1M93A

1.65 a structure of cleaved viral serpin crma
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
46
structure length
46
Chain Sequence
MDIFREIASSMKGENVFISPPSISSVLTILYYGANGSTAEQLSKYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of viral serpin crmA provides insights into its mechanism of cysteine proteinase inhibition
pubmed rcsb
source organism Cowpox virus
molecule tags Viral protein
molecule keywords Serine proteinase inhibitor 2
total genus 15
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2002-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.580 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1m93A00
1M93A 1JJOA
chains in the Genus database with same CATH superfamily
3BRCA 2WLNA 4P2ZA 1Q5OA 3GWKC 3JARB 1KUQA 4WFEA 2QTOA 3DXRB 2ZR2A 3OUFA 2HFEC 1MMMA 3M8AA 5JCOA 3DSQA 2FMLA 1N32B 1V55B 4DK0A 1NKDA 4Z2WA 4GKJO 5KAIZ 2IJHA 5LGUA 2AZ2A 2Q9LA 1HNWO 2WLLB 2JRIA 4LF4O 5L3DA 1XEQA 2NNUA 3LSSA 3L74H 4GKKO 1ZL8A 2JEXA 1KECA 4R50A 1PM9A 4GT1A 4WFGA 5IY5C 4F6EA 2R72A 5J2UA 1SZXA 2DWEC 2ILMA 2VS0A 4HYOA 3ZMVA 1QVFU 3JCZA 2ZE6A 2B1IA 1Z5WA 4YJ3B 3JASB 4NVPA 2P4KA 1I94O 4MT8A 2CTWA 1J5EB 4UCRA 2C2AA 5L3EA 1CP9A 1Q90D 5JVDB 2ITCC 4ZOLB 2PTMA 1HNZO 2XTAA 3FKSG 5KX5A 4XDKA 1PD3A 2CH7B 3E22B 4LBEC 3JALA 1FFTB 3BY6A 4U7OA 3BA9A 3C3TA 3FB5C 1P7BA 4ZKIA 3CEIA 2ODMA 1G4YB 1ZLZA 4MVUA 2Q0AA 1KKDA 2WWWA 4TV9A 1L0LH 1HR0B 2EX3A 2K1EA 3CXCU 3JCUZ 2DMXA 1QHTA 2LP7A 2DYRB 4DRXA 3I56V 1HNZB 4B3RB 1M57C 2GUZB 1W59A 2R9RB 2KG7A 1G1XB 4MSWC 3N2GB 3ETEA 1JFFB 5H2FZ 3L72H 1W2BU 5B3SC 1F23A 1XBLA 1RM1C 4EB6A 4B3MB 3CPWU 5DM6V 4I5SA 3ZJZA 3RYFB 5BMVB 4D7TA 2IU3A 1Q86W 4HBNA 5IJ9A 1YEWA 4B3RO 1TAEA 4DW0A 3O65A 1WA8A 1NQTA 2E75B 5IE9A 3E35A 3CMAV 2HVJC 2ZINA 4DR1B 3DXRA 2A7WA 4MTOA 1Y76B 3QNEA 1Q8IA 1I5XA 3E89A 5LA6A 1KC8W 5D5QA 2EINB 2ZM6B 1ENVA 5EC2C 4JPRA 5LGTA 2O57A 3JSNA 1JR9A 2Q7EA 3L73H 4DV5O 4IL6Z 1FFXA 1S5JA 3RYCA 3D8CA 2XAHA 1L0NH 2YI9A 4O2AA 5ITZA 4I9WA 1I5YA 1PP9H 2QKCA 1GH6A 1OCRB 3A2FA 3SDLA 1IURA 4XDLA 1I94B 4K8XA 2JGDB 2BTQB 5B1AB 2WA4A 2PI4A 5LOVB 4MW3A 4TWKA 2X6BA 2R70A 1RFYA 5E79Z 3R65A 3CCVV 2VQFB 1R3JC 3CWBH 1Y6XA 2EIJC 5JVDA 1NZ6A 4J9YB 1VEWA 4FK5C 2WLJA 3L9DA 5IYBO 3H1JH 4LF5B 1KYOF 5CMUA 3Q4HB 4JI6O 1TVKB 5KHJA 1HWYA 1MZEA 2OIGA 2JIZG 4I7ZB 3J80N 1CEZA 5CBGA 3LSQA 5BZBA 3K0DA 4YIPA 4JI2B 2CDYA 2FYUH 1M5IA 4X62O 4CS2A 4CS4A 1R3LC 5GTHZ 3CHXA 2WAMA 2BE3A 1AP5A 1GAXA 3H1LH 2RQ6A 2EJ7A 2ZKOA 3ZIAG 3JAKB 4IIJA 1Y74B 3T1CA 4X8AA 5JH7A 5F2VO 1GM7A 4DUYO 2W0FC 2YEVA 4O4HB 4CH6A 3OD4A 2QSAA 1XUQA 1XMOB 1LUWA 3CRAA 3LSUA 2IH1C 2VQFO 2YC0A 3RYFA 1B3QA 2R9IA 4XDJA 2K9PA 4YHHB 1AI5A 4JASA 1XL4A 4WCEV 4U3JB 2WLKA 4PA4A 2DYRC 3SPHA 2LW1A 2IW5A 2Y4UA 3G67A 4EFEA 2PI5A 1Q7YW 1TUBA 5LXTA 2QWPB 1DTOA 1XMOO 5J2TB 4UCTA 3A8TA 1OV9A 1Q43A 3TGUH 2IJIA 3SPJA 5IJ0A 2X6AA 3JAWA 3ZMSA 5B1AC 2ZIOA 3ZEDA 5LP6B 4WFAV 5KHIA 4KUMA 4JI7O 2WLLA 3IGAC 4HNAB 4X1IB 2WA3A 1XNQB 1BQZA 4PA9A 2F1MA 4QIWF 3RFRA 4B3TO 2HVKC 2JDIG 4LF6O 3SR2C 4X64B 1HNXO 1F4NA 4UVAA 1L1FA 4LF5O 1FXKA 2CTPA 2JS3A 1H2KA 3F5TA 5L3GA 2QWOB 3SPIA 1YITV 3WB2A 3Q4HA 4DR7O 1IX9A 5E1AC 3UT5A 2QM8A 1VQKV 4JI2O 1B04A 5EZYB 5L3FA 1WN7A 2GSMB 5JJEB 1R1BA 2WLMA 2YICA 3GWOA 2CH7A 1XNRB 4H37A 1MG1A 4DR5B 3SPGA 2PUSA 1HNXB 1NR1A 1GN3A 3QO7A 2VQEB 2EIKC 4FJCC 5GTIZ 3ICXA 2XAFA 2YDEA 1WJZA 2A3QA 2BOBC 3BFRA 4U7NA 4LF7B 3LDEA 1NH2B 1XL6A 4DR7B 3SYQA 3VQVA 3W7TA 4JI4O 4UFZA 1I7FA 4DV4O 4DW1A 3FAVB 4D7SA 2P7TC 4X1YA 3BA8A 2QTSA 4XBFA 2EBOA 1AVMA 4B08A 2ZE7A 1G6UA 1SZTA 4A5UB 1NH2D 1PPJH 3ZHQA 4YIOA 3K5LA 1X59A 4J80A 1VF6C 4G27B 4OX9O 5IYZA 4H13B 3VQXA 4UCUA 2P22C 4D6TH 2ZCEA 3B77A 2EULA 2QGNA 4DUZB 5KHGA 1QQCA 3HKCA 3IFXA 2NN4A 3D3IA 2EILC 4JI5O 2UXBB 2B5UA 4FFBB 2YEVB 2WLIA 1HR0O 2Z3YA 3LDDA 4K3AA 3ZHRA 4PI2A 1NVPD 4JI0B 4BW9A 3IJ4A 1Y76A 2F43G 2OT5A 1JQ0A 3AG1C 3ZMUA 4PV1B 3OR6C 3UO3A 1E1QG 3BPZA 5EYPA 4EEQA 1YJNV 4B3SO 4I4TA 5JJNB 2X7RB 2IM9A 1XREA 1H2NA 1OCOC 1EZJA 1YSCA 3AG1B 1WLEA 1TGOA 5LMUB 1VMGA 3D36A 3M7MX 1SS3A 1MOFA 2YIBD 4UV8A 1EFRG 1FXKB 1GRJA 4UXNA 4JI0O 2DE0X 1VQPV 1M56C 4IGGA 3OMAB 3P30A 1UJWB 4AHCA 2OTLV 5IWAO 4ASUG 4BW5A 4Q20A 1WA8B 4IHJA 5IJ0B 4DUZO 2DYSB 4YY3O 4X66O 3I5DA 3OMNB 3N2KA 1VF5B 2RN9A 1OCCB 4TV9B 2ZNIA 1P84F 1JPXA 2Q6AA 4LF9B 2HJFC 5LHIA 3CRRA 5JWPA 4DV7O 1M90W 1Q6UA 4X65O 5ITZB 1BS3A 3ZRWB 4DR3B 2LFRA 2X6CA 1V54C 3G80A 2VRZA 1WB7A 5B3SB 5CA3A 5LMNO 1QCEA 1O9HA 3QO5A 3ABUA 3ASOC 1YZBA 3H1HH 3APQA 3CCUV 3H01A 2LW7A 3OTOO 3ZCCA 4OX9B 2ZE5A 4R7CA 1Y74A 4Z1VA 1YIJV 2V1DA 4PA3A 2DJVA 1OHHG 3TETA 3C90A 4LFBO 4MVQA 2ADPA 2B9ZA 4N21A 3RVYA 4PD4F 1IBKB 2OCCC 3SYOA 3CCRV 2LQTA 4X1KB 5DEDA 1VQMV 2KKWA 2QKSA 1PNLA 1GM9A 4DR2O 2EZPA 1DLBA 1KU9A 3S3WA 1HNWB 3CMEV 4X9QA 1WP7A 5KA6A 2CK3G 4RQEA 1QU7A 1HDJA 4J7KA 1FD9A 2UXDB 4JI3B 3RYCB 5FPRA 4KHPO 4X1YB 2JJ1G 1K92A 4P30A 2JK5C 3ETGA 5EYPB 1ORQC 2CTQA 3JAKA 4X20B 2GBOA 3B8NA 4J11A 5LBQA 1K7DA 1BSMA 4Z1MG 1Q3EA 1W0KG 4NYKA 1NBMG 4JYAO 4PA6A 4GYCB 2GV9A 2LFSA 2EIMC 3WU2Z 2PYLA 5LGNA 1IBKO 3JASA 4JTAB 3F7VC 4DV6O 4MTFA 5DN6G 2V4DA 1VQ6V 3B4SA 1K5QA 4UB8Z 4IHJB 4UVBA 3EHBB 2EILB 5LMUO 3T1HB 4FLUA 1SQVH 3NXSA 4AQYB 3SYCA 1TUEB 3P32A 1SQPH 5TISZ 4LF9O 1SRYA 1PL4A 1BT8A 1FS0G 3SGIA 3ABMC 3MHHC 5IYCO 3AG4B 4DV7B 2BCCH 3E8BA 5CB4A 2W6JG 4UCVA 2GDSA 4X65B 4KL1A 3E83A 3BAAA 4DYLA 3QO8A 4TQFA 4HAMA 2F66C 3JAWB 4MVSA 1VQLV 1K5SA 2A79B 1GM8A 1QLEB 1JMKC 3WB1A 3GB7C 4X66B 1S3JA 2QE7G 1LNQA 2RJZA 3KCXA 4BIOA 2W0XA 2FKXA 2YXLA 3SJBC 2LO1A 4UCSA 4DR2B 1RPOA 2BSKA 1IBLO 4YJ3A 4TV8A 4TUYB 4MS2A 2HP8A 4JI1O 2ZR3A 2E74B 4CBCA 4ZIBA 2YIBA 2P5OA 2LJ2A 2Z0AA 1MABG 3CCSV 1IBMB 1K9MW 3QG5A 2IBZH 1ROPA 4E4EA 5KX5B 1Z2GA 1N32O 4WF9V 2PGGA 3K5OA 2HKOA 4R8CA 3RYIB 1JJ2U 3ABKB 3HKEB 1TA8A 3ETQA 4PDMA 5H6QA 1AJNA 3SPCA 4K0KO 4QPKA 1RPRA 4Q6GA 3VQWA 4ZI7A 1IXMA 2QWRB 1KKCA 2FTKA 3JD0A 2GTAA 4I9QA 3CC2V 1AR1B 3K08A 3PN1A 2UXXA 5KUKA 2YUAA 3P3PA 4LF6B 1KMIZ 3FX7A 1FPOA 3ZHTA 4DR1O 1RSOA 2DW4A 2KSDA 4LNUA 1D5AA 3GVMA 5CA0B 4CH3A 1YTFB 2UU9O 1WNSA 4MTXA 1NS1A 4WFHA 1UPGA 1Q6IA 2YS8A 4LR3A 5CN0A 1GN2A 3OFNG 2ITDC 1EN5A 1MNGA 3FYIB 4GX1A 5EC1C 4GCZA 4I4TB 4J7ZA 2E3CA 3RGBA 3HR0A 1VQ7V 1IZ3A 2DYSC 1QNMA 3E8FA 1OCOB 3T1HO 5IYZB 4W4KA 2UUCB 4LWSB 4JZ2A 5IY5B 1BHAA 5EZYA 1SQXH 1H2LA 4JYBA 1BGYH 3I55V 5CBHA 4FFKA 4FVMA 1NVPB 4H33A 1M56B 2XAJA 3T1YO 4QNHB 4LH7A 1AP6A 2QJ1A 3CE2A 3WG7C 1EN6A 2YIDA 2WLIB 4DR4B 1BHBA 1K4CC 1WPBA 2E76B 3H1IH 2IJJA 1R3KC 5GW7A 2UXCO 4RUEA 4YHHO 1A32A 5IT9N 4WFFA 4WFBV 3U0ZA 1M57B 4CC5A 1YVWA 4DV1B 5H5NA 4OXSA 1X4TA 4TUYA 3G6BA 3HKDB 2AW9A 1EN4A 3WG7B 4NXMB 3K9SA 5CA1A 2BTOA 4J9ZB 5JH7B 3D3QA 5B1OA 5JQGA 5EIBD 1OJHA 3FFQA 3TK1A 4DR6B 3UQ8A 3OW2U 1S77D 1GTOA 1K3EA 4LFCB 2M7WA 5KMGA 1FXHA 3DC5A 3ZRSA 5EBLC 4H0LB 3EFFK 1M1KW 1N33O 2VWKA 1AI4A 3JALB 1S76D 1J95A 2XUMA 1VQOV 1BL8A 3OMIB 3EVKA 4L87A 2EIJB 5KAFZ 4BAYA 4JI7B 3N27A 3SYPA 1NTMH 3ZRWA 2X0LA 1RSOB 1WAZA 4LNUB 2HR3A 3C3SA 4IIJB 4WBNB 3FB6C 5KLVH 5LYJA 5FLXN 2F93B 1PKXA 4AI8A 4PJ0Z 3G71V 2DQ3A 1V9PA 2L6LA 2Q4PA 4DR5O 1JFFA 1SESA 3RVZA 1MZFA 4JYCA 3ABLC 4FPPA 1AI7A 3CD6V 3AK3A 5L3CA 4GKKB 3LUTB 1F7YA 1K73W 2OIEA 2G38A 4IYHA 4U3JA 4X1KA 1S72V 4JV5O 2UUAO 1W0JG 4B3TB 3SJAC 1S5LZ 4JGSA 1SQBH 1D2DA 3OE7G 4LFAO 4JAAA 2Q7GA 4KXRA 5AG2A 1H8EG 4UVCA 3ABLB 1E79G 1YJWV 1B06A 1JA8A 4FLVA 2CE4A 1M4UA 1M9NA 4DV2O 1VQ9V 2BOCC 5LP6A 1XNQO 2EINC 4PI0A 2XASA 4JV5B 1B6QA 2RDCA 2YXYA 3DGEA 4LCUC 4X20A 1BE3H 1AR5A 4H44B 2Y0IA 1XNRO 1RM1B 2Q68A 5GONA 4O2AB 1DF4A 2F4VO 2JS5A 2Y4TA 3APOA 2HJDA 1SF9A 3ZMZA 1V54B 1N34B 1BZKA 1IDSA 3AG2C 4F6RB 3FB7C 4RAIA 2BSKB 3M99B 4RUFA 5FNVB 2DN9A 3E86A 4RQFA 3AG3B 5FPOA 2AZ0A 4MVOA 1S0VA 3K03A 4O4JA 5A2QN 1HW7A 2QR4A 4UUJC 5HFMA 4JZGA 4GX0A 1N36O 3E8GA 4GX5A 1N0NA 1GKFA 1WPXA 1XI1A 4LF8O 3RYIA 4B3MO 4I50B 4DO2A 2R9AA 1N0JA 4JI8O 5EIBC 3SJQC 2E5LO 3X2QC 1YCIA 4NXNB 2KG7B 5IWAB 1HP8A 1FXKC 4TQDA 5KHKA 2IH3C 3F7YC 1IVSA 2QEXV 1SA0A 4JI5B 2ZD9A 1JJOA 3K5MA 1R6KA 1DF5A 2GHYA 3IC9A 4O4HA 4QE7A 3JAMN 4J41A 2XAGA 2OWOA 4B3SB 3FYEB 4GX2A 4NR1A 3L71H 2Q73A 2RMKB 3OEHG 2Q8VA 4IT5A 3SJCC 4QGPA 2ZE8A 5LA6B 2AXTZ 1RP3B 3PJSK 1R6NA 4FLXA 3W7XA 4P9PA 1CXZB 3CSXA 4FLYA 4FFBA 2ETNA 1AROP 4R6ZA 4ZBMA 3BCCH 4FMTA 4BIZA 4DV4B 2EJRA 3S3XA 1US6A 2HLDG 2Q7HA 1YTFD 2ATKC 4TT3G 2WLHA 4C7UA 1OCZC 1OCRC 1QR9A 3ZS8C 5IYDO 2KQXA 4U3FH 4I0XB 5L3BA 4FZ0A 3TXQA 3W7SA 1YHQV 4PHZA 3K59A 1XILA 1ZL8B 2OCCB 3K57A 5LP6C 3AG3C 3FD9A 3KG2A 4QJFB 3RT3C 1R6TA 4JTCB 4FIPC 3K04A 3BABA 3RN4A 3HKDA 3STLC 4FZ1A 1TVKA 4UCOA 2NLJC 1Q6HA 3JARA 4X89A 1YXBA 2UXNA 4ZI7B 5JQGB 4OGQB 1FYJA 4DV0O 3CCQV 1VF7A 5B1BC 2JEUA 2WSSG 3ZBHA 1MA1A 2WPDG 4YJ2B 3RBZA 4KHPB 1JVMA 4UV9A 2JJ2G 3OEEG 4HZ3A 2P06A 4MW8A 3STZC 1XHXA 4KFMA 5LL6Y 3T4ZA 5CA0A 3ML0A 1FJGO 4O4LA 4LF4B 4G28B 3OTOB 3ETDA 5KHHA 5KUMA 4CC6A 4JAUA 5H6RA 1AI6A 3OTFA 3AK1A 1P7GA 4JI3O 1URFA 3L70H 3HB3B 1PL0A 1VP7A 4BWAA 4ZOLA 2UUBB 1FAFA 2PYJA 5B66Z 2YIAA 3E22A 1H2GA 1OCCC 1L8DA 1VQNV 4FLWA 3OR7C 4I50A 3OGCC 2QA4V 5LHGA 4KP4A 3VOUA 3ABTA 2ARHA 3CS5A 2XNDG 4MVRA 1GN4A 2H8PC 1IBLB 4MTGA 1GMGA 1AJPA 4RO2A 3CC7V 4GLXA 4DV1O 4LFBB 4DK1A 2Q5ZA 3CCLV 1OCZB 3K3WA 3QTCA 1GN6A 3CP1A 4PDVA 2ZNJA 3IAYA 3HKCB 4L8JA 2OCHA 1T5EA 3K79A 3KZIZ 4RWUA 5EK0A 3MD0A 4DR6O 2Q0OC 2QDOA 1MSWD 5LYJB 2EIKB 4E2LA 2ZM6O 1WP8A 4AILC 1K4DC 1MSDA 4IYIA 1S5HC 2HHHO 1NI8A 5LHHA 4O4IA 1DK1A 2XOKG 3ZN1A 3TJTA 3JATA 2JVDA 2VQEO 3J7AU 1H2MA 5JJJB 3ZHVA 3CCEV 5LOVA 3UT5B 1U97A 3IC7A 5DECA 4JI4B 3LNMB 4DV3O 3FB8C 1JCHA 2L35A 2YI8A 1YI2V 2A06H 3CRQA 5K1PA 1Q82W 3A0RA 1GK9A 3K06A 1VQ4V 4JI1B 1LR1A 2Y69B 5FNVA 3WB0A 1BCCH 4GZRB 4YJ2A 3CJHB 1VIBA 3K58A 3ZRVA 3HKBA 4LH6A 2F23A 4OPHA 2HG5C 1ZWIC 1ZSPA 2HEPA 4W4LA 1NTKH 1K97A 1WB8A 4DUYB 1FXVA 4DV0B 1KP3A 4J42A 4WBNA 4NTXA 4DV3B 2AHZA 1NTZH 3KCYA 2QWQB 1Y67A 3CB2A 1F51A 5GONB 2Q69A 1PNKA 2NR5A 3ASNB 4LFAB 1Y66A 4OPAA 2JGUA 5K1XA 2P6JA 2F95B 4NTWA 3E2EA 1R3IC 2VWJA 3HPLC 1K34A 3UM7A 4QE9A 3HKEA 1YJ9V 2UU9B 3JD3A 3OM3B 4N23A 1SQGA 4K8ZA 3P3NA 1OZ0A 1XQ8A 3T2MA 4GUNA 1UFIA 4P9OA 5FL7G 1G8MA 3O9OA 1YDXA 1AILA 3LNNA 3CC4V 2A0LA 4NXMO 1N36B 3KKYA 2ZDIC 4LWSA 1VQ5V 1PV0A 4B7EA 1AJQA 2RCVA 1NU1H 4YXWG 1N34O 1KB9F 1TUBB 2D3OW 4B7KA 2XHBA 3TXSA 5J2TA 1JOYA 3TCUA 2P67A 3CX5F 2ZQMA 4CZZA 4UB6Z 2MK3A 2ZDIA 4DRXB 4DR4O 2AHYA 5C93A 1O9GA 1R73A 3AG4C 3JSLA 3UCSC 3JYCA 1EM1A 4HNAA 4TSFG 5J2UB 4K0KB 2N74A 1VQ8V 3R66A 5BR8B 1SC5B 1XMQB 1ZAUA 4ZHQA 4LF7O 4EB6B 1N8RW 2E5LB 4ABMA 1THZA 3ZN0A 1LUVA 4LFCO 3ZHUA 2XT9A 3D36C 5CA1B 4O4JB 3OAAG 4DV5B 3MAQA 2PF4E 5KA5A 3A0HZ 5LMNB 5C8YA 1SETA 4NTYA 2Y48A 3UO2A 1COWG 3AG7A 3CJHA 1KP2A 4FM0A 5B1NA 2UXCB 4JAVA 4NB5A 1E1RG 1N4CA 1K8AW 1Z5VA 1XOUA 1D5NA 1P49A 3DC6A 1ZTEA 5A9GA 1VF6A 3MDSA 3ABMB 1F4MA 1N33B 2LGQA 1ZX3A 3JATB 2FB5A 2N04A 4X64O 4O2BA 4K35A 1BQ0A 4DV6B 2RNBA 2GUZA 5BXZA 3NR7A 4PA7A 1GO3F 3CYOA 4TOIA 2UUCO 1NT2B 4QPJA 3W7UA 2QWNB 4JI8B 3VQYA 2QM7A 1XDCA 3OGIB 2EIMB 4O4LB 2UXDO 2JGDA 2DQ0A 3CRCA 3FAVA 1XHZA 4TV8B 3ZMTA 3T1YB 2UUAB 2YXHA 4I55A 2GTSA 4BR6A 3HKBB 1JX9A 4ICGA 1QR8A 5KMGB 2CGNA 3CRMA 2CAZC 4JF3A 3RWRD 2FL4A 3RYHB 1CPYA 3H9VA 3QF7A 5D5PA 1SERA 2A9HA 3B2EE 3UKMA 2Y69C 1SQFA 4JTDB 3RW0A 1K33A 4JYAB 4X88A 4CS3A 3G6EV 3N2GA 3CXHF 1VARA 1I0HA 2M6YA 1QBZA 5B5EZ 3JD4A 1FKAO 2AGAA 4I0XA 1FFXB 3H1KH 1V55C 4CH5A 3AEIA 3THOA 2YSUB 4JI6B 2CTRA 1QLEC 1EZVH 5H9CA 2MW2B 5BR8O 1XMQO 3E8HA 1IXBA 3SYAA 2LGWA 4FM2A 3EXAA 5IJ9B 4NXNO 4X62B 3DTUB 3WFVA 2IU0A 2UUBO 3U10A 1H2SB 4G2KA 4MVZA 4F6RA 4O4IB 5C8YB 1NJIW 4LF8B 2PZSA 5B1BB 2ADQB 1BMFG 5CB4B 2EZOA 3B09A 3BHPA 1AB3A 1DGSA 3CCJV 2H3OA 4DXWA 1IBMO 3JD1A 3N2KB 3T4DA 1AR4A 2P90A 1QLNA 3K5NA 3BVOA 3ASOB 2UXBO 2ZXWB 2F4VB 3MHSC 2Y0PA 1PNMA 1H8HG 1I08A 2H94A 2XAQA 4DV2B 1J5EO 2Q67A 3W7WA 1U96A 3VBBA 4PDLA 1SKVA 1YF2A 2PY5A 4EKWA 1KD1W 1KQSU 2P4VA 2QKAA 2DOSA 1Q81W 4YY3B 2Z5UA 2OYQA 1SA0B 4FM1A 4NKGB 3OT7A 2ZT9B 4I55B 5BY1A 2ZXWC 3G4SV 5EBMC 2CGOA 4PDRA 4MVMA 5CBFA 3QVNA 3J81N 4BIUA 2CUGA 3OUSA 2D2CB 4JYYA 3K9AA 3AK2A 1ZUQA 3CCMV 5HFLA 3B8MA 4FLTA 4CH4A 4DR3O 3A0BZ 2V7QG 5BMVA 3LDCA 3ZRXA 2HHHB 3F5WC 1SQQH 5LXTB 4O2BB 3ASNC 2QM4A 3AG2B 3ZHSA 3ABKC 4PELA 5JCOC 2B1GA 5J9PC 3BEHA 2OTJV 3ZX6A 4AQYO 5EBWC 4EFBA 2IJKA 1P4RA 3L75H 4LP8A 2W6IG 4X1IA 3U11A 1KBHA 3B40A 2N05A 4FLZA 1QVGU 2KB1A 1NR7A 3RYHA 1M93A 2ZIMA 5IDJA 4GKJB 3X2QB 4LC1A 4J7JA 1Y4MA 1FJGB 2DWDC 3K0GA 4J10A 1EBOA 1H38A 4F4LA 3JD2A 4ZHQB 2BTQA
chains in the Genus database with same CATH topology
4UCUA 5KMGA 4JI1B 2P22C 2ZCEA 3BRCA 5FNVA 3WB0A 1Q5OA 2VWKA 3JARB 5KHGA 4DUZB 1QQCA 3HKCA 4YJ2A 3JALB 3K58A 3HKBA 5JCOA 3DSQA 4LH6A 1N32B 4DK0A 2UXBB 4FFBB 2HEPA 4PI2A 4JI0B 4JI7B 4BW9A 4DUYB 4DV0B 4WBNA 4LNUB 4DV3B 4IIJB 4WBNB 3BPZA 5EYPA 5LYJA 4EEQA 3CB2A 4I4TA 2F93B 5JJNB 5GONB 2IM9A 2R72A 5J2UA 1V9PA 4LFAB 1TGOA 1Z5WA 1JFFA 2JGUA 4YJ3B 5LMUB 5K1XA 3JASB 2F95B 3M7MX 4NVPA 2YIBD 2VWJA 4GKKB 1J5EB 4UCRA 3HKEA 5JVDB 2UU9B 4ZOLB 2PTMA 1SQGA 4U3JA 4X1KA 4AHCA 4K8ZA 5KX5A 1XQ8A 3E22B 3JALA 4IHJA 3BA9A 4B3TB 5IJ0B 3SJAC 3LNNA 1N36B 3N2KA 4TV9B 2ZNIA 2Q0AA 2Q7GA 4TV9A 1HR0B 1TUBB 4LF9B 2EX3A 2XHBA 4FLVA 1M4UA 5J2TA 5LP6A 1QHTA 4PI0A 5ITZB 4DRXA 4DR3B 1HNZB 4JV5B 4B3RB 4X20A 4DRXB 3N2GB 1JFFB 1O9GA 1O9HA 5GONA 4O2AB 3JSLA 2JS5A 4HNAA 5J2UB 4K0KB 4EB6A 5BR8B 1XMQB 1N34B 4F6RB 1ZAUA 4B3MB 4ZHQA 4OX9B 4EB6B 2E5LB 5FNVB 3RYFB 5BMVB 5CA1B 4D7TA 5FPOA 4O4JB 4HBNA 4DV5B 5IJ9A 3MAQA 1IBKB 1YEWA 1TAEA 4O4JA 5LMNB 5C8YA 1HW7A 4X1KB 2KKWA 1XI1A 2ZINA 4DR1B 4FM0A 1KU9A 3RYIA 2UXCB 1HNWB 4I50B 1Q8IA 2R9AA 5LA6A 5D5QA 1Z5VA 2ZM6B 1P49A 3JSNA 5EIBC 2Q7EA 2UXDB 4NXNB 4JI3B 3RYCB 5FPRA 4X1YB 1FFXA 5IWAB 1S5JA 3RYCA 1N33B 3JATB 2YI9A 4O2AA 5EYPB 4TQDA 5ITZA 5KHKA 3JAKA 4O2BA 4DV6B 4X20B 1SA0A 4TOIA 3A2FA 4JI5B 1NT2B 1I94B 4K8XA 1JJOA 4JI8B 3VQYA 2BTQB 4O4LB 1Q3EA 5LOVB 3K5MA 1XHZA 4O4HA 4TV8B 2R70A 3T1YB 4GYCB 2GV9A 2UUAB 2VQFB 2PYLA 2OWOA 4B3SB 5JVDA 4I55A 3HKBB 3JASA 5KMGB 2CAZC 3RWRD 2V4DA 4LF5B 4IHJB 3SJCC 1TVKB 5KHJA 4FLUA 3T1HB 3RYHB 5LA6B 4AQYB 3QF7A 5D5PA 3B2EE 4FLXA 3CSXA 3SGIA 1SQFA 4JI2B 4FLYA 4FFBA 4JYAB 4DV7B 4CS3A 1M5IA 5CB4A 4UCVA 4CS2A 4CS4A 4DV4B 4X65B 4KL1A 3BAAA 3N2GA 4TQFA 2F66C 2Q7HA 3JAWB 3CHXA 3ZS8C 3WB1A 4X66B 1JMKC 1FFXB 2RQ6A 2RJZA 4CH5A 3THOA 2YXLA 4JI6B 3SJBC 4UCSA 4DR2B 4PHZA 3K59A 3JAKB 4IIJA 5JH7A 3K57A 4YJ3A 4O4HB 4TV8A 4CH6A 4TUYB 5LP6C 4FM2A 1XMOB 4ZIBA 5IJ9B 3BABA 2YIBA 2P5OA 4X62B 1IBMB 3RYFA 3QG5A 3U10A 3HKDA 5KX5B 1TVKA 1H2SB 2PGGA 4UCOA 3K5OA 4F6RA 4O4IB 3RYIB 3JARA 5C8YB 3HKEB 1TA8A 3ETQA 4YHHB 4LF8B 2PZSA 4ZI7B 4U3JB 5JQGB 5CB4B 4Q6GA 3VQWA 1VF7A 4ZI7A 3BHPA 4EFEA 1TUBA 5LXTA 4I9QA 4YJ2B 1DGSA 4KHPB 5J2TB 3PN1A 4UCTA 3N2KB 4LF6B 1KMIZ 1Q43A 1XHXA 3K5NA 5IJ0A 3JAWA 2F4VB 1RSOA 5CA0A 2ZIOA 4LNUA 3ZEDA 1D5AA 5LP6B 5KHIA 4O4LA 4LF4B 3OTOB 5CA0B 5KHHA 4CH3A 4DV2B 4HNAB 4X1IB 4CC6A 1WNSA 1XNQB 1SKVA 3OTFA 4LR3A 2PY5A 2F1MA 3RFRA 4YY3B 2OYQA 4BWAA 4ZOLA 1SA0B 4I4TB 4FM1A 2UUBB 2PYJA 3SR2C 4X64B 2E3CA 3RGBA 2YIAA 3E22A 1L8DA 4I55B 4FLWA 4I50A 5IYZB 2UUCB 3WB2A 5EZYA 3UT5A 1IBLB 1B04A 5EZYB 4GLXA 4LFBB 4DK1A 4FVMA 4FLTA 1WN7A 5JJEB 4CH4A 4LH7A 5BMVA 2QJ1A 3QTCA 2HHHB 5LXTB 4O2BB 2QM4A 1XNRB 4DR4B 5JCOC 2ZNJA 3IAYA 4DR5B 3HKCB 4L8JA 2PUSA 1HNXB 1T5EA 2VQEB 1WPBA 3ICXA 4LF7B 5LYJB 4EFBA 3U0ZA 4DR7B 3VQVA 4CC5A 4UFZA 1I7FA 4AILC 4DV1B 1X4TA 4TUYA 4X1IA 3HKDB 3U11A 4D7SA 4X1YA 3BA8A 4NXMB 4O4IA 5CA1A 4FLZA 3JATA 2BTOA 4B08A 1G6UA 2JVDA 3RYHA 1M93A 2ZIMA 5JH7B 5JJJB 4GKJB 5LOVA 3K5LA 5JQGA 5EIBD 3FFQA 3UT5B 1FJGB 4DR6B 4JI4B 2YI8A 5IYZA 5K1PA 4ZHQB 3UQ8A 2BTQA 4LFCB 3VQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M93 A;  1JJO A; 
#chains in the Genus database with same CATH topology
 3BRC A;  2WLN A;  4P2Z A;  1Q5O A;  3GWK C;  3JAR B;  1KUQ A;  4WFE A;  2QTO A;  3DXR B;  2ZR2 A;  3OUF A;  2HFE C;  1MMM A;  3M8A A;  5JCO A;  3DSQ A;  2FML A;  1N32 B;  1V55 B;  4DK0 A;  1NKD A;  4Z2W A;  4GKJ O;  5KAI Z;  2IJH A;  5LGU A;  2AZ2 A;  2Q9L A;  1HNW O;  2WLL B;  2JRI A;  4LF4 O;  5L3D A;  1XEQ A;  2NNU A;  3LSS A;  3L74 H;  4GKK O;  1ZL8 A;  2JEX A;  1KEC A;  4R50 A;  1PM9 A;  4GT1 A;  4WFG A;  5IY5 C;  4F6E A;  2R72 A;  5J2U A;  1SZX A;  2DWE C;  2ILM A;  2VS0 A;  4HYO A;  3ZMV A;  1QVF U;  3JCZ A;  2ZE6 A;  2B1I A;  1Z5W A;  4YJ3 B;  3JAS B;  4NVP A;  2P4K A;  1I94 O;  4MT8 A;  2CTW A;  1J5E B;  4UCR A;  2C2A A;  5L3E A;  1CP9 A;  1Q90 D;  5JVD B;  2ITC C;  4ZOL B;  2PTM A;  1HNZ O;  2XTA A;  3FKS G;  5KX5 A;  4XDK A;  1PD3 A;  2CH7 B;  3E22 B;  4LBE C;  3JAL A;  1FFT B;  3BY6 A;  4U7O A;  3BA9 A;  3C3T A;  3FB5 C;  1P7B A;  4ZKI A;  3CEI A;  2ODM A;  1G4Y B;  1ZLZ A;  4MVU A;  2Q0A A;  1KKD A;  2WWW A;  4TV9 A;  1L0L H;  1HR0 B;  2EX3 A;  2K1E A;  3CXC U;  3JCU Z;  2DMX A;  1QHT A;  2LP7 A;  2DYR B;  4DRX A;  3I56 V;  1HNZ B;  4B3R B;  1M57 C;  2GUZ B;  1W59 A;  2R9R B;  2KG7 A;  1G1X B;  4MSW C;  3N2G B;  3ETE A;  1JFF B;  5H2F Z;  3L72 H;  1W2B U;  5B3S C;  1F23 A;  1XBL A;  1RM1 C;  4EB6 A;  4B3M B;  3CPW U;  5DM6 V;  4I5S A;  3ZJZ A;  3RYF B;  5BMV B;  4D7T A;  2IU3 A;  1Q86 W;  4HBN A;  5IJ9 A;  1YEW A;  4B3R O;  1TAE A;  4DW0 A;  3O65 A;  1WA8 A;  1NQT A;  2E75 B;  5IE9 A;  3E35 A;  3CMA V;  2HVJ C;  2ZIN A;  4DR1 B;  3DXR A;  2A7W A;  4MTO A;  1Y76 B;  3QNE A;  1Q8I A;  1I5X A;  3E89 A;  5LA6 A;  1KC8 W;  5D5Q A;  2EIN B;  2ZM6 B;  1ENV A;  5EC2 C;  4JPR A;  5LGT A;  2O57 A;  3JSN A;  1JR9 A;  2Q7E A;  3L73 H;  4DV5 O;  4IL6 Z;  1FFX A;  1S5J A;  3RYC A;  3D8C A;  2XAH A;  1L0N H;  2YI9 A;  4O2A A;  5ITZ A;  4I9W A;  1I5Y A;  1PP9 H;  2QKC A;  1GH6 A;  1OCR B;  3A2F A;  3SDL A;  1IUR A;  4XDL A;  1I94 B;  4K8X A;  2JGD B;  2BTQ B;  5B1A B;  2WA4 A;  2PI4 A;  5LOV B;  4MW3 A;  4TWK A;  2X6B A;  2R70 A;  1RFY A;  5E79 Z;  3R65 A;  3CCV V;  2VQF B;  1R3J C;  3CWB H;  1Y6X A;  2EIJ C;  5JVD A;  1NZ6 A;  4J9Y B;  1VEW A;  4FK5 C;  2WLJ A;  3L9D A;  5IYB O;  3H1J H;  4LF5 B;  1KYO F;  5CMU A;  3Q4H B;  4JI6 O;  1TVK B;  5KHJ A;  1HWY A;  1MZE A;  2OIG A;  2JIZ G;  4I7Z B;  3J80 N;  1CEZ A;  5CBG A;  3LSQ A;  5BZB A;  3K0D A;  4YIP A;  4JI2 B;  2CDY A;  2FYU H;  1M5I A;  4X62 O;  4CS2 A;  4CS4 A;  1R3L C;  5GTH Z;  3CHX A;  2WAM A;  2BE3 A;  1AP5 A;  1GAX A;  3H1L H;  2RQ6 A;  2EJ7 A;  2ZKO A;  3ZIA G;  3JAK B;  4IIJ A;  1Y74 B;  3T1C A;  4X8A A;  5JH7 A;  5F2V O;  1GM7 A;  4DUY O;  2W0F C;  2YEV A;  4O4H B;  4CH6 A;  3OD4 A;  2QSA A;  1XUQ A;  1XMO B;  1LUW A;  3CRA A;  3LSU A;  2IH1 C;  2VQF O;  2YC0 A;  3RYF A;  1B3Q A;  2R9I A;  4XDJ A;  2K9P A;  4YHH B;  1AI5 A;  4JAS A;  1XL4 A;  4WCE V;  4U3J B;  2WLK A;  4PA4 A;  2DYR C;  3SPH A;  2LW1 A;  2IW5 A;  2Y4U A;  3G67 A;  4EFE A;  2PI5 A;  1Q7Y W;  1TUB A;  5LXT A;  2QWP B;  1DTO A;  1XMO O;  5J2T B;  4UCT A;  3A8T A;  1OV9 A;  1Q43 A;  3TGU H;  2IJI A;  3SPJ A;  5IJ0 A;  2X6A A;  3JAW A;  3ZMS A;  5B1A C;  2ZIO A;  3ZED A;  5LP6 B;  4WFA V;  5KHI A;  4KUM A;  4JI7 O;  2WLL A;  3IGA C;  4HNA B;  4X1I B;  2WA3 A;  1XNQ B;  1BQZ A;  4PA9 A;  2F1M A;  4QIW F;  3RFR A;  4B3T O;  2HVK C;  2JDI G;  4LF6 O;  3SR2 C;  4X64 B;  1HNX O;  1F4N A;  4UVA A;  1L1F A;  4LF5 O;  1FXK A;  2CTP A;  2JS3 A;  1H2K A;  3F5T A;  5L3G A;  2QWO B;  3SPI A;  1YIT V;  3WB2 A;  3Q4H A;  4DR7 O;  1IX9 A;  5E1A C;  3UT5 A;  2QM8 A;  1VQK V;  4JI2 O;  1B04 A;  5EZY B;  5L3F A;  1WN7 A;  2GSM B;  5JJE B;  1R1B A;  2WLM A;  2YIC A;  3GWO A;  2CH7 A;  1XNR B;  4H37 A;  1MG1 A;  4DR5 B;  3SPG A;  2PUS A;  1HNX B;  1NR1 A;  1GN3 A;  3QO7 A;  2VQE B;  2EIK C;  4FJC C;  5GTI Z;  3ICX A;  2XAF A;  2YDE A;  1WJZ A;  2A3Q A;  2BOB C;  3BFR A;  4U7N A;  4LF7 B;  3LDE A;  1NH2 B;  1XL6 A;  4DR7 B;  3SYQ A;  3VQV A;  3W7T A;  4JI4 O;  4UFZ A;  1I7F A;  4DV4 O;  4DW1 A;  3FAV B;  4D7S A;  2P7T C;  4X1Y A;  3BA8 A;  2QTS A;  4XBF A;  2EBO A;  1AVM A;  4B08 A;  2ZE7 A;  1G6U A;  1SZT A;  4A5U B;  1NH2 D;  1PPJ H;  3ZHQ A;  4YIO A;  3K5L A;  1X59 A;  4J80 A;  1VF6 C;  4G27 B;  4OX9 O;  5IYZ A;  4H13 B;  3VQX A;  4UCU A;  2P22 C;  4D6T H;  2ZCE A;  3B77 A;  2EUL A;  2QGN A;  4DUZ B;  5KHG A;  1QQC A;  3HKC A;  3IFX A;  2NN4 A;  3D3I A;  2EIL C;  4JI5 O;  2UXB B;  2B5U A;  4FFB B;  2YEV B;  2WLI A;  1HR0 O;  2Z3Y A;  3LDD A;  4K3A A;  3ZHR A;  4PI2 A;  1NVP D;  4JI0 B;  4BW9 A;  3IJ4 A;  1Y76 A;  2F43 G;  2OT5 A;  1JQ0 A;  3AG1 C;  3ZMU A;  4PV1 B;  3OR6 C;  3UO3 A;  1E1Q G;  3BPZ A;  5EYP A;  4EEQ A;  1YJN V;  4B3S O;  4I4T A;  5JJN B;  2X7R B;  2IM9 A;  1XRE A;  1H2N A;  1OCO C;  1EZJ A;  1YSC A;  3AG1 B;  1WLE A;  1TGO A;  5LMU B;  1VMG A;  3D36 A;  3M7M X;  1SS3 A;  1MOF A;  2YIB D;  4UV8 A;  1EFR G;  1FXK B;  1GRJ A;  4UXN A;  4JI0 O;  2DE0 X;  1VQP V;  1M56 C;  4IGG A;  3OMA B;  3P30 A;  1UJW B;  4AHC A;  2OTL V;  5IWA O;  4ASU G;  4BW5 A;  4Q20 A;  1WA8 B;  4IHJ A;  5IJ0 B;  4DUZ O;  2DYS B;  4YY3 O;  4X66 O;  3I5D A;  3OMN B;  3N2K A;  1VF5 B;  2RN9 A;  1OCC B;  4TV9 B;  2ZNI A;  1P84 F;  1JPX A;  2Q6A A;  4LF9 B;  2HJF C;  5LHI A;  3CRR A;  5JWP A;  4DV7 O;  1M90 W;  1Q6U A;  4X65 O;  5ITZ B;  1BS3 A;  3ZRW B;  4DR3 B;  2LFR A;  2X6C A;  1V54 C;  3G80 A;  2VRZ A;  1WB7 A;  5B3S B;  5CA3 A;  5LMN O;  1QCE A;  1O9H A;  3QO5 A;  3ABU A;  3ASO C;  1YZB A;  3H1H H;  3APQ A;  3CCU V;  3H01 A;  2LW7 A;  3OTO O;  3ZCC A;  4OX9 B;  2ZE5 A;  4R7C A;  1Y74 A;  4Z1V A;  1YIJ V;  2V1D A;  4PA3 A;  2DJV A;  1OHH G;  3TET A;  3C90 A;  4LFB O;  4MVQ A;  2ADP A;  2B9Z A;  4N21 A;  3RVY A;  4PD4 F;  1IBK B;  2OCC C;  3SYO A;  3CCR V;  2LQT A;  4X1K B;  5DED A;  1VQM V;  2KKW A;  2QKS A;  1PNL A;  1GM9 A;  4DR2 O;  2EZP A;  1DLB A;  1KU9 A;  3S3W A;  1HNW B;  3CME V;  4X9Q A;  1WP7 A;  5KA6 A;  2CK3 G;  4RQE A;  1QU7 A;  1HDJ A;  4J7K A;  1FD9 A;  2UXD B;  4JI3 B;  3RYC B;  5FPR A;  4KHP O;  4X1Y B;  2JJ1 G;  1K92 A;  4P30 A;  2JK5 C;  3ETG A;  5EYP B;  1ORQ C;  2CTQ A;  3JAK A;  4X20 B;  2GBO A;  3B8N A;  4J11 A;  5LBQ A;  1K7D A;  1BSM A;  4Z1M G;  1Q3E A;  1W0K G;  4NYK A;  1NBM G;  4JYA O;  4PA6 A;  4GYC B;  2GV9 A;  2LFS A;  2EIM C;  3WU2 Z;  2PYL A;  5LGN A;  1IBK O;  3JAS A;  4JTA B;  3F7V C;  4DV6 O;  4MTF A;  5DN6 G;  2V4D A;  1VQ6 V;  3B4S A;  1K5Q A;  4UB8 Z;  4IHJ B;  4UVB A;  3EHB B;  2EIL B;  5LMU O;  3T1H B;  4FLU A;  1SQV H;  3NXS A;  4AQY B;  3SYC A;  1TUE B;  3P32 A;  1SQP H;  5TIS Z;  4LF9 O;  1SRY A;  1PL4 A;  1BT8 A;  1FS0 G;  3SGI A;  3ABM C;  3MHH C;  5IYC O;  3AG4 B;  4DV7 B;  2BCC H;  3E8B A;  5CB4 A;  2W6J G;  4UCV A;  2GDS A;  4X65 B;  4KL1 A;  3E83 A;  3BAA A;  4DYL A;  3QO8 A;  4TQF A;  4HAM A;  2F66 C;  3JAW B;  4MVS A;  1VQL V;  1K5S A;  2A79 B;  1GM8 A;  1QLE B;  1JMK C;  3WB1 A;  3GB7 C;  4X66 B;  1S3J A;  2QE7 G;  1LNQ A;  2RJZ A;  3KCX A;  4BIO A;  2W0X A;  2FKX A;  2YXL A;  3SJB C;  2LO1 A;  4UCS A;  4DR2 B;  1RPO A;  2BSK A;  1IBL O;  4YJ3 A;  4TV8 A;  4TUY B;  4MS2 A;  2HP8 A;  4JI1 O;  2ZR3 A;  2E74 B;  4CBC A;  4ZIB A;  2YIB A;  2P5O A;  2LJ2 A;  2Z0A A;  1MAB G;  3CCS V;  1IBM B;  1K9M W;  3QG5 A;  2IBZ H;  1ROP A;  4E4E A;  5KX5 B;  1Z2G A;  1N32 O;  4WF9 V;  2PGG A;  3K5O A;  2HKO A;  4R8C A;  3RYI B;  1JJ2 U;  3ABK B;  3HKE B;  1TA8 A;  3ETQ A;  4PDM A;  5H6Q A;  1AJN A;  3SPC A;  4K0K O;  4QPK A;  1RPR A;  4Q6G A;  3VQW A;  4ZI7 A;  1IXM A;  2QWR B;  1KKC A;  2FTK A;  3JD0 A;  2GTA A;  4I9Q A;  3CC2 V;  1AR1 B;  3K08 A;  3PN1 A;  2UXX A;  5KUK A;  2YUA A;  3P3P A;  4LF6 B;  1KMI Z;  3FX7 A;  1FPO A;  3ZHT A;  4DR1 O;  1RSO A;  2DW4 A;  2KSD A;  4LNU A;  1D5A A;  3GVM A;  5CA0 B;  4CH3 A;  1YTF B;  2UU9 O;  1WNS A;  4MTX A;  1NS1 A;  4WFH A;  1UPG A;  1Q6I A;  2YS8 A;  4LR3 A;  5CN0 A;  1GN2 A;  3OFN G;  2ITD C;  1EN5 A;  1MNG A;  3FYI B;  4GX1 A;  5EC1 C;  4GCZ A;  4I4T B;  4J7Z A;  2E3C A;  3RGB A;  3HR0 A;  1VQ7 V;  1IZ3 A;  2DYS C;  1QNM A;  3E8F A;  1OCO B;  3T1H O;  5IYZ B;  4W4K A;  2UUC B;  4LWS B;  4JZ2 A;  5IY5 B;  1BHA A;  5EZY A;  1SQX H;  1H2L A;  4JYB A;  1BGY H;  3I55 V;  5CBH A;  4FFK A;  4FVM A;  1NVP B;  4H33 A;  1M56 B;  2XAJ A;  3T1Y O;  4QNH B;  4LH7 A;  1AP6 A;  2QJ1 A;  3CE2 A;  3WG7 C;  1EN6 A;  2YID A;  2WLI B;  4DR4 B;  1BHB A;  1K4C C;  1WPB A;  2E76 B;  3H1I H;  2IJJ A;  1R3K C;  5GW7 A;  2UXC O;  4RUE A;  4YHH O;  1A32 A;  5IT9 N;  4WFF A;  4WFB V;  3U0Z A;  1M57 B;  4CC5 A;  1YVW A;  4DV1 B;  5H5N A;  4OXS A;  1X4T A;  4TUY A;  3G6B A;  3HKD B;  2AW9 A;  1EN4 A;  3WG7 B;  4NXM B;  3K9S A;  5CA1 A;  2BTO A;  4J9Z B;  5JH7 B;  3D3Q A;  5B1O A;  5JQG A;  5EIB D;  1OJH A;  3FFQ A;  3TK1 A;  4DR6 B;  3UQ8 A;  3OW2 U;  1S77 D;  1GTO A;  1K3E A;  4LFC B;  2M7W A;  5KMG A;  1FXH A;  3DC5 A;  3ZRS A;  5EBL C;  4H0L B;  3EFF K;  1M1K W;  1N33 O;  2VWK A;  1AI4 A;  3JAL B;  1S76 D;  1J95 A;  2XUM A;  1VQO V;  1BL8 A;  3OMI B;  3EVK A;  4L87 A;  2EIJ B;  5KAF Z;  4BAY A;  4JI7 B;  3N27 A;  3SYP A;  1NTM H;  3ZRW A;  2X0L A;  1RSO B;  1WAZ A;  4LNU B;  2HR3 A;  3C3S A;  4IIJ B;  4WBN B;  3FB6 C;  5KLV H;  5LYJ A;  5FLX N;  2F93 B;  1PKX A;  4AI8 A;  4PJ0 Z;  3G71 V;  2DQ3 A;  1V9P A;  2L6L A;  2Q4P A;  4DR5 O;  1JFF A;  1SES A;  3RVZ A;  1MZF A;  4JYC A;  3ABL C;  4FPP A;  1AI7 A;  3CD6 V;  3AK3 A;  5L3C A;  4GKK B;  3LUT B;  1F7Y A;  1K73 W;  2OIE A;  2G38 A;  4IYH A;  4U3J A;  4X1K A;  1S72 V;  4JV5 O;  2UUA O;  1W0J G;  4B3T B;  3SJA C;  1S5L Z;  4JGS A;  1SQB H;  1D2D A;  3OE7 G;  4LFA O;  4JAA A;  2Q7G A;  4KXR A;  5AG2 A;  1H8E G;  4UVC A;  3ABL B;  1E79 G;  1YJW V;  1B06 A;  1JA8 A;  4FLV A;  2CE4 A;  1M4U A;  1M9N A;  4DV2 O;  1VQ9 V;  2BOC C;  5LP6 A;  1XNQ O;  2EIN C;  4PI0 A;  2XAS A;  4JV5 B;  1B6Q A;  2RDC A;  2YXY A;  3DGE A;  4LCU C;  4X20 A;  1BE3 H;  1AR5 A;  4H44 B;  2Y0I A;  1XNR O;  1RM1 B;  2Q68 A;  5GON A;  4O2A B;  1DF4 A;  2F4V O;  2JS5 A;  2Y4T A;  3APO A;  2HJD A;  1SF9 A;  3ZMZ A;  1V54 B;  1N34 B;  1BZK A;  1IDS A;  3AG2 C;  4F6R B;  3FB7 C;  4RAI A;  2BSK B;  3M99 B;  4RUF A;  5FNV B;  2DN9 A;  3E86 A;  4RQF A;  3AG3 B;  5FPO A;  2AZ0 A;  4MVO A;  1S0V A;  3K03 A;  4O4J A;  5A2Q N;  1HW7 A;  2QR4 A;  4UUJ C;  5HFM A;  4JZG A;  4GX0 A;  1N36 O;  3E8G A;  4GX5 A;  1N0N A;  1GKF A;  1WPX A;  1XI1 A;  4LF8 O;  3RYI A;  4B3M O;  4I50 B;  4DO2 A;  2R9A A;  1N0J A;  4JI8 O;  5EIB C;  3SJQ C;  2E5L O;  3X2Q C;  1YCI A;  4NXN B;  2KG7 B;  5IWA B;  1HP8 A;  1FXK C;  4TQD A;  5KHK A;  2IH3 C;  3F7Y C;  1IVS A;  2QEX V;  1SA0 A;  4JI5 B;  2ZD9 A;  1JJO A;  3K5M A;  1R6K A;  1DF5 A;  2GHY A;  3IC9 A;  4O4H A;  4QE7 A;  3JAM N;  4J41 A;  2XAG A;  2OWO A;  4B3S B;  3FYE B;  4GX2 A;  4NR1 A;  3L71 H;  2Q73 A;  2RMK B;  3OEH G;  2Q8V A;  4IT5 A;  3SJC C;  4QGP A;  2ZE8 A;  5LA6 B;  2AXT Z;  1RP3 B;  3PJS K;  1R6N A;  4FLX A;  3W7X A;  4P9P A;  1CXZ B;  3CSX A;  4FLY A;  4FFB A;  2ETN A;  1ARO P;  4R6Z A;  4ZBM A;  3BCC H;  4FMT A;  4BIZ A;  4DV4 B;  2EJR A;  3S3X A;  1US6 A;  2HLD G;  2Q7H A;  1YTF D;  2ATK C;  4TT3 G;  2WLH A;  4C7U A;  1OCZ C;  1OCR C;  1QR9 A;  3ZS8 C;  5IYD O;  2KQX A;  4U3F H;  4I0X B;  5L3B A;  4FZ0 A;  3TXQ A;  3W7S A;  1YHQ V;  4PHZ A;  3K59 A;  1XIL A;  1ZL8 B;  2OCC B;  3K57 A;  5LP6 C;  3AG3 C;  3FD9 A;  3KG2 A;  4QJF B;  3RT3 C;  1R6T A;  4JTC B;  4FIP C;  3K04 A;  3BAB A;  3RN4 A;  3HKD A;  3STL C;  4FZ1 A;  1TVK A;  4UCO A;  2NLJ C;  1Q6H A;  3JAR A;  4X89 A;  1YXB A;  2UXN A;  4ZI7 B;  5JQG B;  4OGQ B;  1FYJ A;  4DV0 O;  3CCQ V;  1VF7 A;  5B1B C;  2JEU A;  2WSS G;  3ZBH A;  1MA1 A;  2WPD G;  4YJ2 B;  3RBZ A;  4KHP B;  1JVM A;  4UV9 A;  2JJ2 G;  3OEE G;  4HZ3 A;  2P06 A;  4MW8 A;  3STZ C;  1XHX A;  4KFM A;  5LL6 Y;  3T4Z A;  5CA0 A;  3ML0 A;  1FJG O;  4O4L A;  4LF4 B;  4G28 B;  3OTO B;  3ETD A;  5KHH A;  5KUM A;  4CC6 A;  4JAU A;  5H6R A;  1AI6 A;  3OTF A;  3AK1 A;  1P7G A;  4JI3 O;  1URF A;  3L70 H;  3HB3 B;  1PL0 A;  1VP7 A;  4BWA A;  4ZOL A;  2UUB B;  1FAF A;  2PYJ A;  5B66 Z;  2YIA A;  3E22 A;  1H2G A;  1OCC C;  1L8D A;  1VQN V;  4FLW A;  3OR7 C;  4I50 A;  3OGC C;  2QA4 V;  5LHG A;  4KP4 A;  3VOU A;  3ABT A;  2ARH A;  3CS5 A;  2XND G;  4MVR A;  1GN4 A;  2H8P C;  1IBL B;  4MTG A;  1GMG A;  1AJP A;  4RO2 A;  3CC7 V;  4GLX A;  4DV1 O;  4LFB B;  4DK1 A;  2Q5Z A;  3CCL V;  1OCZ B;  3K3W A;  3QTC A;  1GN6 A;  3CP1 A;  4PDV A;  2ZNJ A;  3IAY A;  3HKC B;  4L8J A;  2OCH A;  1T5E A;  3K79 A;  3KZI Z;  4RWU A;  5EK0 A;  3MD0 A;  4DR6 O;  2Q0O C;  2QDO A;  1MSW D;  5LYJ B;  2EIK B;  4E2L A;  2ZM6 O;  1WP8 A;  4AIL C;  1K4D C;  1MSD A;  4IYI A;  1S5H C;  2HHH O;  1NI8 A;  5LHH A;  4O4I A;  1DK1 A;  2XOK G;  3ZN1 A;  3TJT A;  3JAT A;  2JVD A;  2VQE O;  3J7A U;  1H2M A;  5JJJ B;  3ZHV A;  3CCE V;  5LOV A;  3UT5 B;  1U97 A;  3IC7 A;  5DEC A;  4JI4 B;  3LNM B;  4DV3 O;  3FB8 C;  1JCH A;  2L35 A;  2YI8 A;  1YI2 V;  2A06 H;  3CRQ A;  5K1P A;  1Q82 W;  3A0R A;  1GK9 A;  3K06 A;  1VQ4 V;  4JI1 B;  1LR1 A;  2Y69 B;  5FNV A;  3WB0 A;  1BCC H;  4GZR B;  4YJ2 A;  3CJH B;  1VIB A;  3K58 A;  3ZRV A;  3HKB A;  4LH6 A;  2F23 A;  4OPH A;  2HG5 C;  1ZWI C;  1ZSP A;  2HEP A;  4W4L A;  1NTK H;  1K97 A;  1WB8 A;  4DUY B;  1FXV A;  4DV0 B;  1KP3 A;  4J42 A;  4WBN A;  4NTX A;  4DV3 B;  2AHZ A;  1NTZ H;  3KCY A;  2QWQ B;  1Y67 A;  3CB2 A;  1F51 A;  5GON B;  2Q69 A;  1PNK A;  2NR5 A;  3ASN B;  4LFA B;  1Y66 A;  4OPA A;  2JGU A;  5K1X A;  2P6J A;  2F95 B;  4NTW A;  3E2E A;  1R3I C;  2VWJ A;  3HPL C;  1K34 A;  3UM7 A;  4QE9 A;  3HKE A;  1YJ9 V;  2UU9 B;  3JD3 A;  3OM3 B;  4N23 A;  1SQG A;  4K8Z A;  3P3N A;  1OZ0 A;  1XQ8 A;  3T2M A;  4GUN A;  1UFI A;  4P9O A;  5FL7 G;  1G8M A;  3O9O A;  1YDX A;  1AIL A;  3LNN A;  3CC4 V;  2A0L A;  4NXM O;  1N36 B;  3KKY A;  2ZDI C;  4LWS A;  1VQ5 V;  1PV0 A;  4B7E A;  1AJQ A;  2RCV A;  1NU1 H;  4YXW G;  1N34 O;  1KB9 F;  1TUB B;  2D3O W;  4B7K A;  2XHB A;  3TXS A;  5J2T A;  1JOY A;  3TCU A;  2P67 A;  3CX5 F;  2ZQM A;  4CZZ A;  4UB6 Z;  2MK3 A;  2ZDI A;  4DRX B;  4DR4 O;  2AHY A;  5C93 A;  1O9G A;  1R73 A;  3AG4 C;  3JSL A;  3UCS C;  3JYC A;  1EM1 A;  4HNA A;  4TSF G;  5J2U B;  4K0K B;  2N74 A;  1VQ8 V;  3R66 A;  5BR8 B;  1SC5 B;  1XMQ B;  1ZAU A;  4ZHQ A;  4LF7 O;  4EB6 B;  1N8R W;  2E5L B;  4ABM A;  1THZ A;  3ZN0 A;  1LUV A;  4LFC O;  3ZHU A;  2XT9 A;  3D36 C;  5CA1 B;  4O4J B;  3OAA G;  4DV5 B;  3MAQ A;  2PF4 E;  5KA5 A;  3A0H Z;  5LMN B;  5C8Y A;  1SET A;  4NTY A;  2Y48 A;  3UO2 A;  1COW G;  3AG7 A;  3CJH A;  1KP2 A;  4FM0 A;  5B1N A;  2UXC B;  4JAV A;  4NB5 A;  1E1R G;  1N4C A;  1K8A W;  1Z5V A;  1XOU A;  1D5N A;  1P49 A;  3DC6 A;  1ZTE A;  5A9G A;  1VF6 A;  3MDS A;  3ABM B;  1F4M A;  1N33 B;  2LGQ A;  1ZX3 A;  3JAT B;  2FB5 A;  2N04 A;  4X64 O;  4O2B A;  4K35 A;  1BQ0 A;  4DV6 B;  2RNB A;  2GUZ A;  5BXZ A;  3NR7 A;  4PA7 A;  1GO3 F;  3CYO A;  4TOI A;  2UUC O;  1NT2 B;  4QPJ A;  3W7U A;  2QWN B;  4JI8 B;  3VQY A;  2QM7 A;  1XDC A;  3OGI B;  2EIM B;  4O4L B;  2UXD O;  2JGD A;  2DQ0 A;  3CRC A;  3FAV A;  1XHZ A;  4TV8 B;  3ZMT A;  3T1Y B;  2UUA B;  2YXH A;  4I55 A;  2GTS A;  4BR6 A;  3HKB B;  1JX9 A;  4ICG A;  1QR8 A;  5KMG B;  2CGN A;  3CRM A;  2CAZ C;  4JF3 A;  3RWR D;  2FL4 A;  3RYH B;  1CPY A;  3H9V A;  3QF7 A;  5D5P A;  1SER A;  2A9H A;  3B2E E;  3UKM A;  2Y69 C;  1SQF A;  4JTD B;  3RW0 A;  1K33 A;  4JYA B;  4X88 A;  4CS3 A;  3G6E V;  3N2G A;  3CXH F;  1VAR A;  1I0H A;  2M6Y A;  1QBZ A;  5B5E Z;  3JD4 A;  1FKA O;  2AGA A;  4I0X A;  1FFX B;  3H1K H;  1V55 C;  4CH5 A;  3AEI A;  3THO A;  2YSU B;  4JI6 B;  2CTR A;  1QLE C;  1EZV H;  5H9C A;  2MW2 B;  5BR8 O;  1XMQ O;  3E8H A;  1IXB A;  3SYA A;  2LGW A;  4FM2 A;  3EXA A;  5IJ9 B;  4NXN O;  4X62 B;  3DTU B;  3WFV A;  2IU0 A;  2UUB O;  3U10 A;  1H2S B;  4G2K A;  4MVZ A;  4F6R A;  4O4I B;  5C8Y B;  1NJI W;  4LF8 B;  2PZS A;  5B1B B;  2ADQ B;  1BMF G;  5CB4 B;  2EZO A;  3B09 A;  3BHP A;  1AB3 A;  1DGS A;  3CCJ V;  2H3O A;  4DXW A;  1IBM O;  3JD1 A;  3N2K B;  3T4D A;  1AR4 A;  2P90 A;  1QLN A;  3K5N A;  3BVO A;  3ASO B;  2UXB O;  2ZXW B;  2F4V B;  3MHS C;  2Y0P A;  1PNM A;  1H8H G;  1I08 A;  2H94 A;  2XAQ A;  4DV2 B;  1J5E O;  2Q67 A;  3W7W A;  1U96 A;  3VBB A;  4PDL A;  1SKV A;  1YF2 A;  2PY5 A;  4EKW A;  1KD1 W;  1KQS U;  2P4V A;  2QKA A;  2DOS A;  1Q81 W;  4YY3 B;  2Z5U A;  2OYQ A;  1SA0 B;  4FM1 A;  4NKG B;  3OT7 A;  2ZT9 B;  4I55 B;  5BY1 A;  2ZXW C;  3G4S V;  5EBM C;  2CGO A;  4PDR A;  4MVM A;  5CBF A;  3QVN A;  3J81 N;  4BIU A;  2CUG A;  3OUS A;  2D2C B;  4JYY A;  3K9A A;  3AK2 A;  1ZUQ A;  3CCM V;  5HFL A;  3B8M A;  4FLT A;  4CH4 A;  4DR3 O;  3A0B Z;  2V7Q G;  5BMV A;  3LDC A;  3ZRX A;  2HHH B;  3F5W C;  1SQQ H;  5LXT B;  4O2B B;  3ASN C;  2QM4 A;  3AG2 B;  3ZHS A;  3ABK C;  4PEL A;  5JCO C;  2B1G A;  5J9P C;  3BEH A;  2OTJ V;  3ZX6 A;  4AQY O;  5EBW C;  4EFB A;  2IJK A;  1P4R A;  3L75 H;  4LP8 A;  2W6I G;  4X1I A;  3U11 A;  1KBH A;  3B40 A;  2N05 A;  4FLZ A;  1QVG U;  2KB1 A;  1NR7 A;  3RYH A;  1M93 A;  2ZIM A;  5IDJ A;  4GKJ B;  3X2Q B;  4LC1 A;  4J7J A;  1Y4M A;  1FJG B;  2DWD C;  3K0G A;  4J10 A;  1EBO A;  1H38 A;  4F4L A;  3JD2 A;  4ZHQ B;  2BTQ A; 
#chains in the Genus database with same CATH homology
 4UCU A;  5KMG A;  4JI1 B;  2P22 C;  2ZCE A;  3BRC A;  5FNV A;  3WB0 A;  1Q5O A;  2VWK A;  3JAR B;  5KHG A;  4DUZ B;  1QQC A;  3HKC A;  4YJ2 A;  3JAL B;  3K58 A;  3HKB A;  5JCO A;  3DSQ A;  4LH6 A;  1N32 B;  4DK0 A;  2UXB B;  4FFB B;  2HEP A;  4PI2 A;  4JI0 B;  4JI7 B;  4BW9 A;  4DUY B;  4DV0 B;  4WBN A;  4LNU B;  4DV3 B;  4IIJ B;  4WBN B;  3BPZ A;  5EYP A;  5LYJ A;  4EEQ A;  3CB2 A;  4I4T A;  2F93 B;  5JJN B;  5GON B;  2IM9 A;  2R72 A;  5J2U A;  1V9P A;  4LFA B;  1TGO A;  1Z5W A;  1JFF A;  2JGU A;  4YJ3 B;  5LMU B;  5K1X A;  3JAS B;  2F95 B;  3M7M X;  4NVP A;  2YIB D;  2VWJ A;  4GKK B;  1J5E B;  4UCR A;  3HKE A;  5JVD B;  2UU9 B;  4ZOL B;  2PTM A;  1SQG A;  4U3J A;  4X1K A;  4AHC A;  4K8Z A;  5KX5 A;  1XQ8 A;  3E22 B;  3JAL A;  4IHJ A;  3BA9 A;  4B3T B;  5IJ0 B;  3SJA C;  3LNN A;  1N36 B;  3N2K A;  4TV9 B;  2ZNI A;  2Q0A A;  2Q7G A;  4TV9 A;  1HR0 B;  1TUB B;  4LF9 B;  2EX3 A;  2XHB A;  4FLV A;  1M4U A;  5J2T A;  5LP6 A;  1QHT A;  4PI0 A;  5ITZ B;  4DRX A;  4DR3 B;  1HNZ B;  4JV5 B;  4B3R B;  4X20 A;  4DRX B;  3N2G B;  1JFF B;  1O9G A;  1O9H A;  5GON A;  4O2A B;  3JSL A;  2JS5 A;  4HNA A;  5J2U B;  4K0K B;  4EB6 A;  5BR8 B;  1XMQ B;  1N34 B;  4F6R B;  1ZAU A;  4B3M B;  4ZHQ A;  4OX9 B;  4EB6 B;  2E5L B;  5FNV B;  3RYF B;  5BMV B;  5CA1 B;  4D7T A;  5FPO A;  4O4J B;  4HBN A;  4DV5 B;  5IJ9 A;  3MAQ A;  1IBK B;  1YEW A;  1TAE A;  4O4J A;  5LMN B;  5C8Y A;  1HW7 A;  4X1K B;  2KKW A;  1XI1 A;  2ZIN A;  4DR1 B;  4FM0 A;  1KU9 A;  3RYI A;  2UXC B;  1HNW B;  4I50 B;  1Q8I A;  2R9A A;  5LA6 A;  5D5Q A;  1Z5V A;  2ZM6 B;  1P49 A;  3JSN A;  5EIB C;  2Q7E A;  2UXD B;  4NXN B;  4JI3 B;  3RYC B;  5FPR A;  4X1Y B;  1FFX A;  5IWA B;  1S5J A;  3RYC A;  1N33 B;  3JAT B;  2YI9 A;  4O2A A;  5EYP B;  4TQD A;  5ITZ A;  5KHK A;  3JAK A;  4O2B A;  4DV6 B;  4X20 B;  1SA0 A;  4TOI A;  3A2F A;  4JI5 B;  1NT2 B;  1I94 B;  4K8X A;  1JJO A;  4JI8 B;  3VQY A;  2BTQ B;  4O4L B;  1Q3E A;  5LOV B;  3K5M A;  1XHZ A;  4O4H A;  4TV8 B;  2R70 A;  3T1Y B;  4GYC B;  2GV9 A;  2UUA B;  2VQF B;  2PYL A;  2OWO A;  4B3S B;  5JVD A;  4I55 A;  3HKB B;  3JAS A;  5KMG B;  2CAZ C;  3RWR D;  2V4D A;  4LF5 B;  4IHJ B;  3SJC C;  1TVK B;  5KHJ A;  4FLU A;  3T1H B;  3RYH B;  5LA6 B;  4AQY B;  3QF7 A;  5D5P A;  3B2E E;  4FLX A;  3CSX A;  3SGI A;  1SQF A;  4JI2 B;  4FLY A;  4FFB A;  4JYA B;  4DV7 B;  4CS3 A;  1M5I A;  5CB4 A;  4UCV A;  4CS2 A;  4CS4 A;  4DV4 B;  4X65 B;  4KL1 A;  3BAA A;  3N2G A;  4TQF A;  2F66 C;  2Q7H A;  3JAW B;  3CHX A;  3ZS8 C;  3WB1 A;  4X66 B;  1JMK C;  1FFX B;  2RQ6 A;  2RJZ A;  4CH5 A;  3THO A;  2YXL A;  4JI6 B;  3SJB C;  4UCS A;  4DR2 B;  4PHZ A;  3K59 A;  3JAK B;  4IIJ A;  5JH7 A;  3K57 A;  4YJ3 A;  4O4H B;  4TV8 A;  4CH6 A;  4TUY B;  5LP6 C;  4FM2 A;  1XMO B;  4ZIB A;  5IJ9 B;  3BAB A;  2YIB A;  2P5O A;  4X62 B;  1IBM B;  3RYF A;  3QG5 A;  3U10 A;  3HKD A;  5KX5 B;  1TVK A;  1H2S B;  2PGG A;  4UCO A;  3K5O A;  4F6R A;  4O4I B;  3RYI B;  3JAR A;  5C8Y B;  3HKE B;  1TA8 A;  3ETQ A;  4YHH B;  4LF8 B;  2PZS A;  4ZI7 B;  4U3J B;  5JQG B;  5CB4 B;  4Q6G A;  3VQW A;  1VF7 A;  4ZI7 A;  3BHP A;  4EFE A;  1TUB A;  5LXT A;  4I9Q A;  4YJ2 B;  1DGS A;  4KHP B;  5J2T B;  3PN1 A;  4UCT A;  3N2K B;  4LF6 B;  1KMI Z;  1Q43 A;  1XHX A;  3K5N A;  5IJ0 A;  3JAW A;  2F4V B;  1RSO A;  5CA0 A;  2ZIO A;  4LNU A;  3ZED A;  1D5A A;  5LP6 B;  5KHI A;  4O4L A;  4LF4 B;  3OTO B;  5CA0 B;  5KHH A;  4CH3 A;  4DV2 B;  4HNA B;  4X1I B;  4CC6 A;  1WNS A;  1XNQ B;  1SKV A;  3OTF A;  4LR3 A;  2PY5 A;  2F1M A;  3RFR A;  4YY3 B;  2OYQ A;  4BWA A;  4ZOL A;  1SA0 B;  4I4T B;  4FM1 A;  2UUB B;  2PYJ A;  3SR2 C;  4X64 B;  2E3C A;  3RGB A;  2YIA A;  3E22 A;  1L8D A;  4I55 B;  4FLW A;  4I50 A;  5IYZ B;  2UUC B;  3WB2 A;  5EZY A;  3UT5 A;  1IBL B;  1B04 A;  5EZY B;  4GLX A;  4LFB B;  4DK1 A;  4FVM A;  4FLT A;  1WN7 A;  5JJE B;  4CH4 A;  4LH7 A;  5BMV A;  2QJ1 A;  3QTC A;  2HHH B;  5LXT B;  4O2B B;  2QM4 A;  1XNR B;  4DR4 B;  5JCO C;  2ZNJ A;  3IAY A;  4DR5 B;  3HKC B;  4L8J A;  2PUS A;  1HNX B;  1T5E A;  2VQE B;  1WPB A;  3ICX A;  4LF7 B;  5LYJ B;  4EFB A;  3U0Z A;  4DR7 B;  3VQV A;  4CC5 A;  4UFZ A;  1I7F A;  4AIL C;  4DV1 B;  1X4T A;  4TUY A;  4X1I A;  3HKD B;  3U11 A;  4D7S A;  4X1Y A;  3BA8 A;  4NXM B;  4O4I A;  5CA1 A;  4FLZ A;  3JAT A;  2BTO A;  4B08 A;  1G6U A;  2JVD A;  3RYH A;  1M93 A;  2ZIM A;  5JH7 B;  5JJJ B;  4GKJ B;  5LOV A;  3K5L A;  5JQG A;  5EIB D;  3FFQ A;  3UT5 B;  1FJG B;  4DR6 B;  4JI4 B;  2YI8 A;  5IYZ A;  5K1P A;  4ZHQ B;  3UQ8 A;  2BTQ A;  4LFC B;  3VQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...