4I9WA

Human two pore domain k+ channel traak (k2p4.1) - fab complex structure
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Domain-swapped chain connectivity and gated membrane access in a Fab-mediated crystal of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 95
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4i9wA00
3IGAC 4JTAB 3F5WC 3F7YC 3FB6C 4X89A 5KUKA 4RUEA 3PJSK 1M56C 4MTOA 2ITCC 3ABMC 2Q68A 2WLMA 3FB8C 4PDVA 3AG3C 3E8BA 3F7VC 3OR6C 2DYSC 2HJFC 2HVJC 2EIKC 4GX2A 4R6ZA 5J9PC 5BZBA 4P9PA 2WLIA 3SPCA 2HG5C 1R3KC 2QTOA 4MVOA 2IH1C 4PA4A 4CBCA 2WLLA 4PDMA 4MW3A 3BEHA 4PA3A 2Q6AA 2A0LA 4QE9A 5E1AC 5EBLC 2HVKC 2X6AA 3K0GA 4BW5A 1ORQC 3SYOA 5IY5C 4MTFA 3OR7C 4LBEC 4H33A 3T4ZA 2K1EA 4JTDB 3LNMB 2Q69A 2A9HA 5B1AC 3K03A 3K04A 4PDRA 2ZXWC 4MVQA 2AHYA 3AG1C 1J95A 1OCRC 1OCOC 4F4LA 4X88A 3TETA 2X6CA 5EK0A 4X8AA 1XL6A 3OUFA 1V54C 5CBGA 2JK5C 3K06A 2WLIB 5B1BC 1OCCC 3T1CA 3SPIA 3ZJZA 2AHZA 4G28B 3K0DA 4PA7A 5CBFA 3STLC 1S5HC 3KG2A 4GX0A 4WFHA 2EINC 2P7TC 3WG7C 4GX1A 4UUJC 3OUSA 2ITDC 4PA6A 5CBHA 4WFGA 2DYRC 1G4YB 2WLHA 3SPHA 3RVYA 3AG4C 4MVUA 2KB1A 3X2QC 1K4DC 3E86A 2EILC 3FB5C 5EC1C 3LDDA 2EIMC 3EFFK 4RUFA 2NLJC 2R9RB 4MS2A 3SYAA 1R3JC 3JYCA 4WFEA 1ZWIC 2DWEC 2WLNA 3LDCA 2X6BA 3IFXA 1QLEC 3GB7C 4JTCB 1JVMA 2DWDC 2ATKC 3E8GA 4J9YB 4KFMA 3E8FA 2WLLB 4LCUC 4MVRA 3RW0A 4OXSA 4PA9A 1M57C 1R3IC 4MTGA 4MW8A 4XDLA 5KUMA 4MSWC 4QNHB 3VOUA 3UKMA 3SYPA 1P7BA 1OCZC 1XL4A 3SYQA 4DXWA 3ASOC 1BL8A 4RO2A 4WFFA 4P9OA 4G27B 4H37A 4HZ3A 4RAIA 3UM7A 1K4CC 2ZD9A 3TCUA 1KKDA 3STZC 4GX5A 3ABKC 3E8HA 4J9ZB 4EKWA 4LP8A 3SPJA 2WLKA 3LUTB 4TWKA 3T4DA 3E83A 3RVZA 2Q67A 2W0FC 4I9WA 4ZBMA 5B3SC 4MVZA 4PDLA 2H8PC 4MVMA 3ASNC 2HFEC 2BOBC 2EIJC 3HPLC 3RBZA 1LNQA 3AG2C 4P30A 2YEVA 4P2ZA 4R50A 2WLJA 3K08A 3OGCC 3SJQC 5EBMC 3SYCA 3ZRSA 2QKSA 2A79B 4XDKA 3R65A 2IH3C 3E89A 4XDJA 4HYOA 2BOCC 4QE7A 2OCCC 5EBWC 3T2MA 3SPGA 5EC2C 4R8CA 3LDEA 1R3LC 4MVSA 3ABLC 2Y69C 4R7CA 1V55C 3FB7C
chains in the Genus database with same CATH superfamily
4X1KA 3CRMA 3LNNA 3KCXA 3ABMC 5B5EZ 1FXHA 2Q68A 3AG2B 4D7TA 1WP7A 2DE0X 1WA8A 4QJFB 3SJCC 4LFBO 2HJFC 4FIPC 1H2LA 1YZBA 4NVPA 1SS3A 3JAKB 2IH1C 1IBKO 1P49A 2Y48A 1B6QA 4JYAO 1H2MA 3L72H 1YSCA 4PHZA 1AB3A 3CYOA 1KQSU 5LOVB 3ETDA 4UFZA 4JI3B 1Q6IA 1GN6A 2ZT9B 3OMAB 4GKKO 2CAZC 3FYIB 4JYYA 2ZIOA 1YJ9V 4X66B 2C2AA 2WA3A 5BR8B 4JV5O 2PI4A 2JRIA 3ZS8C 1FS0G 2VWKA 4DR4O 4H44B 4J41A 2GUZB 2WAMA 1PM9A 3IFXA 1QLEC 3E8FA 4WFAV 3SYPA 1R6KA 1Y6XA 1SA0B 5IWAO 4LP8A 3M7MX 1SERA 1AILA 3P3PA 4KHPB 1THZA 3THOA 3OW2U 4UCRA 3RYFB 3ZCCA 3SJQC 1FKAO 4I55B 4UCTA 1BQ0A 2P4KA 2QKSA 2DQ3A 4X62B 4DV4O 1JMKC 5KAFZ 5KHKA 1MZEA 1MZFA 2GDSA 1SZTA 4U7NA 2VS0A 3S3WA 2LJ2A 2JDIG 1AJPA 3FFQA 1MMMA 5ITZB 1PL0A 5BZBA 4K35A 4IT5A 3OTOO 3OFNG 1D5NA 1I5YA 2WLLA 2QA4V 2ILMA 4QE9A 1XOUA 2XUMA 2ZE7A 3K79A 5LGTA 5HFMA 4X65O 5EYPB 5L3EA 5KA5A 2Z0AA 1PV0A 5C8YA 5LXTA 1BCCH 1IXBA 4CS2A 3CMAV 4FZ1A 5LA6A 1HW7A 1N34B 2F4VB 3DTUB 1AI7A 1YJWV 3P30A 5IYDO 4UUJC 3CRRA 2RCVA 1VQPV 4DV0B 2R9AA 3SPHA 4O4IB 1FYJA 3RVYA 2EILC 4DR7B 5GTIZ 4CC6A 1HNWB 3JYCA 1F23A 1NKDA 4X64O 4LWSB 4DV6B 4AILC 2ZM6O 3CSXA 4UCUA 4JI0B 1PNKA 2FMLA 1XQ8A 3SJBC 4B3TO 1BL8A 4O4JA 4G27B 4H37A 3UM7A 3ZMSA 5IJ9A 1FD9A 4ZHQB 1QLEB 4EKWA 4DV1O 2W0XA 1N8RW 3BA8A 1I08A 4FLVA 3CP1A 4TSFG 5CA0B 2E75B 1LUVA 4JPRA 3SGIA 4QE7A 3K59A 3TXSA 1G8MA 4JI4B 2EX3A 2WLMA 3E8BA 1GN2A 4F6RA 4DR6B 3CRAA 4FLUA 3JCUZ 2KG7A 4RWUA 4K8XA 4PA3A 4BW5A 2F66C 2YI9A 1Y67A 1JJOA 3JALB 4JTDB 4J11A 4TQDA 1AI5A 2JS5A 2GBOA 1OZ0A 1WPBA 5EZYA 3ZRVA 1MSWD 4X1IB 4ZOLA 4JI1O 2ADPA 1Q82W 1N36O 3W7XA 5KHGA 4X8AA 2WSSG 1S77D 4UVBA 3SPIA 2QDOA 3X2QB 4YXWG 2P67A 3H1KH 4O2AB 5CBHA 1UFIA 3ZRXA 5IJ0B 2QKCA 3RT3C 2F23A 4PV1B 2EIMC 3JD2A 3HKBA 1JFFA 2OWOA 1RP3B 1SKVA 2ZE5A 3JAWA 1ZWIC 3LDCA 4I50B 5GONB 1MG1A 2JVDA 3U0ZA 3OGIB 3A2FA 3ASOC 4KUMA 4DUYO 1O9HA 1K4CC 4JI5O 3SR2C 2UXCB 3OD4A 4F6EA 2QM7A 4ZBMA 5CA1B 4MVZA 4MVMA 3WFVA 2B1GA 3JASA 4B3RO 1O9GA 2Q7GA 5IYBO 4I0XB 4B3MB 4PELA 5KMGA 1XMOB 1R3LC 1V55C 5EIBD 4TOIA 1PP9H 1H2SB 3HR0A 3HB3B 1UJWB 1HR0B 3DC6A 3DXRA 2LW7A 3TGUH 3FB8C 4I4TA 2R70A 4PA4A 2ZKOA 4MW3A 3UT5A 4IL6Z 4YJ2A 3L70H 3AG1B 1FFXA 1PNMA 1RFYA 4MTFA 4H33A 3T4ZA 5L3CA 2OIGA 2Y0PA 1WN7A 3LSUA 4DUZB 1NTKH 4LFCB 4MVQA 2KSDA 2XAJA 3CRQA 1EBOA 1NH2D 3ZRWA 3H01A 2PYJA 1WNSA 4AQYO 2RQ6A 2JK5C 3K06A 2P22C 4EB6B 5CBGA 3ZJZA 3OEEG 2V7QG 1Q86W 1SQGA 3ZN1A 5KAIZ 3J7AU 4FZ0A 4NXNO 4FK5C 3HKDB 5IT9N 4DK0A 1IBLO 2QWOB 3BY6A 1AI4A 2BTQA 5JCOA 4DK1A 1R3JC 3UCSC 2JS3A 1KP3A 4CH6A 5FLXN 3HKEA 2DJVA 1K92A 4FPPA 4OX9B 4XDLA 3DGEA 2AZ0A 3S3XA 1SQXH 4DYLA 2QWPB 5KX5B 4U3JA 1ZTEA 1TVKA 4BR6A 3A0RA 3ASNC 2EIJC 4TV8B 1LNQA 1LUWA 1F4MA 1Q7YW 4KL1A 4W4LA 3R65A 4JYCA 2BOCC 2EBOA 3IC9A 1R1BA 4FLYA 1Y74A 4NTWA 2NNUA 1VARA 2ITCC 3H9VA 5IYCO 2UUBB 3MDSA 3F7VC 2ZE6A 1CXZB 1TAEA 4D6TH 2HKOA 2BSKB 1V55B 1YVWA 5B1AB 1KD1W 4X1YB 4RQFA 4DR1B 4LBEC 1N32B 2Y4UA 3LNMB 2ZDIA 2PGGA 3JATA 5B1BB 2IU0A 2UXDB 2XAGA 4JI2O 2LFSA 2IJKA 4X20B 1XL6A 4U7OA 1EFRG 4GLXA 2WA4A 5CB4B 1I0HA 1R6NA 3OUSA 1ZX3A 1S0VA 2DYRC 1G4YB 3I56V 1MOFA 2KB1A 4N21A 3BFRA 4DV0O 4DV3B 1G6UA 1E1RG 1M57B 4DR7O 4YJ3A 3RYCB 1BT8A 5IDJA 2PF4E 1SF9A 2B5UA 3O65A 1HNWO 2DWDC 2HJDA 4ZI7A 3B8MA 4QNHB 1L1FA 3VOUA 4LF4B 2G38A 4DV6O 1I7FA 2Q7EA 1H8EG 3IAYA 4P9OA 4LNUB 2XHBA 5KLVH 4DV7O 2YUAA 3BABA 5CN0A 4EFBA 3T4DA 1K7DA 5FPOA 1RM1C 1B06A 2QE7G 4UV8A 2YI8A 3HPLC 4P30A 1XMQB 4D7SA 3SYCA 3TJTA 1YITV 4O4HB 5LHGA 4H0LB 4GKJB 1HNZO 4JI8B 2IU3A 1SQFA 4J10A 2KQXA 4MTOA 4O4LA 3CCMV 2H94A 5FNVA 3RFRA 5LGNA 3W7TA 2ETNA 5K1PA 1SQPH 1Q81W 5JWPA 2HVKC 1GN3A 4FFKA 2DMXA 5IYZB 3K3WA 2IJIA 1P84F 3TXQA 3RYIA 4B3SO 2A9HA 2JIZG 4UB6Z 2Q5ZA 4F4LA 1WA8B 3G80A 2CH7B 5B1NA 5CA3A 3ETEA 4YHHO 4GZRB 1WB7A 1L0LH 3ZMVA 1DF4A 3H1JH 3QO7A 2F43G 4DR3B 4ZKIA 4GX1A 3CRCA 3UO3A 1QVGU 2Q9LA 1B04A 3FB5C 5H9CA 2VQEB 1EM1A 3A8TA 1MNGA 5LP6A 4FLWA 1NVPD 2Y0IA 4JI6B 2DWEC 4JI7O 2Z3YA 3CCUV 2DYRB 1QNMA 1XREA 4J9YB 1BMFG 2F95B 1GTOA 3WB1A 4QPJA 1JOYA 2HHHB 1VF6C 3SYQA 5LOVA 5JJEB 1AR5A 1BE3H 1TA8A 2EULA 1BQZA 5C93A 5JJJB 2B1IA 4LF9B 2PZSA 4LF5O 2FL4A 4P2ZA 3G4SV 1D5AA 4FMTA 4LR3A 3WB2A 1Y4MA 4E4EA 4LF7B 2OCHA 1EZJA 5BXZA 3RGBA 3AG3B 3RN4A 2DYSB 5LHIA 5LMUB 1IVSA 1M9NA 3N2KB 1RM1B 4RUEA 1GO3F 4PJ0Z 3CCRV 1DTOA 2GUZA 3ETQA 3R66A 4PDVA 3ZHUA 1HR0O 2V1DA 1H38A 3KKYA 1P7GA 2OT5A 3PN1A 4K0KO 2HG5C 3U10A 3ZHVA 2JGUA 2CTWA 2QKAA 2X6AA 4U3FH 4HNAB 2VQFB 1TGOA 3BRCA 3D3IA 4N23A 1YJNV 3BHPA 1OCCB 1Q6UA 4PDRA 1S5JA 3ZMUA 3ZMTA 3K9AA 1OCOC 2IJHA 3L9DA 2CTRA 3OUFA 2JGDA 1FJGB 4NR1A 3B09A 4B7KA 1NZ6A 3KG2A 1QBZA 1I94B 2P7TC 4YIPA 3J81N 3MAQA 5LHHA 2UXXA 3K5MA 5BY1A 1KB9F 1Q3EA 4WFBV 2UU9O 3X2QC 1K4DC 1AR1B 2LW1A 3EFFK 1E1QG 3SYAA 5LXTB 2QWNB 2XAHA 3J80N 2ODMA 1NT2B 1N0JA 3RW0A 5EYPA 3ZX6A 4YY3B 4BIZA 3QNEA 4DXWA 4OX9O 4AHCA 5LMNO 4LFAB 2UUCO 3AEIA 3KZIZ 4J9ZB 5GTHZ 4DV5O 3NXSA 1SC5B 2H8PC 1GM9A 4GT1A 2HFEC 1MA1A 3OMNB 3T1YO 3E89A 4XDJA 3CC2V 1K5QA 3IGAC 4WBNA 4JTAB 3FB6C 5KUKA 3H1HH 4L8JA 1M90W 5BMVB 2EJRA 4JASA 5IJ9B 1X59A 3ZMZA 4UCVA 2HVJC 1ZSPA 3VQXA 3BEHA 1PPJH 1IX9A 2A0LA 3FKSG 3DSQA 4IHJB 2BE3A 1IBMB 2YXLA 3K5NA 3MD0A 1J5EB 1E79G 2ZXWC 4FLZA 3AG1C 2HLDG 1VQMV 2UXDO 5H5NA 1YTFD 1M93A 3K9SA 1PL4A 5EK0A 2OTLV 4F6RB 1NTZH 1N33B 2KG7B 1NR7A 4FM1A 4NTYA 4YIOA 2E5LB 1XNRO 3N2GA 1OCOB 3K58A 5EZYB 5EC1C 1XDCA 4QIWF 1KYOF 2NLJC 1VQ5V 3ZHTA 4TUYB 1Y76A 1YI2V 2QR4A 3JD0A 2UUAB 5JH7A 4UV9A 4OGQB 5J2UB 4UXNA 1AROP 3CX5F 2GV9A 2WPDG 2FB5A 4I9QA 4LFBB 4HZ3A 2ZQMA 2WLKA 3LUTB 4TWKA 3HKBB 1IBKB 1JFFB 2OTJV 3JAWB 1JA8A 2YSUB 3CE2A 4IIJA 4DV2B 1K9MW 3WB0A 4LH7A 1IURA 2OCCC 1IDSA 3B8NA 2GTAA 3LDEA 2Y69C 2W6IG 3CS5A 4UB8Z 1KP2A 5IJ0A 4GKKB 2F93B 3F5WC 1H8HG 4GKJO 1FAFA 3BPZA 4JI8O 1U96A 4CH5A 2AW9A 5GW7A 4E2LA 2P6JA 2YS8A 5GONA 3SPCA 4OPHA 3BA9A 4JV5B 2IBZH 3JARB 4JAVA 2ARHA 1DK1A 3EXAA 2ZE8A 3CMEV 2ZNJA 4DR4B 2CGNA 3KCYA 5H2FZ 5B1AC 3G6EV 2CE4A 1WP8A 3DXRB 2Z5UA 1IXMA 3ETGA 1Q43A 5LYJB 3QTCA 5IE9A 3C90A 4I4TB 5B1BC 1I5XA 2YXYA 1Q90D 4QPKA 2CDYA 3STLC 2EINC 4B7EA 1FXKC 2ZXWB 3SDLA 2CGOA 3D36C 4K8ZA 5IWAB 4UCOA 4PA6A 5A2QN 2Q73A 3CCEV 1XNQB 2EZOA 1WPXA 4CS4A 4LC1A 4RUFA 5E79Z 4MS2A 1Z5WA 3CC4V 1EN5A 5LL6Y 3ZRWB 1D2DA 4JI3O 2Q8VA 3FD9A 3GB7C 2ZCEA 5JVDB 4MVRA 3APOA 3ABKB 1M57C 4MTGA 4FJCC 4X66O 2JEUA 4TV9B 5BR8O 4UCSA 1KBHA 1AVMA 3STZC 4EEQA 5FL7G 1U97A 2QTSA 3UO2A 4GYCB 1ZLZA 5K1XA 3OTOB 3RVZA 2BTQB 4I9WA 3ABLB 4AI8A 1SESA 4UVAA 2IH3C 3RYHA 1K73W 1OHHG 4PA9A 5KUMA 4FLTA 4K3AA 4KXRA 3B2EE 4X89A 1SQBH 1RSOA 1TUBA 2A06H 2FKXA 1VQKV 4BIUA 3IC7A 4R6ZA 2OCCB 3QVNA 1TVKB 2WLIA 1SETA 2ZIMA 1PNLA 3ZBHA 3TK1A 2Y69B 1QU7A 4KHPO 1H2GA 3Q4HB 1ORQC 1NU1H 1OCRB 2VQFO 5JQGB 1K34A 3FYEB 2QGNA 2AHYA 4X62O 1GM7A 2VWJA 4X64B 1X4TA 4Z1MG 1MSDA 2XTAA 3UQ8A 4I5SA 3K0DA 3JCZA 4B3TB 1N4CA 2QEXV 2ZR3A 4FLXA 4DV1B 2OIEA 3E22A 3EVKA 1GN4A 1DLBA 3JATB 3P32A 2A7WA 3H1IH 4WF9V 4I7ZB 4G2KA 4TT3G 3VBBA 2DN9A 2EINB 2L6LA 1FXKB 4L87A 1M1KW 4DRXB 1KUQA 1BZKA 2DOSA 4X1YA 3H1LH 3CJHB 3M99B 2PUSA 3K5LA 1N34O 2F4VO 4LF8B 5B3SB 3FAVB 1VQ8V 1KKDA 3CD6V 1QCEA 5J2TB 4LH6A 2VRZA 3G71V 4LFAO 2Q67A 3HKCB 4EFEA 4J42A 4Q20A 3RBZA 5CB4A 2OYQA 2YEVA 2WLJA 1UPGA 3JD4A 3OMIB 1BS3A 3CCSV 5B1OA 1S76D 4JI1B 4BIOA 4O2BB 4NXMB 4DW1A 3U11A 2LQTA 2AZ2A 1N36B 4JI0O 2UXBB 3K57A 5DEDA 3AG3C 3EHBB 2DYSC 1G1XB 4MT8A 2JJ1G 1NH2B 2O57A 3CXCU 1HDJA 2IJJA 1FFTB 2QWQB 4FFBB 3CCVV 3LSQA 4HAMA 5IY5C 2D3OW 2YIBA 4LNUA 2YC0A 3K04A 1IBMO 3JD1A 3P3NA 1S72V 3OEHG 1J95A 5FNVB 1J5EO 4JI4O 2X6CA 1ZL8B 1XBLA 2XOKG 1V54C 1OCCC 1V9PA 1K33A 4DR6O 2RN9A 4O4HA 3ZIAG 4X9QA 5TISZ 1BSMA 2N74A 3CCLV 4JI5B 4ASUG 4J7KA 1CPYA 3RYIB 1F51A 2AXTZ 3JAMN 4X1KB 4NTXA 3CCQV 1HNXB 1NQTA 4B3RB 1PKXA 5L3FA 3AG7A 1URFA 3E8GA 3E2EA 4OXSA 2E3CA 2QM8A 4PI0A 4WCEV 1K8AW 1OJHA 2CH7A 5LP6B 2P90A 2YXHA 3JAKA 1HP8A 3BAAA 3K08A 4BW9A 3ZRSA 4Q6GA 2JEXA 3ABUA 2XASA 4DV2O 4R7CA 2EIKB 1US6A 1K97A 5AG2A 3I5DA 2LP7A 2M6YA 1S5LZ 2NR5A 3PJSK 4H13B 2Y4TA 1SRYA 4AQYB 2Q4PA 3OT7A 1AP5A 1YCIA 3QF7A 2P4VA 2P06A 2UXCO 2X0LA 4PI2A 4CH3A 2E76B 4PDMA 4NXNB 3SYOA 1ROPA 3BVOA 1IBLB 4B3MO 1F4NA 2Q69A 3IJ4A 1XMOO 3JSLA 3ICXA 5IY5B 2PI5A 4PA7A 1SQQH 3WG7C 2QWRB 3N2KA 1YDXA 5DN6G 4BAYA 1SA0A 1V54B 3AG4C 4MVUA 2LGQA 2IM9A 1Q6HA 1XNQO 4DUZO 2GSMB 4LFCO 4ICGA 3RYFA 1OCZB 1EN4A 2Q0AA 2JGDB 2ZR2A 4I55A 4FM2A 5H6QA 1SZXA 2ATKC 4HNAA 1IZ3A 2WLLB 4DR5B 4GUNA 1VQNV 3W7UA 4MSWC 2N04A 2HR3A 2QSAA 2H3OA 4RAIA 3AK1A 1FXVA 2RMKB 2E74B 3E8HA 4C7UA 3A0HZ 3E83A 5ITZA 5C8YB 2GTSA 2X7RB 4PDLA 1L8DA 4R50A 1JX9A 5LA6B 3ABMB 3SPGA 2F1MA 5FPRA 3RWRD 1WLEA 3VQWA 1MABG 3CHXA 4JI2B 1W59A 1CEZA 3NR7A 2BTOA 1AR4A 2LFRA 4P9PA 1JR9A 2YICA 2B9ZA 1A32A 3GWKC 2ADQB 2YDEA 3K0GA 3ZHSA 3QG5A 3QO8A 1M4UA 2A3QA 1WAZA 4O4IA 4IGGA 3E35A 4WBNB 1GMGA 4O4JB 2W6JG 4GCZA 4LF6B 2RJZA 4X88A 1QLNA 3CWBH 1VF6A 3OM3B 2UUBO 1NVPB 2AHZA 5L3BA 4LWSA 2HEPA 1KU9A 4DV7B 5BMVA 2HP8A 1AJQA 4ZHQA 2AGAA 4TQFA 4DR1O 1N32O 3T1HB 1YF2A 3F5TA 2R9RB 4UVCA 4DR2B 1N0NA 3WG7B 3W7SA 1NI8A 5CA0A 1QVFU 4IYHA 4JTCB 1JVMA 1HNZB 1WJZA 1VQ7V 4IHJA 3VQVA 4LCUC 3AG4B 3B77A 3GVMA 4ABMA 3N2GB 5D5QA 1W0KG 4LF8O 2ZD9A 2N05A 3ABTA 1Z5VA 3ABKC 3SPJA 4ZOLB 3QO5A 2L35A 4DV3O 1Y76B 1VIBA 3GWOA 5JH7B 3CPWU 3L73H 4B3SB 1ZAUA 4B08A 4A5UB 5EBWC 3T2MA 2ZINA 3JALA 5JCOC 3A0BZ 2K9PA 1K3EA 3ABLC 4X1IA 4LF4O 1GAXA 1H2NA 4NXMO 4YHHB 1GM8A 5DECA 5F2VO 4TUYA 3OR6C 2UXBO 4XBFA 1BGYH 2XT9A 1VQ6V 4JYAB 3FX7A 2QTOA 2IW5A 5D5PA 4CBCA 5DM6V 5J2UA 3SJAC 4JZGA 5E1AC 5EBLC 4IIJB 3M8AA 1GRJA 4JYBA 1XMQO 5JJNB 4O2AA 2JJ2G 2PTMA 3K03A 3ML0A 1AI6A 4JI7B 1OCRC 1HWYA 1Q8IA 1LR1A 4JAAA 4IYIA 4RQEA 1VP7A 4I50A 4JGSA 1EN6A 4G28B 1GKFA 4NYKA 5CBFA 2R72A 1S5HC 1JJ2U 3JASB 3D3QA 2EILB 3JD3A 1CP9A 4BWAA 2XAFA 5KMGB 3CB2A 1VQLV 1QQCA 2BCCH 3AK2A 3ZHQA 2WLHA 4Z2WA 2CUGA 4LF5B 1P4RA 1KECA 1B3QA 3LDDA 4J7JA 4JAUA 3I55V 1RPRA 3ZEDA 1DF5A 4JZ2A 5A9GA 5CA1A 5KHJA 1YHQV 4DW0A 2ZDIC 4WFEA 1HNXO 1Y66A 2X6BA 3JARA 4W4KA 4I0XA 1NTMH 3UT5B 1R3IC 5CMUA 4MW8A 4YJ2B 4KP4A 1FFXB 2V4DA 4DR3O 1ZUQA 1QR8A 1L0NH 5L3DA 3TCUA 4K0KB 1W0JG 2WWWA 5LYJA 1JQ0A 1WB8A 2UXNA 4PD4F 2MW2B 5B3SC 2M7WA 4J7ZA 2VQEO 1KKCA 2NN4A 2P5OA 3OAAG 5EIBC 3CC7V 1XUQA 4JI6O 2CTPA 4DV4B 4HYOA 4ZIBA 2Q0OC 1GH6A 3B4SA 2CTQA 2YIBD 1QHTA 3LSSA 4CC5A 3F7YC 1M56C 3OE7G 4CS3A 1KMIZ 2HHHO 4NB5A 4EB6A 1PD3A 1YTFB 4LF9O 1XHXA 2DQ0A 5JVDA 2YIAA 1S3JA 4X65B 1XHZA 2UU9B 3G6BA 1NR1A 3HKEB 4TV9A 3RYHB 1XILA 3HKDA 4LF7O 1EZVH 1RSOB 5LMUO 1TUBB 3APQA 3C3SA 2ZNIA 1VF5B 1YXBA 4U3JB 2WLIB 1DGSA 3T1CA 5LGUA 3BCCH 1VF7A 5LBQA 5KHIA 2EIMB 3MHSC 5LMNB 2KKWA 1VQ4V 2UUCB 1VQ9V 4WFGA 1T5EA 4DV5B 1Y74B 3E86A 3VQYA 3B40A 5KX5A 3T1YB 2Q7HA 4TV8A 3ASOB 2ZM6B 1COWG 3Q4HA 4MTXA 3AK3A 3CEIA 1VQOV 1FJGO 1BHAA 3ZHRA 5JQGA 4DR5O 1XL4A 1VMGA 2YIDA 1I94O 2LO1A 4WFFA 3ZN0A 3E22B 4FVMA 1W2BU 3K5OA 2LGWA 1H2KA 2W0FC 2BSKA 1AP6A 2BOBC 3AG2C 2EJ7A 3OGCC 1JCHA 1GK9A 5LP6C 4HBNA 5EC2C 4R8CA 1M5IA 1Q5OA 4MVSA 4NKGB 1YIJV 5HFLA 1RPOA 4YY3O 3C3TA 3MHHC 3CXHF 1FXKA 3L71H 1YEWA 4X20A 4GX2A 2EIKC 2FYUH 4DRXA 3D36A 5J9PC 1R3KC 4DO2A 1Z2GA 4MVOA 4YJ3B 1XNRB 3CJHA 1OV9A 2YEVB 2Q6AA 4Z1VA 1M56B 4ZI7B 4FM0A 3DC5A 2MK3A 3OR7C 4OPAA 3OTFA 2K1EA 3FAVA 1XI1A 4J80A 5J2TA 2CK3G 3HKCA 3TETA 5KA6A 1FPOA 1TUEB 3RYCA 1R6TA 2RNBA 1KC8W 2XNDG 4LF6O 5KHHA 5B66Z 3JSNA 1BHBA 1AJNA 4GX0A 4WFHA 3O9OA 4O2BA 2XAQA 1R73A 5H6RA 1K5SA 2ITDC 1QR9A 2D2CB 3D8CA 1NBMG 3WU2Z 4O4LB 3T1HO 1NS1A 2WLNA 1VEWA 4DR2O 2QM4A 4FFBA 4KFMA 1N33O 4QGPA 1NJIW 3UKMA 4DUYB 1P7BA 1OCZC 3N27A 2QJ1A 3W7WA 2DW4A 4RO2A 1F7YA 3ASNB 2E5LO 2RDCA 2EIJB 2FTKA 2R9IA 4GX5A 4JF3A 1ENVA 1ZL8A 3L74H 1JPXA 3G67A 3CCJV 1SQVH 2EZPA 5EBMC 3L75H 4CZZA 2A79B 4XDKA 4CH4A 5L3GA 5IYZA 1XEQA 2UUAO 2PYLA 2PY5A 3FB7C 2GHYA
chains in the Genus database with same CATH topology
1WLEA 3F5WC 1H8HG 2NNUA 1MABG 2ITCC 3ABMC 1FXHA 2Q68A 3AG2B 5GW7A 1CEZA 5IYCO 4QJFB 3F7VC 2HJFC 4FIPC 4E2LA 2LFRA 4P9PA 2P6JA 2HKOA 3SPCA 2IH1C 1V55B 2Y48A 1B6QA 5B1AB 1KD1W 4JAVA 3K0GA 3QO8A 4RQFA 3CMEV 1YSCA 4LBEC 3LNMB 2ZDIA 3CYOA 1KQSU 3E35A 5B1AC 5B1BB 2IU0A 1GMGA 3ETDA 3G6EV 2W6JG 2XAGA 2Z5UA 1IXMA 3ETGA 3OMAB 3FYIB 4GCZA 4X88A 1QLNA 2LFSA 2IJKA 1XL6A 4U7OA 1EFRG 3OM3B 5B1BC 1NVPB 1I5XA 4QPKA 2AHZA 1YJ9V 5L3BA 3STLC 2C2AA 1R6NA 2EINC 1FXKC 2ZXWB 3OUSA 2PI4A 4PA6A 1S0VA 2DYRC 1G4YB 3CCEV 1AJQA 1FS0G 3I56V 1MOFA 2KB1A 4N21A 2EZOA 1WPXA 4LC1A 4RUFA 2R9RB 4MS2A 4UVCA 2WAMA 1E1RG 3CC4V 1M57B 3WG7B 3ZRWB 3W7SA 5IDJA 1QVFU 2B5UA 3IFXA 1QLEC 3GB7C 4JTCB 1JVMA 2DWDC 1VQ7V 3E8FA 4LCUC 4MVRA 3AG4B 3B8MA 3ABKB 4QNHB 1M57C 4MTGA 1L1FA 4WFAV 3B77A 3VOUA 3SYPA 1R6KA 4FJCC 2JEUA 1H8EG 4P9OA 1W0KG 2ZD9A 3STZC 3ABTA 3ABKC 5FL7G 4LP8A 3SPJA 5CN0A 3QO5A 3T4DA 1SERA 3RVZA 1K7DA 4I9WA 1RM1C 1THZA 3OW2U 2QE7G 3ABLB 4UV8A 3GWOA 3HPLC 3ZCCA 4P30A 3SJQC 1SESA 3SYCA 2QKSA 4UVAA 3CPWU 2IH3C 1YITV 5EBWC 5LHGA 3T2MA 2DQ3A 1OHHG 1K73W 1K3EA 3ABLC 4PA9A 5KUMA 2IU3A 4X89A 4MTOA 1SZTA 4U7NA 1VQKV 3CCMV 2H94A 1GM8A 4BIUA 2JDIG 3IC7A 3OR6C 1AJPA 4XBFA 4R6ZA 2OCCB 1PL0A 5BZBA 5LGNA 3W7TA 2WLIA 1SETA 1VQ6V 1PNLA 2QTOA 3TK1A 2IW5A 2Y69B 4CBCA 3OFNG 5DM6V 1I5YA 2WLLA 2QA4V 1Q81W 5E1AC 4QE9A 5EBLC 1H2GA 2HVKC 1ORQC 4JYBA 1OCRB 3K3WA 2JJ2G 3K79A 5LGTA 5HFMA 2IJIA 5L3EA 2A9HA 3K03A 2JIZG 1K34A 3FYEB 5KA5A 2AHYA 3ML0A 1GM7A 1AI6A 1OCRC 1HWYA 4F4LA 4Z1MG 5B1NA 5CA3A 3CMAV 4RQEA 3ETEA 4I5SA 4JGSA 4G28B 1GKFA 3K0DA 3ZMVA 1DF4A 3DTUB 5CBFA 1S5HC 3QO7A 1AI7A 1JJ2U 3JCZA 2F43G 1YJWV 2EILB 2QEXV 4ZKIA 3JD3A 1CP9A 3P30A 5IYDO 2XAFA 2ZR3A 4GX1A 4UUJC 1VQPV 1VQLV 1QVGU 2WLHA 3SPHA 1DLBA 3RVYA 3P32A 1P4RA 1KECA 2EILC 3FB5C 5H9CA 3LDDA 4WF9V 4G2KA 4JAUA 4TT3G 3I55V 1RPRA 3VBBA 1DF5A 2EINB 1YHQV 1FXKB 1NVPD 4L87A 1M1KW 3JYCA 1F23A 1NKDA 2ZDIC 4WFEA 2DWEC 1Y66A 2X6BA 2Z3YA 3CCUV 2DYRB 4J9YB 1BMFG 3M99B 1GTOA 1R3IC 5CMUA 4MW8A 4QPJA 1PNKA 4KP4A 1JOYA 3SYQA 5B3SB 1BL8A 1QR8A 1VQ8V 5L3DA 4G27B 4H37A 3UM7A 3ZMSA 5C93A 3TCUA 1KKDA 3CD6V 1QCEA 1QLEB 1W0JG 2WWWA 4EKWA 2B1IA 1JQ0A 3G71V 1N8RW 2Q67A 2UXNA 5B3SC 2M7WA 4Q20A 3CP1A 4TSFG 3RBZA 2YEVA 4P2ZA 3OAAG 2WLJA 3G4SV 4FMTA 3CC7V 1Y4MA 3JD4A 4JPRA 3OMIB 3CCSV 4HYOA 4QE7A 5B1OA 1EZJA 1S76D 3AG3B 3LSSA 2DYSB 5LHIA 1M9NA 1RM1B 3F7YC 1G8MA 4RUEA 1M56C 1GO3F 3OE7G 3CCRV 1DTOA 2WLMA 4PDVA 3AG3C 3E8BA 3EHBB 2DYSC 2V1DA 1H38A 2OT5A 1PD3A 4MT8A 2JJ1G 1NH2B 2HG5C 1YTFB 2DQ0A 3CXCU 4PA3A 4BW5A 2IJJA 2X6AA 1FFTB 1S3JA 3CCVV 3LSQA 4HAMA 1NR1A 5IY5C 2D3OW 3D3IA 4JTDB 4N23A 1YJNV 1AI5A 1OZ0A 3K04A 1OCCB 1MSWD 3ZRVA 4PDRA 3JD1A 1S72V 3ZMUA 3ZMTA 3OEHG 1J95A 3K9AA 1OCOC 2IJHA 1Q82W 2X6CA 3W7XA 4X8AA 2WSSG 3OUFA 2XOKG 1S77D 1V54C 4UVBA 2WLIB 1OCCC 3T1CA 3SPIA 5LGUA 1K33A 5LBQA 3KG2A 1QBZA 3X2QB 3ZIAG 2P7TC 4YXWG 2EIMB 5LHHA 2UXXA 3MHSC 3CCLV 2P67A 1VQ4V 1VQ9V 5CBHA 4WFGA 4ASUG 4WFBV 3ZRXA 1CPYA 3X2QC 1F51A 1K4DC 3E86A 1AR1B 2EIMC 3JD2A 3EFFK 3CCQV 1E1QG 1NQTA 3SYAA 1PKXA 1ZWIC 2XAHA 3LDCA 5L3FA 3ASOB 1COWG 1MG1A 3E8GA 4MTXA 3RW0A 3E2EA 4OXSA 1VQOV 2QM8A 1BHAA 4BIZA 1XL4A 3QNEA 4DXWA 4WCEV 1K8AW 3ASOC 4WFFA 3ZN0A 4KUMA 1K4CC 1W2BU 3AEIA 4J9ZB 3NXSA 2W0FC 2P90A 2QM7A 4ZBMA 4MVZA 2H8PC 1GM9A 4MVMA 4GT1A 2HFEC 2BOBC 3WFVA 2B1GA 3AG2C 3OGCC 3K08A 3OMNB 3ZRSA 1JCHA 5IYBO 1GK9A 3E89A 4XDJA 2JEXA 4PELA 3ABUA 2XASA 5EC2C 4R8CA 1R3LC 4MVSA 2EIKB 4R7CA 1YIJV 1V55C 3CC2V 1K97A 1K5QA 3IGAC 2LP7A 5HFLA 4JTAB 3FB6C 5KUKA 1RPOA 3PJSK 1M90W 3HB3B 1UJWB 2EJRA 4JASA 1SRYA 3MHHC 3FB8C 1FXKA 3ZMZA 2HVJC 2EIKC 4GX2A 5J9PC 3D36A 1R3KC 4DO2A 2X0LA 4MVOA 4PA4A 4PDMA 4MW3A 2YEVB 3BEHA 2Q6AA 2A0LA 3FKSG 1M56B 3SYOA 3AG1B 1PNMA 2MK3A 1ROPA 3OR7C 4MTFA 4H33A 3T4ZA 2K1EA 5L3CA 1F4NA 2Q69A 3MD0A 1E79G 2CK3G 2ZXWC 4MVQA 2XAJA 3AG1C 2HLDG 1VQMV 1EBOA 1NH2D 3TETA 1YTFD 3ZRWA 2OTLV 3H01A 5EK0A 5KA6A 1TUEB 1KC8W 2XNDG 5CBGA 2JK5C 3K06A 5IY5B 3ZJZA 3OEEG 1NR7A 2PI5A 4PA7A 1BHBA 1AJNA 4GX0A 4WFHA 2V7QG 3WG7C 2XAQA 1Q86W 1R73A 5H6RA 3ZN1A 1K5SA 1OCOB 2ITDC 3FB7C 5DN6G 4BAYA 4FK5C 1V54B 1QR9A 3AG4C 4MVUA 5EC1C 1NBMG 4QIWF 2NLJC 3BY6A 1AI4A 1VQ5V 2GSMB 1R3JC 1OCZB 2WLNA 1YI2V 2ZR2A 3JD0A 5H6QA 1KP3A 2ATKC 4UV9A 4KFMA 2WLLB 4UXNA 4FPPA 1K92A 1NJIW 1VQNV 4XDLA 3W7UA 4MSWC 1AROP 3UKMA 3DGEA 1P7BA 1OCZC 2WPDG 3W7WA 2DW4A 2HR3A 4RO2A 3ASNB 4RAIA 2EIJB 2FTKA 2ZQMA 4HZ3A 1FXVA 2R9IA 4GX5A 4JF3A 3E8HA 1ENVA 1JPXA 2WLKA 3LUTB 4TWKA 3E83A 3A0RA 2X7RB 4PDLA 2OTJV 3CCJV 3ASNC 2EIJC 1LNQA 1F4MA 2YSUB 2EZPA 1JX9A 4R50A 1Q7YW 5EBMC 1K9MW 3ABMB 2A79B 4CZZA 4XDKA 3R65A 4JYCA 2BOCC 2OCCC 5L3GA 3B8NA 3SPGA 2EBOA 3LDEA 2Y69C 2W6IG 1KP2A 2GHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGA C;  4JTA B;  3F5W C;  3F7Y C;  3FB6 C;  4X89 A;  5KUK A;  4RUE A;  3PJS K;  1M56 C;  4MTO A;  2ITC C;  3ABM C;  2Q68 A;  2WLM A;  3FB8 C;  4PDV A;  3AG3 C;  3E8B A;  3F7V C;  3OR6 C;  2DYS C;  2HJF C;  2HVJ C;  2EIK C;  4GX2 A;  4R6Z A;  5J9P C;  5BZB A;  4P9P A;  2WLI A;  3SPC A;  2HG5 C;  1R3K C;  2QTO A;  4MVO A;  2IH1 C;  4PA4 A;  4CBC A;  2WLL A;  4PDM A;  4MW3 A;  3BEH A;  4PA3 A;  2Q6A A;  2A0L A;  4QE9 A;  5E1A C;  5EBL C;  2HVK C;  2X6A A;  3K0G A;  4BW5 A;  1ORQ C;  3SYO A;  5IY5 C;  4MTF A;  3OR7 C;  4LBE C;  4H33 A;  3T4Z A;  2K1E A;  4JTD B;  3LNM B;  2Q69 A;  2A9H A;  5B1A C;  3K03 A;  3K04 A;  4PDR A;  2ZXW C;  4MVQ A;  2AHY A;  3AG1 C;  1J95 A;  1OCR C;  1OCO C;  4F4L A;  4X88 A;  3TET A;  2X6C A;  5EK0 A;  4X8A A;  1XL6 A;  3OUF A;  1V54 C;  5CBG A;  2JK5 C;  3K06 A;  2WLI B;  5B1B C;  1OCC C;  3T1C A;  3SPI A;  3ZJZ A;  2AHZ A;  4G28 B;  3K0D A;  4PA7 A;  5CBF A;  3STL C;  1S5H C;  3KG2 A;  4GX0 A;  4WFH A;  2EIN C;  2P7T C;  3WG7 C;  4GX1 A;  4UUJ C;  3OUS A;  2ITD C;  4PA6 A;  5CBH A;  4WFG A;  2DYR C;  1G4Y B;  2WLH A;  3SPH A;  3RVY A;  3AG4 C;  4MVU A;  2KB1 A;  3X2Q C;  1K4D C;  3E86 A;  2EIL C;  3FB5 C;  5EC1 C;  3LDD A;  2EIM C;  3EFF K;  4RUF A;  2NLJ C;  2R9R B;  4MS2 A;  3SYA A;  1R3J C;  3JYC A;  4WFE A;  1ZWI C;  2DWE C;  2WLN A;  3LDC A;  2X6B A;  3IFX A;  1QLE C;  3GB7 C;  4JTC B;  1JVM A;  2DWD C;  2ATK C;  3E8G A;  4J9Y B;  4KFM A;  3E8F A;  2WLL B;  4LCU C;  4MVR A;  3RW0 A;  4OXS A;  4PA9 A;  1M57 C;  1R3I C;  4MTG A;  4MW8 A;  4XDL A;  5KUM A;  4MSW C;  4QNH B;  3VOU A;  3UKM A;  3SYP A;  1P7B A;  1OCZ C;  1XL4 A;  3SYQ A;  4DXW A;  3ASO C;  1BL8 A;  4RO2 A;  4WFF A;  4P9O A;  4G27 B;  4H37 A;  4HZ3 A;  4RAI A;  3UM7 A;  1K4C C;  2ZD9 A;  3TCU A;  1KKD A;  3STZ C;  4GX5 A;  3ABK C;  3E8H A;  4J9Z B;  4EKW A;  4LP8 A;  3SPJ A;  2WLK A;  3LUT B;  4TWK A;  3T4D A;  3E83 A;  3RVZ A;  2Q67 A;  2W0F C;  4I9W A;  4ZBM A;  5B3S C;  4MVZ A;  4PDL A;  2H8P C;  4MVM A;  3ASN C;  2HFE C;  2BOB C;  2EIJ C;  3HPL C;  3RBZ A;  1LNQ A;  3AG2 C;  4P30 A;  2YEV A;  4P2Z A;  4R50 A;  2WLJ A;  3K08 A;  3OGC C;  3SJQ C;  5EBM C;  3SYC A;  3ZRS A;  2QKS A;  2A79 B;  4XDK A;  3R65 A;  2IH3 C;  3E89 A;  4XDJ A;  4HYO A;  2BOC C;  4QE7 A;  2OCC C;  5EBW C;  3T2M A;  3SPG A;  5EC2 C;  4R8C A;  3LDE A;  1R3L C;  4MVS A;  3ABL C;  2Y69 C;  4R7C A;  1V55 C;  3FB7 C; 
#chains in the Genus database with same CATH topology
 4X1K A;  3CRM A;  3LNN A;  3KCX A;  3ABM C;  5B5E Z;  1FXH A;  2Q68 A;  3AG2 B;  4D7T A;  1WP7 A;  2DE0 X;  1WA8 A;  4QJF B;  3SJC C;  4LFB O;  2HJF C;  4FIP C;  1H2L A;  1YZB A;  4NVP A;  1SS3 A;  3JAK B;  2IH1 C;  1IBK O;  1P49 A;  2Y48 A;  1B6Q A;  4JYA O;  1H2M A;  3L72 H;  1YSC A;  4PHZ A;  1AB3 A;  3CYO A;  1KQS U;  5LOV B;  3ETD A;  4UFZ A;  4JI3 B;  1Q6I A;  1GN6 A;  2ZT9 B;  3OMA B;  4GKK O;  2CAZ C;  3FYI B;  4JYY A;  2ZIO A;  1YJ9 V;  4X66 B;  2C2A A;  2WA3 A;  5BR8 B;  4JV5 O;  2PI4 A;  2JRI A;  3ZS8 C;  1FS0 G;  2VWK A;  4DR4 O;  4H44 B;  4J41 A;  2GUZ B;  2WAM A;  1PM9 A;  3IFX A;  1QLE C;  3E8F A;  4WFA V;  3SYP A;  1R6K A;  1Y6X A;  1SA0 B;  5IWA O;  4LP8 A;  3M7M X;  1SER A;  1AIL A;  3P3P A;  4KHP B;  1THZ A;  3THO A;  3OW2 U;  4UCR A;  3RYF B;  3ZCC A;  3SJQ C;  1FKA O;  4I55 B;  4UCT A;  1BQ0 A;  2P4K A;  2QKS A;  2DQ3 A;  4X62 B;  4DV4 O;  1JMK C;  5KAF Z;  5KHK A;  1MZE A;  1MZF A;  2GDS A;  1SZT A;  4U7N A;  2VS0 A;  3S3W A;  2LJ2 A;  2JDI G;  1AJP A;  3FFQ A;  1MMM A;  5ITZ B;  1PL0 A;  5BZB A;  4K35 A;  4IT5 A;  3OTO O;  3OFN G;  1D5N A;  1I5Y A;  2WLL A;  2QA4 V;  2ILM A;  4QE9 A;  1XOU A;  2XUM A;  2ZE7 A;  3K79 A;  5LGT A;  5HFM A;  4X65 O;  5EYP B;  5L3E A;  5KA5 A;  2Z0A A;  1PV0 A;  5C8Y A;  5LXT A;  1BCC H;  1IXB A;  4CS2 A;  3CMA V;  4FZ1 A;  5LA6 A;  1HW7 A;  1N34 B;  2F4V B;  3DTU B;  1AI7 A;  1YJW V;  3P30 A;  5IYD O;  4UUJ C;  3CRR A;  2RCV A;  1VQP V;  4DV0 B;  2R9A A;  3SPH A;  4O4I B;  1FYJ A;  3RVY A;  2EIL C;  4DR7 B;  5GTI Z;  4CC6 A;  1HNW B;  3JYC A;  1F23 A;  1NKD A;  4X64 O;  4LWS B;  4DV6 B;  4AIL C;  2ZM6 O;  3CSX A;  4UCU A;  4JI0 B;  1PNK A;  2FML A;  1XQ8 A;  3SJB C;  4B3T O;  1BL8 A;  4O4J A;  4G27 B;  4H37 A;  3UM7 A;  3ZMS A;  5IJ9 A;  1FD9 A;  4ZHQ B;  1QLE B;  4EKW A;  4DV1 O;  2W0X A;  1N8R W;  3BA8 A;  1I08 A;  4FLV A;  3CP1 A;  4TSF G;  5CA0 B;  2E75 B;  1LUV A;  4JPR A;  3SGI A;  4QE7 A;  3K59 A;  3TXS A;  1G8M A;  4JI4 B;  2EX3 A;  2WLM A;  3E8B A;  1GN2 A;  4F6R A;  4DR6 B;  3CRA A;  4FLU A;  3JCU Z;  2KG7 A;  4RWU A;  4K8X A;  4PA3 A;  4BW5 A;  2F66 C;  2YI9 A;  1Y67 A;  1JJO A;  3JAL B;  4JTD B;  4J11 A;  4TQD A;  1AI5 A;  2JS5 A;  2GBO A;  1OZ0 A;  1WPB A;  5EZY A;  3ZRV A;  1MSW D;  4X1I B;  4ZOL A;  4JI1 O;  2ADP A;  1Q82 W;  1N36 O;  3W7X A;  5KHG A;  4X8A A;  2WSS G;  1S77 D;  4UVB A;  3SPI A;  2QDO A;  3X2Q B;  4YXW G;  2P67 A;  3H1K H;  4O2A B;  5CBH A;  1UFI A;  3ZRX A;  5IJ0 B;  2QKC A;  3RT3 C;  2F23 A;  4PV1 B;  2EIM C;  3JD2 A;  3HKB A;  1JFF A;  2OWO A;  1RP3 B;  1SKV A;  2ZE5 A;  3JAW A;  1ZWI C;  3LDC A;  4I50 B;  5GON B;  1MG1 A;  2JVD A;  3U0Z A;  3OGI B;  3A2F A;  3ASO C;  4KUM A;  4DUY O;  1O9H A;  1K4C C;  4JI5 O;  3SR2 C;  2UXC B;  3OD4 A;  4F6E A;  2QM7 A;  4ZBM A;  5CA1 B;  4MVZ A;  4MVM A;  3WFV A;  2B1G A;  3JAS A;  4B3R O;  1O9G A;  2Q7G A;  5IYB O;  4I0X B;  4B3M B;  4PEL A;  5KMG A;  1XMO B;  1R3L C;  1V55 C;  5EIB D;  4TOI A;  1PP9 H;  1H2S B;  3HR0 A;  3HB3 B;  1UJW B;  1HR0 B;  3DC6 A;  3DXR A;  2LW7 A;  3TGU H;  3FB8 C;  4I4T A;  2R70 A;  4PA4 A;  2ZKO A;  4MW3 A;  3UT5 A;  4IL6 Z;  4YJ2 A;  3L70 H;  3AG1 B;  1FFX A;  1PNM A;  1RFY A;  4MTF A;  4H33 A;  3T4Z A;  5L3C A;  2OIG A;  2Y0P A;  1WN7 A;  3LSU A;  4DUZ B;  1NTK H;  4LFC B;  4MVQ A;  2KSD A;  2XAJ A;  3CRQ A;  1EBO A;  1NH2 D;  3ZRW A;  3H01 A;  2PYJ A;  1WNS A;  4AQY O;  2RQ6 A;  2JK5 C;  3K06 A;  2P22 C;  4EB6 B;  5CBG A;  3ZJZ A;  3OEE G;  2V7Q G;  1Q86 W;  1SQG A;  3ZN1 A;  5KAI Z;  3J7A U;  4FZ0 A;  4NXN O;  4FK5 C;  3HKD B;  5IT9 N;  4DK0 A;  1IBL O;  2QWO B;  3BY6 A;  1AI4 A;  2BTQ A;  5JCO A;  4DK1 A;  1R3J C;  3UCS C;  2JS3 A;  1KP3 A;  4CH6 A;  5FLX N;  3HKE A;  2DJV A;  1K92 A;  4FPP A;  4OX9 B;  4XDL A;  3DGE A;  2AZ0 A;  3S3X A;  1SQX H;  4DYL A;  2QWP B;  5KX5 B;  4U3J A;  1ZTE A;  1TVK A;  4BR6 A;  3A0R A;  3ASN C;  2EIJ C;  4TV8 B;  1LNQ A;  1LUW A;  1F4M A;  1Q7Y W;  4KL1 A;  4W4L A;  3R65 A;  4JYC A;  2BOC C;  2EBO A;  3IC9 A;  1R1B A;  4FLY A;  1Y74 A;  4NTW A;  2NNU A;  1VAR A;  2ITC C;  3H9V A;  5IYC O;  2UUB B;  3MDS A;  3F7V C;  2ZE6 A;  1CXZ B;  1TAE A;  4D6T H;  2HKO A;  2BSK B;  1V55 B;  1YVW A;  5B1A B;  1KD1 W;  4X1Y B;  4RQF A;  4DR1 B;  4LBE C;  1N32 B;  2Y4U A;  3LNM B;  2ZDI A;  2PGG A;  3JAT A;  5B1B B;  2IU0 A;  2UXD B;  2XAG A;  4JI2 O;  2LFS A;  2IJK A;  4X20 B;  1XL6 A;  4U7O A;  1EFR G;  4GLX A;  2WA4 A;  5CB4 B;  1I0H A;  1R6N A;  3OUS A;  1ZX3 A;  1S0V A;  2DYR C;  1G4Y B;  3I56 V;  1MOF A;  2KB1 A;  4N21 A;  3BFR A;  4DV0 O;  4DV3 B;  1G6U A;  1E1R G;  1M57 B;  4DR7 O;  4YJ3 A;  3RYC B;  1BT8 A;  5IDJ A;  2PF4 E;  1SF9 A;  2B5U A;  3O65 A;  1HNW O;  2DWD C;  2HJD A;  4ZI7 A;  3B8M A;  4QNH B;  1L1F A;  3VOU A;  4LF4 B;  2G38 A;  4DV6 O;  1I7F A;  2Q7E A;  1H8E G;  3IAY A;  4P9O A;  4LNU B;  2XHB A;  5KLV H;  4DV7 O;  2YUA A;  3BAB A;  5CN0 A;  4EFB A;  3T4D A;  1K7D A;  5FPO A;  1RM1 C;  1B06 A;  2QE7 G;  4UV8 A;  2YI8 A;  3HPL C;  4P30 A;  1XMQ B;  4D7S A;  3SYC A;  3TJT A;  1YIT V;  4O4H B;  5LHG A;  4H0L B;  4GKJ B;  1HNZ O;  4JI8 B;  2IU3 A;  1SQF A;  4J10 A;  2KQX A;  4MTO A;  4O4L A;  3CCM V;  2H94 A;  5FNV A;  3RFR A;  5LGN A;  3W7T A;  2ETN A;  5K1P A;  1SQP H;  1Q81 W;  5JWP A;  2HVK C;  1GN3 A;  4FFK A;  2DMX A;  5IYZ B;  3K3W A;  2IJI A;  1P84 F;  3TXQ A;  3RYI A;  4B3S O;  2A9H A;  2JIZ G;  4UB6 Z;  2Q5Z A;  4F4L A;  1WA8 B;  3G80 A;  2CH7 B;  5B1N A;  5CA3 A;  3ETE A;  4YHH O;  4GZR B;  1WB7 A;  1L0L H;  3ZMV A;  1DF4 A;  3H1J H;  3QO7 A;  2F43 G;  4DR3 B;  4ZKI A;  4GX1 A;  3CRC A;  3UO3 A;  1QVG U;  2Q9L A;  1B04 A;  3FB5 C;  5H9C A;  2VQE B;  1EM1 A;  3A8T A;  1MNG A;  5LP6 A;  4FLW A;  1NVP D;  2Y0I A;  4JI6 B;  2DWE C;  4JI7 O;  2Z3Y A;  3CCU V;  2DYR B;  1QNM A;  1XRE A;  4J9Y B;  1BMF G;  2F95 B;  1GTO A;  3WB1 A;  4QPJ A;  1JOY A;  2HHH B;  1VF6 C;  3SYQ A;  5LOV A;  5JJE B;  1AR5 A;  1BE3 H;  1TA8 A;  2EUL A;  1BQZ A;  5C93 A;  5JJJ B;  2B1I A;  4LF9 B;  2PZS A;  4LF5 O;  2FL4 A;  4P2Z A;  3G4S V;  1D5A A;  4FMT A;  4LR3 A;  3WB2 A;  1Y4M A;  4E4E A;  4LF7 B;  2OCH A;  1EZJ A;  5BXZ A;  3RGB A;  3AG3 B;  3RN4 A;  2DYS B;  5LHI A;  5LMU B;  1IVS A;  1M9N A;  3N2K B;  1RM1 B;  4RUE A;  1GO3 F;  4PJ0 Z;  3CCR V;  1DTO A;  2GUZ A;  3ETQ A;  3R66 A;  4PDV A;  3ZHU A;  1HR0 O;  2V1D A;  1H38 A;  3KKY A;  1P7G A;  2OT5 A;  3PN1 A;  4K0K O;  2HG5 C;  3U10 A;  3ZHV A;  2JGU A;  2CTW A;  2QKA A;  2X6A A;  4U3F H;  4HNA B;  2VQF B;  1TGO A;  3BRC A;  3D3I A;  4N23 A;  1YJN V;  3BHP A;  1OCC B;  1Q6U A;  4PDR A;  1S5J A;  3ZMU A;  3ZMT A;  3K9A A;  1OCO C;  2IJH A;  3L9D A;  2CTR A;  3OUF A;  2JGD A;  1FJG B;  4NR1 A;  3B09 A;  4B7K A;  1NZ6 A;  3KG2 A;  1QBZ A;  1I94 B;  2P7T C;  4YIP A;  3J81 N;  3MAQ A;  5LHH A;  2UXX A;  3K5M A;  5BY1 A;  1KB9 F;  1Q3E A;  4WFB V;  2UU9 O;  3X2Q C;  1K4D C;  1AR1 B;  2LW1 A;  3EFF K;  1E1Q G;  3SYA A;  5LXT B;  2QWN B;  2XAH A;  3J80 N;  2ODM A;  1NT2 B;  1N0J A;  3RW0 A;  5EYP A;  3ZX6 A;  4YY3 B;  4BIZ A;  3QNE A;  4DXW A;  4OX9 O;  4AHC A;  5LMN O;  4LFA B;  2UUC O;  3AEI A;  3KZI Z;  4J9Z B;  5GTH Z;  4DV5 O;  3NXS A;  1SC5 B;  2H8P C;  1GM9 A;  4GT1 A;  2HFE C;  1MA1 A;  3OMN B;  3T1Y O;  3E89 A;  4XDJ A;  3CC2 V;  1K5Q A;  3IGA C;  4WBN A;  4JTA B;  3FB6 C;  5KUK A;  3H1H H;  4L8J A;  1M90 W;  5BMV B;  2EJR A;  4JAS A;  5IJ9 B;  1X59 A;  3ZMZ A;  4UCV A;  2HVJ C;  1ZSP A;  3VQX A;  3BEH A;  1PPJ H;  1IX9 A;  2A0L A;  3FKS G;  3DSQ A;  4IHJ B;  2BE3 A;  1IBM B;  2YXL A;  3K5N A;  3MD0 A;  1J5E B;  1E79 G;  2ZXW C;  4FLZ A;  3AG1 C;  2HLD G;  1VQM V;  2UXD O;  5H5N A;  1YTF D;  1M93 A;  3K9S A;  1PL4 A;  5EK0 A;  2OTL V;  4F6R B;  1NTZ H;  1N33 B;  2KG7 B;  1NR7 A;  4FM1 A;  4NTY A;  4YIO A;  2E5L B;  1XNR O;  3N2G A;  1OCO B;  3K58 A;  5EZY B;  5EC1 C;  1XDC A;  4QIW F;  1KYO F;  2NLJ C;  1VQ5 V;  3ZHT A;  4TUY B;  1Y76 A;  1YI2 V;  2QR4 A;  3JD0 A;  2UUA B;  5JH7 A;  4UV9 A;  4OGQ B;  5J2U B;  4UXN A;  1ARO P;  3CX5 F;  2GV9 A;  2WPD G;  2FB5 A;  4I9Q A;  4LFB B;  4HZ3 A;  2ZQM A;  2WLK A;  3LUT B;  4TWK A;  3HKB B;  1IBK B;  1JFF B;  2OTJ V;  3JAW B;  1JA8 A;  2YSU B;  3CE2 A;  4IIJ A;  4DV2 B;  1K9M W;  3WB0 A;  4LH7 A;  1IUR A;  2OCC C;  1IDS A;  3B8N A;  2GTA A;  3LDE A;  2Y69 C;  2W6I G;  3CS5 A;  4UB8 Z;  1KP2 A;  5IJ0 A;  4GKK B;  2F93 B;  3F5W C;  1H8H G;  4GKJ O;  1FAF A;  3BPZ A;  4JI8 O;  1U96 A;  4CH5 A;  2AW9 A;  5GW7 A;  4E2L A;  2P6J A;  2YS8 A;  5GON A;  3SPC A;  4OPH A;  3BA9 A;  4JV5 B;  2IBZ H;  3JAR B;  4JAV A;  2ARH A;  1DK1 A;  3EXA A;  2ZE8 A;  3CME V;  2ZNJ A;  4DR4 B;  2CGN A;  3KCY A;  5H2F Z;  5B1A C;  3G6E V;  2CE4 A;  1WP8 A;  3DXR B;  2Z5U A;  1IXM A;  3ETG A;  1Q43 A;  5LYJ B;  3QTC A;  5IE9 A;  3C90 A;  4I4T B;  5B1B C;  1I5X A;  2YXY A;  1Q90 D;  4QPK A;  2CDY A;  3STL C;  2EIN C;  4B7E A;  1FXK C;  2ZXW B;  3SDL A;  2CGO A;  3D36 C;  4K8Z A;  5IWA B;  4UCO A;  4PA6 A;  5A2Q N;  2Q73 A;  3CCE V;  1XNQ B;  2EZO A;  1WPX A;  4CS4 A;  4LC1 A;  4RUF A;  5E79 Z;  4MS2 A;  1Z5W A;  3CC4 V;  1EN5 A;  5LL6 Y;  3ZRW B;  1D2D A;  4JI3 O;  2Q8V A;  3FD9 A;  3GB7 C;  2ZCE A;  5JVD B;  4MVR A;  3APO A;  3ABK B;  1M57 C;  4MTG A;  4FJC C;  4X66 O;  2JEU A;  4TV9 B;  5BR8 O;  4UCS A;  1KBH A;  1AVM A;  3STZ C;  4EEQ A;  5FL7 G;  1U97 A;  2QTS A;  3UO2 A;  4GYC B;  1ZLZ A;  5K1X A;  3OTO B;  3RVZ A;  2BTQ B;  4I9W A;  3ABL B;  4AI8 A;  1SES A;  4UVA A;  2IH3 C;  3RYH A;  1K73 W;  1OHH G;  4PA9 A;  5KUM A;  4FLT A;  4K3A A;  4KXR A;  3B2E E;  4X89 A;  1SQB H;  1RSO A;  1TUB A;  2A06 H;  2FKX A;  1VQK V;  4BIU A;  3IC7 A;  4R6Z A;  2OCC B;  3QVN A;  1TVK B;  2WLI A;  1SET A;  2ZIM A;  1PNL A;  3ZBH A;  3TK1 A;  2Y69 B;  1QU7 A;  4KHP O;  1H2G A;  3Q4H B;  1ORQ C;  1NU1 H;  1OCR B;  2VQF O;  5JQG B;  1K34 A;  3FYE B;  2QGN A;  2AHY A;  4X62 O;  1GM7 A;  2VWJ A;  4X64 B;  1X4T A;  4Z1M G;  1MSD A;  2XTA A;  3UQ8 A;  4I5S A;  3K0D A;  3JCZ A;  4B3T B;  1N4C A;  2QEX V;  2ZR3 A;  4FLX A;  4DV1 B;  2OIE A;  3E22 A;  3EVK A;  1GN4 A;  1DLB A;  3JAT B;  3P32 A;  2A7W A;  3H1I H;  4WF9 V;  4I7Z B;  4G2K A;  4TT3 G;  3VBB A;  2DN9 A;  2EIN B;  2L6L A;  1FXK B;  4L87 A;  1M1K W;  4DRX B;  1KUQ A;  1BZK A;  2DOS A;  4X1Y A;  3H1L H;  3CJH B;  3M99 B;  2PUS A;  3K5L A;  1N34 O;  2F4V O;  4LF8 B;  5B3S B;  3FAV B;  1VQ8 V;  1KKD A;  3CD6 V;  1QCE A;  5J2T B;  4LH6 A;  2VRZ A;  3G71 V;  4LFA O;  2Q67 A;  3HKC B;  4EFE A;  4J42 A;  4Q20 A;  3RBZ A;  5CB4 A;  2OYQ A;  2YEV A;  2WLJ A;  1UPG A;  3JD4 A;  3OMI B;  1BS3 A;  3CCS V;  5B1O A;  1S76 D;  4JI1 B;  4BIO A;  4O2B B;  4NXM B;  4DW1 A;  3U11 A;  2LQT A;  2AZ2 A;  1N36 B;  4JI0 O;  2UXB B;  3K57 A;  5DED A;  3AG3 C;  3EHB B;  2DYS C;  1G1X B;  4MT8 A;  2JJ1 G;  1NH2 B;  2O57 A;  3CXC U;  1HDJ A;  2IJJ A;  1FFT B;  2QWQ B;  4FFB B;  3CCV V;  3LSQ A;  4HAM A;  5IY5 C;  2D3O W;  2YIB A;  4LNU A;  2YC0 A;  3K04 A;  1IBM O;  3JD1 A;  3P3N A;  1S72 V;  3OEH G;  1J95 A;  5FNV B;  1J5E O;  4JI4 O;  2X6C A;  1ZL8 B;  1XBL A;  2XOK G;  1V54 C;  1OCC C;  1V9P A;  1K33 A;  4DR6 O;  2RN9 A;  4O4H A;  3ZIA G;  4X9Q A;  5TIS Z;  1BSM A;  2N74 A;  3CCL V;  4JI5 B;  4ASU G;  4J7K A;  1CPY A;  3RYI B;  1F51 A;  2AXT Z;  3JAM N;  4X1K B;  4NTX A;  3CCQ V;  1HNX B;  1NQT A;  4B3R B;  1PKX A;  5L3F A;  3AG7 A;  1URF A;  3E8G A;  3E2E A;  4OXS A;  2E3C A;  2QM8 A;  4PI0 A;  4WCE V;  1K8A W;  1OJH A;  2CH7 A;  5LP6 B;  2P90 A;  2YXH A;  3JAK A;  1HP8 A;  3BAA A;  3K08 A;  4BW9 A;  3ZRS A;  4Q6G A;  2JEX A;  3ABU A;  2XAS A;  4DV2 O;  4R7C A;  2EIK B;  1US6 A;  1K97 A;  5AG2 A;  3I5D A;  2LP7 A;  2M6Y A;  1S5L Z;  2NR5 A;  3PJS K;  4H13 B;  2Y4T A;  1SRY A;  4AQY B;  2Q4P A;  3OT7 A;  1AP5 A;  1YCI A;  3QF7 A;  2P4V A;  2P06 A;  2UXC O;  2X0L A;  4PI2 A;  4CH3 A;  2E76 B;  4PDM A;  4NXN B;  3SYO A;  1ROP A;  3BVO A;  1IBL B;  4B3M O;  1F4N A;  2Q69 A;  3IJ4 A;  1XMO O;  3JSL A;  3ICX A;  5IY5 B;  2PI5 A;  4PA7 A;  1SQQ H;  3WG7 C;  2QWR B;  3N2K A;  1YDX A;  5DN6 G;  4BAY A;  1SA0 A;  1V54 B;  3AG4 C;  4MVU A;  2LGQ A;  2IM9 A;  1Q6H A;  1XNQ O;  4DUZ O;  2GSM B;  4LFC O;  4ICG A;  3RYF A;  1OCZ B;  1EN4 A;  2Q0A A;  2JGD B;  2ZR2 A;  4I55 A;  4FM2 A;  5H6Q A;  1SZX A;  2ATK C;  4HNA A;  1IZ3 A;  2WLL B;  4DR5 B;  4GUN A;  1VQN V;  3W7U A;  4MSW C;  2N04 A;  2HR3 A;  2QSA A;  2H3O A;  4RAI A;  3AK1 A;  1FXV A;  2RMK B;  2E74 B;  3E8H A;  4C7U A;  3A0H Z;  3E83 A;  5ITZ A;  5C8Y B;  2GTS A;  2X7R B;  4PDL A;  1L8D A;  4R50 A;  1JX9 A;  5LA6 B;  3ABM B;  3SPG A;  2F1M A;  5FPR A;  3RWR D;  1WLE A;  3VQW A;  1MAB G;  3CHX A;  4JI2 B;  1W59 A;  1CEZ A;  3NR7 A;  2BTO A;  1AR4 A;  2LFR A;  4P9P A;  1JR9 A;  2YIC A;  2B9Z A;  1A32 A;  3GWK C;  2ADQ B;  2YDE A;  3K0G A;  3ZHS A;  3QG5 A;  3QO8 A;  1M4U A;  2A3Q A;  1WAZ A;  4O4I A;  4IGG A;  3E35 A;  4WBN B;  1GMG A;  4O4J B;  2W6J G;  4GCZ A;  4LF6 B;  2RJZ A;  4X88 A;  1QLN A;  3CWB H;  1VF6 A;  3OM3 B;  2UUB O;  1NVP B;  2AHZ A;  5L3B A;  4LWS A;  2HEP A;  1KU9 A;  4DV7 B;  5BMV A;  2HP8 A;  1AJQ A;  4ZHQ A;  2AGA A;  4TQF A;  4DR1 O;  1N32 O;  3T1H B;  1YF2 A;  3F5T A;  2R9R B;  4UVC A;  4DR2 B;  1N0N A;  3WG7 B;  3W7S A;  1NI8 A;  5CA0 A;  1QVF U;  4IYH A;  4JTC B;  1JVM A;  1HNZ B;  1WJZ A;  1VQ7 V;  4IHJ A;  3VQV A;  4LCU C;  3AG4 B;  3B77 A;  3GVM A;  4ABM A;  3N2G B;  5D5Q A;  1W0K G;  4LF8 O;  2ZD9 A;  2N05 A;  3ABT A;  1Z5V A;  3ABK C;  3SPJ A;  4ZOL B;  3QO5 A;  2L35 A;  4DV3 O;  1Y76 B;  1VIB A;  3GWO A;  5JH7 B;  3CPW U;  3L73 H;  4B3S B;  1ZAU A;  4B08 A;  4A5U B;  5EBW C;  3T2M A;  2ZIN A;  3JAL A;  5JCO C;  3A0B Z;  2K9P A;  1K3E A;  3ABL C;  4X1I A;  4LF4 O;  1GAX A;  1H2N A;  4NXM O;  4YHH B;  1GM8 A;  5DEC A;  5F2V O;  4TUY A;  3OR6 C;  2UXB O;  4XBF A;  1BGY H;  2XT9 A;  1VQ6 V;  4JYA B;  3FX7 A;  2QTO A;  2IW5 A;  5D5P A;  4CBC A;  5DM6 V;  5J2U A;  3SJA C;  4JZG A;  5E1A C;  5EBL C;  4IIJ B;  3M8A A;  1GRJ A;  4JYB A;  1XMQ O;  5JJN B;  4O2A A;  2JJ2 G;  2PTM A;  3K03 A;  3ML0 A;  1AI6 A;  4JI7 B;  1OCR C;  1HWY A;  1Q8I A;  1LR1 A;  4JAA A;  4IYI A;  4RQE A;  1VP7 A;  4I50 A;  4JGS A;  1EN6 A;  4G28 B;  1GKF A;  4NYK A;  5CBF A;  2R72 A;  1S5H C;  1JJ2 U;  3JAS B;  3D3Q A;  2EIL B;  3JD3 A;  1CP9 A;  4BWA A;  2XAF A;  5KMG B;  3CB2 A;  1VQL V;  1QQC A;  2BCC H;  3AK2 A;  3ZHQ A;  2WLH A;  4Z2W A;  2CUG A;  4LF5 B;  1P4R A;  1KEC A;  1B3Q A;  3LDD A;  4J7J A;  4JAU A;  3I55 V;  1RPR A;  3ZED A;  1DF5 A;  4JZ2 A;  5A9G A;  5CA1 A;  5KHJ A;  1YHQ V;  4DW0 A;  2ZDI C;  4WFE A;  1HNX O;  1Y66 A;  2X6B A;  3JAR A;  4W4K A;  4I0X A;  1NTM H;  3UT5 B;  1R3I C;  5CMU A;  4MW8 A;  4YJ2 B;  4KP4 A;  1FFX B;  2V4D A;  4DR3 O;  1ZUQ A;  1QR8 A;  1L0N H;  5L3D A;  3TCU A;  4K0K B;  1W0J G;  2WWW A;  5LYJ A;  1JQ0 A;  1WB8 A;  2UXN A;  4PD4 F;  2MW2 B;  5B3S C;  2M7W A;  4J7Z A;  2VQE O;  1KKC A;  2NN4 A;  2P5O A;  3OAA G;  5EIB C;  3CC7 V;  1XUQ A;  4JI6 O;  2CTP A;  4DV4 B;  4HYO A;  4ZIB A;  2Q0O C;  1GH6 A;  3B4S A;  2CTQ A;  2YIB D;  1QHT A;  3LSS A;  4CC5 A;  3F7Y C;  1M56 C;  3OE7 G;  4CS3 A;  1KMI Z;  2HHH O;  4NB5 A;  4EB6 A;  1PD3 A;  1YTF B;  4LF9 O;  1XHX A;  2DQ0 A;  5JVD A;  2YIA A;  1S3J A;  4X65 B;  1XHZ A;  2UU9 B;  3G6B A;  1NR1 A;  3HKE B;  4TV9 A;  3RYH B;  1XIL A;  3HKD A;  4LF7 O;  1EZV H;  1RSO B;  5LMU O;  1TUB B;  3APQ A;  3C3S A;  2ZNI A;  1VF5 B;  1YXB A;  4U3J B;  2WLI B;  1DGS A;  3T1C A;  5LGU A;  3BCC H;  1VF7 A;  5LBQ A;  5KHI A;  2EIM B;  3MHS C;  5LMN B;  2KKW A;  1VQ4 V;  2UUC B;  1VQ9 V;  4WFG A;  1T5E A;  4DV5 B;  1Y74 B;  3E86 A;  3VQY A;  3B40 A;  5KX5 A;  3T1Y B;  2Q7H A;  4TV8 A;  3ASO B;  2ZM6 B;  1COW G;  3Q4H A;  4MTX A;  3AK3 A;  3CEI A;  1VQO V;  1FJG O;  1BHA A;  3ZHR A;  5JQG A;  4DR5 O;  1XL4 A;  1VMG A;  2YID A;  1I94 O;  2LO1 A;  4WFF A;  3ZN0 A;  3E22 B;  4FVM A;  1W2B U;  3K5O A;  2LGW A;  1H2K A;  2W0F C;  2BSK A;  1AP6 A;  2BOB C;  3AG2 C;  2EJ7 A;  3OGC C;  1JCH A;  1GK9 A;  5LP6 C;  4HBN A;  5EC2 C;  4R8C A;  1M5I A;  1Q5O A;  4MVS A;  4NKG B;  1YIJ V;  5HFL A;  1RPO A;  4YY3 O;  3C3T A;  3MHH C;  3CXH F;  1FXK A;  3L71 H;  1YEW A;  4X20 A;  4GX2 A;  2EIK C;  2FYU H;  4DRX A;  3D36 A;  5J9P C;  1R3K C;  4DO2 A;  1Z2G A;  4MVO A;  4YJ3 B;  1XNR B;  3CJH A;  1OV9 A;  2YEV B;  2Q6A A;  4Z1V A;  1M56 B;  4ZI7 B;  4FM0 A;  3DC5 A;  2MK3 A;  3OR7 C;  4OPA A;  3OTF A;  2K1E A;  3FAV A;  1XI1 A;  4J80 A;  5J2T A;  2CK3 G;  3HKC A;  3TET A;  5KA6 A;  1FPO A;  1TUE B;  3RYC A;  1R6T A;  2RNB A;  1KC8 W;  2XND G;  4LF6 O;  5KHH A;  5B66 Z;  3JSN A;  1BHB A;  1AJN A;  4GX0 A;  4WFH A;  3O9O A;  4O2B A;  2XAQ A;  1R73 A;  5H6R A;  1K5S A;  2ITD C;  1QR9 A;  2D2C B;  3D8C A;  1NBM G;  3WU2 Z;  4O4L B;  3T1H O;  1NS1 A;  2WLN A;  1VEW A;  4DR2 O;  2QM4 A;  4FFB A;  4KFM A;  1N33 O;  4QGP A;  1NJI W;  3UKM A;  4DUY B;  1P7B A;  1OCZ C;  3N27 A;  2QJ1 A;  3W7W A;  2DW4 A;  4RO2 A;  1F7Y A;  3ASN B;  2E5L O;  2RDC A;  2EIJ B;  2FTK A;  2R9I A;  4GX5 A;  4JF3 A;  1ENV A;  1ZL8 A;  3L74 H;  1JPX A;  3G67 A;  3CCJ V;  1SQV H;  2EZP A;  5EBM C;  3L75 H;  4CZZ A;  2A79 B;  4XDK A;  4CH4 A;  5L3G A;  5IYZ A;  1XEQ A;  2UUA O;  2PYL A;  2PY5 A;  3FB7 C;  2GHY A; 
#chains in the Genus database with same CATH homology
 1WLE A;  3F5W C;  1H8H G;  2NNU A;  1MAB G;  2ITC C;  3ABM C;  1FXH A;  2Q68 A;  3AG2 B;  5GW7 A;  1CEZ A;  5IYC O;  4QJF B;  3F7V C;  2HJF C;  4FIP C;  4E2L A;  2LFR A;  4P9P A;  2P6J A;  2HKO A;  3SPC A;  2IH1 C;  1V55 B;  2Y48 A;  1B6Q A;  5B1A B;  1KD1 W;  4JAV A;  3K0G A;  3QO8 A;  4RQF A;  3CME V;  1YSC A;  4LBE C;  3LNM B;  2ZDI A;  3CYO A;  1KQS U;  3E35 A;  5B1A C;  5B1B B;  2IU0 A;  1GMG A;  3ETD A;  3G6E V;  2W6J G;  2XAG A;  2Z5U A;  1IXM A;  3ETG A;  3OMA B;  3FYI B;  4GCZ A;  4X88 A;  1QLN A;  2LFS A;  2IJK A;  1XL6 A;  4U7O A;  1EFR G;  3OM3 B;  5B1B C;  1NVP B;  1I5X A;  4QPK A;  2AHZ A;  1YJ9 V;  5L3B A;  3STL C;  2C2A A;  1R6N A;  2EIN C;  1FXK C;  2ZXW B;  3OUS A;  2PI4 A;  4PA6 A;  1S0V A;  2DYR C;  1G4Y B;  3CCE V;  1AJQ A;  1FS0 G;  3I56 V;  1MOF A;  2KB1 A;  4N21 A;  2EZO A;  1WPX A;  4LC1 A;  4RUF A;  2R9R B;  4MS2 A;  4UVC A;  2WAM A;  1E1R G;  3CC4 V;  1M57 B;  3WG7 B;  3ZRW B;  3W7S A;  5IDJ A;  1QVF U;  2B5U A;  3IFX A;  1QLE C;  3GB7 C;  4JTC B;  1JVM A;  2DWD C;  1VQ7 V;  3E8F A;  4LCU C;  4MVR A;  3AG4 B;  3B8M A;  3ABK B;  4QNH B;  1M57 C;  4MTG A;  1L1F A;  4WFA V;  3B77 A;  3VOU A;  3SYP A;  1R6K A;  4FJC C;  2JEU A;  1H8E G;  4P9O A;  1W0K G;  2ZD9 A;  3STZ C;  3ABT A;  3ABK C;  5FL7 G;  4LP8 A;  3SPJ A;  5CN0 A;  3QO5 A;  3T4D A;  1SER A;  3RVZ A;  1K7D A;  4I9W A;  1RM1 C;  1THZ A;  3OW2 U;  2QE7 G;  3ABL B;  4UV8 A;  3GWO A;  3HPL C;  3ZCC A;  4P30 A;  3SJQ C;  1SES A;  3SYC A;  2QKS A;  4UVA A;  3CPW U;  2IH3 C;  1YIT V;  5EBW C;  5LHG A;  3T2M A;  2DQ3 A;  1OHH G;  1K73 W;  1K3E A;  3ABL C;  4PA9 A;  5KUM A;  2IU3 A;  4X89 A;  4MTO A;  1SZT A;  4U7N A;  1VQK V;  3CCM V;  2H94 A;  1GM8 A;  4BIU A;  2JDI G;  3IC7 A;  3OR6 C;  1AJP A;  4XBF A;  4R6Z A;  2OCC B;  1PL0 A;  5BZB A;  5LGN A;  3W7T A;  2WLI A;  1SET A;  1VQ6 V;  1PNL A;  2QTO A;  3TK1 A;  2IW5 A;  2Y69 B;  4CBC A;  3OFN G;  5DM6 V;  1I5Y A;  2WLL A;  2QA4 V;  1Q81 W;  5E1A C;  4QE9 A;  5EBL C;  1H2G A;  2HVK C;  1ORQ C;  4JYB A;  1OCR B;  3K3W A;  2JJ2 G;  3K79 A;  5LGT A;  5HFM A;  2IJI A;  5L3E A;  2A9H A;  3K03 A;  2JIZ G;  1K34 A;  3FYE B;  5KA5 A;  2AHY A;  3ML0 A;  1GM7 A;  1AI6 A;  1OCR C;  1HWY A;  4F4L A;  4Z1M G;  5B1N A;  5CA3 A;  3CMA V;  4RQE A;  3ETE A;  4I5S A;  4JGS A;  4G28 B;  1GKF A;  3K0D A;  3ZMV A;  1DF4 A;  3DTU B;  5CBF A;  1S5H C;  3QO7 A;  1AI7 A;  1JJ2 U;  3JCZ A;  2F43 G;  1YJW V;  2EIL B;  2QEX V;  4ZKI A;  3JD3 A;  1CP9 A;  3P30 A;  5IYD O;  2XAF A;  2ZR3 A;  4GX1 A;  4UUJ C;  1VQP V;  1VQL V;  1QVG U;  2WLH A;  3SPH A;  1DLB A;  3RVY A;  3P32 A;  1P4R A;  1KEC A;  2EIL C;  3FB5 C;  5H9C A;  3LDD A;  4WF9 V;  4G2K A;  4JAU A;  4TT3 G;  3I55 V;  1RPR A;  3VBB A;  1DF5 A;  2EIN B;  1YHQ V;  1FXK B;  1NVP D;  4L87 A;  1M1K W;  3JYC A;  1F23 A;  1NKD A;  2ZDI C;  4WFE A;  2DWE C;  1Y66 A;  2X6B A;  2Z3Y A;  3CCU V;  2DYR B;  4J9Y B;  1BMF G;  3M99 B;  1GTO A;  1R3I C;  5CMU A;  4MW8 A;  4QPJ A;  1PNK A;  4KP4 A;  1JOY A;  3SYQ A;  5B3S B;  1BL8 A;  1QR8 A;  1VQ8 V;  5L3D A;  4G27 B;  4H37 A;  3UM7 A;  3ZMS A;  5C93 A;  3TCU A;  1KKD A;  3CD6 V;  1QCE A;  1QLE B;  1W0J G;  2WWW A;  4EKW A;  2B1I A;  1JQ0 A;  3G71 V;  1N8R W;  2Q67 A;  2UXN A;  5B3S C;  2M7W A;  4Q20 A;  3CP1 A;  4TSF G;  3RBZ A;  2YEV A;  4P2Z A;  3OAA G;  2WLJ A;  3G4S V;  4FMT A;  3CC7 V;  1Y4M A;  3JD4 A;  4JPR A;  3OMI B;  3CCS V;  4HYO A;  4QE7 A;  5B1O A;  1EZJ A;  1S76 D;  3AG3 B;  3LSS A;  2DYS B;  5LHI A;  1M9N A;  1RM1 B;  3F7Y C;  1G8M A;  4RUE A;  1M56 C;  1GO3 F;  3OE7 G;  3CCR V;  1DTO A;  2WLM A;  4PDV A;  3AG3 C;  3E8B A;  3EHB B;  2DYS C;  2V1D A;  1H38 A;  2OT5 A;  1PD3 A;  4MT8 A;  2JJ1 G;  1NH2 B;  2HG5 C;  1YTF B;  2DQ0 A;  3CXC U;  4PA3 A;  4BW5 A;  2IJJ A;  2X6A A;  1FFT B;  1S3J A;  3CCV V;  3LSQ A;  4HAM A;  1NR1 A;  5IY5 C;  2D3O W;  3D3I A;  4JTD B;  4N23 A;  1YJN V;  1AI5 A;  1OZ0 A;  3K04 A;  1OCC B;  1MSW D;  3ZRV A;  4PDR A;  3JD1 A;  1S72 V;  3ZMU A;  3ZMT A;  3OEH G;  1J95 A;  3K9A A;  1OCO C;  2IJH A;  1Q82 W;  2X6C A;  3W7X A;  4X8A A;  2WSS G;  3OUF A;  2XOK G;  1S77 D;  1V54 C;  4UVB A;  2WLI B;  1OCC C;  3T1C A;  3SPI A;  5LGU A;  1K33 A;  5LBQ A;  3KG2 A;  1QBZ A;  3X2Q B;  3ZIA G;  2P7T C;  4YXW G;  2EIM B;  5LHH A;  2UXX A;  3MHS C;  3CCL V;  2P67 A;  1VQ4 V;  1VQ9 V;  5CBH A;  4WFG A;  4ASU G;  4WFB V;  3ZRX A;  1CPY A;  3X2Q C;  1F51 A;  1K4D C;  3E86 A;  1AR1 B;  2EIM C;  3JD2 A;  3EFF K;  3CCQ V;  1E1Q G;  1NQT A;  3SYA A;  1PKX A;  1ZWI C;  2XAH A;  3LDC A;  5L3F A;  3ASO B;  1COW G;  1MG1 A;  3E8G A;  4MTX A;  3RW0 A;  3E2E A;  4OXS A;  1VQO V;  2QM8 A;  1BHA A;  4BIZ A;  1XL4 A;  3QNE A;  4DXW A;  4WCE V;  1K8A W;  3ASO C;  4WFF A;  3ZN0 A;  4KUM A;  1K4C C;  1W2B U;  3AEI A;  4J9Z B;  3NXS A;  2W0F C;  2P90 A;  2QM7 A;  4ZBM A;  4MVZ A;  2H8P C;  1GM9 A;  4MVM A;  4GT1 A;  2HFE C;  2BOB C;  3WFV A;  2B1G A;  3AG2 C;  3OGC C;  3K08 A;  3OMN B;  3ZRS A;  1JCH A;  5IYB O;  1GK9 A;  3E89 A;  4XDJ A;  2JEX A;  4PEL A;  3ABU A;  2XAS A;  5EC2 C;  4R8C A;  1R3L C;  4MVS A;  2EIK B;  4R7C A;  1YIJ V;  1V55 C;  3CC2 V;  1K97 A;  1K5Q A;  3IGA C;  2LP7 A;  5HFL A;  4JTA B;  3FB6 C;  5KUK A;  1RPO A;  3PJS K;  1M90 W;  3HB3 B;  1UJW B;  2EJR A;  4JAS A;  1SRY A;  3MHH C;  3FB8 C;  1FXK A;  3ZMZ A;  2HVJ C;  2EIK C;  4GX2 A;  5J9P C;  3D36 A;  1R3K C;  4DO2 A;  2X0L A;  4MVO A;  4PA4 A;  4PDM A;  4MW3 A;  2YEV B;  3BEH A;  2Q6A A;  2A0L A;  3FKS G;  1M56 B;  3SYO A;  3AG1 B;  1PNM A;  2MK3 A;  1ROP A;  3OR7 C;  4MTF A;  4H33 A;  3T4Z A;  2K1E A;  5L3C A;  1F4N A;  2Q69 A;  3MD0 A;  1E79 G;  2CK3 G;  2ZXW C;  4MVQ A;  2XAJ A;  3AG1 C;  2HLD G;  1VQM V;  1EBO A;  1NH2 D;  3TET A;  1YTF D;  3ZRW A;  2OTL V;  3H01 A;  5EK0 A;  5KA6 A;  1TUE B;  1KC8 W;  2XND G;  5CBG A;  2JK5 C;  3K06 A;  5IY5 B;  3ZJZ A;  3OEE G;  1NR7 A;  2PI5 A;  4PA7 A;  1BHB A;  1AJN A;  4GX0 A;  4WFH A;  2V7Q G;  3WG7 C;  2XAQ A;  1Q86 W;  1R73 A;  5H6R A;  3ZN1 A;  1K5S A;  1OCO B;  2ITD C;  3FB7 C;  5DN6 G;  4BAY A;  4FK5 C;  1V54 B;  1QR9 A;  3AG4 C;  4MVU A;  5EC1 C;  1NBM G;  4QIW F;  2NLJ C;  3BY6 A;  1AI4 A;  1VQ5 V;  2GSM B;  1R3J C;  1OCZ B;  2WLN A;  1YI2 V;  2ZR2 A;  3JD0 A;  5H6Q A;  1KP3 A;  2ATK C;  4UV9 A;  4KFM A;  2WLL B;  4UXN A;  4FPP A;  1K92 A;  1NJI W;  1VQN V;  4XDL A;  3W7U A;  4MSW C;  1ARO P;  3UKM A;  3DGE A;  1P7B A;  1OCZ C;  2WPD G;  3W7W A;  2DW4 A;  2HR3 A;  4RO2 A;  3ASN B;  4RAI A;  2EIJ B;  2FTK A;  2ZQM A;  4HZ3 A;  1FXV A;  2R9I A;  4GX5 A;  4JF3 A;  3E8H A;  1ENV A;  1JPX A;  2WLK A;  3LUT B;  4TWK A;  3E83 A;  3A0R A;  2X7R B;  4PDL A;  2OTJ V;  3CCJ V;  3ASN C;  2EIJ C;  1LNQ A;  1F4M A;  2YSU B;  2EZP A;  1JX9 A;  4R50 A;  1Q7Y W;  5EBM C;  1K9M W;  3ABM B;  2A79 B;  4CZZ A;  4XDK A;  3R65 A;  4JYC A;  2BOC C;  2OCC C;  5L3G A;  3B8N A;  3SPG A;  2EBO A;  3LDE A;  2Y69 C;  2W6I G;  1KP2 A;  2GHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...