2YS8A

Solution structure of the dnaj-like domain from human ras-associated protein rap1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
b'GSSGSSGSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab-related GTP-binding protein RabJ
publication title Solution structure of the DnaJ-like domain from human ras-associated protein Rap1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ys8A00
1NZ6A 4J80A 2YUAA 1GH6A 2DN9A 3APOA 2CTQA 1N4CA 2KQXA 4RWUA 1BQ0A 2L6LA 2OCHA 1WJZA 2Y4TA 1FPOA 2Y4UA 3AG7A 4J7ZA 2GUZB 2LO1A 3BVOA 3UCSC 1XBLA 3UO2A 1IURA 2EJ7A 2QWRB 2CTPA 2LGWA 2N04A 2YS8A 3APQA 2M6YA 2QWNB 2DMXA 2QWPB 1FAFA 2CTRA 4IT5A 2QWQB 2QWOB 2GUZA 2QSAA 3UO3A 2N05A 1BQZA 2PF4E 1HDJA 2CTWA 2CUGA
chains in the Genus database with same CATH superfamily
1XHZA 4JTAB 4FM1A 5CMUA 1ZSPA 5LP6A 3AK3A 5FLXN 5J9PC 2CK3G 2LW1A 2QM8A 2YI8A 3SPJA 4WFFA 1Q5OA 2VWJA 1I94O 2IH3C 2EILC 4LFCB 1HDJA 1NBMG 5L3BA 2VQEO 5IY5C 2NN4A 4OX9B 3LDEA 4D7SA 3LSUA 1QVGU 1IBMB 4JYYA 3FD9A 4X1KB 3E8FA 2W0XA 4IT5A 3OR7C 4LF6B 1OCOB 3EFFK 5JH7B 1N36B 1K4CC 4UVBA 3G71V 4U3JB 4AQYO 2EX3A 3ZMUA 1KU9A 3JAWA 5LGTA 1XQ8A 4E2LA 5DN6G 2EJ7A 4FFKA 1AVMA 4UB8Z 3G6BA 4YY3B 4B08A 5EC1C 5IE9A 3D8CA 2CTWA 2OTJV 2XNDG 3ZHVA 2OTLV 5L3CA 4H37A 3JAMN 3CCQV 3ZX6A 1JJOA 4PA3A 4KFMA 4B3SO 2ZE6A 2YC0A 5BMVB 3G4SV 2BCCH 3L75H 5KUKA 1HWYA 2EIJC 5L3GA 1OV9A 3ICXA 4EKWA 4DUYO 2Q7GA 1OCCB 4P2ZA 1AR4A 5C8YB 2WLIB 4N23A 4MW8A 2QKCA 1VMGA 2P90A 3SPCA 1US6A 4KP4A 3STZC 1WAZA 2QDOA 4JAAA 1GRJA 2H8PC 1LNQA 1JR9A 4UCRA 2ITCC 4GX5A 3QF7A 1N34B 3K9AA 5BR8O 2X6BA 3JATA 2F95B 2BE3A 3NXSA 4U3FH 4O4JB 4LF5O 4UCTA 2DYRC 4EFEA 2ZCEA 3OUFA 1XI1A 1FXHA 1JQ0A 4UCVA 2WLLB 4ZI7B 3A0BZ 1MSDA 2WLHA 4FZ0A 3ZHTA 5KHIA 2HKOA 4FVMA 1H2LA 1KMIZ 3K5LA 4CH3A 2BOCC 3HKCA 4K3AA 1VQ8V 3SR2C 1NVPD 4AILC 1FKAO 2GTAA 3ZCCA 2DW4A 4H13B 1WA8A 3ETGA 1XMQO 2ZIMA 2YIBD 4DV3B 2OIEA 4OPHA 3KCYA 4OPAA 4D7TA 1RM1C 2ZNJA 4DV2O 2ZD9A 1R3KC 5EIBC 3OM3B 2HP8A 1KC8W 4HAMA 3JASB 4ZHQA 4JYAB 3FKSG 4P30A 4FLXA 1VARA 2FTKA 4KUMA 3RT3C 1H38A 4DV5O 1GN2A 3CRQA 1NH2D 1OCZC 4ZHQB 1Z2GA 2ZDIC 1URFA 5DEDA 1RSOB 1W0JG 2CAZC 5CA3A 4D6TH 5IJ0A 3GB7C 3OAAG 2B5UA 1I94B 5FNVB 2WA3A 2WLMA 4X64O 3M99B 4I55A 2EIKB 1VEWA 1NU1H 4U7OA 1CXZB 3G6EV 1GN6A 4PDLA 2PGGA 1AILA 2X6AA 2BSKA 4QE9A 1UJWB 1OCRC 2P5OA 3ML0A 2A3QA 5LA6A 1OZ0A 4J11A 1KECA 3UO3A 2H94A 2R72A 3SYAA 2Y4TA 2XASA 4N21A 1K5SA 5LGNA 4I50A 3SYCA 4AQYB 2ATKC 3ETQA 3UCSC 3I55V 2YS8A 5B66Z 4X62B 2WWWA 4R8CA 5L3EA 1FAFA 1I7FA 2HLDG 1AR5A 2E3CA 5JJEB 1ZL8A 3HB3B 4B3MO 1B04A 2Q7HA 3OFNG 5EBMC 2Q69A 1Y4MA 1K8AW 2P22C 2UXCO 3JAKB 4O2BB 1M56B 2AXTZ 3ZEDA 5CA0B 1K4DC 2GUZB 4B3SB 3OE7G 3APQA 5B1NA 2YEVB 4JPRA 4DUYB 1PP9H 1YVWA 4K0KO 2N05A 4FLUA 4JI2O 3N2KB 3CC4V 1MOFA 1IVSA 2NLJC 3N2GA 4TSFG 4J42A 5B1AB 1P84F 2O57A 2EBOA 4O4LA 4B7EA 4GCZA 2F1MA 3B8NA 5BR8B 5BY1A 5B3SC 4I4TA 3GWKC 3JD3A 5K1XA 1AJQA 3AG4C 3UKMA 4LF5B 1XL4A 4O4LB 2DQ3A 3ZRSA 2Y4UA 3BEHA 3IJ4A 4PHZA 5D5PA 1O9HA 4I4TB 4PI0A 1MZFA 1XL6A 3WG7B 3ZRVA 1YTFD 4OGQB 3RW0A 4FLZA 1K33A 4O4IB 4LWSA 3BRCA 4FLVA 4UCUA 5KMGB 1VF6C 3Q4HA 4MVRA 3FYEB 2GBOA 1R73A 3K06A 4FZ1A 3CPWU 2LW7A 1XMQB 1XUQA 1XEQA 1K9MW 1Q82W 1VQNV 4LWSB 5K1PA 3W7WA 3RYFA 4WCEV 1AB3A 3UT5A 2JS3A 5B1BB 5LP6C 5BZBA 3RYHA 4DV2B 4JAUA 2BOBC 4B3RO 2QR4A 3WB0A 3JD4A 3LSQA 4MTGA 1BZKA 5LHIA 4EB6B 3OTFA 4DR7B 1GM7A 3RFRA 4EFBA 3N27A 1WP7A 1S72V 2LO1A 3D3QA 4DV5B 2DJVA 1M1KW 4ZKIA 4NTYA 1Q6IA 2QKSA 1S5HC 4HNAA 1FFTB 3F5TA 1JJ2U 1MG1A 4X64B 3QG5A 2V1DA 5H6QA 3KG2A 3VQWA 4GX2A 5A2QN 4UV9A 2P67A 3F5WC 4F6EA 2RJZA 3B09A 1M90W 4YIPA 4I9WA 2W0FC 1N32O 2IH1C 1VQOV 3HKEB 2YXYA 3ZMTA 1F4NA 2CE4A 4MVZA 1OCCC 1H8HG 3P3NA 3W7XA 2QKAA 2VS0A 3CC2V 4J7ZA 4GKJO 2WA4A 4CH5A 2ZXWB 1E1QG 4O2AA 4LFAO 3AK1A 1B06A 4TUYB 2DWEC 1XNQO 1PL0A 4X89A 1YCIA 4HBNA 4B3MB 2V4DA 2KG7A 3JSLA 1NI8A 1S0VA 1EM1A 1FXKB 3RYIA 1SQXH 1NT2B 2P6JA 2ZQMA 2DN9A 1N4CA 2UXCB 2JIZG 3FYIB 5LGUA 2P7TC 1I08A 1Q8IA 3W7TA 2KG7B 3E89A 3U11A 2Q68A 1XDCA 1Y66A 1B6QA 4YJ2A 3RYIB 3ASOC 1MSWD 1AROP 1SF9A 4K8ZA 1NTKH 3LNMB 3HR0A 1EN5A 3PJSK 1EN4A 1AP5A 4BW5A 2E75B 4UVCA 2R9RB 3RVYA 3A0HZ 5H9CA 1Y74B 2E5LO 1O9GA 4RWUA 3EVKA 1VQ5V 3R66A 4X9QA 1PKXA 1VF7A 1FFXA 5JJJB 2R70A 2QEXV 3ZHUA 1TUEB 4PDMA 2Y69B 3W7SA 5KUMA 3AG2B 1PNMA 1HNXO 4J41A 1AI7A 3RBZA 1FFXB 3ZMSA 2M7WA 2IJKA 3TCUA 3SYQA 1FPOA 1FYJA 3E22A 4DW1A 1J5EO 1PD3A 2WPDG 1I5YA 4MVMA 4TWKA 3OUSA 4FFBA 5LMUB 1SQGA 1MZEA 4JI7O 4LF9O 2CUGA 3L9DA 1V9PA 4G2KA 4JI6O 1GTOA 3RGBA 1AR1B 1CEZA 1W59A 2Z5UA 3RYCB 1DF4A 3X2QC 1M5IA 3JD2A 1Q86W 3F7YC 4C7UA 1L0LH 2AW9A 2F4VO 1VF5B 4UV8A 4B7KA 1ENVA 2EIKC 5FL7G 4O4HA 5GW7A 3QO8A 3K5NA 2A0LA 1NZ6A 4DV1O 4K35A 1P4RA 2ARHA 3OR6C 4CZZA 3ABKC 3A0RA 4H33A 3SDLA 1UFIA 1ZX3A 1VIBA 2ZNIA 5KLVH 4CC6A 1PV0A 4X66O 2R9IA 4H44B 4O4HB 2QWPB 1MMMA 3CYOA 4UB6Z 3ETDA 1D5AA 4X1KA 1G6UA 2ADPA 1IBKO 1CP9A 2PY5A 3S3XA 4KXRA 3SJAC 4AI8A 5JH7A 4J10A 5CBHA 3JYCA 4LBEC 4RAIA 2C2AA 4U3JA 1SA0B 1TA8A 2UU9O 4IHJA 2UUAO 4ZOLB 1WNSA 3K08A 4IIJA 2AHZA 3AG1B 4BIOA 1V54B 1M56C 5H5NA 1BQZA 2YIBA 1QVFU 5KHJA 2AGAA 4J9YB 3SJBC 1NVPB 2RQ6A 4IHJB 4X65O 2OCHA 3JCZA 4FM2A 5D5QA 4IIJB 3T4DA 4P9OA 4B3TO 4LFAB 3BA8A 2OIGA 5B1AC 3VQXA 3JSNA 2QSAA 5CA1A 1XNQB 5BMVA 2RN9A 3RN4A 4Z1VA 5LMNO 1JCHA 3L70H 4LP8A 1WPBA 5C8YA 3S3WA 2WLIA 3IC7A 2ITDC 2OT5A 1OHHG 3JALB 1Q90D 1L0NH 5CA1B 2CGOA 4LNUB 1KKDA 3T1HO 3FB7C 1NH2B 1YI2V 2JK5C 2EIMB 3BCCH 4F6RA 4PV1B 3B40A 3CCSV 3WG7C 3A2FA 1LUWA 1G8MA 3CP1A 4O4JA 3K9SA 2E5LB 2WAMA 4F6RB 3DXRB 3HKDA 2WLLA 3IGAC 4ZI7A 2CTRA 2ZM6O 3P30A 2B1GA 1HR0O 5JJNB 1K92A 3ASNC 4ICGA 5IYDO 4X1IA 4DV6O 1K7DA 3HPLC 3HKDB 1S3JA 2XAQA 3FFQA 3LDDA 2X7RB 3K58A 1KB9F 1G4YB 2Q9LA 3ZN1A 4GKKO 1YF2A 2YDEA 3L71H 1J5EB 2E76B 5HFLA 1HNWO 5KA6A 4X1IB 1F51A 1P7BA 2UUBO 4JI0O 1KKCA 4FM0A 4JI7B 5CBGA 4LF9B 4JI6B 3TK1A 1H8EG 4L8JA 3JASA 3LDCA 4L87A 2WSSG 5C93A 2ODMA 3L73H 2F4VB 2HJDA 4MVSA 1QU7A 1KYOF 1S5LZ 2CGNA 4I5SA 1YJWV 2QJ1A 1PNLA 3SPHA 5AG2A 2RNBA 4NYKA 4I9QA 2PTMA 4PA9A 1RSOA 5J2TA 4DV1B 5CBFA 2L6LA 2ILMA 5FNVA 2UXXA 2JDIG 1ZWIC 3CS5A 1IURA 3B77A 4JI5O 4X66B 2CH7A 1VP7A 4DV0O 4JYCA 2DWDC 5J2TB 1Q43A 3CRMA 3HKBB 4MS2A 2VQEB 1D2DA 2CH7B 2ZR2A 3CCUV 2OCCC 2F43G 4R6ZA 3CC7V 1JFFB 3CD6V 2PZSA 2N74A 4Z1MG 2UU9B 2XT9A 1ZTEA 2UUAB 3O65A 1U96A 4FK5C 4JAVA 3TXQA 1YTFB 3ZHQA 1GN4A 3ZMZA 3ABMB 2HVKC 1GH6A 4JZGA 4FIPC 4K8XA 4YHHO 2ZINA 3H1LH 1QLEC 2Q7EA 3SYPA 2JEUA 1DLBA 1YJ9V 1I5XA 1TUBB 3EXAA 4B3TB 3JAKA 3ZHSA 4O2BA 2R9AA 2CDYA 2IW5A 5CA0A 2GUZA 3T1YO 2UXNA 3H01A 4TOIA 5LYJA 2YEVA 5LMNB 1AP6A 4Q20A 4DYLA 4QPKA 2OWOA 2K1EA 2OYQA 3WB2A 1QCEA 1ROPA 3N2KA 1VQ4V 2Y69C 1VQ9V 5EZYB 3AG2C 1K5QA 1NTZH 3T1HB 5LYJB 4FJCC 2KSDA 5F2VO 4BAYA 1WB8A 1VQLV 2Q6AA 1R6NA 3M7MX 3BA9A 2ADQB 1FS0G 1JX9A 4BR6A 3K5OA 4XDLA 5LL6Y 1QBZA 3OD4A 1IBLO 3KZIZ 3QTCA 4X88A 2A9HA 2W6JG 1U97A 1NR7A 1F4MA 2ZM6B 1R6KA 4LF8O 2JJ1G 2Q67A 4O4IA 2P4KA 2CTQA 4W4LA 3UM7A 4DV6B 4NXMO 5KMGA 1QQCA 5KA5A 4PD4F 2JS5A 2ETNA 1BMFG 3AG3B 2EZPA 3SGIA 5LOVB 1N0JA 1YDXA 4GKKB 1EZVH 1NTMH 2JVDA 1HNWB 1YIJV 4GZRB 4PA4A 2YSUB 2UUBB 4JI0B 1KUQA 4G28B 1Q7YW 1V55B 4JV5O 4HYOA 4PA7A 4LR3A 1AI6A 3OEHG 3IC9A 2IBZH 4EB6A 4I7ZB 3PN1A 5DECA 3H1JH 2HEPA 2XHBA 2YI9A 3OTOO 5JVDB 3CXCU 4LH6A 2QA4V 1Q6HA 1OCOC 1V54C 3TGUH 4TV8A 1AJPA 1PPJH 3R65A 4JI5B 1BCCH 4DV0B 2HR3A 1IDSA 3I5DA 5BXZA 1KD1W 1QLNA 4WFEA 1WN7A 4JI8O 3B2EE 1BHAA 4TV8B 2KQXA 3L72H 2QTOA 3HKEA 2A7WA 3E35A 1XMOO 4FPPA 2UXDO 2QWOB 4MTXA 4LFCO 4YJ3B 4LF4O 1RM1B 4PI2A 4TV9B 4JI3O 4TUYA 3WFVA 5EBWC 4XDKA 3NR7A 4GUNA 2NNUA 3ETEA 3ABLB 1MABG 1SRYA 4YHHB 2EIMC 3QO7A 1FXKA 1L1FA 1W0KG 1B3QA 3BAAA 1L8DA 4QNHB 4JASA 1JPXA 4ABMA 4Z2WA 1ZAUA 3K03A 3T1YB 5KHKA 4KHPO 2VWKA 1MNGA 3MD0A 1SQBH 2LFRA 4YIOA 4BWAA 3C3SA 1M4UA 4I0XB 4A5UB 4UXNA 2AHYA 4DO2A 2P4VA 1H2KA 1IX9A 2MK3A 1Y74A 1SERA 1WB7A 1PL4A 4NR1A 3CRAA 1AI4A 3ZN0A 1GN3A 4WFGA 4K0KB 1FJGO 1OCRB 1SQQH 3TJTA 4JI2B 1R3IC 3ABUA 5LBQA 5GONB 2PYLA 1BSMA 1YJNV 1TGOA 4BIUA 5IJ9A 2Q4PA 4DR6O 2ZE5A 3U10A 5ITZA 4X20B 1IBLB 2N04A 2LGWA 2K9PA 2BTQB 5B5EZ 2IJJA 2F66C 5JCOA 2YIDA 2HVJC 4NTWA 1S76D 3E83A 2KKWA 4X1YB 5IJ9B 4LF8B 1D5NA 5IT9N 5ITZB 2IJHA 4JGSA 2HJFC 3CMEV 4MVOA 4F4LA 1R6TA 4NXMB 1H2MA 4HZ3A 2WLKA 1K97A 3QO5A 2CTPA 3CHXA 1XOUA 2Q0OC 2QM4A 5KX5B 4MVQA 3RYCA 3OT7A 4RQEA 2Q5ZA 5EIBD 4GYCB 2HG5C 4TT3G 2PF4E 5CB4B 4MVUA 1H2GA 2DOSA 5GTIZ 1G1XB 1SQFA 5IYZB 4Q6GA 3CXHF 2LP7A 3CCMV 1QHTA 4JV5B 3B8MA 1LR1A 4QPJA 4BIZA 2UXBO 4J7JA 4NKGB 2EULA 3IFXA 1GMGA 2M6YA 3P3PA 5L3FA 3E2EA 5KHHA 3BABA 4TQDA 1SQVH 3FB6C 3I56V 1K73W 4GX0A 3JARB 2PI4A 4B3RB 4WFHA 2XUMA 4W4KA 4DUZO 1BHBA 3JCUZ 3FB8C 5B3SB 2MW2B 2F93B 3LNNA 1PNKA 1JVMA 1SQPH 1IZ3A 1S77D 1QR9A 1YXBA 4DRXB 2QE7G 2JRIA 3QNEA 3ABMC 3H1HH 2Y48A 3L74H 4JTDB 3LSSA 1SA0A 3GVMA 3ZHRA 1Y76B 2YUAA 4ZOLA 4NTXA 1I0HA 4JI8B 1CPYA 5TISZ 2EINB 1TVKB 2Q0AA 3AG7A 1JOYA 3K79A 3VOUA 5EYPB 2ZR3A 4LCUC 4UUJC 1XMOB 1TAEA 4DV4O 2D2CB 2UXDB 4EEQA 4JYBA 4LF4B 4CS3A 4JI3B 5LP6B 2VQFO 1N32B 2PYJA 1R3LC 1THZA 3OEEG 1XNRO 1EFRG 2YIAA 3ZIAG 4IYHA 2FKXA 4GKJB 1BGYH 1SC5B 3OMIB 3JALA 1SKVA 4CC5A 4LNUA 3E8HA 1HW7A 4KHPB 1VQ7V 1YZBA 4QJFB 3D3IA 2Q73A 2GDSA 2QGNA 4X62O 3DC5A 5E1AC 1Z5WA 1YHQV 1M93A 1OJHA 3G80A 3FAVA 3FX7A 3ZJZA 3JAWB 3DXRA 5DM6V 3G67A 1FJGB 3AG3C 1EN6A 5J2UA 2FYUH 2LGQA 1KQSU 4UFZA 3FAVB 4DR6B 3VBBA 3C90A 1UPGA 4RO2A 1W2BU 3OGCC 4QIWF 1V55C 5J2UB 3ZRXA 3MHSC 1SETA 1HNXB 1E79G 5B1BC 3QVNA 4J7KA 1WLEA 1F23A 3UQ8A 1R1BA 2Q8VA 5IYCO 1GM8A 3AEIA 4IL6Z 5LHHA 4DR3O 4XDJA 4DR1O 4YXWG 3EHBB 4WF9V 2WLNA 3ZRWA 2XAHA 3CX5F 3H9VA 2JEXA 2XAFA 3B4SA 1NR1A 2YICA 4ASUG 3ASOB 1JMKC 4JZ2A 3K57A 1AI5A 1GK9A 4DR2O 3JATB 2JGDA 1EBOA 3CCEV 3ZRWB 4FLWA 1PM9A 2UXBB 1ZLZA 3ABTA 1SESA 1YEWA 5JWPA 2DYSB 4X8AA 1DF5A 1S5JA 3U0ZA 3D36C 4NVPA 2JGDB 3ZS8C 4DUZB 1ZUQA 3HKBA 1M57B 3F7VC 3HKCB 4JI4O 2XAJA 1WA8B 3MAQA 2GV9A 3M8AA 2ZT9B 2FMLA 3ABLC 3CWBH 2YXLA 1JFFA 4LFBO 2ZXWC 4DR7O 3SYOA 5KHGA 1RPOA 3CCLV 1IBKB 1VQKV 3K04A 3J80N 2A79B 2UUCO 2LQTA 5A9GA 3X2QB 1FXKC 4FMTA 4P9PA 2JGUA 4DV4B 3FB5C 4NB5A 4H0LB 4QE7A 1K34A 2X6CA 2H3OA 3CCVV 1E1RG 1TUBA 2VQFB 3T1CA 2JJ2G 1Q81W 3H1IH 3CCRV 5L3DA 2KB1A 3CRCA 1XNRB 5IJ0B 4X65B 4DK1A 1XBLA 5KAFZ 4DR5O 2QWRB 3GWOA 1K3EA 3SJQC 2HHHO 3ABKB 4I55B 1T5EA 4XBFA 5LHGA 5EZYA 1DK1A 1SS3A 2WLJA 2RMKB 3WB1A 1R3JC 4FLTA 1Y6XA 3A8TA 4JI1O 2BSKB 2BTOA 1A32A 1H2NA 1VQMV 3TETA 5LA6B 4AHCA 2VRZA 1N33O 2EILB 1DGSA 3E8BA 5IY5B 3DTUB 5IWAO 2P06A 1SZXA 3CJHA 2AZ2A 3E86A 1F7YA 1NJIW 1QNMA 1WP8A 3CE2A 3STLC 3JD0A 5KAIZ 5H6RA 4QGPA 4I50B 4R7CA 1DTOA 3J7AU 1EZJA 5JCOC 3CJHB 2IU3A 4DR4O 1BQ0A 1BS3A 1ZL8B 5EK0A 1VQPV 5EC2C 4JTCB 4DV7O 3BHPA 4UCOA 1KP3A 2XTAA 1QR8A 4FLYA 4CH6A 5LOVA 1Y67A 2LJ2A 1HR0B 4RUFA 3JD1A 4CS4A 5IDJA 4JF3A 3APOA 2GHYA 2EZOA 3BPZA 4DR3B 2DMXA 3N2GB 4DR1B 4BW9A 2PI5A 2Y0IA 2L35A 1GAXA 4MTFA 4LF7O 2NR5A 2EIJB 1RFYA 2W6IG 2DQ0A 3THOA 1NQTA 4DR2B 1P7GA 3BVOA 5JVDA 1XREA 4GX1A 1BT8A 2FB5A 1VQ6V 4J9ZB 2EINC 5LMUO 5H2FZ 3MDSA 4U7NA 1HNZO 3P32A 4J80A 2LFSA 2F23A 2Z3YA 1LUVA 1COWG 5FPOA 1KBHA 3KKYA 3MHHC 3ASNB 4NXNO 4UCSA 2DYRB 1X4TA 3AG1C 3OW2U 4IYIA 1RPRA 3Q4HB 4JI4B 2IJIA 3RVZA 3W7UA 3D36A 3RWRD 4ZIBA 1P49A 3BY6A 4UVAA 3RYFB 4E4EA 1GM9A 4LFBB 4WFAV 3UT5B 1N0NA 3CSXA 4WFBV 1Z5VA 4IGGA 1NS1A 3H1KH 4YJ3A 3RYHB 4TV9A 3K3WA 3DSQA 1FXVA 2Y0PA 4DW0A 3K0GA 2RDCA 4LH7A 3ZBHA 4DXWA 2UUCB 3AK2A 1X59A 2QM7A 3OMNB 4TQFA 1H2SB 4OX9O 3DGEA 3K59A 4HNAB 1IBMO 1YITV 3CEIA 2ZDIA 2QTSA 1IXBA 2GSMB 4ZBMA 4DR5B 2QWNB 4I0XA 3VQYA 3KCXA 2HHHB 1YSCA 2AZ0A 4GT1A 4LF6O 4PDRA 3SPGA 5E79Z 1N36O 3E8GA 5LXTA 2E74B 1OCZB 2G38A 1M9NA 1ORQC 1N8RW 1IXMA 3O9OA 4JI1B 3ZMVA 2EJRA 1AJNA 5GTHZ 5JQGA 1JA8A 3BFRA 1N33B 5IYBO 5LXTB 4YY3O 5IWAB 5GONA 3IAYA 4WBNA 2Z0AA 2OCCB 3K0DA 1NKDA 4DK0A 2X0LA 4X20A 5FPRA 2A06H 4PJ0Z 1MA1A 5JQGB 4O2AB 2IM9A 2BTQA 1XHXA 1WJZA 2ZIOA 4WBNB 4DR4B 1FD9A 2GTSA 4PA6A 4X1YA 3J81N 4R50A 2IU0A 2QWQB 4DV7B 2RCVA 1QLEB 4MW3A 3CCJV 1XILA 1BL8A 5KX5A 4GLXA 2PUSA 3CRRA 3T4ZA 2D3OW 4YJ2B 4CH4A 2DYSC 4KL1A 5CB4A 5CN0A 1KP2A 1N34O 1WPXA 5EBLC 5IYZA 2XAGA 3C3TA 3TXSA 3CB2A 1Q6UA 4PELA 3VQVA 3DC6A 4RQFA 1M57C 1BE3H 3T2MA 3K5MA 1GKFA 4CBCA 4PDVA 4LC1A 4LF7B 2ZE8A 3SJCC 3LUTB 5HFMA 4G27B 1GO3F 3WU2Z 3JARA 2ZKOA 2XOKG 4MTOA 2ZE7A 1J95A 1SZTA 4DRXA 2B1IA 2FL4A 3OGIB 1HP8A 4RUEA 4MSWC 1RP3B 1HNZB 3E22B 1Q3EA 3OMAB 3OTOB 4DV3O 2B9ZA 5B1OA 4MT8A 4CS2A 3AG4B 4OXSA 4NXNB 3UO2A 1Y76A 2DE0X 4FFBB 3SPIA 1TVKA 1VF6A 2HFEC 4JYAO 5EYPA 2YXHA 3CMAV 2V7QG
chains in the Genus database with same CATH topology
1NZ6A 4J80A 2YUAA 1GH6A 2DN9A 3APOA 2CTQA 1N4CA 2KQXA 4RWUA 1BQ0A 2L6LA 2OCHA 1WJZA 2Y4TA 1FPOA 2Y4UA 3AG7A 4J7ZA 2GUZB 2LO1A 3BVOA 3UCSC 1XBLA 3UO2A 1IURA 2EJ7A 2QWRB 2CTPA 2LGWA 2N04A 2YS8A 3APQA 2M6YA 2QWNB 2DMXA 2QWPB 1FAFA 2CTRA 4IT5A 2QWQB 2QWOB 2GUZA 2QSAA 3UO3A 2N05A 1BQZA 2PF4E 1HDJA 2CTWA 2CUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZ6 A;  4J80 A;  2YUA A;  1GH6 A;  2DN9 A;  3APO A;  2CTQ A;  1N4C A;  2KQX A;  4RWU A;  1BQ0 A;  2L6L A;  2OCH A;  1WJZ A;  2Y4T A;  1FPO A;  2Y4U A;  3AG7 A;  4J7Z A;  2GUZ B;  2LO1 A;  3BVO A;  3UCS C;  1XBL A;  3UO2 A;  1IUR A;  2EJ7 A;  2QWR B;  2CTP A;  2LGW A;  2N04 A;  2YS8 A;  3APQ A;  2M6Y A;  2QWN B;  2DMX A;  2QWP B;  1FAF A;  2CTR A;  4IT5 A;  2QWQ B;  2QWO B;  2GUZ A;  2QSA A;  3UO3 A;  2N05 A;  1BQZ A;  2PF4 E;  1HDJ A;  2CTW A;  2CUG A; 
#chains in the Genus database with same CATH topology
 1XHZ A;  4JTA B;  4FM1 A;  5CMU A;  1ZSP A;  5LP6 A;  3AK3 A;  5FLX N;  5J9P C;  2CK3 G;  2LW1 A;  2QM8 A;  2YI8 A;  3SPJ A;  4WFF A;  1Q5O A;  2VWJ A;  1I94 O;  2IH3 C;  2EIL C;  4LFC B;  1HDJ A;  1NBM G;  5L3B A;  2VQE O;  5IY5 C;  2NN4 A;  4OX9 B;  3LDE A;  4D7S A;  3LSU A;  1QVG U;  1IBM B;  4JYY A;  3FD9 A;  4X1K B;  3E8F A;  2W0X A;  4IT5 A;  3OR7 C;  4LF6 B;  1OCO B;  3EFF K;  5JH7 B;  1N36 B;  1K4C C;  4UVB A;  3G71 V;  4U3J B;  4AQY O;  2EX3 A;  3ZMU A;  1KU9 A;  3JAW A;  5LGT A;  1XQ8 A;  4E2L A;  5DN6 G;  2EJ7 A;  4FFK A;  1AVM A;  4UB8 Z;  3G6B A;  4YY3 B;  4B08 A;  5EC1 C;  5IE9 A;  3D8C A;  2CTW A;  2OTJ V;  2XND G;  3ZHV A;  2OTL V;  5L3C A;  4H37 A;  3JAM N;  3CCQ V;  3ZX6 A;  1JJO A;  4PA3 A;  4KFM A;  4B3S O;  2ZE6 A;  2YC0 A;  5BMV B;  3G4S V;  2BCC H;  3L75 H;  5KUK A;  1HWY A;  2EIJ C;  5L3G A;  1OV9 A;  3ICX A;  4EKW A;  4DUY O;  2Q7G A;  1OCC B;  4P2Z A;  1AR4 A;  5C8Y B;  2WLI B;  4N23 A;  4MW8 A;  2QKC A;  1VMG A;  2P90 A;  3SPC A;  1US6 A;  4KP4 A;  3STZ C;  1WAZ A;  2QDO A;  4JAA A;  1GRJ A;  2H8P C;  1LNQ A;  1JR9 A;  4UCR A;  2ITC C;  4GX5 A;  3QF7 A;  1N34 B;  3K9A A;  5BR8 O;  2X6B A;  3JAT A;  2F95 B;  2BE3 A;  3NXS A;  4U3F H;  4O4J B;  4LF5 O;  4UCT A;  2DYR C;  4EFE A;  2ZCE A;  3OUF A;  1XI1 A;  1FXH A;  1JQ0 A;  4UCV A;  2WLL B;  4ZI7 B;  3A0B Z;  1MSD A;  2WLH A;  4FZ0 A;  3ZHT A;  5KHI A;  2HKO A;  4FVM A;  1H2L A;  1KMI Z;  3K5L A;  4CH3 A;  2BOC C;  3HKC A;  4K3A A;  1VQ8 V;  3SR2 C;  1NVP D;  4AIL C;  1FKA O;  2GTA A;  3ZCC A;  2DW4 A;  4H13 B;  1WA8 A;  3ETG A;  1XMQ O;  2ZIM A;  2YIB D;  4DV3 B;  2OIE A;  4OPH A;  3KCY A;  4OPA A;  4D7T A;  1RM1 C;  2ZNJ A;  4DV2 O;  2ZD9 A;  1R3K C;  5EIB C;  3OM3 B;  2HP8 A;  1KC8 W;  4HAM A;  3JAS B;  4ZHQ A;  4JYA B;  3FKS G;  4P30 A;  4FLX A;  1VAR A;  2FTK A;  4KUM A;  3RT3 C;  1H38 A;  4DV5 O;  1GN2 A;  3CRQ A;  1NH2 D;  1OCZ C;  4ZHQ B;  1Z2G A;  2ZDI C;  1URF A;  5DED A;  1RSO B;  1W0J G;  2CAZ C;  5CA3 A;  4D6T H;  5IJ0 A;  3GB7 C;  3OAA G;  2B5U A;  1I94 B;  5FNV B;  2WA3 A;  2WLM A;  4X64 O;  3M99 B;  4I55 A;  2EIK B;  1VEW A;  1NU1 H;  4U7O A;  1CXZ B;  3G6E V;  1GN6 A;  4PDL A;  2PGG A;  1AIL A;  2X6A A;  2BSK A;  4QE9 A;  1UJW B;  1OCR C;  2P5O A;  3ML0 A;  2A3Q A;  5LA6 A;  1OZ0 A;  4J11 A;  1KEC A;  3UO3 A;  2H94 A;  2R72 A;  3SYA A;  2Y4T A;  2XAS A;  4N21 A;  1K5S A;  5LGN A;  4I50 A;  3SYC A;  4AQY B;  2ATK C;  3ETQ A;  3UCS C;  3I55 V;  2YS8 A;  5B66 Z;  4X62 B;  2WWW A;  4R8C A;  5L3E A;  1FAF A;  1I7F A;  2HLD G;  1AR5 A;  2E3C A;  5JJE B;  1ZL8 A;  3HB3 B;  4B3M O;  1B04 A;  2Q7H A;  3OFN G;  5EBM C;  2Q69 A;  1Y4M A;  1K8A W;  2P22 C;  2UXC O;  3JAK B;  4O2B B;  1M56 B;  2AXT Z;  3ZED A;  5CA0 B;  1K4D C;  2GUZ B;  4B3S B;  3OE7 G;  3APQ A;  5B1N A;  2YEV B;  4JPR A;  4DUY B;  1PP9 H;  1YVW A;  4K0K O;  2N05 A;  4FLU A;  4JI2 O;  3N2K B;  3CC4 V;  1MOF A;  1IVS A;  2NLJ C;  3N2G A;  4TSF G;  4J42 A;  5B1A B;  1P84 F;  2O57 A;  2EBO A;  4O4L A;  4B7E A;  4GCZ A;  2F1M A;  3B8N A;  5BR8 B;  5BY1 A;  5B3S C;  4I4T A;  3GWK C;  3JD3 A;  5K1X A;  1AJQ A;  3AG4 C;  3UKM A;  4LF5 B;  1XL4 A;  4O4L B;  2DQ3 A;  3ZRS A;  2Y4U A;  3BEH A;  3IJ4 A;  4PHZ A;  5D5P A;  1O9H A;  4I4T B;  4PI0 A;  1MZF A;  1XL6 A;  3WG7 B;  3ZRV A;  1YTF D;  4OGQ B;  3RW0 A;  4FLZ A;  1K33 A;  4O4I B;  4LWS A;  3BRC A;  4FLV A;  4UCU A;  5KMG B;  1VF6 C;  3Q4H A;  4MVR A;  3FYE B;  2GBO A;  1R73 A;  3K06 A;  4FZ1 A;  3CPW U;  2LW7 A;  1XMQ B;  1XUQ A;  1XEQ A;  1K9M W;  1Q82 W;  1VQN V;  4LWS B;  5K1P A;  3W7W A;  3RYF A;  4WCE V;  1AB3 A;  3UT5 A;  2JS3 A;  5B1B B;  5LP6 C;  5BZB A;  3RYH A;  4DV2 B;  4JAU A;  2BOB C;  4B3R O;  2QR4 A;  3WB0 A;  3JD4 A;  3LSQ A;  4MTG A;  1BZK A;  5LHI A;  4EB6 B;  3OTF A;  4DR7 B;  1GM7 A;  3RFR A;  4EFB A;  3N27 A;  1WP7 A;  1S72 V;  2LO1 A;  3D3Q A;  4DV5 B;  2DJV A;  1M1K W;  4ZKI A;  4NTY A;  1Q6I A;  2QKS A;  1S5H C;  4HNA A;  1FFT B;  3F5T A;  1JJ2 U;  1MG1 A;  4X64 B;  3QG5 A;  2V1D A;  5H6Q A;  3KG2 A;  3VQW A;  4GX2 A;  5A2Q N;  4UV9 A;  2P67 A;  3F5W C;  4F6E A;  2RJZ A;  3B09 A;  1M90 W;  4YIP A;  4I9W A;  2W0F C;  1N32 O;  2IH1 C;  1VQO V;  3HKE B;  2YXY A;  3ZMT A;  1F4N A;  2CE4 A;  4MVZ A;  1OCC C;  1H8H G;  3P3N A;  3W7X A;  2QKA A;  2VS0 A;  3CC2 V;  4J7Z A;  4GKJ O;  2WA4 A;  4CH5 A;  2ZXW B;  1E1Q G;  4O2A A;  4LFA O;  3AK1 A;  1B06 A;  4TUY B;  2DWE C;  1XNQ O;  1PL0 A;  4X89 A;  1YCI A;  4HBN A;  4B3M B;  2V4D A;  2KG7 A;  3JSL A;  1NI8 A;  1S0V A;  1EM1 A;  1FXK B;  3RYI A;  1SQX H;  1NT2 B;  2P6J A;  2ZQM A;  2DN9 A;  1N4C A;  2UXC B;  2JIZ G;  3FYI B;  5LGU A;  2P7T C;  1I08 A;  1Q8I A;  3W7T A;  2KG7 B;  3E89 A;  3U11 A;  2Q68 A;  1XDC A;  1Y66 A;  1B6Q A;  4YJ2 A;  3RYI B;  3ASO C;  1MSW D;  1ARO P;  1SF9 A;  4K8Z A;  1NTK H;  3LNM B;  3HR0 A;  1EN5 A;  3PJS K;  1EN4 A;  1AP5 A;  4BW5 A;  2E75 B;  4UVC A;  2R9R B;  3RVY A;  3A0H Z;  5H9C A;  1Y74 B;  2E5L O;  1O9G A;  4RWU A;  3EVK A;  1VQ5 V;  3R66 A;  4X9Q A;  1PKX A;  1VF7 A;  1FFX A;  5JJJ B;  2R70 A;  2QEX V;  3ZHU A;  1TUE B;  4PDM A;  2Y69 B;  3W7S A;  5KUM A;  3AG2 B;  1PNM A;  1HNX O;  4J41 A;  1AI7 A;  3RBZ A;  1FFX B;  3ZMS A;  2M7W A;  2IJK A;  3TCU A;  3SYQ A;  1FPO A;  1FYJ A;  3E22 A;  4DW1 A;  1J5E O;  1PD3 A;  2WPD G;  1I5Y A;  4MVM A;  4TWK A;  3OUS A;  4FFB A;  5LMU B;  1SQG A;  1MZE A;  4JI7 O;  4LF9 O;  2CUG A;  3L9D A;  1V9P A;  4G2K A;  4JI6 O;  1GTO A;  3RGB A;  1AR1 B;  1CEZ A;  1W59 A;  2Z5U A;  3RYC B;  1DF4 A;  3X2Q C;  1M5I A;  3JD2 A;  1Q86 W;  3F7Y C;  4C7U A;  1L0L H;  2AW9 A;  2F4V O;  1VF5 B;  4UV8 A;  4B7K A;  1ENV A;  2EIK C;  5FL7 G;  4O4H A;  5GW7 A;  3QO8 A;  3K5N A;  2A0L A;  1NZ6 A;  4DV1 O;  4K35 A;  1P4R A;  2ARH A;  3OR6 C;  4CZZ A;  3ABK C;  3A0R A;  4H33 A;  3SDL A;  1UFI A;  1ZX3 A;  1VIB A;  2ZNI A;  5KLV H;  4CC6 A;  1PV0 A;  4X66 O;  2R9I A;  4H44 B;  4O4H B;  2QWP B;  1MMM A;  3CYO A;  4UB6 Z;  3ETD A;  1D5A A;  4X1K A;  1G6U A;  2ADP A;  1IBK O;  1CP9 A;  2PY5 A;  3S3X A;  4KXR A;  3SJA C;  4AI8 A;  5JH7 A;  4J10 A;  5CBH A;  3JYC A;  4LBE C;  4RAI A;  2C2A A;  4U3J A;  1SA0 B;  1TA8 A;  2UU9 O;  4IHJ A;  2UUA O;  4ZOL B;  1WNS A;  3K08 A;  4IIJ A;  2AHZ A;  3AG1 B;  4BIO A;  1V54 B;  1M56 C;  5H5N A;  1BQZ A;  2YIB A;  1QVF U;  5KHJ A;  2AGA A;  4J9Y B;  3SJB C;  1NVP B;  2RQ6 A;  4IHJ B;  4X65 O;  2OCH A;  3JCZ A;  4FM2 A;  5D5Q A;  4IIJ B;  3T4D A;  4P9O A;  4B3T O;  4LFA B;  3BA8 A;  2OIG A;  5B1A C;  3VQX A;  3JSN A;  2QSA A;  5CA1 A;  1XNQ B;  5BMV A;  2RN9 A;  3RN4 A;  4Z1V A;  5LMN O;  1JCH A;  3L70 H;  4LP8 A;  1WPB A;  5C8Y A;  3S3W A;  2WLI A;  3IC7 A;  2ITD C;  2OT5 A;  1OHH G;  3JAL B;  1Q90 D;  1L0N H;  5CA1 B;  2CGO A;  4LNU B;  1KKD A;  3T1H O;  3FB7 C;  1NH2 B;  1YI2 V;  2JK5 C;  2EIM B;  3BCC H;  4F6R A;  4PV1 B;  3B40 A;  3CCS V;  3WG7 C;  3A2F A;  1LUW A;  1G8M A;  3CP1 A;  4O4J A;  3K9S A;  2E5L B;  2WAM A;  4F6R B;  3DXR B;  3HKD A;  2WLL A;  3IGA C;  4ZI7 A;  2CTR A;  2ZM6 O;  3P30 A;  2B1G A;  1HR0 O;  5JJN B;  1K92 A;  3ASN C;  4ICG A;  5IYD O;  4X1I A;  4DV6 O;  1K7D A;  3HPL C;  3HKD B;  1S3J A;  2XAQ A;  3FFQ A;  3LDD A;  2X7R B;  3K58 A;  1KB9 F;  1G4Y B;  2Q9L A;  3ZN1 A;  4GKK O;  1YF2 A;  2YDE A;  3L71 H;  1J5E B;  2E76 B;  5HFL A;  1HNW O;  5KA6 A;  4X1I B;  1F51 A;  1P7B A;  2UUB O;  4JI0 O;  1KKC A;  4FM0 A;  4JI7 B;  5CBG A;  4LF9 B;  4JI6 B;  3TK1 A;  1H8E G;  4L8J A;  3JAS A;  3LDC A;  4L87 A;  2WSS G;  5C93 A;  2ODM A;  3L73 H;  2F4V B;  2HJD A;  4MVS A;  1QU7 A;  1KYO F;  1S5L Z;  2CGN A;  4I5S A;  1YJW V;  2QJ1 A;  1PNL A;  3SPH A;  5AG2 A;  2RNB A;  4NYK A;  4I9Q A;  2PTM A;  4PA9 A;  1RSO A;  5J2T A;  4DV1 B;  5CBF A;  2L6L A;  2ILM A;  5FNV A;  2UXX A;  2JDI G;  1ZWI C;  3CS5 A;  1IUR A;  3B77 A;  4JI5 O;  4X66 B;  2CH7 A;  1VP7 A;  4DV0 O;  4JYC A;  2DWD C;  5J2T B;  1Q43 A;  3CRM A;  3HKB B;  4MS2 A;  2VQE B;  1D2D A;  2CH7 B;  2ZR2 A;  3CCU V;  2OCC C;  2F43 G;  4R6Z A;  3CC7 V;  1JFF B;  3CD6 V;  2PZS A;  2N74 A;  4Z1M G;  2UU9 B;  2XT9 A;  1ZTE A;  2UUA B;  3O65 A;  1U96 A;  4FK5 C;  4JAV A;  3TXQ A;  1YTF B;  3ZHQ A;  1GN4 A;  3ZMZ A;  3ABM B;  2HVK C;  1GH6 A;  4JZG A;  4FIP C;  4K8X A;  4YHH O;  2ZIN A;  3H1L H;  1QLE C;  2Q7E A;  3SYP A;  2JEU A;  1DLB A;  1YJ9 V;  1I5X A;  1TUB B;  3EXA A;  4B3T B;  3JAK A;  3ZHS A;  4O2B A;  2R9A A;  2CDY A;  2IW5 A;  5CA0 A;  2GUZ A;  3T1Y O;  2UXN A;  3H01 A;  4TOI A;  5LYJ A;  2YEV A;  5LMN B;  1AP6 A;  4Q20 A;  4DYL A;  4QPK A;  2OWO A;  2K1E A;  2OYQ A;  3WB2 A;  1QCE A;  1ROP A;  3N2K A;  1VQ4 V;  2Y69 C;  1VQ9 V;  5EZY B;  3AG2 C;  1K5Q A;  1NTZ H;  3T1H B;  5LYJ B;  4FJC C;  2KSD A;  5F2V O;  4BAY A;  1WB8 A;  1VQL V;  2Q6A A;  1R6N A;  3M7M X;  3BA9 A;  2ADQ B;  1FS0 G;  1JX9 A;  4BR6 A;  3K5O A;  4XDL A;  5LL6 Y;  1QBZ A;  3OD4 A;  1IBL O;  3KZI Z;  3QTC A;  4X88 A;  2A9H A;  2W6J G;  1U97 A;  1NR7 A;  1F4M A;  2ZM6 B;  1R6K A;  4LF8 O;  2JJ1 G;  2Q67 A;  4O4I A;  2P4K A;  2CTQ A;  4W4L A;  3UM7 A;  4DV6 B;  4NXM O;  5KMG A;  1QQC A;  5KA5 A;  4PD4 F;  2JS5 A;  2ETN A;  1BMF G;  3AG3 B;  2EZP A;  3SGI A;  5LOV B;  1N0J A;  1YDX A;  4GKK B;  1EZV H;  1NTM H;  2JVD A;  1HNW B;  1YIJ V;  4GZR B;  4PA4 A;  2YSU B;  2UUB B;  4JI0 B;  1KUQ A;  4G28 B;  1Q7Y W;  1V55 B;  4JV5 O;  4HYO A;  4PA7 A;  4LR3 A;  1AI6 A;  3OEH G;  3IC9 A;  2IBZ H;  4EB6 A;  4I7Z B;  3PN1 A;  5DEC A;  3H1J H;  2HEP A;  2XHB A;  2YI9 A;  3OTO O;  5JVD B;  3CXC U;  4LH6 A;  2QA4 V;  1Q6H A;  1OCO C;  1V54 C;  3TGU H;  4TV8 A;  1AJP A;  1PPJ H;  3R65 A;  4JI5 B;  1BCC H;  4DV0 B;  2HR3 A;  1IDS A;  3I5D A;  5BXZ A;  1KD1 W;  1QLN A;  4WFE A;  1WN7 A;  4JI8 O;  3B2E E;  1BHA A;  4TV8 B;  2KQX A;  3L72 H;  2QTO A;  3HKE A;  2A7W A;  3E35 A;  1XMO O;  4FPP A;  2UXD O;  2QWO B;  4MTX A;  4LFC O;  4YJ3 B;  4LF4 O;  1RM1 B;  4PI2 A;  4TV9 B;  4JI3 O;  4TUY A;  3WFV A;  5EBW C;  4XDK A;  3NR7 A;  4GUN A;  2NNU A;  3ETE A;  3ABL B;  1MAB G;  1SRY A;  4YHH B;  2EIM C;  3QO7 A;  1FXK A;  1L1F A;  1W0K G;  1B3Q A;  3BAA A;  1L8D A;  4QNH B;  4JAS A;  1JPX A;  4ABM A;  4Z2W A;  1ZAU A;  3K03 A;  3T1Y B;  5KHK A;  4KHP O;  2VWK A;  1MNG A;  3MD0 A;  1SQB H;  2LFR A;  4YIO A;  4BWA A;  3C3S A;  1M4U A;  4I0X B;  4A5U B;  4UXN A;  2AHY A;  4DO2 A;  2P4V A;  1H2K A;  1IX9 A;  2MK3 A;  1Y74 A;  1SER A;  1WB7 A;  1PL4 A;  4NR1 A;  3CRA A;  1AI4 A;  3ZN0 A;  1GN3 A;  4WFG A;  4K0K B;  1FJG O;  1OCR B;  1SQQ H;  3TJT A;  4JI2 B;  1R3I C;  3ABU A;  5LBQ A;  5GON B;  2PYL A;  1BSM A;  1YJN V;  1TGO A;  4BIU A;  5IJ9 A;  2Q4P A;  4DR6 O;  2ZE5 A;  3U10 A;  5ITZ A;  4X20 B;  1IBL B;  2N04 A;  2LGW A;  2K9P A;  2BTQ B;  5B5E Z;  2IJJ A;  2F66 C;  5JCO A;  2YID A;  2HVJ C;  4NTW A;  1S76 D;  3E83 A;  2KKW A;  4X1Y B;  5IJ9 B;  4LF8 B;  1D5N A;  5IT9 N;  5ITZ B;  2IJH A;  4JGS A;  2HJF C;  3CME V;  4MVO A;  4F4L A;  1R6T A;  4NXM B;  1H2M A;  4HZ3 A;  2WLK A;  1K97 A;  3QO5 A;  2CTP A;  3CHX A;  1XOU A;  2Q0O C;  2QM4 A;  5KX5 B;  4MVQ A;  3RYC A;  3OT7 A;  4RQE A;  2Q5Z A;  5EIB D;  4GYC B;  2HG5 C;  4TT3 G;  2PF4 E;  5CB4 B;  4MVU A;  1H2G A;  2DOS A;  5GTI Z;  1G1X B;  1SQF A;  5IYZ B;  4Q6G A;  3CXH F;  2LP7 A;  3CCM V;  1QHT A;  4JV5 B;  3B8M A;  1LR1 A;  4QPJ A;  4BIZ A;  2UXB O;  4J7J A;  4NKG B;  2EUL A;  3IFX A;  1GMG A;  2M6Y A;  3P3P A;  5L3F A;  3E2E A;  5KHH A;  3BAB A;  4TQD A;  1SQV H;  3FB6 C;  3I56 V;  1K73 W;  4GX0 A;  3JAR B;  2PI4 A;  4B3R B;  4WFH A;  2XUM A;  4W4K A;  4DUZ O;  1BHB A;  3JCU Z;  3FB8 C;  5B3S B;  2MW2 B;  2F93 B;  3LNN A;  1PNK A;  1JVM A;  1SQP H;  1IZ3 A;  1S77 D;  1QR9 A;  1YXB A;  4DRX B;  2QE7 G;  2JRI A;  3QNE A;  3ABM C;  3H1H H;  2Y48 A;  3L74 H;  4JTD B;  3LSS A;  1SA0 A;  3GVM A;  3ZHR A;  1Y76 B;  2YUA A;  4ZOL A;  4NTX A;  1I0H A;  4JI8 B;  1CPY A;  5TIS Z;  2EIN B;  1TVK B;  2Q0A A;  3AG7 A;  1JOY A;  3K79 A;  3VOU A;  5EYP B;  2ZR3 A;  4LCU C;  4UUJ C;  1XMO B;  1TAE A;  4DV4 O;  2D2C B;  2UXD B;  4EEQ A;  4JYB A;  4LF4 B;  4CS3 A;  4JI3 B;  5LP6 B;  2VQF O;  1N32 B;  2PYJ A;  1R3L C;  1THZ A;  3OEE G;  1XNR O;  1EFR G;  2YIA A;  3ZIA G;  4IYH A;  2FKX A;  4GKJ B;  1BGY H;  1SC5 B;  3OMI B;  3JAL A;  1SKV A;  4CC5 A;  4LNU A;  3E8H A;  1HW7 A;  4KHP B;  1VQ7 V;  1YZB A;  4QJF B;  3D3I A;  2Q73 A;  2GDS A;  2QGN A;  4X62 O;  3DC5 A;  5E1A C;  1Z5W A;  1YHQ V;  1M93 A;  1OJH A;  3G80 A;  3FAV A;  3FX7 A;  3ZJZ A;  3JAW B;  3DXR A;  5DM6 V;  3G67 A;  1FJG B;  3AG3 C;  1EN6 A;  5J2U A;  2FYU H;  2LGQ A;  1KQS U;  4UFZ A;  3FAV B;  4DR6 B;  3VBB A;  3C90 A;  1UPG A;  4RO2 A;  1W2B U;  3OGC C;  4QIW F;  1V55 C;  5J2U B;  3ZRX A;  3MHS C;  1SET A;  1HNX B;  1E79 G;  5B1B C;  3QVN A;  4J7K A;  1WLE A;  1F23 A;  3UQ8 A;  1R1B A;  2Q8V A;  5IYC O;  1GM8 A;  3AEI A;  4IL6 Z;  5LHH A;  4DR3 O;  4XDJ A;  4DR1 O;  4YXW G;  3EHB B;  4WF9 V;  2WLN A;  3ZRW A;  2XAH A;  3CX5 F;  3H9V A;  2JEX A;  2XAF A;  3B4S A;  1NR1 A;  2YIC A;  4ASU G;  3ASO B;  1JMK C;  4JZ2 A;  3K57 A;  1AI5 A;  1GK9 A;  4DR2 O;  3JAT B;  2JGD A;  1EBO A;  3CCE V;  3ZRW B;  4FLW A;  1PM9 A;  2UXB B;  1ZLZ A;  3ABT A;  1SES A;  1YEW A;  5JWP A;  2DYS B;  4X8A A;  1DF5 A;  1S5J A;  3U0Z A;  3D36 C;  4NVP A;  2JGD B;  3ZS8 C;  4DUZ B;  1ZUQ A;  3HKB A;  1M57 B;  3F7V C;  3HKC B;  4JI4 O;  2XAJ A;  1WA8 B;  3MAQ A;  2GV9 A;  3M8A A;  2ZT9 B;  2FML A;  3ABL C;  3CWB H;  2YXL A;  1JFF A;  4LFB O;  2ZXW C;  4DR7 O;  3SYO A;  5KHG A;  1RPO A;  3CCL V;  1IBK B;  1VQK V;  3K04 A;  3J80 N;  2A79 B;  2UUC O;  2LQT A;  5A9G A;  3X2Q B;  1FXK C;  4FMT A;  4P9P A;  2JGU A;  4DV4 B;  3FB5 C;  4NB5 A;  4H0L B;  4QE7 A;  1K34 A;  2X6C A;  2H3O A;  3CCV V;  1E1R G;  1TUB A;  2VQF B;  3T1C A;  2JJ2 G;  1Q81 W;  3H1I H;  3CCR V;  5L3D A;  2KB1 A;  3CRC A;  1XNR B;  5IJ0 B;  4X65 B;  4DK1 A;  1XBL A;  5KAF Z;  4DR5 O;  2QWR B;  3GWO A;  1K3E A;  3SJQ C;  2HHH O;  3ABK B;  4I55 B;  1T5E A;  4XBF A;  5LHG A;  5EZY A;  1DK1 A;  1SS3 A;  2WLJ A;  2RMK B;  3WB1 A;  1R3J C;  4FLT A;  1Y6X A;  3A8T A;  4JI1 O;  2BSK B;  2BTO A;  1A32 A;  1H2N A;  1VQM V;  3TET A;  5LA6 B;  4AHC A;  2VRZ A;  1N33 O;  2EIL B;  1DGS A;  3E8B A;  5IY5 B;  3DTU B;  5IWA O;  2P06 A;  1SZX A;  3CJH A;  2AZ2 A;  3E86 A;  1F7Y A;  1NJI W;  1QNM A;  1WP8 A;  3CE2 A;  3STL C;  3JD0 A;  5KAI Z;  5H6R A;  4QGP A;  4I50 B;  4R7C A;  1DTO A;  3J7A U;  1EZJ A;  5JCO C;  3CJH B;  2IU3 A;  4DR4 O;  1BQ0 A;  1BS3 A;  1ZL8 B;  5EK0 A;  1VQP V;  5EC2 C;  4JTC B;  4DV7 O;  3BHP A;  4UCO A;  1KP3 A;  2XTA A;  1QR8 A;  4FLY A;  4CH6 A;  5LOV A;  1Y67 A;  2LJ2 A;  1HR0 B;  4RUF A;  3JD1 A;  4CS4 A;  5IDJ A;  4JF3 A;  3APO A;  2GHY A;  2EZO A;  3BPZ A;  4DR3 B;  2DMX A;  3N2G B;  4DR1 B;  4BW9 A;  2PI5 A;  2Y0I A;  2L35 A;  1GAX A;  4MTF A;  4LF7 O;  2NR5 A;  2EIJ B;  1RFY A;  2W6I G;  2DQ0 A;  3THO A;  1NQT A;  4DR2 B;  1P7G A;  3BVO A;  5JVD A;  1XRE A;  4GX1 A;  1BT8 A;  2FB5 A;  1VQ6 V;  4J9Z B;  2EIN C;  5LMU O;  5H2F Z;  3MDS A;  4U7N A;  1HNZ O;  3P32 A;  4J80 A;  2LFS A;  2F23 A;  2Z3Y A;  1LUV A;  1COW G;  5FPO A;  1KBH A;  3KKY A;  3MHH C;  3ASN B;  4NXN O;  4UCS A;  2DYR B;  1X4T A;  3AG1 C;  3OW2 U;  4IYI A;  1RPR A;  3Q4H B;  4JI4 B;  2IJI A;  3RVZ A;  3W7U A;  3D36 A;  3RWR D;  4ZIB A;  1P49 A;  3BY6 A;  4UVA A;  3RYF B;  4E4E A;  1GM9 A;  4LFB B;  4WFA V;  3UT5 B;  1N0N A;  3CSX A;  4WFB V;  1Z5V A;  4IGG A;  1NS1 A;  3H1K H;  4YJ3 A;  3RYH B;  4TV9 A;  3K3W A;  3DSQ A;  1FXV A;  2Y0P A;  4DW0 A;  3K0G A;  2RDC A;  4LH7 A;  3ZBH A;  4DXW A;  2UUC B;  3AK2 A;  1X59 A;  2QM7 A;  3OMN B;  4TQF A;  1H2S B;  4OX9 O;  3DGE A;  3K59 A;  4HNA B;  1IBM O;  1YIT V;  3CEI A;  2ZDI A;  2QTS A;  1IXB A;  2GSM B;  4ZBM A;  4DR5 B;  2QWN B;  4I0X A;  3VQY A;  3KCX A;  2HHH B;  1YSC A;  2AZ0 A;  4GT1 A;  4LF6 O;  4PDR A;  3SPG A;  5E79 Z;  1N36 O;  3E8G A;  5LXT A;  2E74 B;  1OCZ B;  2G38 A;  1M9N A;  1ORQ C;  1N8R W;  1IXM A;  3O9O A;  4JI1 B;  3ZMV A;  2EJR A;  1AJN A;  5GTH Z;  5JQG A;  1JA8 A;  3BFR A;  1N33 B;  5IYB O;  5LXT B;  4YY3 O;  5IWA B;  5GON A;  3IAY A;  4WBN A;  2Z0A A;  2OCC B;  3K0D A;  1NKD A;  4DK0 A;  2X0L A;  4X20 A;  5FPR A;  2A06 H;  4PJ0 Z;  1MA1 A;  5JQG B;  4O2A B;  2IM9 A;  2BTQ A;  1XHX A;  1WJZ A;  2ZIO A;  4WBN B;  4DR4 B;  1FD9 A;  2GTS A;  4PA6 A;  4X1Y A;  3J81 N;  4R50 A;  2IU0 A;  2QWQ B;  4DV7 B;  2RCV A;  1QLE B;  4MW3 A;  3CCJ V;  1XIL A;  1BL8 A;  5KX5 A;  4GLX A;  2PUS A;  3CRR A;  3T4Z A;  2D3O W;  4YJ2 B;  4CH4 A;  2DYS C;  4KL1 A;  5CB4 A;  5CN0 A;  1KP2 A;  1N34 O;  1WPX A;  5EBL C;  5IYZ A;  2XAG A;  3C3T A;  3TXS A;  3CB2 A;  1Q6U A;  4PEL A;  3VQV A;  3DC6 A;  4RQF A;  1M57 C;  1BE3 H;  3T2M A;  3K5M A;  1GKF A;  4CBC A;  4PDV A;  4LC1 A;  4LF7 B;  2ZE8 A;  3SJC C;  3LUT B;  5HFM A;  4G27 B;  1GO3 F;  3WU2 Z;  3JAR A;  2ZKO A;  2XOK G;  4MTO A;  2ZE7 A;  1J95 A;  1SZT A;  4DRX A;  2B1I A;  2FL4 A;  3OGI B;  1HP8 A;  4RUE A;  4MSW C;  1RP3 B;  1HNZ B;  3E22 B;  1Q3E A;  3OMA B;  3OTO B;  4DV3 O;  2B9Z A;  5B1O A;  4MT8 A;  4CS2 A;  3AG4 B;  4OXS A;  4NXN B;  3UO2 A;  1Y76 A;  2DE0 X;  4FFB B;  3SPI A;  1TVK A;  1VF6 A;  2HFE C;  4JYA O;  5EYP A;  2YXH A;  3CMA V;  2V7Q G; 
#chains in the Genus database with same CATH homology
 1NZ6 A;  4J80 A;  2YUA A;  1GH6 A;  2DN9 A;  3APO A;  2CTQ A;  1N4C A;  2KQX A;  4RWU A;  1BQ0 A;  2L6L A;  2OCH A;  1WJZ A;  2Y4T A;  1FPO A;  2Y4U A;  3AG7 A;  4J7Z A;  2GUZ B;  2LO1 A;  3BVO A;  3UCS C;  1XBL A;  3UO2 A;  1IUR A;  2EJ7 A;  2QWR B;  2CTP A;  2LGW A;  2N04 A;  2YS8 A;  3APQ A;  2M6Y A;  2QWN B;  2DMX A;  2QWP B;  1FAF A;  2CTR A;  4IT5 A;  2QWQ B;  2QWO B;  2GUZ A;  2QSA A;  3UO3 A;  2N05 A;  1BQZ A;  2PF4 E;  1HDJ A;  2CTW A;  2CUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...