3F7YC

Kcsa potassium channel in the partially open state with 17 a opening at t112
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
RAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/metal transport
molecule keywords antibody fab fragment heavy chain
publication title KcsA Potassium channel in the partially open state with 17 A opening at T112
rcsb
source organism Streptomyces lividans
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3f7yC00
3F7YC 3T4DA 4MVZA 5KUKA 3T4ZA 1R3KC 2BOCC 2ZXWC 2WLNA 3ABLC 3T2MA 4EKWA 3SYQA 5KUMA 1P7BA 4XDLA 3TCUA 4WFGA 3SYOA 2H8PC 4JTDB 2A9HA 2DWDC 2NLJC 4RUEA 5J9PC 3X2QC 3FB8C 2HVKC 3K04A 1QLEC 4DXWA 3VOUA 5B3SC 2EILC 2WLHA 4PDMA 3E8FA 3E8BA 3K06A 2K1EA 4PA7A 4I9WA 2BOBC 3AG1C 5E1AC 4GX5A 2Q69A 4KFMA 1R3IC 4TWKA 2R9RB 1LNQA 4GX0A 1R3LC 4WFEA 1G4YB 2Q67A 4PA9A 4XDJA 3SJQC 3E86A 3FB7C 4H37A 3ABKC 4LP8A 4MVMA 4R6ZA 3F7VC 2DYRC 1M57C 3WG7C 2AHZA 3LUTB 3E83A 2WLLB 2QTOA 1J95A 2AHYA 2ITCC 3SPGA 4RUFA 4MVUA 2Q6AA 3UM7A 2ATKC 4MSWC 4P9PA 4G27B 3SPHA 3ZJZA 4GX2A 4MVSA 4GX1A 4BW5A 3T1CA 4PDVA 4CBCA 3SYAA 3R65A 3HPLC 4OXSA 4R7CA 3LNMB 2YEVA 1V55C 4HZ3A 2P7TC 2ZD9A 2IH3C 3AG2C 3SPJA 2DYSC 2WLJA 2Y69C 4J9ZB 4MTOA 4JTCB 5EK0A 4H33A 3OUFA 3SYPA 1JVMA 2HJFC 3BEHA 2OCCC 3KG2A 3LDEA 3OR6C 4MS2A 3STZC 3ZRSA 1K4DC 2IH1C 4ZBMA 3RVZA 3IGAC 3ABMC 4MVRA 3PJSK 3K0GA 3SYCA 4LCUC 4RAIA 4X88A 5BZBA 3UKMA 2A0LA 4QE9A 2ITDC 3LDCA 4R8CA 2DWEC 3GB7C 3FB5C 2W0FC 4HYOA 4WFFA 3FB6C 1S5HC 2X6AA 4P2ZA 4PDLA 4MW8A 1OCRC 4WFHA 3E8GA 4QNHB 5EBMC 2WLMA 3IFXA 4MW3A 3RW0A 3LDDA 4X89A 2HG5C 3K08A 5EBLC 3SPCA 4G28B 2HFEC 3AG3C 5B1AC 5B1BC 2EIJC 1XL4A 1M56C 4RO2A 4F4LA 5CBHA 3AG4C 3JYCA 4P30A 4P9OA 5EBWC 2HVJC 4R50A 3ASOC 4MTGA 3OGCC 2Q68A 3ASNC 1ZWIC 4UUJC 3RBZA 3SPIA 2QKSA 3STLC 1XL6A 3E89A 3F5WC 2X6CA 3K0DA 3TETA 4XDKA 2WLIA 1BL8A 2A79B 2EIKC 4J9YB 4MVOA 1KKDA 4QE7A 5EC1C 3RVYA 5IY5C 4X8AA 2EINC 4LBEC 3OR7C 4MTFA 5EC2C 5CBFA 4PA4A 1V54C 1R3JC 1OCZC 2WLIB 2WLKA 3K03A 1K4CC 1OCOC 1ORQC 3OUSA 4PDRA 3EFFK 2KB1A 1OCCC 3E8HA 4JTAB 4MVQA 4PA3A 4PA6A 5CBGA 2WLLA 2X6BA 2EIMC 2JK5C
chains in the Genus database with same CATH superfamily
5KMGB 1YIJV 5BXZA 4EEQA 3LSSA 5KUMA 1XMOO 1IXMA 4GKKO 5FNVA 1EZJA 1AI7A 1QLEC 2FYUH 1AJQA 1QNMA 2D2CB 4TWKA 2BCCH 2Q67A 1N33B 1NH2B 4MVMA 2VQEB 2JDIG 1S3JA 3IAYA 5KHJA 4NTXA 4NXMO 2F66C 2XOKG 3P32A 3QO8A 5CA0B 2LO1A 1XI1A 4I55B 3AK2A 1M1KW 3MHSC 5H6RA 4BW5A 1BCCH 3HPLC 4OXSA 1P49A 1OCOB 3BA8A 1K8AW 4YJ2B 1WN7A 5GONB 5L3FA 3BEHA 3B77A 3ZRSA 1QLNA 3ZMVA 3AG3B 4CH5A 1H2NA 3K57A 1SESA 4B3SB 1A32A 2GUZA 2DWEC 3OEHG 3DC6A 4MW8A 1V9PA 4X89A 3THOA 4LC1A 2Q9LA 4FLTA 3B8MA 3SDLA 3OGIB 3H9VA 4QPJA 2HR3A 3G6EV 4AHCA 2CTPA 2FMLA 4UUJC 2QJ1A 3F5WC 4EFBA 3VBBA 3VQYA 3A0HZ 1SQGA 3OR7C 1HP8A 1R1BA 1WB7A 4NTYA 4JI0O 4N21A 3B2EE 2DN9A 3FAVA 2W6IG 3EFFK 3E8HA 4BIZA 3M7MX 4GUNA 1SQFA 3IJ4A 2EBOA 1DLBA 2BOCC 4BW9A 2DYSB 2WLNA 4BIOA 3K5MA 1B6QA 2F93B 1MA1A 4YJ3A 4DXWA 4W4LA 4UCOA 4B7EA 2K1EA 3AG1C 1D5NA 1ROPA 4JPRA 1PNMA 4U3JB 3CJHA 4JYBA 1US6A 2EIJB 1J95A 3H01A 3RYFA 5A2QN 1AP5A 2ZR2A 2AW9A 1RM1B 1YI2V 2B9ZA 1HNWO 5IY5B 4LFAB 1NH2D 3SYAA 5CA1A 4LNUB 4KL1A 4OGQB 5TISZ 1HR0B 3STZC 2A06H 4DV6B 4JZGA 5J2UB 2A0LA 2UUAB 1CXZB 4LWSA 3DC5A 4DRXA 4O2AB 4NXNB 3ETDA 2RQ6A 2YIBD 4W4KA 3E8GA 1PD3A 1TUBA 2ZDIA 4K35A 4D7TA 3K08A 1JR9A 1EFRG 4J42A 3C3SA 3CCJV 5LMUO 3H1JH 4JYAB 1KD1W 3CRMA 2JGUA 2ZIOA 2LJ2A 3BVOA 4TT3G 1BHBA 2JS3A 1M93A 5LOVB 2P90A 1ZTEA 2HHHB 2VWJA 3K03A 4DUZO 2KB1A 2YICA 1IX9A 1R3KC 1MZEA 1W0KG 2Y69B 5KA5A 5BR8B 3TJTA 3LSUA 2P67A 4GLXA 5L3GA 4JI8B 1NI8A 5KHGA 4H0LB 4FLYA 1JCHA 4TOIA 1XNQO 1P7GA 3HKEB 5E1AC 2WWWA 3FYEB 2ZQMA 1LUWA 3EVKA 4O4IB 4X65B 4I7ZB 4NVPA 4TUYB 4QIWF 4JI7O 4DV2O 1PL4A 1K7DA 2XAJA 4X1IB 1Q90D 3CE2A 4GX1A 3OTOB 4ZIBA 2Y0PA 1HWYA 3JARB 5JJJB 1I94O 5GONA 3CXCU 1BT8A 1R6TA 3SR2C 2EIMB 1XUQA 3OUFA 5F2VO 2UU9B 4B3RB 4F6EA 4MVRA 1PM9A 4X1YA 3OMIB 1BMFG 5LL6Y 1W2BU 3H1HH 2W0FC 2AZ2A 1DTOA 5DM6V 5IWAB 4FM1A 1IURA 4D6TH 2EZOA 4MW3A 1FS0G 4JAAA 2KKWA 5GTIZ 1AR1B 1VQ6V 4IL6Z 3JYCA 1GMGA 5L3DA 2HVJC 1JMKC 4RWUA 3ASNC 1ZWIC 3ZHRA 2H94A 2JRIA 3U10A 3TETA 2PGGA 3CSXA 4DV5O 2EIKC 4MVOA 5IJ0B 3E35A 4N23A 4X64O 2YUAA 1OCZC 4A5UB 2Q7EA 4NXMB 1Q8IA 3JALA 4Z1VA 4JI5B 2LQTA 1NJIW 2JK5C 3QTCA 1H2MA 3CRRA 1FD9A 4DV0O 5B66Z 2DYRB 1DF5A 4JF3A 1E1RG 2QM4A 1UJWB 4B3TB 4DK1A 3JASA 4U3JA 2Q73A 4UB8Z 1LUVA 2CK3G 5ITZA 2Y0IA 4IHJB 4WFEA 4B3SO 3CP1A 2ODMA 1TVKB 3CHXA 4KHPO 4EFEA 2WA4A 1VF6A 3AG4B 3FD9A 5JQGA 5H9CA 1GN3A 4FLXA 1K73W 3SPHA 1D2DA 1IXBA 2V7QG 4LNUA 5LHGA 1X4TA 1KC8W 5FNVB 2W0XA 2XUMA 3U11A 5LA6B 3P3PA 2P7TC 1VQ5V 2W6JG 5L3CA 1G6UA 1UPGA 1Z5VA 2QM8A 3APQA 2EJ7A 4O2BA 5J2TA 3SYCA 2ZKOA 1QR9A 3W7XA 4JI3B 3CD6V 4JASA 3WB2A 1R6NA 4DR5O 1CPYA 3WFVA 2QA4V 5EBMC 1H8EG 4LF5O 2LFRA 2GBOA 3UO3A 4QGPA 3CCRV 3N2GB 4F4LA 2R9AA 1M56C 4RO2A 3CC7V 1IBMO 4P9OA 4FLUA 4O4LB 4UVAA 3STLC 1BE3H 3G71V 4JAUA 1JOYA 1T5EA 4F6RA 2GUZB 3JAWA 3T4ZA 3HKDB 3DTUB 4LFAO 1VMGA 1O9HA 1VQ7V 3KZIZ 4RUEA 2ZE5A 1K3EA 3HKEA 2IU3A 4HAMA 3VOUA 5B3SC 1HR0O 4NB5A 2XTAA 1N0JA 4DV6O 1NTKH 2CGNA 4O4IA 3JSNA 2UXCB 5LMNB 5JVDA 1BZKA 4R6ZA 4PJ0Z 3ZN0A 2ZIMA 1AI4A 1YSCA 2GTSA 3NR7A 3P30A 1THZA 1GAXA 1K97A 3F5TA 1YJ9V 1H2KA 3CCMV 1K34A 4CBCA 1WA8A 2Q0OC 1V54B 4YJ3B 4CH4A 2ZD9A 3K79A 2BTQA 2PI4A 4WFAV 5EK0A 4MS2A 1ZLZA 2OCCC 2X0LA 3OAAG 2HHHO 2IH1C 4DUZB 3IC9A 1NTMH 1YJNV 1Y74A 1GM8A 4RAIA 3RYCA 3CJHB 2M6YA 3GB7C 4DR7O 2ADPA 4KP4A 2CH7A 5BR8O 4PDLA 1KYOF 3T1YO 2EILB 4CS4A 2ZINA 1OJHA 1Y76B 2AXTZ 1XHXA 4O4HA 2HFEC 3AG3C 3CC4V 1QU7A 1SA0B 3M8AA 4DV7O 3L74H 2DE0X 4UVCA 5CA1B 3I55V 1TUEB 1XREA 4QE7A 5D5QA 5GTHZ 5JCOC 3CCLV 2CTWA 2VRZA 1IVSA 3RYHB 4LWSB 2X6BA 4PV1B 4DRXB 4JI7B 2IJHA 4LF6B 3HKCB 3K3WA 5KAFZ 4DV3B 3DSQA 1ZL8B 4FFBB 3OTOO 4G2KA 3O65A 1I94B 2JEUA 3GVMA 2CDYA 4UFZA 3TGUH 2UU9O 1BSMA 4IHJA 2LFSA 5LHIA 4I9WA 2B5UA 4IYHA 3S3XA 4DW1A 5B1NA 4GX0A 3A0RA 1G4YB 1H8HG 4DR4O 2BE3A 2IBZH 4Z1MG 3A2FA 4NR1A 1KECA 5IWAO 1NTZH 2WA3A 1N34O 2P06A 2GHYA 5IE9A 5KHKA 5LA6A 1NT2B 3Q4HB 4OPHA 3ETEA 5JJNB 1AROP 1QCEA 1Q6IA 2IH3C 4DV5B 3BCCH 4MTOA 3H1IH 5L3EA 4CC6A 3J80N 3JAKB 4X64B 4LF4B 3JD3A 5DEDA 4JI5O 4FMTA 2Q7HA 4B3MB 1AP6A 2CUGA 1E1QG 5KA6A 3VQWA 2ZCEA 2E76B 3N2GA 4P2ZA 2QM7A 3ZX6A 4LH6A 3UCSC 4DV0B 3L75H 4X20A 1KKCA 4U7OA 4O4LA 1OZ0A 4H13B 5B1AC 4WBNA 5EBWC 3FKSG 4B3TO 3WG7B 1XL6A 1PL0A 2ZXWB 3QVNA 5EIBD 1H2LA 5EC2C 4MTFA 4KHPB 1B04A 4X1YB 3OUSA 3HKDA 1SZTA 2DQ3A 2BTOA 1YTFB 1ZAUA 3F7YC 4C7UA 1KP3A 1Q6HA 4JI4B 3SJBC 4WFGA 2H8PC 3X2QC 1NVPD 1I7FA 4FZ1A 1WLEA 1I5YA 4CH6A 3B8NA 1LNQA 2F43G 1S72V 2UUBB 4JI3O 1PP9H 3ABKC 3JALB 4DR5B 4LF5B 3VQVA 1H2GA 1M4UA 2UXXA 1Z5WA 4ZHQA 1SF9A 1ZX3A 1IBMB 3R65A 3CCQV 1WNSA 2DOSA 1OCCB 1VQMV 1H2SB 3JASB 2X7RB 2XAHA 5ITZB 2JJ1G 2VWKA 3JD2A 4BWAA 4X88A 4LF7O 4ZI7B 3CMEV 3FB5C 3CCEV 3OEEG 1Y76A 1B06A 1KQSU 1QLEB 1AVMA 5JQGB 1CEZA 1OCRC 1P84F 1SA0A 1WPBA 5EYPB 2PTMA 4PI0A 1F23A 1Q43A 2RJZA 1BHAA 3NXSA 2F4VO 4JI1B 4U7NA 2GSMB 3ASOC 3OGCC 1KP2A 1HNXO 1AR4A 2CE4A 1XEQA 2X6CA 1EM1A 2HKOA 4XDKA 1F7YA 2UXCO 5LMNO 2Q5ZA 1FXVA 4PD4F 3RYHA 2XNDG 5CBFA 4O2BB 1QBZA 5J2TB 4ZOLB 3HKCA 2RMKB 1WB8A 1ZL8A 4X1KA 5FPOA 4FFBA 1IBLB 4MVZA 2HJDA 3E22A 5K1XA 1XHZA 3ABLC 3T2MA 1KUQA 1N32B 1P7BA 4UVBA 4YIOA 3BAAA 4UV8A 3TCUA 1Z2GA 4YHHB 3RYIA 3CMAV 3OFNG 3CXHF 2QE7G 1JA8A 1KB9F 1YTFD 2DQ0A 2JJ2G 2Q0AA 4PA7A 1NQTA 2YC0A 4CZZA 5CN0A 1QVFU 3OE7G 1OHHG 4F6RB 2VQFB 2LGWA 3RFRA 5H6QA 2DYRC 3DXRB 4DR7B 1GN6A 3T1YB 3JAWB 3K9SA 4BR6A 1MMMA 3Q4HA 4I4TB 1N0NA 1GTOA 3JATA 4DV7B 4MVSA 2EZPA 3T1CA 4FK5C 5H5NA 4FPPA 3LNMB 1HDJA 1YF2A 4KXRA 1KBHA 4I50B 3JAKA 2YDEA 5KX5A 3BPZA 1TA8A 2Z3YA 3UT5A 3QO5A 1K4DC 4J7JA 5FL7G 1B3QA 4ZBMA 1Y4MA 1S5JA 5JVDB 2Z0AA 4LF6O 3HKBA 2CGOA 4DV3O 1HW7A 5LYJA 1S5HC 4NKGB 4DV1B 2HG5C 2DMXA 3SPCA 3BHPA 3AG1B 4WF9V 4EB6B 5CBHA 1WA8B 3N2KA 1J5EO 3L9DA 1BS3A 2BTQB 4J10A 4X8AA 4DR4B 2ARHA 1VQKV 1Y74B 3RYCB 3ZHSA 3IC7A 1YJWV 1N34B 2CH7B 1VIBA 3RT3C 1SKVA 3P3NA 1FXKC 4O4HB 4KUMA 2JEXA 2L35A 4JTDB 3CS5A 3FB8C 3ZMUA 3L70H 2YXLA 1SC5B 3KCXA 3CRAA 2IJKA 4LF4O 2ADQB 2IJJA 1FJGO 1VF7A 2B1GA 4B3MO 3ZRWA 2A3QA 1DK1A 1M57C 3AG2B 3ABUA 2AHZA 4JZ2A 2NN4A 2L6LA 3D36C 2ITCC 1FYJA 2CTRA 2P4KA 4RUFA 2WAMA 2RDCA 3B40A 3SGIA 3JD0A 4JI2O 1WAZA 2YSUB 1U97A 3APOA 3FFQA 1V55C 3W7TA 2F95B 2JVDA 2IW5A 3JCUZ 5KHIA 1H38A 3ZMSA 1MSWD 4ZI7A 3ZBHA 3ABMC 4H44B 3K0GA 3UKMA 2OWOA 4FZ0A 1IDSA 5EYPA 1VARA 4JI4O 4UCRA 4IIJA 3IFXA 4X62B 5LP6C 5JWPA 4L8JA 1XL4A 3ZCCA 4CC5A 5IYDO 1XNRO 1DGSA 3E89A 4MTXA 2UXDO 4ZOLA 1YXBA 2UUBO 2KG7B 5EIBC 1ORQC 5EZYA 4ICGA 3CEIA 1P4RA 4X20B 3JSLA 4RQEA 5JH7A 1K33A 2E74B 4WBNB 2P22C 1GKFA 1RPOA 4DK0A 1RSOA 1MOFA 3DXRA 2ZDIC 5LGTA 1TGOA 2LP7A 4LF7B 3SJQC 1VF5B 1NZ6A 3L73H 4I4TA 2ZE6A 5FLXN 4D7SA 3JCZA 1VQNV 1SZXA 4GYCB 3ASNB 4LR3A 4MVUA 3UM7A 2ATKC 3R66A 1D5AA 4P9PA 3FX7A 4JI1O 3L71H 2F4VB 2EIKB 1N36B 4I50A 2LW1A 4CS2A 2HP8A 5KLVH 1K5SA 1HNXB 1XILA 1OCZB 1VQPV 5HFLA 4FM0A 3SYPA 2PI5A 1S77D 5B1BB 1PPJH 2QWRB 5D5PA 4MT8A 2LGQA 1IBLO 1GM7A 4O4JA 2X6AA 1N32O 4L87A 4EB6A 4ABMA 2WLMA 4YHHO 4ZHQB 2OCHA 1KU9A 3QNEA 4Z2WA 4TQFA 4DYLA 1L1FA 4K8ZA 3ZEDA 4LF8B 4MTGA 4FLZA 3JD1A 1WJZA 1GN2A 1KMIZ 2B1IA 4FFKA 4JV5B 4DV4B 4I5SA 2A79B 2VQFO 1JFFA 3RVYA 3A0BZ 2OTJV 5FPRA 2V1DA 4K0KO 4FLVA 2BSKA 2FL4A 3BFRA 1OCOC 1BQ0A 3W7SA 3ZMTA 1NS1A 1SQXH 2M7WA 1SRYA 1TAEA 2ZXWC 1SQVH 4DO2A 1SQQH 3ZHUA 1Q81W 4FM2A 2E75B 4PHZA 3TXSA 2HVKC 5IJ9B 3ZRVA 3WB1A 2ZM6O 3CC2V 4PDMA 2YXHA 1SQBH 2FKXA 1R3LC 1NBMG 4TV8B 4HNAA 4LP8A 3F7VC 4X66B 1M56B 4X1KB 4DV1O 3E22B 1YDXA 2UUCB 2JGDA 1J5EB 3RYIB 3ZRXA 5LXTB 3K5NA 4R7CA 1XBLA 2YEVA 4HZ3A 3OM3B 1Q5OA 5H2FZ 2DYSC 2WSSG 1Y6XA 2HJFC 4FVMA 2PZSA 5LGUA 1VQLV 1E79G 1NR7A 1Y66A 2OTLV 4QE9A 3M99B 3LDCA 3HR0A 3WB0A 3VQXA 3CRCA 1IBKB 5B3SB 2YI9A 5GW7A 3MHHC 3JATB 5BMVB 2EX3A 4ASUG 4LFBB 2EIJC 5IYBO 2IM9A 2NR5A 5KX5B 1WPXA 1BQZA 2KG7A 1Q3EA 5CA3A 1MSDA 1VF6C 2ZE8A 3UT5B 1RM1C 4J9YB 4TV9B 4LFCB 5IY5C 1WP7A 2P6JA 1FJGB 4AI8A 4PA4A 3OMAB 2VS0A 3N27A 1K4CC 3UQ8A 3HKBB 5IDJA 2WLLA 3LSQA 2OT5A 5LYJB 5KUKA 5LGNA 1SETA 4U3FH 4JI2B 3SYQA 2QWNB 2OCCB 4GZRB 3MDSA 3CPWU 3TK1A 4GKJB 3N2KB 5J9PC 1JQ0A 1JJ2U 3B4SA 1FFXA 4ZKIA 2DW4A 2WLHA 2UXBB 1MZFA 3K06A 1NU1H 2CTQA 4GX5A 3J7AU 2IU0A 3UO2A 1FXKA 4B7KA 2AHYA 5B5EZ 4X62O 2PF4E 2R70A 4K8XA 1N4CA 4I0XA 3RWRD 2XASA 1XQ8A 4G27B 3ZJZA 1G1XB 3KCYA 2C2AA 2IJIA 2V4DA 2XT9A 1L0LH 1XNRB 2MK3A 3BABA 2QGNA 2Q4PA 2UXDB 1F4NA 2ETNA 1I5XA 3K9AA 4UXNA 3SPJA 2Y69C 4DR3B 2PYLA 3L72H 3D36A 3KG2A 4Q6GA 1F4MA 1GK9A 5IYZB 3GWOA 3J81N 1EBOA 3ZRWB 3K59A 1GRJA 3BRCA 5C93A 4HYOA 4OX9O 2EINB 2F1MA 2Q8VA 4WFHA 1SERA 2JS5A 2QEXV 1OV9A 1VQ4V 2N05A 4R50A 3RBZA 4LF9O 2Q68A 2RCVA 3B09A 1X59A 2QR4A 4WCEV 5IT9N 2WLKA 2WLIB 3O9OA 5LP6A 3AEIA 4PDRA 4JTAB 5CBGA 1JPXA 2XAQA 2EIMC 2FTKA 4AQYB 4Q20A 3T4DA 4IIJB 4YY3B 1N36O 5CB4A 2LW7A 1O9GA 1UFIA 4IGGA 5CMUA 4BIUA 3CWBH 1JX9A 5IJ9A 4UCTA 4YXWG 2XAGA 2A9HA 2K9PA 4E4EA 1MABG 4IYIA 1SS3A 2O57A 2GDSA 1Q82W 3G80A 4TV8A 1EN4A 2F23A 4QPKA 1R3IC 3ZIAG 1IZ3A 1DF4A 3TXQA 2DJVA 5EZYB 5B1AB 4CS3A 3OTFA 3GWKC 5L3BA 1YCIA 3SPGA 2E5LB 5LXTA 5JH7B 2N04A 4CH3A 3C3TA 2EJRA 4LF8O 1GM9A 2GTAA 4JV5O 2Y48A 4DV4O 3AG2C 1RSOB 4TSFG 2OYQA 4JTCB 1M5IA 4K0KB 2YIAA 5LHHA 3IGAC 5BZBA 3WU2Z 2ITDC 4R8CA 1EZVH 4HBNA 1L8DA 5BMVA 4RQFA 5KAIZ 3X2QB 1PNKA 2P5OA 5DECA 5KMGA 2ZT9B 4QNHB 3ZS8C 1YHQV 2QKAA 3RW0A 3QO7A 3AG4C 4P30A 2ZM6B 3SPIA 4TV9A 3ABKB 3K5OA 3RN4A 1YITV 2RNBA 3CCUV 4DR2B 1PNLA 2G38A 3H1LH 3OW2U 1FAFA 3H1KH 4GT1A 3D3IA 4LBEC 2XHBA 4X66O 4FIPC 1W59A 2QKCA 4TQDA 3OD4A 3K58A 4PA6A 5IYCO 4O4JB 4DW0A 3T1HB 2UUCO 4DR6B 2YIDA 5CA0A 1HNZB 4E2LA 3G4SV 4FJCC 4XDLA 1YZBA 1VQ9V 4DR1O 2ZNIA 4I55A 3SJAC 2ZNJA 1XMQO 3K04A 3ML0A 4FLWA 4YJ2A 2YIBA 1AJPA 1JFFB 3SJCC 1RFYA 3AK1A 3JD4A 1OCRB 1GN4A 2R9RB 2PUSA 2FB5A 4IT5A 4DUYB 2BSKB 4PA9A 5DN6G 2PYJA 1ZSPA 1PV0A 1LR1A 3BY6A 5HFMA 2Y4TA 1AI6A 5AG2A 3LUTB 4YIPA 3QF7A 3CRQA 1RPRA 1IBKO 1I08A 1CP9A 3ASOB 4JI6B 3D3QA 5JCOA 2Z5UA 4LFBO 3ETGA 2A7WA 1VP7A 4PDVA 4J80A 1XMOB 3CCVV 4GKKB 5LBQA 1S76D 2WLJA 4J9ZB 1RP3B 5IYZA 4UCUA 4LFCO 1QVGU 2QWOB 3LDEA 2Q7GA 3LNNA 2YXYA 3U0ZA 3ABLB 2QDOA 3PJSK 4HNAB 1S5LZ 1N33O 2H3OA 2VQEO 3KKYA 4LH7A 4WFFA 1MG1A 1Q7YW 2KQXA 4GKJO 2JGDB 4J11A 5EBLC 1SQPH 2NNUA 5B1BC 2YEVB 3S3WA 2XAFA 2UXBO 1S0VA 2N74A 5K1PA 3K0DA 2WLIA 1KKDA 2D3OW 1L0NH 2QTSA 2YI8A 4I9QA 1VQOV 1V54C 3HB3B 2UXNA 4JGSA 4PA3A 3K5LA 2HEPA 5C8YB 1URFA 2GV9A 4GCZA 1EN5A 2AGAA 3W7UA 4JAVA 3QG5A 1M90W 2NLJC 4DR3O 3D8CA 2EILC 3E8FA 3C90A 2Q69A 5J2UA 4XDJA 3E86A 3FB7C 3G6BA 4H37A 2CAZC 3E83A 2WLLB 4JI0B 4OX9B 4O2AA 2KSDA 2ZE7A 3ZHVA 2RN9A 2Q6AA 3ZHQA 4MSWC 4J7ZA 5JJEB 2AZ0A 4J7KA 4LF9B 1FFXB 4OPAA 1QHTA 1FFTB 1QR8A 2Y4UA 1K92A 4H33A 1JVMA 4XBFA 3OT7A 1Q86W 5LOVA 1FKAO 4K3AA 1R6KA 4LCUC 1BGYH 1FXKB 2ZR3A 4AQYO 4PI2A 1AB3A 3MD0A 3AK3A 2P4VA 3CB2A 4YY3O 2EULA 3FB6C 4I0XB 3BA9A 2OIEA 1FPOA 3JAMN 3EXAA 1N8RW 1F51A 2OIGA 4QJFB 1HNWB 1M57B 2E3CA 1GH6A 2QWQB 4X9QA 4JYCA 1JJOA 3CYOA 1QQCA 1WP8A 1AJNA 1M9NA 1R3JC 3RGBA 1MNGA 2MW2B 3DGEA 1AI5A 2QSAA 2YS8A 4J41A 4AILC 2E5LO 4NTWA 3ETQA 2UUAO 1V55B 4TUYA 3FAVB 1PKXA 4NXNO 4EKWA 4NYKA 3OMNB 2R72A 4X1IA 3SYOA 1AR5A 1AILA 2DWDC 3G67A 1VQ8V 3ABMB 3JARA 5LMUB 4UB6Z 4JYAO 3FYIB 3E8BA 1W0JG 2BOBC 3AG7A 4KFMA 4PELA 2R9IA 5LP6B 3CX5F 3ABTA 3WG7C 5A9GA 4BAYA 2QTOA 5B1OA 3ZMZA 1XDCA 5CB4B 2QWPB 1ZUQA 1GO3F 3RYFB 4JYYA 3PN1A 1Y67A 4GX2A 2HLDG 5KHHA 3MAQA 2PY5A 4DR2O 1R73A 4WFBV 1YVWA 4JI8O 3CCSV 2WPDG 1Q6UA 3OR6C 1VEWA 1XNQB 1I0HA 3RVZA 5IJ0A 1COWG 3E2EA 1K9MW 3T1HO 4UCSA 3I56V 4DR6O 4X65O 1HNZO 1G8MA 1NVPB 1NR1A 4DR1B 3EHBB 3LDDA 3ZHTA 4DV2B 4G28B 4UV9A 1NKDA 1TUBB 1XMQB 2JIZG 2ILMA 2QKSA 3ICXA 1K5QA 5E79Z 1BL8A 4DUYO 1FXHA 5EC1C 2EINC 1XOUA 3ZN1A 3W7WA 1YEWA 1U96A 5BY1A 4B3RO 5C8YA 1EN6A 4B08A 1TVKA 1ENVA 3I5DA 4MVQA 1OCCC 4JI6O 3A8TA 4UCVA
chains in the Genus database with same CATH topology
3T4DA 3T4ZA 3DTUB 1YIJV 3LSSA 5KUMA 1FXKC 5CMUA 4BIUA 4KUMA 1JX9A 2JEXA 4YXWG 4JTDB 2XAGA 1IXMA 2A9HA 1VQ7V 1EZJA 4RUEA 1MABG 3FB8C 3ZMUA 1K3EA 1AI7A 2IU3A 4HAMA 1QLEC 3VOUA 5B3SC 1AJQA 1Q82W 2IJKA 4QPKA 1R3IC 3ZIAG 4TWKA 2Q67A 2IJJA 1NH2B 2B1GA 1DF4A 4MVMA 4R6ZA 3ZRWA 1M57C 3ZN0A 3AG2B 2JDIG 1S3JA 5B1AB 3ABUA 2AHZA 1AI4A 1YSCA 2ITCC 3P30A 5L3BA 3SPGA 2XOKG 4RUFA 1THZA 3P32A 1K97A 2WAMA 3QO8A 1YJ9V 3JD0A 1M1KW 2EJRA 3MHSC 2YSUB 1GM9A 1K34A 5H6RA 4BW5A 3CCMV 4CBCA 3HPLC 4OXSA 1V54B 1V55C 2Y48A 3W7TA 2IW5A 2ZD9A 3K79A 1OCOB 1K8AW 3AG2C 4TSFG 2PI4A 4WFAV 1H38A 4JTCB 5EK0A 3ZMSA 5L3FA 3BEHA 3B77A 4MS2A 2OCCC 2X0LA 3OAAG 3ZRSA 3ZMVA 1QLNA 3AG3B 5LHHA 2IH1C 3IGAC 3ABMC 3K0GA 1YJNV 1GM8A 4RAIA 5BZBA 3UKMA 1SESA 2ITDC 4R8CA 2DWEC 3GB7C 4RQFA 3OEHG 3X2QB 1PNKA 4KP4A 4PDLA 4MW8A 4QNHB 2EILB 1YHQV 3IFXA 3RW0A 4X89A 4LC1A 3B8MA 2HFEC 3AG3C 3CC4V 1XL4A 3QO7A 4QPJA 3AG4C 2HR3A 4P30A 3ZCCA 3G6EV 5IYDO 4UVCA 3SPIA 3ABKB 4UUJC 3I55V 1TUEB 3E89A 3F5WC 1YITV 3CCUV 4MTXA 1PNLA 3VBBA 3OW2U 4GT1A 4QE7A 3D3IA 4LBEC 3OR7C 3CCLV 4FIPC 4N21A 1ORQC 2W6IG 3EFFK 3E8HA 4BIZA 4PA6A 2X6BA 1P4RA 2IJHA 5IYCO 2EBOA 1DLBA 2BOCC 3K3WA 2DYSB 2WLNA 4E2LA 3G4SV 4FJCC 4XDLA 4RQEA 1B6QA 1VQ9V 4G2KA 1K33A 1GKFA 2JEUA 1RPOA 3K04A 4DXWA 3ML0A 1MOFA 2LFSA 1AJPA 2K1EA 5LHIA 4I9WA 2B5UA 3AG1C 1ROPA 3JD4A 2ZDIC 1OCRB 4JPRA 2R9RB 5B1NA 1PNMA 2LP7A 4GX0A 3A0RA 5LGTA 1H8HG 1G4YB 4PA9A 3SJQC 4Z1MG 5DN6G 1KECA 3BY6A 5HFMA 4JYBA 1AI6A 2EIJB 3LUTB 1J95A 1RPRA 3JCZA 1VQNV 1CP9A 2GHYA 3ASOB 3H01A 3ASNB 4MVUA 2ZR2A 3UM7A 2ATKC 2Z5UA 4P9PA 1RM1B 3ETGA 2EIKB 1YI2V 5IY5B 1NH2D 4PDVA 3SYAA 3ETEA 1AROP 1K5SA 3CCVV 1OCZB 1QCEA 2IH3C 5LBQA 1S76D 2WLJA 4J9ZB 4MTOA 1VQPV 5L3EA 5HFLA 1QVGU 3SYPA 3LDEA 2PI5A 3STZC 1S77D 5B1BB 3JD3A 3ABLB 3PJSK 4MT8A 2A0LA 4FMTA 5KA6A 1E1QG 1GM7A 4WFFA 3ETDA 1MG1A 2X6AA 1Q7YW 4P2ZA 4L87A 2QM7A 3E8GA 1PD3A 2ZDIA 2WLMA 4U7OA 3K08A 5EBLC 2NNUA 1OZ0A 3QNEA 5B1AC 5B1BC 1EFRG 3CCJV 1L1FA 5EBWC 2YEVB 3FKSG 2XAFA 1S0VA 4MTGA 3WG7B 3JD1A 1KD1W 2B1IA 1XL6A 1PL0A 2ZXWB 4TT3G 4I5SA 1BHBA 3K0DA 2WLIA 2A79B 1KKDA 3RVYA 1MSWD 2D3OW 5EC2C 2P90A 4MTFA 2OTJV 2V1DA 1VQOV 1V54C 3K03A 1OCOC 3HB3B 2UXNA 3OUSA 3W7SA 3ZMTA 4JGSA 2KB1A 4PA3A 2M7WA 1SZTA 2DQ3A 1SRYA 1YTFB 3F7YC 1KP3A 1R3KC 2ZXWC 1W0KG 2Y69B 4DO2A 5KA5A 4GCZA 3W7UA 1Q81W 4JAVA 4WFGA 2H8PC 2P67A 1M90W 2NLJC 5L3GA 3X2QC 1NVPD 2HVKC 3ZRVA 1WLEA 3CC2V 1I5YA 2EILC 1JCHA 4PDMA 3E8FA 3B8NA 5E1AC 2Q69A 2WWWA 3FYEB 1LNQA 1R3LC 1NBMG 2F43G 1S72V 4XDJA 3E86A 3FB7C 4H37A 3ABKC 4LP8A 2ZQMA 3F7VC 1M56B 2WLLB 3E83A 4QIWF 2Q6AA 1H2GA 2UXXA 4MSWC 1K7DA 2XAJA 4GX1A 3ZRXA 3R65A 1HWYA 4R7CA 2YEVA 3CCQV 4HZ3A 3OM3B 3CXCU 1FFTB 1QR8A 2DYSC 1OCCB 1VQMV 1K92A 2WSSG 4H33A 2EIMB 3OUFA 1JVMA 2HJFC 2X7RB 4XBFA 2XAHA 1Q86W 5LGUA 2JJ1G 3JD2A 4MVRA 1VQLV 1E79G 1R6KA 1NR7A 4LCUC 4X88A 1FXKB 1Y66A 2ZR3A 1BMFG 3OMIB 4QE9A 3M99B 2OTLV 3LDCA 3CMEV 3FB5C 3CCEV 3OEEG 3MD0A 1W2BU 2W0FC 1DTOA 5DM6V 3FB6C 1KQSU 1QLEB 1CEZA 1OCRC 2EZOA 5GW7A 5B3SB 3MHHC 4MW3A 1FS0G 4ASUG 1F23A 1BHAA 1AR1B 1VQ6V 3NXSA 1N8RW 1F51A 2EIJC 5IYBO 3JYCA 4U7NA 2GSMB 1GMGA 5L3DA 4QJFB 2HVJC 3ASOC 3OGCC 3ASNC 1KP2A 1WPXA 1ZWIC 1M57B 2X6CA 5CA3A 2H94A 2HKOA 4XDKA 3TETA 1RM1C 4JYCA 2EIKC 3CYOA 4J9YB 4MVOA 1FXVA 5IY5C 2P6JA 1AJNA 2XNDG 5CBFA 3E35A 4N23A 4PA4A 3OMAB 1M9NA 1QBZA 1R3JC 1OCZC 1K4CC 3DGEA 1AI5A 5IDJA 2WLLA 3LSQA 2OT5A 1NJIW 1V55B 2JK5C 5KUKA 4MVZA 1PKXA 5LGNA 3ABLC 1SETA 3T2MA 4EKWA 3SYQA 1P7BA 3OMNB 4UVBA 2OCCB 4UV8A 2DYRB 3SYOA 1DF5A 3TCUA 3TK1A 3CPWU 2DWDC 1VQ8V 3ABMB 5J9PC 1JQ0A 3CMAV 3OFNG 1JJ2U 2QE7G 4ZKIA 2DW4A 4JF3A 1E1RG 2WLHA 1YTFD 3FYIB 2DQ0A 2JJ2G 1UJWB 3E8BA 3K06A 4PA7A 1NQTA 1W0JG 2BOBC 4GX5A 4CZZA 4KFMA 4PELA 5CN0A 2R9IA 3OE7G 1OHHG 1QVFU 2IU0A 2CK3G 4WFEA 3CP1A 3ABTA 3WG7C 1FXKA 2DYRC 5H6QA 4BAYA 2QTOA 3AG4B 2AHYA 5B1OA 3ZMZA 5H9CA 2XASA 1GTOA 1K73W 1GO3F 4G27B 3SPHA 3ZJZA 4GX2A 2V7QG 2C2AA 2IJIA 2HLDG 4MVSA 2EZPA 5LHGA 1KC8W 3T1CA 4FK5C 4FPPA 3LNMB 2MK3A 2P7TC 1R73A 4WFBV 1F4NA 1I5XA 3K9AA 4UXNA 3SPJA 2Y69C 3CCSV 1VQ5V 2Z3YA 2WPDG 2W6JG 3D36A 3KG2A 3QO5A 3OR6C 5L3CA 1K4DC 1F4MA 5FL7G 1GK9A 2QM8A 4ZBMA 1Y4MA 3RVZA 1COWG 3E2EA 3GWOA 3SYCA 1EBOA 3ZRWB 1QR9A 3W7XA 1K9MW 5C93A 3I56V 4HYOA 3CD6V 4JASA 1R6NA 1G8MA 1S5HC 1CPYA 2EINB 4WFHA 3WFVA 2QA4V 1NVPB 5EBMC 1NR1A 1SERA 1H8EG 3EHBB 3LDDA 2LFRA 2HG5C 3SPCA 3CCRV 2QEXV 3AG1B 4WF9V 4G28B 4UV9A 1VQ4V 1NKDA 4F4LA 5CBHA 1M56C 4RO2A 3CC7V 4P9OA 2JIZG 4R50A 3RBZA 2Q68A 4UVAA 2QKSA 3STLC 1K5QA 4WCEV 1BL8A 3G71V 4JAUA 1JOYA 1FXHA 5EC1C 4X8AA 2EINC 3ZN1A 3W7WA 2WLKA 2WLIB 1VQKV 3AEIA 1ENVA 4PDRA 4MVQA 1OCCC 4JTAB 3IC7A 5CBGA 1YJWV 1JPXA 2XAQA 2EIMC 2FTKA 4Q20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F7Y C;  3T4D A;  4MVZ A;  5KUK A;  3T4Z A;  1R3K C;  2BOC C;  2ZXW C;  2WLN A;  3ABL C;  3T2M A;  4EKW A;  3SYQ A;  5KUM A;  1P7B A;  4XDL A;  3TCU A;  4WFG A;  3SYO A;  2H8P C;  4JTD B;  2A9H A;  2DWD C;  2NLJ C;  4RUE A;  5J9P C;  3X2Q C;  3FB8 C;  2HVK C;  3K04 A;  1QLE C;  4DXW A;  3VOU A;  5B3S C;  2EIL C;  2WLH A;  4PDM A;  3E8F A;  3E8B A;  3K06 A;  2K1E A;  4PA7 A;  4I9W A;  2BOB C;  3AG1 C;  5E1A C;  4GX5 A;  2Q69 A;  4KFM A;  1R3I C;  4TWK A;  2R9R B;  1LNQ A;  4GX0 A;  1R3L C;  4WFE A;  1G4Y B;  2Q67 A;  4PA9 A;  4XDJ A;  3SJQ C;  3E86 A;  3FB7 C;  4H37 A;  3ABK C;  4LP8 A;  4MVM A;  4R6Z A;  3F7V C;  2DYR C;  1M57 C;  3WG7 C;  2AHZ A;  3LUT B;  3E83 A;  2WLL B;  2QTO A;  1J95 A;  2AHY A;  2ITC C;  3SPG A;  4RUF A;  4MVU A;  2Q6A A;  3UM7 A;  2ATK C;  4MSW C;  4P9P A;  4G27 B;  3SPH A;  3ZJZ A;  4GX2 A;  4MVS A;  4GX1 A;  4BW5 A;  3T1C A;  4PDV A;  4CBC A;  3SYA A;  3R65 A;  3HPL C;  4OXS A;  4R7C A;  3LNM B;  2YEV A;  1V55 C;  4HZ3 A;  2P7T C;  2ZD9 A;  2IH3 C;  3AG2 C;  3SPJ A;  2DYS C;  2WLJ A;  2Y69 C;  4J9Z B;  4MTO A;  4JTC B;  5EK0 A;  4H33 A;  3OUF A;  3SYP A;  1JVM A;  2HJF C;  3BEH A;  2OCC C;  3KG2 A;  3LDE A;  3OR6 C;  4MS2 A;  3STZ C;  3ZRS A;  1K4D C;  2IH1 C;  4ZBM A;  3RVZ A;  3IGA C;  3ABM C;  4MVR A;  3PJS K;  3K0G A;  3SYC A;  4LCU C;  4RAI A;  4X88 A;  5BZB A;  3UKM A;  2A0L A;  4QE9 A;  2ITD C;  3LDC A;  4R8C A;  2DWE C;  3GB7 C;  3FB5 C;  2W0F C;  4HYO A;  4WFF A;  3FB6 C;  1S5H C;  2X6A A;  4P2Z A;  4PDL A;  4MW8 A;  1OCR C;  4WFH A;  3E8G A;  4QNH B;  5EBM C;  2WLM A;  3IFX A;  4MW3 A;  3RW0 A;  3LDD A;  4X89 A;  2HG5 C;  3K08 A;  5EBL C;  3SPC A;  4G28 B;  2HFE C;  3AG3 C;  5B1A C;  5B1B C;  2EIJ C;  1XL4 A;  1M56 C;  4RO2 A;  4F4L A;  5CBH A;  3AG4 C;  3JYC A;  4P30 A;  4P9O A;  5EBW C;  2HVJ C;  4R50 A;  3ASO C;  4MTG A;  3OGC C;  2Q68 A;  3ASN C;  1ZWI C;  4UUJ C;  3RBZ A;  3SPI A;  2QKS A;  3STL C;  1XL6 A;  3E89 A;  3F5W C;  2X6C A;  3K0D A;  3TET A;  4XDK A;  2WLI A;  1BL8 A;  2A79 B;  2EIK C;  4J9Y B;  4MVO A;  1KKD A;  4QE7 A;  5EC1 C;  3RVY A;  5IY5 C;  4X8A A;  2EIN C;  4LBE C;  3OR7 C;  4MTF A;  5EC2 C;  5CBF A;  4PA4 A;  1V54 C;  1R3J C;  1OCZ C;  2WLI B;  2WLK A;  3K03 A;  1K4C C;  1OCO C;  1ORQ C;  3OUS A;  4PDR A;  3EFF K;  2KB1 A;  1OCC C;  3E8H A;  4JTA B;  4MVQ A;  4PA3 A;  4PA6 A;  5CBG A;  2WLL A;  2X6B A;  2EIM C;  2JK5 C; 
#chains in the Genus database with same CATH topology
 5KMG B;  1YIJ V;  5BXZ A;  4EEQ A;  3LSS A;  5KUM A;  1XMO O;  1IXM A;  4GKK O;  5FNV A;  1EZJ A;  1AI7 A;  1QLE C;  2FYU H;  1AJQ A;  1QNM A;  2D2C B;  4TWK A;  2BCC H;  2Q67 A;  1N33 B;  1NH2 B;  4MVM A;  2VQE B;  2JDI G;  1S3J A;  3IAY A;  5KHJ A;  4NTX A;  4NXM O;  2F66 C;  2XOK G;  3P32 A;  3QO8 A;  5CA0 B;  2LO1 A;  1XI1 A;  4I55 B;  3AK2 A;  1M1K W;  3MHS C;  5H6R A;  4BW5 A;  1BCC H;  3HPL C;  4OXS A;  1P49 A;  1OCO B;  3BA8 A;  1K8A W;  4YJ2 B;  1WN7 A;  5GON B;  5L3F A;  3BEH A;  3B77 A;  3ZRS A;  1QLN A;  3ZMV A;  3AG3 B;  4CH5 A;  1H2N A;  3K57 A;  1SES A;  4B3S B;  1A32 A;  2GUZ A;  2DWE C;  3OEH G;  3DC6 A;  4MW8 A;  1V9P A;  4X89 A;  3THO A;  4LC1 A;  2Q9L A;  4FLT A;  3B8M A;  3SDL A;  3OGI B;  3H9V A;  4QPJ A;  2HR3 A;  3G6E V;  4AHC A;  2CTP A;  2FML A;  4UUJ C;  2QJ1 A;  3F5W C;  4EFB A;  3VBB A;  3VQY A;  3A0H Z;  1SQG A;  3OR7 C;  1HP8 A;  1R1B A;  1WB7 A;  4NTY A;  4JI0 O;  4N21 A;  3B2E E;  2DN9 A;  3FAV A;  2W6I G;  3EFF K;  3E8H A;  4BIZ A;  3M7M X;  4GUN A;  1SQF A;  3IJ4 A;  2EBO A;  1DLB A;  2BOC C;  4BW9 A;  2DYS B;  2WLN A;  4BIO A;  3K5M A;  1B6Q A;  2F93 B;  1MA1 A;  4YJ3 A;  4DXW A;  4W4L A;  4UCO A;  4B7E A;  2K1E A;  3AG1 C;  1D5N A;  1ROP A;  4JPR A;  1PNM A;  4U3J B;  3CJH A;  4JYB A;  1US6 A;  2EIJ B;  1J95 A;  3H01 A;  3RYF A;  5A2Q N;  1AP5 A;  2ZR2 A;  2AW9 A;  1RM1 B;  1YI2 V;  2B9Z A;  1HNW O;  5IY5 B;  4LFA B;  1NH2 D;  3SYA A;  5CA1 A;  4LNU B;  4KL1 A;  4OGQ B;  5TIS Z;  1HR0 B;  3STZ C;  2A06 H;  4DV6 B;  4JZG A;  5J2U B;  2A0L A;  2UUA B;  1CXZ B;  4LWS A;  3DC5 A;  4DRX A;  4O2A B;  4NXN B;  3ETD A;  2RQ6 A;  2YIB D;  4W4K A;  3E8G A;  1PD3 A;  1TUB A;  2ZDI A;  4K35 A;  4D7T A;  3K08 A;  1JR9 A;  1EFR G;  4J42 A;  3C3S A;  3CCJ V;  5LMU O;  3H1J H;  4JYA B;  1KD1 W;  3CRM A;  2JGU A;  2ZIO A;  2LJ2 A;  3BVO A;  4TT3 G;  1BHB A;  2JS3 A;  1M93 A;  5LOV B;  2P90 A;  1ZTE A;  2HHH B;  2VWJ A;  3K03 A;  4DUZ O;  2KB1 A;  2YIC A;  1IX9 A;  1R3K C;  1MZE A;  1W0K G;  2Y69 B;  5KA5 A;  5BR8 B;  3TJT A;  3LSU A;  2P67 A;  4GLX A;  5L3G A;  4JI8 B;  1NI8 A;  5KHG A;  4H0L B;  4FLY A;  1JCH A;  4TOI A;  1XNQ O;  1P7G A;  3HKE B;  5E1A C;  2WWW A;  3FYE B;  2ZQM A;  1LUW A;  3EVK A;  4O4I B;  4X65 B;  4I7Z B;  4NVP A;  4TUY B;  4QIW F;  4JI7 O;  4DV2 O;  1PL4 A;  1K7D A;  2XAJ A;  4X1I B;  1Q90 D;  3CE2 A;  4GX1 A;  3OTO B;  4ZIB A;  2Y0P A;  1HWY A;  3JAR B;  5JJJ B;  1I94 O;  5GON A;  3CXC U;  1BT8 A;  1R6T A;  3SR2 C;  2EIM B;  1XUQ A;  3OUF A;  5F2V O;  2UU9 B;  4B3R B;  4F6E A;  4MVR A;  1PM9 A;  4X1Y A;  3OMI B;  1BMF G;  5LL6 Y;  1W2B U;  3H1H H;  2W0F C;  2AZ2 A;  1DTO A;  5DM6 V;  5IWA B;  4FM1 A;  1IUR A;  4D6T H;  2EZO A;  4MW3 A;  1FS0 G;  4JAA A;  2KKW A;  5GTI Z;  1AR1 B;  1VQ6 V;  4IL6 Z;  3JYC A;  1GMG A;  5L3D A;  2HVJ C;  1JMK C;  4RWU A;  3ASN C;  1ZWI C;  3ZHR A;  2H94 A;  2JRI A;  3U10 A;  3TET A;  2PGG A;  3CSX A;  4DV5 O;  2EIK C;  4MVO A;  5IJ0 B;  3E35 A;  4N23 A;  4X64 O;  2YUA A;  1OCZ C;  4A5U B;  2Q7E A;  4NXM B;  1Q8I A;  3JAL A;  4Z1V A;  4JI5 B;  2LQT A;  1NJI W;  2JK5 C;  3QTC A;  1H2M A;  3CRR A;  1FD9 A;  4DV0 O;  5B66 Z;  2DYR B;  1DF5 A;  4JF3 A;  1E1R G;  2QM4 A;  1UJW B;  4B3T B;  4DK1 A;  3JAS A;  4U3J A;  2Q73 A;  4UB8 Z;  1LUV A;  2CK3 G;  5ITZ A;  2Y0I A;  4IHJ B;  4WFE A;  4B3S O;  3CP1 A;  2ODM A;  1TVK B;  3CHX A;  4KHP O;  4EFE A;  2WA4 A;  1VF6 A;  3AG4 B;  3FD9 A;  5JQG A;  5H9C A;  1GN3 A;  4FLX A;  1K73 W;  3SPH A;  1D2D A;  1IXB A;  2V7Q G;  4LNU A;  5LHG A;  1X4T A;  1KC8 W;  5FNV B;  2W0X A;  2XUM A;  3U11 A;  5LA6 B;  3P3P A;  2P7T C;  1VQ5 V;  2W6J G;  5L3C A;  1G6U A;  1UPG A;  1Z5V A;  2QM8 A;  3APQ A;  2EJ7 A;  4O2B A;  5J2T A;  3SYC A;  2ZKO A;  1QR9 A;  3W7X A;  4JI3 B;  3CD6 V;  4JAS A;  3WB2 A;  1R6N A;  4DR5 O;  1CPY A;  3WFV A;  2QA4 V;  5EBM C;  1H8E G;  4LF5 O;  2LFR A;  2GBO A;  3UO3 A;  4QGP A;  3CCR V;  3N2G B;  4F4L A;  2R9A A;  1M56 C;  4RO2 A;  3CC7 V;  1IBM O;  4P9O A;  4FLU A;  4O4L B;  4UVA A;  3STL C;  1BE3 H;  3G71 V;  4JAU A;  1JOY A;  1T5E A;  4F6R A;  2GUZ B;  3JAW A;  3T4Z A;  3HKD B;  3DTU B;  4LFA O;  1VMG A;  1O9H A;  1VQ7 V;  3KZI Z;  4RUE A;  2ZE5 A;  1K3E A;  3HKE A;  2IU3 A;  4HAM A;  3VOU A;  5B3S C;  1HR0 O;  4NB5 A;  2XTA A;  1N0J A;  4DV6 O;  1NTK H;  2CGN A;  4O4I A;  3JSN A;  2UXC B;  5LMN B;  5JVD A;  1BZK A;  4R6Z A;  4PJ0 Z;  3ZN0 A;  2ZIM A;  1AI4 A;  1YSC A;  2GTS A;  3NR7 A;  3P30 A;  1THZ A;  1GAX A;  1K97 A;  3F5T A;  1YJ9 V;  1H2K A;  3CCM V;  1K34 A;  4CBC A;  1WA8 A;  2Q0O C;  1V54 B;  4YJ3 B;  4CH4 A;  2ZD9 A;  3K79 A;  2BTQ A;  2PI4 A;  4WFA V;  5EK0 A;  4MS2 A;  1ZLZ A;  2OCC C;  2X0L A;  3OAA G;  2HHH O;  2IH1 C;  4DUZ B;  3IC9 A;  1NTM H;  1YJN V;  1Y74 A;  1GM8 A;  4RAI A;  3RYC A;  3CJH B;  2M6Y A;  3GB7 C;  4DR7 O;  2ADP A;  4KP4 A;  2CH7 A;  5BR8 O;  4PDL A;  1KYO F;  3T1Y O;  2EIL B;  4CS4 A;  2ZIN A;  1OJH A;  1Y76 B;  2AXT Z;  1XHX A;  4O4H A;  2HFE C;  3AG3 C;  3CC4 V;  1QU7 A;  1SA0 B;  3M8A A;  4DV7 O;  3L74 H;  2DE0 X;  4UVC A;  5CA1 B;  3I55 V;  1TUE B;  1XRE A;  4QE7 A;  5D5Q A;  5GTH Z;  5JCO C;  3CCL V;  2CTW A;  2VRZ A;  1IVS A;  3RYH B;  4LWS B;  2X6B A;  4PV1 B;  4DRX B;  4JI7 B;  2IJH A;  4LF6 B;  3HKC B;  3K3W A;  5KAF Z;  4DV3 B;  3DSQ A;  1ZL8 B;  4FFB B;  3OTO O;  4G2K A;  3O65 A;  1I94 B;  2JEU A;  3GVM A;  2CDY A;  4UFZ A;  3TGU H;  2UU9 O;  1BSM A;  4IHJ A;  2LFS A;  5LHI A;  4I9W A;  2B5U A;  4IYH A;  3S3X A;  4DW1 A;  5B1N A;  4GX0 A;  3A0R A;  1G4Y B;  1H8H G;  4DR4 O;  2BE3 A;  2IBZ H;  4Z1M G;  3A2F A;  4NR1 A;  1KEC A;  5IWA O;  1NTZ H;  2WA3 A;  1N34 O;  2P06 A;  2GHY A;  5IE9 A;  5KHK A;  5LA6 A;  1NT2 B;  3Q4H B;  4OPH A;  3ETE A;  5JJN B;  1ARO P;  1QCE A;  1Q6I A;  2IH3 C;  4DV5 B;  3BCC H;  4MTO A;  3H1I H;  5L3E A;  4CC6 A;  3J80 N;  3JAK B;  4X64 B;  4LF4 B;  3JD3 A;  5DED A;  4JI5 O;  4FMT A;  2Q7H A;  4B3M B;  1AP6 A;  2CUG A;  1E1Q G;  5KA6 A;  3VQW A;  2ZCE A;  2E76 B;  3N2G A;  4P2Z A;  2QM7 A;  3ZX6 A;  4LH6 A;  3UCS C;  4DV0 B;  3L75 H;  4X20 A;  1KKC A;  4U7O A;  4O4L A;  1OZ0 A;  4H13 B;  5B1A C;  4WBN A;  5EBW C;  3FKS G;  4B3T O;  3WG7 B;  1XL6 A;  1PL0 A;  2ZXW B;  3QVN A;  5EIB D;  1H2L A;  5EC2 C;  4MTF A;  4KHP B;  1B04 A;  4X1Y B;  3OUS A;  3HKD A;  1SZT A;  2DQ3 A;  2BTO A;  1YTF B;  1ZAU A;  3F7Y C;  4C7U A;  1KP3 A;  1Q6H A;  4JI4 B;  3SJB C;  4WFG A;  2H8P C;  3X2Q C;  1NVP D;  1I7F A;  4FZ1 A;  1WLE A;  1I5Y A;  4CH6 A;  3B8N A;  1LNQ A;  2F43 G;  1S72 V;  2UUB B;  4JI3 O;  1PP9 H;  3ABK C;  3JAL B;  4DR5 B;  4LF5 B;  3VQV A;  1H2G A;  1M4U A;  2UXX A;  1Z5W A;  4ZHQ A;  1SF9 A;  1ZX3 A;  1IBM B;  3R65 A;  3CCQ V;  1WNS A;  2DOS A;  1OCC B;  1VQM V;  1H2S B;  3JAS B;  2X7R B;  2XAH A;  5ITZ B;  2JJ1 G;  2VWK A;  3JD2 A;  4BWA A;  4X88 A;  4LF7 O;  4ZI7 B;  3CME V;  3FB5 C;  3CCE V;  3OEE G;  1Y76 A;  1B06 A;  1KQS U;  1QLE B;  1AVM A;  5JQG B;  1CEZ A;  1OCR C;  1P84 F;  1SA0 A;  1WPB A;  5EYP B;  2PTM A;  4PI0 A;  1F23 A;  1Q43 A;  2RJZ A;  1BHA A;  3NXS A;  2F4V O;  4JI1 B;  4U7N A;  2GSM B;  3ASO C;  3OGC C;  1KP2 A;  1HNX O;  1AR4 A;  2CE4 A;  1XEQ A;  2X6C A;  1EM1 A;  2HKO A;  4XDK A;  1F7Y A;  2UXC O;  5LMN O;  2Q5Z A;  1FXV A;  4PD4 F;  3RYH A;  2XND G;  5CBF A;  4O2B B;  1QBZ A;  5J2T B;  4ZOL B;  3HKC A;  2RMK B;  1WB8 A;  1ZL8 A;  4X1K A;  5FPO A;  4FFB A;  1IBL B;  4MVZ A;  2HJD A;  3E22 A;  5K1X A;  1XHZ A;  3ABL C;  3T2M A;  1KUQ A;  1N32 B;  1P7B A;  4UVB A;  4YIO A;  3BAA A;  4UV8 A;  3TCU A;  1Z2G A;  4YHH B;  3RYI A;  3CMA V;  3OFN G;  3CXH F;  2QE7 G;  1JA8 A;  1KB9 F;  1YTF D;  2DQ0 A;  2JJ2 G;  2Q0A A;  4PA7 A;  1NQT A;  2YC0 A;  4CZZ A;  5CN0 A;  1QVF U;  3OE7 G;  1OHH G;  4F6R B;  2VQF B;  2LGW A;  3RFR A;  5H6Q A;  2DYR C;  3DXR B;  4DR7 B;  1GN6 A;  3T1Y B;  3JAW B;  3K9S A;  4BR6 A;  1MMM A;  3Q4H A;  4I4T B;  1N0N A;  1GTO A;  3JAT A;  4DV7 B;  4MVS A;  2EZP A;  3T1C A;  4FK5 C;  5H5N A;  4FPP A;  3LNM B;  1HDJ A;  1YF2 A;  4KXR A;  1KBH A;  4I50 B;  3JAK A;  2YDE A;  5KX5 A;  3BPZ A;  1TA8 A;  2Z3Y A;  3UT5 A;  3QO5 A;  1K4D C;  4J7J A;  5FL7 G;  1B3Q A;  4ZBM A;  1Y4M A;  1S5J A;  5JVD B;  2Z0A A;  4LF6 O;  3HKB A;  2CGO A;  4DV3 O;  1HW7 A;  5LYJ A;  1S5H C;  4NKG B;  4DV1 B;  2HG5 C;  2DMX A;  3SPC A;  3BHP A;  3AG1 B;  4WF9 V;  4EB6 B;  5CBH A;  1WA8 B;  3N2K A;  1J5E O;  3L9D A;  1BS3 A;  2BTQ B;  4J10 A;  4X8A A;  4DR4 B;  2ARH A;  1VQK V;  1Y74 B;  3RYC B;  3ZHS A;  3IC7 A;  1YJW V;  1N34 B;  2CH7 B;  1VIB A;  3RT3 C;  1SKV A;  3P3N A;  1FXK C;  4O4H B;  4KUM A;  2JEX A;  2L35 A;  4JTD B;  3CS5 A;  3FB8 C;  3ZMU A;  3L70 H;  2YXL A;  1SC5 B;  3KCX A;  3CRA A;  2IJK A;  4LF4 O;  2ADQ B;  2IJJ A;  1FJG O;  1VF7 A;  2B1G A;  4B3M O;  3ZRW A;  2A3Q A;  1DK1 A;  1M57 C;  3AG2 B;  3ABU A;  2AHZ A;  4JZ2 A;  2NN4 A;  2L6L A;  3D36 C;  2ITC C;  1FYJ A;  2CTR A;  2P4K A;  4RUF A;  2WAM A;  2RDC A;  3B40 A;  3SGI A;  3JD0 A;  4JI2 O;  1WAZ A;  2YSU B;  1U97 A;  3APO A;  3FFQ A;  1V55 C;  3W7T A;  2F95 B;  2JVD A;  2IW5 A;  3JCU Z;  5KHI A;  1H38 A;  3ZMS A;  1MSW D;  4ZI7 A;  3ZBH A;  3ABM C;  4H44 B;  3K0G A;  3UKM A;  2OWO A;  4FZ0 A;  1IDS A;  5EYP A;  1VAR A;  4JI4 O;  4UCR A;  4IIJ A;  3IFX A;  4X62 B;  5LP6 C;  5JWP A;  4L8J A;  1XL4 A;  3ZCC A;  4CC5 A;  5IYD O;  1XNR O;  1DGS A;  3E89 A;  4MTX A;  2UXD O;  4ZOL A;  1YXB A;  2UUB O;  2KG7 B;  5EIB C;  1ORQ C;  5EZY A;  4ICG A;  3CEI A;  1P4R A;  4X20 B;  3JSL A;  4RQE A;  5JH7 A;  1K33 A;  2E74 B;  4WBN B;  2P22 C;  1GKF A;  1RPO A;  4DK0 A;  1RSO A;  1MOF A;  3DXR A;  2ZDI C;  5LGT A;  1TGO A;  2LP7 A;  4LF7 B;  3SJQ C;  1VF5 B;  1NZ6 A;  3L73 H;  4I4T A;  2ZE6 A;  5FLX N;  4D7S A;  3JCZ A;  1VQN V;  1SZX A;  4GYC B;  3ASN B;  4LR3 A;  4MVU A;  3UM7 A;  2ATK C;  3R66 A;  1D5A A;  4P9P A;  3FX7 A;  4JI1 O;  3L71 H;  2F4V B;  2EIK B;  1N36 B;  4I50 A;  2LW1 A;  4CS2 A;  2HP8 A;  5KLV H;  1K5S A;  1HNX B;  1XIL A;  1OCZ B;  1VQP V;  5HFL A;  4FM0 A;  3SYP A;  2PI5 A;  1S77 D;  5B1B B;  1PPJ H;  2QWR B;  5D5P A;  4MT8 A;  2LGQ A;  1IBL O;  1GM7 A;  4O4J A;  2X6A A;  1N32 O;  4L87 A;  4EB6 A;  4ABM A;  2WLM A;  4YHH O;  4ZHQ B;  2OCH A;  1KU9 A;  3QNE A;  4Z2W A;  4TQF A;  4DYL A;  1L1F A;  4K8Z A;  3ZED A;  4LF8 B;  4MTG A;  4FLZ A;  3JD1 A;  1WJZ A;  1GN2 A;  1KMI Z;  2B1I A;  4FFK A;  4JV5 B;  4DV4 B;  4I5S A;  2A79 B;  2VQF O;  1JFF A;  3RVY A;  3A0B Z;  2OTJ V;  5FPR A;  2V1D A;  4K0K O;  4FLV A;  2BSK A;  2FL4 A;  3BFR A;  1OCO C;  1BQ0 A;  3W7S A;  3ZMT A;  1NS1 A;  1SQX H;  2M7W A;  1SRY A;  1TAE A;  2ZXW C;  1SQV H;  4DO2 A;  1SQQ H;  3ZHU A;  1Q81 W;  4FM2 A;  2E75 B;  4PHZ A;  3TXS A;  2HVK C;  5IJ9 B;  3ZRV A;  3WB1 A;  2ZM6 O;  3CC2 V;  4PDM A;  2YXH A;  1SQB H;  2FKX A;  1R3L C;  1NBM G;  4TV8 B;  4HNA A;  4LP8 A;  3F7V C;  4X66 B;  1M56 B;  4X1K B;  4DV1 O;  3E22 B;  1YDX A;  2UUC B;  2JGD A;  1J5E B;  3RYI B;  3ZRX A;  5LXT B;  3K5N A;  4R7C A;  1XBL A;  2YEV A;  4HZ3 A;  3OM3 B;  1Q5O A;  5H2F Z;  2DYS C;  2WSS G;  1Y6X A;  2HJF C;  4FVM A;  2PZS A;  5LGU A;  1VQL V;  1E79 G;  1NR7 A;  1Y66 A;  2OTL V;  4QE9 A;  3M99 B;  3LDC A;  3HR0 A;  3WB0 A;  3VQX A;  3CRC A;  1IBK B;  5B3S B;  2YI9 A;  5GW7 A;  3MHH C;  3JAT B;  5BMV B;  2EX3 A;  4ASU G;  4LFB B;  2EIJ C;  5IYB O;  2IM9 A;  2NR5 A;  5KX5 B;  1WPX A;  1BQZ A;  2KG7 A;  1Q3E A;  5CA3 A;  1MSD A;  1VF6 C;  2ZE8 A;  3UT5 B;  1RM1 C;  4J9Y B;  4TV9 B;  4LFC B;  5IY5 C;  1WP7 A;  2P6J A;  1FJG B;  4AI8 A;  4PA4 A;  3OMA B;  2VS0 A;  3N27 A;  1K4C C;  3UQ8 A;  3HKB B;  5IDJ A;  2WLL A;  3LSQ A;  2OT5 A;  5LYJ B;  5KUK A;  5LGN A;  1SET A;  4U3F H;  4JI2 B;  3SYQ A;  2QWN B;  2OCC B;  4GZR B;  3MDS A;  3CPW U;  3TK1 A;  4GKJ B;  3N2K B;  5J9P C;  1JQ0 A;  1JJ2 U;  3B4S A;  1FFX A;  4ZKI A;  2DW4 A;  2WLH A;  2UXB B;  1MZF A;  3K06 A;  1NU1 H;  2CTQ A;  4GX5 A;  3J7A U;  2IU0 A;  3UO2 A;  1FXK A;  4B7K A;  2AHY A;  5B5E Z;  4X62 O;  2PF4 E;  2R70 A;  4K8X A;  1N4C A;  4I0X A;  3RWR D;  2XAS A;  1XQ8 A;  4G27 B;  3ZJZ A;  1G1X B;  3KCY A;  2C2A A;  2IJI A;  2V4D A;  2XT9 A;  1L0L H;  1XNR B;  2MK3 A;  3BAB A;  2QGN A;  2Q4P A;  2UXD B;  1F4N A;  2ETN A;  1I5X A;  3K9A A;  4UXN A;  3SPJ A;  2Y69 C;  4DR3 B;  2PYL A;  3L72 H;  3D36 A;  3KG2 A;  4Q6G A;  1F4M A;  1GK9 A;  5IYZ B;  3GWO A;  3J81 N;  1EBO A;  3ZRW B;  3K59 A;  1GRJ A;  3BRC A;  5C93 A;  4HYO A;  4OX9 O;  2EIN B;  2F1M A;  2Q8V A;  4WFH A;  1SER A;  2JS5 A;  2QEX V;  1OV9 A;  1VQ4 V;  2N05 A;  4R50 A;  3RBZ A;  4LF9 O;  2Q68 A;  2RCV A;  3B09 A;  1X59 A;  2QR4 A;  4WCE V;  5IT9 N;  2WLK A;  2WLI B;  3O9O A;  5LP6 A;  3AEI A;  4PDR A;  4JTA B;  5CBG A;  1JPX A;  2XAQ A;  2EIM C;  2FTK A;  4AQY B;  4Q20 A;  3T4D A;  4IIJ B;  4YY3 B;  1N36 O;  5CB4 A;  2LW7 A;  1O9G A;  1UFI A;  4IGG A;  5CMU A;  4BIU A;  3CWB H;  1JX9 A;  5IJ9 A;  4UCT A;  4YXW G;  2XAG A;  2A9H A;  2K9P A;  4E4E A;  1MAB G;  4IYI A;  1SS3 A;  2O57 A;  2GDS A;  1Q82 W;  3G80 A;  4TV8 A;  1EN4 A;  2F23 A;  4QPK A;  1R3I C;  3ZIA G;  1IZ3 A;  1DF4 A;  3TXQ A;  2DJV A;  5EZY B;  5B1A B;  4CS3 A;  3OTF A;  3GWK C;  5L3B A;  1YCI A;  3SPG A;  2E5L B;  5LXT A;  5JH7 B;  2N04 A;  4CH3 A;  3C3T A;  2EJR A;  4LF8 O;  1GM9 A;  2GTA A;  4JV5 O;  2Y48 A;  4DV4 O;  3AG2 C;  1RSO B;  4TSF G;  2OYQ A;  4JTC B;  1M5I A;  4K0K B;  2YIA A;  5LHH A;  3IGA C;  5BZB A;  3WU2 Z;  2ITD C;  4R8C A;  1EZV H;  4HBN A;  1L8D A;  5BMV A;  4RQF A;  5KAI Z;  3X2Q B;  1PNK A;  2P5O A;  5DEC A;  5KMG A;  2ZT9 B;  4QNH B;  3ZS8 C;  1YHQ V;  2QKA A;  3RW0 A;  3QO7 A;  3AG4 C;  4P30 A;  2ZM6 B;  3SPI A;  4TV9 A;  3ABK B;  3K5O A;  3RN4 A;  1YIT V;  2RNB A;  3CCU V;  4DR2 B;  1PNL A;  2G38 A;  3H1L H;  3OW2 U;  1FAF A;  3H1K H;  4GT1 A;  3D3I A;  4LBE C;  2XHB A;  4X66 O;  4FIP C;  1W59 A;  2QKC A;  4TQD A;  3OD4 A;  3K58 A;  4PA6 A;  5IYC O;  4O4J B;  4DW0 A;  3T1H B;  2UUC O;  4DR6 B;  2YID A;  5CA0 A;  1HNZ B;  4E2L A;  3G4S V;  4FJC C;  4XDL A;  1YZB A;  1VQ9 V;  4DR1 O;  2ZNI A;  4I55 A;  3SJA C;  2ZNJ A;  1XMQ O;  3K04 A;  3ML0 A;  4FLW A;  4YJ2 A;  2YIB A;  1AJP A;  1JFF B;  3SJC C;  1RFY A;  3AK1 A;  3JD4 A;  1OCR B;  1GN4 A;  2R9R B;  2PUS A;  2FB5 A;  4IT5 A;  4DUY B;  2BSK B;  4PA9 A;  5DN6 G;  2PYJ A;  1ZSP A;  1PV0 A;  1LR1 A;  3BY6 A;  5HFM A;  2Y4T A;  1AI6 A;  5AG2 A;  3LUT B;  4YIP A;  3QF7 A;  3CRQ A;  1RPR A;  1IBK O;  1I08 A;  1CP9 A;  3ASO B;  4JI6 B;  3D3Q A;  5JCO A;  2Z5U A;  4LFB O;  3ETG A;  2A7W A;  1VP7 A;  4PDV A;  4J80 A;  1XMO B;  3CCV V;  4GKK B;  5LBQ A;  1S76 D;  2WLJ A;  4J9Z B;  1RP3 B;  5IYZ A;  4UCU A;  4LFC O;  1QVG U;  2QWO B;  3LDE A;  2Q7G A;  3LNN A;  2YXY A;  3U0Z A;  3ABL B;  2QDO A;  3PJS K;  4HNA B;  1S5L Z;  1N33 O;  2H3O A;  2VQE O;  3KKY A;  4LH7 A;  4WFF A;  1MG1 A;  1Q7Y W;  2KQX A;  4GKJ O;  2JGD B;  4J11 A;  5EBL C;  1SQP H;  2NNU A;  5B1B C;  2YEV B;  3S3W A;  2XAF A;  2UXB O;  1S0V A;  2N74 A;  5K1P A;  3K0D A;  2WLI A;  1KKD A;  2D3O W;  1L0N H;  2QTS A;  2YI8 A;  4I9Q A;  1VQO V;  1V54 C;  3HB3 B;  2UXN A;  4JGS A;  4PA3 A;  3K5L A;  2HEP A;  5C8Y B;  1URF A;  2GV9 A;  4GCZ A;  1EN5 A;  2AGA A;  3W7U A;  4JAV A;  3QG5 A;  1M90 W;  2NLJ C;  4DR3 O;  3D8C A;  2EIL C;  3E8F A;  3C90 A;  2Q69 A;  5J2U A;  4XDJ A;  3E86 A;  3FB7 C;  3G6B A;  4H37 A;  2CAZ C;  3E83 A;  2WLL B;  4JI0 B;  4OX9 B;  4O2A A;  2KSD A;  2ZE7 A;  3ZHV A;  2RN9 A;  2Q6A A;  3ZHQ A;  4MSW C;  4J7Z A;  5JJE B;  2AZ0 A;  4J7K A;  4LF9 B;  1FFX B;  4OPA A;  1QHT A;  1FFT B;  1QR8 A;  2Y4U A;  1K92 A;  4H33 A;  1JVM A;  4XBF A;  3OT7 A;  1Q86 W;  5LOV A;  1FKA O;  4K3A A;  1R6K A;  4LCU C;  1BGY H;  1FXK B;  2ZR3 A;  4AQY O;  4PI2 A;  1AB3 A;  3MD0 A;  3AK3 A;  2P4V A;  3CB2 A;  4YY3 O;  2EUL A;  3FB6 C;  4I0X B;  3BA9 A;  2OIE A;  1FPO A;  3JAM N;  3EXA A;  1N8R W;  1F51 A;  2OIG A;  4QJF B;  1HNW B;  1M57 B;  2E3C A;  1GH6 A;  2QWQ B;  4X9Q A;  4JYC A;  1JJO A;  3CYO A;  1QQC A;  1WP8 A;  1AJN A;  1M9N A;  1R3J C;  3RGB A;  1MNG A;  2MW2 B;  3DGE A;  1AI5 A;  2QSA A;  2YS8 A;  4J41 A;  4AIL C;  2E5L O;  4NTW A;  3ETQ A;  2UUA O;  1V55 B;  4TUY A;  3FAV B;  1PKX A;  4NXN O;  4EKW A;  4NYK A;  3OMN B;  2R72 A;  4X1I A;  3SYO A;  1AR5 A;  1AIL A;  2DWD C;  3G67 A;  1VQ8 V;  3ABM B;  3JAR A;  5LMU B;  4UB6 Z;  4JYA O;  3FYI B;  3E8B A;  1W0J G;  2BOB C;  3AG7 A;  4KFM A;  4PEL A;  2R9I A;  5LP6 B;  3CX5 F;  3ABT A;  3WG7 C;  5A9G A;  4BAY A;  2QTO A;  5B1O A;  3ZMZ A;  1XDC A;  5CB4 B;  2QWP B;  1ZUQ A;  1GO3 F;  3RYF B;  4JYY A;  3PN1 A;  1Y67 A;  4GX2 A;  2HLD G;  5KHH A;  3MAQ A;  2PY5 A;  4DR2 O;  1R73 A;  4WFB V;  1YVW A;  4JI8 O;  3CCS V;  2WPD G;  1Q6U A;  3OR6 C;  1VEW A;  1XNQ B;  1I0H A;  3RVZ A;  5IJ0 A;  1COW G;  3E2E A;  1K9M W;  3T1H O;  4UCS A;  3I56 V;  4DR6 O;  4X65 O;  1HNZ O;  1G8M A;  1NVP B;  1NR1 A;  4DR1 B;  3EHB B;  3LDD A;  3ZHT A;  4DV2 B;  4G28 B;  4UV9 A;  1NKD A;  1TUB B;  1XMQ B;  2JIZ G;  2ILM A;  2QKS A;  3ICX A;  1K5Q A;  5E79 Z;  1BL8 A;  4DUY O;  1FXH A;  5EC1 C;  2EIN C;  1XOU A;  3ZN1 A;  3W7W A;  1YEW A;  1U96 A;  5BY1 A;  4B3R O;  5C8Y A;  1EN6 A;  4B08 A;  1TVK A;  1ENV A;  3I5D A;  4MVQ A;  1OCC C;  4JI6 O;  3A8T A;  4UCV A; 
#chains in the Genus database with same CATH homology
 3T4D A;  3T4Z A;  3DTU B;  1YIJ V;  3LSS A;  5KUM A;  1FXK C;  5CMU A;  4BIU A;  4KUM A;  1JX9 A;  2JEX A;  4YXW G;  4JTD B;  2XAG A;  1IXM A;  2A9H A;  1VQ7 V;  1EZJ A;  4RUE A;  1MAB G;  3FB8 C;  3ZMU A;  1K3E A;  1AI7 A;  2IU3 A;  4HAM A;  1QLE C;  3VOU A;  5B3S C;  1AJQ A;  1Q82 W;  2IJK A;  4QPK A;  1R3I C;  3ZIA G;  4TWK A;  2Q67 A;  2IJJ A;  1NH2 B;  2B1G A;  1DF4 A;  4MVM A;  4R6Z A;  3ZRW A;  1M57 C;  3ZN0 A;  3AG2 B;  2JDI G;  1S3J A;  5B1A B;  3ABU A;  2AHZ A;  1AI4 A;  1YSC A;  2ITC C;  3P30 A;  5L3B A;  3SPG A;  2XOK G;  4RUF A;  1THZ A;  3P32 A;  1K97 A;  2WAM A;  3QO8 A;  1YJ9 V;  3JD0 A;  1M1K W;  2EJR A;  3MHS C;  2YSU B;  1GM9 A;  1K34 A;  5H6R A;  4BW5 A;  3CCM V;  4CBC A;  3HPL C;  4OXS A;  1V54 B;  1V55 C;  2Y48 A;  3W7T A;  2IW5 A;  2ZD9 A;  3K79 A;  1OCO B;  1K8A W;  3AG2 C;  4TSF G;  2PI4 A;  4WFA V;  1H38 A;  4JTC B;  5EK0 A;  3ZMS A;  5L3F A;  3BEH A;  3B77 A;  4MS2 A;  2OCC C;  2X0L A;  3OAA G;  3ZRS A;  3ZMV A;  1QLN A;  3AG3 B;  5LHH A;  2IH1 C;  3IGA C;  3ABM C;  3K0G A;  1YJN V;  1GM8 A;  4RAI A;  5BZB A;  3UKM A;  1SES A;  2ITD C;  4R8C A;  2DWE C;  3GB7 C;  4RQF A;  3OEH G;  3X2Q B;  1PNK A;  4KP4 A;  4PDL A;  4MW8 A;  4QNH B;  2EIL B;  1YHQ V;  3IFX A;  3RW0 A;  4X89 A;  4LC1 A;  3B8M A;  2HFE C;  3AG3 C;  3CC4 V;  1XL4 A;  3QO7 A;  4QPJ A;  3AG4 C;  2HR3 A;  4P30 A;  3ZCC A;  3G6E V;  5IYD O;  4UVC A;  3SPI A;  3ABK B;  4UUJ C;  3I55 V;  1TUE B;  3E89 A;  3F5W C;  1YIT V;  3CCU V;  4MTX A;  1PNL A;  3VBB A;  3OW2 U;  4GT1 A;  4QE7 A;  3D3I A;  4LBE C;  3OR7 C;  3CCL V;  4FIP C;  4N21 A;  1ORQ C;  2W6I G;  3EFF K;  3E8H A;  4BIZ A;  4PA6 A;  2X6B A;  1P4R A;  2IJH A;  5IYC O;  2EBO A;  1DLB A;  2BOC C;  3K3W A;  2DYS B;  2WLN A;  4E2L A;  3G4S V;  4FJC C;  4XDL A;  4RQE A;  1B6Q A;  1VQ9 V;  4G2K A;  1K33 A;  1GKF A;  2JEU A;  1RPO A;  3K04 A;  4DXW A;  3ML0 A;  1MOF A;  2LFS A;  1AJP A;  2K1E A;  5LHI A;  4I9W A;  2B5U A;  3AG1 C;  1ROP A;  3JD4 A;  2ZDI C;  1OCR B;  4JPR A;  2R9R B;  5B1N A;  1PNM A;  2LP7 A;  4GX0 A;  3A0R A;  5LGT A;  1H8H G;  1G4Y B;  4PA9 A;  3SJQ C;  4Z1M G;  5DN6 G;  1KEC A;  3BY6 A;  5HFM A;  4JYB A;  1AI6 A;  2EIJ B;  3LUT B;  1J95 A;  1RPR A;  3JCZ A;  1VQN V;  1CP9 A;  2GHY A;  3ASO B;  3H01 A;  3ASN B;  4MVU A;  2ZR2 A;  3UM7 A;  2ATK C;  2Z5U A;  4P9P A;  1RM1 B;  3ETG A;  2EIK B;  1YI2 V;  5IY5 B;  1NH2 D;  4PDV A;  3SYA A;  3ETE A;  1ARO P;  1K5S A;  3CCV V;  1OCZ B;  1QCE A;  2IH3 C;  5LBQ A;  1S76 D;  2WLJ A;  4J9Z B;  4MTO A;  1VQP V;  5L3E A;  5HFL A;  1QVG U;  3SYP A;  3LDE A;  2PI5 A;  3STZ C;  1S77 D;  5B1B B;  3JD3 A;  3ABL B;  3PJS K;  4MT8 A;  2A0L A;  4FMT A;  5KA6 A;  1E1Q G;  1GM7 A;  4WFF A;  3ETD A;  1MG1 A;  2X6A A;  1Q7Y W;  4P2Z A;  4L87 A;  2QM7 A;  3E8G A;  1PD3 A;  2ZDI A;  2WLM A;  4U7O A;  3K08 A;  5EBL C;  2NNU A;  1OZ0 A;  3QNE A;  5B1A C;  5B1B C;  1EFR G;  3CCJ V;  1L1F A;  5EBW C;  2YEV B;  3FKS G;  2XAF A;  1S0V A;  4MTG A;  3WG7 B;  3JD1 A;  1KD1 W;  2B1I A;  1XL6 A;  1PL0 A;  2ZXW B;  4TT3 G;  4I5S A;  1BHB A;  3K0D A;  2WLI A;  2A79 B;  1KKD A;  3RVY A;  1MSW D;  2D3O W;  5EC2 C;  2P90 A;  4MTF A;  2OTJ V;  2V1D A;  1VQO V;  1V54 C;  3K03 A;  1OCO C;  3HB3 B;  2UXN A;  3OUS A;  3W7S A;  3ZMT A;  4JGS A;  2KB1 A;  4PA3 A;  2M7W A;  1SZT A;  2DQ3 A;  1SRY A;  1YTF B;  3F7Y C;  1KP3 A;  1R3K C;  2ZXW C;  1W0K G;  2Y69 B;  4DO2 A;  5KA5 A;  4GCZ A;  3W7U A;  1Q81 W;  4JAV A;  4WFG A;  2H8P C;  2P67 A;  1M90 W;  2NLJ C;  5L3G A;  3X2Q C;  1NVP D;  2HVK C;  3ZRV A;  1WLE A;  3CC2 V;  1I5Y A;  2EIL C;  1JCH A;  4PDM A;  3E8F A;  3B8N A;  5E1A C;  2Q69 A;  2WWW A;  3FYE B;  1LNQ A;  1R3L C;  1NBM G;  2F43 G;  1S72 V;  4XDJ A;  3E86 A;  3FB7 C;  4H37 A;  3ABK C;  4LP8 A;  2ZQM A;  3F7V C;  1M56 B;  2WLL B;  3E83 A;  4QIW F;  2Q6A A;  1H2G A;  2UXX A;  4MSW C;  1K7D A;  2XAJ A;  4GX1 A;  3ZRX A;  3R65 A;  1HWY A;  4R7C A;  2YEV A;  3CCQ V;  4HZ3 A;  3OM3 B;  3CXC U;  1FFT B;  1QR8 A;  2DYS C;  1OCC B;  1VQM V;  1K92 A;  2WSS G;  4H33 A;  2EIM B;  3OUF A;  1JVM A;  2HJF C;  2X7R B;  4XBF A;  2XAH A;  1Q86 W;  5LGU A;  2JJ1 G;  3JD2 A;  4MVR A;  1VQL V;  1E79 G;  1R6K A;  1NR7 A;  4LCU C;  4X88 A;  1FXK B;  1Y66 A;  2ZR3 A;  1BMF G;  3OMI B;  4QE9 A;  3M99 B;  2OTL V;  3LDC A;  3CME V;  3FB5 C;  3CCE V;  3OEE G;  3MD0 A;  1W2B U;  2W0F C;  1DTO A;  5DM6 V;  3FB6 C;  1KQS U;  1QLE B;  1CEZ A;  1OCR C;  2EZO A;  5GW7 A;  5B3S B;  3MHH C;  4MW3 A;  1FS0 G;  4ASU G;  1F23 A;  1BHA A;  1AR1 B;  1VQ6 V;  3NXS A;  1N8R W;  1F51 A;  2EIJ C;  5IYB O;  3JYC A;  4U7N A;  2GSM B;  1GMG A;  5L3D A;  4QJF B;  2HVJ C;  3ASO C;  3OGC C;  3ASN C;  1KP2 A;  1WPX A;  1ZWI C;  1M57 B;  2X6C A;  5CA3 A;  2H94 A;  2HKO A;  4XDK A;  3TET A;  1RM1 C;  4JYC A;  2EIK C;  3CYO A;  4J9Y B;  4MVO A;  1FXV A;  5IY5 C;  2P6J A;  1AJN A;  2XND G;  5CBF A;  3E35 A;  4N23 A;  4PA4 A;  3OMA B;  1M9N A;  1QBZ A;  1R3J C;  1OCZ C;  1K4C C;  3DGE A;  1AI5 A;  5IDJ A;  2WLL A;  3LSQ A;  2OT5 A;  1NJI W;  1V55 B;  2JK5 C;  5KUK A;  4MVZ A;  1PKX A;  5LGN A;  3ABL C;  1SET A;  3T2M A;  4EKW A;  3SYQ A;  1P7B A;  3OMN B;  4UVB A;  2OCC B;  4UV8 A;  2DYR B;  3SYO A;  1DF5 A;  3TCU A;  3TK1 A;  3CPW U;  2DWD C;  1VQ8 V;  3ABM B;  5J9P C;  1JQ0 A;  3CMA V;  3OFN G;  1JJ2 U;  2QE7 G;  4ZKI A;  2DW4 A;  4JF3 A;  1E1R G;  2WLH A;  1YTF D;  3FYI B;  2DQ0 A;  2JJ2 G;  1UJW B;  3E8B A;  3K06 A;  4PA7 A;  1NQT A;  1W0J G;  2BOB C;  4GX5 A;  4CZZ A;  4KFM A;  4PEL A;  5CN0 A;  2R9I A;  3OE7 G;  1OHH G;  1QVF U;  2IU0 A;  2CK3 G;  4WFE A;  3CP1 A;  3ABT A;  3WG7 C;  1FXK A;  2DYR C;  5H6Q A;  4BAY A;  2QTO A;  3AG4 B;  2AHY A;  5B1O A;  3ZMZ A;  5H9C A;  2XAS A;  1GTO A;  1K73 W;  1GO3 F;  4G27 B;  3SPH A;  3ZJZ A;  4GX2 A;  2V7Q G;  2C2A A;  2IJI A;  2HLD G;  4MVS A;  2EZP A;  5LHG A;  1KC8 W;  3T1C A;  4FK5 C;  4FPP A;  3LNM B;  2MK3 A;  2P7T C;  1R73 A;  4WFB V;  1F4N A;  1I5X A;  3K9A A;  4UXN A;  3SPJ A;  2Y69 C;  3CCS V;  1VQ5 V;  2Z3Y A;  2WPD G;  2W6J G;  3D36 A;  3KG2 A;  3QO5 A;  3OR6 C;  5L3C A;  1K4D C;  1F4M A;  5FL7 G;  1GK9 A;  2QM8 A;  4ZBM A;  1Y4M A;  3RVZ A;  1COW G;  3E2E A;  3GWO A;  3SYC A;  1EBO A;  3ZRW B;  1QR9 A;  3W7X A;  1K9M W;  5C93 A;  3I56 V;  4HYO A;  3CD6 V;  4JAS A;  1R6N A;  1G8M A;  1S5H C;  1CPY A;  2EIN B;  4WFH A;  3WFV A;  2QA4 V;  1NVP B;  5EBM C;  1NR1 A;  1SER A;  1H8E G;  3EHB B;  3LDD A;  2LFR A;  2HG5 C;  3SPC A;  3CCR V;  2QEX V;  3AG1 B;  4WF9 V;  4G28 B;  4UV9 A;  1VQ4 V;  1NKD A;  4F4L A;  5CBH A;  1M56 C;  4RO2 A;  3CC7 V;  4P9O A;  2JIZ G;  4R50 A;  3RBZ A;  2Q68 A;  4UVA A;  2QKS A;  3STL C;  1K5Q A;  4WCE V;  1BL8 A;  3G71 V;  4JAU A;  1JOY A;  1FXH A;  5EC1 C;  4X8A A;  2EIN C;  3ZN1 A;  3W7W A;  2WLK A;  2WLI B;  1VQK V;  3AEI A;  1ENV A;  4PDR A;  4MVQ A;  1OCC C;  4JTA B;  3IC7 A;  5CBG A;  1YJW V;  1JPX A;  2XAQ A;  2EIM C;  2FTK A;  4Q20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...