4B7KA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-ser peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
338
Chain Sequence
b'GSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 338
sequence length 338
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7kA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7kA01
1MZFA 4AI8A 2WA3A 3P3NA 4Z1VA 1H2KA 2CGOA 2ILMA 4NR1A 5JWPA 1YCIA 3KCXA 2XUMA 4B7EA 3KCYA 1MZEA 1IZ3A 4Z2WA 2YC0A 2WA4A 1H2NA 1H2LA 3P3PA 2W0XA 4BIOA 2CGNA 4JAAA 1H2MA 2YDEA 4B7KA 4QU2A 2Y0IA 3D8CA 3OD4A
chains in the Genus database with same CATH superfamily
1W6PB 3CZUA 4E4EA 1U0AA 3ZPYA 2BU9A 3I2IA 1VBA3 5CA1A 1VQPV 2YXLA 3T2TA 4FMTA 4FM0A 3F7YC 3AMMA 1FOD1 3C7EA 1DQ0A 1E5RA 2Y34A 4FBFA 1W8FA 5T50A 1NXD1 4BJ0A 2BTQA 4Y3OA 4K6BA 1JODA 2XH6A 5FPUA 1ENRA 2ZKNA 4FOWA 2ZE6A 1YHQV 4AQYB 3LOIA 1R6KA 4EFBA 2Y64A 3H8XA 2I2SA 3ZXFA 2D3SA 4OUMA 4DXWA 3MPBA 1BQ0A 4CCMA 4BIUA 1SPPA 4LF6O 2ARXA 1AYN2 1RXFA 1HW5A 5EJ3A 4LBOA 5EV7A 1GWKA 4W4ZA 4JDMA 1QJZA 2Q4PA 1LR1A 2OPWA 4CRQA 1KC8W 1N34B 1FYJA 2QDOA 5B1BC 3OE7G 1H2KA 3E8HA 1NI8A 4BDVB 4CEWB 3M1HA 5B4NA 3GXUA 1UJWB 2VAUA 1LRHA 4COVA 2OTJV 2J1AA 4LQRA 1QEXA 3EB7A 1FJGB 4LIUA 2WLNA 2ZMNA 4CDXA 4TT3G 1RIRA 4BAYA 4LBNA 1Z7S2 1OCOC 3PTYA 4NIAA 3DGTA 4QGNA 1FV3A 4M3CA 1G9BA 4OI1A 1OFNA 3CRQA 5FZAA 5A32A 2Z4FA 4TN7A 5F2WA 5GLUA 4HONA 3JALB 3NL1A 2DV9A 1DQ5A 2W46A 2QVSB 4LO5B 3NJZA 1EN5A 1LOBA 1TE1B 3B09A 4HKWA 3LKJA 1NS1A 4IV1C 3WG7B 1DGLA 2MEV1 3LWCA 2PYLA 3UGFA 1BHBA 2WLMA 4HLTA 4KHPB 1M57B 3JAKA 1JZ2A 2RMKB 1UMIA 2Q8OA 1JJOA 1UD1A 2HFEC 4HSLA 3LDDA 3TCUA 1ZZ8A 1M57C 2ZS6B 4Y1ZA 4DV2O 1HJGA 3RMXA 4H3WA 3DL3A 1PZ9A 1RMU3 1VRH3 5DABA 4NAMA 4R9AA 5F37A 2O8QA 2JEMA 3I3EA 3T0BA 2VOWA 1EV12 3H1LH 4ZY9A 1I5YA 3VZMA 4YVSC 2XAFA 1ZA7A 3TWIA 2R062 4YZ3A 3ZFFA 3S7EA 3CMEV 5FO8B 1XU1A 3DF0A 4TUYB 1DF0A 2X5IA 5BYNA 5FBZA 1SQQH 1AR93 4OX9O 5JVDA 1XNCA 2R0HA 1VQ9V 2ZMLA 1AR83 5DUWA 3W7SA 1K34A 4MGYE 2ZKOA 1JYWA 5I0SA 3AM2A 3GZTB 4EWEA 1W6MB 4JAVA 2ENRA 3QO7A 3SC7X 1PMHX 3D0SA 4C7UA 3AFGA 1Y67A 5IJ0B 4QE7A 1X8MA 5DG1A 2WLLA 1E5IA 4FO9A 3UJOA 5BNQA 3IN9A 1FFXB 1AL0G 3JQXA 2CYFA 1SESA 1AILA 4XTPA 1Z5VA 2F66C 3N27A 4XTMA 1POV3 5JQGA 2QE3A 4IGOA 4XURA 1RUC3 5DQ0A 3SYOA 3V0BA 4K1ZA 3GCXA 5CB4B 1O3SA 1FMD3 3PUSA 4TWTA 2M6YA 4PIZA 2JIGA 3CXHF 2VTXJ 3WNMA 1WUVA 5FYSA 1S0CA 1K5QA 3D36A 5J9PC 3HMYA 4YWAA 2PUSA 5A2QN 2ZGUA 1WLTA 2RJKA 2VNVA 2ZAAA 3ZFGB 2VL4A 3K5NA 4BOWA 2RJ2A 3FC0A 1KDKA 1N0NA 4JZGA 4Q4Y2 3FUOA 4Z1MG 3TNPB 1W90A 4I02A 3K06A 2RR12 3BU0A 1S0EA 5J09A 3WHUA 2E5LO 4OI0A 3K0GA 2DFBA 1QR9A 3HJRA 1NX9A 2WNUC 1G8WA 3CDZB 3RWKX 5HFLA 2DMXA 3ATGA 3S3XA 4QM9A 2FHRA 5FZIA 3EXUA 1UZ0A 3QO8A 1Z7S3 1NA1C 1KRIA 2CAZC 2VUAA 1UY0A 1UL9A 2CTPA 1HNWB 2HWF2 1AP5A 4KWJA 1U5IA 3BU7A 2EIGA 5KLVH 1ZRIA 1RUD1 2VMGA 1B35C 4LBMA 3A0HZ 2W08A 3USSA 2YB7A 1EN6A 4X66O 3VHNA 4AHWA 5JZGC 3UKMA 2A71A 2XUMA 3ZX6A 5A7QA 4JQTA 2ZGTA 5HCAA 5GM0A 2JKXA 1H1IA 3AKQA 5B1NA 3WINE 3WU2Z 2VD7A 3CD6V 4GKYA 4OUSA 3N9LA 1CAUA 2GU9A 2VW2A 2WPDG 3AKSA 2UYAA 2ZGQA 4GB33 2YBKA 4B3MB 1QCEA 5FZOB 1LHOA 4Q0SA 2CUGA 2PYTA 1VQ8V 2VOKA 1H0BA 2DF7A 3BTZA 4A2UA 4LR3A 2XR4A 3G7DA 3VDDC 3AJZA 4R8CA 2Y6GA 1J59A 1SQFA 2TNFA 4J1XA 4YIPA 1EV13 5CFCC 2P22C 4X64B 1COV1 2ZE7A 1D0GA 5AC91 3H3LA 4Q6GA 4KG8A 2WZPP 3GNEA 3M3OA 1D5NA 5L9RA 3WG2A 2HKOA 3HR0A 4JI2B 1HNXB 4BWAA 2D6MA 4HKLA 4DV0O 2VUDA 4G9SB 4XDLA 1H4GA 2ZMKA 5DZEA 4GT1A 4XZPA 1F7YA 4WVZA 5EBMC 2D97A 4N8MA 2CV6A 1ZVFA 1SQPH 5I8YA 4F3JA 1IXMA 4MADA 5T5JA 1HRI1 1APNA 5FZKA 2QZ2A 2D5FA 1RM1C 3E35A 4NKGB 2FL4A 3MEPA 3KM5A 1V55B 5LA6B 4WCEV 5FZ9A 5B1OA 4PDMA 4S2GA 1REDA 4DXTA 1GLHA 3RZKA 2W1SA 4GA9A 2YFUA 4LTAA 3FB8C 4LFBO 4CUAA 1OBNA 1QOOA 3QLQA 1YEWA 4JC1A 1K97A 3RW0A 4ZS3A 1DF4A 4Q4Y3 4DR1B 2YZ4A 2QQJA 3AZYA 3W7TA 1YC61 4JF3A 3MF9A 1C8M1 3TBDA 4B8EA 3OGIB 2RHPA 1IBKB 2X05A 3OUFA 1DQ4A 1W6OB 5ITZB 4AL9A 2DU1A 3HPNA 2VNOA 1MQTB 3CJXA 4UFZA 1N3OA 1FATA 4MVTA 2J1VA 1UF2C 2WFF3 2Q30A 1XSQA 2HWF3 4PLMA 1TUEB 3DCQA 2R72A 4S2FA 1O3TA 3LOBA 3WDUA 2CWSA 3WDXA 2C24A 4FI9A 5C9AA 1QXRA 1D4M2 1GP4A 5LA0A 2A7WA 4QQOA 2ODMA 2EIJB 4XVHA 3AZVA 1SBFA 3IB3A 4JGZB 4YY3O 5G04L 1I5ZA 4L87A 3QACA 1J3PA 4CDUA 3OTOO 4JGYC 3WX5A 5KHKA 3AEIA 3X2QB 3ZN6B 3VZLA 3T1YO 1V6KA 3RBZA 2QQWA 2JG8B 2NPIA 1GP5A 1S77D 1SG3A 4Q4W1 5H9PA 4QQHA 4I55A 4AI1A 5F2VO 1Q82W 3OPTA 2FDIA 3T3YA 2VMDA 3OUHA 3CHXA 3SH4A 3WUDA 2VULA 4Y5SA 3TK1A 3ZPOA 2ZGSA 2Y69C 1I3HA 3E1F1 4YW6A 5F5QA 1RSOA 2UXDO 1U12A 4O2AA 5C6CA 2VNGA 5L7OA 2B4KA 4X89A 2CH7A 4X1IA 1RP3B 1UIJA 4P9JA 3PUIA 2LM3A 2VRZA 1PO21 1NJIW 2VMHA 4EQVA 2CAUA 3LNNA 1XL4A 4AE2A 4X8AA 3E22A 4EV0A 1VP6A 2PGGA 4P5YA 2VQAA 1GANA 5L9BA 3UQ8A 2AZ5A 3VKOA 4O9EA 4YGDA 4HZFA 1GKBA 3JD4A 4CS3A 1F35A 2B42B 3WB2A 2ZEXA 4GX1A 3LNMB 1O6UA 4EB6A 3FAVA 4B7KA 3MIFA 1X82A 4P9GA 4XF4A 4MH0E 2ITCC 3JB4C 1CP9A 5E1RA 3HKBA 1SACA 4JCKA 4CDWC 2UWAA 1C5HA 4CPBD 5KHIA 5DZFA 4BWOA 5EZYA 3SYQA 4RYDA 2VOVA 2JJ6A 1POQA 4RR3C 1HB3A 2AEYA 4QKFA 4HNAB 4B3TB 1EM1A 1JBCA 2E6VA 2A0LA 3H3UA 2JDYA 2AYHA 2RJZA 3W58A 2G38A 3HVDA 3ZOIA 5FZGA 3ZIXA 1OLME 1YO8A 4LHNA 3HKCA 3AK1A 4COWA 5FY9A 3AVSA 4YM2A 2I45A 2XJSA 5IJRA 1L3JA 1QJFA 2OYQA 1MEC2 4N23A 4ZHQA 3JSNA 1BS3A 3H0OA 4G4FA 5HXMA 2GN3A 2LW1A 1FX5A 3CCJV 1VB4A 1LOGA 5CFDB 3MFAA 3MUY1 2ZOEB 4RS5B 3WW3A 1F31A 1BHAA 4MHRA 2BW8A 1NTZH 2AREA 2BTVC 1E57A 4AI3A 2RM23 4FFHA 3I3QA 5FJKA 3IT8A 2QWNB 2C9KA 2PF4E 4YVWA 3CCRV 3ZBHA 3LZZA 5K1XA 3B8MA 1FPN2 4YW2A 4I50A 4L8JA 2WQ8A 4MTOA 3UT5B 2WC2A 2Y48A 1AR61 5KA6A 3OCPA 1M06G 2HR3A 1LHNA 1W2UA 2PFWA 1CAXB 2ZIOA 5A7SA 3D4KA 4J25A 2XPJA 4XBNA 2A70A 2WO2A 1N32O 4JI3B 2LROA 4E2QA 1BLZA 5HCBA 1LOCA 3ABLC 2JD4A 2L35A 3JCZA 3SXWA 3NAPA 4NPLA 4UFJA 2AUYA 5G05L 3LEKA 2P1BA 3ZYBA 3EHBB 4TQDA 4BE3A 3AK2A 1RXGA 2XMLA 4WM8A 3WLUA 3MGUA 3T1MA 3WDTA 1GAXA 2HJDA 2RG4A 4MSVA 4NRPA 4JRLA 4J1WA 3JU9A 4DIQA 5FK7A 1ENXA 1VIWB 4O4LB 1S0DA 1SQBH 3HN3A 1QMJA 1QVGU 2PN5A 3WG1A 2C1FA 3I2KA 1O8PA 2XL7A 5CA0B 1TMF1 4ZBMA 3MW3A 3FKSG 3EHKA 3C3VA 3QF7A 1KP2A 3ZRSA 3BODA 3ZDSA 1PIV2 2CE4A 4ZPIA 3DGEA 4AGGA 4LH6A 1SCSA 2FCVA 3APOA 3SDLA 1YWKA 2LALA 4N53C 4QX8A 2OPKA 1SDDB 4AEJA 2YC2A 2VZRA 5FY0A 1N0JA 1CX1A 3SMHA 4EZ4A 1Y76A 2FDJA 2P2KA 2ZE8A 1P7BA 3KVBA 4FPLA 1RYYA 1PNLA 4META 2AHZA 3CXCU 1RMU1 2N04A 1Q7YW 1JUIA 4ABMA 4CU7A 5KX5B 3NV1A 1YVWA 3VBBA 2Y8KA 3ZSEA 4LA2A 4JZ2A 4AVBA 3FN9A 3D3IA 1RUI3 4K3UA 3BABA 1K42A 4L97A 2KR2A 4ICGA 2WLJA 2D6NA 1S0IA 2YDEA 1U97A 2W1UA 1N34O 5JH7A 4LNUA 5LP6B 1PK6A 2VVFA 2QJ1A 1FYUA 3O7OA 3PVNA 1I5PA 3E97A 1ZZ6A 3OUIA 3K51A 3QCWA 4Y1VA 2Z42A 1RC6A 1LECA 1MEC3 1XJAA 3K2OA 4DV6O 3VBHC 4CC6A 1ND3A 1Q8VA 3GHMA 2A3YA 3AG3B 4KXRA 3MLLA 4QB1A 5HV4A 4Q29A 1KMIZ 4CS2A 1RFYA 1IBLB 4NPMA 4Q4V3 1Q6UA 4XFAA 1SCRA 5FZCA 2W68A 4M0NA 3LA3A 5FZFA 5K7PA 5E1AC 3KQRA 1GQGA 5CG9A 2Y6JA 2HP8A 2GUZA 1MS5A 1QQP2 4FFFA 3POBA 2JD9A 4WM7C 2YEVA 1WNSA 4Q1RA 3N35A 5FOBB 1CN1A 4GWJA 4MVMA 3IC7A 1AYN1 2VWKA 2IXHA 5FZBA 1JI6A 3JATA 4G2KA 5CISA 3ACFA 2OTLV 1JYCA 5DDJ3 4BMEA 4HVRA 4X1YB 3NSTA 1QH6A 4KHPO 4K20A 1QQCA 2VR4A 4FTBA 3IZOA 1OOPA 2Q0AA 3B94A 4R7CA 3SLIA 4J7JA 1MSWD 4UFIA 4JDOA 2B9VA 5EFUA 5F7UA 1V54C 3JAWA 5LOVA 1NCQC 1RUF2 4WFFA 4OFGA 2JE7A 2DUPA 1OC1A 2ZE5A 5E88A 1A8MA 1Z7S1 4PLNA 1FXKB 3HOBA 4E9KA 1ZZ7A 4AVVA 3VBUA 4FPPA 5L19A 4P30A 3BIEA 3ZEDA 3NNLA 2CDOA 4AFDA 1YJLA 1BMV2 3FLPA 2ADEA 2ETEA 4N7UA 1Q8IA 4Z2WA 3KZIZ 2RDQA 4AHCA 2ZX2A 1JYVA 1AR4A 2ZM6B 3MV01 4N7IA 1AX1A 3W5MA 5LBEA 3ZDVA 1CGPA 2ZEWA 1WPXA 2JIJA 2CTRA 2QWQB 2Y4UA 2W1WA 3K04A 4KU7A 1YITV 4PDWA 3EVKA 4LE4A 4QKBA 2FDFA 3W9AA 4XW3A 3KV5A 1SEFA 3LF7A 3R6SA 3VBRB 3ZHSA 4GB31 5IK7A 3T0AA 4AVAA 4BXSV 1Q43A 1Y4WA 2XVLA 1VBD2 4JRAA 2BE3A 4JAAA 4HFSA 2GMMA 1AZDA 5GZDA 3ZJZA 4XILA 3NW4A 4C1XA 2A3XA 4WVMB 3MLJA 4CEYB 3AG4C 2AEZA 2ERFA 3MV11 1NQJA 3ZSKA 3DUIA 2D40A 4IGQA 1EV11 2QQNA 3NR7A 5BNNA 2V4DA 3BGAA 1Z5WA 2P4EA 1SZBA 1KBHA 5C4WB 4W4LA 1V9U2 3WCSA 2R061 4BQXA 4PDLA 1VQMV 1DDLA 4YG6A 3HIFA 4EROA 3D0JA 2W6JG 1UPSA 4Z82A 4JZRA 1DCSA 3AXEA 1FNZA 2RS33 2XL9A 2VZQA 3E5QA 1PX3A 2Q8DA 2C0ZA 4G3YC 1JPXA 3SJBC 4IV3C 3T08A 4KQ7A 2O14A 3AG1C 2ES3A 4YGEA 4H0LB 3LDRA 1MZ5A 4B4QA 3S6PA 3O1UA 3TJTA 2X6CA 2V4AA 5J2TA 2E74B 1ZRCA 2RE9A 5F32A 3M99B 3WP5A 3LEGA 5C3SA 3E2EA 2XHNA 2ORZA 1QNWA 4BXFA 1Q86W 2H6BA 1JZ8A 5JVVA 4JTAB 4P14A 4RO2A 1HNWO 3OEBA 3F95A 4E27A 2CHHA 3N7MA 1QJU3 2CGNA 4J9ZB 2BNOA 5BXZA 5CADA 4HVQA 4XF1A 2HWC3 5JUVA 1Q8OA 1RUNA 2Q7EA 1UOGA 5DUXA 4AFBA 1OCCB 2IM9A 2JGDB 4QHOA 4TV8B 4URTA 4Q4Y1 5FUNA 1NH2D 5D5QA 3WP4A 1K5MC 5CBFA 5IVCA 2P6CA 4FFGA 3OJBA 4R9CA 4UFHA 2R9AA 1NTMH 3PUAA 4IE6A 5F6KA 4JTDB 3B02A 2PY5A 3APQA 2EBOA 3JD72 4XJZA 4GX5A 3JCUZ 1RUF3 1XMOB 1JUHA 3PDQA 3KCXA 3ZHTA 3GBGA 3TRSB 2ZACA 4J80A 1D7PM 3ZFEB 3DKQA 1CONA 4JYAO 1LGCA 2WFF1 2B5UA 1AJKA 1VMFA 4YM1A 2HWF1 2WKKA 3E6BA 2Q7GA 3D3QA 3O1MA 4R4ZA 4X64O 2QE7G 2P7TC 3ZX7A 3CMGA 1N3PA 3IIAA 4JI2O 1ULFA 1HNXO 2VECA 1JMUB 1RUE3 1O8SA 1GUIA 2NR5A 1RUH3 1C1FA 5BNOC 4S2DA 2ZNJA 5L3CA 2JB4A 4RGAA 2PHUA 2WSVA 3ORJA 4Q27A 1HRV2 4XFFA 1DQ2A 1W0JG 4CSWA 4FM1A 2IVJA 3K59A 2G19A 3CRMA 4Y4RA 1QOSA 4Y5TA 5A1AA 2BTQB 2VBDA 1KB9F 2V4VA 4IV1A 4NHYA 2N7GA 3ST7A 3PURA 1THZA 3CKHA 2L9LA 2F4VO 2IJJA 4UFLA 1AXKA 2K46A 1W2BU 1R093 2XKOA 2NLRA 3L73H 4LWSB 4ZHNA 1SPPB 4F4LA 1PZ7A 4UCTA 5H6RA 5LBQA 1IPSA 2PTMA 5JXIA 4UF0B 4RA0A 2JJ2G 4QXKA 3O12A 2EIBA 3IGAC 3L72H 3O1VA 3PU8A 2W6IG 4Z07A 3NV4A 2DVGA 3W21A 5IT6A 2HLDG 1S0VA 2ZCEA 4GWIA 4YVSA 2QKAA 3KSCA 3JAMN 4DR1O 5FYCA 2RS13 1AB3A 4LF9O 3ZR5A 4AF9A 4ITCA 1O4YA 3GWOA 5FQ0B 4SLIA 2WA3A 2YYOA 1IBKO 5C93A 3CEWA 3RRDA 3ZYJB 1XE0A 4CDXB 1UY1A 1ULOA 2WR9A 3SGIA 1FAYA 1XEQA 1GYKA 4AXOA 1F5FA 3JB8A 4BM8A 4DR5B 2EINC 1NE4A 5E16A 4QXCA 1UNBA 4IEPA 3ASNB 1TZOA 3KV6A 5IVEA 4OUEA 2K0GA 2FKXA 2PXJA 4XIKA 1ZSPA 3N2KB 1OLMA 1Q56A 5J96B 1DQ6A 1W6MA 5I0DA 4LMFA 4UW3A 2W0XA 1I0HA 3VKLA 1ZLZA 3FMGA 4TLFA 5IUQA 3OPZA 3UT0A 3LGRA 4DV7B 4LBEC 1FFXA 1SZXA 4TSFG 3NJYA 1EFRG 4HG6B 1UXZA 3VBSC 4BQ1A 2IJKA 4LUMA 3ZMZA 3JAKB 2GNDA 2WZR3 4CZZA 1CAWB 5D21A 1XNBA 2WYSA 2QZ3A 2ID4A 1XC6A 4CP9A 3AP4A 1AR73 2A6VA 5GONB 2DYCA 2W52A 2IXKA 4OULA 3V0AB 2EZPA 3K3WA 5LYJA 1KDMA 2HYKA 4IEYA 3T4VA 2RS53 1J83A 1XYPA 1WCDJ 2QTOA 1GO3F 5C71A 1LCLA 4CDQC 4UOJA 4FLVA 1GN4A 2IBZH 4O4JB 3ZFFB 4IYIA 1CZTA 2P6HA 1ASJ2 2ET7A 1LUWA 1EPWA 2X5IB 1D4M1 1NU1H 4WFGA 1HB2A 5JVDB 5FZ3A 4YZ5A 3JBG2 1T5EA 1VBB3 2F93B 4LP8A 1ZYBA 1B35A 3CNAA 3H1KH 3I3DA 4JI0B 1LGBA 3VQWA 2HWE3 3A0BZ 2ZKLA 2VBBA 1YLLA 5JZGA 2E53A 1LULA 4NWVA 5FNVB 4LJHA 4LBQD 3WDYA 1ENSA 3GB7C 3OW2U 4CPBA 1OI6A 1WA8B 3AFKA 3HNYM 5APAA 5EJZB 3EXAA 2BOCC 3WOGA 1ENVA 5JQGB 1SERA 5FMOL 2NLJC 1GKFA 4DY5A 3V0BB 1WLCA 3BCCH 4Q0QA 2EA7A 2A6ZA 4OZOA 2Q5TA 1CJDA 2P3KA 2UUCB 3AG2B 1HLCA 1S2BA 4BQ4A 4DV5O 1PM4A 2ARCA 4UFMA 1W6QA 5FZOA 1ENQA 3ZIWA 3VDDA 4JI5O 1CR7A 4MTGA 1O9HA 2X7RB 2ZXWB 4QDQA 2QEXV 5IK4A 4X6RB 4AEDC 3WF2A 3C90A 3LSUA 1LESA 5FIXA 1CJPA 5DM6V 3T2PA 3DV8A 1EN4A 1UZZA 4PI2A 2DWDC 1GWMA 3W7XA 3B93A 4DINB 2VTFA 3FX7A 5LGTA 4IETA 1LAJA 1S2EA 4L9BA 4ZKTB 1FV2A 1R6TA 3PL0A 3JD1A 4O61A 4A44A 3W7UA 3PMEA 1T2XA 2IFWA 3V64A 1W59A 4UCRA 4C90A 3T1LA 3WB0A 2ZHLA 4LCUC 3BA9A 4LT5A 1QJY3 3QH7A 2XNDG 1NQDA 1RITA 2VQ0A 4A7ZA 4Q8KA 2FTKA 1WMXA 1VF6A 1GR3A 3E86A 1R082 5FKBA 3AYDA 1SQGA 1CAUB 3WDVA 2XONA 3E89A 2E76B 1MEC1 5FP8A 1KFXL 4INDA 1W0PA 5HV0A 1FI2A 3SHRA 4ARYA 4IIJA 1QDOA 4QIWF 4PDVA 3LD8A 1HN1A 4PI0A 1ODNA 2VG9A 1SBEA 2Q69A 1LEMA 2BUKA 5GLWA 3E5XA 4DXRA 4FJCC 1BJQA 5BR8B 2BYVE 3NKTA 2VNRA 1A32A 1OHFA 1BZKA 1RVF2 2MNGA 1W9WA 2XVKA 1FPN1 1L7LA 3PHMA 4LHKA 1ULPA 3OBTA 1TNRA 1YHFA 5ITZA 1GOFA 3KV9A 3JBG3 1PVC3 5DDJ1 1MQTA 4ASUG 1LEDA 2LGQA 4XJUA 4C1WA 1IS5A 2BGPA 1XMQB 4FVVA 4CCLA 1OKOA 3H50A 2FMDA 2VW0A 5J2UA 2VY0A 2QQIA 2JVDA 3ASIA 1GN2A 4A4AA 3JUUA 2WINB 1WMFA 2W47A 5ERLA 3LDBA 1HV1A 3R4DB 3WNLA 1NAEA 4EZHA 4XETA 1MG1A 1S0BA 4JGYA 4YARA 4R4XA 4IT5A 1NY72 4AVSA 1B06A 1MPXA 3UKNA 1MNGA 3ZN6A 4AG4A 1W8HA 2I74A 3ZXEA 2F43G 2JG8A 4LHSA 3GALA 1NR1A 1XOUA 3GCWA 4FPGA 2CWMA 3DEMA 4PF1A 5T3NA 3TN93 4BQ5A 2UYBA 5A6QA 2YROA 3ZHVA 5FUIA 1ZRRA 2PA7A 3IMNA 1HN0A 5I0RA 1DTOA 1YJ9V 4E2SA 1H2LA 1PIV1 1Y9MA 3WZ1A 4XJ8A 1VQ6V 4DUVA 1DGWX 5F5CA 4ES8A 3RGBA 4E4DX 4R9BA 5HXVA 4ONUA 1AHSA 5E6HA 4X8PA 2F1MA 4AFAA 1IX9A 1TQ5A 3GVMA 2GN7A 3KB5A 4URAA 3IFXA 1OD3A 5GTHZ 1IBLO 2EIKB 1JH5A 1YIFA 3SH5A 5HBAA 3A0RA 3AKPA 3CRCA 5FY1A 4PD4F 2BBVA 3IMMA 2JDAA 3FHQA 4B3SB 2BVVA 1PHMA 1J1TA 1IBMO 3SH3A 4BR6A 1DYOA 3AKRA 4QX7A 3K77A 1KEXA 3UCSC 1FT9A 2ZGLA 1PX4A 1JVMA 5ACA2 4QX0A 3RZHA 4RR3A 2RDRA 3CO2A 4W6XA 2EZOA 1W9FA 1VB2A 2ZBJA 3VQXA 4LO4B 1SZTA 4CDUB 1HV0A 3I3BA 1CPMA 4NWWA 4BIFA 1RUG3 2WLPA 3LA2A 3N7JA 4ARXA 4L8QA 2OT7A 3ZYHA 1OPOA 4QXHA 3I54A 4ZKIA 3KMHA 4I55B 3A2FA 2BOIA 1M5IA 2CGPA 5F6LB 5C3OA 1N47A 4D7SA 2UXNA 3ZMVA 2LW8A 2VUCA 3CCMV 1LOAA 2JG9C 1XNKA 2PHLA 2FMYA 3N9QA 4ASLA 3LB9A 5IJ9B 1W3XA 5L7OB 4FAHA 4D6TH 2Y0IA 1HNZO 2CH7B 3M4FA 4X1IB 3JXSA 3AVRA 4QPIC 2GTSA 1UWWA 1TME2 1HJFA 2D3PA 3E22B 5CFDA 4CH3A 5EBWC 5LASA 4HVOA 5FP7A 2ZM6O 3GGLA 4FXGB 5HFMA 1Z0HA 3LUTB 5A7PA 3IPVB 4LF7O 4GH4B 1D2SA 1OHHG 1IQDC 4CP0A 2YS8A 1J3QA 3FHIB 3FLTA 4RHV3 2GALA 4UVCA 1EY2A 4FPHA 2WNEA 1IKPA 4F6RA 2VCMA 3CCEV 4PA6A 1YFXA 4NYKA 3LEMA 5KHJA 4JI7B 4HAMA 1H1MA 4PHZA 1UMHA 3CJIB 4CH6A 4QQPA 1AJNA 2XJUA 2F6BA 3ZXGA 3WSOA 1CAXA 1RUF1 4YW5A 3PJYA 4O65A 2CTQA 1K4CC 2VTXA 2WWUA 5IFPA 1J5EO 1W8TA 3N9MA 3BVCA 4DNYA 3ACHA 3K58A 1GN3A 1O3RA 3KWVA 3HNBM 1RJ7A 2DCZA 2WSSG 2VZPA 1BMV1 2D43A 3HKCB 1PD3A 2ZX3A 3U4XA 4AW7A 4B1MA 4MG2A 5C8YA 1C57A 2GC3A 1RUE1 2DYRC 3QH6A 1V6NA 1NLRA 2B45X 3OGRA 1H4HA 4ZHQB 1BQZA 2FYUH 1N33O 3BN6A 3VQYA 4WBBA 1HW7A 4QD2A 1A34A 3UETA 1JU4A 1HQWA 2W3JA 2IVIB 4O4LA 1A3KA 4MUVA 5JI9A 3WF4A 4D7TA 1ZBE3 3HN1A 2ZQMA 4LFAB 2GDFA 3QNEA 1G9FA 3BFRA 1VBD1 3IDEA 1EBOA 3O65A 3RYIB 3PNAA 4A3XA 3N7LA 2W91A 4AQTA 1NZIA 3EBRA 3RYFA 4FLYA 1R091 4N53A 2EVXA 3SPJA 4PIYA 5A3NA 4XPVA 2V1DA 3ZRVA 1N8RW 5T5OA 3PLQA 5FZ1A 1OXCA 2MPFA 4OQ9A 2QR4A 1V9U1 3B00A 1JQ0A 2P17A 2Y33A 3IAQA 1XBFA 4JTOA 1VJ2A 5L3EA 2W9XA 3C7OA 2R16A 1PKXA 5A7WB 2WZEA 4DRXA 3VHRA 1JYXA 5A7OA 4FFBA 2HWD3 1S0FA 5KC6A 1N1SA 2SBAA 3AYAA 2XJQA 3UO2A 1RUD3 3NAPB 5KX5A 5CKNA 4JHTA 1NT2B 3VBFC 3EQEA 5IK8A 1ZX5A 5BY1A 4WM8B 4ZONA 3OT7A 5IFTA 3VDCA 2QNKA 3RYCA 1XMOO 5LP6A 3POJA 1VMGA 4XBLA 1JS9A 3WNPA 4ZXKA 1DGRN 4XACA 3OBZA 3VBHA 4YG0A 1E5SA 3PIJA 1BK1A 4E4HA 2LFSA 4UAPA 2Z0AA 5FPLA 2HEWF 5CBHA 4M4RA 1EAH3 4HETA 4UYBA 1BEV3 2XUEA 2BWCA 1RUOA 4Q4X3 3IWZA 2Q1MA 3ZIAG 3ABMC 1R1A3 2ATFA 3I2HA 4GKJB 2WJSA 5FPOA 3CCUV 3K0DA 5FK8A 5JXGA 4BLIA 1H8TC 4E2GA 1QH7A 1QF3A 4CYDA 2J1TA 2D98A 2OVUA 2QJVA 2Y6KA 2FQPA 1HR0B 3JD71 2QSAA 4HXCA 1YI2V 3O0XA 2Z2SB 5BZBA 4Y24A 4PA3A 2RNBA 5IVBA 1QLNA 2EXHA 4KFMA 5LK5A 3KT4A 2OA2A 3JD2A 1L0NH 4U36A 3OR7C 1DIWA 1KD7A 4G28B 1S3JA 3U10A 4NOTA 1PNMA 1QHTA 1VE0A 3B77A 1NCQA 1VLNA 3ITQA 1HQNA 2WL1A 1TVKA 5JH7B 1JYIA 4AAXA 1PK6B 1VP7A 2KXLA 5LBBA 1BK0A 3U0ZA 3TB0A 2X29A 3WP3A 1ODMA 3CB2A 4RQPB 2ITDC 1W39A 1JCHA 1JHNA 1VBB1 4GALA 2QWPB 1FXKA 2EILC 4U7OA 5K4LA 1SLCA 4AI9A 5FPAA 1JOJA 4GMP3 2YHJA 4LA3A 1HRV1 2HWE1 4NTYA 2DURA 1KJLA 4Q8LA 3HBZA 1FXZA 3J8F2 1K9MW 4Q0UA 3H1WA 5DAVA 1ZUQA 5CG8A 4DR5O 4DEQA 1WMDA 2DYSB 1LUVA 2HHHO 2YEVB 2UUBO 4IERA 1I94B 1UZYA 4C91A 1C8M3 1CXZB 4DR4B 1XHZA 2DCJA 4K0KB 3CJHB 4XMAA 2F4PA 2QQKA 5B3SC 1ACCA 1OQDA 5F5IA 1UOBA 2PLV2 2GZWA 2YIBD 2B46X 5FZ4A 4Y1YA 1DYKA 4LUKA 4KG0A 5I8TA 4NXNB 1OOPB 1RTVA 3GYDA 1YIPA 4DR6B 4FXKB 4NPRA 4JYBA 5FWJA 4FZ1A 2B1IA 3JAWB 1IDSA 3USUB 2CTWA 3M7AA 2UXCB 2WS92 1SRYA 2CY6A 3R66A 4UB8Z 1QGLA 5CNAA 2EIMB 2CAVA 3BUCA 2LFRA 2ATKC 4IV3A 2YBSA 2K9ZA 1I7FA 3NXSA 3HKDB 1PP9H 5ANQA 5LA1A 2IJIA 4Q4W3 4QPGC 2VOTA 4UV8A 2GH2A 2HLEA 2WBKA 1LNSA 1SFYA 4YHHO 1Y4MA 1QJY1 4IQPA 5FYHA 3LDKA 1VAKA 1T6GC 4XFGA 1XUQA 1VBC3 3M2MA 4JI4B 2HEYF 3A7QA 2WLIA 4CU9A 3AL5A 4BISA 4NXMB 3NV2A 5TSWA 1NBMG 3NMBA 5DUUA 4OQ8A 4JI0O 2EAKA 4PDWB 3MO4A 5A3TA 3A4UA 4FPOB 1CIWA 3MIDA 1HXS2 3SKJE 3ETGA 4MGSA 2WABA 1Q81W 5BPXA 4WVVA 2ZCWA 4LBQA 3N7KA 3U4SA 2ETNA 2R1DA 1ZBA3 1O4ZA 1IPKA 4OMCA 1GOGA 5L9VA 3D6EA 4B3NA 3VN4A 1R1BA 3MYXA 4IESA 4QPWA 5GKAC 1M4UA 4QDRA 2UUCO 4TV8A 2UXBO 1OLRA 2DOSA 5B1AB 3JASA 1YNAA 2BFUS 3WEZA 2BVBA 5CB7A 2ADQB 3RZLA 1L7QA 1YJKA 3RZMA 3L75H 2HJFC 2ZR2A 3P6BA 2F17A 2RDCA 4HOOA 5SV8A 2AC1A 3JBG1 2Y60A 3TNQA 3SPIA 1PVC1 3L9DA 4QHZA 3AKTA 4GKXA 4RUEA 4TQFA 2VVDA 3ME2A 2FB5A 3BTXA 1CAVB 3H3ZA 1K73W 5DECA 5J2TB 5B66Z 5E79Z 2NZ9A 3RZGA 3C8XA 4ZU4A 1V6JA 2AACA 5K8SA 5BNOA 1XHXA 4NN0A 4UV9A 4MSWC 3STZC 1FXHA 5DAWA 2R042 3T1HO 3PMSA 1DP0A 3ZMUA 5GZFA 1C28A 5F9TA 5LA2A 4EN0A 3J9SA 1F4MA 2ZGPA 1GV9A 2LS6A 1XNRO 3SQOA 1Q8PA 2GP5A 2Z69A 3DXUA 2Q0OC 2JDHA 1F9KA 4MZUA 3SPGA 1O59A 4B3RB 3TN91 1KQRA 2BRTA 1AYM2 5KR7A 2ZA9A 5JXHA 1QHDA 4DYLA 3J7MA 4A42A 1AXZA 2MHFA 2UXXA 4X65O 3KT7A 1OURA 1F51A 3VGIA 2D6KA 2PMWB 2VU9A 3T2MA 3POWA 4FOVA 2A79B 4LWSA 4DR2B 1I5XA 2HYXA 4D6RA 5B1BB 1FOD2 1H30A 1HWYA 3OMIB 3CC7V 1AR63 4J10A 4DO0A 1Y7BA 3MDPA 4UF0A 1G9CA 5JSOA 4YPJA 1BL8A 3H8UA 4D7YA 1DZTA 1GM9A 2A9HA 2EALA 2ZJCA 4RWUA 4CCDA 1AI5A 1X50A 2KA3A 5AFBA 3CC4V 4FTSA 2X6AA 1NKDA 4WFHA 5BR8O 4HT1T 3FFQA 2GNMA 2XBO3 5LXTA 4X1KB 4N43C 2HEVF 2MK3A 5IWAB 2QGNA 4LF8B 1LKNA 1O5LA 1OCOB 5H9QA 5FQ0A 5ANNA 3LSEA 3BIWE 4QMAA 1M93A 1UQXA 3ALQA 2ZZJA 4H7MA 1UCXA 4DV1O 4UCVA 4Y4YA 3TAYA 2WNVC 5HI0A 1OQ1A 4IE0A 1RUG1 1IS6A 1MZEA 1RUJ2 4QX2A 3DYMA 3N2KA 2ZX4A 3ZN1A 4XUQA 2NN8A 1PL0A 1TMF3 4Q1PA 1JYTA 2QQUA 3ZSJA 3RJ2X 3BEHA 4IV1B 5JCOA 2XG3A 3VBSA 4RGGA 4WV8A 4IUGA 2RDNA 3LFIA 4OPHA 5EC1C 1L1FA 1K8AW 5FMCA 5CAZA 2F95B 1KUQA 3HQUA 4CUGA 3HQXA 3N36A 4UVAA 3SJQC 3BYWA 3OYWB 2VWJA 2JDPA 1CAWA 2JXAA 4LF6B 1NT0A 5CYYA 1OLQA 1RVF1 5LBCA 2H3OA 1VAVA 3LPFA 2QUOA 5KAIZ 5FLXN 5GONA 1YDXA 3AP5A 4LOSA 3V0AA 4YIOA 3B5LB 4YVSB 3FYEB 5LW9A 1K45A 4IEWA 5FPBA 2MEV2 1R3IC 3I5DA 4RHV1 4DB5A 1W04A 3K46A 1X9TA 1QLEC 2GBOA 4I01A 1N36O 4P9OA 5CEHA 4O4JA 4PT6A 1G4YB 1XNAA 3AMPA 4E4SA 1JN2P 3AK0A 3K4DA 4H55A 3ETPA 3HEIA 1D2DA 4DOUA 5GZEA 1OCRC 3JD0A 5F8PA 1AJPA 1LU2A 1OH3A 3T4DA 4B3SO 2AH2A 2OCCC 1HX6A 5JPNB 4YYOA 1GM8A 4IYHA 1RINA 2BNMA 4LK6A 4BPZA 4LR4A 1NY71 1S72V 3AP7A 3KF5A 3S0MA 4BA6A 3P32A 2QQMA 4TSVA 1C3HA 4DPNA 3B69A 3EYPA 4BHPA 5FNVA 1IG3A 4W6WA 2BSKB 3C7GA 3LSDA 1JFFA 1WA8A 5KA5A 4XDKA 1S4CA 4XE9A 2RMU2 2A6WA 2IXCA 1WCUA 1OA3A 2QQOA 5AVAA 3AYCA 5C33A 2VUJA 1MS4A 1YFUA 3FB5C 1WN7A 4CP9B 4MGQA 1AYN3 5KXBA 1TA8A 4AI2A 1ALYA 4MXVA 3PU3A 1YFYA 1ZBE1 1NE6A 4YM3A 1K12A 4AEDA 5LYJB 2J42A 3CIHA 4LEJA 4DV2B 5FYIA 1RB8G 1H1AA 2XLAA 2WNUB 2VZ3A 3HAGA 2MW2B 4MVRA 2W1QA 2P6JA 2BPA2 4UCUA 2VCBA 3T30A 3D82A 1NA1B 3MUZ1 1EP0A 5ACA1 3PN1A 1ZZBA 3VHOA 2FDHA 1MR5A 2D3RA 2OWOA 4YJ3A 4LO7A 1DZQA 2GMPA 3KT1A 3I2JA 1UXXX 1GU3A 3KGLA 1B35B 1O91A 2TUNA 1GNZA 3QBQA 2HWD1 3E83A 3O1SA 2H94A 3KVAA 2D5HA 5JZGB 4MHUA 3ABKC 2Y0PA 2DVBA 4Y33A 4NRMA 4KNCA 2YIDA 1WW6A 1VR3A 1WA6X 2UU8A 5KUMA 3SPHA 1YCIA 2O1QA 2JE9A 1WLWA 1IXBA 3RYHA 3ZHQA 2YU1A 5C9AC 4DW1A 1NVPD 3UM7A 5A9GA 4HN1A 5BNPC 1UOFA 1QNYA 1YFWA 3ILRA 4GYCB 5HCFA 3THCA 2VZVA 4P2ZA 2WN3A 2DVAA 1X8EA 3VHPA 4JGSA 1W6QB 2D44A 4NIHA 5C8CC 1R6NA 4JKLA 3VDDB 1M56C 4HPKB 1EAH1 1TME1 3ZXJA 4H37A 1BEV1 2ADPA 5LZ6A 1JZ5A 3K57A 5CFCB 4Q4X1 5FWEA 1GQPA 5FR3A 5CMUA 1R1A1 1LNQA 4KL1A 5KC5A 3NV3A 1KKDA 4BQ3A 1XE7A 2YBPA 4CU8A 2R063 1AX2A 2DQ3A 4LFAO 2OUHA 2QCSB 3ACLA 1AI4A 4XIOA 3WB1A 4UXNA 2JWPA 1WPBA 2Q4SA 2DCTA 3SCHA 2Q8CA 5KHHA 5C3RA 1OKQA 1GTOA 5JMCA 1NUKA 2EX3A 2C9AA 1COV2 1NR7A 4PJYA 1RM1B 2Y6LA 3ZMOA 1RPOA 4X66B 1GBGA 2PI4A 4DZGA 1YSCA 4R8HA 3K3NA 5JLVA 4AQSA 4AEKA 1CZSA 4H13B 4BU2A 1OV9A 2FMLA 2LGWA 4M3CF 5HCHA 1K5JA 1KKCA 4Y5Z0 1F4AA 2O57A 4GMP1 4IIJB 2OIEA 3U75A 1X59A 4K35A 5JIAA 3NNGA 1RHI2 1HRI2 2UU9O 1SDWA 2BGOA 4HK8A 4FPJA 1PNKA 3APBA 5LHHA 4B4PA 4CP2A 1AXYA 4F7ZA 2RR13 3UNPA 4MVQA 4XQ4A 3WXPA 5FP9A 2R9IA 4Q2FA 1JX9A 1ZTEA 1LHUA 1HIXA 2VMCA 3WQ1A 2YMZA 5CBGA 3EO6A 1KP3A 1UPIA 2CSGA 2XAGA 3TEWA 4GKJO 3ZSLA 4I0XA 1VALA 2XXZA 3OBRA 5LWBA 1I6XA 2DFCA 3RVZA 1JOYA 3LCPA 1UIKA 5L3DA 4DEVA 1E5HA 5J2UB 5C70A 2Y6FA 4MXWA 4GX2A 3OGSA 1HR0O 4YVWC 2FCUA 4JGYB 3P3NA 1POV0 2FCTA 4U3JB 1U5YA 5IY5C 2VBPA 4AHXA 5K1PA 4D3WA 2JG9A 1YTFD 1COWG 2OIGA 1FD9A 2Y69B 5FOJB 1E79G 4LORA 4KBBA 3O0VA 2ZGMA 4LFBB 1VBC1 3WR0A 3Q9OA 2YIAA 4MW8A 3IAYA 2Q5ZA 2X0LA 3HT1A 4GXLA 5IJ9A 5FXXA 2ZGRA 4XFBA 3NNMA 4IEQA 2E51A 2VQTA 2WT0A 1OCZC 2EXIA 2R49A 3O1TA 4LPLA 1P49A 1SLAA 1VF7A 3CS5A 4CCKA 1ZBA1 3DXTA 5IVYA 3R0RA 1JMKC 5FL7G 5KMGB 1Y9QA 3CPWU 2NMNA 3IPVA 3I7DA 4GH4A 3GZUC 5K0UC 2YXHA 2ZGOA 2ZXQA 1GNYA 4LKDA 4JV5B 4WBNA 2G9GA 4AYUA 3POSA 2X6BA 4DR4O 5IE9A 1XPWA 5LEJA 4CDWB 4K0KO 4TZDA 3HKEA 4RUFA 5FYZA 1REFA 4NHMA 4XMIA 2YG0A 1PO22 3CJIA 4FT8A 4RR3B 4W8JA 2YIBA 3N9NA 5FZ7A 4MO3M 3LDCA 3T4HB 3SJAC 4U3FH 2EXJA 2WIIB 3OUSA 2BV4A 4NHXA 1XXNA 5SV5A 5AFEA 4YY3B 5D8AC 2QDNA 4DR6O 4XEZA 4K1YA 4P02B 3OTOB 3AMQA 5FCCA 2HWB2 5FYMA 3LDEA 4JI6B 2RVAA 5ABJB 1K3IA 1US6A 2UXCO 1RHI3 4EFEA 1XB9A 1R3JC 4XFIA 3J8F1 1PGSA 5FV3A 5ABJC 4XDQA 3W7WA 3BRCA 1SQ4A 2OS2A 4NIGA 2LO1A 3CRRA 3OD0A 4AWDA 1K3EA 4WFAV 2WWSA 2YV8A 2R0FA 2V5DA 2JECA 2Z5WA 3ASOC 2ZNIA 1SFPA 1XNTA 4IEOA 4B08A 3F7VC 5LRSA 1HB1A 5FJHA 4RQFA 4CCNA 2WLKA 2FZ1A 4LO8A 2OKXA 1ND3C 4QPKA 4RN5A 3QOPA 2DJVA 4J9YB 4FLZA 4NMIA 5LHGA 4EYUA 1ZL8A 4JI4O 1CEZA 1X33A 4NXMO 1WCKA 3RYIA 3OM3B 4F6RB 2P4VA 1SMVA 1VBA2 3HR9A 4DUZO 5B5EZ 4D69A 1VQ7V 3CYOA 4I3GA 2HEPA 1Q5OA 1RGSA 5FP4A 5A3LA 1D4M3 4E8DA 4WFBV 1NOVA 3VBOC 2VW1A 4YG3A 2YSUB 4CCCA 4I9QA 2CDYA 2Y4TA 4LC1A 3ABLB 4MOAA 2RN9A 2WS91 1GZ9A 2ZX1A 4WF9V 2WLQA 5A7WA 4AILC 3CQOA 3HPLC 2DWRA 3VBFA 2AZ2A 1QKQA 3WV6A 1WW5A 4KGGA 4Z92B 2QBXA 2R70A 4LLOA 2XBO1 3DYPA 3DXRB 2JRIA 4PCRA 1GMMA 4PA7A 3POEA 3RNSA 1BT8A 2DVDA 3ZXAC 3OPWA 2VXRA 3TGUH 2VZSA 1UO9A 1BE3H 1IVSA 1UW8A 2WAOA 5C8YB 3W20A 4DUWA 1M4WA 3FX3A 4JAUA 5DXDA 1O9GA 4FOYA 3UL2A 3MIBA 5C3PA 3KF3A 4KU8A 5A6XA 2P5OA 1GZCA 2EJRA 1P7GA 4P08A 1UX7A 4CH5A 2YGLA 4OZXA 3DPRC 4JI1O 4IEXA 4M0HA 1CWPA 4JTCB 1HXS1 1MABG 1W8ZA 4PQ9A 2E33A 1KECA 1UZVA 3BI3A 3VBUC 2D6LX 3BB6A 4BLJA 4HMZA 2E32A 3I97A 2FD8A 3RYFB 2Z79A 4N53B 2NM1A 3QG5A 1G7YA 1GZWA 2Y38A 1H8TA 2IW5A 3LFMA 1ND2C 4XUOA 3T1CA 3BKZA 4AAPA 1TUBA 2P06A 1YQ2A 2C5DA 4KI5M 2VGDA 3P1IA 2VQUA 4H2AA 3I2OA 4OHXA 5T52A 3K48A 2RDSA 4JTNA 1MS1A 4AQYO 5JOXA 3R4UA 1JZ7A 4DRXB 2XKPA 4FFBB 5A3PA 2CU5A 2HKXA 1DBNA 1NH2B 1IOAA 1NCRC 4IDZA 4DR2O 4RQEA 1YF2A 2K9PA 3K3OA 2OT5A 4QGLA 3RYCB 4I3PA 3A0NA 3ILNA 2FDKA 5BNNC 2VQFB 2ZT9B 4RQPA 5LGUA 3VD4A 3VBHB 2CDPA 1VRH2 2Y0OA 1VQOV 1W06A 4K9SA 2R041 3K5MA 2Q67A 3P3PA 3ZKYA 4JYCA 4LIVA 5J1XA 3CC2V 1OJHA 4GJYA 5IWAO 2QQPA 4LO6B 4LF8O 4QNHB 3FJSA 4HBNA 1FJGO 1Y43B 1WW7A 4DMIA 1V70A 5KAFZ 4YJ2A 1AYM1 4WM7B 3JYCA 2EJ7A 1AR92 1G1XB 4FPEA 5F39A 2XWBB 2R072 4BK5A 3KZ4C 1US2A 1Y74B 4GAZA 1VARA 5IT9N 3OGGA 4BMBA 1AR82 3VL8A 4Y1XA 2V5YA 2QWRB 1IG0A 1W0KG 2IXJA 4MGKE 2VZUA 4XHBA 1FPN3 4GKKB 3CJHA 3PTRB 4AI8A 3ES4A 2P3YA 2PYJA 3JCIA 2DCKA 2BTOA 4QE9A 1OF3A 1W03A 4XAEA 3ZXDA 1NYWA 5KHGA 2GH8A 2A1XA 1O3QA 4GWMA 4PELA 3KV4A 4ZIBA 4C0HA 2HBTA 4KMQA 4YLZA 1FNYA 1RUC2 4CS4A 3U14A 1FMD2 2DW4A 4B1LA 1KGYA 1V54B 1NCQB 2WSUA 3T09A 1TVKB 1JTZX 1R3LC 3M3EA 3I59A 2R9RB 3URFA 2C2AA 2X53S 4JASA 2VMFA 3RFRA 3USUA 5CA3A 2ZHKA 4CCEA 3AYEA 2PHWA 3B8NA 1VQLV 4B29A 2FZ2A 1ZAUA 4O2BB 4IEUA 4QPGA 3Q8FA 2WDBA 5BMVA 3K4ZA 3WQBA 4ISQA 1UKGA 4QB2A 5JI7A 3O1PA 3HKDA 4DV6B 2XAHA 2WAAA 1RUJ1 4EN7B 2VE1A 4CEWC 3SYCA 1VRBA 3ZRWB 4GD4A 3IDAA 1VIBA 5IVVA 3Q8AA 5J37A 4O7XA 1KS5A 3GHNA 5EXOA 3FWEA 1IHMA 1PIV3 4I0BA 1QOTA 1ZM1A 2RQ6A 4P9WA 2GP3A 2WN2A 1QJX2 3NRUA 3ETEA 3DYOA 3WCRA 3S3WA 3P5BA 5JOWA 4KP4A 3F2ZA 2ZX0A 1OSGA 4QGMA 3ZHUA 3LSQA 4M00A 3H7YA 2UWBA 1J95A 4XJAA 1AR1B 2XWJB 2JDNA 2OW4A 2GNBA 3AG4B 4XDJA 3EFFK 1N1YA 4A7KA 1YI9A 3QVNA 4MYEA 2ZABA 3M3IA 1V6MA 2IXIA 1QDCA 1QY4A 1N1VA 2OZ6A 1IPJA 2B9ZA 2QKSA 5A80A 2GV9A 4GUNA 3WG7C 4GB32 3MIHA 1OUXA 2Q68A 5FYVA 4DY3A 1W0OA 1ULEA 4W65A 2VH9A 3MI8A 1W8OA 3I8TA 5LBFA 2NN4A 4IV3B 3DTUB 5EQUA 3AG1B 1UYPA 5JJNB 4DR3B 5TISZ 4TOIA 2CGOA 1L0LH 1CAVA 3L9JT 2WO3A 3W5NA 3K75B 1H2SB 4GJZA 1W2TA 2H6CA 3D3AA 1K5SA 1BQPA 2YPJA 1CD3G 2W0FC 1YJNV 4DV4B 2WLIB 2JDZA 3OOXA 2VQEB 4N90A 3AZWA 1ROPA 4JHZA 2UY8A 2R073 1QQP3 2RMU1 1S5LZ 4OI4A 3FBYA 2XJVA 4LBQB 2PQQA 4BB3A 5FUPA 4K8FA 1M90W 1J1LA 2OYZA 2OQ7A 1KITA 4YFWA 4H44B 4DW0A 3O9OA 5A1FA 3T4ZA 2A75A 4UBHA 3J81N 4DXZA 1K5MB 2LTNA 1PGL2 4Z1VA 3KGZA 1B04A 2ARHA 5EK0A 4YZ2A 5FY5A 3WP6A 3PVOA 4O4HA 5LATA 3FB6C 1M9NA 2RR11 3JASB 4B3MO 3RSJA 4P9PA 3A0KA 3I56V 2ILMA 1WCSA 5FZMA 3HT2A 4L0PA 4QJFB 4A6OA 3G4SV 4R6ZA 4EN6B 1UMZA 3NVCA 3ZN0A 3ZSMA 3UKTA 4N43A 4DS0A 1PMJX 2HVKC 1W2OA 4XYXA 4JI8B 3ZFGC 3TEYA 4X1KA 2TEPA 4LH7A 4DFSA 3LSSA 1AL22 1ZZCA 5BNOB 2BERA 2WWWA 2DTYA 2PI5A 2WNVA 4BYYA 3THPA 3SJCC 1GWLA 3MW4A 5DAQA 5KXEA 2H0VA 1QJX3 5FXZA 2WFF2 1RJ8A 4QU1A 3J7HA 5IAVA 2OX0A 1EUUA 1YQ8A 4ASMB 3B40A 2DQ0A 1KXGA 1Q8SA 1VBD3 4LHLA 1YQ6A 5JMOA 2X10A 2KQXA 1FFTB 2V7QG 2KD7A 1S5JA 3J80N 3E6DA 3JARA 1H2MA 1WD4A 1VQNV 2TBVA 2IU0A 3OYWA 4BIZA 3SR2C 3SEPA 3AC0A 4L99A 5GLVA 1V9U3 4GQ7A 1PO12 3H7JA 5FPZA 3Q4HA 3JZVA 4WZCA 1OVPA 1G86A 3CF6E 2JDKA 1QNMA 3BALA 1SLBA 4I5SA 3POGA 2YICA 5LXTB 4JYAB 5A33A 4IGGA 5IYZA 4S2HA 1D2QA 2EINB 3WFVA 2VMEA 5A6YA 3E6CC 5D2AA 1XOYA 1SC5B 3H42B 4I0WB 1R73A 2RV9A 1EZJA 3H1JH 4O4IB 4V1PA 4A7YA 3FL7A 1AVBA 3E8GA 2OIIA 3A8TA 2LRPA 2AZ0A 2Q7HA 1WA4A 2XOKG 2ZD9A 2IC1A 3AB0A 3ON7A 4W6YA 4LKEA 3BOWA 3ZXLA 3VD9A 4LXLA 2AHYA 3VBSB 1Q6HA 1SA0B 2BSKA 3B3QE 1DGRA 1N3QA 3IDBB 3OGJA 4AOCA 1BZWA 1RHI1 2Z3YA 4OMDA 3PUHA 4IXLA 4EKWA 1JZ4A 5I8SA 5CIRA 2F4VB 3WHTA 4PBPA 3WNOA 1LHWA 5CBLA 3T2QA 3TYJA 1KS4A 1VF6C 3WG3A 2WNOA 2NMOA 5I91A 3BCWA 2G9FA 4XJWA 1SF9A 1V55C 1S76D 4OHYA 3U78A 3JD73 2AGAA 1NLSA 5FZDA 3BAAA 2ZEYA 3OY8B 4CDQB 5EYPA 4LKFA 1KFUL 3BTYA 1L7RA 2G4IA 5FYTA 4K3AA 5JR2A 3CCVV 1W05A 1PNFA 5AVPA 2DBIA 3GDBA 4K40A 2WNUA 4JV4A 4EN8B 3GWKC 3WD5A 4LF9B 2YUAA 4IE4A 3O14A 4RSUA 1NA1A 1AL23 2XAQA 3MLKA 2KSDA 4NO4A 3I2FA 4E8CA 1XILA 3ECQA 2JEUA 1VQ4V 4NE9A 2ET1A 2GTAA 2BZDA 4D6SA 4K21A 2ZGNA 2VJXA 1WKYA 4JV5O 2RM22 4M4PA 2A73B 1HRV3 1YQCA 1YUDA 2VCAA 2XQXA 1MQTC 3RT3C 2YI8A 1W8WA 2YI9A 3L74H 1BCCH 4IL7A 5FZHA 3B01A 1JFFB 3ES1A 1ULCA 5CN0A 4LITA 5BNPA 5FZLA 2QQVA 2QDRA 1H2NA 3GF6A 2E3CA 1EPZA 4FOQA 1H8EG 2DDUA 3MW2A 1H38A 3G6JB 3LQCA 4Y22A 4B3TO 4H33A 4EN9B 1MS3A 1LOEA 4NR1A 4Y20A 4JPRA 3K4AA 1MVQA 1IZ3A 5C8CA 4P9YA 2EIJC 3ETQA 4JGZC 4JI6O 1UZWA 2P34A 1OPMA 3ABZA 1Y9GA 5J48A 3IAPA 3RDIA 1Z2GA 4QT6A 4XQDA 3X2QC 4AEDB 4YZ1A 4HPKA 1PO13 3VD7A 2JG8C 1UPGA 5JOYA 4FM2A 4XCAA 1NZ6A 5CFCA 4XUPA 4OHVA 3H1IH 5L3FA 1YXBA 3ZS8C 4K8RB 4A45A 4QQ2A 1K4DC 5IVJA 4FQ4A 5FY7A 1ZREA 4NB5A 4DV3B 5DAPA 5JR7B 2YFZA 4UXAA 3B7MA 5FBJA 2IUWA 1LOFC 4BQWA 5K9YA 4YXWG 5FY4A 4YJ3B 4DUXA 3UV9A 5JOZA 4Y1UA 3AK3A 2ZHNA 4DUYB 5FXVA 4M01A 2EIDA 1OA4A 3VZJA 1P8JA 1XNQB 1QU0A 1JR9A 1UKRA 4L2NA 4EE2A 2HWB1 4W50A 4BH9A 3SKVA 3T0DA 3VOUA 4YW7A 3THTA 3RYHB 4V2WA 3K5OA 1U5XA 1V6IA 4JI3O 5L73A 2E7QA 3AZZA 4LULA 3RJRA 3HQRA 4Z8BA 4AGVA 4PV1B 4MX3A 3G80A 1RUI2 5FO7B 1WZXA 2I07B 3U11A 3A23A 1PVXA 2EXKA 3ZYIB 4DV5B 5DMYA 4FSJA 5A3WA 2YU2A 4OGQB 4JI5B 2GC0A 2X8KA 4J42A 2GC2A 4DRRA 3RWNA 1S5HC 2PHTA 1UY2A 1H6XA 1VBA1 5F3CA 3R05A 4ZZ5A 5EIYB 3G67A 3ZCCA 4XZUG 1ASJ3 1HB4A 4MVSA 3SEEA 2VM9A 2HG5C 2QTWB 3ACGA 4Q4V2 3ZYGA 3S5AA 4KUMA 2ARBA 5EHDA 2ARAA 5CFDC 1OFSA 3FYIB 1WLDA 1KJRA 4RS5C 4NTWA 1KYOF 4N9IA 5JJEB 1YI7A 4Q5OA 4UCSA 3G71V 2BBAA 4X62B 5FPVA 3RZJA 3FLRA 3TEZA 4MVZA 3OB8A 3C7FA 3B9IA 3U37A 3ABUA 3JQWA 1BSMA 1V00A 3J26N 5IWFA 2XAJA 2XJRA 1G8MA 5I93A 5LRRA 5DDJ2 3WDWA 4QQLA 4P9LA 4AVCA 4CBCA 4XUTA 2SLIA 1Q90D 4FK5C 2D7FA 3TEXA 3ROUA 4U3JA 4J7KA 3I2GA 1MOFA 3W59A 1J3RA 2QM8A 1AVMA 5LEKA 3DN7A 2WQZC 5A6ZA 3M8AA 1Y3TA 3KD4A 2VQFO 1TNFA 1X9PA 1NLQA 3IBMA 3N3HA 1FS0G 2Q1ZB 3MPPG 2NNUA 3KHBA 4LF5B 1OZ0A 1H6YA 3HWJA 2NP0A 1DU3D 1UY4A 2R7EB 4OXSA 1DYPA 1WB8A 3RG0A 1SLIA 3S5QA 1JZ6A 1C8NA 3WNXA 4E2LA 3RVYA 3DKWA 3MHZA 1QJEA 3RVHA 2HVJC 1ZRDA 1PNGA 3UJQA 4DXSA 1ZA4A 1K33A 4D94A 5K0UA 4FVMA 3I49A 5T5PA 4QKNA 1H9WA 1W3VA 4C8DA 1XL6A 4I0XB 3L2HA 2VXJA 5KMGA 3IDCB 4XQWA 4LBKA 1KU9A 2XLGA 3HD8B 3FB7C 1AUYA 4FLTA 1FXVA 4I09A 4CDWA 2W39A 2IXLA 4GKKO 4MXWB 2UY9A 1GK9A 1SS3A 3JSLA 2JK5C 4X6QB 1JA8A 1WCQA 3H01A 1AI6A 4XF0A 3CCLV 3WF0A 5D8AA 4TTGA 4FTEA 1R083 4XC9A 1LU1A 4IE7A 3OD4A 1VRH1 2NYYA 4JDNA 3N2GA 1W9SA 5T55A 2PHFA 3JD3A 1UX6A 3VD5A 4CU6A 2JG9B 4J41A 1I08A 2JDIG 5ABJA 1QXJA 4TXWA 5BXXA 1BHGA 2KM2A 3OMNB 2QM4A 4TLGA 3NNJA 3ZO0B 1DFQA 3F5TA 4LF4B 1AR91 3ZN4A 4FZ0A 3C2UA 2RS32 3O0WA 4QPIB 5LP6C 2R071 2KG7B 1QQP1 3LEIA 1LJ7A 1AR81 1G9DA 4ZOLB 4DO2A 3H1MA 3BVOA 2BFUL 1JJ2U 4Q0VA 4ZU7A 3STLC 1KQSU 1RVF3 2AENA 1PMIA 4Q0PA 1GH6A 2YPDA 4BQ2A 4CH4A 2QKCA 4QKDA 3AG3C 1DG6A 3KQ4B 1O4TA 3Q8CA 2WAMA 4YSFA 4FP3A 1HDJA 4ZI7A 1GICA 1OQEA 2R30A 2W95A 1FAFA 4WBNB 1Y6XA 1BVP1 4RD7A 2A3WA 1POV1 1IQAA 3ZYFA 1IBMB 1QJU2 3HKEB 1RUC1 4KBZA 2EULA 3UO3A 3IM0A 3VBOA 1ORQC 2K1EA 4QM8A 1FMD1 5KUKA 3I2DA 1UU4A 5FPXA 4TV9B 3KCCA 4NUBA 2HWC2 2VZ1A 2XQRA 2BCCH 1BYHA 1S1AA 4UT5A 3OEEG 1R64A 2D6OX 1YJWV 1QVFU 1XQ8A 4I4TA 1JU3A 2VZTA 3PJSK 1VQ5V 5IAXA 1VMHA 2R1BA 4FQZA 1UU5A 5LCWL 3DXRA 1WBFA 4WFEA 3PVBB 3H8RA 4MT8A 2DYRB 2J1RA 2KB1A 3CLPA 2WA4A 5LK7B 2EF6A 1ZNPA 1W2NA 4X88A 2OQ6A 1JW6A 1H8HG 2UUAB 1MMMA 3ZRXA 2DWEC 4DR3O 4MGTA 3DPRA 2XTAA 5EZWA 2RCVA 1QJX1 4HN0A 3H9AA 5EBLC 2W94A 4FLXA 4PIXA 1FXKC 3VZKA 1W6NA 1HNZB 3FBMA 3I55V 1Q8QA 2O0OA 4X20A 1ZL8B 4DV4O 4KWUA 2VQEO 4P5HA 1RUE2 3AP6A 4HSJA 3RI9A 2VVEA 2LQTA 1RUH2 2Q6AA 4DK0A 1ND2A 1GP6A 3VZNA 4HL0A 4LF7B 1WP8A 3M7MX 2BP6A 2P90A 3O1RA 2CTVA 3HNMA 2ZDIC 4DK1A 1CQ9A 4AI0A 1SLTA 1XE8A 3A22A 5ACA3 3NO8A 2X09A 2P5BA 4YFZA 5IATA 3EJKA 1Q3EA 1NCRA 1CZVA 1SKVA 3VBRC 3TETA 1J84A 4DQAA 4HANA 5IW0A 4J11A 3QD6A 5EYYA 1STMA 1XI1A 3VBFB 2QM7A 1R092 4RAIA 4UW6A 3GZAA 1C5IA 1J5EB 2JDMA 5FZ8A 4AHZA 3OGVA 2DE0X 5FLIA 4CE8A 4QU2A 5JDBA 1X4TA 2VCCA 4CEYC 1DZRA 2WT1A 3CX5F 1IGOA 4YM0A 1CX4A 3DC6A 1ST8A 1JYNA 1YIJV 5C4WC 4L11A 1TEIA 1XNDA 4XBFA 4HK9A 4CC5A 4IHJB 5D1IA 3MD0A 1N33B 2RS12 4JI8O 4UW4A 2J1SA 2BJSA 2ZZQA 3WNNA 4XABA 3BTAA 1TME3 3ABMB 5FMBA 2V72A 4QX3A 1LGNA 1UYXA 2R6QA 4WM7A 2PHXA 1BBT2 3FHAA 1GZWB 2D2CB 3NQHA 4JKMA 4AZZA 1H8TB 1W6PA 5FKCA 1PGL1 1Y74A 4R9DA 3LIGA 2ADDA 1TUBB 2KKWA 4B4RA 2WWJA 2VS0A 2QTSA 1SETA 4KGQA 3P30A 3VKFC 2P37A 1ZZ9A 4CUCA 5IYYA 1WGPA 1DF5A 1UOJA 1AX0A 4ZXEA 5F1RA 2BNNA 1E1QG 4LFCB 4X8NA 1OCCC 2WZR2 4CUBA 3CZJA 3L2YA 4HZ3A 1GQHA 1URXA 1AR72 4P00B 1AL21 1MSDA 2EILB 2PQSA 2QA4V 2RS52 4O2BA 4LBJA 4OI2A 2XJPA 4CEWA 2A6YA 2JEXA 2ZHMA 3FZ3A 3WW2A 5T5LA 3K79A 3N9PA 3NKGA 3SCFA 1CVNA 1GZTA 2DUQA 4YRDA 3ZFEC 2IFRA 3MZHA 4CA9A 1CPNA 1EZVH 3ZRWA 2B5HA 3J4UH 1WB7A 3D5OA 4YJ2B 1CPYA 3THOA 1VBB2 2WO7A 5BUVA 3M3CA 5FZ6A 3ML0A 5CA1B 1WJZA 3I3MA 5FYBA 5B3SB 3IC9A 3ETDA 2HWE2 3BPZA 4JQRA 4AQ2A 2E7TA 2QKDA 3CE2A 2VPVA 4K8XA 4HYOA 1E1RG 3JALA 3E8BA 2L6LA 3OF1A 4DV7O 1PO11 1REEA 3QO5A 4F8AA 1BMFG 5C5UA 1AJOA 3SISA 5KBFA 3B2EE 2B1GA 2LJ2A 4AK3A 3N9OA 1U96A 2F23A 3KG2A 4DRVA 4MTFA 4BW9A 5FMDA 4XDOA 1F8VA 1VBE2 4XCBA 4W4KA 3ILFA 2YUEA 2C26A 5HPOA 2LW7A 2IU3A 4BCUA 4NRQA 3VLBB 3I59B 4JYYA 1PZ8A 1GRJA 4ORFA 2JX9A 2YXYA 4CXWA 4NIDA 2UURA 1HDKA 2YC4A 2IZWA 4QPGB 4AQ6A 5BV6A 1LR5A 4H7LA 5BMVB 1OF4A 1QU7A 1I9RA 2JS3A 3OR6C 4ISRA 5IDJA 3SITA 3ABTA 1UU6A 4LE3A 2G9ZA 2HH9A 5E8AA 5DZGA 4TUYA 1YYNA 1BBT3 1MVEA 1M1KW 2BGCA 5IYBO 3M8LA 1W28A 4CDXC 3GJBA 2PHDA 1XREA 4M3CB 5LMUB 2HHHB 5A32B 2JICA 3VDAA 4NHLA 3EMRA 3POFA 4QX5A 1R1ZA 2UUBB 5EWSA 2ZEZA 4KH9A 4HKOA 4YZ4A 3ASNC 3H9VA 3AX4A 5JCTA 1W8NA 2BQPA 3KLSA 4XAAA 3OUJA 2YC0A 3WF3A 1QJY2 4OPAA 5EYXA 5IJ0A 4F6EA 3E8FA 1W99A 5F3EA 4PA9A 1F5JA 4L92A 3R65A 2JDUA 5GJ6A 1K5MA 5JCOC 2JGUA 5C7GA 2AXTZ 1VF5B 5FY8A 5CB4A 3HBKA 3CU7A 3OEAA 1S0JA 2JKBA 3MAQA 1JZ3A 4D8MA 1ASJ1 3SYPA 2Q8VA 4EJRA 5L3GA 5A70A 3RYRA 1YXWA 1OUSA 1TG7A 4Q26A 1RL3A 3ZFGA 3C3SA 3LAGA 1UAIA 3K9SA 2F4LA 2RM21 4SBVA 5FFOC 4DR7B 4DV3O 5JSPA 3ICXA 3FUQA 1ULGA 2PAKA 3J8F3 1PGW2 1D4VB 2DCYA 2WRAA 3ZFFC 4YHHB 4DUYO 2IH3C 4AHYA 4TWKA 2W87A 1PVC2 5ISLA 2X5IC 4PF5A 4JVAA 1MACA 2JB8A 5H9SA 1XNQO 1B09A 2Z5UA 3LE0A 4IL6Z 2E26A 3CSXA 4YW1A 3Q8BA 2WLLB 1NVPB 2PLV3 1QWRA 1S55A 1QXPA 2WYFA 3C7HA 3B9CA 5IYCO 1NZCA 2LUWA 4O4HB 1F23A 1VBE3 2UXBB 2OUJA 2XLFA 2BOJA 5LMNB 4K7JA 2H0BA 3TN92 3AJYA 2Q9LA 1W9YA 3AG2C 5GZCA 2WS93 2V73A 1P4RA 3D36C 2XGXA 1PM9A 4N43B 2XB6C 3ZKUA 4QPJA 3M3QA 4FFIA 4QWNA 1VMJA 2J1UA 3TOJA 1ONAA 3OEHG 4YW4A 3U1XA 2ZXWC 4GMP0 4FP2A 5FXWA 1QR8A 1ZWIC 3F5WC 4I2OA 5L36A 4XHXA 1NKGA 4QXBA 2D6PA 5JAXA 3THDA 2RJLA 2WNVB 4V2VA 3OG2A 4GZRB 3FFZA 3ZMSA 1WD3A 3GBWA 2BWAA 5DEDA 2JJ1G 3BPSA 3CL1A 4O4IA 5D5PA 1R081 5GTIZ 5IHRA 3T1HB 1PV0A 1J58A 3AMNA 1XMQO 4I9WA 3AG7A 1HXS3 4A5UB 1W2AX 5C8WA 4NJ4A 4X62O 2BDRA 1XNRB 1RUI1 4UB6Z 4UBGA 4MS2A 4XOGA 4IE5A 3CBNA 5LL6Y 3V65A 2GAUA 3SPCA 2AGSA 3TXSA 1SA0A 3WQ0A 5JIUA 3VQVA 2Q1FA 3IKWA 3C3TA 3JARB 3MBWA 4X65B 3BOPA 1RUG2 1DQ1A 4ZZ8A 1D5AA 5LA6A 5AG2A 1ZX3A 5EC2C 4A3ZA 3Q8EA 1HQLA 2E9QA 2W92A 2NQYA 2ZPXA 2M7WA 4LBLA 3Q4HB 1XU2A 4COZA 2H8PC 1T6BX 3OY8A 4CDQA 2Y6HA 1QLEB 4Q4V1 4A41A 3OTFA 2V09A 4LF5O 5A1LA 1DGSA 1AROP 4P9XA 4BZ4A 2HJIA 4F83A 5A33B 2YGMA 5IYZB 1AJQA 1OCRB 2B9UA 5GLTA 1SHWB 5GLZA 2Y26A 1Y66A 5IVFA 2C4XA 1A8DA 2HBUA 1MA1A 3PUQA 2OCCB 2GHYA 2IWGB 4MGIE 4GULA 5T54A 2BOBC 3CCSV 1IKQA 2Q73A 3B4SA 1WAZA 1W6OA 1QBZA 2R043 4KWKA 4U7NA 4WZFA 1XSRA 4IGPA 4DV1B 4RHV2 1A78A 4PBOA 3S7IA 3D8CA 2ZINA 2E7AA 3LIHA 2XJTA 1C1LA 4QX1A 4OHWA 4U2AA 3RYKA 1AYM3 4CZSA 2PELA 4FAGA 5LY2A 3K03A 3ACIA 2P3JA 2WT2A 1X7NA 4JGZA 4MVOA 3BHPA 4JKKA 3U07A 3SYAA 5IK5A 3WT3A 1AF9A 5L3BA 1YTFB 1FOD3 4JX0A 1P84F 3DC5A 2VC9A 1N1TA 1PM7A 2WO1A 1MZFA 3DSQA 5JWPA 1X36A 4CXYA 5C5TA 4QB6A 4YGBA 5EYPB 4TYSA 1H8VA 4ATFA 3MIEA 4LF4O 1D0HA 4C0BA 1VQKV 4FPCA 3UESA 1BCXA 1MS8A 1DK1A 3UKVA 3ZVXA 4XFCA 1L8DA 1SLLA 3ZHRA 1LOFA 2ZAHA 5J7MA 3ZN5A 1N36B 3J7AU 5J3UA 3O1OA 3RN4A 5JJJB 4MV2A 1ZBE2 1CESA 1VPHA 2PAMA 4ZU5A 4AFCA 3GJAA 4RFT0 1BVVA 2ZTNA 2EIKC 3ABKB 4OX9B 4YW3A 1NTKH 2JENA 3OAAG 2CK3G 4WVWA 1G6NA 4J7ZA 1JOPA 4YNIA 2XT9A 1RUJ3 1F2NA 5EPAA 5FZ0A 1YQ5A 3RQ0A 1U5ZA 4JI7O 3CMAV 3LA7A 1TAEA 4UWDA 5C9AB 2O8OA 3UYJA 4PA4A 1SBDA 2GDSA 1KD1W 5BNPB 1MS0A 3FD9A 2K2SA 4QHBA 4ES9A 1XDCA 4FPFA 3GBFA 4UFKA 1DGWA 5F5AA 4Y22B 4Y20B 4UI9L 2HWD2 3ZLIA 2RS31 5C8CB 4CVUA 1RUD2 1M56B 4G27B 1GFF2 4HNAA 4I30A 3UK9A 1AP6A 1YZBA 4LNVA 4CDUC 1UY3A 2A5ZA 4M3CE 1NQTA 3WNKA 2OXBA 4RL7A 1B6QA 3S57A 4QDSA 4UW5A 3QTCA 3V56A 2A7AA 2UUAO 5H2FZ 3OFNG 4EWDA 1LENA 1W9TA 2MEV3 3I4IA 1IURA 1RSOB 3L71H 4XDPA 1NG0A 3ZXKA 3M70A 4O2AB 4AR2A 4IW3A 1QJU1 4NIIA 2YY1A 2E5LB 5EIBC 2WQ4A 1XYOA 4QPYA 4GX0A 1EAH2 5L7OC 2OCHA 3FE5A 2EAAA 1BEV2 3ZMNA 5F3IA 2HWC1 3POIA 4Q4X2 4RS5A 5LGNA 2DN9A 1H9PA 5FYUA 1C4RA 1R1A2 3OBAA 3R4SA 4H14A 4GH4C 3MHSC 4EB6B 5LB6A 3FAVB 5AC92 5CVRA 4BIOA 2OZJA 4XXPA 1O5UA 2FBEA 4NTXA 3HKBB 1LB2A 3UT5A 3GZEA 3KS7A 5E89A 1GN6A 4Q20A 3MIGA 4R52A 1OVSA 1VAMA 1PL4A 1DLBA 1WLEA 5EZYB 3CJIC 4NROA 2D3OW 3RMYA 2RMU3 4AFMA 3NNFA 3E5UA 2AW9A 5LA9A 5H9RA 4CP1A 4XF3A 4Y26A 5CZKA 3WVJA 4AVTA 2GMEA 3ZMTA 3VL9A 1F4HA 1XYNA 5BY5A 2JE8A 5FREA 2QQLA 2D93A 1BKZA 4CXXA 4FPYA 3RI8A 1BXHA 1RUH1 3PJQA 5DN2A 2JS5A 1WP7A 5DAXA 2WUHA 2B7YA 4AGRA 5FO9B 3OSDA 2J1EA 1S2KA 4IEVA 5GZGA 4GIQA 3WG4A 1JXNA 3K08A 5EJ1B 5CA0A 5A3OA 3PVEA 4DV0B 3ZYPA 2E31A 5FMOS 1DLLA 4ZS2A 3GM8A 4YVWB 3NWKA 4D6QA 3IIIA 1C8M2 2B39A 2DBNA 5CU1A 2XHBA 4I50B 4Z2AA 1V0AA 4J6GA 2DTWA 4RGKA 1WWYA 2W2IA 4XJ9A 1GM7A 1OD5A 2P4KA 3PIGA 1JOBA 4EEQA 1GMGA 3INAA 5IY5B 1G6UA 2BEOA 1GSLA 4B7EA 5I0UA 3WW4A 4LFCO 4COYA 4FIPC 2RS11 5CKQA 1EYBA 3MDSA 3G6EV 1SQXH 3AMHA 1I1EA 3NAPC 5FYYA 2E75B 2JIZG 4MTXA 5H9CA 5DUVA 4LLFA 2UU9B 3H8OA 1OCZB 1BBT1 2A06H 1IS4A 4WM8C 4I7ZB 1QIQA 2A6XA 1W0NA 4QPIA 3AL6A 3CEIA 2KG7A 2GSMB 4Q4W2 1LHVA 4ZOLA 3MICA 3LPGA 1XQNA 5CKMA 3CCQV 2GC1A 5K0UB 4GLXA 4E4ZA 2B8MA 3ZR6A 3WW1A 1VBC2 4CTEA 5FZEA 3RZZA 1UFIA 4I0AA 3S30A 3RS6A 1UYYA 3KCYA 5I0TA 3VZOA 1UN1A 3VUOA 1GOHA 3RYPA 1I94O 1PPJH 3WY6A 5LHIA 2XOMA 1V6OA 5A7NA 5B2GB 3K5LA 1COV3 2WZR1 5AC93 2A3QA 5FRAA 5IYDO 3WUCA 2ZR3A 1ZBA2 2VZOA 1Y76B 4NHKA 1Z78A 5KXDA 4TV9A 1AR71 5D8AB 3TXQA 2XASA 2EICA 5FLHA 3J7LA 3N2GB 4X1YA 1UYZA 2RS51 1URFA 4MLOA 4NXNO 1WBLA 4XXAA 3J7NA 2QWOB 3VKNA 1NXMA 3AZXA 1R3KC 4BQYA 5A3MA 3T1YB 2FDGA 2LP7A 4FLWA 2CNAA 5KXCA 3NJXA 4AEMA 3VDBA 4GWNA 2DUOA 4OLLA 4LNUB 1HRI3 1OH4A 4UCOA 3T2OA 2EIEA 2GSYA 1G9AA 3ASOB 1HKDA 1PK6C 3N4MA 1US3A 1ZRFA 4GZ9A 3RWRD 4RQPC 1VEWA 3ELNA 5FAXA 1JHJA 3X29B 3KHCA 1ND3B 2UXDB 3O5SA 5EIBD 4XFHA 2GNTA 4ASKA 3CP1A 1LODA 5J98B 4MVUA 3MFCA 4PDRA 1DHKB 4OVEA 2PLV1 2N05A 4ZI7B 1MS9A 2PAEA 4NVPA 5DPNA 1HP8A 2P67A 1N4CA 3CWBH 2IJHA 1TGOA 2GUZB 2ZDIA 2ZGKA 2QFEA 2WFPA 5LMUO 2VOXA 3VBOB 3ENRA 3BY6A 2DYSC 5DG2A 4FLUA 1H2GA 1Q6IA 1VBE1 4QGPA 2DU0A 3VKMA 2ZIMA 4LKSA 4XF9A 3VBRA 4K8ZA 5GW7A 4N9HA 1V9PA 2PHRA 1XRUA 3JATB 2C6SA 4YGCA 4RFRB 2VMIA 1AI7A 3IJ4A 3MF6A 4I4TB 1TVGA 2E63A 1OT5A 3OGCC 3WF1A 5JSRA 4PQQA 4WVMA 4ET7A 4O9GA 1O7FA 4CEYA 1SFNA 3POYA 3H1HH 3SCGA 1YRZA 2J7MA 1FKAO 4NAOA 3ZYRA 4UUJC 1AR62 4CCOA 1EUTA 3ZM8A 5C4WA 1OOPC 2N74A 5LOVB 4FFKA 5FTTC 1AR5A 4D0QA 2P3IA 4OYUA 5M0TA 3K9AA 3NJVA 4MW3A 3DPRB 3KKYA 3VV1A 1OMIA 2YXSA 4IHJA 3HB3B 1OA2A 5H6QA 3UGGA 3VBUB 2Q8EA 4DR7O 2XBO2 2EIMC 1W6NB 4OHZA 5FPRA 4XBQA 4GCZA 4X20B 1W8UA 2VO5A 2AR6A 1RPRA 3SNMA 2R32A 3RPQA 4ATEA 2IH1C 1F15A 3VD3A 4XUNA 3MHHC 3UGHA 1ND2B 1LTEA 4A6SA 1S0GA 5J36A 5LY1A 3DECA 4BK4A 1MZ6A 3AP9A 1K92A 4PJ0Z 5FDBA 5C3QA 2DVFA 3WQ7A 2XVGA 4X9QA 4FPKA 1ULDA 3H1YA 4DUZB 5FP3A 3VB9A 4B3RO 1TMF2 4PDWC 5KWRA 1PO23 4LK7A 5JPMB 1IS3A 4P9IA 1NCRB 5CA6A 4COUA 3CRAA 4PLOA 2J22A 1WMEA 1XBLA 2WZ8A 2ORXA 4KWLA 5FLJA 5GALA 4R50A 4OCTA 2XDVA 5EP9A 1N32B 2JGDA 5F3GA 5H5NA 4LOTA 1DLCA 2XHKA 3G6BA 5BNNB 2HWB3 1F4NA 5LMNO 2CL2A 2PZSA 3BA8A 2WLHA 1B3QA 1PGW1 3A21A 5B1AC 3AXDA 1SQVH 1V6LA 1RMU2 1A6CA 1K7DA 1GNHA 5B4XA 1BGYH 4BW5A 4QAWA 3L70H 2G1MA 4EWAA 4IEZA 1CIYA 3ZFEA 4N21A 5F2SA 4CCJA 5DN6G 4MGZE 4JI1B 3OMAB 5JXJA 2W5FA 5A3UA 4UVBA 1WW4A 1FPOA 2UWCA 4FCAA
chains in the Genus database with same CATH topology
3KCCA 1LCLA 4CDQC 2HWC2 1W6PB 1U0AA 1BYHA 1S1AA 5JIAA 2D6OX 3ZPYA 3ZFFB 1VBA3 3R1JA 1RHI2 1HRI2 3T2TA 1ASJ2 1SDWA 2ET7A 4HK8A 4FPJA 1EPWA 2X5IB 1D4M1 3AMMA 1FOD1 3APBA 3PVJA 4B4PA 1DQ0A 4CP2A 2R1BA 4YZ5A 4FQZA 1UU5A 3JBG2 1AXYA 4FBFA 1VBB3 1WBFA 5T50A 4F7ZA 3PVBB 1NXD1 2RR13 4K6BA 1ZYBA 1B35A 4XQ4A 2XH6A 3CLPA 3CNAA 3WXPA 1ENRA 2WA4A 2ZKNA 4FOWA 5LK7B 2EF6A 1LGBA 4Q2FA 1ZNPA 3LOIA 2HWE3 1LHUA 1HIXA 2ZKLA 1JW6A 3WQ1A 1YLLA 2YMZA 5JZGA 3EO6A 2E53A 2I2SA 1LULA 3ZXFA 4NWVA 2D3SA 1UPIA 3DPRA 4OUMA 4LBQD 5EZWA 3MPBA 3WDYA 1ENSA 1QJX1 2ARXA 4HN0A 1AYN2 3H9AA 1HW5A 1OI6A 5EJ3A 3AFKA 1VALA 4LBOA 3ZSLA 3OBRA 4PIXA 5EV7A 1I6XA 2DFCA 4JDMA 1QJZA 3WOGA 3VZKA 1W6NA 5FMOL 3FBMA 4CRQA 3LCPA 4DY5A 1UIKA 3V0BB 1WLCA 1Q8QA 4Q0QA 2O0OA 1H2KA 2EA7A 2A6ZA 2Q5TA 1CJDA 2P3KA 4CEWB 4MXWA 4P5HA 1RUE2 3AP6A 3M1HA 4HSJA 1HLCA 1S2BA 3RI9A 2VVEA 1RUH2 4YVWC 1ND2A 1LRHA 3VZNA 4HL0A 1W6QA 4COVA 4JGYB 1ENQA 3ZIWA 3VDDA 3P3NA 1CR7A 2CTVA 1POV0 1CQ9A 4AI0A 1SLTA 1XE8A 5ACA3 5IK4A 2ZMNA 4X6RB 4AEDC 4CDXA 1RIRA 1U5YA 4LBNA 3NO8A 1Z7S2 3PTYA 1LESA 1CJPA 4YFZA 4AHXA 3DV8A 3EJKA 1Q3EA 1NCRA 4DQAA 3VBRC 4D3WA 1UZZA 2JG9A 4HANA 3DGTA 4QGNA 1FV3A 4M3CA 3QD6A 5EYYA 4OI1A 5FOJB 1G9BA 1OFNA 3B93A 5A32A 3VBFB 4KBBA 3O0VA 2ZGMA 4DINB 1R092 3EATX 1VBC1 3WR0A 4UW6A 3GZAA 4IETA 1C5IA 3Q9OA 4ZKTB 4L9BA 1FV2A 5GLUA 3NL1A 2DV9A 4AHZA 5FLIA 4C8RA 1DQ5A 3HT1A 4GXLA 4QU2A 5JDBA 2QVSB 4LO5B 3NJZA 3PMEA 2ZGRA 4XFBA 2IFWA 1LOBA 4IEQA 2E51A 3V64A 4CEYC 1TE1B 2WT0A 2EXIA 1DZRA 2WT1A 2R49A 4C90A 4HKWA 3LKJA 1IGOA 4YM0A 1CX4A 4IV1C 1SLAA 4BGKA 3T1LA 1DGLA 2ZHLA 2MEV1 3LWCA 5C4WC 4L11A 1ZBA1 3SWTA 1TEIA 1XNDA 3R0RA 4HLTA 4HK9A 4LT5A 5D1IA 1QJY3 3QH7A 1Y9QA 2NMNA 1NQDA 3IPVA 2Q8OA 1RITA 2RS12 3I7DA 4GH4A 2VQ0A 3GZUC 5K0UC 1UD1A 4A7ZA 4Q8KA 4UW4A 4HSLA 2ZGOA 1ZZ8A 2ZZQA 1GR3A 2ZS6B 4Y1ZA 1R082 3AYDA 4BHIA 2G9GA 3BTAA 4AYUA 3POSA 1CAUB 3RMXA 1TME3 4H3WA 3WDVA 4CDWB 5LEJA 3DL3A 4TZDA 1PZ9A 1RMU3 1VRH3 1MEC1 1REFA 1KFXL 4NHMA 4INDA 1LGNA 1W0PA 2R6QA 4XMIA 4R9AA 1PO22 2O8QA 2JEMA 4WM7A 2PHXA 3CJIA 1BBT2 4FT8A 2OG5A 1FI2A 2VOWA 1GZWB 4RR3B 3SHRA 1EV12 1QDOA 3VZMA 4YVSC 1H8TB 1W6PA 1PGL1 2EXJA 2WIIB 4R9DA 3TWIA 2R6SA 2R062 4YZ3A 2VG9A 1SBEA 3ZFFA 3S7EA 5FO8B 1XXNA 1XU1A 4B4RA 5SV5A 1LEMA 5AFEA 3DF0A 5D8AC 2BUKA 5GLWA 1DF0A 2QDNA 2X5IA 5BYNA 5FBZA 4KGQA 3E5XA 1AR93 4XEZA 3VKFC