1M93A

1.65 a structure of cleaved viral serpin crma
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
46
structure length
46
Chain Sequence
MDIFREIASSMKGENVFISPPSISSVLTILYYGANGSTAEQLSKYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine proteinase inhibitor 2
publication title Crystal structure of viral serpin crmA provides insights into its mechanism of cysteine proteinase inhibition
pubmed rcsb
source organism Cowpox virus
molecule tags Viral protein
total genus 15
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2002-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.580 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1m93A00
1M93A 1JJOA
chains in the Genus database with same CATH superfamily
4QPJA 2ATKC 2E5LO 4KHPB 1YSCA 3E35A 1I5XA 2IH3C 2MW2B 2RCVA 5CB4A 3B4SA 3OD4A 4PHZA 4DUYO 4WFGA 4CH5A 1YJ9V 2VWKA 3ZRWB 1Q8IA 2UXBB 2ARHA 4PA3A 1L0NH 5JCOA 1AR1B 5KHHA 4Z1VA 3QF7A 4B3TB 3P30A 2ZM6O 1R6KA 4H13B 1R6TA 2DOSA 4QE9A 1N34B 2ZCEA 1EN6A 5B3SB 2OIGA 3K5NA 3ABMB 3B2EE 5J9PC 3SYPA 3M7MX 4DV2B 3UT5A 1H2GA 2ADPA 5IYZB 2F66C 1OCRC 1GTOA 4LP8A 2PUSA 1W0KG 2DQ0A 2CUGA 1D5AA 1QVGU 1F7YA 2FMLA 2DE0X 3ZHSA 1QLEB 1SA0B 4IYIA 2JEXA 3K0DA 1IBMO 3G67A 2Q0AA 4B3SO 1K4CC 4O4LA 1D2DA 1XMOB 4R50A 1JFFA 1EM1A 4J7JA 1WLEA 1KU9A 4PDRA 3E2EA 3RYIA 4BR6A 3CP1A 1K4DC 1XL4A 4CS3A 4NVPA 5JQGA 2IJJA 4LF4B 1IDSA 2P22C 4J41A 1TUBB 2GV9A 4TQFA 5HFLA 3ABKB 1TUEB 4LFAO 5BMVA 2XAFA 2PYJA 1PKXA 4F6RB 1BL8A 1NTZH 1KP2A 4O4IA 1XREA 1HNZO 1N0NA 2Q67A 3K08A 1K92A 1OZ0A 1B04A 1P84F 2UUBB 3BPZA 1HR0O 3JALA 3ABLB 2CH7A 3F5TA 4UFZA 2FB5A 3ZMSA 4DR6O 3MAQA 4GLXA 4NXMB 1QCEA 4JV5O 2O57A 4AI8A 2E5LB 5JJEB 1NBMG 3SJCC 2X6AA 5D5QA 3VQYA 2D2CB 1S76D 4DUYB 4DV4B 1J5EO 2XUMA 3OMAB 2C2AA 2F1MA 4FVMA 2WSSG 4KUMA 2UXNA 1M9NA 1S3JA 4AHCA 1M93A 3F7VC 3DXRA 1NH2D 1Q3EA 2A9HA 2ZM6B 3L73H 1TA8A 1WA8B 3LSSA 1DF4A 4HNAB 1YIJV 2CGNA 4Q20A 3QO8A 3RBZA 1K8AW 1M5IA 5TISZ 4X8AA 5A9GA 5IY5C 1K7DA 5B1BC 3N2GB 2UXDO 4JI7B 3KZIZ 4I7ZB 3CCSV 3CCLV 3T1HO 1AJPA 1OCCB 3NR7A 3ZMVA 4DRXA 3FYIB 1IBMB 1RFYA 4X1KA 2HVKC 4B3SB 1HNXO 1MG1A 3GWOA 3ASOB 3JALB 2ZE8A 3H1LH 1FFTB 2KG7B 1YTFD 5LP6B 1GO3F 4GX5A 4IYHA 2ZNIA 5B1AB 3ZMUA 1FAFA 2HFEC 4EB6B 4B7KA 2JS3A 3W7SA 1KYOF 2EIMB 2YEVB 4LFAB 2XAQA 3SYQA 3WB0A 4WCEV 3FB8C 4B3MO 2EIJC 4O2BB 4LF6O 4DR2B 2EILB 5KHGA 4GX2A 5IYCO 1YJNV 4RQFA 3OFNG 1HNZB 2QKAA 2WWWA 5FPRA 2XTAA 1OCOB 1YZBA 2EULA 4PI2A 2DW4A 1F4NA 2BTQA 3BCCH 3CCVV 3L71H 1VF6C 4YHHO 1HR0B 3PN1A 1VF6A 2P67A 4LFCO 1AI7A 4FIPC 4DR6B 4JV5B 1BT8A 3HKCA 4JI2O 1FXKC 2GTSA 4JAUA 3AEIA 4N23A 5A2QN 3OUSA 4LH7A 1J5EB 4XDJA 3RFRA 4FLVA 4K35A 3U10A 4QNHB 4AQYO 4P2ZA 4DRXB 5CA1A 1Q82W 5KMGA 4DUZO 2L35A 4B7EA 5CMUA 4J7ZA 4J9ZB 2FKXA 3GB7C 2OIEA 2H8PC 3FB5C 1JOYA 3WG7B 3BHPA 1CP9A 1EN4A 3A0HZ 1ZUQA 3HPLC 4IT5A 1IBLO 3E22B 1MSDA 3IGAC 4IHJA 4J9YB 1ZSPA 2IH1C 4PA9A 5BY1A 3Q4HA 3AG2C 2UXDB 1XQ8A 2E75B 4GT1A 1WB8A 1XUQA 4MS2A 1P4RA 2WLMA 5EZYB 1JR9A 1V54B 2F4VO 4ZIBA 4NTWA 1N36O 5LYJA 1G8MA 2QKSA 2VQFO 1SQVH 1OHHG 2WLKA 3SYAA 1ORQC 1FFXA 1OCZC 1MNGA 2EINB 2PY5A 3RYCB 1XHXA 4X1IA 5KUKA 5J2UB 3QNEA 3T1YO 1MZFA 2F23A 3ZCCA 3JATA 4DR1O 1TVKB 1FPOA 2CDYA 1R73A 4B3MB 3H9VA 5CA1B 4X66O 3W7UA 5IDJA 4FPPA 1OJHA 1TGOA 4LFBO 5KUMA 4TOIA 4U3JB 2Q7EA 4D6TH 5GW7A 3DC6A 4WFEA 5CBHA 2HG5C 3ASNC 3RYHA 2AZ0A 4FFBA 3D8CA 4R6ZA 3OUFA 4YHHB 2B1GA 3APOA 4O2AB 4JI8O 1PL0A 1PM9A 4LFCB 1IBKO 4JI2B 2CAZC 2NN4A 5CA0A 4CH4A 3E8HA 2OCHA 3H1KH 3K06A 3BA9A 1AJQA 2P90A 1YDXA 3SPIA 3OTOO 1KUQA 3FB6C 4J7KA 2HJDA 4AQYB 4JZGA 1I94O 2JRIA 4YXWG 3LNNA 4KXRA 4JI4B 3KCYA 3JD1A 5JVDB 3CRRA 4DUZB 3RYFA 1XNRO 1QR9A 2Y0PA 5CBFA 4LR3A 3AG4C 1XBLA 1VMGA 1NTMH 5H6RA 3B8MA 3CYOA 1UJWB 3VOUA 2YXHA 1RM1B 4ZBMA 4DK1A 1Q6IA 2EIKC 4UUJC 1IBLB 2HHHO 1OV9A 1WP8A 2QM8A 1N34O 2DN9A 4MW3A 3CJHA 2CTQA 4PI0A 2Q5ZA 4LF5O 3BEHA 4DV2O 2F4VB 3LDCA 2VWJA 5IYDO 5KAFZ 2ITDC 3MDSA 3P3NA 2VQFB 4LF7O 2DYRC 2H3OA 4WBNB 5KAIZ 1VQ9V 4P9OA 2KB1A 5FNVA 2M6YA 2Z5UA 2QWQB 1VQLV 2IJIA 1BSMA 3ETDA 4L87A 4MTOA 3T1YB 1NJIW 4DO2A 1J95A 5K1XA 2B9ZA 4DR1B 1Y4MA 5EYPB 1NQTA 1S5HC 3FAVB 3OEEG 1KC8W 4JGSA 2RNBA 3W7WA 4X66B 2V4DA 3RGBA 4LFBB 1JA8A 1YEWA 2Q4PA 2ZXWB 4RUEA 1M56B 2QDOA 1NS1A 2OCCB 3BABA 4H44B 4MW8A 4JI6B 4LNUA 5B66Z 1XMQO 1Y76A 5B3SC 1HP8A 4J10A 1XILA 5LA6A 3JYCA 3ABMC 3E89A 4O4JB 2XASA 3K58A 2FYUH 3ICXA 4JI8B 2EBOA 4D7TA 5IE9A 1NT2B 2LP7A 1RPRA 2BSKB 4LH6A 1IBKB 2ZIOA 3CCQV 4LWSA 2RN9A 4CZZA 1UFIA 1AP6A 2LFRA 4GKKO 1GRJA 1JVMA 1P7GA 2R9RB 2W6IG 3L74H 2Q7HA 1WB7A 3OTOB 4JAVA 5JH7A 3TGUH 1VP7A 1QLEC 3VQXA 4H37A 4WF9V 1I94B 3JAWB 2CGOA 5CBGA 5L3EA 4DV4O 3OE7G 4JI0O 3ZEDA 1WN7A 1XNRB 4FZ1A 3CXCU 4MVRA 3HKEB 2DQ3A 2F93B 4I50A 4DV5B 2YXLA 2AHYA 2X0LA 3JAKB 4GZRB 2ZNJA 2AGAA 4JF3A 2HHHB 4DR5O 4OX9O 4N21A 3G80A 5JWPA 4YJ2A 5C8YA 1L8DA 1FS0G 3L72H 3JASA 4ICGA 2QE7G 3SGIA 5FPOA 1PPJH 1H2KA 5LOVB 2Q73A 2E3CA 3OEHG 4DV6O 1AROP 4FMTA 1M1KW 4LF5B 3ZHUA 4PD4F 3K57A 4LNUB 3ZN0A 5F2VO 2LW1A 1PNKA 3ABLC 3TK1A 3BVOA 4JI7O 1IX9A 3OT7A 4ABMA 4ZHQB 1K34A 4LF7B 3STZC 1E1RG 4CC6A 1GN6A 2HVJC 5L3DA 2AXTZ 1HWYA 1B6QA 4NKGB 4NYKA 2YIDA 3EHBB 2IJKA 3CMAV 4DV1O 5JH7B 1U97A 3OMIB 3SJAC 1GN2A 2GUZA 1CXZB 2OYQA 2QM4A 1KMIZ 1Q90D 5CB4B 5BR8O 1WJZA 1Q6HA 2Q0OC 4FK5C 4UB8Z 1GM8A 5ITZA 1SQFA 1XMQB 3ZHVA 2YICA 4I55A 3T4DA 4DK0A 4DR2O 2ZQMA 3T2MA 3FX7A 3K5MA 2P6JA 5CN0A 1SQQH 3QTCA 1E1QG 4MTGA 2A0LA 1KECA 3SPGA 1M57B 3TXQA 2VRZA 4YJ3A 1Q6UA 4GKKB 2YIBD 3UO2A 1SQBH 2X6CA 2AW9A 1KQSU 4JI5O 1NR1A 3LSUA 2V1DA 1KB9F 3UT5B 1BMFG 3OAAG 3A0RA 3ASOC 4NTYA 2QEXV 3CCRV 1YI2V 1BZKA 4JI3O 3FKSG 4JI0B 1OCRB 4RWUA 3QVNA 5LP6C 3WU2Z 4EKWA 3L9DA 2P06A 3ZHTA 4JTAB 3TXSA 5B1AC 3UO3A 3X2QB 5HFMA 3LDEA 4CS2A 1HNWB 3AK2A 4O4LB 4A5UB 1JFFB 2HLDG 2Z0AA 4WFHA 5IJ0A 1X59A 2EIMC 3A0BZ 4DR5B 4OX9B 3RYIB 3ZHQA 1H2NA 4X1YA 2GUZB 5JQGB 2EILC 1SZTA 1O9HA 3SR2C 3KG2A 4DV6B 1RSOA 1DLBA 4EEQA 1PNLA 1OCOC 4TUYA 4UCOA 5BMVB 4U3FH 3ZN1A 3CCJV 3KCXA 4I55B 4OPHA 2BOCC 2R70A 4WFBV 1S72V 4MTXA 4O4IB 4ZKIA 1ENVA 4MVSA 4GX0A 1G6UA 3VQVA 2QA4V 2PTMA 1AI4A 4IIJA 2PZSA 2IU0A 3HKDA 2AHZA 1US6A 2YI8A 3BRCA 4X89A 1IZ3A 4K8ZA 1R3JC 2CH7B 4UVCA 1ROPA 4ZI7A 2RQ6A 3THOA 4DV1B 1PL4A 2ZINA 3FYEB 1SQXH 1AVMA 2LGWA 1YJWV 3ETEA 1VARA 1FKAO 1YXBA 3LUTB 4TV9A 5BR8B 2OT5A 3OR6C 3CCEV 2G38A 3OW2U 4OGQB 5GONA 3AK1A 4PA7A 1WPXA 2XAJA 2W0XA 3WG7C 1M4UA 2YS8A 4CBCA 1N33O 1URFA 3DXRB 3BFRA 4HBNA 3S3XA 4I0XA 5E1AC 2CTPA 2ODMA 5LGUA 1ZL8A 4R7CA 1E79G 5KHKA 4ASUG 1HW7A 4JZ2A 4ZOLA 3CMEV 3E83A 1JCHA 1V54C 1SQPH 1W2BU 1WAZA 4JI5B 4B3RO 5IY5B 3M99B 1Y6XA 4TUYB 1FXKA 4UVBA 3SDLA 4D7SA 1L0LH 5KA6A 1VF7A 2XOKG 4JI3B 4FFKA 1AB3A 4TWKA 3O65A 4NR1A 4G27B 1L1FA 2EINC 3CPWU 1PNMA 1NH2B 2ZE6A 4X1KB 4I4TA 1KD1W 3HKDB 4JI4O 4XDKA 1BE3H 2PI4A 5LMUO 4LC1A 3SJBC 1N0JA 5IJ9A 5KX5A 1VQMV 1LR1A 3JAMN 4Z1MG 3CCMV 2W6JG 1NVPD 1K5QA 5J2TA 2Y4TA 3U11A 3MD0A 4MT8A 2ADQB 4DW1A 4PJ0Z 4BIOA 3D36C 4LF9O 1VQPV 2WLLA 2EIJB 2JGDA 4KFMA 1P7BA 4JTCB 4IGGA 3CB2A 4HAMA 4I0XB 3W7XA 4GX1A 5DEDA 2BTQB 3SPHA 2XHBA 1VQNV 2OTJV 5EIBC 2R72A 3S3WA 3EVKA 1BQ0A 4U7OA 2Z3YA 4BW9A 2MK3A 3HKCB 2PYLA 4DR7O 5EBWC 1LUVA 3CHXA 1FXKB 1KP3A 1Z2GA 5L3CA 1S0VA 1AR5A 2HR3A 3P3PA 3STLC 2WAMA 3CX5F 4EFBA 4RQEA 4Q6GA 3I56V 1Q81W 3HKBA 2ZIMA 4PDMA 3CC7V 1VQKV 3D3IA 2UXCB 3NXSA 3E8GA 4FJCC 4G28B 4X64O 1RM1C 1N33B 4FLXA 5KMGB 1JPXA 3SYOA 3SPJA 1R1BA 3IJ4A 4JI6O 2WLIA 4TQDA 4LBEC 3AG1B 3RVYA 2JGUA 3WB1A 3CE2A 1N32O 3L75H 4BWAA 2E74B 2N74A 1H2LA 4C7UA 3JARA 1XOUA 4U7NA 2R9AA 2EJRA 4B3RB 2RDCA 3PJSK 4PA6A 1VF5B 4IHJB 2Y4UA 4DV0B 3DC5A 3Q4HB 5BZBA 4WFFA 3OTFA 2KKWA 3BY6A 3K5LA 1T5EA 4P30A 5LHIA 2A06H 2ZT9B 2XAGA 5LYJB 1VQ5V 2JEUA 1XHZA 2QSAA 5LMUB 3LSQA 3ZMTA 2W0FC 1FD9A 3RW0A 2OWOA 4FLTA 3AK3A 1ZAUA 3FB7C 1FFXB 4O4HA 3R66A 2E76B 4DV5O 2GTAA 1X4TA 4BIZA 2QWRB 1COWG 3IAYA 2ZXWC 2IBZH 1M56C 4AILC 4X1IB 3J7AU 2OCCC 2K1EA 2DYSB 3K59A 4I5SA 3JATB 4LF9B 3B40A 1JMKC 3L70H 3G6BA 1Q86W 4UVAA 3RYHB 4FFBB 1S5JA 3ZRXA 2R9IA 2PF4E 2ZDIC 3UCSC 4H0LB 3N2KA 4B08A 2ZE7A 1QHTA 1SS3A 3CS5A 1XL6A 4J80A 4W4KA 2DWDC 2BTOA 3ZJZA 3T4ZA 4DR7B 5CA0B 1K33A 4GUNA 2X6BA 3CRQA 4TSFG 5FL7G 3H1HH 2B1IA 5D5PA 1Y74A 3ZRWA 1FYJA 4DW0A 3P32A 4X64B 3TJTA 4OXSA 2DMXA 5KHIA 2UU9O 3RYFB 4PV1B 2EX3A 3QO5A 3RWRD 3AG4B 1Q43A 4O4HB 2FTKA 4YIOA 5FLXN 1GN3A 1IXMA 1N32B 1BCCH 4QPKA 1FJGO 4L8JA 1SKVA 1RP3B 3QO7A 1W59A 5LGTA 3CSXA 3DGEA 3K9AA 2GHYA 1ZLZA 5IYZA 5H2FZ 2LJ2A 3CJHB 5IYBO 2YUAA 1XNQO 2P4VA 2VQEO 2GDSA 3JD0A 4CH3A 4RO2A 1N8RW 3UKMA 1Q5OA 4G2KA 1MA1A 1DGSA 1QNMA 5JJNB 1M90W 4UCTA 3CD6V 3ZS8C 1SERA 1HDJA 1O9GA 3SJQC 2P4KA 5LMNO 5DM6V 2L6LA 2Y69B 5FNVB 1KKDA 4QGPA 5DECA 4FLWA 3EXAA 1HNWO 5H9CA 1V9PA 3ZHRA 4K0KO 1TUBA 3ABKC 2EZOA 3ETQA 1R3IC 3B09A 2DWEC 2B5UA 4DR3B 3OR7C 1IVSA 1Y74B 3WB2A 5JCOC 1XI1A 1V55B 2PGGA 3OMNB 2WPDG 4KL1A 1H2SB 4F6RA 2RJZA 3K5OA 3B77A 3AG3B 4TT3G 1SQGA 2UUCO 2Q7GA 1M57C 3F5WC 3DSQA 2PI5A 4UCVA 1G1XB 5H6QA 1Y76B 3C3TA 4JTDB 1G4YB 5LA6B 4JYAO 1IURA 2QJ1A 2QWPB 1BQZA 3BAAA 2Q6AA 1YHQV 5LHHA 1K73W 2CK3G 4LWSB 4OPAA 1TAEA 2XT9A 1CPYA 3A2FA 1VIBA 4QE7A 2P5OA 1R6NA 1W0JG 3H1IH 1ZX3A 1PD3A 4MTFA 4DXWA 3W7TA 4PA4A 2CE4A 3X2QC 1AI6A 2FL4A 1EZJA 2BCCH 2QWOB 1EFRG 4GCZA 4MVMA 1WNSA 2UU9B 3R65A 2F95B 1WA8A 3JSLA 2F43G 4TV8A 1K97A 2ZR2A 4JYBA 4HNAA 4I50B 1Q7YW 2IJHA 3UM7A 1JJ2U 1FJGB 1KBHA 3H1JH 4UB6Z 4HYOA 2QM7A 4YJ2B 5C8YB 1NTKH 2IU3A 1GN4A 2GSMB 3A8TA 3JASB 3N2GA 4FLUA 4K8XA 4BAYA 3J81N 2A7WA 1H8HG 2Q8VA 2JJ1G 2WLJA 1OCCC 1QLNA 4JASA 2LQTA 5LHGA 1XNQB 2VQEB 5KHJA 4FM0A 2ITCC 3APQA 1AILA 4YY3O 2EJ7A 1MMMA 3GVMA 2K9PA 1R3LC 1WPBA 2NR5A 5IWAB 5LMNB 5L3BA 2KG7A 5LP6A 3IC9A 4K0KB 4UCRA 4LF8O 5JJJB 1JQ0A 2YIBA 4EB6A 2N04A 5H5NA 5LL6Y 2YEVA 3ABUA 3CRAA 4UV9A 2JJ2G 2QTSA 4O2BA 2IM9A 3ML0A 4JPRA 3ZMZA 1EZVH 3E8BA 1WP7A 2UXXA 1H8EG 3VBBA 2UUCB 2V7QG 4W4LA 1EN5A 1GKFA 4TV8B 4DV7O 5ITZB 1F4MA 1F51A 3HB3B 4UCUA 4LCUC 4JYAB 4X65O 2M7WA 4PDVA 2P7TC 5IT9N 2UUAO 3M8AA 1SETA 2CTRA 1THZA 4YJ3B 3ZX6A 3TETA 3ZRSA 1VQOV 2VS0A 1VQ6V 2ETNA 3CRMA 3J80N 4UCSA 1EBOA 2EZPA 2OTLV 4GKJO 4NB5A 1U96A 1N4CA 1XDCA 1YCIA 4PDLA 1MOFA 3GWKC 2UXCO 1R3KC 2D3OW 2NLJC 4FM2A 4I9WA 1AI5A 2QKCA 2HJFC 2H94A 1SRYA 5LXTA 1SESA 3ZRVA 5IJ0B 3E22A 2HEPA 4F6EA 3N27A 5GTIZ 1Z5WA 2KSDA 3QG5A 4X1YB 2YDEA 1LNQA 3K03A 3CXHF 4J11A 1RSOB 3JD3A 1GMGA 4FM1A 5EZYA 1GM7A 4DV0O 1Y66A 5B1BB 2Q68A 1VQ4V 4K3AA 4QIWF 4YY3B 1NZ6A 2Q9LA 2DJVA 5AG2A 3OGCC 3OM3B 1BHAA 4DV3O 3SYCA 2LW7A 4WFAV 2WLNA 3ZIAG 4HZ3A 4IIJB 5KLVH 3JCZA 3RYCA 1FXVA 4LF8B 1PP9H 4YIPA 5J2UA 4GYCB 3K04A 4ZI7B 1DF5A 1SZXA 2JDIG 5LGNA 4DR4O 1AP5A 1TVKA 1YF2A 1F23A 5EIBD 2QWNB 1P49A 4TV9B 4MVZA 4MVQA 2ZE5A 4U3JA 3K3WA 4P9PA 3WFVA 3D36A 4F4LA 3AG1C 3G6EV 5GONB 4DV7B 3ETGA 1K3EA 4Z2WA 1SC5B 4O2AA 4X65B 3C90A 2QTOA 3U0ZA 1GM9A 3O9OA 5LXTB 2UUAB 4H33A 5EC1C 4MVOA 1ZL8B 4XDLA 1YTFB 1K9MW 4X62O 3G71V 3KKYA 4ZOLB 5LBQA 3T1HB 2HP8A 1JX9A 4CH6A 2LO1A 5B1OA 4GKJB 3CC2V 1HNXB 5JVDA 4CS4A 5KA5A 3HR0A 1QVFU 1I08A 1NU1H 3IFXA 1A32A 3FD9A 5BXZA 4X20A 1Z5VA 4I4TB 2NNUA 4NTXA 2N05A 3ABTA 3LDDA 3VQWA 3E8FA 3TCUA 4J42A 2DYSC 1UPGA 4UXNA 1B06A 2X7RB 2IW5A 5IJ9B 3CCUV 5KX5B 2WLHA 2QR4A 5C93A 1ZTEA 4BIUA 4JAAA 1K5SA 4LF6B 4E4EA 1SF9A 4UV8A 5J2TB 4NXNO 1PV0A 3JSNA 5B1NA 3C3SA 3IC7A 1I7FA 4KP4A 4RUFA 1MZEA 5B5EZ 3E86A 2ZR3A 2WLLB 1BGYH 2QGNA 2XAHA 3JD2A 2JGDB 3AG2B 5EC2C 2KQXA 3UQ8A 1GH6A 4JI1O 4WBNA 4DV3B 4E2LA 2ILMA 2Y48A 3F7YC 5EBLC 2GBOA 3D3QA 1AJNA 3FFQA 4X9QA 1NVPB 2YSUB 4FLYA 2HKOA 1MSWD 4DR4B 5EYPA 4KHPO 1OCZB 3FAVA 2JVDA 1H38A 4JYYA 3K79A 1MABG 1Y67A 5EK0A 4R8CA 3MHSC 1H2MA 4DR3O 3JCUZ 3I5DA 5DN6G 2UXBO 3HKBB 1CEZA 4X20B 2BOBC 2JIZG 1GK9A 4O4JA 1ZWIC 4RAIA 4B3TO 1IXBA 3RN4A 2BSKA 4FLZA 3CWBH 1JJOA 3ASNB 2WLIB 2AZ2A 3BA8A 2ZDIA 3SPCA 3JD4A 4X62B 3K0GA 4XBFA 1VEWA 1GAXA 3LNMB 3JARB 3RT3C 2WA3A 1NR7A 3JAWA 5GTHZ 2YXYA 1D5NA 5CA3A 1DK1A 1VQ7V 2XNDG 4PELA 1N36B 5L3GA 1YITV 3MHHC 1B3QA 1VQ8V 1QR8A 2Y69C 4MVUA 2A3QA 3HKEA 2LFSA 3CRCA 5L3FA 2WA4A 3T1CA 1RPOA 4JYCA 1XEQA 3AG7A 3JAKA 1XMOO 3RVZA 1QQCA 3K9SA 1NKDA 1V55C 3B8NA 2YIAA 2YC0A 5LOVA 5E79Z 4LF4O 3CEIA 3AG3C 1AR4A 4NXNB 1S5LZ 5EBMC 1BS3A 1QU7A 3ZBHA 2LGQA 2EIKB 4EFEA 3H01A 2BE3A 4X88A 4FZ0A 2JK5C 4CC5A 2Q69A 2ZKOA 2CTWA 4ZHQA 3I55V 1NI8A 4JI1B 2Y0IA 2YI9A 1QBZA 1SA0A 5K1PA 1S77D 1I5YA 1FXHA 3OGIB 1YVWA 2A79B 1DTOA 4IL6Z 2JS5A 1I0HA 2RMKB 2UUBO 3N2KB 4DYLA 2ZD9A 4QJFB 1BHBA 5IWAO 1LUWA 3G4SV 3EFFK 1KKCA 3DTUB 4I9QA 4BW5A 4MSWC 4NXMO 2DYRB 3CC4V
chains in the Genus database with same CATH topology
5LP6A 4KHPB 4AQYB 4X1KB 4I4TA 3HKDB 3LNNA 5CB4A 4K0KB 4UCRA 4JI4B 5JJJB 4PHZA 2YIBA 5JVDB 4CH5A 3SJBC 4EB6A 4DUZB 3RYFA 2VWKA 2UXBB 1Q8IA 4LR3A 5IJ9A 5KX5A 4O2BA 5JCOA 2IM9A 5KHHA 5J2TA 3QF7A 4B3TB 3U11A 4DK1A 1IBLB 2UUCB 4TV8B 5ITZB 1N34B 2ZCEA 4UCUA 4JYAB 3K5NA 3B2EE 4PI0A 3CB2A 2F4VB 4YJ3B 3M7MX 4DV2B 2BTQB 3UT5A 2XHBA 2VWJA 5EIBC 5IYZB 2F66C 2R72A 2PUSA 2VQFB 4UCSA 1D5AA 4BW9A 4WBNB 3HKCB 2PYLA 5FNVA 1SA0B 3CHXA 2Q0AA 4O4LA 1XMOB 1JFFA 4EFBA 4Q6GA 1KU9A 3T1YB 3HKBA 5K1XA 3RYIA 4DR1B 2ZIMA 5EYPB 4CS3A 2UXCB 4FM2A 4NVPA 5JQGA 4LF4B 4X66B 2P22C 2V4DA 3RGBA 1N33B 4FLXA 4LFBB 1TUBB 5KMGB 1YEWA 5LXTA 2GV9A 4TQFA 5IJ0B 3E22A 2HEPA 3BABA 4JI6B 4TQDA 4LNUA 5BMVA 1Z5WA 2PYJA 3QG5A 2JGUA 3WB1A 4X1YB 5LA6A 4O4JB 3K58A 4F6RB 4BWAA 3ICXA 4JI8B 4O4IA 4D7TA 1NT2B 3JARA 4LH6A 2R9AA 4FM1A 1IBKB 2ZIOA 5EZYA 4B3RB 4IHJB 4DV0B 4YY3B 1B04A 2UUBB 3BPZA 3JALA 3OTFA 2Q7HA 2KKWA 4UFZA 3OTOB 5JH7A 3MAQA 4GLXA 4NXMB 3K5LA 3VQXA 2E5LB 5JJEB 1I94B 3JAWB 1T5EA 4IIJB 3SJCC 5D5QA 3VQYA 3RYCA 5LYJB 4LF8B 1XHZA 5J2UA 4DUYB 5LMUB 4DV4B 3ZEDA 4GYCB 4ZI7B 2OWOA 4FLTA 1WN7A 2F1MA 4FVMA 1XNRB 1ZAUA 1FFXB 1TVKA 5EIBD 4O4HA 3HKEB 2F93B 1X4TA 1P49A 4I50A 4DV5B 2YXLA 4TV9B 4AHCA 1M93A 3IAYA 4AILC 3JAKB 4X1IB 4U3JA 2ZNJA 1Q3EA 2ZM6B 2HHHB 3K59A 1TA8A 3JATB 4LF9B 1JMKC 4YJ2A 5C8YA 5GONB 1L8DA 4DV7B 4HNAB 3JASA 3SGIA 5FPOA 4O2AA 5LOVB 4X65B 3U0ZA 1M5IA 2E3CA 5LXTB 2UUAB 4LF5B 3RYHB 4FFBB 1S5JA 3K57A 4LNUB 3N2GB 3N2KA 4B08A 1QHTA 4ZHQB 4JI7B 4ZOLB 4LF7B 4CC6A 2BTOA 3T1HB 4DR7B 4CH6A 5CA0B 4DRXA 1IBMB 4X1KA 4GKJB 4B3SB 1HNXB 3JALB 5JVDA 4CS4A 5D5PA 5JH7B 4X20A 3SJAC 5LP6B 1Z5VA 2ZNIA 2OYQA 2QM4A 1KMIZ 4I4TB 5CB4B 3VQWA 4X64B 5KHIA 4EB6B 3RYFB 5IJ9B 4LFAB 5KX5B 3WB0A 2EX3A 5ITZA 1SQFA 3RWRD 1Q43A 4O4HB 4O2BB 1XMQB 4I55A 4DK0A 4DR2B 3K5MA 4LF6B 1N32B 5KHGA 5J2TB 4L8JA 1SKVA 3QTCA 3JSNA 1HNZB 1I7FA 5FPRA 3CSXA 4PI2A 4YJ3A 2BTQA 4GKKB 2YIBD 1HR0B 5IYZA 3PN1A 4DR6B 4DV3B 3UQ8A 4JV5B 4WBNA 3HKCA 4CH3A 1Q5OA 1DGSA 3UT5B 5JJNB 4UCTA 4LH7A 3FFQA 3ZS8C 1J5EB 4JI0B 1O9GA 3RFRA 4FLYA 5LP6C 4FLVA 4DR4B 5FNVB 5EYPA 3U10A 4DRXB 4FLWA 2JVDA 5CA1A 1V9PA 4CS2A 1HNWB 4O4LB 1TUBA 5KMGA 1JFFB 3ETQA 5IJ0A 4DR5B 4DR3B 4OX9B 3HKBB 3RYIB 3WB2A 5JCOC 4X20B 1XI1A 2PGGA 4X1YA 4KL1A 1H2SB 5JQGB 4O4JA 4F6RA 3BHPA 2RJZA 3K5OA 1O9HA 3SR2C 4DV6B 1RSOA 1SQGA 4EEQA 3E22B 4FLZA 2Q7GA 1JJOA 4TUYA 3DSQA 4UCOA 3BA8A 4IHJA 5BMVB 4UCVA 5LA6B 4I55B 2QJ1A 2UXDB 1XQ8A 2R70A 4X62B 4O4IB 3BAAA 3JARB 5EZYB 1G6UA 3VQVA 3JAWA 2PTMA 4IIJA 2PZSA 3HKDA 4ZIBA 2YI8A 3BRCA 1TAEA 5LYJA 1N36B 4K8ZA 3A2FA 2P5OA 4ZI7A 2RQ6A 3THOA 4DV1B 2ZINA 1FFXA 3HKEA 2PY5A 4TV9A 3RYCB 1XHXA 5BR8B 3JAKA 4X1IA 5J2UB 1WNSA 2UU9B 2F95B 1QQCA 3JATA 3JSLA 4TV8A 1TVKB 5GONA 4B3MB 2YIAA 4HNAA 4I50B 5LOVA 1M4UA 5CA1B 1TGOA 1FJGB 4TOIA 4NXNB 4U3JB 2Q7EA 4HBNA 4EFEA 3RYHA 4FFBA 4YJ2B 5C8YB 4CC5A 3JASB 4YHHB 3N2GA 4FLUA 5KHKA 4O2AB 4K8XA 1HW7A 4ZHQA 4ZOLA 4LFCB 4JI1B 1XNQB 2VQEB 2YI9A 4JI5B 1SA0A 2CAZC 5K1PA 5CA0A 5KHJA 4FM0A 4CH4A 4JI2B 4TUYB 4D7SA 2JS5A 1VF7A 3BA9A 3N2KB 4JI3B 1WPBA 5IWAB 4I9QA 5LMNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M93 A;  1JJO A; 
#chains in the Genus database with same CATH topology
 4QPJ A;  2ATK C;  2E5L O;  4KHP B;  1YSC A;  3E35 A;  1I5X A;  2IH3 C;  2MW2 B;  2RCV A;  5CB4 A;  3B4S A;  3OD4 A;  4PHZ A;  4DUY O;  4WFG A;  4CH5 A;  1YJ9 V;  2VWK A;  3ZRW B;  1Q8I A;  2UXB B;  2ARH A;  4PA3 A;  1L0N H;  5JCO A;  1AR1 B;  5KHH A;  4Z1V A;  3QF7 A;  4B3T B;  3P30 A;  2ZM6 O;  1R6K A;  4H13 B;  1R6T A;  2DOS A;  4QE9 A;  1N34 B;  2ZCE A;  1EN6 A;  5B3S B;  2OIG A;  3K5N A;  3ABM B;  3B2E E;  5J9P C;  3SYP A;  3M7M X;  4DV2 B;  3UT5 A;  1H2G A;  2ADP A;  5IYZ B;  2F66 C;  1OCR C;  1GTO A;  4LP8 A;  2PUS A;  1W0K G;  2DQ0 A;  2CUG A;  1D5A A;  1QVG U;  1F7Y A;  2FML A;  2DE0 X;  3ZHS A;  1QLE B;  1SA0 B;  4IYI A;  2JEX A;  3K0D A;  1IBM O;  3G67 A;  2Q0A A;  4B3S O;  1K4C C;  4O4L A;  1D2D A;  1XMO B;  4R50 A;  1JFF A;  1EM1 A;  4J7J A;  1WLE A;  1KU9 A;  4PDR A;  3E2E A;  3RYI A;  4BR6 A;  3CP1 A;  1K4D C;  1XL4 A;  4CS3 A;  4NVP A;  5JQG A;  2IJJ A;  4LF4 B;  1IDS A;  2P22 C;  4J41 A;  1TUB B;  2GV9 A;  4TQF A;  5HFL A;  3ABK B;  1TUE B;  4LFA O;  5BMV A;  2XAF A;  2PYJ A;  1PKX A;  4F6R B;  1BL8 A;  1NTZ H;  1KP2 A;  4O4I A;  1XRE A;  1HNZ O;  1N0N A;  2Q67 A;  3K08 A;  1K92 A;  1OZ0 A;  1B04 A;  1P84 F;  2UUB B;  3BPZ A;  1HR0 O;  3JAL A;  3ABL B;  2CH7 A;  3F5T A;  4UFZ A;  2FB5 A;  3ZMS A;  4DR6 O;  3MAQ A;  4GLX A;  4NXM B;  1QCE A;  4JV5 O;  2O57 A;  4AI8 A;  2E5L B;  5JJE B;  1NBM G;  3SJC C;  2X6A A;  5D5Q A;  3VQY A;  2D2C B;  1S76 D;  4DUY B;  4DV4 B;  1J5E O;  2XUM A;  3OMA B;  2C2A A;  2F1M A;  4FVM A;  2WSS G;  4KUM A;  2UXN A;  1M9N A;  1S3J A;  4AHC A;  1M93 A;  3F7V C;  3DXR A;  1NH2 D;  1Q3E A;  2A9H A;  2ZM6 B;  3L73 H;  1TA8 A;  1WA8 B;  3LSS A;  1DF4 A;  4HNA B;  1YIJ V;  2CGN A;  4Q20 A;  3QO8 A;  3RBZ A;  1K8A W;  1M5I A;  5TIS Z;  4X8A A;  5A9G A;  5IY5 C;  1K7D A;  5B1B C;  3N2G B;  2UXD O;  4JI7 B;  3KZI Z;  4I7Z B;  3CCS V;  3CCL V;  3T1H O;  1AJP A;  1OCC B;  3NR7 A;  3ZMV A;  4DRX A;  3FYI B;  1IBM B;  1RFY A;  4X1K A;  2HVK C;  4B3S B;  1HNX O;  1MG1 A;  3GWO A;  3ASO B;  3JAL B;  2ZE8 A;  3H1L H;  1FFT B;  2KG7 B;  1YTF D;  5LP6 B;  1GO3 F;  4GX5 A;  4IYH A;  2ZNI A;  5B1A B;  3ZMU A;  1FAF A;  2HFE C;  4EB6 B;  4B7K A;  2JS3 A;  3W7S A;  1KYO F;  2EIM B;  2YEV B;  4LFA B;  2XAQ A;  3SYQ A;  3WB0 A;  4WCE V;  3FB8 C;  4B3M O;  2EIJ C;  4O2B B;  4LF6 O;  4DR2 B;  2EIL B;  5KHG A;  4GX2 A;  5IYC O;  1YJN V;  4RQF A;  3OFN G;  1HNZ B;  2QKA A;  2WWW A;  5FPR A;  2XTA A;  1OCO B;  1YZB A;  2EUL A;  4PI2 A;  2DW4 A;  1F4N A;  2BTQ A;  3BCC H;  3CCV V;  3L71 H;  1VF6 C;  4YHH O;  1HR0 B;  3PN1 A;  1VF6 A;  2P67 A;  4LFC O;  1AI7 A;  4FIP C;  4DR6 B;  4JV5 B;  1BT8 A;  3HKC A;  4JI2 O;  1FXK C;  2GTS A;  4JAU A;  3AEI A;  4N23 A;  5A2Q N;  3OUS A;  4LH7 A;  1J5E B;  4XDJ A;  3RFR A;  4FLV A;  4K35 A;  3U10 A;  4QNH B;  4AQY O;  4P2Z A;  4DRX B;  5CA1 A;  1Q82 W;  5KMG A;  4DUZ O;  2L35 A;  4B7E A;  5CMU A;  4J7Z A;  4J9Z B;  2FKX A;  3GB7 C;  2OIE A;  2H8P C;  3FB5 C;  1JOY A;  3WG7 B;  3BHP A;  1CP9 A;  1EN4 A;  3A0H Z;  1ZUQ A;  3HPL C;  4IT5 A;  1IBL O;  3E22 B;  1MSD A;  3IGA C;  4IHJ A;  4J9Y B;  1ZSP A;  2IH1 C;  4PA9 A;  5BY1 A;  3Q4H A;  3AG2 C;  2UXD B;  1XQ8 A;  2E75 B;  4GT1 A;  1WB8 A;  1XUQ A;  4MS2 A;  1P4R A;  2WLM A;  5EZY B;  1JR9 A;  1V54 B;  2F4V O;  4ZIB A;  4NTW A;  1N36 O;  5LYJ A;  1G8M A;  2QKS A;  2VQF O;  1SQV H;  1OHH G;  2WLK A;  3SYA A;  1ORQ C;  1FFX A;  1OCZ C;  1MNG A;  2EIN B;  2PY5 A;  3RYC B;  1XHX A;  4X1I A;  5KUK A;  5J2U B;  3QNE A;  3T1Y O;  1MZF A;  2F23 A;  3ZCC A;  3JAT A;  4DR1 O;  1TVK B;  1FPO A;  2CDY A;  1R73 A;  4B3M B;  3H9V A;  5CA1 B;  4X66 O;  3W7U A;  5IDJ A;  4FPP A;  1OJH A;  1TGO A;  4LFB O;  5KUM A;  4TOI A;  4U3J B;  2Q7E A;  4D6T H;  5GW7 A;  3DC6 A;  4WFE A;  5CBH A;  2HG5 C;  3ASN C;  3RYH A;  2AZ0 A;  4FFB A;  3D8C A;  4R6Z A;  3OUF A;  4YHH B;  2B1G A;  3APO A;  4O2A B;  4JI8 O;  1PL0 A;  1PM9 A;  4LFC B;  1IBK O;  4JI2 B;  2CAZ C;  2NN4 A;  5CA0 A;  4CH4 A;  3E8H A;  2OCH A;  3H1K H;  3K06 A;  3BA9 A;  1AJQ A;  2P90 A;  1YDX A;  3SPI A;  3OTO O;  1KUQ A;  3FB6 C;  4J7K A;  2HJD A;  4AQY B;  4JZG A;  1I94 O;  2JRI A;  4YXW G;  3LNN A;  4KXR A;  4JI4 B;  3KCY A;  3JD1 A;  5JVD B;  3CRR A;  4DUZ B;  3RYF A;  1XNR O;  1QR9 A;  2Y0P A;  5CBF A;  4LR3 A;  3AG4 C;  1XBL A;  1VMG A;  1NTM H;  5H6R A;  3B8M A;  3CYO A;  1UJW B;  3VOU A;  2YXH A;  1RM1 B;  4ZBM A;  4DK1 A;  1Q6I A;  2EIK C;  4UUJ C;  1IBL B;  2HHH O;  1OV9 A;  1WP8 A;  2QM8 A;  1N34 O;  2DN9 A;  4MW3 A;  3CJH A;  2CTQ A;  4PI0 A;  2Q5Z A;  4LF5 O;  3BEH A;  4DV2 O;  2F4V B;  3LDC A;  2VWJ A;  5IYD O;  5KAF Z;  2ITD C;  3MDS A;  3P3N A;  2VQF B;  4LF7 O;  2DYR C;  2H3O A;  4WBN B;  5KAI Z;  1VQ9 V;  4P9O A;  2KB1 A;  5FNV A;  2M6Y A;  2Z5U A;  2QWQ B;  1VQL V;  2IJI A;  1BSM A;  3ETD A;  4L87 A;  4MTO A;  3T1Y B;  1NJI W;  4DO2 A;  1J95 A;  5K1X A;  2B9Z A;  4DR1 B;  1Y4M A;  5EYP B;  1NQT A;  1S5H C;  3FAV B;  3OEE G;  1KC8 W;  4JGS A;  2RNB A;  3W7W A;  4X66 B;  2V4D A;  3RGB A;  4LFB B;  1JA8 A;  1YEW A;  2Q4P A;  2ZXW B;  4RUE A;  1M56 B;  2QDO A;  1NS1 A;  2OCC B;  3BAB A;  4H44 B;  4MW8 A;  4JI6 B;  4LNU A;  5B66 Z;  1XMQ O;  1Y76 A;  5B3S C;  1HP8 A;  4J10 A;  1XIL A;  5LA6 A;  3JYC A;  3ABM C;  3E89 A;  4O4J B;  2XAS A;  3K58 A;  2FYU H;  3ICX A;  4JI8 B;  2EBO A;  4D7T A;  5IE9 A;  1NT2 B;  2LP7 A;  1RPR A;  2BSK B;  4LH6 A;  1IBK B;  2ZIO A;  3CCQ V;  4LWS A;  2RN9 A;  4CZZ A;  1UFI A;  1AP6 A;  2LFR A;  4GKK O;  1GRJ A;  1JVM A;  1P7G A;  2R9R B;  2W6I G;  3L74 H;  2Q7H A;  1WB7 A;  3OTO B;  4JAV A;  5JH7 A;  3TGU H;  1VP7 A;  1QLE C;  3VQX A;  4H37 A;  4WF9 V;  1I94 B;  3JAW B;  2CGO A;  5CBG A;  5L3E A;  4DV4 O;  3OE7 G;  4JI0 O;  3ZED A;  1WN7 A;  1XNR B;  4FZ1 A;  3CXC U;  4MVR A;  3HKE B;  2DQ3 A;  2F93 B;  4I50 A;  4DV5 B;  2YXL A;  2AHY A;  2X0L A;  3JAK B;  4GZR B;  2ZNJ A;  2AGA A;  4JF3 A;  2HHH B;  4DR5 O;  4OX9 O;  4N21 A;  3G80 A;  5JWP A;  4YJ2 A;  5C8Y A;  1L8D A;  1FS0 G;  3L72 H;  3JAS A;  4ICG A;  2QE7 G;  3SGI A;  5FPO A;  1PPJ H;  1H2K A;  5LOV B;  2Q73 A;  2E3C A;  3OEH G;  4DV6 O;  1ARO P;  4FMT A;  1M1K W;  4LF5 B;  3ZHU A;  4PD4 F;  3K57 A;  4LNU B;  3ZN0 A;  5F2V O;  2LW1 A;  1PNK A;  3ABL C;  3TK1 A;  3BVO A;  4JI7 O;  1IX9 A;  3OT7 A;  4ABM A;  4ZHQ B;  1K34 A;  4LF7 B;  3STZ C;  1E1R G;  4CC6 A;  1GN6 A;  2HVJ C;  5L3D A;  2AXT Z;  1HWY A;  1B6Q A;  4NKG B;  4NYK A;  2YID A;  3EHB B;  2IJK A;  3CMA V;  4DV1 O;  5JH7 B;  1U97 A;  3OMI B;  3SJA C;  1GN2 A;  2GUZ A;  1CXZ B;  2OYQ A;  2QM4 A;  1KMI Z;  1Q90 D;  5CB4 B;  5BR8 O;  1WJZ A;  1Q6H A;  2Q0O C;  4FK5 C;  4UB8 Z;  1GM8 A;  5ITZ A;  1SQF A;  1XMQ B;  3ZHV A;  2YIC A;  4I55 A;  3T4D A;  4DK0 A;  4DR2 O;  2ZQM A;  3T2M A;  3FX7 A;  3K5M A;  2P6J A;  5CN0 A;  1SQQ H;  3QTC A;  1E1Q G;  4MTG A;  2A0L A;  1KEC A;  3SPG A;  1M57 B;  3TXQ A;  2VRZ A;  4YJ3 A;  1Q6U A;  4GKK B;  2YIB D;  3UO2 A;  1SQB H;  2X6C A;  2AW9 A;  1KQS U;  4JI5 O;  1NR1 A;  3LSU A;  2V1D A;  1KB9 F;  3UT5 B;  1BMF G;  3OAA G;  3A0R A;  3ASO C;  4NTY A;  2QEX V;  3CCR V;  1YI2 V;  1BZK A;  4JI3 O;  3FKS G;  4JI0 B;  1OCR B;  4RWU A;  3QVN A;  5LP6 C;  3WU2 Z;  4EKW A;  3L9D A;  2P06 A;  3ZHT A;  4JTA B;  3TXS A;  5B1A C;  3UO3 A;  3X2Q B;  5HFM A;  3LDE A;  4CS2 A;  1HNW B;  3AK2 A;  4O4L B;  4A5U B;  1JFF B;  2HLD G;  2Z0A A;  4WFH A;  5IJ0 A;  1X59 A;  2EIM C;  3A0B Z;  4DR5 B;  4OX9 B;  3RYI B;  3ZHQ A;  1H2N A;  4X1Y A;  2GUZ B;  5JQG B;  2EIL C;  1SZT A;  1O9H A;  3SR2 C;  3KG2 A;  4DV6 B;  1RSO A;  1DLB A;  4EEQ A;  1PNL A;  1OCO C;  4TUY A;  4UCO A;  5BMV B;  4U3F H;  3ZN1 A;  3CCJ V;  3KCX A;  4I55 B;  4OPH A;  2BOC C;  2R70 A;  4WFB V;  1S72 V;  4MTX A;  4O4I B;  4ZKI A;  1ENV A;  4MVS A;  4GX0 A;  1G6U A;  3VQV A;  2QA4 V;  2PTM A;  1AI4 A;  4IIJ A;  2PZS A;  2IU0 A;  3HKD A;  2AHZ A;  1US6 A;  2YI8 A;  3BRC A;  4X89 A;  1IZ3 A;  4K8Z A;  1R3J C;  2CH7 B;  4UVC A;  1ROP A;  4ZI7 A;  2RQ6 A;  3THO A;  4DV1 B;  1PL4 A;  2ZIN A;  3FYE B;  1SQX H;  1AVM A;  2LGW A;  1YJW V;  3ETE A;  1VAR A;  1FKA O;  1YXB A;  3LUT B;  4TV9 A;  5BR8 B;  2OT5 A;  3OR6 C;  3CCE V;  2G38 A;  3OW2 U;  4OGQ B;  5GON A;  3AK1 A;  4PA7 A;  1WPX A;  2XAJ A;  2W0X A;  3WG7 C;  1M4U A;  2YS8 A;  4CBC A;  1N33 O;  1URF A;  3DXR B;  3BFR A;  4HBN A;  3S3X A;  4I0X A;  5E1A C;  2CTP A;  2ODM A;  5LGU A;  1ZL8 A;  4R7C A;  1E79 G;  5KHK A;  4ASU G;  1HW7 A;  4JZ2 A;  4ZOL A;  3CME V;  3E83 A;  1JCH A;  1V54 C;  1SQP H;  1W2B U;  1WAZ A;  4JI5 B;  4B3R O;  5IY5 B;  3M99 B;  1Y6X A;  4TUY B;  1FXK A;  4UVB A;  3SDL A;  4D7S A;  1L0L H;  5KA6 A;  1VF7 A;  2XOK G;  4JI3 B;  4FFK A;  1AB3 A;  4TWK A;  3O65 A;  4NR1 A;  4G27 B;  1L1F A;  2EIN C;  3CPW U;  1PNM A;  1NH2 B;  2ZE6 A;  4X1K B;  4I4T A;  1KD1 W;  3HKD B;  4JI4 O;  4XDK A;  1BE3 H;  2PI4 A;  5LMU O;  4LC1 A;  3SJB C;  1N0J A;  5IJ9 A;  5KX5 A;  1VQM V;  1LR1 A;  3JAM N;  4Z1M G;  3CCM V;  2W6J G;  1NVP D;  1K5Q A;  5J2T A;  2Y4T A;  3U11 A;  3MD0 A;  4MT8 A;  2ADQ B;  4DW1 A;  4PJ0 Z;  4BIO A;  3D36 C;  4LF9 O;  1VQP V;  2WLL A;  2EIJ B;  2JGD A;  4KFM A;  1P7B A;  4JTC B;  4IGG A;  3CB2 A;  4HAM A;  4I0X B;  3W7X A;  4GX1 A;  5DED A;  2BTQ B;  3SPH A;  2XHB A;  1VQN V;  2OTJ V;  5EIB C;  2R72 A;  3S3W A;  3EVK A;  1BQ0 A;  4U7O A;  2Z3Y A;  4BW9 A;  2MK3 A;  3HKC B;  2PYL A;  4DR7 O;  5EBW C;  1LUV A;  3CHX A;  1FXK B;  1KP3 A;  1Z2G A;  5L3C A;  1S0V A;  1AR5 A;  2HR3 A;  3P3P A;  3STL C;  2WAM A;  3CX5 F;  4EFB A;  4RQE A;  4Q6G A;  3I56 V;  1Q81 W;  3HKB A;  2ZIM A;  4PDM A;  3CC7 V;  1VQK V;  3D3I A;  2UXC B;  3NXS A;  3E8G A;  4FJC C;  4G28 B;  4X64 O;  1RM1 C;  1N33 B;  4FLX A;  5KMG B;  1JPX A;  3SYO A;  3SPJ A;  1R1B A;  3IJ4 A;  4JI6 O;  2WLI A;  4TQD A;  4LBE C;  3AG1 B;  3RVY A;  2JGU A;  3WB1 A;  3CE2 A;  1N32 O;  3L75 H;  4BWA A;  2E74 B;  2N74 A;  1H2L A;  4C7U A;  3JAR A;  1XOU A;  4U7N A;  2R9A A;  2EJR A;  4B3R B;  2RDC A;  3PJS K;  4PA6 A;  1VF5 B;  4IHJ B;  2Y4U A;  4DV0 B;  3DC5 A;  3Q4H B;  5BZB A;  4WFF A;  3OTF A;  2KKW A;  3BY6 A;  3K5L A;  1T5E A;  4P30 A;  5LHI A;  2A06 H;  2ZT9 B;  2XAG A;  5LYJ B;  1VQ5 V;  2JEU A;  1XHZ A;  2QSA A;  5LMU B;  3LSQ A;  3ZMT A;  2W0F C;  1FD9 A;  3RW0 A;  2OWO A;  4FLT A;  3AK3 A;  1ZAU A;  3FB7 C;  1FFX B;  4O4H A;  3R66 A;  2E76 B;  4DV5 O;  2GTA A;  1X4T A;  4BIZ A;  2QWR B;  1COW G;  3IAY A;  2ZXW C;  2IBZ H;  1M56 C;  4AIL C;  4X1I B;  3J7A U;  2OCC C;  2K1E A;  2DYS B;  3K59 A;  4I5S A;  3JAT B;  4LF9 B;  3B40 A;  1JMK C;  3L70 H;  3G6B A;  1Q86 W;  4UVA A;  3RYH B;  4FFB B;  1S5J A;  3ZRX A;  2R9I A;  2PF4 E;  2ZDI C;  3UCS C;  4H0L B;  3N2K A;  4B08 A;  2ZE7 A;  1QHT A;  1SS3 A;  3CS5 A;  1XL6 A;  4J80 A;  4W4K A;  2DWD C;  2BTO A;  3ZJZ A;  3T4Z A;  4DR7 B;  5CA0 B;  1K33 A;  4GUN A;  2X6B A;  3CRQ A;  4TSF G;  5FL7 G;  3H1H H;  2B1I A;  5D5P A;  1Y74 A;  3ZRW A;  1FYJ A;  4DW0 A;  3P32 A;  4X64 B;  3TJT A;  4OXS A;  2DMX A;  5KHI A;  2UU9 O;  3RYF B;  4PV1 B;  2EX3 A;  3QO5 A;  3RWR D;  3AG4 B;  1Q43 A;  4O4H B;  2FTK A;  4YIO A;  5FLX N;  1GN3 A;  1IXM A;  1N32 B;  1BCC H;  4QPK A;  1FJG O;  4L8J A;  1SKV A;  1RP3 B;  3QO7 A;  1W59 A;  5LGT A;  3CSX A;  3DGE A;  3K9A A;  2GHY A;  1ZLZ A;  5IYZ A;  5H2F Z;  2LJ2 A;  3CJH B;  5IYB O;  2YUA A;  1XNQ O;  2P4V A;  2VQE O;  2GDS A;  3JD0 A;  4CH3 A;  4RO2 A;  1N8R W;  3UKM A;  1Q5O A;  4G2K A;  1MA1 A;  1DGS A;  1QNM A;  5JJN B;  1M90 W;  4UCT A;  3CD6 V;  3ZS8 C;  1SER A;  1HDJ A;  1O9G A;  3SJQ C;  2P4K A;  5LMN O;  5DM6 V;  2L6L A;  2Y69 B;  5FNV B;  1KKD A;  4QGP A;  5DEC A;  4FLW A;  3EXA A;  1HNW O;  5H9C A;  1V9P A;  3ZHR A;  4K0K O;  1TUB A;  3ABK C;  2EZO A;  3ETQ A;  1R3I C;  3B09 A;  2DWE C;  2B5U A;  4DR3 B;  3OR7 C;  1IVS A;  1Y74 B;  3WB2 A;  5JCO C;  1XI1 A;  1V55 B;  2PGG A;  3OMN B;  2WPD G;  4KL1 A;  1H2S B;  4F6R A;  2RJZ A;  3K5O A;  3B77 A;  3AG3 B;  4TT3 G;  1SQG A;  2UUC O;  2Q7G A;  1M57 C;  3F5W C;  3DSQ A;  2PI5 A;  4UCV A;  1G1X B;  5H6Q A;  1Y76 B;  3C3T A;  4JTD B;  1G4Y B;  5LA6 B;  4JYA O;  1IUR A;  2QJ1 A;  2QWP B;  1BQZ A;  3BAA A;  2Q6A A;  1YHQ V;  5LHH A;  1K73 W;  2CK3 G;  4LWS B;  4OPA A;  1TAE A;  2XT9 A;  1CPY A;  3A2F A;  1VIB A;  4QE7 A;  2P5O A;  1R6N A;  1W0J G;  3H1I H;  1ZX3 A;  1PD3 A;  4MTF A;  4DXW A;  3W7T A;  4PA4 A;  2CE4 A;  3X2Q C;  1AI6 A;  2FL4 A;  1EZJ A;  2BCC H;  2QWO B;  1EFR G;  4GCZ A;  4MVM A;  1WNS A;  2UU9 B;  3R65 A;  2F95 B;  1WA8 A;  3JSL A;  2F43 G;  4TV8 A;  1K97 A;  2ZR2 A;  4JYB A;  4HNA A;  4I50 B;  1Q7Y W;  2IJH A;  3UM7 A;  1JJ2 U;  1FJG B;  1KBH A;  3H1J H;  4UB6 Z;  4HYO A;  2QM7 A;  4YJ2 B;  5C8Y B;  1NTK H;  2IU3 A;  1GN4 A;  2GSM B;  3A8T A;  3JAS B;  3N2G A;  4FLU A;  4K8X A;  4BAY A;  3J81 N;  2A7W A;  1H8H G;  2Q8V A;  2JJ1 G;  2WLJ A;  1OCC C;  1QLN A;  4JAS A;  2LQT A;  5LHG A;  1XNQ B;  2VQE B;  5KHJ A;  4FM0 A;  2ITC C;  3APQ A;  1AIL A;  4YY3 O;  2EJ7 A;  1MMM A;  3GVM A;  2K9P A;  1R3L C;  1WPB A;  2NR5 A;  5IWA B;  5LMN B;  5L3B A;  2KG7 A;  5LP6 A;  3IC9 A;  4K0K B;  4UCR A;  4LF8 O;  5JJJ B;  1JQ0 A;  2YIB A;  4EB6 A;  2N04 A;  5H5N A;  5LL6 Y;  2YEV A;  3ABU A;  3CRA A;  4UV9 A;  2JJ2 G;  2QTS A;  4O2B A;  2IM9 A;  3ML0 A;  4JPR A;  3ZMZ A;  1EZV H;  3E8B A;  1WP7 A;  2UXX A;  1H8E G;  3VBB A;  2UUC B;  2V7Q G;  4W4L A;  1EN5 A;  1GKF A;  4TV8 B;  4DV7 O;  5ITZ B;  1F4M A;  1F51 A;  3HB3 B;  4UCU A;  4LCU C;  4JYA B;  4X65 O;  2M7W A;  4PDV A;  2P7T C;  5IT9 N;  2UUA O;  3M8A A;  1SET A;  2CTR A;  1THZ A;  4YJ3 B;  3ZX6 A;  3TET A;  3ZRS A;  1VQO V;  2VS0 A;  1VQ6 V;  2ETN A;  3CRM A;  3J80 N;  4UCS A;  1EBO A;  2EZP A;  2OTL V;  4GKJ O;  4NB5 A;  1U96 A;  1N4C A;  1XDC A;  1YCI A;  4PDL A;  1MOF A;  3GWK C;  2UXC O;  1R3K C;  2D3O W;  2NLJ C;  4FM2 A;  4I9W A;  1AI5 A;  2QKC A;  2HJF C;  2H94 A;  1SRY A;  5LXT A;  1SES A;  3ZRV A;  5IJ0 B;  3E22 A;  2HEP A;  4F6E A;  3N27 A;  5GTI Z;  1Z5W A;  2KSD A;  3QG5 A;  4X1Y B;  2YDE A;  1LNQ A;  3K03 A;  3CXH F;  4J11 A;  1RSO B;  3JD3 A;  1GMG A;  4FM1 A;  5EZY A;  1GM7 A;  4DV0 O;  1Y66 A;  5B1B B;  2Q68 A;  1VQ4 V;  4K3A A;  4QIW F;  4YY3 B;  1NZ6 A;  2Q9L A;  2DJV A;  5AG2 A;  3OGC C;  3OM3 B;  1BHA A;  4DV3 O;  3SYC A;  2LW7 A;  4WFA V;  2WLN A;  3ZIA G;  4HZ3 A;  4IIJ B;  5KLV H;  3JCZ A;  3RYC A;  1FXV A;  4LF8 B;  1PP9 H;  4YIP A;  5J2U A;  4GYC B;  3K04 A;  4ZI7 B;  1DF5 A;  1SZX A;  2JDI G;  5LGN A;  4DR4 O;  1AP5 A;  1TVK A;  1YF2 A;  1F23 A;  5EIB D;  2QWN B;  1P49 A;  4TV9 B;  4MVZ A;  4MVQ A;  2ZE5 A;  4U3J A;  3K3W A;  4P9P A;  3WFV A;  3D36 A;  4F4L A;  3AG1 C;  3G6E V;  5GON B;  4DV7 B;  3ETG A;  1K3E A;  4Z2W A;  1SC5 B;  4O2A A;  4X65 B;  3C90 A;  2QTO A;  3U0Z A;  1GM9 A;  3O9O A;  5LXT B;  2UUA B;  4H33 A;  5EC1 C;  4MVO A;  1ZL8 B;  4XDL A;  1YTF B;  1K9M W;  4X62 O;  3G71 V;  3KKY A;  4ZOL B;  5LBQ A;  3T1H B;  2HP8 A;  1JX9 A;  4CH6 A;  2LO1 A;  5B1O A;  4GKJ B;  3CC2 V;  1HNX B;  5JVD A;  4CS4 A;  5KA5 A;  3HR0 A;  1QVF U;  1I08 A;  1NU1 H;  3IFX A;  1A32 A;  3FD9 A;  5BXZ A;  4X20 A;  1Z5V A;  4I4T B;  2NNU A;  4NTX A;  2N05 A;  3ABT A;  3LDD A;  3VQW A;  3E8F A;  3TCU A;  4J42 A;  2DYS C;  1UPG A;  4UXN A;  1B06 A;  2X7R B;  2IW5 A;  5IJ9 B;  3CCU V;  5KX5 B;  2WLH A;  2QR4 A;  5C93 A;  1ZTE A;  4BIU A;  4JAA A;  1K5S A;  4LF6 B;  4E4E A;  1SF9 A;  4UV8 A;  5J2T B;  4NXN O;  1PV0 A;  3JSN A;  5B1N A;  3C3S A;  3IC7 A;  1I7F A;  4KP4 A;  4RUF A;  1MZE A;  5B5E Z;  3E86 A;  2ZR3 A;  2WLL B;  1BGY H;  2QGN A;  2XAH A;  3JD2 A;  2JGD B;  3AG2 B;  5EC2 C;  2KQX A;  3UQ8 A;  1GH6 A;  4JI1 O;  4WBN A;  4DV3 B;  4E2L A;  2ILM A;  2Y48 A;  3F7Y C;  5EBL C;  2GBO A;  3D3Q A;  1AJN A;  3FFQ A;  4X9Q A;  1NVP B;  2YSU B;  4FLY A;  2HKO A;  1MSW D;  4DR4 B;  5EYP A;  4KHP O;  1OCZ B;  3FAV A;  2JVD A;  1H38 A;  4JYY A;  3K79 A;  1MAB G;  1Y67 A;  5EK0 A;  4R8C A;  3MHS C;  1H2M A;  4DR3 O;  3JCU Z;  3I5D A;  5DN6 G;  2UXB O;  3HKB B;  1CEZ A;  4X20 B;  2BOB C;  2JIZ G;  1GK9 A;  4O4J A;  1ZWI C;  4RAI A;  4B3T O;  1IXB A;  3RN4 A;  2BSK A;  4FLZ A;  3CWB H;  1JJO A;  3ASN B;  2WLI B;  2AZ2 A;  3BA8 A;  2ZDI A;  3SPC A;  3JD4 A;  4X62 B;  3K0G A;  4XBF A;  1VEW A;  1GAX A;  3LNM B;  3JAR B;  3RT3 C;  2WA3 A;  1NR7 A;  3JAW A;  5GTH Z;  2YXY A;  1D5N A;  5CA3 A;  1DK1 A;  1VQ7 V;  2XND G;  4PEL A;  1N36 B;  5L3G A;  1YIT V;  3MHH C;  1B3Q A;  1VQ8 V;  1QR8 A;  2Y69 C;  4MVU A;  2A3Q A;  3HKE A;  2LFS A;  3CRC A;  5L3F A;  2WA4 A;  3T1C A;  1RPO A;  4JYC A;  1XEQ A;  3AG7 A;  3JAK A;  1XMO O;  3RVZ A;  1QQC A;  3K9S A;  1NKD A;  1V55 C;  3B8N A;  2YIA A;  2YC0 A;  5LOV A;  5E79 Z;  4LF4 O;  3CEI A;  3AG3 C;  1AR4 A;  4NXN B;  1S5L Z;  5EBM C;  1BS3 A;  1QU7 A;  3ZBH A;  2LGQ A;  2EIK B;  4EFE A;  3H01 A;  2BE3 A;  4X88 A;  4FZ0 A;  2JK5 C;  4CC5 A;  2Q69 A;  2ZKO A;  2CTW A;  4ZHQ A;  3I55 V;  1NI8 A;  4JI1 B;  2Y0I A;  2YI9 A;  1QBZ A;  1SA0 A;  5K1P A;  1S77 D;  1I5Y A;  1FXH A;  3OGI B;  1YVW A;  2A79 B;  1DTO A;  4IL6 Z;  2JS5 A;  1I0H A;  2RMK B;  2UUB O;  3N2K B;  4DYL A;  2ZD9 A;  4QJF B;  1BHB A;  5IWA O;  1LUW A;  3G4S V;  3EFF K;  1KKC A;  3DTU B;  4I9Q A;  4BW5 A;  4MSW C;  4NXM O;  2DYR B;  3CC4 V; 
#chains in the Genus database with same CATH homology
 5LP6 A;  4KHP B;  4AQY B;  4X1K B;  4I4T A;  3HKD B;  3LNN A;  5CB4 A;  4K0K B;  4UCR A;  4JI4 B;  5JJJ B;  4PHZ A;  2YIB A;  5JVD B;  4CH5 A;  3SJB C;  4EB6 A;  4DUZ B;  3RYF A;  2VWK A;  2UXB B;  1Q8I A;  4LR3 A;  5IJ9 A;  5KX5 A;  4O2B A;  5JCO A;  2IM9 A;  5KHH A;  5J2T A;  3QF7 A;  4B3T B;  3U11 A;  4DK1 A;  1IBL B;  2UUC B;  4TV8 B;  5ITZ B;  1N34 B;  2ZCE A;  4UCU A;  4JYA B;  3K5N A;  3B2E E;  4PI0 A;  3CB2 A;  2F4V B;  4YJ3 B;  3M7M X;  4DV2 B;  2BTQ B;  3UT5 A;  2XHB A;  2VWJ A;  5EIB C;  5IYZ B;  2F66 C;  2R72 A;  2PUS A;  2VQF B;  4UCS A;  1D5A A;  4BW9 A;  4WBN B;  3HKC B;  2PYL A;  5FNV A;  1SA0 B;  3CHX A;  2Q0A A;  4O4L A;  1XMO B;  1JFF A;  4EFB A;  4Q6G A;  1KU9 A;  3T1Y B;  3HKB A;  5K1X A;  3RYI A;  4DR1 B;  2ZIM A;  5EYP B;  4CS3 A;  2UXC B;  4FM2 A;  4NVP A;  5JQG A;  4LF4 B;  4X66 B;  2P22 C;  2V4D A;  3RGB A;  1N33 B;  4FLX A;  4LFB B;  1TUB B;  5KMG B;  1YEW A;  5LXT A;  2GV9 A;  4TQF A;  5IJ0 B;  3E22 A;  2HEP A;  3BAB A;  4JI6 B;  4TQD A;  4LNU A;  5BMV A;  1Z5W A;  2PYJ A;  3QG5 A;  2JGU A;  3WB1 A;  4X1Y B;  5LA6 A;  4O4J B;  3K58 A;  4F6R B;  4BWA A;  3ICX A;  4JI8 B;  4O4I A;  4D7T A;  1NT2 B;  3JAR A;  4LH6 A;  2R9A A;  4FM1 A;  1IBK B;  2ZIO A;  5EZY A;  4B3R B;  4IHJ B;  4DV0 B;  4YY3 B;  1B04 A;  2UUB B;  3BPZ A;  3JAL A;  3OTF A;  2Q7H A;  2KKW A;  4UFZ A;  3OTO B;  5JH7 A;  3MAQ A;  4GLX A;  4NXM B;  3K5L A;  3VQX A;  2E5L B;  5JJE B;  1I94 B;  3JAW B;  1T5E A;  4IIJ B;  3SJC C;  5D5Q A;  3VQY A;  3RYC A;  5LYJ B;  4LF8 B;  1XHZ A;  5J2U A;  4DUY B;  5LMU B;  4DV4 B;  3ZED A;  4GYC B;  4ZI7 B;  2OWO A;  4FLT A;  1WN7 A;  2F1M A;  4FVM A;  1XNR B;  1ZAU A;  1FFX B;  1TVK A;  5EIB D;  4O4H A;  3HKE B;  2F93 B;  1X4T A;  1P49 A;  4I50 A;  4DV5 B;  2YXL A;  4TV9 B;  4AHC A;  1M93 A;  3IAY A;  4AIL C;  3JAK B;  4X1I B;  4U3J A;  2ZNJ A;  1Q3E A;  2ZM6 B;  2HHH B;  3K59 A;  1TA8 A;  3JAT B;  4LF9 B;  1JMK C;  4YJ2 A;  5C8Y A;  5GON B;  1L8D A;  4DV7 B;  4HNA B;  3JAS A;  3SGI A;  5FPO A;  4O2A A;  5LOV B;  4X65 B;  3U0Z A;  1M5I A;  2E3C A;  5LXT B;  2UUA B;  4LF5 B;  3RYH B;  4FFB B;  1S5J A;  3K57 A;  4LNU B;  3N2G B;  3N2K A;  4B08 A;  1QHT A;  4ZHQ B;  4JI7 B;  4ZOL B;  4LF7 B;  4CC6 A;  2BTO A;  3T1H B;  4DR7 B;  4CH6 A;  5CA0 B;  4DRX A;  1IBM B;  4X1K A;  4GKJ B;  4B3S B;  1HNX B;  3JAL B;  5JVD A;  4CS4 A;  5D5P A;  5JH7 B;  4X20 A;  3SJA C;  5LP6 B;  1Z5V A;  2ZNI A;  2OYQ A;  2QM4 A;  1KMI Z;  4I4T B;  5CB4 B;  3VQW A;  4X64 B;  5KHI A;  4EB6 B;  3RYF B;  5IJ9 B;  4LFA B;  5KX5 B;  3WB0 A;  2EX3 A;  5ITZ A;  1SQF A;  3RWR D;  1Q43 A;  4O4H B;  4O2B B;  1XMQ B;  4I55 A;  4DK0 A;  4DR2 B;  3K5M A;  4LF6 B;  1N32 B;  5KHG A;  5J2T B;  4L8J A;  1SKV A;  3QTC A;  3JSN A;  1HNZ B;  1I7F A;  5FPR A;  3CSX A;  4PI2 A;  4YJ3 A;  2BTQ A;  4GKK B;  2YIB D;  1HR0 B;  5IYZ A;  3PN1 A;  4DR6 B;  4DV3 B;  3UQ8 A;  4JV5 B;  4WBN A;  3HKC A;  4CH3 A;  1Q5O A;  1DGS A;  3UT5 B;  5JJN B;  4UCT A;  4LH7 A;  3FFQ A;  3ZS8 C;  1J5E B;  4JI0 B;  1O9G A;  3RFR A;  4FLY A;  5LP6 C;  4FLV A;  4DR4 B;  5FNV B;  5EYP A;  3U10 A;  4DRX B;  4FLW A;  2JVD A;  5CA1 A;  1V9P A;  4CS2 A;  1HNW B;  4O4L B;  1TUB A;  5KMG A;  1JFF B;  3ETQ A;  5IJ0 A;  4DR5 B;  4DR3 B;  4OX9 B;  3HKB B;  3RYI B;  3WB2 A;  5JCO C;  4X20 B;  1XI1 A;  2PGG A;  4X1Y A;  4KL1 A;  1H2S B;  5JQG B;  4O4J A;  4F6R A;  3BHP A;  2RJZ A;  3K5O A;  1O9H A;  3SR2 C;  4DV6 B;  1RSO A;  1SQG A;  4EEQ A;  3E22 B;  4FLZ A;  2Q7G A;  1JJO A;  4TUY A;  3DSQ A;  4UCO A;  3BA8 A;  4IHJ A;  5BMV B;  4UCV A;  5LA6 B;  4I55 B;  2QJ1 A;  2UXD B;  1XQ8 A;  2R70 A;  4X62 B;  4O4I B;  3BAA A;  3JAR B;  5EZY B;  1G6U A;  3VQV A;  3JAW A;  2PTM A;  4IIJ A;  2PZS A;  3HKD A;  4ZIB A;  2YI8 A;  3BRC A;  1TAE A;  5LYJ A;  1N36 B;  4K8Z A;  3A2F A;  2P5O A;  4ZI7 A;  2RQ6 A;  3THO A;  4DV1 B;  2ZIN A;  1FFX A;  3HKE A;  2PY5 A;  4TV9 A;  3RYC B;  1XHX A;  5BR8 B;  3JAK A;  4X1I A;  5J2U B;  1WNS A;  2UU9 B;  2F95 B;  1QQC A;  3JAT A;  3JSL A;  4TV8 A;  1TVK B;  5GON A;  4B3M B;  2YIA A;  4HNA A;  4I50 B;  5LOV A;  1M4U A;  5CA1 B;  1TGO A;  1FJG B;  4TOI A;  4NXN B;  4U3J B;  2Q7E A;  4HBN A;  4EFE A;  3RYH A;  4FFB A;  4YJ2 B;  5C8Y B;  4CC5 A;  3JAS B;  4YHH B;  3N2G A;  4FLU A;  5KHK A;  4O2A B;  4K8X A;  1HW7 A;  4ZHQ A;  4ZOL A;  4LFC B;  4JI1 B;  1XNQ B;  2VQE B;  2YI9 A;  4JI5 B;  1SA0 A;  2CAZ C;  5K1P A;  5CA0 A;  5KHJ A;  4FM0 A;  4CH4 A;  4JI2 B;  4TUY B;  4D7S A;  2JS5 A;  1VF7 A;  3BA9 A;  3N2K B;  4JI3 B;  1WPB A;  5IWA B;  4I9Q A;  5LMN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...