2YS8A

Solution structure of the dnaj-like domain from human ras-associated protein rap1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
GSSGSSGSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab-related GTP-binding protein RabJ
publication title Solution structure of the DnaJ-like domain from human ras-associated protein Rap1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ys8A00
2GUZA 2N05A 1BQ0A 3UCSC 1HDJA 1FPOA 1N4CA 2Y4UA 2GUZB 4IT5A 1BQZA 2CTPA 2LGWA 2M6YA 1WJZA 1XBLA 2DN9A 2PF4E 2DMXA 2CTWA 2QWPB 2YUAA 2EJ7A 2QSAA 1GH6A 2CTRA 2QWQB 1NZ6A 2LO1A 3BVOA 3APQA 4RWUA 2N04A 2QWNB 3UO3A 1IURA 3APOA 1FAFA 2L6LA 2CUGA 3UO2A 4J80A 2YS8A 2Y4TA 2OCHA 4J7ZA 2KQXA 3AG7A 2CTQA 2QWRB 2QWOB
chains in the Genus database with same CATH superfamily
1JOYA 4EFBA 1QR8A 2PY5A 1WB8A 1XBLA 1SQVH 1G1XB 2EJ7A 3OEEG 4MVMA 2YXLA 4O4LA 2QA4V 4LFCO 4DV6B 1QVGU 3SJBC 4H13B 3FB8C 4Q6GA 5EK0A 4UCRA 5FNVA 1NH2B 1J5EB 2QM7A 3JALA 4XDLA 4RUFA 4LF7B 4I0XA 4UVBA 3AK2A 1E1RG 2NNUA 4FZ1A 3CCVV 2W6IG 2VQEB 3ZRXA 4CBCA 1YTFB 1NR7A 3I5DA 3ZIAG 3TXQA 1ZL8A 5LMUB 4PA9A 2OYQA 1RPRA 3ZMUA 3BPZA 2DW4A 1GO3F 1QLEC 4X65B 1XHXA 4JTAB 3ABLC 5KA6A 5IJ9A 1GTOA 3C3SA 4GYCB 2PUSA 4I55B 1XILA 4KHPB 2RCVA 1YI2V 3THOA 4WBNB 4JZ2A 4QIWF 1S0VA 1BHBA 3DC5A 2A0LA 3RYCA 4R50A 3UKMA 2VWKA 5EBMC 4MVRA 1YVWA 1XUQA 2WAMA 2FKXA 3K79A 3CCUV 4JI5O 1XDCA 2IU3A 5IT9N 3SPJA 5H6RA 3JD4A 2GSMB 1Z5WA 3A0BZ 3OUFA 1GM7A 3EXAA 1SQGA 4HYOA 1BT8A 1VF7A 5IDJA 3RVZA 3CCRV 2ZT9B 4LC1A 1Y74A 2PGGA 4B3SB 1QLNA 1NBMG 4PDLA 4EB6B 4LF4O 4PI0A 5E1AC 2XAJA 4CC6A 2Q7HA 3KG2A 2FB5A 2Q4PA 3SYPA 5B3SC 5LP6B 2QDOA 3DSQA 5DECA 3K5OA 3UCSC 4X62O 4AILC 4LF8B 5LXTA 1S72V 3CJHB 1P7GA 4DV2O 1Q6HA 3RYIB 2UUAO 1NTKH 4MVSA 2GHYA 2QM4A 4XDKA 4JI3B 3NXSA 2QKSA 4DV3O 3F5TA 4O2BB 3N2KA 4NXNO 3FKSG 1N0NA 2KG7A 4Z1MG 2V1DA 3N27A 3APOA 2ITDC 1I94O 1AJQA 1E1QG 1CP9A 5CA0B 2AHYA 3O65A 2YIAA 4BWAA 4GUNA 1AILA 3CYOA 3LNMB 2ZM6B 4U7OA 4IT5A 1BS3A 3JYCA 4J9YB 2JIZG 4TWKA 4ZOLA 2LW7A 2ZCEA 2OCCC 1Q86W 3AG3C 4JI7O 1IBMB 4DV4O 1COWG 2UUCB 4PHZA 1HDJA 5LBQA 3L9DA 2E76B 1P84F 1S5HC 3ZX6A 4RO2A 3I55V 2BTQB 5LMNB 4DR3B 5IYZA 1H2SB 1FYJA 3DXRA 2HLDG 4HAMA 3EHBB 2EJRA 4K3AA 1BMFG 4JAVA 1A32A 5KHJA 3JSLA 5H5NA 2V7QG 3M99B 2P7TC 3AG2C 3ASNC 3CHXA 4X8AA 1U97A 2LGWA 1V55B 4LFBO 4I50A 3RVYA 2XAFA 3JD0A 1WNSA 5BR8B 2F43G 3ZMSA 5BMVB 3CSXA 4TQDA 4JV5O 1DF5A 2IJKA 4IIJA 4UCSA 3F7VC 5A2QN 1IVSA 1AP6A 2A7WA 4KFMA 5DEDA 5D5PA 3ZHQA 4DR5O 2Y69C 4F4LA 1Y67A 4FIPC 1R3KC 2FTKA 1FXKC 2WLKA 1VARA 3H1HH 2P22C 1YJNV 1FS0G 5BY1A 3P3PA 3H1LH 5GONA 1PP9H 4TV8B 4MVQA 1FAFA 2XOKG 4JI1B 1YDXA 3SPHA 3U11A 2OTJV 1DLBA 1RPOA 5TISZ 1SQPH 1KMIZ 2ADPA 1PD3A 3CEIA 1K34A 4OPAA 1AI6A 5GW7A 1YHQV 2JJ2G 1FXKA 1TUBB 3CCMV 4NTXA 4ZI7B 2RN9A 3Q4HB 3OT7A 3WB2A 2IJJA 2DYSC 4MT8A 4FFBB 2Z5UA 4PELA 4DUZO 2F95B 5IWAB 4RQEA 2B5UA 2H94A 4LNUB 1JR9A 1R3JC 2QM8A 2Q9LA 3OEHG 2HJFC 3LDEA 4Z2WA 1RSOA 2CH7A 1R6NA 3GVMA 1FFXB 3E8HA 4YJ2B 3SJCC 3SYOA 1BSMA 1SC5B 4GLXA 2P5OA 1N32B 4DXWA 3E8BA 2EILB 5KUMA 4X66O 1M56C 1URFA 2GTSA 4UVCA 1LUVA 1K33A 3MAQA 2AZ0A 3CP1A 4MS2A 4PA7A 2VQFB 2PYLA 5LHGA 3SPCA 4GKKB 2QKCA 5CBFA 1KB9F 3BVOA 1NU1H 5IYDO 3E89A 4DR6B 3R66A 1K5SA 3MHHC 4K35A 1D5NA 4U7NA 3AG1B 4WFEA 2IJHA 2NR5A 4J7JA 1TA8A 4IGGA 1Q81W 3E22A 3AG4C 2Y4UA 2GUZB 1RM1C 4P2ZA 2DWDC 3T1HO 3X2QB 4FLXA 1MSWD 3TGUH 4X1IA 2Q7GA 4GKJO 2CGNA 3BA9A 2DYRC 3BRCA 1SQXH 2DOSA 2UXDB 3UQ8A 3ABUA 2QE7G 2VRZA 1N8RW 1KUQA 3B2EE 3CE2A 2F23A 3G4SV 4DV5O 3BY6A 3TXSA 4UB6Z 3OAAG 2HR3A 4J7KA 4GX5A 1H2NA 4AHCA 1VQ4V 3BABA 4X89A 4B3RB 2EIMB 2ATKC 2UU9O 1Q8IA 4LF6O 5J2UA 3QTCA 4U3JB 1N0JA 2ZE6A 2QTOA 4YHHO 4FPPA 4NKGB 2YUAA 2CTRA 3T4ZA 1WA8A 3L70H 4CH4A 2JGDA 2QWNB 2Q69A 5FL7G 4ZBMA 2UXNA 2WLMA 4LH6A 2Y4TA 1MZFA 4H37A 1Y76A 4YIOA 5EZYA 3JAWA 3CMAV 1FXHA 1EZVH 3LSQA 5CA1B 4LR3A 1P7BA 2JGUA 1TVKA 2R9AA 4X20A 3RYFA 5IJ0A 2M6YA 4JZGA 3IAYA 1OCRB 5IYBO 1AJNA 1PKXA 3UO3A 4N23A 3HKBA 1M57B 1WLEA 4FLUA 1M5IA 3JASB 4JI4B 3UT5B 2EZPA 3TJTA 2EIKB 3E35A 2WLJA 1NJIW 2WWWA 4D7TA 4LWSA 1HNWO 3HKEB 1XMOB 3K5LA 2ZR2A 3SDLA 1J95A 1H2MA 1F4NA 3IGAC 3S3WA 4JI0B 2YDEA 3L72H 4MTOA 2KKWA 5IY5B 3HKCB 2N05A 3K0GA 3JAKA 3JCZA 4HNAA 3CC4V 1B06A 4YJ3B 2UXCB 4DV0B 4IYIA 3CCQV 4DR1O 2DN9A 1EN4A 1VIBA 3ZHUA 3JSNA 4JYYA 4JI6B 1MZEA 3G67A 4PD4F 1MABG 3CRAA 3OGIB 1ROPA 1B04A 1E79G 5JVDA 5EYPA 3HR0A 2WLIB 2JS3A 1YITV 3W7TA 3FB5C 3CCLV 2XASA 3WG7C 1SQFA 1HNXO 4W4KA 1S3JA 4LFCB 3ETQA 1M9NA 4JYAO 2LQTA 3P3NA 5ITZA 3B77A 2YIBD 3ETDA 3ASOC 2R72A 2L6LA 3T4DA 4PDVA 5LOVA 1EZJA 4DR7O 3LSUA 1KP2A 4I7ZB 1TGOA 2JRIA 4DUYO 3OUSA 1BQZA 1YZBA 1KC8W 1WJZA 4TT3G 1GH6A 1WP7A 4TV9B 2XTAA 3U10A 2ZXWB 4P30A 3QF7A 1KP3A 1H2GA 4UFZA 4YIPA 5JWPA 1IURA 4LF5O 2BE3A 3W7WA 2HVJC 3ZN1A 1US6A 2DE0X 2Y0PA 3FAVA 4J41A 2D2CB 1D2DA 1R3LC 5CN0A 1WN7A 1IDSA 1BZKA 4O4IA 5EBWC 2HVKC 1S77D 2OT5A 2F4VO 2Q0OC 3SGIA 3K08A 2IU0A 1QQCA 2OIEA 4OX9O 1NH2D 4G28B 1ZWIC 3HKDA 1I5YA 4MTXA 5LA6B 4LCUC 1ZLZA 2YC0A 1M90W 4DRXA 4O2AA 3OMAB 4JI5B 4P9PA 2VS0A 4X1KA 2P90A 5H2FZ 1IBKO 1PL0A 3ZHVA 1DK1A 5KLVH 1GN3A 2YSUB 2YIBA 3H9VA 2YEVA 3QNEA 4CS3A 1IXMA 3K03A 2BSKB 3CXHF 3JARA 2D3OW 2M7WA 3F7YC 4DO2A 2IJIA 2YICA 2V4DA 4TQFA 4YY3O 4ZHQB 2GTAA 1KD1W 4DYLA 5DM6V 4LF4B 1IZ3A 5KMGA 1OCOB 2W6JG 3E8GA 1V54B 4DR2O 4MVZA 4I4TA 3OTOO 3N2GA 2FMLA 1XMQO 5KAIZ 4B7EA 2OCHA 4X62B 2KQXA 1WPXA 3H1KH 1VQPV 4NYKA 2NLJC 1TAEA 1XNRO 4DR4O 1B3QA 4I50B 4DV2B 5B1BB 4J9ZB 3RBZA 3U0ZA 4TUYA 1SERA 2UUAB 4LP8A 4J10A 1Q90D 2EZOA 3K06A 4DV3B 1NVPB 2CTQA 1VQOV 3L75H 4MTFA 4IYHA 3CCSV 3AK1A 4NXNB 4FVMA 2YI8A 2CGOA 4JAUA 3ZHRA 1VF6C 1S5LZ 1I94B 4X9QA 2LJ2A 1CPYA 1SQBH 4X1YB 5FPOA 1BQ0A 5KHKA 2AHZA 4I55A 3STLC 2XAHA 4UB8Z 4E4EA 1KKDA 1XOUA 2KSDA 3ZRWA 1VQ5V 3OR6C 4WBNA 2FL4A 3ZN0A 3LDCA 1FJGO 1JVMA 5C8YB 4JI7B 2LGQA 4DV4B 2PYJA 5HFMA 1JCHA 1R6KA 5C93A 2YS8A 1DF4A 2RNBA 2RJZA 1GN2A 5B1AB 1VF5B 1N33O 1F51A 4K8ZA 4UCTA 4O4HB 2A3QA 2QWPB 2ZQMA 5KUKA 1Q43A 5LP6C 3J81N 3EFFK 4K8XA 1SS3A 4L87A 1EN5A 3BCCH 4U3FH 4F6EA 1Q6UA 3E86A 4I9WA 1XHZA 4LFBB 1SA0B 4NVPA 4DK0A 3CX5F 4CC5A 3A8TA 2CAZC 5CA3A 4EB6A 1N34O 3M8AA 2XUMA 3RYHB 1F7YA 4JV5B 5KX5B 4GZRB 3L71H 4H44B 2QJ1A 4DR5B 4CH6A 5LP6A 3A0RA 4GX2A 4ASUG 4JYBA 1H2KA 2Q68A 3DGEA 1W59A 4KUMA 1GN6A 5J9PC 4X88A 3CJHA 5D5QA 5JJJB 2XAGA 1NR1A 4JPRA 3J7AU 1OCZB 4UCVA 4PDMA 3B4SA 2R9RB 3SPIA 1GKFA 4EEQA 4IHJB 2O57A 2B1GA 5B1OA 3H1JH 4FZ0A 1AI7A 3E2EA 5LGNA 1O9HA 1NQTA 3ZHTA 1VEWA 1T5EA 4GX0A 4O2BA 4JI8O 2Q8VA 5F2VO 4H0LB 4NR1A 1YSCA 2E75B 2PTMA 1V9PA 2ITCC 1YEWA 4NB5A 2QGNA 3PN1A 4B3TO 5CA0A 4FFKA 4FM0A 4ZIBA 4HZ3A 4DUZB 5H6QA 1BHAA 3ZRVA 1BGYH 5JJNB 2RQ6A 1KECA 1UPGA 4FLZA 4DV7O 1X59A 4CH3A 4P9OA 1GN4A 2F1MA 2CUGA 1V55C 2WLLB 4FM2A 4UV9A 4PDRA 3T1YO 2JK5C 3ABKB 3IC7A 5KHGA 1GRJA 1H8EG 5J2UB 1XL6A 4WCEV 2WLHA 2BTQA 1GAXA 1M4UA 4X66B 2EIJB 1XNQO 4JYCA 2IH1C 4MTGA 5EC2C 3O9OA 1AB3A 1ORQC 4BW5A 4F6RB 1CXZB 1K9MW 3E8FA 1CEZA 1L8DA 4FMTA 1L0LH 2PZSA 2ZIOA 5GTIZ 2EINB 1K7DA 2ZINA 5EZYB 4A5UB 1QVFU 1R1BA 2L35A 4JI2O 5JQGB 4EFEA 1Q7YW 5IJ0B 5B1NA 3RWRD 5BMVA 1OV9A 3OMIB 2N04A 1LUWA 3MD0A 1NI8A 4O4JB 3CXCU 4NTWA 4JTDB 3A0HZ 3PJSK 1JPXA 5L3EA 1IX9A 4JF3A 3T1HB 4J11A 1G6UA 5EBLC 4RUEA 4XDJA 4GKJB 4WFAV 1HR0O 4N21A 1VQ7V 4TV8A 3K9AA 5JH7A 4PV1B 4DV1O 5CB4B 1SKVA 1OCCB 1HWYA 3B8MA 2QR4A 2HJDA 4C7UA 4LFAO 3LDDA 3M7MX 4R8CA 2AXTZ 2UXBO 4W4LA 3CCJV 2DQ0A 4PA4A 4FK5C 4HNAB 3S3XA 1HW7A 3ZMTA 1VQ8V 4DV5B 4NXMO 4K0KO 2XNDG 3D3QA 2CE4A 1TUBA 2A06H 4ZI7A 1KKCA 1KBHA 2UU9B 4LF6B 3MDSA 2EILC 3ABMB 3QG5A 4QE7A 2ZIMA 1DTOA 4H33A 5J2TB 4FFBA 1BE3H 2X6AA 1THZA 4YHHB 2LFSA 1AR1B 5JVDB 1PM9A 5EYPB 2OTLV 4UCUA 4UV8A 1I08A 1L0NH 2WLNA 1QBZA 3K04A 4LNUA 4FLWA 1MA1A 3ABTA 3K57A 1N36O 2X7RB 5JCOC 4O4LB 1YJWV 5L3DA 2RMKB 2E5LO 3K5MA 3UO2A 1B6QA 3KCYA 1WPBA 1XQ8A 1FFXA 3K59A 4YJ2A 1M93A 1IBLO 5FNVB 3E83A 3JALB 4QNHB 2UXXA 4J42A 3KCXA 3AG1C 4I0XB 2HHHO 1SRYA 2ZE8A 3ZBHA 2WPDG 4RQFA 3SR2C 3KKYA 3CWBH 3ZHSA 3GWKC 1EFRG 3BHPA 4AQYO 3ZMVA 2W0FC 1SETA 2PI4A 1ZL8B 1H8HG 5H9CA 3W7XA 3C3TA 3X2QC 5IYCO 3JATA 5CMUA 5JCOA 1NTMH 2QWRB 3LSSA 3RGBA 1VQLV 1HNWB 4X64O 5IJ9B 3P32A 2GV9A 1D5AA 1K4CC 1PNMA 4BIZA 3GWOA 4UCOA 2IBZH 1FD9A 3BFRA 3OW2U 3DC6A 2ILMA 2K9PA 4RAIA 5A9GA 1SZTA 3HKDB 1GM9A 3RYCB 3G71V 2GUZA 2HEPA 3B09A 4DR1B 2R70A 1VMGA 2E3CA 3UM7A 3ABMC 2DJVA 2EIMC 2UUBO 2YI9A 1QLEB 1VP7A 3ABLB 3W7UA 2ETNA 2DWEC 3BEHA 3ZS8C 2P4KA 1SZXA 2JEXA 4LF9O 4BAYA 2CDYA 2IH3C 2G38A 4UVAA 4LBEC 4DW0A 3T2MA 2YXYA 3JARB 3ZCCA 1HNXB 4TSFG 2OWOA 3JD3A 3SYQA 3VQWA 1QNMA 4JYAB 2ADQB 1HNZO 4ABMA 2QSAA 5HFLA 1Y74B 5KMGB 3CS5A 4DR7B 2QKAA 5LHIA 1YIJV 2ARHA 4B3MO 3CRRA 2LW1A 4DUYB 2XT9A 1PV0A 3A2FA 1OCRC 3IFXA 1K92A 3ICXA 1M57C 4FJCC 2Q6AA 1JA8A 4R7CA 1K4DC 5LXTB 1FKAO 3FB7C 3TCUA 4LF5B 2EIKC 2EULA 4TUYB 2XAQA 1MNGA 3ETEA 4DV6O 1EN6A 4G2KA 3CRCA 5LYJA 3L74H 3HPLC 1W2BU 1JJOA 5CA1A 5EIBC 3CPWU 1J5EO 1BCCH 2P67A 2WA3A 3CCEV 1FPOA 2H8PC 3K3WA 4LF7O 4QPKA 2F4VB 1O9GA 1P49A 4ICGA 5B3SB 5IY5C 3N2KB 4OX9B 2VQEO 2KB1A 4MVOA 4PA3A 4JAAA 4WFBV 2KG7B 3JASA 5LMUO 3D8CA 3UT5A 3JD2A 2NN4A 5L3GA 4PI2A 1OJHA 1VQKV 2QWQB 4BIOA 2AGAA 1I5XA 2Q0AA 3OR7C 3OFNG 1QU7A 4X65O 5BXZA 1YF2A 3HKEA 1IBKB 1YTFD 2R9IA 2FYUH 5B66Z 3ZRWB 4KHPO 3BA8A 1SESA 1K3EA 4ZOLB 1WB7A 3HKCA 1JX9A 3EVKA 2Y0IA 4YJ3A 3ML0A 3VBBA 4YY3B 1JFFA 3ZJZA 1Q6IA 4LH7A 1K73W 2JJ1G 5FLXN 3J80N 1FFTB 4DR2B 4NTYA 3OTOB 3W7SA 1SQQH 2P6JA 2B9ZA 2ZD9A 4JTCB 1XMQB 4D7SA 1U96A 3F5WC 4YXWG 5IYZB 1AI5A 3DXRB 2WLIA 3KZIZ 2IM9A 4DR4B 3RW0A 2ZXWC 1XNRB 2OCCB 3DTUB 5KHHA 1F23A 1NT2B 3AG3B 4OGQB 4FLTA 2Q5ZA 1RFYA 2F66C 4B3SO 3FFQA 4IIJB 4ZKIA 1KQSU 3OTFA 2BTOA 3GB7C 2X0LA 4MSWC 1OZ0A 2ZR3A 4TV9A 3ZEDA 3FYIB 4LF8O 3CRQA 2P06A 2ZE5A 3AG2B 3ASNB 1NS1A 2EX3A 5GONB 4CS4A 2ODMA 2YIDA 3STZC 1M1KW 3VOUA 4KP4A 5L3CA 2YXHA 1BL8A 1QR9A 4JI3O 3K5NA 5KA5A 3QO7A 1PNLA 3QVNA 1MOFA 2RDCA 3OGCC 2Y69B 4L8JA 1FJGB 3RN4A 1RP3B 4D6TH 4I9QA 1FXKB 2GDSA 5LA6A 1NVPD 1LR1A 5KAFZ 1PPJH 1VF6A 3RT3C 1N33B 1OCOC 3IC9A 1V54C 2AZ2A 4QGPA 3I56V 3FD9A 1XL4A 1QCEA 1KU9A 1ZX3A 3MHSC 2ZM6O 2XHBA 3B8NA 3BAAA 4CH5A 1AP5A 5EC1C 1JQ0A 2BCCH 3JCUZ 3JD1A 3D3IA 1VQ6V 2BSKA 5L3FA 3SJAC 1RSOB 5B1BC 3H1IH 1IBMO 4ZHQA 4QE9A 2CH7B 2UUCO 2C2AA 1N34B 2JS5A 1Q5OA 4FLYA 1I7FA 2LO1A 5LMNO 3SPGA 2DYSB 5CBHA 2AW9A 2Z3YA 1G4YB 3WB0A 3TETA 4DR3O 2BOCC 2W0XA 5L3BA 1W0KG 1WP8A 1WAZA 3SJQC 4B7KA 3CC2V 3QO5A 3VQVA 4GCZA 4GT1A 1ZSPA 4OXSA 1PNKA 1R73A 3HB3B 3APQA 3RYIA 1K8AW 5BR8O 1MMMA 1G8MA 2JEUA 1Y6XA 3AEIA 2ZNJA 3AG7A 1M56B 2H3OA 4JI8B 1KYOF 3OE7G 1YXBA 3E22B 2CTPA 2CTWA 4KXRA 3G80A 2N74A 4I5SA 4UXNA 3CMEV 3OMNB 4B3TB 4RWUA 5B1AC 4X1IB 3FB6C 5JH7B 3OD4A 5IE9A 2A79B 2VWJA 5JJEB 2Q67A 4X1YA 2QWOB 4JI1O 4CS2A 1JMKC 1IXBA 5AG2A 4EKWA 3VQYA 4DV7B 3NR7A 4Z1VA 1P4RA 5C8YA 3AG4B 2LP7A 1AR4A 4MW3A 1RM1B 3T1YB 1K97A 1YJ9V 1GMGA 3T1CA 3CRMA 4Q20A 1XNQB 1EM1A 4O4HA 2JDIG 1GM8A 2DYRB 2Q73A 2WA4A 4UUJC 2BOBC 2Z0AA 4FLVA 4FM1A 2X6CA 5IWAO 1WA8B 4JGSA 1ZTEA 2MW2B 2JGDB 1H38A 2JVDA 3LUTB 1Y66A 4DK1A 1OCZC 1NKDA 2EBOA 4BIUA 5KHIA 4JI2B 1Y76B 1SA0A 3K0DA 5LGTA 3JAWB 4KL1A 4PJ0Z 1GK9A 5FPRA 3RYHA 3G6BA 5K1PA 3RYFB 1TVKB 4X20B 1N32O 5KX5A 3SYAA 4MW8A 3VQXA 3K9SA 1QHTA 3TK1A 1HP8A 2GBOA 5E79Z 2HKOA 3ZRSA 4J80A 3HKBB 1K5QA 4J7ZA 2B1IA 1VQMV 5BZBA 3JATB 2VQFO 4QJFB 4DW1A 3FX7A 1S5JA 4WF9V 1S76D 4GKKO 2A9HA 1HR0B 4TOIA 2PF4E 3G6EV 4LWSB 4DV1B 1Q3EA 4IHJA 1XI1A 5B5EZ 1JJ2U 4LFAB 3OM3B 4DR6O 2ZNIA 4BR6A 3JAMN 2UXBB 3CD6V 1UJWB 1TUEB 4NXMB 1MG1A 4K0KB 3JAKB 1VQNV 1AROP 2DMXA 4HBNA 1H2LA 4G27B 3ABKC 1ZAUA 5K1XA 1Z5VA 3Q4HA 3WB1A 1MSDA 2EIJC 3QO8A 2QTSA 1NTZH 1DGSA 4R6ZA 2UXDO 1N36B 2PI5A 2E5LB 2EINC 2HP8A 2P4VA 1F4MA 2MK3A 2F93B 3C90A 2WLLA 5ITZB 1ENVA 1IBLB 5GTHZ 2Y48A 5LOVB 4B3RO 1R6TA 2K1EA 2WSSG 4WFHA 4CZZA 1XREA 2HHHB 1AR5A 4AQYB 5LL6Y 1NZ6A 1UFIA 4F6RA 4QPJA 2IW5A 4JASA 2ZE7A 5CBGA 3WG7B 3SYCA 5DN6G 1PL4A 2ZDIC 3WFVA 2LFRA 3WU2Z 2HFEC 4IL6Z 5LYJB 1AJPA 1AVMA 1L1FA 3AK3A 2E74B 1YCIA 2OIGA 4X64B 5JQGA 1ZUQA 3ASOB 3FAVB 4E2LA 1OCCC 4XBFA 4B08A 3K58A 1OHHG 3CB2A 4O4IB 4O4JA 1W0JG 1Y4MA 1I0HA 4OPHA 1XEQA 4PA6A 4BW9A 5LGUA 1Z2GA 2CK3G 1Q82W 4MVUA 3FYEB 3D36C 2Q7EA 4JI4O 3CC7V 2UUBB 1N4CA 2ZDIA 4DRXB 4O2AB 3RFRA 3B40A 2DQ3A 3ZMZA 4WFFA 5LHHA 4WFGA 1VQ9V 4X1KB 5CB4A 3IJ4A 1SF9A 1XMOO 4LF9B 2ZKOA 4AI8A 3P30A 3ETGA 2YEVB 4JI0O 2HG5C 2X6BA 1JFFB 1HNZB 3L73H 3H01A 1X4TA 2UXCO 3R65A 3D36A 4DV0O 5EIBD 2QEXV 4B3MB 4GX1A 1AI4A 1R3IC 5J2TA 4JI6O 4I4TB 1EBOA 3N2GB 3LNNA 1FXVA 1LNQA 4U3JA
chains in the Genus database with same CATH topology
2GUZA 2N05A 1BQ0A 3UCSC 1HDJA 1FPOA 1N4CA 2Y4UA 2GUZB 4IT5A 1BQZA 2CTPA 2LGWA 2M6YA 1WJZA 1XBLA 2DN9A 2PF4E 2DMXA 2CTWA 2QWPB 2YUAA 2EJ7A 2QSAA 1GH6A 2CTRA 2QWQB 1NZ6A 2LO1A 3BVOA 3APQA 4RWUA 2N04A 2QWNB 3UO3A 1IURA 3APOA 1FAFA 2L6LA 2CUGA 3UO2A 4J80A 2YS8A 2Y4TA 2OCHA 4J7ZA 2KQXA 3AG7A 2CTQA 2QWRB 2QWOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUZ A;  2N05 A;  1BQ0 A;  3UCS C;  1HDJ A;  1FPO A;  1N4C A;  2Y4U A;  2GUZ B;  4IT5 A;  1BQZ A;  2CTP A;  2LGW A;  2M6Y A;  1WJZ A;  1XBL A;  2DN9 A;  2PF4 E;  2DMX A;  2CTW A;  2QWP B;  2YUA A;  2EJ7 A;  2QSA A;  1GH6 A;  2CTR A;  2QWQ B;  1NZ6 A;  2LO1 A;  3BVO A;  3APQ A;  4RWU A;  2N04 A;  2QWN B;  3UO3 A;  1IUR A;  3APO A;  1FAF A;  2L6L A;  2CUG A;  3UO2 A;  4J80 A;  2YS8 A;  2Y4T A;  2OCH A;  4J7Z A;  2KQX A;  3AG7 A;  2CTQ A;  2QWR B;  2QWO B; 
#chains in the Genus database with same CATH topology
 1JOY A;  4EFB A;  1QR8 A;  2PY5 A;  1WB8 A;  1XBL A;  1SQV H;  1G1X B;  2EJ7 A;  3OEE G;  4MVM A;  2YXL A;  4O4L A;  2QA4 V;  4LFC O;  4DV6 B;  1QVG U;  3SJB C;  4H13 B;  3FB8 C;  4Q6G A;  5EK0 A;  4UCR A;  5FNV A;  1NH2 B;  1J5E B;  2QM7 A;  3JAL A;  4XDL A;  4RUF A;  4LF7 B;  4I0X A;  4UVB A;  3AK2 A;  1E1R G;  2NNU A;  4FZ1 A;  3CCV V;  2W6I G;  2VQE B;  3ZRX A;  4CBC A;  1YTF B;  1NR7 A;  3I5D A;  3ZIA G;  3TXQ A;  1ZL8 A;  5LMU B;  4PA9 A;  2OYQ A;  1RPR A;  3ZMU A;  3BPZ A;  2DW4 A;  1GO3 F;  1QLE C;  4X65 B;  1XHX A;  4JTA B;  3ABL C;  5KA6 A;  5IJ9 A;  1GTO A;  3C3S A;  4GYC B;  2PUS A;  4I55 B;  1XIL A;  4KHP B;  2RCV A;  1YI2 V;  3THO A;  4WBN B;  4JZ2 A;  4QIW F;  1S0V A;  1BHB A;  3DC5 A;  2A0L A;  3RYC A;  4R50 A;  3UKM A;  2VWK A;  5EBM C;  4MVR A;  1YVW A;  1XUQ A;  2WAM A;  2FKX A;  3K79 A;  3CCU V;  4JI5 O;  1XDC A;  2IU3 A;  5IT9 N;  3SPJ A;  5H6R A;  3JD4 A;  2GSM B;  1Z5W A;  3A0B Z;  3OUF A;  1GM7 A;  3EXA A;  1SQG A;  4HYO A;  1BT8 A;  1VF7 A;  5IDJ A;  3RVZ A;  3CCR V;  2ZT9 B;  4LC1 A;  1Y74 A;  2PGG A;  4B3S B;  1QLN A;  1NBM G;  4PDL A;  4EB6 B;  4LF4 O;  4PI0 A;  5E1A C;  2XAJ A;  4CC6 A;  2Q7H A;  3KG2 A;  2FB5 A;  2Q4P A;  3SYP A;  5B3S C;  5LP6 B;  2QDO A;  3DSQ A;  5DEC A;  3K5O A;  3UCS C;  4X62 O;  4AIL C;  4LF8 B;  5LXT A;  1S72 V;  3CJH B;  1P7G A;  4DV2 O;  1Q6H A;  3RYI B;  2UUA O;  1NTK H;  4MVS A;  2GHY A;  2QM4 A;  4XDK A;  4JI3 B;  3NXS A;  2QKS A;  4DV3 O;  3F5T A;  4O2B B;  3N2K A;  4NXN O;  3FKS G;  1N0N A;  2KG7 A;  4Z1M G;  2V1D A;  3N27 A;  3APO A;  2ITD C;  1I94 O;  1AJQ A;  1E1Q G;  1CP9 A;  5CA0 B;  2AHY A;  3O65 A;  2YIA A;  4BWA A;  4GUN A;  1AIL A;  3CYO A;  3LNM B;  2ZM6 B;  4U7O A;  4IT5 A;  1BS3 A;  3JYC A;  4J9Y B;  2JIZ G;  4TWK A;  4ZOL A;  2LW7 A;  2ZCE A;  2OCC C;  1Q86 W;  3AG3 C;  4JI7 O;  1IBM B;  4DV4 O;  1COW G;  2UUC B;  4PHZ A;  1HDJ A;  5LBQ A;  3L9D A;  2E76 B;  1P84 F;  1S5H C;  3ZX6 A;  4RO2 A;  3I55 V;  2BTQ B;  5LMN B;  4DR3 B;  5IYZ A;  1H2S B;  1FYJ A;  3DXR A;  2HLD G;  4HAM A;  3EHB B;  2EJR A;  4K3A A;  1BMF G;  4JAV A;  1A32 A;  5KHJ A;  3JSL A;  5H5N A;  2V7Q G;  3M99 B;  2P7T C;  3AG2 C;  3ASN C;  3CHX A;  4X8A A;  1U97 A;  2LGW A;  1V55 B;  4LFB O;  4I50 A;  3RVY A;  2XAF A;  3JD0 A;  1WNS A;  5BR8 B;  2F43 G;  3ZMS A;  5BMV B;  3CSX A;  4TQD A;  4JV5 O;  1DF5 A;  2IJK A;  4IIJ A;  4UCS A;  3F7V C;  5A2Q N;  1IVS A;  1AP6 A;  2A7W A;  4KFM A;  5DED A;  5D5P A;  3ZHQ A;  4DR5 O;  2Y69 C;  4F4L A;  1Y67 A;  4FIP C;  1R3K C;  2FTK A;  1FXK C;  2WLK A;  1VAR A;  3H1H H;  2P22 C;  1YJN V;  1FS0 G;  5BY1 A;  3P3P A;  3H1L H;  5GON A;  1PP9 H;  4TV8 B;  4MVQ A;  1FAF A;  2XOK G;  4JI1 B;  1YDX A;  3SPH A;  3U11 A;  2OTJ V;  1DLB A;  1RPO A;  5TIS Z;  1SQP H;  1KMI Z;  2ADP A;  1PD3 A;  3CEI A;  1K34 A;  4OPA A;  1AI6 A;  5GW7 A;  1YHQ V;  2JJ2 G;  1FXK A;  1TUB B;  3CCM V;  4NTX A;  4ZI7 B;  2RN9 A;  3Q4H B;  3OT7 A;  3WB2 A;  2IJJ A;  2DYS C;  4MT8 A;  4FFB B;  2Z5U A;  4PEL A;  4DUZ O;  2F95 B;  5IWA B;  4RQE A;  2B5U A;  2H94 A;  4LNU B;  1JR9 A;  1R3J C;  2QM8 A;  2Q9L A;  3OEH G;  2HJF C;  3LDE A;  4Z2W A;  1RSO A;  2CH7 A;  1R6N A;  3GVM A;  1FFX B;  3E8H A;  4YJ2 B;  3SJC C;  3SYO A;  1BSM A;  1SC5 B;  4GLX A;  2P5O A;  1N32 B;  4DXW A;  3E8B A;  2EIL B;  5KUM A;  4X66 O;  1M56 C;  1URF A;  2GTS A;  4UVC A;  1LUV A;  1K33 A;  3MAQ A;  2AZ0 A;  3CP1 A;  4MS2 A;  4PA7 A;  2VQF B;  2PYL A;  5LHG A;  3SPC A;  4GKK B;  2QKC A;  5CBF A;  1KB9 F;  3BVO A;  1NU1 H;  5IYD O;  3E89 A;  4DR6 B;  3R66 A;  1K5S A;  3MHH C;  4K35 A;  1D5N A;  4U7N A;  3AG1 B;  4WFE A;  2IJH A;  2NR5 A;  4J7J A;  1TA8 A;  4IGG A;  1Q81 W;  3E22 A;  3AG4 C;  2Y4U A;  2GUZ B;  1RM1 C;  4P2Z A;  2DWD C;  3T1H O;  3X2Q B;  4FLX A;  1MSW D;  3TGU H;  4X1I A;  2Q7G A;  4GKJ O;  2CGN A;  3BA9 A;  2DYR C;  3BRC A;  1SQX H;  2DOS A;  2UXD B;  3UQ8 A;  3ABU A;  2QE7 G;  2VRZ A;  1N8R W;  1KUQ A;  3B2E E;  3CE2 A;  2F23 A;  3G4S V;  4DV5 O;  3BY6 A;  3TXS A;  4UB6 Z;  3OAA G;  2HR3 A;  4J7K A;  4GX5 A;  1H2N A;  4AHC A;  1VQ4 V;  3BAB A;  4X89 A;  4B3R B;  2EIM B;  2ATK C;  2UU9 O;  1Q8I A;  4LF6 O;  5J2U A;  3QTC A;  4U3J B;  1N0J A;  2ZE6 A;  2QTO A;  4YHH O;  4FPP A;  4NKG B;  2YUA A;  2CTR A;  3T4Z A;  1WA8 A;  3L70 H;  4CH4 A;  2JGD A;  2QWN B;  2Q69 A;  5FL7 G;  4ZBM A;  2UXN A;  2WLM A;  4LH6 A;  2Y4T A;  1MZF A;  4H37 A;  1Y76 A;  4YIO A;  5EZY A;  3JAW A;  3CMA V;  1FXH A;  1EZV H;  3LSQ A;  5CA1 B;  4LR3 A;  1P7B A;  2JGU A;  1TVK A;  2R9A A;  4X20 A;  3RYF A;  5IJ0 A;  2M6Y A;  4JZG A;  3IAY A;  1OCR B;  5IYB O;  1AJN A;  1PKX A;  3UO3 A;  4N23 A;  3HKB A;  1M57 B;  1WLE A;  4FLU A;  1M5I A;  3JAS B;  4JI4 B;  3UT5 B;  2EZP A;  3TJT A;  2EIK B;  3E35 A;  2WLJ A;  1NJI W;  2WWW A;  4D7T A;  4LWS A;  1HNW O;  3HKE B;  1XMO B;  3K5L A;  2ZR2 A;  3SDL A;  1J95 A;  1H2M A;  1F4N A;  3IGA C;  3S3W A;  4JI0 B;  2YDE A;  3L72 H;  4MTO A;  2KKW A;  5IY5 B;  3HKC B;  2N05 A;  3K0G A;  3JAK A;  3JCZ A;  4HNA A;  3CC4 V;  1B06 A;  4YJ3 B;  2UXC B;  4DV0 B;  4IYI A;  3CCQ V;  4DR1 O;  2DN9 A;  1EN4 A;  1VIB A;  3ZHU A;  3JSN A;  4JYY A;  4JI6 B;  1MZE A;  3G67 A;  4PD4 F;  1MAB G;  3CRA A;  3OGI B;  1ROP A;  1B04 A;  1E79 G;  5JVD A;  5EYP A;  3HR0 A;  2WLI B;  2JS3 A;  1YIT V;  3W7T A;  3FB5 C;  3CCL V;  2XAS A;  3WG7 C;  1SQF A;  1HNX O;  4W4K A;  1S3J A;  4LFC B;  3ETQ A;  1M9N A;  4JYA O;  2LQT A;  3P3N A;  5ITZ A;  3B77 A;  2YIB D;  3ETD A;  3ASO C;  2R72 A;  2L6L A;  3T4D A;  4PDV A;  5LOV A;  1EZJ A;  4DR7 O;  3LSU A;  1KP2 A;  4I7Z B;  1TGO A;  2JRI A;  4DUY O;  3OUS A;  1BQZ A;  1YZB A;  1KC8 W;  1WJZ A;  4TT3 G;  1GH6 A;  1WP7 A;  4TV9 B;  2XTA A;  3U10 A;  2ZXW B;  4P30 A;  3QF7 A;  1KP3 A;  1H2G A;  4UFZ A;  4YIP A;  5JWP A;  1IUR A;  4LF5 O;  2BE3 A;  3W7W A;  2HVJ C;  3ZN1 A;  1US6 A;  2DE0 X;  2Y0P A;  3FAV A;  4J41 A;  2D2C B;  1D2D A;  1R3L C;  5CN0 A;  1WN7 A;  1IDS A;  1BZK A;  4O4I A;  5EBW C;  2HVK C;  1S77 D;  2OT5 A;  2F4V O;  2Q0O C;  3SGI A;  3K08 A;  2IU0 A;  1QQC A;  2OIE A;  4OX9 O;  1NH2 D;  4G28 B;  1ZWI C;  3HKD A;  1I5Y A;  4MTX A;  5LA6 B;  4LCU C;  1ZLZ A;  2YC0 A;  1M90 W;  4DRX A;  4O2A A;  3OMA B;  4JI5 B;  4P9P A;  2VS0 A;  4X1K A;  2P90 A;  5H2F Z;  1IBK O;  1PL0 A;  3ZHV A;  1DK1 A;  5KLV H;  1GN3 A;  2YSU B;  2YIB A;  3H9V A;  2YEV A;  3QNE A;  4CS3 A;  1IXM A;  3K03 A;  2BSK B;  3CXH F;  3JAR A;  2D3O W;  2M7W A;  3F7Y C;  4DO2 A;  2IJI A;  2YIC A;  2V4D A;  4TQF A;  4YY3 O;  4ZHQ B;  2GTA A;  1KD1 W;  4DYL A;  5DM6 V;  4LF4 B;  1IZ3 A;  5KMG A;  1OCO B;  2W6J G;  3E8G A;  1V54 B;  4DR2 O;  4MVZ A;  4I4T A;  3OTO O;  3N2G A;  2FML A;  1XMQ O;  5KAI Z;  4B7E A;  2OCH A;  4X62 B;  2KQX A;  1WPX A;  3H1K H;  1VQP V;  4NYK A;  2NLJ C;  1TAE A;  1XNR O;  4DR4 O;  1B3Q A;  4I50 B;  4DV2 B;  5B1B B;  4J9Z B;  3RBZ A;  3U0Z A;  4TUY A;  1SER A;  2UUA B;  4LP8 A;  4J10 A;  1Q90 D;  2EZO A;  3K06 A;  4DV3 B;  1NVP B;  2CTQ A;  1VQO V;  3L75 H;  4MTF A;  4IYH A;  3CCS V;  3AK1 A;  4NXN B;  4FVM A;  2YI8 A;  2CGO A;  4JAU A;  3ZHR A;  1VF6 C;  1S5L Z;  1I94 B;  4X9Q A;  2LJ2 A;  1CPY A;  1SQB H;  4X1Y B;  5FPO A;  1BQ0 A;  5KHK A;  2AHZ A;  4I55 A;  3STL C;  2XAH A;  4UB8 Z;  4E4E A;  1KKD A;  1XOU A;  2KSD A;  3ZRW A;  1VQ5 V;  3OR6 C;  4WBN A;  2FL4 A;  3ZN0 A;  3LDC A;  1FJG O;  1JVM A;  5C8Y B;  4JI7 B;  2LGQ A;  4DV4 B;  2PYJ A;  5HFM A;  1JCH A;  1R6K A;  5C93 A;  2YS8 A;  1DF4 A;  2RNB A;  2RJZ A;  1GN2 A;  5B1A B;  1VF5 B;  1N33 O;  1F51 A;  4K8Z A;  4UCT A;  4O4H B;  2A3Q A;  2QWP B;  2ZQM A;  5KUK A;  1Q43 A;  5LP6 C;  3J81 N;  3EFF K;  4K8X A;  1SS3 A;  4L87 A;  1EN5 A;  3BCC H;  4U3F H;  4F6E A;  1Q6U A;  3E86 A;  4I9W A;  1XHZ A;  4LFB B;  1SA0 B;  4NVP A;  4DK0 A;  3CX5 F;  4CC5 A;  3A8T A;  2CAZ C;  5CA3 A;  4EB6 A;  1N34 O;  3M8A A;  2XUM A;  3RYH B;  1F7Y A;  4JV5 B;  5KX5 B;  4GZR B;  3L71 H;  4H44 B;  2QJ1 A;  4DR5 B;  4CH6 A;  5LP6 A;  3A0R A;  4GX2 A;  4ASU G;  4JYB A;  1H2K A;  2Q68 A;  3DGE A;  1W59 A;  4KUM A;  1GN6 A;  5J9P C;  4X88 A;  3CJH A;  5D5Q A;  5JJJ B;  2XAG A;  1NR1 A;  4JPR A;  3J7A U;  1OCZ B;  4UCV A;  4PDM A;  3B4S A;  2R9R B;  3SPI A;  1GKF A;  4EEQ A;  4IHJ B;  2O57 A;  2B1G A;  5B1O A;  3H1J H;  4FZ0 A;  1AI7 A;  3E2E A;  5LGN A;  1O9H A;  1NQT A;  3ZHT A;  1VEW A;  1T5E A;  4GX0 A;  4O2B A;  4JI8 O;  2Q8V A;  5F2V O;  4H0L B;  4NR1 A;  1YSC A;  2E75 B;  2PTM A;  1V9P A;  2ITC C;  1YEW A;  4NB5 A;  2QGN A;  3PN1 A;  4B3T O;  5CA0 A;  4FFK A;  4FM0 A;  4ZIB A;  4HZ3 A;  4DUZ B;  5H6Q A;  1BHA A;  3ZRV A;  1BGY H;  5JJN B;  2RQ6 A;  1KEC A;  1UPG A;  4FLZ A;  4DV7 O;  1X59 A;  4CH3 A;  4P9O A;  1GN4 A;  2F1M A;  2CUG A;  1V55 C;  2WLL B;  4FM2 A;  4UV9 A;  4PDR A;  3T1Y O;  2JK5 C;  3ABK B;  3IC7 A;  5KHG A;  1GRJ A;  1H8E G;  5J2U B;  1XL6 A;  4WCE V;  2WLH A;  2BTQ A;  1GAX A;  1M4U A;  4X66 B;  2EIJ B;  1XNQ O;  4JYC A;  2IH1 C;  4MTG A;  5EC2 C;  3O9O A;  1AB3 A;  1ORQ C;  4BW5 A;  4F6R B;  1CXZ B;  1K9M W;  3E8F A;  1CEZ A;  1L8D A;  4FMT A;  1L0L H;  2PZS A;  2ZIO A;  5GTI Z;  2EIN B;  1K7D A;  2ZIN A;  5EZY B;  4A5U B;  1QVF U;  1R1B A;  2L35 A;  4JI2 O;  5JQG B;  4EFE A;  1Q7Y W;  5IJ0 B;  5B1N A;  3RWR D;  5BMV A;  1OV9 A;  3OMI B;  2N04 A;  1LUW A;  3MD0 A;  1NI8 A;  4O4J B;  3CXC U;  4NTW A;  4JTD B;  3A0H Z;  3PJS K;  1JPX A;  5L3E A;  1IX9 A;  4JF3 A;  3T1H B;  4J11 A;  1G6U A;  5EBL C;  4RUE A;  4XDJ A;  4GKJ B;  4WFA V;  1HR0 O;  4N21 A;  1VQ7 V;  4TV8 A;  3K9A A;  5JH7 A;  4PV1 B;  4DV1 O;  5CB4 B;  1SKV A;  1OCC B;  1HWY A;  3B8M A;  2QR4 A;  2HJD A;  4C7U A;  4LFA O;  3LDD A;  3M7M X;  4R8C A;  2AXT Z;  2UXB O;  4W4L A;  3CCJ V;  2DQ0 A;  4PA4 A;  4FK5 C;  4HNA B;  3S3X A;  1HW7 A;  3ZMT A;  1VQ8 V;  4DV5 B;  4NXM O;  4K0K O;  2XND G;  3D3Q A;  2CE4 A;  1TUB A;  2A06 H;  4ZI7 A;  1KKC A;  1KBH A;  2UU9 B;  4LF6 B;  3MDS A;  2EIL C;  3ABM B;  3QG5 A;  4QE7 A;  2ZIM A;  1DTO A;  4H33 A;  5J2T B;  4FFB A;  1BE3 H;  2X6A A;  1THZ A;  4YHH B;  2LFS A;  1AR1 B;  5JVD B;  1PM9 A;  5EYP B;  2OTL V;  4UCU A;  4UV8 A;  1I08 A;  1L0N H;  2WLN A;  1QBZ A;  3K04 A;  4LNU A;  4FLW A;  1MA1 A;  3ABT A;  3K57 A;  1N36 O;  2X7R B;  5JCO C;  4O4L B;  1YJW V;  5L3D A;  2RMK B;  2E5L O;  3K5M A;  3UO2 A;  1B6Q A;  3KCY A;  1WPB A;  1XQ8 A;  1FFX A;  3K59 A;  4YJ2 A;  1M93 A;  1IBL O;  5FNV B;  3E83 A;  3JAL B;  4QNH B;  2UXX A;  4J42 A;  3KCX A;  3AG1 C;  4I0X B;  2HHH O;  1SRY A;  2ZE8 A;  3ZBH A;  2WPD G;  4RQF A;  3SR2 C;  3KKY A;  3CWB H;  3ZHS A;  3GWK C;  1EFR G;  3BHP A;  4AQY O;  3ZMV A;  2W0F C;  1SET A;  2PI4 A;  1ZL8 B;  1H8H G;  5H9C A;  3W7X A;  3C3T A;  3X2Q C;  5IYC O;  3JAT A;  5CMU A;  5JCO A;  1NTM H;  2QWR B;  3LSS A;  3RGB A;  1VQL V;  1HNW B;  4X64 O;  5IJ9 B;  3P32 A;  2GV9 A;  1D5A A;  1K4C C;  1PNM A;  4BIZ A;  3GWO A;  4UCO A;  2IBZ H;  1FD9 A;  3BFR A;  3OW2 U;  3DC6 A;  2ILM A;  2K9P A;  4RAI A;  5A9G A;  1SZT A;  3HKD B;  1GM9 A;  3RYC B;  3G71 V;  2GUZ A;  2HEP A;  3B09 A;  4DR1 B;  2R70 A;  1VMG A;  2E3C A;  3UM7 A;  3ABM C;  2DJV A;  2EIM C;  2UUB O;  2YI9 A;  1QLE B;  1VP7 A;  3ABL B;  3W7U A;  2ETN A;  2DWE C;  3BEH A;  3ZS8 C;  2P4K A;  1SZX A;  2JEX A;  4LF9 O;  4BAY A;  2CDY A;  2IH3 C;  2G38 A;  4UVA A;  4LBE C;  4DW0 A;  3T2M A;  2YXY A;  3JAR B;  3ZCC A;  1HNX B;  4TSF G;  2OWO A;  3JD3 A;  3SYQ A;  3VQW A;  1QNM A;  4JYA B;  2ADQ B;  1HNZ O;  4ABM A;  2QSA A;  5HFL A;  1Y74 B;  5KMG B;  3CS5 A;  4DR7 B;  2QKA A;  5LHI A;  1YIJ V;  2ARH A;  4B3M O;  3CRR A;  2LW1 A;  4DUY B;  2XT9 A;  1PV0 A;  3A2F A;  1OCR C;  3IFX A;  1K92 A;  3ICX A;  1M57 C;  4FJC C;  2Q6A A;  1JA8 A;  4R7C A;  1K4D C;  5LXT B;  1FKA O;  3FB7 C;  3TCU A;  4LF5 B;  2EIK C;  2EUL A;  4TUY B;  2XAQ A;  1MNG A;  3ETE A;  4DV6 O;  1EN6 A;  4G2K A;  3CRC A;  5LYJ A;  3L74 H;  3HPL C;  1W2B U;  1JJO A;  5CA1 A;  5EIB C;  3CPW U;  1J5E O;  1BCC H;  2P67 A;  2WA3 A;  3CCE V;  1FPO A;  2H8P C;  3K3W A;  4LF7 O;  4QPK A;  2F4V B;  1O9G A;  1P49 A;  4ICG A;  5B3S B;  5IY5 C;  3N2K B;  4OX9 B;  2VQE O;  2KB1 A;  4MVO A;  4PA3 A;  4JAA A;  4WFB V;  2KG7 B;  3JAS A;  5LMU O;  3D8C A;  3UT5 A;  3JD2 A;  2NN4 A;  5L3G A;  4PI2 A;  1OJH A;  1VQK V;  2QWQ B;  4BIO A;  2AGA A;  1I5X A;  2Q0A A;  3OR7 C;  3OFN G;  1QU7 A;  4X65 O;  5BXZ A;  1YF2 A;  3HKE A;  1IBK B;  1YTF D;  2R9I A;  2FYU H;  5B66 Z;  3ZRW B;  4KHP O;  3BA8 A;  1SES A;  1K3E A;  4ZOL B;  1WB7 A;  3HKC A;  1JX9 A;  3EVK A;  2Y0I A;  4YJ3 A;  3ML0 A;  3VBB A;  4YY3 B;  1JFF A;  3ZJZ A;  1Q6I A;  4LH7 A;  1K73 W;  2JJ1 G;  5FLX N;  3J80 N;  1FFT B;  4DR2 B;  4NTY A;  3OTO B;  3W7S A;  1SQQ H;  2P6J A;  2B9Z A;  2ZD9 A;  4JTC B;  1XMQ B;  4D7S A;  1U96 A;  3F5W C;  4YXW G;  5IYZ B;  1AI5 A;  3DXR B;  2WLI A;  3KZI Z;  2IM9 A;  4DR4 B;  3RW0 A;  2ZXW C;  1XNR B;  2OCC B;  3DTU B;  5KHH A;  1F23 A;  1NT2 B;  3AG3 B;  4OGQ B;  4FLT A;  2Q5Z A;  1RFY A;  2F66 C;  4B3S O;  3FFQ A;  4IIJ B;  4ZKI A;  1KQS U;  3OTF A;  2BTO A;  3GB7 C;  2X0L A;  4MSW C;  1OZ0 A;  2ZR3 A;  4TV9 A;  3ZED A;  3FYI B;  4LF8 O;  3CRQ A;  2P06 A;  2ZE5 A;  3AG2 B;  3ASN B;  1NS1 A;  2EX3 A;  5GON B;  4CS4 A;  2ODM A;  2YID A;  3STZ C;  1M1K W;  3VOU A;  4KP4 A;  5L3C A;  2YXH A;  1BL8 A;  1QR9 A;  4JI3 O;  3K5N A;  5KA5 A;  3QO7 A;  1PNL A;  3QVN A;  1MOF A;  2RDC A;  3OGC C;  2Y69 B;  4L8J A;  1FJG B;  3RN4 A;  1RP3 B;  4D6T H;  4I9Q A;  1FXK B;  2GDS A;  5LA6 A;  1NVP D;  1LR1 A;  5KAF Z;  1PPJ H;  1VF6 A;  3RT3 C;  1N33 B;  1OCO C;  3IC9 A;  1V54 C;  2AZ2 A;  4QGP A;  3I56 V;  3FD9 A;  1XL4 A;  1QCE A;  1KU9 A;  1ZX3 A;  3MHS C;  2ZM6 O;  2XHB A;  3B8N A;  3BAA A;  4CH5 A;  1AP5 A;  5EC1 C;  1JQ0 A;  2BCC H;  3JCU Z;  3JD1 A;  3D3I A;  1VQ6 V;  2BSK A;  5L3F A;  3SJA C;  1RSO B;  5B1B C;  3H1I H;  1IBM O;  4ZHQ A;  4QE9 A;  2CH7 B;  2UUC O;  2C2A A;  1N34 B;  2JS5 A;  1Q5O A;  4FLY A;  1I7F A;  2LO1 A;  5LMN O;  3SPG A;  2DYS B;  5CBH A;  2AW9 A;  2Z3Y A;  1G4Y B;  3WB0 A;  3TET A;  4DR3 O;  2BOC C;  2W0X A;  5L3B A;  1W0K G;  1WP8 A;  1WAZ A;  3SJQ C;  4B7K A;  3CC2 V;  3QO5 A;  3VQV A;  4GCZ A;  4GT1 A;  1ZSP A;  4OXS A;  1PNK A;  1R73 A;  3HB3 B;  3APQ A;  3RYI A;  1K8A W;  5BR8 O;  1MMM A;  1G8M A;  2JEU A;  1Y6X A;  3AEI A;  2ZNJ A;  3AG7 A;  1M56 B;  2H3O A;  4JI8 B;  1KYO F;  3OE7 G;  1YXB A;  3E22 B;  2CTP A;  2CTW A;  4KXR A;  3G80 A;  2N74 A;  4I5S A;  4UXN A;  3CME V;  3OMN B;  4B3T B;  4RWU A;  5B1A C;  4X1I B;  3FB6 C;  5JH7 B;  3OD4 A;  5IE9 A;  2A79 B;  2VWJ A;  5JJE B;  2Q67 A;  4X1Y A;  2QWO B;  4JI1 O;  4CS2 A;  1JMK C;  1IXB A;  5AG2 A;  4EKW A;  3VQY A;  4DV7 B;  3NR7 A;  4Z1V A;  1P4R A;  5C8Y A;  3AG4 B;  2LP7 A;  1AR4 A;  4MW3 A;  1RM1 B;  3T1Y B;  1K97 A;  1YJ9 V;  1GMG A;  3T1C A;  3CRM A;  4Q20 A;  1XNQ B;  1EM1 A;  4O4H A;  2JDI G;  1GM8 A;  2DYR B;  2Q73 A;  2WA4 A;  4UUJ C;  2BOB C;  2Z0A A;  4FLV A;  4FM1 A;  2X6C A;  5IWA O;  1WA8 B;  4JGS A;  1ZTE A;  2MW2 B;  2JGD B;  1H38 A;  2JVD A;  3LUT B;  1Y66 A;  4DK1 A;  1OCZ C;  1NKD A;  2EBO A;  4BIU A;  5KHI A;  4JI2 B;  1Y76 B;  1SA0 A;  3K0D A;  5LGT A;  3JAW B;  4KL1 A;  4PJ0 Z;  1GK9 A;  5FPR A;  3RYH A;  3G6B A;  5K1P A;  3RYF B;  1TVK B;  4X20 B;  1N32 O;  5KX5 A;  3SYA A;  4MW8 A;  3VQX A;  3K9S A;  1QHT A;  3TK1 A;  1HP8 A;  2GBO A;  5E79 Z;  2HKO A;  3ZRS A;  4J80 A;  3HKB B;  1K5Q A;  4J7Z A;  2B1I A;  1VQM V;  5BZB A;  3JAT B;  2VQF O;  4QJF B;  4DW1 A;  3FX7 A;  1S5J A;  4WF9 V;  1S76 D;  4GKK O;  2A9H A;  1HR0 B;  4TOI A;  2PF4 E;  3G6E V;  4LWS B;  4DV1 B;  1Q3E A;  4IHJ A;  1XI1 A;  5B5E Z;  1JJ2 U;  4LFA B;  3OM3 B;  4DR6 O;  2ZNI A;  4BR6 A;  3JAM N;  2UXB B;  3CD6 V;  1UJW B;  1TUE B;  4NXM B;  1MG1 A;  4K0K B;  3JAK B;  1VQN V;  1ARO P;  2DMX A;  4HBN A;  1H2L A;  4G27 B;  3ABK C;  1ZAU A;  5K1X A;  1Z5V A;  3Q4H A;  3WB1 A;  1MSD A;  2EIJ C;  3QO8 A;  2QTS A;  1NTZ H;  1DGS A;  4R6Z A;  2UXD O;  1N36 B;  2PI5 A;  2E5L B;  2EIN C;  2HP8 A;  2P4V A;  1F4M A;  2MK3 A;  2F93 B;  3C90 A;  2WLL A;  5ITZ B;  1ENV A;  1IBL B;  5GTH Z;  2Y48 A;  5LOV B;  4B3R O;  1R6T A;  2K1E A;  2WSS G;  4WFH A;  4CZZ A;  1XRE A;  2HHH B;  1AR5 A;  4AQY B;  5LL6 Y;  1NZ6 A;  1UFI A;  4F6R A;  4QPJ A;  2IW5 A;  4JAS A;  2ZE7 A;  5CBG A;  3WG7 B;  3SYC A;  5DN6 G;  1PL4 A;  2ZDI C;  3WFV A;  2LFR A;  3WU2 Z;  2HFE C;  4IL6 Z;  5LYJ B;  1AJP A;  1AVM A;  1L1F A;  3AK3 A;  2E74 B;  1YCI A;  2OIG A;  4X64 B;  5JQG A;  1ZUQ A;  3ASO B;  3FAV B;  4E2L A;  1OCC C;  4XBF A;  4B08 A;  3K58 A;  1OHH G;  3CB2 A;  4O4I B;  4O4J A;  1W0J G;  1Y4M A;  1I0H A;  4OPH A;  1XEQ A;  4PA6 A;  4BW9 A;  5LGU A;  1Z2G A;  2CK3 G;  1Q82 W;  4MVU A;  3FYE B;  3D36 C;  2Q7E A;  4JI4 O;  3CC7 V;  2UUB B;  1N4C A;  2ZDI A;  4DRX B;  4O2A B;  3RFR A;  3B40 A;  2DQ3 A;  3ZMZ A;  4WFF A;  5LHH A;  4WFG A;  1VQ9 V;  4X1K B;  5CB4 A;  3IJ4 A;  1SF9 A;  1XMO O;  4LF9 B;  2ZKO A;  4AI8 A;  3P30 A;  3ETG A;  2YEV B;  4JI0 O;  2HG5 C;  2X6B A;  1JFF B;  1HNZ B;  3L73 H;  3H01 A;  1X4T A;  2UXC O;  3R65 A;  3D36 A;  4DV0 O;  5EIB D;  2QEX V;  4B3M B;  4GX1 A;  1AI4 A;  1R3I C;  5J2T A;  4JI6 O;  4I4T B;  1EBO A;  3N2G B;  3LNN A;  1FXV A;  1LNQ A;  4U3J A; 
#chains in the Genus database with same CATH homology
 2GUZ A;  2N05 A;  1BQ0 A;  3UCS C;  1HDJ A;  1FPO A;  1N4C A;  2Y4U A;  2GUZ B;  4IT5 A;  1BQZ A;  2CTP A;  2LGW A;  2M6Y A;  1WJZ A;  1XBL A;  2DN9 A;  2PF4 E;  2DMX A;  2CTW A;  2QWP B;  2YUA A;  2EJ7 A;  2QSA A;  1GH6 A;  2CTR A;  2QWQ B;  1NZ6 A;  2LO1 A;  3BVO A;  3APQ A;  4RWU A;  2N04 A;  2QWN B;  3UO3 A;  1IUR A;  3APO A;  1FAF A;  2L6L A;  2CUG A;  3UO2 A;  4J80 A;  2YS8 A;  2Y4T A;  2OCH A;  4J7Z A;  2KQX A;  3AG7 A;  2CTQ A;  2QWR B;  2QWO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...