1FXKA

Crystal structure of archaeal prefoldin (gimc).
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
107
structure length
107
Chain Sequence
QNVQHQLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELSRAADDAEVYKSSGNILIRVAKDELTEELQEKLETLQLREKTIERQEERVMKKLQEMQVNIQEAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords PREFOLDIN
publication title Structure of the molecular chaperone prefoldin: unique interaction of multiple coiled coil tentacles with unfolded proteins.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 40
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2000-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1fxkA00
3AEIA 1FXKA 2ZQMA 2ZDIA 1FXKC 2ZDIC 1FXKB
chains in the Genus database with same CATH superfamily
1YJNV 1JVMA 2AW9A 1EN6A 1RM1C 2IH1C 4JI3O 1N36B 2KQXA 3MD0A 4J41A 1TVKA 3JAKB 4DV3O 4NXMB 3HKBA 4R6ZA 3TJTA 4DR6O 3UKMA 4K0KO 5BMVA 3CRAA 5FPRA 4WFAV 4JYAB 5IE9A 1I5XA 1NU1H 4XDLA 3K5OA 3A0HZ 4CH4A 4ICGA 4B3RO 1Q6UA 5C8YB 1P7GA 2N05A 1Y4MA 3U10A 4GZRB 2QSAA 2NLJC 2Y69B 4Z1MG 1M57B 2XUMA 4JI3B 1VP7A 4LC1A 4ZKIA 4DV3B 4LH6A 3ABUA 4E2LA 4N23A 2YS8A 4U7NA 5H6QA 1PL4A 1AB3A 3T1HO 4K0KB 1VQKV 3E2EA 3K0DA 3DGEA 5B1OA 1MG1A 4QNHB 4OGQB 2Q0OC 2AHYA 1NQTA 1CP9A 4B3RB 1GM9A 2MW2B 3SYQA 2EJ7A 1KC8W 2VQEO 3ZHTA 2AZ0A 5TISZ 1ORQC 2GSMB 3A2FA 3T1HB 1VQ7V 4NR1A 3J7AU 5KHHA 4ZI7B 2OCCC 4O4IB 4GUNA 5J2TA 2LO1A 3GWKC 2IBZH 3CEIA 1QNMA 3CX5F 1YHQV 1ZAUA 3I56V 3ABMC 3FX7A 4UV8A 2A0LA 3CCVV 1OCRC 4CS2A 1LNQA 4FFKA 3IC7A 4XDKA 4TT3G 5EYPB 2PTMA 3J81N 1NI8A 3CJHB 1NKDA 2VQEB 2BCCH 2A06H 2X6BA 3JAWB 2DN9A 4ZHQB 3HKDA 3RYIA 3SPIA 2ZD9A 4HNAA 1HNWO 4FM0A 3B77A 1NBMG 5IDJA 3ASNC 1KBHA 3FB7C 5LA6B 1OZ0A 3R65A 1MZEA 3N2GA 5DN6G 4YJ2B 4NTWA 1K8AW 3H1LH 4I5SA 2OTLV 4O2AA 1KD1W 4JV5O 5EK0A 2JDIG 4X1IB 1RPRA 2M6YA 3APQA 5FL7G 1TUBB 4GX1A 3FAVA 3VOUA 2GTSA 1HNWB 4QPJA 3CCQV 2OIGA 3ZMUA 2E3CA 2ZE8A 4FM1A 5GONB 5DM6V 4J80A 4NVPA 2Y48A 2ILMA 2V4DA 3K9AA 2X7RB 2QA4V 4JV5B 2HVKC 1FS0G 1F4NA 1XL4A 1V55B 2UXBO 3QG5A 3CCEV 5LOVA 1H2KA 1W2BU 1Y74A 2Z0AA 1BS3A 1M57C 4LR3A 4NXNO 4X20B 4LF5O 1IXMA 3VQWA 4FMTA 4GYCB 3RYHB 1GRJA 2YXLA 4DV6O 3FD9A 4UVAA 5L3EA 1W0JG 4LWSA 2ZQMA 3CE2A 3HKEA 4F6EA 4UFZA 5EC2C 4DYLA 2ZE5A 3QTCA 2BTOA 1ZUQA 4MS2A 3E89A 2HKOA 3N2KB 3QO5A 1R6TA 5K1PA 1KMIZ 4BIUA 2EINB 2RN9A 5IJ9A 4WF9V 2N74A 2Q9LA 4NXNB 3ABTA 4LF5B 4QJFB 2QE7G 2GUZA 2RQ6A 5F2VO 4DR2O 2ZIMA 1ZWIC 4JGSA 5IYBO 5LHIA 2JVDA 3K5MA 4TOIA 2EIJB 3ZRXA 1PKXA 4I0XB 3W7SA 4DV6B 2ZKOA 3OGIB 3B8MA 5KUKA 1XHXA 1R6NA 4YXWG 3B40A 2YICA 3ZMTA 4FFBA 4FPPA 2LP7A 1SA0B 2OWOA 3CCLV 2JJ1G 5C8YA 5CBHA 2UUCO 1IXBA 1WJZA 4TQDA 3AG7A 2QEXV 2PGGA 2QJ1A 4DR2B 1VQLV 1K34A 3SYAA 1VMGA 4HBNA 1KKCA 1NZ6A 1Y66A 3LNMB 2JRIA 1SESA 4FZ1A 3GVMA 3TETA 3ZHVA 3KCXA 4B7EA 1MNGA 4TV8B 1ROPA 5JVDB 3OAAG 1F51A 3CC4V 1M90W 5LHGA 3STLC 3UO3A 4UUJC 3RYCB 2K1EA 1AR4A 2QM7A 4PJ0Z 2UUCB 1EZJA 2CH7B 3SYCA 4DR7O 1OCZB 5L3DA 1M5IA 3KZIZ 4YJ3B 2PF4E 1LUWA 1JMKC 2LFSA 1Z5WA 2PI5A 2L6LA 1B6QA 2H94A 1FXKB 1VIBA 4G27B 4O4IA 5CA0B 3P3NA 3IGAC 1O9GA 1H2SB 1XHZA 1THZA 3ASOC 1KQSU 5JQGA 5KHIA 1UFIA 4DR7B 5IYZA 3TGUH 1JJOA 2YIAA 3JAWA 3W7UA 2UUBO 3DSQA 3W7TA 1Z5VA 1Q86W 3CMAV 5B1AB 5CA1A 2QGNA 1IZ3A 1GN4A 4UV9A 4DK1A 1IBKO 4LH7A 1OCOC 1F7YA 5B3SB 1Q82W 3ABKB 3H1JH 2KG7B 5LA6A 4U7OA 2WSSG 1NH2B 2WLIB 1K5SA 1QBZA 3P3PA 4CBCA 2WPDG 1ENVA 1AR5A 2DYRB 3D3IA 3E8FA 4X1IA 3JATA 4WBNB 3ETDA 4B3SO 4G28B 4BWAA 3CC7V 1IBKB 1HNXO 3MHSC 4DV1O 1BQ0A 1GM8A 2EIJC 3R66A 3T1YO 3G80A 3JCUZ 4H0LB 2ZT9B 3GB7C 4UCVA 4JI1O 5IY5C 1QLEB 2DW4A 3JARB 3L74H 5KAIZ 1N32O 2JIZG 3OR6C 4BW5A 5DECA 4JTDB 5LYJB 3CRMA 4B3SB 1AI7A 1HNXB 2C2AA 4DV1B 1QLNA 3ZHSA 3VQVA 1TAEA 2QDOA 5D5QA 4DUZO 4FLTA 4DRXA 2HHHO 3T1YB 4MVQA 5JH7A 4P9OA 2Q5ZA 4L87A 1LR1A 5IWAO 1N0NA 5FNVA 2VRZA 4JI1B 3RT3C 2OYQA 1H2MA 4GX5A 2R9IA 2WLMA 1N32B 1MZFA 5LMUO 1IURA 2EIKB 2BOCC 3ZHUA 1PNLA 4YIOA 1FJGO 3OW2U 3N2KA 4Q6GA 3ZRVA 3CCRV 3AEIA 1B04A 2RDCA 1GAXA 4MT8A 4DR5O 4DUZB 4FLZA 2HHHB 3ETEA 2Y4TA 3C90A 5IWAB 4J42A 1M93A 1PD3A 4OPAA 4LFAO 1FXKC 4MTFA 3UCSC 4WCEV 5EBMC 1DLBA 3OT7A 3LSQA 1H8HG 1RPOA 2QTOA 3CCUV 4LF9O 3WB2A 5LMUB 1XMQO 2XHBA 4MTGA 1MOFA 2DE0X 1FJGB 5IYCO 3IFXA 1S76D 4QGPA 3ZHQA 3CSXA 5HFLA 4FLYA 4PDRA 1R3KC 1HR0O 2BE3A 2DOSA 1IBMO 1AVMA 4R8CA 3ZJZA 1M9NA 2QM8A 5B66Z 3SYPA 5B5EZ 4I7ZB 2ATKC 1W0KG 2HJDA 2R9RB 1WA8A 1PP9H 4JYCA 4Z1VA 4BIZA 3A0RA 4TUYB 4LFAB 5B3SC 2DWDC 4FJCC 4DK0A 3ABKC 2LW7A 4LF9B 3SR2C 4QE9A 2F95B 4LF4B 1HWYA 2AXTZ 3L72H 3ZMSA 5EBLC 2DWEC 4R50A 3AK3A 3ZBHA 2IH3C 3FKSG 2LGWA 2DYRC 1HR0B 1SERA 4ABMA 3ZCCA 4B08A 5LP6A 1IBMB 4D7TA 2CAZC 2OIEA 1Y76B 3S3XA 3ZMVA 1N36O 4IYHA 2JK5C 3K5NA 5KMGA 5J2UA 3I55V 3JD2A 2BTQB 4OPHA 3K79A 2Q67A 1QLEC 1S5JA 3RYFB 3FFQA 2IU3A 2QKCA 5H2FZ 2IM9A 3E22A 2N04A 4K8ZA 4IIJB 3CWBH 2XTAA 2Q7HA 2EJRA 4DW0A 1US6A 3QF7A 1ZSPA 3ZHRA 5L3CA 3OMAB 1SQBH 2B9ZA 2GV9A 1WPXA 5JJNB 1GM7A 1MSWD 4P9PA 4X89A 4B3MO 3U0ZA 1K4DC 4IHJB 4DW1A 1CEZA 4OX9O 2YI9A 4UCTA 5EC1C 3NXSA 2EIKC 3ZS8C 1SKVA 4K35A 2YEVA 1XNQO 5B1NA 1IVSA 4F6RA 4P2ZA 5IJ0B 4TSFG 2UXXA 2R9AA 3Q4HB 3JSLA 4LCUC 1Y67A 4B3MB 1XUQA 5L3GA 3LUTB 3FB6C 3NR7A 1KYOF 2K9PA 2R72A 4OX9B 4KL1A 1S72V 1K5QA 2AGAA 2DYSC 1NTZH 4H37A 1VQ5V 1IBLB 2P06A 1XQ8A 2FTKA 3RN4A 4RQFA 3BVOA 3D36A 5CMUA 1BZKA 1XNRO 1R3JC 1XNQB 3GWOA 2Q68A 3WFVA 1M4UA 1Q7YW 3CPWU 1AJQA 4O2BB 3DC5A 1MA1A 3AG3B 4C7UA 2Q0AA 1L0NH 2WLLA 2UXDO 2CTWA 3RW0A 1AP6A 3CB2A 2XAQA 2Z5UA 4JI7O 4JI0O 2EULA 4FVMA 3RGBA 2WLHA 5AG2A 3FYEB 1FFXB 2IJJA 1XNRB 2KSDA 2PY5A 1E79G 1VF5B 5CB4A 2XAFA 1TGOA 2JS3A 2NNUA 4Q20A 4IYIA 2QKAA 1XI1A 4O4LA 5BR8B 2F23A 3ZRWB 1SQGA 2CE4A 5LXTB 2UXDB 4HZ3A 5CN0A 3AG4B 2ZCEA 3U11A 4WFGA 1GK9A 3P32A 4JI7B 1AROP 1MMMA 4JI0B 3L71H 1AJNA 4U3JB 4GLXA 3JALA 1QHTA 2ZXWB 3MDSA 1G1XB 1PPJH 3OGCC 2JGDB 2PYJA 3ZX6A 2ZE6A 3H1KH 4PDVA 4I4TB 3K57A 2FYUH 3ABLB 3HKCB 1K92A 5J9PC 1EBOA 2WAMA 1Q8IA 3OFNG 1PNMA 3AK2A 4GCZA 4PELA 1X4TA 4NTYA 4X1YB 1KUQA 2NR5A 3OEHG 2ARHA 3D3QA 4MVMA 1KP3A 5LGNA 1N33O 4JZGA 3ZIAG 2R70A 3K9SA 1EM1A 3J80N 5L3FA 3SPGA 3H1IH 3A8TA 2BSKB 3DXRA 4ZBMA 4UVBA 2Y69C 3OE7G 3UT5A 4AHCA 2G38A 1D2DA 1Y76A 1YF2A 3H9VA 2LFRA 3JD4A 1VEWA 1NS1A 3ZEDA 4LNUA 2L35A 3A0BZ 4G2KA 4X1KA 1SRYA 2D3OW 2H3OA 4O4HB 1N33B 4ZOLB 1WP8A 3I5DA 3BHPA 1Q5OA 1VQ4V 4O4JB 4MTOA 2CGOA 1WB7A 2E75B 3S3WA 2Y0IA 1PV0A 3DTUB 3LNNA 5LGUA 5B1BB 4JI6B 1G6UA 3JAKA 1MSDA 3AG1B 3B4SA 4LF7O 5JWPA 1H2LA 4IL6Z 5ITZB 2D2CB 4DXWA 1VF6C 3SPHA 4A5UB 1DGSA 2Y0PA 2UXNA 3OR7C 1SQPH 2EZOA 1XMOO 5LGTA 1QR9A 4JI2O 2V7QG 4RAIA 4UB6Z 2W6JG 3X2QB 5KHJA 5L3BA 4GKJO 4JI8O 1PL0A 2WA4A 4LF7B 3E86A 1CXZB 1YJWV 2QWOB 1E1RG 3JCZA 3IJ4A 2XOKG 2FKXA 1QVFU 2ZXWC 3SPCA 1K4CC 1U96A 2XAHA 1QU7A 2VWKA 3SJAC 4PD4F 1XMOB 4JI2B 5BXZA 1AI6A 4JAVA 4GKJB 4O2BA 2V1DA 4JI8B 1BT8A 1P7BA 1W59A 2XASA 4PV1B 4ZI7A 1R6KA 2P6JA 1SQXH 3B09A 4X65O 4RUFA 3RBZA 2LGQA 5JJJB 4NB5A 2IJKA 3L73H 3JYCA 1FFXA 1ZL8B 2CTPA 1V55C 3C3SA 2Q4PA 3N27A 5KLVH 2WLKA 1AP5A 1WNSA 5EYPA 3CJHA 2ETNA 3K59A 1S5LZ 2YXHA 1H2NA 1D5AA 2WLJA 4ZHQA 1D5NA 3F7YC 1RP3B 1DK1A 1Z2GA 4PI0A 1R73A 3H1HH 3LSSA 3LDDA 4WFEA 3JASB 1XDCA 2A3QA 4X65B 1ZTEA 1XOUA 1R3LC 1SQQH 1URFA 4LP8A 1SF9A 4X66O 3G67A 5IYDO 3BAAA 4YJ2A 4CH5A 3OEEG 4GX2A 2GTAA 4JTAB 1TVKB 4MVOA 3K3WA 2EINC 3CRCA 4WFFA 3OUSA 2F4VO 1YEWA 1X59A 2CTQA 4E4EA 3K04A 1BSMA 3WG7B 2XT9A 2F43G 5K1XA 4I4TA 3BCCH 2EIMB 1TUBA 5B1BC 4FLVA 3THOA 5GONA 4X66B 4J11A 4H44B 1TA8A 2YSUB 1AILA 3JSNA 5JCOC 2HVJC 4DV4O 2F4VB 3W7XA 3KKYA 1I08A 3ETQA 3PN1A 1EN5A 2MK3A 5H6RA 4PDMA 2EILB 4J7KA 4JAUA 3X2QC 4X20A 4LF6B 5LMNO 1YSCA 2A9HA 3K08A 5KUMA 1XL6A 1OV9A 4UCSA 3RYHA 2X6CA 2Q7EA 1SC5B 5KA6A 4CC5A 3FYIB 5D5PA 2X0LA 4X64O 4O4HA 1XILA 4DV4B 1RM1B 4I50B 1H8EG 5A9GA 1B06A 5J2TB 1OCZC 1S77D 1L8DA 3IC9A 5LMNB 1Y6XA 4L8JA 1EZVH 1WB8A 2IW5A 5CBFA 1VQ6V 1PNKA 4H33A 4I0XA 2HFEC 4W4KA 1VQ9V 4FLUA 4X64B 4LF4O 3HKDB 2WWWA 4EB6B 1U97A 1NH2D 1WP7A 5JCOA 1SA0A 3G6BA 1G4YB 3EXAA 1I7FA 3N2GB 2UXCO 4PA6A 1NTMH 3VQYA 5LHHA 5B1AC 2OCHA 4O2AB 1NR7A 1H2GA 2FL4A 5IT9N 4AI8A 2QWPB 4TV8A 5JVDA 4D6TH 2QM4A 1M1KW 1Q6HA 2QR4A 3FAVB 2HR3A 4DV0B 3BEHA 4GT1A 3RYCA 1EFRG 2B1IA 2OCCB 1WLEA 2CH7A 2UXCB 1DTOA 5E79Z 4X62O 4YJ3A 4RO2A 2HP8A 3ABMB 3M99B 1OCRB 2YXYA 1PM9A 4DV5O 4UVCA 1VQMV 4PA7A 5EZYB 1FXKA 5LOVB 3CCSV 2ZIOA 3T4ZA 1Q43A 3SJQC 2CDYA 4JZ2A 5CA0A 2WLNA 3JD3A 5GW7A 3ZRSA 2HG5C 4RUEA 4I9QA 1KP2A 3TCUA 4DUYO 5HFMA 1EN4A 1HW7A 5GTIZ 3HPLC 4YHHO 4X62B 3APOA 1L0LH 3JAMN 1IDSA 1JR9A 4LWSB 3HKEB 4DR4O 3TXQA 2P4VA 2EILC 1QR8A 1P4RA 3RVYA 1VQ8V 4DV5B 2ZNIA 1BE3H 3OTFA 2E74B 5FPOA 4MVRA 3T1CA 4J9YB 1B3QA 2KG7A 2YDEA 5KAFZ 2GUZB 2WLIA 1IBLO 1BHBA 3P30A 4F4LA 4DUYB 3CYOA 5JJEB 3RWRD 4YHHB 2GDSA 3OD4A 1I5YA 4DR4B 1BGYH 4WBNA 3G4SV 1GN2A 1GTOA 1N0JA 3E83A 4FFBB 1Q81W 2JJ2G 2ZR3A 4AILC 3CRRA 4PA4A 4UCOA 2UUAO 5KX5B 1WAZA 4FZ0A 3M7MX 2A79B 3BPZA 1FFTB 3JARA 4BR6A 4DR6B 4TQFA 3K03A 1RFYA 1FAFA 4LBEC 3PJSK 1K7DA 5LYJA 3CP1A 4LF8O 5BR8O 5FLXN 4FM2A 1RSOB 1SZTA 2LQTA 1AR1B 2QWRB 3JD1A 2UUAB 3OMIB 4ZIBA 2VQFO 5EBWC 2ADPA 2JEXA 5KA5A 3BRCA 1ZLZA 2DJVA 2AZ2A 1MABG 4MW3A 3K06A 4I50A 4KUMA 1IX9A 2JGUA 2W6IG 2ZDIC 3LDEA 3LDCA 3F5WC 4LF8B 3CD6V 4RWUA 1CPYA 2IJHA 1R1BA 2IJIA 4XBFA 3E8HA 2FMLA 2ZR2A 4AQYO 2XAGA 4X8AA 5JQGB 1YITV 1S3JA 1S5HC 4CH3A 5IYZB 3CS5A 4MSWC 2VQFB 2W0XA 2BOBC 1SETA 4HYOA 3E35A 2CGNA 3SGIA 3QNEA 5CA1B 1YIJV 1I0HA 1N4CA 4EB6A 1YTFB 1QVGU 3CCMV 4X9QA 2H8PC 4ASUG 1SZXA 3ZN0A 3TK1A 5H9CA 4AQYB 3VQXA 1SQVH 3CCJV 1NVPB 1GN3A 3EHBB 4TUYA 3SPJA 1P84F 3KG2A 4N21A 4QPKA 3JATB 1N34O 4I55B 2W0FC 3KCYA 1WN7A 2QWNB 3JD0A 1BHAA 3UO2A 5KHKA 1NJIW 2FB5A 1K73W 1AI4A 1Q90D 2RMKB 4PA3A 3L75H 2ZDIA 1VQPV 3BA9A 4JF3A 4JI4O 2P90A 3AG2B 4W4LA 1GH6A 1E1QG 4YY3O 1FXVA 2O57A 1JCHA 1JFFB 4IT5A 3ASOB 3SDLA 4JI6O 1QCEA 4Z2WA 1JJ2U 1N34B 2WA3A 3O9OA 5EZYA 1YCIA 3OMNB 2JS5A 2BTQA 1DF4A 4DRXB 1JX9A 2DQ3A 5JH7B 3RYFA 3SYOA 4EFBA 1R3IC 1OCOB 4JI4B 4J7JA 5FNVB 3AG3C 1YJ9V 4EFEA 4YY3B 1HNZO 1VARA 4NYKA 4IIJA 2CUGA 1GO3F 1BMFG 2UXBB 1KU9A 3OTOO 4X88A 4R7CA 3UM7A 2Q73A 2F1MA 1BCCH 4PHZA 3TXSA 2P5OA 5CBGA 4IHJA 1KKDA 1N8RW 1XREA 2XNDG 1SQFA 4KHPO 4CZZA 2EZPA 3EFFK 3D8CA 1FPOA 4UXNA 1YTFD 4FIPC 1VQNV 1P49A 1HNZB 3SJBC 5IJ0A 1K3EA 1NTKH 5LL6Y 1VQOV 3OTOB 3Q4HA 2ZINA 5IY5B 5BY1A 3AG4C 3FB5C 2E76B 4NTXA 2QTSA 1NVPD 2UU9O 2ODMA 1K33A 3MAQA 3ZMZA 4KHPB 4RQEA 5KX5A 5CA3A 1J5EO 1WA8B 2HLDG 4KXRA 1UJWB 1OHHG 4JYYA 2YIDA 4UCRA 3W7WA 3B2EE 3HR0A 1OCCB 4K8XA 4BAYA 1KB9F 3ABLC 2PYLA 2EBOA 4J7ZA 4BIOA 2VWJA 3EVKA 1YZBA 1RSOA 1YI2V 2HJFC 2UU9B 1WPBA 2QWQB 5LP6B 3B8NA 4CC6A 4TV9B 1J5EB 3VBBA 3OUFA 3CXCU 2F66C 1VF6A 3C3TA 5EIBD 2PUSA 1JQ0A 2P4KA 1JA8A 1J95A 4B3TO 5KMGB 2ITDC 4DR3O 5J2UB 1M56B 2Q69A 4IGGA 1FXHA 3AG2C 3ZRWA 2ITCC 4KP4A 2IU0A 5LXTA 2PI4A 1Q6IA 3CXHF 4YIPA 3BA8A 4EEQA 1Q3EA 3E22B 5EIBC 1JOYA 4U3JA 3F7VC 4UCUA 1BQZA 2HEPA 1I94O 1H38A 4B3TB 3HKBB 4JTCB 5GTHZ 4DR3B 1XEQA 2JGDA 3ICXA 5BMVB 4P30A 1NR1A 3CC2V 3AK1A 1FD9A 3HKCA 4WFHA 4HAMA 4KFMA 4MVUA 4PI2A 2Q7GA 3RFRA 4I9WA 4LF6O 3MHHC 2X6AA 4FLXA 3AG1C 2EX3A 1V54B 2YEVB 4OXSA 4X1YA 4MTXA 4F6RB 2UUBB 1HP8A 4FLWA 1YDXA 3BABA 1I94B 4I55A 2ADQB 1KECA 3F5TA 4PDLA 2OTJV 2LW1A 4CS4A 2A7WA 3ML0A 2B1GA 1K97A 2ZE7A 3H01A 5C93A 2BSKA 1AI5A 4WFBV 2YIBD 3QO7A 4BW9A 2NN4A 4LFCO 1S0VA 1F4MA 4QE7A 3HB3B 2CTRA 3K5LA 2YUAA 1JFFA 3G6EV 2LJ2A 2ZNJA 4JPRA 1YXBA 4QIWF 4CH6A 1V9PA 2E5LO 4U3FH 1BL8A 2KB1A 2YI8A 4J9ZB 4ZOLA 3IAYA 3RVZA 3L9DA 2WLLB 2Y4UA 4D7SA 4LFBO 4FK5C 4H13B 1GKFA 4O4JA 2KKWA 5BZBA 1OCCC 2M7WA 4LFCB 1F23A 2Z3YA 3DC6A 2B5UA 5CB4B 4DR1O 1GN6A 3UQ8A 5LP6C 1QQCA 1COWG 1NT2B 2E5LB 4O4LB 2Q8VA 3BFRA 3CMEV 5ITZA 3WU2Z 5E1AC 4K3AA 5H5NA 2F93B 3RYIB 1FKAO 2AHZA 4HNAB 3E8BA 4LFBB 4DV0O 3OM3B 3T2MA 1DF5A 1GMGA 1A32A 1JPXA 4B7KA 4GKKO 1FYJA 1M56C 3SJCC 2PZSA 4TWKA 1G8MA 4DV7O 3JALB 3QO8A 2DYSB 3LSUA 3T4DA 3WB1A 4JASA 4MW8A 2CK3G 1SS3A 4DR1B 1O9HA 3M8AA 1ZX3A 3CHXA 1XBLA 2RJZA 4J10A 3L70H 2RNBA 2ZM6O 4DR5B 1AJPA 2JEUA 1HDJA 1UPGA 2DMXA 2GHYA 4GKKB 5LBQA 4DV7B 2YIBA 1VF7A 3WG7C 3K0GA 3K58A 2EIMC 1XMQB 5KHGA 3G71V 2QKSA 1L1FA 2DQ0A 4DV2O 1YVWA 2Q6AA 1T5EA 3O65A 1V54C 4GX0A 2ZM6B 3DXRB 5A2QN 1Y74B 4CS3A 3BY6A 3ETGA 3UT5B 4TV9A 3STZC 4MVSA 5DEDA 4JI5O 2XAJA 1LUVA 2P22C 3E8GA 2YC0A 1ZL8A 4JYBA 4LNUB 1TUEB 3ASNB 2OT5A 4NXMO 4X1KB 1K9MW 3CRQA 4DV2B 2GBOA 4DO2A 4XDJA 4JYAO 3D36C 2P7TC 2P67A 3QVNA 1OJHA 3ZN1A 3WB0A 4MVZA 4JAAA 4EKWA 3FB8C 3JASA 4PA9A 2RCVA 4NKGB 5IJ9B 4UB8Z 4JI5B 2VS0A
chains in the Genus database with same CATH topology
1NVPB 3EHBB 1YJNV 1JVMA 1RM1C 3SPJA 2IH1C 4GX5A 3MD0A 2R9IA 1AI6A 2WLMA 3KG2A 4N21A 4JAVA 4QPKA 4R6ZA 2EIKB 2BOCC 3UKMA 2V1DA 1PNLA 2W0FC 1P7BA 3OW2U 2XASA 4WFAV 3ZRVA 1I5XA 1R6KA 2P6JA 3JD0A 3CCRV 3AEIA 4XDLA 1BHAA 1NJIW 4MT8A 4RUFA 3RBZA 1K73W 1AI4A 4PA3A 3ETEA 2ZDIA 1Y4MA 1VQPV 2IJKA 4JF3A 3JYCA 2P90A 3AG2B 2NLJC 1PD3A 1FXKC 1E1QG 1V55C 2Y69B 4MTFA 1FXVA 4Z1MG 4WCEV 5EBMC 1DLBA 1M57B 2WLKA 3LSQA 1H8HG 1JCHA 4LC1A 3ASOB 1RPOA 2QTOA 4ZKIA 3CCUV 1QCEA 3ABUA 4E2LA 1JJ2U 2WLJA 4N23A 5H6QA 3F7YC 4U7NA 4MTGA 1MOFA 5IYCO 1VQKV 3OMNB 3IFXA 1S76D 3E2EA 1R73A 3K0DA 3DGEA 5B1OA 3LSSA 5HFLA 3LDDA 1MG1A 1R3KC 4PDRA 4QNHB 4WFEA 1DF4A 1JX9A 2DQ3A 2AHYA 4R8CA 1NQTA 3SYOA 3ZJZA 1CP9A 1M9NA 2QM8A 1GM9A 1R3IC 1R3LC 1OCOB 3SYPA 4LP8A 3SYQA 2ATKC 1W0KG 2R9RB 5IYDO 4JYCA 4BIZA 3A0RA 3AG3C 3OEEG 4GX2A 1YJ9V 1KC8W 4JTAB 5B3SC 2DWDC 4FJCC 4MVOA 3K3WA 3ABKC 2EINC 4WFFA 4QE9A 3OUSA 1GO3F 1BMFG 1ORQC 1HWYA 2GSMB 4X88A 4R7CA 3UM7A 3K04A 3ZMSA 5EBLC 1VQ7V 2DWEC 4R50A 3WG7B 2F43G 2OCCC 2EIMB 2IH3C 3FKSG 5CBGA 2DYRC 1SERA 1KKDA 1N8RW 5B1BC 2XNDG 3ZCCA 1YHQV 4CZZA 3I56V 3ABMC 4UV8A 2A0LA 2EZPA 3EFFK 3CCVV 1OCRC 1LNQA 3IC7A 4UXNA 4XDKA 1YTFD 4FIPC 4TT3G 2YSUB 1VQNV 3ZMVA 1NKDA 2JK5C 1K3EA 2X6BA 2HVJC 1VQOV 3W7XA 3I55V 5IY5B 3AG4C 3FB5C 3JD2A 3SPIA 3K79A 2ZD9A 2Q67A 1NVPD 3B77A 1QLEC 1K33A 2MK3A 5H6RA 4PDMA 2EILB 1NBMG 5IDJA 3ASNC 4JAUA 3X2QC 3ZMZA 2IU3A 3FB7C 1YSCA 4RQEA 1OZ0A 2A9HA 3R65A 3K08A 5CA3A 5DN6G 2HLDG 5KUMA 1XL6A 1K8AW 4I5SA 2OTLV 2X6CA 1UJWB 1OHHG 1KD1W 5KA6A 3FYIB 2EJRA 3W7WA 5EK0A 1OCCB 2JDIG 4BAYA 1RPRA 2X0LA 5L3CA 3ABLC 3OMAB 2EBOA 5FL7G 1RM1B 1WPXA 1H8EG 1GM7A 1MSWD 4P9PA 4X89A 4GX1A 1K4DC 3VOUA 2HJFC 1YI2V 1OCZC 1CEZA 1S77D 4QPJA 3CCQV 5EC1C 3NXSA 3ZMUA 3B8NA 2EIKC 5DM6V 2Y48A 2IW5A 3VBBA 3K9AA 3OUFA 3CXCU 5CBFA 2YEVA 1PNKA 4H33A 1VQ6V 5B1NA 1JQ0A 2HFEC 2X7RB 4P2ZA 1J95A 1VQ9V 4TSFG 2UXXA 2QA4V 2ITDC 2HVKC 1FS0G 1F4NA 1M56B 1XL4A 1V55B 2Q69A 4LCUC 2WWWA 3AG2C 1FXHA 3CCEV 3ZRWA 1NH2D 5L3GA 2ITCC 3FB6C 3LUTB 4KP4A 1W2BU 2IU0A 1M57C 1S72V 1K5QA 2PI4A 2DYSC 1IXMA 4H37A 1VQ5V 1G4YB 4FMTA 2FTKA 4PA6A 4RQFA 5LHHA 3D36A 5B1AC 5CMUA 1JOYA 1R3JC 1NR7A 3F7VC 4UVAA 1H2GA 3GWOA 5L3EA 2Q68A 1W0JG 2ZQMA 3WFVA 1H38A 1Q7YW 3CPWU 5EC2C 1AJQA 4JTCB 3AG3B 4MS2A 3E89A 2HKOA 1M1KW 3QO5A 4P30A 4BIUA 2EINB 2HR3A 2WLLA 1NR1A 3RW0A 3CC2V 3BEHA 4WFHA 2XAQA 4HAMA 4KFMA 4GT1A 4MVUA 4WF9V 3ABTA 1EFRG 2B1IA 2Z5UA 4QJFB 2OCCB 1WLEA 4I9WA 2QE7G 3MHHC 2X6AA 1DTOA 3AG1C 2WLHA 1ZWIC 1V54B 4JGSA 5IYBO 2YEVB 4OXSA 5LHIA 3FYEB 2IJJA 4RO2A 2EIJB 3ZRXA 1PKXA 1E79G 4MTXA 3ABMB 3W7SA 3M99B 1OCRB 2XAFA 2NNUA 4Q20A 1KECA 2OTJV 4PDLA 4UVCA 3B8MA 5KUKA 1VQMV 4PA7A 1R6NA 4YXWG 3ML0A 2B1GA 1FXKA 1K97A 3ZRWB 3ZMTA 4FPPA 3T4ZA 3CCSV 3H01A 5C93A 3SJQC 2LP7A 1AI5A 4HZ3A 4WFBV 2JJ1G 3CCLV 3QO7A 5CN0A 2WLNA 3JD3A 3AG4B 5CBHA 4WFGA 1GK9A 3P32A 2HG5C 5GW7A 3ZRSA 1AROP 4RUEA 2QEXV 1S0VA 1KP2A 1F4MA 4QE7A 3TCUA 5HFMA 3HB3B 3HPLC 1AJNA 1VQLV 1K34A 3SYAA 3G6EV 2ZXWB 1Y66A 3LNMB 1SESA 3TETA 4JPRA 4QIWF 2EILC 1QR8A 1ROPA 3OGCC 1P4RA 3OAAG 1BL8A 3RVYA 1VQ8V 2KB1A 4J9ZB 3RVZA 1F51A 3CC4V 2WLLB 1M90W 4PDVA 4FK5C 5LHGA 4MVRA 3STLC 3ABLB 3T1CA 1GKFA 4J9YB 4UUJC 1K92A 5J9PC 1EBOA 2WAMA 2K1EA 5BZBA 1OCCC 2M7WA 2QM7A 3OFNG 1PNMA 1EZJA 3SYCA 2WLIA 4PELA 4GCZA 1BHBA 1F23A 1OCZB 3P30A 4F4LA 2Z3YA 3CYOA 5L3DA 2B5UA 3OEHG 1I5YA 4MVMA 2LFSA 2PI5A 1KP3A 1COWG 3G4SV 1GTOA 5LGNA 1B6QA 3E83A 3ZIAG 2H94A 1FXKB 3CMEV 4G27B 1Q81W 5E1AC 5L3FA 3SPGA 2AHZA 3E8BA 2JJ2G 4ZBMA 3OM3B 3IGAC 4UVBA 2Y69C 2ZR3A 3OE7G 3T2MA 1DF5A 1GMGA 1THZA 3ASOC 4PA4A 1KQSU 1JPXA 1M56C 2A79B 2LFRA 4TWKA 1G8MA 3JD4A 3QO8A 1FFTB 2DYSB 3T4DA 4JASA 4MW8A 2CK3G 3K03A 3W7UA 4G2KA 3W7TA 1SRYA 1Q86W 3CMAV 4LBEC 5B1AB 2D3OW 3PJSK 1K7DA 3CP1A 4UV9A 1OCOC 5B3SB 1Q82W 1VQ4V 1AJPA 3ABKB 1SZTA 4MTOA 4U7OA 2WSSG 2JEUA 1AR1B 1NH2B 2WLIB 1K5SA 1QBZA 3JD1A 3OMIB 4CBCA 2GHYA 2WPDG 5LBQA 1ENVA 5EBWC 2DYRB 3DTUB 3WG7C 2JEXA 3D3IA 5B1BB 5KA5A 3K0GA 5LGUA 3E8FA 2EIMC 1MABG 3ETDA 3G71V 2QKSA 4MW3A 1L1FA 3AG1B 3K06A 2DQ0A 4G28B 3CC7V 4KUMA 2W6IG 2ZDIC 3LDEA 2Q6AA 3MHSC 3LDCA 3F5WC 1V54C 4GX0A 3SPHA 4DXWA 3CD6V 1GM8A 1CPYA 2EIJC 2IJHA 3BY6A 3ETGA 2IJIA 4XBFA 3E8HA 3STZC 2ZR2A 2UXNA 2XAGA 4MVSA 4X8AA 1YITV 1S3JA 1S5HC 2XAJA 3GB7C 3OR7C 3E8GA 2EZOA 4MSWC 4JYBA 5IY5C 5LGTA 1QR9A 1QLEB 2DW4A 2BOBC 2V7QG 4RAIA 1SETA 1TUEB 4HYOA 2W6JG 2OT5A 3ASNB 3E35A 3X2QB 2JIZG 3OR6C 3QNEA 4BW5A 5L3BA 1K9MW 1PL0A 4JTDB 1YIJV 3E86A 1YJWV 1YTFB 1AI7A 4DO2A 4XDJA 1QVGU 1E1RG 2P7TC 2P67A 2C2AA 3CCMV 3JCZA 1QLNA 2H8PC 3ZN1A 2XOKG 4MVZA 4EKWA 3FB8C 4ASUG 1QVFU 4PA9A 2ZXWC 3SPCA 1K4CC 4MVQA 4P9OA 3ZN0A 2XAHA 4L87A 3TK1A 5H9CA 3CCJV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEI A;  1FXK A;  2ZQM A;  2ZDI A;  1FXK C;  2ZDI C;  1FXK B; 
#chains in the Genus database with same CATH topology
 1YJN V;  1JVM A;  2AW9 A;  1EN6 A;  1RM1 C;  2IH1 C;  4JI3 O;  1N36 B;  2KQX A;  3MD0 A;  4J41 A;  1TVK A;  3JAK B;  4DV3 O;  4NXM B;  3HKB A;  4R6Z A;  3TJT A;  4DR6 O;  3UKM A;  4K0K O;  5BMV A;  3CRA A;  5FPR A;  4WFA V;  4JYA B;  5IE9 A;  1I5X A;  1NU1 H;  4XDL A;  3K5O A;  3A0H Z;  4CH4 A;  4ICG A;  4B3R O;  1Q6U A;  5C8Y B;  1P7G A;  2N05 A;  1Y4M A;  3U10 A;  4GZR B;  2QSA A;  2NLJ C;  2Y69 B;  4Z1M G;  1M57 B;  2XUM A;  4JI3 B;  1VP7 A;  4LC1 A;  4ZKI A;  4DV3 B;  4LH6 A;  3ABU A;  4E2L A;  4N23 A;  2YS8 A;  4U7N A;  5H6Q A;  1PL4 A;  1AB3 A;  3T1H O;  4K0K B;  1VQK V;  3E2E A;  3K0D A;  3DGE A;  5B1O A;  1MG1 A;  4QNH B;  4OGQ B;  2Q0O C;  2AHY A;  1NQT A;  1CP9 A;  4B3R B;  1GM9 A;  2MW2 B;  3SYQ A;  2EJ7 A;  1KC8 W;  2VQE O;  3ZHT A;  2AZ0 A;  5TIS Z;  1ORQ C;  2GSM B;  3A2F A;  3T1H B;  1VQ7 V;  4NR1 A;  3J7A U;  5KHH A;  4ZI7 B;  2OCC C;  4O4I B;  4GUN A;  5J2T A;  2LO1 A;  3GWK C;  2IBZ H;  3CEI A;  1QNM A;  3CX5 F;  1YHQ V;  1ZAU A;  3I56 V;  3ABM C;  3FX7 A;  4UV8 A;  2A0L A;  3CCV V;  1OCR C;  4CS2 A;  1LNQ A;  4FFK A;  3IC7 A;  4XDK A;  4TT3 G;  5EYP B;  2PTM A;  3J81 N;  1NI8 A;  3CJH B;  1NKD A;  2VQE B;  2BCC H;  2A06 H;  2X6B A;  3JAW B;  2DN9 A;  4ZHQ B;  3HKD A;  3RYI A;  3SPI A;  2ZD9 A;  4HNA A;  1HNW O;  4FM0 A;  3B77 A;  1NBM G;  5IDJ A;  3ASN C;  1KBH A;  3FB7 C;  5LA6 B;  1OZ0 A;  3R65 A;  1MZE A;  3N2G A;  5DN6 G;  4YJ2 B;  4NTW A;  1K8A W;  3H1L H;  4I5S A;  2OTL V;  4O2A A;  1KD1 W;  4JV5 O;  5EK0 A;  2JDI G;  4X1I B;  1RPR A;  2M6Y A;  3APQ A;  5FL7 G;  1TUB B;  4GX1 A;  3FAV A;  3VOU A;  2GTS A;  1HNW B;  4QPJ A;  3CCQ V;  2OIG A;  3ZMU A;  2E3C A;  2ZE8 A;  4FM1 A;  5GON B;  5DM6 V;  4J80 A;  4NVP A;  2Y48 A;  2ILM A;  2V4D A;  3K9A A;  2X7R B;  2QA4 V;  4JV5 B;  2HVK C;  1FS0 G;  1F4N A;  1XL4 A;  1V55 B;  2UXB O;  3QG5 A;  3CCE V;  5LOV A;  1H2K A;  1W2B U;  1Y74 A;  2Z0A A;  1BS3 A;  1M57 C;  4LR3 A;  4NXN O;  4X20 B;  4LF5 O;  1IXM A;  3VQW A;  4FMT A;  4GYC B;  3RYH B;  1GRJ A;  2YXL A;  4DV6 O;  3FD9 A;  4UVA A;  5L3E A;  1W0J G;  4LWS A;  2ZQM A;  3CE2 A;  3HKE A;  4F6E A;  4UFZ A;  5EC2 C;  4DYL A;  2ZE5 A;  3QTC A;  2BTO A;  1ZUQ A;  4MS2 A;  3E89 A;  2HKO A;  3N2K B;  3QO5 A;  1R6T A;  5K1P A;  1KMI Z;  4BIU A;  2EIN B;  2RN9 A;  5IJ9 A;  4WF9 V;  2N74 A;  2Q9L A;  4NXN B;  3ABT A;  4LF5 B;  4QJF B;  2QE7 G;  2GUZ A;  2RQ6 A;  5F2V O;  4DR2 O;  2ZIM A;  1ZWI C;  4JGS A;  5IYB O;  5LHI A;  2JVD A;  3K5M A;  4TOI A;  2EIJ B;  3ZRX A;  1PKX A;  4I0X B;  3W7S A;  4DV6 B;  2ZKO A;  3OGI B;  3B8M A;  5KUK A;  1XHX A;  1R6N A;  4YXW G;  3B40 A;  2YIC A;  3ZMT A;  4FFB A;  4FPP A;  2LP7 A;  1SA0 B;  2OWO A;  3CCL V;  2JJ1 G;  5C8Y A;  5CBH A;  2UUC O;  1IXB A;  1WJZ A;  4TQD A;  3AG7 A;  2QEX V;  2PGG A;  2QJ1 A;  4DR2 B;  1VQL V;  1K34 A;  3SYA A;  1VMG A;  4HBN A;  1KKC A;  1NZ6 A;  1Y66 A;  3LNM B;  2JRI A;  1SES A;  4FZ1 A;  3GVM A;  3TET A;  3ZHV A;  3KCX A;  4B7E A;  1MNG A;  4TV8 B;  1ROP A;  5JVD B;  3OAA G;  1F51 A;  3CC4 V;  1M90 W;  5LHG A;  3STL C;  3UO3 A;  4UUJ C;  3RYC B;  2K1E A;  1AR4 A;  2QM7 A;  4PJ0 Z;  2UUC B;  1EZJ A;  2CH7 B;  3SYC A;  4DR7 O;  1OCZ B;  5L3D A;  1M5I A;  3KZI Z;  4YJ3 B;  2PF4 E;  1LUW A;  1JMK C;  2LFS A;  1Z5W A;  2PI5 A;  2L6L A;  1B6Q A;  2H94 A;  1FXK B;  1VIB A;  4G27 B;  4O4I A;  5CA0 B;  3P3N A;  3IGA C;  1O9G A;  1H2S B;  1XHZ A;  1THZ A;  3ASO C;  1KQS U;  5JQG A;  5KHI A;  1UFI A;  4DR7 B;  5IYZ A;  3TGU H;  1JJO A;  2YIA A;  3JAW A;  3W7U A;  2UUB O;  3DSQ A;  3W7T A;  1Z5V A;  1Q86 W;  3CMA V;  5B1A B;  5CA1 A;  2QGN A;  1IZ3 A;  1GN4 A;  4UV9 A;  4DK1 A;  1IBK O;  4LH7 A;  1OCO C;  1F7Y A;  5B3S B;  1Q82 W;  3ABK B;  3H1J H;  2KG7 B;  5LA6 A;  4U7O A;  2WSS G;  1NH2 B;  2WLI B;  1K5S A;  1QBZ A;  3P3P A;  4CBC A;  2WPD G;  1ENV A;  1AR5 A;  2DYR B;  3D3I A;  3E8F A;  4X1I A;  3JAT A;  4WBN B;  3ETD A;  4B3S O;  4G28 B;  4BWA A;  3CC7 V;  1IBK B;  1HNX O;  3MHS C;  4DV1 O;  1BQ0 A;  1GM8 A;  2EIJ C;  3R66 A;  3T1Y O;  3G80 A;  3JCU Z;  4H0L B;  2ZT9 B;  3GB7 C;  4UCV A;  4JI1 O;  5IY5 C;  1QLE B;  2DW4 A;  3JAR B;  3L74 H;  5KAI Z;  1N32 O;  2JIZ G;  3OR6 C;  4BW5 A;  5DEC A;  4JTD B;  5LYJ B;  3CRM A;  4B3S B;  1AI7 A;  1HNX B;  2C2A A;  4DV1 B;  1QLN A;  3ZHS A;  3VQV A;  1TAE A;  2QDO A;  5D5Q A;  4DUZ O;  4FLT A;  4DRX A;  2HHH O;  3T1Y B;  4MVQ A;  5JH7 A;  4P9O A;  2Q5Z A;  4L87 A;  1LR1 A;  5IWA O;  1N0N A;  5FNV A;  2VRZ A;  4JI1 B;  3RT3 C;  2OYQ A;  1H2M A;  4GX5 A;  2R9I A;  2WLM A;  1N32 B;  1MZF A;  5LMU O;  1IUR A;  2EIK B;  2BOC C;  3ZHU A;  1PNL A;  4YIO A;  1FJG O;  3OW2 U;  3N2K A;  4Q6G A;  3ZRV A;  3CCR V;  3AEI A;  1B04 A;  2RDC A;  1GAX A;  4MT8 A;  4DR5 O;  4DUZ B;  4FLZ A;  2HHH B;  3ETE A;  2Y4T A;  3C90 A;  5IWA B;  4J42 A;  1M93 A;  1PD3 A;  4OPA A;  4LFA O;  1FXK C;  4MTF A;  3UCS C;  4WCE V;  5EBM C;  1DLB A;  3OT7 A;  3LSQ A;  1H8H G;  1RPO A;  2QTO A;  3CCU V;  4LF9 O;  3WB2 A;  5LMU B;  1XMQ O;  2XHB A;  4MTG A;  1MOF A;  2DE0 X;  1FJG B;  5IYC O;  3IFX A;  1S76 D;  4QGP A;  3ZHQ A;  3CSX A;  5HFL A;  4FLY A;  4PDR A;  1R3K C;  1HR0 O;  2BE3 A;  2DOS A;  1IBM O;  1AVM A;  4R8C A;  3ZJZ A;  1M9N A;  2QM8 A;  5B66 Z;  3SYP A;  5B5E Z;  4I7Z B;  2ATK C;  1W0K G;  2HJD A;  2R9R B;  1WA8 A;  1PP9 H;  4JYC A;  4Z1V A;  4BIZ A;  3A0R A;  4TUY B;  4LFA B;  5B3S C;  2DWD C;  4FJC C;  4DK0 A;  3ABK C;  2LW7 A;  4LF9 B;  3SR2 C;  4QE9 A;  2F95 B;  4LF4 B;  1HWY A;  2AXT Z;  3L72 H;  3ZMS A;  5EBL C;  2DWE C;  4R50 A;  3AK3 A;  3ZBH A;  2IH3 C;  3FKS G;  2LGW A;  2DYR C;  1HR0 B;  1SER A;  4ABM A;  3ZCC A;  4B08 A;  5LP6 A;  1IBM B;  4D7T A;  2CAZ C;  2OIE A;  1Y76 B;  3S3X A;  3ZMV A;  1N36 O;  4IYH A;  2JK5 C;  3K5N A;  5KMG A;  5J2U A;  3I55 V;  3JD2 A;  2BTQ B;  4OPH A;  3K79 A;  2Q67 A;  1QLE C;  1S5J A;  3RYF B;  3FFQ A;  2IU3 A;  2QKC A;  5H2F Z;  2IM9 A;  3E22 A;  2N04 A;  4K8Z A;  4IIJ B;  3CWB H;  2XTA A;  2Q7H A;  2EJR A;  4DW0 A;  1US6 A;  3QF7 A;  1ZSP A;  3ZHR A;  5L3C A;  3OMA B;  1SQB H;  2B9Z A;  2GV9 A;  1WPX A;  5JJN B;  1GM7 A;  1MSW D;  4P9P A;  4X89 A;  4B3M O;  3U0Z A;  1K4D C;  4IHJ B;  4DW1 A;  1CEZ A;  4OX9 O;  2YI9 A;  4UCT A;  5EC1 C;  3NXS A;  2EIK C;  3ZS8 C;  1SKV A;  4K35 A;  2YEV A;  1XNQ O;  5B1N A;  1IVS A;  4F6R A;  4P2Z A;  5IJ0 B;  4TSF G;  2UXX A;  2R9A A;  3Q4H B;  3JSL A;  4LCU C;  1Y67 A;  4B3M B;  1XUQ A;  5L3G A;  3LUT B;  3FB6 C;  3NR7 A;  1KYO F;  2K9P A;  2R72 A;  4OX9 B;  4KL1 A;  1S72 V;  1K5Q A;  2AGA A;  2DYS C;  1NTZ H;  4H37 A;  1VQ5 V;  1IBL B;  2P06 A;  1XQ8 A;  2FTK A;  3RN4 A;  4RQF A;  3BVO A;  3D36 A;  5CMU A;  1BZK A;  1XNR O;  1R3J C;  1XNQ B;  3GWO A;  2Q68 A;  3WFV A;  1M4U A;  1Q7Y W;  3CPW U;  1AJQ A;  4O2B B;  3DC5 A;  1MA1 A;  3AG3 B;  4C7U A;  2Q0A A;  1L0N H;  2WLL A;  2UXD O;  2CTW A;  3RW0 A;  1AP6 A;  3CB2 A;  2XAQ A;  2Z5U A;  4JI7 O;  4JI0 O;  2EUL A;  4FVM A;  3RGB A;  2WLH A;  5AG2 A;  3FYE B;  1FFX B;  2IJJ A;  1XNR B;  2KSD A;  2PY5 A;  1E79 G;  1VF5 B;  5CB4 A;  2XAF A;  1TGO A;  2JS3 A;  2NNU A;  4Q20 A;  4IYI A;  2QKA A;  1XI1 A;  4O4L A;  5BR8 B;  2F23 A;  3ZRW B;  1SQG A;  2CE4 A;  5LXT B;  2UXD B;  4HZ3 A;  5CN0 A;  3AG4 B;  2ZCE A;  3U11 A;  4WFG A;  1GK9 A;  3P32 A;  4JI7 B;  1ARO P;  1MMM A;  4JI0 B;  3L71 H;  1AJN A;  4U3J B;  4GLX A;  3JAL A;  1QHT A;  2ZXW B;  3MDS A;  1G1X B;  1PPJ H;  3OGC C;  2JGD B;  2PYJ A;  3ZX6 A;  2ZE6 A;  3H1K H;  4PDV A;  4I4T B;  3K57 A;  2FYU H;  3ABL B;  3HKC B;  1K92 A;  5J9P C;  1EBO A;  2WAM A;  1Q8I A;  3OFN G;  1PNM A;  3AK2 A;  4GCZ A;  4PEL A;  1X4T A;  4NTY A;  4X1Y B;  1KUQ A;  2NR5 A;  3OEH G;  2ARH A;  3D3Q A;  4MVM A;  1KP3 A;  5LGN A;  1N33 O;  4JZG A;  3ZIA G;  2R70 A;  3K9S A;  1EM1 A;  3J80 N;  5L3F A;  3SPG A;  3H1I H;  3A8T A;  2BSK B;  3DXR A;  4ZBM A;  4UVB A;  2Y69 C;  3OE7 G;  3UT5 A;  4AHC A;  2G38 A;  1D2D A;  1Y76 A;  1YF2 A;  3H9V A;  2LFR A;  3JD4 A;  1VEW A;  1NS1 A;  3ZED A;  4LNU A;  2L35 A;  3A0B Z;  4G2K A;  4X1K A;  1SRY A;  2D3O W;  2H3O A;  4O4H B;  1N33 B;  4ZOL B;  1WP8 A;  3I5D A;  3BHP A;  1Q5O A;  1VQ4 V;  4O4J B;  4MTO A;  2CGO A;  1WB7 A;  2E75 B;  3S3W A;  2Y0I A;  1PV0 A;  3DTU B;  3LNN A;  5LGU A;  5B1B B;  4JI6 B;  1G6U A;  3JAK A;  1MSD A;  3AG1 B;  3B4S A;  4LF7 O;  5JWP A;  1H2L A;  4IL6 Z;  5ITZ B;  2D2C B;  4DXW A;  1VF6 C;  3SPH A;  4A5U B;  1DGS A;  2Y0P A;  2UXN A;  3OR7 C;  1SQP H;  2EZO A;  1XMO O;  5LGT A;  1QR9 A;  4JI2 O;  2V7Q G;  4RAI A;  4UB6 Z;  2W6J G;  3X2Q B;  5KHJ A;  5L3B A;  4GKJ O;  4JI8 O;  1PL0 A;  2WA4 A;  4LF7 B;  3E86 A;  1CXZ B;  1YJW V;  2QWO B;  1E1R G;  3JCZ A;  3IJ4 A;  2XOK G;  2FKX A;  1QVF U;  2ZXW C;  3SPC A;  1K4C C;  1U96 A;  2XAH A;  1QU7 A;  2VWK A;  3SJA C;  4PD4 F;  1XMO B;  4JI2 B;  5BXZ A;  1AI6 A;  4JAV A;  4GKJ B;  4O2B A;  2V1D A;  4JI8 B;  1BT8 A;  1P7B A;  1W59 A;  2XAS A;  4PV1 B;  4ZI7 A;  1R6K A;  2P6J A;  1SQX H;  3B09 A;  4X65 O;  4RUF A;  3RBZ A;  2LGQ A;  5JJJ B;  4NB5 A;  2IJK A;  3L73 H;  3JYC A;  1FFX A;  1ZL8 B;  2CTP A;  1V55 C;  3C3S A;  2Q4P A;  3N27 A;  5KLV H;  2WLK A;  1AP5 A;  1WNS A;  5EYP A;  3CJH A;  2ETN A;  3K59 A;  1S5L Z;  2YXH A;  1H2N A;  1D5A A;  2WLJ A;  4ZHQ A;  1D5N A;  3F7Y C;  1RP3 B;  1DK1 A;  1Z2G A;  4PI0 A;  1R73 A;  3H1H H;  3LSS A;  3LDD A;  4WFE A;  3JAS B;  1XDC A;  2A3Q A;  4X65 B;  1ZTE A;  1XOU A;  1R3L C;  1SQQ H;  1URF A;  4LP8 A;  1SF9 A;  4X66 O;  3G67 A;  5IYD O;  3BAA A;  4YJ2 A;  4CH5 A;  3OEE G;  4GX2 A;  2GTA A;  4JTA B;  1TVK B;  4MVO A;  3K3W A;  2EIN C;  3CRC A;  4WFF A;  3OUS A;  2F4V O;  1YEW A;  1X59 A;  2CTQ A;  4E4E A;  3K04 A;  1BSM A;  3WG7 B;  2XT9 A;  2F43 G;  5K1X A;  4I4T A;  3BCC H;  2EIM B;  1TUB A;  5B1B C;  4FLV A;  3THO A;  5GON A;  4X66 B;  4J11 A;  4H44 B;  1TA8 A;  2YSU B;  1AIL A;  3JSN A;  5JCO C;  2HVJ C;  4DV4 O;  2F4V B;  3W7X A;  3KKY A;  1I08 A;  3ETQ A;  3PN1 A;  1EN5 A;  2MK3 A;  5H6R A;  4PDM A;  2EIL B;  4J7K A;  4JAU A;  3X2Q C;  4X20 A;  4LF6 B;  5LMN O;  1YSC A;  2A9H A;  3K08 A;  5KUM A;  1XL6 A;  1OV9 A;  4UCS A;  3RYH A;  2X6C A;  2Q7E A;  1SC5 B;  5KA6 A;  4CC5 A;  3FYI B;  5D5P A;  2X0L A;  4X64 O;  4O4H A;  1XIL A;  4DV4 B;  1RM1 B;  4I50 B;  1H8E G;  5A9G A;  1B06 A;  5J2T B;  1OCZ C;  1S77 D;  1L8D A;  3IC9 A;  5LMN B;  1Y6X A;  4L8J A;  1EZV H;  1WB8 A;  2IW5 A;  5CBF A;  1VQ6 V;  1PNK A;  4H33 A;  4I0X A;  2HFE C;  4W4K A;  1VQ9 V;  4FLU A;  4X64 B;  4LF4 O;  3HKD B;  2WWW A;  4EB6 B;  1U97 A;  1NH2 D;  1WP7 A;  5JCO A;  1SA0 A;  3G6B A;  1G4Y B;  3EXA A;  1I7F A;  3N2G B;  2UXC O;  4PA6 A;  1NTM H;  3VQY A;  5LHH A;  5B1A C;  2OCH A;  4O2A B;  1NR7 A;  1H2G A;  2FL4 A;  5IT9 N;  4AI8 A;  2QWP B;  4TV8 A;  5JVD A;  4D6T H;  2QM4 A;  1M1K W;  1Q6H A;  2QR4 A;  3FAV B;  2HR3 A;  4DV0 B;  3BEH A;  4GT1 A;  3RYC A;  1EFR G;  2B1I A;  2OCC B;  1WLE A;  2CH7 A;  2UXC B;  1DTO A;  5E79 Z;  4X62 O;  4YJ3 A;  4RO2 A;  2HP8 A;  3ABM B;  3M99 B;  1OCR B;  2YXY A;  1PM9 A;  4DV5 O;  4UVC A;  1VQM V;  4PA7 A;  5EZY B;  1FXK A;  5LOV B;  3CCS V;  2ZIO A;  3T4Z A;  1Q43 A;  3SJQ C;  2CDY A;  4JZ2 A;  5CA0 A;  2WLN A;  3JD3 A;  5GW7 A;  3ZRS A;  2HG5 C;  4RUE A;  4I9Q A;  1KP2 A;  3TCU A;  4DUY O;  5HFM A;  1EN4 A;  1HW7 A;  5GTI Z;  3HPL C;  4YHH O;  4X62 B;  3APO A;  1L0L H;  3JAM N;  1IDS A;  1JR9 A;  4LWS B;  3HKE B;  4DR4 O;  3TXQ A;  2P4V A;  2EIL C;  1QR8 A;  1P4R A;  3RVY A;  1VQ8 V;  4DV5 B;  2ZNI A;  1BE3 H;  3OTF A;  2E74 B;  5FPO A;  4MVR A;  3T1C A;  4J9Y B;  1B3Q A;  2KG7 A;  2YDE A;  5KAF Z;  2GUZ B;  2WLI A;  1IBL O;  1BHB A;  3P30 A;  4F4L A;  4DUY B;  3CYO A;  5JJE B;  3RWR D;  4YHH B;  2GDS A;  3OD4 A;  1I5Y A;  4DR4 B;  1BGY H;  4WBN A;  3G4S V;  1GN2 A;  1GTO A;  1N0J A;  3E83 A;  4FFB B;  1Q81 W;  2JJ2 G;  2ZR3 A;  4AIL C;  3CRR A;  4PA4 A;  4UCO A;  2UUA O;  5KX5 B;  1WAZ A;  4FZ0 A;  3M7M X;  2A79 B;  3BPZ A;  1FFT B;  3JAR A;  4BR6 A;  4DR6 B;  4TQF A;  3K03 A;  1RFY A;  1FAF A;  4LBE C;  3PJS K;  1K7D A;  5LYJ A;  3CP1 A;  4LF8 O;  5BR8 O;  5FLX N;  4FM2 A;  1RSO B;  1SZT A;  2LQT A;  1AR1 B;  2QWR B;  3JD1 A;  2UUA B;  3OMI B;  4ZIB A;  2VQF O;  5EBW C;  2ADP A;  2JEX A;  5KA5 A;  3BRC A;  1ZLZ A;  2DJV A;  2AZ2 A;  1MAB G;  4MW3 A;  3K06 A;  4I50 A;  4KUM A;  1IX9 A;  2JGU A;  2W6I G;  2ZDI C;  3LDE A;  3LDC A;  3F5W C;  4LF8 B;  3CD6 V;  4RWU A;  1CPY A;  2IJH A;  1R1B A;  2IJI A;  4XBF A;  3E8H A;  2FML A;  2ZR2 A;  4AQY O;  2XAG A;  4X8A A;  5JQG B;  1YIT V;  1S3J A;  1S5H C;  4CH3 A;  5IYZ B;  3CS5 A;  4MSW C;  2VQF B;  2W0X A;  2BOB C;  1SET A;  4HYO A;  3E35 A;  2CGN A;  3SGI A;  3QNE A;  5CA1 B;  1YIJ V;  1I0H A;  1N4C A;  4EB6 A;  1YTF B;  1QVG U;  3CCM V;  4X9Q A;  2H8P C;  4ASU G;  1SZX A;  3ZN0 A;  3TK1 A;  5H9C A;  4AQY B;  3VQX A;  1SQV H;  3CCJ V;  1NVP B;  1GN3 A;  3EHB B;  4TUY A;  3SPJ A;  1P84 F;  3KG2 A;  4N21 A;  4QPK A;  3JAT B;  1N34 O;  4I55 B;  2W0F C;  3KCY A;  1WN7 A;  2QWN B;  3JD0 A;  1BHA A;  3UO2 A;  5KHK A;  1NJI W;  2FB5 A;  1K73 W;  1AI4 A;  1Q90 D;  2RMK B;  4PA3 A;  3L75 H;  2ZDI A;  1VQP V;  3BA9 A;  4JF3 A;  4JI4 O;  2P90 A;  3AG2 B;  4W4L A;  1GH6 A;  1E1Q G;  4YY3 O;  1FXV A;  2O57 A;  1JCH A;  1JFF B;  4IT5 A;  3ASO B;  3SDL A;  4JI6 O;  1QCE A;  4Z2W A;  1JJ2 U;  1N34 B;  2WA3 A;  3O9O A;  5EZY A;  1YCI A;  3OMN B;  2JS5 A;  2BTQ A;  1DF4 A;  4DRX B;  1JX9 A;  2DQ3 A;  5JH7 B;  3RYF A;  3SYO A;  4EFB A;  1R3I C;  1OCO B;  4JI4 B;  4J7J A;  5FNV B;  3AG3 C;  1YJ9 V;  4EFE A;  4YY3 B;  1HNZ O;  1VAR A;  4NYK A;  4IIJ A;  2CUG A;  1GO3 F;  1BMF G;  2UXB B;  1KU9 A;  3OTO O;  4X88 A;  4R7C A;  3UM7 A;  2Q73 A;  2F1M A;  1BCC H;  4PHZ A;  3TXS A;  2P5O A;  5CBG A;  4IHJ A;  1KKD A;  1N8R W;  1XRE A;  2XND G;  1SQF A;  4KHP O;  4CZZ A;  2EZP A;  3EFF K;  3D8C A;  1FPO A;  4UXN A;  1YTF D;  4FIP C;  1VQN V;  1P49 A;  1HNZ B;  3SJB C;  5IJ0 A;  1K3E A;  1NTK H;  5LL6 Y;  1VQO V;  3OTO B;  3Q4H A;  2ZIN A;  5IY5 B;  5BY1 A;  3AG4 C;  3FB5 C;  2E76 B;  4NTX A;  2QTS A;  1NVP D;  2UU9 O;  2ODM A;  1K33 A;  3MAQ A;  3ZMZ A;  4KHP B;  4RQE A;  5KX5 A;  5CA3 A;  1J5E O;  1WA8 B;  2HLD G;  4KXR A;  1UJW B;  1OHH G;  4JYY A;  2YID A;  4UCR A;  3W7W A;  3B2E E;  3HR0 A;  1OCC B;  4K8X A;  4BAY A;  1KB9 F;  3ABL C;  2PYL A;  2EBO A;  4J7Z A;  4BIO A;  2VWJ A;  3EVK A;  1YZB A;  1RSO A;  1YI2 V;  2HJF C;  2UU9 B;  1WPB A;  2QWQ B;  5LP6 B;  3B8N A;  4CC6 A;  4TV9 B;  1J5E B;  3VBB A;  3OUF A;  3CXC U;  2F66 C;  1VF6 A;  3C3T A;  5EIB D;  2PUS A;  1JQ0 A;  2P4K A;  1JA8 A;  1J95 A;  4B3T O;  5KMG B;  2ITD C;  4DR3 O;  5J2U B;  1M56 B;  2Q69 A;  4IGG A;  1FXH A;  3AG2 C;  3ZRW A;  2ITC C;  4KP4 A;  2IU0 A;  5LXT A;  2PI4 A;  1Q6I A;  3CXH F;  4YIP A;  3BA8 A;  4EEQ A;  1Q3E A;  3E22 B;  5EIB C;  1JOY A;  4U3J A;  3F7V C;  4UCU A;  1BQZ A;  2HEP A;  1I94 O;  1H38 A;  4B3T B;  3HKB B;  4JTC B;  5GTH Z;  4DR3 B;  1XEQ A;  2JGD A;  3ICX A;  5BMV B;  4P30 A;  1NR1 A;  3CC2 V;  3AK1 A;  1FD9 A;  3HKC A;  4WFH A;  4HAM A;  4KFM A;  4MVU A;  4PI2 A;  2Q7G A;  3RFR A;  4I9W A;  4LF6 O;  3MHH C;  2X6A A;  4FLX A;  3AG1 C;  2EX3 A;  1V54 B;  2YEV B;  4OXS A;  4X1Y A;  4MTX A;  4F6R B;  2UUB B;  1HP8 A;  4FLW A;  1YDX A;  3BAB A;  1I94 B;  4I55 A;  2ADQ B;  1KEC A;  3F5T A;  4PDL A;  2OTJ V;  2LW1 A;  4CS4 A;  2A7W A;  3ML0 A;  2B1G A;  1K97 A;  2ZE7 A;  3H01 A;  5C93 A;  2BSK A;  1AI5 A;  4WFB V;  2YIB D;  3QO7 A;  4BW9 A;  2NN4 A;  4LFC O;  1S0V A;  1F4M A;  4QE7 A;  3HB3 B;  2CTR A;  3K5L A;  2YUA A;  1JFF A;  3G6E V;  2LJ2 A;  2ZNJ A;  4JPR A;  1YXB A;  4QIW F;  4CH6 A;  1V9P A;  2E5L O;  4U3F H;  1BL8 A;  2KB1 A;  2YI8 A;  4J9Z B;  4ZOL A;  3IAY A;  3RVZ A;  3L9D A;  2WLL B;  2Y4U A;  4D7S A;  4LFB O;  4FK5 C;  4H13 B;  1GKF A;  4O4J A;  2KKW A;  5BZB A;  1OCC C;  2M7W A;  4LFC B;  1F23 A;  2Z3Y A;  3DC6 A;  2B5U A;  5CB4 B;  4DR1 O;  1GN6 A;  3UQ8 A;  5LP6 C;  1QQC A;  1COW G;  1NT2 B;  2E5L B;  4O4L B;  2Q8V A;  3BFR A;  3CME V;  5ITZ A;  3WU2 Z;  5E1A C;  4K3A A;  5H5N A;  2F93 B;  3RYI B;  1FKA O;  2AHZ A;  4HNA B;  3E8B A;  4LFB B;  4DV0 O;  3OM3 B;  3T2M A;  1DF5 A;  1GMG A;  1A32 A;  1JPX A;  4B7K A;  4GKK O;  1FYJ A;  1M56 C;  3SJC C;  2PZS A;  4TWK A;  1G8M A;  4DV7 O;  3JAL B;  3QO8 A;  2DYS B;  3LSU A;  3T4D A;  3WB1 A;  4JAS A;  4MW8 A;  2CK3 G;  1SS3 A;  4DR1 B;  1O9H A;  3M8A A;  1ZX3 A;  3CHX A;  1XBL A;  2RJZ A;  4J10 A;  3L70 H;  2RNB A;  2ZM6 O;  4DR5 B;  1AJP A;  2JEU A;  1HDJ A;  1UPG A;  2DMX A;  2GHY A;  4GKK B;  5LBQ A;  4DV7 B;  2YIB A;  1VF7 A;  3WG7 C;  3K0G A;  3K58 A;  2EIM C;  1XMQ B;  5KHG A;  3G71 V;  2QKS A;  1L1F A;  2DQ0 A;  4DV2 O;  1YVW A;  2Q6A A;  1T5E A;  3O65 A;  1V54 C;  4GX0 A;  2ZM6 B;  3DXR B;  5A2Q N;  1Y74 B;  4CS3 A;  3BY6 A;  3ETG A;  3UT5 B;  4TV9 A;  3STZ C;  4MVS A;  5DED A;  4JI5 O;  2XAJ A;  1LUV A;  2P22 C;  3E8G A;  2YC0 A;  1ZL8 A;  4JYB A;  4LNU B;  1TUE B;  3ASN B;  2OT5 A;  4NXM O;  4X1K B;  1K9M W;  3CRQ A;  4DV2 B;  2GBO A;  4DO2 A;  4XDJ A;  4JYA O;  3D36 C;  2P7T C;  2P67 A;  3QVN A;  1OJH A;  3ZN1 A;  3WB0 A;  4MVZ A;  4JAA A;  4EKW A;  3FB8 C;  3JAS A;  4PA9 A;  2RCV A;  4NKG B;  5IJ9 B;  4UB8 Z;  4JI5 B;  2VS0 A; 
#chains in the Genus database with same CATH homology
 1NVP B;  3EHB B;  1YJN V;  1JVM A;  1RM1 C;  3SPJ A;  2IH1 C;  4GX5 A;  3MD0 A;  2R9I A;  1AI6 A;  2WLM A;  3KG2 A;  4N21 A;  4JAV A;  4QPK A;  4R6Z A;  2EIK B;  2BOC C;  3UKM A;  2V1D A;  1PNL A;  2W0F C;  1P7B A;  3OW2 U;  2XAS A;  4WFA V;  3ZRV A;  1I5X A;  1R6K A;  2P6J A;  3JD0 A;  3CCR V;  3AEI A;  4XDL A;  1BHA A;  1NJI W;  4MT8 A;  4RUF A;  3RBZ A;  1K73 W;  1AI4 A;  4PA3 A;  3ETE A;  2ZDI A;  1Y4M A;  1VQP V;  2IJK A;  4JF3 A;  3JYC A;  2P90 A;  3AG2 B;  2NLJ C;  1PD3 A;  1FXK C;  1E1Q G;  1V55 C;  2Y69 B;  4MTF A;  1FXV A;  4Z1M G;  4WCE V;  5EBM C;  1DLB A;  1M57 B;  2WLK A;  3LSQ A;  1H8H G;  1JCH A;  4LC1 A;  3ASO B;  1RPO A;  2QTO A;  4ZKI A;  3CCU V;  1QCE A;  3ABU A;  4E2L A;  1JJ2 U;  2WLJ A;  4N23 A;  5H6Q A;  3F7Y C;  4U7N A;  4MTG A;  1MOF A;  5IYC O;  1VQK V;  3OMN B;  3IFX A;  1S76 D;  3E2E A;  1R73 A;  3K0D A;  3DGE A;  5B1O A;  3LSS A;  5HFL A;  3LDD A;  1MG1 A;  1R3K C;  4PDR A;  4QNH B;  4WFE A;  1DF4 A;  1JX9 A;  2DQ3 A;  2AHY A;  4R8C A;  1NQT A;  3SYO A;  3ZJZ A;  1CP9 A;  1M9N A;  2QM8 A;  1GM9 A;  1R3I C;  1R3L C;  1OCO B;  3SYP A;  4LP8 A;  3SYQ A;  2ATK C;  1W0K G;  2R9R B;  5IYD O;  4JYC A;  4BIZ A;  3A0R A;  3AG3 C;  3OEE G;  4GX2 A;  1YJ9 V;  1KC8 W;  4JTA B;  5B3S C;  2DWD C;  4FJC C;  4MVO A;  3K3W A;  3ABK C;  2EIN C;  4WFF A;  4QE9 A;  3OUS A;  1GO3 F;  1BMF G;  1ORQ C;  1HWY A;  2GSM B;  4X88 A;  4R7C A;  3UM7 A;  3K04 A;  3ZMS A;  5EBL C;  1VQ7 V;  2DWE C;  4R50 A;  3WG7 B;  2F43 G;  2OCC C;  2EIM B;  2IH3 C;  3FKS G;  5CBG A;  2DYR C;  1SER A;  1KKD A;  1N8R W;  5B1B C;  2XND G;  3ZCC A;  1YHQ V;  4CZZ A;  3I56 V;  3ABM C;  4UV8 A;  2A0L A;  2EZP A;  3EFF K;  3CCV V;  1OCR C;  1LNQ A;  3IC7 A;  4UXN A;  4XDK A;  1YTF D;  4FIP C;  4TT3 G;  2YSU B;  1VQN V;  3ZMV A;  1NKD A;  2JK5 C;  1K3E A;  2X6B A;  2HVJ C;  1VQO V;  3W7X A;  3I55 V;  5IY5 B;  3AG4 C;  3FB5 C;  3JD2 A;  3SPI A;  3K79 A;  2ZD9 A;  2Q67 A;  1NVP D;  3B77 A;  1QLE C;  1K33 A;  2MK3 A;  5H6R A;  4PDM A;  2EIL B;  1NBM G;  5IDJ A;  3ASN C;  4JAU A;  3X2Q C;  3ZMZ A;  2IU3 A;  3FB7 C;  1YSC A;  4RQE A;  1OZ0 A;  2A9H A;  3R65 A;  3K08 A;  5CA3 A;  5DN6 G;  2HLD G;  5KUM A;  1XL6 A;  1K8A W;  4I5S A;  2OTL V;  2X6C A;  1UJW B;  1OHH G;  1KD1 W;  5KA6 A;  3FYI B;  2EJR A;  3W7W A;  5EK0 A;  1OCC B;  2JDI G;  4BAY A;  1RPR A;  2X0L A;  5L3C A;  3ABL C;  3OMA B;  2EBO A;  5FL7 G;  1RM1 B;  1WPX A;  1H8E G;  1GM7 A;  1MSW D;  4P9P A;  4X89 A;  4GX1 A;  1K4D C;  3VOU A;  2HJF C;  1YI2 V;  1OCZ C;  1CEZ A;  1S77 D;  4QPJ A;  3CCQ V;  5EC1 C;  3NXS A;  3ZMU A;  3B8N A;  2EIK C;  5DM6 V;  2Y48 A;  2IW5 A;  3VBB A;  3K9A A;  3OUF A;  3CXC U;  5CBF A;  2YEV A;  1PNK A;  4H33 A;  1VQ6 V;  5B1N A;  1JQ0 A;  2HFE C;  2X7R B;  4P2Z A;  1J95 A;  1VQ9 V;  4TSF G;  2UXX A;  2QA4 V;  2ITD C;  2HVK C;  1FS0 G;  1F4N A;  1M56 B;  1XL4 A;  1V55 B;  2Q69 A;  4LCU C;  2WWW A;  3AG2 C;  1FXH A;  3CCE V;  3ZRW A;  1NH2 D;  5L3G A;  2ITC C;  3FB6 C;  3LUT B;  4KP4 A;  1W2B U;  2IU0 A;  1M57 C;  1S72 V;  1K5Q A;  2PI4 A;  2DYS C;  1IXM A;  4H37 A;  1VQ5 V;  1G4Y B;  4FMT A;  2FTK A;  4PA6 A;  4RQF A;  5LHH A;  3D36 A;  5B1A C;  5CMU A;  1JOY A;  1R3J C;  1NR7 A;  3F7V C;  4UVA A;  1H2G A;  3GWO A;  5L3E A;  2Q68 A;  1W0J G;  2ZQM A;  3WFV A;  1H38 A;  1Q7Y W;  3CPW U;  5EC2 C;  1AJQ A;  4JTC B;  3AG3 B;  4MS2 A;  3E89 A;  2HKO A;  1M1K W;  3QO5 A;  4P30 A;  4BIU A;  2EIN B;  2HR3 A;  2WLL A;  1NR1 A;  3RW0 A;  3CC2 V;  3BEH A;  4WFH A;  2XAQ A;  4HAM A;  4KFM A;  4GT1 A;  4MVU A;  4WF9 V;  3ABT A;  1EFR G;  2B1I A;  2Z5U A;  4QJF B;  2OCC B;  1WLE A;  4I9W A;  2QE7 G;  3MHH C;  2X6A A;  1DTO A;  3AG1 C;  2WLH A;  1ZWI C;  1V54 B;  4JGS A;  5IYB O;  2YEV B;  4OXS A;  5LHI A;  3FYE B;  2IJJ A;  4RO2 A;  2EIJ B;  3ZRX A;  1PKX A;  1E79 G;  4MTX A;  3ABM B;  3W7S A;  3M99 B;  1OCR B;  2XAF A;  2NNU A;  4Q20 A;  1KEC A;  2OTJ V;  4PDL A;  4UVC A;  3B8M A;  5KUK A;  1VQM V;  4PA7 A;  1R6N A;  4YXW G;  3ML0 A;  2B1G A;  1FXK A;  1K97 A;  3ZRW B;  3ZMT A;  4FPP A;  3T4Z A;  3CCS V;  3H01 A;  5C93 A;  3SJQ C;  2LP7 A;  1AI5 A;  4HZ3 A;  4WFB V;  2JJ1 G;  3CCL V;  3QO7 A;  5CN0 A;  2WLN A;  3JD3 A;  3AG4 B;  5CBH A;  4WFG A;  1GK9 A;  3P32 A;  2HG5 C;  5GW7 A;  3ZRS A;  1ARO P;  4RUE A;  2QEX V;  1S0V A;  1KP2 A;  1F4M A;  4QE7 A;  3TCU A;  5HFM A;  3HB3 B;  3HPL C;  1AJN A;  1VQL V;  1K34 A;  3SYA A;  3G6E V;  2ZXW B;  1Y66 A;  3LNM B;  1SES A;  3TET A;  4JPR A;  4QIW F;  2EIL C;  1QR8 A;  1ROP A;  3OGC C;  1P4R A;  3OAA G;  1BL8 A;  3RVY A;  1VQ8 V;  2KB1 A;  4J9Z B;  3RVZ A;  1F51 A;  3CC4 V;  2WLL B;  1M90 W;  4PDV A;  4FK5 C;  5LHG A;  4MVR A;  3STL C;  3ABL B;  3T1C A;  1GKF A;  4J9Y B;  4UUJ C;  1K92 A;  5J9P C;  1EBO A;  2WAM A;  2K1E A;  5BZB A;  1OCC C;  2M7W A;  2QM7 A;  3OFN G;  1PNM A;  1EZJ A;  3SYC A;  2WLI A;  4PEL A;  4GCZ A;  1BHB A;  1F23 A;  1OCZ B;  3P30 A;  4F4L A;  2Z3Y A;  3CYO A;  5L3D A;  2B5U A;  3OEH G;  1I5Y A;  4MVM A;  2LFS A;  2PI5 A;  1KP3 A;  1COW G;  3G4S V;  1GTO A;  5LGN A;  1B6Q A;  3E83 A;  3ZIA G;  2H94 A;  1FXK B;  3CME V;  4G27 B;  1Q81 W;  5E1A C;  5L3F A;  3SPG A;  2AHZ A;  3E8B A;  2JJ2 G;  4ZBM A;  3OM3 B;  3IGA C;  4UVB A;  2Y69 C;  2ZR3 A;  3OE7 G;  3T2M A;  1DF5 A;  1GMG A;  1THZ A;  3ASO C;  4PA4 A;  1KQS U;  1JPX A;  1M56 C;  2A79 B;  2LFR A;  4TWK A;  1G8M A;  3JD4 A;  3QO8 A;  1FFT B;  2DYS B;  3T4D A;  4JAS A;  4MW8 A;  2CK3 G;  3K03 A;  3W7U A;  4G2K A;  3W7T A;  1SRY A;  1Q86 W;  3CMA V;  4LBE C;  5B1A B;  2D3O W;  3PJS K;  1K7D A;  3CP1 A;  4UV9 A;  1OCO C;  5B3S B;  1Q82 W;  1VQ4 V;  1AJP A;  3ABK B;  1SZT A;  4MTO A;  4U7O A;  2WSS G;  2JEU A;  1AR1 B;  1NH2 B;  2WLI B;  1K5S A;  1QBZ A;  3JD1 A;  3OMI B;  4CBC A;  2GHY A;  2WPD G;  5LBQ A;  1ENV A;  5EBW C;  2DYR B;  3DTU B;  3WG7 C;  2JEX A;  3D3I A;  5B1B B;  5KA5 A;  3K0G A;  5LGU A;  3E8F A;  2EIM C;  1MAB G;  3ETD A;  3G71 V;  2QKS A;  4MW3 A;  1L1F A;  3AG1 B;  3K06 A;  2DQ0 A;  4G28 B;  3CC7 V;  4KUM A;  2W6I G;  2ZDI C;  3LDE A;  2Q6A A;  3MHS C;  3LDC A;  3F5W C;  1V54 C;  4GX0 A;  3SPH A;  4DXW A;  3CD6 V;  1GM8 A;  1CPY A;  2EIJ C;  2IJH A;  3BY6 A;  3ETG A;  2IJI A;  4XBF A;  3E8H A;  3STZ C;  2ZR2 A;  2UXN A;  2XAG A;  4MVS A;  4X8A A;  1YIT V;  1S3J A;  1S5H C;  2XAJ A;  3GB7 C;  3OR7 C;  3E8G A;  2EZO A;  4MSW C;  4JYB A;  5IY5 C;  5LGT A;  1QR9 A;  1QLE B;  2DW4 A;  2BOB C;  2V7Q G;  4RAI A;  1SET A;  1TUE B;  4HYO A;  2W6J G;  2OT5 A;  3ASN B;  3E35 A;  3X2Q B;  2JIZ G;  3OR6 C;  3QNE A;  4BW5 A;  5L3B A;  1K9M W;  1PL0 A;  4JTD B;  1YIJ V;  3E86 A;  1YJW V;  1YTF B;  1AI7 A;  4DO2 A;  4XDJ A;  1QVG U;  1E1R G;  2P7T C;  2P67 A;  2C2A A;  3CCM V;  3JCZ A;  1QLN A;  2H8P C;  3ZN1 A;  2XOK G;  4MVZ A;  4EKW A;  3FB8 C;  4ASU G;  1QVF U;  4PA9 A;  2ZXW C;  3SPC A;  1K4C C;  4MVQ A;  4P9O A;  3ZN0 A;  2XAH A;  4L87 A;  3TK1 A;  5H9C A;  3CCJ V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...