2YS8A

Solution structure of the dnaj-like domain from human ras-associated protein rap1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
GSSGSSGSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Rab-related GTP-binding protein RabJ
publication title Solution structure of the DnaJ-like domain from human ras-associated protein Rap1
rcsb
source organism Homo sapiens
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ys8A00
2CTWA 2KQXA 3BVOA 2M6YA 2Y4TA 2CTRA 2DN9A 1FAFA 2GUZA 1NZ6A 2OCHA 1N4CA 2QWOB 2QSAA 1HDJA 1BQZA 4J7ZA 3AG7A 2EJ7A 2N04A 2YUAA 2CTPA 4J80A 3UO2A 2PF4E 2DMXA 2L6LA 1BQ0A 4RWUA 3APOA 1XBLA 3UO3A 2LO1A 3UCSC 2QWNB 2Y4UA 1FPOA 2QWQB 2CTQA 3APQA 1GH6A 2QWRB 2GUZB 2CUGA 2N05A 4IT5A 1WJZA 2LGWA 2YS8A 1IURA 2QWPB
chains in the Genus database with same CATH superfamily
1FJGB 1JJOA 2YC0A 1H2SB 1R3KC 4DV0O 4GKJO 1KBHA 3K59A 4B3MB 3G80A 1JFFA 5LHGA 4HNAB 4B3TB 1YI2V 2DWDC 3H1IH 2EIJC 4WFAV 2H3OA 3VBBA 4EB6A 4G27B 2PZSA 1FXKC 1L8DA 3RW0A 1R6TA 3T1HB 3AG4C 1IBMB 5B5EZ 2VQFO 2DYRB 5EIBC 4B08A 1S5JA 2A06H 3UQ8A 3KZIZ 2WLIB 2M6YA 2EIMC 2FYUH 2GUZA 4OGQB 2EINB 3MD0A 3P3PA 1ZUQA 3CCEV 4DR2B 1NI8A 1XOUA 3LDDA 3SYCA 3THOA 4MVMA 3LNNA 1VQ8V 4CH6A 2B9ZA 4BIOA 3OM3B 3R65A 1P7BA 1PD3A 1V9PA 2DYSC 2QR4A 2Q7EA 5ITZB 4J11A 1WA8B 4EFEA 1KMIZ 1NZ6A 3D36A 1K8AW 4X62O 1SQVH 1JPXA 2UU9B 4NVPA 4E2LA 1D5AA 1PM9A 4JI7O 3BA8A 2ZM6O 4DW0A 2JGUA 2JS5A 3SGIA 3APQA 4JZ2A 3W7XA 3BABA 1G8MA 3AK1A 2IJHA 1OCZB 2LQTA 1XMOB 1G1XB 1ZL8B 2OTLV 2QEXV 1PL0A 3DGEA 4X9QA 1QHTA 5EK0A 4E4EA 3CP1A 1RP3B 1FXVA 4LF9B 2PYJA 4X65O 3ZRWB 2EX3A 1N0JA 1TUBB 5LHHA 4FJCC 1RPOA 4X64B 4BIUA 3U11A 4J7JA 4IYIA 4YHHO 3ZHUA 3TXSA 1ZX3A 1HDJA 3ZMSA 4PDLA 1THZA 3TXQA 1BSMA 4NXNB 2DYRC 4DV7B 1EM1A 4DV6O 1D5NA 2PUSA 5GW7A 4R6ZA 1ZAUA 3RYHA 1CXZB 2EINC 4IT5A 1TGOA 1TVKB 1XNRB 1IXMA 1VQ4V 2F93B 2QTOA 3ZN1A 3GWOA 4GX0A 4GLXA 4GX2A 3ZMTA 2EBOA 2ZNIA 3B8MA 2UUBO 1ZSPA 2YXHA 1SQQH 1DF4A 4DUZO 4P30A 4NKGB 4FVMA 5IT9N 1N33O 1H2MA 2BSKB 4RUFA 1M4UA 4XDJA 2DQ3A 2C2AA 4WFHA 4JI1O 1BZKA 5JQGA 1N4CA 4YJ2B 2N74A 1V55C 2HG5C 3SPJA 1OCZC 4BWAA 4LF8O 5CBFA 4DR3B 4JTAB 3M99B 4UUJC 1JOYA 2P4VA 5GONA 1HNXO 3CC2V 5BMVB 3AG2B 5KLVH 2Y4TA 4CZZA 1GK9A 4H13B 2P90A 4KL1A 3K04A 4U7NA 3ZX6A 1K3EA 1M93A 3JAWA 1ORQC 5B66Z 2HR3A 4DV1O 2CH7A 2M7WA 1TAEA 4I9WA 3ZHQA 3CCRV 2A79B 5LYJB 2H8PC 2XASA 2QWQB 2XAHA 1GH6A 1N32B 1KECA 2RJZA 4ZHQA 3SDLA 4I9QA 4MT8A 3B77A 2B1IA 1SQXH 5KUKA 1SERA 3KKYA 3ZMUA 3JSLA 2Q5ZA 5AG2A 2XTAA 3AG3B 2ITCC 5JH7B 5IYDO 4UVCA 2YIAA 1VARA 3EXAA 3SYQA 5CBHA 3ASNB 1L0LH 2VWJA 2YIBD 4OPHA 4JI0B 1Q90D 2XHBA 3SPHA 1HR0O 4MVUA 5J2UB 1UPGA 5CBGA 3E8FA 2GSMB 3JAKA 5KA6A 2AHYA 1U97A 4DV4O 3OTOO 3RYFB 3A8TA 3OR7C 2K9PA 1EN6A 4WBNB 3OUFA 4QNHB 2G38A 2CUGA 2VRZA 5B1BB 1K92A 1KP2A 2A3QA 2GBOA 1AILA 2Q73A 4DUYO 3RYIA 5F2VO 5TISZ 2YSUB 3G71V 2ZE7A 1H38A 3SYAA 4F6RA 1EZJA 3CMEV 4JI8O 1S77D 4DO2A 1MABG 2UXDB 3HKCB 3K5OA 3AG2C 5IE9A 3UT5A 2CTQA 2ZNJA 3ZHTA 1DLBA 1YTFD 5L3DA 1YTFB 1S76D 4W4KA 1S3JA 3OAAG 3SYOA 1P7GA 1W0JG 4O4HB 3IFXA 5D5QA 3K5MA 1F4NA 3ZN0A 1Q81W 3D3QA 5CB4A 3AG1B 4LF6B 3K3WA 4I55B 4P9OA 2XNDG 3CC7V 1MMMA 3GVMA 3K0GA 3CC4V 2LFSA 2PTMA 3BVOA 3E8HA 3OMIB 3ZIAG 3ZJZA 3CCSV 1OCCB 2RQ6A 2YXYA 4TSFG 2K1EA 4B3RO 4DR1O 3CCVV 3ASNC 3QVNA 3S3XA 1VQNV 2L6LA 3H1KH 1R6KA 1JMKC 2VS0A 5JVDA 4Z1MG 4ZOLA 4JI2B 4FIPC 3CCJV 5LL6Y 3JD4A 1IURA 5KAIZ 1SQGA 4YJ3B 1FAFA 4LFBO 3VQVA 1RSOB 2OCHA 4J41A 1VF5B 3NR7A 1V54C 1OCOB 2Y69C 2N04A 2WA3A 2ETNA 2R9AA 3E83A 4K8ZA 4U3JB 2R70A 4YY3O 2NR5A 2UXCB 2ZINA 1OJHA 2UUCB 1JFFB 2HVKC 2JJ1G 3CMAV 3CCLV 5KHGA 4DK1A 3DC5A 1IZ3A 2MK3A 4MTOA 4EB6B 3W7TA 1H2GA 1OV9A 4JYAO 3C90A 3SR2C 1XL6A 4G2KA 3ZEDA 5EC2C 2ZXWB 4DR5B 4UCUA 2GUZB 2Q8VA 1FFXA 2LW1A 1Z5VA 4JI3O 5KX5A 2PY5A 5JJJB 3SJBC 3BAAA 1QBZA 1XQ8A 4C7UA 2BTQA 1FKAO 4LFAB 2YUAA 3BEHA 4J80A 2ZDIC 4DR6O 3JALA 2OT5A 2YXLA 3STZC 4WFGA 2W6IG 2BOCC 5IYZA 1AR1B 1Q6IA 4YIOA 1Q7YW 1J5EB 2YEVA 3RGBA 2AZ0A 4FMTA 4KXRA 5JJEB 3STLC 1B3QA 1NVPD 2YIBA 1NVPB 4FFBA 1QQCA 5JCOC 4CS3A 5IJ0A 4UV9A 4NTWA 3O65A 5B3SB 1GM9A 3CD6V 2Q0OC 2F4VB 1HNZO 2DJVA 2ZR3A 2UUAO 4HYOA 2EILC 2IJJA 3HB3B 3SYPA 1ZLZA 1XREA 3K57A 3JATA 4KHPB 3B4SA 4R50A 2PI5A 4DV3O 1YXBA 4GCZA 5IY5B 1QLEB 4K3AA 1VF6C 2Y4UA 4UCRA 1F4MA 2O57A 2GDSA 5LGUA 3RT3C 5LOVA 3CYOA 2WLMA 4LNUA 4Q6GA 2GHYA 5JJNB 4H44B 4LF5B 2CE4A 1Q86W 4UFZA 3RWRD 2FL4A 4JI5O 3RYHB 2VQEB 2PGGA 4MS2A 5HFLA 4EKWA 1X59A 2UXBB 3E8GA 5L3GA 3CRRA 4X8AA 1SQBH 5LMNB 1EFRG 4MTFA 5BXZA 2B1GA 4LH6A 1BL8A 1R3JC 5IYBO 1N34O 1IXBA 2CTPA 3D36C 4JPRA 3ZBHA 1AROP 3RBZA 5JQGB 5JWPA 1N0NA 1L0NH 5IWAB 3S3WA 3J81N 4UV8A 3N27A 2H94A 3WG7B 4CH4A 4TQFA 2WWWA 5GONB 2E5LB 4R7CA 1DK1A 2UXXA 3ABMC 3P3NA 2HJDA 4PD4F 1LR1A 1XNQO 3E22A 5CMUA 1NTMH 4FLVA 4J10A 1NR1A 1JQ0A 3IAYA 2RNBA 1FJGO 5C8YA 4I4TA 3RVZA 3I56V 3JAWB 1QLEC 2CH7B 3IC7A 3OFNG 3TGUH 3H01A 2KKWA 1FFTB 1BT8A 2IM9A 1Y6XA 2XUMA 4GT1A 4ZHQB 4DXWA 2CGOA 1F51A 4Q20A 4LFCB 1TA8A 1KC8W 4PDMA 4JI4O 1K73W 1AVMA 3FB5C 3SPGA 4DV0B 4GKJB 3OGCC 4CBCA 2EZOA 4O2BA 3FB6C 3BRCA 4PV1B 2ATKC 3RVYA 1Y4MA 3OTFA 3K03A 5K1PA 1AI4A 2VQFB 4DV2O 2R9RB 1IBKO 3JAKB 3WU2Z 1IVSA 1AI7A 1AR4A 3ASOB 2Q69A 5GTIZ 3G6BA 1WB7A 1R3IC 4DR4O 2JDIG 4GKKO 1M56C 4JASA 1I94O 3SJCC 3OMNB 3RYIB 2LW7A 2D2CB 3LSUA 3QO8A 4UCOA 3WG7C 4F6RB 3ABKB 2CTWA 3VQWA 1HW7A 4XDLA 4B3SO 4X62B 5EBMC 2QSAA 3ETQA 1R3LC 3UT5B 1AJQA 4JI7B 4AQYO 2FMLA 2ZM6B 2EIKB 4OX9O 1I5XA 2FKXA 1QLNA 1LUWA 1XUQA 1CPYA 5CB4B 2HLDG 3T4DA 4WFFA 1P4RA 1DGSA 3ZRSA 2Y0PA 4TV9A 5H6QA 4WF9V 3JCZA 5LGTA 3RYCA 1KP3A 3C3SA 2QE7G 1BQ0A 5H9CA 3CCUV 4X65B 1ZWIC 1ENVA 5DEDA 5FLXN 3ABUA 4DK0A 1NR7A 1VQMV 2HHHO 1PPJH 4YHHB 2HJFC 3B09A 5JVDB 3LDEA 1BMFG 4CC6A 1FXKA 4ZOLB 3ETDA 4DV6B 3TCUA 4PHZA 2QKCA 3J80N 2WLLA 1OCRB 3D3IA 3ETEA 1S5HC 3CE2A 2YS8A 1IBLO 4MVZA 5LP6A 4Z2WA 1GN2A 3CRQA 1M57B 1NJIW 1NQTA 2CDYA 3FD9A 3T1CA 4IHJA 2UUBB 3GWKC 4JZGA 4DUZB 1VIBA 2QJ1A 2ZCEA 1N33B 3EVKA 4TQDA 4GX1A 1YIJV 5C93A 1MNGA 2QWRB 4LF7O 1LNQA 3RN4A 1K34A 4NB5A 3IGAC 4JI1B 1K33A 3CCMV 3CS5A 2EIKC 5LXTA 2PYLA 1GTOA 3ZS8C 5EZYA 5L3EA 2RCVA 1BHBA 1YITV 3FYEB 4LF8B 1FFXB 2B5UA 2LO1A 2HEPA 2DQ0A 5IYCO 5KX5B 2XAQA 4J42A 4IGGA 3G6EV 2BTQB 4H37A 1WP8A 3ETGA 4F4LA 3JALB 2A9HA 4UVBA 1KKCA 4TWKA 4DV1B 1E79G 2OIEA 5HFMA 5IYZB 2Z3YA 3JCUZ 2YEVB 3M7MX 4CC5A 2P22C 1B6QA 3CPWU 1XMQO 4FFBB 1GAXA 5A9GA 5IJ0B 3VQYA 1WPBA 1W2BU 3VQXA 2QKSA 2P5OA 1EZVH 5E1AC 1OCRC 5KHHA 4X66B 4RQFA 4FZ0A 1P84F 1MA1A 4DR7O 2CGNA 2Q0AA 4RO2A 1K97A 3PN1A 1YJWV 1P49A 3JATB 3B2EE 4W4LA 1KD1W 4UCTA 2GTAA 2ZD9A 1HR0B 2IJIA 2CTRA 4U7OA 2BTOA 1AJNA 1BS3A 5KAFZ 4L8JA 1JJ2U 2F43G 5B1NA 1XHXA 1VQ9V 4CH5A 2DE0X 4DV4B 3OTOB 3P32A 5LOVB 3M8AA 4EFBA 4LNUB 4FLTA 1S0VA 2OYQA 3JD0A 2QGNA 1SRYA 3WB0A 1S72V 2XAFA 5CA3A 2V1DA 2D3OW 1M1KW 4DUYB 1BGYH 3ZRXA 1O9GA 1VQKV 4JI8B 1NS1A 4X1IA 1JA8A 2V7QG 2ADQB 3OT7A 5DECA 1KQSU 2YIDA 4JAAA 1US6A 1EBOA 1Q6UA 1PL4A 4X1YA 4I0XA 2WLJA 2RN9A 3AK2A 4YXWG 1K5QA 3AG3C 5KUMA 3FYIB 1R1BA 3HKEA 1PKXA 1PNKA 4I50A 3A0HZ 5KA5A 5LMUO 5D5PA 3HKBA 4CH3A 1PNLA 2DMXA 5CA1A 4N23A 4RAIA 1W59A 4IL6Z 3L73H 3OD4A 4XDKA 1GN6A 4ABMA 4JV5O 2P7TC 4BW5A 1HNWO 1TUEB 3B40A 1Q82W 4AHCA 4DR1B 2WLNA 1W0KG 2DWEC 4A5UB 3E22B 5B1BC 4O4LA 2W0FC 2RDCA 2ITDC 4X89A 5C8YB 4I4TB 4LWSA 3QTCA 4IIJA 3K5LA 3OEHG 5KHKA 2WA4A 3WB2A 2HFEC 4LFBB 1NH2D 4PI2A 3EFFK 1U96A 4EEQA 2RMKB 1PV0A 4JI6O 1PP9H 2QM8A 4YY3B 1NKDA 2E3CA 2QDOA 4MSWC 3E89A 4DV5O 3AG1C 1JVMA 4LR3A 4O2BB 1KYOF 4GX5A 3JYCA 2XAGA 3SJQC 4UB8Z 5KMGA 4QE9A 1YVWA 4J7ZA 4JYAB 3K79A 3CXHF 3H1HH 1VQLV 3JSNA 3K9SA 1QCEA 3CX5F 4XBFA 5EBWC 3E2EA 1OCCC 1Y74A 2JJ2G 3TK1A 1QR9A 4QE7A 1AJPA 2Q7GA 4JI3B 3GB7C 1WB8A 2DN9A 3PJSK 3AK3A 4NXMO 2ZIMA 4K35A 2EJ7A 4LP8A 3E86A 4HAMA 1FD9A 4TT3G 5J9PC 1XL4A 1YCIA 1CEZA 1G6UA 2WAMA 1GN3A 1FS0G 2QM7A 1OCOC 3CWBH 1Q6HA 1EN5A 1I08A 3MHSC 2IH3C 3JASA 3QO5A 4UB6Z 1K4DC 3UKMA 4LF4O 4J9ZB 2ARHA 1K9MW 5A2QN 2NN4A 3ZHVA 2A0LA 3R66A 3H1LH 1HNZB 2A7WA 4RQEA 2UUAB 1X4TA 4TV9B 3CJHA 4YIPA 1BE3H 3RYCB 1VQ5V 5BR8O 3JD3A 1G4YB 2JVDA 2ZXWC 5B1AB 1WAZA 4DV3B 1Z5WA 4MVQA 3JD2A 2XAJA 3F7YC 3ZMZA 2JS3A 4N21A 1N36B 3DTUB 2P67A 4Z1VA 3CB2A 3LSQA 4PA6A 1QVFU 4K0KO 2ZE6A 1FXKB 3N2GA 2MW2B 1VQ6V 4L87A 5EIBD 1GKFA 4PELA 4D7TA 3QNEA 1MG1A 2WLLB 4JI5B 4JTCB 3KCYA 3O9OA 1H2NA 5LBQA 3Q4HA 3DC6A 1XI1A 3ZRVA 1WP7A 2QM4A 5LP6B 1Y67A 1IX9A 4DRXA 4FLYA 1I7FA 1AB3A 3ZHSA 4IHJB 5FL7G 1I0HA 4OXSA 2ZDIA 4BW9A 3H1JH 4MVRA 5B3SC 2DYSB 3JARA 1N34B 3CRMA 4AILC 3T1YB 2DW4A 4X88A 2E76B 4NTYA 3SJAC 4BR6A 1R6NA 2X6AA 2X0LA 5CA0A 1AP5A 1FPOA 2WPDG 5LXTB 2AHZA 1Q43A 4R8CA 5EZYB 4GUNA 5IY5C 3W7SA 1HP8A 5IJ9A 5GTHZ 4KP4A 4B3MO 4UVAA 4ZI7A 4B3TO 1YDXA 2PF4E 4X1KA 1NBMG 2JGDA 3NXSA 3UO3A 5B1OA 3T1HO 1IBMO 1XNQB 4DYLA 4WCEV 4TV8A 1LUVA 1COWG 4LH7A 3FAVA 4PDRA 3HR0A 3T2MA 1MSWD 3K58A 3LUTB 2YI8A 3H9VA 5L3FA 1VF6A 3U0ZA 1QR8A 3N2KA 5LGNA 4DR2O 4PA7A 2Q6AA 1SZTA 4JI4B 1YZBA 4ASUG 3F5WC 4ZBMA 3W7UA 4JYYA 1YSCA 3TETA 4BIZA 2Q67A 4WFBV 1UFIA 2JEUA 3L9DA 3QO7A 2HVJC 1MZFA 1E1QG 2ZR2A 5LP6C 2UU9O 4BAYA 2LFRA 4FLXA 4O2AA 4NTXA 4UCSA 5LA6A 4O4JA 3UCSC 2QA4V 3A2FA 5EYPA 3F7VC 1K7DA 4DV2B 3ML0A 3L71H 3T4ZA 2Q9LA 3B8NA 4HBNA 1IBKB 1XMOO 4JYBA 4X20A 4DR4B 3JAMN 4GKKB 2IU3A 1Q5OA 1QVGU 3LNMB 1I94B 2ZIOA 4LF9O 2VWKA 5DN6G 1AI5A 1F7YA 3K5NA 1V55B 2KG7A 3CHXA 4X1IB 4X64O 1BCCH 4QGPA 2R72A 3DXRA 2OCCB 5FNVA 4B3SB 1H2KA 3CRAA 4X1YB 4NXNO 2JEXA 4DV7O 4I0XB 2ILMA 4CS2A 4AQYB 3MAQA 4OX9B 3L72H 4ZKIA 2QTSA 4PI0A 1KUQA 4MVOA 2L35A 3HKEB 2JIZG 2Q4PA 1XNRO 4I50B 3HKDA 3HKBB 1Y76A 3HPLC 5CA1B 1XDCA 2QWOB 1WLEA 4UXNA 2V4DA 4HZ3A 1Q8IA 3JD1A 1NTKH 5KHJA 4GZRB 1FYJA 4J9YB 3FKSG 4H0LB 1KKDA 5K1XA 3ASOC 2F1MA 2HHHB 2F23A 1SQFA 5CN0A 3E8BA 3MHHC 5DM6V 4O4LB 1O9HA 3OUSA 3LDCA 4LWSB 4IIJB 4QPJA 3ABKC 1OZ0A 3BY6A 4JF3A 4DR3O 4FM0A 2QKAA 1GMGA 2NLJC 5J2TA 1IBLB 4J7KA 3WFVA 3TJTA 4TUYA 3MDSA 5EBLC 1WN7A 2CAZC 2XOKG 2NNUA 4JGSA 3K08A 1SA0A 1DF5A 4QIWF 1SESA 2KSDA 2OCCC 4LF7B 1MSDA 1N32O 2P4KA 2HKOA 5KMGB 1URFA 2AXTZ 1HNXB 1ZTEA 3W7WA 4RUEA 2KQXA 1SF9A 2W0XA 4QPKA 1S5LZ 4FLZA 3L70H 4O4IA 3G67A 5FPRA 1XILA 1Z2GA 1Y74B 5BZBA 4HNAA 1CP9A 1T5EA 3ZCCA 4AI8A 2BCCH 2OIGA 3OGIB 1WJZA 1YJNV 4JI0O 4OPAA 3CSXA 3LSSA 3BHPA 5E79Z 1GM7A 2WLIA 1QNMA 2OWOA 3K9AA 4JTDB 4X66O 1R73A 2F66C 2HP8A 4QJFB 3UM7A 3RFRA 1GN4A 1XEQA 3JASB 1RM1B 3K06A 1M57C 2LGWA 1XMQB 4LCUC 4ICGA 1RPRA 3L74H 4FLWA 1KU9A 2LJ2A 3P30A 4H33A 5ITZA 1WA8A 2W6JG 4G28B 4PA9A 3OE7G 3I55V 3CJHB 2UXDO 1V54B 3AEIA 4DR7B 2Y69B 1Y66A 4MTGA 2JK5C 3CCQV 1GO3F 2IH1C 1UJWB 2IBZH 1ZL8A 4PA4A 3QG5A 3I5DA 4LF6O 4NR1A 4RWUA 3FB8C 1L1FA 1MZEA 3F5TA 3CRCA 3N2GB 1VEWA 4NYKA 1VQPV 4UCVA 1KB9F 3IJ4A 4TOIA 3ZRWA 1FXHA 1H2LA 3Q4HB 1AP6A 1TUBA 4KUMA 1SETA 4FM2A 1B06A 3ABLB 4LC1A 4DRXB 1EN4A 3D8CA 3OW2U 2QWNB 2ADPA 4JI2O 3FFQA 2AW9A 3JARB 1WPXA 3A0RA 3SPIA 2ZKOA 1A32A 5H2FZ 1BHAA 1GRJA 4D6TH 2Y48A 4FFKA 1TVKA 5LMUB 4B3RB 5CA0B 1RM1C 3BPZA 1VP7A 2F95B 3APOA 3C3TA 2R9IA 3OEEG 1AI6A 1YJ9V 2UXCO 2FB5A 2UUCO 4JV5B 5IJ9B 3FB7C 2AZ2A 4ZI7B 2X6BA 5H5NA 1M5IA 2ZE8A 2BSKA 2EZPA 3E35A 4X1KB 1HNWB 2JGDB 3KCXA 2P06A 5LHIA 1NH2B 2EILB 2WLHA 1HWYA 4TV8B 4YJ2A 4DR5O 1WNSA 2EULA 3FAVB 3OR6C 4FM1A 2YI9A 2N05A 3A0BZ 2Z0AA 2BE3A 2X6CA 4FLUA 4FZ1A 3N2KB 1SZXA 4PA3A 5L3BA 3J7AU 2LGQA 4P2ZA 2CK3G 3AG7A 4LFAO 5BMVA 4JI6B 1AR5A 4MW3A 3FX7A 4B7EA 4B7KA 2Z5UA 2Y0IA 4DV5B 1OHHG 3ABLC 1B04A 4GYCB 1H8HG 2IJKA 1J5EO 5LYJA 4O2AB 2Q7HA 4PDVA 1D2DA 5LA6B 1NTZH 3VOUA 4O4JB 1XHZA 5EYPB 2AGAA 2GTSA 4DR6B 2IW5A 1H8EG 4ZIBA 3L75H 2ZT9B 2F4VO 1JR9A 5JH7A 4X20B 3G4SV 4DW1A 5EC1C 1YF2A 5IDJA 4NXMB 1SC5B 1RFYA 3BCCH 1BQZA 4IYHA 4KHPO 4K8XA 4JAVA 1DTOA 2KG7B 4I5SA 5L3CA 2JRIA 5J2UA 5KHIA 3OMAB 2PI4A 3QF7A 2YDEA 3IC9A 1JX9A 3CXCU 3DXRB 1SS3A 3EHBB 5FNVB 1MOFA 4PJ0Z 5H6RA 1IDSA 3RYFA 3ABMB 1PNMA 4WBNA 1M90W 2KB1A 4LF5O 3X2QB 2ZE5A 5FPOA 3U10A 3ABTA 1E1RG 4LF4B 1YHQV 4MVSA 2VQEO 3UO2A 4F6EA 2ZQMA 4FK5C 2IU0A 3HKDB 1VF7A 2UXBO 1N36O 1Y76B 2EIJB 2EJRA 5LMNO 3HKCA 5BR8B 4D7SA 3AG4B 2XT9A 4CS4A 2WSSG 4FPPA 2UXNA 2Q68A 1GM8A 1K5SA 4JYCA 4O4HA 2EIMB 1NT2B 1SQPH 1XBLA 4JAUA 3CEIA 5BY1A 1I5YA 4I55A 4K0KB 4LBEC 3BFRA 3SPCA 3ICXA 1J95A 2ODMA 2QWPB 1N8RW 1VQOV 5IWAO 4P9PA 2YICA 1K4CC 1Q3EA 1SKVA 3T1YO 1F23A 3KG2A 3DSQA 1VMGA 3K0DA 4MTXA 5J2TB 2E5LO 1NU1H 1JCHA 4TUYB 1ROPA 2FTKA 1M56B 2E75B 3BA9A 2E74B 2BOBC 1YEWA 3WB1A 4U3FH 5JCOA 1SA0B 4WFEA 3ZHRA 1M9NA 4I7ZB 4KFMA 2DOSA 4YJ3A 1RSOA 2GV9A 3ZMVA 2LP7A 2WLKA 4LFCO 2X7RB 4MW8A 2P6JA 4U3JA 3X2QC 4O4IB 1QU7A 2OTJV 5B1AC 1VQ7V
chains in the Genus database with same CATH topology
2CTWA 2KQXA 3BVOA 2M6YA 2Y4TA 2CTRA 2DN9A 1FAFA 2GUZA 1NZ6A 2OCHA 1N4CA 2QWOB 2QSAA 1HDJA 1BQZA 4J7ZA 3AG7A 2EJ7A 2N04A 2YUAA 2CTPA 4J80A 3UO2A 2PF4E 2DMXA 2L6LA 1BQ0A 4RWUA 3APOA 1XBLA 3UO3A 2LO1A 3UCSC 2QWNB 2Y4UA 1FPOA 2QWQB 2CTQA 3APQA 1GH6A 2QWRB 2GUZB 2CUGA 2N05A 4IT5A 1WJZA 2LGWA 2YS8A 1IURA 2QWPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTW A;  2KQX A;  3BVO A;  2M6Y A;  2Y4T A;  2CTR A;  2DN9 A;  1FAF A;  2GUZ A;  1NZ6 A;  2OCH A;  1N4C A;  2QWO B;  2QSA A;  1HDJ A;  1BQZ A;  4J7Z A;  3AG7 A;  2EJ7 A;  2N04 A;  2YUA A;  2CTP A;  4J80 A;  3UO2 A;  2PF4 E;  2DMX A;  2L6L A;  1BQ0 A;  4RWU A;  3APO A;  1XBL A;  3UO3 A;  2LO1 A;  3UCS C;  2QWN B;  2Y4U A;  1FPO A;  2QWQ B;  2CTQ A;  3APQ A;  1GH6 A;  2QWR B;  2GUZ B;  2CUG A;  2N05 A;  4IT5 A;  1WJZ A;  2LGW A;  2YS8 A;  1IUR A;  2QWP B; 
#chains in the Genus database with same CATH topology
 1FJG B;  1JJO A;  2YC0 A;  1H2S B;  1R3K C;  4DV0 O;  4GKJ O;  1KBH A;  3K59 A;  4B3M B;  3G80 A;  1JFF A;  5LHG A;  4HNA B;  4B3T B;  1YI2 V;  2DWD C;  3H1I H;  2EIJ C;  4WFA V;  2H3O A;  3VBB A;  4EB6 A;  4G27 B;  2PZS A;  1FXK C;  1L8D A;  3RW0 A;  1R6T A;  3T1H B;  3AG4 C;  1IBM B;  5B5E Z;  2VQF O;  2DYR B;  5EIB C;  4B08 A;  1S5J A;  2A06 H;  3UQ8 A;  3KZI Z;  2WLI B;  2M6Y A;  2EIM C;  2FYU H;  2GUZ A;  4OGQ B;  2EIN B;  3MD0 A;  3P3P A;  1ZUQ A;  3CCE V;  4DR2 B;  1NI8 A;  1XOU A;  3LDD A;  3SYC A;  3THO A;  4MVM A;  3LNN A;  1VQ8 V;  4CH6 A;  2B9Z A;  4BIO A;  3OM3 B;  3R65 A;  1P7B A;  1PD3 A;  1V9P A;  2DYS C;  2QR4 A;  2Q7E A;  5ITZ B;  4J11 A;  1WA8 B;  4EFE A;  1KMI Z;  1NZ6 A;  3D36 A;  1K8A W;  4X62 O;  1SQV H;  1JPX A;  2UU9 B;  4NVP A;  4E2L A;  1D5A A;  1PM9 A;  4JI7 O;  3BA8 A;  2ZM6 O;  4DW0 A;  2JGU A;  2JS5 A;  3SGI A;  3APQ A;  4JZ2 A;  3W7X A;  3BAB A;  1G8M A;  3AK1 A;  2IJH A;  1OCZ B;  2LQT A;  1XMO B;  1G1X B;  1ZL8 B;  2OTL V;  2QEX V;  1PL0 A;  3DGE A;  4X9Q A;  1QHT A;  5EK0 A;  4E4E A;  3CP1 A;  1RP3 B;  1FXV A;  4LF9 B;  2PYJ A;  4X65 O;  3ZRW B;  2EX3 A;  1N0J A;  1TUB B;  5LHH A;  4FJC C;  1RPO A;  4X64 B;  4BIU A;  3U11 A;  4J7J A;  4IYI A;  4YHH O;  3ZHU A;  3TXS A;  1ZX3 A;  1HDJ A;  3ZMS A;  4PDL A;  1THZ A;  3TXQ A;  1BSM A;  4NXN B;  2DYR C;  4DV7 B;  1EM1 A;  4DV6 O;  1D5N A;  2PUS A;  5GW7 A;  4R6Z A;  1ZAU A;  3RYH A;  1CXZ B;  2EIN C;  4IT5 A;  1TGO A;  1TVK B;  1XNR B;  1IXM A;  1VQ4 V;  2F93 B;  2QTO A;  3ZN1 A;  3GWO A;  4GX0 A;  4GLX A;  4GX2 A;  3ZMT A;  2EBO A;  2ZNI A;  3B8M A;  2UUB O;  1ZSP A;  2YXH A;  1SQQ H;  1DF4 A;  4DUZ O;  4P30 A;  4NKG B;  4FVM A;  5IT9 N;  1N33 O;  1H2M A;  2BSK B;  4RUF A;  1M4U A;  4XDJ A;  2DQ3 A;  2C2A A;  4WFH A;  4JI1 O;  1BZK A;  5JQG A;  1N4C A;  4YJ2 B;  2N74 A;  1V55 C;  2HG5 C;  3SPJ A;  1OCZ C;  4BWA A;  4LF8 O;  5CBF A;  4DR3 B;  4JTA B;  3M99 B;  4UUJ C;  1JOY A;  2P4V A;  5GON A;  1HNX O;  3CC2 V;  5BMV B;  3AG2 B;  5KLV H;  2Y4T A;  4CZZ A;  1GK9 A;  4H13 B;  2P90 A;  4KL1 A;  3K04 A;  4U7N A;  3ZX6 A;  1K3E A;  1M93 A;  3JAW A;  1ORQ C;  5B66 Z;  2HR3 A;  4DV1 O;  2CH7 A;  2M7W A;  1TAE A;  4I9W A;  3ZHQ A;  3CCR V;  2A79 B;  5LYJ B;  2H8P C;  2XAS A;  2QWQ B;  2XAH A;  1GH6 A;  1N32 B;  1KEC A;  2RJZ A;  4ZHQ A;  3SDL A;  4I9Q A;  4MT8 A;  3B77 A;  2B1I A;  1SQX H;  5KUK A;  1SER A;  3KKY A;  3ZMU A;  3JSL A;  2Q5Z A;  5AG2 A;  2XTA A;  3AG3 B;  2ITC C;  5JH7 B;  5IYD O;  4UVC A;  2YIA A;  1VAR A;  3EXA A;  3SYQ A;  5CBH A;  3ASN B;  1L0L H;  2VWJ A;  2YIB D;  4OPH A;  4JI0 B;  1Q90 D;  2XHB A;  3SPH A;  1HR0 O;  4MVU A;  5J2U B;  1UPG A;  5CBG A;  3E8F A;  2GSM B;  3JAK A;  5KA6 A;  2AHY A;  1U97 A;  4DV4 O;  3OTO O;  3RYF B;  3A8T A;  3OR7 C;  2K9P A;  1EN6 A;  4WBN B;  3OUF A;  4QNH B;  2G38 A;  2CUG A;  2VRZ A;  5B1B B;  1K92 A;  1KP2 A;  2A3Q A;  2GBO A;  1AIL A;  2Q73 A;  4DUY O;  3RYI A;  5F2V O;  5TIS Z;  2YSU B;  3G71 V;  2ZE7 A;  1H38 A;  3SYA A;  4F6R A;  1EZJ A;  3CME V;  4JI8 O;  1S77 D;  4DO2 A;  1MAB G;  2UXD B;  3HKC B;  3K5O A;  3AG2 C;  5IE9 A;  3UT5 A;  2CTQ A;  2ZNJ A;  3ZHT A;  1DLB A;  1YTF D;  5L3D A;  1YTF B;  1S76 D;  4W4K A;  1S3J A;  3OAA G;  3SYO A;  1P7G A;  1W0J G;  4O4H B;  3IFX A;  5D5Q A;  3K5M A;  1F4N A;  3ZN0 A;  1Q81 W;  3D3Q A;  5CB4 A;  3AG1 B;  4LF6 B;  3K3W A;  4I55 B;  4P9O A;  2XND G;  3CC7 V;  1MMM A;  3GVM A;  3K0G A;  3CC4 V;  2LFS A;  2PTM A;  3BVO A;  3E8H A;  3OMI B;  3ZIA G;  3ZJZ A;  3CCS V;  1OCC B;  2RQ6 A;  2YXY A;  4TSF G;  2K1E A;  4B3R O;  4DR1 O;  3CCV V;  3ASN C;  3QVN A;  3S3X A;  1VQN V;  2L6L A;  3H1K H;  1R6K A;  1JMK C;  2VS0 A;  5JVD A;  4Z1M G;  4ZOL A;  4JI2 B;  4FIP C;  3CCJ V;  5LL6 Y;  3JD4 A;  1IUR A;  5KAI Z;  1SQG A;  4YJ3 B;  1FAF A;  4LFB O;  3VQV A;  1RSO B;  2OCH A;  4J41 A;  1VF5 B;  3NR7 A;  1V54 C;  1OCO B;  2Y69 C;  2N04 A;  2WA3 A;  2ETN A;  2R9A A;  3E83 A;  4K8Z A;  4U3J B;  2R70 A;  4YY3 O;  2NR5 A;  2UXC B;  2ZIN A;  1OJH A;  2UUC B;  1JFF B;  2HVK C;  2JJ1 G;  3CMA V;  3CCL V;  5KHG A;  4DK1 A;  3DC5 A;  1IZ3 A;  2MK3 A;  4MTO A;  4EB6 B;  3W7T A;  1H2G A;  1OV9 A;  4JYA O;  3C90 A;  3SR2 C;  1XL6 A;  4G2K A;  3ZED A;  5EC2 C;  2ZXW B;  4DR5 B;  4UCU A;  2GUZ B;  2Q8V A;  1FFX A;  2LW1 A;  1Z5V A;  4JI3 O;  5KX5 A;  2PY5 A;  5JJJ B;  3SJB C;  3BAA A;  1QBZ A;  1XQ8 A;  4C7U A;  2BTQ A;  1FKA O;  4LFA B;  2YUA A;  3BEH A;  4J80 A;  2ZDI C;  4DR6 O;  3JAL A;  2OT5 A;  2YXL A;  3STZ C;  4WFG A;  2W6I G;  2BOC C;  5IYZ A;  1AR1 B;  1Q6I A;  4YIO A;  1Q7Y W;  1J5E B;  2YEV A;  3RGB A;  2AZ0 A;  4FMT A;  4KXR A;  5JJE B;  3STL C;  1B3Q A;  1NVP D;  2YIB A;  1NVP B;  4FFB A;  1QQC A;  5JCO C;  4CS3 A;  5IJ0 A;  4UV9 A;  4NTW A;  3O65 A;  5B3S B;  1GM9 A;  3CD6 V;  2Q0O C;  2F4V B;  1HNZ O;  2DJV A;  2ZR3 A;  2UUA O;  4HYO A;  2EIL C;  2IJJ A;  3HB3 B;  3SYP A;  1ZLZ A;  1XRE A;  3K57 A;  3JAT A;  4KHP B;  3B4S A;  4R50 A;  2PI5 A;  4DV3 O;  1YXB A;  4GCZ A;  5IY5 B;  1QLE B;  4K3A A;  1VF6 C;  2Y4U A;  4UCR A;  1F4M A;  2O57 A;  2GDS A;  5LGU A;  3RT3 C;  5LOV A;  3CYO A;  2WLM A;  4LNU A;  4Q6G A;  2GHY A;  5JJN B;  4H44 B;  4LF5 B;  2CE4 A;  1Q86 W;  4UFZ A;  3RWR D;  2FL4 A;  4JI5 O;  3RYH B;  2VQE B;  2PGG A;  4MS2 A;  5HFL A;  4EKW A;  1X59 A;  2UXB B;  3E8G A;  5L3G A;  3CRR A;  4X8A A;  1SQB H;  5LMN B;  1EFR G;  4MTF A;  5BXZ A;  2B1G A;  4LH6 A;  1BL8 A;  1R3J C;  5IYB O;  1N34 O;  1IXB A;  2CTP A;  3D36 C;  4JPR A;  3ZBH A;  1ARO P;  3RBZ A;  5JQG B;  5JWP A;  1N0N A;  1L0N H;  5IWA B;  3S3W A;  3J81 N;  4UV8 A;  3N27 A;  2H94 A;  3WG7 B;  4CH4 A;  4TQF A;  2WWW A;  5GON B;  2E5L B;  4R7C A;  1DK1 A;  2UXX A;  3ABM C;  3P3N A;  2HJD A;  4PD4 F;  1LR1 A;  1XNQ O;  3E22 A;  5CMU A;  1NTM H;  4FLV A;  4J10 A;  1NR1 A;  1JQ0 A;  3IAY A;  2RNB A;  1FJG O;  5C8Y A;  4I4T A;  3RVZ A;  3I56 V;  3JAW B;  1QLE C;  2CH7 B;  3IC7 A;  3OFN G;  3TGU H;  3H01 A;  2KKW A;  1FFT B;  1BT8 A;  2IM9 A;  1Y6X A;  2XUM A;  4GT1 A;  4ZHQ B;  4DXW A;  2CGO A;  1F51 A;  4Q20 A;  4LFC B;  1TA8 A;  1KC8 W;  4PDM A;  4JI4 O;  1K73 W;  1AVM A;  3FB5 C;  3SPG A;  4DV0 B;  4GKJ B;  3OGC C;  4CBC A;  2EZO A;  4O2B A;  3FB6 C;  3BRC A;  4PV1 B;  2ATK C;  3RVY A;  1Y4M A;  3OTF A;  3K03 A;  5K1P A;  1AI4 A;  2VQF B;  4DV2 O;  2R9R B;  1IBK O;  3JAK B;  3WU2 Z;  1IVS A;  1AI7 A;  1AR4 A;  3ASO B;  2Q69 A;  5GTI Z;  3G6B A;  1WB7 A;  1R3I C;  4DR4 O;  2JDI G;  4GKK O;  1M56 C;  4JAS A;  1I94 O;  3SJC C;  3OMN B;  3RYI B;  2LW7 A;  2D2C B;  3LSU A;  3QO8 A;  4UCO A;  3WG7 C;  4F6R B;  3ABK B;  2CTW A;  3VQW A;  1HW7 A;  4XDL A;  4B3S O;  4X62 B;  5EBM C;  2QSA A;  3ETQ A;  1R3L C;  3UT5 B;  1AJQ A;  4JI7 B;  4AQY O;  2FML A;  2ZM6 B;  2EIK B;  4OX9 O;  1I5X A;  2FKX A;  1QLN A;  1LUW A;  1XUQ A;  1CPY A;  5CB4 B;  2HLD G;  3T4D A;  4WFF A;  1P4R A;  1DGS A;  3ZRS A;  2Y0P A;  4TV9 A;  5H6Q A;  4WF9 V;  3JCZ A;  5LGT A;  3RYC A;  1KP3 A;  3C3S A;  2QE7 G;  1BQ0 A;  5H9C A;  3CCU V;  4X65 B;  1ZWI C;  1ENV A;  5DED A;  5FLX N;  3ABU A;  4DK0 A;  1NR7 A;  1VQM V;  2HHH O;  1PPJ H;  4YHH B;  2HJF C;  3B09 A;  5JVD B;  3LDE A;  1BMF G;  4CC6 A;  1FXK A;  4ZOL B;  3ETD A;  4DV6 B;  3TCU A;  4PHZ A;  2QKC A;  3J80 N;  2WLL A;  1OCR B;  3D3I A;  3ETE A;  1S5H C;  3CE2 A;  2YS8 A;  1IBL O;  4MVZ A;  5LP6 A;  4Z2W A;  1GN2 A;  3CRQ A;  1M57 B;  1NJI W;  1NQT A;  2CDY A;  3FD9 A;  3T1C A;  4IHJ A;  2UUB B;  3GWK C;  4JZG A;  4DUZ B;  1VIB A;  2QJ1 A;  2ZCE A;  1N33 B;  3EVK A;  4TQD A;  4GX1 A;  1YIJ V;  5C93 A;  1MNG A;  2QWR B;  4LF7 O;  1LNQ A;  3RN4 A;  1K34 A;  4NB5 A;  3IGA C;  4JI1 B;  1K33 A;  3CCM V;  3CS5 A;  2EIK C;  5LXT A;  2PYL A;  1GTO A;  3ZS8 C;  5EZY A;  5L3E A;  2RCV A;  1BHB A;  1YIT V;  3FYE B;  4LF8 B;  1FFX B;  2B5U A;  2LO1 A;  2HEP A;  2DQ0 A;  5IYC O;  5KX5 B;  2XAQ A;  4J42 A;  4IGG A;  3G6E V;  2BTQ B;  4H37 A;  1WP8 A;  3ETG A;  4F4L A;  3JAL B;  2A9H A;  4UVB A;  1KKC A;  4TWK A;  4DV1 B;  1E79 G;  2OIE A;  5HFM A;  5IYZ B;  2Z3Y A;  3JCU Z;  2YEV B;  3M7M X;  4CC5 A;  2P22 C;  1B6Q A;  3CPW U;  1XMQ O;  4FFB B;  1GAX A;  5A9G A;  5IJ0 B;  3VQY A;  1WPB A;  1W2B U;  3VQX A;  2QKS A;  2P5O A;  1EZV H;  5E1A C;  1OCR C;  5KHH A;  4X66 B;  4RQF A;  4FZ0 A;  1P84 F;  1MA1 A;  4DR7 O;  2CGN A;  2Q0A A;  4RO2 A;  1K97 A;  3PN1 A;  1YJW V;  1P49 A;  3JAT B;  3B2E E;  4W4L A;  1KD1 W;  4UCT A;  2GTA A;  2ZD9 A;  1HR0 B;  2IJI A;  2CTR A;  4U7O A;  2BTO A;  1AJN A;  1BS3 A;  5KAF Z;  4L8J A;  1JJ2 U;  2F43 G;  5B1N A;  1XHX A;  1VQ9 V;  4CH5 A;  2DE0 X;  4DV4 B;  3OTO B;  3P32 A;  5LOV B;  3M8A A;  4EFB A;  4LNU B;  4FLT A;  1S0V A;  2OYQ A;  3JD0 A;  2QGN A;  1SRY A;  3WB0 A;  1S72 V;  2XAF A;  5CA3 A;  2V1D A;  2D3O W;  1M1K W;  4DUY B;  1BGY H;  3ZRX A;  1O9G A;  1VQK V;  4JI8 B;  1NS1 A;  4X1I A;  1JA8 A;  2V7Q G;  2ADQ B;  3OT7 A;  5DEC A;  1KQS U;  2YID A;  4JAA A;  1US6 A;  1EBO A;  1Q6U A;  1PL4 A;  4X1Y A;  4I0X A;  2WLJ A;  2RN9 A;  3AK2 A;  4YXW G;  1K5Q A;  3AG3 C;  5KUM A;  3FYI B;  1R1B A;  3HKE A;  1PKX A;  1PNK A;  4I50 A;  3A0H Z;  5KA5 A;  5LMU O;  5D5P A;  3HKB A;  4CH3 A;  1PNL A;  2DMX A;  5CA1 A;  4N23 A;  4RAI A;  1W59 A;  4IL6 Z;  3L73 H;  3OD4 A;  4XDK A;  1GN6 A;  4ABM A;  4JV5 O;  2P7T C;  4BW5 A;  1HNW O;  1TUE B;  3B40 A;  1Q82 W;  4AHC A;  4DR1 B;  2WLN A;  1W0K G;  2DWE C;  4A5U B;  3E22 B;  5B1B C;  4O4L A;  2W0F C;  2RDC A;  2ITD C;  4X89 A;  5C8Y B;  4I4T B;  4LWS A;  3QTC A;  4IIJ A;  3K5L A;  3OEH G;  5KHK A;  2WA4 A;  3WB2 A;  2HFE C;  4LFB B;  1NH2 D;  4PI2 A;  3EFF K;  1U96 A;  4EEQ A;  2RMK B;  1PV0 A;  4JI6 O;  1PP9 H;  2QM8 A;  4YY3 B;  1NKD A;  2E3C A;  2QDO A;  4MSW C;  3E89 A;  4DV5 O;  3AG1 C;  1JVM A;  4LR3 A;  4O2B B;  1KYO F;  4GX5 A;  3JYC A;  2XAG A;  3SJQ C;  4UB8 Z;  5KMG A;  4QE9 A;  1YVW A;  4J7Z A;  4JYA B;  3K79 A;  3CXH F;  3H1H H;  1VQL V;  3JSN A;  3K9S A;  1QCE A;  3CX5 F;  4XBF A;  5EBW C;  3E2E A;  1OCC C;  1Y74 A;  2JJ2 G;  3TK1 A;  1QR9 A;  4QE7 A;  1AJP A;  2Q7G A;  4JI3 B;  3GB7 C;  1WB8 A;  2DN9 A;  3PJS K;  3AK3 A;  4NXM O;  2ZIM A;  4K35 A;  2EJ7 A;  4LP8 A;  3E86 A;  4HAM A;  1FD9 A;  4TT3 G;  5J9P C;  1XL4 A;  1YCI A;  1CEZ A;  1G6U A;  2WAM A;  1GN3 A;  1FS0 G;  2QM7 A;  1OCO C;  3CWB H;  1Q6H A;  1EN5 A;  1I08 A;  3MHS C;  2IH3 C;  3JAS A;  3QO5 A;  4UB6 Z;  1K4D C;  3UKM A;  4LF4 O;  4J9Z B;  2ARH A;  1K9M W;  5A2Q N;  2NN4 A;  3ZHV A;  2A0L A;  3R66 A;  3H1L H;  1HNZ B;  2A7W A;  4RQE A;  2UUA B;  1X4T A;  4TV9 B;  3CJH A;  4YIP A;  1BE3 H;  3RYC B;  1VQ5 V;  5BR8 O;  3JD3 A;  1G4Y B;  2JVD A;  2ZXW C;  5B1A B;  1WAZ A;  4DV3 B;  1Z5W A;  4MVQ A;  3JD2 A;  2XAJ A;  3F7Y C;  3ZMZ A;  2JS3 A;  4N21 A;  1N36 B;  3DTU B;  2P67 A;  4Z1V A;  3CB2 A;  3LSQ A;  4PA6 A;  1QVF U;  4K0K O;  2ZE6 A;  1FXK B;  3N2G A;  2MW2 B;  1VQ6 V;  4L87 A;  5EIB D;  1GKF A;  4PEL A;  4D7T A;  3QNE A;  1MG1 A;  2WLL B;  4JI5 B;  4JTC B;  3KCY A;  3O9O A;  1H2N A;  5LBQ A;  3Q4H A;  3DC6 A;  1XI1 A;  3ZRV A;  1WP7 A;  2QM4 A;  5LP6 B;  1Y67 A;  1IX9 A;  4DRX A;  4FLY A;  1I7F A;  1AB3 A;  3ZHS A;  4IHJ B;  5FL7 G;  1I0H A;  4OXS A;  2ZDI A;  4BW9 A;  3H1J H;  4MVR A;  5B3S C;  2DYS B;  3JAR A;  1N34 B;  3CRM A;  4AIL C;  3T1Y B;  2DW4 A;  4X88 A;  2E76 B;  4NTY A;  3SJA C;  4BR6 A;  1R6N A;  2X6A A;  2X0L A;  5CA0 A;  1AP5 A;  1FPO A;  2WPD G;  5LXT B;  2AHZ A;  1Q43 A;  4R8C A;  5EZY B;  4GUN A;  5IY5 C;  3W7S A;  1HP8 A;  5IJ9 A;  5GTH Z;  4KP4 A;  4B3M O;  4UVA A;  4ZI7 A;  4B3T O;  1YDX A;  2PF4 E;  4X1K A;  1NBM G;  2JGD A;  3NXS A;  3UO3 A;  5B1O A;  3T1H O;  1IBM O;  1XNQ B;  4DYL A;  4WCE V;  4TV8 A;  1LUV A;  1COW G;  4LH7 A;  3FAV A;  4PDR A;  3HR0 A;  3T2M A;  1MSW D;  3K58 A;  3LUT B;  2YI8 A;  3H9V A;  5L3F A;  1VF6 A;  3U0Z A;  1QR8 A;  3N2K A;  5LGN A;  4DR2 O;  4PA7 A;  2Q6A A;  1SZT A;  4JI4 B;  1YZB A;  4ASU G;  3F5W C;  4ZBM A;  3W7U A;  4JYY A;  1YSC A;  3TET A;  4BIZ A;  2Q67 A;  4WFB V;  1UFI A;  2JEU A;  3L9D A;  3QO7 A;  2HVJ C;  1MZF A;  1E1Q G;  2ZR2 A;  5LP6 C;  2UU9 O;  4BAY A;  2LFR A;  4FLX A;  4O2A A;  4NTX A;  4UCS A;  5LA6 A;  4O4J A;  3UCS C;  2QA4 V;  3A2F A;  5EYP A;  3F7V C;  1K7D A;  4DV2 B;  3ML0 A;  3L71 H;  3T4Z A;  2Q9L A;  3B8N A;  4HBN A;  1IBK B;  1XMO O;  4JYB A;  4X20 A;  4DR4 B;  3JAM N;  4GKK B;  2IU3 A;  1Q5O A;  1QVG U;  3LNM B;  1I94 B;  2ZIO A;  4LF9 O;  2VWK A;  5DN6 G;  1AI5 A;  1F7Y A;  3K5N A;  1V55 B;  2KG7 A;  3CHX A;  4X1I B;  4X64 O;  1BCC H;  4QGP A;  2R72 A;  3DXR A;  2OCC B;  5FNV A;  4B3S B;  1H2K A;  3CRA A;  4X1Y B;  4NXN O;  2JEX A;  4DV7 O;  4I0X B;  2ILM A;  4CS2 A;  4AQY B;  3MAQ A;  4OX9 B;  3L72 H;  4ZKI A;  2QTS A;  4PI0 A;  1KUQ A;  4MVO A;  2L35 A;  3HKE B;  2JIZ G;  2Q4P A;  1XNR O;  4I50 B;  3HKD A;  3HKB B;  1Y76 A;  3HPL C;  5CA1 B;  1XDC A;  2QWO B;  1WLE A;  4UXN A;  2V4D A;  4HZ3 A;  1Q8I A;  3JD1 A;  1NTK H;  5KHJ A;  4GZR B;  1FYJ A;  4J9Y B;  3FKS G;  4H0L B;  1KKD A;  5K1X A;  3ASO C;  2F1M A;  2HHH B;  2F23 A;  1SQF A;  5CN0 A;  3E8B A;  3MHH C;  5DM6 V;  4O4L B;  1O9H A;  3OUS A;  3LDC A;  4LWS B;  4IIJ B;  4QPJ A;  3ABK C;  1OZ0 A;  3BY6 A;  4JF3 A;  4DR3 O;  4FM0 A;  2QKA A;  1GMG A;  2NLJ C;  5J2T A;  1IBL B;  4J7K A;  3WFV A;  3TJT A;  4TUY A;  3MDS A;  5EBL C;  1WN7 A;  2CAZ C;  2XOK G;  2NNU A;  4JGS A;  3K08 A;  1SA0 A;  1DF5 A;  4QIW F;  1SES A;  2KSD A;  2OCC C;  4LF7 B;  1MSD A;  1N32 O;  2P4K A;  2HKO A;  5KMG B;  1URF A;  2AXT Z;  1HNX B;  1ZTE A;  3W7W A;  4RUE A;  2KQX A;  1SF9 A;  2W0X A;  4QPK A;  1S5L Z;  4FLZ A;  3L70 H;  4O4I A;  3G67 A;  5FPR A;  1XIL A;  1Z2G A;  1Y74 B;  5BZB A;  4HNA A;  1CP9 A;  1T5E A;  3ZCC A;  4AI8 A;  2BCC H;  2OIG A;  3OGI B;  1WJZ A;  1YJN V;  4JI0 O;  4OPA A;  3CSX A;  3LSS A;  3BHP A;  5E79 Z;  1GM7 A;  2WLI A;  1QNM A;  2OWO A;  3K9A A;  4JTD B;  4X66 O;  1R73 A;  2F66 C;  2HP8 A;  4QJF B;  3UM7 A;  3RFR A;  1GN4 A;  1XEQ A;  3JAS B;  1RM1 B;  3K06 A;  1M57 C;  2LGW A;  1XMQ B;  4LCU C;  4ICG A;  1RPR A;  3L74 H;  4FLW A;  1KU9 A;  2LJ2 A;  3P30 A;  4H33 A;  5ITZ A;  1WA8 A;  2W6J G;  4G28 B;  4PA9 A;  3OE7 G;  3I55 V;  3CJH B;  2UXD O;  1V54 B;  3AEI A;  4DR7 B;  2Y69 B;  1Y66 A;  4MTG A;  2JK5 C;  3CCQ V;  1GO3 F;  2IH1 C;  1UJW B;  2IBZ H;  1ZL8 A;  4PA4 A;  3QG5 A;  3I5D A;  4LF6 O;  4NR1 A;  4RWU A;  3FB8 C;  1L1F A;  1MZE A;  3F5T A;  3CRC A;  3N2G B;  1VEW A;  4NYK A;  1VQP V;  4UCV A;  1KB9 F;  3IJ4 A;  4TOI A;  3ZRW A;  1FXH A;  1H2L A;  3Q4H B;  1AP6 A;  1TUB A;  4KUM A;  1SET A;  4FM2 A;  1B06 A;  3ABL B;  4LC1 A;  4DRX B;  1EN4 A;  3D8C A;  3OW2 U;  2QWN B;  2ADP A;  4JI2 O;  3FFQ A;  2AW9 A;  3JAR B;  1WPX A;  3A0R A;  3SPI A;  2ZKO A;  1A32 A;  5H2F Z;  1BHA A;  1GRJ A;  4D6T H;  2Y48 A;  4FFK A;  1TVK A;  5LMU B;  4B3R B;  5CA0 B;  1RM1 C;  3BPZ A;  1VP7 A;  2F95 B;  3APO A;  3C3T A;  2R9I A;  3OEE G;  1AI6 A;  1YJ9 V;  2UXC O;  2FB5 A;  2UUC O;  4JV5 B;  5IJ9 B;  3FB7 C;  2AZ2 A;  4ZI7 B;  2X6B A;  5H5N A;  1M5I A;  2ZE8 A;  2BSK A;  2EZP A;  3E35 A;  4X1K B;  1HNW B;  2JGD B;  3KCX A;  2P06 A;  5LHI A;  1NH2 B;  2EIL B;  2WLH A;  1HWY A;  4TV8 B;  4YJ2 A;  4DR5 O;  1WNS A;  2EUL A;  3FAV B;  3OR6 C;  4FM1 A;  2YI9 A;  2N05 A;  3A0B Z;  2Z0A A;  2BE3 A;  2X6C A;  4FLU A;  4FZ1 A;  3N2K B;  1SZX A;  4PA3 A;  5L3B A;  3J7A U;  2LGQ A;  4P2Z A;  2CK3 G;  3AG7 A;  4LFA O;  5BMV A;  4JI6 B;  1AR5 A;  4MW3 A;  3FX7 A;  4B7E A;  4B7K A;  2Z5U A;  2Y0I A;  4DV5 B;  1OHH G;  3ABL C;  1B04 A;  4GYC B;  1H8H G;  2IJK A;  1J5E O;  5LYJ A;  4O2A B;  2Q7H A;  4PDV A;  1D2D A;  5LA6 B;  1NTZ H;  3VOU A;  4O4J B;  1XHZ A;  5EYP B;  2AGA A;  2GTS A;  4DR6 B;  2IW5 A;  1H8E G;  4ZIB A;  3L75 H;  2ZT9 B;  2F4V O;  1JR9 A;  5JH7 A;  4X20 B;  3G4S V;  4DW1 A;  5EC1 C;  1YF2 A;  5IDJ A;  4NXM B;  1SC5 B;  1RFY A;  3BCC H;  1BQZ A;  4IYH A;  4KHP O;  4K8X A;  4JAV A;  1DTO A;  2KG7 B;  4I5S A;  5L3C A;  2JRI A;  5J2U A;  5KHI A;  3OMA B;  2PI4 A;  3QF7 A;  2YDE A;  3IC9 A;  1JX9 A;  3CXC U;  3DXR B;  1SS3 A;  3EHB B;  5FNV B;  1MOF A;  4PJ0 Z;  5H6R A;  1IDS A;  3RYF A;  3ABM B;  1PNM A;  4WBN A;  1M90 W;  2KB1 A;  4LF5 O;  3X2Q B;  2ZE5 A;  5FPO A;  3U10 A;  3ABT A;  1E1R G;  4LF4 B;  1YHQ V;  4MVS A;  2VQE O;  3UO2 A;  4F6E A;  2ZQM A;  4FK5 C;  2IU0 A;  3HKD B;  1VF7 A;  2UXB O;  1N36 O;  1Y76 B;  2EIJ B;  2EJR A;  5LMN O;  3HKC A;  5BR8 B;  4D7S A;  3AG4 B;  2XT9 A;  4CS4 A;  2WSS G;  4FPP A;  2UXN A;  2Q68 A;  1GM8 A;  1K5S A;  4JYC A;  4O4H A;  2EIM B;  1NT2 B;  1SQP H;  1XBL A;  4JAU A;  3CEI A;  5BY1 A;  1I5Y A;  4I55 A;  4K0K B;  4LBE C;  3BFR A;  3SPC A;  3ICX A;  1J95 A;  2ODM A;  2QWP B;  1N8R W;  1VQO V;  5IWA O;  4P9P A;  2YIC A;  1K4C C;  1Q3E A;  1SKV A;  3T1Y O;  1F23 A;  3KG2 A;  3DSQ A;  1VMG A;  3K0D A;  4MTX A;  5J2T B;  2E5L O;  1NU1 H;  1JCH A;  4TUY B;  1ROP A;  2FTK A;  1M56 B;  2E75 B;  3BA9 A;  2E74 B;  2BOB C;  1YEW A;  3WB1 A;  4U3F H;  5JCO A;  1SA0 B;  4WFE A;  3ZHR A;  1M9N A;  4I7Z B;  4KFM A;  2DOS A;  4YJ3 A;  1RSO A;  2GV9 A;  3ZMV A;  2LP7 A;  2WLK A;  4LFC O;  2X7R B;  4MW8 A;  2P6J A;  4U3J A;  3X2Q C;  4O4I B;  1QU7 A;  2OTJ V;  5B1A C;  1VQ7 V; 
#chains in the Genus database with same CATH homology
 2CTW A;  2KQX A;  3BVO A;  2M6Y A;  2Y4T A;  2CTR A;  2DN9 A;  1FAF A;  2GUZ A;  1NZ6 A;  2OCH A;  1N4C A;  2QWO B;  2QSA A;  1HDJ A;  1BQZ A;  4J7Z A;  3AG7 A;  2EJ7 A;  2N04 A;  2YUA A;  2CTP A;  4J80 A;  3UO2 A;  2PF4 E;  2DMX A;  2L6L A;  1BQ0 A;  4RWU A;  3APO A;  1XBL A;  3UO3 A;  2LO1 A;  3UCS C;  2QWN B;  2Y4U A;  1FPO A;  2QWQ B;  2CTQ A;  3APQ A;  1GH6 A;  2QWR B;  2GUZ B;  2CUG A;  2N05 A;  4IT5 A;  1WJZ A;  2LGW A;  2YS8 A;  1IUR A;  2QWP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...