4I9WA

Human two pore domain k+ channel traak (k2p4.1) - fab complex structure
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
publication title Domain-swapped chain connectivity and gated membrane access in a Fab-mediated crystal of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4i9wA00
5BZBA 3SYCA 5B1AC 2K1EA 2DWDC 3ASNC 3F7YC 2DYRC 4QE9A 1M56C 4PA3A 3RW0A 2X6AA 4X8AA 2AHZA 2IH1C 2Q69A 3SPGA 2YEVA 4G28B 1OCRC 4P30A 3AG2C 4P9PA 3SJQC 5EBLC 3SYAA 2ITDC 3SPHA 3RVZA 5CBFA 3RVYA 3SPCA 4G27B 4HZ3A 1G4YB 2Q67A 3GB7C 2JK5C 2ZD9A 3E86A 4XDJA 4BW5A 4DXWA 4WFFA 4PA4A 3K0GA 3K04A 3FB6C 3E83A 2HVKC 4GX2A 2EIMC 5EK0A 3RBZA 2WLHA 2X6CA 3AG4C 2WLJA 4PA9A 4PDVA 5EBWC 3ABKC 2BOCC 2WLIA 2A9HA 4MTGA 3E8HA 4LCUC 3PJSK 3TCUA 4GX5A 2AHYA 3F7VC 4R7CA 4F4LA 1QLEC 5IY5C 1P7BA 3E89A 1R3JC 1V54C 4JTDB 3IFXA 3ABMC 4RO2A 5J9PC 1R3KC 1R3IC 4P9OA 2EIKC 3E8FA 3LDEA 3OGCC 4MVSA 4MW3A 3X2QC 3AG1C 1M57C 4WFGA 3R65A 3T4ZA 3E8BA 3UKMA 4J9ZB 2WLNA 2WLMA 5KUMA 3WG7C 2ZXWC 4X89A 2OCCC 2HJFC 3ASOC 4MW8A 2NLJC 3K08A 4GX0A 4KFMA 4UUJC 3STZC 3AG3C 2HFEC 3OUSA 4I9WA 2HVJC 3K0DA 1J95A 2HG5C 4WFEA 3FB7C 4MVRA 3FB8C 3LUTB 3OUFA 4PDRA 4EKWA 3F5WC 4MS2A 3T1CA 4LP8A 3LNMB 1LNQA 1V55C 3SPJA 3OR6C 2ITCC 2WLLB 4J9YB 2H8PC 4R50A 4XDKA 3T2MA 1ORQC 2A79B 2EIJC 2P7TC 3STLC 3SYQA 3HPLC 1XL6A 1OCCC 3LDDA 4QNHB 3ABLC 2Q6AA 3K03A 1OCOC 1R3LC 4RUEA 2W0FC 2BOBC 4GX1A 4QE7A 1KKDA 4HYOA 2DYSC 3KG2A 3K06A 3SYPA 2WLIB 2EILC 4JTAB 4MSWC 4RAIA 1S5HC 3SPIA 4H37A 3TETA 5EC2C 5EBMC 2KB1A 4PDMA 2ATKC 3IGAC 2R9RB 4MVMA 4RUFA 2IH3C 5CBHA 4H33A 2QKSA 3VOUA 1K4DC 5B1BC 2Q68A 2DWEC 4R8CA 4MVOA 3ZRSA 1BL8A 4WFHA 4CBCA 4MVUA 5EC1C 3E8GA 4PDLA 2EINC 4X88A 2WLKA 4MTOA 1XL4A 3SYOA 4OXSA 1JVMA 3JYCA 2WLLA 5CBGA 3FB5C 3LDCA 4MTFA 2A0LA 5KUKA 3ZJZA 4P2ZA 4XDLA 3BEHA 4JTCB 4MVQA 4TWKA 1OCZC 5E1AC 4LBEC 4ZBMA 3EFFK 4PA6A 3T4DA 4PA7A 3OR7C 4MVZA 2Y69C 1ZWIC 3UM7A 4R6ZA 2X6BA 5B3SC 2QTOA 1K4CC
chains in the Genus database with same CATH superfamily
5JJEB 5A2QN 3F5TA 2FYUH 4E4EA 2IH1C 4BIUA 2VS0A 4P9PA 5EZYB 4ASUG 2ITDC 5IYDO 1FD9A 4DV0B 1N34B 4FFBA 1M5IA 1XMQO 4ZHQB 4IHJA 4J11A 3JSNA 4O4LB 1VIBA 1TA8A 3RFRA 3JARB 5GONB 4AHCA 3ABKC 3CS5A 4MTGA 4F4LA 3A0HZ 2YUAA 3BABA 3CWBH 4H44B 3LDEA 3G67A 4X64B 3UKMA 3DC6A 4DUZB 4DR2O 4KFMA 4GX0A 1THZA 5B1BC 4I9WA 2HLDG 3FB8C 3HKDA 3OUFA 4YY3O 1HNZO 1S77D 4CS4A 5LOVA 2LQTA 2Q8VA 3H1KH 4ZI7B 4A5UB 4IGGA 5IWAB 1YITV 1NS1A 3SYQA 2F4VB 5JVDA 4DW0A 1GM7A 2CDYA 3KG2A 1GAXA 1OCCB 1YTFD 1S5HC 1H2NA 4K8XA 5LP6B 1PNMA 1AVMA 3K57A 5EZYA 3QVNA 2IH3C 3H1JH 3QO8A 2Q7GA 1AR1B 5JJNB 4ZHQA 4O4LA 3ZCCA 2F95B 5GONA 1XDCA 1ZX3A 4HNAA 3HKCA 2XAQA 3ZHTA 1RM1C 1UPGA 1GRJA 3OW2U 2PF4E 1SC5B 4JTCB 5J2UB 4TWKA 4ZBMA 2QWQB 3EFFK 4UV9A 1K3EA 4NXMB 2Y4UA 5LGUA 4CH6A 5CMUA 1JMKC 2QTOA 4E2LA 1QU7A 1NBMG 4NVPA 2HEPA 4JYBA 1OJHA 2G38A 3SYAA 4UCVA 3WB0A 4JI0B 1RSOA 4ZI7A 2WA3A 2Y0PA 3E22B 1BQZA 2PTMA 4YJ3B 1HNWO 3K04A 1KKCA 2A9HA 5B5EZ 1SA0A 5LP6A 2AHYA 4RQEA 4DK1A 1JFFA 3IJ4A 1I08A 3NXSA 2ZCEA 5IY5B 1XNQO 3CCMV 1M90W 1PL4A 4O4JB 5EIBD 1L0LH 1QR9A 5D5QA 3H1LH 3CRAA 4EKWA 1IBMB 1FXVA 2YDEA 4XDKA 4DR1O 3QNEA 4O2BB 1P4RA 3EHBB 3HPLC 1OCCC 1D2DA 4PI2A 3KCXA 5LP6C 4GX1A 5IYCO 3NR7A 4FJCC 4UVAA 3ABLB 2XTAA 4JTAB 3K5MA 2ZE8A 1QLNA 3JALB 1Y74A 5KHJA 1VP7A 2QWPB 3BY6A 1KB9F 3U0ZA 1S72V 2QM8A 3LNNA 1XHXA 5LHGA 3E22A 3JD3A 4JI5O 2VQFO 4NTYA 1BL8A 2QWRB 2Z0AA 4J80A 4TUYB 4Z1MG 4DV7O 5JQGA 3APQA 3RT3C 3JAWB 4LF8O 2WLKA 2YI8A 4KUMA 3QO5A 1PP9H 1HWYA 1VF5B 2A0LA 1B3QA 5KMGA 4B3SB 1QVFU 3RWRD 1W59A 1YZBA 4FFKA 1XEQA 2IJIA 3AG4B 5KHHA 5KLVH 5E79Z 2Y69B 1M9NA 4GKKO 2ETNA 5KX5B 5B1AB 4DR7O 5CBFA 3DC5A 5EBLC 2QKAA 2ZR3A 4N21A 1KD1W 1MG1A 3P32A 2XUMA 4X20A 3CMAV 2CTQA 5K1PA 2HVKC 3LSSA 4JI6B 3JASB 3MHSC 3S3WA 3JD4A 1UFIA 1DGSA 5FNVB 4JI2O 2EBOA 1H2SB 5IY5C 4WFBV 4D7SA 3J7AU 4GT1A 1GN3A 3FD9A 1Z2GA 4LF9O 3K3WA 3U11A 2EULA 1MNGA 4I4TB 1KBHA 3JAWA 3STZC 3P3PA 3K0DA 1J95A 2DQ3A 1LNQA 1NTZH 1YJWV 2ITCC 4J9YB 5GTIZ 4FLWA 4H0LB 2UU9O 2AGAA 1N32B 3ABLC 4JI8O 1HR0O 4B3MB 4MSWC 4FK5C 3TETA 4I50B 5KX5A 3W7WA 3JAMN 1PV0A 1SZXA 3IGAC 4MVMA 1YF2A 4H33A 2IW5A 3VOUA 4JZGA 3IC7A 3CCUV 1YCIA 3RN4A 2YI9A 3K5LA 1NI8A 4X65O 2GDSA 4MTOA 5LHIA 4QIWF 1FXKB 3LDCA 4DR5B 2UUCO 3BHPA 5KAFZ 1G1XB 1SF9A 1XI1A 4DV2B 1LUVA 5IYBO 2HHHO 2Y69C 1DLBA 1MZEA 2MK3A 1K4CC 1FAFA 5B1AC 4DR6B 2DE0X 2H3OA 4L87A 3QG5A 2JEUA 4F6EA 1X59A 1WPBA 1MSWD 4LF4B 3SPHA 2XOKG 2ZIOA 4W4KA 1G4YB 2Q67A 2ZNIA 1KECA 3K0GA 4KL1A 1JJ2U 2KQXA 3RBZA 3TK1A 4DV1O 3PJSK 3QO7A 2EIMB 4X1YB 5CA0B 1RP3B 3OTFA 1Z5WA 3CEIA 2QEXV 2F93B 4K0KB 1AP5A 4BW9A 2P06A 5ITZB 1G8MA 4JYCA 4X62O 5KUMA 2CAZC 4O2AB 4I9QA 2HJFC 4ICGA 1AILA 1OHHG 3R66A 2JS3A 1KP3A 3I5DA 5H6RA 1GN6A 2A79B 5LGNA 5LYJB 2A7WA 1QHTA 3C3SA 3RYFA 3ZRWB 3ZMUA 3WB1A 1CXZB 1OCOB 3I56V 2EZPA 5DM6V 4LC1A 3DTUB 1DF5A 2KB1A 4PDMA 5LGTA 2WPDG 1KU9A 2B5UA 5BR8O 3KKYA 2LW7A 4O4IA 2N04A 5IJ9B 2B1IA 2PYJA 5H5NA 1FXKC 2DYRB 1JQ0A 4LFCB 4CC5A 1J5EB 2UUAO 1K34A 1XILA 1R6TA 3CSXA 4Z1VA 3CMEV 4JV5O 4MVZA 3ABUA 2D2CB 5ITZA 2X6BA 2JGDB 2H94A 5BZBA 5KA5A 2IM9A 4LF7B 3D3IA 2IJKA 2AXTZ 2WWWA 4HZ3A 4BIOA 1YJ9V 5LYJA 4TV8B 1FFXB 4W4LA 3ZRWA 4JAAA 2EIMC 1KMIZ 1Q43A 3OFNG 4UXNA 3TXQA 5CA1B 3ETQA 1K92A 2Z3YA 5LHHA 4DK0A 3J81N 1VQOV 2DOSA 1JOYA 2YXYA 3UQ8A 1MSDA 2YIDA 1V9PA 1F4NA 3AEIA 5JCOA 4JI4O 2UXNA 2EIKB 4LWSB 4CH3A 4DV5B 3VBBA 3AK2A 1EZJA 1W0KG 4I5SA 1R6KA 2HG5C 4MVRA 1EBOA 1S5LZ 1NKDA 3T1CA 1NTKH 3JATB 4ZOLB 2WLLB 2XAGA 1OCOC 1BT8A 1X4TA 2JGDA 2BOBC 1K73W 3K59A 2OWOA 2WLIB 2Q73A 3G6BA 4DV6O 3ICXA 5DEDA 1KQSU 1AR5A 2JDIG 3N27A 3MDSA 4DR4B 3B2EE 4R8CA 4TV8A 2UUBB 3CXHF 4AQYO 1VF7A 1VARA 3D3QA 2F43G 3T1YB 4IHJB 3CRCA 2RN9A 1XL4A 2UXDO 1TAEA 4RWUA 5JWPA 1WAZA 2VQEB 1PNKA 3A2FA 3C3TA 3BEHA 4GUNA 4OX9B 4CZZA 2KSDA 2Q0AA 4X1KB 1SQVH 4B3TO 4J41A 1TVKA 1MABG 1D5NA 2XNDG 4IYIA 2YIAA 1P49A 1NH2B 2B1GA 2Q69A 3SPGA 2HKOA 2P4KA 2ZR2A 2UXBB 1PNLA 3JATA 2YIBD 3SR2C 1OCRB 5LOVB 5KHGA 4WCEV 4FLVA 4QPKA 2WLIA 4JI1B 1PKXA 4L8JA 4FLTA 3E35A 3ZEDA 3CC2V 2D3OW 3G80A 3OTOO 2EIKC 3K9AA 5L3GA 1YIJV 2ZNJA 3ABMB 1RFYA 4J9ZB 4DV4O 2WLMA 2OYQA 3OMIB 4FVMA 2ZXWB 3FB7C 4CH4A 2B9ZA 4MS2A 4HNAB 4LFBO 1Y76A 3HKCB 3LNMB 1N4CA 3T1HO 1NVPD 3ML0A 4IIJA 2JEXA 4X1KA 2ZM6B 3EXAA 4U7NA 4FLZA 3WU2Z 1AI5A 1KC8W 2OTLV 1Q86W 3I55V 1O9HA 1YDXA 1GMGA 4LFAB 3OEHG 1AR4A 4LF6O 1QNMA 1DK1A 3O9OA 2Q7HA 1Q3EA 3APOA 2Q4PA 2JJ1G 5KHIA 2OCHA 1XNRB 1RSOB 4BIZA 2A3QA 5B1NA 4AILC 1BHBA 4GKJO 3ZMSA 4MTFA 2BSKA 5L3BA 1SA0B 1I94O 3GWOA 1JFFB 2OIGA 4YIPA 1ZAUA 2WA4A 1VQNV 4DV0O 3RW0A 1N34O 2JS5A 5L3FA 3ASNB 3THOA 3ZHQA 5IYZB 1OCRC 1SZTA 1SESA 5L3EA 4ZIBA 2UXXA 2N74A 4NKGB 1NJIW 1QQCA 2WAMA 2CK3G 4LCUC 1K8AW 4R7CA 3WB2A 4X64O 5J2TB 3ABMC 4U3JB 3ZHSA 4UV8A 1NR7A 3SJAC 1QLEB 1BGYH 1Y74B 4MVSA 4DUZO 4GYCB 2QR4A 2P6JA 1EZVH 2ZXWC 3X2QB 1N36O 4B3RB 4JI7B 3CXCU 3RYCB 1VQ6V 5LMNB 3WG7B 1ZSPA 2NR5A 1R6NA 5TISZ 5L3CA 2ZE7A 5JQGB 5IWAO 4J42A 4PELA 4QPJA 2F4VO 1YSCA 4JI5B 1ORQC 2EX3A 5GTHZ 1FJGB 5KMGB 1DF4A 4B08A 3W7TA 5EYPB 1KKDA 4DV7B 1N33O 2QSAA 4UFZA 2RDCA 2XT9A 4UCUA 5IYZA 2R9RB 2ZQMA 4RUFA 1YJNV 1YHQV 4DRXA 1VQ7V 1QCEA 1OV9A 1XMOO 2BTQA 5F2VO 1SKVA 3FYEB 4X20B 1WB7A 4DR7B 2R72A 3WFVA 5CB4B 4DR3B 5J2TA 2F23A 5KUKA 4NXMO 2LJ2A 4U3JA 1K9MW 2F66C 4JI3B 4PA6A 3MHHC 1EFRG 1I7FA 2ZKOA 2RMKB 3ASNC 2DQ0A 3RYCA 2X7RB 5CA3A 3A0RA 5B3SB 4JI0O 4J10A 4JAUA 4FLYA 2YEVA 3CCQV 2UXCB 3ZN1A 1BHAA 2LP7A 4ZKIA 1F51A 5EYPA 2WLHA 5EBWC 2WLJA 4BR6A 3CB2A 3E8HA 4O4HA 1H2LA 1QLEC 2QWNB 2KKWA 3JD2A 3VQYA 1SQBH 4TV9A 3OM3B 1GTOA 1K7DA 3E8FA 1TUEB 3X2QC 1US6A 4WFGA 1XOUA 4JI8B 3B4SA 2RCVA 3WG7C 5HFLA 3ETGA 1S3JA 1IX9A 2OCCB 5CB4A 1NU1H 4WBNA 3AG3B 3SGIA 3SPJA 5FPOA 2FTKA 1WJZA 2P4VA 2RJZA 3SJBC 1XL6A 2ZINA 1VQ8V 1HNXB 2F1MA 2W0FC 1IBKO 4HYOA 1JJOA 2ILMA 4X66B 1K4DC 3QF7A 2ZIMA 3H1IH 3A0BZ 3ZHUA 3CP1A 4QJFB 4OPHA 2E76B 3CCSV 1Q81W 4PV1B 4B3SO 1MMMA 1CEZA 3W7XA 1EM1A 2YIBA 1AJNA 4MVQA 2RNBA 2RQ6A 1F4MA 1ZWIC 5KHKA 1W0JG 5B3SC 5LA6A 4BWAA 2QE7G 2ADQB 2Y4TA 4NB5A 1YTFB 1B6QA 5BMVB 1MZFA 1M4UA 3TGUH 3C90A 4JPRA 4FLUA 3L72H 3MAQA 2JK5C 4JI6O 4XDJA 4KHPB 4WFFA 3TXSA 4XBFA 1IBLO 3AG4C 4PDVA 3RYFB 3ZMZA 4GX5A 1GK9A 2PI5A 3IFXA 1R3KC 4CS3A 1NH2D 4KP4A 3ZMVA 1JX9A 3QTCA 3R65A 4B7KA 3K5NA 2ZDIA 2E5LO 2OCCC 3AG1B 2KG7B 1JCHA 4UUJC 3AG3C 2HFEC 2Z5UA 4O4IB 2X0LA 1VF6A 3HKEA 3H9VA 2L6LA 1U97A 1Q6IA 3ZRVA 1L1FA 3JCUZ 4B3MO 2VWKA 3M7MX 5JH7B 1SS3A 4I0XB 1BE3H 3RYHA 4DUYB 4OPAA 5BMVA 2QKSA 2ZDIC 1FPOA 4CH5A 4MVUA 5LMUB 3CE2A 4YJ2B 4DR5O 3Q4HA 4X9QA 4U3FH 4DV2O 2QM7A 1Q6HA 4KXRA 1DTOA 5BXZA 2Q0OC 2YXLA 3FKSG 3UM7A 1K5SA 1KP2A 3RYIB 1S0VA 1BSMA 4LF5O 4DR6O 2KG7A 1VMGA 1D5AA 4QE9A 4LF4O 4X8AA 1F23A 4IT5A 4IL6Z 4PI0A 3SPCA 4G27B 3AG2B 1B06A 1VQLV 4GX2A 2DJVA 3ETDA 5JH7A 3OEEG 4K3AA 1NTMH 3ZRXA 4H13B 4K0KO 5LXTA 4I0XA 3CJHB 2QM4A 1W2BU 3E89A 3BPZA 3H1HH 4JTDB 2FL4A 5J9PC 2Q5ZA 3S3XA 3ZN0A 3AG1C 2WLNA 4YJ2A 3D36A 3JAKA 2Y48A 2Q7EA 4CC6A 2W0XA 3OR6C 1FXHA 1Y67A 1BCCH 4NR1A 2CGNA 3STLC 4WF9V 4X1IB 2DN9A 2QJ1A 1R3LC 3RYIA 2O57A 1IXMA 2BTOA 2GTSA 1TVKB 4RAIA 2CTRA 2EILB 3BA8A 3OGIB 3ZX6A 4MVOA 3ZRSA 2GHYA 3B8NA 5EIBC 1J5EO 2CTPA 2IJJA 3CD6V 1I0HA 3FX7A 3CJHA 2R70A 3FB5C 4DV3B 1RPOA 1B04A 4P2ZA 1SRYA 4I55A 5C93A 4TQDA 4LR3A 4YHHO 1WLEA 1WP8A 2QA4V 3JD1A 4R6ZA 3CPWU 4LF7O 1PL0A 3ABTA 5JCOC 1IZ3A 4NXNB 3ZS8C 2DYRC 3P30A 4NTXA 3PN1A 3P3NA 2AHZA 1H8HG 1S5JA 2AW9A 2M6YA 5H9CA 3AG2C 3RVZA 3OTOB 1ENVA 2ZD9A 1Y76B 4X1IA 4IIJB 3UT5A 2AZ0A 4DV4B 3E83A 2QDOA 3G4SV 4PA9A 1XMQB 3RGBA 3DGEA 2GUZA 5LL6Y 4DV5O 3K58A 2P5OA 3E2EA 2PGGA 3N2KB 3T4ZA 1K33A 2NLJC 1GM8A 3OUSA 4UVBA 4DR2B 1SETA 4LF6B 4NYKA 1YI2V 1URFA 2QWOB 4J7ZA 4YY3B 1HNZB 2N05A 1Q5OA 2VRZA 1TGOA 1V55B 2BSKB 1H2GA 3K03A 4LNUB 4F6RA 5IJ0B 1ZLZA 2EILC 3SPIA 4GKJB 2GBOA 5EBMC 4DR4O 2LFSA 3HR0A 1WNSA 5D5PA 1S76D 2DWEC 3CHXA 3T1YO 3CYOA 3LSQA 4PDLA 2YC0A 5DECA 1K97A 2VQEO 5LBQA 1JVMA 2OIEA 1E1QG 3JCZA 4OX9O 1E1RG 2PY5A 3FAVA 3OMNB 1UJWB 3L70H 2XAJA 2EJRA 3W7UA 1BQ0A 3N2KA 1WPXA 4Q6GA 1SQFA 4CBCA 3MD0A 2R9AA 3CCVV 4Q20A 5KAIZ 1PM9A 1T5EA 2UXBO 4PA3A 3CC4V 4B7EA 3W7SA 1YXBA 1G6UA 5H2FZ 3ETEA 1M56B 4JYAO 4Z2WA 4UB6Z 4UCRA 5JJJB 2M7WA 2QGNA 1BZKA 3CCRV 4LNUA 4JI1O 1N36B 3FFQA 3L9DA 2BOCC 5IJ0A 1HNWB 4J7JA 1PPJH 4PJ0Z 4CS2A 2OT5A 1ZUQA 2CTWA 3CRMA 4P9OA 4MW3A 3O65A 1IURA 4FZ1A 1L8DA 1XNQB 1N33B 4DRXB 2LW1A 3K5OA 3BA9A 2HVJC 2BTQB 1P7GA 2ZM6O 1V55C 5DN6G 1AP6A 4TOIA 3JARA 4GCZA 1YVWA 4GZRB 1VQ4V 1XMOB 4DR1B 4LFAO 4QE7A 2XHBA 3B8MA 3L73H 3DSQA 2E75B 4HBNA 3OMAB 3UO3A 1AJPA 3M99B 1AI6A 2DYSB 2CE4A 1ZL8B 3L71H 5CBHA 1XNRO 4WFAV 2YEVB 4WFHA 1COWG 1O9GA 2EJ7A 1EN4A 4JZ2A 3HKBB 3OAAG 2VQFB 3OT7A 3ZMTA 2EINB 5CBGA 4LF8B 4JASA 2C2AA 4O4HB 2JVDA 5IT9N 3N2GB 3K9SA 1EN5A 4TV9B 4GLXA 3IAYA 1NR1A 1M56C 2E3CA 3KCYA 1VEWA 4P30A 4GKKB 1H2KA 2ODMA 2XASA 3E86A 3BFRA 3VQVA 2R9IA 4WBNB 3FB6C 3OE7G 1U96A 3CX5F 3CC7V 1Q6UA 1GO3F 5J2UA 2FKXA 2GV9A 1ZL8A 1P7BA 1NT2B 4RO2A 1HW7A 4JI2B 1HP8A 4JI7O 4B3RO 2W6JG 1N0JA 1SERA 5LMNO 1IBKB 3HKBA 2GTAA 4MW8A 1I5YA 3K08A 4LF9B 3ASOB 2P22C 3F5WC 4TQFA 1ZTEA 1FJGO 4YJ3A 4K35A 2YXHA 3N2GA 2P7TC 3B77A 3ZHRA 3LDDA 2Q6AA 3M8AA 1Y6XA 2DYSC 2UU9B 1QBZA 5LA6B 1IBMO 3CRQA 2AZ2A 1HR0B 4I7ZB 3HB3B 4FPPA 3H01A 4O4JA 1JR9A 3BCCH 2Q68A 2V4DA 4FM2A 5FL7G 4PD4F 1WA8B 4U7OA 2EINC 2FB5A 1IXBA 4DR3O 1FKAO 4OXSA 4O2BA 4JI3O 2E74B 4X65B 1KUQA 4LBEC 2UUCB 4JAVA 3T4DA 4PA7A 1NVPB 5K1XA 1OCZB 4QGPA 3JALA 1IBLB 1EN6A 2K1EA 2HHHB 2DWDC 1H2MA 2UXCO 1Q90D 4FMTA 2X6AA 3AG7A 1P84F 5IE9A 4G28B 4PHZA 3UCSC 4EB6B 1AJQA 1KYOF 2JIZG 2CGOA 4TUYA 3B40A 3GB7C 4FM0A 3HKEB 3JD0A 2E5LB 3OD4A 4BAYA 3FYIB 1YEWA 4FIPC 3ZIAG 4C7UA 5H6QA 4NTWA 1WP7A 4DV1B 5IDJA 2ZE5A 2NNUA 4AI8A 4UCOA 4DW1A 5B66Z 2CUGA 1WB8A 4IYHA 3RYHB 2YICA 1WA8A 1XQ8A 2ZT9B 1Z5VA 3ASOC 2JJ2G 1AI7A 2YSUB 4X62B 4WFEA 3UO2A 3K79A 3Q4HB 3VQXA 2H8PC 1HNXO 1SQGA 4MTXA 3JASA 4QNHB 5C8YB 4LH7A 2EIJB 5FNVA 1LR1A 4X66O 2MW2B 2ADPA 1L0NH 4H37A 5EC2C 2P90A 2EZOA 3CCEV 2VWJA 4EB6A 4FLXA 2FMLA 2WSSG 2LGQA 1I5XA 4I4TA 5AG2A 5EC1C 1N32O 5BR8B 4LF5B 5CN0A 4X88A 1XBLA 2OTJV 2L35A 1Y4MA 4UCSA 1R1BA 1GN2A 4ABMA 3L75H 1VQ5V 2V7QG 2Y0IA 4XDLA 1OCZC 5LXTB 2UUAB 3AK1A 3OR7C 2HR3A 3L74H 1E79G 4RQFA 4JF3A 1JA8A 4I50A 4JV5B 3SYCA 1BMFG 5L3DA 2PI4A 3AK3A 3SDLA 4KHPO 3TJTA 3JAKB 1VF6C 1LUWA 3SJQC 1SQXH 1VQPV 1SQPH 4BW5A 2HP8A 2NN4A 5C8YA 2Q9LA 3G71V 4UB8Z 1N0NA 1FXKA 1Q8IA 4EFEA 3LSUA 1XHZA 3DXRB 1TUBB 1QVGU 3GWKC 1OZ0A 1R3JC 3IC9A 2IU0A 1R3IC 4UVCA 3OGCC 1WN7A 4FM1A 1V54B 1IVSA 4X89A 1AB3A 1M57B 4DYLA 4JI4B 1Q7YW 3LUTB 3CCLV 1VQ9V 2LFRA 2JGUA 4D7TA 1Y66A 4TT3G 3T2MA 2EIJC 2QTSA 4YIOA 3BVOA 1MA1A 4RUEA 4X1YA 5CA0A 4I55B 5A9GA 3K06A 5KA6A 4DUYO 4EEQA 1BS3A 4YXWG 3CCJV 1GH6A 5LMUO 2PYLA 4DV6B 4O2AA 4YHHB 2QKCA 4OGQB 3A8TA 3BRCA 2BCCH 4UCTA 1JPXA 1VQKV 4LH6A 2IU3A 1FYJA 3UT5B 2ZE6A 3JYCA 4G2KA 4AQYB 2CH7B 3DXRA 1TUBA 1XUQA 2IBZH 1FFTB 3D8CA 2UXDB 2ARHA 3VQWA 1K5QA 4K8ZA 1CP9A 1H8EG 2GUZB 1AI4A 4PDRA 4B3TB 3G6EV 3EVKA 3D36C 3F7YC 2YS8A 1GN4A 4J7KA 4MT8A 3GVMA 4LFCO 2GSMB 1IDSA 1GM9A 2V1DA 3RVYA 1N8RW 5IJ9A 1M93A 2BE3A 3CRRA 4DXWA 2PUSA 2HJDA 4PA4A 5EK0A 2X6CA 3TCUA 4TSFG 2A06H 3F7VC 4F6RB 5FLXN 3ABKB 1V54C 2PZSA 3KZIZ 2P67A 1M57C 2XAHA 3E8BA 2IJHA 1Q82W 1R73A 1XREA 2CH7A 4JYYA 1VQMV 1FFXA 4LP8A 1FS0G 4N23A 5B1BB 2W6IG 4FFBB 3B09A 3SJCC 4R50A 4EFBA 4LFBB 3FAVB 3T1HB 1HDJA 2LGWA 5CA1A 1F7YA 2K9PA 2DMXA 1ROPA 1NQTA 3SYPA 3U10A 3ZBHA 4HAMA 1RPRA 2DW4A 1M1KW 2ATKC 3BAAA 5BY1A 2LO1A 5FPRA 5GW7A 1H38A 4LWSA 4FZ0A 2JRIA 3ZHVA 2XAFA 1A32A 3E8GA 1QR8A 4DV3O 1AROP 4JGSA 1PD3A 3SYOA 1GKFA 1MOFA 4D6TH 4ZOLA 1NZ6A 2WLLA 3HKDB 5B1OA 1CPYA 5HFMA 4JYAB 3ZJZA 1RM1B 5E1AC 1SQQH 4NXNO 1I94B 4DO2A 2UUBO 5JVDB 3J80N 3JSLA
chains in the Genus database with same CATH topology
5BZBA 5KA5A 1NR1A 1M56C 2QE7G 2IH1C 3D3IA 4BIUA 2IJKA 4P30A 4P9PA 4ASUG 1YTFB 1B6QA 2ITDC 5IYDO 2WWWA 4JPRA 4HZ3A 2XASA 2JK5C 1YJ9V 3E86A 4XDJA 4WFFA 2R9IA 3ZRWA 3FB6C 3OE7G 2EIMC 4XBFA 3AG4C 4PDVA 3OFNG 3ABKC 4UXNA 3CC7V 4MTGA 1K92A 2Z3YA 3ZMZA 1GO3F 5LHHA 4GX5A 4F4LA 1GK9A 1VQOV 1JOYA 1P7BA 2PI5A 3IFXA 4RO2A 1R3KC 1NH2D 3LDEA 4KP4A 3ZMVA 1F4NA 1JX9A 2W6JG 3AEIA 3R65A 3UKMA 1SERA 2UXNA 2EIKB 2ZDIA 2OCCC 3AG1B 4MW8A 1JCHA 1I5YA 3VBBA 4KFMA 3K08A 4GX0A 4UUJC 1EZJA 1THZA 1W0KG 2HFEC 2Z5UA 1R6KA 3AG3C 2HG5C 4I9WA 2HLDG 1EBOA 3FB8C 4I5SA 3OUFA 3ASOB 1NKDA 3F5WC 4MVRA 3T1CA 2X0LA 1S77D 2WLLB 1YITV 3SYQA 2P7TC 3ZRVA 3B77A 2XAGA 3LDDA 1L1FA 2Q6AA 1OCOC 2BOBC 1K73W 1GM7A 2DYSC 3KG2A 1OCCB 2WLIB 1QBZA 1YTFD 1S5HC 1PNMA 1KQSU 3HB3B 4FPPA 3H01A 2IH3C 2JDIG 2QKSA 2ZDIC 3QO8A 2Q68A 4R8CA 1AR1B 4MVUA 5FL7G 4U7OA 3ZCCA 2EINC 2F43G 2XAQA 1XL4A 4OXSA 1RM1C 2QM7A 3OW2U 1PNKA 3BEHA 4JTCB 1DTOA 4TWKA 4CZZA 4LBEC 4ZBMA 4JAVA 3EFFK 3FKSG 3T4DA 4PA7A 4UV9A 3UM7A 1K3EA 1K5SA 1KP2A 1NVPB 1S0VA 1OCZB 5LGUA 5CMUA 2QTOA 4E2LA 1MABG 2K1EA 2XNDG 2DWDC 4QE9A 1NBMG 4FMTA 4JYBA 1NH2B 2X6AA 4X8AA 1F23A 2B1GA 2Q69A 3SPGA 2HKOA 4G28B 1AJQA 3SYAA 2ZR2A 2JIZG 1PNLA 3SPCA 4G27B 3GB7C 1OCRB 3AG2B 3K04A 3JD0A 1VQLV 4GX2A 4BAYA 4WCEV 3FYIB 3ETDA 4QPKA 3OEEG 2WLIA 2A9HA 3ZRXA 4FIPC 1PKXA 3ZIAG 2AHYA 5H6QA 4RQEA 3E35A 1W2BU 3CC2V 2D3OW 5IDJA 3E89A 4JTDB 2NNUA 5J9PC 2EIKC 3NXSA 3K9AA 3ZN0A 3AG1C 5IY5B 5L3GA 3CCMV 1YIJV 1M90W 3ABMB 4J9ZB 2WLNA 2WLMA 3OMIB 1QR9A 3ASOC 3D36A 2JJ2G 1AI7A 2YSUB 2Y48A 4WFEA 2ZXWB 3FB7C 4EKWA 1FXVA 3K79A 4MS2A 3LNMB 1NVPD 3ML0A 3OR6C 1FXHA 2JEXA 2H8PC 4XDKA 3QNEA 3STLC 1P4RA 3EHBB 3HPLC 4MTXA 4WF9V 1OCCC 4QNHB 4U7NA 1R3LC 1AI5A 1KC8W 2OTLV 1IXMA 2EIJB 4GX1A 5IYCO 3I55V 1Q86W 4UVAA 4FJCC 3ABLB 4JTAB 4RAIA 1GMGA 4H37A 1QLNA 5EC2C 2P90A 3OEHG 2EZOA 3CCEV 3BY6A 2EILB 1S72V 2QM8A 5LHGA 2WSSG 3JD3A 4MVOA 1I5XA 3ZRSA 1BL8A 2GHYA 2JJ1G 5EC1C 3B8NA 5CN0A 4X88A 4BIZA 4Z1MG 5B1NA 2OTJV 2WLKA 2IJJA 3CD6V 1Y4MA 4KUMA 1BHBA 3QO5A 3FB5C 1HWYA 3ZMSA 4MTFA 2A0LA 1RPOA 5L3BA 1VQ5V 4P2ZA 2V7QG 4XDLA 1QVFU 1SRYA 1OCZC 3GWOA 5C93A 1WLEA 3OR7C 2QA4V 2HR3A 1E79G 3JD1A 4R6ZA 4JF3A 4RQFA 3CPWU 1PL0A 3ABTA 2IJIA 3AG4B 3SYCA 1BMFG 5L3DA 2Y69B 1M9NA 2DYRC 3P30A 2PI4A 1VQNV 3RW0A 2AHZA 5B1AB 5L3FA 1H8HG 3ASNB 5H9CA 1OCRC 5CBFA 3AG2C 3SJQC 5EBLC 1SZTA 3RVZA 2ZR3A 4N21A 1ENVA 1KD1W 1SESA 1VQPV 1MG1A 5L3EA 4BW5A 3P32A 2ZD9A 2UXXA 3CMAV 1NJIW 3G71V 3E83A 2HVKC 3LSSA 3G4SV 1FXKA 3MHSC 4PA9A 3JD4A 2WAMA 2CK3G 4LCUC 1K8AW 4R7CA 1QVGU 2EBOA 1OZ0A 3DGEA 5IY5C 4WFBV 1R3JC 2IU0A 3ABMC 4UV8A 1NR7A 1R3IC 1QLEB 4UVCA 4MVSA 3OGCC 3E2EA 4GT1A 1V54B 3T4ZA 2P6JA 2ZXWC 4X89A 3K3WA 3X2QB 1K33A 3CXCU 1M57B 2NLJC 1GM8A 3STZC 1VQ6V 3OUSA 1Q7YW 3K0DA 1J95A 2DQ3A 3WG7B 4UVBA 1R6NA 3LUTB 5L3CA 1SETA 3CCLV 1VQ9V 2LFRA 4PELA 1LNQA 4QPJA 1YI2V 1Y66A 1YJWV 2ITCC 1YSCA 4J9YB 4TT3G 3T2MA 1ORQC 2EIJC 1V55B 1H2GA 3ABLC 3K03A 1DF4A 4RUEA 3W7TA 1KKDA 3K06A 5KA6A 2EILC 4MSWC 3SPIA 4FK5C 4YXWG 3TETA 3CCJV 3W7WA 5EBMC 3IGAC 2R9RB 4MVMA 2ZQMA 2LFSA 4RUFA 4H33A 2IW5A 1YJNV 3VOUA 1S76D 1YHQV 3IC7A 2DWEC 1VQ7V 3CCUV 1QCEA 3CYOA 3LSQA 4PDLA 3FYEB 1JPXA 1VQKV 1K97A 2IU3A 4MTOA 5LBQA 1JVMA 3JYCA 1E1QG 3JCZA 4G2KA 4QIWF 1E1RG 5LHIA 1FXKB 3LDCA 3WFVA 1FFTB 5KUKA 3OMNB 5IYBO 1UJWB 1K9MW 1K5QA 1CP9A 1H8EG 2XAJA 2EJRA 3W7UA 4PA6A 2Y69C 1DLBA 1WPXA 3MHHC 1EFRG 4CBCA 3MD0A 2MK3A 1AI4A 1K4CC 4PDRA 3CCVV 5B1AC 3G6EV 4Q20A 3ASNC 2DQ0A 2X7RB 3F7YC 5CA3A 3A0RA 4MT8A 5B3SB 4PA3A 2GSMB 4L87A 3CC4V 4JAUA 2JEUA 2YEVA 1GM9A 2V1DA 3W7SA 3CCQV 1MSWD 3ETEA 1M56B 3SPHA 3RVYA 1N8RW 3ZN1A 1BHAA 2LP7A 2M7WA 2XOKG 1G4YB 2Q67A 4ZKIA 4DXWA 1KECA 4PA4A 3K0GA 1F51A 1JJ2U 3CCRV 5EK0A 3RBZA 3TK1A 2WLHA 2X6CA 5EBWC 2WLJA 2BOCC 3E8HA 3PJSK 3QO7A 3TCUA 4TSFG 2EIMB 2OT5A 3F7VC 1QLEC 3ABKB 3JD2A 1V54C 2QEXV 3OM3B 2P67A 4P9OA 1GTOA 1K7DA 3E8FA 1TUEB 3X2QC 4MW3A 1M57C 2XAHA 4WFGA 3E8BA 1G8MA 4JYCA 2IJHA 5KUMA 3WG7C 5HFLA 2HJFC 3ETGA 1S3JA 1OHHG 1Q82W 2HVJC 2OCCB 1KP3A 1R73A 1VQMV 4LP8A 1FS0G 3AG3B 4N23A 1V55C 5B1BB 5H6RA 5DN6G 3SPJA 2FTKA 2W6IG 4R50A 2A79B 5LGNA 4GCZA 1XL6A 3ZRWB 1VQ4V 3ZMUA 1VQ8V 2W0FC 4QE7A 3B8MA 4HYOA 1ROPA 1NQTA 3SYPA 1OCOB 3OMAB 1AJPA 3M99B 2EZPA 4HAMA 5DM6V 3I56V 1AI6A 1RPRA 2DYSB 2DW4A 4LC1A 3DTUB 1DF5A 2KB1A 1M1KW 4PDMA 2ATKC 5LGTA 2WPDG 5CBHA 5GW7A 2B5UA 4WFAV 1H38A 1K4DC 5B1BC 2YEVB 4WFHA 1COWG 2XAFA 3E8GA 3CP1A 4QJFB 1QR8A 2B1IA 3OAAG 1FXKC 3CCSV 1AROP 2DYRB 1JQ0A 3ZMTA 1Q81W 4JGSA 1PD3A 3SYOA 1GKFA 1MOFA 2EINB 1CEZA 5CBGA 2WLLA 3W7XA 1K34A 5B1OA 1CPYA 4JASA 5HFMA 3ZJZA 2C2AA 1RM1B 1AJNA 4MVQA 5E1AC 3CMEV 1F4MA 4MVZA 4DO2A 1ZWIC 3ABUA 1W0JG 2X6BA 5B3SC 2H94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BZB A;  3SYC A;  5B1A C;  2K1E A;  2DWD C;  3ASN C;  3F7Y C;  2DYR C;  4QE9 A;  1M56 C;  4PA3 A;  3RW0 A;  2X6A A;  4X8A A;  2AHZ A;  2IH1 C;  2Q69 A;  3SPG A;  2YEV A;  4G28 B;  1OCR C;  4P30 A;  3AG2 C;  4P9P A;  3SJQ C;  5EBL C;  3SYA A;  2ITD C;  3SPH A;  3RVZ A;  5CBF A;  3RVY A;  3SPC A;  4G27 B;  4HZ3 A;  1G4Y B;  2Q67 A;  3GB7 C;  2JK5 C;  2ZD9 A;  3E86 A;  4XDJ A;  4BW5 A;  4DXW A;  4WFF A;  4PA4 A;  3K0G A;  3K04 A;  3FB6 C;  3E83 A;  2HVK C;  4GX2 A;  2EIM C;  5EK0 A;  3RBZ A;  2WLH A;  2X6C A;  3AG4 C;  2WLJ A;  4PA9 A;  4PDV A;  5EBW C;  3ABK C;  2BOC C;  2WLI A;  2A9H A;  4MTG A;  3E8H A;  4LCU C;  3PJS K;  3TCU A;  4GX5 A;  2AHY A;  3F7V C;  4R7C A;  4F4L A;  1QLE C;  5IY5 C;  1P7B A;  3E89 A;  1R3J C;  1V54 C;  4JTD B;  3IFX A;  3ABM C;  4RO2 A;  5J9P C;  1R3K C;  1R3I C;  4P9O A;  2EIK C;  3E8F A;  3LDE A;  3OGC C;  4MVS A;  4MW3 A;  3X2Q C;  3AG1 C;  1M57 C;  4WFG A;  3R65 A;  3T4Z A;  3E8B A;  3UKM A;  4J9Z B;  2WLN A;  2WLM A;  5KUM A;  3WG7 C;  2ZXW C;  4X89 A;  2OCC C;  2HJF C;  3ASO C;  4MW8 A;  2NLJ C;  3K08 A;  4GX0 A;  4KFM A;  4UUJ C;  3STZ C;  3AG3 C;  2HFE C;  3OUS A;  4I9W A;  2HVJ C;  3K0D A;  1J95 A;  2HG5 C;  4WFE A;  3FB7 C;  4MVR A;  3FB8 C;  3LUT B;  3OUF A;  4PDR A;  4EKW A;  3F5W C;  4MS2 A;  3T1C A;  4LP8 A;  3LNM B;  1LNQ A;  1V55 C;  3SPJ A;  3OR6 C;  2ITC C;  2WLL B;  4J9Y B;  2H8P C;  4R50 A;  4XDK A;  3T2M A;  1ORQ C;  2A79 B;  2EIJ C;  2P7T C;  3STL C;  3SYQ A;  3HPL C;  1XL6 A;  1OCC C;  3LDD A;  4QNH B;  3ABL C;  2Q6A A;  3K03 A;  1OCO C;  1R3L C;  4RUE A;  2W0F C;  2BOB C;  4GX1 A;  4QE7 A;  1KKD A;  4HYO A;  2DYS C;  3KG2 A;  3K06 A;  3SYP A;  2WLI B;  2EIL C;  4JTA B;  4MSW C;  4RAI A;  1S5H C;  3SPI A;  4H37 A;  3TET A;  5EC2 C;  5EBM C;  2KB1 A;  4PDM A;  2ATK C;  3IGA C;  2R9R B;  4MVM A;  4RUF A;  2IH3 C;  5CBH A;  4H33 A;  2QKS A;  3VOU A;  1K4D C;  5B1B C;  2Q68 A;  2DWE C;  4R8C A;  4MVO A;  3ZRS A;  1BL8 A;  4WFH A;  4CBC A;  4MVU A;  5EC1 C;  3E8G A;  4PDL A;  2EIN C;  4X88 A;  2WLK A;  4MTO A;  1XL4 A;  3SYO A;  4OXS A;  1JVM A;  3JYC A;  2WLL A;  5CBG A;  3FB5 C;  3LDC A;  4MTF A;  2A0L A;  5KUK A;  3ZJZ A;  4P2Z A;  4XDL A;  3BEH A;  4JTC B;  4MVQ A;  4TWK A;  1OCZ C;  5E1A C;  4LBE C;  4ZBM A;  3EFF K;  4PA6 A;  3T4D A;  4PA7 A;  3OR7 C;  4MVZ A;  2Y69 C;  1ZWI C;  3UM7 A;  4R6Z A;  2X6B A;  5B3S C;  2QTO A;  1K4C C; 
#chains in the Genus database with same CATH topology
 5JJE B;  5A2Q N;  3F5T A;  2FYU H;  4E4E A;  2IH1 C;  4BIU A;  2VS0 A;  4P9P A;  5EZY B;  4ASU G;  2ITD C;  5IYD O;  1FD9 A;  4DV0 B;  1N34 B;  4FFB A;  1M5I A;  1XMQ O;  4ZHQ B;  4IHJ A;  4J11 A;  3JSN A;  4O4L B;  1VIB A;  1TA8 A;  3RFR A;  3JAR B;  5GON B;  4AHC A;  3ABK C;  3CS5 A;  4MTG A;  4F4L A;  3A0H Z;  2YUA A;  3BAB A;  3CWB H;  4H44 B;  3LDE A;  3G67 A;  4X64 B;  3UKM A;  3DC6 A;  4DUZ B;  4DR2 O;  4KFM A;  4GX0 A;  1THZ A;  5B1B C;  4I9W A;  2HLD G;  3FB8 C;  3HKD A;  3OUF A;  4YY3 O;  1HNZ O;  1S77 D;  4CS4 A;  5LOV A;  2LQT A;  2Q8V A;  3H1K H;  4ZI7 B;  4A5U B;  4IGG A;  5IWA B;  1YIT V;  1NS1 A;  3SYQ A;  2F4V B;  5JVD A;  4DW0 A;  1GM7 A;  2CDY A;  3KG2 A;  1GAX A;  1OCC B;  1YTF D;  1S5H C;  1H2N A;  4K8X A;  5LP6 B;  1PNM A;  1AVM A;  3K57 A;  5EZY A;  3QVN A;  2IH3 C;  3H1J H;  3QO8 A;  2Q7G A;  1AR1 B;  5JJN B;  4ZHQ A;  4O4L A;  3ZCC A;  2F95 B;  5GON A;  1XDC A;  1ZX3 A;  4HNA A;  3HKC A;  2XAQ A;  3ZHT A;  1RM1 C;  1UPG A;  1GRJ A;  3OW2 U;  2PF4 E;  1SC5 B;  4JTC B;  5J2U B;  4TWK A;  4ZBM A;  2QWQ B;  3EFF K;  4UV9 A;  1K3E A;  4NXM B;  2Y4U A;  5LGU A;  4CH6 A;  5CMU A;  1JMK C;  2QTO A;  4E2L A;  1QU7 A;  1NBM G;  4NVP A;  2HEP A;  4JYB A;  1OJH A;  2G38 A;  3SYA A;  4UCV A;  3WB0 A;  4JI0 B;  1RSO A;  4ZI7 A;  2WA3 A;  2Y0P A;  3E22 B;  1BQZ A;  2PTM A;  4YJ3 B;  1HNW O;  3K04 A;  1KKC A;  2A9H A;  5B5E Z;  1SA0 A;  5LP6 A;  2AHY A;  4RQE A;  4DK1 A;  1JFF A;  3IJ4 A;  1I08 A;  3NXS A;  2ZCE A;  5IY5 B;  1XNQ O;  3CCM V;  1M90 W;  1PL4 A;  4O4J B;  5EIB D;  1L0L H;  1QR9 A;  5D5Q A;  3H1L H;  3CRA A;  4EKW A;  1IBM B;  1FXV A;  2YDE A;  4XDK A;  4DR1 O;  3QNE A;  4O2B B;  1P4R A;  3EHB B;  3HPL C;  1OCC C;  1D2D A;  4PI2 A;  3KCX A;  5LP6 C;  4GX1 A;  5IYC O;  3NR7 A;  4FJC C;  4UVA A;  3ABL B;  2XTA A;  4JTA B;  3K5M A;  2ZE8 A;  1QLN A;  3JAL B;  1Y74 A;  5KHJ A;  1VP7 A;  2QWP B;  3BY6 A;  1KB9 F;  3U0Z A;  1S72 V;  2QM8 A;  3LNN A;  1XHX A;  5LHG A;  3E22 A;  3JD3 A;  4JI5 O;  2VQF O;  4NTY A;  1BL8 A;  2QWR B;  2Z0A A;  4J80 A;  4TUY B;  4Z1M G;  4DV7 O;  5JQG A;  3APQ A;  3RT3 C;  3JAW B;  4LF8 O;  2WLK A;  2YI8 A;  4KUM A;  3QO5 A;  1PP9 H;  1HWY A;  1VF5 B;  2A0L A;  1B3Q A;  5KMG A;  4B3S B;  1QVF U;  3RWR D;  1W59 A;  1YZB A;  4FFK A;  1XEQ A;  2IJI A;  3AG4 B;  5KHH A;  5KLV H;  5E79 Z;  2Y69 B;  1M9N A;  4GKK O;  2ETN A;  5KX5 B;  5B1A B;  4DR7 O;  5CBF A;  3DC5 A;  5EBL C;  2QKA A;  2ZR3 A;  4N21 A;  1KD1 W;  1MG1 A;  3P32 A;  2XUM A;  4X20 A;  3CMA V;  2CTQ A;  5K1P A;  2HVK C;  3LSS A;  4JI6 B;  3JAS B;  3MHS C;  3S3W A;  3JD4 A;  1UFI A;  1DGS A;  5FNV B;  4JI2 O;  2EBO A;  1H2S B;  5IY5 C;  4WFB V;  4D7S A;  3J7A U;  4GT1 A;  1GN3 A;  3FD9 A;  1Z2G A;  4LF9 O;  3K3W A;  3U11 A;  2EUL A;  1MNG A;  4I4T B;  1KBH A;  3JAW A;  3STZ C;  3P3P A;  3K0D A;  1J95 A;  2DQ3 A;  1LNQ A;  1NTZ H;  1YJW V;  2ITC C;  4J9Y B;  5GTI Z;  4FLW A;  4H0L B;  2UU9 O;  2AGA A;  1N32 B;  3ABL C;  4JI8 O;  1HR0 O;  4B3M B;  4MSW C;  4FK5 C;  3TET A;  4I50 B;  5KX5 A;  3W7W A;  3JAM N;  1PV0 A;  1SZX A;  3IGA C;  4MVM A;  1YF2 A;  4H33 A;  2IW5 A;  3VOU A;  4JZG A;  3IC7 A;  3CCU V;  1YCI A;  3RN4 A;  2YI9 A;  3K5L A;  1NI8 A;  4X65 O;  2GDS A;  4MTO A;  5LHI A;  4QIW F;  1FXK B;  3LDC A;  4DR5 B;  2UUC O;  3BHP A;  5KAF Z;  1G1X B;  1SF9 A;  1XI1 A;  4DV2 B;  1LUV A;  5IYB O;  2HHH O;  2Y69 C;  1DLB A;  1MZE A;  2MK3 A;  1K4C C;  1FAF A;  5B1A C;  4DR6 B;  2DE0 X;  2H3O A;  4L87 A;  3QG5 A;  2JEU A;  4F6E A;  1X59 A;  1WPB A;  1MSW D;  4LF4 B;  3SPH A;  2XOK G;  2ZIO A;  4W4K A;  1G4Y B;  2Q67 A;  2ZNI A;  1KEC A;  3K0G A;  4KL1 A;  1JJ2 U;  2KQX A;  3RBZ A;  3TK1 A;  4DV1 O;  3PJS K;  3QO7 A;  2EIM B;  4X1Y B;  5CA0 B;  1RP3 B;  3OTF A;  1Z5W A;  3CEI A;  2QEX V;  2F93 B;  4K0K B;  1AP5 A;  4BW9 A;  2P06 A;  5ITZ B;  1G8M A;  4JYC A;  4X62 O;  5KUM A;  2CAZ C;  4O2A B;  4I9Q A;  2HJF C;  4ICG A;  1AIL A;  1OHH G;  3R66 A;  2JS3 A;  1KP3 A;  3I5D A;  5H6R A;  1GN6 A;  2A79 B;  5LGN A;  5LYJ B;  2A7W A;  1QHT A;  3C3S A;  3RYF A;  3ZRW B;  3ZMU A;  3WB1 A;  1CXZ B;  1OCO B;  3I56 V;  2EZP A;  5DM6 V;  4LC1 A;  3DTU B;  1DF5 A;  2KB1 A;  4PDM A;  5LGT A;  2WPD G;  1KU9 A;  2B5U A;  5BR8 O;  3KKY A;  2LW7 A;  4O4I A;  2N04 A;  5IJ9 B;  2B1I A;  2PYJ A;  5H5N A;  1FXK C;  2DYR B;  1JQ0 A;  4LFC B;  4CC5 A;  1J5E B;  2UUA O;  1K34 A;  1XIL A;  1R6T A;  3CSX A;  4Z1V A;  3CME V;  4JV5 O;  4MVZ A;  3ABU A;  2D2C B;  5ITZ A;  2X6B A;  2JGD B;  2H94 A;  5BZB A;  5KA5 A;  2IM9 A;  4LF7 B;  3D3I A;  2IJK A;  2AXT Z;  2WWW A;  4HZ3 A;  4BIO A;  1YJ9 V;  5LYJ A;  4TV8 B;  1FFX B;  4W4L A;  3ZRW A;  4JAA A;  2EIM C;  1KMI Z;  1Q43 A;  3OFN G;  4UXN A;  3TXQ A;  5CA1 B;  3ETQ A;  1K92 A;  2Z3Y A;  5LHH A;  4DK0 A;  3J81 N;  1VQO V;  2DOS A;  1JOY A;  2YXY A;  3UQ8 A;  1MSD A;  2YID A;  1V9P A;  1F4N A;  3AEI A;  5JCO A;  4JI4 O;  2UXN A;  2EIK B;  4LWS B;  4CH3 A;  4DV5 B;  3VBB A;  3AK2 A;  1EZJ A;  1W0K G;  4I5S A;  1R6K A;  2HG5 C;  4MVR A;  1EBO A;  1S5L Z;  1NKD A;  3T1C A;  1NTK H;  3JAT B;  4ZOL B;  2WLL B;  2XAG A;  1OCO C;  1BT8 A;  1X4T A;  2JGD A;  2BOB C;  1K73 W;  3K59 A;  2OWO A;  2WLI B;  2Q73 A;  3G6B A;  4DV6 O;  3ICX A;  5DED A;  1KQS U;  1AR5 A;  2JDI G;  3N27 A;  3MDS A;  4DR4 B;  3B2E E;  4R8C A;  4TV8 A;  2UUB B;  3CXH F;  4AQY O;  1VF7 A;  1VAR A;  3D3Q A;  2F43 G;  3T1Y B;  4IHJ B;  3CRC A;  2RN9 A;  1XL4 A;  2UXD O;  1TAE A;  4RWU A;  5JWP A;  1WAZ A;  2VQE B;  1PNK A;  3A2F A;  3C3T A;  3BEH A;  4GUN A;  4OX9 B;  4CZZ A;  2KSD A;  2Q0A A;  4X1K B;  1SQV H;  4B3T O;  4J41 A;  1TVK A;  1MAB G;  1D5N A;  2XND G;  4IYI A;  2YIA A;  1P49 A;  1NH2 B;  2B1G A;  2Q69 A;  3SPG A;  2HKO A;  2P4K A;  2ZR2 A;  2UXB B;  1PNL A;  3JAT A;  2YIB D;  3SR2 C;  1OCR B;  5LOV B;  5KHG A;  4WCE V;  4FLV A;  4QPK A;  2WLI A;  4JI1 B;  1PKX A;  4L8J A;  4FLT A;  3E35 A;  3ZED A;  3CC2 V;  2D3O W;  3G80 A;  3OTO O;  2EIK C;  3K9A A;  5L3G A;  1YIJ V;  2ZNJ A;  3ABM B;  1RFY A;  4J9Z B;  4DV4 O;  2WLM A;  2OYQ A;  3OMI B;  4FVM A;  2ZXW B;  3FB7 C;  4CH4 A;  2B9Z A;  4MS2 A;  4HNA B;  4LFB O;  1Y76 A;  3HKC B;  3LNM B;  1N4C A;  3T1H O;  1NVP D;  3ML0 A;  4IIJ A;  2JEX A;  4X1K A;  2ZM6 B;  3EXA A;  4U7N A;  4FLZ A;  3WU2 Z;  1AI5 A;  1KC8 W;  2OTL V;  1Q86 W;  3I55 V;  1O9H A;  1YDX A;  1GMG A;  4LFA B;  3OEH G;  1AR4 A;  4LF6 O;  1QNM A;  1DK1 A;  3O9O A;  2Q7H A;  1Q3E A;  3APO A;  2Q4P A;  2JJ1 G;  5KHI A;  2OCH A;  1XNR B;  1RSO B;  4BIZ A;  2A3Q A;  5B1N A;  4AIL C;  1BHB A;  4GKJ O;  3ZMS A;  4MTF A;  2BSK A;  5L3B A;  1SA0 B;  1I94 O;  3GWO A;  1JFF B;  2OIG A;  4YIP A;  1ZAU A;  2WA4 A;  1VQN V;  4DV0 O;  3RW0 A;  1N34 O;  2JS5 A;  5L3F A;  3ASN B;  3THO A;  3ZHQ A;  5IYZ B;  1OCR C;  1SZT A;  1SES A;  5L3E A;  4ZIB A;  2UXX A;  2N74 A;  4NKG B;  1NJI W;  1QQC A;  2WAM A;  2CK3 G;  4LCU C;  1K8A W;  4R7C A;  3WB2 A;  4X64 O;  5J2T B;  3ABM C;  4U3J B;  3ZHS A;  4UV8 A;  1NR7 A;  3SJA C;  1QLE B;  1BGY H;  1Y74 B;  4MVS A;  4DUZ O;  4GYC B;  2QR4 A;  2P6J A;  1EZV H;  2ZXW C;  3X2Q B;  1N36 O;  4B3R B;  4JI7 B;  3CXC U;  3RYC B;  1VQ6 V;  5LMN B;  3WG7 B;  1ZSP A;  2NR5 A;  1R6N A;  5TIS Z;  5L3C A;  2ZE7 A;  5JQG B;  5IWA O;  4J42 A;  4PEL A;  4QPJ A;  2F4V O;  1YSC A;  4JI5 B;  1ORQ C;  2EX3 A;  5GTH Z;  1FJG B;  5KMG B;  1DF4 A;  4B08 A;  3W7T A;  5EYP B;  1KKD A;  4DV7 B;  1N33 O;  2QSA A;  4UFZ A;  2RDC A;  2XT9 A;  4UCU A;  5IYZ A;  2R9R B;  2ZQM A;  4RUF A;  1YJN V;  1YHQ V;  4DRX A;  1VQ7 V;  1QCE A;  1OV9 A;  1XMO O;  2BTQ A;  5F2V O;  1SKV A;  3FYE B;  4X20 B;  1WB7 A;  4DR7 B;  2R72 A;  3WFV A;  5CB4 B;  4DR3 B;  5J2T A;  2F23 A;  5KUK A;  4NXM O;  2LJ2 A;  4U3J A;  1K9M W;  2F66 C;  4JI3 B;  4PA6 A;  3MHH C;  1EFR G;  1I7F A;  2ZKO A;  2RMK B;  3ASN C;  2DQ0 A;  3RYC A;  2X7R B;  5CA3 A;  3A0R A;  5B3S B;  4JI0 O;  4J10 A;  4JAU A;  4FLY A;  2YEV A;  3CCQ V;  2UXC B;  3ZN1 A;  1BHA A;  2LP7 A;  4ZKI A;  1F51 A;  5EYP A;  2WLH A;  5EBW C;  2WLJ A;  4BR6 A;  3CB2 A;  3E8H A;  4O4H A;  1H2L A;  1QLE C;  2QWN B;  2KKW A;  3JD2 A;  3VQY A;  1SQB H;  4TV9 A;  3OM3 B;  1GTO A;  1K7D A;  3E8F A;  1TUE B;  3X2Q C;  1US6 A;  4WFG A;  1XOU A;  4JI8 B;  3B4S A;  2RCV A;  3WG7 C;  5HFL A;  3ETG A;  1S3J A;  1IX9 A;  2OCC B;  5CB4 A;  1NU1 H;  4WBN A;  3AG3 B;  3SGI A;  3SPJ A;  5FPO A;  2FTK A;  1WJZ A;  2P4V A;  2RJZ A;  3SJB C;  1XL6 A;  2ZIN A;  1VQ8 V;  1HNX B;  2F1M A;  2W0F C;  1IBK O;  4HYO A;  1JJO A;  2ILM A;  4X66 B;  1K4D C;  3QF7 A;  2ZIM A;  3H1I H;  3A0B Z;  3ZHU A;  3CP1 A;  4QJF B;  4OPH A;  2E76 B;  3CCS V;  1Q81 W;  4PV1 B;  4B3S O;  1MMM A;  1CEZ A;  3W7X A;  1EM1 A;  2YIB A;  1AJN A;  4MVQ A;  2RNB A;  2RQ6 A;  1F4M A;  1ZWI C;  5KHK A;  1W0J G;  5B3S C;  5LA6 A;  4BWA A;  2QE7 G;  2ADQ B;  2Y4T A;  4NB5 A;  1YTF B;  1B6Q A;  5BMV B;  1MZF A;  1M4U A;  3TGU H;  3C90 A;  4JPR A;  4FLU A;  3L72 H;  3MAQ A;  2JK5 C;  4JI6 O;  4XDJ A;  4KHP B;  4WFF A;  3TXS A;  4XBF A;  1IBL O;  3AG4 C;  4PDV A;  3RYF B;  3ZMZ A;  4GX5 A;  1GK9 A;  2PI5 A;  3IFX A;  1R3K C;  4CS3 A;  1NH2 D;  4KP4 A;  3ZMV A;  1JX9 A;  3QTC A;  3R65 A;  4B7K A;  3K5N A;  2ZDI A;  2E5L O;  2OCC C;  3AG1 B;  2KG7 B;  1JCH A;  4UUJ C;  3AG3 C;  2HFE C;  2Z5U A;  4O4I B;  2X0L A;  1VF6 A;  3HKE A;  3H9V A;  2L6L A;  1U97 A;  1Q6I A;  3ZRV A;  1L1F A;  3JCU Z;  4B3M O;  2VWK A;  3M7M X;  5JH7 B;  1SS3 A;  4I0X B;  1BE3 H;  3RYH A;  4DUY B;  4OPA A;  5BMV A;  2QKS A;  2ZDI C;  1FPO A;  4CH5 A;  4MVU A;  5LMU B;  3CE2 A;  4YJ2 B;  4DR5 O;  3Q4H A;  4X9Q A;  4U3F H;  4DV2 O;  2QM7 A;  1Q6H A;  4KXR A;  1DTO A;  5BXZ A;  2Q0O C;  2YXL A;  3FKS G;  3UM7 A;  1K5S A;  1KP2 A;  3RYI B;  1S0V A;  1BSM A;  4LF5 O;  4DR6 O;  2KG7 A;  1VMG A;  1D5A A;  4QE9 A;  4LF4 O;  4X8A A;  1F23 A;  4IT5 A;  4IL6 Z;  4PI0 A;  3SPC A;  4G27 B;  3AG2 B;  1B06 A;  1VQL V;  4GX2 A;  2DJV A;  3ETD A;  5JH7 A;  3OEE G;  4K3A A;  1NTM H;  3ZRX A;  4H13 B;  4K0K O;  5LXT A;  4I0X A;  3CJH B;  2QM4 A;  1W2B U;  3E89 A;  3BPZ A;  3H1H H;  4JTD B;  2FL4 A;  5J9P C;  2Q5Z A;  3S3X A;  3ZN0 A;  3AG1 C;  2WLN A;  4YJ2 A;  3D36 A;  3JAK A;  2Y48 A;  2Q7E A;  4CC6 A;  2W0X A;  3OR6 C;  1FXH A;  1Y67 A;  1BCC H;  4NR1 A;  2CGN A;  3STL C;  4WF9 V;  4X1I B;  2DN9 A;  2QJ1 A;  1R3L C;  3RYI A;  2O57 A;  1IXM A;  2BTO A;  2GTS A;  1TVK B;  4RAI A;  2CTR A;  2EIL B;  3BA8 A;  3OGI B;  3ZX6 A;  4MVO A;  3ZRS A;  2GHY A;  3B8N A;  5EIB C;  1J5E O;  2CTP A;  2IJJ A;  3CD6 V;  1I0H A;  3FX7 A;  3CJH A;  2R70 A;  3FB5 C;  4DV3 B;  1RPO A;  1B04 A;  4P2Z A;  1SRY A;  4I55 A;  5C93 A;  4TQD A;  4LR3 A;  4YHH O;  1WLE A;  1WP8 A;  2QA4 V;  3JD1 A;  4R6Z A;  3CPW U;  4LF7 O;  1PL0 A;  3ABT A;  5JCO C;  1IZ3 A;  4NXN B;  3ZS8 C;  2DYR C;  3P30 A;  4NTX A;  3PN1 A;  3P3N A;  2AHZ A;  1H8H G;  1S5J A;  2AW9 A;  2M6Y A;  5H9C A;  3AG2 C;  3RVZ A;  3OTO B;  1ENV A;  2ZD9 A;  1Y76 B;  4X1I A;  4IIJ B;  3UT5 A;  2AZ0 A;  4DV4 B;  3E83 A;  2QDO A;  3G4S V;  4PA9 A;  1XMQ B;  3RGB A;  3DGE A;  2GUZ A;  5LL6 Y;  4DV5 O;  3K58 A;  2P5O A;  3E2E A;  2PGG A;  3N2K B;  3T4Z A;  1K33 A;  2NLJ C;  1GM8 A;  3OUS A;  4UVB A;  4DR2 B;  1SET A;  4LF6 B;  4NYK A;  1YI2 V;  1URF A;  2QWO B;  4J7Z A;  4YY3 B;  1HNZ B;  2N05 A;  1Q5O A;  2VRZ A;  1TGO A;  1V55 B;  2BSK B;  1H2G A;  3K03 A;  4LNU B;  4F6R A;  5IJ0 B;  1ZLZ A;  2EIL C;  3SPI A;  4GKJ B;  2GBO A;  5EBM C;  4DR4 O;  2LFS A;  3HR0 A;  1WNS A;  5D5P A;  1S76 D;  2DWE C;  3CHX A;  3T1Y O;  3CYO A;  3LSQ A;  4PDL A;  2YC0 A;  5DEC A;  1K97 A;  2VQE O;  5LBQ A;  1JVM A;  2OIE A;  1E1Q G;  3JCZ A;  4OX9 O;  1E1R G;  2PY5 A;  3FAV A;  3OMN B;  1UJW B;  3L70 H;  2XAJ A;  2EJR A;  3W7U A;  1BQ0 A;  3N2K A;  1WPX A;  4Q6G A;  1SQF A;  4CBC A;  3MD0 A;  2R9A A;  3CCV V;  4Q20 A;  5KAI Z;  1PM9 A;  1T5E A;  2UXB O;  4PA3 A;  3CC4 V;  4B7E A;  3W7S A;  1YXB A;  1G6U A;  5H2F Z;  3ETE A;  1M56 B;  4JYA O;  4Z2W A;  4UB6 Z;  4UCR A;  5JJJ B;  2M7W A;  2QGN A;  1BZK A;  3CCR V;  4LNU A;  4JI1 O;  1N36 B;  3FFQ A;  3L9D A;  2BOC C;  5IJ0 A;  1HNW B;  4J7J A;  1PPJ H;  4PJ0 Z;  4CS2 A;  2OT5 A;  1ZUQ A;  2CTW A;  3CRM A;  4P9O A;  4MW3 A;  3O65 A;  1IUR A;  4FZ1 A;  1L8D A;  1XNQ B;  1N33 B;  4DRX B;  2LW1 A;  3K5O A;  3BA9 A;  2HVJ C;  2BTQ B;  1P7G A;  2ZM6 O;  1V55 C;  5DN6 G;  1AP6 A;  4TOI A;  3JAR A;  4GCZ A;  1YVW A;  4GZR B;  1VQ4 V;  1XMO B;  4DR1 B;  4LFA O;  4QE7 A;  2XHB A;  3B8M A;  3L73 H;  3DSQ A;  2E75 B;  4HBN A;  3OMA B;  3UO3 A;  1AJP A;  3M99 B;  1AI6 A;  2DYS B;  2CE4 A;  1ZL8 B;  3L71 H;  5CBH A;  1XNR O;  4WFA V;  2YEV B;  4WFH A;  1COW G;  1O9G A;  2EJ7 A;  1EN4 A;  4JZ2 A;  3HKB B;  3OAA G;  2VQF B;  3OT7 A;  3ZMT A;  2EIN B;  5CBG A;  4LF8 B;  4JAS A;  2C2A A;  4O4H B;  2JVD A;  5IT9 N;  3N2G B;  3K9S A;  1EN5 A;  4TV9 B;  4GLX A;  3IAY A;  1NR1 A;  1M56 C;  2E3C A;  3KCY A;  1VEW A;  4P30 A;  4GKK B;  1H2K A;  2ODM A;  2XAS A;  3E86 A;  3BFR A;  3VQV A;  2R9I A;  4WBN B;  3FB6 C;  3OE7 G;  1U96 A;  3CX5 F;  3CC7 V;  1Q6U A;  1GO3 F;  5J2U A;  2FKX A;  2GV9 A;  1ZL8 A;  1P7B A;  1NT2 B;  4RO2 A;  1HW7 A;  4JI2 B;  1HP8 A;  4JI7 O;  4B3R O;  2W6J G;  1N0J A;  1SER A;  5LMN O;  1IBK B;  3HKB A;  2GTA A;  4MW8 A;  1I5Y A;  3K08 A;  4LF9 B;  3ASO B;  2P22 C;  3F5W C;  4TQF A;  1ZTE A;  1FJG O;  4YJ3 A;  4K35 A;  2YXH A;  3N2G A;  2P7T C;  3B77 A;  3ZHR A;  3LDD A;  2Q6A A;  3M8A A;  1Y6X A;  2DYS C;  2UU9 B;  1QBZ A;  5LA6 B;  1IBM O;  3CRQ A;  2AZ2 A;  1HR0 B;  4I7Z B;  3HB3 B;  4FPP A;  3H01 A;  4O4J A;  1JR9 A;  3BCC H;  2Q68 A;  2V4D A;  4FM2 A;  5FL7 G;  4PD4 F;  1WA8 B;  4U7O A;  2EIN C;  2FB5 A;  1IXB A;  4DR3 O;  1FKA O;  4OXS A;  4O2B A;  4JI3 O;  2E74 B;  4X65 B;  1KUQ A;  4LBE C;  2UUC B;  4JAV A;  3T4D A;  4PA7 A;  1NVP B;  5K1X A;  1OCZ B;  4QGP A;  3JAL A;  1IBL B;  1EN6 A;  2K1E A;  2HHH B;  2DWD C;  1H2M A;  2UXC O;  1Q90 D;  4FMT A;  2X6A A;  3AG7 A;  1P84 F;  5IE9 A;  4G28 B;  4PHZ A;  3UCS C;  4EB6 B;  1AJQ A;  1KYO F;  2JIZ G;  2CGO A;  4TUY A;  3B40 A;  3GB7 C;  4FM0 A;  3HKE B;  3JD0 A;  2E5L B;  3OD4 A;  4BAY A;  3FYI B;  1YEW A;  4FIP C;  3ZIA G;  4C7U A;  5H6Q A;  4NTW A;  1WP7 A;  4DV1 B;  5IDJ A;  2ZE5 A;  2NNU A;  4AI8 A;  4UCO A;  4DW1 A;  5B66 Z;  2CUG A;  1WB8 A;  4IYH A;  3RYH B;  2YIC A;  1WA8 A;  1XQ8 A;  2ZT9 B;  1Z5V A;  3ASO C;  2JJ2 G;  1AI7 A;  2YSU B;  4X62 B;  4WFE A;  3UO2 A;  3K79 A;  3Q4H B;  3VQX A;  2H8P C;  1HNX O;  1SQG A;  4MTX A;  3JAS A;  4QNH B;  5C8Y B;  4LH7 A;  2EIJ B;  5FNV A;  1LR1 A;  4X66 O;  2MW2 B;  2ADP A;  1L0N H;  4H37 A;  5EC2 C;  2P90 A;  2EZO A;  3CCE V;  2VWJ A;  4EB6 A;  4FLX A;  2FML A;  2WSS G;  2LGQ A;  1I5X A;  4I4T A;  5AG2 A;  5EC1 C;  1N32 O;  5BR8 B;  4LF5 B;  5CN0 A;  4X88 A;  1XBL A;  2OTJ V;  2L35 A;  1Y4M A;  4UCS A;  1R1B A;  1GN2 A;  4ABM A;  3L75 H;  1VQ5 V;  2V7Q G;  2Y0I A;  4XDL A;  1OCZ C;  5LXT B;  2UUA B;  3AK1 A;  3OR7 C;  2HR3 A;  3L74 H;  1E79 G;  4RQF A;  4JF3 A;  1JA8 A;  4I50 A;  4JV5 B;  3SYC A;  1BMF G;  5L3D A;  2PI4 A;  3AK3 A;  3SDL A;  4KHP O;  3TJT A;  3JAK B;  1VF6 C;  1LUW A;  3SJQ C;  1SQX H;  1VQP V;  1SQP H;  4BW5 A;  2HP8 A;  2NN4 A;  5C8Y A;  2Q9L A;  3G71 V;  4UB8 Z;  1N0N A;  1FXK A;  1Q8I A;  4EFE A;  3LSU A;  1XHZ A;  3DXR B;  1TUB B;  1QVG U;  3GWK C;  1OZ0 A;  1R3J C;  3IC9 A;  2IU0 A;  1R3I C;  4UVC A;  3OGC C;  1WN7 A;  4FM1 A;  1V54 B;  1IVS A;  4X89 A;  1AB3 A;  1M57 B;  4DYL A;  4JI4 B;  1Q7Y W;  3LUT B;  3CCL V;  1VQ9 V;  2LFR A;  2JGU A;  4D7T A;  1Y66 A;  4TT3 G;  3T2M A;  2EIJ C;  2QTS A;  4YIO A;  3BVO A;  1MA1 A;  4RUE A;  4X1Y A;  5CA0 A;  4I55 B;  5A9G A;  3K06 A;  5KA6 A;  4DUY O;  4EEQ A;  1BS3 A;  4YXW G;  3CCJ V;  1GH6 A;  5LMU O;  2PYL A;  4DV6 B;  4O2A A;  4YHH B;  2QKC A;  4OGQ B;  3A8T A;  3BRC A;  2BCC H;  4UCT A;  1JPX A;  1VQK V;  4LH6 A;  2IU3 A;  1FYJ A;  3UT5 B;  2ZE6 A;  3JYC A;  4G2K A;  4AQY B;  2CH7 B;  3DXR A;  1TUB A;  1XUQ A;  2IBZ H;  1FFT B;  3D8C A;  2UXD B;  2ARH A;  3VQW A;  1K5Q A;  4K8Z A;  1CP9 A;  1H8E G;  2GUZ B;  1AI4 A;  4PDR A;  4B3T B;  3G6E V;  3EVK A;  3D36 C;  3F7Y C;  2YS8 A;  1GN4 A;  4J7K A;  4MT8 A;  3GVM A;  4LFC O;  2GSM B;  1IDS A;  1GM9 A;  2V1D A;  3RVY A;  1N8R W;  5IJ9 A;  1M93 A;  2BE3 A;  3CRR A;  4DXW A;  2PUS A;  2HJD A;  4PA4 A;  5EK0 A;  2X6C A;  3TCU A;  4TSF G;  2A06 H;  3F7V C;  4F6R B;  5FLX N;  3ABK B;  1V54 C;  2PZS A;  3KZI Z;  2P67 A;  1M57 C;  2XAH A;  3E8B A;  2IJH A;  1Q82 W;  1R73 A;  1XRE A;  2CH7 A;  4JYY A;  1VQM V;  1FFX A;  4LP8 A;  1FS0 G;  4N23 A;  5B1B B;  2W6I G;  4FFB B;  3B09 A;  3SJC C;  4R50 A;  4EFB A;  4LFB B;  3FAV B;  3T1H B;  1HDJ A;  2LGW A;  5CA1 A;  1F7Y A;  2K9P A;  2DMX A;  1ROP A;  1NQT A;  3SYP A;  3U10 A;  3ZBH A;  4HAM A;  1RPR A;  2DW4 A;  1M1K W;  2ATK C;  3BAA A;  5BY1 A;  2LO1 A;  5FPR A;  5GW7 A;  1H38 A;  4LWS A;  4FZ0 A;  2JRI A;  3ZHV A;  2XAF A;  1A32 A;  3E8G A;  1QR8 A;  4DV3 O;  1ARO P;  4JGS A;  1PD3 A;  3SYO A;  1GKF A;  1MOF A;  4D6T H;  4ZOL A;  1NZ6 A;  2WLL A;  3HKD B;  5B1O A;  1CPY A;  5HFM A;  4JYA B;  3ZJZ A;  1RM1 B;  5E1A C;  1SQQ H;  4NXN O;  1I94 B;  4DO2 A;  2UUB O;  5JVD B;  3J80 N;  3JSL A; 
#chains in the Genus database with same CATH homology
 5BZB A;  5KA5 A;  1NR1 A;  1M56 C;  2QE7 G;  2IH1 C;  3D3I A;  4BIU A;  2IJK A;  4P30 A;  4P9P A;  4ASU G;  1YTF B;  1B6Q A;  2ITD C;  5IYD O;  2WWW A;  4JPR A;  4HZ3 A;  2XAS A;  2JK5 C;  1YJ9 V;  3E86 A;  4XDJ A;  4WFF A;  2R9I A;  3ZRW A;  3FB6 C;  3OE7 G;  2EIM C;  4XBF A;  3AG4 C;  4PDV A;  3OFN G;  3ABK C;  4UXN A;  3CC7 V;  4MTG A;  1K92 A;  2Z3Y A;  3ZMZ A;  1GO3 F;  5LHH A;  4GX5 A;  4F4L A;  1GK9 A;  1VQO V;  1JOY A;  1P7B A;  2PI5 A;  3IFX A;  4RO2 A;  1R3K C;  1NH2 D;  3LDE A;  4KP4 A;  3ZMV A;  1F4N A;  1JX9 A;  2W6J G;  3AEI A;  3R65 A;  3UKM A;  1SER A;  2UXN A;  2EIK B;  2ZDI A;  2OCC C;  3AG1 B;  4MW8 A;  1JCH A;  1I5Y A;  3VBB A;  4KFM A;  3K08 A;  4GX0 A;  4UUJ C;  1EZJ A;  1THZ A;  1W0K G;  2HFE C;  2Z5U A;  1R6K A;  3AG3 C;  2HG5 C;  4I9W A;  2HLD G;  1EBO A;  3FB8 C;  4I5S A;  3OUF A;  3ASO B;  1NKD A;  3F5W C;  4MVR A;  3T1C A;  2X0L A;  1S77 D;  2WLL B;  1YIT V;  3SYQ A;  2P7T C;  3ZRV A;  3B77 A;  2XAG A;  3LDD A;  1L1F A;  2Q6A A;  1OCO C;  2BOB C;  1K73 W;  1GM7 A;  2DYS C;  3KG2 A;  1OCC B;  2WLI B;  1QBZ A;  1YTF D;  1S5H C;  1PNM A;  1KQS U;  3HB3 B;  4FPP A;  3H01 A;  2IH3 C;  2JDI G;  2QKS A;  2ZDI C;  3QO8 A;  2Q68 A;  4R8C A;  1AR1 B;  4MVU A;  5FL7 G;  4U7O A;  3ZCC A;  2EIN C;  2F43 G;  2XAQ A;  1XL4 A;  4OXS A;  1RM1 C;  2QM7 A;  3OW2 U;  1PNK A;  3BEH A;  4JTC B;  1DTO A;  4TWK A;  4CZZ A;  4LBE C;  4ZBM A;  4JAV A;  3EFF K;  3FKS G;  3T4D A;  4PA7 A;  4UV9 A;  3UM7 A;  1K3E A;  1K5S A;  1KP2 A;  1NVP B;  1S0V A;  1OCZ B;  5LGU A;  5CMU A;  2QTO A;  4E2L A;  1MAB G;  2K1E A;  2XND G;  2DWD C;  4QE9 A;  1NBM G;  4FMT A;  4JYB A;  1NH2 B;  2X6A A;  4X8A A;  1F23 A;  2B1G A;  2Q69 A;  3SPG A;  2HKO A;  4G28 B;  1AJQ A;  3SYA A;  2ZR2 A;  2JIZ G;  1PNL A;  3SPC A;  4G27 B;  3GB7 C;  1OCR B;  3AG2 B;  3K04 A;  3JD0 A;  1VQL V;  4GX2 A;  4BAY A;  4WCE V;  3FYI B;  3ETD A;  4QPK A;  3OEE G;  2WLI A;  2A9H A;  3ZRX A;  4FIP C;  1PKX A;  3ZIA G;  2AHY A;  5H6Q A;  4RQE A;  3E35 A;  1W2B U;  3CC2 V;  2D3O W;  5IDJ A;  3E89 A;  4JTD B;  2NNU A;  5J9P C;  2EIK C;  3NXS A;  3K9A A;  3ZN0 A;  3AG1 C;  5IY5 B;  5L3G A;  3CCM V;  1YIJ V;  1M90 W;  3ABM B;  4J9Z B;  2WLN A;  2WLM A;  3OMI B;  1QR9 A;  3ASO C;  3D36 A;  2JJ2 G;  1AI7 A;  2YSU B;  2Y48 A;  4WFE A;  2ZXW B;  3FB7 C;  4EKW A;  1FXV A;  3K79 A;  4MS2 A;  3LNM B;  1NVP D;  3ML0 A;  3OR6 C;  1FXH A;  2JEX A;  2H8P C;  4XDK A;  3QNE A;  3STL C;  1P4R A;  3EHB B;  3HPL C;  4MTX A;  4WF9 V;  1OCC C;  4QNH B;  4U7N A;  1R3L C;  1AI5 A;  1KC8 W;  2OTL V;  1IXM A;  2EIJ B;  4GX1 A;  5IYC O;  3I55 V;  1Q86 W;  4UVA A;  4FJC C;  3ABL B;  4JTA B;  4RAI A;  1GMG A;  4H37 A;  1QLN A;  5EC2 C;  2P90 A;  3OEH G;  2EZO A;  3CCE V;  3BY6 A;  2EIL B;  1S72 V;  2QM8 A;  5LHG A;  2WSS G;  3JD3 A;  4MVO A;  1I5X A;  3ZRS A;  1BL8 A;  2GHY A;  2JJ1 G;  5EC1 C;  3B8N A;  5CN0 A;  4X88 A;  4BIZ A;  4Z1M G;  5B1N A;  2OTJ V;  2WLK A;  2IJJ A;  3CD6 V;  1Y4M A;  4KUM A;  1BHB A;  3QO5 A;  3FB5 C;  1HWY A;  3ZMS A;  4MTF A;  2A0L A;  1RPO A;  5L3B A;  1VQ5 V;  4P2Z A;  2V7Q G;  4XDL A;  1QVF U;  1SRY A;  1OCZ C;  3GWO A;  5C93 A;  1WLE A;  3OR7 C;  2QA4 V;  2HR3 A;  1E79 G;  3JD1 A;  4R6Z A;  4JF3 A;  4RQF A;  3CPW U;  1PL0 A;  3ABT A;  2IJI A;  3AG4 B;  3SYC A;  1BMF G;  5L3D A;  2Y69 B;  1M9N A;  2DYR C;  3P30 A;  2PI4 A;  1VQN V;  3RW0 A;  2AHZ A;  5B1A B;  5L3F A;  1H8H G;  3ASN B;  5H9C A;  1OCR C;  5CBF A;  3AG2 C;  3SJQ C;  5EBL C;  1SZT A;  3RVZ A;  2ZR3 A;  4N21 A;  1ENV A;  1KD1 W;  1SES A;  1VQP V;  1MG1 A;  5L3E A;  4BW5 A;  3P32 A;  2ZD9 A;  2UXX A;  3CMA V;  1NJI W;  3G71 V;  3E83 A;  2HVK C;  3LSS A;  3G4S V;  1FXK A;  3MHS C;  4PA9 A;  3JD4 A;  2WAM A;  2CK3 G;  4LCU C;  1K8A W;  4R7C A;  1QVG U;  2EBO A;  1OZ0 A;  3DGE A;  5IY5 C;  4WFB V;  1R3J C;  2IU0 A;  3ABM C;  4UV8 A;  1NR7 A;  1R3I C;  1QLE B;  4UVC A;  4MVS A;  3OGC C;  3E2E A;  4GT1 A;  1V54 B;  3T4Z A;  2P6J A;  2ZXW C;  4X89 A;  3K3W A;  3X2Q B;  1K33 A;  3CXC U;  1M57 B;  2NLJ C;  1GM8 A;  3STZ C;  1VQ6 V;  3OUS A;  1Q7Y W;  3K0D A;  1J95 A;  2DQ3 A;  3WG7 B;  4UVB A;  1R6N A;  3LUT B;  5L3C A;  1SET A;  3CCL V;  1VQ9 V;  2LFR A;  4PEL A;  1LNQ A;  4QPJ A;  1YI2 V;  1Y66 A;  1YJW V;  2ITC C;  1YSC A;  4J9Y B;  4TT3 G;  3T2M A;  1ORQ C;  2EIJ C;  1V55 B;  1H2G A;  3ABL C;  3K03 A;  1DF4 A;  4RUE A;  3W7T A;  1KKD A;  3K06 A;  5KA6 A;  2EIL C;  4MSW C;  3SPI A;  4FK5 C;  4YXW G;  3TET A;  3CCJ V;  3W7W A;  5EBM C;  3IGA C;  2R9R B;  4MVM A;  2ZQM A;  2LFS A;  4RUF A;  4H33 A;  2IW5 A;  1YJN V;  3VOU A;  1S76 D;  1YHQ V;  3IC7 A;  2DWE C;  1VQ7 V;  3CCU V;  1QCE A;  3CYO A;  3LSQ A;  4PDL A;  3FYE B;  1JPX A;  1VQK V;  1K97 A;  2IU3 A;  4MTO A;  5LBQ A;  1JVM A;  3JYC A;  1E1Q G;  3JCZ A;  4G2K A;  4QIW F;  1E1R G;  5LHI A;  1FXK B;  3LDC A;  3WFV A;  1FFT B;  5KUK A;  3OMN B;  5IYB O;  1UJW B;  1K9M W;  1K5Q A;  1CP9 A;  1H8E G;  2XAJ A;  2EJR A;  3W7U A;  4PA6 A;  2Y69 C;  1DLB A;  1WPX A;  3MHH C;  1EFR G;  4CBC A;  3MD0 A;  2MK3 A;  1AI4 A;  1K4C C;  4PDR A;  3CCV V;  5B1A C;  3G6E V;  4Q20 A;  3ASN C;  2DQ0 A;  2X7R B;  3F7Y C;  5CA3 A;  3A0R A;  4MT8 A;  5B3S B;  4PA3 A;  2GSM B;  4L87 A;  3CC4 V;  4JAU A;  2JEU A;  2YEV A;  1GM9 A;  2V1D A;  3W7S A;  3CCQ V;  1MSW D;  3ETE A;  1M56 B;  3SPH A;  3RVY A;  1N8R W;  3ZN1 A;  1BHA A;  2LP7 A;  2M7W A;  2XOK G;  1G4Y B;  2Q67 A;  4ZKI A;  4DXW A;  1KEC A;  4PA4 A;  3K0G A;  1F51 A;  1JJ2 U;  3CCR V;  5EK0 A;  3RBZ A;  3TK1 A;  2WLH A;  2X6C A;  5EBW C;  2WLJ A;  2BOC C;  3E8H A;  3PJS K;  3QO7 A;  3TCU A;  4TSF G;  2EIM B;  2OT5 A;  3F7V C;  1QLE C;  3ABK B;  3JD2 A;  1V54 C;  2QEX V;  3OM3 B;  2P67 A;  4P9O A;  1GTO A;  1K7D A;  3E8F A;  1TUE B;  3X2Q C;  4MW3 A;  1M57 C;  2XAH A;  4WFG A;  3E8B A;  1G8M A;  4JYC A;  2IJH A;  5KUM A;  3WG7 C;  5HFL A;  2HJF C;  3ETG A;  1S3J A;  1OHH G;  1Q82 W;  2HVJ C;  2OCC B;  1KP3 A;  1R73 A;  1VQM V;  4LP8 A;  1FS0 G;  3AG3 B;  4N23 A;  1V55 C;  5B1B B;  5H6R A;  5DN6 G;  3SPJ A;  2FTK A;  2W6I G;  4R50 A;  2A79 B;  5LGN A;  4GCZ A;  1XL6 A;  3ZRW B;  1VQ4 V;  3ZMU A;  1VQ8 V;  2W0F C;  4QE7 A;  3B8M A;  4HYO A;  1ROP A;  1NQT A;  3SYP A;  1OCO B;  3OMA B;  1AJP A;  3M99 B;  2EZP A;  4HAM A;  5DM6 V;  3I56 V;  1AI6 A;  1RPR A;  2DYS B;  2DW4 A;  4LC1 A;  3DTU B;  1DF5 A;  2KB1 A;  1M1K W;  4PDM A;  2ATK C;  5LGT A;  2WPD G;  5CBH A;  5GW7 A;  2B5U A;  4WFA V;  1H38 A;  1K4D C;  5B1B C;  2YEV B;  4WFH A;  1COW G;  2XAF A;  3E8G A;  3CP1 A;  4QJF B;  1QR8 A;  2B1I A;  3OAA G;  1FXK C;  3CCS V;  1ARO P;  2DYR B;  1JQ0 A;  3ZMT A;  1Q81 W;  4JGS A;  1PD3 A;  3SYO A;  1GKF A;  1MOF A;  2EIN B;  1CEZ A;  5CBG A;  2WLL A;  3W7X A;  1K34 A;  5B1O A;  1CPY A;  4JAS A;  5HFM A;  3ZJZ A;  2C2A A;  1RM1 B;  1AJN A;  4MVQ A;  5E1A C;  3CME V;  1F4M A;  4MVZ A;  4DO2 A;  1ZWI C;  3ABU A;  1W0J G;  2X6B A;  5B3S C;  2H94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...