4B7KA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-ser peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
338
Chain Sequence
GSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 105
structure length 338
sequence length 338
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7kA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7kA01
2ILMA 4AI8A 4Z1VA 1YCIA 2XUMA 1H2KA 4NR1A 4B7EA 2CGOA 2W0XA 1IZ3A 2YC0A 2WA3A 2CGNA 3P3PA 4JAAA 3D8CA 3OD4A 3KCXA 3KCYA 1H2LA 1MZFA 2Y0IA 4QU2A 1MZEA 1H2MA 2WA4A 2YDEA 4B7KA 4BIOA 4Z2WA 3P3NA 1H2NA 5JWPA
chains in the Genus database with same CATH superfamily
3CJXA 3JAMN 3IDAA 1Q56A 2VMDA 4CEWB 4S2DA 5EIYB 5JXGA 3MBWA 1WCKA 2X29A 5J96B 4B3RB 1THZA 1H2GA 5KMGA 3ZSKA 2ZX2A 1VMJA 2B46X 1RVF3 1N1YA 2PHXA 4ZONA 4FLZA 3KV4A 2ZGLA 4FOVA 5EJ1B 1IZ3A 4XF1A 2B4KA 2JVDA 2R061 3FB6C 2CDPA 1DGRN 3GWKC 1R3IC 3A2FA 3O1RA 2ITCC 1C1FA 4DRXB 1J3RA 4XEZA 4FZ0A 3BVOA 3SJCC 5A7WB 2PYJA 4I50B 2X6AA 4CDUB 1QIQA 5DN6G 1KDKA 3QBQA 5I8TA 1PV0A 5FP7A 3K08A 3MIDA 4J25A 2P3IA 1WJZA 4K6BA 4Q0QA 4K20A 1QJX3 5FYBA 4KBZA 3LUTB 2WS91 2D7FA 3UETA 4LO7A 3R05A 4GB32 3VUOA 2Y60A 3JAKB 1AF9A 1W8NA 3K46A 2HHHB 4META 3JCUZ 1I9RA 4N9HA 4FVVA 1PKXA 4Q4V1 3AL6A 1S0JA 4QB6A 4Q4W2 2ID4A 3ECQA 4XFGA 1NLQA 2JIJA 1SQPH 1AR82 3F7VC 5J2UA 5L3CA 2VQFO 3OEHG 2VMCA 5GLUA 4BB3A 4AL9A 3WNNA 2R072 3ZFEB 4O4HB 3KS7A 2XASA 4XW3A 5LHGA 5IFPA 1BK0A 4UYBA 3QD6A 4UB8Z 5M0TA 1AI6A 2EICA 2GNDA 3WHUA 1Y66A 4IGGA 2FDKA 3JQXA 2Q7EA 3WG7C 1NTKH 1M06G 1W39A 3VV1A 1SA0B 5DAVA 3N2KB 5C70A 4AEKA 3H3LA 4B4PA 1Y7BA 2RS31 4ISRA 3RZKA 3A0BZ 4Y26A 4JVAA 5LHHA 2F66C 4FFGA 4LORA 4QB1A 5CN0A 4JKMA 2K9PA 1V70A 3ZRWA 2A7AA 1LGNA 2QQMA 3OUHA 4LBQD 3EMRA 3N2GA 4RR3C 5IE9A 3SPCA 2Y4TA 3B5LB 4ZBMA 1BBT1 2WT2A 4V2WA 2DBNA 1QNWA 3DYOA 5FZCA 4QQPA 3ZFFA 5F1RA 1YJLA 1D5NA 3K77A 1WLDA 2ZE6A 2DYSB 4O7XA 3JD72 1HNWO 4MO3M 2RDCA 1JPXA 1D0GA 3FLRA 1XNRB 4ZS2A 5EBMC 4NHMA 1S0GA 2RMU2 1KQSU 3ABTA 3K2OA 4H55A 1ZNPA 1ZM1A 2R72A 1FS0G 1OD5A 4FSJA 3GJAA 1LAJA 3O0VA 3UT5A 1R081 4KWUA 4E2GA 3NRUA 4AEDC 1BEV3 4WV8A 2ZOEB 4OYUA 5LA6B 5L9BA 4HK8A 3T3YA 2K1EA 2WAOA 4Q1PA 2QQVA 2HJIA 3OM3B 1C4RA 3DKQA 2DOSA 1IHMA 3JZVA 3PU3A 4IGQA 4DR7O 1K33A 5B66Z 4K7JA 1CR7A 5FZ1A 1CX4A 4JI7O 2FQPA 5B1BC 1OXCA 5FREA 2Y0IA 1UU5A 2OUHA 4BQYA 2D6OX 2UUCO 1EFRG 4KFMA 4MTXA 2ZGRA 3EO6A 1JBCA 4K0KB 1BZKA 2JX9A 3MW3A 2W1QA 1HJFA 2W68A 4AQYO 4DV7B 4MVOA 5KHIA 3ZSEA 1CESA 1QU0A 1WMFA 1PZ9A 2OUJA 3GJBA 2CWSA 3ETEA 3NAPB 5K0UA 1VB2A 3UGHA 4TQFA 1NBMG 5KWRA 3S5QA 1O8SA 3LNMB 1H4GA 4AEJA 5LRSA 5F2WA 4YZ1A 1W9YA 1RUI1 2ENRA 1Z7S3 3TJTA 4DUZO 3AG2B 1V0AA 4YY3B 1PM9A 1QMJA 3LSQA 1COV2 4QU2A 1QLEB 1QGLA 1S0BA 4C91A 1HB1A 5F39A 1ZRCA 1KKCA 2YXHA 2XWJB 2R063 3WUDA 3K4AA 4QXHA 2E51A 3DF0A 4CXWA 5F7UA 1V9U1 1DQ0A 2E53A 5JR7B 2C5DA 2E75B 3J7LA 3KM5A 2VNVA 3CE2A 1UOJA 2LW1A 3AYCA 1UPIA 3ZMUA 2Q30A 1WNSA 4JF3A 4QX2A 1K5SA 4JTOA 4BU2A 3QH7A 2HWE3 4GKYA 1J59A 1W6PB 3AG3B 4QKBA 1NKGA 5DM6V 1GMMA 5LOVB 3OTFA 5FPRA 4Q4Y1 5C3PA 3BTZA 2FYUH 2FMLA 1NYWA 4HAMA 4CU7A 2P7TC 5CYYA 4CS2A 1GZWB 5LGUA 4AQTA 4QQHA 4QGNA 4AR2A 1FXHA 3SCHA 4AVBA 1JZ3A 5K7PA 2GMMA 2VQ0A 4DXRA 4NXMO 1V6IA 4JTNA 1QF3A 1FMD1 4UCUA 5K0UC 1NCQB 1VRH2 3AJZA 1GP4A 1JS9A 2BGOA 4DR7B 2GAUA 3J26N 1XILA 1HNZO 1S1AA 5CG8A 3U1XA 4OHXA 2WZR2 2IJKA 4JC1A 3Q9OA 3POFA 4KWLA 1SRYA 3OJBA 2D3RA 3I2OA 2JG9A 2VZUA 2A79B 1S2KA 4J42A 4JI6O 4AF9A 2A0LA 2N74A 1UAIA 2ZIMA 3ACFA 5FYMA 4GALA 4WVMB 1O4TA 5FJHA 1XNRO 2QQJA 2TNFA 2QQIA 4KU8A 4QX3A 5FZOB 1UX6A 3HAGA 2E76B 2ZGQA 1PIV1 2AR6A 4HETA 4XJZA 3AEIA 1QU7A 2YY1A 2HWB3 2XLFA 1NCRB 4ZOLA 5GKAC 2VXJA 4DXWA 2ZXQA 2ZGKA 3WF1A 1L7RA 2XNDG 3PVBB 1AB3A 4XE9A 2XG3A 1M4UA 5LASA 1GKBA 5I0SA 2OZJA 1LECA 1CEZA 1H9WA 3VZKA 4PA6A 2QFEA 2WFPA 1R092 3T09A 1AR73 2XAFA 3LDKA 4MHRA 3RYRA 5LHIA 2ZKOA 3KCYA 4COUA 1UQXA 3CB2A 4OHVA 1FD9A 2F4VB 1MZ5A 3W7UA 4K8FA 1NLSA 2E6VA 1BVVA 3ZRSA 1PMJX 5JSOA 4OHWA 5BUVA 1NZIA 5DDJ1 1BMV2 4Q4X1 1FXZA 3PVNA 3USSA 1F35A 5K0UB 3LEKA 4LFCO 1RPOA 1QH7A 1YI7A 4ASMB 4DR1B 5A33A 4NXNO 4IEWA 4YHHB 1F51A 4CBCA 1K3IA 2CWMA 2VH9A 1VP6A 3HBZA 2B5UA 2B9ZA 5EBWC 4RUEA 1ND3A 1IKPA 3N2GB 1R3KC 1OZ0A 4Q8LA 3ACLA 4IHJA 5IJ9A 1AR4A 5IFTA 1Z7S1 4RO2A 2AGSA 5GALA 4DRVA 1R1A1 5HBAA 3O65A 1C57A 3SH3A 4AGGA 5BY1A 3POBA 1I1EA 1VIWB 5IUQA 4HONA 4NIHA 2YIAA 3WQBA 4IE6A 1G9AA 1AL0G 4CDQC 3DTUB 2JK5C 3RT3C 5KLVH 1B35B 4QAWA 1UKRA 1RIRA 3TEZA 1G9CA 3THPA 5CFDA 1HRI2 1SETA 3J8F1 2HLEA 3QCWA 5FQ0A 3FMGA 1UXZA 3O1SA 2LRPA 4XPVA 1NAEA 1YO8A 5DAQA 2V72A 3JATA 4AWDA 1FI2A 4CH3A 2P17A 1JHJA 3U11A 2XVLA 4JI6B 3FLTA 5LYJB 2WRAA 3ABZA 4Y1XA 1I6XA 5JAXA 2AH2A 3RWNA 5GTIZ 1HDJA 3T2MA 3PUSA 3AP4A 1RUOA 1J95A 1R093 3N2KA 3HBKA 2JD4A 3MIEA 2Y69C 2R16A 4IEZA 4OUEA 3SLIA 1HNZB 3OD4A 5JMOA 3GWOA 4H37A 2F43G 4N8MA 4B4QA 4F4LA 1NX9A 4UF0A 1REFA 3D36C 1ST8A 1OCRB 2X5IC 1A8MA 5IJ0B 3HQRA 5DABA 3QLQA 5FMCA 4MV2A 3KGZA 2E3CA 4DUYB 1H2LA 2YZ4A 2JDKA 2QQWA 1F5JA 1W2UA 4QQ2A 2ZBJA 1TUEB 1CAUB 4YVSA 4IL6Z 2EIKB 1RYYA 4BE3A 4ZZ5A 4ZHQA 2W6JG 3AMNA 5T55A 4QX7A 1RHI3 4CDQA 3QH6A 5FZEA 3STLC 4TSVA 1XRUA 1GZCA 4YIOA 4IE7A 3F7YC 1HRV2 4DV2O 2YBPA 2YC4A 1F31A 1XYPA 1N36O 1BLZA 3RZZA 4JKKA 3RDIA 1RUF1 1IS3A 1U5ZA 2XHBA 2RVAA 3MUZ1 5FQ0B 1WMEA 3DSQA 4G3YC 4XF9A 4JAUA 2B7YA 2CV6A 3GXUA 4IE0A 4URTA 4XDQA 5BNNB 3ZXDA 4DR2B 4TTGA 1W8ZA 4BYYA 1Y67A 5H6QA 1YHFA 4D0QA 4LBJA 1LJ7A 4TV9B 2HR3A 3NV2A 4C90A 3CSXA 3TEYA 2DCJA 2DBIA 1MEC2 3VBRB 3KV6A 1DQ5A 3BI3A 2RDSA 1X8EA 2AUYA 2YDEA 2W5FA 4LPLA 4O4LB 2WS93 2JG8A 5C5UA 3QO5A 5FNVA 2RM23 1RUE1 2IJHA 2ZKLA 3BUCA 4QPGC 5I0RA 3APBA 5DG2A 2DUPA 4O4JA 4O2BA 2IVIB 3L9JT 1UKGA 4UW4A 1MABG 4CH6A 4FLXA 1TUBB 1ZA7A 4Y20B 5EYXA 1NCRA 4N53A 3S30A 4GB31 4PT6A 3OW2U 1NH2B 3ZSMA 4LXLA 1I7FA 3HB3B 3KHBA 1DFQA 3JB8A 4JI0B 4KGQA 1CZTA 5FJKA 4MUVA 2VR4A 5ABJA 2VZSA 4K0KO 4W6XA 2ZDIC 3T2TA 1HIXA 2JG8C 5C3QA 1U5IA 1JJ2U 4IXLA 2DVBA 1GZTA 3I54A 3BU0A 4J7JA 4WF9V 1LOEA 1PGL1 3T0DA 2E7QA 1K3EA 4J1XA 4UB6Z 4JI7B 3PJYA 4GMP3 4WCEV 2CL2A 1ONAA 4X65O 1WPBA 2WLIB 2ZKNA 5CA6A 4HN0A 3MYXA 2ES3A 2RS52 4YXWG 2WFF1 2BTVC 3NNGA 5I0UA 2QCSB 3ABMC 4YW5A 4LLFA 2VQAA 2D97A 5DUWA 2Z5UA 2XL7A 1GANA 4IUGA 3FHAA 4RHV1 2P37A 4PLNA 3EHKA 3N7KA 2QKSA 1L0LH 4FMTA 4Y4RA 1OSGA 2GMPA 2ET7A 4Q0UA 1W8OA 2RS13 1GQHA 4D69A 3KQRA 2BVVA 1IQDC 1RUH3 2QVSB 5DPNA 5FZGA 2ZE5A 3B00A 1MS8A 5FY1A 1HNWB 1YIPA 2ZAHA 3BIEA 5H2FZ 4IL7A 4CU6A 3ML0A 1PVXA 4XYXA 1SFNA 2J1TA 1H1IA 4AVVA 2P3KA 4JGYB 5CG9A 3ETPA 4TUYA 4OI4A 5C8YB 2ZZQA 4DV2B 3ZYHA 3UQ8A 4LFAO 2ADPA 2HJFC 1FPN3 5FFOC 1YJNV 4GWJA 2VQEO 2BERA 3TB0A 2IXHA 4XXPA 1FXVA 2WWWA 2J1AA 4P9XA 3I3MA 1OVSA 1QQP2 2XXZA 1Z5WA 1WW6A 3IAPA 4U7OA 3FX3A 2GSYA 2NPIA 2MEV1 5LZ6A 3GBWA 3A0HZ 2AHYA 5JMCA 1Y6XA 4TSFG 1GO3F 3FYEB 4EEQA 2OT7A 2UXBO 2BZDA 4RFRB 4EWEA 2JB4A 5DEDA 3WP3A 1JZ2A 2X0LA 5LP6A 1S76D 1K7DA 4BHPA 1WCSA 2XB6C 4RR3B 4HPKA 2YIBD 1P4RA 2Q8VA 1COWG 5DQ0A 2ZAAA 3L9DA 2JDIG 1OA2A 1GWKA 4Q26A 3I3BA 1ZX5A 4B8EA 1F2NA 1X82A 4B3TO 1E1RG 1VEWA 1AVMA 2OW4A 1LR5A 3B3QE 3OGRA 3VD5A 3EYPA 2R071 4CCOA 2HWD1 1REDA 3D5OA 3NV1A 4TOIA 1P7GA 1ND3C 1C8M1 2PQQA 5IVFA 1ACCA 3VHOA 3G6EV 2VBDA 3W5NA 1UMZA 1HN0A 4A42A 5JIAA 2ZINA 1FOD2 1A6CA 2D93A 2QDNA 4QXBA 3N35A 3ZJZA 3H1YA 1ASJ3 2C6SA 4LKFA 2VECA 3WD5A 4RFT0 4WVMA 4UT5A 3G6JB 3E6CC 1GLHA 2DYRC 1W03A 4PA9A 4I7ZB 1VAKA 2HP8A 3VD4A 1XBLA 3POWA 1LR1A 5IY5C 3F5WC 4P5HA 2DQ3A 4IEVA 1LGBA 2KG7A 4Q4V2 1DP0A 1BCXA 1F4MA 5GZDA 3N9PA 4FFBB 3WQ7A 2OTJV 3OUIA 4XUPA 2W1SA 1NKDA 2WYFA 1YNAA 3NXSA 5B1OA 3SYQA 4YZ2A 3FAVB 2R043 2AW9A 1VQPV 5DMYA 1NS1A 2K46A 3LB9A 4GKJB 4AHZA 1VR3A 3PTYA 3VZLA 1DQ4A 2XJPA 3JD4A 2IFRA 4CE8A 4OMCA 2WFF3 4QMAA 5HXMA 2VUDA 4BQ5A 2XLGA 2K0GA 4FLVA 3LEMA 2W52A 2IU0A 1N32O 2P3YA 2EXKA 3ZMZA 3OFNG 2V4VA 3ZRWB 2XR4A 4Q5OA 2JG9C 1AHSA 1YFYA 5SV5A 2XBO1 1AYN1 1ORQC 1RUH2 3DYMA 4H14A 4Y1VA 4GD4A 5A3NA 1WLEA 3RYFB 3Q8AA 5LB6A 1RUH1 2R49A 3SPGA 2YGMA 4XFIA 3T4DA 5K1XA 4JI3B 2R073 1AI5A 3C90A 2YSUB 4AI3A 4LOTA 2D6LX 3MV11 1PHMA 1W04A 3WF2A 1LNSA 5LBCA 5C3RA 4FO9A 2UWBA 2KB1A 3ZN1A 2C26A 4QXCA 1A34A 4LBKA 4NPMA 1W6OB 4LF9O 3KD4A 2Y6KA 2PFWA 4S2FA 1ASJ1 1XU1A 3MI8A 2GC0A 5CKQA 1RUC1 5BY5A 4U7NA 4LP8A 1J3PA 5L9VA 5FOBB 2QQLA 5CVRA 2GTSA 2YFUA 1IXMA 3P3PA 1B09A 1IG3A 1GTOA 1GAXA 4NIGA 1BEV2 1AP5A 3PN1A 4NAOA 5H9CA 1BMFG 3H8UA 4HNAB 5FUNA 2GC1A 2WPDG 4Q20A 4Q0SA 1AL21 4O4JB 4GMP0 3ZMOA 5EZYB 3T1HO 2GP3A 1UPGA 3L70H 3A8TA 4CSWA 4Z2AA 1RGSA 3GBFA 4XAAA 4BIOA 4TN7A 5JVDA 3ITQA 4OULA 2QZ3A 2RMU1 5E6HA 4DR5B 4LFBB 4KQ7A 1X59A 3RQ0A 5FZDA 3SISA 3V64A 1ASJ2 1Y76B 4MGYE 4CCMA 5C6CA 5LCWL 3SKVA 2VMHA 2NZ9A 1MG1A 3CCQV 2ETNA 4BM8A 1UU4A 3ASOB 2YYOA 1Q8VA 2H0VA 4MSWC 3P5BA 3E35A 1HKDA 2P2KA 3WG4A 1C3HA 4FI9A 4DZGA 4AI1A 1NZ6A 1HNXB 2JECA 2M7WA 3VBRA 4PDWB 2JGDA 3H1WA 3S7EA 3S0MA 5B1NA 1SACA 2XJVA 3CCJV 3EXUA 3VQYA 1AXKA 3JARB 2HKOA 4TT3G 2Y26A 3MW4A 4FLUA 4GX0A 2D2CB 4LUMA 3ZXAC 1HJGA 4TYSA 3OBRA 2VS0A 2BRTA 5FDBA 3LOBA 4IV1A 3SR2C 4R50A 1I5ZA 3AMQA 2JDNA 3OTOO 4Q29A 3FX7A 3K4ZA 3PDQA 4YW3A 5LBBA 4F3JA 1DZQA 3P30A 1QJU3 5F6LB 4YWAA 2B1GA 4A3ZA 5TSWA 3N27A 5SV8A 5KXCA 4DUZB 3GGLA 4FFKA 2IWGB 1VBB3 1V9U3 4CA9A 1AR83 2VCCA 5J09A 4BDVB 5FOJB 4FPEA 2WJSA 2W2IA 3KG2A 1S72V 4MHUA 1ENQA 3D0JA 3JU9A 3ZN6A 4DV6B 1VQ5V 3CCEV 4OI0A 2DCZA 4DV1B 1W05A 3RI9A 5EC2C 1FJGB 1Z0HA 4M01A 5GZGA 4LO8A 2JS5A 3T2OA 2IXJA 4R8CA 3MAQA 2ZQMA 2PY5A 3I5DA 4R9BA 5IK5A 3ZN4A 3GZEA 4ES9A 3WCSA 3LGRA 3ZFFC 5E1RA 5JOXA 4E9KA 1W6MA 4XFFA 3HQXA 1ZTEA 4WM8B 3ZPOA 2ZZJA 2DYRB 1NVPB 1R6TA 4PHZA 4RD7A 3ZYPA 5IJRA 1AYN3 4UWDA 3OGIB 3VBHC 1JYTA 1JJOA 2ZHNA 4BJ0A 2LM3A 2WABA 1OURA 4I30A 4N7IA 3RYCA 3O1UA 3P32A 4G4FA 5IT9N 3CBNA 4YZ3A 3LCPA 2UYAA 3IKWA 1PX4A 4OXSA 5IVVA 5CNAA 2IFWA 1ZRFA 2HFEC 1OPOA 4YW6A 2EXJA 3Q8BA 2XLAA 4FOYA 1TZOA 5JOWA 1B35A 3HQUA 3DXUA 3LDDA 5HCAA 2YUAA 2JIGA 1M57B 3LFMA 3I56V 4C0HA 1ZSPA 1SPPB 4UCVA 5T54A 5LP6B 3J9SA 1GM9A 3LDEA 1EUUA 1XDCA 1KDMA 4FP2A 3WW4A 3WV6A 4DV0O 3TXQA 1SQGA 3B2EE 1DGWX 4BQWA 4XVHA 3MLKA 3WZ1A 2VVDA 3S5AA 5IVJA 4NR1A 5A1LA 2QE3A 3GVMA 1IKQA 3POSA 2YXSA 3D0SA 1PO22 1GUIA 2BWCA 4QPIB 1W2BU 3SJAC 3VB9A 3C2UA 4UCSA 3ZR6A 2EALA 2RJKA 4J80A 3O1MA 1EAH1 5CFCA 3ZDSA 2A3XA 2UU8A 4D8MA 1VQOV 3KVBA 1ZVFA 2VZVA 4IIJB 1XNQB 1O3RA 5H9RA 2CTVA 1G9DA 1AXYA 1EN5A 5LY2A 5HPOA 1DHKB 5A3UA 2DV9A 3VDDC 1XSQA 3CF6E 3ZX6A 3JD71 4YVWC 4O2AB 1SC5B 2W91A 4DFSA 4URAA 5JCTA 2HWD2 2MNGA 1BSMA 2O8OA 4MGSA 3CCMV 2XTAA 2R30A 1YTFD 4CCNA 1OC1A 3VKMA 3IFXA 2LJ2A 3IGAC 2YROA 3DPRA 4DQAA 2GZWA 4DR6O 2Q1FA 3AK1A 2IXIA 1NTZH 3WG1A 1N1VA 5L3EA 1AJPA 3IPVA 2Q5TA 1D7PM 1C5IA 4RHV2 3CD6V 3KT1A 3VBOB 1VF6A 5IATA 3OAAG 4W65A 5K4LA 1GSLA 2YUEA 1Y9QA 4HANA 2P4VA 2QSAA 1WN7A 5C5TA 1XNKA 4FAGA 5IYBO 4YIPA 4Z92B 1MS3A 4NAMA 4FLTA 4KH9A 5FYSA 3AKTA 3MDSA 4IYIA 2QQOA 5C9AA 3T4VA 1S77D 1K5MA 3FD9A 1VAVA 2E33A 5A70A 1YVWA 1US6A 3I97A 5GZFA 4LJHA 3W21A 1BKZA 4AZZA 1KP3A 1OF3A 3VDDA 3SYPA 1SF9A 1UIKA 4XJ9A 5FUIA 5JPMB 1GWMA 1OFSA 4OQ9A 2B39A 2YI8A 1JOJA 2Q4PA 1ZLZA 3JSNA 4AEDA 1LKNA 2BOBC 1IBMB 1T6GC 4IE5A 4WFEA 1MQTB 1NCRC 4ZXEA 1JYIA 3DXRB 1DF0A 2EBOA 3H0OA 4COVA 1XL6A 4CUAA 3MW2A 2XHNA 3JSLA 3WOGA 4W6YA 1GRJA 3RZJA 1LOBA 4D6SA 3VBSC 2ZMKA 5L7OA 3EBRA 4K9SA 1ZZ8A 1K9MW 4OUMA 4R7CA 3K5MA 4I4TB 3DV8A 3ZM8A 3KF3A 3MLJA 1DQ6A 1IBKB 3SGIA 2LGQA 4PF5A 2L35A 4P14A 1YQ6A 4RS5A 3O5SA 3ZXLA 4E4ZA 4KHPB 4LF5B 3AC0A 3VBOA 3SNMA 4NO4A 4RQPB 1EV11 1NA1B 4B29A 1BJQA 1ZA4A 1OOPB 3WDVA 4XQDA 1TAEA 2A6ZA 5JJEB 5CBLA 3WB0A 4JQRA 1BHAA 1VPHA 2WNVB 5EYPA 1OHFA 4IT5A 3ZRVA 2Q1ZB 2VTXJ 4Q27A 4YW1A 1KMIZ 3OPTA 5KA5A 2HLDG 5LL6Y 2UXCB 3D82A 5GTHZ 4LBQB 3RJRA 1IBMO 3VHNA 1UMHA 4FOWA 4EZ4A 2IXLA 3ILNA 1PO12 5H9QA 2A73B 4PJYA 4FVMA 3WX5A 3PHMA 1S3JA 4MVTA 4OZOA 3ZN0A 5FY7A 4AVCA 3BALA 4LF6O 5AFEA 1SQBH 5J1XA 2EILC 2XGXA 1JCHA 1GOFA 5FPOA 2DCKA 1MA1A 4Y1YA 5LOVA 3H8XA 4DYLA 3WHTA 1WMDA 2M6YA 1W9TA 5FZMA 3I49A 2H6BA 4MSVA 1MR5A 3ILRA 1WWYA 4X89A 1MZ6A 3H9VA 2EXIA 3J80N 3OR6C 3X29B 1BEV1 5FZLA 3VDBA 2DYCA 3PJQA 4XMIA 1AVBA 3TYJA 3THOA 3PMEA 3PLQA 5F8PA 2JDZA 4HXCA 3GALA 4JGSA 4UCRA 1XOUA 4JCKA 3T1LA 5FTTC 2VM9A 3JARA 1R73A 3TK1A 5FR3A 1L1FA 5D8AB 2UY8A 1NCQA 3AG4B 3OB8A 3H1HH 4K21A 4FLYA 3H1JH 4CDUA 1NH2D 3M7AA 1KBHA 2XMLA 1WA8B 1POV1 1UJWB 2BPA2 3AVRA 3W7XA 5JCOA 3NV3A 1XREA 4OZXA 2P6CA 2BSKB 1W8UA 5FZHA 3G4SV 3LEGA 2GC2A 3HT1A 1HRV1 5FWJA 3HVDA 4B7KA 1VQ9V 3HN1A 3K58A 4XAEA 5JUVA 2N7GA 1MOFA 2W46A 1WLTA 1XNBA 2VG9A 4UFLA 1MPXA 4LLOA 5DUXA 4JASA 5FP8A 1OMIA 2QKDA 4X64O 2I07B 4UVCA 4PIXA 3HWJA 2WZR1 1NT2B 1HX6A 5CB4A 1MVEA 2C2AA 1G1XB 4MXWB 4YVWA 1ODNA 2P6HA 4B08A 3R4DB 5LBQA 3VKNA 4GH4B 3AZXA 2CH7B 1YSCA 5DUVA 3CC4V 3AFKA 4CDXB 4W6WA 3K79A 1J84A 1PNGA 1QDCA 2E7TA 1U12A 3TNPB 4BK5A 2QWOB 3AMHA 4DUXA 5AC93 2CGNA 3LKJA 2E5LB 4I0XB 2ZE7A 1LUVA 2DTYA 1Y9MA 4X1YB 2PLV2 5A6XA 4QB2A 3M3QA 4JDOA 4RQPA 1APNA 1ZBA1 4DUWA 5EC1C 1JFFB 1W59A 3I8TA 4BMEA 5CA1B 4ARYA 4XF3A 5DUUA 4FQZA 3U37A 4LH7A 2NYYA 1XJAA 3A22A 2FL4A 2EAAA 2WKKA 1J83A 1BXHA 3D4KA 4PELA 4P08A 3CJHB 1UL9A 2JWPA 3HN3A 4W4ZA 1OFNA 2R0HA 4YJ2A 4FAHA 1E5SA 1GV9A 1E79G 1IPJA 4N43B 4CCDA 3HNBM 4WBBA 2Y38A 3C3TA 4AI8A 5T5LA 2ORXA 2BV4A 5KHGA 1VIBA 2P6JA 2WLKA 5CMUA 2FCVA 2Q0OC 1YI2V 1N34B 2VJXA 4J1WA 5C8CC 4J7ZA 2EINC 1H0BA 3TGUH 2EA7A 2X10A 1QOOA 3E6BA 2ITDC 3ZYBA 4ATFA 4I2OA 2Y8KA 4TLGA 3QO7A 1W2AX 1KUQA 2WZPP 3OGSA 3KZ4C 2F4PA 4AHXA 1KECA 4X1IA 2HH9A 3RBZA 3UGGA 1R1A3 1F4AA 4MG2A 5B4NA 4QXKA 2E5LO 3ZKUA 4YVSC 4I09A 1W6NB 5D1IA 3AMPA 2V7QG 4N9IA 2F6BA 4JZGA 4CC6A 3TRSB 4IETA 5A6QA 5FPBA 2K9ZA 1YLLA 5LA9A 5FK8A 5IWAB 3U10A 1V6KA 5EPAA 4BAYA 2P5BA 2Q1MA 5FZ6A 2IH3C 5BNPC 2X09A 1LUWA 4J7KA 1OI6A 1QQP3 4X64B 4X1IB 4NHLA 3GF6A 4XUQA 2C1FA 3WDTA 4AEDB 2ZR3A 1I5YA 4XJUA 3INAA 3VBSA 1ZBA3 3OBAA 4PDLA 2R9AA 1ZUQA 5F3CA 3D3QA 3UNPA 1NQJA 4C1WA 4ORFA 2MHFA 4CPBD 1KS4A 1LOAA 1EAH2 2ADEA 3CJIC 1HP8A 2MW2B 3BGAA 3IDEA 3T1CA 1N1TA 1HRI3 2GNBA 2VBPA 1OCCC 1SQVH 2JG8B 3WF3A 4LO4B 4OGQB 2DQ0A 1JYNA 1H8TB 4H2AA 5IDJA 2C24A 5F6KA 3J8F2 5B1AB 5IY5B 4YJ3B 4IV1C 1S0EA 3JALA 1D4M2 4XBLA 3T1YB 3RYPA 5FMDA 3O1VA 3Q8FA 5FY5A 4F6RA 2W3JA 2Y6LA 4DK0A 1BBT2 3UM7A 1F4HA 1GN4A 4YGCA 3VL8A 4O4HA 1KGYA 5BNOB 3T1HB 1VBA3 4LCUC 4COZA 2NR5A 1CXZB 5C4WB 2ORZA 2UUBO 3PL0A 5CKNA 3IAQA 4S2HA 2JDMA 4QKNA 3RMYA 3AP9A 4EZHA 2DW4A 4XXAA 2BSKA 4MT8A 1BVP1 4LF6B 1K45A 5I93A 4QPGB 4HT1T 4BR6A 2RHPA 3ES4A 2WLQA 1TEIA 2J22A 3RYHB 4RQEA 1PD3A 1BCCH 2CNAA 1SKVA 2Y0OA 3IZOA 2CYFA 4JAVA 1PMIA 4L8QA 2VPVA 4Y5Z0 2W08A 2UU9B 5FPUA 3BPZA 2EIJB 3G6BA 4PQ9A 5KC6A 1Q8IA 1LESA 4L92A 4ONUA 5GZCA 5IT6A 3U0ZA 3PVEA 2UXCO 4HKOA 3AL5A 4AILC 4RWUA 5EYPB 3SPHA 4WFHA 4RS5B 2P67A 4A2UA 1WP8A 1EN6A 5JSPA 1H1AA 1I3HA 3CKHA 1AYM1 2DWDC 4FPOB 1SFYA 4NIAA 1CAXA 1LNQA 5KXBA 1VF7A 1YWKA 3L74H 4A5UB 1QQCA 2GNTA 1ZBA2 1RC6A 5JOZA 4IV1B 4CCJA 4UAPA 4OI2A 1YUDA 3OOXA 2BFUS 1OA3A 1RUD3 4K1YA 3WXPA 4A7ZA 3EJKA 5LMUB 1NVPD 3HKCB 2WLIA 3K57A 4HFSA 3GBGA 2ZGPA 3NJYA 4MTFA 5DAWA 2VULA 4GKJO 1NY71 1CIWA 5GLWA 5K9YA 1YIJV 1R3JC 1X9PA 2QE7G 4RSUA 3ZMVA 1DGWA 1EM1A 3BY6A 2FBEA 2Z4FA 2Q0AA 3AYDA 4XACA 2BTOA 3B02A 2VMGA 3D8CA 1V55B 1BS3A 3PUHA 2P34A 1VQ4V 1ND3B 1T2XA 1VRH1 4GA9A 2J7MA 1S0VA 2VTFA 1R6KA 5IWAO 1ZYBA 1SFPA 1JZ5A 5FRAA 1RXFA 1JOYA 3VBHA 3A0NA 1XU2A 5FPXA 1FXKC 3B40A 2WO2A 4LF8B 1D2DA 4EFEA 4LH6A 5CADA 5GW7A 2D5FA 4KP4A 1ENRA 2PMWB 3B77A 4YJ3A 1W2OA 2JJ2G 2JICA 3CEIA 5BMVB 4XFCA 3CCRV 2BP6A 2FMDA 4CC5A 3ABMB 1BT8A 3SITA 2E32A 1YHQV 2EZOA 4L11A 2Y6JA 3G71V 4FLWA 2DTWA 1AJKA 4DR6B 4IDZA 1H1MA 5C33A 5F2VO 1DYKA 1H6XA 4FPYA 4NRPA 1TVKB 2AGAA 4RQPC 3WDYA 1TUBA 2JDAA 5FO7B 1OLME 1M93A 1W06A 2CTPA 4UBHA 4EE2A 2YIDA 1XE0A 3USUA 1F9KA 3K59A 3RMXA 3IB3A 5IYCO 1RITA 5LWBA 1H2MA 1RL3A 1WW5A 3C3SA 4PDMA 1O3TA 1TQ5A 3N9OA 1GK9A 5FLJA 1QLNA 4WBNB 4OVEA 4IEXA 3FC0A 2HJDA 4QGLA 3NKTA 2TEPA 1KD1W 1UU6A 3FJSA 2ARCA 4I4TA 3LE0A 1IXBA 1EV12 5I8YA 2JD9A 1VBA1 4JTAB 1L0NH 2RS51 4AW7A 4LO6B 4F6RB 1UOGA 3FWEA 4CYDA 4DB5A 2GNMA 1UW8A 4HVRA 5FZ9A 1MNGA 2FDHA 4LFAB 4BPZA 2H0BA 4OHZA 4AOCA 3E6DA 3I59B 1RVF1 3E2EA 1TA8A 1IX9A 4N7UA 1SEFA 4DV5B 2W1UA 4LHLA 5C8CB 3KVAA 2AZ2A 4YM2A 3JBG2 4NOTA 4CP0A 2G1MA 3OBTA 5LBFA 4QDQA 1FT9A 1AYM3 1LTEA 4QT6A 1RUG2 2P06A 5GLZA 4EWDA 4AYUA 2AZ0A 2YB7A 3L72H 3BHPA 2IC1A 2NNUA 2EIDA 3TN91 4LA2A 5EV7A 5DXDA 1US2A 1W3VA 5BNPA 4UBGA 3KSCA 1G8WA 3POGA 3IJ4A 4CPBA 4J6GA 1C1LA 2D6MA 3F2ZA 3IWZA 2VXRA 1JN2P 2W6IG 2RE9A 2BQPA 3E8FA 2VGDA 1XC6A 3JQWA 3SDLA 1GOGA 3JBG3 1GOHA 1GR3A 4GJZA 4AI0A 1OUSA 3SC7X 2WDBA 5FP4A 1JVMA 4X1KB 1QVFU 1KJRA 3SCGA 4J41A 3RYFA 5FLIA 3L73H 3RPQA 4DR5O 1E5HA 4Y20A 1DZTA 1NR7A 5DAPA 3F5TA 1RJ8A 2YBSA 4FFFA 2RN9A 4Y4YA 4NJ4A 4A6OA 5I0DA 4BIUA 5AG2A 4L99A 4CP9B 2WQZC 4O4IA 4Y1UA 4XUNA 4O4IB 2Q69A 3W7SA 4K1ZA 4I9WA 2BDRA 1PNLA 3U78A 3VD9A 3K5NA 5AFBA 4X20A 2B45X 2WLMA 3EVKA 1O3SA 1IPSA 2VL4A 5FXVA 5CA1A 2RR13 2ZPXA 5FMOS 2VMEA 5JOYA 4ASKA 3UO2A 5FO8B 3CX5F 2PXJA 3ZOIA 4ZY9A 4BLJA 3CCUV 4DR2O 3P1IA 2EIEA 3ZN5A 1QQP1 2WUHA 3MIGA 1RB8G 1B3QA 3OPWA 3N9MA 1FATA 3WNPA 1G86A 2AZ5A 1WMXA 3WU2Z 4FFHA 4Q4W3 2GN7A 2WS92 1V54C 2XJTA 3AZVA 2TBVA 1G8MA 3K5LA 4AQ6A 3RYIA 1KQRA 5K1PA 1H8TC 1RMU3 1QJX2 1EPZA 1FX5A 4UFMA 1YFXA 4MZUA 3ZFEA 1AX1A 3HNMA 3RSJA 2ZS6B 4R9DA 1WGPA 1N32B 4OLLA 3BU7A 4LKDA 1PZ8A 2V4AA 5EQUA 4I01A 1IBKO 4DV3O 4A44A 3HKCA 2D3PA 3O1TA 3GNEA 1AR61 1HQWA 2QM4A 5KUMA 1ULFA 5J2UB 4LBLA 4TV8A 1WAZA 4JI4O 2XQRA 1Q8PA 1ZZCA 4ZI7B 2J1SA 4A41A 3UCSC 2UUAB 2VZPA 3NNJA 4B3SB 2XJUA 3U14A 2EIMC 4XJAA 5C8WA 3A0RA 2RDQA 2RDNA 1SMVA 5A2QN 1VBD1 3KT4A 2VAUA 1NQDA 4M4PA 2V73A 4K3AA 4XILA 5EIBD 3BCWA 3CC7V 2WSSG 2VOXA 3H1IH 1NA1C 1LU2A 1XPWA 3WG3A 1AJOA 2B9VA 5EJZB 2EIJC 2HVJC 3POYA 4P00B 3DPRC 5E16A 4CVUA 4RAIA 2DVGA 4LT5A 5B3SC 5E1AC 1MZEA 5DDJ2 1YQ2A 1BMV1 3BABA 3VGIA 3CJIA 4HK9A 3ABUA 2VZOA 4A4AA 3E97A 2JJ1G 2HWB1 1E57A 1W0OA 1P7BA 3I2IA 4IGPA 3MFCA 2GBOA 3L71H 3W59A 4B3TB 2YC2A 4ARXA 3GYDA 2HWF2 4GWNA 3Q4HB 2RDRA 3PUQA 4CS4A 1ENVA 3NQHA 4YM0A 5D2AA 3MF9A 1O4ZA 2VWJA 1ULOA 4WM8A 2BBVA 3KGLA 4IESA 4QHZA 4X6QB 3WW2A 3B4SA 2C0ZA 1IDSA 5HI0A 2FHRA 4QX8A 5FYTA 4DR4O 3JBG1 5A7WA 4I50A 5LK7B 1Y43B 1JYCA 4UV9A 4EYUA 1PVC2 4BWAA 3DKWA 2YXYA 2DCTA 3ZXJA 2R7EB 2OVUA 4AHCA 3V56A 3LEIA 1KFXL 4Y1ZA 1HXS2 2WLNA 5L3BA 1T6BX 5C9AB 3MPBA 3MGUA 2CY6A 1YIFA 3MD0A 2KR2A 1TVGA 2IW5A 1UY1A 2YPDA 3MEPA 2AHZA 4ASLA 3FYIB 1OOPA 1IS5A 1OF4A 1VQ8V 1B6QA 3RFRA 1J1TA 3BOPA 1GM8A 3WQ1A 2GDSA 3OEEG 2JDPA 2YMZA 1VMFA 1QJZA 1KEXA 5LEJA 1HLCA 2RJLA 2G9ZA 4DO2A 5G05L 2WR9A 4JKLA 4MGTA 5KA6A 2P4KA 2FDGA 3DECA 5JXIA 2LS6A 4Y24A 1STMA 3E86A 1IQAA 2HWD3 4ATEA 4EN0A 1AX0A 4FTEA 2JXAA 4CP2A 2BUKA 4UOJA 1JOPA 3ETGA 1RUJ2 4DINB 2DDUA 1ZZ7A 3T1MA 5ERLA 3IIAA 1OD3A 1O6UA 3PURA 4JHTA 3MFAA 2FCTA 3BIWE 3O1PA 3EHBB 1OT5A 3UESA 1SCRA 1RMU2 3RZGA 2ATFA 4FFBA 4M4RA 3EQEA 2R70A 5IVCA 1ENSA 1PMHX 1LODA 3WY6A 1RFYA 2VD7A 2ZHLA 4UV8A 3AG1C 1O5UA 4IIJA 4U3JB 3A0KA 5DZFA 5EIBC 4A7YA 5K8SA 2JRIA 1F23A 1RM1C 1HW5A 3VQWA 1AX2A 1R083 5FP9A 4O2BB 3ZEDA 1S55A 3ZHVA 2VZQA 2R9IA 3CCSV 1SCSA 4OX9O 4AK3A 2UXBB 5C9AC 2JIZG 1O9GA 3AXEA 2R1DA 4NXMB 4JGYC 2BTQB 5KXEA 4LIVA 5IVEA 2WBKA 1OLRA 4R4ZA 2DFBA 3KMHA 5LY1A 1AJQA 1X33A 5A6YA 4LBEC 3MV01 3IPVB 1SLTA 2PHFA 2TUNA 1JOBA 2D43A 5EP9A 3N3HA 3UV9A 2VUAA 4DEQA 1NU1H 1H8HG 3I3DA 3NNMA 4Q8KA 2QDRA 4X20B 3N4MA 2E9QA 5JI9A 4NHXA 4CXYA 4I3PA 1S0IA 3K51A 1SDDB 2YI9A 3WNXA 4JV4A 4LHSA 4PI2A 1GNZA 3QG5A 1KJLA 1VMGA 3R0RA 1PGL2 4XFHA 4TLFA 2A6VA 1N33O 3OE7G 2PHLA 5ACA1 5FPZA 1DG6A 2BOCC 1JH5A 2JDYA 1IPKA 1GFF2 5FYIA 3ACGA 5FXXA 2WYSA 1LHNA 4SLIA 3L2YA 3VBUC 2HVKC 5D5QA 2AENA 3AJYA 3LA3A 4ASUG 3ZXGA 3THTA 3LNNA 1UFIA 5FZ8A 3C3VA 3BTAA 4YGDA 2XH6A 4IV3A 1PP9H 1TME1 1VQNV 1N0JA 4XDOA 3RZHA 3AFGA 2KQXA 1VALA 1NOVA 5GM0A 3ZYGA 3SQOA 1R082 2DU1A 2N05A 2A3WA 3SEEA 1MS1A 4Q4Y3 1MS5A 3K75B 4NE9A 4YG3A 2FMYA 4LF7O 1EAH3 4LK6A 2WWJA 1M57C 3GM8A 2DFCA 2Z79A 4GWMA 5F9TA 1UOFA 4HG6B 4TV9A 4PQQA 4QX5A 4LWSA 1WB8A 4X65B 2ZGMA 1URFA 4QKDA 1JFFA 2A1XA 4AQYB 3SCFA 3GCXA 4QDSA 4WM7B 4B3MB 3T2QA 5FV3A 3AKSA 3DC5A 3VN4A 4CCCA 1PZ7A 2RNBA 2UUCB 1LCLA 1UY0A 4LNUA 4X66B 1RVF2 1UOBA 1DQ2A 5JWPA 3ZN6B 5E79Z 4JI0O 4XC9A 5CFDB 4HSLA 2JS3A 5CFDC 4OQ8A 1N47A 1V6NA 3K03A 5BYNA 4FPLA 3ABKB 2QM7A 2ZGTA 3CXHF 1KKDA 1GNYA 4QM8A 3LIHA 1YJWV 2DUOA 2EAKA 2JJ6A 2Z69A 5T5JA 2ZACA 3I2FA 1B35C 2OIIA 1YZBA 3VZMA 1MS9A 3A21A 3M70A 3H3UA 3RYIB 4XDPA 4AI9A 5IAXA 5KAIZ 2A06H 4Y33A 1J58A 3JD2A 5JZGA 2EULA 3V0AB 3ELNA 2DCYA 2GSMB 2R32A 1BL8A 1CPYA 1W6MB 4XDJA 1WCQA 3ZMTA 1EP0A 4R9AA 3AK0A 4HNAA 1SBEA 3CLPA 2CGPA 3BOWA 2WO1A 4GKXA 1HXS3 1DBNA 1RUC3 2ZM6B 3VKLA 5D8AC 1UZVA 4ZI7A 4C7UA 4GUNA 4V2VA 1PGSA 5KC5A 1ULPA 1UYYA 2QA4V 2OCCC 2GUZB 5CA0A 3ZHTA 2ZX1A 4ZS3A 1GWLA 4DXSA 4DRRA 2KM2A 3OBZA 3M7MX 1G6NA 2J42A 1A8DA 3IDCB 2QZ2A 5D8AA 4UVAA 3RVZA 4CZSA 2PLV3 1Q8QA 2X5IB 1YI9A 1Q3EA 2A3QA 3BAAA 3THCA 3R6SA 2X7RB 2WQ8A 5LA2A 4GB33 3LF7A 3O7OA 2KKWA 2HWF3 2A6XA 3R4UA 2EF6A 3HR9A 3G7DA 1HN1A 1CN1A 3K04A 3WNMA 3HOBA 3NWKA 1ULDA 3Q8CA 5IJ9B 4UCTA 1ZZ9A 5DDJ3 3A23A 3AZZA 1BK1A 2XOMA 3ZYJB 4YYOA 2X6CA 2XUMA 1QCEA 2HBUA 3IC9A 2WZ8A 4M3CF 2RV9A 2VQFB 5JPNB 3OF1A 4LFCB 3AG1B 1SLLA 1W8WA 3HEIA 3FUOA 4Z2WA 1HRV3 3VBRC 1COV1 3KB5A 4LBOA 5CB4B 3J81N 5A3WA 3LSEA 2F4VO 5J3UA 2LTNA 5I0TA 5F37A 2G38A 3BCCH 3ZXKA 4YVSB 1BBT3 1DZRA 1M90W 3GHNA 1NQTA 4BQ2A 5FZ3A 3APOA 5LA1A 5LP6C 3ZFGB 3KF5A 5J2TA 2JE8A 5EJ3A 1D4M3 3KT7A 2JG9B 4LMFA 1QY4A 3K9AA 4KNCA 5EFUA 1AR62 2X53S 4N43A 4GYCB 4E2SA 1ROPA 1QLEC 4GZ9A 2WT1A 4CP9A 4XOGA 4DV4B 3SKJE 2EZPA 3H42B 1CP9A 1KC8W 3LFIA 4FPHA 5GZEA 4D7YA 1VQLV 4S2GA 5HCFA 2O8QA 3ABKC 2WAAA 4E4SA 2JENA 4WM8C 2JGDB 3U4SA 5IYZA 3MO4A 5FCCA 1BZWA 1K12A 5F5AA 2Q68A 3LIGA 3HKEB 1E5IA 5LGNA 3VBHB 3A4UA 1QJY2 1QXJA 1DU3D 1RMU1 3NJVA 3HD8B 1RSOB 2PHTA 4QDRA 5C7GA 1W9WA 4SBVA 3IM0A 2XHKA 3UKVA 2YU2A 1DGSA 1S5HC 1SS3A 1RUD1 1YXWA 3NMBA 2YICA 1G9BA 4IV3C 2P3JA 1R091 3B8MA 1HV0A 4M3CB 1W8TA 1CAVA 4EN7B 4YHHO 2R041 3WR0A 1EY2A 2QTOA 2WA4A 4NXNB 2VQTA 3KV5A 4DR1O 1FFXA 1Q86W 4U2AA 5E89A 3NSTA 2DN9A 4QGPA 5GONB 5LW9A 1ENXA 1CGPA 2B9UA 3IC7A 3W5MA 4Z1VA 4XQ4A 1JYWA 3VBUA 1PIV2 3ACIA 4GAZA 2UURA 2F93B 3AK2A 2HYXA 2ZGUA 1CJPA 4B1MA 4JHZA 1W0NA 4BXSV 5L3DA 2PN5A 4NHKA 3E1F1 1AR91 2VBBA 4GKKO 2DJVA 2VQEB 2Z42A 4AEMA 2RS53 2VO5A 2ZCEA 2WLHA 3H7JA 2VOWA 3NW4A 4RGAA 2A6YA 4AG4A 1X9TA 4AGRA 3CS5A 1UWWA 4JX0A 2PTMA 3BRCA 3OSDA 4YG0A 3OUJA 5T50A 1W28A 4CEWC 3UK9A 2WO3A 2P22C 3FLPA 2GDFA 3J8F3 4FXGB 5FZ4A 4LUKA 4C0BA 4DRXA 3AZWA 4A45A 1WA4A 2DF7A 3BPSA 4HPKB 3FHIB 1JXNA 2W94A 2MEV2 3H7YA 5A7SA 1Q8SA 2YBKA 3GDBA 4OCTA 4I0XA 3TAYA 1PO23 2WN3A 4OHYA 5LBEA 4ZHNA 3I4IA 3DN7A 1TME2 2YG0A 2HWE2 5FYZA 3RVHA 4FXKB 3H1KH 4NTWA 1ZRRA 2Y34A 4PBOA 3ZVXA 4CCLA 4XURA 1MEC3 4FTBA 4F7ZA 3MICA 1FV3A 4L97A 1MZFA 1TNRA 4MTGA 1RUC2 3VBFB 3KCCA 4I55B 4GMP1 5JQGB 2AEYA 5JJNB 3NV4A 4KG8A 3MLLA 2RMU3 5DZEA 2WWUA 3VZJA 5F3GA 2OYQA 5JDBA 5LXTA 3CJHA 1COV3 2HKXA 3ZSJA 1VBC1 1PK6C 2ZGNA 4JGZA 1F15A 4Z1MG 2GALA 3SH4A 2OCHA 4LR3A 1LU1A 1QEXA 1VBC2 2BNNA 3O0XA 3HKDB 4OUSA 2ERFA 1IURA 3BEHA 3CMAV 2EX3A 4MH0E 3B09A 1Y74B 4XF4A 4JI5O 2R6QA 3CP1A 2A75A 1BHBA 1RJ7A 3CCLV 4I5SA 1J3QA 3JD1A 2FKXA 2RS11 2EILB 3ZO0B 2JE7A 3WP6A 4ET7A 4DNYA 4JI5B 4G9SB 1TG7A 1GZWA 4WM7A 2VCAA 4KGGA 3N9NA 4YY3O 5A6ZA 5FLXN 2HYKA 2IXCA 1SZTA 1UZYA 3TN93 1VARA 3FFZA 5BNNA 3ME2A 3ZFGA 1N36B 3D36A 5BNOC 3CZUA 2DYSC 2J1UA 3JUUA 2Q4SA 1JHNA 3RRDA 4GT1A 2R0FA 1J5EO 1S2EA 1D0HA 3AG2C 4FPCA 1H8VA 2HWE1 3I2DA 1I08A 2BOJA 2D6KA 5IK7A 3VBFC 4IW3A 4EKWA 1HB3A 3LSUA 2H6CA 3VHPA 4WM7C 1RUE2 4WVWA 2ZNIA 1VQ7V 1QWRA 2V5DA 1RUJ1 3N7LA 4JYCA 2QR4A 2ET1A 4QPIC 3CCVV 2PI5A 4V1PA 1K97A 4JV5O 2BNOA 4OX9B 3QACA 2FZ2A 5DAXA 4JAAA 1XNCA 1VB4A 2D3OW 3DYPA 1OH4A 4YSFA 2Y0PA 3ABLB 3CL1A 2XPJA 4QPJA 3URFA 1VQ6V 5B1BB 4DMIA 1H8EG 3LDCA 3ZIWA 4UFZA 1QDOA 3THDA 1FXKB 1DF4A 5ACA3 2WO7A 3WNLA 5KX5A 3MZHA 4GH4C 4PLMA 5B1AC 3ACHA 1UZ0A 1H2KA 5G04L 4XABA 1OQEA 4HSJA 2ZXWC 2OPWA 5A1AA 2ZX0A 5HXVA 1KRIA 2NMOA 2PELA 2ZR2A 2QNKA 4MVRA 2QDOA 1DYOA 5L3GA 3CMEV 2PAEA 4ZPIA 3IBMA 2WNUC 2Z5WA 1XHZA 2D3SA 2WC2A 4FBFA 4QM9A 1H4HA 3I2JA 4LE3A 4Q4Y2 1O9HA 3KV9A 3NO8A 3BTXA 1C8M3 2E74B 1NJIW 3LOIA 2OT5A 5AC91 3DXRA 4WFBV 1HQLA 5F5IA 5KX5B 3DXTA 1JU3A 1W6OA 4NWVA 5FP3A 2XQXA 3NAPA 1XQNA 3K4DA 1YQ8A 2O1QA 1QJY3 1PL4A 3T4ZA 3AG4C 4DPNA 2PLV1 3RW0A 1UX7A 5FZFA 3VQXA 1PO21 4Z82A 3C7HA 1F5FA 1D2SA 3LDBA 3WG2A 1XI1A 4QPGA 4CEWA 5BNQA 3M1HA 1AILA 1HV1A 4TWTA 2EJ7A 4PD4F 1JQ0A 2NLRA 1DF5A 3PIGA 1UMIA 2VMFA 1V9U2 1TMF1 2FDFA 2FTKA 1NZCA 4JYYA 3SYAA 4JPRA 1CZVA 5B5EZ 2P1BA 1YEWA 2DVFA 4CUCA 3OGCC 2ZTNA 4H7LA 2OZ6A 2RS33 3ZPYA 3SXWA 2PAKA 1KS5A 4P9IA 2A3YA 3RVYA 2R062 2HHHO 2WLJA 1ZX3A 2ZGOA 3UGFA 2A71A 5FLHA 3HPLC 1E5RA 1NXMA 2ZXWB 2XJRA 5FUPA 1VF6C 4RYDA 4BMBA 4QPKA 4ZXKA 4ZZ8A 2VOKA 1K8AW 1JTZX 5I8SA 1RUF3 2OTLV 1X36A 5LATA 5FZKA 5ANQA 2XBO2 4G2KA 1CWPA 2Y48A 4DW1A 1PNMA 2WLPA 1CAVB 2XT9A 2WNVA 4PJ0Z 2WFF2 4ZKTB 1OCZC 2Y69B 3T0AA 2NM1A 4QNHB 4LIUA 1H2SB 4YW2A 3K3WA 3MF6A 4MLOA 4D7TA 4QE7A 4CU8A 1Q6IA 2PUSA 3WNKA 1YFUA 2GH2A 1XYNA 2GMEA 4NUBA 1GMGA 3WF4A 2A5ZA 5KHJA 4I9QA 3B01A 4HOOA 4R9CA 1N1SA 5FBZA 5FYCA 4I0WB 3KLSA 4TZDA 4E2LA 1F7YA 4LULA 5C93A 4GX5A 5ANNA 4UVBA 2YGLA 1A78A 4QQOA 3OEBA 4DXZA 2P90A 5BNOA 1M4WA 1SQ4A 2Q7HA 4UUJC 1QNMA 2LGWA 1VQMV 5EYYA 5A33B 1JW6A 4FPFA 1L7QA 1EBOA 4K8RB 3CWBH 5FMBA 2OIGA 1S0FA 2VZTA 3DL3A 4FM2A 1Y4MA 3H3ZA 4HZFA 1GQPA 5F3IA 3ZIXA 5KBFA 2AREA 1P84F 1N3OA 5A3OA 1ZREA 2ARAA 3H50A 4X8NA 1VBB2 3OR7C 3BB6A 5BNNC 1AR1B 2WZEA 1WA6X 2VWKA 1FMD3 4Y22B 1DCSA 4I02A 2ATKC 1W9SA 1KXGA 2W92A 1JMKC 4LQRA 1WA8A 5JJJB 2IZWA 5FAXA 1DDLA 3CDZB 1LOFA 4GIQA 3OMNB 5FPAA 2A9HA 1GZ9A 4X9QA 5F5QA 3QOPA 4R52A 3RZMA 1POQA 1RUI3 5IWFA 4O4LA 4IYHA 2CDYA 4BK4A 1UZWA 4QWNA 1A3KA 1PK6B 3V65A 1WB7A 1C28A 4PV1B 3ZXEA 2E26A 2ZM6O 3M2MA 1MS4A 4PDRA 4UXAA 3MHZA 2AACA 2QJ1A 1EN4A 3KHCA 5AVPA 2WSUA 3B7MA 5CAZA 2ARBA 3VD3A 3U4XA 3RJ2X 1ZZBA 1VBB1 4GZRB 2EIKC 3SPJA 3JAWB 4XDKA 2UY9A 5LEKA 5FKCA 1MS0A 4O2AA 1SG3A 1CZSA 2VRZA 5L36A 4YGBA 3LWCA 4ZU7A 4AAPA 4I0BA 2ARHA 3I2HA 2HWB2 3TN92 4EFBA 2ZABA 2NMNA 3AMMA 2GUZA 4BIFA 3CIHA 3PU8A 5KAFZ 1BQ0A 1O8PA 4XIKA 2Y33A 1QJY1 3O0WA 5CFCB 3AKRA 2QQKA 4LOSA 2B5HA 2EXHA 2MEV3 5GJ6A 5IJ0A 4DV7O 2Q6AA 3OY8A 4LA3A 4AVAA 2N04A 4X66O 1WD3A 4JTDB 3S3XA 1XOYA 2G9FA 3CXCU 3UJQA 4FQ4A 1C5HA 1ZL8A 3H8OA 3AZYA 4KMQA 3VD7A 5FYYA 1HR0B 1R1BA 1FXKA 3K3OA 1TMF3 1AR63 5A3MA 1B06A 2IBZH 3N9QA 3JATB 2WLLA 4X88A 3ASNC 5A3PA 4KU7A 2NP0A 4YGEA 3M4FA 1AR93 4A6SA 4RHV3 4C1XA 4CEYA 4FOQA 4LF7B 2MPFA 3J7HA 3ZDVA 2BJSA 3VBBA 1K4DC 4I55A 3NNLA 2DVAA 1PPJH 3J7MA 3PUAA 1VAMA 1DLLA 1HQNA 1WCUA 3WT3A 4LO5B 2XOKG 4W4KA 4BCUA 2I2SA 4F8AA 2UYBA 4EB6B 4MX3A 1BQPA 1YQ5A 1JUHA 4E27A 4QGMA 2C4XA 1DLBA 4RGKA 1SLAA 2OQ7A 2VCMA 3BODA 1NLRA 2VUCA 1XSRA 1K92A 1N4CA 5KR7A 1LHVA 4AXOA 4DV5O 5BR8B 2QWQB 3O14A 2HWC2 4AQSA 5FXZA 1N33B 2UXDO 4GX2A 4K8XA 2FD8A 1UYZA 1SLIA 3A7QA 2ILMA 5FYUA 4E8CA 4CCEA 2GN3A 4YZ4A 2CTWA 3VBFA 2ZEYA 2CGOA 3QVNA 3K48A 3AK3A 4P2ZA 4EROA 5HV0A 1K34A 2ZT9B 4E4HA 4GKKB 1VE0A 5A7PA 4AE2A 1RTVA 1I5XA 1CJDA 2EIMB 1W6QB 5ISLA 4UXNA 1O59A 1RM1B 2RR12 1UO9A 1OV9A 2VNGA 4JQTA 2NN8A 1ZWIC 1OLMA 1FV2A 4L9BA 1W99A 5IVBA 1EUTA 3ST7A 2PZSA 3IAYA 1TE1B 1YXBA 3RYHA 1FPN2 1AJNA 3H8RA 3HKDA 2YXLA 3JCIA 3S57A 1W8FA 3UT5B 3DCQA 1QVGU 5JH7B 1MVQA 1IS4A 2WT0A 1K4CC 4DR4B 1UIJA 2CE4A 1C8NA 2CTRA 2A70A 3OGVA 2AC1A 5FWEA 1YJKA 4BQ1A 3JASB 4UF0B 2W9XA 3WLUA 2B8MA 1O4YA 4QE9A 5IW0A 4AVSA 4EV0A 3C7FA 1V6JA 4NTXA 1JUIA 1WBLA 3JAKA 2BTQA 4FCAA 4CZZA 3SJQC 2PHUA 4FPPA 3C7EA 4NB5A 4CEYC 2W95A 2MK3A 4D94A 4DV4O 5JIUA 1PVC3 1VRH3 3LA7A 4PI0A 3PIJA 1R3LC 4OPAA 1V9PA 5AVAA 4IQPA 1HXS1 3D3IA 2OKXA 4NRMA 2LALA 3FN9A 3ZLIA 1SZBA 3RS6A 5C4WC 5LGTA 4UCOA 4ABMA 2Q73A 3WCRA 4LBQA 1GU3A 2CSGA 4K3UA 4B4RA 5J37A 2PF4E 4YFZA 2IUWA 3MHSC 3ORJA 5J36A 5FZBA 1Y76A 2Z2SB 4HYOA 1HWYA 4B3RO 3WEZA 3TEXA 2W1WA 1ZZ6A 3VDAA 3K3NA 3UYJA 3ZSLA 3E5XA 4OFGA 1BE3H 5DZGA 1R6NA 1AYM2 2NQYA 1NE6A 4ISQA 4DO0A 2LW7A 4BQ4A 4M3CA 3NR7A 4BIZA 3CNAA 1JYVA 2Y64A 4MS2A 2UWAA 4YLZA 2NLJC 2HWF1 1M9NA 1WKYA 4HVQA 3FE5A 4LITA 2ZX4A 3WQ0A 4EQVA 4IEYA 1VP7A 2E63A 3ABLC 2ZIOA 1WD4A 2HWC1 3FL7A 4NHYA 3ZFFB 4CDWB 2CUGA 5IAVA 1G9FA 1XMQB 4X6RB 4MGQA 3K0GA 5FY9A 5T52A 5CBGA 1H9PA 4AVTA 1CD3G 4DEVA 3O1OA 1VBD2 1ND2A 2ZCWA 3MUY1 2VW0A 4CXXA 1XE8A 2FZ1A 5H9PA 5F2SA 2QTWB 2FCUA 1YCIA 1YRZA 5JVVA 2Q8CA 1QHTA 3DC6A 4NIIA 1RXGA 3TEWA 1FFTB 4D6TH 3CU7A 1QHDA 3W9AA 4JRLA 4IEPA 1OCOC 1IBLO 3HKBB 1Q6UA 4ZKIA 3SPIA 4AFMA 2OS2A 2Y6HA 3V0BB 4FP3A 1LOGA 1XBFA 1CVNA 2ZE8A 5HFLA 3O12A 1UNBA 4FPKA 1UYPA 2GV9A 4PA3A 3W20A 4D6QA 2R1BA 4HZ3A 4AQ2A 1AI7A 3JCZA 1QXPA 1OJHA 3VBOC 1Y74A 5EZYA 1RUNA 4Y22A 3BA8A 2ADQB 4FK5C 3POJA 1Q8OA 3VKFC 2DE0X 2PHDA 3E83A 3SHRA 3MIBA 3CRCA 4L0PA 1AR72 3U75A 2CDOA 1GH6A 1QXRA 5A7OA 2BYVE 4NTYA 3ZS8C 4JYAB 4MGIE 3GHMA 1Q90D 2XKOA 1WUVA 3E8BA 2UXNA 3HNYM 3AX4A 3JB4C 3UKMA 2UUAO 2D6PA 4H7MA 4J9YB 2L6LA 3RNSA 1V6LA 2J1VA 4QPYA 4E2QA 2Q5ZA 1H30A 3E22A 5EHDA 4JI4B 3S3WA 2FDIA 4KBBA 5JLVA 5EXOA 2LP7A 5D5PA 1MQTA 2YHJA 1SERA 2LFSA 1XEQA 5J2TB 4MADA 4RN5A 1SBFA 3VQVA 3CYOA 2IJIA 2QEXV 1LGCA 4EN6B 1W6NA 2JEXA 1OVPA 5GLVA 2FDJA 3WUCA 4XUOA 3VDDB 3AP6A 1WP7A 2I74A 4LKSA 4B3MO 1F4NA 3T30A 2Q8EA 1XYOA 3KQ4B 1UN1A 3WW3A 4CP1A 2L9LA 3CQOA 1I94O 2IJJA 5LA6A 2VW2A 1QR8A 2PYLA 2LFRA 1SHWB 3X2QB 1W90A 4GXLA 2UWCA 4GH4A 2OX0A 3ZX7A 3E5QA 2UXXA 2ZMLA 2QKCA 2F95B 4GX1A 1M5IA 1AR92 5L7OB 5CBFA 1PVC1 4LF4B 3Q4HA 4K40A 3D3AA 5JCOC 1WLCA 3T0BA 3I55V 2YIBA 1SLCA 1WW4A 4XBNA 1SLBA 4MVUA 2AYHA 2VY0A 4WZCA 5JI7A 3NL1A 3S6PA 2DMXA 4ICGA 1XUQA 3K5OA 2GH8A 1O5LA 1XL4A 3MHHC 1H38A 3CJIB 4HVOA 1FFXB 4R4XA 1YITV 1TMF2 3IIIA 5FO9B 4PDWC 4BQXA 4XJ8A 2BW8A 2W0XA 4YZ5A 2Q67A 5FYVA 1KYOF 1U97A 4ZOLB 2Z3YA 3WG7B 2DWRA 5GONA 4LC1A 1GN6A 4BWOA 2WLLB 3UO3A 1RSOA 4DR3O 1HB4A 4JRAA 4CEYB 3CRRA 1K42A 3K9SA 4QQLA 5B2GB 3STZC 1LRHA 2Q8DA 3AYAA 4JI8O 4CDXA 4XZPA 1QJEA 2RJZA 1SZXA 1X7NA 4K35A 1LULA 3D6EA 1Z5VA 3G67A 1FYUA 3CRAA 3JALB 3LD8A 1XMOB 1U0AA 2BOIA 4LTAA 2EIGA 1YYNA 3BFRA 2JDHA 3M3IA 2ZD9A 1RINA 1VBA2 5H9SA 5FZOA 1WZXA 4BISA 1GP6A 2KXLA 1PM7A 4MW3A 1NG0A 3ZHSA 2HEYF 4JYBA 4XF0A 2VNOA 3OCPA 1ALYA 4HN1A 5C8CA 3DGTA 1NI8A 1R1A2 4JI2B 1PNFA 1OPMA 3MDPA 4MVZA 3TBDA 3SJBC 1RHI1 2WA3A 1NR1A 5BPXA 2VZRA 1GN3A 1ULGA 2GP5A 2ZEZA 3IT8A 4INDA 3J4UH 5FBJA 3J7NA 4E8DA 2QTSA 5B4XA 4PIYA 4P30A 1IS6A 3MPPG 1YQCA 2VOVA 1N3PA 1V6MA 5FZAA 1S0DA 3RWKX 4J9ZB 2KG7B 3CRMA 1G6UA 4JI1O 3WFVA 2CTQA 1XNDA 4GWIA 2BNMA 4FTSA 3T2PA 2RCVA 2KA3A 1LOCA 1PL0A 1YTFB 1VLNA 5L73A 4RUFA 5T5PA 3R65A 4MXWA 1N8RW 4YVWB 1LB2A 4FPJA 4ES8A 2ZJCA 2ETEA 3CZJA 4N53C 4J11A 5FPLA 2OXBA 1YDXA 3UKTA 1CAWB 2CHHA 3HKEA 4LBNA 4CDXC 3OGJA 5LMNB 3MIFA 5EZWA 4FIPC 4Q2FA 4ZU5A 4AGVA 4LF4O 3RI8A 3ZXFA 4KXRA 4P9LA 1YF2A 4CH4A 4PDWA 4O9EA 5KHKA 3VZOA 4BXFA 1RUJ3 4Q0VA 3TWIA 3JD73 1UF2C 4KI5M 2W0FC 2AXTZ 3ZFGC 3ZBHA 5ITZB 1QOTA 3I2GA 4YFWA 4CS3A 4Q0PA 1VBE2 3W58A 3VL9A 4RA0A 5CIRA 1Y4WA 4XFBA 4Y5SA 3W7WA 2RS12 3HKBA 3NNFA 3BTYA 3CHXA 4EWAA 1OLQA 2I45A 1XHXA 5FK7A 5JZGB 1QR9A 2BVBA 3ALQA 4NPLA 3WP4A 1W2TA 1YC61 4YPJA 3RZLA 4NMIA 4O61A 1N0NA 2RS32 2VCBA 5JQGA 5L19A 4BZ4A 2X6BA 4M0HA 2W47A 4P9WA 1O7FA 4DW0A 4NYKA 4JYAO 5IK8A 5A80A 4EN8B 5F3EA 4CDWA 4JDNA 1U5XA 1KB9F 2OA2A 2Q7GA 1FKAO 2QWNB 1SQXH 2VTXA 1ULCA 4AFCA 4YW7A 2UU9O 4H33A 2ZA9A 5FL7G 2JB8A 4M0NA 1SA0A 1ULEA 3R66A 1Q7YW 1OQDA 4CU9A 2V1DA 5CFCC 4MGKE 5FKBA 4IEQA 1AZDA 2VNRA 4HLTA 2OYZA 3S7IA 2WNOA 5JH7A 4UFIA 3WDWA 4XIOA 4P9JA 1K5MB 4WZFA 4B3SO 1VBE3 2BWAA 3GB7C 2BBAA 1LEMA 1ZBE3 3POEA 4IE4A 2J1RA 3WINE 5F5CA 5CB7A 3WP5A 1O3QA 1W0JG 3WDUA 3PTRB 4PIZA 3H1MA 2JKXA 2DWEC 1HRI1 2CAZC 5EK0A 4DV3B 4GULA 5LMUO 3LPGA 4ZU4A 3I7DA 3GZTB 4X62O 1C8M2 1HDKA 4N43C 4XHBA 4N23A 2PYTA 3C8XA 3VKOA 4DXTA 3JXSA 1V54B 2ZEWA 4BOWA 1TVKA 4PF1A 3FUQA 4DIQA 2D44A 1VQKV 1NUKA 2XAJA 2O14A 4UW6A 3KCXA 1P8JA 1Q81W 5ACA2 4OMDA 4YNIA 1OCOB 3I2KA 1W3XA 1VBC3 2C9AA 1AI4A 2F23A 1NT0A 3NKGA 5JXHA 5JVDB 3I3QA 4NVPA 5APAA 4UFKA 4YG6A 3WF0A 2G19A 2XVGA 4H3WA 1F8VA 1K5QA 2OQ6A 2D6NA 4YW4A 4X1YA 2PQSA 5T3NA 4JGZC 4QX0A 2DU0A 4CCKA 5CISA 1TGOA 2IM9A 2NN4A 1FPOA 4EB6A 1P49A 4AI2A 1LHUA 3RYCB 1KITA 4XQWA 1QJU1 3QF7A 3K0DA 2BU9A 2WNUB 4QD2A 5HCBA 5J7MA 3WB2A 5L7OC 5HFMA 3H1LH 3OEAA 2H8PC 4XJWA 4XTMA 1S0CA 4Q4X2 2R042 5DECA 1CQ9A 1W9FA 1AP6A 3N7JA 5FZ7A 1Q82W 1W6QA 5BXXA 2F17A 4H44B 2J1EA 2V4DA 4G27B 1ZRIA 1UY2A 3RGBA 5A9GA 1VBE1 1Y9GA 3F95A 1GQGA 2JE9A 2Q9LA 3M3EA 3BA9A 1DK1A 1DGLA 3LZZA 1H2NA 2O57A 1GYKA 3QNEA 4JI2O 2OPKA 1V55C 1PO13 4COWA 4XDLA 1IOAA 1POV3 1HW7A 4COYA 1OCCB 2VU9A 4KWJA 3H9AA 3V0BA 2Y4UA 4ZIBA 1LENA 3PVOA 1Y3TA 3W7TA 2XAQA 3GZUC 4R6ZA 1KFUL 2PHRA 5LK5A 2G4IA 4JZ2A 2VQUA 2V5YA 3AKPA 1XMOO 4NRQA 4XMAA 4AAXA 2O0OA 1R64A 3FZ3A 1CONA 4PA7A 3OPZA 2V09A 4I0AA 3AXDA 3PNAA 1XNQO 3CC2V 4HKWA 1RHI2 2BFUL 3TNQA 2YU1A 1I5PA 3ZYIB 2PAMA 1REEA 1FNYA 3HR0A 5KXDA 1PNKA 2LO1A 2Y6FA 1W6PA 1Q5OA 2VW1A 4M3CE 4RGGA 1QBZA 3M3CA 4LHNA 3E5UA 4OPHA 4KG0A 4MVQA 4WFGA 1JYXA 4QPWA 1AR5A 3CPWU 2CAVA 4NPRA 1UXXX 1PK6A 1XXNA 1DQ1A 2XONA 4XETA 4GQ7A 2QBXA 3IDBB 3GCWA 2UXDB 1XNTA 1ZBE2 2VMIA 3AKQA 2QQUA 2VE1A 5FIXA 4TV8B 5E8AA 1GKFA 4JI1B 3M8LA 1D4VB 1WPXA 2XJSA 2QQPA 2XAHA 1JZ8A 4MOAA 1O91A 3ZYRA 4LHKA 1JR9A 3KWVA 2EINB 3KKYA 2VC9A 3PUIA 4W8JA 1W2NA 2PHWA 3LPFA 1M1KW 1RUE3 2IH1C 2D40A 2YPJA 4WFFA 4XUTA 3P3NA 3AVSA 4KUMA 1FNZA 4UFHA 3NJZA 1JMUB 3SEPA 4FPGA 3VHRA 4PA4A 3ZIAG 5IYDO 2CAUA 4JGZB 1ZBE1 2X05A 1L7LA 5HCHA 4D6RA 1BYHA 3O9OA 4CTEA 2H3OA 3V0AA 4UW5A 2BE3A 3BN6A 5A3TA 4KWKA 4N90A 1SDWA 1S2BA 2GU9A 2LW8A 5CZKA 4HL0A 1HR0O 1A32A 2XWBB 4WFAV 5A7NA 4CUBA 2WSVA 1KP2A 3RYKA 1GP5A 5I91A 2QWPB 2WIIB 2CU5A 1EV13 4XHXA 3G80A 4M00A 1TNFA 2WNVC 1R1ZA 1JZ7A 4K8ZA 4FFIA 4YRDA 1FJGO 4FM0A 4L87A 4DR3B 1U96A 3ASNB 4DV1O 5FMOL 4DV6O 3CO2A 1EYBA 5L9RA 3GZAA 4EN9B 2VOTA 3OT7A 3BYWA 1SBDA 2KSDA 2A6WA 4LF8O 3T4HB 3WW1A 3E22B 3WB1A 4BH9A 4UW3A 4JGYA 3I3EA 4IEOA 5DG1A 1U5YA 2YEVB 3EFFK 2KD7A 2RMKB 5C8YA 2GTAA 3ZHRA 4F6EA 3ON7A 2QWRB 4WVVA 1MMMA 1DIWA 4TUYB 3FB5C 3RN4A 2D98A 2XAGA 4B7EA 3DEMA 1Q43A 3AG7A 4MVMA 4QKFA 2K2SA 4WBNA 2ZDIA 4F83A 1UY4A 1XE7A 3B94A 5C3OA 3R4SA 3TXSA 2IU3A 1UY3A 2JDUA 3FHQA 2HBTA 1CAUA 4PLOA 1PM4A 2QQNA 4E4EA 1AL23 1SQQH 2IVJA 4LE4A 4ZHQB 3ZRXA 5BZBA 2QKAA 1YFWA 4IERA 3ZR5A 4QHOA 1XQ8A 1V6OA 3HT2A 3APQA 5CA0B 1QKQA 4MYEA 5LRRA 1MSDA 1QNYA 1HNXO 4XBQA 4Z07A 2ZHKA 5JSRA 2JEMA 2LROA 1S5LZ 2HEVF 2ADDA 1QJU2 1PO11 4QHBA 1G4YB 3B93A 1UCXA 4LF5O 4B1LA 5DN2A 4Q4V3 2G9GA 4YJ2B 4Q4X3 1PGW2 2W87A 5T5OA 5EWSA 4EJRA 4X62B 5JXJA 2Q8OA 1FAYA 1VJ2A 2F1MA 4MVSA 3OMIB 4I3GA 2AEZA 5JZGC 1VMHA 1XMQO 5KUKA 4MTOA 5KHHA 1UYXA 5BXZA 4BLIA 4IHJB 1H6YA 5C3SA 1RUI2 1LOFC 4Y3OA 1Q6HA 3ENRA 2LUWA 1KU9A 3ASIA 4DY3A 2PGGA 4CDWC 3N9LA 3E89A 1Z78A 5CU1A 2DUQA 4CDQB 5TISZ 2R9RB 1CPNA 1JODA 4CH5A 4XCBA 2RJ2A 2EVXA 3FAVA 2IXKA 4LBMA 4N53B 1N3QA 4P9YA 2LQTA 1QH6A 1V00A 1OUXA 1VBD3 2XL9A 3WNOA 1NY72 3JAWA 1QOSA 1PIV3 4LF9B 1NCQC 3ILFA 1WLWA 2SBAA 2B42B 2DVDA 3EB7A 1KD7A 3ZYFA 2QM8A 1VF5B 2HEWF 3LQCA 4MW8A 2BCCH 3USUB 2VZ1A 2ZHMA 2A7WA 4L8JA 1CX1A 3P6BA 1TME3 4X8AA 5IVYA 3HIFA 1E1QG 4P9PA 4TWKA 4JI3O 1SQFA 2UUBB 5A32B 4CDUC 4NROA 5HV4A 4U3JA 1IBLB 5FNVB 1IVSA 1GN2A 2JEUA 4FT8A 3FB8C 4H0LB 4DY5A 5JR2A 4CRQA 2DURA 1VRBA 4E4DX 1OQ1A 1JZ6A 5IYZB 3B9IA 4H13B 1RUG1 1MEC1 1OCRC 3ICXA 4IEUA 2VZ3A 3T1YO 1M56C 4DOUA 1POV0 3DPRB 4HKLA 1LHOA 4LKEA 1URXA 3JD0A 3HJRA 1I0HA 3AYEA 3ETQA 1GBGA 2ZNJA 1Z2GA 4UI9L 1SESA 2BGCA 4LK7A 1FYJA 1RUF2 5CA3A 5H6RA 4YM3A 1OKOA 3VZNA 2ZGSA 5FZIA 4RR3A 2QGNA 1JI6A 4IV3B 4BQ3A 5J98B 1DLCA 4FJCC 4XFAA 2WINB 1OH3A 1ZRDA 5IYYA 4QJFB 1MACA 1WW7A 4N21A 5LMNO 3RG0A 2C9KA 3FBMA 4A7KA 4DUVA 2F4LA 3TOJA 1BQZA 3E8GA 3FBYA 2XUEA 3UKNA 3IMMA 5LA0A 2YFZA 3IN9A 3ROUA 2JKBA 2RQ6A 3OYWB 5F32A 1WBFA 2VVEA 3N36A 4TXWA 1D4M1 4XBFA 4KL1A 3ZMNA 5BR8O 1PGW1 1WCDJ 5CEHA 1EPWA 1ZAUA 4D7SA 3CEWA 5J48A 1XNAA 2H94A 1RUD2 5C71A 1L8DA 1DYPA 3PJSK 5FYHA 1AL22 4LEJA 5ABJC 3JYCA 3C7OA 3JASA 1BGYH 4C8DA 4YM1A 4Q6GA 3SH5A 4PCRA 5B3SB 2SLIA 4B3NA 3LSDA 1CPMA 1M56B 2FB5A 2RM21 1L3JA 3ETDA 4HBNA 3M99B 5GLTA 4WVZA 4GJYA 1JX9A 3DGEA 5FY0A 4XZUG 3WVJA 1N34O 2ZEXA 1EZVH 1RP3B 5CBHA 2PA7A 1FOD3 1RPRA 4A3XA 5IK4A 4D3WA 3HMYA 3FKSG 2D5HA 5FY4A 1W0PA 1UZZA 4LNUB 4FZ1A 4JDMA 4LWSB 4RL7A 4DK1A 4JV5B 4ITCA 2CH7A 5J9PC 5EBLC 3EXAA 2JGUA 1LEDA 4JTCB 4NIDA 2WNUA 1CAWA 2XBO3 3B69A 4Q1RA 4JI8B 1ODMA 5FZ0A 2XJQA 5LXTB 1DGRA 3FFQA 2YV8A 1Z7S2 3UT0A 2XVKA 4BW5A 4IGOA 4TQDA 3JD3A 3OYWA 1J5EB 1GICA 1OKQA 3B8NA 2XDVA 3ES1A 3X2QC 5D21A 5FY8A 3UJOA 2YS8A 1S4CA 4W50A 4AFBA 1UPSA 2X5IA 3LDRA 3ZCCA 3U07A 2BEOA 4BW9A 5ITZA 3ATGA 5BNPB 4BA6A 4DV0B 2EJRA 2WL1A 4AFDA 1YJ9V 2OCCB 3HPNA 1EZJA 3J7AU 1AYN2 4U3FH 2WWSA 3OUSA 4L2NA 2YC0A 3T08A 3NVCA 4LR4A 3AP5A 4MGZE 1GM7A 1NE4A 1AXZA 3ZFEC 3IMNA 3ZHUA 3OTOB 1J1LA 3CRQA 3CMGA 4QPIA 4X1KA 2VVFA 1QJX1 4X8PA 4DS0A 4P9GA 1K5JA 1JA8A 2BGPA 3AP7A 3H01A 5BMVA 1ZL8B 3DUIA 1HB2A 1XB9A 5KMGB 4U36A 4Z8BA 1RUG3 5AC92 3K06A 1D5AA 2RM22 4Y5TA 1MQTC 4O65A 2EIBA 4P02B 1X8MA 3TETA 1FOD1 4AFAA 3QO8A 3M8AA 2HG5C 3BKZA 4OI1A 5LYJA 1JZ4A 2ZX3A 4GCZA 3OGGA 3BVCA 1I94B 4W4LA 2WQ4A 3RWRD 1UD1A 1US3A 3SYOA 1MSWD 2PI4A 1BHGA 3OY8B 5BV6A 1OHHG 1SPPA 1S5JA 2B1IA 2HWC3 3OD0A 2RG4A 1DTOA 1CAXB 3C7GA 1IG0A 3LAGA 1GNHA 3N7MA 3ZMSA 2WNEA 3VDCA 4LFBO 2YEVA 5H5NA 4G28B 4UFJA 3AM2A 1X50A 1IGOA 1NTMH 4LNVA 4R8HA 4P5YA 3NJXA 3OG2A 2Y6GA 5FPVA 1OA4A 4YARA 2P5OA 4P9OA 5A1FA 3I59A 4PDVA 4MXVA 2GHYA 2ARXA 2P4EA 4J10A 1OOPC 1QJFA 3QTCA 4NWWA 3TCUA 1G7YA 5A3LA 4XCAA 2WZR3 3E8HA 1ND2C 3KZIZ 3WSOA 5CKMA 1B04A 3AG3C 1FMD2 2HEPA 3VLBB 3L75H 3SMHA 4CUGA 4RS5C 4HMZA 3LSSA 3MIHA 4QU1A 1CIYA 3WDXA 4PBPA 3Q8EA 2RR11 2Z0AA 2ODMA 1W0KG 3PMSA 1AR81 1H8TA 2QJVA 4Q4W1 5L3FA 4NKGB 1OBNA 2CK3G 3LA2A 1FPN1 1T5EA 3VBUB 5A7QA 2W39A 2E31A 5A32A 1X4TA 2E7AA 1AR71 3OUFA 4AHYA 3L2HA 2QUOA 5E88A 1FAFA 3VBSB 2OIEA 1OCZB 4FM1A 2XKPA 2VUJA 1LHWA 3M3OA 3NAPC 1K5MC 3AB0A 4KHPO 4AHWA 3VOUA 4DUYO 2WAMA 2GC3A 1JU4A 3SYCA 3UL2A 1NXD1 1K73W 1D2QA 4NN0A 1AUYA 1AROP 3ZKYA 4QIWF 3B9CA 5FXWA 4JZRA 5ABJB 2OWOA 4QX1A 2X8KA 1NA1A 3FB7C 4GLXA 4RQFA 5IHRA 3OMAB 2ZMNA 3ASOC 1W8HA 3ZHQA 2WN2A 5C4WA 4O9GA 1ND2B 3POIA 1PX3A 4XTPA
chains in the Genus database with same CATH topology
3CJXA 1Q56A 2EALA 3RNSA 3K51A 1V6LA 2RJKA 4QPYA 4E2QA 1H30A 3WNXA 4JV4A 4CEWB 1GNZA 4S2DA 1EAH1 5CFCA 3ZDSA 1KJLA 2A3XA 2UU8A 3R0RA 1PGL2 4KBBA 5JLVA 4XFHA 4TLFA 2A6VA 5EXOA 1MQTA 1WCKA 1ZVFA 2YHJA 2X29A 5J96B 2PHLA 5ACA1 5FPZA 1O3RA 1DG6A 3ZSKA 1JH5A 1SBFA 2B46X 2ZX2A 5H9RA 1RVF3 1N1YA 2PHXA 1IPKA 2CTVA 1GFF2 1G9DA 1AXYA 1LGCA 2ZGLA 4EN6B 4FOVA 1W6NA 1DHKB 1IZ3A 4XF1A 5GLVA 3O2GA 3WUCA 2DV9A 3VDDC 1LHNA 4SLIA 3CF6E 3VDDB 2R061 3JD71 3L2YA 3VBUC 4YVWC 3AP6A 2AENA 3AJYA 2I74A 3LA3A 1DGRN 3ZXGA 1C1FA 3THTA 4DFSA 1XYOA 5JCTA 2HWD2 2MNGA 1UN1A 3WW3A 4CP1A 2O8OA 3C3VA 3BTAA 2R30A 1J3RA 4YGDA 2XH6A 4XEZA 4IV3A 2VW2A 3VKMA 1TME1 4CDUB 2YROA 3DPRA 1KDKA 3AFGA 3QBQA 4DQAA 2GZWA 5I8TA 1VALA 1NOVA 5GM0A 4GXLA 3MIDA 2IXIA 2UWCA 3ZYGA 4GH4A 1R082 2P3IA 2DU1A 3WG1A 1N1VA 2A3WA 4K6BA 4Q0QA 1MS1A 4Q4Y3 1MS5A 4K20A 1QJX3 3ZX7A 3E5QA 4YG3A 3PVJA 2ZMLA 2FMYA 2WS91 3IPVA 2Q5TA 1AR92 1C5IA 1EAH3 2D7FA 4LO7A 4RHV2 3KT1A 3R05A 5L7OB 4GB32 3VBOB 3VUOA 1Y0ZA 2DFCA 2Z79A 1PVC1 4GWMA 1AF9A 5F9TA 4W65A 4K40A 1GSLA 2YUEA 4META 1Y9QA 4HANA 1WLCA 4QX5A 1I9RA 4N9HA 4FVVA 4Q4V1 1S0JA 2ZGMA 1SLCA 1WW4A 4XBNA 4Q4W2 1SLBA 2AYHA 1OIJB 2VY0A 4WZCA 1XNKA 3ECQA 4FAGA 5JI7A 3NL1A 4XFGA 3S6PA 3SCFA 4Z92B 1MS3A 1AR82 5GLUA 4WM7B 4KH9A 3AKSA 2GH8A 2R072 3AKTA 3VN4A 3ZFEB 1O5LA 1PZ7A 3KS7A 5C9AA 4XW3A 1LCLA 3CJIB 1K5MA 4HVOA 1VAVA 4R4XA 1RVF2 5GZFA 3QD6A 1TMF2 1DQ2A 5JWPA 1BKZA 3ZN6B 5CFDB 5FO9B 4HSLA 5CFDC 3VDDA 4PDWC 2GNDA 4XJ8A 3WHUA 1N47A 2BW8A 1V6NA 1UIKA 4XJ9A 5JPMB 2W0XA 1OFSA 5BYNA 3JQXA 4FPLA 4YZ5A 2B39A 1JOJA 2ZGTA 4AEDA 1LKNA 1M06G 1W39A 3VV1A 1T6GC 1MQTB 4QM8A 1NCRC 2DWRA 4AEKA 4BWOA 4B4PA 2DUOA 1Y7BA 1JYIA 2RS31 1DF0A 2EAKA 2JJ6A 2Z69A 3H0OA 4ISRA 5T5JA 4COVA 4Y26A 4JVAA 2ZACA 1GQWA 1B35C 2OIIA 4JRAA 3VZMA 4CEYB 1MS9A 3MW2A 3M70A 1V70A 3H3UA 4QQLA 3WOGA 5B2GB 4W6YA 1LRHA 2A7AA 3AYAA 1LGNA 4LBQD 1LOBA 4RR3C 3VBSC 2ZMKA 3B5LB 4CDXA 5L7OA 3EBRA 1J58A 1BBT1 2WT2A 4XZPA 2OG5A 4K9SA 1ZZ8A 1QNWA 5JZGA 3V0AB 3ELNA 4OUMA 1X7NA 2DCYA 3DV8A 2R32A 1LULA 4QQPA 3MLJA 1W6MB 3ZFFA 3D6EA 1DQ6A 5F1RA 1YJLA 1FYUA 1EP0A 4PF5A 1OIJA 4R9AA 1WLDA 3AK0A 1SBEA 3CLPA 2CGPA 3BOWA 1U0AA 4P14A 4GKXA 1HXS3 4LTAA 1DBNA 2EIGA 1OIIA 1YYNA 3JD72 1RUC3 4RS5A 3O5SA 3M3IA 5D8AC 3VKLA 3ZXLA 4E4ZA 1RINA 1D0GA 3VBOA 1VBA2 3FLRA 5H9SA 3SNMA 1PGSA 4NO4A 4RQPB 4NHMA 1S0GA 2RMU2 5KC5A