7B 1AR62 1HRV3 1Q81W 4QAWA 5BMVA 4IE0A 1NOVA 4CCMA 1J84A 1G8WA 4NO4A 2GV9A 3SJAC 3MICA 4B3RO 2HWF1 2CK3G 3B7MA 1RC6A 4A3ZA 5DAVA 2PHLA 5A7SA 5FZHA 3G4SV 3WP5A 5LBQA 3JQXA 4L9BA 2W92A 3OY8B 4Q1RA 1FMD3 1IX9A 1NQDA 1SERA 1K4CC 4GWMA 2YZ4A 1PK6B 2ARXA 1A34A 3WW1A 1ASJ2 2FDGA 2ZMLA 1TME3 3LDRA 3O0XA 5F37A 2R072 1YCIA 4Z2AA 2WQ8A 3HAGA 5SV8A 4W6WA 2VXJA 2ZGTA 4GQ7A 1W0NA 2F23A 4DV6B 4AI2A 2LROA 3DECA 4R9BA 2H8PC 2OIIA 3WW3A 4M01A 1MOFA 5T5JA 1CGPA 1J83A 4MW8A 2YV8A 2MPFA 4GIQA 2IJJA 1VRH3 1FXVA 4QGPA 2PYTA 4KI5M 5JVVA 3SISA 3DXRB 1W2NA 3KSCA 1PO12 4B3SB 2X10A 4J9ZB 1RUG2 4FMTA 1RIRA 1LGBA 1EYBA 5FYUA 3ZJZA 1FAYA 4XETA 3U14A 2ZKOA 5C9AA 3IT8A 3KV4A 1D0GA 4QHZA 5FPRA 2HWE1 4YRDA 4JQRA 3DKQA 2RS12 1R73A 2BWCA 2BOJA 1BQZA 1T6BX 3MIDA 4LBJA 4QX7A 4X89A 4P30A 3X2QB 4ES8A 1XUQA 2EULA 5E8AA 4XJAA 5BY5A 2H94A 2WL1A 3BOPA 5F6LB 2BSKB 5J7MA 2DTWA 1S55A 5FZBA 3SC7X 1CVNA 5J37A 3E8FA 1NTKH 3QO5A 1JU4A 5DM6V 3GZTB 2JIJA 5EC1C 2ZGSA 3SKVA 4LFAB 2QM7A 4QGMA 3B94A 2XH6A 4W65A 3V65A 2EIJC 5KA5A 1XRUA 5FXXA 1YIFA 4GB31 1RUI1 2GUZB 2AXTZ 1LECA 3OBRA 4PDMA 1FYUA 1DQ0A 4LP8A 3H0OA 2JEXA 2A7WA 1OJHA 3HN3A 4DXRA 5J36A 3M3EA 4UW3A 2J1AA 4HMZA 5T54A 1Q8SA 2KQXA 5FJKA 1MS8A 5J2UA 3NNGA 2YEVB 3BU7A 2ZBJA 1H2NA 3ZFFA 2W6IG 1F4AA 5JQGB 2BDRA 1LOFA 1JOPA 4Q0SA 2EINB 4UB8Z 2F6BA 5FNVA 3CCVV 3OMAB 2JICA 4DR5B 1AR82 2JIGA 3JB4C 3ZPOA 3Q8AA 1LUVA 1L7RA 5JSOA 1S0EA 3H8UA 4RHV3 2ZNJA 4D6TH 4IEZA 2VO5A 1DZTA 3OF1A 1V6NA 2B5HA 1BBT2 2ZMKA 1GZWB 5KMGA 2Y64A 1OOPA 4AHXA 5FYZA 3AEIA 5T5PA 5A3PA 3ZFEA 4DRVA 4QHBA 2DYSC 1H2LA 4QPIA 1DQ1A 3LWCA 4QWNA 2KR2A 3ZFFC 1LGNA 3WZ1A 3TAYA 1ENVA 1LOFC 4NJ4A 1N32B 2YXLA 3I97A 2ETEA 1VBB2 4ASKA 4GALA 4GUNA 2E5LB 4B1LA 1W0PA 4UVCA 4R7CA 3HKBA 1TVGA 3LEMA 1JW6A 1VBA3 1EAH2 3FLTA 2VECA 2QTWB 1J3QA 3MV11 1CPNA 4LHKA 1XMOO 2R042 4AVVA 4UXNA 1JYCA 3ZFEC 5CKMA 5GLVA 5GZCA 1DZQA 2PZSA 3UJOA 4TOIA 1Y67A 4GH4A 2BGCA 3VBRB 1ZBA1 1TZOA 1YVWA 3ACLA 4LOTA 3TN91 2B1IA 3IKWA 3W7WA 3WNLA 4RQPB 1BHGA 4QNHB 3GBWA 2CV6A 1MZ5A 1WPXA 4XIOA 4YW5A 3ZKYA 1OURA 3ZXKA 1ND2C 1H30A 1N3PA 5FQ0B 3H01A 4YM1A 2H6CA 2Q1ZB 3T2PA 4BDVB 3HR9A 5DEDA 3VBFB 1G9CA 3EMRA 1QU7A 2HWB2 1VRBA 3E8BA 4HVOA 1GWMA 1G9BA 3JAWB 1REDA 2R70A 2IVIB 4E4HA 3JD1A 3AG1B 4CS2A 3OY8A 2QM8A 1W59A 5GZDA 3LCPA 4HKWA 1KGYA 4GH4C 1W8WA 1FMD1 5C3PA 3I3MA 3VBOB 2EBOA 1CX4A 1GN3A 1PM9A 5IFPA 4HXCA 2WINB 1T6GC 4P02B 4Y22B 5JJJB 1BHAA 1ODNA 4CDUB 2MW2B 1W9TA 1TME1 1VQ6V 2WSSG 2OTLV 2OTJV 4R8HA 4QKFA 4CDQA 1JYVA 1RUJ2 4X65B 5LA2A 2Z5WA 3O1OA 4B1MA 3QOPA 5B4XA 2C9KA 1BCCH 3VHRA 2Z5UA 2WSUA 2QQUA 2P3YA 1W8UA 1JFFB 2XMLA 1MPXA 2UWBA 3DXRA 3WQBA 3T1CA 1W9WA 1VRH1 1DK1A 2XJQA 4JTNA 4EV0A 4AEDB 1TEIA 4PIZA 2O8OA 1PK6C 3IFXA 4XTMA 1JYIA 3WVJA 4CZSA 5FMOL 1S4CA 3ZYHA 4NIIA 1B35B 2PAKA 2W91A 2OA2A 5A80A 3WHTA 5KAFZ 3APOA 4CC6A 4JI2B 2BFUS 4ZU4A 1YJLA 1NJIW 1U12A 3GZUC 3W59A 3GWOA 5LHGA 2PLV3 2BSKA 1LTEA 4AHYA 2BBVA 3WNOA 2W39A 3RJRA 1Q43A 5A3UA 4KWUA 5LY1A 4LXLA 4Y24A 1N1VA 2XQXA 3C3VA 3B02A 4NTXA 2VL4A 2W6JG 4OX9B 4DR2B 3CIHA 3FMGA 2R0HA 2ZXWB 3AP6A 4KGQA 2RMU2 3U10A 1GZCA 3MW3A 2BTOA 4SLIA 4DR3O 3OGIB 5IVVA 1DG6A 4GMP1 3A0NA 2GUZA 3CZJA 2VNRA 1NAEA 2WO3A 3O65A 3ZHTA 3AK2A 2VZTA 4EB6B 1UXZA 2Q7HA 1ULFA 2PYJA 5FZGA 1W6NB 4FPKA 1QGLA 5J96B 4D7TA 2G9FA 2DBIA 3MPPG 4Z1MG 1O9GA 2AEYA 1WW6A 1B3QA 3GBGA 3O0WA 4W6YA 3W7UA 2YEVA 2QEXV 3RYCB 4XXAA 4WVZA 4C0HA 5JQGA 2IXHA 1W2TA 1ULDA 4FAGA 4PELA 3Q8FA 5B1AB 4UCTA 4WFHA 3U11A 3CC7V 1JH5A 5FP3A 1Q6HA 3KCYA 4QX8A 5BNOB 2A73B 5FZ4A 1HXS3 4QQHA 4Q4V2 1ULPA 4X6RB 5BNPB 3WQ7A 2ZR3A 4ZKTB 1JYTA 4X1IB 2GN3A 3ABKB 5C3RA 1Q8VA 5B66Z 4N53C 1C28A 1GZWA 3ZIXA 2D3RA 5JMOA 4PI2A 4E8DA 1JOBA 1N1YA 3T3YA 3DEMA 4CUGA 1AYN2 4ZS3A 1PVC3 2F93B 2WZEA 2VE1A 4OHYA 1CIWA 4URTA 2EINC 4LH6A 5AC93 2F4PA 3WDXA 1VF5B 3SITA 3WB2A 3JB8A 5GZFA 4BAYA 1GM8A 1ZZCA 4LF8B 5E88A 2XASA 4S2DA 5SV5A 4YW7A 5F8PA 1COV1 4NUBA 1LR5A 2DU1A 3U78A 4WFGA 1ZSPA 4FPGA 4LBEC 3P3PA 4BM8A 4HYOA 3VKNA 2VQUA 4U2AA 1HB4A 2HWD1 3H1YA 2W47A 5FZFA 4Q4Y3 3I4IA 2BNNA 1VE0A 1AI4A 4B4RA 3ZSJA 3VBRA 5FYHA 2RDRA 3SPIA 4V2VA 1R1A1 2WR9A 3AG2C 3FYEB 1DGRN 4HK8A 2LQTA 5LB6A 5L9VA 1WA6X 4HG6B 5HCAA 4P5YA 5KXEA 3AG3B 3E6CC 3G80A 1AL22 1FYJA 2DURA 3KT4A 1O3TA 2PI5A 1CJPA 4H14A 2J1TA 4JTOA 1UY1A 1KKCA 3VBFA 2B9VA 2YXHA 1MNGA 2DCKA 4LTAA 2WN2A 1AILA 2D98A 5J48A 1RMU1 4DNYA 1N8RW 2IH3C 3JAWA 2R9AA 1ZBE2 4HVRA 4MV2A 1D4M3 3ABLC 2WA3A 4D0QA 5CBFA 1K12A 2TNFA 3ZR6A 1MS5A 4HK9A 5BXXA 2VZVA 3JU9A 3VBOA 3ZKUA 3BOWA 1IPKA 2B7YA 1IBKO 4RQPC 4Y22A 1SQPH 3FUOA 5T55A 5HXVA 4CDUA 1O5UA 2A3WA 1VQLV 3SH3A 5C70A 4ZZ8A 2HJFC 3SPJA 1UXXX 4GWIA 3CC2V 4Q0VA 5T3NA 2QKAA 1B04A 2ZR2A 4Z2WA 5C5TA 4NE9A 2AW9A 1I94O 3N7MA 5IVBA 1I9RA 2BCCH 4PIYA 2AENA 5IT9N 4F4LA 3MHSC 3J9SA 3VBFC 1SEFA 3BIWE 4X20A 4XCBA 1A6CA 4GX1A 4BIOA 5CEHA 4XF1A 4RR3B 2OZ6A 5K7PA 4J80A 4XJUA 1AP5A 2DMXA 3FBMA 5K0UB 1AI5A 3WSOA 1JFFA 3AG1C 4QD2A 1H9WA 1OFSA 3CF6E 3T4DA 1W90A 4MGQA 1S0GA 4AEDA 5HFLA 1N36O 3AJYA 1GOGA 3VBOC 4D6QA 5EBMC 2OYQA 2EA7A 2P4KA 3CEWA 2ZTNA 2WFF2 4L99A 1B35A 3HOBA 4JKKA 4CDUC 5JSRA 1RXFA 1V6IA 2VZSA 4XFGA 4YWAA 3SKJE 4CCLA 5FZ8A 5C71A 5FZAA 5L3FA 3NV1A 1QOTA 5FV3A 3L71H 3N35A 4PJ0Z 2JG8C 3T30A 2HHHB 2XVGA 4OZXA 1FXKA 4IE4A 5EXOA 2WC2A 1M5IA 4FPPA 3WW4A 5F5CA 3PL0A 4M3CE 3SYPA 3UGFA 1SS3A 2JDUA 1HJGA 4JAAA 4PI0A 2ZE6A 1XMQB 4AEDC 3JCIA 2WWWA 4NIDA 2O14A 3TJTA 2C0ZA 2CAUA 1S77D 3LPGA 1FPN3 3JASB 2BERA 1C8M2 4J10A 1JUIA 3ZYRA 3HD8B 1LHNA 3OG2A 5FLIA 1W6NA 4DMIA 3BALA 1V54B 4MVSA 3AZWA 3RQ0A 4UV8A 4HT1T 2VVFA 2JB4A 3RYCA 5IHRA 2WAAA 3J80N 5FXWA 3SEEA 3AFGA 1QLNA 4EWAA 4BQXA 1S2BA 1XNQO 1NE6A 1OLMA 1SLBA 2RS53 3SPHA 2DVBA 1Y74B 4HETA 4BJ0A 3ZS8C 2PHUA 1AP6A 3NVCA 5BNPA 3WDWA 4AI3A 2YC2A 3PJSK 4JRLA 1R093 2E75B 4X1IA 4PQ9A 3RWKX 4D94A 3MAQA 4PDWB 2Y60A 1US3A 4A4AA 3PVBB 3L73H 2HJIA 2A6ZA 1QHTA 4MGYE 1HRI3 3LUTB 4NXMB 5DAQA 3GF6A 3JBG2 3RJ2X 2P5OA 1PVC1 2OVUA 3ZFGB 4C8DA 2G19A 5FZIA 2JIZG 1ULCA 5B1AC 4BQ4A 2Y6GA 1XNKA 5BNOC 2J1UA 1RB8G 3J7LA 5AC91 1L1FA 4I50B 1GKBA 3WUDA 2EILB 5BNPC 2YU2A 1D2DA 5IYZB 2XG3A 3ABKC 2JS5A 2Y4UA 3T4ZA 1N34B 1UU6A 4TV9B 3TGUH 1QBZA 3RW0A 3VZMA 1YJWV 5IWFA 1F15A 1TUBA 1XSRA 1HR0B 2PELA 3JQWA 4IESA 4GA9A 3RDIA 1IS6A 3M3CA 3KT1A 2LUWA 3E89A 1GQHA 1POQA 2HWF2 1VQPV 2AREA 1JZ7A 1HNZO 3A0KA 4Q4Y1 3OSDA 1VP6A 2WA4A 1Y4MA 3HKCB 3PU3A 3C8XA 2DYCA 4FBFA 4NRMA 2XWJB 2XOKG 4LFBO 4B3TO 2OYZA 1HW7A 4LIUA 3PMSA 2HVJC 4UFJA 3TEXA 1BMFG 4WFEA 3AL6A 4O4JA 3NNMA 3NJZA 4J25A 2XUEA 2YPJA 4UW6A 2P22C 2BQPA 2KKWA 2GNTA 5EQUA 1E79G 2MHFA 4D8MA 3QF7A 4TT3G 3UK9A 2ATKC 5L73A 4QB1A 3PNAA 2RNBA 5LA6B 4XAAA 1PVXA 4OI2A 2WWSA 1KBHA 1YXWA 2Y26A 2QDOA 1K5JA 1PZ8A 1VIBA 3AG3C 4FFFA 1XSQA 3FFQA 2GTAA 4QX5A 2HWE2 4QX1A 1DF5A 5D8AB 5F3GA 2NQYA 4FTSA 5EJ3A 1R6KA 3ZBHA 4Q0QA 5T50A 3VKLA 2GN7A 4C1WA 1F4HA 2BRTA 1IZ3A 5FOBB 3WP6A 2X6BA 3NXSA 1XL4A 4ZKIA 2GBOA 3I2IA 1AXKA 3EVKA 1NKGA 3KZIZ 1GM7A 1UYXA 5KHGA 3S7EA 4GKJO 3K51A 3K59A 2A3XA 1QMJA 3NV2A 1RUH3 2DCTA 4PHZA 3OCPA 1SMVA 4IETA 4IEQA 2PUSA 4LF6B 5IYCO 5IK7A 3ASNB 1UOFA 2VQTA 4GB32 1RUI2 2OZJA 2EAKA 3VBSB 3EYPA 3N9MA 2QJ1A 4Q1PA 4DK1A 2D93A 4CCOA 1TVKA 3ZMSA 3WDYA 4I30A 1ZA7A 1X9TA 3UKTA 1B09A 1LGCA 4A42A 1W9FA 3VGIA 4RR3C 3LA7A 5K0UC 2ZCWA 3T2MA 4YLZA 1UMZA 3CJXA 1SA0B 2WPDG 2V09A 1IHMA 1WCQA 4FLVA 1OKQA 1S2EA 3KLSA 2VJXA 3H3ZA 3AM2A 2X5IB 4B7KA 2NLJC 5C93A 3A7QA 3SCHA 2LS6A 1UNBA 4YJ2B 5LK5A 3JASA 2ZDIA 2ODMA 1NT2B 1ZRDA 1YUDA 1E1RG 1ND3B 3SHRA 3TBDA 4J42A 4JI1O 3ILRA 4AWDA 5IAVA 2DUPA 3SNMA 1FOD1 4P9JA 5AVPA 5IW0A 4FZ1A 3T1YB 4K20A 1Y4WA 1LUWA 1DF0A 3TXQA 1Y74A 3K3OA 1LR1A 5F5IA 4K0KB 1I7FA 1O8SA 2P4VA 1GLHA 3C7OA 3EXAA 4MXWB 3KV9A 3ZSKA 4DR1B 1QNYA 4LA3A 1R091 4PDWA 4EWDA 3M8LA 2K46A 1OQ1A 3FX3A 4YZ3A 1G86A 1KFXL 3NNFA 5L36A 1V54C 4XFAA 4LF9B 4FPHA 4DXTA 1H8TB 1HRI1 3TWIA 3ROUA 1OT5A 1G6UA 1LOAA 5IDJA 3ZFGA 2UY8A 4AVSA 2R16A 5ERLA 5CVRA 3JD71 4XILA 1P84F 1XXNA 1QJFA 2JJ6A 2ZZQA 3CYOA 3POWA 1ZBA2 2E3CA 2UU8A 5A7WB 3BAAA 5EIBD 1JYNA 2J1EA 2WQ4A 3WFVA 3U07A 5IYZA 1UJWB 4ATFA 3UJQA 2ZE8A 4PDWC 3B8MA 4TV9A 3UT5B 5KHHA 1SLIA 3ZYBA 4K1YA 4KWKA 4TV8A 1HRV2 4DB5A 3VHOA 4X1YB 4XOGA 5FPXA 5FMCA 5DUXA 2X0LA 1W9SA 1UFIA 3A21A 1AR63 4AI0A 1TGOA 4BR6A 4DY5A 3BTXA 3ZFGC 1RUNA 3E6DA 2XJUA 1TNRA 5LW9A 3HKCA 1UU5A 5FPBA 2YICA 4JI4B 4QGLA 1J1LA 1FMD2 2E7TA 2Z0AA 2NNUA 4U3JB 2L35A 4L2NA 4B4QA 4K9SA 3CRCA 2XHBA 1W8ZA 2VPVA 2QBXA 1F5JA 5GONA 1TME2 5B2GB 4IT5A 1X33A 2Q9LA 2IU3A 5C8CB 1RJ7A 2W0FC 3KKYA 5I8TA 5FZOB 1ASJ3 3IIAA 3IC7A 3OBZA 3D5OA 1AR5A 3OPWA 4UCRA 4A6SA 2Q8DA 3RMYA 4TWTA 2ZCEA 1VBC1 4CP2A 2FYUH 5LA6A 3ZXDA 2ATFA 4LIVA 1VRH2 4MTXA 3WQ1A 2FB5A 1WGPA 3IM0A 1V9U1 1ZNPA 2AZ2A 2KB1A 4GKKB 1X82A 5APAA 5KHIA 1S0CA 2RDCA 1RUG3 1WLCA 1UPGA 5IUQA 2JJ2G 1JYXA 1GZ9A 2W52A 1LHUA 5GLUA 1OHFA 1W0OA 3QACA 2RS13 1FNYA 2ZX3A 4G28B 4B3RB 5A7OA 1BT8A 1N33O 1YDXA 1UIKA 3ZMNA 1XI1A 3PLQA 5BV6A 4YG0A 1YFXA 3RZMA 3AMNA 3MBWA 4MYEA 2BOCC 2UU9O 2P2KA 5C6CA 2WNOA 3IWZA 1WA4A 4RGAA 2Y69B 2I45A 2A70A 2D97A 1KJRA 1QJX3 3T09A 3VBSA 4DV3B 3X29B 3O5SA 4HZ3A 5D8AC 4BPZA 2WS91 1PNFA 4Z92B 4O2AB 2J22A 5IK4A 5HFMA 1FPOA 4B29A 3T2OA 3W9AA 4AGVA 5DZEA 1FV3A 1IQAA 5H9QA 3JAKA 3ETDA 4K8RB 3HQXA 1GO3F 2IXJA 2LFSA 1SA0A 1PGL1 5KAIZ 1GQGA 1K3EA 3OEAA 1UOJA 4HAMA 3H1WA 1FNZA 1SLTA 4LO7A 2YYOA 4GMP0 4A44A 4Q4W1 2Q8CA 4QPJA 2X5IA 3AKPA 1JN2P 4XDJA 2ET1A 2BTVC 4E4SA 4RL7A 3OGGA 5E6HA 1R3LC 3VBSC 1GR3A 5ANNA 1ND3A 2XVLA 4YJ3B 1VQ8V 5HPOA 1GWLA 1C5IA 1Q8OA 2RMKB 3BEHA 1S72V 2Y6LA 2FDJA 5CFDB 4JF3A 2FD8A 1UPSA 2IJHA 2V5YA 1LJ7A 2QQOA 1YQCA 2TEPA 1HNWO 1W2UA 3NSTA 4JDOA 2IXCA 2ZX4A 2L9LA 4P9WA 2OCHA 4FTBA 4MXWA 1OCOB 2Q7GA 3H1JH 1AROP 1VQ5V 4BQYA 5H6QA 4IV1A 1QIQA 1COV2 1GFF2 3AK0A 4CSWA 3RZHA 1ZRIA 2AHYA 3VB9A 3AMPA 1CZTA 2WZR1 1ND3C 2LGWA 5C8YB 1SETA 2HWD2 2RJKA 4ZI7B 2UXDO 4XHXA 3Q8CA 2NN4A 1EAH3 4K7JA 4UFIA 3A0BZ 1VQKV 5LMNO 2R043 2A75A 3BTZA 1CXZB 1SF9A 3JSNA 1NLSA 4HBNA 3DPRB 3ABUA 1TE1B 1R1A2 5A7WA 5F32A 5I93A 1W8HA 1WZXA 1NU1H 3VLBB 3E5UA 3LAGA 1IS4A 4FXGB 3ASOB 5I91A 1X50A 1MS4A 4CH3A 5EZYA 4EZHA 1JR9A 3I5DA 1A32A 1K42A 5IYDO 3UT5A 3ECQA 1JJ2U 4QB6A 4DS0A 3F95A 4HFSA 5LATA 4NHLA 4LE4A 4X1YA 3OPTA 1G9DA 2Q67A 1EY2A 1H8TC 3PIJA 3FWEA 4NKGB 1S5JA 2AYHA 1H8EG 2RJ2A 4TSVA 2PGGA 1VQ9V 1RGSA 1RMU2 4HLTA 4A6OA 3PU8A 4AVAA 3GJBA 2VH9A 1Z2GA 1T2XA 2WT2A 5J09A 3V0AB 1M06G 4GT1A 4XMAA 4J7JA 1PZ9A 4U3JA 4IEUA 1AVMA 5J3UA 1HDJA 4MGKE 2YI9A 1AL0G 4O4HA 2RQ6A 3UETA 2UXBO 2DOSA 4IUGA 1Z5VA 4DEVA 4UYBA 2V4AA 5C8CA 4IYHA 4S2HA 5FY8A 3DSQA 5CAZA 4L8JA 4EWEA 1QVGU 3PTYA 5JJNB 1XMOB 4CRQA 3J7AU 1IG3A 1Y9QA 3KVBA 5GLWA 3VZLA 5FPUA 3JATB 2CH7B 1UO9A 2DDUA 1NYWA 3EQEA 1SBFA 4YY3O 3LA2A 3R65A 4A45A 3IZOA 3E5XA 2BNMA 2QWQB 5EBWC 4UT5A 1MZ6A 3POIA 1L0LH 3ME2A 4K40A 3N7JA 4YSFA 5H9CA 4AQYO 3GBFA 3MF9A 3RYPA 1NY71 2D43A 3AVSA 3FX7A 3AP9A 2ITCC 3DYMA 1NZIA 5CKQA 2VMIA 3WB1A 4BQWA 2VGDA 4J41A 3E1F1 2HG5C 1XL6A 1QWRA 2X7RB 5JOZA 2IFWA 3IMNA 4FPFA 3FC0A 4XAEA 2QSAA 1Q86W 1QF3A 1GM9A 5ACA1 2JJ1G 2Q8OA 2N04A 1QJX1 1PPJH 5FP8A 1XU1A 4JQTA 2RMU3 4I55B 5DUUA 4E2GA 2BFUL 2XAQA 2DJVA 5DUVA 3EHBB 4XDKA 4CDWB 5JIAA 2B8MA 4GULA 3ZYJB 2EXIA 3WF3A 2VWKA 3WLUA 3NO8A 5K1XA 1AXZA 3PUHA 3T4HB 3BGAA 4I0BA 2ZINA 3K4DA 2Z79A 4CH5A 2IM9A 4DW1A 1BZWA 3NMBA 4JI0O 2R061 2LO1A 2P06A 4Y33A 4NPMA 4YW3A 5KWRA 5FLXN 2FMLA 1BE3H 2Y69C 4JPRA 4CH4A 4CEWB 1ZYBA 4R9DA 2XJRA 3BY6A 4LNUB 3ABZA 4IEPA 1JYWA 2Q8VA 4J1XA 4X8PA 5BNNB 4FOYA 1LENA 1BKZA 3ZYPA 4YJ3A 1QJU1 4XTPA 3LFIA 3VD9A 2WRAA 1UZ0A 5LRRA 3WNKA 2WUHA 5CFDA 4MTGA 1V6JA 2I2SA 4QDQA 3CEIA 1G4YB 1MMMA 4WM7B 3LNMB 1XOYA 4XUNA 5IYYA 5EZWA 5F2VO 4XDOA 1PVC2 3WG2A 5GKAC 3U1XA 3L9JT 2BVBA 1HNXO 3Q8EA 3H8OA 1IOAA 2D6KA 1AYN3 2Y0OA 5AC92 5LCWL 2WO1A 3VV1A 5CBLA 4DXZA 4RS5B 4JKLA 4DR3B 5T5OA 5D2AA 1XQNA 3I49A 3B3QE 3HT1A 4ZU7A 3LNNA 3BRCA 1SFNA 3TRSB 2IU0A 2AZ0A 5C8YA 2QTSA 4ZI7A 1OLRA 1DU3D 1Y7BA 3UGHA 5CFDC 4X66O 4N21A 3LSUA 4HSJA 4ZXKA 2F95B 5A3TA 1F8VA 4R4XA 2JEUA 1G7YA 2A0LA 4Q4Y2 1S0DA 2JGDB 4DR6O 1W3XA 2VR4A 3DPRA 4ZOLB 2WN3A 1CP9A 1Q6IA 1ZAUA 3LKJA 3MIBA 1OCOC 1LRHA 1VBE3 4YPJA 1AR93 4PLOA 2DV9A 2ID4A 4K8FA 1H38A 1OCZB 1JBCA 5E89A 4P9PA 3B4SA 3RYHB 3W5MA 2R72A 3ZO0B 3FB5C 1UY2A 5A7PA 5IWAB 1AL23 1RFYA 1KB9F 1VIWB 1R64A 1MG1A 1WMDA 4RWUA 3V0AA 4PD4F 2GHYA 3R4SA 1D4M2 3DYOA 3OYWB 4NOTA 3E5QA 2K2SA 1ZBE3 3UM7A 5D5QA 4EN6B 3OAAG 5C4WB 5C3QA 2NMNA 3M4FA 5ITZB 4QMAA 1BSMA 2EIGA 3T1HO 2C2AA 2EIKC 4IIJB 4LF4O 4XBNA 2VZPA 2ENRA 2OXBA 5T52A 1OCRB 1WKYA 1M90W 3E2EA 2ZHLA 3ENRA 5DDJ1 3WNMA 3D8CA 3JATA 2CDOA 2CH7A 4OQ8A 2XJVA 4Y1XA 1NT0A 1VEWA 2VM9A 3UGGA 4LO6B 5I8YA 1AZDA 2PY5A 1SCSA 1W28A 3TNPB 5J1XA 4LMFA 4YARA 1THZA 3PJYA 1DGLA 1NX9A 5AVAA 5FZLA 4AFAA 1J3PA 4FPYA 3DF0A 4A7ZA 4YHHO 2YMZA 1GZTA 4FK5C 1NTZH 1D5AA 4FT8A 3MFAA 2BBAA 1SG3A 1X8MA 4GWNA 2J42A 2VZQA 5FY4A 4BOWA 5CBGA 3VBBA 3WR0A 2IWGB 1X8EA 3C3SA 1QQCA 1HQLA 4HOOA 4QGNA 1WB8A 1O3QA 3BPSA 1W6OB 4UB6Z 4CUCA 4F6RB 5KLVH 2VWJA 4I55A 1ZZBA 4Q0PA 2BUKA 4EJRA 3AC0A 4UAPA 2OCCC 2VZOA 3KF3A 1I1EA 3RI9A 4JI6O 2YPDA 2WNVB 2BE3A 4TQDA 3VDCA 3QLQA 4SBVA 1QNWA 3HBZA 2WAMA 1GMGA 1YFUA 1ZVFA 4I4TB 3BABA 5IJRA 2NYYA 2N05A 4XMIA 4N43B 1GNZA 4JX0A 1FD9A 4UOJA 2ADEA 2JDAA 2XLAA 1JCHA 2B9ZA 1K73W 1SDDB 4RQEA 3BIEA 4GAZA 3IAQA 4LH7A 2R6QA 2Q1FA 1GQPA 3WF1A 1S5HC 3I2FA 4LNUA 3OFNG 1ZX5A 5F2SA 1R092 5BNNA 3G6JB 4DO2A 1SQVH 3JYCA 3LEKA 5FY1A 1QR9A 1SKVA 3QVNA 5JR2A 3KVAA 1LOEA 1VALA 3K0GA 4IGGA 4CDWC 2VOWA 2YS8A 4FVMA 3ZVXA 1HRI2 2VCMA 2W0XA 4WM7A 2VNGA 4G2KA 4CUBA 3JD72 5CA1B 2W1UA 1PNKA 4KU8A 3JBG3 3CB2A 3BUCA 3DN7A 1JJOA 4EYUA 4NXNO 1W8NA 2XONA 3W5NA 2EIBA 3VQXA 1W06A 2JDYA 2BYVE 4RS5A 2OX0A 4HKLA 2LTNA 4P9YA 4CEWC 4XACA 1VBD1 4YIPA 4UCSA 5IJ9B 4EEQA 2ZHNA 3D3IA 4W6XA 1YLLA 1W8OA 1IS3A 1WN7A 4N8MA 5LGTA 2VMCA 2DVDA 3NV4A 4HZFA 3PTRB 4KHPO 3CKHA 2RG4A 2JG9B 4I0WB 1SZXA 3CCMV 1W9YA 4WM7C 2O8QA 2JGDA 1HB1A 3Q9OA 3RVYA 4YW1A 4ZOLA 2JDMA 4N9IA 3RBZA 2HWF3 3ILFA 1WPBA 5I0SA 4KWJA 2ZE5A 4QX3A 3C7GA 4DV6O 4AAPA 3K03A 5IVYA 1XNRO 2YROA 3WB0A 3HR0A 4RS5C 4BW9A 2EICA 5KR7A 2E9QA 1VBE1 4LUKA 2VQFO 1DCSA 1AR91 2VUJA 3RYHA 3VBHA 4FP2A 4UBHA 2X53S 4CBCA 3N9LA 3UNPA 3S3XA 4FFGA 4B3SO 4FLWA 4L87A 4XBQA 4O4LB 5JPMB 1AF9A 3H9AA 1ZZ9A 2CY6A 5CISA 1Q7YW 1VBC2 1CN1A 1MABG 4XZUG 4W50A 1UYYA 2RCVA 2ZAAA 3LSSA 3RYFB 1GH6A 3OYWA 1WBFA 2DFBA 4P2ZA 1V9U2 4HKOA 1QNMA 1RVF3 3J7HA 4XFCA 1UPIA 1BS3A 1YQ8A 5C4WA 1R083 5ITZA 1LOGA 1TQ5A 4LBQB 3I59B 2QWOB 4CS3A 3PUAA 4MHRA 1V6OA 1RPOA 4NAMA 2EIJB 5FPAA 2G38A 4NTWA 4WCEV 3JD3A 3A8TA 5B1BB 5A3LA 4LFAO 3VKFC 4LJHA 4KGGA 2CDPA 1XBLA 2FHRA 2KM2A 3STLC 4A3XA 3CX5F 4OPAA 2FDIA 1HNZB 1QXPA 1ZL8B 3VL9A 1OH3A 3H42B 1FXHA 2ORZA 1NQJA 4AGRA 3ZMZA 3O1MA 4ITCA 1DP0A 4NIGA 2HKOA 1J58A 4UFLA 3PJQA 5H9RA 4LFBB 4B3TB 1NCRB 5C4WC 4YGBA 4PF1A 4CPBA 2LP7A 4JYAO 5FP7A 1BEV3 4OUSA 2WS92 1L7QA 2QCSB 4JGSA 3LSQA 3B8NA 4ZS2A 1SBDA 2R9RB 1HB3A 3I2DA 4GB33 1RUI3 4MSWC 1OCRC 3VDDC 4NRPA 3I54A 1NR1A 1N3OA 1PGL2 2EIMB 4LOSA 2LW8A 2RS33 3F2ZA 5JXJA 3M99B 3D36A 5A2QN 2LM3A 2IVJA 2DYSB 4AFDA 4Q4W2 3ON7A 3TB0A 1SESA 4X88A 1DQ5A 4FPJA 2WLIB 4OUEA 4CVUA 4Y3OA 1BQ0A 1QJY1 3IAPA 3HEIA 3THTA 4BB3A 2WNVA 4DR7B 5JLVA 4FLXA 2E51A 3CCSV 2C1FA 3WINE 5BZBA 4X62O 3AYEA 3PVOA 3QO7A 4I4TA 4N43A 5G05L 4LO5B 3RS6A 3VBUB 4AL9A 1KKDA 1K34A 3QH6A 2GH8A 2QQLA 3R4DB 2X6AA 2BZDA 4J9YB 3CU7A 3LQCA 2J1VA 2QE7G 2BGOA 2QFEA 4DV1O 2XWBB 5FZ6A 4PDRA 1SQGA 1DIWA 3ICXA 3R66A 3K57A 3AFKA 3ITQA 3LSEA 4TWKA 1I5YA 2BEOA 4NTYA 4BIZA 1RUE3 2Q8EA 2BV4A 2WNVC 3OR7C 3O1PA 1DHKB 5FRAA 2EZPA 4MTFA 4CU8A 4IDZA 5CA1A 4I5SA 2DQ0A 3P5BA 4CU6A 4CCCA 2RV9A 2WNUB 4JI7O 3J26N 2O57A 1VQNV 4KG0A 4DRRA 2QUOA 3IC9A 1E5HA 1CAUB 5IJ9A 3AXEA 4FPEA 1W8TA 3A22A 4CPBD 5BR8B 4AQSA 4DINB 3TN93 4HN0A 1SHWB 2YXSA 4A7YA 1J95A 2YU1A 3K5LA 3H1LH 3ALQA 2VW1A 2JG9A 3QG5A 2B46X 1ONAA 4OHZA 2W68A 4JI1B 4CYDA 5FTTC 2ZACA 2CGOA 4CP0A 3FBYA 4Y20A 4BQ5A 4XUPA 4D7SA 4XFHA 5F5AA 3FLPA 3USSA 3ETEA 4X65O 2VCCA 1JVMA 2ZOEB 2MK3A 5JDBA 2YIAA 4BIFA 1DLCA 1NZ6A 5KC6A 1JU3A 1BHBA 2EAAA 4CP9B 3IDEA 2QJVA 3GWKC 3J7MA 3RZGA 3JARB 2B5UA 3L9DA 4QE7A 1Z7S3 1W0KG 3VHNA 3ZMOA 3KGZA 1LOBA 1YQ5A 2E31A 4O4LA 5E79Z 4FFIA 2JG9C 1BVVA 4X9QA 1CAVB 2IJKA 4AR2A 4CXXA 1QDOA 2VW0A 5GW7A 5JXGA 3DGEA 1PMHX 4DV0O 3T1LA 1RP3B 3ACFA 1N47A 1K5QA 3IIIA 1IXMA 4JI2O 2KSDA 4H7MA 3BVCA 4UBGA 4QDRA 4K3AA 2G1MA 1O5LA 4CU9A 3ETGA 1RVF1 2HFEC 4AHWA 1BLZA 3BPZA 5FWEA 1LODA 1L0NH 5JSPA 3CXHF 4LBQA 5EBLC 1R081 3HQRA 1DZRA 2QQWA 1UF2C 2A9HA 3LSDA 4Y5SA 5HI0A 1FT9A 2BNOA 4OX9O 5LMUO 2AHZA 1YEWA 5I0RA 4MVQA 3IB3A 1NG0A 1DYPA 2LALA 3NV3A 1CR7A 1NY72 1NH2B 3QNEA 5DPNA 4I02A 4QM8A 5FMOS 1ZL8A 3KB5A 5FYYA 3S5AA 5FZMA 3JZVA 4RQFA 3TYJA 1XNAA 1YTFB 2M7WA 4COZA 3I3EA 2QVSB 5FDBA 1ROPA 4BU2A 5ACA2 1NCRA 1JZ4A 1NKDA 4QXHA 1QJX2 2K9ZA 1BEV1 5FXVA 2P6HA 3VZJA 1UYPA 1UZWA 2OIEA 2VY0A 4GMP3 3NNLA 1Q90D 2WWJA 3WF0A 3OR6C 1MEC1 2X8KA 4AFCA 5B1BC 5GLTA 4ORFA 1XC6A 4N53B 2YUEA 2HR3A 1CZVA 2IXLA 3TNQA 2TUNA 4G4FA 4E4ZA 4FQZA 2RS31 2BU9A 2R062 4LO4B 4U7OA 1HWYA 2D3SA 1OCCB 4EE2A 4LPLA 2XVKA 5LGNA 4YVWB 4Z1VA 1NCRC 2D6LX 1RPRA 1UZZA 1JZ6A 2Y6FA 1O8PA 5JVDA 1WW5A 1QJU2 3E8HA 1L8DA 4AVTA 3UL2A 3CRMA 3FD9A 1Q3EA 3KG2A 4TLFA 3GXUA 1SLCA 3W58A 1OLME 3VBUA 2VMHA 4QKDA 3T08A 1FFXB 2E32A 1N33B 2FDFA 2EIMC 4DK0A 2CAVA 3ZXEA 4FI9A 4UUJC 4CU7A 4E2LA 4IQPA 2Q68A 1HV1A 1W6MB 4Q26A 2A6WA 2QGNA 5F9TA 2UU9B 4LLFA 2FMYA 3KV6A 2EJRA 2VUDA 2FKXA 4LBQD 5CBHA 3G6BA 5J9PC 5L3DA 3AG2B 5F7UA 5JOYA 5F2WA 4H2AA 3FKSG 3RZJA 1RUE1 3S3WA 5CA0B 4COYA 1COV3 1QQP1 1WA8B 2VZ1A 1ND2A 4L92A 2BWAA 1PIV1 4LLOA 4MG2A 2ZX1A 5FUNA 5FZ0A 2HLDG 3AG7A 3VBUC 3P32A 4IEWA 1JHNA 3TCUA 2HWD3 4CEYC 1XB9A 2XTAA 3OD4A 2HBTA 4R4ZA 1CAXB 2WNUA 4WVWA 4QDSA 3EFFK 5A1LA 1CAUA 3I2KA 4KP4A 2H3OA 1GYKA 3ABLB 4LR4A 4BE3A 2ZGMA 1R1A3 4C90A 1HDKA 4YFWA 4Q0UA 1D7PM 1GANA 5ABJB 3UKMA 3BFRA 3CCEV 3OD0A 3BVOA 4XURA 3ZHRA 3HIFA 1KJLA 2HYXA 1SQQH 2Y38A 4Q8KA 2X29A 1AYM3 2D6NA 3G67A 1MQTC 2JKBA 1GU3A 3BA9A 5J98B 4I9QA 2E74B 4YW6A 1CPYA 1HNWB 1RMU3 4XJZA 2DTYA 1S0VA 3LOBA 1YSCA 2D40A 2WNUC 3ZYIB 1K97A 1NQTA 5F39A 2P4EA 2HJDA 4K8XA 2UYAA 2XAGA 2P6CA 4DV5B 4W4ZA 1HLCA 1ZRCA 2VUCA 3RI8A 2Y6HA 5FJHA 5FO7B 3JARA 3M2MA 1JQ0A 3V0BB 1M56B 1ZZ7A 1PK6A 4K1ZA 3ZXLA 2YFZA 1N0JA 4LO8A 3IMMA 2H0BA 1Z7S1 3BB6A 1JZ5A 2ZIOA 2GC0A 4EN7B 1CAVA 1XYOA 2VMDA 2OPKA 5DDJ2 3MI8A 4EFBA 2OS2A 4DUYO 5LMNB 3ZXGA 2D6OX 3L2YA 5D5PA 1RHI3 5CB7A 5KXCA 2JG8B 1AJQA 2RDQA 2NZ9A 3S57A 4XABA 1M9NA 3ZMUA 2D5HA 1SRYA 2JECA 3CCUV 4Z07A 5LOVB 2HHHO 4N7UA 4OYUA 4J7ZA 3QBQA 3B5LB 4XQDA 3ORJA 2Q30A 1K8AW 1COWG 4AHCA 1E1QG 5EPAA 2Q69A 3B77A 1OLQA 5F3CA 2UXCB 2R0FA 2AC1A 5JXIA 3B09A 4IGQA 2YIDA 5EP9A 1UU4A 3T1MA 2YG0A 3FHQA 5FZ7A 1VQ7V 2DBNA 3UCSC 4C0BA 3B40A 2MEV3 3M8AA 5BYNA 1YIPA 4JGZB 1EUTA 3OMNB 1A8MA 3LDDA 1RUJ1 4ZHNA 2V5DA 4YVSC 2UURA 4ZZ5A 1UD1A 4RAIA 1EZJA 5LWBA 2ZEWA 1V6KA 1LB2A 3IDCB 4YW4A 2H0VA 2Z69A 2UXBB 3K75B 4NIHA 4IV3B 5EHDA 5K4LA 3T2TA 5KHKA 2UY9A 5FZ3A 3FAVB 4N53A 5CN0A 4QPYA 4E8CA 1EV11 3TK1A 2OQ6A 2GNDA 2QDRA 3BN6A 4Z8BA 4P14A 4CC5A 4HONA 1Z0HA 5JZGC 3WT3A 4XXPA 3L75H 4NXMO 2VCAA 2XBO1 4MSVA 4YVWA 2KG7B 2PQSA 4L8QA 4PA4A 3O1UA 5D21A 3LD8A 1YI9A 1L3JA 5BNQA 3ZRVA 1S1AA 2AGAA 1S5LZ 1LNSA 1FKAO 3ZHUA 3CJIB 3GM8A 1DYOA 1G6NA 2RHPA 3IPVB 3WCSA 4F83A 4AQYB 1UAIA 4H33A 2GNMA 5LBEA 1FFXA 2JD9A 3NAPC 5GM0A 2VQEO 1BYHA 2A6YA 3RG0A 3HNMA 1W99A 1RTVA 3AKTA 1OCCC 4ASMB 3W21A 1RUC1 3H3UA 3ILNA 3RGBA 4K3UA 3N27A 1VBD2 4KBBA 4YVWC 4DXWA 2W87A 2XHKA 1I5ZA 3OTOB 2VTFA 3USUB 2F4VO 3VHPA 4JTCB 1VMJA 2D3PA 5CA0A 4MUVA 2EALA 3V56A 1XU2A 2Z2SB 3BA8A 1WA8A 2DF7A 4XCAA 3POSA 2OPWA 3WG4A 1NH2D 1YWKA 2ZE7A 1ACCA 1SFPA 1H1MA 2GC2A 3WX5A 1P7GA 1K5MB 3H1MA 1N1TA 2D6PA 1LNQA 3ML0A 4RFRB 4FXKB 5JI9A 4EKWA 4QU1A 2ZNIA 1YTFD 1CAXA 3ZSMA 4JI0B 4EN9B 5ISLA 3F7YC 5L3GA 1I08A 4PA6A 5FYMA 2A5ZA 3F5TA 3EO6A 5LASA 3PN1A 2VMFA 1VBE2 3B69A 3AMQA 1AR92 5KX5B 4UVAA 3SPGA 2I07B 4ES9A 5LA1A 5GTHZ 5ABJA 1KFUL 4RQPA 5IK5A 3KHCA 5K8SA 3WDUA 1XEQA 4Q5OA 4D7YA 4K35A 2YY1A 3KGLA 4QPKA 2OW4A 3S6PA 1DLBA 3CNAA 1DFQA 4HVQA 1DGSA 2PHRA 3THDA 3AYAA 5FQ0A 2UUAB 1KQSU 3POYA 2CTQA 2DWRA 1AYM1 3CJHB 3FL7A 2RM21 3I2GA 4AI8A 2P37A 4XF4A 2ZS6B 3U75A 1OZ0A 1YFYA 3RYIB 4XQWA 2VMGA 4NHMA 1ULOA 2ZHMA 2OT7A 3PUSA 2YBKA 2DCJA 4OHXA 4HL0A 1OSGA 5A6XA 5KC5A 4XW3A 4GX2A 3INAA 1JS9A 1Y76B 5FZ9A 3I8TA 5DZFA 5ABJC 5IFTA 1VP7A 3B01A 4P9GA 4DY3A 4AVCA 1H1IA 5IVJA 4B3MO 1YQ2A 5FO9B 5DAWA 3VKOA 1Q8IA 3KHBA 3ABMB 2JDHA 1JOJA 2ADPA 1VAKA 2ARBA 2JG8A 1RHI1 5A9GA 1VF6A 4OHWA 1OA4A 1WCKA 1JZ8A 1QH7A 5LOVA 4ASUG 5FKBA 2XJTA 4DR4B 1FAFA 2CE4A 4PLMA 3MW2A 1M56C 5JH7B 4Y5Z0 5L7OB 5EJZB 2UWCA 5DG2A 1S2KA 1NBMG 4R50A 1HIXA 3I3BA 2P3JA 4WFBV 1J5EO 1US2A 2GSYA 4YM3A 1MZFA 1XNDA 1KC8W 4BMBA 2Q73A 4H0LB 3RFRA 2Y8KA 5CYYA 2CDYA 4IEOA 4URAA 4MVOA 2DU0A 1Q82W 1IG0A 2QQIA 1EFRG 2MEV1 2OIGA 2C4XA 1C3HA 4HSLA 1ZM1A 1VF6C 4XJ9A 1GSLA 2UUBO 4JI5B 4MS2A 5BUVA 4CP1A 5DABA 3LDKA 2R9IA 2Y33A 4LUMA 3E22B 5LRSA 1FI2A 2GNBA 1WP8A 3WG1A 4P9OA 1YFWA 5CA3A 3OB8A 4RYDA 4QXCA 3JSLA 4FFHA 5FYSA 1IBLB 1QJY2 3T1YO 1DGRA 3KT7A 3VDBA 2DWEC 3T1HB 5C8WA 4LF4B 4GWJA 4YG6A 1P7BA 5T5LA 2JE8A 2Q5ZA 1EPWA 3FAVA 3K0DA 3KM5A 4H3WA 4EB6A 4FIPC 2J1RA 1VMGA 1QEXA 3BYWA 2OKXA 5C3SA 3ES4A 4JGZC 4AW7A 1TA8A 1YXBA 5C7GA 3T0AA 1W3VA 1FOD3 4GZRB 2B4KA 3E86A 1UN1A 1EUUA 4IXLA 1YIJV 3E83A 3POFA 2PFWA 2KG7A 3WEZA 2EZOA 1U5XA 5J2UB 5BNOA 2ZJCA 4QQPA 1Q5OA 3WV6A 1WB7A 1GP4A 4QE9A 1OQDA 4KXRA 1ZUQA 4LR3A 5J2TB 2W95A 2FBEA 4IV3C 4JC1A 3PUQA 1R3IC 2JE7A 1QR8A 2ZQMA 1PHMA 4OMCA 5HXMA 1GWKA 2WZ8A 3IPVA 2LGQA 1QVFU 4E2QA 4YHHB 2WQZC 1FFTB 3DL3A 1QLEC 1IXBA 5GLZA 3VD7A 3LFMA 1Y43B 2VBBA 4NHKA 4LKDA 5FYBA 4CCDA 2YDEA 1QY4A 4YFZA 2E7QA 1WCSA 3JD73 4CE8A 1OPOA 2EXJA 2ZPXA 3HQUA 2IBZH 3USUA 4PBPA 1AR1B 1HQNA 2HYKA 4QPIB 4TSFG 3NR7A 3LOIA 1Q6UA 2YGMA 4QQLA 3ZN5A 1U97A 3CJIC 3NJYA 4IE5A 4BWAA 1K5MA 2ERFA 4TZDA 3CBNA 3H1IH 1I3HA 1UY3A 4LBLA 3MLJA 3WD5A 3JXSA 5LHHA 2ETNA 1H8VA 5GZEA 5A7NA 1V9PA 3WCRA 1KXGA 3K9SA 1UMHA 2OUHA 1SLLA 2JDKA 4DXSA 4YNIA 4R9AA 3OEEG 3GNEA 4JV4A 2YC4A 3M3QA 5KX5A 4QB2A 3CCQV 2Y0IA 2XDVA 2GC1A 1NLRA 1W0JG 1M57B 2XLGA 5DN2A 3CRQA 4AF9A 2DFCA 1FJGO 3UO2A 1TAEA 3M3OA 1X36A 5GTIZ 4GKKO 3HJRA 4OLLA 1K5MC 3LIGA 3EXUA 3K9AA 3CJHA 3SCGA 3HBKA 1F4NA 4RGGA 5CB4B 4B8EA 1UOGA 4GXLA 5E1AC 3RYIA 1VBC3 4NXNB 4DUXA 4UFHA 2DYRB 1K33A 3I2OA 1YRZA 2ZGOA 3C3TA 1SQFA 2BPA2 1RVF2 1UY0A 4XFBA 1WJZA 2VCBA 1R082 1V9U3 3RT3C 3NRUA 1Y76A 2K9PA 3ZX6A 5B1OA 1VQOV 4KHPB 4AHZA 4UFMA 3EJKA 1K4DC 3ASIA 5JIUA 3H50A 4DV3O 4C7UA 3ZYFA 1NCQB 2PAEA 4H37A 1JA8A 3APQA 2WO7A 4CDQB 2VTXA 3FB7C 1KS4A 4RR3A 4BZ4A 2JEMA 3TXSA 5K0UA 5EFUA 1VMHA 4KNCA 1XNRB 3ACGA 3GCWA 4JI8O 4DW0A 2VQFB 1TMF3 1BEV2 2Q7EA 5JH7A 1HQWA 4LQRA 5L7OA 1KITA 3AG4C 4NYKA 3SYAA 1MEC2 2PXJA 4DYLA 4GD4A 2BOBC 1ZRRA 2WS93 1NR7A 3ABMC 3VDAA 2OWOA 5FPVA 2W1QA 1XBFA 2YFUA 2DUQA 2E6VA 2CTWA 5JCOA 2RJZA 4QX2A 1C8NA 5GZGA 4B4PA 1AJPA 4WZCA 1YITV 2RS32 1WLWA 3NJVA 4CUAA 1LCLA 3MIEA 1H2GA 3GHNA 4OI4A 3E22A 5FYIA 4PA3A 2ZMNA 2W1WA 3ZXFA 4FOQA 4BLJA 1AR73 2WIIB 1NTMH 4DUWA 2J1SA 4Q4W3 1IDSA 1OQEA 5L7OC 3SR2C 4DZGA 2ZEYA 5KXDA 3ACHA 1UL9A 5IE9A 2Q0OC 1XE0A 2VULA 4FPLA 4NROA 3IDBB 1KECA 3KV5A 3DV8A 5FMDA 1WMFA 4M0HA 4YZ2A 1O91A 4AGGA 3N7LA 1US6A 2CWSA 5C9AC 3CP1A 5JCOC 3VZOA 3O0VA 4WFAV 3ZIAG 3SJBC 5FKCA 4Y1YA 1JTZX 2JWPA 1PNGA 5DZGA 2P7TC 1KS5A 2BGPA 1WW7A 4A2UA 1S76D 3OEHG 3UV9A 4JYAB 3AKRA 5J2TA 3H7YA 2ARHA 1SQXH 1PD3A 1QKQA 2Y6JA 3OMIB 5DAXA 5B1NA 1RUE2 5LK7B 3K48A 4BQ3A 4YM0A 2WNEA 3HVDA 2PHXA 1QQP2 3QO8A 1PIV2 4QPGB 2WZR3 4Q29A 3W7XA 2CYFA 1A8DA 1GN6A 2Q4PA 4I0XB 1WLDA 1XDCA 3OJBA 4XZPA 2VOTA 1KDKA 3ZEDA 1MS9A 1UW8A 4AFBA 1C4RA 5EK0A 2P34A 4UW5A 4P00B 1XE8A 4TQFA 4I50A 1XREA 5L3EA 3TN92 2X6CA 5LGUA 4ZPIA 3ETPA 1ZREA 1DGWA 2HEWF 4Y4RA 1WCDJ 3OUHA 3S7IA 4FAHA 4O2BB 4X62B 4XIKA 2XKOA 2DE0X 2H6BA 5LA0A 3OGCC 1OXCA 5FBZA 2VW2A 1ZLZA 4XYXA 3G7DA 1GK9A 4P08A 3WY6A 4LA2A 3NKTA 2RN9A 1MSDA 1OOPC 4DV1B 2WYSA 3D0JA 3JD2A 4QKNA 3AMHA 3S30A 3LA3A 5AG2A 5FOJB 4QPIC 3MUZ1 1RJ8A 1GNHA 3SXWA 1ENSA 1H1AA 1Z7S2 1AJOA 1NXMA 2WLQA 3VD5A 3G6EV 4XBLA 3KS7A 1V6MA 1V70A 4LITA 1E57A 3SYOA 4DFSA 5H5NA 4V2WA 3K06A 5FPOA 3ZPYA 4KBZA 4Q6GA 2UUCO 2VC9A 5CB4A 1BK0A 3BCCH 3MFCA 2FDHA 3FB8C 4F6EA 1LHWA 3VZKA 4DQAA 3ETQA 4PA9A 4DV7O 3CO2A 1GOFA 5LL6Y 2Y48A 1HRV1 3JCZA 4JI7B 2VVEA 1N3QA 3DGTA 4NMIA 4JDNA 1AHSA 4YW2A 1VQ4V 4JI3O 4LCUC 2G4IA 3OGJA 4ZIBA 2SBAA 1I6XA 1M57C 2QM4A 1UIJA 1LHOA 4JTDB 1URXA 5D8AA 1EZVH 1F5FA 4XFIA 4LNVA 4EN8B 1M4UA 3NW4A 4XDLA 4M4RA 2QZ2A 4IL6Z 4GJYA 1PZ7A 5GALA 2PAMA 2FZ1A 1NCQA 5F6KA 2JB8A 4JAUA 3WP3A 3WG7C 4MHUA 1MS1A 4X64O 1OC1A 4LHLA 4G27B 4R9CA 2WFPA 1Y3TA 3O1SA 2CSGA 2RE9A 2C24A 3VOUA 1YNAA 2DYRC 4BLIA 5DQ0A 1RYYA 4X20B 2QQNA 3OBAA 5EV7A 1O3RA 4UF0B 5FZCA 1STMA 3GYDA 2GU9A 1TMF1 4QPWA 3MIGA 4XFFA 2JVDA 5ACA3 4Q4X3 5A1AA 3STZC 3FHAA 4D69A 3MW4A 5A7QA 4I2OA 1TNFA 1YI7A 4R52A 2V1DA 2A06H 2VD7A 1EV12 5JWPA 4DV0B 3MLLA 1NCQC 4CDQC 3K5MA 2VOVA 1QH6A 3T0DA 1O6UA 1ENQA 4FFBB 1CX1A 3U0ZA 2XBO2 2ITDC 1RUD3 1CZSA 1CAWB 4QU2A 2R063 1FXKB 5C5UA 2YIBA 1AR71 1XQ8A 4YGEA 1S0JA 3D82A 4X8AA 3AMMA 4GCZA 2CWMA 5LMUB 4YJ2A 1YHQV 2PHWA 2Y0PA 1UY4A 2DVAA 4XUQA 4EFEA 1GKFA 5L19A 5A3NA 4JV5O 4J11A 1QJU3 4P5HA 1PM7A 1PX4A 3GALA 1MA1A 2HKXA 5A33B 5KA6A 1BL8A 3ELNA 1RUC2 2CGPA 1E5IA 3X2QC 3AP5A 1V00A 3L2HA 2FCVA 3HPLC 4FM1A 2NPIA 4A7KA 2RR13 5FY5A 1PO23 3K4ZA 2W94A 2JDNA 3E8GA 2JDIG 3U4XA 2IW5A 1ALYA 1F9KA 4UWDA 2LJ2A 2V73A 4FTEA 1S3JA 3P3NA 2PHDA 4AFMA 3NQHA 4XF9A 5K9YA 4QPGA 1PGSA 3N36A 4KH9A 4KG8A 4I0XA 3JUUA 2EVXA 1H8TA 1YYNA 4RHV1 2LW7A 4LHNA 5LP6B 1O59A 4NB5A 4O9GA 3TEZA 3JCUZ 4BXFA 3CQOA 1XOUA 5IWAO 5FIXA 2HWC3 1AR4A 4FVVA 2QQPA 3OW2U 4OPHA 4DEQA 4J1WA 4RUFA 4FLYA 4INDA 2FCTA 4JZRA 3LPFA 1OUXA 1R6TA 3HKDB 3SCFA 1RL3A 3OE7G 4FPOB 3S0MA 2P5BA 3Q4HB 2BJSA 4O2BA 1EN5A 1TG7A 4EROA 4QPGC 1B6QA 2EIKB 3C90A 3PIGA 4LWSB 2E33A 1AX0A 4GJZA 1OBNA 4AVBA 1AYM2 1YJKA 2RM22 4M3CF 2HEYF 1FXZA 2ZGRA 4KL1A 1VBA1 1UQXA 4COVA 4W4LA 2HVKC 4DUZO 4H7LA 1TUBB 4MGSA 2YIBD 5FPZA 1POV0 3N9NA 1JUHA 2NM1A 4MVMA 5FLJA 3VD3A 4UI9L 3ZMVA 3HN1A 2HH9A 1QHDA 1O3SA 4RFT0 4DV2O 5LA9A 1HB2A 2GZWA 4E4EA 3WXPA 5FZOA 3SDLA 2V72A 3MIFA 4M4PA 4KMQA 1RHI2 1VARA 2W2IA 3AVRA 4ET7A 5DDJ3 4O4JB 1AX2A 4GKXA 3AB0A 4O9EA 2CTPA 3OGVA 1JHJA 3ST7A 3N7KA 2GH2A 1K3IA 4TLGA 1SZTA 2VZUA 5I8SA 2FZ2A 3GDBA 3VBRC 1XNTA 4FQ4A 5A6QA 3SGIA 3KD4A 3CCRV 2OCCB 4KQ7A 1NLQA 4BISA 2P3KA 4Q20A 4W4KA 2QQKA 2V7QG 3O9OA 4R8CA 2AACA 2MEV2 1WMXA 2FCUA 2DW4A 1OD5A 2ZKNA 1H4HA 2QWNB 1IBMO 4NVPA 3IDAA 2HEPA 1MVEA 2WLJA 5CA6A 2PHTA 4UF0A 2AEZA 1OVSA 3SPCA 1GOHA 5FCCA 3BODA 1PNLA 4UXAA 4AYUA 2Q1MA 4XJWA 1YZBA 4IHJB 2GP3A 5H6RA 5TISZ 2BVVA 4Q4X1 4PA7A 4CXYA 5DN6G 4MVRA 3CMEV 4YGCA 4LFCO 1IPJA 1VQMV 1R1ZA 4G9SB 2A6XA 4BH9A 4XC9A 4O2AA 3ZM8A 2YGLA 5FL7G 3MGUA 3M1HA 3M3IA 4LF7O 4DUYB 1LKNA 2P90A 2R1BA 5A1FA 2ZXQA 1TVKB 4N9HA 1AI7A 4FFBA 1OA2A 4OGQB 2VZ3A 1EM1A 1CAWA 3I3DA 1RUD1 1QJZA 4DV4O 3DTUB 3W7SA 2PLV1 3BTAA 3SMHA 4TUYB 2WLHA 1I0HA 2ORXA 3LDCA 4LT5A 1C1FA 5IY5B 3IJ4A 3OBTA 4RGKA 3B2EE 5C33A 1NS1A 3HT2A 1URFA 4BIUA 4H55A 1VAVA 3FE5A 4M00A 4ARYA 1G9FA 1B35C 2YC0A 1U5ZA 2WZPP 3NNJA 2XJPA 3DUIA 3HMYA 1R6NA 4QJFB 4PDVA 1PP9H 3LDBA 1LAJA 5A33A 5LZ6A 4H44B 4X6QB 1SQBH 3ZRXA 4OXSA 2QWPB 3DXUA 5L9RA 3OT7A 3APBA 3L72H 1VR3A 2JD4A 4K6BA 1FXKC 4FP3A 2VQ0A 2RR11 5EC2C 1PO21 3NL1A 1K5SA 3MIHA 4AXOA 1VBD3 1QOOA 4QKBA 1O4TA 4MGZE 3AX4A 1REFA 2ZXWC 1HXS1 5KUMA 3THPA 2MNGA 1MS3A 2FQPA 1NA1B 4IE7A 4NWWA 3QH7A 1RSOB 3A0RA 5B3SB 5LP6A 5EYPB 3MZHA 1PMIA 1SZBA 3FFZA 4ARXA 4BWOA 1QXRA 1XPWA 2GSMB 1QOSA 2HWC1 2XOMA 3VUOA 2ZM6O 3A23A 4JGYB 4NHYA 2ET7A 4LF5O 4CCNA 4I3PA 5CIRA 2P6JA 3I2JA 3HKDA 3E97A 1VB4A 3K4AA 3Q4HA 4I01A 1FX5A 2WDBA 4J6GA 4LWSA 1YJNV 5FR3A 1A3KA 2XQRA 4KWLA 5LP6C 2VQEB 4DIQA 1WLEA 5LBBA 5LEKA 2IJIA 3O7OA 4YZ4A 4TV8B 2PTMA 2VU9A 1BQPA 3C2UA 2GMMA 2F1MA 5F3IA 2UYBA 3OTFA 4BK5A 2F4VB 1QDCA 3R0RA 3D3QA 4BQ2A 1K92A 1KP2A 3IAYA 2IXKA 2HLEA 4GZ9A 5FZDA 4PBOA 1H9PA 5JJEB 1W03A 1YHFA 5A3MA 5TSWA 1W6PB 5FYCA 2QZ3A 2KA3A 4I09A 1VJ2A 2WO2A 4C91A 5GONB 3OGRA 5EWSA 3K58A 1YC61 1BMV1 3VDDB 1VPHA 3CDZB 4ZBMA 4O4IB 2HP8A 4IL7A 4MTOA 1VAMA 2GDSA 2C9AA 1GAXA 5FXZA 5KXBA 1SLAA 4U7NA 3UO3A 1OF4A 3VZNA 1V0AA 3ZXJA 4OI0A 1BZKA 3JALB 4BW5A 3LEGA 4LHSA 1BCXA 4GKYA 1SC5B 2WSVA 1QCEA 1A78A 1BXHA 1D4M1 2E53A 2VTXJ 3ZRSA 1H0BA 5E1RA 2M6YA 1JX9A 2IZWA 5E16A 2AH2A 3HNYM 4E2SA 5FFOC 3POGA 2EIEA 2JE9A 4WM8B 3VKMA 1RM1B 2XB6C 4XVHA 5FK8A 5FY0A 5HV0A 2B9UA 4DR7O 1OUSA 5B5EZ 3POEA 1NVPB 3M7MX 2KXLA 3RVHA 3THCA 1SCRA 5I0TA 1ENXA 2ZD9A 2VOKA 3HWJA 3PDQA 3RMXA 4NN0A 4IHJA 4DPNA 1KYOF 1F4MA 1CWPA 1WWYA 1IBKB 4OMDA 1CEZA 4OULA 4B3MB 1REEA 1QJY3 4G3YC 2VOXA 3H7JA 2QR4A 4WZFA 3W7TA 3LE0A 3CXCU 1JZ2A 4CDWA 1OI6A 1WNSA 1I94B 3J81N 4FFKA 4Y1VA 4M3CB 1FOD2 4CS4A 1O9HA 4NAOA 1KQRA 2ZGNA 3DXTA 3OGSA 1DQ2A 3KMHA 1EP0A 4KU7A 1KP3A 2HBUA 3WDTA 3JAKB 1MVQA 4JVAA 3UT0A 2WYFA 1N36B 4TUYA 1PL4A 2YUAA 1IS5A 4CEWA 5IVFA 3J7NA 4L0PA 5CNAA 2ZIMA 1J5EB 1SDWA 1Z78A 1H8HG 5EIBC 5BR8O 4F3JA 5KHJA 3OUIA 1NUKA 1Q8PA 2PN5A 5LY2A 1GN4A 2XT9A 2XJSA 4JKMA 1KRIA 5F1RA 1RUF3 3UQ8A 1AJNA 1FPN1 3QD6A 4MX3A 2V4DA 2UUBB 2R32A 4PQQA 4IYIA 4C1XA 4Y1UA 2XHNA 3ZN6B 3MDPA 4MADA 1J3RA 2Z3YA 2GALA 5HCHA 4QT6A 2XUMA 3UYJA 3POJA 3NKGA 3FLRA 4Y26A 5LHIA 4WF9V 3H3LA 5IY5C 2RS51 4BCUA 4RD7A 3RVZA 3FZ3A 2PA7A 2WABA 1NA1A 4MVUA 1RSOA 4EN0A 4IV1B 1CESA 2GMEA 1DQ4A 1GICA 5EYPA 3GB7C 2ZDIC 2JRIA 1UZYA 4FSJA 3ZN0A 1HX6A 4MGTA 4AEMA 2YBPA 3BCWA 1MZEA 2FTKA 5JPNB 1WMEA 4JGYA 5H9SA 3ZN1A 1XNQB 1LEDA 3RZZA 1KUQA 4ZHQB 2BP6A 1X4TA 3EB7A 4WFFA 2GP5A 1NZCA 5CADA 4JHTA 4CTEA 3WF2A 1PNMA 3KF5A 4QIWF 2A71A 3JAMN 3FB6C 4AOCA 2GTSA 3H1HH 2VAUA 2XR4A 1NA1C 4NPLA 4E9KA 2Y6KA 5JOXA 2Q0AA 5B3SC 5FO8B 5EZYB 3KCCA 3EHKA 3J8F3 3DKWA 1EPZA 1XJAA 2ZX2A 3M70A 3RWNA 1LEMA 4XUTA 4CCJA 1UYZA 3WP4A 4AAXA 1ZRFA 3CPWU 4ASLA 4YZ1A 1Y9GA 3WQ0A 5FLHA 4BK4A 4WVVA 4HPKB 1OV9A 3NWKA 1V6LA 3URFA 4JGYC 2CHHA 3E6BA 3Q8BA 5JUVA 4FCAA 1GNYA 2CUGA 1HN0A 2Q5TA 1F7YA 3GGLA 2N74A 3VQVA 4AI9A 2EILC 5A70A 5H2FZ 1W6PA 1C57A 4IIJA 2A7AA 3C7FA 1M93A 2WLMA 2UXNA 2W5FA 3FUQA 4O4HB 4AE2A 3U4SA 3VDDA 4FOVA 4A5UB 1XYPA 3HPNA 4O4IA 3T4VA 4YGDA 3CMAV 4YM2A 4UVBA 2R073 1W2AX 2QKCA 3MO4A 2J7MA 3T0BA 3CSXA 4OVEA 1MACA 4PT6A 3JALA 4MXVA 4WVMB 1FV2A 1TMF2 5BXZA 3RPQA 2PHFA 4B08A 3CD6V 2K1EA 4O65A 2OUJA 4XDQA 2XAHA 4HNAB 1AXYA 2ZT9B 4PF5A 1FJGB 2JK5C 4WM8A 2A3QA 3D3AA 2JGUA 5JR7B 1MEC3 4AQTA 1PO13 1J1TA 4DR5O 1UKGA 3B00A 4QQ2A 3CS5A 3MUY1 2D7FA 3CZUA 2QNKA 4DUVA 1BGYH 3O12A 3VQYA 4FO9A 4IW3A 4LBNA 2B45X 4WV8A 4FLUA 1AR72 3CRRA 2G9ZA 3FHIB 3PMEA 3L70H 4GX5A 2WAOA 3DC5A 1UCXA 1W6OA 2F17A 2XXZA 1Q8QA 3WNPA 4XE9A 4F6RA 2BOIA 1APNA 4UV9A 1RUH1 4WM8C 5IK8A 1RM1C 3CHXA 1OA3A 1N32O 2NLRA 1DDLA 1W39A 1CPMA 4Q8LA 4E4DX 4M3CA 4PJYA 2E5LO 1XNCA 2JS3A 1PGW1 4BQ1A 2RDSA 4TXWA 1E5SA 3GCXA 3IN9A 5IVCA 1W2OA 4CEYB 2VUAA 1ENRA 1SPPB 3TOJA 2VRZA 4GKJB 4MH0E 4JI8B 2IXIA 5A6ZA 4XF0A 3AYDA 2E26A 5A3WA 4IEVA 4LKFA 3LZZA 1UKRA 2WLKA 5I0DA 3HNBM 5LEJA 4QQOA 1DBNA 2WZR2 2Y34A 2ZGUA 4XEZA 2AGSA 3ASNC 1B06A 1QQP3 4L11A 1XHZA 1D2QA 4RHV2 1AR83 4LC1A 1WBLA 1PIV3 1RUF1 1XILA 2Z4FA 2QDNA 3ZR5A 4XJ8A 3O1VA 3AK1A 1CD3G 4FLZA 3VD4A 1MQTB 3K46A 3KQRA 4IERA 3ZN6A 1DYKA 4IEXA 1R1BA 1KD7A 5DMYA 4UCUA 1BBT3 2GC3A 1JODA 3K04A 3H8RA 1L7LA 1LHVA 5JMCA 1GUIA 2ZGQA 4DV5O 1JZ3A 2X5IC 5F3EA 4AK3A 1WCUA 3RYRA 4ONUA 3CWBH 4ATEA 3PVNA 5HV4A 4QHOA 1U0AA 1VBB3 5FP4A 5FY9A 1GN2A 1NVPD 3MHZA 4LK7A 1VBA2 1KDMA 3D6EA 3AL5A 5FPLA 1PKXA 4LK6A 1V55B 2X05A 4ZY9A 4ZHQA 4F8AA 3T2QA 4GYCB 2YSUB 4K8ZA 2Q4SA 2VBDA 4MGIE 1H6XA 2PMWB 5IATA 4B7EA 3AXDA 4XUOA 1GTOA 1KU9A 2ZGPA 1WLTA 3D4KA 2JDPA 1G9AA 2TBVA 3KWVA 4HN1A 3N2GB 1UZVA 1YF2A 4D3WA 1U96A 1M4WA 2L6LA 4KUMA 2VG9A 4QX0A 1QU0A 1UX7A 3GZEA 2EX3A 4IV1C 4X8NA 3BTYA 1O7FA 3BKZA 1G1XB 3A0HZ 5LBCA 3J8F1 2UXCO 3N9PA 2ZA9A 1MR5A 1JOYA 4XBFA 3RWRD 4FM0A 1YO8A 2VXRA 4JASA 1P4RA 1F31A 4HPKA 3RYFA 3RSJA 2PYLA 2VQAA 1AR61 2GMPA 2IC1A 4YVSB 3ZX7A 2AUYA 3R4UA 2HWB3 1XYNA 1PMJX 3I59A 4IEYA 4BHPA 3ZHSA 5HCBA 4KFMA 2F43G 3OM3B 3OEBA 2FL4A 3AZYA 3QTCA 4CCKA 4PV1B 1P49A 4DR2O 1F23A 2DN9A 3G71V 1X9PA 4ICGA 4FOWA 3AJZA 5K1PA 3D0SA 2RVAA 1MSWD 1ASJ1 3N3HA 2WBKA 4YXWG 3CC4V 2R071 3K3NA 4OFGA 2P3IA 1RUJ3 4BXSV 1PV0A 4K21A 4WVMA 4QM9A 1ULEA 5JZGB 3O1RA 3PURA 2ZZJA 2G9GA 3N4MA 4RUEA 2QKSA 4MZUA 1H2KA 2P67A 4Q4X2 1JI6A 1H6YA 4CA9A 4O7XA 5IVEA 4HNAA 1R3JC 3AZXA 2C5DA 1K9MW 1H2SB 2WT0A 1WD4A 2UXXA 5CU1A 3GJAA 2A6VA 2NN8A 5EYXA 2UUCB 1PO11 1P8JA 1RUG1 1LOCA 5C8CC 1W2BU 3WUCA 2D6MA 4DV7B 2LW1A 1EV13 1T5EA 3WOGA 3NAPB 1RUOA 1OH4A 1D2SA 1RUD2 2B1GA 1LULA 2RS11 2CU5A 4JTAB 4IE6A 4AG4A 2PLV2 2LFRA 3SYQA 2Q6AA 2BTQB 3H9VA 2XBO3 4LBMA 4JI3B 4YYOA 4N23A 2WLIA 1F2NA 5DG1A 3A2FA 2NMOA 3I56V 4LKEA 2JDZA 1OVPA 3OTOO 3ZXAC 5A32B 1TUEB 2ZEZA 3DCQA 1K45A 1RITA 3MLKA 4JDMA 2Z42A 2K0GA 4LF8O 4X64B 3MV01 1IKPA 1Y6XA 4LORA 2WWUA 4AQ2A 1ZX3A 3N9OA 4CEYA 1SPPA 4I0AA 2RR12 1PO22 1RUC3 1C1LA 4MT8A 2JX9A 2WLLB 2ARCA 3B9IA 1HXS2 3ZCCA 3R05A 3I55V 5DECA 5M0TA 1FS0G 5FK7A 3SH5A 4Q4V3 2YHJA 3P1IA 1AR81 3N9QA 1ZZ8A 4PLNA 4ZU5A 4XHBA 1MQTA 3M7AA 1WD3A 5FUIA 1OF3A 2HWC2 2VS0A 5CMUA 3BI3A 2UUAO 3ZN4A 1D0HA 4MW3A 1BBT1 1DTOA 3HKEB 4B3NA 2ZGLA 3WG3A 4CDXB 3SQOA 1GMMA 3KCXA 5BY1A 3AZVA 4AI1A 3MEPA 3K5OA 2D2CB 2A79B 4JYCA 1POV3 2DUOA 2IH1C 3SEPA 3BHPA 5FUPA 4JV5B 1SBEA 2CTRA 5IT6A 3TEWA 1K7DA 3O14A 1KEXA 1X7NA 2EIDA 1SFYA 1VBB1 2JENA 4WBBA 3RYKA 2R7EB 2RM23 4LE3A 3RRDA 3LDEA 2E76B 4QXBA 3RZKA 2I74A 3WW2A 1EAH1 4FPCA 3FJSA 2YXYA 1C5HA 2R041 2VMEA 2YI8A 4CP9A 5GJ6A 3EBRA 4EZ4A 2FMDA 2DCZA 3N2GA 3KZ4C 4UFKA 1OPMA 1F51A 3J4UH 2W08A 4NHXA 4CXWA 4DR4O 5IYBO 1UX6A 3GHMA 3LGRA 3VN4A 2QQMA 3ATGA 3H1KH 5IJ0B 2V4VA 1CONA 1Z5WA 2KD7A 1BMV2 3VBHB 3R6SA 1ORQC 1DLLA 4Y5TA 2UXDB 3WF4A 2CAZC 3OUSA 1OD3A 4DRXB 1PM4A 2ZHKA 4X1KB 4DO0A 1V55C 3RNSA 4COUA 1BJQA 4PCRA 4YVSA 4JZ2A 4R6ZA 3IGAC 3HB3B 4F7ZA 3TETA 3DPRC 2QQJA 3MYXA 4JI5O 5BPXA 3UKVA 2HWB1 3K79A 1OFNA 4XDPA 4LBKA 2XL7A 3K77A 5CFCB 3I2HA 3ASOC 1D4VB 1IBLO 1I5PA 1R3KC 4XQ4A 3OUJA 1XMQO 1AUYA 1O4ZA 2DQ3A 2P17A 1YJ9V 2ZEXA 3CL1A 3N2KB 1KMIZ 4IGPA 4DUZB 3P6BA 4JRAA 5JAXA 3CMGA 1VMFA 4JHZA 1MS0A 1W04A 3WHUA 5JZGA 1H2MA 1OKOA 1Q56A 5DXDA 1EN6A 3LB9A 2WLPA 1Y9MA 2JKXA 5FZEA 3ZLIA 4S2FA 1RINA 4MO3M 3ZHVA 1UOBA 4DV2B 1HP8A 5HCFA 4Y4YA 3RZLA 4H13B 4Q27A 1HKDA 1W6QB 1OHHG 1W05A 4AEKA 3F5WC 3FYIB 3NJXA 2ZGKA 3POBA 5G04L 3SYCA 3JD4A 2UWAA 2EF6A 3ZDVA 5H9PA 1IPSA 2WFF3 5FBJA 1HJFA 3A4UA 1QLEB 2B39A 4MVTA 5FAXA 3NAPA 2XL9A 2PF4E 1VF7A 4LEJA 4CCEA 3WNXA 2DWDC 1Y66A 5FWJA 1SQ4A 3IBMA 2HEVF 1WUVA 1G8MA 4O61A 2BTQA 2QQVA 4YY3B 4AEJA 4AZZA 3AP4A 3BU0A 2A1XA 1N1SA 3K2OA 4MLOA 4LKSA 1NE4A 3RN4A 3ZDSA 2ZX0A 4EQVA 3AK3A 4ZONA 3VL8A 2DVGA 2QTOA 5A32A 1XHXA 2DVFA 4FM2A 4ISQA 2A3YA 3K08A 1FPN2 2RMU1 5D1IA 5LYJB 5EIYB 5FREA 3LIHA 3I7DA 2XAJA 1ZWIC 2C26A 1M1KW 1IBMB 1ULGA 2PQQA 3DYPA 5FYVA 2JXAA 1N34O 1C8M3 4UCVA 1H4GA 3MD0A 1W6MA 3MDSA 1HR0O 1HV0A 3DC6A 2LRPA 4JCKA 5AFEA 2QWRB 2WLLA 3ZHQA 2RS52 4TYSA 1ST8A 4UFZA 4UCOA 3ZRWB 1IKQA 2RJLA 4LFCB 1AVBA 1EN4A 4WBNB 5A6YA 5LXTB 1DGWX 1D5NA 4P9LA 4LF7B 3B9CA 2VNVA 4PIXA 4Q4V1 2ARAA 3ZSEA 4ABMA 4Z82A 1XE7A 5CG9A 1U5YA 4I9WA 1UMIA 5CKNA 3WNNA 3E35A 3S5QA 4V1PA 3K3WA 4RA0A 3W20A 4DV4B 3PUIA 2O1QA 4XF3A 1AI6A 1CJDA 3HKEA 2F66C 2W46A 3THOA 4CDXA 2CNAA 5C3OA 5ANQA 4BA6A 2XGXA 1AYN1 1S0BA 4E27A 2VNOA 2FDKA 1POV1 1JPXA 5JOWA 1YI2V 3WDVA 1WW4A 5CG8A 5BNNC 1RXGA 4TN7A 1F35A 4Q2FA 4DOUA 2AZ5A 2O0OA 4N90A 2ZKLA 1WP7A 2C6SA 5HBAA 3ABTA 4NPRA 2R1DA 5A3OA 4AILC 3ZIWA 2N7GA 4CH6A 2XLFA 1HNXB 4OUMA 3ES1A 4YZ5A 4ZXEA 3OOXA 2D3OW 4MVZA 2EJ7A 2ADDA 2CTVA 3SLIA 1ZA4A 1QXJA 5BMVB 4Y20B 2VVDA 2CGNA 4D6RA 4CDXC 3AYCA 3PHMA 1O4YA 3V0BA 4AQ6A 3AZZA 2CL2A 3AG4B 4ISRA 4N7IA 5F5QA 5FZ1A 3CCJV 1PL0A 3SJCC 2GDFA 1AB3A 5IJ0A 4RO2A 1QJEA 5L9BA 5EYYA 1IVSA 1CQ9A 1VB2A 2F4LA 4X66B 4LF6O 1HN1A 4DRXA 4BMEA 2QA4V 4X1KA 2OQ7A 1AL21 2AR6A 4DR6B 4YIOA 5AFBA 2EXKA 4LBOA 2XAFA 1JMUB 2ZM6B 4RSUA 4P9XA 2ZABA 3UESA 2ES3A 2QKDA 2XPJA 3SJQC 2WKKA 4LF5B 3TEYA 1GP5A 4GLXA 2W3JA 3I3QA 1LESA 3ACIA 1ZBE1 2D5FA 5CFCA 4NR1A 4D6SA 3ZOIA 5FMBA 1HW5A 2E63A 1E5RA 1KD1W 2ILMA 1OCZC 2X09A 3VBHC 3N2KA 1ZTEA 4I3GA 2ZAHA 4OHVA 2NR5A 3WU2Z 5L3BA 3H8XA 1SACA 3AP7A 4UW4A 2W9XA 4IGOA 1OMIA 2YB7A 4P9IA 4OQ9A 2RDNA 4RN5A 2HWE3 4JGZA 5C9AB 1X59A 4J7KA 5DUWA 5EJ1B 2R49A 1WAZA 1AX1A 1N0NA 2DCYA 2W1SA 1LU1A 3CE2A 4U36A 4JZGA 4FZ0A 5CZKA 3LEIA 4I7ZB 2E7AA 4IV3A 4NIAA 1RUH2 1UWWA 3QCWA 5CFCC 1W6QA 4JYYA 4Y1ZA 4K0KO 2SLIA 3AKQA 3F7VC 2OT5A 5KBFA 2ADQB 4DR1O 1PGW2 4MOAA 1GV9A 2WFF1 4OZOA 2BW8A 3OPZA 5FYTA 3OUFA 1NXD1 4COWA 4LF9O 3C7EA 3ZSLA 1J59A 3VQWA 3FN9A 5KUKA 3O1TA 1S0IA 1XNBA 2WJSA 3MF6A 3MHHC 3JD0A 4OCTA 5FY7A 2QE3A 4QXKA 3KQ4B 3ZFFB 2VBPA 5DAPA 5LBFA 2EXHA 4FJCC 3P30A 3CJIA 1BK1A 5FNVB 5LYJA 1RUF2 4XPVA 5L3CA 3GVMA 1S0FA 4JYBA 5JVDB 1U5IA 2PI4A 3ZMTA 5JI7A 1JMKC 1I5XA 4PDLA 3CLPA 1C8M1 3GZAA 5FP9A 3CRAA 3L74H 1YQ6A 2WLNA 5KMGB 5IAXA 1OOPB 5FZKA 4CZZA 4TTGA 4FLTA 3ZRWA 3ZFEB 3D36C 3B93A 3C7HA 4WBNA 5I0UA
chains in the Genus database with same CATH topology
4B29A 5LEKA 3O7OA 4YZ4A 4S2GA 3W9AA 4AGVA 5DZEA 4BYYA 1FV3A 1OLQA 2PTMA 2VU9A 1IQAA 5H9QA 2R0FA 1BQPA 2R30A 3C2UA 2GMMA 3HQXA 2IXJA 2D44A 4NWVA 1PGL1 2UYBA 3OTFA 1GQGA 1UU4A 1IGOA 1LU2A 2XKPA 3T1MA 1NX4A 1JXNA 1QDCA 3H1WA 4META 3R0RA 1FNZA 1SLTA 4YG3A 1AJKA 4M0NA 4LO7A 2YYOA 4GMP0 3AKSA 4L97A 4Q4W1 1ND2B 4C0BA 2IXKA 2X5IA 2MEV3 3AKPA 5BYNA 1YIPA 1JN2P 4JGZB 2GAUA 2ET1A 1VLNA 2IFRA 1H9PA 2BTVC 4PBOA 1A8MA 4N43C 1YHFA 1BVP1 1RUJ1 5TSWA 4RL7A 4E4SA 5A3MA 1W6PB 4YVSC 2QZ3A 3OGGA 2KA3A 2UURA 4I09A 3VBSC 3JBG1 1UD1A 1GR3A 1VJ2A 1ND3A 4C91A 2XVLA 5EWSA 3UKNA 1V6KA 1LB2A 1FATA 1BMV1 3IDCB 4YW4A 3SH4A 3VDDB 4BHFA 1GBGA 2H0VA 2Z69A 1C5IA 1Q8OA 1DQ6A 5CFDB 4IL7A 1ZBA3 4GH4B 3V64A 4IV3B 1VAMA 2C9AA 2B42B 1UPSA 3J8F2 3PVEA 5KXBA 3ZYGA 1SLAA 2WT1A 3VZNA 5JCTA 3T2TA 2V5YA 1LJ7A 3ZXJA 4OI0A 2UY9A 5KHKA 3MPBA 2TEPA 4N53A 1BCXA 4GKYA 4HANA 4LULA 2NP0A 1W2UA 3NSTA 4JDOA 2IXCA 2WSVA 4NE0A 1ZZ6A 2ZX4A 1A78A 1BXHA 1D4M1 2E53A 4P9WA 4OI1A 4QPYA 1H0BA 5E1RA 4FTBA 4MXWA 1EV11 1AR62 2IZWA 5E16A 2GNDA 2AH2A 4E2SA 2QDRA 5FFOC 1HRV3 4IV1A 4Z8BA 4P14A 1NOVA 1G8WA 1Z0HA 2JE9A 1COV2 4NO4A 4WM8B 3VKMA 5JZGC 1GFF2 3AK0A 2XB6C 3MICA 3WT3A 4XXPA 3AMPA 2WZR1 2XBO1 2HWF1 3B7MA 4MSVA 1RC6A 4YVWA 1ND3C 4L8QA 2PHLA 3WP5A 3JQXA 2B9UA 4L9BA 4BHIA 4YLMX 1GQWA 3OY8B 1OIHA 2HWD2 2RJKA 1YI9A 1L3JA 2KXLA 5BNQA 4XHXA 4Q1RA 1FMD3 1EAH3 1NQDA 1S1AA 4K7JA 1SCRA 2OG7A 5I0TA 1ENXA 4GWMA 2R043 2A75A 2YZ4A 1PK6B 2VOKA 2ARXA 3CJIB 3HWJA 3WW1A 1G6NA 1NLSA 2RHPA 1ASJ2 3IPVB 4HBNA 3WCSA 4F83A 3DPRB 2ZMLA 3RMXA 1TME3 3N6WA 1UAIA 1DRTA 3O0XA 4NN0A 1TE1B 1R1A2 4DPNA 2GNMA 2R072 1YCIA 5I93A 3HAGA 3NAPC 3VLBB 3E5UA 4OULA 5GM0A 1BYHA 1REEA 2A6YA 1QJY3 5SV8A 4W6WA 3LAGA 1IS4A 4FXGB 2ZGTA 4GQ7A 3RG0A 5I91A 4G3YC 1X50A 4M2IA 1MS4A 2VOXA 1RTVA 3H7JA 4WZFA 3AKTA 4AI2A 4ASMB 3ECQA 1RUC1 3H3UA 4CDWA 4R9BA 2OIIA 1OI6A 4DS0A 3ILNA 3WW3A 3V17A 4HFSA 4K3UA 4M01A 4NHLA 1VBD2 4KBBA 4YVWC 1CGPA 4LE4A 5T5JA 2XHKA 1I5ZA 4Y1VA 2YV8A 1G9DA 4M3CB 1EY2A 1FOD2 2MPFA 1H8TC 4GIQA 1KQRA 3USUB 3FWEA 2AYHA 1VRH3 3VHPA 2ZGNA 2PYTA 5JVVA 3SISA 4TSVA 2D3PA 3KSCA 1DQ2A 1RGSA 1PO12 1RMU2 3KMHA 4HLTA 4MUVA 1EP0A 1RUG2 2EALA 4KU7A 3V56A 1XU2A 3WDTA 1RIRA 4AVAA 2Z2SB 2VH9A 2DF7A 3POSA 2WT2A 5J09A 3V0AB 1LGBA 1EYBA 3WG4A 1M06G 1MVQA 1FAYA 1YWKA 4XETA 4JVAA 4XMAA 1H1MA 2GC2A 3WX5A 5C9AA 3IT8A 1D0GA 1K5MB