4I9WA

Human two pore domain k+ channel traak (k2p4.1) - fab complex structure
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-swapped chain connectivity and gated membrane access in a Fab-mediated crystal of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
total genus 95
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4i9wA00
2WLKA 3OUSA 3UM7A 4QE9A 2Y69C 4QNHB 1OCCC 3ZJZA 3T2MA 3T4ZA 3ASNC 1R3LC 3F7VC 2WLNA 4KFMA 4P9OA 3STZC 2EIKC 3T4DA 4QE7A 3TETA 1K4CC 4GX0A 4LP8A 2AHYA 4P2ZA 5CBHA 1M57C 2OCCC 4DXWA 4J9YB 3K08A 4MVZA 4PA7A 3EFFK 2JK5C 4PA3A 1OCZC 1V55C 4TWKA 3SPIA 2A79B 1R3KC 2P7TC 3F5WC 3SYCA 3T1CA 4BW5A 2DWEC 2IH3C 1OCRC 3ASOC 4HZ3A 2WLLA 5J9PC 1BL8A 4XDLA 3K03A 4PDVA 3AG1C 3LDCA 2NLJC 1J95A 2A0LA 4XDKA 4MTFA 3RBZA 3RW0A 4R7CA 4GX1A 3LUTB 2Q6AA 2IH1C 4LBEC 4PA6A 5CBFA 2K1EA 4LCUC 5BZBA 3E8BA 3FB5C 2ITCC 3K04A 4JTCB 4OXSA 3WG7C 3RVZA 1XL4A 2ZD9A 3OGCC 2KB1A 4R50A 2WLLB 4MVUA 4WFFA 3K0GA 4RAIA 4MW3A 4RUEA 3FB6C 4PA4A 4G28B 4RUFA 1M56C 3PJSK 4F4LA 4MTGA 4PDLA 3TCUA 1KKDA 5KUMA 1V54C 2EINC 2ITDC 4MVOA 2EILC 2WLMA 3AG2C 3IFXA 4HYOA 3E83A 2EIMC 1R3IC 3ABKC 3OR7C 2WLIB 4MS2A 1LNQA 4WFHA 3GB7C 3E86A 5IY5C 4X8AA 2H8PC 2AHZA 4PDRA 3SYOA 2Q69A 1G4YB 3SPCA 2BOBC 3X2QC 3RVYA 2ZXWC 5EC1C 3E8GA 4ZBMA 2X6AA 2HVJC 2WLJA 4MVSA 2WLIA 3UKMA 3HPLC 2EIJC 3ZRSA 2A9HA 2HJFC 2YEVA 4P9PA 3FB7C 1JVMA 3SPGA 3ABLC 4WFGA 4GX5A 1QLEC 2X6BA 2HG5C 5E1AC 3E8HA 4MW8A 2W0FC 3SYPA 2HVKC 1ZWIC 3AG3C 2R9RB 3OUFA 2DYRC 4X88A 5B3SC 3SPHA 5B1AC 5CBGA 4H33A 3SJQC 4R8CA 4R6ZA 1K4DC 4I9WA 4MTOA 5B1BC 2ATKC 3AG4C 4H37A 4RO2A 3JYCA 1S5HC 4J9ZB 5EBWC 4G27B 4MVRA 3F7YC 3VOUA 2X6CA 3KG2A 4WFEA 5EK0A 2DYSC 4JTAB 3E8FA 3SPJA 1OCOC 5EC2C 2Q67A 4MVMA 4PA9A 3SYAA 2DWDC 5EBMC 4PDMA 4MSWC 4MVQA 3K0DA 4GX2A 3STLC 2WLHA 4XDJA 3OR6C 3ABMC 1XL6A 2BOCC 3LDDA 2QKSA 3BEHA 3IGAC 1P7BA 1R3JC 4JTDB 4UUJC 5EBLC 5KUKA 3R65A 1ORQC 4P30A 3LNMB 3E89A 3FB8C 4X89A 4CBCA 2Q68A 2HFEC 3K06A 3SYQA 2QTOA 4EKWA 3LDEA
chains in the Genus database with same CATH superfamily
2N05A 3G6EV 4JZ2A 1RM1C 1KP3A 4P9OA 1DGSA 5IWAB 5IWAO 4UCTA 2HHHO 1KUQA 2QTSA 2PI5A 1PL0A 3K03A 3RYCA 4K3AA 4D7TA 2R9IA 2WLLB 1BZKA 2A7WA 3OEHG 4XBFA 2UXNA 1QVFU 4KP4A 2F1MA 1NT2B 4LF5B 1WP8A 4PDLA 1GM7A 5JVDA 2HR3A 4MVOA 1XMOO 3AG2C 3CRAA 1I94O 2OYQA 3WU2Z 3JAWA 3TGUH 3D3QA 2CH7A 1T5EA 1AP6A 4DK0A 2CK3G 4NXMB 4JI4B 4JI4O 3JD1A 5LYJB 2JVDA 4Q20A 1QQCA 4JV5O 1Q6HA 5LGNA 4LNUA 2IU0A 2QKAA 2GUZA 4PHZA 4CC5A 1M56B 1WNSA 4X88A 3OD4A 5B1AC 1H2SB 5LHIA 2P6JA 2ZE7A 4J10A 1H2LA 4JI5O 2EBOA 1MSWD 1N36O 4WFBV 2E76B 2BTQA 1V9PA 4W4LA 5ITZB 2DYSC 2OIEA 1GH6A 1YVWA 3RYHB 3WG7B 4UCOA 1VQ8V 3N2KA 1RM1B 3DC6A 1FXKB 2OT5A 1KECA 3LDEA 2LJ2A 4IHJB 3F7VC 3H1HH 3QF7A 1XI1A 1KQSU 1FFTB 3CC4V 4LF4O 3H9VA 5A2QN 1QLNA 1FFXA 3ASOC 2WLLA 2ZE8A 4F6RB 3RBZA 1GK9A 2UXDO 4JI8O 5BZBA 2ITCC 5LMUB 4R50A 4JYAO 4X64O 1GN4A 4RAIA 4RUEA 1NH2B 5IYZB 2JRIA 5KA6A 2KQXA 3ETQA 5AG2A 2CGOA 1NZ6A 2P4VA 3JD2A 2H3OA 4O4JB 4LNUB 4JI0B 5FPOA 2EX3A 5IT9N 1DF4A 1N32B 3X2QC 1K7DA 3E8GA 2HVJC 3B8NA 4DV2O 3B77A 3ZMZA 1PL4A 1Q81W 1GRJA 4D7SA 2BTQB 2X7RB 4DUYB 1Z5VA 1IBMO 1H8HG 5CBGA 1MMMA 3MDSA 4I9WA 2V7QG 4DV1O 4DV1B 4YJ2B 4E4EA 3E2EA 4DW0A 4NXMO 1EFRG 2VWKA 3I55V 2Z5UA 3O65A 3UT5B 3SPJA 2RMKB 2Q67A 2LGQA 3UO2A 2UU9B 5B1NA 2YI8A 1OCOB 4JPRA 4I9QA 3K79A 3OR6C 4XDJA 2CUGA 3CEIA 5GW7A 1XMOB 5C8YB 4YJ3B 4TV8A 2F4VO 2E74B 2A06H 4DR3O 4I0XB 4JGSA 3KKYA 3OMNB 2ZR3A 2WLNA 4KFMA 1R6NA 4CH5A 5JCOA 1Q6IA 5JCOC 4O4IA 3JARA 3ASOB 5CBHA 1ZL8B 3B09A 4L87A 3GVMA 4DR4O 2DMXA 2P7TC 3D36A 4PJ0Z 2UXCO 3CWBH 2IH3C 1RPOA 3RYHA 2VRZA 5IE9A 2YIDA 3RW0A 4O4HB 4H44B 3LUTB 3P3NA 1N8RW 3ZMTA 1WA8B 3W7UA 4OXSA 4FZ1A 1S76D 4UCUA 1E79G 1OZ0A 3O9OA 4MVUA 5IJ9B 3AK3A 2DW4A 3JATB 4PA4A 3FB6C 2ZM6B 3PJSK 2PZSA 1HP8A 4RQFA 4O2BB 2Y4UA 3CXCU 5KMGB 3FFQA 1AP5A 4WFHA 1FXVA 5LYJA 4DRXB 1MNGA 3RVYA 1HWYA 1BHAA 5IJ0A 4EEQA 3JD0A 3S3WA 1L0NH 2ZE5A 4DV3O 4GYCB 1SRYA 5EIBD 2HG5C 2R9RB 4BWAA 2D3OW 3OT7A 5EZYA 3OAAG 3SPHA 4R8CA 4UFZA 3DGEA 1YITV 5HFLA 3RWRD 2OTLV 4JI8B 4AILC 1YHQV 1ZX3A 1JFFA 1WAZA 3QG5A 5EBMC 3HKDB 4RWUA 3STLC 1WPBA 2BTOA 3CRMA 4KL1A 3Q4HA 1OCCB 1NQTA 2Y0IA 2ZNJA 3QTCA 2Q68A 2CGNA 2FTKA 1NTKH 3K58A 1SS3A 4H13B 3W7SA 4DV7B 2R9AA 1ZL8A 4HBNA 5A9GA 1S5JA 1VARA 4IL6Z 1EBOA 4PV1B 1QBZA 4DV4B 4J9YB 1XNQB 3EFFK 3CCUV 4TSFG 2A79B 1FD9A 5H2FZ 4Z2WA 5IJ9A 1Y66A 4QPJA 4GKJO 3WFVA 1I08A 2F43G 4E2LA 4FFKA 3KZIZ 1AI5A 3JAWB 3JD3A 1NBMG 3K0GA 2AZ0A 3HKBA 5GONB 1AB3A 4TUYA 1K34A 1N32O 3HKEB 2QWPB 4X1KA 3ZRVA 2Q0OC 2WLMA 1NVPD 1L8DA 3B8MA 1U97A 4JI7O 4ZHQA 4DR5B 2XTAA 1XILA 4DR1O 1GM9A 3HR0A 4PDRA 4CH6A 4FZ0A 2R72A 3L75H 2RDCA 2M6YA 2YICA 3UO3A 3UKMA 1GMGA 2L6LA 4EB6B 2YEVA 3AG3B 3U11A 1XEQA 4BAYA 4NYKA 1QLEC 2W6IG 4PELA 2PI4A 1HDJA 2UXCB 2IJKA 1SA0A 3JATA 4OGQB 3P32A 1M1KW 4QGPA 2XAQA 4J9ZB 5LL6Y 1KBHA 5LMNB 4LFCB 4DYLA 5JQGB 2WLHA 3ETGA 4TQFA 3ABMC 3ICXA 1VQOV 1PPJH 3BEHA 1X59A 4HAMA 4DW1A 1KD1W 4P30A 5JJJB 2IJIA 2PTMA 3FB8C 2HFEC 1EZJA 3OTOB 1IVSA 2F95B 2A3QA 3RFRA 5KAFZ 2UUBB 4DR4B 2EIKC 1FPOA 5EIBC 3CP1A 2AHYA 1IXBA 1B6QA 3MD0A 2JK5C 4K0KB 4K0KO 1HNXO 3SYCA 1N34B 4IGGA 5LP6B 1BCCH 4PD4F 2WA4A 4XDKA 1S0VA 1PD3A 4GX1A 4ZIBA 4LBEC 2IH1C 4PA6A 3CCJV 2K1EA 1UPGA 2P4KA 2ZINA 2C2AA 4I4TB 1GTOA 2QWRB 2Q7HA 3CRRA 3DC5A 1ZUQA 4MT8A 1IURA 3TCUA 3EVKA 3OTFA 1Y67A 1VF5B 1SC5B 5JH7B 2FB5A 2ADPA 3ABKC 1O9GA 5B3SB 4YY3B 2N74A 1QLEB 1M5IA 4JI2O 1Y6XA 1I5XA 1I5YA 3A2FA 3FB7C 4X20B 3W7XA 1TA8A 1JOYA 1PNMA 2VS0A 2QEXV 3RYIB 2UXXA 2P06A 5B3SC 2Y48A 2RN9A 2DYSB 1V55B 1AVMA 3BVOA 4CS3A 3JALA 4MVMA 4MSWC 3R66A 3LSSA 5BR8O 1SKVA 2UXDB 1W0JG 1NR1A 4DV5O 4X89A 4LF9B 1K5QA 3JSNA 2VQEB 4X64B 3P3PA 2WLKA 4GKKB 4D6TH 2QWQB 2R70A 4DV4O 4UCVA 3ZJZA 2P90A 1F4MA 2UXBO 3CRQA 1E1QG 2EULA 4UVCA 1N0JA 1KC8W 4EFBA 4JYBA 2OCCC 4ASUG 3DTUB 4PA3A 1V55C 3TXQA 1Q8IA 1ROPA 1VP7A 4X1YB 5LHGA 4JYYA 2UUAO 2CDYA 5J9PC 3IAYA 3HKDA 4ZKIA 1VF6A 1WLEA 3ZHRA 4KXRA 1VQ4V 3BABA 1HW7A 5GONA 4DR2B 4YIOA 2MW2B 3ZHVA 2EIMB 1QU7A 4WFFA 3WB1A 2GV9A 3ZBHA 2ARHA 3ZHUA 1N33B 3RYFB 5IYDO 1N33O 1M57B 5B1BB 1JPXA 2Y0PA 2Q5ZA 2B9ZA 1YXBA 2UUBO 2AHZA 3SYOA 2Q69A 1LUVA 2YEVB 1Q90D 4ZBMA 3CMAV 3M99B 2WLJA 2WLIA 1L0LH 1CPYA 3OM3B 3CCRV 3GWOA 3UT5A 1FJGO 1AR4A 1NI8A 3ASNB 2HVKC 1XBLA 4CC6A 5JJEB 4X66O 3FYEB 3JALB 3OGIB 5JWPA 4BIZA 2GTSA 4OX9B 5LP6C 1H2MA 1FXKA 2LW1A 5EBWC 2WAMA 4FLWA 2JIZG 2JGDB 3VQXA 5DEDA 4LH7A 2P67A 2ZIMA 1YEWA 2QKSA 3LDDA 1R3JC 3CMEV 2Z0AA 3AG1B 3R65A 1ORQC 2EIJB 1ZAUA 2F4VB 4Q6GA 1JA8A 1SQPH 4LF7B 1S72V 3P30A 4UB6Z 3W7TA 2LFRA 4YY3O 2GHYA 2QGNA 4I5SA 1W2BU 4JI2B 3FAVB 4P2ZA 4L8JA 1AI4A 4FFBB 3MAQA 4B7EA 2Q0AA 3SR2C 1N0NA 3AG2B 4FLXA 4PDVA 1O9HA 2YXLA 4O4JA 2KB1A 2D2CB 3T1HB 2GSMB 1S3JA 4F4LA 3H1LH 1QVGU 2ITDC 2IU3A 4HNAA 2XUMA 5IY5C 4JAVA 4X8AA 2H8PC 5L3FA 1YF2A 3ABTA 3TXSA 2ZXWC 3G4SV 1B06A 2ILMA 2L35A 1TUBB 3M8AA 2CTRA 4ABMA 1TUEB 2RNBA 4NR1A 3EXAA 3BAAA 2EJ7A 2HKOA 4NXNB 5KHGA 1P49A 4LF4B 2F23A 3CPWU 1U96A 2YDEA 4WFEA 3ETEA 4DV5B 3HKBB 1WN7A 2E75B 1PKXA 4O2AB 4K8ZA 1AJNA 2DWDC 4A5UB 1NJIW 2AGAA 2LW7A 4JI1O 4BIOA 5DM6V 3ZMUA 3HKCA 3SJCC 1BMFG 2Y69C 3G67A 1BSMA 1XMQO 1GO3F 4DV0O 3G71V 5KHJA 3E22A 3ZHSA 2VQEO 1TAEA 2AW9A 4MTXA 1IBKB 4FMTA 2LO1A 3OMAB 4PA7A 1B3QA 4FLUA 1N36B 3CCEV 1IBMB 1NR7A 1OCRC 1AILA 4PI2A 4XDLA 1Q5OA 3APOA 2AXTZ 1K8AW 3N2KB 3ABUA 4MTFA 1OCZB 2K9PA 5CBFA 3G80A 3IC9A 3ZHTA 2EIKB 2XASA 4MTGA 1ENVA 5KUMA 5BMVB 2QA4V 3LNNA 1SETA 4JI6B 1SESA 4FIPC 2QE7G 3L74H 4N21A 2JS5A 1MG1A 3JCUZ 1R1BA 1DTOA 1Y74A 3KCYA 2UUCO 4FLTA 2EIJC 1URFA 1YIJV 1JFFB 2FYUH 5E1AC 1VQKV 3E8HA 1H2NA 3ABLB 1SQXH 3QO7A 1Q6UA 2CE4A 2V1DA 1QNMA 1XQ8A 1IXMA 2RJZA 4UCRA 4O2BA 4FJCC 3AG4C 4I4TA 3ZHQA 4EFEA 3F7YC 1WP7A 3ETDA 2YIAA 1Q43A 3PN1A 1FKAO 1BE3H 1IZ3A 3CE2A 3E8FA 4UCSA 3RN4A 3HKCB 4LFAB 2ZIOA 3I5DA 2UXBB 1YJ9V 1EN6A 4LF7O 1M90W 2E5LO 4UV9A 5LBQA 1SZTA 2CTQA 2BOCC 2ZT9B 4J7JA 4UXNA 4YIPA 4JTDB 4DRXA 5FNVA 1PP9H 4QIWF 1S5LZ 1NH2D 3A0BZ 3JARB 4C7UA 1SQVH 5LHHA 3T2MA 2QM4A 2RQ6A 1P84F 3ZX6A 4FLYA 3DSQA 1MSDA 5IY5B 1RSOB 1NKDA 5CA3A 1SQGA 1OCRB 4U3JB 4DV3B 3BA8A 5J2TB 2PF4E 1THZA 3SPIA 3LSUA 4I50A 4LF8B 1HR0O 4GT1A 1HNWO 3SJAC 1R6KA 4X9QA 1J95A 1EM1A 2DOSA 3RT3C 3AK1A 4LCUC 3I56V 5EYPB 1JX9A 5TISZ 3WB2A 5CB4B 4MW3A 3VQYA 4DUZB 4DUZO 1HNZO 2QDOA 3BY6A 4CH4A 3H1IH 4NTWA 4DUYO 3E83A 4O4IB 1PNLA 3FAVA 3L9DA 2HP8A 3D8CA 5IJ0B 1LNQA 2DQ0A 4DV7O 2GUZB 4KHPB 4AHCA 1KP2A 4KHPO 2H94A 4X20A 2PYJA 5EC1C 1HR0B 1HNWB 1BQZA 1JR9A 1LR1A 1R73A 2JEXA 4P9PA 5KHHA 2KG7A 3ABLC 2EJRA 4UV8A 5LOVB 4TUYB 4FM0A 1GM8A 1GN6A 2Q8VA 4R6ZA 2Q7GA 2ZM6O 5BMVA 3QO8A 2JDIG 4J41A 4GKJB 1OCOC 2Q4PA 5CMUA 3AG7A 5C93A 4J42A 5BR8B 5DECA 3CC7V 3OMIB 1F7YA 4B3TB 3LNMB 3E35A 4TWKA 1WB8A 4EKWA 3JD4A 1IBKO 1VQNV 3SGIA 3ASNC 3KCXA 3VBBA 3F5TA 3WB0A 3CYOA 1H8EG 2UUCB 5LA6B 4LF6O 1WPXA 5BY1A 1YTFB 4LFCO 2ZNIA 4UB8Z 3DXRB 3ZS8C 4DR7O 2CTPA 2P5OA 1R3KC 4W4KA 4BW5A 2VQFB 1WJZA 4J80A 5L3EA 3J81N 1P7GA 4X62B 1DK1A 2G38A 3LDCA 1GAXA 1KU9A 1EN4A 3FB5C 3CRCA 4U7NA 3S3XA 1Q86W 2B1GA 3RYFA 4QPKA 2JJ1G 2IW5A 3B2EE 2XAGA 1TUBA 3OR7C 3ZN0A 3AK2A 3RYIA 1OJHA 4DV6O 3CXHF 3K5OA 3H1JH 3J7AU 1BHBA 4DO2A 3ZMSA 3C3TA 2HJFC 1M4UA 4X62O 2F66C 2X6BA 2QM8A 4IIJB 5CA1A 4TT3G 4PI0A 4H0LB 5GTIZ 2QM7A 2QR4A 3CX5F 3AG4B 5KLVH 2P22C 2IBZH 2O57A 1J5EB 2QJ1A 3X2QB 3W7WA 4J11A 3JAMN 4UUJC 1KYOF 1Y76A 4O4LB 4Z1VA 3K5LA 2NR5A 3JCZA 2DN9A 3QNEA 5LA6A 4LF5O 3IJ4A 2ZQMA 2EILB 1BQ0A 4B7KA 5LOVA 3STZC 5L3CA 3IC7A 3T4DA 3A0HZ 3A0RA 2NN4A 3TETA 3N2GB 1K33A 3T1YB 2JGUA 1YJWV 3OEEG 3VQVA 3CD6V 1QR8A 1H2KA 2WSSG 1M9NA 1OHHG 4OPAA 1IDSA 1YSCA 2ZDIA 3LSQA 5JQGA 3CCLV 1XNQO 1NU1H 1YTFD 4B3MO 3VQWA 2NLJC 3CJHB 4DR5O 2PYLA 4Z1MG 4LF8O 2ZD9A 3T1HO 4NXNO 1P4RA 1Q3EA 2KKWA 1KB9F 1VQMV 2PUSA 2FL4A 4NVPA 1NTZH 5IDJA 2HEPA 2XAJA 2ZXWB 3GB7C 3E86A 3CCQV 4K35A 1HNZB 5KA5A 3ZRXA 4I7ZB 1E1RG 1BGYH 1HNXB 4FM2A 3ZRSA 3BRCA 3L73H 4X66B 1Z5WA 2WPDG 4DR1B 3UQ8A 1JVMA 1TVKA 1PM9A 4WFAV 1XMQB 3OUFA 2LP7A 4JI0O 3ML0A 2BE3A 4CS4A 4KUMA 4MTOA 5B1BC 3FYIB 4RO2A 4H37A 4BIUA 4GLXA 2DJVA 3JYCA 4YXWG 1IX9A 4B3TO 4MVRA 1JJOA 3KG2A 1VMGA 2ZR2A 3ZCCA 4PA9A 3BFRA 3U10A 1B04A 1BT8A 2ZE6A 3U0ZA 1P7BA 3ZMVA 1G1XB 4QE9A 4QNHB 1Q7YW 3EHBB 4OX9O 4IIJA 4DR7B 3ZN1A 5LGUA 4WBNA 5J2UB 4N23A 1K4CC 2UU9O 1NTMH 4GX0A 4LP8A 5H5NA 3SJBC 3OW2U 2PY5A 2W0XA 4MVZA 5IYCO 3ZRWA 3F5WC 4ZOLB 4ZI7A 1DLBA 2WWWA 4IYHA 1FJGB 4B3SO 2F93B 4R7CA 2FKXA 2JGDA 2VQFO 1L1FA 3FKSG 1OV9A 1K92A 2Y4TA 4AQYO 1D5NA 2YI9A 4LC1A 1M56C 3ZIAG 1RPRA 2DE0X 1RSOA 5BXZA 1KKDA 1XREA 2N04A 3THOA 3JASB 2OWOA 3L72H 1WB7A 4JAUA 4EB6A 1K9MW 2JEUA 1FAFA 2ODMA 1D5AA 2BOBC 4FFBA 4U3JA 4TV8B 5B1AB 3CB2A 4ZHQB 4I50B 1EN5A 1YCIA 3C90A 1ZWIC 1JQ0A 3CCSV 2XOKG 5IYBO 4K8XA 4LF9O 4DR2O 1K97A 2ATKC 5GTHZ 4YHHO 4X65O 5FNVB 1D2DA 5EYPA 1XDCA 1SZXA 2IM9A 5F2VO 1QCEA 4JYCA 4NKGB 5LXTB 1SQFA 1LUWA 2HLDG 1QR9A 2DQ3A 2Q7EA 3TJTA 5KX5B 4DR6B 2CAZC 4BW9A 4O4HA 1Q82W 5FPRA 1SERA 1YZBA 2Z3YA 5JVDB 5KHKA 5LMUO 2E3CA 4I0XA 5KMGA 1FXHA 4X65B 4NB5A 2IJHA 2DWEC 3D36C 1F51A 3A8TA 1N4CA 4U7OA 4O2AA 1GKFA 4CZZA 3L70H 1QHTA 3QO5A 5H6QA 1PNKA 1I7FA 3ZEDA 2X0LA 4LWSB 2GTAA 2BSKB 5LGTA 3J80N 2QKCA 1AROP 4JI1B 1V54C 2LGWA 2EINC 4JYAB 4B3RO 2DYRB 4X1IB 4B3SB 4WF9V 3ZRWB 4DK1A 4UVBA 3TK1A 3DXRA 2ZKOA 2X6AA 2LFSA 2XAFA 1ZLZA 5B1OA 2EINB 4J7ZA 1NS1A 4GX5A 1KMIZ 1MOFA 3SYPA 2CH7B 2OCCB 5FL7G 2DYRC 4DV2B 5LXTA 3BHPA 4LFAO 5B5EZ 1S5HC 4FPPA 4B08A 3RYCB 4F6RA 2YIBA 1ZTEA 4PDMA 2XHBA 1Y74B 3IGAC 1VEWA 4YJ2A 4JI6O 2QWOB 3K5MA 4FK5C 3E22B 3UM7A 5ITZA 4FM1A 5CN0A 2ETNA 5J2UA 1YI2V 4YHHB 3HKEA 5LMNO 4DR3B 2Q9LA 5DN6G 1M57C 4YJ3A 1OCZC 4LR3A 4DR6O 3OFNG 1CP9A 3T1CA 1MA1A 4BR6A 1RP3B 1VQ7V 3D3IA 4G2KA 4NTYA 1YJNV 2B1IA 4LWSA 2M7WA 1BL8A 3FX7A 1VQ5V 4ICGA 1FFXB 3HB3B 2QSAA 1SQBH 4GCZA 1S77D 2BCCH 2XNDG 4TQDA 1SA0B 4JI3B 4QJFB 1VIBA 4RUFA 2EZOA 2IJJA 1V54B 5EZYB 3UCSC 1VQ6V 2OCHA 3B40A 4TOIA 2EILC 4NTXA 3IFXA 1TGOA 1F23A 2WLIB 2E5LB 4MS2A 5CA1B 3K3WA 1J5EO 2OIGA 3N27A 1RFYA 3SPCA 4I55A 4IHJA 1Z2GA 4IT5A 4J7KA 2Q73A 1H38A 3BCCH 3NXSA 4LFBB 4GUNA 4WFGA 2GBOA 5E79Z 2V4DA 3CC2V 5KHIA 1I94B 1SQQH 1VQLV 3SDLA 1AR1B 5CA0B 1K4DC 1XHXA 2OTJV 5CB4A 3CHXA 4LH6A 1N34O 2XAHA 1VF7A 3VOUA 4OPHA 5H6RA 3SYAA 4DV0B 3K0DA 1KKCA 4GKKO 2KSDA 1XL6A 5FLXN 1VQPV 3ABMB 5KUKA 3K9SA 1R6TA 4CBCA 2RCVA 3OGCC 3OUSA 3N2GA 3B4SA 2LQTA 3T4ZA 1R3LC 5J2TA 1CXZB 2CTWA 2W6JG 4U3FH 5IYZA 4QE7A 3K57A 3ABKB 5JH7A 5D5QA 4X1KB 4DXWA 3QVNA 5C8YA 1H2GA 3K08A 1F4NA 3CJHA 1W0KG 1MZEA 4HZ3A 2ADQB 2JS3A 1AI6A 3AG1C 3JASA 3E8BA 2VWJA 4B3RB 2BSKA 1XL4A 4RQEA 1X4TA 1XNRO 1UJWB 3JSLA 2WA3A 1AJQA 3BA9A 4G28B 4LF6B 2ZCEA 4WBNB 3H01A 3L71H 4TV9B 1NVPB 1US6A 1ZSPA 4WCEV 4JV5B 2PGGA 2B5UA 1WA8A 3OE7G 1CEZA 3NR7A 4ZI7B 2NNUA 1M93A 3BPZA 2KG7B 3Q4HB 1G4YB 2MK3A 4GZRB 1AR5A 2Y69B 5JJNB 1GN2A 3JAKA 2QWNB 4HNAB 2A9HA 1K73W 4JI5B 5K1XA 2W0FC 1XHZA 3CCMV 3OTOO 1YDXA 4H33A 1BS3A 3K5NA 4FVMA 2JJ2G 4F6EA 1MABG 3MHSC 5EK0A 4DV6B 5B66Z 2HHHB 1VQ9V 3H1KH 4GX2A 4AI8A 1XOUA 4I55B 1A32A 5EBLC 1PV0A 3E89A 2EZPA 4FLZA 4AQYB 4ZOLA 3MHHC 5HFMA 1OCCC 4JF3A 2YIBD 1TVKB 1AI7A 2FMLA 5CA0A 2YXYA 2YC0A 3K59A 4FLVA 2ZDIC 1Y4MA 5K1PA 2YUAA 3CS5A 3G6BA 1JJ2U 1JMKC 1W59A 4UVAA 4JI3O 1Y76B 2HJDA 3RGBA 4CH3A 1VF6C 2A0LA 2XT9A 2YS8A 5L3DA 2Q6AA 3C3SA 3K04A 4JTCB 1G6UA 3WG7C 3RVZA 1EZVH 5LP6A 5D5PA 1FXKC 3M7MX 2YXHA 3T1YO 1MZFA 2YSUB 1AJPA 4JAAA 4HYOA 1DF5A 3APQA 3FD9A 1R3IC 2EIMC 1IBLB 1FS0G 1IBLO 1SF9A 3JAKB 3K9AA 2GDSA 4CS2A 1COWG 2AZ2A 3AEIA 4JASA 4MVSA 5KAIZ 3HPLC 3CSXA 1I0HA 1K3EA 3SPGA 4JZGA 4MW8A 3AG3C 1UFIA 1JCHA 4IYIA 3SJQC 1G8MA 1GN3A 5H9CA 4LFBO 4TV9A 5L3GA 3GWKC 4G27B 2X6CA 5KX5A 4JTAB 5EC2C 5L3BA 4JI7B 4O4LA 1XNRB 1FYJA 4B3MB 4MVQA 4X1YA 3CCVV 2UUAB 1K5SA 4X1IA 1XUQA 3K06A 3SYQA 2QTOA
chains in the Genus database with same CATH topology
3G6EV 2Z3YA 5LHHA 3T2MA 1RM1C 1KP3A 4P9OA 2EIKC 5IY5B 1NKDA 3CP1A 5CA3A 2AHYA 1OCRB 1FXHA 1B6QA 3MD0A 2JK5C 1THZA 3SPIA 3SYCA 2IJHA 2DWEC 1F51A 2PI5A 4GT1A 1PL0A 4U7OA 3K03A 1R6KA 1GKFA 4CZZA 1J95A 4XDKA 1S0VA 1PD3A 4GX1A 4LBEC 2IH1C 4PA6A 2R9IA 3CCJV 2K1EA 3QO5A 4LCUC 5H6QA 3I56V 1PNKA 2C2AA 1JX9A 1GTOA 2X0LA 2WLLB 3OEHG 4MW3A 4XBFA 2UXNA 1QVFU 4KP4A 4MT8A 5LGTA 4PDLA 3BY6A 1AROP 3TCUA 1V54C 1GM7A 2EINC 2HR3A 4MVOA 3AG2C 3E83A 1PNLA 3ABKC 1LNQA 2DQ0A 2DYRB 5B3SB 2CK3G 4WF9V 3ZRWB 1KP2A 3JD1A 1QLEB 2H94A 4UVBA 3TK1A 5EC1C 4Q20A 2X6AA 1R73A 5LGNA 2XAFA 2LFSA 2JEXA 1I5XA 1I5YA 4P9PA 5B1OA 2IU0A 2EINB 3FB7C 3W7XA 3ABLC 1JOYA 1PNMA 4GX5A 2EJRA 1MOFA 4UV8A 3SYPA 2QEXV 1M56B 2UXXA 2OCCB 5FL7G 2DYRC 4X88A 5B3SC 2Y48A 5B1AC 1GM8A 5LHIA 4R6ZA 2P6JA 2DYSB 2EBOA 1S5HC 1MSWD 3QO8A 1V55B 4FPPA 4WFBV 2DYSC 2JDIG 1OCOC 4MVMA 5CMUA 5C93A 4PDMA 4MSWC 3LSSA 3WG7B 1VQ8V 3CC7V 3OMIB 3IGAC 1W0JG 1RM1B 1NR1A 1FXKB 3LNMB 3E35A 2OT5A 4X89A 1KECA 1K5QA 4TWKA 4EKWA 3LDEA 4FK5C 2WLKA 3JD4A 3UM7A 5CN0A 1VQNV 3ZJZA 1YI2V 3ASNC 3F7VC 2P90A 3VBBA 1F4MA 3CYOA 1H8EG 1E1QG 4UVCA 1WPXA 1KQSU 5DN6G 1M57C 1KC8W 1YTFB 4JYBA 2OCCC 1FFTB 3CC4V 4ASUG 3DTUB 4PA3A 1OCZC 1V55C 1R3KC 1CP9A 3OFNG 3T1CA 4BW5A 1ROPA 1QLNA 5LHGA 1VQ7V 3D3IA 4G2KA 3ASOC 1YJNV 2B1IA 5L3EA 2WLLA 5J9PC 2M7WA 1BL8A 4ZKIA 1VQ5V 3RBZA 3LDCA 1WLEA 1GK9A 3HB3B 1VQ4V 5BZBA 3FB5C 2ITCC 4GCZA 1S77D 4R50A 4U7NA 1Q86W 2EIMB 4WFFA 2B1GA 2XNDG 4RAIA 4QJFB 4RUEA 4QPKA 4RUFA 2JJ1G 2EZOA 2IJJA 1V54B 1NH2B 1VQ6V 2IW5A 5KA6A 2EILC 5IYDO 1M57B 2XAGA 3IFXA 5B1BB 1F23A 1JPXA 3JD2A 3OR7C 2WLIB 4MS2A 3K3WA 3ZN0A 1DF4A 2AHZA 3SYOA 2Q69A 3SPCA 3X2QC 2YEVB 1BHBA 1K7DA 3E8GA 4DO2A 4ZBMA 3CMAV 3M99B 3ZMSA 2HVJC 2WLJA 3B8NA 2WLIA 1H38A 2HJFC 1CPYA 3B77A 3NXSA 3OM3B 3CCRV 3GWOA 3ZMZA 4WFGA 2X6BA 1Q81W 3CC2V 2QM8A 3ASNB 2X7RB 2HVKC 1VQLV 1H8HG 5CBGA 1AR1B 3FYEB 4BIZA 1K4DC 4I9WA 2V7QG 4TT3G 2OTJV 1FXKA 2XAHA 2QM7A 5EBWC 2WAMA 3E2EA 3VOUA 2JIZG 1EFRG 3AG4B 3I55V 2Z5UA 3SPJA 2Q67A 5H6RA 3SYAA 5B1NA 1OCOB 3K0DA 4JPRA 3K79A 3OR6C 4XDJA 3X2QB 3W7WA 1XL6A 2P67A 3LDDA 2QKSA 3ABMB 1VQPV 1R3JC 4UUJC 3CMEV 5KUKA 3AG1B 5GW7A 3R65A 1ORQC 2EIJB 4CBCA 3OGCC 3JCZA 3QNEA 3OUSA 2ZQMA 4JGSA 1S72V 2EILB 3P30A 3OMNB 3T4ZA 3W7TA 1R3LC 2LFRA 2ZR3A 2WLNA 4KFMA 2GHYA 1R6NA 3STZC 5L3CA 3IC7A 2W6JG 3T4DA 3A0RA 4QE7A 3TETA 4I5SA 1W2BU 1K33A 3ABKB 4P2ZA 3ASOB 5CBHA 4DXWA 1AI4A 1H2GA 3K08A 1YJWV 4L87A 3OEEG 1F4NA 3D36A 2P7TC 3CD6V 1QR8A 1W0KG 2IH3C 1RPOA 2WSSG 1M9NA 1OHHG 4HZ3A 1YSCA 2ZDIA 3LSQA 3CCLV 1AI6A 3AG2B 4PDVA 1YTFD 3AG1C 3RW0A 2NLJC 3LUTB 1N8RW 3ZMTA 3E8BA 4Z1MG 3W7UA 4OXSA 1XL4A 2ZD9A 1S76D 2KB1A 1E79G 1OZ0A 4MVUA 4RQEA 2GSMB 1UJWB 1S3JA 1P4RA 2DW4A 3FB6C 4PA4A 1AJQA 4G28B 1VQMV 3PJSK 4F4LA 3H01A 1NVPB 1QVGU 4RQFA 2ITDC 2IU3A 3CXCU 5IDJA 4WCEV 2XAJA 2B5UA 4WFHA 2ZXWB 1FXVA 3E86A 3GB7C 3OE7G 4JAVA 5IY5C 1CEZA 3CCQV 4X8AA 2H8PC 2NNUA 5L3FA 5KA5A 1G4YB 2MK3A 3ZRXA 1E1RG 3ABTA 2Y69B 3RVYA 2ZXWC 3G4SV 1HWYA 1BHAA 3ZRSA 2WPDG 3JD0A 2A9HA 1K73W 1JVMA 1SRYA 1TUEB 2HG5C 2W0FC 4WFAV 3CCMV 2R9RB 3OUFA 2D3OW 2LP7A 3OAAG 3SPHA 2HKOA 3ML0A 4H33A 4R8CA 4KUMA 4MTOA 5B1BC 3FYIB 4RO2A 4H37A 4BIUA 2JJ2G 3JYCA 1YITV 3DGEA 4YXWG 3CPWU 5HFLA 2OTLV 4MVRA 1MABG 3KG2A 4WFEA 1YHQV 3MHSC 3ETEA 5EK0A 2ZR2A 1PKXA 3ZCCA 4PA9A 1AJNA 2DWDC 5EBMC 1VQ9V 4GX2A 3STLC 1NJIW 1P7BA 5EBLC 5DM6V 1OCCB 1NQTA 3E89A 3ZMUA 2EZPA 2Q68A 2FTKA 3ZMVA 1BMFG 3MHHC 4QE9A 2Y69C 4QNHB 5HFMA 1OCCC 3W7SA 1Q7YW 3EHBB 4JF3A 3ZN1A 5LGUA 1AI7A 1GO3F 4N23A 1K4CC 1EBOA 4GX0A 3G71V 4LP8A 3OW2U 1QBZA 2ZDIC 1Y4MA 4MTXA 4J9YB 4FMTA 3OMAB 1JJ2U 4MVZA 4PA7A 3EFFK 5IYCO 3CCUV 4TSFG 2A79B 3ZRWA 3F5WC 3CCEV 1NR7A 1DLBA 1OCRC 2WWWA 4UVAA 1Y66A 4QPJA 4XDLA 3WFVA 2F43G 4E2LA 2A0LA 1K8AW 4MTFA 3ABUA 1OCZB 4R7CA 5L3DA 2Q6AA 5CBFA 3K04A 1AI5A 4JTCB 1L1FA 3WG7C 3RVZA 3JD3A 1NBMG 3FKSG 1K92A 3K0GA 1FXKC 4LC1A 1M56C 3ZIAG 1RPRA 2EIKB 2XASA 4MTGA 1ENVA 1K34A 1KKDA 5KUMA 2YSUB 1AJPA 2QA4V 1SETA 3ZRVA 2WLMA 1SESA 1DF5A 4FIPC 2QE7G 4HYOA 1R3IC 2EIMC 3B8MA 1FS0G 4JAUA 4N21A 1NVPD 3K9AA 1K9MW 2JEUA 1MG1A 1GM9A 4PDRA 2BOBC 1DTOA 1COWG 3AEIA 4JASA 1GMGA 4MVSA 5B1AB 3UKMA 3HPLC 2EIJC 2YEVA 3AG3B 1K3EA 3SPGA 1YIJV 4BAYA 1QLEC 5E1AC 1VQKV 2W6IG 4PELA 3E8HA 4MW8A 2PI4A 3ABLB 1ZWIC 1JQ0A 3AG3C 3CCSV 2XOKG 5IYBO 1JCHA 3QO7A 2V1DA 3SJQC 2IJKA 1IXMA 1G8MA 3P32A 4FJCC 1M1KW 1K97A 2ATKC 3AG4C 2XAQA 5H9CA 5L3GA 4J9ZB 4G27B 3F7YC 3ETDA 2X6CA 1QCEA 4JTAB 4JYCA 3E8FA 5EC2C 5L3BA 2HLDG 1QR9A 4MVQA 1YJ9V 1M90W 2DQ3A 2WLHA 3ETGA 4UV9A 5LBQA 1SZTA 3ABMC 2BOCC 1VQOV 3BEHA 4HAMA 4UXNA 4JTDB 3CCVV 1Q82W 1KD1W 4P30A 3FB8C 2IJIA 1K5SA 2HFEC 3K06A 4QIWF 3SYQA 2QTOA 1EZJA 1SERA 1NH2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLK A;  3OUS A;  3UM7 A;  4QE9 A;  2Y69 C;  4QNH B;  1OCC C;  3ZJZ A;  3T2M A;  3T4Z A;  3ASN C;  1R3L C;  3F7V C;  2WLN A;  4KFM A;  4P9O A;  3STZ C;  2EIK C;  3T4D A;  4QE7 A;  3TET A;  1K4C C;  4GX0 A;  4LP8 A;  2AHY A;  4P2Z A;  5CBH A;  1M57 C;  2OCC C;  4DXW A;  4J9Y B;  3K08 A;  4MVZ A;  4PA7 A;  3EFF K;  2JK5 C;  4PA3 A;  1OCZ C;  1V55 C;  4TWK A;  3SPI A;  2A79 B;  1R3K C;  2P7T C;  3F5W C;  3SYC A;  3T1C A;  4BW5 A;  2DWE C;  2IH3 C;  1OCR C;  3ASO C;  4HZ3 A;  2WLL A;  5J9P C;  1BL8 A;  4XDL A;  3K03 A;  4PDV A;  3AG1 C;  3LDC A;  2NLJ C;  1J95 A;  2A0L A;  4XDK A;  4MTF A;  3RBZ A;  3RW0 A;  4R7C A;  4GX1 A;  3LUT B;  2Q6A A;  2IH1 C;  4LBE C;  4PA6 A;  5CBF A;  2K1E A;  4LCU C;  5BZB A;  3E8B A;  3FB5 C;  2ITC C;  3K04 A;  4JTC B;  4OXS A;  3WG7 C;  3RVZ A;  1XL4 A;  2ZD9 A;  3OGC C;  2KB1 A;  4R50 A;  2WLL B;  4MVU A;  4WFF A;  3K0G A;  4RAI A;  4MW3 A;  4RUE A;  3FB6 C;  4PA4 A;  4G28 B;  4RUF A;  1M56 C;  3PJS K;  4F4L A;  4MTG A;  4PDL A;  3TCU A;  1KKD A;  5KUM A;  1V54 C;  2EIN C;  2ITD C;  4MVO A;  2EIL C;  2WLM A;  3AG2 C;  3IFX A;  4HYO A;  3E83 A;  2EIM C;  1R3I C;  3ABK C;  3OR7 C;  2WLI B;  4MS2 A;  1LNQ A;  4WFH A;  3GB7 C;  3E86 A;  5IY5 C;  4X8A A;  2H8P C;  2AHZ A;  4PDR A;  3SYO A;  2Q69 A;  1G4Y B;  3SPC A;  2BOB C;  3X2Q C;  3RVY A;  2ZXW C;  5EC1 C;  3E8G A;  4ZBM A;  2X6A A;  2HVJ C;  2WLJ A;  4MVS A;  2WLI A;  3UKM A;  3HPL C;  2EIJ C;  3ZRS A;  2A9H A;  2HJF C;  2YEV A;  4P9P A;  3FB7 C;  1JVM A;  3SPG A;  3ABL C;  4WFG A;  4GX5 A;  1QLE C;  2X6B A;  2HG5 C;  5E1A C;  3E8H A;  4MW8 A;  2W0F C;  3SYP A;  2HVK C;  1ZWI C;  3AG3 C;  2R9R B;  3OUF A;  2DYR C;  4X88 A;  5B3S C;  3SPH A;  5B1A C;  5CBG A;  4H33 A;  3SJQ C;  4R8C A;  4R6Z A;  1K4D C;  4I9W A;  4MTO A;  5B1B C;  2ATK C;  3AG4 C;  4H37 A;  4RO2 A;  3JYC A;  1S5H C;  4J9Z B;  5EBW C;  4G27 B;  4MVR A;  3F7Y C;  3VOU A;  2X6C A;  3KG2 A;  4WFE A;  5EK0 A;  2DYS C;  4JTA B;  3E8F A;  3SPJ A;  1OCO C;  5EC2 C;  2Q67 A;  4MVM A;  4PA9 A;  3SYA A;  2DWD C;  5EBM C;  4PDM A;  4MSW C;  4MVQ A;  3K0D A;  4GX2 A;  3STL C;  2WLH A;  4XDJ A;  3OR6 C;  3ABM C;  1XL6 A;  2BOC C;  3LDD A;  2QKS A;  3BEH A;  3IGA C;  1P7B A;  1R3J C;  4JTD B;  4UUJ C;  5EBL C;  5KUK A;  3R65 A;  1ORQ C;  4P30 A;  3LNM B;  3E89 A;  3FB8 C;  4X89 A;  4CBC A;  2Q68 A;  2HFE C;  3K06 A;  3SYQ A;  2QTO A;  4EKW A;  3LDE A; 
#chains in the Genus database with same CATH topology
 2N05 A;  3G6E V;  4JZ2 A;  1RM1 C;  1KP3 A;  4P9O A;  1DGS A;  5IWA B;  5IWA O;  4UCT A;  2HHH O;  1KUQ A;  2QTS A;  2PI5 A;  1PL0 A;  3K03 A;  3RYC A;  4K3A A;  4D7T A;  2R9I A;  2WLL B;  1BZK A;  2A7W A;  3OEH G;  4XBF A;  2UXN A;  1QVF U;  4KP4 A;  2F1M A;  1NT2 B;  4LF5 B;  1WP8 A;  4PDL A;  1GM7 A;  5JVD A;  2HR3 A;  4MVO A;  1XMO O;  3AG2 C;  3CRA A;  1I94 O;  2OYQ A;  3WU2 Z;  3JAW A;  3TGU H;  3D3Q A;  2CH7 A;  1T5E A;  1AP6 A;  4DK0 A;  2CK3 G;  4NXM B;  4JI4 B;  4JI4 O;  3JD1 A;  5LYJ B;  2JVD A;  4Q20 A;  1QQC A;  4JV5 O;  1Q6H A;  5LGN A;  4LNU A;  2IU0 A;  2QKA A;  2GUZ A;  4PHZ A;  4CC5 A;  1M56 B;  1WNS A;  4X88 A;  3OD4 A;  5B1A C;  1H2S B;  5LHI A;  2P6J A;  2ZE7 A;  4J10 A;  1H2L A;  4JI5 O;  2EBO A;  1MSW D;  1N36 O;  4WFB V;  2E76 B;  2BTQ A;  1V9P A;  4W4L A;  5ITZ B;  2DYS C;  2OIE A;  1GH6 A;  1YVW A;  3RYH B;  3WG7 B;  4UCO A;  1VQ8 V;  3N2K A;  1RM1 B;  3DC6 A;  1FXK B;  2OT5 A;  1KEC A;  3LDE A;  2LJ2 A;  4IHJ B;  3F7V C;  3H1H H;  3QF7 A;  1XI1 A;  1KQS U;  1FFT B;  3CC4 V;  4LF4 O;  3H9V A;  5A2Q N;  1QLN A;  1FFX A;  3ASO C;  2WLL A;  2ZE8 A;  4F6R B;  3RBZ A;  1GK9 A;  2UXD O;  4JI8 O;  5BZB A;  2ITC C;  5LMU B;  4R50 A;  4JYA O;  4X64 O;  1GN4 A;  4RAI A;  4RUE A;  1NH2 B;  5IYZ B;  2JRI A;  5KA6 A;  2KQX A;  3ETQ A;  5AG2 A;  2CGO A;  1NZ6 A;  2P4V A;  3JD2 A;  2H3O A;  4O4J B;  4LNU B;  4JI0 B;  5FPO A;  2EX3 A;  5IT9 N;  1DF4 A;  1N32 B;  3X2Q C;  1K7D A;  3E8G A;  2HVJ C;  3B8N A;  4DV2 O;  3B77 A;  3ZMZ A;  1PL4 A;  1Q81 W;  1GRJ A;  4D7S A;  2BTQ B;  2X7R B;  4DUY B;  1Z5V A;  1IBM O;  1H8H G;  5CBG A;  1MMM A;  3MDS A;  4I9W A;  2V7Q G;  4DV1 O;  4DV1 B;  4YJ2 B;  4E4E A;  3E2E A;  4DW0 A;  4NXM O;  1EFR G;  2VWK A;  3I55 V;  2Z5U A;  3O65 A;  3UT5 B;  3SPJ A;  2RMK B;  2Q67 A;  2LGQ A;  3UO2 A;  2UU9 B;  5B1N A;  2YI8 A;  1OCO B;  4JPR A;  4I9Q A;  3K79 A;  3OR6 C;  4XDJ A;  2CUG A;  3CEI A;  5GW7 A;  1XMO B;  5C8Y B;  4YJ3 B;  4TV8 A;  2F4V O;  2E74 B;  2A06 H;  4DR3 O;  4I0X B;  4JGS A;  3KKY A;  3OMN B;  2ZR3 A;  2WLN A;  4KFM A;  1R6N A;  4CH5 A;  5JCO A;  1Q6I A;  5JCO C;  4O4I A;  3JAR A;  3ASO B;  5CBH A;  1ZL8 B;  3B09 A;  4L87 A;  3GVM A;  4DR4 O;  2DMX A;  2P7T C;  3D36 A;  4PJ0 Z;  2UXC O;  3CWB H;  2IH3 C;  1RPO A;  3RYH A;  2VRZ A;  5IE9 A;  2YID A;  3RW0 A;  4O4H B;  4H44 B;  3LUT B;  3P3N A;  1N8R W;  3ZMT A;  1WA8 B;  3W7U A;  4OXS A;  4FZ1 A;  1S76 D;  4UCU A;  1E79 G;  1OZ0 A;  3O9O A;  4MVU A;  5IJ9 B;  3AK3 A;  2DW4 A;  3JAT B;  4PA4 A;  3FB6 C;  2ZM6 B;  3PJS K;  2PZS A;  1HP8 A;  4RQF A;  4O2B B;  2Y4U A;  3CXC U;  5KMG B;  3FFQ A;  1AP5 A;  4WFH A;  1FXV A;  5LYJ A;  4DRX B;  1MNG A;  3RVY A;  1HWY A;  1BHA A;  5IJ0 A;  4EEQ A;  3JD0 A;  3S3W A;  1L0N H;  2ZE5 A;  4DV3 O;  4GYC B;  1SRY A;  5EIB D;  2HG5 C;  2R9R B;  4BWA A;  2D3O W;  3OT7 A;  5EZY A;  3OAA G;  3SPH A;  4R8C A;  4UFZ A;  3DGE A;  1YIT V;  5HFL A;  3RWR D;  2OTL V;  4JI8 B;  4AIL C;  1YHQ V;  1ZX3 A;  1JFF A;  1WAZ A;  3QG5 A;  5EBM C;  3HKD B;  4RWU A;  3STL C;  1WPB A;  2BTO A;  3CRM A;  4KL1 A;  3Q4H A;  1OCC B;  1NQT A;  2Y0I A;  2ZNJ A;  3QTC A;  2Q68 A;  2CGN A;  2FTK A;  1NTK H;  3K58 A;  1SS3 A;  4H13 B;  3W7S A;  4DV7 B;  2R9A A;  1ZL8 A;  4HBN A;  5A9G A;  1S5J A;  1VAR A;  4IL6 Z;  1EBO A;  4PV1 B;  1QBZ A;  4DV4 B;  4J9Y B;  1XNQ B;  3EFF K;  3CCU V;  4TSF G;  2A79 B;  1FD9 A;  5H2F Z;  4Z2W A;  5IJ9 A;  1Y66 A;  4QPJ A;  4GKJ O;  3WFV A;  1I08 A;  2F43 G;  4E2L A;  4FFK A;  3KZI Z;  1AI5 A;  3JAW B;  3JD3 A;  1NBM G;  3K0G A;  2AZ0 A;  3HKB A;  5GON B;  1AB3 A;  4TUY A;  1K34 A;  1N32 O;  3HKE B;  2QWP B;  4X1K A;  3ZRV A;  2Q0O C;  2WLM A;  1NVP D;  1L8D A;  3B8M A;  1U97 A;  4JI7 O;  4ZHQ A;  4DR5 B;  2XTA A;  1XIL A;  4DR1 O;  1GM9 A;  3HR0 A;  4PDR A;  4CH6 A;  4FZ0 A;  2R72 A;  3L75 H;  2RDC A;  2M6Y A;  2YIC A;  3UO3 A;  3UKM A;  1GMG A;  2L6L A;  4EB6 B;  2YEV A;  3AG3 B;  3U11 A;  1XEQ A;  4BAY A;  4NYK A;  1QLE C;  2W6I G;  4PEL A;  2PI4 A;  1HDJ A;  2UXC B;  2IJK A;  1SA0 A;  3JAT A;  4OGQ B;  3P32 A;  1M1K W;  4QGP A;  2XAQ A;  4J9Z B;  5LL6 Y;  1KBH A;  5LMN B;  4LFC B;  4DYL A;  5JQG B;  2WLH A;  3ETG A;  4TQF A;  3ABM C;  3ICX A;  1VQO V;  1PPJ H;  3BEH A;  1X59 A;  4HAM A;  4DW1 A;  1KD1 W;  4P30 A;  5JJJ B;  2IJI A;  2PTM A;  3FB8 C;  2HFE C;  1EZJ A;  3OTO B;  1IVS A;  2F95 B;  2A3Q A;  3RFR A;  5KAF Z;  2UUB B;  4DR4 B;  2EIK C;  1FPO A;  5EIB C;  3CP1 A;  2AHY A;  1IXB A;  1B6Q A;  3MD0 A;  2JK5 C;  4K0K B;  4K0K O;  1HNX O;  3SYC A;  1N34 B;  4IGG A;  5LP6 B;  1BCC H;  4PD4 F;  2WA4 A;  4XDK A;  1S0V A;  1PD3 A;  4GX1 A;  4ZIB A;  4LBE C;  2IH1 C;  4PA6 A;  3CCJ V;  2K1E A;  1UPG A;  2P4K A;  2ZIN A;  2C2A A;  4I4T B;  1GTO A;  2QWR B;  2Q7H A;  3CRR A;  3DC5 A;  1ZUQ A;  4MT8 A;  1IUR A;  3TCU A;  3EVK A;  3OTF A;  1Y67 A;  1VF5 B;  1SC5 B;  5JH7 B;  2FB5 A;  2ADP A;  3ABK C;  1O9G A;  5B3S B;  4YY3 B;  2N74 A;  1QLE B;  1M5I A;  4JI2 O;  1Y6X A;  1I5X A;  1I5Y A;  3A2F A;  3FB7 C;  4X20 B;  3W7X A;  1TA8 A;  1JOY A;  1PNM A;  2VS0 A;  2QEX V;  3RYI B;  2UXX A;  2P06 A;  5B3S C;  2Y48 A;  2RN9 A;  2DYS B;  1V55 B;  1AVM A;  3BVO A;  4CS3 A;  3JAL A;  4MVM A;  4MSW C;  3R66 A;  3LSS A;  5BR8 O;  1SKV A;  2UXD B;  1W0J G;  1NR1 A;  4DV5 O;  4X89 A;  4LF9 B;  1K5Q A;  3JSN A;  2VQE B;  4X64 B;  3P3P A;  2WLK A;  4GKK B;  4D6T H;  2QWQ B;  2R70 A;  4DV4 O;  4UCV A;  3ZJZ A;  2P90 A;  1F4M A;  2UXB O;  3CRQ A;  1E1Q G;  2EUL A;  4UVC A;  1N0J A;  1KC8 W;  4EFB A;  4JYB A;  2OCC C;  4ASU G;  3DTU B;  4PA3 A;  1V55 C;  3TXQ A;  1Q8I A;  1ROP A;  1VP7 A;  4X1Y B;  5LHG A;  4JYY A;  2UUA O;  2CDY A;  5J9P C;  3IAY A;  3HKD A;  4ZKI A;  1VF6 A;  1WLE A;  3ZHR A;  4KXR A;  1VQ4 V;  3BAB A;  1HW7 A;  5GON A;  4DR2 B;  4YIO A;  2MW2 B;  3ZHV A;  2EIM B;  1QU7 A;  4WFF A;  3WB1 A;  2GV9 A;  3ZBH A;  2ARH A;  3ZHU A;  1N33 B;  3RYF B;  5IYD O;  1N33 O;  1M57 B;  5B1B B;  1JPX A;  2Y0P A;  2Q5Z A;  2B9Z A;  1YXB A;  2UUB O;  2AHZ A;  3SYO A;  2Q69 A;  1LUV A;  2YEV B;  1Q90 D;  4ZBM A;  3CMA V;  3M99 B;  2WLJ A;  2WLI A;  1L0L H;  1CPY A;  3OM3 B;  3CCR V;  3GWO A;  3UT5 A;  1FJG O;  1AR4 A;  1NI8 A;  3ASN B;  2HVK C;  1XBL A;  4CC6 A;  5JJE B;  4X66 O;  3FYE B;  3JAL B;  3OGI B;  5JWP A;  4BIZ A;  2GTS A;  4OX9 B;  5LP6 C;  1H2M A;  1FXK A;  2LW1 A;  5EBW C;  2WAM A;  4FLW A;  2JIZ G;  2JGD B;  3VQX A;  5DED A;  4LH7 A;  2P67 A;  2ZIM A;  1YEW A;  2QKS A;  3LDD A;  1R3J C;  3CME V;  2Z0A A;  3AG1 B;  3R65 A;  1ORQ C;  2EIJ B;  1ZAU A;  2F4V B;  4Q6G A;  1JA8 A;  1SQP H;  4LF7 B;  1S72 V;  3P30 A;  4UB6 Z;  3W7T A;  2LFR A;  4YY3 O;  2GHY A;  2QGN A;  4I5S A;  1W2B U;  4JI2 B;  3FAV B;  4P2Z A;  4L8J A;  1AI4 A;  4FFB B;  3MAQ A;  4B7E A;  2Q0A A;  3SR2 C;  1N0N A;  3AG2 B;  4FLX A;  4PDV A;  1O9H A;  2YXL A;  4O4J A;  2KB1 A;  2D2C B;  3T1H B;  2GSM B;  1S3J A;  4F4L A;  3H1L H;  1QVG U;  2ITD C;  2IU3 A;  4HNA A;  2XUM A;  5IY5 C;  4JAV A;  4X8A A;  2H8P C;  5L3F A;  1YF2 A;  3ABT A;  3TXS A;  2ZXW C;  3G4S V;  1B06 A;  2ILM A;  2L35 A;  1TUB B;  3M8A A;  2CTR A;  4ABM A;  1TUE B;  2RNB A;  4NR1 A;  3EXA A;  3BAA A;  2EJ7 A;  2HKO A;  4NXN B;  5KHG A;  1P49 A;  4LF4 B;  2F23 A;  3CPW U;  1U96 A;  2YDE A;  4WFE A;  3ETE A;  4DV5 B;  3HKB B;  1WN7 A;  2E75 B;  1PKX A;  4O2A B;  4K8Z A;  1AJN A;  2DWD C;  4A5U B;  1NJI W;  2AGA A;  2LW7 A;  4JI1 O;  4BIO A;  5DM6 V;  3ZMU A;  3HKC A;  3SJC C;  1BMF G;  2Y69 C;  3G67 A;  1BSM A;  1XMQ O;  1GO3 F;  4DV0 O;  3G71 V;  5KHJ A;  3E22 A;  3ZHS A;  2VQE O;  1TAE A;  2AW9 A;  4MTX A;  1IBK B;  4FMT A;  2LO1 A;  3OMA B;  4PA7 A;  1B3Q A;  4FLU A;  1N36 B;  3CCE V;  1IBM B;  1NR7 A;  1OCR C;  1AIL A;  4PI2 A;  4XDL A;  1Q5O A;  3APO A;  2AXT Z;  1K8A W;  3N2K B;  3ABU A;  4MTF A;  1OCZ B;  2K9P A;  5CBF A;  3G80 A;  3IC9 A;  3ZHT A;  2EIK B;  2XAS A;  4MTG A;  1ENV A;  5KUM A;  5BMV B;  2QA4 V;  3LNN A;  1SET A;  4JI6 B;  1SES A;  4FIP C;  2QE7 G;  3L74 H;  4N21 A;  2JS5 A;  1MG1 A;  3JCU Z;  1R1B A;  1DTO A;  1Y74 A;  3KCY A;  2UUC O;  4FLT A;  2EIJ C;  1URF A;  1YIJ V;  1JFF B;  2FYU H;  5E1A C;  1VQK V;  3E8H A;  1H2N A;  3ABL B;  1SQX H;  3QO7 A;  1Q6U A;  2CE4 A;  2V1D A;  1QNM A;  1XQ8 A;  1IXM A;  2RJZ A;  4UCR A;  4O2B A;  4FJC C;  3AG4 C;  4I4T A;  3ZHQ A;  4EFE A;  3F7Y C;  1WP7 A;  3ETD A;  2YIA A;  1Q43 A;  3PN1 A;  1FKA O;  1BE3 H;  1IZ3 A;  3CE2 A;  3E8F A;  4UCS A;  3RN4 A;  3HKC B;  4LFA B;  2ZIO A;  3I5D A;  2UXB B;  1YJ9 V;  1EN6 A;  4LF7 O;  1M90 W;  2E5L O;  4UV9 A;  5LBQ A;  1SZT A;  2CTQ A;  2BOC C;  2ZT9 B;  4J7J A;  4UXN A;  4YIP A;  4JTD B;  4DRX A;  5FNV A;  1PP9 H;  4QIW F;  1S5L Z;  1NH2 D;  3A0B Z;  3JAR B;  4C7U A;  1SQV H;  5LHH A;  3T2M A;  2QM4 A;  2RQ6 A;  1P84 F;  3ZX6 A;  4FLY A;  3DSQ A;  1MSD A;  5IY5 B;  1RSO B;  1NKD A;  5CA3 A;  1SQG A;  1OCR B;  4U3J B;  4DV3 B;  3BA8 A;  5J2T B;  2PF4 E;  1THZ A;  3SPI A;  3LSU A;  4I50 A;  4LF8 B;  1HR0 O;  4GT1 A;  1HNW O;  3SJA C;  1R6K A;  4X9Q A;  1J95 A;  1EM1 A;  2DOS A;  3RT3 C;  3AK1 A;  4LCU C;  3I56 V;  5EYP B;  1JX9 A;  5TIS Z;  3WB2 A;  5CB4 B;  4MW3 A;  3VQY A;  4DUZ B;  4DUZ O;  1HNZ O;  2QDO A;  3BY6 A;  4CH4 A;  3H1I H;  4NTW A;  4DUY O;  3E83 A;  4O4I B;  1PNL A;  3FAV A;  3L9D A;  2HP8 A;  3D8C A;  5IJ0 B;  1LNQ A;  2DQ0 A;  4DV7 O;  2GUZ B;  4KHP B;  4AHC A;  1KP2 A;  4KHP O;  2H94 A;  4X20 A;  2PYJ A;  5EC1 C;  1HR0 B;  1HNW B;  1BQZ A;  1JR9 A;  1LR1 A;  1R73 A;  2JEX A;  4P9P A;  5KHH A;  2KG7 A;  3ABL C;  2EJR A;  4UV8 A;  5LOV B;  4TUY B;  4FM0 A;  1GM8 A;  1GN6 A;  2Q8V A;  4R6Z A;  2Q7G A;  2ZM6 O;  5BMV A;  3QO8 A;  2JDI G;  4J41 A;  4GKJ B;  1OCO C;  2Q4P A;  5CMU A;  3AG7 A;  5C93 A;  4J42 A;  5BR8 B;  5DEC A;  3CC7 V;  3OMI B;  1F7Y A;  4B3T B;  3LNM B;  3E35 A;  4TWK A;  1WB8 A;  4EKW A;  3JD4 A;  1IBK O;  1VQN V;  3SGI A;  3ASN C;  3KCX A;  3VBB A;  3F5T A;  3WB0 A;  3CYO A;  1H8E G;  2UUC B;  5LA6 B;  4LF6 O;  1WPX A;  5BY1 A;  1YTF B;  4LFC O;  2ZNI A;  4UB8 Z;  3DXR B;  3ZS8 C;  4DR7 O;  2CTP A;  2P5O A;  1R3K C;  4W4K A;  4BW5 A;  2VQF B;  1WJZ A;  4J80 A;  5L3E A;  3J81 N;  1P7G A;  4X62 B;  1DK1 A;  2G38 A;  3LDC A;  1GAX A;  1KU9 A;  1EN4 A;  3FB5 C;  3CRC A;  4U7N A;  3S3X A;  1Q86 W;  2B1G A;  3RYF A;  4QPK A;  2JJ1 G;  2IW5 A;  3B2E E;  2XAG A;  1TUB A;  3OR7 C;  3ZN0 A;  3AK2 A;  3RYI A;  1OJH A;  4DV6 O;  3CXH F;  3K5O A;  3H1J H;  3J7A U;  1BHB A;  4DO2 A;  3ZMS A;  3C3T A;  2HJF C;  1M4U A;  4X62 O;  2F66 C;  2X6B A;  2QM8 A;  4IIJ B;  5CA1 A;  4TT3 G;  4PI0 A;  4H0L B;  5GTI Z;  2QM7 A;  2QR4 A;  3CX5 F;  3AG4 B;  5KLV H;  2P22 C;  2IBZ H;  2O57 A;  1J5E B;  2QJ1 A;  3X2Q B;  3W7W A;  4J11 A;  3JAM N;  4UUJ C;  1KYO F;  1Y76 A;  4O4L B;  4Z1V A;  3K5L A;  2NR5 A;  3JCZ A;  2DN9 A;  3QNE A;  5LA6 A;  4LF5 O;  3IJ4 A;  2ZQM A;  2EIL B;  1BQ0 A;  4B7K A;  5LOV A;  3STZ C;  5L3C A;  3IC7 A;  3T4D A;  3A0H Z;  3A0R A;  2NN4 A;  3TET A;  3N2G B;  1K33 A;  3T1Y B;  2JGU A;  1YJW V;  3OEE G;  3VQV A;  3CD6 V;  1QR8 A;  1H2K A;  2WSS G;  1M9N A;  1OHH G;  4OPA A;  1IDS A;  1YSC A;  2ZDI A;  3LSQ A;  5JQG A;  3CCL V;  1XNQ O;  1NU1 H;  1YTF D;  4B3M O;  3VQW A;  2NLJ C;  3CJH B;  4DR5 O;  2PYL A;  4Z1M G;  4LF8 O;  2ZD9 A;  3T1H O;  4NXN O;  1P4R A;  1Q3E A;  2KKW A;  1KB9 F;  1VQM V;  2PUS A;  2FL4 A;  4NVP A;  1NTZ H;  5IDJ A;  2HEP A;  2XAJ A;  2ZXW B;  3GB7 C;  3E86 A;  3CCQ V;  4K35 A;  1HNZ B;  5KA5 A;  3ZRX A;  4I7Z B;  1E1R G;  1BGY H;  1HNX B;  4FM2 A;  3ZRS A;  3BRC A;  3L73 H;  4X66 B;  1Z5W A;  2WPD G;  4DR1 B;  3UQ8 A;  1JVM A;  1TVK A;  1PM9 A;  4WFA V;  1XMQ B;  3OUF A;  2LP7 A;  4JI0 O;  3ML0 A;  2BE3 A;  4CS4 A;  4KUM A;  4MTO A;  5B1B C;  3FYI B;  4RO2 A;  4H37 A;  4BIU A;  4GLX A;  2DJV A;  3JYC A;  4YXW G;  1IX9 A;  4B3T O;  4MVR A;  1JJO A;  3KG2 A;  1VMG A;  2ZR2 A;  3ZCC A;  4PA9 A;  3BFR A;  3U10 A;  1B04 A;  1BT8 A;  2ZE6 A;  3U0Z A;  1P7B A;  3ZMV A;  1G1X B;  4QE9 A;  4QNH B;  1Q7Y W;  3EHB B;  4OX9 O;  4IIJ A;  4DR7 B;  3ZN1 A;  5LGU A;  4WBN A;  5J2U B;  4N23 A;  1K4C C;  2UU9 O;  1NTM H;  4GX0 A;  4LP8 A;  5H5N A;  3SJB C;  3OW2 U;  2PY5 A;  2W0X A;  4MVZ A;  5IYC O;  3ZRW A;  3F5W C;  4ZOL B;  4ZI7 A;  1DLB A;  2WWW A;  4IYH A;  1FJG B;  4B3S O;  2F93 B;  4R7C A;  2FKX A;  2JGD A;  2VQF O;  1L1F A;  3FKS G;  1OV9 A;  1K92 A;  2Y4T A;  4AQY O;  1D5N A;  2YI9 A;  4LC1 A;  1M56 C;  3ZIA G;  1RPR A;  2DE0 X;  1RSO A;  5BXZ A;  1KKD A;  1XRE A;  2N04 A;  3THO A;  3JAS B;  2OWO A;  3L72 H;  1WB7 A;  4JAU A;  4EB6 A;  1K9M W;  2JEU A;  1FAF A;  2ODM A;  1D5A A;  2BOB C;  4FFB A;  4U3J A;  4TV8 B;  5B1A B;  3CB2 A;  4ZHQ B;  4I50 B;  1EN5 A;  1YCI A;  3C90 A;  1ZWI C;  1JQ0 A;  3CCS V;  2XOK G;  5IYB O;  4K8X A;  4LF9 O;  4DR2 O;  1K97 A;  2ATK C;  5GTH Z;  4YHH O;  4X65 O;  5FNV B;  1D2D A;  5EYP A;  1XDC A;  1SZX A;  2IM9 A;  5F2V O;  1QCE A;  4JYC A;  4NKG B;  5LXT B;  1SQF A;  1LUW A;  2HLD G;  1QR9 A;  2DQ3 A;  2Q7E A;  3TJT A;  5KX5 B;  4DR6 B;  2CAZ C;  4BW9 A;  4O4H A;  1Q82 W;  5FPR A;  1SER A;  1YZB A;  2Z3Y A;  5JVD B;  5KHK A;  5LMU O;  2E3C A;  4I0X A;  5KMG A;  1FXH A;  4X65 B;  4NB5 A;  2IJH A;  2DWE C;  3D36 C;  1F51 A;  3A8T A;  1N4C A;  4U7O A;  4O2A A;  1GKF A;  4CZZ A;  3L70 H;  1QHT A;  3QO5 A;  5H6Q A;  1PNK A;  1I7F A;  3ZED A;  2X0L A;  4LWS B;  2GTA A;  2BSK B;  5LGT A;  3J80 N;  2QKC A;  1ARO P;  4JI1 B;  1V54 C;  2LGW A;  2EIN C;  4JYA B;  4B3R O;  2DYR B;  4X1I B;  4B3S B;  4WF9 V;  3ZRW B;  4DK1 A;  4UVB A;  3TK1 A;  3DXR A;  2ZKO A;  2X6A A;  2LFS A;  2XAF A;  1ZLZ A;  5B1O A;  2EIN B;  4J7Z A;  1NS1 A;  4GX5 A;  1KMI Z;  1MOF A;  3SYP A;  2CH7 B;  2OCC B;  5FL7 G;  2DYR C;  4DV2 B;  5LXT A;  3BHP A;  4LFA O;  5B5E Z;  1S5H C;  4FPP A;  4B08 A;  3RYC B;  4F6R A;  2YIB A;  1ZTE A;  4PDM A;  2XHB A;  1Y74 B;  3IGA C;  1VEW A;  4YJ2 A;  4JI6 O;  2QWO B;  3K5M A;  4FK5 C;  3E22 B;  3UM7 A;  5ITZ A;  4FM1 A;  5CN0 A;  2ETN A;  5J2U A;  1YI2 V;  4YHH B;  3HKE A;  5LMN O;  4DR3 B;  2Q9L A;  5DN6 G;  1M57 C;  4YJ3 A;  1OCZ C;  4LR3 A;  4DR6 O;  3OFN G;  1CP9 A;  3T1C A;  1MA1 A;  4BR6 A;  1RP3 B;  1VQ7 V;  3D3I A;  4G2K A;  4NTY A;  1YJN V;  2B1I A;  4LWS A;  2M7W A;  1BL8 A;  3FX7 A;  1VQ5 V;  4ICG A;  1FFX B;  3HB3 B;  2QSA A;  1SQB H;  4GCZ A;  1S77 D;  2BCC H;  2XND G;  4TQD A;  1SA0 B;  4JI3 B;  4QJF B;  1VIB A;  4RUF A;  2EZO A;  2IJJ A;  1V54 B;  5EZY B;  3UCS C;  1VQ6 V;  2OCH A;  3B40 A;  4TOI A;  2EIL C;  4NTX A;  3IFX A;  1TGO A;  1F23 A;  2WLI B;  2E5L B;  4MS2 A;  5CA1 B;  3K3W A;  1J5E O;  2OIG A;  3N27 A;  1RFY A;  3SPC A;  4I55 A;  4IHJ A;  1Z2G A;  4IT5 A;  4J7K A;  2Q73 A;  1H38 A;  3BCC H;  3NXS A;  4LFB B;  4GUN A;  4WFG A;  2GBO A;  5E79 Z;  2V4D A;  3CC2 V;  5KHI A;  1I94 B;  1SQQ H;  1VQL V;  3SDL A;  1AR1 B;  5CA0 B;  1K4D C;  1XHX A;  2OTJ V;  5CB4 A;  3CHX A;  4LH6 A;  1N34 O;  2XAH A;  1VF7 A;  3VOU A;  4OPH A;  5H6R A;  3SYA A;  4DV0 B;  3K0D A;  1KKC A;  4GKK O;  2KSD A;  1XL6 A;  5FLX N;  1VQP V;  3ABM B;  5KUK A;  3K9S A;  1R6T A;  4CBC A;  2RCV A;  3OGC C;  3OUS A;  3N2G A;  3B4S A;  2LQT A;  3T4Z A;  1R3L C;  5J2T A;  1CXZ B;  2CTW A;  2W6J G;  4U3F H;  5IYZ A;  4QE7 A;  3K57 A;  3ABK B;  5JH7 A;  5D5Q A;  4X1K B;  4DXW A;  3QVN A;  5C8Y A;  1H2G A;  3K08 A;  1F4N A;  3CJH A;  1W0K G;  1MZE A;  4HZ3 A;  2ADQ B;  2JS3 A;  1AI6 A;  3AG1 C;  3JAS A;  3E8B A;  2VWJ A;  4B3R B;  2BSK A;  1XL4 A;  4RQE A;  1X4T A;  1XNR O;  1UJW B;  3JSL A;  2WA3 A;  1AJQ A;  3BA9 A;  4G28 B;  4LF6 B;  2ZCE A;  4WBN B;  3H01 A;  3L71 H;  4TV9 B;  1NVP B;  1US6 A;  1ZSP A;  4WCE V;  4JV5 B;  2PGG A;  2B5U A;  1WA8 A;  3OE7 G;  1CEZ A;  3NR7 A;  4ZI7 B;  2NNU A;  1M93 A;  3BPZ A;  2KG7 B;  3Q4H B;  1G4Y B;  2MK3 A;  4GZR B;  1AR5 A;  2Y69 B;  5JJN B;  1GN2 A;  3JAK A;  2QWN B;  4HNA B;  2A9H A;  1K73 W;  4JI5 B;  5K1X A;  2W0F C;  1XHZ A;  3CCM V;  3OTO O;  1YDX A;  4H33 A;  1BS3 A;  3K5N A;  4FVM A;  2JJ2 G;  4F6E A;  1MAB G;  3MHS C;  5EK0 A;  4DV6 B;  5B66 Z;  2HHH B;  1VQ9 V;  3H1K H;  4GX2 A;  4AI8 A;  1XOU A;  4I55 B;  1A32 A;  5EBL C;  1PV0 A;  3E89 A;  2EZP A;  4FLZ A;  4AQY B;  4ZOL A;  3MHH C;  5HFM A;  1OCC C;  4JF3 A;  2YIB D;  1TVK B;  1AI7 A;  2FML A;  5CA0 A;  2YXY A;  2YC0 A;  3K59 A;  4FLV A;  2ZDI C;  1Y4M A;  5K1P A;  2YUA A;  3CS5 A;  3G6B A;  1JJ2 U;  1JMK C;  1W59 A;  4UVA A;  4JI3 O;  1Y76 B;  2HJD A;  3RGB A;  4CH3 A;  1VF6 C;  2A0L A;  2XT9 A;  2YS8 A;  5L3D A;  2Q6A A;  3C3S A;  3K04 A;  4JTC B;  1G6U A;  3WG7 C;  3RVZ A;  1EZV H;  5LP6 A;  5D5P A;  1FXK C;  3M7M X;  2YXH A;  3T1Y O;  1MZF A;  2YSU B;  1AJP A;  4JAA A;  4HYO A;  1DF5 A;  3APQ A;  3FD9 A;  1R3I C;  2EIM C;  1IBL B;  1FS0 G;  1IBL O;  1SF9 A;  3JAK B;  3K9A A;  2GDS A;  4CS2 A;  1COW G;  2AZ2 A;  3AEI A;  4JAS A;  4MVS A;  5KAI Z;  3HPL C;  3CSX A;  1I0H A;  1K3E A;  3SPG A;  4JZG A;  4MW8 A;  3AG3 C;  1UFI A;  1JCH A;  4IYI A;  3SJQ C;  1G8M A;  1GN3 A;  5H9C A;  4LFB O;  4TV9 A;  5L3G A;  3GWK C;  4G27 B;  2X6C A;  5KX5 A;  4JTA B;  5EC2 C;  5L3B A;  4JI7 B;  4O4L A;  1XNR B;  1FYJ A;  4B3M B;  4MVQ A;  4X1Y A;  3CCV V;  2UUA B;  1K5S A;  4X1I A;  1XUQ A;  3K06 A;  3SYQ A;  2QTO A; 
#chains in the Genus database with same CATH homology
 3G6E V;  2Z3Y A;  5LHH A;  3T2M A;  1RM1 C;  1KP3 A;  4P9O A;  2EIK C;  5IY5 B;  1NKD A;  3CP1 A;  5CA3 A;  2AHY A;  1OCR B;  1FXH A;  1B6Q A;  3MD0 A;  2JK5 C;  1THZ A;  3SPI A;  3SYC A;  2IJH A;  2DWE C;  1F51 A;  2PI5 A;  4GT1 A;  1PL0 A;  4U7O A;  3K03 A;  1R6K A;  1GKF A;  4CZZ A;  1J95 A;  4XDK A;  1S0V A;  1PD3 A;  4GX1 A;  4LBE C;  2IH1 C;  4PA6 A;  2R9I A;  3CCJ V;  2K1E A;  3QO5 A;  4LCU C;  5H6Q A;  3I56 V;  1PNK A;  2C2A A;  1JX9 A;  1GTO A;  2X0L A;  2WLL B;  3OEH G;  4MW3 A;  4XBF A;  2UXN A;  1QVF U;  4KP4 A;  4MT8 A;  5LGT A;  4PDL A;  3BY6 A;  1ARO P;  3TCU A;  1V54 C;  1GM7 A;  2EIN C;  2HR3 A;  4MVO A;  3AG2 C;  3E83 A;  1PNL A;  3ABK C;  1LNQ A;  2DQ0 A;  2DYR B;  5B3S B;  2CK3 G;  4WF9 V;  3ZRW B;  1KP2 A;  3JD1 A;  1QLE B;  2H94 A;  4UVB A;  3TK1 A;  5EC1 C;  4Q20 A;  2X6A A;  1R73 A;  5LGN A;  2XAF A;  2LFS A;  2JEX A;  1I5X A;  1I5Y A;  4P9P A;  5B1O A;  2IU0 A;  2EIN B;  3FB7 C;  3W7X A;  3ABL C;  1JOY A;  1PNM A;  4GX5 A;  2EJR A;  1MOF A;  4UV8 A;  3SYP A;  2QEX V;  1M56 B;  2UXX A;  2OCC B;  5FL7 G;  2DYR C;  4X88 A;  5B3S C;  2Y48 A;  5B1A C;  1GM8 A;  5LHI A;  4R6Z A;  2P6J A;  2DYS B;  2EBO A;  1S5H C;  1MSW D;  3QO8 A;  1V55 B;  4FPP A;  4WFB V;  2DYS C;  2JDI G;  1OCO C;  4MVM A;  5CMU A;  5C93 A;  4PDM A;  4MSW C;  3LSS A;  3WG7 B;  1VQ8 V;  3CC7 V;  3OMI B;  3IGA C;  1W0J G;  1RM1 B;  1NR1 A;  1FXK B;  3LNM B;  3E35 A;  2OT5 A;  4X89 A;  1KEC A;  1K5Q A;  4TWK A;  4EKW A;  3LDE A;  4FK5 C;  2WLK A;  3JD4 A;  3UM7 A;  5CN0 A;  1VQN V;  3ZJZ A;  1YI2 V;  3ASN C;  3F7V C;  2P90 A;  3VBB A;  1F4M A;  3CYO A;  1H8E G;  1E1Q G;  4UVC A;  1WPX A;  1KQS U;  5DN6 G;  1M57 C;  1KC8 W;  1YTF B;  4JYB A;  2OCC C;  1FFT B;  3CC4 V;  4ASU G;  3DTU B;  4PA3 A;  1OCZ C;  1V55 C;  1R3K C;  1CP9 A;  3OFN G;  3T1C A;  4BW5 A;  1ROP A;  1QLN A;  5LHG A;  1VQ7 V;  3D3I A;  4G2K A;  3ASO C;  1YJN V;  2B1I A;  5L3E A;  2WLL A;  5J9P C;  2M7W A;  1BL8 A;  4ZKI A;  1VQ5 V;  3RBZ A;  3LDC A;  1WLE A;  1GK9 A;  3HB3 B;  1VQ4 V;  5BZB A;  3FB5 C;  2ITC C;  4GCZ A;  1S77 D;  4R50 A;  4U7N A;  1Q86 W;  2EIM B;  4WFF A;  2B1G A;  2XND G;  4RAI A;  4QJF B;  4RUE A;  4QPK A;  4RUF A;  2JJ1 G;  2EZO A;  2IJJ A;  1V54 B;  1NH2 B;  1VQ6 V;  2IW5 A;  5KA6 A;  2EIL C;  5IYD O;  1M57 B;  2XAG A;  3IFX A;  5B1B B;  1F23 A;  1JPX A;  3JD2 A;  3OR7 C;  2WLI B;  4MS2 A;  3K3W A;  3ZN0 A;  1DF4 A;  2AHZ A;  3SYO A;  2Q69 A;  3SPC A;  3X2Q C;  2YEV B;  1BHB A;  1K7D A;  3E8G A;  4DO2 A;  4ZBM A;  3CMA V;  3M99 B;  3ZMS A;  2HVJ C;  2WLJ A;  3B8N A;  2WLI A;  1H38 A;  2HJF C;  1CPY A;  3B77 A;  3NXS A;  3OM3 B;  3CCR V;  3GWO A;  3ZMZ A;  4WFG A;  2X6B A;  1Q81 W;  3CC2 V;  2QM8 A;  3ASN B;  2X7R B;  2HVK C;  1VQL V;  1H8H G;  5CBG A;  1AR1 B;  3FYE B;  4BIZ A;  1K4D C;  4I9W A;  2V7Q G;  4TT3 G;  2OTJ V;  1FXK A;  2XAH A;  2QM7 A;  5EBW C;  2WAM A;  3E2E A;  3VOU A;  2JIZ G;  1EFR G;  3AG4 B;  3I55 V;  2Z5U A;  3SPJ A;  2Q67 A;  5H6R A;  3SYA A;  5B1N A;  1OCO B;  3K0D A;  4JPR A;  3K79 A;  3OR6 C;  4XDJ A;  3X2Q B;  3W7W A;  1XL6 A;  2P67 A;  3LDD A;  2QKS A;  3ABM B;  1VQP V;  1R3J C;  4UUJ C;  3CME V;  5KUK A;  3AG1 B;  5GW7 A;  3R65 A;  1ORQ C;  2EIJ B;  4CBC A;  3OGC C;  3JCZ A;  3QNE A;  3OUS A;  2ZQM A;  4JGS A;  1S72 V;  2EIL B;  3P30 A;  3OMN B;  3T4Z A;  3W7T A;  1R3L C;  2LFR A;  2ZR3 A;  2WLN A;  4KFM A;  2GHY A;  1R6N A;  3STZ C;  5L3C A;  3IC7 A;  2W6J G;  3T4D A;  3A0R A;  4QE7 A;  3TET A;  4I5S A;  1W2B U;  1K33 A;  3ABK B;  4P2Z A;  3ASO B;  5CBH A;  4DXW A;  1AI4 A;  1H2G A;  3K08 A;  1YJW V;  4L87 A;  3OEE G;  1F4N A;  3D36 A;  2P7T C;  3CD6 V;  1QR8 A;  1W0K G;  2IH3 C;  1RPO A;  2WSS G;  1M9N A;  1OHH G;  4HZ3 A;  1YSC A;  2ZDI A;  3LSQ A;  3CCL V;  1AI6 A;  3AG2 B;  4PDV A;  1YTF D;  3AG1 C;  3RW0 A;  2NLJ C;  3LUT B;  1N8R W;  3ZMT A;  3E8B A;  4Z1M G;  3W7U A;  4OXS A;  1XL4 A;  2ZD9 A;  1S76 D;  2KB1 A;  1E79 G;  1OZ0 A;  4MVU A;  4RQE A;  2GSM B;  1UJW B;  1S3J A;  1P4R A;  2DW4 A;  3FB6 C;  4PA4 A;  1AJQ A;  4G28 B;  1VQM V;  3PJS K;  4F4L A;  3H01 A;  1NVP B;  1QVG U;  4RQF A;  2ITD C;  2IU3 A;  3CXC U;  5IDJ A;  4WCE V;  2XAJ A;  2B5U A;  4WFH A;  2ZXW B;  1FXV A;  3E86 A;  3GB7 C;  3OE7 G;  4JAV A;  5IY5 C;  1CEZ A;  3CCQ V;  4X8A A;  2H8P C;  2NNU A;  5L3F A;  5KA5 A;  1G4Y B;  2MK3 A;  3ZRX A;  1E1R G;  3ABT A;  2Y69 B;  3RVY A;  2ZXW C;  3G4S V;  1HWY A;  1BHA A;  3ZRS A;  2WPD G;  3JD0 A;  2A9H A;  1K73 W;  1JVM A;  1SRY A;  1TUE B;  2HG5 C;  2W0F C;  4WFA V;  3CCM V;  2R9R B;  3OUF A;  2D3O W;  2LP7 A;  3OAA G;  3SPH A;  2HKO A;  3ML0 A;  4H33 A;  4R8C A;  4KUM A;  4MTO A;  5B1B C;  3FYI B;  4RO2 A;  4H37 A;  4BIU A;  2JJ2 G;  3JYC A;  1YIT V;  3DGE A;  4YXW G;  3CPW U;  5HFL A;  2OTL V;  4MVR A;  1MAB G;  3KG2 A;  4WFE A;  1YHQ V;  3MHS C;  3ETE A;  5EK0 A;  2ZR2 A;  1PKX A;  3ZCC A;  4PA9 A;  1AJN A;  2DWD C;  5EBM C;  1VQ9 V;  4GX2 A;  3STL C;  1NJI W;  1P7B A;  5EBL C;  5DM6 V;  1OCC B;  1NQT A;  3E89 A;  3ZMU A;  2EZP A;  2Q68 A;  2FTK A;  3ZMV A;  1BMF G;  3MHH C;  4QE9 A;  2Y69 C;  4QNH B;  5HFM A;  1OCC C;  3W7S A;  1Q7Y W;  3EHB B;  4JF3 A;  3ZN1 A;  5LGU A;  1AI7 A;  1GO3 F;  4N23 A;  1K4C C;  1EBO A;  4GX0 A;  3G71 V;  4LP8 A;  3OW2 U;  1QBZ A;  2ZDI C;  1Y4M A;  4MTX A;  4J9Y B;  4FMT A;  3OMA B;  1JJ2 U;  4MVZ A;  4PA7 A;  3EFF K;  5IYC O;  3CCU V;  4TSF G;  2A79 B;  3ZRW A;  3F5W C;  3CCE V;  1NR7 A;  1DLB A;  1OCR C;  2WWW A;  4UVA A;  1Y66 A;  4QPJ A;  4XDL A;  3WFV A;  2F43 G;  4E2L A;  2A0L A;  1K8A W;  4MTF A;  3ABU A;  1OCZ B;  4R7C A;  5L3D A;  2Q6A A;  5CBF A;  3K04 A;  1AI5 A;  4JTC B;  1L1F A;  3WG7 C;  3RVZ A;  3JD3 A;  1NBM G;  3FKS G;  1K92 A;  3K0G A;  1FXK C;  4LC1 A;  1M56 C;  3ZIA G;  1RPR A;  2EIK B;  2XAS A;  4MTG A;  1ENV A;  1K34 A;  1KKD A;  5KUM A;  2YSU B;  1AJP A;  2QA4 V;  1SET A;  3ZRV A;  2WLM A;  1SES A;  1DF5 A;  4FIP C;  2QE7 G;  4HYO A;  1R3I C;  2EIM C;  3B8M A;  1FS0 G;  4JAU A;  4N21 A;  1NVP D;  3K9A A;  1K9M W;  2JEU A;  1MG1 A;  1GM9 A;  4PDR A;  2BOB C;  1DTO A;  1COW G;  3AEI A;  4JAS A;  1GMG A;  4MVS A;  5B1A B;  3UKM A;  3HPL C;  2EIJ C;  2YEV A;  3AG3 B;  1K3E A;  3SPG A;  1YIJ V;  4BAY A;  1QLE C;  5E1A C;  1VQK V;  2W6I G;  4PEL A;  3E8H A;  4MW8 A;  2PI4 A;  3ABL B;  1ZWI C;  1JQ0 A;  3AG3 C;  3CCS V;  2XOK G;  5IYB O;  1JCH A;  3QO7 A;  2V1D A;  3SJQ C;  2IJK A;  1IXM A;  1G8M A;  3P32 A;  4FJC C;  1M1K W;  1K97 A;  2ATK C;  3AG4 C;  2XAQ A;  5H9C A;  5L3G A;  4J9Z B;  4G27 B;  3F7Y C;  3ETD A;  2X6C A;  1QCE A;  4JTA B;  4JYC A;  3E8F A;  5EC2 C;  5L3B A;  2HLD G;  1QR9 A;  4MVQ A;  1YJ9 V;  1M90 W;  2DQ3 A;  2WLH A;  3ETG A;  4UV9 A;  5LBQ A;  1SZT A;  3ABM C;  2BOC C;  1VQO V;  3BEH A;  4HAM A;  4UXN A;  4JTD B;  3CCV V;  1Q82 W;  1KD1 W;  4P30 A;  3FB8 C;  2IJI A;  1K5S A;  2HFE C;  3K06 A;  4QIW F;  3SYQ A;  2QTO A;  1EZJ A;  1SER A;  1NH2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...