1M93A

1.65 a structure of cleaved viral serpin crma
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
46
structure length
46
Chain Sequence
MDIFREIASSMKGENVFISPPSISSVLTILYYGANGSTAEQLSKYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Serine proteinase inhibitor 2
publication title Crystal structure of viral serpin crmA provides insights into its mechanism of cysteine proteinase inhibition
pubmed rcsb
source organism Cowpox virus
total genus 15
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2002-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.580 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1m93A00
1M93A 1JJOA
chains in the Genus database with same CATH superfamily
5JCOC 3K5LA 1JPXA 1PP9H 1GN4A 4K3AA 1NKDA 2LFRA 5J2TA 1TUEB 1DF4A 1KD1W 1N32B 3T2MA 2WLKA 1YHQV 1TA8A 5IWAO 3OTFA 1PV0A 1H2SB 5HFMA 1ZLZA 1NH2D 5D5QA 1IBMB 3AG4B 4CH5A 1TAEA 3F7VC 3HR0A 4ZOLB 3L75H 3SJBC 5KA6A 1M5IA 1VQNV 5KUMA 4DV5O 4UV9A 1YITV 1WAZA 4PI2A 4BIOA 5KMGB 2YDEA 2OIEA 3UO3A 4DR1O 1K5SA 5BMVB 2VQEB 2ZKOA 3L74H 1VF6C 1VQKV 1ORQC 1VQ9V 3RVZA 1PNKA 2JGDA 2L6LA 3E35A 4UCUA 1DK1A 4PA3A 2Z5UA 5LMNB 3ASOB 1QR9A 2VWKA 1K34A 4B7EA 2GTAA 4J11A 4BIZA 2Z3YA 3OW2U 5KA5A 5L3EA 4ZI7A 4YHHB 5C8YA 2ZXWC 3SYAA 4R50A 2EULA 2EIMB 2AHYA 4GKJB 4QNHB 4H0LB 1COWG 1GKFA 1BMFG 4FK5C 1VEWA 3GWOA 3CCMV 2O57A 2F66C 4JV5B 1BHAA 2JEXA 2FYUH 5A2QN 2R9AA 1XILA 2PYLA 2QM7A 2FKXA 2QDOA 1WP7A 5LHHA 3E86A 2VQFB 3KZIZ 2Q7EA 4XBFA 4JYCA 3H1JH 4KHPB 1SQPH 1NZ6A 4B3TB 4U3JA 4N23A 5B1NA 2IU3A 1CP9A 1I94O 4NXMB 1MNGA 2DE0X 4RWUA 4X64O 4UVCA 3X2QB 4JYYA 2YIBD 2IJHA 3K9SA 3HKBA 4JI7B 3FAVA 1YDXA 1K7DA 5GTIZ 1KKCA 3D3IA 1XNRB 3WB2A 4K35A 4W4KA 3JCUZ 2XT9A 5CA0B 3UCSC 2XAQA 4FM2A 4JGSA 5B1AC 4LWSA 1MZFA 1W59A 1S77D 3MHHC 1FYJA 2M6YA 2V7QG 1FXHA 1KUQA 1NS1A 2IM9A 3RVYA 3G6EV 4O2BA 1U97A 4CBCA 2GTSA 1B06A 4LR3A 4FZ0A 2Q73A 2ZE8A 1FKAO 4HZ3A 2ZQMA 1W0JG 3TXSA 1IURA 2WLLA 2D3OW 5KX5B 1PKXA 1SQVH 4UV8A 3T4ZA 1ZAUA 3TK1A 1Q82W 1LUWA 5JVDA 1K3EA 1PNMA 4DV4O 2UXCB 1TUBB 3FFQA 1XQ8A 5GTHZ 1XBLA 1QCEA 1WNSA 2DYSB 5CB4B 4YJ2A 4DV7O 1S3JA 2P90A 1N8RW 3JATA 2LGWA 4YY3B 2AW9A 4CH6A 1BE3H 1FXKC 4WFGA 4JTCB 5IJ0B 1YJ9V 4PELA 2ZE6A 2OT5A 4JAUA 2ZM6O 4D7TA 4DR4B 3HKDA 1H2GA 2PUSA 1XMQB 4DR6B 2KG7B 4H44B 4LNUB 1SZTA 4LC1A 2LQTA 1Y67A 1JJOA 4ZBMA 1US6A 3NR7A 1OCCC 4B3RB 2CTRA 2QWRB 5LGTA 1SQBH 4E4EA 1I08A 3B8NA 4X1KB 3W7XA 1VMGA 1P4RA 3BAAA 1HNWO 3AG1B 4Q20A 1FS0G 1EBOA 1QQCA 2E3CA 2YXHA 4WFFA 2C2AA 2UUCB 2Y69C 2Z0AA 3UT5A 2DQ3A 2K1EA 3ZIAG 1LNQA 4G28B 4FFKA 3TGUH 1NJIW 4CS3A 1MMMA 1IBKB 3E89A 1FFTB 1NTZH 3P32A 3SJCC 1Q3EA 3I5DA 1KP3A 5H9CA 5E79Z 3ZHRA 4X20B 2PZSA 3ZHTA 1AJPA 3ZBHA 2CTPA 2WLJA 5GW7A 3OD4A 3B2EE 3CJHB 3W7WA 2B9ZA 4FLYA 2ADQB 1N36O 2G38A 4YIPA 3M99B 2DWEC 5IJ9B 1B3QA 4GX0A 2IW5A 5H6QA 3CCVV 1Q6UA 3JD2A 5IE9A 3PJSK 3K57A 2NLJC 1MSDA 4Q6GA 1KU9A 4G2KA 3JALB 3GWKC 3OGIB 4ZOLA 3SJQC 4PA9A 1L0LH 3Q4HB 4EFBA 3MAQA 4JAAA 3JARA 4B7KA 3IJ4A 4LFCB 3DTUB 5KMGA 1H2MA 3ZCCA 3C90A 5BMVA 4R6ZA 4J10A 2A0LA 2RCVA 1JR9A 4DR3O 3ZMUA 4JAVA 5LHIA 3RYHB 4FZ1A 4DUZB 3OFNG 5CA1B 2PI4A 2H94A 4LFBB 5LMUB 1DLBA 4HYOA 5CMUA 4MVMA 2P6JA 2YSUB 4U3FH 2A9HA 3N2GB 3CRMA 2UUAB 1L0NH 5L3DA 2OCCC 3ZN0A 3CD6V 3APOA 5E1AC 3SJAC 3B09A 3QNEA 4GX2A 1FFXA 3AG2B 5EBMC 1QU7A 4IT5A 3P3PA 4NTYA 1N32O 1YTFD 4P9PA 1YJNV 4B3MB 2OIGA 4DW1A 3O65A 1B6QA 2BSKB 2L35A 1KBHA 3H01A 1VQ8V 5LHGA 1S5HC 3SYCA 1R1BA 5H5NA 1IBMO 5EIBC 1FJGB 1L1FA 3SPCA 1Z2GA 4X88A 3U10A 4FJCC 4DR7B 3CPWU 5FPRA 5B3SB 3OAAG 4F6RA 1SZXA 4H33A 3K04A 1GAXA 3BCCH 1VQMV 1FXVA 4IIJB 4F6EA 1SERA 4W4LA 2IH1C 4I4TB 2VQEO 1JCHA 1Q6IA 4KP4A 3DSQA 3A8TA 3F5TA 1V55C 2FL4A 4RUEA 1DGSA 2UXXA 4MT8A 3J7AU 2HJFC 3ABTA 2WLMA 2BCCH 1P7BA 3N2KB 2HEPA 2DQ0A 2JRIA 5LMNO 2X6CA 4OXSA 3FD9A 5EC1C 1OZ0A 2HJDA 1OV9A 1IXMA 4YHHO 1YEWA 1YIJV 1RSOB 2P06A 1S5LZ 3MDSA 1K92A 2A79B 1M90W 1KYOF 1Z5VA 1TGOA 3W7TA 1IDSA 1TVKB 5IT9N 1M56B 3CB2A 2LW7A 4X1IA 3L71H 1K4DC 4JV5O 2QGNA 4UCRA 5EIBD 1KECA 3ABKB 5IY5C 4FLZA 5L3GA 3WU2Z 5KX5A 3OM3B 2DYRB 5IDJA 4O4HB 3SYQA 4H37A 1XEQA 4U7OA 2YEVA 4MVSA 2VQFO 2EIKC 5J2UA 4MVUA 4KHPO 3L70H 4YXWG 4B3TO 1Y76B 3OMNB 1XMOB 2KKWA 3RYCB 1K97A 4O4JB 2E76B 5CB4A 3ASNC 3JAMN 2W0XA 3QF7A 3LSQA 2AXTZ 3BRCA 4FLXA 3H1IH 1YSCA 2XTAA 3JSNA 2KB1A 4GKKB 4D7SA 1BCCH 3BFRA 4DR2B 3IC9A 4JI7O 4MSWC 5IJ0A 1WN7A 2GSMB 1VQ7V 3TETA 2IU0A 4JI6B 2JK5C 1OCRB 3OMIB 4BW5A 3D8CA 4TV8B 3H9VA 3B4SA 4ABMA 4MTGA 3VQXA 4AQYB 2UU9B 2RQ6A 2B5UA 4LNUA 4PDLA 3ABLB 4JI4B 4FM1A 1JMKC 3CCUV 1K5QA 2A06H 2JGUA 1A32A 4CS2A 1N34B 1GK9A 2WSSG 3G6BA 3JAWB 5EZYB 4HAMA 4HNAB 4WFEA 3R65A 4X65B 3DC5A 1BT8A 1XL6A 3CYOA 2WWWA 5JJNB 3JD0A 4X8AA 2CAZC 5LXTB 1XHZA 4I7ZB 3ABUA 5BR8B 2DJVA 4FM0A 1P84F 3HB3B 5L3CA 2EJRA 3CCQV 2UXCO 4B3SB 3K0DA 2ZIOA 4WF9V 4X20A 1EM1A 4DV2B 3OR7C 3CMEV 2PY5A 1GMGA 1K33A 4DYLA 3I56V 3SGIA 2KQXA 4YY3O 1GRJA 3T1HB 2EZOA 3O9OA 2ODMA 1WPBA 4QIWF 2BE3A 2W6IG 3WB0A 2PYJA 2QA4V 1KB9F 1VF7A 5IJ9A 5CBGA 2ZCEA 3ETGA 4JI1B 3CP1A 1LR1A 1LUVA 5KAFZ 3LDDA 3A0RA 4DR4O 3OEEG 1H2KA 2LP7A 5DEDA 4UFZA 1XMQO 4DR6O 1DTOA 2IBZH 3JALA 5DM6V 4O4LA 2Q9LA 1NR7A 2RDCA 3UM7A 4B3RO 1N33B 2Q7GA 4TOIA 3Q4HA 2ZR3A 3ZRSA 4J9YB 3CRRA 4PA7A 5KLVH 4DUYB 4PV1B 5A9GA 4DV1B 4MVZA 3SPHA 4MVQA 1AROP 3UKMA 2R9RB 3OTOB 4DK0A 4GYCB 3SPGA 4J7ZA 2UUCO 3IC7A 3RYHA 2EJ7A 2GUZB 3ZRWB 2Y69B 3AG3B 3W7SA 3EHBB 1YF2A 2F23A 5CA3A 1J95A 2EILB 4I55B 1IXBA 1BQ0A 1GN3A 1IBKO 1AI5A 1S72V 3CC4V 4LF6B 4D6TH 2Q0OC 1B04A 3N2GA 2QWOB 1RP3B 2JEUA 1Q5OA 4DV6B 4DV3B 4BR6A 4OPHA 2LFSA 3RYFB 1AI7A 1SKVA 2R70A 1XDCA 2E74B 3QO8A 1ZL8B 2GBOA 4MW3A 5LBQA 3CMAV 1EZVH 1S0VA 2BSKA 4FVMA 2A7WA 1KP2A 4DRXB 3CRAA 1YTFB 2F4VB 3H1LH 4PA6A 2ILMA 1W2BU 3OMAB 3ABMC 3B40A 3THOA 4IIJA 5ITZB 4J41A 4UXNA 5BXZA 2XUMA 3RYIB 3OR6C 3AK2A 3ZX6A 1R6NA 3OGCC 1MZEA 1OHHG 5EK0A 1AP6A 2WA4A 2AZ0A 4BAYA 3CCEV 4DUZO 3L72H 1THZA 1XHXA 3OUSA 4QGPA 4TUYB 3N2KA 3JASA 4I9WA 1D2DA 1AR1B 4LFBO 5LMUO 3BABA 3FKSG 1R6TA 3APQA 3BHPA 3LDCA 5GONB 3DXRB 4X62B 1Y74A 4FLTA 2AZ2A 1RSOA 2UUAO 5EYPA 3JD3A 4YJ3B 1TVKA 2F95B 2X6AA 2M7WA 3HPLC 3T1YB 1PNLA 4J7KA 1G4YB 4DR5B 3S3WA 4O4HA 1VP7A 2LJ2A 2H8PC 3AG4C 4I0XB 4JI8B 1H8EG 4GX5A 3ZHVA 2QSAA 4PHZA 5LP6B 1FJGO 4AILC 1K8AW 2KSDA 4NTXA 1QLEB 1Y76A 3LNMB 1M9NA 1YCIA 4JTAB 5KHIA 3RYCA 1D5AA 2ZE7A 2EIJC 1BGYH 4CC6A 4E2LA 1MA1A 4UUJC 4ZKIA 1NTKH 1NU1H 4CH3A 3CX5F 3D36A 1G6UA 3CCRV 1XNQB 3ML0A 2FB5A 2WLHA 5JJJB 1F7YA 3JYCA 2QWPB 3CXHF 3LDEA 2JVDA 1KMIZ 4TV8A 5B66Z 3ASOC 1Q43A 1V9PA 1R3JC 2WPDG 1NI8A 4JI5B 1RM1B 2WAMA 3RFRA 1BSMA 4UCSA 4K0KB 3E22B 3CCJV 3ZMTA 4RO2A 1FPOA 3JAWA 5EZYA 3CC7V 4HNAA 1XI1A 1I0HA 4DO2A 2NN4A 4TQFA 1FD9A 1GM7A 1PD3A 3AK3A 3HKCB 4TSFG 1I5YA 2Y0PA 3EXAA 5LXTA 4Z2WA 4LF7B 2X7RB 2ZDIA 3F7YC 2EIKB 3E8FA 3E8HA 1ENVA 3CCLV 4FLWA 2HFEC 1Y66A 3ZHQA 1XMOO 5LOVB 4NR1A 2YXYA 3X2QC 5KHHA 1JFFB 1IVSA 4CH4A 1BQZA 2CGNA 1JX9A 2Y4TA 2X0LA 1P49A 3EFFK 1OCZB 3IGAC 3LSSA 4LF9B 3STLC 5K1XA 1NH2B 4GKKO 3K5NA 1BS3A 4JI0B 1AP5A 4DR2O 4LF4B 1IBLO 1M57C 4BIUA 3VQWA 3ETEA 5K1PA 2JGDB 2ZNIA 4Z1VA 4JI3O 2HR3A 4JI6O 2N04A 2ZR2A 4ASUG 1AR5A 1ZX3A 2AHZA 3VOUA 4X1YB 3RN4A 1NVPD 4LBEC 2UU9O 5JWPA 2B1GA 5F2VO 1EN4A 2EINC 3WFVA 2E5LB 4WFHA 5JQGB 1OCOC 3IAYA 3CE2A 2IJJA 1J5EB 1N34O 5JH7B 3K0GA 4O2AB 1WJZA 3VQYA 1ZTEA 2HHHB 4DW0A 1K4CC 4JYAB 2BTOA 3RT3C 4X65O 3NXSA 1KQSU 2CTWA 3N27A 2ADPA 1Z5WA 1MG1A 4KFMA 4MW8A 2IH3C 2GUZA 3ZRWA 3LUTB 1VARA 4DXWA 4TV9B 4I55A 2DMXA 1R3KC 2CH7B 3RBZA 5BR8O 1DF5A 3ZJZA 2B1IA 4FLUA 5DECA 2LW1A 4B3SO 4FFBB 2DYSC 3STZC 5FNVB 4IYHA 3ZMSA 1GN6A 4DV2O 2JS3A 3RYFA 1QNMA 2UXNA 3E83A 3T1HO 2XHBA 3HKBB 4DV0B 3FAVB 2OYQA 2UXBB 4JTDB 5B1BC 1IZ3A 4GZRB 1HR0B 3U0ZA 1RFYA 4C7UA 3K9AA 4NKGB 4DRXA 4JI2B 4NXNB 4U7NA 4LCUC 4N21A 5CA0A 2XAFA 1YJWV 3ZEDA 3UQ8A 1N33O 4WFAV 1SA0B 3CWBH 1HNXB 3UO2A 2JJ1G 4PJ0Z 3AG1C 2QM8A 1HNWB 2ZXWB 5ITZA 4GX1A 3CHXA 4DUYO 2VWJA 3RYIA 4GKJO 1SQGA 3BVOA 3D3QA 4DV1O 2Q8VA 2E75B 5AG2A 2Q67A 3OTOO 2YI9A 5EBWC 3JD1A 2QKCA 4FMTA 2HLDG 5JVDB 2ATKC 3K79A 2YIAA 4IHJB 4LF5B 5GONA 4UB6Z 4LF6O 3DXRA 1ZUQA 1WA8B 4YJ2B 3K58A 1TUBA 2CUGA 3LNNA 1AR4A 4YJ3A 2ZINA 1HP8A 1SRYA 1CEZA 4FIPC 3FB6C 4NXMO 4IYIA 5FPOA 4CS4A 4PDVA 3SDLA 1AB3A 3B77A 2H3OA 2HKOA 4J9ZB 2DWDC 1M4UA 2K9PA 1UJWB 3K06A 4RQFA 3CRCA 4OX9B 4I0XA 4XDKA 4P30A 5LP6A 1XNRO 1WPXA 2KG7A 2F4VO 1MABG 5B1AB 3ZHUA 2BTQB 3IFXA 4UCTA 5CN0A 2YC0A 4J7JA 1P7GA 3ZRVA 2DN9A 4G27B 3JAKB 4OGQB 4X1KA 1V54C 4L87A 4LH6A 1BZKA 3QTCA 3KCXA 3QVNA 1WB7A 2V1DA 1PPJH 3WB1A 1GH6A 3MHSC 3FYEB 5CBHA 1VF5B 3FYIB 2VS0A 2JJ2G 1YI2V 4ZIBA 2JS5A 1SETA 1RPOA 4LFAB 2CDYA 3BA8A 4X62O 3FB8C 4TWKA 3K03A 3E22A 3BEHA 5C93A 4UCOA 2PI5A 2VRZA 3HKEB 4QPJA 5LA6B 3FB5C 3AG2C 4JPRA 1YZBA 2RJZA 4JYBA 5D5PA 4WFBV 3BPZA 3T1YO 3CJHA 2YI8A 3HKCA 4DR5O 4KXRA 1FXKB 5TISZ 3M7MX 1GN2A 4JI8O 3DC6A 3KG2A 1MSWD 3ETQA 1H2NA 5B3SC 1GM9A 2X6BA 3E8BA 2CTQA 2XNDG 1F51A 2BOBC 5KAIZ 4QPKA 2IJKA 4F4LA 1EN5A 3JARB 2EIJB 5LOVA 3CSXA 2W6JG 3CC2V 1JFFA 3G67A 5IYDO 1OCCB 2UUBB 1QVFU 1E1RG 5B5EZ 2LGQA 4NVPA 4CZZA 2XAJA 2YICA 4CC5A 4GT1A 4GUNA 5HFLA 1XNQO 5DN6G 2P7TC 4PDRA 3SYPA 1VQ6V 2UXDB 2ZNJA 1QR8A 2R72A 4LH7A 1H8HG 1MOFA 3H1HH 1WP8A 2MW2B 5L3BA 4EFEA 4X1YA 2P5OA 1F4NA 5CA1A 4JI5O 3SPIA 4X66B 1M1KW 4LF8B 5JQGA 5JJEB 1JVMA 3AG7A 1M56C 4K0KO 1NT2B 3OT7A 1NTMH 4X89A 1KC8W 1NVPB 3WG7C 1FFXB 5JH7A 2Q69A 4O2AA 3ABKC 5KUKA 3E8GA 5JCOA 2DYRC 3C3TA 2RNBA 1HWYA 4MTXA 3MD0A 1O9HA 2W0FC 1SQXH 1R3IC 4PA4A 4TV9A 1Q81W 2CH7A 4LF7O 1S76D 1X4TA 4F6RB 4FFBA 1ZWIC 2QR4A 2Y0IA 4JASA 5FNVA 1HNZB 3A0HZ 2WLIB 3OUFA 4H13B 1EN6A 1Y6XA 3ZS8C 3D36C 2EZPA 2ZE5A 1PL4A 4LF9O 2DW4A 4TT3G 4JI0O 4LFCO 4ZHQB 1H38A 4LF4O 2A3QA 5CBFA 2FMLA 1M57B 1Y4MA 1OCRC 2QWNB 4I4TA 5KHGA 1VF6A 1PM9A 3SPJA 1QVGU 2F1MA 3L73H 4I50B 2Y48A 1HW7A 2OCHA 3ABLC 3H1KH 2N74A 4QE9A 2F43G 1AJNA 2ZIMA 1NR1A 2YIBA 2EINB 4JZ2A 5BY1A 2E5LO 2XAGA 2Q0AA 1OCOB 1SA0A 2P67A 1WB8A 4X1IB 4BWAA 1J5EO 4EKWA 1AILA 4X9QA 2QKAA 2LO1A 4NB5A 4AI8A 2YIDA 2HHHO 1ZSPA 4JYAO 1SESA 2OCCB 1SQQH 4EB6B 5KHJA 1EZJA 2JIZG 4NYKA 1SQFA 2YEVB 2ZDIC 3RW0A 4O4IB 4B3MO 3J81N 5IWAB 1VQPV 5J2UB 5LYJB 1OJHA 3S3XA 4WBNB 2PGGA 2RN9A 3TCUA 4IHJA 1JJ2U 3I55V 1WA8A 3G80A 5EC2C 3GB7C 5B1OA 4FLVA 4DR7O 2HVJC 1K73W 2D2CB 2WA3A 1JA8A 1BL8A 4DV5B 4R7CA 4O4JA 1VIBA 1URFA 1XOUA 3KCYA 4DV0O 2UXBO 1R3LC 4IL6Z 5IYZB 4DR1B 1HR0O 5B1BB 2WLNA 3G4SV 5LGUA 2ETNA 3P30A 4J42A 3T1CA 1V55B 1VQLV 3K3WA 2Q5ZA 3CXCU 4JI2O 2YS8A 4NXNO 2BOCC 1WLEA 4A5UB 5J9PC 4WCEV 1SS3A 2CE4A 2BTQA 3ICXA 2QKSA 1SF9A 1E79G 1HNXO 2EIMC 3ZMZA 3K59A 1Q6HA 3C3SA 4GCZA 1AI6A 2HG5C 2P4VA 2QM4A 3JAKA 2ITCC 4OPAA 2XOKG 1KKDA 2Q4PA 4PD4F 1R6KA 4I5SA 5J2TB 3AG3C 2QJ1A 3F5WC 1CPYA 2Q7HA 2EILC 4UVAA 2RMKB 5EBLC 5IY5B 3CCSV 4XDJA 2QWQB 4J80A 1M93A 2JDIG 3GVMA 1I5XA 1EFRG 4LF5O 4RAIA 2AGAA 4K8XA 4L8JA 1S5JA 5BZBA 2PTMA 1F4MA 4YIOA 1SC5B 2ZT9B 2NR5A 3HKEA 4AHCA 3A0BZ 3K5OA 5LA6A 1I94B 4QJFB 1R73A 3JSLA 4X64B 3ASNB 1G8MA 3SR2C 1Q86W 1RPRA 2GDSA 1AI4A 1AVMA 1AJQA 3DGEA 2HVKC 1FXKA 2V4DA 4OX9O 4O4LB 2OTJV 2QEXV 3W7UA 2NNUA 1GO3F 4HBNA 1I7FA 4AQYO 4MVRA 4ZI7B 3R66A 4MS2A 5C8YB 4P9OA 3ZMVA 1D5NA 4JI4O 1T5EA 1U96A 4KUMA 5FL7G 2QTOA 1NQTA 1V54B 3SYOA 3RWRD 2ITDC 5LL6Y 3M8AA 4B08A 3K08A 3LSUA 1Q90D 3J80N 5IYCO 4PI0A 2Q68A 1VQ5V 3PN1A 3K5MA 4LFAO 2P4KA 2ARHA 4DV4B 1XL4A 3ZHSA 1K9MW 4U3JB 2R9IA 4DV7B 2YUAA 5LGNA 4UB8Z 2XAHA 2DOSA 4R8CA 5FLXN 4IGGA 2GV9A 2XASA 1N0JA 1O9GA 1UFIA 3KKYA 4KL1A 3E2EA 3B8MA 2Q6AA 1ZL8A 1JQ0A 4NTWA 3FB7C 5LP6C 4K8ZA 4JI1O 2ZM6B 1IX9A 1QLEC 4RUFA 3QG5A 3L9DA 1PL0A 4I9QA 3CEIA 4LWSB 2GHYA 2WLIA 4MVOA 2MK3A 2HP8A 2F93B 2CK3G 3JD4A 3CS5A 4RQEA 2UUBO 1XUQA 1BHBA 5IYBO 4O2BB 4ZHQA 3ZRXA 2N05A 4DK1A 3TJTA 1GM8A 2UXDO 3BY6A 2YXLA 1YXBA 4P2ZA 3ZN1A 3JASB 2EX3A 4PDMA 1YVWA 2WLLB 3FX7A 4LP8A 4GLXA 4EEQA 4I50A 1RM1C 3OE7G 2P22C 4FPPA 1NBMG 1X59A 4TUYA 3BA9A 4MTFA 2OWOA 1Y74B 1CXZB 3AEIA 3EVKA 4X66O 1GTOA 3JCZA 4UCVA 3QO7A 2QTSA 5EYPB 4LF8O 3A2FA 3U11A 4ICGA 1QLNA 4DV6O 3JATB 2OTLV 3WG7B 4DV3O 3P3NA 1JOYA 1QHTA 3CRQA 1N36B 1Q8IA 4XDLA 4EB6A 4QE7A 1FAFA 2IJIA 1E1QG 1W0KG 3G71V 5L3FA 4O4IA 2Y4UA 1H2LA 5H6RA 5LYJA 4UVBA 4WBNA 3HKDB 1N0NA 2ZD9A 3VQVA 5H2FZ 4MTOA 1L8DA 2CGOA 1VQ4V 5KHKA 2PF4E 3ETDA 1HNZO 3AK1A 3VBBA 4Z1MG 1VQOV 1OCZC 3RGBA 1ROPA 4JZGA 1HDJA 3T4DA 3TXQA 1UPGA 1IBLB 4BW9A 1Q7YW 1G1XB 3ABMB 5IYZA 4TQDA 1N4CA 2QE7G 4JI3B 4DR3B 1QBZA 1F23A 3UT5B 3OEHG 1XREA 3QO5A 4JF3A 2EBOA 2FTKA
chains in the Genus database with same CATH topology
3ZS8C 5JCOC 3K5LA 3JAWA 4IIJB 5EZYA 4HNAA 1XI1A 4ZHQB 4I4TB 5J2TA 4TQFA 3DSQA 1N32B 5KHGA 4I4TA 3HKCB 1DGSA 1TA8A 3OTFA 1H2SB 5LXTA 2F1MA 3N2KB 2HEPA 4I50B 4LF7B 1HW7A 5D5QA 1IBMB 4CH5A 2ZIMA 1TAEA 4ZOLB 2YIBA 4FLWA 3SJBC 2Q0AA 1YEWA 1SA0A 1M5IA 5LOVB 4X1IB 1Z5VA 1TGOA 4BWAA 5KHHA 1TVKB 1JFFB 4CH4A 3CB2A 4PI2A 1P49A 4X1IA 5KMGB 4LF9B 5K1XA 3K5NA 4JI0B 4EB6B 4UCRA 5BMVB 5KHJA 2VQEB 5EIBD 4LF4B 3VQWA 4FLZA 5K1PA 5KX5A 1SQFA 2ZNIA 4O4HB 4O4IB 5IWAB 5J2UB 5LYJB 4WBNB 2PGGA 4UCUA 4X1YB 4IHJA 5J2UA 5LMNB 2VWKA 2E5LB 5JQGB 1XMOB 2KKWA 4FLVA 4ZI7A 3RYCB 4YHHB 5C8YA 4O4JB 5CB4A 3IAYA 4GKJB 3QF7A 4DV5B 1J5EB 3BRCA 4FLXA 4O4JA 5JH7B 4O2AB 3VQYA 3JSNA 2HHHB 4GKKB 4D7SA 4JYAB 2F66C 2BTOA 4JV5B 5IYZB 4DR2B 4DR1B 5IJ0A 1Z5WA 1WN7A 2R9AA 2PYLA 4JI6B 4TV9B 4I55A 4TV8B 3VQXA 2VQFB 4FLUA 4AQYB 2Q7EA 2UU9B 2RQ6A 4LNUA 4FFBB 4KHPB 4B3TB 4U3JA 2BTQA 3ICXA 4JI4B 5FNVB 4FM1A 1JMKC 3K59A 4NXMB 3RYFA 2JGUA 4CS2A 1N34B 2QM4A 3JAWB 3JAKA 5EZYB 2XHBA 3HKBB 4DV0B 4HNAB 2OYQA 2YIBD 2UXBB 5J2TB 4X65B 3HKBA 2QJ1A 4JI7B 2Q7HA 1HR0B 3U0ZA 5JJNB 1XNRB 2CAZC 3WB2A 5LXTB 1XHZA 1M93A 4DRXA 5CA0B 5BR8B 4JI2B 4NXNB 4FM0A 4FM2A 4K8XA 4L8JA 5CA0A 4B3SB 2ZIOA 1S5JA 3ZEDA 2PTMA 3UQ8A 4X20A 4DV2B 1SA0B 1HNXB 3HKEA 4AHCA 2PY5A 3K5OA 1I94B 5LA6A 1HNWB 2IM9A 3SGIA 5ITZA 3CHXA 3T1HB 2VWJA 3JSLA 4X64B 3RYIA 4O2BA 1SQGA 4LR3A 1WPBA 3SR2C 3WB0A 2PYJA 1VF7A 5IJ9A 2ZCEA 4JI1B 2YI9A 5KX5B 2V4DA 5JVDB 4O4LB 1ZAUA 4UFZA 2YIAA 3JALA 5JVDA 4IHJB 4O4LA 4LF5B 5GONA 4HBNA 2UXCB 1I7FA 1TUBB 3FFQA 4YJ2B 1XQ8A 4ZI7B 1N33B 3K58A 5C8YB 1TUBA 2Q7GA 3LNNA 4TOIA 4YJ3A 1WNSA 5CB4B 4YJ2A 1T5EA 3JATA 2ZINA 4YY3B 4DUYB 4CS4A 5FPOA 4DV1B 4CH6A 3RWRD 3OTOB 4DK0A 5IJ0B 4GYCB 4B08A 3RYHA 1M4UA 4DR4B 4D7TA 4OX9B 3HKDA 4I55B 4PI0A 2PUSA 5LP6A 1XMQB 3PN1A 4DR6B 3K5MA 4LNUB 4DV4B 4LF6B 3N2GA 1B04A 1JJOA 4U3JB 2BTQB 1Q5OA 4B3RB 4UCTA 4DV6B 4DV3B 4DV7B 3RYFB 4X1KB 1SKVA 2R70A 3JAKB 3BAAA 4X1KA 2GV9A 4LH6A 3QTCA 1QQCA 1O9GA 2E3CA 4KL1A 2UUCB 3WB1A 3UT5A 4FVMA 5LP6C 4K8ZA 2ZM6B 4DRXB 4ZIBA 3QG5A 4CS3A 2JS5A 1IBKB 4I9QA 4LFAB 3SJCC 1Q3EA 3BA8A 2F4VB 4X20B 3E22A 4UCOA 2PZSA 2F93B 3HKEB 5LA6B 3THOA 4IIJA 5ITZB 3B2EE 3RYIB 4O2BB 4FLYA 2RJZA 5D5PA 3BPZA 4ZHQA 4DK1A 5IJ9B 2YI8A 3HKCA 2YXLA 3JASB 2EX3A 1XHXA 3M7MX 4TUYB 3N2KA 3JASA 3K57A 4EEQA 4I50A 4GLXA 4Q6GA 3ETQA 2P22C 1KU9A 4TUYA 3BABA 3BA9A 2OWOA 3JALB 3BHPA 4ZOLA 5GONB 4UCVA 5EYPB 4X62B 4FLTA 1RSOA 3A2FA 3JARB 5LOVA 5EYPA 3U11A 3CSXA 4YJ3B 1TVKA 1JFFA 4EFBA 3MAQA 3JARA 3JATB 2UUBB 4LFCB 5KMGA 4NVPA 4CC5A 1QHTA 2F95B 1N36B 1Q8IA 4EB6A 5BMVA 3T1YB 2UXDB 2ZNJA 4DR5B 2R72A 3RYHB 4O4HA 4LH7A 4O4IA 4DUZB 5LYJA 5CA1B 4WBNA 4JI8B 3HKDB 4EFEA 4LFBB 4X1YA 2P5OA 5LMUB 4PHZA 3VQVA 5LP6B 5CA1A 4AILC 1L8DA 4X66B 5KHKA 4LF8B 5JQGA 5KHIA 3RYCA 1D5AA 3N2GB 5JJEB 1NT2B 4CC6A 2UUAB 3RGBA 1FFXB 4CH3A 5JH7A 4O2AA 3SJAC 1IBLB 4BW9A 5JCOA 1FFXA 1G6UA 5IYZA 1XNQB 4TQDA 4JI3B 4B3MB 5JJJB 4DR3B 1O9HA 3UT5B 2JVDA 1KMIZ 4TV9A 4TV8A 1X4TA 1Q43A 1V9PA 5EIBC 1FJGB 4F6RB 4FFBA 4JI5B 3U10A 4DR7B 5FPRA 5FNVA 3RFRA 4F6RA 1HNZB 4UCSA 4K0KB 3E22B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M93 A;  1JJO A; 
#chains in the Genus database with same CATH topology
 5JCO C;  3K5L A;  1JPX A;  1PP9 H;  1GN4 A;  4K3A A;  1NKD A;  2LFR A;  5J2T A;  1TUE B;  1DF4 A;  1KD1 W;  1N32 B;  3T2M A;  2WLK A;  1YHQ V;  1TA8 A;  5IWA O;  3OTF A;  1PV0 A;  1H2S B;  5HFM A;  1ZLZ A;  1NH2 D;  5D5Q A;  1IBM B;  3AG4 B;  4CH5 A;  1TAE A;  3F7V C;  3HR0 A;  4ZOL B;  3L75 H;  3SJB C;  5KA6 A;  1M5I A;  1VQN V;  5KUM A;  4DV5 O;  4UV9 A;  1YIT V;  1WAZ A;  4PI2 A;  4BIO A;  5KMG B;  2YDE A;  2OIE A;  3UO3 A;  4DR1 O;  1K5S A;  5BMV B;  2VQE B;  2ZKO A;  3L74 H;  1VF6 C;  1VQK V;  1ORQ C;  1VQ9 V;  3RVZ A;  1PNK A;  2JGD A;  2L6L A;  3E35 A;  4UCU A;  1DK1 A;  4PA3 A;  2Z5U A;  5LMN B;  3ASO B;  1QR9 A;  2VWK A;  1K34 A;  4B7E A;  2GTA A;  4J11 A;  4BIZ A;  2Z3Y A;  3OW2 U;  5KA5 A;  5L3E A;  4ZI7 A;  4YHH B;  5C8Y A;  2ZXW C;  3SYA A;  4R50 A;  2EUL A;  2EIM B;  2AHY A;  4GKJ B;  4QNH B;  4H0L B;  1COW G;  1GKF A;  1BMF G;  4FK5 C;  1VEW A;  3GWO A;  3CCM V;  2O57 A;  2F66 C;  4JV5 B;  1BHA A;  2JEX A;  2FYU H;  5A2Q N;  2R9A A;  1XIL A;  2PYL A;  2QM7 A;  2FKX A;  2QDO A;  1WP7 A;  5LHH A;  3E86 A;  2VQF B;  3KZI Z;  2Q7E A;  4XBF A;  4JYC A;  3H1J H;  4KHP B;  1SQP H;  1NZ6 A;  4B3T B;  4U3J A;  4N23 A;  5B1N A;  2IU3 A;  1CP9 A;  1I94 O;  4NXM B;  1MNG A;  2DE0 X;  4RWU A;  4X64 O;  4UVC A;  3X2Q B;  4JYY A;  2YIB D;  2IJH A;  3K9S A;  3HKB A;  4JI7 B;  3FAV A;  1YDX A;  1K7D A;  5GTI Z;  1KKC A;  3D3I A;  1XNR B;  3WB2 A;  4K35 A;  4W4K A;  3JCU Z;  2XT9 A;  5CA0 B;  3UCS C;  2XAQ A;  4FM2 A;  4JGS A;  5B1A C;  4LWS A;  1MZF A;  1W59 A;  1S77 D;  3MHH C;  1FYJ A;  2M6Y A;  2V7Q G;  1FXH A;  1KUQ A;  1NS1 A;  2IM9 A;  3RVY A;  3G6E V;  4O2B A;  1U97 A;  4CBC A;  2GTS A;  1B06 A;  4LR3 A;  4FZ0 A;  2Q73 A;  2ZE8 A;  1FKA O;  4HZ3 A;  2ZQM A;  1W0J G;  3TXS A;  1IUR A;  2WLL A;  2D3O W;  5KX5 B;  1PKX A;  1SQV H;  4UV8 A;  3T4Z A;  1ZAU A;  3TK1 A;  1Q82 W;  1LUW A;  5JVD A;  1K3E A;  1PNM A;  4DV4 O;  2UXC B;  1TUB B;  3FFQ A;  1XQ8 A;  5GTH Z;  1XBL A;  1QCE A;  1WNS A;  2DYS B;  5CB4 B;  4YJ2 A;  4DV7 O;  1S3J A;  2P90 A;  1N8R W;  3JAT A;  2LGW A;  4YY3 B;  2AW9 A;  4CH6 A;  1BE3 H;  1FXK C;  4WFG A;  4JTC B;  5IJ0 B;  1YJ9 V;  4PEL A;  2ZE6 A;  2OT5 A;  4JAU A;  2ZM6 O;  4D7T A;  4DR4 B;  3HKD A;  1H2G A;  2PUS A;  1XMQ B;  4DR6 B;  2KG7 B;  4H44 B;  4LNU B;  1SZT A;  4LC1 A;  2LQT A;  1Y67 A;  1JJO A;  4ZBM A;  1US6 A;  3NR7 A;  1OCC C;  4B3R B;  2CTR A;  2QWR B;  5LGT A;  1SQB H;  4E4E A;  1I08 A;  3B8N A;  4X1K B;  3W7X A;  1VMG A;  1P4R A;  3BAA A;  1HNW O;  3AG1 B;  4Q20 A;  1FS0 G;  1EBO A;  1QQC A;  2E3C A;  2YXH A;  4WFF A;  2C2A A;  2UUC B;  2Y69 C;  2Z0A A;  3UT5 A;  2DQ3 A;  2K1E A;  3ZIA G;  1LNQ A;  4G28 B;  4FFK A;  3TGU H;  1NJI W;  4CS3 A;  1MMM A;  1IBK B;  3E89 A;  1FFT B;  1NTZ H;  3P32 A;  3SJC C;  1Q3E A;  3I5D A;  1KP3 A;  5H9C A;  5E79 Z;  3ZHR A;  4X20 B;  2PZS A;  3ZHT A;  1AJP A;  3ZBH A;  2CTP A;  2WLJ A;  5GW7 A;  3OD4 A;  3B2E E;  3CJH B;  3W7W A;  2B9Z A;  4FLY A;  2ADQ B;  1N36 O;  2G38 A;  4YIP A;  3M99 B;  2DWE C;  5IJ9 B;  1B3Q A;  4GX0 A;  2IW5 A;  5H6Q A;  3CCV V;  1Q6U A;  3JD2 A;  5IE9 A;  3PJS K;  3K57 A;  2NLJ C;  1MSD A;  4Q6G A;  1KU9 A;  4G2K A;  3JAL B;  3GWK C;  3OGI B;  4ZOL A;  3SJQ C;  4PA9 A;  1L0L H;  3Q4H B;  4EFB A;  3MAQ A;  4JAA A;  3JAR A;  4B7K A;  3IJ4 A;  4LFC B;  3DTU B;  5KMG A;  1H2M A;  3ZCC A;  3C90 A;  5BMV A;  4R6Z A;  4J10 A;  2A0L A;  2RCV A;  1JR9 A;  4DR3 O;  3ZMU A;  4JAV A;  5LHI A;  3RYH B;  4FZ1 A;  4DUZ B;  3OFN G;  5CA1 B;  2PI4 A;  2H94 A;  4LFB B;  5LMU B;  1DLB A;  4HYO A;  5CMU A;  4MVM A;  2P6J A;  2YSU B;  4U3F H;  2A9H A;  3N2G B;  3CRM A;  2UUA B;  1L0N H;  5L3D A;  2OCC C;  3ZN0 A;  3CD6 V;  3APO A;  5E1A C;  3SJA C;  3B09 A;  3QNE A;  4GX2 A;  1FFX A;  3AG2 B;  5EBM C;  1QU7 A;  4IT5 A;  3P3P A;  4NTY A;  1N32 O;  1YTF D;  4P9P A;  1YJN V;  4B3M B;  2OIG A;  4DW1 A;  3O65 A;  1B6Q A;  2BSK B;  2L35 A;  1KBH A;  3H01 A;  1VQ8 V;  5LHG A;  1S5H C;  3SYC A;  1R1B A;  5H5N A;  1IBM O;  5EIB C;  1FJG B;  1L1F A;  3SPC A;  1Z2G A;  4X88 A;  3U10 A;  4FJC C;  4DR7 B;  3CPW U;  5FPR A;  5B3S B;  3OAA G;  4F6R A;  1SZX A;  4H33 A;  3K04 A;  1GAX A;  3BCC H;  1VQM V;  1FXV A;  4IIJ B;  4F6E A;  1SER A;  4W4L A;  2IH1 C;  4I4T B;  2VQE O;  1JCH A;  1Q6I A;  4KP4 A;  3DSQ A;  3A8T A;  3F5T A;  1V55 C;  2FL4 A;  4RUE A;  1DGS A;  2UXX A;  4MT8 A;  3J7A U;  2HJF C;  3ABT A;  2WLM A;  2BCC H;  1P7B A;  3N2K B;  2HEP A;  2DQ0 A;  2JRI A;  5LMN O;  2X6C A;  4OXS A;  3FD9 A;  5EC1 C;  1OZ0 A;  2HJD A;  1OV9 A;  1IXM A;  4YHH O;  1YEW A;  1YIJ V;  1RSO B;  2P06 A;  1S5L Z;  3MDS A;  1K92 A;  2A79 B;  1M90 W;  1KYO F;  1Z5V A;  1TGO A;  3W7T A;  1IDS A;  1TVK B;  5IT9 N;  1M56 B;  3CB2 A;  2LW7 A;  4X1I A;  3L71 H;  1K4D C;  4JV5 O;  2QGN A;  4UCR A;  5EIB D;  1KEC A;  3ABK B;  5IY5 C;  4FLZ A;  5L3G A;  3WU2 Z;  5KX5 A;  3OM3 B;  2DYR B;  5IDJ A;  4O4H B;  3SYQ A;  4H37 A;  1XEQ A;  4U7O A;  2YEV A;  4MVS A;  2VQF O;  2EIK C;  5J2U A;  4MVU A;  4KHP O;  3L70 H;  4YXW G;  4B3T O;  1Y76 B;  3OMN B;  1XMO B;  2KKW A;  3RYC B;  1K97 A;  4O4J B;  2E76 B;  5CB4 A;  3ASN C;  3JAM N;  2W0X A;  3QF7 A;  3LSQ A;  2AXT Z;  3BRC A;  4FLX A;  3H1I H;  1YSC A;  2XTA A;  3JSN A;  2KB1 A;  4GKK B;  4D7S A;  1BCC H;  3BFR A;  4DR2 B;  3IC9 A;  4JI7 O;  4MSW C;  5IJ0 A;  1WN7 A;  2GSM B;  1VQ7 V;  3TET A;  2IU0 A;  4JI6 B;  2JK5 C;  1OCR B;  3OMI B;  4BW5 A;  3D8C A;  4TV8 B;  3H9V A;  3B4S A;  4ABM A;  4MTG A;  3VQX A;  4AQY B;  2UU9 B;  2RQ6 A;  2B5U A;  4LNU A;  4PDL A;  3ABL B;  4JI4 B;  4FM1 A;  1JMK C;  3CCU V;  1K5Q A;  2A06 H;  2JGU A;  1A32 A;  4CS2 A;  1N34 B;  1GK9 A;  2WSS G;  3G6B A;  3JAW B;  5EZY B;  4HAM A;  4HNA B;  4WFE A;  3R65 A;  4X65 B;  3DC5 A;  1BT8 A;  1XL6 A;  3CYO A;  2WWW A;  5JJN B;  3JD0 A;  4X8A A;  2CAZ C;  5LXT B;  1XHZ A;  4I7Z B;  3ABU A;  5BR8 B;  2DJV A;  4FM0 A;  1P84 F;  3HB3 B;  5L3C A;  2EJR A;  3CCQ V;  2UXC O;  4B3S B;  3K0D A;  2ZIO A;  4WF9 V;  4X20 A;  1EM1 A;  4DV2 B;  3OR7 C;  3CME V;  2PY5 A;  1GMG A;  1K33 A;  4DYL A;  3I56 V;  3SGI A;  2KQX A;  4YY3 O;  1GRJ A;  3T1H B;  2EZO A;  3O9O A;  2ODM A;  1WPB A;  4QIW F;  2BE3 A;  2W6I G;  3WB0 A;  2PYJ A;  2QA4 V;  1KB9 F;  1VF7 A;  5IJ9 A;  5CBG A;  2ZCE A;  3ETG A;  4JI1 B;  3CP1 A;  1LR1 A;  1LUV A;  5KAF Z;  3LDD A;  3A0R A;  4DR4 O;  3OEE G;  1H2K A;  2LP7 A;  5DED A;  4UFZ A;  1XMQ O;  4DR6 O;  1DTO A;  2IBZ H;  3JAL A;  5DM6 V;  4O4L A;  2Q9L A;  1NR7 A;  2RDC A;  3UM7 A;  4B3R O;  1N33 B;  2Q7G A;  4TOI A;  3Q4H A;  2ZR3 A;  3ZRS A;  4J9Y B;  3CRR A;  4PA7 A;  5KLV H;  4DUY B;  4PV1 B;  5A9G A;  4DV1 B;  4MVZ A;  3SPH A;  4MVQ A;  1ARO P;  3UKM A;  2R9R B;  3OTO B;  4DK0 A;  4GYC B;  3SPG A;  4J7Z A;  2UUC O;  3IC7 A;  3RYH A;  2EJ7 A;  2GUZ B;  3ZRW B;  2Y69 B;  3AG3 B;  3W7S A;  3EHB B;  1YF2 A;  2F23 A;  5CA3 A;  1J95 A;  2EIL B;  4I55 B;  1IXB A;  1BQ0 A;  1GN3 A;  1IBK O;  1AI5 A;  1S72 V;  3CC4 V;  4LF6 B;  4D6T H;  2Q0O C;  1B04 A;  3N2G A;  2QWO B;  1RP3 B;  2JEU A;  1Q5O A;  4DV6 B;  4DV3 B;  4BR6 A;  4OPH A;  2LFS A;  3RYF B;  1AI7 A;  1SKV A;  2R70 A;  1XDC A;  2E74 B;  3QO8 A;  1ZL8 B;  2GBO A;  4MW3 A;  5LBQ A;  3CMA V;  1EZV H;  1S0V A;  2BSK A;  4FVM A;  2A7W A;  1KP2 A;  4DRX B;  3CRA A;  1YTF B;  2F4V B;  3H1L H;  4PA6 A;  2ILM A;  1W2B U;  3OMA B;  3ABM C;  3B40 A;  3THO A;  4IIJ A;  5ITZ B;  4J41 A;  4UXN A;  5BXZ A;  2XUM A;  3RYI B;  3OR6 C;  3AK2 A;  3ZX6 A;  1R6N A;  3OGC C;  1MZE A;  1OHH G;  5EK0 A;  1AP6 A;  2WA4 A;  2AZ0 A;  4BAY A;  3CCE V;  4DUZ O;  3L72 H;  1THZ A;  1XHX A;  3OUS A;  4QGP A;  4TUY B;  3N2K A;  3JAS A;  4I9W A;  1D2D A;  1AR1 B;  4LFB O;  5LMU O;  3BAB A;  3FKS G;  1R6T A;  3APQ A;  3BHP A;  3LDC A;  5GON B;  3DXR B;  4X62 B;  1Y74 A;  4FLT A;  2AZ2 A;  1RSO A;  2UUA O;  5EYP A;  3JD3 A;  4YJ3 B;  1TVK A;  2F95 B;  2X6A A;  2M7W A;  3HPL C;  3T1Y B;  1PNL A;  4J7K A;  1G4Y B;  4DR5 B;  3S3W A;  4O4H A;  1VP7 A;  2LJ2 A;  2H8P C;  3AG4 C;  4I0X B;  4JI8 B;  1H8E G;  4GX5 A;  3ZHV A;  2QSA A;  4PHZ A;  5LP6 B;  1FJG O;  4AIL C;  1K8A W;  2KSD A;  4NTX A;  1QLE B;  1Y76 A;  3LNM B;  1M9N A;  1YCI A;  4JTA B;  5KHI A;  3RYC A;  1D5A A;  2ZE7 A;  2EIJ C;  1BGY H;  4CC6 A;  4E2L A;  1MA1 A;  4UUJ C;  4ZKI A;  1NTK H;  1NU1 H;  4CH3 A;  3CX5 F;  3D36 A;  1G6U A;  3CCR V;  1XNQ B;  3ML0 A;  2FB5 A;  2WLH A;  5JJJ B;  1F7Y A;  3JYC A;  2QWP B;  3CXH F;  3LDE A;  2JVD A;  1KMI Z;  4TV8 A;  5B66 Z;  3ASO C;  1Q43 A;  1V9P A;  1R3J C;  2WPD G;  1NI8 A;  4JI5 B;  1RM1 B;  2WAM A;  3RFR A;  1BSM A;  4UCS A;  4K0K B;  3E22 B;  3CCJ V;  3ZMT A;  4RO2 A;  1FPO A;  3JAW A;  5EZY A;  3CC7 V;  4HNA A;  1XI1 A;  1I0H A;  4DO2 A;  2NN4 A;  4TQF A;  1FD9 A;  1GM7 A;  1PD3 A;  3AK3 A;  3HKC B;  4TSF G;  1I5Y A;  2Y0P A;  3EXA A;  5LXT A;  4Z2W A;  4LF7 B;  2X7R B;  2ZDI A;  3F7Y C;  2EIK B;  3E8F A;  3E8H A;  1ENV A;  3CCL V;  4FLW A;  2HFE C;  1Y66 A;  3ZHQ A;  1XMO O;  5LOV B;  4NR1 A;  2YXY A;  3X2Q C;  5KHH A;  1JFF B;  1IVS A;  4CH4 A;  1BQZ A;  2CGN A;  1JX9 A;  2Y4T A;  2X0L A;  1P49 A;  3EFF K;  1OCZ B;  3IGA C;  3LSS A;  4LF9 B;  3STL C;  5K1X A;  1NH2 B;  4GKK O;  3K5N A;  1BS3 A;  4JI0 B;  1AP5 A;  4DR2 O;  4LF4 B;  1IBL O;  1M57 C;  4BIU A;  3VQW A;  3ETE A;  5K1P A;  2JGD B;  2ZNI A;  4Z1V A;  4JI3 O;  2HR3 A;  4JI6 O;  2N04 A;  2ZR2 A;  4ASU G;  1AR5 A;  1ZX3 A;  2AHZ A;  3VOU A;  4X1Y B;  3RN4 A;  1NVP D;  4LBE C;  2UU9 O;  5JWP A;  2B1G A;  5F2V O;  1EN4 A;  2EIN C;  3WFV A;  2E5L B;  4WFH A;  5JQG B;  1OCO C;  3IAY A;  3CE2 A;  2IJJ A;  1J5E B;  1N34 O;  5JH7 B;  3K0G A;  4O2A B;  1WJZ A;  3VQY A;  1ZTE A;  2HHH B;  4DW0 A;  1K4C C;  4JYA B;  2BTO A;  3RT3 C;  4X65 O;  3NXS A;  1KQS U;  2CTW A;  3N27 A;  2ADP A;  1Z5W A;  1MG1 A;  4KFM A;  4MW8 A;  2IH3 C;  2GUZ A;  3ZRW A;  3LUT B;  1VAR A;  4DXW A;  4TV9 B;  4I55 A;  2DMX A;  1R3K C;  2CH7 B;  3RBZ A;  5BR8 O;  1DF5 A;  3ZJZ A;  2B1I A;  4FLU A;  5DEC A;  2LW1 A;  4B3S O;  4FFB B;  2DYS C;  3STZ C;  5FNV B;  4IYH A;  3ZMS A;  1GN6 A;  4DV2 O;  2JS3 A;  3RYF A;  1QNM A;  2UXN A;  3E83 A;  3T1H O;  2XHB A;  3HKB B;  4DV0 B;  3FAV B;  2OYQ A;  2UXB B;  4JTD B;  5B1B C;  1IZ3 A;  4GZR B;  1HR0 B;  3U0Z A;  1RFY A;  4C7U A;  3K9A A;  4NKG B;  4DRX A;  4JI2 B;  4NXN B;  4U7N A;  4LCU C;  4N21 A;  5CA0 A;  2XAF A;  1YJW V;  3ZED A;  3UQ8 A;  1N33 O;  4WFA V;  1SA0 B;  3CWB H;  1HNX B;  3UO2 A;  2JJ1 G;  4PJ0 Z;  3AG1 C;  2QM8 A;  1HNW B;  2ZXW B;  5ITZ A;  4GX1 A;  3CHX A;  4DUY O;  2VWJ A;  3RYI A;  4GKJ O;  1SQG A;  3BVO A;  3D3Q A;  4DV1 O;  2Q8V A;  2E75 B;  5AG2 A;  2Q67 A;  3OTO O;  2YI9 A;  5EBW C;  3JD1 A;  2QKC A;  4FMT A;  2HLD G;  5JVD B;  2ATK C;  3K79 A;  2YIA A;  4IHJ B;  4LF5 B;  5GON A;  4UB6 Z;  4LF6 O;  3DXR A;  1ZUQ A;  1WA8 B;  4YJ2 B;  3K58 A;  1TUB A;  2CUG A;  3LNN A;  1AR4 A;  4YJ3 A;  2ZIN A;  1HP8 A;  1SRY A;  1CEZ A;  4FIP C;  3FB6 C;  4NXM O;  4IYI A;  5FPO A;  4CS4 A;  4PDV A;  3SDL A;  1AB3 A;  3B77 A;  2H3O A;  2HKO A;  4J9Z B;  2DWD C;  1M4U A;  2K9P A;  1UJW B;  3K06 A;  4RQF A;  3CRC A;  4OX9 B;  4I0X A;  4XDK A;  4P30 A;  5LP6 A;  1XNR O;  1WPX A;  2KG7 A;  2F4V O;  1MAB G;  5B1A B;  3ZHU A;  2BTQ B;  3IFX A;  4UCT A;  5CN0 A;  2YC0 A;  4J7J A;  1P7G A;  3ZRV A;  2DN9 A;  4G27 B;  3JAK B;  4OGQ B;  4X1K A;  1V54 C;  4L87 A;  4LH6 A;  1BZK A;  3QTC A;  3KCX A;  3QVN A;  1WB7 A;  2V1D A;  1PPJ H;  3WB1 A;  1GH6 A;  3MHS C;  3FYE B;  5CBH A;  1VF5 B;  3FYI B;  2VS0 A;  2JJ2 G;  1YI2 V;  4ZIB A;  2JS5 A;  1SET A;  1RPO A;  4LFA B;  2CDY A;  3BA8 A;  4X62 O;  3FB8 C;  4TWK A;  3K03 A;  3E22 A;  3BEH A;  5C93 A;  4UCO A;  2PI5 A;  2VRZ A;  3HKE B;  4QPJ A;  5LA6 B;  3FB5 C;  3AG2 C;  4JPR A;  1YZB A;  2RJZ A;  4JYB A;  5D5P A;  4WFB V;  3BPZ A;  3T1Y O;  3CJH A;  2YI8 A;  3HKC A;  4DR5 O;  4KXR A;  1FXK B;  5TIS Z;  3M7M X;  1GN2 A;  4JI8 O;  3DC6 A;  3KG2 A;  1MSW D;  3ETQ A;  1H2N A;  5B3S C;  1GM9 A;  2X6B A;  3E8B A;  2CTQ A;  2XND G;  1F51 A;  2BOB C;  5KAI Z;  4QPK A;  2IJK A;  4F4L A;  1EN5 A;  3JAR B;  2EIJ B;  5LOV A;  3CSX A;  2W6J G;  3CC2 V;  1JFF A;  3G67 A;  5IYD O;  1OCC B;  2UUB B;  1QVF U;  1E1R G;  5B5E Z;  2LGQ A;  4NVP A;  4CZZ A;  2XAJ A;  2YIC A;  4CC5 A;  4GT1 A;  4GUN A;  5HFL A;  1XNQ O;  5DN6 G;  2P7T C;  4PDR A;  3SYP A;  1VQ6 V;  2UXD B;  2ZNJ A;  1QR8 A;  2R72 A;  4LH7 A;  1H8H G;  1MOF A;  3H1H H;  1WP8 A;  2MW2 B;  5L3B A;  4EFE A;  4X1Y A;  2P5O A;  1F4N A;  5CA1 A;  4JI5 O;  3SPI A;  4X66 B;  1M1K W;  4LF8 B;  5JQG A;  5JJE B;  1JVM A;  3AG7 A;  1M56 C;  4K0K O;  1NT2 B;  3OT7 A;  1NTM H;  4X89 A;  1KC8 W;  1NVP B;  3WG7 C;  1FFX B;  5JH7 A;  2Q69 A;  4O2A A;  3ABK C;  5KUK A;  3E8G A;  5JCO A;  2DYR C;  3C3T A;  2RNB A;  1HWY A;  4MTX A;  3MD0 A;  1O9H A;  2W0F C;  1SQX H;  1R3I C;  4PA4 A;  4TV9 A;  1Q81 W;  2CH7 A;  4LF7 O;  1S76 D;  1X4T A;  4F6R B;  4FFB A;  1ZWI C;  2QR4 A;  2Y0I A;  4JAS A;  5FNV A;  1HNZ B;  3A0H Z;  2WLI B;  3OUF A;  4H13 B;  1EN6 A;  1Y6X A;  3ZS8 C;  3D36 C;  2EZP A;  2ZE5 A;  1PL4 A;  4LF9 O;  2DW4 A;  4TT3 G;  4JI0 O;  4LFC O;  4ZHQ B;  1H38 A;  4LF4 O;  2A3Q A;  5CBF A;  2FML A;  1M57 B;  1Y4M A;  1OCR C;  2QWN B;  4I4T A;  5KHG A;  1VF6 A;  1PM9 A;  3SPJ A;  1QVG U;  2F1M A;  3L73 H;  4I50 B;  2Y48 A;  1HW7 A;  2OCH A;  3ABL C;  3H1K H;  2N74 A;  4QE9 A;  2F43 G;  1AJN A;  2ZIM A;  1NR1 A;  2YIB A;  2EIN B;  4JZ2 A;  5BY1 A;  2E5L O;  2XAG A;  2Q0A A;  1OCO B;  1SA0 A;  2P67 A;  1WB8 A;  4X1I B;  4BWA A;  1J5E O;  4EKW A;  1AIL A;  4X9Q A;  2QKA A;  2LO1 A;  4NB5 A;  4AI8 A;  2YID A;  2HHH O;  1ZSP A;  4JYA O;  1SES A;  2OCC B;  1SQQ H;  4EB6 B;  5KHJ A;  1EZJ A;  2JIZ G;  4NYK A;  1SQF A;  2YEV B;  2ZDI C;  3RW0 A;  4O4I B;  4B3M O;  3J81 N;  5IWA B;  1VQP V;  5J2U B;  5LYJ B;  1OJH A;  3S3X A;  4WBN B;  2PGG A;  2RN9 A;  3TCU A;  4IHJ A;  1JJ2 U;  3I55 V;  1WA8 A;  3G80 A;  5EC2 C;  3GB7 C;  5B1O A;  4FLV A;  4DR7 O;  2HVJ C;  1K73 W;  2D2C B;  2WA3 A;  1JA8 A;  1BL8 A;  4DV5 B;  4R7C A;  4O4J A;  1VIB A;  1URF A;  1XOU A;  3KCY A;  4DV0 O;  2UXB O;  1R3L C;  4IL6 Z;  5IYZ B;  4DR1 B;  1HR0 O;  5B1B B;  2WLN A;  3G4S V;  5LGU A;  2ETN A;  3P30 A;  4J42 A;  3T1C A;  1V55 B;  1VQL V;  3K3W A;  2Q5Z A;  3CXC U;  4JI2 O;  2YS8 A;  4NXN O;  2BOC C;  1WLE A;  4A5U B;  5J9P C;  4WCE V;  1SS3 A;  2CE4 A;  2BTQ A;  3ICX A;  2QKS A;  1SF9 A;  1E79 G;  1HNX O;  2EIM C;  3ZMZ A;  3K59 A;  1Q6H A;  3C3S A;  4GCZ A;  1AI6 A;  2HG5 C;  2P4V A;  2QM4 A;  3JAK A;  2ITC C;  4OPA A;  2XOK G;  1KKD A;  2Q4P A;  4PD4 F;  1R6K A;  4I5S A;  5J2T B;  3AG3 C;  2QJ1 A;  3F5W C;  1CPY A;  2Q7H A;  2EIL C;  4UVA A;  2RMK B;  5EBL C;  5IY5 B;  3CCS V;  4XDJ A;  2QWQ B;  4J80 A;  1M93 A;  2JDI G;  3GVM A;  1I5X A;  1EFR G;  4LF5 O;  4RAI A;  2AGA A;  4K8X A;  4L8J A;  1S5J A;  5BZB A;  2PTM A;  1F4M A;  4YIO A;  1SC5 B;  2ZT9 B;  2NR5 A;  3HKE A;  4AHC A;  3A0B Z;  3K5O A;  5LA6 A;  1I94 B;  4QJF B;  1R73 A;  3JSL A;  4X64 B;  3ASN B;  1G8M A;  3SR2 C;  1Q86 W;  1RPR A;  2GDS A;  1AI4 A;  1AVM A;  1AJQ A;  3DGE A;  2HVK C;  1FXK A;  2V4D A;  4OX9 O;  4O4L B;  2OTJ V;  2QEX V;  3W7U A;  2NNU A;  1GO3 F;  4HBN A;  1I7F A;  4AQY O;  4MVR A;  4ZI7 B;  3R66 A;  4MS2 A;  5C8Y B;  4P9O A;  3ZMV A;  1D5N A;  4JI4 O;  1T5E A;  1U96 A;  4KUM A;  5FL7 G;  2QTO A;  1NQT A;  1V54 B;  3SYO A;  3RWR D;  2ITD C;  5LL6 Y;  3M8A A;  4B08 A;  3K08 A;  3LSU A;  1Q90 D;  3J80 N;  5IYC O;  4PI0 A;  2Q68 A;  1VQ5 V;  3PN1 A;  3K5M A;  4LFA O;  2P4K A;  2ARH A;  4DV4 B;  1XL4 A;  3ZHS A;  1K9M W;  4U3J B;  2R9I A;  4DV7 B;  2YUA A;  5LGN A;  4UB8 Z;  2XAH A;  2DOS A;  4R8C A;  5FLX N;  4IGG A;  2GV9 A;  2XAS A;  1N0J A;  1O9G A;  1UFI A;  3KKY A;  4KL1 A;  3E2E A;  3B8M A;  2Q6A A;  1ZL8 A;  1JQ0 A;  4NTW A;  3FB7 C;  5LP6 C;  4K8Z A;  4JI1 O;  2ZM6 B;  1IX9 A;  1QLE C;  4RUF A;  3QG5 A;  3L9D A;  1PL0 A;  4I9Q A;  3CEI A;  4LWS B;  2GHY A;  2WLI A;  4MVO A;  2MK3 A;  2HP8 A;  2F93 B;  2CK3 G;  3JD4 A;  3CS5 A;  4RQE A;  2UUB O;  1XUQ A;  1BHB A;  5IYB O;  4O2B B;  4ZHQ A;  3ZRX A;  2N05 A;  4DK1 A;  3TJT A;  1GM8 A;  2UXD O;  3BY6 A;  2YXL A;  1YXB A;  4P2Z A;  3ZN1 A;  3JAS B;  2EX3 A;  4PDM A;  1YVW A;  2WLL B;  3FX7 A;  4LP8 A;  4GLX A;  4EEQ A;  4I50 A;  1RM1 C;  3OE7 G;  2P22 C;  4FPP A;  1NBM G;  1X59 A;  4TUY A;  3BA9 A;  4MTF A;  2OWO A;  1Y74 B;  1CXZ B;  3AEI A;  3EVK A;  4X66 O;  1GTO A;  3JCZ A;  4UCV A;  3QO7 A;  2QTS A;  5EYP B;  4LF8 O;  3A2F A;  3U11 A;  4ICG A;  1QLN A;  4DV6 O;  3JAT B;  2OTL V;  3WG7 B;  4DV3 O;  3P3N A;  1JOY A;  1QHT A;  3CRQ A;  1N36 B;  1Q8I A;  4XDL A;  4EB6 A;  4QE7 A;  1FAF A;  2IJI A;  1E1Q G;  1W0K G;  3G71 V;  5L3F A;  4O4I A;  2Y4U A;  1H2L A;  5H6R A;  5LYJ A;  4UVB A;  4WBN A;  3HKD B;  1N0N A;  2ZD9 A;  3VQV A;  5H2F Z;  4MTO A;  1L8D A;  2CGO A;  1VQ4 V;  5KHK A;  2PF4 E;  3ETD A;  1HNZ O;  3AK1 A;  3VBB A;  4Z1M G;  1VQO V;  1OCZ C;  3RGB A;  1ROP A;  4JZG A;  1HDJ A;  3T4D A;  3TXQ A;  1UPG A;  1IBL B;  4BW9 A;  1Q7Y W;  1G1X B;  3ABM B;  5IYZ A;  4TQD A;  1N4C A;  2QE7 G;  4JI3 B;  4DR3 B;  1QBZ A;  1F23 A;  3UT5 B;  3OEH G;  1XRE A;  3QO5 A;  4JF3 A;  2EBO A;  2FTK A; 
#chains in the Genus database with same CATH homology
 3ZS8 C;  5JCO C;  3K5L A;  3JAW A;  4IIJ B;  5EZY A;  4HNA A;  1XI1 A;  4ZHQ B;  4I4T B;  5J2T A;  4TQF A;  3DSQ A;  1N32 B;  5KHG A;  4I4T A;  3HKC B;  1DGS A;  1TA8 A;  3OTF A;  1H2S B;  5LXT A;  2F1M A;  3N2K B;  2HEP A;  4I50 B;  4LF7 B;  1HW7 A;  5D5Q A;  1IBM B;  4CH5 A;  2ZIM A;  1TAE A;  4ZOL B;  2YIB A;  4FLW A;  3SJB C;  2Q0A A;  1YEW A;  1SA0 A;  1M5I A;  5LOV B;  4X1I B;  1Z5V A;  1TGO A;  4BWA A;  5KHH A;  1TVK B;  1JFF B;  4CH4 A;  3CB2 A;  4PI2 A;  1P49 A;  4X1I A;  5KMG B;  4LF9 B;  5K1X A;  3K5N A;  4JI0 B;  4EB6 B;  4UCR A;  5BMV B;  5KHJ A;  2VQE B;  5EIB D;  4LF4 B;  3VQW A;  4FLZ A;  5K1P A;  5KX5 A;  1SQF A;  2ZNI A;  4O4H B;  4O4I B;  5IWA B;  5J2U B;  5LYJ B;  4WBN B;  2PGG A;  4UCU A;  4X1Y B;  4IHJ A;  5J2U A;  5LMN B;  2VWK A;  2E5L B;  5JQG B;  1XMO B;  2KKW A;  4FLV A;  4ZI7 A;  3RYC B;  4YHH B;  5C8Y A;  4O4J B;  5CB4 A;  3IAY A;  4GKJ B;  3QF7 A;  4DV5 B;  1J5E B;  3BRC A;  4FLX A;  4O4J A;  5JH7 B;  4O2A B;  3VQY A;  3JSN A;  2HHH B;  4GKK B;  4D7S A;  4JYA B;  2F66 C;  2BTO A;  4JV5 B;  5IYZ B;  4DR2 B;  4DR1 B;  5IJ0 A;  1Z5W A;  1WN7 A;  2R9A A;  2PYL A;  4JI6 B;  4TV9 B;  4I55 A;  4TV8 B;  3VQX A;  2VQF B;  4FLU A;  4AQY B;  2Q7E A;  2UU9 B;  2RQ6 A;  4LNU A;  4FFB B;  4KHP B;  4B3T B;  4U3J A;  2BTQ A;  3ICX A;  4JI4 B;  5FNV B;  4FM1 A;  1JMK C;  3K59 A;  4NXM B;  3RYF A;  2JGU A;  4CS2 A;  1N34 B;  2QM4 A;  3JAW B;  3JAK A;  5EZY B;  2XHB A;  3HKB B;  4DV0 B;  4HNA B;  2OYQ A;  2YIB D;  2UXB B;  5J2T B;  4X65 B;  3HKB A;  2QJ1 A;  4JI7 B;  2Q7H A;  1HR0 B;  3U0Z A;  5JJN B;  1XNR B;  2CAZ C;  3WB2 A;  5LXT B;  1XHZ A;  1M93 A;  4DRX A;  5CA0 B;  5BR8 B;  4JI2 B;  4NXN B;  4FM0 A;  4FM2 A;  4K8X A;  4L8J A;  5CA0 A;  4B3S B;  2ZIO A;  1S5J A;  3ZED A;  2PTM A;  3UQ8 A;  4X20 A;  4DV2 B;  1SA0 B;  1HNX B;  3HKE A;  4AHC A;  2PY5 A;  3K5O A;  1I94 B;  5LA6 A;  1HNW B;  2IM9 A;  3SGI A;  5ITZ A;  3CHX A;  3T1H B;  2VWJ A;  3JSL A;  4X64 B;  3RYI A;  4O2B A;  1SQG A;  4LR3 A;  1WPB A;  3SR2 C;  3WB0 A;  2PYJ A;  1VF7 A;  5IJ9 A;  2ZCE A;  4JI1 B;  2YI9 A;  5KX5 B;  2V4D A;  5JVD B;  4O4L B;  1ZAU A;  4UFZ A;  2YIA A;  3JAL A;  5JVD A;  4IHJ B;  4O4L A;  4LF5 B;  5GON A;  4HBN A;  2UXC B;  1I7F A;  1TUB B;  3FFQ A;  4YJ2 B;  1XQ8 A;  4ZI7 B;  1N33 B;  3K58 A;  5C8Y B;  1TUB A;  2Q7G A;  3LNN A;  4TOI A;  4YJ3 A;  1WNS A;  5CB4 B;  4YJ2 A;  1T5E A;  3JAT A;  2ZIN A;  4YY3 B;  4DUY B;  4CS4 A;  5FPO A;  4DV1 B;  4CH6 A;  3RWR D;  3OTO B;  4DK0 A;  5IJ0 B;  4GYC B;  4B08 A;  3RYH A;  1M4U A;  4DR4 B;  4D7T A;  4OX9 B;  3HKD A;  4I55 B;  4PI0 A;  2PUS A;  5LP6 A;  1XMQ B;  3PN1 A;  4DR6 B;  3K5M A;  4LNU B;  4DV4 B;  4LF6 B;  3N2G A;  1B04 A;  1JJO A;  4U3J B;  2BTQ B;  1Q5O A;  4B3R B;  4UCT A;  4DV6 B;  4DV3 B;  4DV7 B;  3RYF B;  4X1K B;  1SKV A;  2R70 A;  3JAK B;  3BAA A;  4X1K A;  2GV9 A;  4LH6 A;  3QTC A;  1QQC A;  1O9G A;  2E3C A;  4KL1 A;  2UUC B;  3WB1 A;  3UT5 A;  4FVM A;  5LP6 C;  4K8Z A;  2ZM6 B;  4DRX B;  4ZIB A;  3QG5 A;  4CS3 A;  2JS5 A;  1IBK B;  4I9Q A;  4LFA B;  3SJC C;  1Q3E A;  3BA8 A;  2F4V B;  4X20 B;  3E22 A;  4UCO A;  2PZS A;  2F93 B;  3HKE B;  5LA6 B;  3THO A;  4IIJ A;  5ITZ B;  3B2E E;  3RYI B;  4O2B B;  4FLY A;  2RJZ A;  5D5P A;  3BPZ A;  4ZHQ A;  4DK1 A;  5IJ9 B;  2YI8 A;  3HKC A;  2YXL A;  3JAS B;  2EX3 A;  1XHX A;  3M7M X;  4TUY B;  3N2K A;  3JAS A;  3K57 A;  4EEQ A;  4I50 A;  4GLX A;  4Q6G A;  3ETQ A;  2P22 C;  1KU9 A;  4TUY A;  3BAB A;  3BA9 A;  2OWO A;  3JAL B;  3BHP A;  4ZOL A;  5GON B;  4UCV A;  5EYP B;  4X62 B;  4FLT A;  1RSO A;  3A2F A;  3JAR B;  5LOV A;  5EYP A;  3U11 A;  3CSX A;  4YJ3 B;  1TVK A;  1JFF A;  4EFB A;  3MAQ A;  3JAR A;  3JAT B;  2UUB B;  4LFC B;  5KMG A;  4NVP A;  4CC5 A;  1QHT A;  2F95 B;  1N36 B;  1Q8I A;  4EB6 A;  5BMV A;  3T1Y B;  2UXD B;  2ZNJ A;  4DR5 B;  2R72 A;  3RYH B;  4O4H A;  4LH7 A;  4O4I A;  4DUZ B;  5LYJ A;  5CA1 B;  4WBN A;  4JI8 B;  3HKD B;  4EFE A;  4LFB B;  4X1Y A;  2P5O A;  5LMU B;  4PHZ A;  3VQV A;  5LP6 B;  5CA1 A;  4AIL C;  1L8D A;  4X66 B;  5KHK A;  4LF8 B;  5JQG A;  5KHI A;  3RYC A;  1D5A A;  3N2G B;  5JJE B;  1NT2 B;  4CC6 A;  2UUA B;  3RGB A;  1FFX B;  4CH3 A;  5JH7 A;  4O2A A;  3SJA C;  1IBL B;  4BW9 A;  5JCO A;  1FFX A;  1G6U A;  5IYZ A;  1XNQ B;  4TQD A;  4JI3 B;  4B3M B;  5JJJ B;  4DR3 B;  1O9H A;  3UT5 B;  2JVD A;  1KMI Z;  4TV9 A;  4TV8 A;  1X4T A;  1Q43 A;  1V9P A;  5EIB C;  1FJG B;  4F6R B;  4FFB A;  4JI5 B;  3U10 A;  4DR7 B;  5FPR A;  5FNV A;  3RFR A;  4F6R A;  1HNZ B;  4UCS A;  4K0K B;  3E22 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...