1FXKA

Crystal structure of archaeal prefoldin (gimc).
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
107
structure length
107
Chain Sequence
QNVQHQLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELSRAADDAEVYKSSGNILIRVAKDELTEELQEKLETLQLREKTIERQEERVMKKLQEMQVNIQEAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the molecular chaperone prefoldin: unique interaction of multiple coiled coil tentacles with unfolded proteins.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Chaperone
molecule keywords PREFOLDIN
total genus 40
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2000-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1fxkA00
3AEIA 2ZDIA 2ZQMA 1FXKB 1FXKC 2ZDIC 1FXKA
chains in the Genus database with same CATH superfamily
4NR1A 3ZRSA 3OAAG 4H44B 4FZ0A 2P22C 5LP6A 4QPKA 4RWUA 2PI4A 2H3OA 4OX9B 5H6RA 1ZX3A 1TVKA 5CBFA 5E79Z 2RQ6A 4YJ3B 4IHJB 2MK3A 3F7VC 2BTQA 2BSKB 5GTIZ 4BWAA 4R8CA 5LGTA 4JTAB 3CCEV 1K97A 3QTCA 4DV7B 5LYJA 1SERA 4I0XA 4DV1O 1N32O 2E3CA 1VQOV 2WA4A 4FLUA 4FVMA 3JAWA 4X66B 2ZCEA 1YDXA 1VQ4V 3HKBB 1DTOA 2QGNA 3EFFK 5J9PC 1L8DA 2N05A 2F4VO 3HPLC 3CCSV 1Y66A 2H94A 2W6IG 1RM1B 1IBKB 1FFTB 1N4CA 2E5LO 3FAVB 3WU2Z 4NXMB 5JCOC 2EBOA 2QWQB 1Z5VA 2NLJC 5H9CA 2N04A 3CMEV 1SQGA 3THOA 2WSSG 3ETGA 3T1YB 2ZNIA 3DC5A 4O4JB 1K33A 3RYHB 1GO3F 4I55B 1CPYA 3RGBA 2BSKA 4BW9A 1PP9H 2ZM6B 2N74A 3CCQV 3BEHA 3AK3A 1EN4A 1N32B 3CWBH 2PZSA 2P4VA 1YSCA 3AK2A 2XHBA 3NXSA 1KKDA 2R72A 2HLDG 4J9YB 2PY5A 2ZE6A 2YIBD 4J11A 2CGNA 5KA6A 3JD0A 4PA6A 4DR7O 2YEVB 2IH3C 3TK1A 1CP9A 1H2KA 5L3GA 4PA7A 3AK1A 2OCCB 3GWOA 4HNAB 1RSOB 3JAKB 3APQA 4QE9A 4LFBO 3SDLA 2JJ1G 1QVFU 3OTOO 4JI4O 1KU9A 1NKDA 4UCOA 3BA8A 2XOKG 3E83A 3ZMTA 4IHJA 1QR9A 1I08A 3BFRA 1KECA 4DUZB 1F7YA 4JPRA 2A9HA 3R66A 5KLVH 3CP1A 3EVKA 1SA0A 3JARA 4X20B 5CBHA 4PA3A 1E1RG 3ICXA 2YEVA 3CX5F 2QM7A 2H8PC 3JD3A 1OCRC 2JEUA 4X1YA 3W7XA 1Y74A 1IXMA 1K7DA 4F6RB 4KXRA 5CMUA 3CCRV 3CMAV 3K57A 2XAJA 4F6EA 4X88A 3E8FA 1LR1A 3ZHRA 1VP7A 4H0LB 4UXNA 5LBQA 3FKSG 2CDYA 1EZJA 1EFRG 3U11A 3JAKA 3D3QA 4DK0A 2XASA 2IU3A 1XQ8A 4B3TB 4RO2A 3E22A 5IYDO 2Q8VA 2EZOA 5K1PA 3JATA 3RYIB 3OMAB 1G6UA 5CB4B 4IIJB 4EEQA 1YITV 4X65O 1DLBA 4OPAA 4AI8A 2P4KA 3RVYA 3PN1A 1KB9F 2OCCC 4PHZA 2XUMA 4UV8A 1HDJA 3DSQA 3QVNA 4GKKO 2F66C 1UJWB 3KCXA 5DECA 2DWDC 2OYQA 3VQYA 4X1KA 3G71V 1VIBA 4E4EA 2DYRC 4JI7B 3CC7V 1ZWIC 4PV1B 3B2EE 5EK0A 3JD2A 5J2UA 5IYBO 1P7GA 1LUWA 2Q4PA 1OCCB 1XL4A 1W59A 2X6BA 3ZMZA 4X1IA 3SPHA 3HR0A 3WG7B 4JI8O 1NH2D 2P7TC 4DR4B 4JAVA 4DR2B 5EZYB 4B3TO 3ZHQA 3EXAA 1AJQA 1GN3A 4UB8Z 1NR1A 1NBMG 3NR7A 3IJ4A 1WA8B 4ZI7A 2FKXA 1UPGA 4X65B 3MAQA 2NN4A 4OPHA 2QTOA 3ZHSA 2R9RB 1OZ0A 4YY3O 3IC9A 1RM1C 3B09A 3G67A 1GTOA 1KC8W 2LGWA 4YIPA 3AG1C 1VQ6V 4K0KO 3T1YO 3T1CA 3TXQA 1URFA 3HKEB 4P9OA 2UUCB 3WFVA 1K9MW 2Y4UA 3CRQA 4L8JA 2ZE7A 2ZXWB 1VQ7V 1KUQA 2IU0A 1H8EG 3F5TA 3RWRD 2HG5C 1V54B 2UXDB 2Y0PA 5H2FZ 1K3EA 2KG7B 4J10A 2ILMA 5KA5A 2YXHA 4HZ3A 4LCUC 1BE3H 3K06A 4X1KB 1BSMA 2E76B 1R3JC 3M99B 4QIWF 2QKAA 3LDEA 5FPOA 4DYLA 4KP4A 5A9GA 2QWOB 1N34B 3FAVA 5AG2A 4JI3O 1YJNV 3KKYA 2P06A 2ATKC 4DR1B 1AP5A 1DF4A 5LP6B 3I56V 4N23A 2A7WA 3JASB 1DF5A 3TGUH 4O4IB 2UU9O 1GM8A 1SZTA 4GKJO 4FLYA 4RQEA 2XAHA 1FXHA 3GWKC 2ETNA 3JSNA 2Q68A 3CEIA 1F4MA 4I0XB 1Q90D 3ZN0A 4W4KA 1K34A 3P32A 4KUMA 2BTQB 2XAQA 1DGSA 1IBKO 5B5EZ 3K0GA 1AP6A 2QTSA 2DW4A 3N27A 1F23A 1XHZA 2YDEA 4DV4O 3HKCA 4X66O 1XNRB 3T2MA 1RP3B 1Y74B 4MTGA 1NU1H 1YTFB 2F93B 3ZX6A 2KG7A 4LF8B 3WB1A 4WFBV 4JI7O 2BCCH 3OUSA 4MVRA 4DR1O 2CAZC 4AQYB 2DOSA 1NR7A 2QWRB 2IW5A 3L75H 3BVOA 1PM9A 3F5WC 4JYBA 2GTSA 1Q6HA 2AGAA 3CCVV 3PJSK 1XMOO 2X0LA 1MZFA 3H9VA 3SPGA 1G8MA 1KYOF 2WA3A 1JR9A 1R3LC 3J81N 1JA8A 4JV5B 3VOUA 2DMXA 4U7NA 3KZIZ 4O4LA 5IYCO 2DWEC 3DGEA 4EKWA 1TGOA 1VMGA 1KP3A 2Q73A 3RW0A 1QU7A 1HR0B 3N2GA 4DV0O 1L0LH 3O65A 4TV9B 4TOIA 4FFBA 3WB0A 3OR7C 5EYPA 4IYIA 3P3PA 2CH7B 2QM8A 3W7TA 1Z5WA 4LF9B 1H2LA 4NYKA 4LF4O 4WF9V 2DE0X 3ABTA 5F2VO 1VQKV 2KB1A 3RYFB 4DRXA 4AQYO 3ZRXA 3HKCB 3W7WA 4KHPB 3K08A 4O4LB 5FLXN 2JGDB 4EFBA 2V1DA 2M7WA 2B1GA 4E2LA 4K8ZA 2EIJB 3T4DA 5B1AB 3FYEB 2OIEA 3LNNA 3QG5A 2HKOA 1N0JA 3OW2U 1YI2V 4DXWA 4DR7B 1K8AW 4PDMA 1AI6A 4FLTA 2HJDA 1B6QA 2W6JG 2OTJV 1M9NA 4TQDA 1F4NA 4DR3B 4JZGA 2LQTA 5IY5B 5B1BC 1B3QA 1JVMA 4DV1B 4GX0A 5B3SC 4MT8A 4LFBB 1VQ5V 1XNQB 2VRZA 1JQ0A 1FXKB 3ZIAG 1M56C 4NXNO 3JCZA 4DR6O 2QM4A 4K35A 4CH6A 1PD3A 2GTAA 5BR8O 1AJNA 2YXYA 5JJEB 1HNXB 2UXDO 2Q67A 4YJ2B 2CUGA 2DQ3A 5IY5C 4DV0B 4IIJA 2WWWA 2E74B 1U96A 1FXKA 5CA1A 5IT9N 1W0JG 3AG7A 2UUBO 3UO2A 3AG4B 4JTCB 5KUKA 3ZS8C 1XBLA 4P30A 5IJ9A 3BA9A 3S3WA 2D2CB 4CH3A 1P84F 3LDDA 1AJPA 3OEHG 4MVOA 2BOBC 3SYQA 1R6TA 1BT8A 1A32A 3FB6C 3WG7C 4I4TB 1BHBA 2KKWA 4DO2A 4NXMO 1COWG 1WB7A 4D6TH 1VQ9V 2CTWA 4TSFG 1AR1B 1Q3EA 3AG3C 2XT9A 1HNWO 2Z0AA 1IBMB 4FM0A 3JALA 3CYOA 2BOCC 4I5SA 1N0NA 1GN2A 1ZTEA 5L3CA 1VF5B 3BAAA 4FLZA 1ZLZA 2C2AA 1FS0G 5LXTB 1G4YB 4X64B 4PELA 4DV5B 1Y67A 4GZRB 2EX3A 1WLEA 4RUFA 1X59A 5BMVA 4TUYB 1MMMA 2QA4V 2ZIMA 4J7ZA 1PV0A 4JYYA 1NVPB 5LXTA 3MHHC 1PNKA 2JK5C 2R70A 3BHPA 3OGCC 2Q69A 1JX9A 2YSUB 2LO1A 1M4UA 2JJ2G 2YI9A 2GUZA 2WLLB 1GH6A 1ZUQA 1SQFA 3UKMA 4G27B 3J80N 1GRJA 1KMIZ 3SYOA 5LHHA 3CXCU 4JYAO 2Q0OC 5IYZA 1HNWB 4J80A 3QO5A 2DN9A 3K59A 1OV9A 2F23A 3A2FA 4I4TA 4X20A 2V7QG 4B7EA 2JEXA 5B66Z 1QLEC 4ZIBA 4LNUB 4JI6B 2LGQA 4KHPO 3L70H 5IYZB 4Z1MG 4ZHQB 1T5EA 3F7YC 4UVBA 4CH5A 3B8NA 2HP8A 4GKJB 3MD0A 3CJHA 3SJQC 3ZHTA 1WAZA 5TISZ 4MW8A 3UQ8A 1CXZB 4YXWG 2Y4TA 3ABKC 2EIKC 5E1AC 4QGPA 4R6ZA 3FB8C 4TUYA 5LMUO 3SJBC 5BMVB 3CCMV 1OCCC 5LHIA 3QO7A 4FJCC 4I9QA 3KCYA 3BRCA 1JFFA 4GKKB 1BHAA 3HKBA 1GM9A 3JAMN 1IBLO 2CGOA 3AG2C 1I94O 3B8MA 2DYSB 4PDLA 4ZBMA 5A2QN 2UXCB 3H1HH 2JS5A 1YTFD 1TUEB 3RYHA 2B1IA 2ZNJA 3E89A 1M57B 5CBGA 3S3XA 3SYPA 1SC5B 1XUQA 3SR2C 4B08A 5C8YB 2OWOA 1N36B 5JVDA 3QO8A 2PI5A 2R9IA 1QVGU 4ICGA 3CHXA 3E8GA 1QCEA 3LSSA 4FPPA 5ITZB 5EBMC 2UUAO 4D7SA 1Z2GA 3OMIB 4AHCA 3CCUV 4X89A 1P4RA 1M93A 2GSMB 1FPOA 2YC0A 2GBOA 4O2AB 4UCRA 1BMFG 4WCEV 2Q0AA 1XNQO 5EC1C 4Q6GA 4YJ2A 1D5AA 4H13B 4LF9O 3LNMB 3OUFA 1VARA 3VQXA 4Z2WA 4JI3B 1TVKB 3K5OA 2AZ2A 1HP8A 5H6QA 2A79B 1MABG 3FYIB 2F43G 3LDCA 2XAGA 3OMNB 4JI0B 4DR5B 1SESA 3LSQA 4J7JA 4JASA 4DRXB 2XAFA 3CRRA 4ZHQA 1ORQC 2VQEB 1NTMH 4OXSA 1SRYA 2WLMA 4JI1O 3DXRA 1IBLB 5HFLA 1MNGA 4CZZA 1YIJV 2UUCO 3ABMB 1XOUA 4DV2O 1SQPH 1SQBH 1SZXA 4JI0O 4IT5A 2IJIA 4BR6A 2ZQMA 3K0DA 2ZIOA 2EJ7A 1GMGA 4HBNA 4JZ2A 3CRAA 1VF7A 1SKVA 2JRIA 2QSAA 4X62B 2WAMA 1US6A 3ABLC 4PJ0Z 4NVPA 3AEIA 2Q9LA 5FPRA 1XHXA 4JYCA 4FM1A 2K1EA 3Q4HB 5IJ9B 3STZC 3H1KH 2X6CA 3BPZA 4DR3O 1O9GA 4MS2A 3U10A 4UV9A 4JI8B 3JATB 3RYIA 5CA0B 1JMKC 3X2QB 1P7BA 5KX5B 3LSUA 4QE7A 3SJCC 3W7SA 1I5YA 4I9WA 2ITCC 5DEDA 1D2DA 4JTDB 4Z1VA 2W0FC 3L72H 3UM7A 1S0VA 4U3JA 5C93A 1SQVH 2YIAA 1XMOB 3H1LH 3CC4V 1D5NA 3FD9A 5KMGA 1AI4A 4YY3B 4UVAA 3H1JH 4LF5B 1ROPA 3C3TA 5EC2C 4X62O 5IE9A 3OFNG 4TV9A 1MG1A 5J2UB 1Q43A 1AB3A 1M5IA 3ABKB 4EB6A 2P90A 3E86A 1G1XB 4WFAV 1N8RW 4N21A 2ZDIA 1VQPV 4JI6O 3D3IA 5LMUB 4K8XA 2L35A 4KFMA 1H2SB 2HJFC 2XNDG 4DR4O 4LBEC 2CTRA 1B04A 5JJJB 4B3SO 4PI2A 2P67A 3SGIA 1B06A 1WN7A 1WP8A 3L9DA 3SYAA 4BIZA 5LHGA 2RCVA 4YJ3A 2PTMA 3D36C 1ZL8A 4IGGA 4P2ZA 5LGUA 4I50B 2UXCO 5FL7G 2E75B 3IC7A 2PF4E 5CB4A 4DUYB 1S5HC 5KX5A 1H2NA 1M90W 1THZA 2LFSA 4H37A 1QNMA 1JFFB 1J5EO 2YXLA 2QKSA 3N2KB 3FB5C 5KHJA 5EBLC 4PI0A 5L3FA 3BABA 3CD6V 1XI1A 5EZYA 3AG3B 1PL4A 1JCHA 1ZSPA 4B3MO 2OTLV 1TAEA 1Q5OA 3QF7A 4MSWC 2KQXA 2ARHA 3SYCA 3G4SV 1XEQA 1ENVA 4FM2A 4F6RA 2F4VB 1EZVH 1AILA 4B7KA 5LYJB 5KHKA 3RVZA 3LUTB 1I0HA 3OGIB 3MHSC 1FYJA 1R3KC 1VF6C 1WPXA 2Y0IA 2HVJC 3RYFA 4FK5C 2LFRA 3E22B 3H01A 3CS5A 3CC2V 1BGYH 4DUYO 4NKGB 1NJIW 3FX7A 5JQGA 4JI2O 2EINC 1BQZA 2O57A 1LUVA 5J2TA 1RPRA 4BIOA 1DK1A 3ZRVA 3GB7C 2Y48A 4B3SB 2FB5A 1R1BA 4FLVA 2NR5A 2RMKB 5IWAO 4NXNB 1YEWA 2WPDG 2ZT9B 1NVPD 2Q7GA 3T4ZA 3ASOC 1N33B 1VEWA 2FL4A 3I55V 4DV6B 4CH4A 1QLNA 1HNZO 1SQXH 4O4IA 1Q81W 2P5OA 1PNMA 2B5UA 2ZD9A 5KAFZ 1YXBA 2WLKA 2WLJA 3G6BA 1AI5A 1Q7YW 1FXKC 4HNAA 3ASNB 4JI2B 2IJJA 2QE7G 1R3IC 3I5DA 2ZE5A 4XBFA 2FMLA 3A0RA 4MVMA 1IX9A 5KMGB 1U97A 3QNEA 2QKCA 1W2BU 2LW1A 3T1HB 2EILB 1H2GA 3ZHUA 1XL6A 1GK9A 4NTXA 4LF7O 4WFHA 1KBHA 3A0HZ 4TWKA 2EJRA 4O2BA 4TV8A 1HNZB 2WLHA 3N2KA 2DQ0A 4EFEA 3MDSA 1PNLA 2YICA 3IFXA 1NTKH 4NB5A 1F51A 3HKDA 2V4DA 2YUAA 1SF9A 3HKEA 1OCOB 3HB3B 4GYCB 4JYAB 3E2EA 4D7TA 3FFQA 1NT2B 5LGNA 2UU9B 3K9AA 4LFCB 2OCHA 1EM1A 1QHTA 4MW3A 5D5PA 4B3RB 1S77D 2PGGA 4DR6B 4JAAA 4FIPC 1JJ2U 1WJZA 2WLNA 2DYRB 5B3SB 4UFZA 4GX2A 1VF6A 4O4JA 1HNXO 5LA6B 2A3QA 2UXBO 2LP7A 3C90A 1KP2A 4LH6A 4NTYA 4MTOA 4JI1B 1FJGO 1EN5A 2YIBA 3U0ZA 3TXSA 3ASNC 2AHYA 4YHHB 4RUEA 4KL1A 4X8AA 1I94B 1SA0B 4X1IB 1XILA 1E1QG 4PA9A 1BZKA 5L3DA 1YHQV 5GW7A 1IVSA 3K5NA 3ML0A 1VQMV 5KHHA 3H1IH 4J7KA 4U7OA 5JJNB 3E8HA 2ODMA 2UXBB 1J95A 2F1MA 3SPIA 1NQTA 4CC5A 3T1HO 2X7RB 1YZBA 2BE3A 2ZE8A 4UUJC 1I7FA 1IBMO 4UCTA 1S3JA 5EBWC 3CRMA 4R50A 2RDCA 1Q82W 3B4SA 3G80A 1NZ6A 4LNUA 3ETDA 2CH7A 2OT5A 1S72V 1GN6A 3B77A 1MSWD 1QLEB 3N2GB 1V54C 4YIOA 1OCOC 1OJHA 5JVDB 3OTOB 3KG2A 4MVQA 4ZKIA 4HYOA 3JCUZ 1NS1A 4WBNA 1HWYA 5LMNO 1UFIA 3CJHB 4DK1A 2FYUH 1S5JA 3JYCA 3RT3C 4BAYA 1IXBA 2MW2B 1BS3A 3L74H 4ZI7B 3JALB 4WFEA 3CSXA 2PUSA 2X6AA 4NTWA 3CB2A 5LL6Y 3A8TA 2ZR3A 1R6KA 2ZINA 2G38A 2YI8A 2JIZG 5KHIA 4DV3B 1M1KW 1NI8A 4LFAB 1VQ8V 2EZPA 1FXVA 2VS0A 1HW7A 2YS8A 4G2KA 1YJ9V 1BCCH 4CBCA 3K58A 4FFKA 4JI5B 3UT5A 1W0KG 3JARB 4MTFA 4RAIA 2QR4A 2WLLA 5B1OA 5GONB 1OHHG 4OGQB 1FFXA 4PDVA 3OTFA 2F95B 4FMTA 1VQNV 1IDSA 4UB6Z 2D3OW 3ASOB 3VQWA 5BY1A 3ABLB 4UCUA 4GX5A 4IYHA 3GVMA 4UCVA 2GV9A 2QDOA 1XNRO 3ZEDA 4UCSA 3G6EV 1RSOA 2CTPA 1V55C 1K4CC 1MZEA 1AROP 4LF6O 2NNUA 2ADPA 2KSDA 4DR5O 1PKXA 1WP7A 1YJWV 5BZBA 3E8BA 5LP6C 2ZM6O 4GUNA 1PPJH 5KHGA 1X4TA 5H5NA 1VQLV 4W4LA 1EBOA 3OM3B 4WFGA 3WB2A 2AZ0A 2Y69B 3D8CA 5B1AC 3AG4C 3SPCA 4JI4B 3VBBA 2UUBB 2ZR2A 1Q6UA 4JV5O 2HVKC 1LNQA 2LW7A 5EIBC 3BCCH 4H33A 1N34O 5EIBD 2AHZA 3TCUA 1KD1W 5C8YA 3TJTA 3ETQA 4LP8A 2BTOA 2W0XA 5HFMA 2Q5ZA 2EINB 3OT7A 3RBZA 1IURA 2IBZH 5GTHZ 4J41A 5LOVA 4LF7B 4MVUA 5B1BB 4O2AA 4LC1A 4DV3O 2WLIB 2RN9A 3APOA 4C7UA 1M56B 3IGAC 4XDJA 1L0NH 1M57C 1GAXA 2B9ZA 3CPWU 5J2TB 2OIGA 3P30A 4HAMA 4R7CA 5DN6G 1Y76A 3JASA 5JQGB 2UUAB 2RNBA 1WNSA 2HEPA 4QJFB 3JD4A 2R9AA 4FFBB 3K9SA 4P9PA 3E35A 2EILC 3CCJV 1O9HA 1Q86W 2QWNB 4WFFA 4TQFA 2QWPB 1FJGB 4F4LA 4K0KB 2GUZB 3L71H 5CA3A 4B3RO 4X9QA 1H2MA 4LF8O 1KKCA 3UT5B 3M8AA 2VQFB 2HR3A 2PYJA 1FKAO 2EIMC 3O9OA 3SJAC 1E79G 3HKDB 5LMNB 5FNVA 2LJ2A 2Z3YA 5IJ0A 5JH7B 3ABMC 2K9PA 1WPBA 3UCSC 4ABMA 5B1NA 4PDRA 1OCZB 2IJKA 2PYLA 2AXTZ 2JGDA 5L3BA 3SPJA 5D5QA 3JAWB 1KQSU 1YCIA 2HHHO 4CS4A 2GHYA 1MA1A 1K73W 2JGUA 4DV6O 3TETA 2A06H 3M7MX 1H8HG 1WA8A 1QBZA 4QNHB 1CEZA 2JS3A 4LWSA 4GX1A 5JWPA 1AI7A 3UO3A 2GDSA 1Y6XA 3CE2A 5GONA 3ZCCA 1BQ0A 2JVDA 1AVMA 4DW0A 2CE4A 4FZ1A 1GM7A 1TA8A 5KAIZ 4DV7O 4J9ZB 1XDCA 5K1XA 5LOVB 1S5LZ 5FNVB 5EYPB 3OR6C 3K04A 4IL6Z 1K5SA 3B40A 3ZJZA 2ITDC 2Q7HA 1L1FA 3RN4A 3CCLV 4LF6B 4XDLA 1MOFA 3IAYA 3K5LA 1GKFA 1OCRB 3ABUA 5DM6V 2Q6AA 1JJOA 1Q8IA 1I5XA 2L6LA 4CS2A 3DTUB 2VQFO 4X64O 4GCZA 2E5LB 4ZOLB 4G28B 1NH2B 2XTAA 3ZMVA 4RQFA 1XMQO 1NTZH 3JD1A 4WBNB 3ZBHA 2EULA 3K03A 5BXZA 1FD9A 2Y69C 3OE7G 2QJ1A 1R73A 2P6JA 4A5UB 1TUBA 1Y4MA 2DYSC 2HFEC 3Q4HA 4ZOLA 3ZMSA 4L87A 1RFYA 4J42A 1ZL8B 5BR8B 2IJHA 3K3WA 4MTXA 4O4HA 4UVCA 4O2BB 4TV8B 1K5QA 3W7UA 4U3JB 1JOYA 2Q7EA 1XREA 1N33O 3C3SA 2DJVA 4DV5O 1V9PA 3JSLA 2ADQB 1ZAUA 1S76D 1V55B 5LA6A 4GT1A 2ZDIC 2WLIA 4LH7A 3RYCB 2ZKOA 2CK3G 1FAFA 2UXNA 5IDJA 2RJZA 3ZHVA 2ZXWC 1AR4A 3AG1B 4U3FH 4CS3A 3CXHF 5JH7A 4DW1A 3ETEA 3OEEG 1OCZC 2IH1C 1H38A 2M6YA 4XDKA 1K92A 1R6NA 1QQCA 4DR2O 1XMQB 2VQEO 4DV4B 3A0BZ 3STLC 1JPXA 3ZRWB 1BL8A 4LWSB 4LFCO 1SETA 4I7ZB 4MVZA 4I55A 3CRCA 2EIMB 4JI5O 4I50A 4DUZO 5KUMA 3ZN1A 1GN4A 4Q20A 4K3AA 5JCOA 4DV2B 3J7AU 4PA4A 1RPOA 3P3NA 1EN6A 3D36A 1PL0A 2EIJC 1YF2A 1WB8A 3ZRWA 1K4DC 5L3EA 2FTKA 3RFRA 1Q6IA 1YVWA 4O4HB 5IJ0B 1SQQH 4JF3A 4BIUA 4LFAO 1FFXB 1Y76B 2EIKB 4B3MB 4JGSA 4CC6A 4EB6B 3OD4A 3EHBB 2VWJA 2A0LA 4LR3A 3X2QC 4GLXA 4FLXA 3RYCA 5ITZA 2HHHB 2QEXV 5CA1B 1J5EB 4BW5A 5CN0A 4QPJA 2AW9A 4PD4F 4AILC 2YIDA 1N36O 1IZ3A 2UXXA 2IM9A 2Z5UA 3K5MA 2JDIG 4LF5O 4JAUA 1SS3A 3VQVA 3L73H 4LF4B 4TT3G 3AG2B 4YHHO 4ASUG 5IWAB 4OX9O 1TUBB 3K79A 1QR8A 2VWKA 3FB7C 4MVSA 1MSDA 3DC6A 1HR0O 5CA0A 3R65A 4X1YB 1P49A 1AR5A 3DXRB 2CTQA 3BY6A 3ZMUA 4FLWA
chains in the Genus database with same CATH topology
1R3LC 3ZRSA 3OAAG 2JIZG 1M1KW 3VOUA 4QPKA 1VQ8V 2EZPA 1FXVA 2WAMA 3ABLC 3AEIA 4U7NA 4G2KA 2PI4A 1YJ9V 4CBCA 5H6RA 5CBFA 4JYCA 5IYCO 2DWEC 3DGEA 4EKWA 2MK3A 1W0KG 3F7VC 2K1EA 4MTFA 4RAIA 4R8CA 5LGTA 1KP3A 4JTAB 2WLLA 5B1OA 1K97A 3STZC 3CCEV 3RW0A 1OHHG 2X6CA 4PDVA 4MS2A 1SERA 4FMTA 4UV9A 1VQNV 1VQOV 2D3OW 3ASOB 3OR7C 3ABLB 3X2QB 1P7BA 4GX5A 2QM8A 3W7TA 3G6EV 4QE7A 1VQ4V 3W7SA 1DTOA 4WF9V 3ABTA 1I5YA 4I9WA 1VQKV 2ITCC 3EFFK 1V55C 5J9PC 1K4CC 1AROP 2KB1A 2NNUA 4JTDB 3HPLC 2W0FC 3UM7A 1S0VA 3CCSV 1PKXA 1Y66A 2H94A 2W6IG 3ZRXA 1YJWV 5BZBA 3E8BA 3W7WA 1RM1B 5C93A 3K08A 1FFTB 1VQLV 1EBOA 2V1DA 3CC4V 3OM3B 4WFGA 2M7WA 1AI4A 2B1GA 4UVAA 2EBOA 2Y69B 4E2LA 5B1AC 2EIJB 2NLJC 3AG4C 5H9CA 3SPCA 1ROPA 3VBBA 5EC2C 3CMEV 2ZR2A 3T4DA 5B1AB 3FYEB 2HVKC 2WSSG 3ETGA 2HKOA 1LNQA 3OFNG 1MG1A 3OW2U 4H33A 1YI2V 4DXWA 3ABKB 1K8AW 2AHZA 2P90A 1K33A 1GO3F 3E86A 4WFAV 3TCUA 1KD1W 1CPYA 1N8RW 4PDMA 4N21A 4LP8A 2ZDIA 1VQPV 3D3IA 1AI6A 5HFMA 2EINB 1B6QA 2W6JG 2OTJV 1M9NA 3CCQV 1F4NA 4KFMA 3BEHA 3RBZA 2HJFC 5B1BC 1JVMA 2XNDG 5IY5B 4GX0A 5B3SC 4MT8A 4MVUA 1VQ5V 4LBEC 5B1BB 1YSCA 4LC1A 2P67A 2WLIB 3NXSA 1KKDA 4J9YB 2HLDG 1M56B 3IGAC 4XDJA 3SYAA 1JQ0A 4BIZA 1M57C 5LHGA 1FXKB 3ZIAG 1M56C 5KA6A 3CPWU 3JD0A 4PA6A 4P2ZA 3JCZA 5LGUA 3P30A 2YEVB 4HAMA 5FL7G 4R7CA 5DN6G 2IH3C 3TK1A 1CP9A 1PD3A 3IC7A 1AJNA 5L3GA 4PA7A 1S5HC 4QJFB 1M90W 1THZA 2LFSA 2Q67A 3JD4A 4H37A 2OCCB 3GWOA 3E35A 4P9PA 2EILC 2QKSA 3CCJV 2DQ3A 5IY5C 3FB5C 4QE9A 2WWWA 5EBLC 1FXKA 2JJ1G 5L3FA 1QVFU 1W0JG 1Q86W 3CD6V 4WFFA 3AG3B 4F4LA 1JCHA 1NKDA 2XOKG 3E83A 5CA3A 2OTLV 3ZMTA 1QR9A 3AG4B 1KECA 4JTCB 5KUKA 4JPRA 4MSWC 2A9HA 4P30A 3CP1A 3SYCA 5CBHA 3G4SV 1ENVA 3LDDA 4PA3A 1AJPA 1E1RG 2HR3A 2YEVA 3OEHG 4MVOA 2BOBC 3SYQA 3FB6C 3WG7C 2QM7A 1BHBA 4DO2A 2H8PC 3JD3A 1COWG 2EIMC 3RVZA 1OCRC 3LUTB 2JEUA 3W7XA 1VQ9V 1E79G 1IXMA 4TSFG 1AR1B 1K7DA 3MHSC 2Z3YA 1R3KC 3AG3C 1WPXA 3ABMC 2HVJC 4FK5C 2LFRA 5CMUA 3CCRV 3CYOA 3CMAV 3H01A 2BOCC 4I5SA 3CC2V 2XAJA 5B1NA 4PDRA 4X88A 1OCZB 3E8FA 2IJKA 5L3CA 1NJIW 5L3BA 3SPJA 2C2AA 4UXNA 1FS0G 5LBQA 1KQSU 3FKSG 1EZJA 2EINC 1EFRG 2GHYA 1G4YB 1K73W 4PELA 3TETA 1RPRA 1WLEA 1H8HG 4RUFA 3ZRVA 2XASA 3GB7C 2Y48A 2IU3A 1QBZA 4QNHB 1CEZA 4RO2A 5IYDO 4GX1A 2EZOA 2QA4V 1AI7A 3OMAB 1NVPB 2WPDG 3MHHC 1PNKA 1NVPD 2JK5C 3OGCC 2Q69A 1JX9A 2YSUB 3SPGA 3T4ZA 3ZCCA 2JJ2G 1YITV 2WLLB 1DLBA 1GM7A 3ASOC 4J9ZB 3UKMA 4G27B 3I55V 3RVYA 2OCCC 1QLNA 3SYOA 5LHHA 3CXCU 4UV8A 3OR6C 3K04A 3QO5A 1K5SA 3ZJZA 1UJWB 2DWDC 2ITDC 1Q81W 1PNMA 3G71V 1L1FA 2B5UA 2DYRC 2ZD9A 2V7QG 3CCLV 2WLKA 2JEXA 1MOFA 4XDLA 3CC7V 1GKFA 1OCRB 2WLJA 3ABUA 1ZWIC 1AI5A 5DM6V 2Q6AA 5EK0A 3JD2A 1I5XA 1QLEC 5IYBO 1FXKC 1Q7YW 3ASNB 2IJJA 2QE7G 1OCCB 1R3IC 3DTUB 4XBFA 3A0RA 1XL4A 4MVMA 4GCZA 2X6BA 4G28B 3QNEA 3ZMZA 3SPHA 4Z1MG 1W2BU 1NH2B 2EILB 3WG7B 1H2GA 1XL6A 1GK9A 2P7TC 3F7YC 4UVBA 3ZMVA 4RQFA 1NH2D 4WFHA 4JAVA 3B8NA 4TWKA 3JD1A 2EJRA 3MD0A 3SJQC 1AJQA 4MW8A 3K03A 4YXWG 1NR1A 1NBMG 2WLHA 2Y69C 3OE7G 1R73A 2DQ0A 2P6JA 3ABKC 1Y4MA 2DYSC 2HFEC 3ZMSA 4L87A 2EIKC 5E1AC 2IJHA 3K3WA 4MTXA 4R6ZA 4UVCA 1PNLA 3FB8C 1K5QA 3W7UA 1JOYA 3CCMV 3IFXA 1OCCC 5LHIA 1F51A 2QTOA 3QO7A 4FJCC 1OCOB 3HB3B 2R9RB 1OZ0A 3E2EA 1RM1C 1V55B 1S76D 4GT1A 1GTOA 2ZDIC 1BHAA 2WLIA 5LGNA 3K9AA 1KC8W 1GM9A 3AG2C 3AG1C 1VQ6V 3B8MA 4MW3A 2DYSB 3T1CA 2CK3G 4PDLA 2UXNA 5IDJA 1S77D 4ZBMA 2ZXWC 4P9OA 4FIPC 3WFVA 1JJ2U 1K9MW 1TUEB 1YTFD 2WLNA 2ZXWB 1VQ7V 2DYRB 5B3SB 2IU0A 2B1IA 3E89A 1H8EG 1M57B 4GX2A 5CBGA 3AG1B 3SYPA 2HG5C 1V54B 3ETEA 3OEEG 1OCZC 1K3EA 2IH1C 2LP7A 1H38A 4XDKA 1KP2A 1K92A 5KA5A 4HZ3A 4LCUC 1R6NA 3K06A 4MTOA 3STLC 1JPXA 3ZRWB 1BL8A 3ASNC 2AHYA 1R3JC 3QO8A 1SETA 3M99B 4QIWF 2PI5A 2R9IA 4RUEA 3LDEA 4X8AA 1QVGU 4KP4A 4MVZA 3E8GA 1QCEA 2EIMB 1E1QG 1YJNV 3LSSA 4PA9A 4FPPA 5KUMA 5L3DA 3ZN1A 4Q20A 1YHQV 2ATKC 5GW7A 5EBMC 3ML0A 4PA4A 1RPOA 3OMIB 1VQMV 3CCUV 1DF4A 4U7OA 4X89A 1P4RA 3E8HA 2GSMB 3I56V 4N23A 3D36A 1J95A 1PL0A 2EIJC 3SPIA 1BMFG 3ZRWA 1DF5A 1NQTA 4WCEV 1K4DC 5L3EA 2X7RB 2FTKA 5EC1C 1GM8A 1SZTA 4RQEA 3LNMB 2XAHA 1FXHA 4UUJC 3OUFA 4JF3A 4BIUA 2Q68A 2EIKB 1S3JA 1F4MA 4JGSA 3EHBB 3ZN0A 5EBWC 4R50A 2A0LA 5H6QA 1Q82W 2A79B 1MABG 1K34A 3FYIB 3X2QC 3ETDA 2F43G 2XAGA 3LDCA 3OMNB 3P32A 4KUMA 2OT5A 2XAQA 1S72V 1SESA 3LSQA 4JASA 2QEXV 2XAFA 4BW5A 3B77A 5CN0A 3K0GA 1MSWD 4QPJA 1ORQC 1QLEB 2DW4A 1F23A 1V54C 1OCOC 4OXSA 1SRYA 2WLMA 3KG2A 2UXXA 4MVQA 2Z5UA 4ZKIA 2JDIG 4HYOA 4JAUA 5HFLA 1HWYA 3T2MA 4TT3G 3AG2B 4MTGA 4ASUG 1YTFB 3JYCA 4BAYA 4WFBV 4CZZA 1YIJV 3OUSA 4MVRA 3ABMB 3K79A 4WFEA 1NR7A 2IW5A 1QR8A 3F5WC 3FB7C 4MVSA 4JYBA 2X6AA 3CCVV 3PJSK 2ZR3A 2IJIA 3R65A 1R6KA 2ZQMA 3K0DA 2X0LA 1GMGA 3BY6A 1G8MA 3ZMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEI A;  2ZDI A;  2ZQM A;  1FXK B;  1FXK C;  2ZDI C;  1FXK A; 
#chains in the Genus database with same CATH topology
 4NR1 A;  3ZRS A;  3OAA G;  4H44 B;  4FZ0 A;  2P22 C;  5LP6 A;  4QPK A;  4RWU A;  2PI4 A;  2H3O A;  4OX9 B;  5H6R A;  1ZX3 A;  1TVK A;  5CBF A;  5E79 Z;  2RQ6 A;  4YJ3 B;  4IHJ B;  2MK3 A;  3F7V C;  2BTQ A;  2BSK B;  5GTI Z;  4BWA A;  4R8C A;  5LGT A;  4JTA B;  3CCE V;  1K97 A;  3QTC A;  4DV7 B;  5LYJ A;  1SER A;  4I0X A;  4DV1 O;  1N32 O;  2E3C A;  1VQO V;  2WA4 A;  4FLU A;  4FVM A;  3JAW A;  4X66 B;  2ZCE A;  1YDX A;  1VQ4 V;  3HKB B;  1DTO A;  2QGN A;  3EFF K;  5J9P C;  1L8D A;  2N05 A;  2F4V O;  3HPL C;  3CCS V;  1Y66 A;  2H94 A;  2W6I G;  1RM1 B;  1IBK B;  1FFT B;  1N4C A;  2E5L O;  3FAV B;  3WU2 Z;  4NXM B;  5JCO C;  2EBO A;  2QWQ B;  1Z5V A;  2NLJ C;  5H9C A;  2N04 A;  3CME V;  1SQG A;  3THO A;  2WSS G;  3ETG A;  3T1Y B;  2ZNI A;  3DC5 A;  4O4J B;  1K33 A;  3RYH B;  1GO3 F;  4I55 B;  1CPY A;  3RGB A;  2BSK A;  4BW9 A;  1PP9 H;  2ZM6 B;  2N74 A;  3CCQ V;  3BEH A;  3AK3 A;  1EN4 A;  1N32 B;  3CWB H;  2PZS A;  2P4V A;  1YSC A;  3AK2 A;  2XHB A;  3NXS A;  1KKD A;  2R72 A;  2HLD G;  4J9Y B;  2PY5 A;  2ZE6 A;  2YIB D;  4J11 A;  2CGN A;  5KA6 A;  3JD0 A;  4PA6 A;  4DR7 O;  2YEV B;  2IH3 C;  3TK1 A;  1CP9 A;  1H2K A;  5L3G A;  4PA7 A;  3AK1 A;  2OCC B;  3GWO A;  4HNA B;  1RSO B;  3JAK B;  3APQ A;  4QE9 A;  4LFB O;  3SDL A;  2JJ1 G;  1QVF U;  3OTO O;  4JI4 O;  1KU9 A;  1NKD A;  4UCO A;  3BA8 A;  2XOK G;  3E83 A;  3ZMT A;  4IHJ A;  1QR9 A;  1I08 A;  3BFR A;  1KEC A;  4DUZ B;  1F7Y A;  4JPR A;  2A9H A;  3R66 A;  5KLV H;  3CP1 A;  3EVK A;  1SA0 A;  3JAR A;  4X20 B;  5CBH A;  4PA3 A;  1E1R G;  3ICX A;  2YEV A;  3CX5 F;  2QM7 A;  2H8P C;  3JD3 A;  1OCR C;  2JEU A;  4X1Y A;  3W7X A;  1Y74 A;  1IXM A;  1K7D A;  4F6R B;  4KXR A;  5CMU A;  3CCR V;  3CMA V;  3K57 A;  2XAJ A;  4F6E A;  4X88 A;  3E8F A;  1LR1 A;  3ZHR A;  1VP7 A;  4H0L B;  4UXN A;  5LBQ A;  3FKS G;  2CDY A;  1EZJ A;  1EFR G;  3U11 A;  3JAK A;  3D3Q A;  4DK0 A;  2XAS A;  2IU3 A;  1XQ8 A;  4B3T B;  4RO2 A;  3E22 A;  5IYD O;  2Q8V A;  2EZO A;  5K1P A;  3JAT A;  3RYI B;  3OMA B;  1G6U A;  5CB4 B;  4IIJ B;  4EEQ A;  1YIT V;  4X65 O;  1DLB A;  4OPA A;  4AI8 A;  2P4K A;  3RVY A;  3PN1 A;  1KB9 F;  2OCC C;  4PHZ A;  2XUM A;  4UV8 A;  1HDJ A;  3DSQ A;  3QVN A;  4GKK O;  2F66 C;  1UJW B;  3KCX A;  5DEC A;  2DWD C;  2OYQ A;  3VQY A;  4X1K A;  3G71 V;  1VIB A;  4E4E A;  2DYR C;  4JI7 B;  3CC7 V;  1ZWI C;  4PV1 B;  3B2E E;  5EK0 A;  3JD2 A;  5J2U A;  5IYB O;  1P7G A;  1LUW A;  2Q4P A;  1OCC B;  1XL4 A;  1W59 A;  2X6B A;  3ZMZ A;  4X1I A;  3SPH A;  3HR0 A;  3WG7 B;  4JI8 O;  1NH2 D;  2P7T C;  4DR4 B;  4JAV A;  4DR2 B;  5EZY B;  4B3T O;  3ZHQ A;  3EXA A;  1AJQ A;  1GN3 A;  4UB8 Z;  1NR1 A;  1NBM G;  3NR7 A;  3IJ4 A;  1WA8 B;  4ZI7 A;  2FKX A;  1UPG A;  4X65 B;  3MAQ A;  2NN4 A;  4OPH A;  2QTO A;  3ZHS A;  2R9R B;  1OZ0 A;  4YY3 O;  3IC9 A;  1RM1 C;  3B09 A;  3G67 A;  1GTO A;  1KC8 W;  2LGW A;  4YIP A;  3AG1 C;  1VQ6 V;  4K0K O;  3T1Y O;  3T1C A;  3TXQ A;  1URF A;  3HKE B;  4P9O A;  2UUC B;  3WFV A;  1K9M W;  2Y4U A;  3CRQ A;  4L8J A;  2ZE7 A;  2ZXW B;  1VQ7 V;  1KUQ A;  2IU0 A;  1H8E G;  3F5T A;  3RWR D;  2HG5 C;  1V54 B;  2UXD B;  2Y0P A;  5H2F Z;  1K3E A;  2KG7 B;  4J10 A;  2ILM A;  5KA5 A;  2YXH A;  4HZ3 A;  4LCU C;  1BE3 H;  3K06 A;  4X1K B;  1BSM A;  2E76 B;  1R3J C;  3M99 B;  4QIW F;  2QKA A;  3LDE A;  5FPO A;  4DYL A;  4KP4 A;  5A9G A;  2QWO B;  1N34 B;  3FAV A;  5AG2 A;  4JI3 O;  1YJN V;  3KKY A;  2P06 A;  2ATK C;  4DR1 B;  1AP5 A;  1DF4 A;  5LP6 B;  3I56 V;  4N23 A;  2A7W A;  3JAS B;  1DF5 A;  3TGU H;  4O4I B;  2UU9 O;  1GM8 A;  1SZT A;  4GKJ O;  4FLY A;  4RQE A;  2XAH A;  1FXH A;  3GWK C;  2ETN A;  3JSN A;  2Q68 A;  3CEI A;  1F4M A;  4I0X B;  1Q90 D;  3ZN0 A;  4W4K A;  1K34 A;  3P32 A;  4KUM A;  2BTQ B;  2XAQ A;  1DGS A;  1IBK O;  5B5E Z;  3K0G A;  1AP6 A;  2QTS A;  2DW4 A;  3N27 A;  1F23 A;  1XHZ A;  2YDE A;  4DV4 O;  3HKC A;  4X66 O;  1XNR B;  3T2M A;  1RP3 B;  1Y74 B;  4MTG A;  1NU1 H;  1YTF B;  2F93 B;  3ZX6 A;  2KG7 A;  4LF8 B;  3WB1 A;  4WFB V;  4JI7 O;  2BCC H;  3OUS A;  4MVR A;  4DR1 O;  2CAZ C;  4AQY B;  2DOS A;  1NR7 A;  2QWR B;  2IW5 A;  3L75 H;  3BVO A;  1PM9 A;  3F5W C;  4JYB A;  2GTS A;  1Q6H A;  2AGA A;  3CCV V;  3PJS K;  1XMO O;  2X0L A;  1MZF A;  3H9V A;  3SPG A;  1G8M A;  1KYO F;  2WA3 A;  1JR9 A;  1R3L C;  3J81 N;  1JA8 A;  4JV5 B;  3VOU A;  2DMX A;  4U7N A;  3KZI Z;  4O4L A;  5IYC O;  2DWE C;  3DGE A;  4EKW A;  1TGO A;  1VMG A;  1KP3 A;  2Q73 A;  3RW0 A;  1QU7 A;  1HR0 B;  3N2G A;  4DV0 O;  1L0L H;  3O65 A;  4TV9 B;  4TOI A;  4FFB A;  3WB0 A;  3OR7 C;  5EYP A;  4IYI A;  3P3P A;  2CH7 B;  2QM8 A;  3W7T A;  1Z5W A;  4LF9 B;  1H2L A;  4NYK A;  4LF4 O;  4WF9 V;  2DE0 X;  3ABT A;  5F2V O;  1VQK V;  2KB1 A;  3RYF B;  4DRX A;  4AQY O;  3ZRX A;  3HKC B;  3W7W A;  4KHP B;  3K08 A;  4O4L B;  5FLX N;  2JGD B;  4EFB A;  2V1D A;  2M7W A;  2B1G A;  4E2L A;  4K8Z A;  2EIJ B;  3T4D A;  5B1A B;  3FYE B;  2OIE A;  3LNN A;  3QG5 A;  2HKO A;  1N0J A;  3OW2 U;  1YI2 V;  4DXW A;  4DR7 B;  1K8A W;  4PDM A;  1AI6 A;  4FLT A;  2HJD A;  1B6Q A;  2W6J G;  2OTJ V;  1M9N A;  4TQD A;  1F4N A;  4DR3 B;  4JZG A;  2LQT A;  5IY5 B;  5B1B C;  1B3Q A;  1JVM A;  4DV1 B;  4GX0 A;  5B3S C;  4MT8 A;  4LFB B;  1VQ5 V;  1XNQ B;  2VRZ A;  1JQ0 A;  1FXK B;  3ZIA G;  1M56 C;  4NXN O;  3JCZ A;  4DR6 O;  2QM4 A;  4K35 A;  4CH6 A;  1PD3 A;  2GTA A;  5BR8 O;  1AJN A;  2YXY A;  5JJE B;  1HNX B;  2UXD O;  2Q67 A;  4YJ2 B;  2CUG A;  2DQ3 A;  5IY5 C;  4DV0 B;  4IIJ A;  2WWW A;  2E74 B;  1U96 A;  1FXK A;  5CA1 A;  5IT9 N;  1W0J G;  3AG7 A;  2UUB O;  3UO2 A;  3AG4 B;  4JTC B;  5KUK A;  3ZS8 C;  1XBL A;  4P30 A;  5IJ9 A;  3BA9 A;  3S3W A;  2D2C B;  4CH3 A;  1P84 F;  3LDD A;  1AJP A;  3OEH G;  4MVO A;  2BOB C;  3SYQ A;  1R6T A;  1BT8 A;  1A32 A;  3FB6 C;  3WG7 C;  4I4T B;  1BHB A;  2KKW A;  4DO2 A;  4NXM O;  1COW G;  1WB7 A;  4D6T H;  1VQ9 V;  2CTW A;  4TSF G;  1AR1 B;  1Q3E A;  3AG3 C;  2XT9 A;  1HNW O;  2Z0A A;  1IBM B;  4FM0 A;  3JAL A;  3CYO A;  2BOC C;  4I5S A;  1N0N A;  1GN2 A;  1ZTE A;  5L3C A;  1VF5 B;  3BAA A;  4FLZ A;  1ZLZ A;  2C2A A;  1FS0 G;  5LXT B;  1G4Y B;  4X64 B;  4PEL A;  4DV5 B;  1Y67 A;  4GZR B;  2EX3 A;  1WLE A;  4RUF A;  1X59 A;  5BMV A;  4TUY B;  1MMM A;  2QA4 V;  2ZIM A;  4J7Z A;  1PV0 A;  4JYY A;  1NVP B;  5LXT A;  3MHH C;  1PNK A;  2JK5 C;  2R70 A;  3BHP A;  3OGC C;  2Q69 A;  1JX9 A;  2YSU B;  2LO1 A;  1M4U A;  2JJ2 G;  2YI9 A;  2GUZ A;  2WLL B;  1GH6 A;  1ZUQ A;  1SQF A;  3UKM A;  4G27 B;  3J80 N;  1GRJ A;  1KMI Z;  3SYO A;  5LHH A;  3CXC U;  4JYA O;  2Q0O C;  5IYZ A;  1HNW B;  4J80 A;  3QO5 A;  2DN9 A;  3K59 A;  1OV9 A;  2F23 A;  3A2F A;  4I4T A;  4X20 A;  2V7Q G;  4B7E A;  2JEX A;  5B66 Z;  1QLE C;  4ZIB A;  4LNU B;  4JI6 B;  2LGQ A;  4KHP O;  3L70 H;  5IYZ B;  4Z1M G;  4ZHQ B;  1T5E A;  3F7Y C;  4UVB A;  4CH5 A;  3B8N A;  2HP8 A;  4GKJ B;  3MD0 A;  3CJH A;  3SJQ C;  3ZHT A;  1WAZ A;  5TIS Z;  4MW8 A;  3UQ8 A;  1CXZ B;  4YXW G;  2Y4T A;  3ABK C;  2EIK C;  5E1A C;  4QGP A;  4R6Z A;  3FB8 C;  4TUY A;  5LMU O;  3SJB C;  5BMV B;  3CCM V;  1OCC C;  5LHI A;  3QO7 A;  4FJC C;  4I9Q A;  3KCY A;  3BRC A;  1JFF A;  4GKK B;  1BHA A;  3HKB A;  1GM9 A;  3JAM N;  1IBL O;  2CGO A;  3AG2 C;  1I94 O;  3B8M A;  2DYS B;  4PDL A;  4ZBM A;  5A2Q N;  2UXC B;  3H1H H;  2JS5 A;  1YTF D;  1TUE B;  3RYH A;  2B1I A;  2ZNJ A;  3E89 A;  1M57 B;  5CBG A;  3S3X A;  3SYP A;  1SC5 B;  1XUQ A;  3SR2 C;  4B08 A;  5C8Y B;  2OWO A;  1N36 B;  5JVD A;  3QO8 A;  2PI5 A;  2R9I A;  1QVG U;  4ICG A;  3CHX A;  3E8G A;  1QCE A;  3LSS A;  4FPP A;  5ITZ B;  5EBM C;  2UUA O;  4D7S A;  1Z2G A;  3OMI B;  4AHC A;  3CCU V;  4X89 A;  1P4R A;  1M93 A;  2GSM B;  1FPO A;  2YC0 A;  2GBO A;  4O2A B;  4UCR A;  1BMF G;  4WCE V;  2Q0A A;  1XNQ O;  5EC1 C;  4Q6G A;  4YJ2 A;  1D5A A;  4H13 B;  4LF9 O;  3LNM B;  3OUF A;  1VAR A;  3VQX A;  4Z2W A;  4JI3 B;  1TVK B;  3K5O A;  2AZ2 A;  1HP8 A;  5H6Q A;  2A79 B;  1MAB G;  3FYI B;  2F43 G;  3LDC A;  2XAG A;  3OMN B;  4JI0 B;  4DR5 B;  1SES A;  3LSQ A;  4J7J A;  4JAS A;  4DRX B;  2XAF A;  3CRR A;  4ZHQ A;  1ORQ C;  2VQE B;  1NTM H;  4OXS A;  1SRY A;  2WLM A;  4JI1 O;  3DXR A;  1IBL B;  5HFL A;  1MNG A;  4CZZ A;  1YIJ V;  2UUC O;  3ABM B;  1XOU A;  4DV2 O;  1SQP H;  1SQB H;  1SZX A;  4JI0 O;  4IT5 A;  2IJI A;  4BR6 A;  2ZQM A;  3K0D A;  2ZIO A;  2EJ7 A;  1GMG A;  4HBN A;  4JZ2 A;  3CRA A;  1VF7 A;  1SKV A;  2JRI A;  2QSA A;  4X62 B;  2WAM A;  1US6 A;  3ABL C;  4PJ0 Z;  4NVP A;  3AEI A;  2Q9L A;  5FPR A;  1XHX A;  4JYC A;  4FM1 A;  2K1E A;  3Q4H B;  5IJ9 B;  3STZ C;  3H1K H;  2X6C A;  3BPZ A;  4DR3 O;  1O9G A;  4MS2 A;  3U10 A;  4UV9 A;  4JI8 B;  3JAT B;  3RYI A;  5CA0 B;  1JMK C;  3X2Q B;  1P7B A;  5KX5 B;  3LSU A;  4QE7 A;  3SJC C;  3W7S A;  1I5Y A;  4I9W A;  2ITC C;  5DED A;  1D2D A;  4JTD B;  4Z1V A;  2W0F C;  3L72 H;  3UM7 A;  1S0V A;  4U3J A;  5C93 A;  1SQV H;  2YIA A;  1XMO B;  3H1L H;  3CC4 V;  1D5N A;  3FD9 A;  5KMG A;  1AI4 A;  4YY3 B;  4UVA A;  3H1J H;  4LF5 B;  1ROP A;  3C3T A;  5EC2 C;  4X62 O;  5IE9 A;  3OFN G;  4TV9 A;  1MG1 A;  5J2U B;  1Q43 A;  1AB3 A;  1M5I A;  3ABK B;  4EB6 A;  2P90 A;  3E86 A;  1G1X B;  4WFA V;  1N8R W;  4N21 A;  2ZDI A;  1VQP V;  4JI6 O;  3D3I A;  5LMU B;  4K8X A;  2L35 A;  4KFM A;  1H2S B;  2HJF C;  2XND G;  4DR4 O;  4LBE C;  2CTR A;  1B04 A;  5JJJ B;  4B3S O;  4PI2 A;  2P67 A;  3SGI A;  1B06 A;  1WN7 A;  1WP8 A;  3L9D A;  3SYA A;  4BIZ A;  5LHG A;  2RCV A;  4YJ3 A;  2PTM A;  3D36 C;  1ZL8 A;  4IGG A;  4P2Z A;  5LGU A;  4I50 B;  2UXC O;  5FL7 G;  2E75 B;  3IC7 A;  2PF4 E;  5CB4 A;  4DUY B;  1S5H C;  5KX5 A;  1H2N A;  1M90 W;  1THZ A;  2LFS A;  4H37 A;  1QNM A;  1JFF B;  1J5E O;  2YXL A;  2QKS A;  3N2K B;  3FB5 C;  5KHJ A;  5EBL C;  4PI0 A;  5L3F A;  3BAB A;  3CD6 V;  1XI1 A;  5EZY A;  3AG3 B;  1PL4 A;  1JCH A;  1ZSP A;  4B3M O;  2OTL V;  1TAE A;  1Q5O A;  3QF7 A;  4MSW C;  2KQX A;  2ARH A;  3SYC A;  3G4S V;  1XEQ A;  1ENV A;  4FM2 A;  4F6R A;  2F4V B;  1EZV H;  1AIL A;  4B7K A;  5LYJ B;  5KHK A;  3RVZ A;  3LUT B;  1I0H A;  3OGI B;  3MHS C;  1FYJ A;  1R3K C;  1VF6 C;  1WPX A;  2Y0I A;  2HVJ C;  3RYF A;  4FK5 C;  2LFR A;  3E22 B;  3H01 A;  3CS5 A;  3CC2 V;  1BGY H;  4DUY O;  4NKG B;  1NJI W;  3FX7 A;  5JQG A;  4JI2 O;  2EIN C;  1BQZ A;  2O57 A;  1LUV A;  5J2T A;  1RPR A;  4BIO A;  1DK1 A;  3ZRV A;  3GB7 C;  2Y48 A;  4B3S B;  2FB5 A;  1R1B A;  4FLV A;  2NR5 A;  2RMK B;  5IWA O;  4NXN B;  1YEW A;  2WPD G;  2ZT9 B;  1NVP D;  2Q7G A;  3T4Z A;  3ASO C;  1N33 B;  1VEW A;  2FL4 A;  3I55 V;  4DV6 B;  4CH4 A;  1QLN A;  1HNZ O;  1SQX H;  4O4I A;  1Q81 W;  2P5O A;  1PNM A;  2B5U A;  2ZD9 A;  5KAF Z;  1YXB A;  2WLK A;  2WLJ A;  3G6B A;  1AI5 A;  1Q7Y W;  1FXK C;  4HNA A;  3ASN B;  4JI2 B;  2IJJ A;  2QE7 G;  1R3I C;  3I5D A;  2ZE5 A;  4XBF A;  2FML A;  3A0R A;  4MVM A;  1IX9 A;  5KMG B;  1U97 A;  3QNE A;  2QKC A;  1W2B U;  2LW1 A;  3T1H B;  2EIL B;  1H2G A;  3ZHU A;  1XL6 A;  1GK9 A;  4NTX A;  4LF7 O;  4WFH A;  1KBH A;  3A0H Z;  4TWK A;  2EJR A;  4O2B A;  4TV8 A;  1HNZ B;  2WLH A;  3N2K A;  2DQ0 A;  4EFE A;  3MDS A;  1PNL A;  2YIC A;  3IFX A;  1NTK H;  4NB5 A;  1F51 A;  3HKD A;  2V4D A;  2YUA A;  1SF9 A;  3HKE A;  1OCO B;  3HB3 B;  4GYC B;  4JYA B;  3E2E A;  4D7T A;  3FFQ A;  1NT2 B;  5LGN A;  2UU9 B;  3K9A A;  4LFC B;  2OCH A;  1EM1 A;  1QHT A;  4MW3 A;  5D5P A;  4B3R B;  1S77 D;  2PGG A;  4DR6 B;  4JAA A;  4FIP C;  1JJ2 U;  1WJZ A;  2WLN A;  2DYR B;  5B3S B;  4UFZ A;  4GX2 A;  1VF6 A;  4O4J A;  1HNX O;  5LA6 B;  2A3Q A;  2UXB O;  2LP7 A;  3C90 A;  1KP2 A;  4LH6 A;  4NTY A;  4MTO A;  4JI1 B;  1FJG O;  1EN5 A;  2YIB A;  3U0Z A;  3TXS A;  3ASN C;  2AHY A;  4YHH B;  4RUE A;  4KL1 A;  4X8A A;  1I94 B;  1SA0 B;  4X1I B;  1XIL A;  1E1Q G;  4PA9 A;  1BZK A;  5L3D A;  1YHQ V;  5GW7 A;  1IVS A;  3K5N A;  3ML0 A;  1VQM V;  5KHH A;  3H1I H;  4J7K A;  4U7O A;  5JJN B;  3E8H A;  2ODM A;  2UXB B;  1J95 A;  2F1M A;  3SPI A;  1NQT A;  4CC5 A;  3T1H O;  2X7R B;  1YZB A;  2BE3 A;  2ZE8 A;  4UUJ C;  1I7F A;  1IBM O;  4UCT A;  1S3J A;  5EBW C;  3CRM A;  4R50 A;  2RDC A;  1Q82 W;  3B4S A;  3G80 A;  1NZ6 A;  4LNU A;  3ETD A;  2CH7 A;  2OT5 A;  1S72 V;  1GN6 A;  3B77 A;  1MSW D;  1QLE B;  3N2G B;  1V54 C;  4YIO A;  1OCO C;  1OJH A;  5JVD B;  3OTO B;  3KG2 A;  4MVQ A;  4ZKI A;  4HYO A;  3JCU Z;  1NS1 A;  4WBN A;  1HWY A;  5LMN O;  1UFI A;  3CJH B;  4DK1 A;  2FYU H;  1S5J A;  3JYC A;  3RT3 C;  4BAY A;  1IXB A;  2MW2 B;  1BS3 A;  3L74 H;  4ZI7 B;  3JAL B;  4WFE A;  3CSX A;  2PUS A;  2X6A A;  4NTW A;  3CB2 A;  5LL6 Y;  3A8T A;  2ZR3 A;  1R6K A;  2ZIN A;  2G38 A;  2YI8 A;  2JIZ G;  5KHI A;  4DV3 B;  1M1K W;  1NI8 A;  4LFA B;  1VQ8 V;  2EZP A;  1FXV A;  2VS0 A;  1HW7 A;  2YS8 A;  4G2K A;  1YJ9 V;  1BCC H;  4CBC A;  3K58 A;  4FFK A;  4JI5 B;  3UT5 A;  1W0K G;  3JAR B;  4MTF A;  4RAI A;  2QR4 A;  2WLL A;  5B1O A;  5GON B;  1OHH G;  4OGQ B;  1FFX A;  4PDV A;  3OTF A;  2F95 B;  4FMT A;  1VQN V;  1IDS A;  4UB6 Z;  2D3O W;  3ASO B;  3VQW A;  5BY1 A;  3ABL B;  4UCU A;  4GX5 A;  4IYH A;  3GVM A;  4UCV A;  2GV9 A;  2QDO A;  1XNR O;  3ZED A;  4UCS A;  3G6E V;  1RSO A;  2CTP A;  1V55 C;  1K4C C;  1MZE A;  1ARO P;  4LF6 O;  2NNU A;  2ADP A;  2KSD A;  4DR5 O;  1PKX A;  1WP7 A;  1YJW V;  5BZB A;  3E8B A;  5LP6 C;  2ZM6 O;  4GUN A;  1PPJ H;  5KHG A;  1X4T A;  5H5N A;  1VQL V;  4W4L A;  1EBO A;  3OM3 B;  4WFG A;  3WB2 A;  2AZ0 A;  2Y69 B;  3D8C A;  5B1A C;  3AG4 C;  3SPC A;  4JI4 B;  3VBB A;  2UUB B;  2ZR2 A;  1Q6U A;  4JV5 O;  2HVK C;  1LNQ A;  2LW7 A;  5EIB C;  3BCC H;  4H33 A;  1N34 O;  5EIB D;  2AHZ A;  3TCU A;  1KD1 W;  5C8Y A;  3TJT A;  3ETQ A;  4LP8 A;  2BTO A;  2W0X A;  5HFM A;  2Q5Z A;  2EIN B;  3OT7 A;  3RBZ A;  1IUR A;  2IBZ H;  5GTH Z;  4J41 A;  5LOV A;  4LF7 B;  4MVU A;  5B1B B;  4O2A A;  4LC1 A;  4DV3 O;  2WLI B;  2RN9 A;  3APO A;  4C7U A;  1M56 B;  3IGA C;  4XDJ A;  1L0N H;  1M57 C;  1GAX A;  2B9Z A;  3CPW U;  5J2T B;  2OIG A;  3P30 A;  4HAM A;  4R7C A;  5DN6 G;  1Y76 A;  3JAS A;  5JQG B;  2UUA B;  2RNB A;  1WNS A;  2HEP A;  4QJF B;  3JD4 A;  2R9A A;  4FFB B;  3K9S A;  4P9P A;  3E35 A;  2EIL C;  3CCJ V;  1O9H A;  1Q86 W;  2QWN B;  4WFF A;  4TQF A;  2QWP B;  1FJG B;  4F4L A;  4K0K B;  2GUZ B;  3L71 H;  5CA3 A;  4B3R O;  4X9Q A;  1H2M A;  4LF8 O;  1KKC A;  3UT5 B;  3M8A A;  2VQF B;  2HR3 A;  2PYJ A;  1FKA O;  2EIM C;  3O9O A;  3SJA C;  1E79 G;  3HKD B;  5LMN B;  5FNV A;  2LJ2 A;  2Z3Y A;  5IJ0 A;  5JH7 B;  3ABM C;  2K9P A;  1WPB A;  3UCS C;  4ABM A;  5B1N A;  4PDR A;  1OCZ B;  2IJK A;  2PYL A;  2AXT Z;  2JGD A;  5L3B A;  3SPJ A;  5D5Q A;  3JAW B;  1KQS U;  1YCI A;  2HHH O;  4CS4 A;  2GHY A;  1MA1 A;  1K73 W;  2JGU A;  4DV6 O;  3TET A;  2A06 H;  3M7M X;  1H8H G;  1WA8 A;  1QBZ A;  4QNH B;  1CEZ A;  2JS3 A;  4LWS A;  4GX1 A;  5JWP A;  1AI7 A;  3UO3 A;  2GDS A;  1Y6X A;  3CE2 A;  5GON A;  3ZCC A;  1BQ0 A;  2JVD A;  1AVM A;  4DW0 A;  2CE4 A;  4FZ1 A;  1GM7 A;  1TA8 A;  5KAI Z;  4DV7 O;  4J9Z B;  1XDC A;  5K1X A;  5LOV B;  1S5L Z;  5FNV B;  5EYP B;  3OR6 C;  3K04 A;  4IL6 Z;  1K5S A;  3B40 A;  3ZJZ A;  2ITD C;  2Q7H A;  1L1F A;  3RN4 A;  3CCL V;  4LF6 B;  4XDL A;  1MOF A;  3IAY A;  3K5L A;  1GKF A;  1OCR B;  3ABU A;  5DM6 V;  2Q6A A;  1JJO A;  1Q8I A;  1I5X A;  2L6L A;  4CS2 A;  3DTU B;  2VQF O;  4X64 O;  4GCZ A;  2E5L B;  4ZOL B;  4G28 B;  1NH2 B;  2XTA A;  3ZMV A;  4RQF A;  1XMQ O;  1NTZ H;  3JD1 A;  4WBN B;  3ZBH A;  2EUL A;  3K03 A;  5BXZ A;  1FD9 A;  2Y69 C;  3OE7 G;  2QJ1 A;  1R73 A;  2P6J A;  4A5U B;  1TUB A;  1Y4M A;  2DYS C;  2HFE C;  3Q4H A;  4ZOL A;  3ZMS A;  4L87 A;  1RFY A;  4J42 A;  1ZL8 B;  5BR8 B;  2IJH A;  3K3W A;  4MTX A;  4O4H A;  4UVC A;  4O2B B;  4TV8 B;  1K5Q A;  3W7U A;  4U3J B;  1JOY A;  2Q7E A;  1XRE A;  1N33 O;  3C3S A;  2DJV A;  4DV5 O;  1V9P A;  3JSL A;  2ADQ B;  1ZAU A;  1S76 D;  1V55 B;  5LA6 A;  4GT1 A;  2ZDI C;  2WLI A;  4LH7 A;  3RYC B;  2ZKO A;  2CK3 G;  1FAF A;  2UXN A;  5IDJ A;  2RJZ A;  3ZHV A;  2ZXW C;  1AR4 A;  3AG1 B;  4U3F H;  4CS3 A;  3CXH F;  5JH7 A;  4DW1 A;  3ETE A;  3OEE G;  1OCZ C;  2IH1 C;  1H38 A;  2M6Y A;  4XDK A;  1K92 A;  1R6N A;  1QQC A;  4DR2 O;  1XMQ B;  2VQE O;  4DV4 B;  3A0B Z;  3STL C;  1JPX A;  3ZRW B;  1BL8 A;  4LWS B;  4LFC O;  1SET A;  4I7Z B;  4MVZ A;  4I55 A;  3CRC A;  2EIM B;  4JI5 O;  4I50 A;  4DUZ O;  5KUM A;  3ZN1 A;  1GN4 A;  4Q20 A;  4K3A A;  5JCO A;  4DV2 B;  3J7A U;  4PA4 A;  1RPO A;  3P3N A;  1EN6 A;  3D36 A;  1PL0 A;  2EIJ C;  1YF2 A;  1WB8 A;  3ZRW A;  1K4D C;  5L3E A;  2FTK A;  3RFR A;  1Q6I A;  1YVW A;  4O4H B;  5IJ0 B;  1SQQ H;  4JF3 A;  4BIU A;  4LFA O;  1FFX B;  1Y76 B;  2EIK B;  4B3M B;  4JGS A;  4CC6 A;  4EB6 B;  3OD4 A;  3EHB B;  2VWJ A;  2A0L A;  4LR3 A;  3X2Q C;  4GLX A;  4FLX A;  3RYC A;  5ITZ A;  2HHH B;  2QEX V;  5CA1 B;  1J5E B;  4BW5 A;  5CN0 A;  4QPJ A;  2AW9 A;  4PD4 F;  4AIL C;  2YID A;  1N36 O;  1IZ3 A;  2UXX A;  2IM9 A;  2Z5U A;  3K5M A;  2JDI G;  4LF5 O;  4JAU A;  1SS3 A;  3VQV A;  3L73 H;  4LF4 B;  4TT3 G;  3AG2 B;  4YHH O;  4ASU G;  5IWA B;  4OX9 O;  1TUB B;  3K79 A;  1QR8 A;  2VWK A;  3FB7 C;  4MVS A;  1MSD A;  3DC6 A;  1HR0 O;  5CA0 A;  3R65 A;  4X1Y B;  1P49 A;  1AR5 A;  3DXR B;  2CTQ A;  3BY6 A;  3ZMU A;  4FLW A; 
#chains in the Genus database with same CATH homology
 1R3L C;  3ZRS A;  3OAA G;  2JIZ G;  1M1K W;  3VOU A;  4QPK A;  1VQ8 V;  2EZP A;  1FXV A;  2WAM A;  3ABL C;  3AEI A;  4U7N A;  4G2K A;  2PI4 A;  1YJ9 V;  4CBC A;  5H6R A;  5CBF A;  4JYC A;  5IYC O;  2DWE C;  3DGE A;  4EKW A;  2MK3 A;  1W0K G;  3F7V C;  2K1E A;  4MTF A;  4RAI A;  4R8C A;  5LGT A;  1KP3 A;  4JTA B;  2WLL A;  5B1O A;  1K97 A;  3STZ C;  3CCE V;  3RW0 A;  1OHH G;  2X6C A;  4PDV A;  4MS2 A;  1SER A;  4FMT A;  4UV9 A;  1VQN V;  1VQO V;  2D3O W;  3ASO B;  3OR7 C;  3ABL B;  3X2Q B;  1P7B A;  4GX5 A;  2QM8 A;  3W7T A;  3G6E V;  4QE7 A;  1VQ4 V;  3W7S A;  1DTO A;  4WF9 V;  3ABT A;  1I5Y A;  4I9W A;  1VQK V;  2ITC C;  3EFF K;  1V55 C;  5J9P C;  1K4C C;  1ARO P;  2KB1 A;  2NNU A;  4JTD B;  3HPL C;  2W0F C;  3UM7 A;  1S0V A;  3CCS V;  1PKX A;  1Y66 A;  2H94 A;  2W6I G;  3ZRX A;  1YJW V;  5BZB A;  3E8B A;  3W7W A;  1RM1 B;  5C93 A;  3K08 A;  1FFT B;  1VQL V;  1EBO A;  2V1D A;  3CC4 V;  3OM3 B;  4WFG A;  2M7W A;  1AI4 A;  2B1G A;  4UVA A;  2EBO A;  2Y69 B;  4E2L A;  5B1A C;  2EIJ B;  2NLJ C;  3AG4 C;  5H9C A;  3SPC A;  1ROP A;  3VBB A;  5EC2 C;  3CME V;  2ZR2 A;  3T4D A;  5B1A B;  3FYE B;  2HVK C;  2WSS G;  3ETG A;  2HKO A;  1LNQ A;  3OFN G;  1MG1 A;  3OW2 U;  4H33 A;  1YI2 V;  4DXW A;  3ABK B;  1K8A W;  2AHZ A;  2P90 A;  1K33 A;  1GO3 F;  3E86 A;  4WFA V;  3TCU A;  1KD1 W;  1CPY A;  1N8R W;  4PDM A;  4N21 A;  4LP8 A;  2ZDI A;  1VQP V;  3D3I A;  1AI6 A;  5HFM A;  2EIN B;  1B6Q A;  2W6J G;  2OTJ V;  1M9N A;  3CCQ V;  1F4N A;  4KFM A;  3BEH A;  3RBZ A;  2HJF C;  5B1B C;  1JVM A;  2XND G;  5IY5 B;  4GX0 A;  5B3S C;  4MT8 A;  4MVU A;  1VQ5 V;  4LBE C;  5B1B B;  1YSC A;  4LC1 A;  2P67 A;  2WLI B;  3NXS A;  1KKD A;  4J9Y B;  2HLD G;  1M56 B;  3IGA C;  4XDJ A;  3SYA A;  1JQ0 A;  4BIZ A;  1M57 C;  5LHG A;  1FXK B;  3ZIA G;  1M56 C;  5KA6 A;  3CPW U;  3JD0 A;  4PA6 A;  4P2Z A;  3JCZ A;  5LGU A;  3P30 A;  2YEV B;  4HAM A;  5FL7 G;  4R7C A;  5DN6 G;  2IH3 C;  3TK1 A;  1CP9 A;  1PD3 A;  3IC7 A;  1AJN A;  5L3G A;  4PA7 A;  1S5H C;  4QJF B;  1M90 W;  1THZ A;  2LFS A;  2Q67 A;  3JD4 A;  4H37 A;  2OCC B;  3GWO A;  3E35 A;  4P9P A;  2EIL C;  2QKS A;  3CCJ V;  2DQ3 A;  5IY5 C;  3FB5 C;  4QE9 A;  2WWW A;  5EBL C;  1FXK A;  2JJ1 G;  5L3F A;  1QVF U;  1W0J G;  1Q86 W;  3CD6 V;  4WFF A;  3AG3 B;  4F4L A;  1JCH A;  1NKD A;  2XOK G;  3E83 A;  5CA3 A;  2OTL V;  3ZMT A;  1QR9 A;  3AG4 B;  1KEC A;  4JTC B;  5KUK A;  4JPR A;  4MSW C;  2A9H A;  4P30 A;  3CP1 A;  3SYC A;  5CBH A;  3G4S V;  1ENV A;  3LDD A;  4PA3 A;  1AJP A;  1E1R G;  2HR3 A;  2YEV A;  3OEH G;  4MVO A;  2BOB C;  3SYQ A;  3FB6 C;  3WG7 C;  2QM7 A;  1BHB A;  4DO2 A;  2H8P C;  3JD3 A;  1COW G;  2EIM C;  3RVZ A;  1OCR C;  3LUT B;  2JEU A;  3W7X A;  1VQ9 V;  1E79 G;  1IXM A;  4TSF G;  1AR1 B;  1K7D A;  3MHS C;  2Z3Y A;  1R3K C;  3AG3 C;  1WPX A;  3ABM C;  2HVJ C;  4FK5 C;  2LFR A;  5CMU A;  3CCR V;  3CYO A;  3CMA V;  3H01 A;  2BOC C;  4I5S A;  3CC2 V;  2XAJ A;  5B1N A;  4PDR A;  4X88 A;  1OCZ B;  3E8F A;  2IJK A;  5L3C A;  1NJI W;  5L3B A;  3SPJ A;  2C2A A;  4UXN A;  1FS0 G;  5LBQ A;  1KQS U;  3FKS G;  1EZJ A;  2EIN C;  1EFR G;  2GHY A;  1G4Y B;  1K73 W;  4PEL A;  3TET A;  1RPR A;  1WLE A;  1H8H G;  4RUF A;  3ZRV A;  2XAS A;  3GB7 C;  2Y48 A;  2IU3 A;  1QBZ A;  4QNH B;  1CEZ A;  4RO2 A;  5IYD O;  4GX1 A;  2EZO A;  2QA4 V;  1AI7 A;  3OMA B;  1NVP B;  2WPD G;  3MHH C;  1PNK A;  1NVP D;  2JK5 C;  3OGC C;  2Q69 A;  1JX9 A;  2YSU B;  3SPG A;  3T4Z A;  3ZCC A;  2JJ2 G;  1YIT V;  2WLL B;  1DLB A;  1GM7 A;  3ASO C;  4J9Z B;  3UKM A;  4G27 B;  3I55 V;  3RVY A;  2OCC C;  1QLN A;  3SYO A;  5LHH A;  3CXC U;  4UV8 A;  3OR6 C;  3K04 A;  3QO5 A;  1K5S A;  3ZJZ A;  1UJW B;  2DWD C;  2ITD C;  1Q81 W;  1PNM A;  3G71 V;  1L1F A;  2B5U A;  2DYR C;  2ZD9 A;  2V7Q G;  3CCL V;  2WLK A;  2JEX A;  1MOF A;  4XDL A;  3CC7 V;  1GKF A;  1OCR B;  2WLJ A;  3ABU A;  1ZWI C;  1AI5 A;  5DM6 V;  2Q6A A;  5EK0 A;  3JD2 A;  1I5X A;  1QLE C;  5IYB O;  1FXK C;  1Q7Y W;  3ASN B;  2IJJ A;  2QE7 G;  1OCC B;  1R3I C;  3DTU B;  4XBF A;  3A0R A;  1XL4 A;  4MVM A;  4GCZ A;  2X6B A;  4G28 B;  3QNE A;  3ZMZ A;  3SPH A;  4Z1M G;  1W2B U;  1NH2 B;  2EIL B;  3WG7 B;  1H2G A;  1XL6 A;  1GK9 A;  2P7T C;  3F7Y C;  4UVB A;  3ZMV A;  4RQF A;  1NH2 D;  4WFH A;  4JAV A;  3B8N A;  4TWK A;  3JD1 A;  2EJR A;  3MD0 A;  3SJQ C;  1AJQ A;  4MW8 A;  3K03 A;  4YXW G;  1NR1 A;  1NBM G;  2WLH A;  2Y69 C;  3OE7 G;  1R73 A;  2DQ0 A;  2P6J A;  3ABK C;  1Y4M A;  2DYS C;  2HFE C;  3ZMS A;  4L87 A;  2EIK C;  5E1A C;  2IJH A;  3K3W A;  4MTX A;  4R6Z A;  4UVC A;  1PNL A;  3FB8 C;  1K5Q A;  3W7U A;  1JOY A;  3CCM V;  3IFX A;  1OCC C;  5LHI A;  1F51 A;  2QTO A;  3QO7 A;  4FJC C;  1OCO B;  3HB3 B;  2R9R B;  1OZ0 A;  3E2E A;  1RM1 C;  1V55 B;  1S76 D;  4GT1 A;  1GTO A;  2ZDI C;  1BHA A;  2WLI A;  5LGN A;  3K9A A;  1KC8 W;  1GM9 A;  3AG2 C;  3AG1 C;  1VQ6 V;  3B8M A;  4MW3 A;  2DYS B;  3T1C A;  2CK3 G;  4PDL A;  2UXN A;  5IDJ A;  1S77 D;  4ZBM A;  2ZXW C;  4P9O A;  4FIP C;  3WFV A;  1JJ2 U;  1K9M W;  1TUE B;  1YTF D;  2WLN A;  2ZXW B;  1VQ7 V;  2DYR B;  5B3S B;  2IU0 A;  2B1I A;  3E89 A;  1H8E G;  1M57 B;  4GX2 A;  5CBG A;  3AG1 B;  3SYP A;  2HG5 C;  1V54 B;  3ETE A;  3OEE G;  1OCZ C;  1K3E A;  2IH1 C;  2LP7 A;  1H38 A;  4XDK A;  1KP2 A;  1K92 A;  5KA5 A;  4HZ3 A;  4LCU C;  1R6N A;  3K06 A;  4MTO A;  3STL C;  1JPX A;  3ZRW B;  1BL8 A;  3ASN C;  2AHY A;  1R3J C;  3QO8 A;  1SET A;  3M99 B;  4QIW F;  2PI5 A;  2R9I A;  4RUE A;  3LDE A;  4X8A A;  1QVG U;  4KP4 A;  4MVZ A;  3E8G A;  1QCE A;  2EIM B;  1E1Q G;  1YJN V;  3LSS A;  4PA9 A;  4FPP A;  5KUM A;  5L3D A;  3ZN1 A;  4Q20 A;  1YHQ V;  2ATK C;  5GW7 A;  5EBM C;  3ML0 A;  4PA4 A;  1RPO A;  3OMI B;  1VQM V;  3CCU V;  1DF4 A;  4U7O A;  4X89 A;  1P4R A;  3E8H A;  2GSM B;  3I56 V;  4N23 A;  3D36 A;  1J95 A;  1PL0 A;  2EIJ C;  3SPI A;  1BMF G;  3ZRW A;  1DF5 A;  1NQT A;  4WCE V;  1K4D C;  5L3E A;  2X7R B;  2FTK A;  5EC1 C;  1GM8 A;  1SZT A;  4RQE A;  3LNM B;  2XAH A;  1FXH A;  4UUJ C;  3OUF A;  4JF3 A;  4BIU A;  2Q68 A;  2EIK B;  1S3J A;  1F4M A;  4JGS A;  3EHB B;  3ZN0 A;  5EBW C;  4R50 A;  2A0L A;  5H6Q A;  1Q82 W;  2A79 B;  1MAB G;  1K34 A;  3FYI B;  3X2Q C;  3ETD A;  2F43 G;  2XAG A;  3LDC A;  3OMN B;  3P32 A;  4KUM A;  2OT5 A;  2XAQ A;  1S72 V;  1SES A;  3LSQ A;  4JAS A;  2QEX V;  2XAF A;  4BW5 A;  3B77 A;  5CN0 A;  3K0G A;  1MSW D;  4QPJ A;  1ORQ C;  1QLE B;  2DW4 A;  1F23 A;  1V54 C;  1OCO C;  4OXS A;  1SRY A;  2WLM A;  3KG2 A;  2UXX A;  4MVQ A;  2Z5U A;  4ZKI A;  2JDI G;  4HYO A;  4JAU A;  5HFL A;  1HWY A;  3T2M A;  4TT3 G;  3AG2 B;  4MTG A;  4ASU G;  1YTF B;  3JYC A;  4BAY A;  4WFB V;  4CZZ A;  1YIJ V;  3OUS A;  4MVR A;  3ABM B;  3K79 A;  4WFE A;  1NR7 A;  2IW5 A;  1QR8 A;  3F5W C;  3FB7 C;  4MVS A;  4JYB A;  2X6A A;  3CCV V;  3PJS K;  2ZR3 A;  2IJI A;  3R65 A;  1R6K A;  2ZQM A;  3K0D A;  2X0L A;  1GMG A;  3BY6 A;  1G8M A;  3ZMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...