2YS8A

Solution structure of the dnaj-like domain from human ras-associated protein rap1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
GSSGSSGSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab-related GTP-binding protein RabJ
publication title Solution structure of the DnaJ-like domain from human ras-associated protein Rap1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ys8A00
2QWQB 3APQA 2CTQA 1WJZA 1BQ0A 2Y4UA 2OCHA 2LGWA 2QWPB 2QWNB 3APOA 2CTPA 2EJ7A 2N05A 3UCSC 2DN9A 4IT5A 1FPOA 4J80A 1IURA 2N04A 2GUZA 1N4CA 2LO1A 2L6LA 2PF4E 2DMXA 2YUAA 1GH6A 2YS8A 1BQZA 2QWRB 1HDJA 2CUGA 1XBLA 4RWUA 4J7ZA 2KQXA 3UO3A 2QWOB 2GUZB 2QSAA 2Y4TA 2M6YA 2CTWA 3UO2A 1FAFA 2CTRA 1NZ6A 3AG7A 3BVOA
chains in the Genus database with same CATH superfamily
2AXTZ 1H2GA 4DV4O 2F4VO 5KAFZ 2Z3YA 1L8DA 5LMNO 3K59A 4NXMO 1W59A 1TUBA 3FB7C 3L70H 3DXRB 2AW9A 2ZE8A 1HNWO 1Y76A 4H0LB 4QJFB 3CC4V 4QE7A 1SQVH 3EVKA 3OW2U 3PN1A 4IGGA 3UM7A 3DC5A 2MK3A 3G67A 1MSWD 1TUEB 4CH3A 3N2GB 1NQTA 5LGTA 4KFMA 4TUYB 4UB8Z 1K92A 5IE9A 1SA0A 1S5HC 3RYFB 1YF2A 2AGAA 3H1LH 2JEUA 1QHTA 1NVPB 2WLIB 4N21A 3TJTA 3OM3B 1JX9A 1BQ0A 3O9OA 3UT5A 1XDCA 4KUMA 3GB7C 1FFXB 1OCCC 2Q67A 2AHYA 2GBOA 4KHPB 1XQ8A 1WB8A 5J9PC 3IC7A 4DR4O 4CBCA 1WNSA 2H8PC 2X6CA 2ADQB 2ITCC 1D2DA 4RUEA 1M9NA 5LOVA 3ZEDA 4K0KB 4YHHO 2V7QG 3AK3A 3CX5F 1K33A 5L3BA 3ZN1A 3OUFA 5FL7G 5KX5A 3K3WA 4O4LB 3CCRV 4PA3A 3JATA 3CPWU 2ODMA 2E76B 1BMFG 3L74H 5H6QA 3RFRA 2FMLA 4DUZB 4WFHA 3T4DA 3JYCA 2A9HA 4PI2A 3SPHA 4BWAA 4JAVA 4AI8A 1I7FA 1N34O 1VQ9V 3ZHTA 3K06A 3CS5A 3OFNG 1R6TA 2WWWA 4JTAB 2DYRB 1RP3B 4LNUB 2UXDO 4JI8B 3R66A 5TISZ 1HDJA 3X2QC 2Q7GA 1ORQC 2RQ6A 2QA4V 4P2ZA 1R3JC 1UJWB 1PPJH 3ABTA 4DR1O 1AI5A 3QNEA 4ZOLA 2UUCB 2OWOA 2Y4UA 1W2BU 4LF5O 2KSDA 1B6QA 4HNAA 4TV8B 2ZKOA 4LF9O 4BIUA 1V55C 4CC6A 4LF4B 4DR6B 4LF6O 1FFTB 3G71V 4MT8A 4ZBMA 3ETGA 2JS5A 2CTWA 4EEQA 5KMGB 2V4DA 3CC2V 1I08A 4UCSA 5LL6Y 1CXZB 3KG2A 5LHHA 4J80A 5GONB 1KYOF 4LP8A 2EIMB 2ZXWC 3CWBH 1V9PA 2EILC 3SYPA 4BIZA 1RM1B 2P7TC 4LF7O 3B09A 1YI2V 2X0LA 4X1YA 2F95B 3RWRD 4AILC 3A0HZ 4LH6A 4KL1A 3CXHF 3HKCA 3OMNB 1QLNA 2JDIG 3E8GA 4DV2O 4FVMA 1TVKA 5CB4A 1JMKC 1GH6A 3FB8C 1FXKC 1F4MA 1TUBB 2WAMA 2P4VA 3E86A 1OJHA 3STLC 1VQPV 2IJJA 1ZSPA 2QWQB 2GV9A 1Y76B 1Q3EA 5EYPA 2N05A 1ZLZA 2Y48A 5C8YA 4DUYB 5GW7A 2YDEA 4R8CA 5EIBC 3CCLV 4LH7A 1JJ2U 2E75B 2Q68A 1SA0B 4MW8A 3HKDA 1SQPH 3H1HH 3JSLA 4WF9V 2HVKC 3LUTB 1NTZH 4DV7B 4Q6GA 1KU9A 2KKWA 2YXYA 2P22C 4QPKA 3ZHUA 3UT5B 1YDXA 2ZM6O 2EJRA 1EN5A 1VQ7V 3BAAA 1MG1A 4JI5B 2Q9LA 5EBMC 2A0LA 1S77D 4Z1MG 4FPPA 5HFMA 5H9CA 2R9AA 5IYDO 3BRCA 2DYSB 3MHHC 5L3DA 1COWG 3K58A 5KLVH 5LOVB 1AILA 2N04A 1DGSA 1WA8A 1FXKA 1YZBA 1ZX3A 4MVRA 3RW0A 3UKMA 1IBLO 2PYLA 5KX5B 1ZAUA 3BY6A 3OMIB 2QM7A 4MW3A 1Z2GA 3JATB 2VQEB 4NXNO 1YXBA 1P7BA 1Q86W 3P3PA 4JZ2A 4YY3B 5LP6C 1NR1A 2JK5C 1Q8IA 4FM2A 1YJWV 4J9YB 2H3OA 3T2MA 5KUKA 2OIEA 3ZHQA 1H2NA 1BQZA 4WCEV 5B1AC 2XHBA 1E1RG 1F23A 4JAUA 4J7JA 1XL4A 4JI2B 1NI8A 2ITDC 4QPJA 4U7OA 3CYOA 4JZGA 1KB9F 2BSKA 2DWEC 3ZX6A 2QM4A 4JYAB 4FLTA 4ZOLB 3HKEA 3ABMC 3IGAC 3E2EA 4PJ0Z 3N27A 1OCCB 2YUAA 1VQOV 4HNAB 2IJIA 2Q5ZA 2PGGA 3ZBHA 4RQFA 1NVPD 4CS4A 4H13B 3VOUA 4DO2A 4X64B 3SJBC 5JWPA 3H1IH 5K1PA 4R6ZA 3AK2A 3E8BA 2OTJV 4QGPA 1M93A 4NYKA 4Q20A 4B3MB 2CUGA 4BW5A 1BHAA 4I0XA 4GKJO 1AP5A 4X66O 3QO5A 1K73W 4JI3B 3DC6A 1A32A 2B1IA 5LP6A 4CZZA 5JQGA 4FFBA 2A3QA 1FJGB 4X1YB 3GVMA 2BOCC 2UUBO 1J95A 1YIJV 5B1BC 2OIGA 3FAVB 5FNVA 3FYEB 1TVKB 3K0DA 5CB4B 4FM1A 3FYIB 3X2QB 5KUMA 1PNKA 3T1HB 5LMUB 5IWAB 4KXRA 5KA6A 3SPJA 1WLEA 2DJVA 4L8JA 3M99B 5EYPB 4OGQB 2R9RB 1V55B 3W7UA 5C8YB 1WP7A 1BS3A 1S72V 4UCRA 3OTOB 1VF5B 3THOA 1P84F 1NT2B 3Q4HA 4O2AA 1R3IC 4HZ3A 1Q5OA 2PI5A 4X65B 3JARA 4DV3B 2RMKB 4TSFG 1XHZA 1K97A 4DR7B 1HP8A 1Q81W 1GN4A 1K34A 3M8AA 4PDMA 4MS2A 4DR3O 2ZXWB 3CXCU 2EILB 1RPOA 4LR3A 2CK3G 3RVYA 2QWPB 1MMMA 3A2FA 5L3FA 2UXCO 1R3LC 3TCUA 1H2LA 2IU3A 1ZL8A 3ZS8C 4DV4B 2QKCA 4UVAA 2YIAA 1NS1A 2JIZG 5LMNB 1Q82W 5D5QA 3G6BA 1J5EO 5J2UA 4YJ3A 4NTWA 3SPCA 3WG7C 4UVCA 5CA0A 4IHJA 1FXKB 1FYJA 1GK9A 1HNWB 2IM9A 4F6RA 2DW4A 2UUAB 4ZI7A 2YIBD 4J9ZB 2LQTA 4FLXA 4LCUC 1NTKH 1JQ0A 2HKOA 3JSNA 3EXAA 4LWSA 3HKBA 4DW0A 1YITV 1BHBA 1H38A 3JD3A 2WA3A 4DK1A 3J81N 2IU0A 2F93B 4B3TB 1IDSA 1VQ4V 2Q73A 3L75H 4PDLA 4PD4F 2GHYA 1OCOC 2GTSA 4E4EA 4X20A 2WLJA 3ZCCA 2GUZA 2ZD9A 1EZJA 3STZC 3VQWA 2BSKB 2DMXA 2GDSA 2YS8A 3P32A 3H9VA 4EFEA 2AZ0A 5L3CA 2Q0AA 1PL4A 3L9DA 4MSWC 4CS2A 3HKEB 2HJFC 1VARA 1NZ6A 3ZMUA 3AK1A 1B3QA 2VRZA 1JR9A 1ZWIC 4JI6B 5LYJA 3RT3C 2GSMB 3RYIB 4FZ1A 1S5LZ 4TV9A 4I5SA 1DF4A 4AQYO 2HEPA 4UB6Z 4CH4A 4OXSA 4YHHB 1M56C 1YTFB 3P3NA 2QWOB 5IJ0A 1D5AA 4JI1B 2VQFO 1IBKB 1GRJA 3L71H 3LNMB 1KECA 3CRMA 4FLWA 1R6NA 4I0XB 2UXBO 2FTKA 5LP6B 5JQGB 4DV6O 2PYJA 4FFBB 1N34B 1Y74A 2EIJC 3ZMTA 2VWJA 4LFCB 2XAGA 3T4ZA 4B7EA 2JGUA 5EBLC 3ZHSA 3APQA 5B1AB 3ZMZA 2UXDB 1HW7A 1XMQO 2EJ7A 3ZRWA 5FNVB 4LFBB 4DR1B 3OGCC 3LSQA 3QO7A 4UCOA 1Y4MA 4LF5B 2Q4PA 2A7WA 1GAXA 1XBLA 3ABMB 4LF9B 3T1CA 4I7ZB 2BTQA 1SQBH 3WU2Z 4LF6B 2IH1C 5C93A 5BXZA 5GTIZ 2LJ2A 5CA1A 1IZ3A 3K5MA 2CGNA 3Q4HB 4O2AB 2QR4A 3JARB 1ROPA 4K3AA 4UCUA 3BVOA 1NR7A 3SPGA 5DM6V 1N32O 5BR8O 4TQDA 4WBNA 2XAQA 4NTXA 4HAMA 2JEXA 4MVZA 2FL4A 4I50A 4PDRA 1AI7A 4LF7B 5JH7A 1OV9A 2ZE6A 2FB5A 5H6RA 4GX2A 3OUSA 1PKXA 2YI8A 3IAYA 4P30A 1GM9A 2P67A 4RUFA 1FAFA 1GN6A 1BL8A 1ZL8B 4J11A 4DV2B 3CMEV 1F4NA 2CTPA 3T1YO 3A8TA 2LGQA 2DN9A 3SDLA 5J2UB 1VP7A 3AG2C 4YJ3B 4LF8O 5CA0B 1R1BA 1PD3A 4F6RB 3DTUB 1DK1A 4ZI7B 2EINC 2F23A 3OMAB 3F7YC 2CE4A 3C3TA 4LWSB 3HKBB 1YJNV 2HR3A 3KKYA 1JA8A 3D3IA 2QEXV 4TQFA 2EZPA 5IT9N 2M7WA 3VQVA 1FXHA 2UXNA 4JI0O 1QVFU 5IY5C 1XILA 5GTHZ 3OEEG 4X20B 4NKGB 2GUZB 4EFBA 1SESA 4O4HA 4B3RB 1V54C 3ETQA 3ZRVA 2ZM6B 1S0VA 2ZNJA 3M7MX 2E5LB 1Y66A 4OPHA 3BFRA 1I94B 3SR2C 1N4CA 1ENVA 4BIOA 2EULA 4K8ZA 2EBOA 1DF5A 4XDLA 4RAIA 5LYJB 5B1OA 4TV9B 1P7GA 3E35A 3TGUH 1M5IA 4PA6A 3JAMN 3D3QA 5IJ0B 4JYYA 3WG7B 1P49A 4X1KA 2QE7G 4FIPC 4NXNB 4PA9A 4P9OA 2WLMA 1Q6UA 2BTOA 5EZYA 2P06A 3B8NA 1Z5WA 3BHPA 3LDCA 2WLKA 2ZT9B 4DUZO 2KG7A 3CCMV 1Y74B 1HR0O 1GTOA 2F1MA 3QTCA 3FX7A 1HNZO 2FYUH 1OCOB 5K1XA 4DV5O 4GCZA 4NTYA 3OE7G 4MVMA 4DR2O 3ZRWB 2CDYA 3OEHG 1XNQO 3LSSA 3CRAA 1HWYA 2XAJA 1KBHA 5EIBD 2CAZC 2UUCO 1XMOO 1VMGA 1HNXO 1WP8A 1KUQA 2BTQB 4J7KA 2QTSA 5JCOC 4MVUA 5EK0A 5CA1B 4LF4O 1XOUA 2JGDA 4U3JA 1M56B 2ZCEA 1PNLA 4TOIA 3QG5A 1VQNV 1Q43A 4GKJB 4X66B 2GTAA 4X62O 4WBNB 3CRRA 1N36O 4I50B 1IXMA 2X6AA 5JH7B 5CBGA 4ABMA 4N23A 3JAKA 4X1IA 4GT1A 1N33B 3S3WA 1YTFD 2EIJB 1G8MA 4FM0A 1PL0A 1WN7A 5LXTA 2IH3C 2HLDG 3KZIZ 1EN6A 4YJ2A 4NB5A 5F2VO 1LNQA 2XNDG 1G4YB 5KA5A 3OGIB 3BPZA 2ZR2A 2KB1A 1T5EA 3A0BZ 1US6A 4JV5B 3G80A 4GUNA 2DWDC 1AR5A 4F6EA 3IFXA 2HHHB 4U7NA 1VQMV 4KP4A 1E79G 1XL6A 3C90A 4D7SA 5JCOA 1RFYA 2B5UA 3QVNA 3RVZA 5A2QN 1VQ8V 4I9WA 1CPYA 1KKDA 2Y4TA 3GWKC 4CH5A 3CSXA 4IYIA 3R65A 4O4HB 3TK1A 4DR3B 1EBOA 4B3SB 5CBHA 3JALA 4GKKB 1F7YA 4JAAA 4FJCC 1JPXA 2W6JG 1YEWA 4UV8A 3SJCC 2HVJC 1Q6HA 3ASNC 2QWNB 1VIBA 2JRIA 1M57C 1VQLV 3K79A 3WB1A 2EX3A 5IJ9A 1J5EB 2LW1A 1FD9A 1KKCA 5FPRA 4ZKIA 3AG2B 1AR4A 5JJEB 3CCQV 4X1KB 3HKCB 4I55A 4ASUG 3UO2A 2V1DA 2ETNA 3E22A 1H8HG 3FD9A 4LFAB 3O65A 2G38A 3ASOC 4NR1A 5KHHA 4A5UB 2EZOA 2KG7B 3N2GA 3TETA 4PHZA 5B3SC 4X8AA 5CBFA 4J42A 1BCCH 4JF3A 1NKDA 3F5WC 1H2MA 3U10A 3UQ8A 4YIOA 4MVOA 2H94A 3VBBA 2PUSA 2ZDIC 1QCEA 2B1GA 4JTCB 4YIPA 1GM7A 4OX9O 4PA7A 4DR5O 1QR9A 2BCCH 3TXSA 5CMUA 1V54B 3FKSG 3HKDB 3OTFA 2QGNA 5E79Z 3H01A 4DRXA 2PI4A 1SRYA 2ATKC 2RN9A 5H2FZ 1MZEA 4DW1A 4EB6A 4MTOA 4JI7O 4QNHB 3DGEA 4XDJA 1OCRC 2K1EA 4AQYB 3CRCA 3APOA 3BA9A 2UU9B 3ABKC 4IT5A 2HP8A 3LNNA 3H1KH 4MTFA 1IURA 3ICXA 2JGDB 4U3JB 3SPIA 5DECA 3CCEV 2F4VB 2IBZH 4NXMB 3RYHA 4O4LA 2UXBB 1WA8B 4B3MO 3JD4A 1TAEA 1MSDA 2ZNIA 3UCSC 4DV6B 2YC0A 3BA8A 3K04A 3JAKB 4X1IB 4JI3O 4ZIBA 5HFLA 1OHHG 1PV0A 3HR0A 3ZHRA 4O2BA 1RSOA 1FJGO 5LXTB 1SKVA 4FK5C 3RYCA 1XMQB 3ZHVA 2JVDA 4AHCA 2Y69C 2ZDIA 2Q7EA 1S76D 4YJ2B 1K3EA 4DV1O 1NU1H 1EM1A 3ABUA 1AI6A 4DK0A 1NH2B 5EC2C 5IYZA 1KC8W 5LHGA 5IYBO 1IBMO 3B2EE 2XAHA 1QBZA 3CC7V 2WSSG 3T1HO 3B4SA 5IWAO 2O57A 5JJJB 4JASA 3LDEA 1LUVA 1IXBA 1THZA 1NTMH 4H37A 2VWKA 2LFRA 3WFVA 2AZ2A 3DSQA 3ZRSA 5IYCO 3ABLC 4DR4B 2OCCC 4G2KA 1DTOA 3FB5C 2NN4A 1N32B 3CRQA 3K0GA 4CH6A 2YXHA 2YEVA 3QO8A 4FZ0A 4CC5A 1BSMA 4DV3O 3J7AU 1BT8A 3CCSV 4W4KA 1EZVH 1YCIA 3JALB 1URFA 3EHBB 1MA1A 4O4JA 3SJAC 3SYAA 2DQ3A 1QU7A 2IJHA 1AP6A 4X9QA 3D36C 4MTGA 4WFFA 1CP9A 3AG4C 1N0NA 5DEDA 1OCZC 3T1YB 5IJ9B 4FLZA 1KMIZ 1ZTEA 1KQSU 4LF8B 2Q69A 2YSUB 3AEIA 4JYBA 5H5NA 1K4CC 3CP1A 2PY5A 1AJPA 3A0RA 2YICA 1Z5VA 2ZQMA 5LBQA 4I55B 1Q7YW 2YI9A 3SYCA 3E22B 2UUAO 1MOFA 1MNGA 5B66Z 3CCVV 1UFIA 2LFSA 2LW7A 5CA3A 3ML0A 4JI0B 3GWOA 4F4LA 1AR1B 4DV0O 1R3KC 4FFKA 5AG2A 4B3TO 3VQYA 5LGUA 3WB2A 1Y6XA 3TXQA 4UCTA 2CGOA 2AHZA 4DRXB 2BOBC 1AJQA 3ZIAG 4WFAV 1JFFA 2WLHA 3OD4A 2WLNA 4EB6B 1AI4A 1M4UA 4JI4O 1XNRO 2ZIOA 5BMVA 1H2SB 3D36A 1R6KA 3ASNB 4I4TA 1R73A 1M57B 1M1KW 4ICGA 4DYLA 4JI6O 1BGYH 2ARHA 5A9GA 1AB3A 2ZIMA 1VQ5V 2Q7HA 4FLVA 1PP9H 3FB6C 1BZKA 1LR1A 1O9GA 4GZRB 4JI1O 4R7CA 2HJDA 5B1BB 3RYHB 1IVSA 1I5XA 3CMAV 5J2TA 5KHGA 1IBKO 4JYCA 4IHJB 4UFZA 2EIKC 3ZMSA 1SETA 4UV9A 3JASA 3ETEA 2UXXA 1HR0B 1JVMA 3ASOB 3K08A 1SQFA 1O9HA 3E8FA 2E3CA 2VS0A 1HNZB 5B3SB 4O2BB 1RSOB 4DV5B 1XI1A 4LFCO 3RYCB 3K9SA 4E2LA 2CH7A 4DR2B 1XNQB 4YXWG 2OYQA 3RBZA 1TA8A 3JD2A 1GKFA 4LFBO 2Q8VA 5IYZB 3K57A 5FLXN 1XMOB 1N8RW 5ITZA 1HNXB 5LA6A 4O4IA 4UXNA 1VQ6V 4XDKA 5FPOA 3WB0A 2XAFA 3FFQA 1K9MW 1OCRB 2F43G 1VQKV 3RN4A 4BAYA 2IW5A 3ABKB 1SF9A 2ZE7A 2YXLA 1M90W 4KHPO 4C7UA 3ZN0A 2M6YA 4LBEC 2Y0PA 3BEHA 2YEVB 4K35A 4X62B 4D6TH 2PZSA 5CN0A 1N36B 1IBLB 2Y0IA 4K0KO 3L72H 4WFEA 1AROP 4PA4A 2HG5C 3I55V 1I0HA 1SZTA 5IDJA 4O4JB 4PV1B 3JAWA 2P4KA 1FKAO 4HBNA 1SERA 1QNMA 2ZE5A 3CD6V 4PELA 5JVDA 2OCHA 4ZHQA 1K4DC 3MAQA 1EN4A 4WFBV 4I9QA 1RPRA 3CCUV 2N74A 1NBMG 3CJHA 2Y69B 2ZR3A 2NLJC 3FAVA 3B77A 1QLEC 4Z1VA 3U0ZA 1GO3F 3AG3C 4MVSA 1K8AW 4UUJC 2KQXA 1IX9A 1UPGA 2P5OA 1GN2A 1DLBA 1XEQA 4JI8O 3IJ4A 1QVGU 4TT3G 4X89A 4D7TA 3SYOA 3JD0A 2FKXA 3K5LA 4RQEA 2DE0X 3ABLB 1NH2D 1G1XB 1CEZA 2OCCB 3I5DA 2DQ0A 3MD0A 2WA4A 1U97A 2XOKG 1D5NA 3K5OA 3K03A 4DR6O 2ILMA 1Y67A 1OZ0A 2X6BA 4QE9A 2OT5A 4U3FH 4P9PA 4B3RO 2A79B 1Q90D 3E89A 5KAIZ 1JFFB 3B8MA 3LDDA 2E74B 3SYQA 2RJZA 2E5LO 1L0NH 3JCZA 1H2KA 3OR7C 1I94O 5BMVB 5JJNB 3K9AA 2PTMA 4I4TB 3AG4B 1NJIW 2Q0OC 2Z5UA 1OCZB 1LUWA 2XUMA 2UUBB 2MW2B 2P6JA 1WAZA 1W0JG 2WLLA 3AG1C 4FLYA 2QWRB 3PJSK 2K9PA 1JCHA 2XTAA 2A06H 1S3JA 5J2TB 3CE2A 3S3XA 4GLXA 1P4RA 3NR7A 3F7VC 3JASB 2NNUA 1JOYA 4FLUA 3E8HA 2DOSA 1F51A 2JJ2G 3E83A 1SC5B 2ZINA 3VQXA 2WPDG 2RCVA 1VF7A 2CH7B 3ZMVA 2D2CB 3JCUZ 4UCVA 1FXVA 1SZXA 4X88A 4DUYO 4PDVA 4DR5B 4OX9B 4UVBA 2D3OW 1X4TA 3D8CA 3OR6C 4R50A 3G6EV 1BE3H 3W7XA 4J41A 5LHIA 3N2KA 3W7WA 3EFFK 4JI7B 5ITZB 2QM8A 3ZRXA 3BCCH 1PM9A 5LA6B 2PF4E 3OT7A 4GX1A 4O4IB 5KHKA 3BABA 4DV7O 4L87A 2F66C 3RYIA 1YJ9V 2UXCB 2B9ZA 3AG7A 5B5EZ 2BE3A 4FMTA 2CTQA 1WJZA 1WPXA 4JI5O 4GX5A 1H8EG 4OPAA 4IIJA 5BY1A 5B1NA 4RO2A 2R9IA 2X7RB 1XHXA 4NVPA 3NXSA 2QJ1A 1WB7A 4G27B 2EIKB 3CEIA 3RGBA 2YIDA 3DXRA 1GM8A 1AVMA 5BZBA 2EINB 1B04A 1S5JA 3JAWB 1SQQH 4GYCB 1Q6IA 2JJ1G 4JTDB 1W0KG 5EZYB 3KCXA 2NR5A 2VQEO 1N33O 4DXWA 4QIWF 4TWKA 5JVDB 4ZHQB 4YY3O 5KHIA 4WFGA 3SJQC 4DV1B 3CJHB 4TUYA 2QKSA 2QSAA 1IBMB 5IY5B 3RYFA 2DYRC 2XASA 4HYOA 1KP2A 3L73H 3U11A 4JI2O 2ADPA 1TGOA 1SQXH 1SQGA 2WLIA 5EC1C 3P30A 3SGIA 3J80N 5KHJA 4JV5O 2QTOA 3OAAG 2JS3A 2L6LA 4MVQA 3W7SA 4LC1A 2XT9A 2HHHO 3KCYA 4JYAO 1FFXA 4CS3A 1N0JA 5EBWC 4Z2WA 1K7DA 4XBFA 1AJNA 4JGSA 1G6UA 5DN6G 1SS3A 1XREA 4JPRA 4W4LA 1ZUQA 3H1JH 2VQFB 1E1QG 4X64O 1PNMA 2C2AA 1MZFA 1EFRG 2HFEC 5D5PA 4GX0A 4B3SO 4GKKO 2LGWA 2EIMC 3LSUA 2LP7A 3K5NA 3CB2A 1RM1C 1VF6C 2RDCA 2LO1A 2Z0AA 5L3EA 1GN3A 3HPLC 3CCJV 2QDOA 2QKAA 1QR8A 4IL6Z 1KP3A 1QLEB 2Q6AA 4J7ZA 3G4SV 2OTLV 2WLLB 2CTRA 3AG3B 2W6IG 3MDSA 4PI0A 4LNUA 1U96A 1K5QA 2P90A 4K8XA 2R70A 4LFAO 1FS0G 3B40A 2RNBA 2IJKA 5LMUO 4DV0B 4MTXA 4TV8A 3UO3A 1I5YA 1K5SA 1L0LH 3W7TA 1XUQA 3ETDA 1X59A 4EKWA 2R72A 2W0FC 5E1AC 1B06A 1JJOA 4H44B 3OTOO 5LGNA 5KMGA 3I56V 5BR8B 3N2KB 1VEWA 4H33A 4BR6A 4X65O 1WPBA 4JI4B 1XNRB 2W0XA 5GONA 4J10A 4DR7O 1KD1W 1YHQV 1YSCA 1GMGA 3F5TA 1L1FA 1QQCA 1FPOA 3QF7A 1VF6A 3CHXA 5L3GA 3MHSC 2YIBA 3ZJZA 3HB3B 4G28B 2UU9O 4IYHA 1MABG 3C3SA 1YVWA 2DYSC 3IC9A 3JD1A 4RWUA 4IIJB 4B08A 4BW9A 2L35A 3AG1B 4B7KA
chains in the Genus database with same CATH topology
2QWQB 3APQA 2CTQA 1WJZA 1BQ0A 2Y4UA 2OCHA 2LGWA 2QWPB 2QWNB 3APOA 2CTPA 2EJ7A 2N05A 3UCSC 2DN9A 4IT5A 1FPOA 4J80A 1IURA 2N04A 2GUZA 1N4CA 2LO1A 2L6LA 2PF4E 2DMXA 2YUAA 1GH6A 2YS8A 1BQZA 2QWRB 1HDJA 2CUGA 1XBLA 4RWUA 4J7ZA 2KQXA 3UO3A 2QWOB 2GUZB 2QSAA 2Y4TA 2M6YA 2CTWA 3UO2A 1FAFA 2CTRA 1NZ6A 3AG7A 3BVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWQ B;  3APQ A;  2CTQ A;  1WJZ A;  1BQ0 A;  2Y4U A;  2OCH A;  2LGW A;  2QWP B;  2QWN B;  3APO A;  2CTP A;  2EJ7 A;  2N05 A;  3UCS C;  2DN9 A;  4IT5 A;  1FPO A;  4J80 A;  1IUR A;  2N04 A;  2GUZ A;  1N4C A;  2LO1 A;  2L6L A;  2PF4 E;  2DMX A;  2YUA A;  1GH6 A;  2YS8 A;  1BQZ A;  2QWR B;  1HDJ A;  2CUG A;  1XBL A;  4RWU A;  4J7Z A;  2KQX A;  3UO3 A;  2QWO B;  2GUZ B;  2QSA A;  2Y4T A;  2M6Y A;  2CTW A;  3UO2 A;  1FAF A;  2CTR A;  1NZ6 A;  3AG7 A;  3BVO A; 
#chains in the Genus database with same CATH topology
 2AXT Z;  1H2G A;  4DV4 O;  2F4V O;  5KAF Z;  2Z3Y A;  1L8D A;  5LMN O;  3K59 A;  4NXM O;  1W59 A;  1TUB A;  3FB7 C;  3L70 H;  3DXR B;  2AW9 A;  2ZE8 A;  1HNW O;  1Y76 A;  4H0L B;  4QJF B;  3CC4 V;  4QE7 A;  1SQV H;  3EVK A;  3OW2 U;  3PN1 A;  4IGG A;  3UM7 A;  3DC5 A;  2MK3 A;  3G67 A;  1MSW D;  1TUE B;  4CH3 A;  3N2G B;  1NQT A;  5LGT A;  4KFM A;  4TUY B;  4UB8 Z;  1K92 A;  5IE9 A;  1SA0 A;  1S5H C;  3RYF B;  1YF2 A;  2AGA A;  3H1L H;  2JEU A;  1QHT A;  1NVP B;  2WLI B;  4N21 A;  3TJT A;  3OM3 B;  1JX9 A;  1BQ0 A;  3O9O A;  3UT5 A;  1XDC A;  4KUM A;  3GB7 C;  1FFX B;  1OCC C;  2Q67 A;  2AHY A;  2GBO A;  4KHP B;  1XQ8 A;  1WB8 A;  5J9P C;  3IC7 A;  4DR4 O;  4CBC A;  1WNS A;  2H8P C;  2X6C A;  2ADQ B;  2ITC C;  1D2D A;  4RUE A;  1M9N A;  5LOV A;  3ZED A;  4K0K B;  4YHH O;  2V7Q G;  3AK3 A;  3CX5 F;  1K33 A;  5L3B A;  3ZN1 A;  3OUF A;  5FL7 G;  5KX5 A;  3K3W A;  4O4L B;  3CCR V;  4PA3 A;  3JAT A;  3CPW U;  2ODM A;  2E76 B;  1BMF G;  3L74 H;  5H6Q A;  3RFR A;  2FML A;  4DUZ B;  4WFH A;  3T4D A;  3JYC A;  2A9H A;  4PI2 A;  3SPH A;  4BWA A;  4JAV A;  4AI8 A;  1I7F A;  1N34 O;  1VQ9 V;  3ZHT A;  3K06 A;  3CS5 A;  3OFN G;  1R6T A;  2WWW A;  4JTA B;  2DYR B;  1RP3 B;  4LNU B;  2UXD O;  4JI8 B;  3R66 A;  5TIS Z;  1HDJ A;  3X2Q C;  2Q7G A;  1ORQ C;  2RQ6 A;  2QA4 V;  4P2Z A;  1R3J C;  1UJW B;  1PPJ H;  3ABT A;  4DR1 O;  1AI5 A;  3QNE A;  4ZOL A;  2UUC B;  2OWO A;  2Y4U A;  1W2B U;  4LF5 O;  2KSD A;  1B6Q A;  4HNA A;  4TV8 B;  2ZKO A;  4LF9 O;  4BIU A;  1V55 C;  4CC6 A;  4LF4 B;  4DR6 B;  4LF6 O;  1FFT B;  3G71 V;  4MT8 A;  4ZBM A;  3ETG A;  2JS5 A;  2CTW A;  4EEQ A;  5KMG B;  2V4D A;  3CC2 V;  1I08 A;  4UCS A;  5LL6 Y;  1CXZ B;  3KG2 A;  5LHH A;  4J80 A;  5GON B;  1KYO F;  4LP8 A;  2EIM B;  2ZXW C;  3CWB H;  1V9P A;  2EIL C;  3SYP A;  4BIZ A;  1RM1 B;  2P7T C;  4LF7 O;  3B09 A;  1YI2 V;  2X0L A;  4X1Y A;  2F95 B;  3RWR D;  4AIL C;  3A0H Z;  4LH6 A;  4KL1 A;  3CXH F;  3HKC A;  3OMN B;  1QLN A;  2JDI G;  3E8G A;  4DV2 O;  4FVM A;  1TVK A;  5CB4 A;  1JMK C;  1GH6 A;  3FB8 C;  1FXK C;  1F4M A;  1TUB B;  2WAM A;  2P4V A;  3E86 A;  1OJH A;  3STL C;  1VQP V;  2IJJ A;  1ZSP A;  2QWQ B;  2GV9 A;  1Y76 B;  1Q3E A;  5EYP A;  2N05 A;  1ZLZ A;  2Y48 A;  5C8Y A;  4DUY B;  5GW7 A;  2YDE A;  4R8C A;  5EIB C;  3CCL V;  4LH7 A;  1JJ2 U;  2E75 B;  2Q68 A;  1SA0 B;  4MW8 A;  3HKD A;  1SQP H;  3H1H H;  3JSL A;  4WF9 V;  2HVK C;  3LUT B;  1NTZ H;  4DV7 B;  4Q6G A;  1KU9 A;  2KKW A;  2YXY A;  2P22 C;  4QPK A;  3ZHU A;  3UT5 B;  1YDX A;  2ZM6 O;  2EJR A;  1EN5 A;  1VQ7 V;  3BAA A;  1MG1 A;  4JI5 B;  2Q9L A;  5EBM C;  2A0L A;  1S77 D;  4Z1M G;  4FPP A;  5HFM A;  5H9C A;  2R9A A;  5IYD O;  3BRC A;  2DYS B;  3MHH C;  5L3D A;  1COW G;  3K58 A;  5KLV H;  5LOV B;  1AIL A;  2N04 A;  1DGS A;  1WA8 A;  1FXK A;  1YZB A;  1ZX3 A;  4MVR A;  3RW0 A;  3UKM A;  1IBL O;  2PYL A;  5KX5 B;  1ZAU A;  3BY6 A;  3OMI B;  2QM7 A;  4MW3 A;  1Z2G A;  3JAT B;  2VQE B;  4NXN O;  1YXB A;  1P7B A;  1Q86 W;  3P3P A;  4JZ2 A;  4YY3 B;  5LP6 C;  1NR1 A;  2JK5 C;  1Q8I A;  4FM2 A;  1YJW V;  4J9Y B;  2H3O A;  3T2M A;  5KUK A;  2OIE A;  3ZHQ A;  1H2N A;  1BQZ A;  4WCE V;  5B1A C;  2XHB A;  1E1R G;  1F23 A;  4JAU A;  4J7J A;  1XL4 A;  4JI2 B;  1NI8 A;  2ITD C;  4QPJ A;  4U7O A;  3CYO A;  4JZG A;  1KB9 F;  2BSK A;  2DWE C;  3ZX6 A;  2QM4 A;  4JYA B;  4FLT A;  4ZOL B;  3HKE A;  3ABM C;  3IGA C;  3E2E A;  4PJ0 Z;  3N27 A;  1OCC B;  2YUA A;  1VQO V;  4HNA B;  2IJI A;  2Q5Z A;  2PGG A;  3ZBH A;  4RQF A;  1NVP D;  4CS4 A;  4H13 B;  3VOU A;  4DO2 A;  4X64 B;  3SJB C;  5JWP A;  3H1I H;  5K1P A;  4R6Z A;  3AK2 A;  3E8B A;  2OTJ V;  4QGP A;  1M93 A;  4NYK A;  4Q20 A;  4B3M B;  2CUG A;  4BW5 A;  1BHA A;  4I0X A;  4GKJ O;  1AP5 A;  4X66 O;  3QO5 A;  1K73 W;  4JI3 B;  3DC6 A;  1A32 A;  2B1I A;  5LP6 A;  4CZZ A;  5JQG A;  4FFB A;  2A3Q A;  1FJG B;  4X1Y B;  3GVM A;  2BOC C;  2UUB O;  1J95 A;  1YIJ V;  5B1B C;  2OIG A;  3FAV B;  5FNV A;  3FYE B;  1TVK B;  3K0D A;  5CB4 B;  4FM1 A;  3FYI B;  3X2Q B;  5KUM A;  1PNK A;  3T1H B;  5LMU B;  5IWA B;  4KXR A;  5KA6 A;  3SPJ A;  1WLE A;  2DJV A;  4L8J A;  3M99 B;  5EYP B;  4OGQ B;  2R9R B;  1V55 B;  3W7U A;  5C8Y B;  1WP7 A;  1BS3 A;  1S72 V;  4UCR A;  3OTO B;  1VF5 B;  3THO A;  1P84 F;  1NT2 B;  3Q4H A;  4O2A A;  1R3I C;  4HZ3 A;  1Q5O A;  2PI5 A;  4X65 B;  3JAR A;  4DV3 B;  2RMK B;  4TSF G;  1XHZ A;  1K97 A;  4DR7 B;  1HP8 A;  1Q81 W;  1GN4 A;  1K34 A;  3M8A A;  4PDM A;  4MS2 A;  4DR3 O;  2ZXW B;  3CXC U;  2EIL B;  1RPO A;  4LR3 A;  2CK3 G;  3RVY A;  2QWP B;  1MMM A;  3A2F A;  5L3F A;  2UXC O;  1R3L C;  3TCU A;  1H2L A;  2IU3 A;  1ZL8 A;  3ZS8 C;  4DV4 B;  2QKC A;  4UVA A;  2YIA A;  1NS1 A;  2JIZ G;  5LMN B;  1Q82 W;  5D5Q A;  3G6B A;  1J5E O;  5J2U A;  4YJ3 A;  4NTW A;  3SPC A;  3WG7 C;  4UVC A;  5CA0 A;  4IHJ A;  1FXK B;  1FYJ A;  1GK9 A;  1HNW B;  2IM9 A;  4F6R A;  2DW4 A;  2UUA B;  4ZI7 A;  2YIB D;  4J9Z B;  2LQT A;  4FLX A;  4LCU C;  1NTK H;  1JQ0 A;  2HKO A;  3JSN A;  3EXA A;  4LWS A;  3HKB A;  4DW0 A;  1YIT V;  1BHB A;  1H38 A;  3JD3 A;  2WA3 A;  4DK1 A;  3J81 N;  2IU0 A;  2F93 B;  4B3T B;  1IDS A;  1VQ4 V;  2Q73 A;  3L75 H;  4PDL A;  4PD4 F;  2GHY A;  1OCO C;  2GTS A;  4E4E A;  4X20 A;  2WLJ A;  3ZCC A;  2GUZ A;  2ZD9 A;  1EZJ A;  3STZ C;  3VQW A;  2BSK B;  2DMX A;  2GDS A;  2YS8 A;  3P32 A;  3H9V A;  4EFE A;  2AZ0 A;  5L3C A;  2Q0A A;  1PL4 A;  3L9D A;  4MSW C;  4CS2 A;  3HKE B;  2HJF C;  1VAR A;  1NZ6 A;  3ZMU A;  3AK1 A;  1B3Q A;  2VRZ A;  1JR9 A;  1ZWI C;  4JI6 B;  5LYJ A;  3RT3 C;  2GSM B;  3RYI B;  4FZ1 A;  1S5L Z;  4TV9 A;  4I5S A;  1DF4 A;  4AQY O;  2HEP A;  4UB6 Z;  4CH4 A;  4OXS A;  4YHH B;  1M56 C;  1YTF B;  3P3N A;  2QWO B;  5IJ0 A;  1D5A A;  4JI1 B;  2VQF O;  1IBK B;  1GRJ A;  3L71 H;  3LNM B;  1KEC A;  3CRM A;  4FLW A;  1R6N A;  4I0X B;  2UXB O;  2FTK A;  5LP6 B;  5JQG B;  4DV6 O;  2PYJ A;  4FFB B;  1N34 B;  1Y74 A;  2EIJ C;  3ZMT A;  2VWJ A;  4LFC B;  2XAG A;  3T4Z A;  4B7E A;  2JGU A;  5EBL C;  3ZHS A;  3APQ A;  5B1A B;  3ZMZ A;  2UXD B;  1HW7 A;  1XMQ O;  2EJ7 A;  3ZRW A;  5FNV B;  4LFB B;  4DR1 B;  3OGC C;  3LSQ A;  3QO7 A;  4UCO A;  1Y4M A;  4LF5 B;  2Q4P A;  2A7W A;  1GAX A;  1XBL A;  3ABM B;  4LF9 B;  3T1C A;  4I7Z B;  2BTQ A;  1SQB H;  3WU2 Z;  4LF6 B;  2IH1 C;  5C93 A;  5BXZ A;  5GTI Z;  2LJ2 A;  5CA1 A;  1IZ3 A;  3K5M A;  2CGN A;  3Q4H B;  4O2A B;  2QR4 A;  3JAR B;  1ROP A;  4K3A A;  4UCU A;  3BVO A;  1NR7 A;  3SPG A;  5DM6 V;  1N32 O;  5BR8 O;  4TQD A;  4WBN A;  2XAQ A;  4NTX A;  4HAM A;  2JEX A;  4MVZ A;  2FL4 A;  4I50 A;  4PDR A;  1AI7 A;  4LF7 B;  5JH7 A;  1OV9 A;  2ZE6 A;  2FB5 A;  5H6R A;  4GX2 A;  3OUS A;  1PKX A;  2YI8 A;  3IAY A;  4P30 A;  1GM9 A;  2P67 A;  4RUF A;  1FAF A;  1GN6 A;  1BL8 A;  1ZL8 B;  4J11 A;  4DV2 B;  3CME V;  1F4N A;  2CTP A;  3T1Y O;  3A8T A;  2LGQ A;  2DN9 A;  3SDL A;  5J2U B;  1VP7 A;  3AG2 C;  4YJ3 B;  4LF8 O;  5CA0 B;  1R1B A;  1PD3 A;  4F6R B;  3DTU B;  1DK1 A;  4ZI7 B;  2EIN C;  2F23 A;  3OMA B;  3F7Y C;  2CE4 A;  3C3T A;  4LWS B;  3HKB B;  1YJN V;  2HR3 A;  3KKY A;  1JA8 A;  3D3I A;  2QEX V;  4TQF A;  2EZP A;  5IT9 N;  2M7W A;  3VQV A;  1FXH A;  2UXN A;  4JI0 O;  1QVF U;  5IY5 C;  1XIL A;  5GTH Z;  3OEE G;  4X20 B;  4NKG B;  2GUZ B;  4EFB A;  1SES A;  4O4H A;  4B3R B;  1V54 C;  3ETQ A;  3ZRV A;  2ZM6 B;  1S0V A;  2ZNJ A;  3M7M X;  2E5L B;  1Y66 A;  4OPH A;  3BFR A;  1I94 B;  3SR2 C;  1N4C A;  1ENV A;  4BIO A;  2EUL A;  4K8Z A;  2EBO A;  1DF5 A;  4XDL A;  4RAI A;  5LYJ B;  5B1O A;  4TV9 B;  1P7G A;  3E35 A;  3TGU H;  1M5I A;  4PA6 A;  3JAM N;  3D3Q A;  5IJ0 B;  4JYY A;  3WG7 B;  1P49 A;  4X1K A;  2QE7 G;  4FIP C;  4NXN B;  4PA9 A;  4P9O A;  2WLM A;  1Q6U A;  2BTO A;  5EZY A;  2P06 A;  3B8N A;  1Z5W A;  3BHP A;  3LDC A;  2WLK A;  2ZT9 B;  4DUZ O;  2KG7 A;  3CCM V;  1Y74 B;  1HR0 O;  1GTO A;  2F1M A;  3QTC A;  3FX7 A;  1HNZ O;  2FYU H;  1OCO B;  5K1X A;  4DV5 O;  4GCZ A;  4NTY A;  3OE7 G;  4MVM A;  4DR2 O;  3ZRW B;  2CDY A;  3OEH G;  1XNQ O;  3LSS A;  3CRA A;  1HWY A;  2XAJ A;  1KBH A;  5EIB D;  2CAZ C;  2UUC O;  1XMO O;  1VMG A;  1HNX O;  1WP8 A;  1KUQ A;  2BTQ B;  4J7K A;  2QTS A;  5JCO C;  4MVU A;  5EK0 A;  5CA1 B;  4LF4 O;  1XOU A;  2JGD A;  4U3J A;  1M56 B;  2ZCE A;  1PNL A;  4TOI A;  3QG5 A;  1VQN V;  1Q43 A;  4GKJ B;  4X66 B;  2GTA A;  4X62 O;  4WBN B;  3CRR A;  1N36 O;  4I50 B;  1IXM A;  2X6A A;  5JH7 B;  5CBG A;  4ABM A;  4N23 A;  3JAK A;  4X1I A;  4GT1 A;  1N33 B;  3S3W A;  1YTF D;  2EIJ B;  1G8M A;  4FM0 A;  1PL0 A;  1WN7 A;  5LXT A;  2IH3 C;  2HLD G;  3KZI Z;  1EN6 A;  4YJ2 A;  4NB5 A;  5F2V O;  1LNQ A;  2XND G;  1G4Y B;  5KA5 A;  3OGI B;  3BPZ A;  2ZR2 A;  2KB1 A;  1T5E A;  3A0B Z;  1US6 A;  4JV5 B;  3G80 A;  4GUN A;  2DWD C;  1AR5 A;  4F6E A;  3IFX A;  2HHH B;  4U7N A;  1VQM V;  4KP4 A;  1E79 G;  1XL6 A;  3C90 A;  4D7S A;  5JCO A;  1RFY A;  2B5U A;  3QVN A;  3RVZ A;  5A2Q N;  1VQ8 V;  4I9W A;  1CPY A;  1KKD A;  2Y4T A;  3GWK C;  4CH5 A;  3CSX A;  4IYI A;  3R65 A;  4O4H B;  3TK1 A;  4DR3 B;  1EBO A;  4B3S B;  5CBH A;  3JAL A;  4GKK B;  1F7Y A;  4JAA A;  4FJC C;  1JPX A;  2W6J G;  1YEW A;  4UV8 A;  3SJC C;  2HVJ C;  1Q6H A;  3ASN C;  2QWN B;  1VIB A;  2JRI A;  1M57 C;  1VQL V;  3K79 A;  3WB1 A;  2EX3 A;  5IJ9 A;  1J5E B;  2LW1 A;  1FD9 A;  1KKC A;  5FPR A;  4ZKI A;  3AG2 B;  1AR4 A;  5JJE B;  3CCQ V;  4X1K B;  3HKC B;  4I55 A;  4ASU G;  3UO2 A;  2V1D A;  2ETN A;  3E22 A;  1H8H G;  3FD9 A;  4LFA B;  3O65 A;  2G38 A;  3ASO C;  4NR1 A;  5KHH A;  4A5U B;  2EZO A;  2KG7 B;  3N2G A;  3TET A;  4PHZ A;  5B3S C;  4X8A A;  5CBF A;  4J42 A;  1BCC H;  4JF3 A;  1NKD A;  3F5W C;  1H2M A;  3U10 A;  3UQ8 A;  4YIO A;  4MVO A;  2H94 A;  3VBB A;  2PUS A;  2ZDI C;  1QCE A;  2B1G A;  4JTC B;  4YIP A;  1GM7 A;  4OX9 O;  4PA7 A;  4DR5 O;  1QR9 A;  2BCC H;  3TXS A;  5CMU A;  1V54 B;  3FKS G;  3HKD B;  3OTF A;  2QGN A;  5E79 Z;  3H01 A;  4DRX A;  2PI4 A;  1SRY A;  2ATK C;  2RN9 A;  5H2F Z;  1MZE A;  4DW1 A;  4EB6 A;  4MTO A;  4JI7 O;  4QNH B;  3DGE A;  4XDJ A;  1OCR C;  2K1E A;  4AQY B;  3CRC A;  3APO A;  3BA9 A;  2UU9 B;  3ABK C;  4IT5 A;  2HP8 A;  3LNN A;  3H1K H;  4MTF A;  1IUR A;  3ICX A;  2JGD B;  4U3J B;  3SPI A;  5DEC A;  3CCE V;  2F4V B;  2IBZ H;  4NXM B;  3RYH A;  4O4L A;  2UXB B;  1WA8 B;  4B3M O;  3JD4 A;  1TAE A;  1MSD A;  2ZNI A;  3UCS C;  4DV6 B;  2YC0 A;  3BA8 A;  3K04 A;  3JAK B;  4X1I B;  4JI3 O;  4ZIB A;  5HFL A;  1OHH G;  1PV0 A;  3HR0 A;  3ZHR A;  4O2B A;  1RSO A;  1FJG O;  5LXT B;  1SKV A;  4FK5 C;  3RYC A;  1XMQ B;  3ZHV A;  2JVD A;  4AHC A;  2Y69 C;  2ZDI A;  2Q7E A;  1S76 D;  4YJ2 B;  1K3E A;  4DV1 O;  1NU1 H;  1EM1 A;  3ABU A;  1AI6 A;  4DK0 A;  1NH2 B;  5EC2 C;  5IYZ A;  1KC8 W;  5LHG A;  5IYB O;  1IBM O;  3B2E E;  2XAH A;  1QBZ A;  3CC7 V;  2WSS G;  3T1H O;  3B4S A;  5IWA O;  2O57 A;  5JJJ B;  4JAS A;  3LDE A;  1LUV A;  1IXB A;  1THZ A;  1NTM H;  4H37 A;  2VWK A;  2LFR A;  3WFV A;  2AZ2 A;  3DSQ A;  3ZRS A;  5IYC O;  3ABL C;  4DR4 B;  2OCC C;  4G2K A;  1DTO A;  3FB5 C;  2NN4 A;  1N32 B;  3CRQ A;  3K0G A;  4CH6 A;  2YXH A;  2YEV A;  3QO8 A;  4FZ0 A;  4CC5 A;  1BSM A;  4DV3 O;  3J7A U;  1BT8 A;  3CCS V;  4W4K A;  1EZV H;  1YCI A;  3JAL B;  1URF A;  3EHB B;  1MA1 A;  4O4J A;  3SJA C;  3SYA A;  2DQ3 A;  1QU7 A;  2IJH A;  1AP6 A;  4X9Q A;  3D36 C;  4MTG A;  4WFF A;  1CP9 A;  3AG4 C;  1N0N A;  5DED A;  1OCZ C;  3T1Y B;  5IJ9 B;  4FLZ A;  1KMI Z;  1ZTE A;  1KQS U;  4LF8 B;  2Q69 A;  2YSU B;  3AEI A;  4JYB A;  5H5N A;  1K4C C;  3CP1 A;  2PY5 A;  1AJP A;  3A0R A;  2YIC A;  1Z5V A;  2ZQM A;  5LBQ A;  4I55 B;  1Q7Y W;  2YI9 A;  3SYC A;  3E22 B;  2UUA O;  1MOF A;  1MNG A;  5B66 Z;  3CCV V;  1UFI A;  2LFS A;  2LW7 A;  5CA3 A;  3ML0 A;  4JI0 B;  3GWO A;  4F4L A;  1AR1 B;  4DV0 O;  1R3K C;  4FFK A;  5AG2 A;  4B3T O;  3VQY A;  5LGU A;  3WB2 A;  1Y6X A;  3TXQ A;  4UCT A;  2CGO A;  2AHZ A;  4DRX B;  2BOB C;  1AJQ A;  3ZIA G;  4WFA V;  1JFF A;  2WLH A;  3OD4 A;  2WLN A;  4EB6 B;  1AI4 A;  1M4U A;  4JI4 O;  1XNR O;  2ZIO A;  5BMV A;  1H2S B;  3D36 A;  1R6K A;  3ASN B;  4I4T A;  1R73 A;  1M57 B;  1M1K W;  4ICG A;  4DYL A;  4JI6 O;  1BGY H;  2ARH A;  5A9G A;  1AB3 A;  2ZIM A;  1VQ5 V;  2Q7H A;  4FLV A;  1PP9 H;  3FB6 C;  1BZK A;  1LR1 A;  1O9G A;  4GZR B;  4JI1 O;  4R7C A;  2HJD A;  5B1B B;  3RYH B;  1IVS A;  1I5X A;  3CMA V;  5J2T A;  5KHG A;  1IBK O;  4JYC A;  4IHJ B;  4UFZ A;  2EIK C;  3ZMS A;  1SET A;  4UV9 A;  3JAS A;  3ETE A;  2UXX A;  1HR0 B;  1JVM A;  3ASO B;  3K08 A;  1SQF A;  1O9H A;  3E8F A;  2E3C A;  2VS0 A;  1HNZ B;  5B3S B;  4O2B B;  1RSO B;  4DV5 B;  1XI1 A;  4LFC O;  3RYC B;  3K9S A;  4E2L A;  2CH7 A;  4DR2 B;  1XNQ B;  4YXW G;  2OYQ A;  3RBZ A;  1TA8 A;  3JD2 A;  1GKF A;  4LFB O;  2Q8V A;  5IYZ B;  3K57 A;  5FLX N;  1XMO B;  1N8R W;  5ITZ A;  1HNX B;  5LA6 A;  4O4I A;  4UXN A;  1VQ6 V;  4XDK A;  5FPO A;  3WB0 A;  2XAF A;  3FFQ A;  1K9M W;  1OCR B;  2F43 G;  1VQK V;  3RN4 A;  4BAY A;  2IW5 A;  3ABK B;  1SF9 A;  2ZE7 A;  2YXL A;  1M90 W;  4KHP O;  4C7U A;  3ZN0 A;  2M6Y A;  4LBE C;  2Y0P A;  3BEH A;  2YEV B;  4K35 A;  4X62 B;  4D6T H;  2PZS A;  5CN0 A;  1N36 B;  1IBL B;  2Y0I A;  4K0K O;  3L72 H;  4WFE A;  1ARO P;  4PA4 A;  2HG5 C;  3I55 V;  1I0H A;  1SZT A;  5IDJ A;  4O4J B;  4PV1 B;  3JAW A;  2P4K A;  1FKA O;  4HBN A;  1SER A;  1QNM A;  2ZE5 A;  3CD6 V;  4PEL A;  5JVD A;  2OCH A;  4ZHQ A;  1K4D C;  3MAQ A;  1EN4 A;  4WFB V;  4I9Q A;  1RPR A;  3CCU V;  2N74 A;  1NBM G;  3CJH A;  2Y69 B;  2ZR3 A;  2NLJ C;  3FAV A;  3B77 A;  1QLE C;  4Z1V A;  3U0Z A;  1GO3 F;  3AG3 C;  4MVS A;  1K8A W;  4UUJ C;  2KQX A;  1IX9 A;  1UPG A;  2P5O A;  1GN2 A;  1DLB A;  1XEQ A;  4JI8 O;  3IJ4 A;  1QVG U;  4TT3 G;  4X89 A;  4D7T A;  3SYO A;  3JD0 A;  2FKX A;  3K5L A;  4RQE A;  2DE0 X;  3ABL B;  1NH2 D;  1G1X B;  1CEZ A;  2OCC B;  3I5D A;  2DQ0 A;  3MD0 A;  2WA4 A;  1U97 A;  2XOK G;  1D5N A;  3K5O A;  3K03 A;  4DR6 O;  2ILM A;  1Y67 A;  1OZ0 A;  2X6B A;  4QE9 A;  2OT5 A;  4U3F H;  4P9P A;  4B3R O;  2A79 B;  1Q90 D;  3E89 A;  5KAI Z;  1JFF B;  3B8M A;  3LDD A;  2E74 B;  3SYQ A;  2RJZ A;  2E5L O;  1L0N H;  3JCZ A;  1H2K A;  3OR7 C;  1I94 O;  5BMV B;  5JJN B;  3K9A A;  2PTM A;  4I4T B;  3AG4 B;  1NJI W;  2Q0O C;  2Z5U A;  1OCZ B;  1LUW A;  2XUM A;  2UUB B;  2MW2 B;  2P6J A;  1WAZ A;  1W0J G;  2WLL A;  3AG1 C;  4FLY A;  2QWR B;  3PJS K;  2K9P A;  1JCH A;  2XTA A;  2A06 H;  1S3J A;  5J2T B;  3CE2 A;  3S3X A;  4GLX A;  1P4R A;  3NR7 A;  3F7V C;  3JAS B;  2NNU A;  1JOY A;  4FLU A;  3E8H A;  2DOS A;  1F51 A;  2JJ2 G;  3E83 A;  1SC5 B;  2ZIN A;  3VQX A;  2WPD G;  2RCV A;  1VF7 A;  2CH7 B;  3ZMV A;  2D2C B;  3JCU Z;  4UCV A;  1FXV A;  1SZX A;  4X88 A;  4DUY O;  4PDV A;  4DR5 B;  4OX9 B;  4UVB A;  2D3O W;  1X4T A;  3D8C A;  3OR6 C;  4R50 A;  3G6E V;  1BE3 H;  3W7X A;  4J41 A;  5LHI A;  3N2K A;  3W7W A;  3EFF K;  4JI7 B;  5ITZ B;  2QM8 A;  3ZRX A;  3BCC H;  1PM9 A;  5LA6 B;  2PF4 E;  3OT7 A;  4GX1 A;  4O4I B;  5KHK A;  3BAB A;  4DV7 O;  4L87 A;  2F66 C;  3RYI A;  1YJ9 V;  2UXC B;  2B9Z A;  3AG7 A;  5B5E Z;  2BE3 A;  4FMT A;  2CTQ A;  1WJZ A;  1WPX A;  4JI5 O;  4GX5 A;  1H8E G;  4OPA A;  4IIJ A;  5BY1 A;  5B1N A;  4RO2 A;  2R9I A;  2X7R B;  1XHX A;  4NVP A;  3NXS A;  2QJ1 A;  1WB7 A;  4G27 B;  2EIK B;  3CEI A;  3RGB A;  2YID A;  3DXR A;  1GM8 A;  1AVM A;  5BZB A;  2EIN B;  1B04 A;  1S5J A;  3JAW B;  1SQQ H;  4GYC B;  1Q6I A;  2JJ1 G;  4JTD B;  1W0K G;  5EZY B;  3KCX A;  2NR5 A;  2VQE O;  1N33 O;  4DXW A;  4QIW F;  4TWK A;  5JVD B;  4ZHQ B;  4YY3 O;  5KHI A;  4WFG A;  3SJQ C;  4DV1 B;  3CJH B;  4TUY A;  2QKS A;  2QSA A;  1IBM B;  5IY5 B;  3RYF A;  2DYR C;  2XAS A;  4HYO A;  1KP2 A;  3L73 H;  3U11 A;  4JI2 O;  2ADP A;  1TGO A;  1SQX H;  1SQG A;  2WLI A;  5EC1 C;  3P30 A;  3SGI A;  3J80 N;  5KHJ A;  4JV5 O;  2QTO A;  3OAA G;  2JS3 A;  2L6L A;  4MVQ A;  3W7S A;  4LC1 A;  2XT9 A;  2HHH O;  3KCY A;  4JYA O;  1FFX A;  4CS3 A;  1N0J A;  5EBW C;  4Z2W A;  1K7D A;  4XBF A;  1AJN A;  4JGS A;  1G6U A;  5DN6 G;  1SS3 A;  1XRE A;  4JPR A;  4W4L A;  1ZUQ A;  3H1J H;  2VQF B;  1E1Q G;  4X64 O;  1PNM A;  2C2A A;  1MZF A;  1EFR G;  2HFE C;  5D5P A;  4GX0 A;  4B3S O;  4GKK O;  2LGW A;  2EIM C;  3LSU A;  2LP7 A;  3K5N A;  3CB2 A;  1RM1 C;  1VF6 C;  2RDC A;  2LO1 A;  2Z0A A;  5L3E A;  1GN3 A;  3HPL C;  3CCJ V;  2QDO A;  2QKA A;  1QR8 A;  4IL6 Z;  1KP3 A;  1QLE B;  2Q6A A;  4J7Z A;  3G4S V;  2OTL V;  2WLL B;  2CTR A;  3AG3 B;  2W6I G;  3MDS A;  4PI0 A;  4LNU A;  1U96 A;  1K5Q A;  2P90 A;  4K8X A;  2R70 A;  4LFA O;  1FS0 G;  3B40 A;  2RNB A;  2IJK A;  5LMU O;  4DV0 B;  4MTX A;  4TV8 A;  3UO3 A;  1I5Y A;  1K5S A;  1L0L H;  3W7T A;  1XUQ A;  3ETD A;  1X59 A;  4EKW A;  2R72 A;  2W0F C;  5E1A C;  1B06 A;  1JJO A;  4H44 B;  3OTO O;  5LGN A;  5KMG A;  3I56 V;  5BR8 B;  3N2K B;  1VEW A;  4H33 A;  4BR6 A;  4X65 O;  1WPB A;  4JI4 B;  1XNR B;  2W0X A;  5GON A;  4J10 A;  4DR7 O;  1KD1 W;  1YHQ V;  1YSC A;  1GMG A;  3F5T A;  1L1F A;  1QQC A;  1FPO A;  3QF7 A;  1VF6 A;  3CHX A;  5L3G A;  3MHS C;  2YIB A;  3ZJZ A;  3HB3 B;  4G28 B;  2UU9 O;  4IYH A;  1MAB G;  3C3S A;  1YVW A;  2DYS C;  3IC9 A;  3JD1 A;  4RWU A;  4IIJ B;  4B08 A;  4BW9 A;  2L35 A;  3AG1 B;  4B7K A; 
#chains in the Genus database with same CATH homology
 2QWQ B;  3APQ A;  2CTQ A;  1WJZ A;  1BQ0 A;  2Y4U A;  2OCH A;  2LGW A;  2QWP B;  2QWN B;  3APO A;  2CTP A;  2EJ7 A;  2N05 A;  3UCS C;  2DN9 A;  4IT5 A;  1FPO A;  4J80 A;  1IUR A;  2N04 A;  2GUZ A;  1N4C A;  2LO1 A;  2L6L A;  2PF4 E;  2DMX A;  2YUA A;  1GH6 A;  2YS8 A;  1BQZ A;  2QWR B;  1HDJ A;  2CUG A;  1XBL A;  4RWU A;  4J7Z A;  2KQX A;  3UO3 A;  2QWO B;  2GUZ B;  2QSA A;  2Y4T A;  2M6Y A;  2CTW A;  3UO2 A;  1FAF A;  2CTR A;  1NZ6 A;  3AG7 A;  3BVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...