4B7KA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-ser peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
338
Chain Sequence
GSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 338
sequence length 338
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7kA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7kA01
3P3PA 2YC0A 5JWPA 4B7KA 3D8CA 3KCYA 2W0XA 2WA4A 3P3NA 3OD4A 4Z1VA 1YCIA 4JAAA 1H2MA 2XUMA 1MZFA 4AI8A 2YDEA 4NR1A 1H2NA 3KCXA 4QU2A 1H2KA 2CGOA 4Z2WA 1H2LA 1IZ3A 2Y0IA 1MZEA 2ILMA 2CGNA 2WA3A 4BIOA 4B7EA
chains in the Genus database with same CATH superfamily
3ML0A 2HWB3 1U5YA 2VJXA 2RV9A 3H9AA 2VU9A 3JATB 1IPKA 1DCSA 4JC1A 4XDPA 4H44B 4M3CB 3L75H 2IH1C 1SCRA 1WPBA 3KMHA 3AZYA 4NROA 3P3PA 2KKWA 4CCKA 1VF5B 2QJ1A 1AR82 4XHBA 2J1TA 3CC7V 1YIPA 2ZE8A 4Z1MG 2BFUL 4DS0A 4J6GA 2IXIA 2VNGA 5LZ6A 2ZXWC 4PDMA 2OWOA 3FZ3A 1W05A 1CESA 1AR93 1Q8IA 2YIBA 2CY6A 5EYYA 1GOFA 3ZKUA 4GKJB 1TUEB 4D6SA 3BVOA 1TMF3 2VOTA 3RJRA 4QGPA 1M5IA 1DLBA 1YTFD 1RFYA 2DOSA 4GKJO 5C8YA 4MT8A 4BE3A 1CR7A 2JG9A 3S0MA 4NB5A 4QT6A 1OPMA 1UXZA 4AXOA 2ITDC 4JI5B 2UXDO 1S0CA 4GB32 3ACGA 4FFBA 4X1YA 4LBOA 3I7DA 5FXWA 1N1SA 1WA4A 2NLJC 2Y26A 1AR63 2PI4A 3MDSA 3TRSB 4I0XB 4ZHQB 3H50A 4JI5O 4XJUA 4Z1VA 4WFEA 3FLRA 3JAKA 3WOGA 3PIJA 1Z7S2 4AEJA 1QGLA 4XC9A 1MSWD 3WDTA 3DF0A 3Q8AA 3ILRA 5HCHA 3CBNA 1VQLV 1GWKA 5FZOA 1Q8OA 2OPKA 1VBC2 3WDXA 1VRH3 4ZPIA 2ARHA 2XTAA 3BYWA 2XJSA 2HJFC 3WW3A 1NCQA 4A7YA 2ZGUA 5A7WB 1JVMA 1V9U3 3WG2A 4RGGA 1IKPA 4UI9L 4DR4O 3AP5A 5LEJA 1RUJ2 1DGSA 3GZAA 1JA8A 4X62B 4XOGA 5C4WC 1FMD2 2JVDA 1VAKA 4E4SA 2E5LB 2RDCA 2ZBJA 4X62O 2FZ2A 5H9CA 4FFKA 1NI8A 4QPGC 5EBLC 4PDRA 5DZFA 5IK5A 5JUVA 4JVAA 4GAZA 3N2KA 5FL7G 5A7OA 3WD5A 1FAFA 4EWDA 4PBPA 2X09A 2NN8A 1FV2A 4LP8A 1G7YA 4JKKA 4AFMA 2ZGSA 5KC6A 4DV2B 5TSWA 1OF3A 3D5OA 1MS0A 1ND2B 3NNFA 1MZ6A 4RQPB 4NIHA 1Z5WA 5IYCO 3CJIB 4NIIA 4DV2O 2YFUA 4CS2A 4HPKB 3VB9A 4UUJC 2BDRA 3O12A 4WM8A 2OUHA 1VB4A 4LIUA 1ZUQA 4FTSA 4H2AA 1N0NA 2GN3A 1M56B 1K3IA 1PO22 2W08A 4PIYA 4JYYA 1K4CC 4XFFA 2GMMA 3FUOA 4QQLA 1NTKH 2VZVA 5HV0A 2ZHLA 3TBDA 2OIGA 4CCOA 3G6JB 1Q82W 2ZMLA 1NZIA 2VOXA 1OF4A 4KI5M 3KHCA 2IU3A 5A3NA 1OCZC 4HN1A 3LOBA 4FFHA 1C5HA 3VBHB 5CBFA 4Q6GA 3AG2C 1SQVH 4XFGA 5JQGA 3ZO0B 2IJHA 1QNMA 1RUH3 5IDJA 1JMUB 1HR0B 2R1DA 2GU9A 3Q8FA 4FPOB 5CKMA 1DYKA 1CAVB 1N8RW 1HR0O 5C93A 1RUG2 3ZN4A 5GZDA 4YY3O 4XF9A 1WB8A 1TME1 1VEWA 5L3GA 4QXCA 2A6XA 1O4ZA 4XHXA 5CISA 2EIKC 3HT2A 1SCSA 1H6XA 1IS5A 1F9KA 1Z0HA 2WN3A 2HKXA 3CNAA 3D3QA 3AZXA 4ITCA 2XR4A 3K46A 4O2AB 1O59A 2HLEA 1DZTA 1QY4A 2CTPA 1GV9A 1TZOA 3AK1A 3MGUA 4M0HA 2R072 3N3HA 4NRPA 3UM7A 1YUDA 2JDNA 5AVAA 4ZXEA 3CLPA 4LKDA 1R6NA 2V1DA 2VS0A 4O61A 2JRIA 3ZKYA 1RUF2 3PURA 1AL23 4ZOLB 1QXJA 5BNOB 2LUWA 3K5MA 4JI1B 4KHPB 4JGSA 4AEDC 4CXYA 2F1MA 4R9BA 1GSLA 3FLPA 1HRV1 2ADDA 2QQIA 4HVRA 4IV1B 1GN2A 2GH8A 3K08A 1THZA 4JI1O 4KHPO 1K73W 1QLEB 1XQNA 5FZLA 5FO9B 5JZGC 4OUEA 4YPJA 4KBZA 2Q1ZB 4KL1A 2ILMA 3ABZA 4AEMA 1DDLA 3E86A 2UUAO 3ZHVA 2XOKG 4FPLA 3VZKA 2G38A 3VDCA 5HFMA 1W3VA 3H1IH 3W7WA 2RS52 2OYZA 1I94B 1YFXA 1UY4A 1L7QA 2ARAA 4AW7A 3H1YA 1O9HA 1FNYA 4ASLA 4CDXC 3UKNA 3ZHSA 3TYJA 2RMU2 2V5DA 5HXMA 3U11A 4CXXA 5BNNC 1I94O 4B4RA 1CAXA 5FPUA 2VQEB 1XREA 1EAH2 1Y3TA 3POEA 2FQPA 1YSCA 1POV3 5GALA 1VQ9V 3JARB 1QQP1 2VNOA 2XL7A 2VQEO 1AB3A 1HJGA 4AVAA 4NRQA 2GZWA 1WA8B 1XNQB 1HNWB 1FOD2 1W6QA 4FTBA 4COVA 1H6YA 2VZ1A 4FP3A 5A33A 4G27B 1L1FA 1XNQO 4LNUA 3HQRA 3IDAA 5LYJA 3ZDSA 4QPIC 4GKXA 4LF5B 5F3GA 4XFIA 5IWAB 3VDAA 5FZ4A 1C1LA 1N3PA 3VQVA 1SEFA 4AHCA 3OEAA 2C26A 4DR6B 4DRRA 4GJYA 1IS4A 3W5MA 5IWAO 4GMP3 5ACA2 1BZKA 2P1BA 1N47A 2PAKA 1PL0A 3POJA 4DR6O 2JIGA 2K9ZA 4XF3A 1I9RA 4Y1YA 3WNXA 4YW3A 4XUTA 2Q69A 3KGLA 4JQRA 5E6HA 4QB2A 2WNVA 3C7FA 5C8YB 1AYN3 1RUI1 1XE8A 2ZXQA 2JG9B 5JDBA 3WG3A 4E8DA 2BBVA 3A23A 1N3OA 4MADA 4N7IA 2QKAA 2EIJB 4ISQA 4DV6B 2DYCA 5DZEA 2X5IC 2WWSA 5JJEB 4DV6O 1XYPA 1O4TA 5HXVA 4FMTA 2YI9A 1XB9A 3N9MA 1YO8A 3HQXA 2DTWA 5EQUA 1RUC1 3VN4A 3B2EE 2WSUA 5F7UA 4E27A 4J11A 1AX0A 4RHV2 2IW5A 4NXMO 2CV6A 4PDWB 5FOBB 3DXRA 3WHUA 3ZMTA 1WMDA 2WZEA 4FOVA 3RYKA 1QH6A 1VF6A 4K6BA 3O1OA 3T2MA 1SKVA 3TETA 4TTGA 1FXZA 5AVPA 2D98A 4CP2A 5EJ1B 4HETA 2UXCB 4GWIA 2OS2A 3AK2A 2JXAA 4LCUC 1RM1C 1JYCA 1FATA 2WZR1 4FLTA 1V6KA 3B02A 4IEVA 5T50A 3JALB 3N2KB 2UXCO 2CTVA 5LA1A 1SLBA 4MVTA 1O3TA 1BCXA 2QSAA 3B8NA 5CA1A 2H3OA 2DBIA 4QKBA 4LBQA 4J7JA 4LH6A 3VKFC 3LDBA 2GNTA 4I3GA 3ZXDA 4MV2A 4CEWC 3ZFFB 2F6BA 5T5JA 1W9WA 3ABUA 2ZDIC 4QIWF 4U36A 1FFXA 4FT8A 2VZUA 1KITA 1K42A 3J8F2 4XBFA 4WM8B 5BNPA 4DR2O 3HNBM 3RW0A 1VBE2 2WYSA 3AK3A 5JVDB 1UYPA 2DN9A 1UY3A 3J26N 3WNLA 1N3QA 2IUWA 2A79B 3QVNA 5A3MA 5LHGA 4X9QA 4DV1B 5LCWL 5FK7A 3E8FA 1W90A 4MHUA 1H8VA 2Q5ZA 5J2UB 4TSVA 2JEUA 4DV1O 1VQ7V 4DR5B 5JQGB 1K5QA 4XFBA 3VKOA 3S3WA 4FAHA 1RVF3 4YLZA 4DOUA 1PVXA 1ZVFA 3V56A 5L3DA 1KC8W 3AVRA 1LODA 4DR5O 3IZOA 2QWNB 4JI8O 3ETPA 4AVTA 2F4LA 3OPZA 2CGNA 1J58A 2HJDA 4QQOA 2W52A 2J1SA 5EIBD 3JBG1 1VQ4V 3C2UA 1KXGA 1OKQA 3APOA 2P67A 4LF8B 2DW4A 3LFIA 1L7RA 1HRI1 2BQPA 2EIGA 2CWSA 4UCTA 5CKNA 4ARXA 4LF8O 1WW5A 4AI8A 4D3WA 3BTYA 3UCSC 3M8LA 3JAWA 3AZZA 3URFA 3U1XA 1PGSA 2PY5A 3IBMA 4L0PA 2DU1A 2QQMA 1NQTA 2LQTA 1QOOA 1VBD1 3K4DA 1JFFA 4LHLA 5FZIA 5DDJ1 4LFAB 4PDLA 1DF0A 3CEIA 3IKWA 1R1A3 2D43A 4F83A 1IBLO 5FXXA 5DUXA 1HB1A 2P3KA 3AP4A 4JI2B 3K0GA 1W8WA 4LFAO 1W0NA 3OAAG 1KFUL 4I9WA 3C7OA 1OA2A 3T2OA 3PUAA 4JI2O 4HANA 4K20A 4MZUA 5LHHA 3CCUV 2LO1A 1D4M3 5A32A 2QA4V 4QPGA 1KDKA 3LEIA 3G7DA 4CP1A 4YVWC 1WUVA 5DUVA 1DHKB 3KV5A 3F5TA 5FY5A 3WF3A 1UYZA 1PV0A 2YBPA 2H0VA 3A7QA 4X8AA 1IVSA 4YG6A 3CJXA 4LOSA 3MEPA 4UF0A 5F32A 3TN91 3QO8A 5E79Z 3RZJA 1SFYA 3RPQA 1RUE2 3ZMZA 3NJXA 2A3YA 1W39A 4WVMA 4XJAA 5BY5A 1W6QB 3RYPA 1NTMH 2ZT9B 5C5TA 5LYJB 4AFBA 4NJ4A 3UT0A 4CUAA 2WFF2 1S5LZ 2VECA 4YW1A 3POGA 3ROUA 2F4VB 1NVPB 4ONUA 4ASMB 4Q4Y3 3HB3B 2KM2A 3NAPA 4I0AA 2J1EA 2ZEWA 4YZ1A 3E5QA 2EIMC 3A21A 3N35A 3ZBHA 5LMNB 1QVFU 2IC1A 4FP2A 3AM2A 1O5UA 5K1PA 1RPRA 2VG9A 3AMHA 3AZVA 4DUYB 4N43B 1ULEA 2B9UA 3WVJA 1QDCA 4ZU4A 5KA6A 1JZ2A 1IQAA 4XDKA 2W91A 4ZZ5A 1UFIA 2Z5UA 4GKYA 4W8JA 4D94A 3W5NA 1GUIA 3OSDA 4GWNA 1KJLA 2WNVB 4DUYO 1XPWA 1RUD1 3OG2A 4QU1A 1KRIA 2GV9A 4PLMA 1W2BU 3WQ7A 2XJTA 3HKBB 4F8AA 5FP7A 1DP0A 3VV1A 1AR73 2L9LA 3C8XA 1IPJA 4B3MB 3SDLA 2VBBA 2YGMA 2RN9A 4BWOA 1W6PA 1C57A 3PVOA 5KHIA 1B35C 4P30A 3J9SA 1NKDA 4NN0A 4B3MO 4ZS2A 4X88A 3DGEA 1FJGB 1DQ6A 4DXSA 3VDDB 1KQRA 2PMWB 2PHWA 5CZKA 4OUSA 2ARCA 4UCVA 1FJGO 1OLRA 5GONB 5FV3A 1MOFA 1XU1A 5B4XA 4XXAA 1ROPA 2BRTA 1NUKA 3B5LB 5D21A 4U3FH 1FXKB 1Y76A 3PUQA 2K2SA 2EZPA 1GN3A 3CYOA 3LKJA 4BLJA 4OI0A 3EVKA 5IJ9B 3RZLA 4J7ZA 4IXLA 1HB3A 2R7EB 2LW7A 4Q4V2 5ANNA 1S2EA 3SHRA 3LF7A 4FFFA 5IYZA 4B3TB 1RUI3 5K0UC 1V6IA 1VB2A 5IVVA 1YRZA 4FCAA 2X29A 4CTEA 1CAWB 3NL1A 5LK7B 1PGL1 1ULDA 1K5MB 3C7HA 3LSDA 4B3TO 5L9RA 5IY5C 4CDXA 3PMSA 5LBCA 3OMIB 5BNNA 4A2UA 2QNKA 2UU9O 1UF2C 1I5YA 4CUBA 4CE8A 4HN0A 4CU6A 1TGOA 2R063 5C8CB 3RFRA 5DQ0A 1MS9A 1Q5OA 3OBRA 3ABLB 4FK5C 4IYIA 2V7QG 5C9AB 2R72A 2O8OA 3D36A 4XQWA 1YNAA 3MF6A 5KHHA 5BNPB 3JD1A 2QQKA 2K1EA 1F2NA 3LSUA 4FZ0A 3LIHA 1R3IC 2OX0A 1N4CA 2XXZA 3GHNA 4XBLA 4QX8A 2VMGA 5H9SA 3T0AA 1JU4A 2DMXA 4MYEA 4L92A 2P22C 3H3LA 5LGNA 3MIEA 2ETNA 1JZ3A 2G9GA 3D0SA 4UV9A 4PHZA 4HL0A 3BU0A 3T1CA 2E75B 1B06A 5FZEA 1GM9A 2ZXWB 3OT7A 3GXUA 5IVJA 3VGIA 2VBDA 3AG3C 2D93A 1I5XA 2B46X 5AC93 4TT3G 3SR2C 1QNWA 4I9QA 1TUBA 2R30A 3OGSA 1NT2B 3F5WC 4EZ4A 1W6NB 1R73A 5IT9N 1R083 1LHVA 4R7CA 5ERLA 5KAFZ 2X5IA 3SPCA 3MIFA 4IGOA 5K7PA 4LBLA 3LDRA 4IEWA 2RM21 2PHLA 1RHI1 4P9YA 3O1UA 1LOEA 4JAVA 1ODNA 4WCEV 4UW3A 2Z5WA 3BABA 4GT1A 3JAWB 1W0JG 4X1KA 3RYIB 2QR4A 1DF5A 1SQXH 2F4PA 5F3EA 1N33O 3I2HA 3EJKA 1AJKA 1H8HG 1AR83 2A7AA 4DUZB 3FMGA 1DU3D 1JZ8A 5DABA 5B4NA 3NJZA 3ZRXA 1AI6A 2AXTZ 1PIV1 2EBOA 3JASA 3STZC 1FYJA 1G9AA 4DUZO 5C4WB 4TV9B 2WLPA 5JMOA 1NR1A 5FK8A 2GDFA 3KT4A 2GHYA 3VBSC 3NXSA 1IG0A 3SYAA 4XUNA 4KMQA 5A32B 2WL1A 3T1YB 3O0VA 4QPGB 3AG4B 3B9CA 4GB33 3N36A 4DXRA 4DR1B 2WO7A 2EZOA 5J2TA 1U5IA 4LOTA 2M7WA 2L6LA 1HRI3 4AILC 3WINE 2QKSA 2QQPA 1W03A 5DZGA 4DR1O 1J5EB 1Z7S3 1JU3A 1ST8A 2P6CA 1B09A 3P30A 2FCVA 4GWMA 4J41A 5EYPA 3B93A 4O4IA 1J5EO 3OUJA 4X64B 3N7JA 3ES4A 5H9RA 1M06G 3VD4A 4H33A 2Y4UA 1J1TA 1VBC3 5FZ1A 3SJBC 4GALA 4WVMB 3LSEA 2YYOA 3EBRA 2GSMB 4X64O 1MR5A 3IJ4A 5EIBC 5C3RA 3AKSA 1Q8PA 2DVAA 3M8AA 1QXPA 3D4KA 1W8FA 2G9FA 2ZIOA 2R9IA 1R64A 2ZE5A 1S72V 1RUJ3 3WG7C 4LF9B 4XETA 3OE7G 3M7AA 1YYNA 4RL7A 1ZTEA 4C7UA 4YM3A 4Q1RA 2W6JG 5GLZA 2C4XA 3I3MA 5J36A 3THCA 2BTQA 3WP5A 1OCZB 4UCRA 2EVXA 1Q6HA 3AG2B 4OI4A 1F31A 1R6TA 4NHXA 4UVAA 5AFEA 2E7QA 1RPOA 3GCXA 4ES9A 1GH6A 2DVFA 3A2FA 4CDUC 3FUQA 4IERA 3K2OA 3RYHB 2RS31 4U3JB 3TCUA 2W1SA 4XIOA 5FPVA 2W95A 3K77A 2ZHKA 1CWPA 2E33A 5CA0A 2LM3A 4B1LA 3PLQA 1U96A 3WW4A 5D5PA 1OA3A 4WV8A 4JI0B 2Z4FA 4QXBA 4RAIA 2GTSA 4YIOA 1RJ7A 4LEJA 4XDOA 3S57A 3ZMOA 4FM0A 4AI0A 1VMGA 4JI0O 5KR7A 1N0JA 3FJSA 3AXEA 3HR0A 4M01A 4U7NA 3H1MA 3ASOC 1YFWA 1KKCA 1PO23 4ZI7A 1OQEA 1CP9A 2ZE7A 4FPFA 2K46A 5FFOC 4Q0VA 1SMVA 1GN4A 2ZABA 1DFQA 1GOGA 3BA9A 3MFCA 2XLGA 5IVYA 2PHDA 1L7LA 2XJPA 1APNA 2Y0OA 2QWPB 4AEDB 1W6OA 3FAVB 1QU7A 2HWF2 1BBT1 5GW7A 3IIIA 3QACA 2XT9A 2RJZA 5I8TA 4EEQA 2ERFA 4BXSV 1CZSA 4A41A 1ZYBA 2R1BA 3TB0A 1IDSA 4GUNA 1EP0A 5A7NA 3WUCA 4TXWA 1W2UA 3TNPB 3BTZA 1DGLA 2XMLA 2Q68A 1SQQH 4IEZA 4RR3C 5IAVA 1AILA 1Y4WA 2R041 1DQ2A 4Q4W2 3THOA 1E5RA 5KUKA 3IC7A 5ANQA 2GC2A 1AR5A 4RUEA 4KWUA 4BMBA 4CDXB 1UOJA 5BNNB 2AW9A 2PQQA 1FPN1 4MX3A 4DR3B 2Y4TA 5IE9A 4DW1A 1H1IA 2J1VA 3ZXAC 4BPZA 2YI8A 2HEVF 4B3RB 2VZ3A 1Z78A 4PQ9A 4GCZA 2R073 3BB6A 4DR3O 4QM8A 4GX5A 3ZN1A 4DYLA 5J48A 4B3RO 3ZRWA 4H14A 1RUF3 3KF3A 5A9GA 1CQ9A 5CIRA 4MTFA 5FPZA 1H9PA 1KKDA 3PL0A 2VZRA 3VD9A 1QLNA 5FAXA 3DCQA 3TAYA 3E22B 1QJY1 4QPIB 5GZEA 1UMHA 2YV8A 3H01A 4KGGA 1UWWA 5CBHA 2R16A 2A3WA 4KU7A 5EPAA 2UWBA 1QJU2 4LIVA 3LCPA 2N7GA 1P7GA 1ZX5A 1QR8A 3BGAA 3E6CC 3TEZA 4GYCB 4XDLA 4Z2WA 4HKWA 4IEOA 4QKDA 4LO7A 2RS53 5T5PA 3KV4A 3D8CA 3W59A 1LENA 4UAPA 3T2TA 3CP1A 3IFXA 4QAWA 4AI3A 1W99A 1TUBB 1VBB2 2YMZA 1OUXA 2WBKA 1MEC2 2VO5A 3MIHA 4DB5A 1XSQA 4N90A 1ZWIC 1HQWA 1UZZA 5B1BC 5FZMA 1EAH3 1EZJA 2EXJA 1LR5A 2GC1A 5LY2A 5C5UA 3CMEV 5A6ZA 4WM7A 1S55A 2X5IB 4E4ZA 1B35A 3T09A 4IYHA 2ZEYA 4GQ7A 2GDSA 4PCRA 4I4TB 4LC1A 1BT8A 2ZGKA 3SJAC 5JJJB 1PO11 2JK5C 3X29B 1HW7A 3CRMA 1DYOA 1GM7A 3IAQA 4S2HA 2X53S 3BIWE 1L0LH 2KSDA 4BDVB 1O5LA 3CMGA 4AHXA 5T3NA 2BP6A 3UGGA 4JCKA 3JB4C 3U10A 1YI7A 1K92A 2QQUA 5ACA3 1X9PA 4KWKA 2AHYA 2WDBA 3PUSA 3T1HO 4LK7A 3FE5A 4Q4X1 2E74B 2VY0A 3OFNG 4BIZA 4YZ3A 4AEKA 2CNAA 2YGLA 5B66Z 1HNZO 1K12A 1K5SA 1NXD1 4QB1A 1RM1B 2FYUH 3CS5A 4DQAA 4J9YB 4QGLA 3OBZA 2Q1MA 5IT6A 1COV1 1V6NA 2W0XA 1SQGA 1H38A 3PJQA 3GYDA 1VIWB 3U75A 5F8PA 2P6JA 2DYRC 2ZPXA 2HVJC 3HKEA 4CU7A 4FPEA 2H0BA 4YIPA 1U5ZA 2NYYA 5EYPB 4CEWB 1VIBA 4N8MA 1ZBA2 1C8M2 1ODMA 4IQPA 1YTFB 2XLFA 1GK9A 1F15A 4D7TA 4RHV3 4OXSA 4UB8Z 3ENRA 4DIQA 4BA6A 5BPXA 2IXHA 5CFDC 3GBGA 2D5HA 1IXBA 1NE4A 4GD4A 4CU9A 5B1AC 4P5HA 5F5QA 1MNGA 1PIV3 5HCAA 3ILFA 4QXHA 1RUNA 4DFSA 3D82A 4Z2AA 4TSFG 2QE7G 3ZJZA 4DV5B 4XDQA 1UYYA 4BK4A 2BTQB 5FBZA 3V65A 5LBEA 1TVKB 1VP7A 1CPNA 4BB3A 1AX2A 4DV5O 1S76D 1HJFA 1QQCA 4XZPA 3AFGA 3QCWA 3QO5A 5FYVA 4CP9A 2O8QA 1H8TA 2UY9A 4J25A 5GZFA 4ZXKA 3VQWA 5HFLA 4CS4A 1M57C 5CNAA 1LGNA 1MPXA 2QVSB 1X9TA 4YM0A 2ZR3A 3SPHA 4OULA 4X20B 4QGMA 2WKKA 1E57A 4R4XA 1F4HA 4OHXA 3H9VA 2QWRB 1H8EG 2VMEA 3BN6A 2UWAA 5I8SA 1CGPA 1VBE3 4FAGA 3FFZA 4P9PA 3P1IA 2NMNA 2HWC1 4ZI7B 2VW0A 1CAUB 1Q8QA 4NHKA 4IV3A 1J1LA 5FZ7A 5A1FA 4W6WA 4MVSA 3ZFEA 3I3QA 3RMXA 2XBO1 2A9HA 4I2OA 3VD7A 4FLXA 2JKXA 3CJHB 3UJQA 2WABA 2YG0A 4X1IB 4MG2A 3OGCC 3DGTA 4GZ9A 4Q5OA 2EULA 4IE7A 3L74H 4ZIBA 3UYJA 2VTXA 1OXCA 3R4UA 4RYDA 2MHFA 3VBSA 2ARXA 5FLHA 2CDPA 4YYOA 1OLMA 1QCEA 1JH5A 5EXOA 1W8TA 1AVMA 5I0RA 3FYIB 4YVWB 2K0GA 2DBNA 5KXDA 3O14A 1KYOF 3SYOA 3KLSA 1VF7A 3QD6A 3AKTA 3ST7A 4LF6B 5K1XA 1S0BA 1LUVA 2VCBA 4Q0SA 4LF6O 5C3SA 3H7JA 3VZJA 2OA2A 4V2WA 4CS3A 3P3NA 3CCLV 2VCCA 3DPRA 2DTYA 1GQHA 4SLIA 3JSNA 1VQMV 3ZRWB 1QIQA 2R70A 4RS5C 1FYUA 4TWTA 1W9TA 1VQKV 2QDNA 3B7MA 3BRCA 1BBT3 2VMHA 1JZ4A 5FP8A 1QXRA 3IAPA 5GLVA 1V54C 4B1MA 4LF7B 1HNXB 5A7QA 4RQEA 1CJPA 4DXWA 3WQBA 4IE6A 4C8DA 3T4VA 3JZVA 2E7AA 3VZNA 3VZMA 2EIMB 5GZGA 3JD71 3CC4V 1S5JA 3T4ZA 4LF7O 1HNXO 4XW3A 1NS1A 2WWJA 3OCPA 3JQWA 3ZPOA 2VNVA 1I7FA 2GTAA 4FPKA 4C91A 2VM9A 3FD9A 5IWFA 4CDUA 4QKFA 5F9TA 1VMFA 2RNBA 1OC1A 1YJNV 2ETEA 4JGYC 4IEQA 4H13B 2AH2A 1HX6A 2QQLA 4OZXA 2P2KA 4R9AA 1ACCA 1NCRA 1VARA 1N36O 3MAQA 2MEV2 4HZ3A 4RO2A 5JPMB 2QQVA 1SLAA 4Y22A 4XMAA 1RUE3 1OCCB 4WFGA 2Z42A 1B35B 2ZKNA 2IXCA 1MS1A 1RC6A 2Q30A 4YM2A 3SITA 2VZOA 5JIUA 2WO2A 3FL7A 4FLYA 1GP5A 1G8MA 3AJZA 1UOGA 2JX9A 1KECA 2XAJA 4A4AA 1XE7A 3WLUA 3L73H 1XEQA 1ZBE1 2DCTA 3KV6A 3CCRV 1O9GA 3L72H 1NR7A 3MUY1 1NZ6A 4I7ZB 1HXS2 5L7OC 2JB4A 3MD0A 3ACFA 2WNEA 2HWB1 3BCWA 2DFBA 2PF4E 1F4NA 3S7IA 1K97A 5D1IA 1F5JA 1NT0A 1OA4A 3ICXA 2Y6JA 1O8SA 1SRYA 3VHPA 3DYMA 1P8JA 3MV01 3NWKA 3M99B 1ZRRA 5K0UB 3AG7A 3R0RA 2FD8A 4QX1A 1CEZA 2JGDA 5GTHZ 3HKCA 4RR3A 5L3CA 1UX7A 4LUKA 3BTXA 2VQAA 2WLJA 2ZR2A 3KKYA 1W28A 5IY5B 1DIWA 1QDOA 4ZU5A 1N34B 5JOWA 1AR91 3ZIXA 1OVSA 5GJ6A 1X59A 1TMF1 1PO13 3M3IA 4RN5A 1N34O 4NPMA 3POIA 4YJ2A 2KQXA 4BIFA 1SZTA 1IS3A 1DYPA 1X4TA 2VZTA 4AQYB 3IPVA 1AR61 1NXMA 4EN8B 2AZ2A 1BEV1 2WUHA 2D44A 4FXKB 1PK6A 4O2BB 2YU1A 5C3PA 4AQYO 3WNOA 4XURA 1QH7A 1VQNV 4YM1A 1EUUA 2ENRA 4WZCA 3FN9A 4MXWA 2XQXA 3DYOA 4K35A 3RI9A 4LXLA 3KV9A 1VRH1 1AXKA 5F3CA 1SZBA 3STLC 1UZYA 2IXJA 4Q4V3 2YY1A 4YHHB 1V9U1 3N9LA 3VBBA 2RS12 1W0PA 1LNQA 2Y6HA 4H3WA 1UPIA 4XYXA 4K0KB 3KD4A 1M9NA 2P37A 3AG3B 3AYAA 4IEUA 4CP9B 1H4HA 1J95A 4OCTA 3PU8A 4K0KO 3LA7A 3D3AA 2GUZB 2Y48A 5EIYB 1S0VA 3VQXA 5DG1A 3H8RA 5KHGA 3HEIA 1QJX2 2VAUA 4QKNA 2K9PA 1WA6X 1K33A 2A3QA 3NRUA 3KCYA 4HONA 4AI2A 3UKMA 1YIFA 4IETA 1G9BA 4JPRA 4AHWA 2XVGA 5J7MA 2VUJA 4FFIA 4A6SA 4ZHQA 5FUPA 3V0BA 1JMKC 1WMEA 3HWJA 2VZPA 3OJBA 4XF4A 2EILC 2PXJA 5KC5A 2JE8A 4CCCA 5HBAA 3RZZA 1OHFA 4IV3B 5K8SA 2MPFA 4HNAB 2ZZQA 3ZXEA 4JRLA 4CC6A 2AC1A 2B5HA 3ZFEB 4LFBB 3LQCA 4PDVA 3MIDA 2AR6A 5LB6A 1US2A 2BOCC 4N53C 5A7WA 1AP6A 3ZMNA 4XACA 5FY1A 4LFBO 4AAXA 3H8XA 4XQ4A 3K4ZA 5A80A 3VBSB 1WJZA 2W9XA 3CMAV 1OLME 1REDA 1QJEA 2P5OA 4W4ZA 1IKQA 4R8CA 3HPLC 2JKBA 1SQBH 4MVUA 2AEZA 3I4IA 3AVSA 3FLTA 1ZRIA 2VR4A 1RUH1 5EC1C 3K3WA 1UW8A 5I0SA 4LE4A 4QXKA 1WD3A 4YG0A 1ZRCA 3KHBA 2Q0OC 3H1HH 4IL6Z 1Q6UA 3VHOA 3OYWA 1QOTA 2HJIA 4UFKA 2GMPA 2VW1A 3ZHQA 3SNMA 4A3ZA 5FJKA 2YC0A 3OEBA 4RQPA 1F23A 3B9IA 2RR12 1KS5A 3HIFA 5FNVA 3CJIA 4K8RB 1G8WA 3W9AA 4HPKA 3IB3A 1XJAA 1PM7A 2W46A 1OJHA 4DR7B 1LOGA 3PTRB 2D6LX 3VZOA 2A6YA 3WG7B 4UWDA 3BIEA 3WF2A 2ZAAA 2WO1A 3J4UH 4QE7A 2JD9A 5C70A 5FKCA 4DR7O 4K1YA 1CONA 3ME2A 1PNKA 2DCYA 1VALA 5IATA 1PVC2 2JDUA 5I0DA 3FYEB 4JI7B 4UFHA 2O57A 3HBKA 2RDRA 4LA3A 4DPNA 1W2AX 2ZJCA 4PA3A 4JI7O 2JGUA 1UXXX 1ULCA 4CDUB 1XBLA 5A6YA 3CL1A 1EV11 1NKGA 1OMIA 5LATA 3ZHTA 3ZSMA 3F7VC 2D6NA 4CCDA 5M0TA 2W92A 2YICA 2FDJA 2TUNA 1CAVA 2SBAA 2WS92 3QOPA 4MUVA 4AHYA 1H4GA 3POSA 4Y22B 3G6BA 1P4RA 4KG0A 3NKTA 2CK3G 4JI6B 4QGNA 4JV4A 1U5XA 1XNRO 1SPPA 4JI6O 2MW2B 4G28B 5IVFA 3OPWA 1XNDA 4KP4A 3I2OA 5JWPA 1WD4A 2DCZA 1ZREA 1WCQA 1POV1 5F1RA 2IFWA 5GLUA 3GALA 5FY7A 3VHNA 5LW9A 3PTYA 5TISZ 4PV1B 1GO3F 3JD73 1H2GA 2Y34A 4QX2A 1KB9F 2HWE1 3THTA 5B1OA 2X7RB 4PI2A 4ZOLA 4B7KA 2XASA 2C9KA 4NAMA 5E1AC 2D40A 4A3XA 1Y6XA 1BL8A 5IVBA 4LULA 2HEWF 3OM3B 2UURA 2V4VA 4YSFA 1NOVA 3DSQA 1POV0 3J7HA 2PLV2 3NNGA 2BWAA 5HCFA 2JGDB 3HKCB 5FYTA 2IH3C 4RR3B 4GMP1 4XUQA 3LEKA 2FDHA 4JAAA 4CCMA 5JIAA 5IK4A 3B09A 1WW4A 4LTAA 1IHMA 4CPBA 1ENSA 1F4AA 2DFCA 4NUBA 4A7KA 5LA0A 3EB7A 3QH6A 2UU8A 1NY72 3S30A 2GNDA 2Q73A 5FYSA 3A0BZ 4P9WA 1YLLA 2GN7A 4YW6A 5FPOA 2X0LA 2XVKA 1AYN1 1A8DA 1PZ8A 4QU2A 2GALA 1EUTA 1PMHX 3WZ1A 4E2QA 4L87A 2ZNJA 3JD0A 3JARA 1JZ5A 3IPVB 1ZBE3 2R0FA 5EJZB 1WA8A 3RRDA 1BQ0A 2Q8OA 2VCAA 2FDIA 4BQ1A 3AC0A 2HWF3 1CZVA 4DW0A 1EN5A 4UVBA 4JKMA 2LROA 3HMYA 2W3JA 3IDEA 5DUUA 5IK7A 3M4FA 1V70A 3ACIA 1AI7A 2F17A 4MXWB 5KAIZ 1GNYA 3OMAB 3ZYPA 5CG8A 1XMOO 5BZBA 4M3CE 1VQOV 3BFRA 5DMYA 3EO6A 5LBBA 3N9NA 4R8HA 4K9SA 4ATEA 1NA1C 1SDDB 3CIHA 3I2DA 1W8HA 4Q4W3 1BXHA 2C6SA 5FPBA 1DLLA 3JCIA 2Y0IA 3J7MA 1PGW1 1NX9A 5ABJA 2BGCA 3BOWA 2ZEXA 3R4DB 2XAGA 4HVQA 3ZFGC 4TLFA 2ODMA 1OI6A 2UXDB 5B1BB 3CPWU 3K5LA 2VVDA 1WB7A 1AYM1 2Y64A 1AHSA 5J37A 3FKSG 4AVBA 1R3KC 3ETGA 5A2QN 4JYCA 3PVNA 3J81N 1UOFA 1WW7A 2ZEZA 4OLLA 5DAXA 1VR3A 2EJ7A 3V0BB 4W65A 1BEV3 2D3PA 1KUQA 3BEHA 3UV9A 1PKXA 2QZ3A 3N9QA 5KA5A 1YQCA 1VQ5V 3OUIA 3WG1A 3QNEA 1AR1B 4MOAA 4HK8A 2W2IA 5FYHA 1PMJX 3JU9A 2FMYA 3ACLA 5APAA 3C90A 3SMHA 4EE2A 2XG3A 1BE3H 2FB5A 5FPLA 4XZUG 4DR4B 4NWVA 1QJU3 2ZGTA 2YBKA 2GSYA 4NR1A 5JH7A 5L7OA 4PDWA 1RMU1 4F6EA 4LA2A 2G19A 3MW2A 2KR2A 3CHXA 3RJ2X 3OD4A 4B8EA 4MLOA 1ND2C 3OEEG 1S1AA 3I59A 3QLQA 5DN6G 4ABMA 2AEYA 2Y69C 1VBB3 1MEC3 4TUYB 3CF6E 4AFDA 4CEYC 3IWZA 5EJ3A 4HSJA 1OKOA 3DKQA 2YB7A 3LOIA 3H8OA 2HR3A 3RZKA 1COWG 1UO9A 4AZZA 2HWD2 1SQ4A 3JALA 1RVF1 1EN4A 4NVPA 2W47A 3B94A 2D97A 4UBGA 4Y1XA 4RQFA 1GKFA 2WSVA 3OYWB 4NIGA 4QPYA 2OTJV 1KD1W 1AL22 2WNUC 3ORJA 2VXJA 5FMOS 4FOYA 4QQ2A 4CC5A 5ISLA 4RGAA 1LHNA 4BIOA 3LUTB 3K06A 3VZLA 5JCOC 3ZFFA 3UT5A 1URFA 2BEOA 5FNVB 2B4KA 1SQPH 5A3PA 5LA9A 1OCOC 5CFDB 3AXDA 3B77A 4OPAA 1YQ2A 3K58A 3K9SA 5B1AB 5D5QA 3PVBB 5JVDA 4CCEA 5FZBA 1LKNA 1OCRC 5FDBA 2XUEA 2Z2SB 1W6MA 2E9QA 3JB8A 1DGWA 2PI5A 1JOJA 4D0QA 4MSVA 1IBMB 2JECA 1WZXA 1FXHA 1XQ8A 3JCZA 2W39A 2ES3A 2HG5C 3HPNA 1R1A1 5J2UA 4KGQA 4FJCC 4NPRA 1IBMO 4FLUA 3POFA 4BQWA 3ZIAG 1FX5A 5EK0A 2ADQB 1DLCA 2KD7A 1ASJ2 3KVBA 4DEVA 3T4DA 3AMNA 4MTXA 4LBKA 2R0HA 4YY3B 1WPXA 1ZZBA 5LXTB 3VBUC 1VBA2 4XCAA 3M3QA 1D4M1 3HKDA 5JXIA 4YARA 4IHJA 3ZHUA 5BNOC 5FQ0A 1C8M3 1H0BA 2WWUA 1S0GA 5DAVA 2XDVA 2WFPA 5A3TA 4HBNA 3GCWA 4H55A 3SLIA 1QHDA 1GTOA 4BQ3A 1SPPB 1OOPC 2H94A 4LO6B 3HN1A 4K3UA 1L8DA 1VQPV 2GP5A 2OQ7A 3T2QA 2W68A 2Y6KA 4DXZA 2FCUA 3V0AA 2ZX0A 3EYPA 5L3FA 1B6QA 1LRHA 2R9RB 4A45A 1JW6A 3FHAA 3QTCA 2YXLA 4AL9A 1O3RA 4JHTA 4P9JA 3LE0A 5FZKA 1MACA 4TYSA 4XPVA 3UO3A 2W87A 1I3HA 4AVCA 3HJRA 3P6BA 2J7MA 4I09A 3QBQA 5CBLA 3H8UA 1SERA 4BHPA 2UUAB 4Q4Y1 3I2JA 1EV13 1R6KA 3KT1A 3E89A 2QQJA 3SPGA 3KT7A 3NR7A 4H7MA 2UWCA 3NJYA 2A70A 3DC6A 4EB6B 4SBVA 1UPSA 2KG7B 4XFCA 3VBOC 4AK3A 4G4FA 1CD3G 4E4DX 2D6OX 1HW5A 3VUOA 2JS5A 2GBOA 4KUMA 3RDIA 1EPWA 2J22A 3OPTA 3OBTA 3ZN6A 1AI4A 5LHIA 1XNCA 4XUPA 1US3A 2ZCEA 1S0FA 2UXXA 1YVWA 1OFSA 5KBFA 4FPJA 2RDNA 3LFMA 4C0HA 1UJWB 1BZWA 1XYNA 1AR71 4E2GA 2QTWB 3WDUA 3WSOA 3ZPYA 2VQTA 4RS5B 1QU0A 2E76B 5FZ0A 3VBRC 4LHSA 1ENRA 3POWA 3ZEDA 1LHOA 2J1RA 2Z79A 2P3JA 2HWE3 3UKTA 3TXQA 1R1BA 1R3LC 2PA7A 1ULPA 3F2ZA 2IFRA 1V54B 2D3SA 3ZN5A 1LOCA 1JHNA 2EAKA 1LGBA 2O14A 5E8AA 1BQPA 1GQGA 4I30A 4YW7A 3CCSV 1CPYA 3KM5A 1UCXA 3I56V 4IESA 5LEKA 1MMMA 1BMV1 5FZ8A 1EBOA 3I55V 4JHZA 4FLWA 1KGYA 2IJJA 4N43A 5ABJB 3WG4A 4OHWA 3WT3A 4YZ2A 2AHZA 1KMIZ 1NCQC 2E63A 1XNTA 4PLNA 3HKBA 5FLJA 2X10A 1RB8G 1PZ9A 1H1MA 2DE0X 1NTZH 2I74A 4X6RB 3ATGA 4P9LA 3WHTA 4IIJA 4QQHA 1IPSA 2P6HA 4A6OA 3KSCA 5FCCA 2D6KA 5KXCA 2EA7A 4LJHA 2R061 3HQUA 1A3KA 3ZXFA 2EIDA 4ASUG 3VDDA 4J7KA 1UZWA 1GAXA 2CWMA 4GX1A 3T2PA 5CFCA 4NXMB 3PIGA 5CBGA 3LEGA 5GONA 2ET1A 3CZUA 5JH7B 1QOSA 3FB6C 3A22A 4NHMA 2OZ6A 5L7OB 4PA6A 5DUWA 2A6WA 1FXKA 2UUBB 1P49A 2CAZC 4WFFA 3WQ1A 2RDQA 2IZWA 4BLIA 3MPBA 5CN0A 5CA6A 2RCVA 1VLNA 3I59B 2CE4A 1HQNA 1GM8A 5IJ9A 2UUBO 3CE2A 2J42A 1HKDA 4UFLA 1G4YB 5H6QA 4PQQA 3BALA 1FI2A 4FLVA 1AYM3 5L36A 2MEV3 3WNMA 1BYHA 2E51A 3B3QE 2N05A 3L9JT 4TQDA 2HEPA 1OH3A 2FDGA 1CAWA 3UKVA 3FHQA 4Y1VA 1K5MA 1YHFA 5I0TA 4FZ1A 2P5BA 5JOYA 2F66C 5AC91 1Y9GA 5A3WA 4XAEA 1X33A 2HBTA 2ZKLA 1WAZA 5C8CA 2XUMA 1R081 4B29A 3UT5B 3MDPA 4AOCA 4DR2B 5SV5A 3SKJE 3ZHRA 1LNSA 2OW4A 5C9AA 2QWOB 4JDOA 4FPHA 2CDYA 4URAA 1HXS3 2YUEA 1ND3C 1RMU3 1N1TA 1H2KA 1X82A 1AR4A 4WBNB 3D3IA 1TME2 3SH5A 1F35A 1J84A 1W6MB 3POBA 2WN2A 4TN7A 3E83A 3K03A 4PF5A 1GMMA 4HYOA 4EFEA 3ETEA 2DUPA 3WB2A 1PZ7A 1ULFA 2Q7HA 3ABTA 3NW4A 4LPLA 1M1KW 3RS6A 5T5OA 2NR5A 1F51A 1AR81 2QBXA 5FOJB 1NZCA 4WBBA 1P7BA 1MVEA 2X05A 4JI8B 2PHFA 1D2DA 1UN1A 3ZSEA 4Y5Z0 3SISA 2DURA 4FXGB 4D69A 5J96B 2DWDC 5C3QA 2BERA 3ZFGA 3G71V 4AAPA 2Y6LA 3ACHA 1WLCA 1LEDA 4Y5SA 3J80N 3HKDB 4PA9A 4O4LB 4IHJB 2VD7A 1UMZA 2PN5A 5FQ0B 1W6NA 4GB31 4YG3A 1HRV2 5BMVA 4XCBA 1JHJA 1JODA 2TEPA 2YEVA 4L97A 2VCMA 3HNMA 5FZGA 2JG8C 1MA1A 3JAMN 4J1XA 1Y9MA 3S3XA 1XOYA 1AVBA 1Z7S1 3RI8A 4DV0B 4MGYE 3M2MA 3C3TA 2EILB 1V6LA 3V0AB 1DZRA 1F5FA 4B4PA 4BXFA 4DV0O 3RYIA 2BSKB 4MXVA 1VBC1 1OBNA 4FQ4A 2QJVA 1IBLB 1V0AA 5A7PA 1UD1A 4N53B 3RWNA 5FZHA 4ZONA 3K4AA 4TWKA 2F43G 1RUJ1 1JN2P 2E6VA 2XHKA 4KH9A 5IJ0B 1J3PA 3BAAA 5C4WA 1QQP2 4TV9A 1OFNA 1FMD1 3SCGA 4CDQC 4KXRA 2OIEA 3UK9A 2KB1A 3KF5A 5LWBA 3N7LA 1QJX3 5F2VO 4JYAO 2TBVA 1JYXA 4XMIA 1TNRA 2AZ0A 1N32B 1EM1A 1PNFA 3KGZA 3HNYM 1ZA7A 3ZN6B 3MHHC 1CPMA 4BYYA 3PUIA 2VW2A 2LS6A 2ZGRA 1HN1A 2CSGA 2W1WA 1N32O 3MZHA 2Q4SA 1AP5A 4QB6A 3S7EA 1BQZA 5F6LB 2WLIA 5F6KA 3NJVA 4ICGA 1GZWB 2A75A 4M00A 5A70A 1C28A 4Q26A 4F4LA 2PTMA 1G1XB 3VKNA 4Q0UA 3GF6A 3OF1A 3EXAA 2WNOA 5JI7A 3ZS8C 3BTAA 2VE1A 3ZN0A 2CDOA 3S5AA 2DV9A 3RYRA 1RUI2 4NPLA 1PO21 1ZX3A 4GLXA 1Q6IA 2PYJA 2VOVA 1P84F 3N9OA 1V55B 3POYA 5I91A 1CVNA 3MLJA 3Q8CA 3ASNC 2Y6GA 3SCHA 1YI9A 4RUFA 2NQYA 1AJNA 2CYFA 3LNNA 5KMGA 3Q9OA 3WDWA 3DC5A 1XL6A 2YUAA 3SYCA 4N7UA 1ZZ6A 3T08A 4FFGA 1ALYA 1RUC2 1SLTA 4BIUA 2E7TA 4HG6B 2DCJA 1C4RA 3Q8EA 1GWLA 4AWDA 4JDMA 1O8PA 3RYHA 2ZINA 4EWEA 4U3JA 1BLZA 3VBUA 3ZXJA 1W9YA 3I97A 1RUG1 4AI9A 3L2HA 4UW4A 5A1LA 1GYKA 2CH7B 4XXPA 3ECQA 2RR13 4IIJB 2G1MA 2Q8EA 1DQ5A 5L19A 4H7LA 1VF6C 4E9KA 1XUQA 5K4LA 2YS8A 2ZS6B 4JI3B 5BY1A 1UU6A 3U14A 4DRXA 1Y4MA 5BR8B 2WIIB 3LDEA 1O3SA 1AXZA 2ZD9A 4JI3O 3GDBA 5J09A 2WZR2 2CTRA 2A6VA 1GWMA 2R071 5CFCB 5FZCA 1G9FA 5BR8O 1D0HA 2XB6C 3OW2U 3WV6A 5FZ6A 2RJLA 1WLTA 2YPJA 1GQPA 1PVC3 4R6ZA 1RUF1 5H6RA 2R49A 1OPOA 1W06A 1KDMA 2Z3YA 1OD3A 5G05L 5IVEA 2XL9A 3LIGA 4AEDA 3FAVA 5KX5B 4R50A 1BK0A 2UYBA 3K75B 4Z92B 4I0BA 2YU2A 1LB2A 1UPGA 1AI5A 1POQA 2DJVA 5JZGA 3W20A 4NYKA 4PF1A 2XAFA 4JTCB 1BMFG 3LEMA 2XPJA 3LPGA 2ZA9A 4M4RA 2GAUA 2WS93 2Y60A 1Q56A 5F5IA 3VBOA 4ZBMA 3NNJA 2VBPA 3WDVA 4MGKE 4MGQA 2ZTNA 2RS51 4XTPA 1YCIA 2UU9B 3ABMC 2RMU1 5FYZA 3ZDVA 5EFUA 3ON7A 1WMXA 4QNHB 4O4HA 2WA4A 1EAH1 3JCUZ 4XF1A 4JZ2A 1S0EA 4LORA 4CSWA 1JYVA 3LDKA 3SEPA 3VBRA 2WQ4A 3WFVA 3IIAA 3MUZ1 4DNYA 1MS4A 4AQ6A 1AX1A 1FOD1 3EMRA 3RYFA 2BOJA 4YW4A 4MVMA 2JJ6A 4FI9A 2C1FA 3E22A 1UOBA 4QPIA 3AKPA 4DV3B 1IX9A 2IVIB 5IUQA 2ZGLA 3JBG2 4QDRA 3NNMA 1VQ6V 2UUCB 4HK9A 1EPZA 4DV3O 1RGSA 1HRI2 1S2KA 2GC3A 2PLV3 4P14A 5C71A 5CEHA 4P02B 1YQ6A 4KQ7A 1NA1B 4GKKB 2Q1FA 1K7DA 5ACA1 1STMA 2UUCO 2PHXA 2EIBA 3INAA 1DGRA 1CZTA 3R66A 5GLWA 2XVLA 4GKKO 4OHVA 3MF9A 1CX1A 4LR3A 1UQXA 5G04L 3ZFGB 1URXA 3ZYRA 1O7FA 3TXSA 2WINB 4LHNA 4AHZA 4QPKA 4NHYA 1VE0A 2H8PC 1VBD2 1CN1A 5DDJ2 3AL6A 1KQSU 2XAHA 5IW0A 4AQTA 5HI0A 3WF4A 5BMVB 5FMCA 4NTWA 2DQ3A 2VOKA 3TEXA 4QPJA 2Q9LA 3MIBA 3OGJA 2YEVB 4BZ4A 4R9DA 1QWRA 4DO0A 3DTUB 5LGUA 4HLTA 1JUHA 4WFBV 4I4TA 1JYTA 1JJOA 1LTEA 1GU3A 3OR7C 2PAMA 1TAEA 1ZZ9A 1BJQA 2E5LO 2LFSA 1N33B 3AG4C 4DXTA 1AXYA 2NZ9A 3RMYA 2JDZA 4N23A 5HPOA 4BWAA 4CXWA 1VMJA 4RHV1 2JE7A 5FJHA 2DVDA 4PD4F 4D7SA 5FUIA 4K8FA 5LP6C 1XMQB 5FP4A 3WP3A 3TN92 1PNGA 3Q8BA 3P32A 1OD5A 4ATFA 1XMQO 5FXVA 2GNMA 4G2KA 2Y69B 2UYAA 1I1EA 2BNMA 3GZEA 4CEYB 4ZHNA 4B3SB 2WLLA 2EJRA 5FYBA 4COZA 3TGUH 1H2LA 3IC9A 3WP4A 1UMIA 3WP6A 4F6RB 3JD3A 4B3SO 2QTOA 3BI3A 1TQ5A 2VTFA 2D3OW 4HOOA 1XE0A 2EALA 4Q20A 3NAPC 2JDKA 3C3SA 4E4EA 2QFEA 2JJ2G 4OMDA 2WNUB 3UGFA 2LP7A 1IURA 4XEZA 5C7GA 4GX2A 5ITZB 2JEMA 2WLIB 2ZQMA 2OT7A 3OUFA 4IDZA 4BCUA 1Q43A 4CEWA 1GP6A 3AP9A 1W3XA 2ZDIA 2FDFA 5JMCA 2W6IG 3LB9A 2ZCWA 1OCOB 3AB0A 4XUOA 4YVSC 3J8F1 2ZMKA 4GWJA 1ND3A 2BCCH 1VBE1 2WLKA 3M70A 1RUD2 4NXNB 3ZXLA 1OCRB 3KWVA 4YNIA 3CXHF 2FKXA 3FX7A 4IE4A 3BKZA 4NXNO 4RFT0 1FMD3 4AGRA 5KMGB 5A3OA 5C3OA 4CPBD 1YF2A 3MV11 1GMGA 3IN9A 5JXGA 3CCJV 1TVKA 4BU2A 4L99A 3WUDA 3CWBH 2YROA 5DAPA 1W9FA 2HWD3 2OKXA 5FY9A 2DYSC 4MO3M 2JDPA 2HHHB 5E88A 4XJ9A 2F23A 1NJIW 2NNUA 3HR9A 3DECA 3LSQA 1A8MA 1EY2A 3VBUB 3NV4A 4AE2A 2BFUS 4FM1A 4W6YA 3KCXA 4WVWA 4YZ5A 2HHHO 2C0ZA 5HV4A 3K5OA 5J1XA 4GX0A 3N4MA 3CC2V 2HLDG 4BW5A 3ALQA 3W7SA 4XF0A 3VD5A 2EIKB 2VZSA 1VPHA 3A0NA 5JPNB 4X20A 2ZGMA 3OTFA 5JOXA 2KXLA 1OOPB 4XTMA 2JG8A 1E1RG 4DRXB 2ITCC 1D2QA 2VQFB 4UFIA 1DK1A 4DY3A 3C7EA 1E5IA 1G86A 2CAUA 4W50A 4AFCA 1LESA 1T5EA 5BUVA 1HIXA 1CAUA 4UCSA 1SS3A 5FMBA 2VQFO 3O65A 1M90W 1PGL2 3WDYA 4FVMA 3AJYA 2QKDA 1OUSA 3DUIA 1E1QG 1C3HA 1XHXA 4FM2A 5LOVB 1LU2A 4TLGA 5EP9A 1B3QA 4ZZ8A 2OCCC 5FUNA 4LO8A 3CJHA 2ZOEB 3PU3A 4X1IA 4JQTA 4FPGA 5JZGB 5L3EA 1ASJ3 1EFRG 4CDQA 5D8AC 3D36C 1M4UA 1JS9A 3A8TA 1NYWA 1VBA3 3SJQC 1RUG3 3CXCU 4MS2A 3H0OA 3VBOB 3IM0A 1HNWO 1QJFA 2HYXA 4YVWA 1WW6A 1KBHA 1FV3A 2ZHNA 3AP7A 4BQ4A 4WZFA 5CU1A 3CU7A 2Y6FA 3TK1A 1LHUA 1V6OA 1S0DA 4PIZA 1BHAA 4AFAA 5EZYA 5F39A 2OUJA 4LF5O 1GZTA 4O4HB 2EAAA 4QDSA 3E8GA 5EZWA 3UNPA 2B42B 2QGNA 1TVGA 3J7AU 3CCMV 1DGRN 1IQDC 4V2VA 1SA0A 4FOQA 1NE6A 2PGGA 4TZDA 4J9ZB 3CEWA 1RUE1 4KFMA 2BGOA 3VBRB 1HWYA 1LOAA 2V4DA 2IWGB 3RYFB 4Y26A 4COYA 3G6EV 3K51A 4NTXA 3AMPA 5GKAC 4OX9B 4XFHA 4HMZA 4Q8LA 3LDDA 2WFF1 3AYCA 5FP3A 5FYMA 2QQOA 1ULOA 4FFBB 4X1YB 4R4ZA 2PQSA 2YXYA 4OX9O 1SETA 5EWSA 1A6CA 4MSWC 3I2FA 3GJAA 2IJKA 2VMIA 1OSGA 1UX6A 4JZGA 3OBAA 1HDKA 3JAKB 2OTLV 2RM22 1H2MA 2LGQA 4LITA 1RHI2 1QJZA 3N7KA 4Y3OA 3EHBB 2O1QA 1I5ZA 3EQEA 1PPJH 1OURA 3ZYGA 1W2NA 5FZOB 3X2QC 2X6CA 1RINA 1YQ5A 2LFRA 3CCEV 5LA2A 1EYBA 2EXKA 2RMU3 4XVHA 3FWEA 1OT5A 4MH0E 1NCQB 1QR9A 1U12A 4A44A 1IGOA 2ZM6B 2A73B 3E35A 2XAQA 1R3JC 1AJOA 4BMEA 1PIV2 2J1AA 3SPJA 2CL2A 2YXSA 2ZM6O 2QKCA 1FOD3 5DAWA 3SYQA 2YIDA 3ETDA 3ZM8A 3F95A 1BCCH 1ULGA 3OGGA 3ZYBA 4K7JA 2BUKA 4Y33A 1KU9A 1MSDA 1YJWV 2VPVA 4RWUA 4JI4B 1DZQA 3MICA 4HZFA 1MZEA 1NAEA 1Y43B 1CXZB 3T1HB 2X6AA 3B8MA 2BU9A 5BV6A 3A4UA 4JI4O 1IOAA 1QHTA 2VTXJ 3FBYA 4OMCA 1HNZB 1O6UA 3ZSLA 4K8ZA 4I0WB 2P4VA 3QH7A 4UB6Z 4B7EA 3GHMA 3M3OA 1RXFA 2WLLB 5F5AA 4Q4V1 1PX3A 5K0UA 3T3YA 3K3OA 2A06H 3IAYA 5F3IA 1WCSA 3G67A 1XNBA 3VLBB 2ZIMA 2BWCA 1HP8A 2YIAA 2BGPA 3PUHA 1KP3A 2P7TC 3WY6A 2X8KA 5F2SA 1QBZA 2VVEA 4RFRB 3C3VA 3K5NA 2H6CA 2ORXA 1WCDJ 2DCKA 1OZ0A 3G80A 1LOFC 2JE9A 1YEWA 3VKLA 3BODA 2L35A 4CP0A 4Q2FA 5J98B 1LCLA 2W0FC 3VBFC 2RS32 1MZ5A 1ND3B 2YZ4A 1A32A 4DV4B 2NP0A 1XYOA 1PD3A 4J1WA 3M7MX 4O2BA 4WFHA 2A3XA 3RYCA 4L9BA 1O4YA 3B4SA 1D0GA 4IE0A 5FWEA 4AQ2A 2YPDA 4DV4O 1G6NA 4D6QA 3AL5A 4PBOA 1JOBA 4NWWA 1CX4A 3CQOA 2AACA 1U0AA 3RBZA 1Y74A 4CUGA 1JUIA 1G9CA 4XBQA 5IFPA 3J7LA 3VOUA 4BJ0A 4COUA 3I5DA 4PA7A 1WKYA 4NIAA 1REEA 3ZYFA 1VQ8V 4YRDA 3LWCA 4K1ZA 4LBEC 1V6MA 3AKRA 4X89A 1BKZA 1YJLA 4N21A 3BPSA 1RTVA 3CRAA 1Q3EA 1TEIA 2GUZA 2XJRA 1FT9A 5LK5A 4JTOA 1EZVH 1BBT2 1ZL8A 1HLCA 3OEHG 4FSJA 3OGRA 5FY4A 2XH6A 3VHRA 1Q81W 1JTZX 1RJ8A 2BOIA 3RVHA 4K40A 4Q27A 1Q90D 3O1PA 2JG8B 3J8F3 4YWAA 4DY5A 2VQ0A 3DXTA 3HBZA 2BNOA 2FZ1A 4DEQA 4OGQB 2LTNA 1J3QA 1TME3 4AVVA 2XJUA 2R042 3QG5A 2XOMA 3O5SA 5FY0A 2RMKB 4HNAA 1KEXA 2WQZC 2BW8A 2LALA 2A7WA 3AKQA 1FPN2 5LP6A 3WQ0A 1CAXB 2M6YA 3CRQA 1ZZCA 3KG2A 1ZNPA 2WAMA 4HFSA 2WC2A 2AREA 2OXBA 1IS6A 4CDQB 3MFAA 4JTNA 5DM6V 2VH9A 3GM8A 2B5UA 2VWJA 2WT0A 5J3UA 5A33B 1SLCA 4LNUB 3PHMA 3RT3C 2RJ2A 1OQDA 1QJY2 1HRV3 1HV1A 5AFBA 4RGKA 2C9AA 2PHUA 1CJDA 4W6XA 4GIQA 2PUSA 1UIKA 2EIEA 4HKOA 5JSRA 1XILA 1Q7YW 5EZYB 4V1PA 3AMMA 1PMIA 5T55A 3JD4A 2IU0A 2F4VO 2WRAA 5IVCA 1JYNA 3GJBA 4C1XA 3E5UA 3R05A 4PLOA 5E89A 1SA0B 4XJZA 1D5NA 4O7XA 3AYEA 4C0BA 5LMNO 4BQYA 4AYUA 1YC61 4YVSA 2VUAA 1PL4A 4BM8A 2MK3A 2WZ8A 4EKWA 3ABKC 3GBFA 5KHJA 4KWLA 4QHZA 2EF6A 3TEWA 4IEXA 3O1TA 1JQ0A 4DK1A 4JTAB 2CAVA 3ASNB 1QQP3 3GZTB 4WM7C 1K9MW 1OCCC 4Y4YA 2J1UA 1OH4A 1QMJA 4A42A 1FFTB 5EHDA 4O4JA 1KS4A 1Y7BA 1PO12 1R1ZA 5FO8B 1X36A 3G4SV 1SZXA 4FLZA 3SPIA 3CRRA 2LW8A 2A5ZA 2V4AA 1SFNA 2VULA 3ILNA 2EXIA 1YFUA 4P2ZA 1AL0G 1N36B 4OZOA 1G6UA 2VNRA 2IBZH 5HCBA 4YJ3A 2DWEC 1YITV 3GBWA 3I3DA 3CKHA 3DXRB 5FPRA 4FPYA 2F95B 3MBWA 2ZNIA 1UY1A 1WLWA 4TV8A 4O9EA 3DN7A 3SKVA 3U4SA 3D0JA 4Q4X2 4LT5A 3IMMA 3UETA 3ZMSA 1J83A 4OFGA 4P00B 2QDRA 2DVBA 1H30A 1K8AW 2P17A 4EN7B 1OQ1A 2WT1A 4P08A 4HXCA 2HH9A 2WFF3 2XWJB 4FQZA 4OUMA 1UAIA 2P34A 5C8WA 1COV2 2WAAA 2RJKA 2RG4A 4JAUA 3JQXA 3OD0A 2XHNA 4P9XA 3SC7X 5CA1B 1GANA 3RNSA 1I0HA 2HWF1 3C7GA 1XL4A 4LBQB 1HDJA 5AG2A 1HQLA 2RE9A 1MQTC 3WF0A 1AJQA 1Z5VA 1X8MA 1RUC3 4K21A 4I02A 3ZXGA 1FFXB 1JXNA 5D8AA 2JWPA 2P4KA 2UXNA 4MW3A 3T30A 2VUDA 1XXNA 4CDWC 3M3CA 1W59A 2W5FA 3U0ZA 4LH7A 2NPIA 3W58A 4QWNA 5LASA 1IBKB 1NH2B 4Q4W1 2PFWA 4IW3A 1XNKA 4OI2A 1SFPA 5A7SA 4W4KA 2BVBA 4UXNA 4FO9A 5FZ9A 4CU8A 3ABMB 2XKOA 1IBKO 2QUOA 1A78A 1JBCA 2ZZJA 1HB2A 5CAZA 2BV4A 3E97A 2B1IA 3DYPA 2IXKA 2WZR3 1RITA 2YC4A 2ZMNA 4KG8A 4HVOA 1OVPA 1A34A 2EXHA 1SLIA 1J59A 1BVVA 1KJRA 4JRAA 1YFYA 3PNAA 5H2FZ 4YGBA 4CBCA 1V6JA 2WLNA 1LUWA 1H8TC 2VVFA 2WA3A 1YJKA 3RYCB 4XQDA 2G4IA 1F8VA 3OGVA 5CB4A 2EINC 1C1FA 2XKPA 4JGZC 3B69A 3MI8A 1JOYA 3RQ0A 1Y74B 4GH4C 1UZVA 4QX0A 2OZJA 1QJU1 3H42B 3ZMUA 3NO8A 4JX0A 1YWKA 3T0DA 3N7MA 3AG1C 2HWC2 5L73A 1E79G 2QE3A 5I93A 4MVQA 3CD6V 1VP6A 1QF3A 2CU5A 3BVCA 3APBA 1OV9A 4EWAA 1RYYA 1PHMA 3HN3A 1LULA 1VBB1 4IV3C 4WF9V 1MEC1 1ENXA 4PT6A 4E4HA 4JYBA 1DGWX 1SLLA 1JFFB 1ZZ8A 4B3NA 3ZFEC 3RZHA 5IYDO 2XBO2 2YSUB 3AZWA 4AF9A 2JD4A 3IGAC 5T5LA 1ZL8B 2Q67A 4EN6B 4ZS3A 2ORZA 3ZYIB 3WU2Z 5DXDA 3E1F1 3O0WA 4EN0A 3ZSKA 4FVVA 4CH3A 1LEMA 4COWA 1QNYA 2ADPA 1NQJA 4AG4A 1B04A 3HAGA 2ZGNA 2QM8A 2DUQA 2PYTA 2D6MA 2QEXV 4DUXA 1GKBA 2CGPA 4EROA 4GA9A 2RHPA 4JKLA 4C90A 3ES1A 3JBG3 3JD2A 5LRRA 3SXWA 3T1YO 3ZRVA 4MVOA 4C1WA 2FMDA 2XONA 4LLFA 5F5CA 1ZLZA 2NN4A 5LP6B 2WAOA 3APQA 4UF0B 2Y0PA 3L71H 1EN6A 5I8YA 4JF3A 3F7YC 2AUYA 1AUYA 3DPRC 5IYBO 4GULA 3GWKC 1FD9A 4TUYA 2PYLA 4OI1A 1GNZA 1VBD3 3EHKA 5DDJ3 4Z07A 3W7UA 2YHJA 1FNZA 4Q0QA 5F37A 2HFEC 3NVCA 1DBNA 5IJRA 4D6TH 1KD7A 3PVEA 5FR3A 4CZSA 3K79A 2YXHA 3NAPB 3DL3A 1PM9A 5JXHA 4NTYA 4LF9O 3KS7A 3RG0A 3JD72 2WO3A 2G9ZA 1Y67A 3SH4A 2LGWA 4R9CA 5FYCA 4MW8A 3PMEA 1ZBA1 4AR2A 4ES8A 1C8M1 1LOFA 3MYXA 4YVSB 3GGLA 4CCNA 4LWSA 3WCSA 3SCFA 1ONAA 2KA3A 3VBFA 3LZZA 2JDHA 2B9VA 3O1SA 5CFDA 3OGIB 4EJRA 1JZ6A 3BCCH 5DECA 4Q1PA 1QEXA 3K9AA 3TN93 4JDNA 3HVDA 2XLAA 2JDYA 2FDKA 1NCRC 1W8OA 3AEIA 1W6PB 3AP6A 1ENQA 3W7TA 4DRVA 4LO5B 3I2KA 4HAMA 3RZGA 1ZM1A 2PAEA 4O4JB 2VUCA 3NV2A 1GNHA 3SGIA 3THPA 3H1LH 2Y33A 1US6A 2MNGA 5FRAA 2P3IA 2DYSB 2EICA 2JDMA 3WX5A 2RQ6A 1HV0A 3WXPA 5EBWC 5CG9A 1UIJA 3O1MA 5B3SC 1ZBE2 3H1JH 2V72A 4YJ3B 4E8CA 3CRCA 4BK5A 4NAOA 2BZDA 5LXTA 2VOWA 1IG3A 1Y76B 2YIBD 1R092 2B39A 4O9GA 3T0BA 3FBMA 4TV8B 1GR3A 1XNRB 2HWB2 3WB1A 2W1UA 4TOIA 5LBQA 3O0XA 2XQRA 3MLKA 1PP9H 1X50A 3TNQA 2YFZA 1J3RA 3ASOB 3VD3A 1RUD3 5IYZB 1ZAUA 4P9GA 2XNDG 4D7YA 4CH5A 2GMEA 5LMUB 2Q4PA 4XAAA 4Y24A 4NIDA 5FMOL 4UFZA 1AR92 3KQ4B 4L8QA 4EN9B 1X8EA 4KU8A 5LMUO 4IGGA 1W0OA 2CGOA 3VL9A 5FBJA 3L2YA 5DN2A 2VMDA 2JIZG 1TMF2 2VMFA 1WNSA 4F7ZA 1E5HA 4QE9A 2OCCB 1GLHA 1WLDA 2VXRA 3K57A 1VRBA 4I01A 5JXJA 1SC5B 3WEZA 4XJWA 3ZYHA 3T1LA 1K34A 2A6ZA 4UW6A 4UOJA 3PN1A 5D8AB 2VRZA 1W04A 4QX5A 4I55A 1K5JA 1FS0G 4Y5TA 1RIRA 1AR62 3R6SA 4WFAV 3IDCB 1BEV2 4YFWA 1NLQA 4CH6A 1PK6C 4EB6A 3WW2A 4DUWA 1UU4A 3I2GA 4IT5A 2KG7A 1NBMG 1K45A 2E26A 3HD8B 1I6XA 5LA6A 4BISA 4XILA 2BNNA 3BHPA 3DKWA 4EQVA 4DK0A 3A0RA 3O7OA 3VDBA 3ZMVA 2CTWA 3ZYJB 2I07B 1YQ8A 3GNEA 1VRH2 4EZHA 4LKSA 4FPCA 1YZBA 1GICA 5IYYA 1RXGA 2D2CB 3USSA 3E6BA 4E2SA 1UU5A 1V9U2 1L3JA 3B40A 1W8NA 2Z0AA 5JJNB 3H3UA 1LGCA 1NG0A 2NM1A 3SEEA 1SF9A 4XDJA 2DF7A 3RWRD 2Y38A 4Q0PA 4RS5A 3I8TA 3USUA 2VQUA 2N04A 2FBEA 1PM4A 5FO7B 2WR9A 3ZX6A 4CRQA 3NV3A 3PDQA 1ZRDA 1XMOB 3O9OA 5CB4B 4YGEA 3GZUC 1UY2A 1VJ2A 4EYUA 1Q8SA 1AROP 3ZX7A 4XBNA 3HOBA 2B45X 3U07A 2QDOA 5CB7A 1GBGA 1WN7A 5IHRA 5JVVA 5FTTC 1UKRA 2WLMA 4X1KB 3X2QB 4MGIE 1NU1H 2QQWA 4JGYA 4QM9A 1GOHA 3CZJA 3L70H 1XI1A 5KUMA 4UBHA 2Z69A 3JSLA 3UESA 2E53A 3SQOA 2MEV1 4INDA 4LFCB 5A6XA 3JASB 4META 3VQYA 2BPA2 3MLLA 4IUGA 3QO7A 4LKFA 4LBJA 4LFCO 2BTVC 3UO2A 4XJ8A 2VC9A 5DPNA 3BY6A 2YDEA 1WMFA 2BOBC 2DDUA 3N9PA 5JSPA 1W2OA 3FX3A 5KLVH 3HT1A 4L8JA 1XSRA 4X8PA 3BU7A 3T4HB 5J2TB 4ZY9A 3T1MA 1RUH2 3THDA 3MO4A 2JEXA 1LAJA 2OPWA 5B5EZ 4QMAA 3OMNB 1V9PA 2BBAA 2ZX2A 1XOUA 1SBDA 2A71A 4PIXA 2I2SA 2RM23 3M3EA 1HXS1 2AGAA 1MQTA 1RHI3 1UYXA 3W21A 4LE3A 2A1XA 4MGZE 4O4IB 4G3YC 4AGGA 2CTQA 2CUGA 4RQPC 1JJ2U 3H3ZA 1TNFA 1WBLA 3KCCA 5JLVA 4OQ8A 4PA4A 4NE9A 4CDWA 3CJIC 1JOPA 3NSTA 4OHZA 1S4CA 2PHTA 1TA8A 1M56C 3AMQA 2ADEA 4LKEA 5DG2A 4ET7A 2GNBA 1F4MA 4M4PA 1RP3B 4QHBA 2DYRB 5DAQA 2OCHA 4X66B 3UQ8A 2BVVA 2V09A 5CADA 3I49A 5GTIZ 2WWWA 1DG6A 2ZACA 2Q6AA 1S0JA 4X66O 3K48A 4QJFB 3VBHC 2P90A 4LWSB 4AI1A 5FYIA 3FB8C 2R9AA 4IE5A 3VBFB 4JZRA 1EV12 3RN4A 5JSOA 4WVZA 4YGDA 2YC2A 1SHWB 5F2WA 2F93B 1NQDA 2B8MA 3U78A 4OVEA 5CA0B 1CIWA 1T6GC 5FY8A 4WBNA 4JGZA 1O91A 1YXBA 3WNPA 4BQXA 2QM7A 1U97A 1LOBA 4GH4A 4Z8BA 3LNMB 2ZGPA 2XGXA 1WCKA 2ATFA 4NHLA 4NMIA 3BA8A 4D6RA 5A1AA 1NVPD 3OOXA 4B4QA 2RS11 3JYCA 1N1YA 3AK0A 4LLOA 3WB0A 3KQRA 5B2GB 5FZDA 4I50A 1D2SA 4R52A 4LBNA 4FTEA 1JI6A 1ZRFA 5FZAA 4Y20A 2LJ2A 2RDSA 2WPDG 1W6OB 1M57B 3O1VA 3Q4HA 2HWE2 5JR7B 4O4LA 1QJX1 2N74A 3M1HA 4H37A 1GP4A 5EC2C 1N1VA 1ZBA3 4HT1T 3NQHA 1WLEA 1S3JA 5H9QA 3QF7A 3SJCC 2ATKC 4IV1C 3ZSJA 1W8ZA 5KHKA 4DINB 1QLEC 2RS33 1JPXA 3RVZA 3NMBA 1T6BX 1YXWA 3J7NA 4CUCA 2B7YA 2V5YA 2UXBB 5A3UA 2JENA 1SBEA 4AGVA 2BYVE 2WYFA 4XIKA 4UV8A 2FHRA 3LA2A 1S2BA 2UXBO 2BSKA 2FTKA 4B08A 1DTOA 4UT5A 3RZMA 2XHBA 1QVGU 4GJZA 5GZCA 2AZ5A 4N53A 5JAXA 3OB8A 1AYN2 4PELA 3TWIA 1BHBA 5JOZA 4YFZA 5JR2A 2XJVA 4I55B 3TOJA 5IJ0A 5D2AA 5B1NA 4MTOA 2WSSG 3MHZA 4QDQA 4E2LA 2R32A 3FFQA 2Q0AA 2ZGOA 2OT5A 3CCVV 3CDZB 4ISRA 3R65A 3VL8A 3A0HZ 3UGHA 1MABG 3CB2A 5LA6B 3UL2A 2IXLA 5E1RA 1F7YA 2BTOA 2I45A 2CHHA 1RL3A 5KXEA 2ZHMA 2P06A 2BJSA 3V64A 5DEDA 2QWQB 5CYYA 4AVSA 4MHRA 5LL6Y 5EBMC 3OUSA 4UFMA 1ENVA 5FMDA 2R043 4QQPA 2W94A 5FLIA 2RR11 1GZWA 2WLHA 5CKQA 4RD7A 2ZX4A 2W1QA 4LBQD 3USUB 2QQNA 3SH3A 2C5DA 1OLQA 1PGW2 5ABJC 3E6DA 4IEYA 4NO4A 1M93A 4CVUA 1FPN3 3ABKB 1XRUA 1BSMA 3KZIZ 4K8XA 4MGTA 1HB4A 1AYM2 1AZDA 4YW5A 2AENA 2JG9C 4D8MA 2IM9A 4WM7B 3OY8A 1NLSA 2Q8CA 3LSSA 1ZA4A 2EIJC 3VKMA 3IMNA 3PJSK 1H2SB 1PVC1 1NH2D 4WVVA 4OPHA 3S6PA 4P9IA 3ZR6A 1GZCA 5I0UA 3EFFK 3ETQA 3ZLIA 3PJYA 2P3YA 5SV8A 1QJY3 2RVAA 1V00A 4LF4B 5FP9A 1UZ0A 3N2GA 5FIXA 4JGYB 4Y4RA 1PNLA 4ZU7A 2E31A 3A0KA 3UJOA 1D4VB 1AJPA 3H1WA 4LF4O 1QKQA 1R091 3K04A 1M4WA 2WS91 2SLIA 4PDWC 1RMU2 2Q8DA 1X7NA 1IXMA 1H1AA 3TEYA 5FWJA 1MZFA 1MS8A 2CH7A 2ZX3A 3LA3A 4CCLA 2NMOA 5FPXA 3CX5F 4CZZA 3ASIA 1UY0A 3BPZA 1RSOA 3GVMA 2UY8A 4BOWA 1UNBA 1K4DC 2PZSA 1S77D 4LBMA 3LDCA 5A6QA 4M0NA 2VMCA 5LY1A 3D6EA 1KP2A 5GLTA 3KVAA 3W7XA 1XC6A 1DQ0A 4W4LA 2VGDA 1RVF2 5C33A 1K3EA 3I2IA 3HKEB 5JCTA 1SACA 2TNFA 1MG1A 2X6BA 1MQTB 4PJ0Z 3WR0A 5KX5A 4DMIA 1REFA 1MS5A 1I5PA 4LR4A 4UCUA 5FZ3A 1YJ9V 3ZVXA 5FREA 1VAMA 2HKOA 3ZFFC 4CDWB 2GP3A 3H1KH 3WCRA 4LNVA 2PLV1 2LW1A 1DF4A 4DZGA 4FOWA 3K3NA 4WM8C 1XBFA 4KWJA 1ZSPA 3OTOB 4BQ5A 1O3QA 4P9OA 4BAYA 3DEMA 4Q4X3 3JATA 4GZRB 3S5QA 1JX9A 3CO2A 4JV5B 3E8BA 3OTOO 4N9IA 2ZE6A 4M3CA 5EV7A 2D7FA 4M3CF 4XE9A 4CA9A 2FMLA 1NY71 2GH2A 3ELNA 4XFAA 3L9DA 5CMUA 4LHKA 1PNMA 4JV5O 3RWKX 1BVP1 4F3JA 1W9SA 2ZGQA 1R1A2 1W2TA 1D5AA 3KZ4C 2DU0A 3U37A 3KB5A 2VWKA 4ASKA 2HBUA 1COV3 4U2AA 3K59A 3BUCA 4YHHO 4NKGB 2H6BA 1OHHG 3WNNA 1VAVA 1H8TB 2ZAHA 4QHOA 2OQ6A 1W0KG 3R4SA 4U7OA 3DV8A 1WP7A 4PJYA 4LQRA 1D4M2 3ZXKA 1XDCA 1SG3A 1JYIA 1BK1A 2EINB 2P4EA 4JGZB 3AX4A 1DQ4A 3CCQV 3MW3A 4GH4B 3ITQA 4Y1ZA 5FYYA 4QX3A 1LHWA 4A7ZA 1C5IA 1XNAA 3GWOA 4I0XA 1NA1A 2Q5TA 3AG1B 1CIYA 2WT2A 4PI0A 1L0NH 2AGSA 4FBFA 4MVRA 2YBSA 4I50B 1SBFA 2A0LA 3MPPG 4Y20B 2OYQA 4DUVA 4S2FA 2B1GA 3JUUA 2JDAA 1IZ3A 3AYDA 4DO2A 5FLXN 2ET7A 3Q4HB 2DUOA 5C6CA 4HKLA 1GRJA 1Q8VA 2FCTA 4UXAA 2IVJA 1MVQA 4J80A 1H9WA 1FPOA 3B00A 2OIIA 2FL4A 2ZKOA 1JYWA 4X65B 4Q4Y2 2D6PA 1ZZ7A 3FB5C 5T52A 4NOTA 2WJSA 2XWBB 1JZ7A 1BGYH 4FIPC 2B9ZA 2VZQA 2O0OA 4X65O 1LU1A 4AQSA 3BOPA 1GFF2 3LAGA 2WLQA 1NLRA 1PX4A 3EXUA 4KNCA 4IL7A 4YZ4A 5IAXA 2JIJA 3O1RA 4GXLA 5H5NA 3OR6C 1WCUA 4BR6A 3FHIB 3I54A 2ZX1A 3WW1A 1RUOA 1SQFA 1UKGA 4URTA 1YDXA 3CSXA 1FXVA 2WZPP 2RS13 5L9VA 2HWC3 4JASA 4IEPA 2QM4A 1JR9A 3E8HA 1ND2A 4Q29A 4A5UB 1AR72 3NV1A 4LMFA 1I08A 3LPFA 3DPRB 4L11A 4IGQA 4EFBA 1KFXL 2V73A 1XHZA 1GZ9A 2JS3A 4JYAB 4EV0A 4CEYA 5A3LA 2XBO3 5IK8A 2DQ0A 2D3RA 1SESA 2JB8A 1HN0A 4I3PA 4ORFA 4UFJA 4IGPA 4KBBA 4OQ9A 3N27A 3RVYA 3IT8A 4JTDB 5BXXA 2HWD1 4F6RA 4J42A 1VMHA 2PHRA 2VL4A 4QD2A 3ZOIA 2DVGA 1V55C 3FC0A 1WGPA 3JXSA 4Q8KA 2WQ8A 3MHSC 5K9YA 5FPAA 4YW2A 3MW4A 3K0DA 4P5YA 2WNUA 1AL21 5FXZA 4CCJA 4XABA 5ITZA 2DWRA 4L2NA 4LK6A 4S2GA 5KXBA 5KWRA 3I3EA 1BS3A 3VBHA 1BMV2 5JCOA 1LR1A 4MVZA 3B01A 1D7PM 1WWYA 4FPPA 4K3AA 1FKAO 4X6QB 2QTSA 4N43C 3ZRSA 5J9PC 2IJIA 2Q7GA 4RSUA 2C2AA 3H7YA 5BXZA 3ZR5A 1BHGA 2WNVC 3DXUA 1LJ7A 5L3BA 1NCRB 4UVCA 4CYDA 1E5SA 2HVKC 5CVRA 1Z2GA 2D5FA 5T54A 3OY8B 4S2DA 3TJTA 1G9DA 4J10A 1YHQV 5H9PA 4DV7B 1S5HC 2OVUA 2HYKA 2E32A 4UYBA 2JJ1G 5GM0A 2XJQA 3NKGA 4NRMA 3FB7C 4DV7O 4O2AA 2R062 1SDWA 4UW5A 3VDDC 3RGBA 4N9HA 1MS3A 1DQ1A 2QCSB 1UL9A 3N2GB 3OUHA 4I5SA 1ASJ1 5BNQA 5CFCC 5B3SB 5FZFA 3ZIWA 5IFTA 5L9BA 2HEYF 1VBA1 5CA3A 2QZ2A 4X8NA 1XU2A 2AYHA 2R6QA 5BYNA 1W8UA 1JCHA 3WF1A 5BNOA 1FXKC 4CH4A 4Y1UA 4Z82A 2HP8A 1YIJV 4BQ2A 4YGCA 4BW9A 3RSJA 1TE1B 1RSOB 2LRPA 5FKBA 4OYUA 4IV1A 2EX3A 2Q7EA 4O65A 1OOPA 4H0LB 2Y8KA 1Y66A 3E5XA 1LECA 1WP8A 3LGRA 3GB7C 4QPWA 4OHYA 3ZCCA 5LRSA 3SYPA 5LGTA 1H2NA 2C24A 5JI9A 2ARBA 1K5MC 3WNKA 4TQFA 4LO4B 4ARYA 1FAYA 5AC92 2NLRA 5LBFA 1S0IA 2PELA 4BH9A 4ZKIA 4HSLA 5LOVA 2JDIG 1YI2V 3MIGA 1Y9QA 1TG7A 4MGSA 2JICA 4YJ2B 4YXWG 4QX7A 4ZKTB 5C8CC 5FYUA 1T2XA 5EYXA 3NNLA 1R082 3AFKA 5E16A 1AF9A 2E3CA 2Q8VA 4G9SB 3LD8A 4GMP0 3ABLC 1ORQC 4MTGA 3E2EA 2ID4A 1WBFA 1C8NA 2GC0A 4LUMA 5C9AC 1Q86W 3I3BA 4RA0A 1PK6B 3P5BA 5BNPC 1GN6A 1R093 3U4XA 2BE3A 4UCOA 3IDBB
chains in the Genus database with same CATH topology
4LO7A 1GANA 3RNSA 2RS53 5T5PA 2HWB3 3D8CA 1U5YA 1LENA 2HWF1 3T2TA 3KSCA 3W59A 3H9AA 4LBQB 2VU9A 1IPKA 1HQLA 2RE9A 1MQTC 5FCCA 4AI3A 2D6KA 4JC1A 5KXCA 2EA7A 1VBB2 2YMZA 1X8MA 1MEC2 1RUC3 4K21A 4M3CB 4I02A 2R061 3MIHA 4DB5A 1A3KA 3ZXFA 3ZXGA 3VDDA 4N90A 1SCRA 5D8AA 1JXNA 1HQWA 1UZZA 2CWMA 1EAH3 5CFCA 3KMHA 3AZYA 3P3PA 1XXNA 4CDWC 2EXJA 1AR82 4XHBA 3M3CA 1LR5A 2GC1A 1YIPA 3U0ZA 2BFUL 4DS0A 4J6GA 4WM7A 1S55A 2IXIA 2X5IB 2ET1A 1QOSA 2VNGA 4E4ZA 1B35A 2NPIA 3W58A 4NHMA 2OZ6A 5L7OB 3FZ3A 4GQ7A 1CESA 4Q4W1 1AR93 4PCRA 2CY6A 2A6WA 5DUWA 5EYYA 2PFWA 2ZGKA 1XNKA 4OI2A 2BVBA 1PO11 3WQ1A 4FO9A 3X29B 2IZWA 4BLIA 1TMF3 2XKOA 3MPBA 3RJRA 5CA6A 1VLNA 3I59B 1HQNA 1JR7A 2QUOA 1A78A 4S2HA 2X53S 1JBCA 2ZZJA 3BIWE 5CAZA 1HKDA 3E97A 4BE3A 1CR7A 2JG9A 2IXKA 3S0MA 1O5LA 4QT6A 1OPMA 4AHXA 4AXOA 2WZR3 1RITA 2ZMNA 1S0CA 4GB32 4HVOA 4KG8A 5T3NA 3BALA 4LBOA 3I7DA 2EXHA 4JCKA 1N1SA 1SLIA 1WA4A 1FI2A 1J59A 1BVVA 2Y26A 3JB4C 1AYM3 3U10A 1AR63 1KJRA 2MEV3 1BYHA 2E51A 3B3QE 1YI7A 4JRAA 5L36A 1YFYA 3TRSB 5ACA3 3L9JT 3H50A 1CAWA 3PNAA 3UKVA 4XJUA 4Z1VA 4KWKA 3FLRA 4YGBA 4Y1VA 1K5MA 1YHFA 5I0TA 1V6JA 1Z7S2 3WOGA 3FE5A 4AEJA 1QGLA 5JOYA 4Q4X1 1H8TC 2VY0A 2VVFA 3WDTA 5AC91 4YZ3A 2WA3A 1YJKA 3DF0A 3ILRA 4AEKA 2CNAA 2YGLA 4XQDA 2G4IA 1X33A 1F8VA 2ZKLA 1Q8OA 1C1FA 1NXD1 2OPKA 1VBC2 2XKPA 4JGZC 3WDXA 3B69A 1VRH3 5C8CA 2XUMA 3MI8A 4DQAA 2XJSA 3RQ0A 1R081 4B29A 3WW3A 3SWTA 3MDPA 1NCQA 4A7YA 4GH4C 5SV5A 4QGLA 2OZJA 2Q1MA 1QJU1 2ZGUA 1V9U3 3WG2A 3NO8A 2OW4A 5C9AA 1YWKA 4JDOA 5IT6A 4FPHA 4RGGA 1IKPA 1COV1 1V6NA 2W0XA 3N7MA 4FFAA 3AP5A 5LEJA 1RUJ2 3PJQA 2HWC2 3GYDA 5L73A 3GZAA 1VIWB 2QE3A 1HXS3 2YUEA 1ND3C 5I93A 1VP6A 1QF3A 1RMU3 1N1TA 2ZPXA 1H2KA 1X82A 4XOGA 5C4WC 1FMD2 1VAKA 3APBA 4FPEA 3V17A 4E4SA 2H0BA 1TME2 4EWAA 3SH5A 1U5ZA 2ZBJA 1PHMA 1W6MB 1LULA 1VBB1 4IV3C 2NYYA 1MEC1 1ENXA 4CEWB 4PF5A 2FZ2A 1ZBA2 2DUPA 1DGWX 1PZ7A 1C8M2 1SLLA 1ULFA 1ZZ8A 4B3NA 3ZFEC 4QPGC 4IQPA 5DZFA 2XBO2 3AZWA 3NW4A 2JD4A 4AF9A 2XLFA 5IK5A 4JVAA 3RS6A 5T5LA 5T5OA 4D7TA 4RHV3 4EN6B 1AR81 3ENRA 5FOJB 3WD5A 1NZCA 4WBBA 4BA6A 3ZYIB 5BPXA 2IXHA 5DXDA 1MVEA 5CFDC 3O0WA 4EN0A 3ZSKA 4FVVA 4EWDA 4PBPA 3GBGA 2D5HA 2PHFA 1LEMA 4COWA 1NE4A 2NN8A 1FV2A 1UN1A 3ZSEA 4Y5Z0 1QNYA 3SISA 1NQJA 2DURA 1G7YA 4FXGB 4P5HA 5F5QA 4AG4A 4D69A 5J96B 4AFMA 1PIV3 3HAGA 2ZGNA 2ZGSA 5HCAA 5KC6A 2DUQA 2PYTA