2YS8A

Solution structure of the dnaj-like domain from human ras-associated protein rap1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
GSSGSSGSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DnaJ-like domain from human ras-associated protein Rap1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Rab-related GTP-binding protein RabJ
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ys8A00
3UO2A 1GH6A 2DMXA 2LO1A 2QWRB 2OCHA 2DN9A 2CTRA 1HDJA 3UO3A 2GUZB 4J80A 2CUGA 1XBLA 2Y4TA 2QWNB 2QWPB 2YS8A 3AG7A 4RWUA 2M6YA 2L6LA 2QWOB 2Y4UA 2GUZA 1IURA 2PF4E 2N05A 1BQ0A 1BQZA 2QWQB 2YUAA 3BVOA 1NZ6A 2QSAA 1FAFA 2N04A 3UCSC 2CTQA 4IT5A 2CTWA 1WJZA 2CTPA 3APQA 4J7ZA 2EJ7A 1N4CA 2KQXA 3APOA 1FPOA 2LGWA
chains in the Genus database with same CATH superfamily
2YXLA 4R6ZA 1Q81W 3OR6C 4DV3O 4IYIA 1P7GA 5H5NA 3NXSA 4JI6O 3DXRB 4DR7O 2WLLA 4I55B 3K0DA 4FK5C 4UFZA 4RQFA 1JX9A 2YUAA 1A32A 2P6JA 4DR5B 2CGNA 2F1MA 2OIEA 3ZMTA 1MABG 3KCYA 1IZ3A 1WB8A 3ETQA 3UQ8A 5K1XA 4LWSA 2LW7A 1FFXA 3PJSK 1XDCA 4JAUA 3ZX6A 5LHHA 1HDJA 5CBFA 4PELA 4JPRA 3FKSG 2XHBA 2E75B 2PF4E 1VARA 1ZSPA 4DRXA 5JVDA 3AG2B 1KQSU 4O4IA 4JTDB 1LR1A 4B3MO 1I08A 3APQA 5L3DA 2EINC 3ZHVA 3K3WA 1D5NA 5DEDA 4R8CA 2AZ0A 3SJBC 5IJ9B 4UVCA 3K06A 4DUYO 3UT5A 2JJ2G 1NH2D 5KA6A 3W7WA 4PDVA 2HLDG 1R3JC 1VEWA 5LHIA 1RFYA 1FFXB 3HKDA 5KAFZ 5IJ9A 1WPXA 1VQ7V 2DWDC 1SERA 1M56B 1YVWA 2IJKA 1JFFA 4PHZA 5LA6A 3ZIAG 1E79G 3B40A 4JAAA 1HNWB 4TV8B 2Q68A 2LGQA 5EYPB 4JI1O 3M7MX 1FAFA 3F7VC 1B04A 1R6TA 2Q0OC 3ABKC 4MVOA 3JYCA 2PGGA 4ZI7B 4TV8A 2QGNA 1PP9H 2CUGA 4J9ZB 4B3RB 1Z5WA 5LXTA 1QCEA 1X4TA 4ZHQA 1GKFA 4A5UB 3GWOA 2A3QA 4X1YA 5E79Z 4NYKA 1S76D 2Q7EA 4O4JA 2JDIG 1AP6A 3U0ZA 3APOA 1PKXA 4LH7A 3ABUA 1THZA 1YSCA 4FMTA 3K03A 1N36O 3CPWU 1ZX3A 4LR3A 3ZHRA 5JCOC 4O4LB 3ABLC 4PA6A 4LH6A 4GCZA 2HG5C 3SYPA 2IJIA 2OTLV 4U7NA 1XMQB 1KKDA 1XHXA 1KBHA 3CC2V 5KLVH 1H2KA 1OCCB 4MTOA 4JF3A 1R6KA 3H9VA 4W4LA 2ITDC 3E8BA 1R1BA 3JSNA 1MMMA 3LNMB 2AZ2A 1J5EB 1N32O 3N2KA 1SS3A 1YEWA 4P9OA 3STZC 1MZEA 1Y74B 2ADQB 3S3WA 2M6YA 3LDDA 4YJ3A 5J2TB 3N2GA 2QKSA 1MNGA 1V55B 2HHHO 4YJ2B 3BABA 3K79A 1N33O 4XDKA 4JI5B 2UXBO 1XMOO 2YSUB 4G27B 3G67A 3BEHA 2CGOA 3QVNA 4GKJB 1X59A 3OW2U 1TVKA 2RQ6A 4I9WA 3HB3B 4H44B 4J41A 4WCEV 2KQXA 3ETEA 2DE0X 1NTZH 5F2VO 1KUQA 3LUTB 2O57A 3A0RA 5FNVB 2Y69B 4DR6O 5IY5C 4YHHB 1SKVA 3RN4A 4JI8O 4RO2A 3BVOA 3K5MA 3CCLV 2R9RB 2ZNJA 1Q6HA 2FTKA 3CXHF 1JOYA 1YJNV 1SQPH 4B3RO 5J2TA 1NI8A 1WNSA 1P7BA 2EILC 3UO2A 3A0HZ 1UJWB 1MSDA 3G6EV 4OX9O 2JRIA 1OV9A 4X62B 3ASOB 3JCZA 5A2QN 1YTFB 4I50B 4GX0A 1W59A 3D3IA 1YIJV 2PTMA 3OEEG 1NBMG 3ZRVA 4FLWA 3FX7A 1EM1A 2DN9A 1FXVA 3CCJV 5KHKA 5KX5A 2Y4TA 4X66B 1PNMA 4U3FH 1BHAA 4UXNA 4DR2O 3WG7B 4LP8A 1Q8IA 4H37A 2UUAB 3ZHSA 4K3AA 2EIMC 5BZBA 4LFBB 1S77D 3SPGA 2VQEO 1AR5A 1OCRB 3IAYA 3CD6V 3TXQA 1SA0A 1JJ2U 4X65O 2DYRB 3HKEB 3ZBHA 2X7RB 2H94A 3QTCA 1XMOB 3WU2Z 5CA1B 1GM7A 2OYQA 1FPOA 2HR3A 4GKJO 1WLEA 2DMXA 4DRXB 4NKGB 3DC5A 3RYFA 1N34O 2IH1C 3K5NA 3M8AA 3NR7A 4J7JA 1SQGA 3AEIA 3MAQA 3G71V 1H2NA 3SPJA 2V7QG 5C93A 1YCIA 2RDCA 4LBEC 2Z5UA 4I5SA 4N21A 1CXZB 4JYAB 1RM1C 3KKYA 3CRQA 2JIZG 5C8YA 4ZOLB 1UFIA 4O2AB 3LSQA 1TUEB 2H3OA 3AG4C 2UXNA 5LGTA 1Y6XA 1NJIW 4MVRA 4O2BA 4HYOA 1SQVH 4NB5A 4FLZA 2QWOB 3SR2C 4F6RA 4MW3A 1M93A 3RYCB 3LSUA 5LYJA 1NZ6A 1KU9A 1TVKB 1EN4A 1GAXA 2VQFO 1R3KC 1XI1A 1K73W 2BSKB 2N74A 1H2LA 2ZNIA 1ZTEA 3KCXA 5IE9A 1S5JA 4B7KA 2QKAA 5IYZA 3JCUZ 3CCVV 5EZYB 3FB7C 4DR7B 1U97A 4FVMA 4I4TA 2X0LA 2ZE7A 3CCRV 3MHSC 1VQOV 5CBHA 2LQTA 2KSDA 1XILA 4DK1A 3CCUV 4DR5O 4K0KB 2A0LA 3RGBA 1Z2GA 3ZHUA 3K58A 2B1IA 3CSXA 2FYUH 5B1BB 1PL4A 1QLEB 3AG1B 1PNLA 4DV5B 1XNQB 4PA7A 2EBOA 2ILMA 4FLTA 1LUWA 2UUAO 1M57B 5B1AC 3W7TA 1M90W 2R72A 5LXTB 3ZRSA 3T1YB 3VQVA 5JQGB 3SJCC 1M4UA 4HZ3A 4C7UA 1W0KG 3SYCA 4K8ZA 1GN6A 3L72H 1AVMA 2QWRB 2CDYA 2PUSA 4X88A 1V54B 2ZE6A 4EFBA 3E35A 2AW9A 4EB6A 4O4HB 4UCSA 3H1LH 3OUFA 1GMGA 2MW2B 1PM9A 4X20B 2CAZC 4B08A 5LL6Y 4MTXA 4DYLA 3RWRD 3WB2A 4IHJA 4B3MB 3B09A 4OGQB 3BY6A 4UCUA 5HFLA 1Q7YW 2A9HA 4AILC 3RYHA 3R65A 1VQKV 3JASB 3OTOO 4DUYB 1SC5B 1VQNV 1SQFA 4X1IA 2XAFA 1K34A 2HVKC 3K57A 1Q3EA 2IJHA 2G38A 3O9OA 4CH5A 3OE7G 3JATB 2A06H 1BZKA 1RPRA 4LF8O 1HNZB 1GM8A 3T1HO 2ZXWC 3JD3A 1DGSA 2QR4A 3CCSV 2P06A 3SPHA 2LJ2A 3ZRWA 3STLC 3OR7C 4YY3O 1WN7A 5BR8B 5KHJA 2A7WA 1JMKC 1BCCH 1YI2V 4JGSA 2PYJA 4NTWA 4YJ3B 2HKOA 4NVPA 2N05A 5LGUA 1Q6UA 2P90A 1XMQO 4FPPA 3W7UA 4I9QA 1Y67A 3I55V 4OXSA 5LYJB 3JASA 3RYIB 1KC8W 4QJFB 2RMKB 3J80N 4QPJA 2KB1A 4Z2WA 1K5SA 1KKCA 4HBNA 3T4ZA 2WLNA 2XUMA 3GVMA 5GTIZ 1Y66A 2HFEC 1QR9A 1GTOA 1PPJH 4XDLA 4PD4F 5LOVA 2PI4A 3ABMC 3E89A 4QPKA 3UM7A 5LGNA 4JTCB 4ICGA 3A0BZ 4CH4A 4IGGA 4RAIA 3W7SA 4RUEA 4LF4O 1J5EO 1N32B 1DLBA 3B8NA 2DWEC 3CE2A 2ATKC 4X20A 5HFMA 5KMGA 5A9GA 2UXDB 5EC1C 4LFCO 4D7TA 3MDSA 1Z5VA 3ETDA 2X6BA 2BOCC 2UU9B 1SQBH 4LNUB 1NTKH 3ZMSA 3RVYA 1AR1B 4DR6B 3O65A 4RUFA 1XNRO 3RFRA 2F4VB 1K4CC 4U3JA 3ZHTA 3HKBA 3FB8C 3JAWA 4Z1VA 2OCCB 2X6CA 3ASNB 2QEXV 4IIJA 1F4NA 4IIJB 1TUBA 4P9PA 3T1HB 1FXHA 2ODMA 4ZHQB 4U3JB 3HKBB 4ABMA 4ZI7A 4JV5B 4YJ2A 4CC5A 3FYEB 5BR8O 4PDRA 2XTAA 3HPLC 2QJ1A 3ZJZA 2FL4A 1Y76A 4OPAA 5H2FZ 2ZT9B 2JGDA 1F4MA 3IJ4A 1H38A 4JI2O 2EIJB 3RYCA 2WLIB 4DV6B 3E8FA 2R9AA 1ROPA 2GBOA 2XNDG 1JJOA 5D5QA 2YEVB 1LNQA 1FS0G 5E1AC 5J2UB 1YXBA 1CEZA 5LA6B 1IBLB 1YDXA 4TUYB 4LFBO 1QVFU 2VS0A 2ETNA 1NS1A 2W0FC 1VIBA 3QO5A 3FB5C 4DK0A 4LF6B 1RP3B 4LFAB 1WPBA 3IC9A 4XBFA 4BW9A 1QHTA 3N2GB 2YIBD 2JGDB 5L3GA 1M5IA 4PI2A 4TT3G 1B3QA 3LSSA 1S72V 5JQGA 2CTRA 4PA3A 2IH3C 2VQEB 2WWWA 2PI5A 1VQ8V 3ZEDA 4KL1A 4EEQA 4TV9B 2EIKB 3VQWA 2YIAA 4AQYO 1YJWV 3E8GA 2KG7A 2D2CB 3VOUA 4NXNB 1B06A 3WB1A 4CH3A 2NLJC 2DYRC 3UCSC 4TUYA 4EB6B 1L0LH 2A79B 1US6A 4PI0A 2WLLB 4KUMA 2F4VO 3Q4HB 2HJDA 3CJHB 1NU1H 5IDJA 1O9HA 1N34B 5CA0A 3BCCH 1M9NA 2AHYA 2QM7A 1IBMO 3H01A 3D36A 4JV5O 2XT9A 4KHPB 4NR1A 1EN6A 4DR3B 2ZDIC 1IBKB 3RYIA 5FL7G 4JYAO 1GM9A 1ENVA 1AI5A 4GX5A 4X64B 3L9DA 4TSFG 5DM6V 3IFXA 1ZUQA 3C3TA 5JJEB 5LP6B 4UCRA 4X8AA 4WBNB 4DV6O 2UUBO 2V4DA 1D5AA 4BWAA 1JPXA 4F4LA 5C8YB 2QM4A 4CC6A 3QO8A 1K33A 1TUBB 5LP6A 2UXXA 4OPHA 5L3CA 4O4HA 3VBBA 2QE7G 4GX2A 3N2KB 2W6JG 2Y0PA 3B4SA 3CMEV 2FB5A 2GV9A 4JI3B 2ZE5A 4LF6O 1WA8A 1CP9A 4FIPC 1OCZC 2F66C 1WA8B 1S0VA 3K08A 1XQ8A 3SDLA 1QLEC 3RYHB 1SQQH 2GSMB 3JARA 5LMUB 3P32A 3LNNA 5CA1A 1BGYH 2UUCO 2HJFC 3RW0A 5B1AB 5AG2A 1OCOC 1NVPD 3TGUH 1O9GA 4LF5O 1ZWIC 1I7FA 4D6TH 3T1YO 5JH7B 1U96A 2OIGA 1FJGB 5EBMC 2JEXA 3DC6A 1Q82W 4NXNO 3U10A 4E2LA 5H6RA 1ZLZA 3C3SA 4X1YB 1JR9A 1RPOA 4R50A 4ZBMA 4B3SB 4J42A 1V55C 2YICA 1EZVH 1N0JA 3QO7A 2ZM6B 4YIOA 3IC7A 2CTWA 3A2FA 3P30A 1MA1A 2DYSC 1HNZO 1IBMB 2ZIOA 1HW7A 4JI4B 2GUZA 4BIUA 1BHBA 3CS5A 4U7OA 4GLXA 4YY3B 2IU0A 1VF7A 3HR0A 1GN2A 5ITZB 4MVMA 5EC2C 1GO3F 3VQXA 3LDEA 1XHZA 3CRMA 1WP8A 2UXCB 4JYYA 2Y69C 1XBLA 2JGUA 2QWPB 1EZJA 1PNKA 4QE9A 2X6AA 4FFBB 1SZXA 2RNBA 2WPDG 3AG3C 4TWKA 4JI3O 1IVSA 5CB4A 2JVDA 3WB0A 3K9SA 1EN5A 1WJZA 4WFAV 1N8RW 1IX9A 3P3PA 2D3OW 4AI8A 4P2ZA 3D8CA 4I0XA 1Y76B 3ASOC 2LFSA 4X89A 4RWUA 5KHHA 1KECA 1S5LZ 2FKXA 1BL8A 3F5WC 1GRJA 3CWBH 1Q5OA 1K7DA 2UUCB 1IDSA 1F7YA 2HVJC 1HWYA 4ZOLA 2P7TC 1VMGA 2Y48A 3JAKB 3CCEV 1QQCA 2QWNB 1ZAUA 2YS8A 3JAWB 4H33A 4LF7O 3DXRA 4GX1A 3JD0A 4H0LB 2UXDO 1AJPA 4LFCB 1G8MA 5B1OA 2JS5A 3RVZA 3CEIA 3N27A 4CS4A 5CB4B 3JATA 3HKCA 2LO1A 4DV7O 4I50A 1OCRC 4LWSB 4JI0O 1B6QA 1CPYA 3JSLA 3OTFA 5L3BA 1W0JG 1XNRB 1MZFA 2DQ0A 3QF7A 1SRYA 4FZ1A 4QE7A 1RSOA 5B1NA 4G2KA 2OTJV 5B66Z 1R73A 1AR4A 1P4RA 3ZN0A 2VRZA 5IYDO 3H1JH 4H13B 1VQLV 5CMUA 4GKKB 1NR1A 1RSOB 4I7ZB 3CC4V 1H2MA 2XAHA 3EVKA 5IYZB 2F43G 4DR4B 4LC1A 4G28B 1NQTA 1SETA 3OGIB 4FFKA 1VF5B 5EIBC 5KUMA 3HKCB 3ASNC 4JI2B 3BFRA 4FLVA 4UV9A 3W7XA 2OCHA 2Q6AA 1AILA 1YTFD 4FFBA 3L71H 1YF2A 5CA0B 4Q6GA 3KZIZ 3K5OA 1VQ5V 3OUSA 3BA8A 5ITZA 3DGEA 4MSWC 1XL4A 1N4CA 4YHHO 3G6BA 2IJJA 1L1FA 1D2DA 2ZIMA 5JWPA 3ML0A 4LFAO 3UO3A 4J80A 2Q7GA 3AG7A 4MVZA 5FPOA 4EKWA 1TAEA 3K0GA 1G1XB 2E5LO 2M7WA 5H6QA 2VWJA 3F7YC 5B1BC 1SF9A 4LNUA 3UT5B 3E83A 2YC0A 3AG1C 1QNMA 2ARHA 4LF7B 5H9CA 4X1KB 1M57C 3ZMVA 4Q20A 4O4LA 3HKEA 1K92A 5GONA 4JI5O 3E22A 3CJHA 4IYHA 3AG2C 3MD0A 1YZBA 2YDEA 4JASA 2PZSA 4UB8Z 1NKDA 3BPZA 4L87A 4J10A 1V54C 1SESA 4MVSA 2QTSA 3CCQV 2ZR3A 1VQMV 1MOFA 4BIOA 4NXMO 2P5OA 2EIKC 1Q86W 2Q9LA 1QU7A 4AQYB 1BQZA 4EFEA 3A8TA 2LW1A 3DSQA 1PD3A 3U11A 4GKKO 1IXBA 4WFFA 5LHGA 3FD9A 3H1KH 5IJ0B 4DUZO 1J95A 3IGAC 3TK1A 2PY5A 2LGWA 5B5EZ 4DV1B 2WSSG 4X65B 1EFRG 2XAJA 5LBQA 3SYQA 2VWKA 2W6IG 3ZCCA 4X64O 4F6EA 2XAGA 1VQ9V 1IXMA 5BY1A 5IYCO 1VQPV 2H8PC 3OEHG 4GZRB 2NR5A 1BSMA 2WLJA 1HR0O 3QG5A 4ZKIA 2UUBB 3B8MA 4HAMA 3CHXA 3EXAA 3H1IH 3HKDB 4UV8A 4KHPO 2EJ7A 4MT8A 5CA3A 1SQXH 2YIBA 1T5EA 1KYOF 5IWAO 5GONB 1IBKO 2MK3A 3RT3C 1Y74A 3J81N 1E1QG 4JI7O 2BTQB 4IHJB 4CS3A 4GT1A 1AI6A 3CX5F 1AB3A 5IJ0A 5LP6C 4HNAA 3L74H 1NH2B 3GWKC 1P84F 3L70H 2YI8A 5EZYA 1KMIZ 4X66O 3THOA 3L73H 3OD4A 4DR1O 2ADPA 3H1HH 2GHYA 4BAYA 5KUKA 2JEUA 1L8DA 1L0NH 5FPRA 5EYPA 3ZMUA 2VQFB 1FXKB 3P3NA 3ABLB 1JVMA 1M1KW 5JJJB 1UPGA 3OAAG 4NTXA 5B3SB 1G6UA 4O4JB 3J7AU 2Q7HA 2E76B 2ZDIA 4MTGA 2QA4V 4B3TB 1QVGU 3EHBB 1K8AW 5EBWC 1Q6IA 3TXSA 3CMAV 2RCVA 3FAVA 2GTSA 3FYIB 2R9IA 3ZRWB 4FJCC 2GUZB 1FD9A 1NR7A 3X2QC 4I55A 4B3SO 3E2EA 3C90A 2C2AA 2CH7A 1DTOA 1E1RG 3T4DA 2WLIA 1P49A 4K8XA 3E22B 4DV5O 1XNQO 5TISZ 3ABMB 2N04A 1OCOB 2ZM6O 1QBZA 4LF5B 4QIWF 3UKMA 4E4EA 1HP8A 1I0HA 4NXMB 4HNAB 1DF5A 4KXRA 1VQ6V 3CRRA 2EX3A 4RQEA 4JI4O 4QNHB 2Q5ZA 2ZCEA 4FM1A 2L6LA 1QLNA 2WA4A 3F5TA 1MG1A 3PN1A 1TGOA 5JCOA 2WLKA 2UXCO 2RJZA 2P4VA 3QNEA 2E3CA 4MW8A 4AHCA 1Q43A 2KG7B 3RBZA 2DQ3A 3CCMV 4FZ0A 1ZL8B 3BA9A 1BQ0A 2OCCC 1H2GA 4MVUA 5KA5A 2F93B 3OMNB 4J9YB 5JVDB 1DF4A 4JYCA 4MVQA 3CP1A 3K04A 4DV4B 2HP8A 4PA4A 1YJ9V 3OM3B 2YXYA 4Z1MG 4CS2A 2Y4UA 3AK1A 4O2BB 3BRCA 4UVAA 3AG3B 3E8HA 2BOBC 2LP7A 4LF8B 1Y4MA 4I4TB 2EIJC 2BTQA 2EULA 1EBOA 4DV3B 2NNUA 3ZHQA 1WB7A 5J2UA 4JI6B 2HEPA 3B2EE 4TQFA 3SJAC 2PYLA 4B3TO 5LOVB 1URFA 3ETGA 1PV0A 2CK3G 2DOSA 3K59A 3RYFB 4DXWA 2ZR2A 3WG7C 5IYBO 3I5DA 4TQDA 1GH6A 2RN9A 4YXWG 2E74B 1V9PA 1I5YA 4KP4A 4X9QA 4JAVA 2V1DA 1R3IC 3TCUA 2EZPA 3FFQA 4R7CA 4WFHA 2QM8A 3DTUB 3OTOB 4J7ZA 1XOUA 2EINB 5BXZA 1N0NA 4PDLA 1FKAO 4DV7B 1F51A 5D5PA 1S3JA 3GB7C 5FLXN 4JI0B 1AI7A 2L35A 2BSKA 4DV2O 4WF9V 3SYOA 2QWQB 2IM9A 3OMIB 3LDCA 3ZMZA 2CTQA 3JD2A 5IT9N 2R70A 2B5UA 2BCCH 1OJHA 4FM2A 2ZINA 1WAZA 2ZD9A 2ZE8A 1M56C 2ZQMA 3AG4B 1I94B 5L3FA 4LCUC 3ABTA 4L8JA 2FMLA 4DR4O 4NTYA 3TETA 5CBGA 2P67A 5EK0A 2CE4A 3ABKB 5JH7A 3CYOA 3JALB 2YI9A 4DO2A 3JALA 2XAQA 2B9ZA 2ITCC 2P22C 4J7KA 2E5LB 1NVPB 1XL6A 1AI4A 2EZOA 1HNWO 3OMAB 1BMFG 2K1EA 2WA3A 1JA8A 1JFFB 3CRCA 4UUJC 4WFGA 2ZKOA 1NT2B 5GTHZ 1GK9A 3ZS8C 1AJNA 1K97A 4D7SA 1YHQV 4DV0O 2OT5A 5CN0A 1HNXO 3JAKA 2YIDA 2Q0AA 3K5LA 3OGCC 3D36C 4YIPA 1VQ4V 1G4YB 1NTMH 1FYJA 1LUVA 4LF4B 1OCCC 2AHZA 1OCZB 1AJQA 1AROP 3CB2A 4LF9B 1XEQA 4WBNA 1F23A 4B7EA 4TV9A 2Q4PA 3JD4A 1N36B 2WAMA 3MHHC 4JYBA 4FLXA 1IBLO 1BT8A 2UU9O 4PJ0Z 3SJQC 4UVBA 4DUZB 2IW5A 2CH7B 2EJRA 1VP7A 2Q8VA 3BAAA 4DV1O 2AGAA 4DV2B 2UXBB 1QR8A 4UB6Z 5K1PA 2QDOA 5KHIA 3FAVB 1PL0A 2QTOA 4MS2A 4UCVA 4F6RB 4P30A 5BMVA 1ORQC 3Q4HA 1R6NA 2HHHB 3ICXA 1KP3A 2Z3YA 1Q90D 4XDJA 1I94O 4QGPA 5IWAB 1N33B 4TOIA 4BR6A 1VF6A 3FB6C 3K9AA 1W2BU 2DYSB 1OHHG 1FXKA 4K35A 3G4SV 2K9PA 5GW7A 5IY5B 5KHGA 5LMNO 2JJ1G 5J9PC 2ZXWB 3BHPA 4KFMA 4O4IB 5JJNB 1WP7A 1HR0B 5EBLC 2OWOA 1I5XA 3OFNG 4BIZA 2IBZH 4W4KA 3SGIA 4CZZA 1AP5A 2EILB 3KG2A 3WFVA 2AXTZ 4WFEA 4FLUA 2W0XA 2F95B 3AK3A 3AK2A 4X62O 4JI7B 3I56V 3OT7A 2Q73A 4O2AA 2BE3A 1OZ0A 2JK5C 1SA0B 4JI8B 1ZL8A 4ZIBA 2B1GA 4DV0B 1HNXB 2IU3A 5BMVB 4ASUG 4DR1B 2P4KA 1KP2A 4OX9B 1VF6C 4FLYA 1FXKC 3B77A 1JQ0A 4DW0A 1SZTA 5EIBD 2F23A 4DR2B 4LF9O 2YEVA 2JS3A 2XOKG 2GTAA 5B3SC 3JARB 4JZGA 2EIMB 1YITV 2DW4A 1K4DC 1BS3A 4X1IB 3M99B 3G80A 1TA8A 3X2QB 4IL6Z 3ZRXA 4PA9A 5LMUO 1K5QA 4JTAB 4PV1B 2CTPA 2QKCA 3R66A 3ZN1A 4PDMA 4FM0A 1R3LC 1MSWD 5FNVA 2LFRA 2GDSA 1FJGO 5KAIZ 2Z0AA 4DR3O 4UCOA 5KX5B 3D3QA 5DN6G 1IURA 3T1CA 3TJTA 1K9MW 2NN4A 2QSAA 1FFTB 4BW5A 2XASA 5DECA 4CBCA 1RM1B 2WLHA 5LMNB 2WLMA 3CC7V 3SPIA 1JCHA 1GN3A 3T2MA 4UCTA 1H2SB 4JZ2A 5KMGB 3VQYA 4DW1A 4J11A 3JAMN 4CH6A 1GN4A 2Q69A 4MTFA 1H8EG 4GYCB 3EFFK 2BTOA 2KKWA 4GUNA 1KD1W 3CXCU 4IT5A 2Q67A 2DJVA 1DK1A 3E86A 2Y0IA 3SPCA 4JI1B 1BE3H 1K3EA 1XREA 4I0XB 4N23A 4DV4O 1XUQA 1KB9F 3CRAA 3JD1A 3L75H 5L3EA 1COWG 1S5HC 4X1KA 4K0KO 2YXHA 3SYAA 3S3XA 4WFBV 1H8HG
chains in the Genus database with same CATH topology
3UO2A 1GH6A 2DMXA 2LO1A 2QWRB 2OCHA 2DN9A 2CTRA 1HDJA 3UO3A 2GUZB 4J80A 2CUGA 1XBLA 2Y4TA 2QWNB 2QWPB 2YS8A 3AG7A 4RWUA 2M6YA 2L6LA 2QWOB 2Y4UA 2GUZA 1IURA 2PF4E 2N05A 1BQ0A 1BQZA 2QWQB 2YUAA 3BVOA 1NZ6A 2QSAA 1FAFA 2N04A 3UCSC 2CTQA 4IT5A 2CTWA 1WJZA 2CTPA 3APQA 4J7ZA 2EJ7A 1N4CA 2KQXA 3APOA 1FPOA 2LGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UO2 A;  1GH6 A;  2DMX A;  2LO1 A;  2QWR B;  2OCH A;  2DN9 A;  2CTR A;  1HDJ A;  3UO3 A;  2GUZ B;  4J80 A;  2CUG A;  1XBL A;  2Y4T A;  2QWN B;  2QWP B;  2YS8 A;  3AG7 A;  4RWU A;  2M6Y A;  2L6L A;  2QWO B;  2Y4U A;  2GUZ A;  1IUR A;  2PF4 E;  2N05 A;  1BQ0 A;  1BQZ A;  2QWQ B;  2YUA A;  3BVO A;  1NZ6 A;  2QSA A;  1FAF A;  2N04 A;  3UCS C;  2CTQ A;  4IT5 A;  2CTW A;  1WJZ A;  2CTP A;  3APQ A;  4J7Z A;  2EJ7 A;  1N4C A;  2KQX A;  3APO A;  1FPO A;  2LGW A; 
#chains in the Genus database with same CATH topology
 2YXL A;  4R6Z A;  1Q81 W;  3OR6 C;  4DV3 O;  4IYI A;  1P7G A;  5H5N A;  3NXS A;  4JI6 O;  3DXR B;  4DR7 O;  2WLL A;  4I55 B;  3K0D A;  4FK5 C;  4UFZ A;  4RQF A;  1JX9 A;  2YUA A;  1A32 A;  2P6J A;  4DR5 B;  2CGN A;  2F1M A;  2OIE A;  3ZMT A;  1MAB G;  3KCY A;  1IZ3 A;  1WB8 A;  3ETQ A;  3UQ8 A;  5K1X A;  4LWS A;  2LW7 A;  1FFX A;  3PJS K;  1XDC A;  4JAU A;  3ZX6 A;  5LHH A;  1HDJ A;  5CBF A;  4PEL A;  4JPR A;  3FKS G;  2XHB A;  2E75 B;  2PF4 E;  1VAR A;  1ZSP A;  4DRX A;  5JVD A;  3AG2 B;  1KQS U;  4O4I A;  4JTD B;  1LR1 A;  4B3M O;  1I08 A;  3APQ A;  5L3D A;  2EIN C;  3ZHV A;  3K3W A;  1D5N A;  5DED A;  4R8C A;  2AZ0 A;  3SJB C;  5IJ9 B;  4UVC A;  3K06 A;  4DUY O;  3UT5 A;  2JJ2 G;  1NH2 D;  5KA6 A;  3W7W A;  4PDV A;  2HLD G;  1R3J C;  1VEW A;  5LHI A;  1RFY A;  1FFX B;  3HKD A;  5KAF Z;  5IJ9 A;  1WPX A;  1VQ7 V;  2DWD C;  1SER A;  1M56 B;  1YVW A;  2IJK A;  1JFF A;  4PHZ A;  5LA6 A;  3ZIA G;  1E79 G;  3B40 A;  4JAA A;  1HNW B;  4TV8 B;  2Q68 A;  2LGQ A;  5EYP B;  4JI1 O;  3M7M X;  1FAF A;  3F7V C;  1B04 A;  1R6T A;  2Q0O C;  3ABK C;  4MVO A;  3JYC A;  2PGG A;  4ZI7 B;  4TV8 A;  2QGN A;  1PP9 H;  2CUG A;  4J9Z B;  4B3R B;  1Z5W A;  5LXT A;  1QCE A;  1X4T A;  4ZHQ A;  1GKF A;  4A5U B;  3GWO A;  2A3Q A;  4X1Y A;  5E79 Z;  4NYK A;  1S76 D;  2Q7E A;  4O4J A;  2JDI G;  1AP6 A;  3U0Z A;  3APO A;  1PKX A;  4LH7 A;  3ABU A;  1THZ A;  1YSC A;  4FMT A;  3K03 A;  1N36 O;  3CPW U;  1ZX3 A;  4LR3 A;  3ZHR A;  5JCO C;  4O4L B;  3ABL C;  4PA6 A;  4LH6 A;  4GCZ A;  2HG5 C;  3SYP A;  2IJI A;  2OTL V;  4U7N A;  1XMQ B;  1KKD A;  1XHX A;  1KBH A;  3CC2 V;  5KLV H;  1H2K A;  1OCC B;  4MTO A;  4JF3 A;  1R6K A;  3H9V A;  4W4L A;  2ITD C;  3E8B A;  1R1B A;  3JSN A;  1MMM A;  3LNM B;  2AZ2 A;  1J5E B;  1N32 O;  3N2K A;  1SS3 A;  1YEW A;  4P9O A;  3STZ C;  1MZE A;  1Y74 B;  2ADQ B;  3S3W A;  2M6Y A;  3LDD A;  4YJ3 A;  5J2T B;  3N2G A;  2QKS A;  1MNG A;  1V55 B;  2HHH O;  4YJ2 B;  3BAB A;  3K79 A;  1N33 O;  4XDK A;  4JI5 B;  2UXB O;  1XMO O;  2YSU B;  4G27 B;  3G67 A;  3BEH A;  2CGO A;  3QVN A;  4GKJ B;  1X59 A;  3OW2 U;  1TVK A;  2RQ6 A;  4I9W A;  3HB3 B;  4H44 B;  4J41 A;  4WCE V;  2KQX A;  3ETE A;  2DE0 X;  1NTZ H;  5F2V O;  1KUQ A;  3LUT B;  2O57 A;  3A0R A;  5FNV B;  2Y69 B;  4DR6 O;  5IY5 C;  4YHH B;  1SKV A;  3RN4 A;  4JI8 O;  4RO2 A;  3BVO A;  3K5M A;  3CCL V;  2R9R B;  2ZNJ A;  1Q6H A;  2FTK A;  3CXH F;  1JOY A;  1YJN V;  1SQP H;  4B3R O;  5J2T A;  1NI8 A;  1WNS A;  1P7B A;  2EIL C;  3UO2 A;  3A0H Z;  1UJW B;  1MSD A;  3G6E V;  4OX9 O;  2JRI A;  1OV9 A;  4X62 B;  3ASO B;  3JCZ A;  5A2Q N;  1YTF B;  4I50 B;  4GX0 A;  1W59 A;  3D3I A;  1YIJ V;  2PTM A;  3OEE G;  1NBM G;  3ZRV A;  4FLW A;  3FX7 A;  1EM1 A;  2DN9 A;  1FXV A;  3CCJ V;  5KHK A;  5KX5 A;  2Y4T A;  4X66 B;  1PNM A;  4U3F H;  1BHA A;  4UXN A;  4DR2 O;  3WG7 B;  4LP8 A;  1Q8I A;  4H37 A;  2UUA B;  3ZHS A;  4K3A A;  2EIM C;  5BZB A;  4LFB B;  1S77 D;  3SPG A;  2VQE O;  1AR5 A;  1OCR B;  3IAY A;  3CD6 V;  3TXQ A;  1SA0 A;  1JJ2 U;  4X65 O;  2DYR B;  3HKE B;  3ZBH A;  2X7R B;  2H94 A;  3QTC A;  1XMO B;  3WU2 Z;  5CA1 B;  1GM7 A;  2OYQ A;  1FPO A;  2HR3 A;  4GKJ O;  1WLE A;  2DMX A;  4DRX B;  4NKG B;  3DC5 A;  3RYF A;  1N34 O;  2IH1 C;  3K5N A;  3M8A A;  3NR7 A;  4J7J A;  1SQG A;  3AEI A;  3MAQ A;  3G71 V;  1H2N A;  3SPJ A;  2V7Q G;  5C93 A;  1YCI A;  2RDC A;  4LBE C;  2Z5U A;  4I5S A;  4N21 A;  1CXZ B;  4JYA B;  1RM1 C;  3KKY A;  3CRQ A;  2JIZ G;  5C8Y A;  4ZOL B;  1UFI A;  4O2A B;  3LSQ A;  1TUE B;  2H3O A;  3AG4 C;  2UXN A;  5LGT A;  1Y6X A;  1NJI W;  4MVR A;  4O2B A;  4HYO A;  1SQV H;  4NB5 A;  4FLZ A;  2QWO B;  3SR2 C;  4F6R A;  4MW3 A;  1M93 A;  3RYC B;  3LSU A;  5LYJ A;  1NZ6 A;  1KU9 A;  1TVK B;  1EN4 A;  1GAX A;  2VQF O;  1R3K C;  1XI1 A;  1K73 W;  2BSK B;  2N74 A;  1H2L A;  2ZNI A;  1ZTE A;  3KCX A;  5IE9 A;  1S5J A;  4B7K A;  2QKA A;  5IYZ A;  3JCU Z;  3CCV V;  5EZY B;  3FB7 C;  4DR7 B;  1U97 A;  4FVM A;  4I4T A;  2X0L A;  2ZE7 A;  3CCR V;  3MHS C;  1VQO V;  5CBH A;  2LQT A;  2KSD A;  1XIL A;  4DK1 A;  3CCU V;  4DR5 O;  4K0K B;  2A0L A;  3RGB A;  1Z2G A;  3ZHU A;  3K58 A;  2B1I A;  3CSX A;  2FYU H;  5B1B B;  1PL4 A;  1QLE B;  3AG1 B;  1PNL A;  4DV5 B;  1XNQ B;  4PA7 A;  2EBO A;  2ILM A;  4FLT A;  1LUW A;  2UUA O;  1M57 B;  5B1A C;  3W7T A;  1M90 W;  2R72 A;  5LXT B;  3ZRS A;  3T1Y B;  3VQV A;  5JQG B;  3SJC C;  1M4U A;  4HZ3 A;  4C7U A;  1W0K G;  3SYC A;  4K8Z A;  1GN6 A;  3L72 H;  1AVM A;  2QWR B;  2CDY A;  2PUS A;  4X88 A;  1V54 B;  2ZE6 A;  4EFB A;  3E35 A;  2AW9 A;  4EB6 A;  4O4H B;  4UCS A;  3H1L H;  3OUF A;  1GMG A;  2MW2 B;  1PM9 A;  4X20 B;  2CAZ C;  4B08 A;  5LL6 Y;  4MTX A;  4DYL A;  3RWR D;  3WB2 A;  4IHJ A;  4B3M B;  3B09 A;  4OGQ B;  3BY6 A;  4UCU A;  5HFL A;  1Q7Y W;  2A9H A;  4AIL C;  3RYH A;  3R65 A;  1VQK V;  3JAS B;  3OTO O;  4DUY B;  1SC5 B;  1VQN V;  1SQF A;  4X1I A;  2XAF A;  1K34 A;  2HVK C;  3K57 A;  1Q3E A;  2IJH A;  2G38 A;  3O9O A;  4CH5 A;  3OE7 G;  3JAT B;  2A06 H;  1BZK A;  1RPR A;  4LF8 O;  1HNZ B;  1GM8 A;  3T1H O;  2ZXW C;  3JD3 A;  1DGS A;  2QR4 A;  3CCS V;  2P06 A;  3SPH A;  2LJ2 A;  3ZRW A;  3STL C;  3OR7 C;  4YY3 O;  1WN7 A;  5BR8 B;  5KHJ A;  2A7W A;  1JMK C;  1BCC H;  1YI2 V;  4JGS A;  2PYJ A;  4NTW A;  4YJ3 B;  2HKO A;  4NVP A;  2N05 A;  5LGU A;  1Q6U A;  2P90 A;  1XMQ O;  4FPP A;  3W7U A;  4I9Q A;  1Y67 A;  3I55 V;  4OXS A;  5LYJ B;  3JAS A;  3RYI B;  1KC8 W;  4QJF B;  2RMK B;  3J80 N;  4QPJ A;  2KB1 A;  4Z2W A;  1K5S A;  1KKC A;  4HBN A;  3T4Z A;  2WLN A;  2XUM A;  3GVM A;  5GTI Z;  1Y66 A;  2HFE C;  1QR9 A;  1GTO A;  1PPJ H;  4XDL A;  4PD4 F;  5LOV A;  2PI4 A;  3ABM C;  3E89 A;  4QPK A;  3UM7 A;  5LGN A;  4JTC B;  4ICG A;  3A0B Z;  4CH4 A;  4IGG A;  4RAI A;  3W7S A;  4RUE A;  4LF4 O;  1J5E O;  1N32 B;  1DLB A;  3B8N A;  2DWE C;  3CE2 A;  2ATK C;  4X20 A;  5HFM A;  5KMG A;  5A9G A;  2UXD B;  5EC1 C;  4LFC O;  4D7T A;  3MDS A;  1Z5V A;  3ETD A;  2X6B A;  2BOC C;  2UU9 B;  1SQB H;  4LNU B;  1NTK H;  3ZMS A;  3RVY A;  1AR1 B;  4DR6 B;  3O65 A;  4RUF A;  1XNR O;  3RFR A;  2F4V B;  1K4C C;  4U3J A;  3ZHT A;  3HKB A;  3FB8 C;  3JAW A;  4Z1V A;  2OCC B;  2X6C A;  3ASN B;  2QEX V;  4IIJ A;  1F4N A;  4IIJ B;  1TUB A;  4P9P A;  3T1H B;  1FXH A;  2ODM A;  4ZHQ B;  4U3J B;  3HKB B;  4ABM A;  4ZI7 A;  4JV5 B;  4YJ2 A;  4CC5 A;  3FYE B;  5BR8 O;  4PDR A;  2XTA A;  3HPL C;  2QJ1 A;  3ZJZ A;  2FL4 A;  1Y76 A;  4OPA A;  5H2F Z;  2ZT9 B;  2JGD A;  1F4M A;  3IJ4 A;  1H38 A;  4JI2 O;  2EIJ B;  3RYC A;  2WLI B;  4DV6 B;  3E8F A;  2R9A A;  1ROP A;  2GBO A;  2XND G;  1JJO A;  5D5Q A;  2YEV B;  1LNQ A;  1FS0 G;  5E1A C;  5J2U B;  1YXB A;  1CEZ A;  5LA6 B;  1IBL B;  1YDX A;  4TUY B;  4LFB O;  1QVF U;  2VS0 A;  2ETN A;  1NS1 A;  2W0F C;  1VIB A;  3QO5 A;  3FB5 C;  4DK0 A;  4LF6 B;  1RP3 B;  4LFA B;  1WPB A;  3IC9 A;  4XBF A;  4BW9 A;  1QHT A;  3N2G B;  2YIB D;  2JGD B;  5L3G A;  1M5I A;  4PI2 A;  4TT3 G;  1B3Q A;  3LSS A;  1S72 V;  5JQG A;  2CTR A;  4PA3 A;  2IH3 C;  2VQE B;  2WWW A;  2PI5 A;  1VQ8 V;  3ZED A;  4KL1 A;  4EEQ A;  4TV9 B;  2EIK B;  3VQW A;  2YIA A;  4AQY O;  1YJW V;  3E8G A;  2KG7 A;  2D2C B;  3VOU A;  4NXN B;  1B06 A;  3WB1 A;  4CH3 A;  2NLJ C;  2DYR C;  3UCS C;  4TUY A;  4EB6 B;  1L0L H;  2A79 B;  1US6 A;  4PI0 A;  2WLL B;  4KUM A;  2F4V O;  3Q4H B;  2HJD A;  3CJH B;  1NU1 H;  5IDJ A;  1O9H A;  1N34 B;  5CA0 A;  3BCC H;  1M9N A;  2AHY A;  2QM7 A;  1IBM O;  3H01 A;  3D36 A;  4JV5 O;  2XT9 A;  4KHP B;  4NR1 A;  1EN6 A;  4DR3 B;  2ZDI C;  1IBK B;  3RYI A;  5FL7 G;  4JYA O;  1GM9 A;  1ENV A;  1AI5 A;  4GX5 A;  4X64 B;  3L9D A;  4TSF G;  5DM6 V;  3IFX A;  1ZUQ A;  3C3T A;  5JJE B;  5LP6 B;  4UCR A;  4X8A A;  4WBN B;  4DV6 O;  2UUB O;  2V4D A;  1D5A A;  4BWA A;  1JPX A;  4F4L A;  5C8Y B;  2QM4 A;  4CC6 A;  3QO8 A;  1K33 A;  1TUB B;  5LP6 A;  2UXX A;  4OPH A;  5L3C A;  4O4H A;  3VBB A;  2QE7 G;  4GX2 A;  3N2K B;  2W6J G;  2Y0P A;  3B4S A;  3CME V;  2FB5 A;  2GV9 A;  4JI3 B;  2ZE5 A;  4LF6 O;  1WA8 A;  1CP9 A;  4FIP C;  1OCZ C;  2F66 C;  1WA8 B;  1S0V A;  3K08 A;  1XQ8 A;  3SDL A;  1QLE C;  3RYH B;  1SQQ H;  2GSM B;  3JAR A;  5LMU B;  3P32 A;  3LNN A;  5CA1 A;  1BGY H;  2UUC O;  2HJF C;  3RW0 A;  5B1A B;  5AG2 A;  1OCO C;  1NVP D;  3TGU H;  1O9G A;  4LF5 O;  1ZWI C;  1I7F A;  4D6T H;  3T1Y O;  5JH7 B;  1U96 A;  2OIG A;  1FJG B;  5EBM C;  2JEX A;  3DC6 A;  1Q82 W;  4NXN O;  3U10 A;  4E2L A;  5H6R A;  1ZLZ A;  3C3S A;  4X1Y B;  1JR9 A;  1RPO A;  4R50 A;  4ZBM A;  4B3S B;  4J42 A;  1V55 C;  2YIC A;  1EZV H;  1N0J A;  3QO7 A;  2ZM6 B;  4YIO A;  3IC7 A;  2CTW A;  3A2F A;  3P30 A;  1MA1 A;  2DYS C;  1HNZ O;  1IBM B;  2ZIO A;  1HW7 A;  4JI4 B;  2GUZ A;  4BIU A;  1BHB A;  3CS5 A;  4U7O A;  4GLX A;  4YY3 B;  2IU0 A;  1VF7 A;  3HR0 A;  1GN2 A;  5ITZ B;  4MVM A;  5EC2 C;  1GO3 F;  3VQX A;  3LDE A;  1XHZ A;  3CRM A;  1WP8 A;  2UXC B;  4JYY A;  2Y69 C;  1XBL A;  2JGU A;  2QWP B;  1EZJ A;  1PNK A;  4QE9 A;  2X6A A;  4FFB B;  1SZX A;  2RNB A;  2WPD G;  3AG3 C;  4TWK A;  4JI3 O;  1IVS A;  5CB4 A;  2JVD A;  3WB0 A;  3K9S A;  1EN5 A;  1WJZ A;  4WFA V;  1N8R W;  1IX9 A;  3P3P A;  2D3O W;  4AI8 A;  4P2Z A;  3D8C A;  4I0X A;  1Y76 B;  3ASO C;  2LFS A;  4X89 A;  4RWU A;  5KHH A;  1KEC A;  1S5L Z;  2FKX A;  1BL8 A;  3F5W C;  1GRJ A;  3CWB H;  1Q5O A;  1K7D A;  2UUC B;  1IDS A;  1F7Y A;  2HVJ C;  1HWY A;  4ZOL A;  2P7T C;  1VMG A;  2Y48 A;  3JAK B;  3CCE V;  1QQC A;  2QWN B;  1ZAU A;  2YS8 A;  3JAW B;  4H33 A;  4LF7 O;  3DXR A;  4GX1 A;  3JD0 A;  4H0L B;  2UXD O;  1AJP A;  4LFC B;  1G8M A;  5B1O A;  2JS5 A;  3RVZ A;  3CEI A;  3N27 A;  4CS4 A;  5CB4 B;  3JAT A;  3HKC A;  2LO1 A;  4DV7 O;  4I50 A;  1OCR C;  4LWS B;  4JI0 O;  1B6Q A;  1CPY A;  3JSL A;  3OTF A;  5L3B A;  1W0J G;  1XNR B;  1MZF A;  2DQ0 A;  3QF7 A;  1SRY A;  4FZ1 A;  4QE7 A;  1RSO A;  5B1N A;  4G2K A;  2OTJ V;  5B66 Z;  1R73 A;  1AR4 A;  1P4R A;  3ZN0 A;  2VRZ A;  5IYD O;  3H1J H;  4H13 B;  1VQL V;  5CMU A;  4GKK B;  1NR1 A;  1RSO B;  4I7Z B;  3CC4 V;  1H2M A;  2XAH A;  3EVK A;  5IYZ B;  2F43 G;  4DR4 B;  4LC1 A;  4G28 B;  1NQT A;  1SET A;  3OGI B;  4FFK A;  1VF5 B;  5EIB C;  5KUM A;  3HKC B;  3ASN C;  4JI2 B;  3BFR A;  4FLV A;  4UV9 A;  3W7X A;  2OCH A;  2Q6A A;  1AIL A;  1YTF D;  4FFB A;  3L71 H;  1YF2 A;  5CA0 B;  4Q6G A;  3KZI Z;  3K5O A;  1VQ5 V;  3OUS A;  3BA8 A;  5ITZ A;  3DGE A;  4MSW C;  1XL4 A;  1N4C A;  4YHH O;  3G6B A;  2IJJ A;  1L1F A;  1D2D A;  2ZIM A;  5JWP A;  3ML0 A;  4LFA O;  3UO3 A;  4J80 A;  2Q7G A;  3AG7 A;  4MVZ A;  5FPO A;  4EKW A;  1TAE A;  3K0G A;  1G1X B;  2E5L O;  2M7W A;  5H6Q A;  2VWJ A;  3F7Y C;  5B1B C;  1SF9 A;  4LNU A;  3UT5 B;  3E83 A;  2YC0 A;  3AG1 C;  1QNM A;  2ARH A;  4LF7 B;  5H9C A;  4X1K B;  1M57 C;  3ZMV A;  4Q20 A;  4O4L A;  3HKE A;  1K92 A;  5GON A;  4JI5 O;  3E22 A;  3CJH A;  4IYH A;  3AG2 C;  3MD0 A;  1YZB A;  2YDE A;  4JAS A;  2PZS A;  4UB8 Z;  1NKD A;  3BPZ A;  4L87 A;  4J10 A;  1V54 C;  1SES A;  4MVS A;  2QTS A;  3CCQ V;  2ZR3 A;  1VQM V;  1MOF A;  4BIO A;  4NXM O;  2P5O A;  2EIK C;  1Q86 W;  2Q9L A;  1QU7 A;  4AQY B;  1BQZ A;  4EFE A;  3A8T A;  2LW1 A;  3DSQ A;  1PD3 A;  3U11 A;  4GKK O;  1IXB A;  4WFF A;  5LHG A;  3FD9 A;  3H1K H;  5IJ0 B;  4DUZ O;  1J95 A;  3IGA C;  3TK1 A;  2PY5 A;  2LGW A;  5B5E Z;  4DV1 B;  2WSS G;  4X65 B;  1EFR G;  2XAJ A;  5LBQ A;  3SYQ A;  2VWK A;  2W6I G;  3ZCC A;  4X64 O;  4F6E A;  2XAG A;  1VQ9 V;  1IXM A;  5BY1 A;  5IYC O;  1VQP V;  2H8P C;  3OEH G;  4GZR B;  2NR5 A;  1BSM A;  2WLJ A;  1HR0 O;  3QG5 A;  4ZKI A;  2UUB B;  3B8M A;  4HAM A;  3CHX A;  3EXA A;  3H1I H;  3HKD B;  4UV8 A;  4KHP O;  2EJ7 A;  4MT8 A;  5CA3 A;  1SQX H;  2YIB A;  1T5E A;  1KYO F;  5IWA O;  5GON B;  1IBK O;  2MK3 A;  3RT3 C;  1Y74 A;  3J81 N;  1E1Q G;  4JI7 O;  2BTQ B;  4IHJ B;  4CS3 A;  4GT1 A;  1AI6 A;  3CX5 F;  1AB3 A;  5IJ0 A;  5LP6 C;  4HNA A;  3L74 H;  1NH2 B;  3GWK C;  1P84 F;  3L70 H;  2YI8 A;  5EZY A;  1KMI Z;  4X66 O;  3THO A;  3L73 H;  3OD4 A;  4DR1 O;  2ADP A;  3H1H H;  2GHY A;  4BAY A;  5KUK A;  2JEU A;  1L8D A;  1L0N H;  5FPR A;  5EYP A;  3ZMU A;  2VQF B;  1FXK B;  3P3N A;  3ABL B;  1JVM A;  1M1K W;  5JJJ B;  1UPG A;  3OAA G;  4NTX A;  5B3S B;  1G6U A;  4O4J B;  3J7A U;  2Q7H A;  2E76 B;  2ZDI A;  4MTG A;  2QA4 V;  4B3T B;  1QVG U;  3EHB B;  1K8A W;  5EBW C;  1Q6I A;  3TXS A;  3CMA V;  2RCV A;  3FAV A;  2GTS A;  3FYI B;  2R9I A;  3ZRW B;  4FJC C;  2GUZ B;  1FD9 A;  1NR7 A;  3X2Q C;  4I55 A;  4B3S O;  3E2E A;  3C90 A;  2C2A A;  2CH7 A;  1DTO A;  1E1R G;  3T4D A;  2WLI A;  1P49 A;  4K8X A;  3E22 B;  4DV5 O;  1XNQ O;  5TIS Z;  3ABM B;  2N04 A;  1OCO B;  2ZM6 O;  1QBZ A;  4LF5 B;  4QIW F;  3UKM A;  4E4E A;  1HP8 A;  1I0H A;  4NXM B;  4HNA B;  1DF5 A;  4KXR A;  1VQ6 V;  3CRR A;  2EX3 A;  4RQE A;  4JI4 O;  4QNH B;  2Q5Z A;  2ZCE A;  4FM1 A;  2L6L A;  1QLN A;  2WA4 A;  3F5T A;  1MG1 A;  3PN1 A;  1TGO A;  5JCO A;  2WLK A;  2UXC O;  2RJZ A;  2P4V A;  3QNE A;  2E3C A;  4MW8 A;  4AHC A;  1Q43 A;  2KG7 B;  3RBZ A;  2DQ3 A;  3CCM V;  4FZ0 A;  1ZL8 B;  3BA9 A;  1BQ0 A;  2OCC C;  1H2G A;  4MVU A;  5KA5 A;  2F93 B;  3OMN B;  4J9Y B;  5JVD B;  1DF4 A;  4JYC A;  4MVQ A;  3CP1 A;  3K04 A;  4DV4 B;  2HP8 A;  4PA4 A;  1YJ9 V;  3OM3 B;  2YXY A;  4Z1M G;  4CS2 A;  2Y4U A;  3AK1 A;  4O2B B;  3BRC A;  4UVA A;  3AG3 B;  3E8H A;  2BOB C;  2LP7 A;  4LF8 B;  1Y4M A;  4I4T B;  2EIJ C;  2BTQ A;  2EUL A;  1EBO A;  4DV3 B;  2NNU A;  3ZHQ A;  1WB7 A;  5J2U A;  4JI6 B;  2HEP A;  3B2E E;  4TQF A;  3SJA C;  2PYL A;  4B3T O;  5LOV B;  1URF A;  3ETG A;  1PV0 A;  2CK3 G;  2DOS A;  3K59 A;  3RYF B;  4DXW A;  2ZR2 A;  3WG7 C;  5IYB O;  3I5D A;  4TQD A;  1GH6 A;  2RN9 A;  4YXW G;  2E74 B;  1V9P A;  1I5Y A;  4KP4 A;  4X9Q A;  4JAV A;  2V1D A;  1R3I C;  3TCU A;  2EZP A;  3FFQ A;  4R7C A;  4WFH A;  2QM8 A;  3DTU B;  3OTO B;  4J7Z A;  1XOU A;  2EIN B;  5BXZ A;  1N0N A;  4PDL A;  1FKA O;  4DV7 B;  1F51 A;  5D5P A;  1S3J A;  3GB7 C;  5FLX N;  4JI0 B;  1AI7 A;  2L35 A;  2BSK A;  4DV2 O;  4WF9 V;  3SYO A;  2QWQ B;  2IM9 A;  3OMI B;  3LDC A;  3ZMZ A;  2CTQ A;  3JD2 A;  5IT9 N;  2R70 A;  2B5U A;  2BCC H;  1OJH A;  4FM2 A;  2ZIN A;  1WAZ A;  2ZD9 A;  2ZE8 A;  1M56 C;  2ZQM A;  3AG4 B;  1I94 B;  5L3F A;  4LCU C;  3ABT A;  4L8J A;  2FML A;  4DR4 O;  4NTY A;  3TET A;  5CBG A;  2P67 A;  5EK0 A;  2CE4 A;  3ABK B;  5JH7 A;  3CYO A;  3JAL B;  2YI9 A;  4DO2 A;  3JAL A;  2XAQ A;  2B9Z A;  2ITC C;  2P22 C;  4J7K A;  2E5L B;  1NVP B;  1XL6 A;  1AI4 A;  2EZO A;  1HNW O;  3OMA B;  1BMF G;  2K1E A;  2WA3 A;  1JA8 A;  1JFF B;  3CRC A;  4UUJ C;  4WFG A;  2ZKO A;  1NT2 B;  5GTH Z;  1GK9 A;  3ZS8 C;  1AJN A;  1K97 A;  4D7S A;  1YHQ V;  4DV0 O;  2OT5 A;  5CN0 A;  1HNX O;  3JAK A;  2YID A;  2Q0A A;  3K5L A;  3OGC C;  3D36 C;  4YIP A;  1VQ4 V;  1G4Y B;  1NTM H;  1FYJ A;  1LUV A;  4LF4 B;  1OCC C;  2AHZ A;  1OCZ B;  1AJQ A;  1ARO P;  3CB2 A;  4LF9 B;  1XEQ A;  4WBN A;  1F23 A;  4B7E A;  4TV9 A;  2Q4P A;  3JD4 A;  1N36 B;  2WAM A;  3MHH C;  4JYB A;  4FLX A;  1IBL O;  1BT8 A;  2UU9 O;  4PJ0 Z;  3SJQ C;  4UVB A;  4DUZ B;  2IW5 A;  2CH7 B;  2EJR A;  1VP7 A;  2Q8V A;  3BAA A;  4DV1 O;  2AGA A;  4DV2 B;  2UXB B;  1QR8 A;  4UB6 Z;  5K1P A;  2QDO A;  5KHI A;  3FAV B;  1PL0 A;  2QTO A;  4MS2 A;  4UCV A;  4F6R B;  4P30 A;  5BMV A;  1ORQ C;  3Q4H A;  1R6N A;  2HHH B;  3ICX A;  1KP3 A;  2Z3Y A;  1Q90 D;  4XDJ A;  1I94 O;  4QGP A;  5IWA B;  1N33 B;  4TOI A;  4BR6 A;  1VF6 A;  3FB6 C;  3K9A A;  1W2B U;  2DYS B;  1OHH G;  1FXK A;  4K35 A;  3G4S V;  2K9P A;  5GW7 A;  5IY5 B;  5KHG A;  5LMN O;  2JJ1 G;  5J9P C;  2ZXW B;  3BHP A;  4KFM A;  4O4I B;  5JJN B;  1WP7 A;  1HR0 B;  5EBL C;  2OWO A;  1I5X A;  3OFN G;  4BIZ A;  2IBZ H;  4W4K A;  3SGI A;  4CZZ A;  1AP5 A;  2EIL B;  3KG2 A;  3WFV A;  2AXT Z;  4WFE A;  4FLU A;  2W0X A;  2F95 B;  3AK3 A;  3AK2 A;  4X62 O;  4JI7 B;  3I56 V;  3OT7 A;  2Q73 A;  4O2A A;  2BE3 A;  1OZ0 A;  2JK5 C;  1SA0 B;  4JI8 B;  1ZL8 A;  4ZIB A;  2B1G A;  4DV0 B;  1HNX B;  2IU3 A;  5BMV B;  4ASU G;  4DR1 B;  2P4K A;  1KP2 A;  4OX9 B;  1VF6 C;  4FLY A;  1FXK C;  3B77 A;  1JQ0 A;  4DW0 A;  1SZT A;  5EIB D;  2F23 A;  4DR2 B;  4LF9 O;  2YEV A;  2JS3 A;  2XOK G;  2GTA A;  5B3S C;  3JAR B;  4JZG A;  2EIM B;  1YIT V;  2DW4 A;  1K4D C;  1BS3 A;  4X1I B;  3M99 B;  3G80 A;  1TA8 A;  3X2Q B;  4IL6 Z;  3ZRX A;  4PA9 A;  5LMU O;  1K5Q A;  4JTA B;  4PV1 B;  2CTP A;  2QKC A;  3R66 A;  3ZN1 A;  4PDM A;  4FM0 A;  1R3L C;  1MSW D;  5FNV A;  2LFR A;  2GDS A;  1FJG O;  5KAI Z;  2Z0A A;  4DR3 O;  4UCO A;  5KX5 B;  3D3Q A;  5DN6 G;  1IUR A;  3T1C A;  3TJT A;  1K9M W;  2NN4 A;  2QSA A;  1FFT B;  4BW5 A;  2XAS A;  5DEC A;  4CBC A;  1RM1 B;  2WLH A;  5LMN B;  2WLM A;  3CC7 V;  3SPI A;  1JCH A;  1GN3 A;  3T2M A;  4UCT A;  1H2S B;  4JZ2 A;  5KMG B;  3VQY A;  4DW1 A;  4J11 A;  3JAM N;  4CH6 A;  1GN4 A;  2Q69 A;  4MTF A;  1H8E G;  4GYC B;  3EFF K;  2BTO A;  2KKW A;  4GUN A;  1KD1 W;  3CXC U;  4IT5 A;  2Q67 A;  2DJV A;  1DK1 A;  3E86 A;  2Y0I A;  3SPC A;  4JI1 B;  1BE3 H;  1K3E A;  1XRE A;  4I0X B;  4N23 A;  4DV4 O;  1XUQ A;  1KB9 F;  3CRA A;  3JD1 A;  3L75 H;  5L3E A;  1COW G;  1S5H C;  4X1K A;  4K0K O;  2YXH A;  3SYA A;  3S3X A;  4WFB V;  1H8H G; 
#chains in the Genus database with same CATH homology
 3UO2 A;  1GH6 A;  2DMX A;  2LO1 A;  2QWR B;  2OCH A;  2DN9 A;  2CTR A;  1HDJ A;  3UO3 A;  2GUZ B;  4J80 A;  2CUG A;  1XBL A;  2Y4T A;  2QWN B;  2QWP B;  2YS8 A;  3AG7 A;  4RWU A;  2M6Y A;  2L6L A;  2QWO B;  2Y4U A;  2GUZ A;  1IUR A;  2PF4 E;  2N05 A;  1BQ0 A;  1BQZ A;  2QWQ B;  2YUA A;  3BVO A;  1NZ6 A;  2QSA A;  1FAF A;  2N04 A;  3UCS C;  2CTQ A;  4IT5 A;  2CTW A;  1WJZ A;  2CTP A;  3APQ A;  4J7Z A;  2EJ7 A;  1N4C A;  2KQX A;  3APO A;  1FPO A;  2LGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...