3F7YC

Kcsa potassium channel in the partially open state with 17 a opening at t112
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
RAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title KcsA Potassium channel in the partially open state with 17 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3f7yC00
4X8AA 3JYCA 1R3IC 4R8CA 3T1CA 1OCCC 2HG5C 4WFEA 4P9OA 2EILC 4XDKA 3AG3C 2A9HA 1G4YB 2EIJC 4MTOA 3OUFA 4P2ZA 1QLEC 3STZC 3SPCA 3F7VC 3SYCA 3K03A 4JTCB 3UKMA 2A79B 1P7BA 3WG7C 4MW8A 1R3KC 2OCCC 4RAIA 2WLHA 3E8HA 4UUJC 3E86A 4MVMA 5EBWC 1K4CC 2QTOA 3E89A 5CBGA 3K0GA 2ZXWC 3ABMC 5J9PC 1S5HC 3LDDA 4PDLA 4R7CA 4RUFA 3SPGA 4MVQA 1V55C 5B1AC 3PJSK 2R9RB 1J95A 2DWEC 2WLIB 3IFXA 3RVZA 4PA7A 2BOBC 2YEVA 4MS2A 3E83A 3K08A 2HJFC 4MVZA 5EBLC 2WLLA 3SJQC 5B3SC 3SPIA 4H33A 3SPJA 4WFGA 2WLKA 3AG1C 4MVOA 5KUKA 3SPHA 4MSWC 4P9PA 4XDJA 4MVUA 4R6ZA 3SYQA 4PDVA 3RW0A 4ZBMA 4WFFA 5CBHA 3FB5C 2ATKC 4OXSA 5B1BC 4GX5A 4MVSA 2IH1C 4PA4A 3RBZA 2W0FC 3R65A 4QNHB 3GB7C 4J9ZB 2NLJC 4LBEC 3F5WC 3EFFK 3LDEA 4CBCA 2Q6AA 2WLMA 4MVRA 2P7TC 1K4DC 3OR7C 3T4DA 3IGAC 2WLLB 4GX2A 4PDMA 2X6BA 1R3JC 2EINC 3X2QC 2QKSA 4X89A 5E1AC 4BW5A 2H8PC 4MTFA 1M57C 1LNQA 2Q68A 4G28B 2X6AA 2EIKC 2K1EA 4QE9A 4WFHA 3ZRSA 4J9YB 5EC2C 4F4LA 2ITCC 3UM7A 4LCUC 4JTDB 2Q69A 3LUTB 3BEHA 3ASNC 1BL8A 4I9WA 3E8BA 4PA3A 3RVYA 1OCOC 2DWDC 2HVKC 3FB6C 3FB8C 3SYPA 3AG2C 3K06A 5EK0A 2HFEC 5BZBA 2KB1A 3ABKC 1ORQC 3ABLC 3K04A 2ITDC 4JTAB 1R3LC 4RO2A 1XL4A 2A0LA 5EBMC 1KKDA 3FB7C 3F7YC 4PDRA 3SYOA 4EKWA 3TETA 2JK5C 3HPLC 5IY5C 4MTGA 4GX0A 1JVMA 4DXWA 4R50A 3E8FA 3LDCA 4H37A 2AHZA 3AG4C 4RUEA 2ZD9A 3KG2A 2WLJA 4TWKA 2HVJC 4LP8A 5KUMA 2X6CA 3STLC 4PA6A 4HYOA 4KFMA 1V54C 2WLNA 2Y69C 1M56C 1OCRC 1XL6A 3ASOC 1OCZC 4P30A 3LNMB 2IH3C 2DYSC 4G27B 5CBFA 4XDLA 3OUSA 3ZJZA 4PA9A 2Q67A 3K0DA 4GX1A 4HZ3A 3E8GA 2DYRC 3SYAA 3T4ZA 2EIMC 3TCUA 3OGCC 5EC1C 4MW3A 2AHYA 4QE7A 2BOCC 4X88A 3VOUA 2WLIA 3T2MA 1ZWIC 3OR6C
chains in the Genus database with same CATH superfamily
1MA1A 5JJEB 4LF8O 5B1AB 4DK0A 3IC7A 3S3XA 5DECA 5K1PA 3I56V 4D7SA 2NN4A 5EBWC 2ZNIA 1Y74B 1VQ9V 1FXKA 1U96A 1TVKB 1VF6A 3PJSK 1KKCA 5IYCO 1MMMA 4LF9B 5FPRA 5B3SC 1QNMA 5CA0A 1KU9A 1H2NA 2Y0PA 3CCSV 4LFCB 4O2BA 4YHHB 4XDJA 1JA8A 3BAAA 2YDEA 1QR8A 4NXNB 1N34O 5CBHA 5B1BC 3OT7A 2RCVA 1FD9A 5GW7A 4QNHB 3BVOA 4UVCA 4NXMO 3W7WA 4JI6B 1EM1A 3ABLB 4JYAB 2YUAA 1R3JC 1RPOA 5E1AC 2H8PC 3HKDA 3SDLA 3ZRSA 4WFHA 4F4LA 1Y67A 2P4KA 2DQ3A 3K06A 4DV5O 4LF9O 3JASA 2A0LA 1AR1B 4YY3B 4ZIBA 2Y48A 5LHHA 4YHHO 2UU9B 1RPRA 4RUEA 1H38A 1AP5A 2LW1A 1NJIW 1LUVA 4LNUB 4QJFB 1FFXB 1Q81W 2IH3C 3RT3C 4JI6O 3OUSA 3OEHG 5LBQA 4JYAO 2DYRC 3ZHRA 1VEWA 5GTIZ 2BOCC 1D5AA 1SZXA 4DW1A 3DTUB 1K33A 2OT5A 4IHJB 1GKFA 3K58A 5GONB 4J10A 2DOSA 2EIMB 2F95B 2Y4TA 3CRCA 3FKSG 2KQXA 3S3WA 2FTKA 2OCCC 4YY3O 3E8HA 3VBBA 4DV6O 4MVMA 3AG1B 4B7EA 4PV1B 4U3FH 3W7XA 1G8MA 1N0NA 2UU9O 2R9RB 1QHTA 3OGIB 1YIJV 1GMGA 1N8RW 4X65B 2LFRA 4GT1A 2F66C 1GN2A 2KKWA 4H33A 4OX9B 4MVOA 1AJQA 3CMEV 2R9AA 3X2QB 2EX3A 2ETNA 2ATKC 5EZYA 4B3SB 4LBEC 3ETGA 1NU1H 2CAZC 2DQ0A 3CP1A 3T4DA 3Q4HA 2IJKA 3C90A 3HKEB 2QDOA 1M57C 4JI0O 4G28B 4YJ3A 3CCUV 2YSUB 4L8JA 1NTZH 2QEXV 3T1HB 4X1KB 5CB4B 2RNBA 3LUTB 3ASNC 3E8BA 4X65O 3K04A 3MHSC 1GAXA 4Z1MG 4I5SA 2B5UA 4OX9O 4JYCA 2N04A 1Q6UA 2HEPA 1S5JA 3BRCA 1XDCA 5LHIA 4LFBO 1BCCH 1JX9A 1ROPA 5L3FA 2WSSG 1WPBA 2X7RB 4KFMA 1EBOA 5KX5A 1NZ6A 1QLEB 2FMLA 1JQ0A 5JVDA 3WB1A 1Z2GA 2ZR3A 5E79Z 2ILMA 3I55V 4FM2A 3M99B 2Q73A 1JPXA 4R8CA 3MHHC 5IJ9B 5IYDO 1G4YB 1WNSA 3T1HO 4LF6O 3K5NA 3ETQA 2XUMA 5KMGA 4RAIA 1MABG 3E86A 4FK5C 3CCJV 5IYZB 3ABMC 1RP3B 3ZMVA 4CH5A 3K3WA 3K08A 4DV1B 5KAIZ 4NKGB 4IIJB 5FLXN 2WA3A 4J41A 3MAQA 2GBOA 1SA0A 1A32A 5EYPB 4PDVA 5B3SB 1HW7A 3DC5A 1EN5A 4CH4A 2ZCEA 4J9ZB 4DW0A 1L0LH 4FLZA 2EBOA 3CJHA 2ZT9B 4B3MB 2Q8VA 3U10A 2X6BA 3LSQA 1X59A 5LP6C 2PUSA 1SKVA 4OPHA 2HJDA 5FNVA 3ZMUA 4YIOA 5LMNO 5CMUA 4JI2O 3CXHF 4BAYA 4JPRA 4DV1O 1R3LC 5LYJB 4ZI7B 3D36C 2LW7A 3N2GB 4PDRA 3O65A 2JK5C 3C3TA 1G6UA 2HR3A 5KA5A 1BGYH 2KG7A 1K7DA 2EJ7A 3E8FA 4WBNA 3B09A 5LXTB 3KG2A 3E2EA 4FZ0A 1GN6A 2FB5A 2DMXA 3L71H 4PI2A 1M56C 3AG3B 4JI1B 1YF2A 3A2FA 4B3MO 1TAEA 2LJ2A 3TCUA 2Z3YA 3K57A 1K73W 4Q20A 2QWRB 4UV8A 2ZXWB 4XDKA 2EILC 2DYRB 2JGDB 1FFTB 1XOUA 3TXQA 2K9PA 4DV3B 3JSLA 4J7ZA 1I5XA 3RYIB 2OCCB 5B1AC 4O2AB 2LP7A 3IFXA 1Q3EA 2BOBC 2LO1A 4DK1A 3CPWU 5C93A 1ZSPA 1GTOA 3UQ8A 4F6RB 4JI1O 4FFBA 4P9PA 4MTXA 1Q86W 4WFFA 3CE2A 4RWUA 2IBZH 4GZRB 2LFSA 3A8TA 4PHZA 1FJGB 4FFKA 2ADQB 2Q5ZA 3FAVA 4GCZA 4CBCA 3OTOB 1K4DC 2JVDA 4TT3G 3IGAC 1YJWV 2QM8A 4U7OA 4DV3O 3CCQV 2YI9A 2AZ2A 3BHPA 4TV8A 2FYUH 4QE9A 4I7ZB 1NTKH 2OWOA 1Q5OA 1ZL8A 4O4LA 4QIWF 1LUWA 4ABMA 3ABLC 4AILC 1GN3A 4RO2A 1IZ3A 1PNLA 4LF4B 1KP2A 2IJIA 3JAKB 4ASUG 1WAZA 2YXLA 3N2KB 1I7FA 2LGQA 1FJGO 1GM9A 3ABTA 3UO3A 2WLNA 4CS4A 3OTOO 4UCUA 1GM7A 1CPYA 1GM8A 4EB6B 1NI8A 3ZRWA 2ZQMA 2Q67A 3W7SA 5JH7A 1RSOB 3CC4V 1FAFA 3T4ZA 1BE3H 2AHYA 4X88A 3VOUA 1ZWIC 4FM0A 2NR5A 3CRAA 4WFEA 3H1IH 2GUZA 3K03A 4QGPA 1JOYA 3JATA 4FZ1A 2UXXA 2WLHA 5LMUB 2JEXA 4LF4O 2QWOB 1H2KA 2Q9LA 5K1XA 2Q4PA 2YEVA 2GSMB 3B2EE 4MVZA 5EBLC 1EN6A 3G6EV 2CH7B 2JDIG 5LL6Y 5D5QA 3ZN1A 3AG1C 3CMAV 3APOA 4GYCB 1NH2B 3FB5C 1BMFG 2H3OA 2R9IA 2W0FC 3R65A 4UVBA 3M7MX 1JR9A 2P7TC 4DR3O 3ABKB 4W4KA 2YIAA 3L9DA 1W0JG 3X2QC 1I08A 1SQBH 1QR9A 4LF7B 3UT5B 1J5EB 3AG4B 1IBMO 4I4TA 4E4EA 4J7KA 5BZBA 2KB1A 1K34A 4LF5O 3QVNA 2RN9A 1UFIA 4DR4B 1TUBB 4MTGA 4GX0A 1SESA 5CN0A 2W0XA 3PN1A 3JD4A 4LH6A 5EIBC 1QLNA 4LF8B 4B3RB 2L35A 4N21A 5BMVA 4GX1A 3SYAA 1M56B 1SRYA 1N33B 3T2MA 4LF7O 4IT5A 3JALA 1NBMG 2ZINA 4CS2A 1QLEC 2ARHA 3UKMA 5LGUA 5CB4A 1PKXA 1B6QA 1EZJA 2EILB 1NR1A 2PY5A 3E89A 4DR4O 1E1QG 3HKBB 3BA9A 2HP8A 4BIUA 2DN9A 2GTSA 1J95A 4DRXA 1VQ4V 4PA7A 4FLUA 4O4JB 1Y4MA 2ADPA 2BTQA 2P06A 4NXMB 2Q7EA 5KUKA 1YDXA 5EIBD 4TV9A 4UCOA 1YI2V 4B3RO 4KL1A 2BCCH 4OPAA 3ZN0A 1N33O 1MZFA 4ZOLA 3F5WC 2Q6AA 3P3NA 4Z1VA 5JJJB 4DV5B 4PDMA 5CA1B 1BT8A 3GWKC 4U3JB 4DR7B 5H9CA 1HWYA 1AROP 3UO2A 2CTWA 2JGUA 2ZDIC 1RM1B 2EIKC 5IY5B 5AG2A 4JI5O 1PNMA 2VS0A 3L75H 1L1FA 4J42A 3RVYA 3AK3A 3RYHB 4PJ0Z 5L3EA 1KKDA 1BS3A 3SYOA 4EKWA 4K3AA 3OW2U 2ZD9A 4HNAA 1H2GA 2E76B 3STLC 2PI4A 2QM7A 2EULA 1V9PA 1IBKB 2CGOA 3DC6A 1L0NH 1RFYA 3JARA 4N23A 1LR1A 4FIPC 1S76D 4DR7O 2HKOA 5J2TA 4DV6B 3AG7A 1WJZA 2R72A 3AG3C 3E22A 5C8YA 1KUQA 1SQXH 2A79B 4LWSA 1FXHA 4DR5O 4KHPB 1K4CC 3U0ZA 3K0GA 2F1MA 3OD4A 2ZXWC 4R7CA 4JV5O 1I94B 2DWEC 2WLIB 2AGAA 3J81N 2ODMA 1AP6A 2DJVA 2YIBD 3B40A 3QTCA 4L87A 2A7WA 4CH3A 2ZIMA 4UCSA 1IBKO 5KHHA 3RYCA 3SYQA 2EINB 5KA6A 4JI0B 3JAWB 4PA4A 5KAFZ 1Y76A 4I55A 3LDEA 2Q7GA 4I0XB 1UJWB 2EJRA 1PNKA 5J2UA 1KMIZ 2YXHA 4O4IA 3CC7V 4D7TA 2M6YA 1KC8W 4KHPO 2X6AA 3VQYA 2B9ZA 1DF4A 4LFBB 2Q69A 3CRRA 1IURA 1OCOC 2P90A 4UFZA 1I94O 2HFEC 2UXCB 4X1IB 5H2FZ 2ZKOA 4X66O 2LQTA 2VWKA 3TXSA 4J7JA 4H37A 1BQ0A 1HNZO 1YITV 2QKCA 1JFFA 1KYOF 2L6LA 4PA6A 2OTJV 4JI8B 2O57A 4X1YB 2BSKB 4LF6B 4NYKA 3ZS8C 1BHAA 2YC0A 5H6RA 1FS0G 4LFAB 1JMKC 5LOVB 1CP9A 2MK3A 3ZRVA 2N05A 3GVMA 2XAJA 3G6BA 3HKCB 2UXCO 3WG7C 3P32A 5CA3A 2IW5A 2F4VB 5LA6A 5ITZA 1IX9A 1IBLO 2CTQA 2IU0A 1S5HC 5JCOC 3SPGA 1V55C 1P7GA 1TA8A 1XNRB 1K92A 3CCLV 4FLYA 4ZHQB 3ETEA 4JI8O 4I9QA 4UXNA 2Z5UA 3K5MA 1SS3A 4R6ZA 4FJCC 4LFAO 4TOIA 4DO2A 4DR1O 1FXKB 1QVGU 1UPGA 1E79G 3WB0A 5LMNB 5FL7G 4MVRA 4JAVA 1K97A 1SERA 4JI2B 4K0KB 1B3QA 5CA0B 2QKSA 2F4VO 3RYFA 1LNQA 1HNWB 4O2BB 3IC9A 3JAMN 4WFBV 3UM7A 5B1OA 4B08A 5GTHZ 2DWDC 4NTXA 4DR6B 5KLVH 1SETA 2H94A 2Z0AA 2B1IA 3ABKC 1XNRO 1URFA 4UB6Z 2EIKB 2X0LA 1XL4A 2P5OA 1BHBA 2CTPA 4TSFG 1VARA 2QSAA 2GDSA 1MOFA 4R50A 5IWAB 4FLWA 3AG4C 4DV2O 4AHCA 1SQPH 3CSXA 5KUMA 1SQFA 2Y69C 1XL6A 3BABA 4HAMA 4X20A 2FKXA 1OCZC 3WB2A 2QR4A 3R66A 5CBFA 3JASB 1DLBA 2M7WA 4K0KO 3K0DA 1PL4A 3ZMTA 3JD3A 3B8MA 4TUYA 1HNWO 2XAGA 5LGNA 3ZMZA 4DYLA 4P2ZA 4FLVA 5H5NA 4DR6O 1NH2D 3F7VC 1WA8A 1R3KC 2MW2B 1AI4A 4H44B 5LP6A 2UXDB 3B77A 2CTRA 2UUBB 1FXVA 3DXRA 5IWAO 1XBLA 3K9AA 1YTFD 3QG5A 4NR1A 2WLLA 1GRJA 1U97A 4FLXA 1GH6A 3QO8A 3RW0A 3OMAB 4JF3A 1IXMA 4JI3B 2CK3G 4I50A 3ZHUA 2OTLV 4A5UB 5KHGA 2EZPA 1PM9A 3EFFK 2UUCB 3OR7C 1B04A 4JYBA 5JQGA 1SZTA 3ABUA 1BZKA 5IJ0A 4BR6A 1PL0A 1H8EG 2UXDO 2YICA 4YJ2A 2UUBO 4UB8Z 2JEUA 2JJ2G 2QWNB 5EZYB 1MZEA 2HVKC 4IL6Z 1S0VA 1PV0A 1OCRB 3FB7C 1OCOB 3Q4HB 3HPLC 1RM1C 5IY5C 3G4SV 3NXSA 3LDCA 3E35A 4JI3O 1R1BA 4YJ3B 2OIGA 1NTMH 1VQ8V 3K5LA 3J80N 2V7QG 2UUCO 3W7TA 2GV9A 3K79A 1Y74A 1NVPB 3SGIA 2XNDG 1FKAO 1YJ9V 1EFRG 3H1LH 1AR5A 4EFBA 1S77D 5HFMA 3TJTA 4GKJO 1TVKA 2E74B 2RJZA 1OHHG 3SJQC 1MSDA 2PF4E 3UCSC 3L73H 4H0LB 1W2BU 4MTOA 3NR7A 4QPKA 5KX5B 2V4DA 1WN7A 1AI5A 2RMKB 1VQPV 2WWWA 5JVDB 3WG7B 2XHBA 3H1KH 3FFQA 3TK1A 1M9NA 3RFRA 1VF7A 3SR2C 4LH7A 1S3JA 3SPIA 2NNUA 1YEWA 2UUAB 1TUEB 1V55B 4DR3B 5KMGB 4YIPA 4MVUA 1M1KW 2UXNA 4GX5A 1DTOA 1D2DA 1WB7A 5L3CA 2CE4A 4UCRA 1KD1W 1COWG 1IBMB 3J7AU 1VF5B 1BQZA 3B4SA 4LF5B 3BFRA 2EINC 4IYHA 1SA0B 3OM3B 2LGWA 1ZTEA 4LNUA 2YS8A 3SYPA 1SC5B 1HR0B 1FFXA 1DGSA 1NKDA 3ICXA 4RQEA 4K8XA 3CJHB 4UV9A 2XAQA 3F7YC 3KZIZ 2GHYA 2UUAO 1CEZA 2DYSB 3T1YB 2GTAA 1JVMA 2BE3A 4IHJA 4KP4A 3OTFA 2AHZA 5GONA 5A9GA 1YTFB 2WLJA 1JCHA 5FNVB 4G2KA 5BXZA 4CZZA 1PD3A 3I5DA 4X9QA 4WF9V 1F4MA 2EIJB 1WB8A 4H13B 1X4TA 4CC5A 1K5SA 5B66Z 1ZLZA 2Y69B 4MW3A 4NTYA 4X62B 2OCHA 1OCZB 1QU7A 2KG7B 4WBNB 4P9OA 4AI8A 3OUFA 5JJNB 1HR0O 2Q0OC 3SYCA 2F93B 4JASA 1P7BA 1K8AW 3L72H 2ZM6B 4JI4B 3GWOA 1VQNV 4CH6A 4BIOA 3A0BZ 3T1YO 1H2LA 4PDLA 1OV9A 5B5EZ 1XILA 3RVZA 4O4HB 2KSDA 1WPXA 3HB3B 1Y6XA 3CCVV 1T5EA 3HKEA 3CD6V 3K5OA 3DGEA 3W7UA 3THOA 3L70H 4K35A 4X1KA 3M8AA 3IAYA 4X62O 2IH1C 4D6TH 3RWRD 2QGNA 4JI5B 2AXTZ 1WP7A 2P22C 2WLMA 3G67A 1YJNV 2E5LB 1CXZB 1QBZA 1N4CA 1NQTA 2ZM6O 2Q0AA 4YXWG 4JI4O 1VQ7V 1IDSA 4FFBB 1VQMV 1AI6A 1HNXB 1FXKC 5D5PA 1VF6C 2ZR2A 2VQFO 4KXRA 4PA3A 1VQOV 5HFLA 4X64B 3FAVB 4BW9A 1XEQA 4DXWA 1XREA 1R6KA 1OZ0A 2N74A 4ZHQA 1XQ8A 4J11A 5IJ9A 4TV8B 2IU3A 4LP8A 1OCCB 1ZL8B 3ZCCA 1MG1A 4O4LB 4P30A 2V1DA 2E5LO 1F23A 4PA9A 3ZEDA 4CS3A 5IYZA 3A0RA 3U11A 1XI1A 1KECA 4DR5B 1HNXO 4X8AA 3JYCA 3FD9A 5B1NA 4IIJA 1QCEA 4JV5B 3STZC 2PZSA 4WFAV 2A3QA 4X64O 5EYPA 3DSQA 5JWPA 1NR7A 1YZBA 3EVKA 1JJOA 2ZDIA 4HBNA 3ZRWB 5JH7B 2A06H 1W59A 3D8CA 1PP9H 1IVSA 4MS2A 2FL4A 3E83A 1O9GA 2JIZG 2GUZB 4MSWC 1XNQB 1MNGA 2QWQB 3JATB 2P67A 4U7NA 1R73A 2YIBA 2Y4UA 4PD4F 3RBZA 1AILA 3N27A 2NLJC 3ZRXA 4EFEA 5LYJA 4PI0A 1P4RA 3JCUZ 4ZI7A 1IXBA 2YEVB 2VQEB 3AG2B 3N2GA 4LFCO 4UCVA 2W6JG 4NXNO 2WPDG 1PPJH 4BIZA 4MTFA 3CCMV 2ZIOA 5LXTA 4X66B 3RN4A 5DEDA 4J9YB 3A0HZ 4LCUC 3BEHA 2UXBB 1HNZB 2QM4A 1P84F 1FPOA 1ORQC 5H6QA 1I5YA 3ASOB 3L74H 4C7UA 1XNQO 1JJ2U 1DK1A 3OAAG 3H1HH 1AVMA 2JGDA 2HVJC 1W0KG 4B7KA 3G80A 1ZAUA 1V54C 4E2LA 1OCRC 2PTMA 4I4TB 1M5IA 4ICGA 4J80A 1KQSU 2VQEO 1HDJA 2ZE8A 3FX7A 5LGTA 3RYIA 1YSCA 1SQQH 1VQ5V 3EHBB 4O2AA 3OR6C 2CUGA 4DR2B 1IBLB 2HG5C 2A9HA 4K8ZA 4NB5A 2UXBO 4F6RA 5IDJA 1SQVH 5DM6V 3B8NA 1YHQV 4XBFA 4RQFA 2Y0IA 1H2MA 1XMQB 1XHXA 5CBGA 5BMVB 3IJ4A 3LDDA 3CHXA 2QE7G 4GUNA 4DR1B 3JALB 3ZHQA 1GO3F 3SPJA 2WLKA 1Y66A 3P30A 2CGNA 3CS5A 1F51A 1AR4A 4OXSA 3H1JH 5IYBO 1XMOB 4DR2O 4DV7B 4DRXB 3JAKA 2JJ1G 2BTQB 4X89A 3N2KA 1XMQO 4TV9B 2K1EA 2ZE7A 5FPOA 5TISZ 4B3SO 1MSWD 5BR8B 1NVPD 1Z5VA 1N32B 4DV2B 4IYIA 3FB8C 3WU2Z 3EXAA 1VQLV 5EK0A 4ZOLB 4EB6A 3KCYA 1RSOA 4UCTA 1YCIA 4W4LA 4EEQA 1VQKV 5JCOA 1E1RG 1ZUQA 4TWKA 1WP8A 3O9OA 1XMOO 4JZ2A 1Q6IA 4HYOA 2WAMA 4DV7O 3ZX6A 4NTWA 2DYSC 3ZJZA 3E8GA 1Q43A 3BCCH 3OGCC 3JD1A 1KP3A 4NVPA 1I0HA 1M4UA 5BR8O 4DUYB 2CH7A 2EIJC 3OFNG 1Q7YW 1YVWA 4HNAB 3SJAC 3HKDB 1N32O 5LHGA 4JTCB 2F43G 4UUJC 1YXBA 2HLDG 3JARB 5J9PC 4RUFA 5J2TB 4MVQA 5KHIA 5B1BB 3OEEG 2P6JA 3E22B 5C8YB 3VQVA 1B06A 1Q6HA 1THZA 4LWSB 5L3DA 2QWPB 4LR3A 2E75B 4DV4B 2QA4V 4KUMA 3CCEV 3UT5A 3D3IA 1KB9F 1F4NA 4FPPA 3ZHVA 2P4VA 3GB7C 4DUYO 4TQDA 3CX5F 4JAAA 4GX2A 1TUBA 5A2QN 1AB3A 4UVAA 3G71V 5L3GA 3OMIB 2Q68A 3D36A 3K59A 3RYCB 4JTDB 1ZX3A 1BL8A 5F2VO 3FB6C 1D5NA 1EN4A 2Q7HA 4IGGA 1Y76B 4I55B 4O4HA 3CXCU 2D3OW 5J2UB 2XAFA 3FYIB 5BY1A 4O4IB 4DUZB 4DV4O 3CEIA 3QO7A 4GKJB 5DN6G 2DW4A 2X6CA 3AK1A 3OMNB 1XUQA 1EZVH 3CC2V 1Q8IA 4TQFA 4G27B 4JGSA 2XTAA 1N36B 3QO5A 1M90W 1AI7A 3HKBA 3OE7G 1V54B 2OYQA 5EC1C 4JZGA 4PELA 2R70A 4JAUA 1K3EA 1OCCC 3JCZA 4O4JA 3APQA 1R6NA 2EZOA 3SPCA 4GLXA 2JS3A 4GKKB 1JFFB 3BY6A 2PYLA 1HP8A 1AJPA 2JRIA 3VQWA 2VRZA 2QTOA 3HR0A 2XASA 1OJHA 1R6TA 1VMGA 4DUZO 3MD0A 2HHHB 3LNNA 2HJFC 5KHJA 2IJJA 4FVMA 5CA1A 4U3JA 1GK9A 2D2CB 2AW9A 1N36O 5LA6B 2XT9A 1Q90D 3JSNA 4DV0B 1M57B 5ITZB 3RYHA 5IE9A 1O9HA 1SQGA 3ASNB 4JI7B 1TGOA 1VP7A 1VIBA 4GKKO 1KBHA 4B3TB 2PI5A 4QPJA 3CB2A 2RQ6A 3BA8A 3ZMSA 1AJNA 3VQXA 3AG2C 4F6EA 2HHHO 2ITDC 3K9SA 4JTAB 4Q6GA 2IJHA 1K5QA 2IM9A 2QKAA 1Q82W 1P49A 1WLEA 3RYFB 1US6A 1XHZA 4DV0O 4AQYB 3ML0A 2DE0X 3KCXA 1ENVA 4FMTA 3ASOC 3KKYA 4JI7O 3ZHTA 3LNMB 3BPZA 3WFVA 4Z2WA 2ZE5A 1K9MW 4HZ3A 2EIMC 4QE7A 4B3TO 2XAHA 2E3CA 2WLIA 3H01A 4OGQB 1S5LZ 1R3IC 3T1CA 5L3BA 4WCEV 1L8DA 3ABMB 1DF5A 2YXYA 2G38A 3CCRV 1H8HG 2RDCA 4ZKIA 1NT2B 4MW8A 1QVFU 3CWBH 4X20B 2VWJA 2JS5A 2ZE6A 3JAWA 3JD2A 1M93A 1SF9A 2B1GA 4TUYB 4I0XA 4AQYO 3ZBHA 3MDSA 2CDYA 1FYJA 5LMUO 5KHKA 2WA4A 4WFGA 1WA8B 1QQCA 3H9VA 3SPHA 3LSUA 3D3QA 2OIEA 4LC1A 4ZBMA 3AK2A 3SJCC 5LP6B 4MVSA 3TGUH 3F5TA 2W6IG 3FYEB 3DXRB 4X1IA 3ZIAG 2VQFB 1S72V 2XOKG 2WLLB 3CRQA 3QF7A 3CRMA 1BSMA 4BW5A 3CYOA 3ZHSA 5EC2C 3P3PA 2ITCC 5IT9N 4I9WA 1H2SB 4X1YA 2BSKA 4FM1A 4I50B 3JD0A 2C2AA 3AEIA 5EBMC 3SJBC 1GN4A 3TETA 5LOVA 2AZ0A 5JQGB 3ETDA 1F7YA 2PYJA 1NS1A 1J5EO 2QJ1A 2YIDA 2F23A 4BWAA 5IJ0B 4FLTA 1Z5WA 3HKCA 4YJ2B 1VQ6V 2BTOA 2YI8A 3RGBA 2PGGA 3LSSA 3QNEA 4XDLA 4CC6A 2QTSA 1N34B 4JYYA 2ZNJA 1G1XB 4MT8A 3C3SA 1N0JA
chains in the Genus database with same CATH topology
2XAGA 5LGNA 2HG5C 4WFEA 3ZMZA 2A9HA 5B1AB 4P2ZA 3IC7A 1NH2D 3F7VC 5IDJA 3K03A 5DM6V 1JOYA 3B8NA 1YHQV 1R3KC 4XBFA 2UXXA 1AI4A 2WLHA 4RQFA 3I56V 2JEXA 5EBWC 3B77A 5CBGA 1VQ9V 1FXKA 1FXVA 3LDDA 3PJSK 2QE7G 3K9AA 5IYCO 1YTFD 2YEVA 2GSMB 4MVZA 5EBLC 2WLLA 3G6EV 5B3SC 2JDIG 1GO3F 3SPJA 3ZN1A 2WLKA 3AG1C 3CMAV 1Y66A 3CCSV 3P30A 1F51A 3QO8A 4XDJA 1QR8A 3RW0A 3OMAB 4JF3A 1IXMA 1NH2B 5CBHA 3FB5C 4OXSA 1BMFG 5B1BC 2CK3G 2R9IA 5IYBO 5GW7A 2W0FC 3R65A 4QNHB 2OTLV 4UVBA 2EZPA 4UVCA 3EFFK 2P7TC 3W7WA 3OR7C 3ABKB 3ABLB 2JJ1G 4JYBA 1R3JC 1SZTA 3X2QC 1W0JG 3ABUA 4X89A 1RPOA 5E1AC 2H8PC 3ZRSA 2K1EA 1PL0A 1H8EG 1QR9A 4WFHA 1MSWD 4F4LA 1NVPD 2JEUA 2DQ3A 2JJ2G 3AG4B 2HVKC 1VQLV 3FB8C 3K06A 5EK0A 5BZBA 2KB1A 1K34A 1S0VA 1OCRB 2A0LA 1AR1B 3FB7C 2Y48A 5LHHA 1OCOB 3HPLC 1RM1C 5IY5C 4MTGA 3G4SV 4GX0A 3NXSA 1VQKV 1SESA 3LDCA 5CN0A 1RPRA 1E1RG 3E35A 4RUEA 3JD4A 1H38A 4TWKA 1NJIW 1QLNA 4HYOA 1VQ8V 4QJFB 2WAMA 2V7QG 1Q81W 3W7TA 2IH3C 2DYSC 3K79A 3OUSA 3ZJZA 1NVPB 4N21A 2XNDG 3OEHG 5LBQA 4GX1A 1YJ9V 1EFRG 3E8GA 2DYRC 3SYAA 1S77D 5HFMA 1M56B 3OGCC 3JD1A 1KP3A 2BOCC 1SRYA 1OHHG 3T2MA 3SJQC 3DTUB 1K33A 2OT5A 1GKFA 1NBMG 3OFNG 2EIJC 1W2BU 4MTOA 1Q7YW 2EIMB 1QLEC 3FKSG 5LHGA 4JTCB 4QPKA 3UKMA 2FTKA 5LGUA 2OCCC 1AI5A 1PKXA 1B6QA 1EZJA 2EILB 1NR1A 2F43G 3E8HA 3VBBA 4UUJC 4MVMA 3AG1B 1VQPV 2HLDG 3E89A 2WWWA 3W7XA 1E1QG 3WG7B 5J9PC 1G8MA 4RUFA 4BIUA 4MVQA 3TK1A 1M9NA 2R9RB 5B1BB 1J95A 3OEEG 1VQ4V 1YIJV 1GMGA 4PA7A 1N8RW 1S3JA 2LFRA 4GT1A 3SPIA 1Y4MA 2NNUA 4H33A 2P6JA 1TUEB 1V55B 4MVOA 1AJQA 5KUKA 3CMEV 1THZA 5L3DA 1YI2V 4MVUA 3X2QB 1M1KW 2QA4V 4KUMA 3CCEV 2ATKC 3D3IA 2UXNA 4GX5A 1DTOA 1F4NA 3ZN0A 4FPPA 3GB7C 5L3CA 4LBEC 3F5WC 3ETGA 2Q6AA 1KD1W 1COWG 2DQ0A 3CP1A 3T4DA 4GX2A 4PDMA 2IJKA 5H9CA 1HWYA 2EINC 1AROP 4UVAA 3G71V 5L3GA 3OMIB 1M57C 2Q68A 2ZDIC 4G28B 3D36A 3CCUV 2EIKC 2YSUB 5IY5B 1RM1B 3OM3B 1PNMA 1L1FA 2QEXV 4JTDB 3LUTB 3RVYA 3ASNC 1BL8A 3E8BA 3SYPA 3FB6C 1NKDA 4RQEA 3K04A 3MHSC 4Z1MG 4I5SA 5L3EA 1KKDA 4UV9A 2B5UA 2XAQA 3F7YC 2GHYA 4JYCA 3SYOA 4EKWA 1CEZA 3CXCU 2DYSB 2D3OW 2XAFA 1JVMA 3FYIB 5LHIA 4KP4A 2AHZA 3QO7A 1JX9A 3OW2U 2ZD9A 1YTFB 2WLJA 1ROPA 5DN6G 5L3FA 2WSSG 1H2GA 1JCHA 2DW4A 4G2KA 2X6CA 2X7RB 4CZZA 3STLC 1PD3A 2PI4A 4KFMA 1EBOA 4WF9V 1F4MA 2QM7A 3OMNB 2EIJB 1QLEB 3CC2V 4G27B 4JGSA 1K5SA 3QO5A 1JQ0A 4N23A 1M90W 1AI7A 4FIPC 3OE7G 1S76D 1V54B 2Y69B 2ZR3A 5EC1C 2HKOA 4MW3A 3I55V 1OCZB 4PELA 3M99B 4JAUA 1JPXA 1K3EA 4R8CA 1OCCC 3JCZA 3MHHC 4P9OA 3AG3C 5IYDO 1G4YB 1R6NA 3OUFA 2EZOA 3SPCA 3SYCA 3BY6A 2A79B 1P7BA 4JASA 1K8AW 1AJPA 4RAIA 3GWOA 1VQNV 1FXHA 1MABG 3E86A 1K4CC 4FK5C 2QTOA 3K0GA 3CCJV 2ZXWC 3ABMC 2XASA 4PDLA 4R7CA 3ZMVA 3MD0A 2DWEC 2WLIB 3RVZA 3K3WA 3K08A 2HJFC 2IJJA 1WPXA 3HB3B 1GK9A 3CCVV 4L87A 3CD6V 3DGEA 3W7UA 3SYQA 4PDVA 5B3SB 2EINB 1M57B 5KA6A 2IH1C 4PA4A 4J9ZB 2EBOA 3ASNB 3LDEA 2WLMA 1YJNV 1UJWB 2EJRA 1PNKA 1QBZA 2X6BA 1NQTA 4YXWG 1VQ7V 3LSQA 3CC7V 2PI5A 4QPJA 1KC8W 2X6AA 1VQMV 1AI6A 1FXKC 3ZMUA 1DF4A 2Q69A 2ZR2A 4PA3A 5CMUA 3ZMSA 1OCOC 2P90A 1VQOV 1AJNA 3AG2C 5HFLA 2HFEC 4BAYA 4JPRA 2ITDC 4JTAB 1R3LC 2IJHA 4PDRA 1K5QA 2JK5C 2HR3A 5KA5A 1Q82W 4DXWA 1R6KA 1OZ0A 1WLEA 1K7DA 3E8FA 4H37A 3KG2A 3E2EA 2IU3A 3ML0A 4LP8A 1YITV 4PA6A 1OCCB 2OTJV 1ENVA 1M56C 3AG3B 3ZCCA 1MG1A 4FMTA 3ASOC 4P30A 3LNMB 2V1DA 1BHAA 1F23A 4PA9A 3WFVA 5H6RA 1FS0G 1K9MW 4HZ3A 3A0RA 3TCUA 2EIMC 2Z3YA 1CP9A 1K73W 1KECA 4Q20A 4QE7A 2XAHA 2WLIA 2MK3A 3H01A 4UV8A 4X8AA 3JYCA 3ZRVA 1R3IC 3T1CA 5L3BA 4WCEV 2ZXWB 3ABMB 4XDKA 1DF5A 2EILC 5B1NA 2XAJA 2DYRB 1QCEA 3CCRV 1H8HG 3STZC 4ZKIA 1FFTB 4WFAV 3WG7C 4MW8A 1QVFU 3P32A 5CA3A 2IW5A 1NR7A 2ZDIA 1I5XA 3JD2A 3ZRWB 2IU0A 1S5HC 2B1GA 2OCCB 3SPGA 5B1AC 1V55C 2LP7A 3IFXA 2BOBC 1K92A 3E83A 4MS2A 3CPWU 5C93A 3CCLV 1GTOA 3ETEA 2JIZG 4UXNA 4WFGA 2Z5UA 3SPHA 4MSWC 4P9PA 4MTXA 1Q86W 4R6ZA 2P67A 4LC1A 4U7NA 1R73A 4FJCC 4ZBMA 4WFFA 4DO2A 2LFSA 4MVSA 3RBZA 1FXKB 1QVGU 2NLJC 2W6IG 3FYEB 3ZIAG 1E79G 4GCZA 4CBCA 5FL7G 3ZRXA 4MVRA 1P4RA 1K97A 1K4DC 4JAVA 2YEVB 4TT3G 3AG2B 1S72V 2XOKG 1SERA 3IGAC 1YJWV 2WLLB 2QM8A 4U7OA 2W6JG 3CCQV 2QKSA 2WPDG 4BW5A 4BIZA 4MTFA 3CCMV 3CYOA 1LNQA 4QE9A 4WFBV 4J9YB 5EC2C 2ITCC 5B1OA 3UM7A 4LCUC 3BEHA 4I9WA 2DWDC 1SETA 2H94A 4QIWF 2B1IA 3ABKC 1ORQC 2EIKB 3ABLC 3JD0A 2C2AA 5H6QA 1I5YA 3AEIA 2X0LA 4RO2A 1XL4A 5EBMC 1BHBA 3ASOB 4TSFG 3TETA 1PNLA 1KP2A 2IJIA 4ASUG 1MOFA 3ETDA 1JJ2U 3OAAG 4R50A 3AG4C 2HVJC 1W0KG 5KUMA 1GM9A 1VQ6V 3ABTA 1V54C 2WLNA 2Y69C 1OCRC 1XL6A 4E2LA 4HAMA 1OCZC 1KQSU 1GM7A 1CPYA 1GM8A 3LSSA 3QNEA 5CBFA 4XDLA 1DLBA 2M7WA 3ZRWA 2ZQMA 2Q67A 3K0DA 5LGTA 3W7SA 3CC4V 3T4ZA 1YSCA 3ZMTA 3JD3A 3B8MA 2AHYA 4MT8A 1VQ5V 3EHBB 4X88A 3VOUA 1ZWIC 3OR6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X8A A;  3JYC A;  1R3I C;  4R8C A;  3T1C A;  1OCC C;  2HG5 C;  4WFE A;  4P9O A;  2EIL C;  4XDK A;  3AG3 C;  2A9H A;  1G4Y B;  2EIJ C;  4MTO A;  3OUF A;  4P2Z A;  1QLE C;  3STZ C;  3SPC A;  3F7V C;  3SYC A;  3K03 A;  4JTC B;  3UKM A;  2A79 B;  1P7B A;  3WG7 C;  4MW8 A;  1R3K C;  2OCC C;  4RAI A;  2WLH A;  3E8H A;  4UUJ C;  3E86 A;  4MVM A;  5EBW C;  1K4C C;  2QTO A;  3E89 A;  5CBG A;  3K0G A;  2ZXW C;  3ABM C;  5J9P C;  1S5H C;  3LDD A;  4PDL A;  4R7C A;  4RUF A;  3SPG A;  4MVQ A;  1V55 C;  5B1A C;  3PJS K;  2R9R B;  1J95 A;  2DWE C;  2WLI B;  3IFX A;  3RVZ A;  4PA7 A;  2BOB C;  2YEV A;  4MS2 A;  3E83 A;  3K08 A;  2HJF C;  4MVZ A;  5EBL C;  2WLL A;  3SJQ C;  5B3S C;  3SPI A;  4H33 A;  3SPJ A;  4WFG A;  2WLK A;  3AG1 C;  4MVO A;  5KUK A;  3SPH A;  4MSW C;  4P9P A;  4XDJ A;  4MVU A;  4R6Z A;  3SYQ A;  4PDV A;  3RW0 A;  4ZBM A;  4WFF A;  5CBH A;  3FB5 C;  2ATK C;  4OXS A;  5B1B C;  4GX5 A;  4MVS A;  2IH1 C;  4PA4 A;  3RBZ A;  2W0F C;  3R65 A;  4QNH B;  3GB7 C;  4J9Z B;  2NLJ C;  4LBE C;  3F5W C;  3EFF K;  3LDE A;  4CBC A;  2Q6A A;  2WLM A;  4MVR A;  2P7T C;  1K4D C;  3OR7 C;  3T4D A;  3IGA C;  2WLL B;  4GX2 A;  4PDM A;  2X6B A;  1R3J C;  2EIN C;  3X2Q C;  2QKS A;  4X89 A;  5E1A C;  4BW5 A;  2H8P C;  4MTF A;  1M57 C;  1LNQ A;  2Q68 A;  4G28 B;  2X6A A;  2EIK C;  2K1E A;  4QE9 A;  4WFH A;  3ZRS A;  4J9Y B;  5EC2 C;  4F4L A;  2ITC C;  3UM7 A;  4LCU C;  4JTD B;  2Q69 A;  3LUT B;  3BEH A;  3ASN C;  1BL8 A;  4I9W A;  3E8B A;  4PA3 A;  3RVY A;  1OCO C;  2DWD C;  2HVK C;  3FB6 C;  3FB8 C;  3SYP A;  3AG2 C;  3K06 A;  5EK0 A;  2HFE C;  5BZB A;  2KB1 A;  3ABK C;  1ORQ C;  3ABL C;  3K04 A;  2ITD C;  4JTA B;  1R3L C;  4RO2 A;  1XL4 A;  2A0L A;  5EBM C;  1KKD A;  3FB7 C;  3F7Y C;  4PDR A;  3SYO A;  4EKW A;  3TET A;  2JK5 C;  3HPL C;  5IY5 C;  4MTG A;  4GX0 A;  1JVM A;  4DXW A;  4R50 A;  3E8F A;  3LDC A;  4H37 A;  2AHZ A;  3AG4 C;  4RUE A;  2ZD9 A;  3KG2 A;  2WLJ A;  4TWK A;  2HVJ C;  4LP8 A;  5KUM A;  2X6C A;  3STL C;  4PA6 A;  4HYO A;  4KFM A;  1V54 C;  2WLN A;  2Y69 C;  1M56 C;  1OCR C;  1XL6 A;  3ASO C;  1OCZ C;  4P30 A;  3LNM B;  2IH3 C;  2DYS C;  4G27 B;  5CBF A;  4XDL A;  3OUS A;  3ZJZ A;  4PA9 A;  2Q67 A;  3K0D A;  4GX1 A;  4HZ3 A;  3E8G A;  2DYR C;  3SYA A;  3T4Z A;  2EIM C;  3TCU A;  3OGC C;  5EC1 C;  4MW3 A;  2AHY A;  4QE7 A;  2BOC C;  4X88 A;  3VOU A;  2WLI A;  3T2M A;  1ZWI C;  3OR6 C; 
#chains in the Genus database with same CATH topology
 1MA1 A;  5JJE B;  4LF8 O;  5B1A B;  4DK0 A;  3IC7 A;  3S3X A;  5DEC A;  5K1P A;  3I56 V;  4D7S A;  2NN4 A;  5EBW C;  2ZNI A;  1Y74 B;  1VQ9 V;  1FXK A;  1U96 A;  1TVK B;  1VF6 A;  3PJS K;  1KKC A;  5IYC O;  1MMM A;  4LF9 B;  5FPR A;  5B3S C;  1QNM A;  5CA0 A;  1KU9 A;  1H2N A;  2Y0P A;  3CCS V;  4LFC B;  4O2B A;  4YHH B;  4XDJ A;  1JA8 A;  3BAA A;  2YDE A;  1QR8 A;  4NXN B;  1N34 O;  5CBH A;  5B1B C;  3OT7 A;  2RCV A;  1FD9 A;  5GW7 A;  4QNH B;  3BVO A;  4UVC A;  4NXM O;  3W7W A;  4JI6 B;  1EM1 A;  3ABL B;  4JYA B;  2YUA A;  1R3J C;  1RPO A;  5E1A C;  2H8P C;  3HKD A;  3SDL A;  3ZRS A;  4WFH A;  4F4L A;  1Y67 A;  2P4K A;  2DQ3 A;  3K06 A;  4DV5 O;  4LF9 O;  3JAS A;  2A0L A;  1AR1 B;  4YY3 B;  4ZIB A;  2Y48 A;  5LHH A;  4YHH O;  2UU9 B;  1RPR A;  4RUE A;  1H38 A;  1AP5 A;  2LW1 A;  1NJI W;  1LUV A;  4LNU B;  4QJF B;  1FFX B;  1Q81 W;  2IH3 C;  3RT3 C;  4JI6 O;  3OUS A;  3OEH G;  5LBQ A;  4JYA O;  2DYR C;  3ZHR A;  1VEW A;  5GTI Z;  2BOC C;  1D5A A;  1SZX A;  4DW1 A;  3DTU B;  1K33 A;  2OT5 A;  4IHJ B;  1GKF A;  3K58 A;  5GON B;  4J10 A;  2DOS A;  2EIM B;  2F95 B;  2Y4T A;  3CRC A;  3FKS G;  2KQX A;  3S3W A;  2FTK A;  2OCC C;  4YY3 O;  3E8H A;  3VBB A;  4DV6 O;  4MVM A;  3AG1 B;  4B7E A;  4PV1 B;  4U3F H;  3W7X A;  1G8M A;  1N0N A;  2UU9 O;  2R9R B;  1QHT A;  3OGI B;  1YIJ V;  1GMG A;  1N8R W;  4X65 B;  2LFR A;  4GT1 A;  2F66 C;  1GN2 A;  2KKW A;  4H33 A;  4OX9 B;  4MVO A;  1AJQ A;  3CME V;  2R9A A;  3X2Q B;  2EX3 A;  2ETN A;  2ATK C;  5EZY A;  4B3S B;  4LBE C;  3ETG A;  1NU1 H;  2CAZ C;  2DQ0 A;  3CP1 A;  3T4D A;  3Q4H A;  2IJK A;  3C90 A;  3HKE B;  2QDO A;  1M57 C;  4JI0 O;  4G28 B;  4YJ3 A;  3CCU V;  2YSU B;  4L8J A;  1NTZ H;  2QEX V;  3T1H B;  4X1K B;  5CB4 B;  2RNB A;  3LUT B;  3ASN C;  3E8B A;  4X65 O;  3K04 A;  3MHS C;  1GAX A;  4Z1M G;  4I5S A;  2B5U A;  4OX9 O;  4JYC A;  2N04 A;  1Q6U A;  2HEP A;  1S5J A;  3BRC A;  1XDC A;  5LHI A;  4LFB O;  1BCC H;  1JX9 A;  1ROP A;  5L3F A;  2WSS G;  1WPB A;  2X7R B;  4KFM A;  1EBO A;  5KX5 A;  1NZ6 A;  1QLE B;  2FML A;  1JQ0 A;  5JVD A;  3WB1 A;  1Z2G A;  2ZR3 A;  5E79 Z;  2ILM A;  3I55 V;  4FM2 A;  3M99 B;  2Q73 A;  1JPX A;  4R8C A;  3MHH C;  5IJ9 B;  5IYD O;  1G4Y B;  1WNS A;  3T1H O;  4LF6 O;  3K5N A;  3ETQ A;  2XUM A;  5KMG A;  4RAI A;  1MAB G;  3E86 A;  4FK5 C;  3CCJ V;  5IYZ B;  3ABM C;  1RP3 B;  3ZMV A;  4CH5 A;  3K3W A;  3K08 A;  4DV1 B;  5KAI Z;  4NKG B;  4IIJ B;  5FLX N;  2WA3 A;  4J41 A;  3MAQ A;  2GBO A;  1SA0 A;  1A32 A;  5EYP B;  4PDV A;  5B3S B;  1HW7 A;  3DC5 A;  1EN5 A;  4CH4 A;  2ZCE A;  4J9Z B;  4DW0 A;  1L0L H;  4FLZ A;  2EBO A;  3CJH A;  2ZT9 B;  4B3M B;  2Q8V A;  3U10 A;  2X6B A;  3LSQ A;  1X59 A;  5LP6 C;  2PUS A;  1SKV A;  4OPH A;  2HJD A;  5FNV A;  3ZMU A;  4YIO A;  5LMN O;  5CMU A;  4JI2 O;  3CXH F;  4BAY A;  4JPR A;  4DV1 O;  1R3L C;  5LYJ B;  4ZI7 B;  3D36 C;  2LW7 A;  3N2G B;  4PDR A;  3O65 A;  2JK5 C;  3C3T A;  1G6U A;  2HR3 A;  5KA5 A;  1BGY H;  2KG7 A;  1K7D A;  2EJ7 A;  3E8F A;  4WBN A;  3B09 A;  5LXT B;  3KG2 A;  3E2E A;  4FZ0 A;  1GN6 A;  2FB5 A;  2DMX A;  3L71 H;  4PI2 A;  1M56 C;  3AG3 B;  4JI1 B;  1YF2 A;  3A2F A;  4B3M O;  1TAE A;  2LJ2 A;  3TCU A;  2Z3Y A;  3K57 A;  1K73 W;  4Q20 A;  2QWR B;  4UV8 A;  2ZXW B;  4XDK A;  2EIL C;  2DYR B;  2JGD B;  1FFT B;  1XOU A;  3TXQ A;  2K9P A;  4DV3 B;  3JSL A;  4J7Z A;  1I5X A;  3RYI B;  2OCC B;  5B1A C;  4O2A B;  2LP7 A;  3IFX A;  1Q3E A;  2BOB C;  2LO1 A;  4DK1 A;  3CPW U;  5C93 A;  1ZSP A;  1GTO A;  3UQ8 A;  4F6R B;  4JI1 O;  4FFB A;  4P9P A;  4MTX A;  1Q86 W;  4WFF A;  3CE2 A;  4RWU A;  2IBZ H;  4GZR B;  2LFS A;  3A8T A;  4PHZ A;  1FJG B;  4FFK A;  2ADQ B;  2Q5Z A;  3FAV A;  4GCZ A;  4CBC A;  3OTO B;  1K4D C;  2JVD A;  4TT3 G;  3IGA C;  1YJW V;  2QM8 A;  4U7O A;  4DV3 O;  3CCQ V;  2YI9 A;  2AZ2 A;  3BHP A;  4TV8 A;  2FYU H;  4QE9 A;  4I7Z B;  1NTK H;  2OWO A;  1Q5O A;  1ZL8 A;  4O4L A;  4QIW F;  1LUW A;  4ABM A;  3ABL C;  4AIL C;  1GN3 A;  4RO2 A;  1IZ3 A;  1PNL A;  4LF4 B;  1KP2 A;  2IJI A;  3JAK B;  4ASU G;  1WAZ A;  2YXL A;  3N2K B;  1I7F A;  2LGQ A;  1FJG O;  1GM9 A;  3ABT A;  3UO3 A;  2WLN A;  4CS4 A;  3OTO O;  4UCU A;  1GM7 A;  1CPY A;  1GM8 A;  4EB6 B;  1NI8 A;  3ZRW A;  2ZQM A;  2Q67 A;  3W7S A;  5JH7 A;  1RSO B;  3CC4 V;  1FAF A;  3T4Z A;  1BE3 H;  2AHY A;  4X88 A;  3VOU A;  1ZWI C;  4FM0 A;  2NR5 A;  3CRA A;  4WFE A;  3H1I H;  2GUZ A;  3K03 A;  4QGP A;  1JOY A;  3JAT A;  4FZ1 A;  2UXX A;  2WLH A;  5LMU B;  2JEX A;  4LF4 O;  2QWO B;  1H2K A;  2Q9L A;  5K1X A;  2Q4P A;  2YEV A;  2GSM B;  3B2E E;  4MVZ A;  5EBL C;  1EN6 A;  3G6E V;  2CH7 B;  2JDI G;  5LL6 Y;  5D5Q A;  3ZN1 A;  3AG1 C;  3CMA V;  3APO A;  4GYC B;  1NH2 B;  3FB5 C;  1BMF G;  2H3O A;  2R9I A;  2W0F C;  3R65 A;  4UVB A;  3M7M X;  1JR9 A;  2P7T C;  4DR3 O;  3ABK B;  4W4K A;  2YIA A;  3L9D A;  1W0J G;  3X2Q C;  1I08 A;  1SQB H;  1QR9 A;  4LF7 B;  3UT5 B;  1J5E B;  3AG4 B;  1IBM O;  4I4T A;  4E4E A;  4J7K A;  5BZB A;  2KB1 A;  1K34 A;  4LF5 O;  3QVN A;  2RN9 A;  1UFI A;  4DR4 B;  1TUB B;  4MTG A;  4GX0 A;  1SES A;  5CN0 A;  2W0X A;  3PN1 A;  3JD4 A;  4LH6 A;  5EIB C;  1QLN A;  4LF8 B;  4B3R B;  2L35 A;  4N21 A;  5BMV A;  4GX1 A;  3SYA A;  1M56 B;  1SRY A;  1N33 B;  3T2M A;  4LF7 O;  4IT5 A;  3JAL A;  1NBM G;  2ZIN A;  4CS2 A;  1QLE C;  2ARH A;  3UKM A;  5LGU A;  5CB4 A;  1PKX A;  1B6Q A;  1EZJ A;  2EIL B;  1NR1 A;  2PY5 A;  3E89 A;  4DR4 O;  1E1Q G;  3HKB B;  3BA9 A;  2HP8 A;  4BIU A;  2DN9 A;  2GTS A;  1J95 A;  4DRX A;  1VQ4 V;  4PA7 A;  4FLU A;  4O4J B;  1Y4M A;  2ADP A;  2BTQ A;  2P06 A;  4NXM B;  2Q7E A;  5KUK A;  1YDX A;  5EIB D;  4TV9 A;  4UCO A;  1YI2 V;  4B3R O;  4KL1 A;  2BCC H;  4OPA A;  3ZN0 A;  1N33 O;  1MZF A;  4ZOL A;  3F5W C;  2Q6A A;  3P3N A;  4Z1V A;  5JJJ B;  4DV5 B;  4PDM A;  5CA1 B;  1BT8 A;  3GWK C;  4U3J B;  4DR7 B;  5H9C A;  1HWY A;  1ARO P;  3UO2 A;  2CTW A;  2JGU A;  2ZDI C;  1RM1 B;  2EIK C;  5IY5 B;  5AG2 A;  4JI5 O;  1PNM A;  2VS0 A;  3L75 H;  1L1F A;  4J42 A;  3RVY A;  3AK3 A;  3RYH B;  4PJ0 Z;  5L3E A;  1KKD A;  1BS3 A;  3SYO A;  4EKW A;  4K3A A;  3OW2 U;  2ZD9 A;  4HNA A;  1H2G A;  2E76 B;  3STL C;  2PI4 A;  2QM7 A;  2EUL A;  1V9P A;  1IBK B;  2CGO A;  3DC6 A;  1L0N H;  1RFY A;  3JAR A;  4N23 A;  1LR1 A;  4FIP C;  1S76 D;  4DR7 O;  2HKO A;  5J2T A;  4DV6 B;  3AG7 A;  1WJZ A;  2R72 A;  3AG3 C;  3E22 A;  5C8Y A;  1KUQ A;  1SQX H;  2A79 B;  4LWS A;  1FXH A;  4DR5 O;  4KHP B;  1K4C C;  3U0Z A;  3K0G A;  2F1M A;  3OD4 A;  2ZXW C;  4R7C A;  4JV5 O;  1I94 B;  2DWE C;  2WLI B;  2AGA A;  3J81 N;  2ODM A;  1AP6 A;  2DJV A;  2YIB D;  3B40 A;  3QTC A;  4L87 A;  2A7W A;  4CH3 A;  2ZIM A;  4UCS A;  1IBK O;  5KHH A;  3RYC A;  3SYQ A;  2EIN B;  5KA6 A;  4JI0 B;  3JAW B;  4PA4 A;  5KAF Z;  1Y76 A;  4I55 A;  3LDE A;  2Q7G A;  4I0X B;  1UJW B;  2EJR A;  1PNK A;  5J2U A;  1KMI Z;  2YXH A;  4O4I A;  3CC7 V;  4D7T A;  2M6Y A;  1KC8 W;  4KHP O;  2X6A A;  3VQY A;  2B9Z A;  1DF4 A;  4LFB B;  2Q69 A;  3CRR A;  1IUR A;  1OCO C;  2P90 A;  4UFZ A;  1I94 O;  2HFE C;  2UXC B;  4X1I B;  5H2F Z;  2ZKO A;  4X66 O;  2LQT A;  2VWK A;  3TXS A;  4J7J A;  4H37 A;  1BQ0 A;  1HNZ O;  1YIT V;  2QKC A;  1JFF A;  1KYO F;  2L6L A;  4PA6 A;  2OTJ V;  4JI8 B;  2O57 A;  4X1Y B;  2BSK B;  4LF6 B;  4NYK A;  3ZS8 C;  1BHA A;  2YC0 A;  5H6R A;  1FS0 G;  4LFA B;  1JMK C;  5LOV B;  1CP9 A;  2MK3 A;  3ZRV A;  2N05 A;  3GVM A;  2XAJ A;  3G6B A;  3HKC B;  2UXC O;  3WG7 C;  3P32 A;  5CA3 A;  2IW5 A;  2F4V B;  5LA6 A;  5ITZ A;  1IX9 A;  1IBL O;  2CTQ A;  2IU0 A;  1S5H C;  5JCO C;  3SPG A;  1V55 C;  1P7G A;  1TA8 A;  1XNR B;  1K92 A;  3CCL V;  4FLY A;  4ZHQ B;  3ETE A;  4JI8 O;  4I9Q A;  4UXN A;  2Z5U A;  3K5M A;  1SS3 A;  4R6Z A;  4FJC C;  4LFA O;  4TOI A;  4DO2 A;  4DR1 O;  1FXK B;  1QVG U;  1UPG A;  1E79 G;  3WB0 A;  5LMN B;  5FL7 G;  4MVR A;  4JAV A;  1K97 A;  1SER A;  4JI2 B;  4K0K B;  1B3Q A;  5CA0 B;  2QKS A;  2F4V O;  3RYF A;  1LNQ A;  1HNW B;  4O2B B;  3IC9 A;  3JAM N;  4WFB V;  3UM7 A;  5B1O A;  4B08 A;  5GTH Z;  2DWD C;  4NTX A;  4DR6 B;  5KLV H;  1SET A;  2H94 A;  2Z0A A;  2B1I A;  3ABK C;  1XNR O;  1URF A;  4UB6 Z;  2EIK B;  2X0L A;  1XL4 A;  2P5O A;  1BHB A;  2CTP A;  4TSF G;  1VAR A;  2QSA A;  2GDS A;  1MOF A;  4R50 A;  5IWA B;  4FLW A;  3AG4 C;  4DV2 O;  4AHC A;  1SQP H;  3CSX A;  5KUM A;  1SQF A;  2Y69 C;  1XL6 A;  3BAB A;  4HAM A;  4X20 A;  2FKX A;  1OCZ C;  3WB2 A;  2QR4 A;  3R66 A;  5CBF A;  3JAS B;  1DLB A;  2M7W A;  4K0K O;  3K0D A;  1PL4 A;  3ZMT A;  3JD3 A;  3B8M A;  4TUY A;  1HNW O;  2XAG A;  5LGN A;  3ZMZ A;  4DYL A;  4P2Z A;  4FLV A;  5H5N A;  4DR6 O;  1NH2 D;  3F7V C;  1WA8 A;  1R3K C;  2MW2 B;  1AI4 A;  4H44 B;  5LP6 A;  2UXD B;  3B77 A;  2CTR A;  2UUB B;  1FXV A;  3DXR A;  5IWA O;  1XBL A;  3K9A A;  1YTF D;  3QG5 A;  4NR1 A;  2WLL A;  1GRJ A;  1U97 A;  4FLX A;  1GH6 A;  3QO8 A;  3RW0 A;  3OMA B;  4JF3 A;  1IXM A;  4JI3 B;  2CK3 G;  4I50 A;  3ZHU A;  2OTL V;  4A5U B;  5KHG A;  2EZP A;  1PM9 A;  3EFF K;  2UUC B;  3OR7 C;  1B04 A;  4JYB A;  5JQG A;  1SZT A;  3ABU A;  1BZK A;  5IJ0 A;  4BR6 A;  1PL0 A;  1H8E G;  2UXD O;  2YIC A;  4YJ2 A;  2UUB O;  4UB8 Z;  2JEU A;  2JJ2 G;  2QWN B;  5EZY B;  1MZE A;  2HVK C;  4IL6 Z;  1S0V A;  1PV0 A;  1OCR B;  3FB7 C;  1OCO B;  3Q4H B;  3HPL C;  1RM1 C;  5IY5 C;  3G4S V;  3NXS A;  3LDC A;  3E35 A;  4JI3 O;  1R1B A;  4YJ3 B;  2OIG A;  1NTM H;  1VQ8 V;  3K5L A;  3J80 N;  2V7Q G;  2UUC O;  3W7T A;  2GV9 A;  3K79 A;  1Y74 A;  1NVP B;  3SGI A;  2XND G;  1FKA O;  1YJ9 V;  1EFR G;  3H1L H;  1AR5 A;  4EFB A;  1S77 D;  5HFM A;  3TJT A;  4GKJ O;  1TVK A;  2E74 B;  2RJZ A;  1OHH G;  3SJQ C;  1MSD A;  2PF4 E;  3UCS C;  3L73 H;  4H0L B;  1W2B U;  4MTO A;  3NR7 A;  4QPK A;  5KX5 B;  2V4D A;  1WN7 A;  1AI5 A;  2RMK B;  1VQP V;  2WWW A;  5JVD B;  3WG7 B;  2XHB A;  3H1K H;  3FFQ A;  3TK1 A;  1M9N A;  3RFR A;  1VF7 A;  3SR2 C;  4LH7 A;  1S3J A;  3SPI A;  2NNU A;  1YEW A;  2UUA B;  1TUE B;  1V55 B;  4DR3 B;  5KMG B;  4YIP A;  4MVU A;  1M1K W;  2UXN A;  4GX5 A;  1DTO A;  1D2D A;  1WB7 A;  5L3C A;  2CE4 A;  4UCR A;  1KD1 W;  1COW G;  1IBM B;  3J7A U;  1VF5 B;  1BQZ A;  3B4S A;  4LF5 B;  3BFR A;  2EIN C;  4IYH A;  1SA0 B;  3OM3 B;  2LGW A;  1ZTE A;  4LNU A;  2YS8 A;  3SYP A;  1SC5 B;  1HR0 B;  1FFX A;  1DGS A;  1NKD A;  3ICX A;  4RQE A;  4K8X A;  3CJH B;  4UV9 A;  2XAQ A;  3F7Y C;  3KZI Z;  2GHY A;  2UUA O;  1CEZ A;  2DYS B;  3T1Y B;  2GTA A;  1JVM A;  2BE3 A;  4IHJ A;  4KP4 A;  3OTF A;  2AHZ A;  5GON A;  5A9G A;  1YTF B;  2WLJ A;  1JCH A;  5FNV B;  4G2K A;  5BXZ A;  4CZZ A;  1PD3 A;  3I5D A;  4X9Q A;  4WF9 V;  1F4M A;  2EIJ B;  1WB8 A;  4H13 B;  1X4T A;  4CC5 A;  1K5S A;  5B66 Z;  1ZLZ A;  2Y69 B;  4MW3 A;  4NTY A;  4X62 B;  2OCH A;  1OCZ B;  1QU7 A;  2KG7 B;  4WBN B;  4P9O A;  4AI8 A;  3OUF A;  5JJN B;  1HR0 O;  2Q0O C;  3SYC A;  2F93 B;  4JAS A;  1P7B A;  1K8A W;  3L72 H;  2ZM6 B;  4JI4 B;  3GWO A;  1VQN V;  4CH6 A;  4BIO A;  3A0B Z;  3T1Y O;  1H2L A;  4PDL A;  1OV9 A;  5B5E Z;  1XIL A;  3RVZ A;  4O4H B;  2KSD A;  1WPX A;  3HB3 B;  1Y6X A;  3CCV V;  1T5E A;  3HKE A;  3CD6 V;  3K5O A;  3DGE A;  3W7U A;  3THO A;  3L70 H;  4K35 A;  4X1K A;  3M8A A;  3IAY A;  4X62 O;  2IH1 C;  4D6T H;  3RWR D;  2QGN A;  4JI5 B;  2AXT Z;  1WP7 A;  2P22 C;  2WLM A;  3G67 A;  1YJN V;  2E5L B;  1CXZ B;  1QBZ A;  1N4C A;  1NQT A;  2ZM6 O;  2Q0A A;  4YXW G;  4JI4 O;  1VQ7 V;  1IDS A;  4FFB B;  1VQM V;  1AI6 A;  1HNX B;  1FXK C;  5D5P A;  1VF6 C;  2ZR2 A;  2VQF O;  4KXR A;  4PA3 A;  1VQO V;  5HFL A;  4X64 B;  3FAV B;  4BW9 A;  1XEQ A;  4DXW A;  1XRE A;  1R6K A;  1OZ0 A;  2N74 A;  4ZHQ A;  1XQ8 A;  4J11 A;  5IJ9 A;  4TV8 B;  2IU3 A;  4LP8 A;  1OCC B;  1ZL8 B;  3ZCC A;  1MG1 A;  4O4L B;  4P30 A;  2V1D A;  2E5L O;  1F23 A;  4PA9 A;  3ZED A;  4CS3 A;  5IYZ A;  3A0R A;  3U11 A;  1XI1 A;  1KEC A;  4DR5 B;  1HNX O;  4X8A A;  3JYC A;  3FD9 A;  5B1N A;  4IIJ A;  1QCE A;  4JV5 B;  3STZ C;  2PZS A;  4WFA V;  2A3Q A;  4X64 O;  5EYP A;  3DSQ A;  5JWP A;  1NR7 A;  1YZB A;  3EVK A;  1JJO A;  2ZDI A;  4HBN A;  3ZRW B;  5JH7 B;  2A06 H;  1W59 A;  3D8C A;  1PP9 H;  1IVS A;  4MS2 A;  2FL4 A;  3E83 A;  1O9G A;  2JIZ G;  2GUZ B;  4MSW C;  1XNQ B;  1MNG A;  2QWQ B;  3JAT B;  2P67 A;  4U7N A;  1R73 A;  2YIB A;  2Y4U A;  4PD4 F;  3RBZ A;  1AIL A;  3N27 A;  2NLJ C;  3ZRX A;  4EFE A;  5LYJ A;  4PI0 A;  1P4R A;  3JCU Z;  4ZI7 A;  1IXB A;  2YEV B;  2VQE B;  3AG2 B;  3N2G A;  4LFC O;  4UCV A;  2W6J G;  4NXN O;  2WPD G;  1PPJ H;  4BIZ A;  4MTF A;  3CCM V;  2ZIO A;  5LXT A;  4X66 B;  3RN4 A;  5DED A;  4J9Y B;  3A0H Z;  4LCU C;  3BEH A;  2UXB B;  1HNZ B;  2QM4 A;  1P84 F;  1FPO A;  1ORQ C;  5H6Q A;  1I5Y A;  3ASO B;  3L74 H;  4C7U A;  1XNQ O;  1JJ2 U;  1DK1 A;  3OAA G;  3H1H H;  1AVM A;  2JGD A;  2HVJ C;  1W0K G;  4B7K A;  3G80 A;  1ZAU A;  1V54 C;  4E2L A;  1OCR C;  2PTM A;  4I4T B;  1M5I A;  4ICG A;  4J80 A;  1KQS U;  2VQE O;  1HDJ A;  2ZE8 A;  3FX7 A;  5LGT A;  3RYI A;  1YSC A;  1SQQ H;  1VQ5 V;  3EHB B;  4O2A A;  3OR6 C;  2CUG A;  4DR2 B;  1IBL B;  2HG5 C;  2A9H A;  4K8Z A;  4NB5 A;  2UXB O;  4F6R A;  5IDJ A;  1SQV H;  5DM6 V;  3B8N A;  1YHQ V;  4XBF A;  4RQF A;  2Y0I A;  1H2M A;  1XMQ B;  1XHX A;  5CBG A;  5BMV B;  3IJ4 A;  3LDD A;  3CHX A;  2QE7 G;  4GUN A;  4DR1 B;  3JAL B;  3ZHQ A;  1GO3 F;  3SPJ A;  2WLK A;  1Y66 A;  3P30 A;  2CGN A;  3CS5 A;  1F51 A;  1AR4 A;  4OXS A;  3H1J H;  5IYB O;  1XMO B;  4DR2 O;  4DV7 B;  4DRX B;  3JAK A;  2JJ1 G;  2BTQ B;  4X89 A;  3N2K A;  1XMQ O;  4TV9 B;  2K1E A;  2ZE7 A;  5FPO A;  5TIS Z;  4B3S O;  1MSW D;  5BR8 B;  1NVP D;  1Z5V A;  1N32 B;  4DV2 B;  4IYI A;  3FB8 C;  3WU2 Z;  3EXA A;  1VQL V;  5EK0 A;  4ZOL B;  4EB6 A;  3KCY A;  1RSO A;  4UCT A;  1YCI A;  4W4L A;  4EEQ A;  1VQK V;  5JCO A;  1E1R G;  1ZUQ A;  4TWK A;  1WP8 A;  3O9O A;  1XMO O;  4JZ2 A;  1Q6I A;  4HYO A;  2WAM A;  4DV7 O;  3ZX6 A;  4NTW A;  2DYS C;  3ZJZ A;  3E8G A;  1Q43 A;  3BCC H;  3OGC C;  3JD1 A;  1KP3 A;  4NVP A;  1I0H A;  1M4U A;  5BR8 O;  4DUY B;  2CH7 A;  2EIJ C;  3OFN G;  1Q7Y W;  1YVW A;  4HNA B;  3SJA C;  3HKD B;  1N32 O;  5LHG A;  4JTC B;  2F43 G;  4UUJ C;  1YXB A;  2HLD G;  3JAR B;  5J9P C;  4RUF A;  5J2T B;  4MVQ A;  5KHI A;  5B1B B;  3OEE G;  2P6J A;  3E22 B;  5C8Y B;  3VQV A;  1B06 A;  1Q6H A;  1THZ A;  4LWS B;  5L3D A;  2QWP B;  4LR3 A;  2E75 B;  4DV4 B;  2QA4 V;  4KUM A;  3CCE V;  3UT5 A;  3D3I A;  1KB9 F;  1F4N A;  4FPP A;  3ZHV A;  2P4V A;  3GB7 C;  4DUY O;  4TQD A;  3CX5 F;  4JAA A;  4GX2 A;  1TUB A;  5A2Q N;  1AB3 A;  4UVA A;  3G71 V;  5L3G A;  3OMI B;  2Q68 A;  3D36 A;  3K59 A;  3RYC B;  4JTD B;  1ZX3 A;  1BL8 A;  5F2V O;  3FB6 C;  1D5N A;  1EN4 A;  2Q7H A;  4IGG A;  1Y76 B;  4I55 B;  4O4H A;  3CXC U;  2D3O W;  5J2U B;  2XAF A;  3FYI B;  5BY1 A;  4O4I B;  4DUZ B;  4DV4 O;  3CEI A;  3QO7 A;  4GKJ B;  5DN6 G;  2DW4 A;  2X6C A;  3AK1 A;  3OMN B;  1XUQ A;  1EZV H;  3CC2 V;  1Q8I A;  4TQF A;  4G27 B;  4JGS A;  2XTA A;  1N36 B;  3QO5 A;  1M90 W;  1AI7 A;  3HKB A;  3OE7 G;  1V54 B;  2OYQ A;  5EC1 C;  4JZG A;  4PEL A;  2R70 A;  4JAU A;  1K3E A;  1OCC C;  3JCZ A;  4O4J A;  3APQ A;  1R6N A;  2EZO A;  3SPC A;  4GLX A;  2JS3 A;  4GKK B;  1JFF B;  3BY6 A;  2PYL A;  1HP8 A;  1AJP A;  2JRI A;  3VQW A;  2VRZ A;  2QTO A;  3HR0 A;  2XAS A;  1OJH A;  1R6T A;  1VMG A;  4DUZ O;  3MD0 A;  2HHH B;  3LNN A;  2HJF C;  5KHJ A;  2IJJ A;  4FVM A;  5CA1 A;  4U3J A;  1GK9 A;  2D2C B;  2AW9 A;  1N36 O;  5LA6 B;  2XT9 A;  1Q90 D;  3JSN A;  4DV0 B;  1M57 B;  5ITZ B;  3RYH A;  5IE9 A;  1O9H A;  1SQG A;  3ASN B;  4JI7 B;  1TGO A;  1VP7 A;  1VIB A;  4GKK O;  1KBH A;  4B3T B;  2PI5 A;  4QPJ A;  3CB2 A;  2RQ6 A;  3BA8 A;  3ZMS A;  1AJN A;  3VQX A;  3AG2 C;  4F6E A;  2HHH O;  2ITD C;  3K9S A;  4JTA B;  4Q6G A;  2IJH A;  1K5Q A;  2IM9 A;  2QKA A;  1Q82 W;  1P49 A;  1WLE A;  3RYF B;  1US6 A;  1XHZ A;  4DV0 O;  4AQY B;  3ML0 A;  2DE0 X;  3KCX A;  1ENV A;  4FMT A;  3ASO C;  3KKY A;  4JI7 O;  3ZHT A;  3LNM B;  3BPZ A;  3WFV A;  4Z2W A;  2ZE5 A;  1K9M W;  4HZ3 A;  2EIM C;  4QE7 A;  4B3T O;  2XAH A;  2E3C A;  2WLI A;  3H01 A;  4OGQ B;  1S5L Z;  1R3I C;  3T1C A;  5L3B A;  4WCE V;  1L8D A;  3ABM B;  1DF5 A;  2YXY A;  2G38 A;  3CCR V;  1H8H G;  2RDC A;  4ZKI A;  1NT2 B;  4MW8 A;  1QVF U;  3CWB H;  4X20 B;  2VWJ A;  2JS5 A;  2ZE6 A;  3JAW A;  3JD2 A;  1M93 A;  1SF9 A;  2B1G A;  4TUY B;  4I0X A;  4AQY O;  3ZBH A;  3MDS A;  2CDY A;  1FYJ A;  5LMU O;  5KHK A;  2WA4 A;  4WFG A;  1WA8 B;  1QQC A;  3H9V A;  3SPH A;  3LSU A;  3D3Q A;  2OIE A;  4LC1 A;  4ZBM A;  3AK2 A;  3SJC C;  5LP6 B;  4MVS A;  3TGU H;  3F5T A;  2W6I G;  3FYE B;  3DXR B;  4X1I A;  3ZIA G;  2VQF B;  1S72 V;  2XOK G;  2WLL B;  3CRQ A;  3QF7 A;  3CRM A;  1BSM A;  4BW5 A;  3CYO A;  3ZHS A;  5EC2 C;  3P3P A;  2ITC C;  5IT9 N;  4I9W A;  1H2S B;  4X1Y A;  2BSK A;  4FM1 A;  4I50 B;  3JD0 A;  2C2A A;  3AEI A;  5EBM C;  3SJB C;  1GN4 A;  3TET A;  5LOV A;  2AZ0 A;  5JQG B;  3ETD A;  1F7Y A;  2PYJ A;  1NS1 A;  1J5E O;  2QJ1 A;  2YID A;  2F23 A;  4BWA A;  5IJ0 B;  4FLT A;  1Z5W A;  3HKC A;  4YJ2 B;  1VQ6 V;  2BTO A;  2YI8 A;  3RGB A;  2PGG A;  3LSS A;  3QNE A;  4XDL A;  4CC6 A;  2QTS A;  1N34 B;  4JYY A;  2ZNJ A;  1G1X B;  4MT8 A;  3C3S A;  1N0J A; 
#chains in the Genus database with same CATH homology
 2XAG A;  5LGN A;  2HG5 C;  4WFE A;  3ZMZ A;  2A9H A;  5B1A B;  4P2Z A;  3IC7 A;  1NH2 D;  3F7V C;  5IDJ A;  3K03 A;  5DM6 V;  1JOY A;  3B8N A;  1YHQ V;  1R3K C;  4XBF A;  2UXX A;  1AI4 A;  2WLH A;  4RQF A;  3I56 V;  2JEX A;  5EBW C;  3B77 A;  5CBG A;  1VQ9 V;  1FXK A;  1FXV A;  3LDD A;  3PJS K;  2QE7 G;  3K9A A;  5IYC O;  1YTF D;  2YEV A;  2GSM B;  4MVZ A;  5EBL C;  2WLL A;  3G6E V;  5B3S C;  2JDI G;  1GO3 F;  3SPJ A;  3ZN1 A;  2WLK A;  3AG1 C;  3CMA V;  1Y66 A;  3CCS V;  3P30 A;  1F51 A;  3QO8 A;  4XDJ A;  1QR8 A;  3RW0 A;  3OMA B;  4JF3 A;  1IXM A;  1NH2 B;  5CBH A;  3FB5 C;  4OXS A;  1BMF G;  5B1B C;  2CK3 G;  2R9I A;  5IYB O;  5GW7 A;  2W0F C;  3R65 A;  4QNH B;  2OTL V;  4UVB A;  2EZP A;  4UVC A;  3EFF K;  2P7T C;  3W7W A;  3OR7 C;  3ABK B;  3ABL B;  2JJ1 G;  4JYB A;  1R3J C;  1SZT A;  3X2Q C;  1W0J G;  3ABU A;  4X89 A;  1RPO A;  5E1A C;  2H8P C;  3ZRS A;  2K1E A;  1PL0 A;  1H8E G;  1QR9 A;  4WFH A;  1MSW D;  4F4L A;  1NVP D;  2JEU A;  2DQ3 A;  2JJ2 G;  3AG4 B;  2HVK C;  1VQL V;  3FB8 C;  3K06 A;  5EK0 A;  5BZB A;  2KB1 A;  1K34 A;  1S0V A;  1OCR B;  2A0L A;  1AR1 B;  3FB7 C;  2Y48 A;  5LHH A;  1OCO B;  3HPL C;  1RM1 C;  5IY5 C;  4MTG A;  3G4S V;  4GX0 A;  3NXS A;  1VQK V;  1SES A;  3LDC A;  5CN0 A;  1RPR A;  1E1R G;  3E35 A;  4RUE A;  3JD4 A;  1H38 A;  4TWK A;  1NJI W;  1QLN A;  4HYO A;  1VQ8 V;  4QJF B;  2WAM A;  2V7Q G;  1Q81 W;  3W7T A;  2IH3 C;  2DYS C;  3K79 A;  3OUS A;  3ZJZ A;  1NVP B;  4N21 A;  2XND G;  3OEH G;  5LBQ A;  4GX1 A;  1YJ9 V;  1EFR G;  3E8G A;  2DYR C;  3SYA A;  1S77 D;  5HFM A;  1M56 B;  3OGC C;  3JD1 A;  1KP3 A;  2BOC C;  1SRY A;  1OHH G;  3T2M A;  3SJQ C;  3DTU B;  1K33 A;  2OT5 A;  1GKF A;  1NBM G;  3OFN G;  2EIJ C;  1W2B U;  4MTO A;  1Q7Y W;  2EIM B;  1QLE C;  3FKS G;  5LHG A;  4JTC B;  4QPK A;  3UKM A;  2FTK A;  5LGU A;  2OCC C;  1AI5 A;  1PKX A;  1B6Q A;  1EZJ A;  2EIL B;  1NR1 A;  2F43 G;  3E8H A;  3VBB A;  4UUJ C;  4MVM A;  3AG1 B;  1VQP V;  2HLD G;  3E89 A;  2WWW A;  3W7X A;  1E1Q G;  3WG7 B;  5J9P C;  1G8M A;  4RUF A;  4BIU A;  4MVQ A;  3TK1 A;  1M9N A;  2R9R B;  5B1B B;  1J95 A;  3OEE G;  1VQ4 V;  1YIJ V;  1GMG A;  4PA7 A;  1N8R W;  1S3J A;  2LFR A;  4GT1 A;  3SPI A;  1Y4M A;  2NNU A;  4H33 A;  2P6J A;  1TUE B;  1V55 B;  4MVO A;  1AJQ A;  5KUK A;  3CME V;  1THZ A;  5L3D A;  1YI2 V;  4MVU A;  3X2Q B;  1M1K W;  2QA4 V;  4KUM A;  3CCE V;  2ATK C;  3D3I A;  2UXN A;  4GX5 A;  1DTO A;  1F4N A;  3ZN0 A;  4FPP A;  3GB7 C;  5L3C A;  4LBE C;  3F5W C;  3ETG A;  2Q6A A;  1KD1 W;  1COW G;  2DQ0 A;  3CP1 A;  3T4D A;  4GX2 A;  4PDM A;  2IJK A;  5H9C A;  1HWY A;  2EIN C;  1ARO P;  4UVA A;  3G71 V;  5L3G A;  3OMI B;  1M57 C;  2Q68 A;  2ZDI C;  4G28 B;  3D36 A;  3CCU V;  2EIK C;  2YSU B;  5IY5 B;  1RM1 B;  3OM3 B;  1PNM A;  1L1F A;  2QEX V;  4JTD B;  3LUT B;  3RVY A;  3ASN C;  1BL8 A;  3E8B A;  3SYP A;  3FB6 C;  1NKD A;  4RQE A;  3K04 A;  3MHS C;  4Z1M G;  4I5S A;  5L3E A;  1KKD A;  4UV9 A;  2B5U A;  2XAQ A;  3F7Y C;  2GHY A;  4JYC A;  3SYO A;  4EKW A;  1CEZ A;  3CXC U;  2DYS B;  2D3O W;  2XAF A;  1JVM A;  3FYI B;  5LHI A;  4KP4 A;  2AHZ A;  3QO7 A;  1JX9 A;  3OW2 U;  2ZD9 A;  1YTF B;  2WLJ A;  1ROP A;  5DN6 G;  5L3F A;  2WSS G;  1H2G A;  1JCH A;  2DW4 A;  4G2K A;  2X6C A;  2X7R B;  4CZZ A;  3STL C;  1PD3 A;  2PI4 A;  4KFM A;  1EBO A;  4WF9 V;  1F4M A;  2QM7 A;  3OMN B;  2EIJ B;  1QLE B;  3CC2 V;  4G27 B;  4JGS A;  1K5S A;  3QO5 A;  1JQ0 A;  4N23 A;  1M90 W;  1AI7 A;  4FIP C;  3OE7 G;  1S76 D;  1V54 B;  2Y69 B;  2ZR3 A;  5EC1 C;  2HKO A;  4MW3 A;  3I55 V;  1OCZ B;  4PEL A;  3M99 B;  4JAU A;  1JPX A;  1K3E A;  4R8C A;  1OCC C;  3JCZ A;  3MHH C;  4P9O A;  3AG3 C;  5IYD O;  1G4Y B;  1R6N A;  3OUF A;  2EZO A;  3SPC A;  3SYC A;  3BY6 A;  2A79 B;  1P7B A;  4JAS A;  1K8A W;  1AJP A;  4RAI A;  3GWO A;  1VQN V;  1FXH A;  1MAB G;  3E86 A;  1K4C C;  4FK5 C;  2QTO A;  3K0G A;  3CCJ V;  2ZXW C;  3ABM C;  2XAS A;  4PDL A;  4R7C A;  3ZMV A;  3MD0 A;  2DWE C;  2WLI B;  3RVZ A;  3K3W A;  3K08 A;  2HJF C;  2IJJ A;  1WPX A;  3HB3 B;  1GK9 A;  3CCV V;  4L87 A;  3CD6 V;  3DGE A;  3W7U A;  3SYQ A;  4PDV A;  5B3S B;  2EIN B;  1M57 B;  5KA6 A;  2IH1 C;  4PA4 A;  4J9Z B;  2EBO A;  3ASN B;  3LDE A;  2WLM A;  1YJN V;  1UJW B;  2EJR A;  1PNK A;  1QBZ A;  2X6B A;  1NQT A;  4YXW G;  1VQ7 V;  3LSQ A;  3CC7 V;  2PI5 A;  4QPJ A;  1KC8 W;  2X6A A;  1VQM V;  1AI6 A;  1FXK C;  3ZMU A;  1DF4 A;  2Q69 A;  2ZR2 A;  4PA3 A;  5CMU A;  3ZMS A;  1OCO C;  2P90 A;  1VQO V;  1AJN A;  3AG2 C;  5HFL A;  2HFE C;  4BAY A;  4JPR A;  2ITD C;  4JTA B;  1R3L C;  2IJH A;  4PDR A;  1K5Q A;  2JK5 C;  2HR3 A;  5KA5 A;  1Q82 W;  4DXW A;  1R6K A;  1OZ0 A;  1WLE A;  1K7D A;  3E8F A;  4H37 A;  3KG2 A;  3E2E A;  2IU3 A;  3ML0 A;  4LP8 A;  1YIT V;  4PA6 A;  1OCC B;  2OTJ V;  1ENV A;  1M56 C;  3AG3 B;  3ZCC A;  1MG1 A;  4FMT A;  3ASO C;  4P30 A;  3LNM B;  2V1D A;  1BHA A;  1F23 A;  4PA9 A;  3WFV A;  5H6R A;  1FS0 G;  1K9M W;  4HZ3 A;  3A0R A;  3TCU A;  2EIM C;  2Z3Y A;  1CP9 A;  1K73 W;  1KEC A;  4Q20 A;  4QE7 A;  2XAH A;  2WLI A;  2MK3 A;  3H01 A;  4UV8 A;  4X8A A;  3JYC A;  3ZRV A;  1R3I C;  3T1C A;  5L3B A;  4WCE V;  2ZXW B;  3ABM B;  4XDK A;  1DF5 A;  2EIL C;  5B1N A;  2XAJ A;  2DYR B;  1QCE A;  3CCR V;  1H8H G;  3STZ C;  4ZKI A;  1FFT B;  4WFA V;  3WG7 C;  4MW8 A;  1QVF U;  3P32 A;  5CA3 A;  2IW5 A;  1NR7 A;  2ZDI A;  1I5X A;  3JD2 A;  3ZRW B;  2IU0 A;  1S5H C;  2B1G A;  2OCC B;  3SPG A;  5B1A C;  1V55 C;  2LP7 A;  3IFX A;  2BOB C;  1K92 A;  3E83 A;  4MS2 A;  3CPW U;  5C93 A;  3CCL V;  1GTO A;  3ETE A;  2JIZ G;  4UXN A;  4WFG A;  2Z5U A;  3SPH A;  4MSW C;  4P9P A;  4MTX A;  1Q86 W;  4R6Z A;  2P67 A;  4LC1 A;  4U7N A;  1R73 A;  4FJC C;  4ZBM A;  4WFF A;  4DO2 A;  2LFS A;  4MVS A;  3RBZ A;  1FXK B;  1QVG U;  2NLJ C;  2W6I G;  3FYE B;  3ZIA G;  1E79 G;  4GCZ A;  4CBC A;  5FL7 G;  3ZRX A;  4MVR A;  1P4R A;  1K97 A;  1K4D C;  4JAV A;  2YEV B;  4TT3 G;  3AG2 B;  1S72 V;  2XOK G;  1SER A;  3IGA C;  1YJW V;  2WLL B;  2QM8 A;  4U7O A;  2W6J G;  3CCQ V;  2QKS A;  2WPD G;  4BW5 A;  4BIZ A;  4MTF A;  3CCM V;  3CYO A;  1LNQ A;  4QE9 A;  4WFB V;  4J9Y B;  5EC2 C;  2ITC C;  5B1O A;  3UM7 A;  4LCU C;  3BEH A;  4I9W A;  2DWD C;  1SET A;  2H94 A;  4QIW F;  2B1I A;  3ABK C;  1ORQ C;  2EIK B;  3ABL C;  3JD0 A;  2C2A A;  5H6Q A;  1I5Y A;  3AEI A;  2X0L A;  4RO2 A;  1XL4 A;  5EBM C;  1BHB A;  3ASO B;  4TSF G;  3TET A;  1PNL A;  1KP2 A;  2IJI A;  4ASU G;  1MOF A;  3ETD A;  1JJ2 U;  3OAA G;  4R50 A;  3AG4 C;  2HVJ C;  1W0K G;  5KUM A;  1GM9 A;  1VQ6 V;  3ABT A;  1V54 C;  2WLN A;  2Y69 C;  1OCR C;  1XL6 A;  4E2L A;  4HAM A;  1OCZ C;  1KQS U;  1GM7 A;  1CPY A;  1GM8 A;  3LSS A;  3QNE A;  5CBF A;  4XDL A;  1DLB A;  2M7W A;  3ZRW A;  2ZQM A;  2Q67 A;  3K0D A;  5LGT A;  3W7S A;  3CC4 V;  3T4Z A;  1YSC A;  3ZMT A;  3JD3 A;  3B8M A;  2AHY A;  4MT8 A;  1VQ5 V;  3EHB B;  4X88 A;  3VOU A;  1ZWI C;  3OR6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...