3F7YC

Kcsa potassium channel in the partially open state with 17 a opening at t112
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
RAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title KcsA Potassium channel in the partially open state with 17 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
molecule keywords antibody fab fragment heavy chain
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3f7yC00
1K4DC 1LNQA 2NLJC 4GX2A 4JTDB 4X88A 1XL4A 2H8PC 1V54C 2X6AA 4RO2A 4H37A 2WLIB 4MVOA 2JK5C 4QNHB 4MW3A 3JYCA 1R3LC 3ABMC 2WLHA 3LDCA 5IY5C 3EFFK 4P9OA 5BZBA 3RVYA 3AG2C 2Q69A 3K06A 3VOUA 2WLNA 1V55C 2WLLB 4OXSA 4PDRA 4X8AA 3STZC 2R9RB 4CBCA 1J95A 3OR7C 2OCCC 3IGAC 4LBEC 3K08A 3K03A 2AHZA 3ZJZA 2EIJC 5J9PC 4ZBMA 3SPIA 4LCUC 2EIKC 4XDLA 2DWDC 3K04A 3LDDA 3LDEA 4WFFA 2K1EA 4J9ZB 1M56C 1KKDA 2A79B 3ABLC 5CBGA 2BOCC 3FB8C 1K4CC 3F7VC 3FB7C 2WLKA 2KB1A 4G28B 4P9PA 3KG2A 5EBMC 5CBFA 4DXWA 2HVKC 4G27B 4MTFA 4PA4A 3E8FA 5EBLC 2Q67A 4PA6A 3ABKC 1R3KC 4PA9A 4WFEA 5CBHA 3SYAA 2HJFC 4F4LA 1XL6A 3SPHA 1OCRC 1R3JC 2IH3C 4R8CA 5B1BC 4PA3A 5KUKA 4H33A 3E83A 3GB7C 1BL8A 2ATKC 4J9YB 3T4DA 2EINC 3ZRSA 3UKMA 5B3SC 2W0FC 1G4YB 1OCOC 4HZ3A 2Q6AA 4MS2A 2DYSC 4PDLA 2P7TC 4XDKA 5E1AC 5EC1C 3SPCA 2QTOA 3E89A 2EILC 4P30A 2HG5C 2EIMC 2X6BA 2WLJA 5EBWC 3K0GA 3T1CA 4EKWA 2YEVA 3SYCA 3E8GA 3FB5C 3OR6C 3IFXA 4MW8A 2WLIA 2X6CA 2BOBC 2A9HA 4JTCB 3OGCC 4MSWC 1R3IC 2A0LA 5B1AC 3RVZA 3SYQA 2AHYA 2WLLA 3ASOC 3AG3C 4UUJC 4XDJA 3OUSA 4X89A 5KUMA 3F7YC 3AG1C 4GX1A 3E8HA 3LNMB 4MVRA 4MVUA 2ZD9A 4WFHA 2DWEC 3E86A 1ZWIC 3UM7A 4JTAB 3BEHA 4MTOA 4R7CA 3PJSK 4RAIA 2HFEC 3SPGA 2WLMA 4R50A 4LP8A 3RBZA 3T4ZA 3T2MA 4PA7A 3AG4C 3WG7C 3X2QC 2ITCC 3TETA 3K0DA 4QE7A 4KFMA 4TWKA 4I9WA 4MVZA 4PDMA 2QKSA 3HPLC 3R65A 4MTGA 4R6ZA 3E8BA 4QE9A 3SYOA 1QLEC 1P7BA 4HYOA 3STLC 2ITDC 3RW0A 5EK0A 4MVQA 3OUFA 3SPJA 2Y69C 1M57C 1S5HC 2DYRC 4MVSA 4PDVA 4MVMA 2IH1C 2Q68A 2HVJC 3SJQC 1JVMA 3TCUA 4BW5A 3LUTB 4P2ZA 4GX0A 1OCZC 5EC2C 4WFGA 1ORQC 1OCCC 3SYPA 2ZXWC 3ASNC 3F5WC 4GX5A 4RUEA 3FB6C 4RUFA
chains in the Genus database with same CATH superfamily
4BWAA 4JTDB 4X88A 4JAAA 2OTLV 4DV0B 1J5EB 2YI9A 1SQXH 3VOUA 5DM6V 2PTMA 2JIZG 4K8XA 4RQFA 1VF6A 4WF9V 3IGAC 1NT2B 3QVNA 4JI3B 2AW9A 4DV7B 3K59A 2NR5A 3IC9A 1YHQV 5A2QN 1M56C 3ETDA 5CBFA 4I9QA 1XNQO 1WPBA 1O9HA 4CC5A 5DN6G 3ZBHA 1OCRC 3GB7C 1WJZA 1JPXA 1MSDA 2ODMA 1G4YB 1GM8A 1SRYA 4FLWA 4HNAA 2QM7A 4PDLA 1Y76B 2EIKB 5CMUA 5EBWC 3WB1A 3K57A 1HP8A 1VQOV 3OFNG 1HR0O 2FYUH 1JX9A 4LFAB 5IE9A 3OMAB 2VQEB 2OIGA 4LF9O 3DGEA 2EINB 3H1JH 2QA4V 4B3TB 4PI2A 2ZE5A 1QHTA 5LMNO 1YITV 3WB0A 3BVOA 3RT3C 3KCXA 3JAWA 5FPRA 4WBNA 2FTKA 4NR1A 1NS1A 2QKSA 3GWOA 5H2FZ 2ITDC 5EK0A 2VQEO 1AVMA 1S5HC 1IBKO 3HKBA 4FZ1A 2CH7A 2F4VO 3WB2A 2KSDA 4FMTA 2WLIB 1ZX3A 1AI7A 2PF4E 3CCQV 2HKOA 5KHGA 5H9CA 3LDCA 5IYZA 3OMNB 3T1HB 5IY5C 2BSKA 5J2UA 2UUCB 4AI8A 2Q69A 5LMUO 5IJ0B 4X8AA 3THOA 4F6RA 3FYEB 1NU1H 3QF7A 2BE3A 1MG1A 2UU9O 2AGAA 3JSNA 4TOIA 2D3OW 3E22A 1U96A 2EIKC 4WBNB 1K4CC 1AP5A 1YTFD 1RP3B 2HEPA 5HFLA 2PYJA 3RYFB 5LMNB 4JV5O 2LW1A 2ATKC 1KUQA 4CC6A 1PD3A 4LFCB 4L8JA 2E75B 3BAAA 3ZMSA 5JH7A 2HG5C 2Q7HA 5LGNA 3OEEG 3CCVV 1IURA 4B7KA 1AI6A 4MW8A 1Y66A 1YEWA 1Q43A 2A9HA 4J7KA 5KMGB 1R6KA 3C90A 2JGDA 3W7WA 4LH6A 4DW0A 1M5IA 2YC0A 5LXTB 3OUSA 4EB6B 2YUAA 2LFRA 1FJGB 3QTCA 1HDJA 1I5YA 4X66B 4JTAB 3PJSK 4RAIA 2Q7GA 2XAFA 4R50A 4JI5B 3L71H 1LR1A 4X64O 3K9AA 5LA6A 3OTFA 4QE7A 4YXWG 3E2EA 1AI5A 1PKXA 4ZIBA 3Q4HB 4DO2A 1YJ9V 2YIBA 1R73A 1HNZB 2QWNB 2XTAA 1WAZA 3HKEB 3LUTB 4YY3B 2WSSG 2UXBB 4O2AB 2BTQA 2NLJC 4H37A 4CH6A 3OEHG 3OAAG 3BABA 1K8AW 5JQGB 5LOVA 4P9OA 1S5JA 2QR4A 2OYQA 4KP4A 2M6YA 2F95B 3J7AU 4UCVA 4YHHO 3B8NA 1H2LA 1S3JA 1IXBA 2ARHA 3ZHQA 4DV6B 2Q9LA 4AQYO 4DV0O 2A79B 3JAMN 4UCOA 1QBZA 1ZTEA 1CXZB 5EZYA 4CS4A 3SYAA 4DR1B 1R1BA 4R8CA 4WFBV 1NKDA 3UKMA 1LUWA 4TUYB 2F93B 2QTOA 2V7QG 3WFVA 3T1CA 2X6BA 2UXXA 3CJHA 3OTOB 5LYJA 3UO2A 1KBHA 4NXMB 2YEVB 1SETA 3RYCB 1JJOA 4DV2O 2R9AA 1XNRB 3LNMB 3QNEA 5GTHZ 2XAGA 5AG2A 4ICGA 1AROP 2HFEC 3S3WA 3WG7B 1WP7A 2UUBB 3CD6V 4DV4O 4K0KO 4TWKA 4B3RO 2QJ1A 3APOA 2YICA 2XNDG 1YF2A 2Y69C 2ZIMA 1I94B 4FK5C 1KU9A 1BE3H 4QPKA 3EVKA 1S0VA 4WFGA 3A0HZ 1QU7A 4UCSA 2P4KA 4GX2A 1KP3A 3CRAA 1N34O 5K1XA 1R3LC 2CE4A 1N32B 3EFFK 5LOVB 3K06A 2LW7A 3STZC 4JI3O 4J7JA 3D3IA 1TUEB 3KKYA 5ITZA 3CCRV 1PNMA 4QGPA 5B1OA 2Q0AA 4UV9A 2ZDIA 3N2KA 4DUYB 2WPDG 1VP7A 1ZAUA 4UCRA 4B3TO 2CTQA 5LGTA 2VQFO 2Q0OC 3HB3B 4CS3A 3SPHA 1TUBA 3JD0A 4NB5A 1QLEB 5C8YA 4JI7O 2Q4PA 1NR1A 3ZHVA 4C7UA 1HNXB 4FM0A 3K5OA 5BMVB 4DV5O 3CHXA 1NI8A 3SJAC 1KMIZ 5LHHA 3QG5A 1V9PA 2P6JA 5LP6A 1M1KW 2W6JG 2EJRA 2AHYA 3U11A 3AG3C 4XDJA 3HKCB 4TT3G 2P90A 3BA8A 3JATB 1VQPV 1VIBA 1EN4A 4I0XB 1JJ2U 2BSKB 4N21A 3FFQA 3SPGA 3ZIAG 3N2KB 1W59A 3BHPA 3VQWA 2H94A 1AR1B 4FPPA 5K1PA 2XOKG 3ZCCA 4B3MB 2EIMB 4QE9A 1H38A 3H1HH 5C8YB 1OCRB 1M56B 4J42A 2RMKB 4PDVA 4MVMA 2YS8A 4B7EA 1VEWA 1Q6HA 2JJ1G 3H1KH 3I56V 3CPWU 2LQTA 2JJ2G 1US6A 2H8PC 1G1XB 2EULA 4RO2A 2UUCO 4MVOA 2OWOA 4JYAO 1XHXA 4J10A 2XAJA 1KYOF 4B3MO 1QQCA 2QWOB 2UXBO 4OGQB 1BT8A 1X4TA 1DGSA 3G4SV 3K03A 4DR7O 2PI4A 4NXNO 2X0LA 3ZN1A 5J9PC 3B4SA 3SPIA 1XREA 4X1YB 2DWDC 2RN9A 4GYCB 1K5QA 3RYIA 2K1EA 1BHBA 1NH2B 5B5EZ 2BTOA 3FKSG 4NKGB 4GKJB 1R3KC 3K5LA 1FPOA 5B1BC 5HFMA 1TVKA 3ZRSA 1YXBA 3AG1B 3FD9A 1FKAO 2QDOA 4E2LA 2F4VB 2JRIA 2LP7A 2P7TC 5EC1C 3Q4HA 3K79A 5CA1A 4P30A 3JAKB 5JCOC 2P22C 1VQ5V 4MSWC 2DN9A 3CC4V 4I55A 3DC6A 5IWAB 1VQ9V 2OTJV 2L35A 2G38A 3AG1C 4U3JA 4LNUA 2ZCEA 3G80A 1ZWIC 1AJNA 1SZTA 4BW9A 5L3FA 3OW2U 3T1YB 4QIWF 2RJZA 4UB6Z 1I08A 3RBZA 1KKCA 1JQ0A 1KP2A 4PA7A 1SA0B 1L8DA 4LF5O 1V54B 1M57B 3TETA 4DV3O 4MTXA 1D2DA 1AP6A 3JCUZ 2ZM6O 3J80N 4QJFB 1KB9F 2JEXA 4UVAA 1VQNV 3B09A 4DUYO 1SKVA 2JDIG 3H1LH 4PV1B 3JAKA 4LF4O 3HKBB 1L1FA 3ABTA 4FM2A 2WLLB 4U3JB 1MNGA 1WNSA 1H2MA 2R9RB 3RGBA 3ZX6A 5BY1A 1J95A 2ZIOA 2HHHB 4NYKA 4I4TB 5FLXN 2IBZH 4YJ3A 1IBKB 3RYCA 3T1HO 1H2SB 4XBFA 1PL4A 2CTRA 2WLKA 2KB1A 4FLXA 3UO3A 3E22B 5GONB 3ZRXA 1VF5B 2PGGA 3BFRA 3ABKC 4WFEA 2L6LA 2IJJA 2F66C 1FXHA 4JI6B 1GMGA 1IBLB 1PM9A 1Q86W 2QM8A 1NVPD 3SPCA 1YZBA 1WA8B 3D3QA 5CA1B 1N36O 1MA1A 1MZFA 1JMKC 5L3GA 4IIJB 4JI4O 1D5AA 1AI4A 4DRXB 1JFFA 4AQYB 2CTPA 1G8MA 5KUMA 2ZD9A 5KMGA 5FNVA 4LNUB 2B9ZA 1I0HA 5IJ9A 4TV8B 4MTOA 1Q82W 3LSUA 5LXTA 4TV9B 3L74H 2CK3G 3WG7C 2UU9B 2ADPA 1GM9A 3ZHSA 3M8AA 5CA0A 3HPLC 2DW4A 4UCUA 3ZHUA 1W2BU 2QM4A 4DR7B 2ZNJA 3RW0A 3OUFA 4ZI7B 4GX0A 4EFEA 2N05A 3SYPA 4JYBA 2ZE8A 1YIJV 3MAQA 3CRRA 1K4DC 4UCTA 1XL4A 1JCHA 2KG7A 4F6EA 4QNHB 4GKJO 3P3PA 1VARA 1GRJA 1O9GA 2CTWA 4CBCA 5KA6A 1N33B 4J41A 2FL4A 2EIJC 3LSQA 2IU3A 2OT5A 1DLBA 4XDLA 2Q5ZA 3K58A 4P9PA 1SQVH 4CH5A 2GUZB 1MZEA 1XHZA 3FAVB 4X1KA 5GONA 4GLXA 1AB3A 2HJFC 2HLDG 2QEXV 3ZRWA 2LGQA 2P67A 3AG4B 1T5EA 2FMLA 4TQFA 1N32O 1OCZB 1Y4MA 5EIBD 2EJ7A 2ZKOA 5JVDB 1YDXA 1YJWV 4LR3A 4DR1O 1YJNV 3FB5C 3ZMVA 4IYIA 1Q5OA 1RPOA 3OD4A 4LF8O 2PZSA 5EYPA 1FXKA 2DMXA 4DRXA 3E35A 5KX5B 1OV9A 1GM7A 2CAZC 3ASOB 4HBNA 3JASA 1ROPA 4K0KB 4IYHA 3E86A 1GO3F 5IJ9B 5KLVH 1K7DA 3G71V 4DUZO 1THZA 4HAMA 4OPHA 2IJIA 3K0DA 4AILC 1PV0A 2OCCB 2Y4UA 4JI2O 3E8BA 4TSFG 4X1IA 4JI6O 3W7UA 2R9IA 4ZHQB 1DF4A 1SC5B 1K92A 1VQ6V 3ABLB 3SJQC 4GKKO 1AJQA 3D8CA 2ADQB 1OCCC 4JI4B 1MSWD 3FB6C 2ZXWB 1N8RW 2WWWA 3AEIA 4D7SA 1B04A 4B3SO 4DK1A 2B5UA 3A0RA 2A06H 4X20B 3ABMC 3AG2C 1RM1B 3SGIA 2QWPB 5TISZ 3JASB 1SESA 2OCCC 3CRCA 4JV5B 1X59A 3T1YO 1OZ0A 2F43G 2CDYA 3CWBH 2EIJB 3HKDB 4OPAA 1HNZO 5CA3A 4YIPA 5F2VO 1BZKA 1EM1A 3N27A 5CB4B 3VQYA 3MDSA 2LFSA 2P06A 5C93A 5ITZB 4KUMA 1N36B 5BMVA 1TA8A 4PA3A 3JALA 4X65B 2H3OA 4O2AA 1BL8A 4DUZB 4FFKA 2Q73A 5L3EA 1AR5A 4HZ3A 1WLEA 5E1AC 1SQFA 2F23A 1NBMG 4O4LB 3ICXA 3ZMTA 1COWG 1I94O 2HP8A 2PUSA 5GTIZ 3IFXA 4FJCC 1XUQA 1GAXA 2FKXA 2E5LO 1E79G 4X65O 3GVMA 5L3BA 3RVZA 2Y4TA 1I5XA 1P84F 1PNLA 4U7OA 2KQXA 1HWYA 3DSQA 2VQFB 4GX1A 4MVUA 1Q7YW 2KKWA 4DV4B 3K5NA 1ZLZA 2QKAA 4R7CA 1TGOA 1IX9A 3W7TA 4JF3A 4DV3B 1FD9A 4DV7O 4H44B 1KD1W 4DK0A 1Y6XA 4I9WA 4NTXA 5B1AB 3A8TA 4BR6A 1VQLV 4KHPO 2Z0AA 1J5EO 3AG3B 1H2GA 3OTOO 4CH3A 3B8MA 4DW1A 4JZGA 4B3SB 2A7WA 3L72H 4TQDA 1QCEA 5CN0A 5KAFZ 1CPYA 3K9SA 4K8ZA 2WLNA 3BA9A 2YXYA 4D7TA 4BAYA 3RYIB 1NJIW 1Y74B 1F4MA 1FYJA 1WB8A 4H13B 3OGIB 3ZEDA 1XEQA 2AHZA 2IJKA 4JYAB 2UXCB 3TJTA 3K04A 4B3RB 1WPXA 1OHHG 4AHCA 1RSOA 5J2TA 1L0LH 1YI2V 1IBMO 1DF5A 1VF6C 2EINC 1SQQH 1MABG 3H9VA 3JARB 1B06A 2EILC 2EIMC 1AR4A 4CS2A 1Q6UA 2E74B 1IBMB 3MD0A 2PYLA 2ZT9B 3UT5A 4JPRA 1ZL8B 2IW5A 4GCZA 2W0XA 1GKFA 2QTSA 1H2KA 1GTOA 4JZ2A 4LF5B 1GN6A 4JI5O 2WLMA 2B1IA 1XILA 1M93A 3JD2A 4MTGA 1N34B 2PY5A 1XNQB 4E4EA 5JJJB 4RWUA 1SA0A 3K3WA 2GHYA 3STLC 1NH2D 1K5SA 4EEQA 2GUZA 4GT1A 1M90W 1B6QA 1K33A 3U0ZA 1FS0G 3HKEA 1CEZA 4HNAB 2WAMA 5EC2C 1N0NA 5LP6B 1QLNA 4GX5A 2ZR2A 1P49A 3X2QC 4JYYA 2RCVA 3ETQA 2RNBA 2O57A 3KZIZ 4UVBA 1K34A 3C3SA 5JVDA 3MHHC 3SR2C 1XMQB 3AK2A 2RDCA 3RYHB 1UJWB 4J7ZA 3CC2V 3CYOA 5EYPB 4ZBMA 4DV2B 3LDDA 3LDEA 4WFFA 4NXNB 2LO1A 5L3CA 2WA4A 5JJNB 4ASUG 1RSOB 5J2TB 4PA4A 4UVCA 3E8FA 5EZYB 4LF4B 1VQMV 5IY5B 4UFZA 3E83A 1IDSA 1NZ6A 3J81N 1FJGO 5B3SC 4IIJA 1EZJA 1SS3A 4O4JA 4L87A 1K9MW 4ZHQA 3CRQA 5FPOA 2XAQA 3CXCU 1DK1A 3SYCA 1W0JG 2WLIA 5IWAO 2K9PA 3JD1A 3IAYA 4FVMA 1WA8A 2CUGA 4F6RB 2Z5UA 1F23A 2DYRB 4JYCA 3UM7A 1VQ8V 3CE2A 1XMOO 3NR7A 4YJ2B 2YXHA 3CB2A 5FNVB 4LF6B 1U97A 1BQ0A 4KL1A 3QO7A 1GN3A 2Y0PA 1ENVA 3CCLV 1SZXA 1P7BA 3BCCH 1BHAA 2X7RB 1Q81W 3ZMUA 2YIAA 1M57C 1BSMA 2DYRC 4BW5A 1OCZC 4JI1B 1VQKV 1FAFA 3ASNC 5KA5A 4J11A 4I55B 3JCZA 3JSLA 4WCEV 1V54C 3DXRA 4I5SA 4ZI7A 1Z5VA 3M7MX 4FLYA 4PI0A 2YDEA 1XMQO 4FM1A 3N2GB 4FLTA 1RM1C 1EFRG 5KHHA 1L0NH 1H8HG 4LBEC 3K08A 2ZM6B 4LF7B 4LCUC 4QPJA 5DEDA 3FB8C 3FB7C 5B3SB 2ETNA 4G27B 2XHBA 2W6IG 1QR9A 3H1IH 5BXZA 4F4LA 4LWSA 3W7XA 1WP8A 1SQGA 3K5MA 2ZDIC 3FAVA 4X1KB 5KHIA 2Q6AA 5DECA 1GN4A 4LF6O 5JWPA 3OMIB 3E8GA 3W7SA 2LGWA 4FLVA 2BOBC 3UQ8A 2P4VA 2E3CA 2QSAA 2XAHA 1A32A 3RFRA 1WN7A 5LGUA 2XASA 1G6UA 3JATA 2DWEC 4UXNA 5H6QA 1AILA 5IYDO 1S5LZ 4JI0B 2F1MA 5LP6C 4X1IB 3T2MA 5GW7A 2YXLA 4X64B 3AK1A 1ZUQA 3CCJV 1URFA 4PELA 4RQEA 4HYOA 3AK3A 4NVPA 2IH1C 3I55V 3VQXA 1LUVA 1XOUA 2VWJA 4X20A 1UFIA 2AXTZ 3ASNB 4RUFA 2BTQB 1HNWB 1TAEA 5EIBC 2BCCH 1YVWA 4LFBO 3JYCA 4TV8A 2WLHA 4Q6GA 3WU2Z 4O4IB 1Y67A 3S3XA 4OXSA 4PDRA 3X2QB 1BGYH 5B66Z 1WB7A 3UT5B 1ZL8A 4X1YA 2D2CB 2OIEA 3CSXA 4YHHB 5IT9N 4GUNA 1E1QG 1FXVA 3JALB 5EBMC 4DV6O 3CEIA 4JASA 4LF9B 5EBLC 5LHGA 1BQZA 3JD4A 2YSUB 5KHKA 1TVKB 2IH3C 1VQ4V 1V55B 5CB4A 4H33A 4IHJB 4X62B 5LL6Y 3ZS8C 3ML0A 2GTAA 1XMOB 2DYSC 4PD4F 3L9DA 2WLJA 4DR3O 3CJHB 2VWKA 3OE7G 4OX9B 1JA8A 3PN1A 5BR8B 4JTCB 1B3QA 1EZVH 4DV1O 1MMMA 5L3DA 1F51A 2GSMB 3HR0A 4CZZA 5LBQA 3E8HA 2IU0A 2Z3YA 2ZR3A 3EHBB 1FFXA 5KHJA 5D5QA 2UUBO 3G67A 5J2UB 1IBLO 2R72A 3T4ZA 2EZOA 4DR2O 2R70A 1NR7A 2OCHA 1H2NA 3VQVA 2AZ0A 1KQSU 4OX9O 1XI1A 4PDMA 1DTOA 3R65A 1D5NA 5B1NA 4I50B 3F5TA 4IHJA 1AJPA 3TK1A 3QO5A 1FFTB 2Y0IA 3FX7A 2Q68A 3IC7A 4DR6B 2HR3A 4FIPC 3RYFA 1K73W 3VBBA 5KX5A 3A2FA 3BPZA 2GDSA 4CH4A 2JK5C 2EZPA 3RWRD 2UXDO 5JH7B 3RVYA 4O4IA 1K97A 1XBLA 4LH7A 1SERA 3OR7C 2B1GA 1BMFG 3NXSA 4B08A 1SQPH 1S76D 4DR4O 5E79Z 4K35A 4FFBA 1UPGA 3F7VC 4KXRA 3CCUV 4G28B 4UB8Z 3B77A 4W4KA 4I50A 1R3JC 1TUBB 2ZE7A 1GK9A 4U7NA 1RFYA 2Y69B 3LSSA 2HJDA 4JAUA 3DC5A 3OR6C 5JJEB 2DOSA 1NTZH 3TGUH 4DYLA 3OGCC 3ZRVA 3G6EV 2EBOA 1SF9A 3L70H 4GZRB 4ZOLA 2IJHA 3R66A 3RN4A 3HKCA 4LF8B 2UUAO 5JQGA 1RPRA 1FFXB 1IXMA 1P4RA 4FFBB 1OCCB 4YJ3B 2XUMA 4LP8A 3CS5A 1F7YA 1BS3A 1H8EG 2XT9A 4X9QA 1VF7A 2PI5A 3JAWB 3SYOA 2RQ6A 4MVQA 3SPJA 4I7ZB 5H5NA 3UCSC 2JS5A 1M4UA 5IYZB 1LNQA 2Q7EA 2WA3A 2X6AA 1OJHA 3CMEV 3RYHA 1HW7A 5JCOA 2CH7B 3B40A 4IGGA 5BZBA 1IVSA 2N74A 1V55C 5LYJB 3ETGA 4A5UB 4FLUA 3ABUA 1KC8W 4DR4B 5LMUB 5IJ0A 1GN2A 1R6NA 2IM9A 2GTSA 4J9ZB 5IYBO 1KKDA 4TV9A 5CBGA 3D36C 3TXSA 3QO8A 3CRMA 4NTWA 4O4JB 5CBHA 2UUAB 5KUKA 3I5DA 4PHZA 4EFBA 3CP1A 3T4DA 1I7FA 4LC1A 4JI2B 4PJ0Z 5KAIZ 1Q3EA 1OCOC 2LJ2A 1NTKH 3CX5F 2JGUA 4Q20A 4O2BB 5IDJA 2NNUA 2A3QA 1CP9A 4EKWA 1HNWO 3BY6A 3M99B 3GWKC 3P32A 2X6CA 1ZSPA 4BIUA 1MOFA 2A0LA 3P30A 2WLLA 3ASOC 4X89A 1VQ7V 4NXMO 5LHIA 5LA6B 1S77D 1BCCH 2DYSB 3BEHA 3EXAA 3BRCA 4EB6A 3A0BZ 2CGNA 3JARA 3B2EE 4R6ZA 4DR5O 3IJ4A 1QLEC 5IYCO 3ZRWB 1K3EA 1Z5WA 2UXNA 3DXRB 3FYIB 2DQ0A 3SJBC 4P2ZA 1QVFU 3APQA 4O2BA 2GBOA 2VRZA 1QVGU 2ZXWC 1JR9A 4JAVA 3OM3B 3N2GA 4LF7O 3CC7V 4X62O 3O65A 1EBOA 4MW3A 4N23A 4JI8O 4IL6Z 2EILB 4DR5B 1R6TA 2MK3A 2MW2B 2YI8A 2E76B 1M9NA 1NVPB 2ZINA 4I4TA 3ETEA 3HKDA 4YIOA 5D5PA 2GV9A 4LWSB 2QKCA 2UXDB 4X66O 1XQ8A 2V4DA 3KG2A 3LNNA 3CCEV 2HVKC 4I0XA 5H6RA 2Q67A 4PA6A 4TUYA 1XL6A 3ABKB 3JD3A 4BIOA 4J9YB 2YIDA 4DR2B 4H0LB 3ZMZA 2W0FC 4LFAO 4MS2A 4XDKA 2QE7G 1EN6A 3E89A 4GKKB 3H01A 1E1RG 1XNRO 5BR8O 3K0GA 2YEVA 2KG7B 1JOYA 4NTYA 4ZKIA 4DV5B 4JI1O 4IT5A 1SQBH 1R3IC 3O9OA 3SYQA 3CMAV 1PP9H 4WFAV 1N4CA 1Q8IA 1JFFB 3L75H 3ZHTA 4UUJC 1N0JA 3AG7A 3F7YC 4MVRA 1Q6IA 4O4HB 2DQ3A 1HR0B 4W4LA 3DTUB 2NN4A 3KCYA 2QWQB 2QWRB 2ILMA 1OCOB 4LFCO 2P5OA 2DE0X 4MVZA 4Z1VA 4Z1MG 5CA0B 4K3AA 1YSCA 4JGSA 3P3NA 3C3TA 2YIBD 2Y48A 5A9GA 1P7GA 4MVSA 3TCUA 2ZNIA 4DR3B 1NQTA 1YTFB 2ZQMA 3ABMB 1ORQC 2VS0A 2JGDB 1QNMA 3F5WC 4ABMA 4Z2WA 4O4LA 1XDCA 3SDLA 4JI8B 1Z2GA 1QR8A 4YJ2A 1GH6A 3ZJZA 4U3FH 1NTMH 4FZ0A 4MT8A 2AZ2A 4ZOLB 2M7WA 3ABLC 2BOCC 3SJCC 1YCIA 2EX3A 1KECA 3OT7A 4DXWA 4DR6O 4G2KA 4MTFA 4JI0O 1PPJH 3G6BA 4PA9A 2HHHO 4LFBB 4KHPB 1F4NA 1IZ3A 2JEUA 3MHSC 3CXHF 1W0KG 2JS3A 4DV1B 4YY3O 3CCMV 1PNKA 2CGOA 3D36A 1VMGA 4JI7B 3AG2B 5B1AC 1FXKB 1HNXO 1Q90D 4D6TH 2FB5A 2JVDA 2UXCO 4WFHA 2N04A 1Y74A 3L73H 4O4HA 1S72V 1EN5A 1FXKC 1PL0A 3AG4C 2DJVA 2ITCC 4J80A 3U10A 2E5LB 4KFMA 3ZN0A 4UV8A 3ZHRA 2ZE6A 5B1BB 1N33O 4FLZA 4BIZA 2QGNA 2HVJC 1JVMA 5FL7G 3CCSV 2V1DA 2Q8VA 1Y76A 3TXQA 4RUEA 2C2AA
chains in the Genus database with same CATH topology
2JJ2G 4JTDB 4X88A 2H8PC 4RO2A 2OTLV 4MVOA 1QCEA 2JK5C 2EZPA 5CN0A 2XAJA 1CPYA 3RVYA 3VOUA 2WLNA 1K97A 4BAYA 5DM6V 1NJIW 1SERA 2JIZG 1F4MA 4RQFA 3OR7C 2B1GA 4WF9V 3IGAC 3G4SV 3K03A 2PI4A 2AHZA 2X0LA 3ZN1A 5J9PC 1BMFG 2IJKA 3NXSA 3SPIA 1S76D 2DWDC 3K04A 1WPXA 1K5QA 1YHQV 2K1EA 1OHHG 1M56C 1BHBA 1NH2B 3ETDA 3F7VC 3CCUV 4G28B 5CBFA 3B77A 3FKSG 1YI2V 5DN6G 1R3KC 1DF5A 1OCRC 1R3JC 5B1BC 5HFMA 1GK9A 3GB7C 4U7NA 3ZRSA 2EINC 3AG1B 1JPXA 1G4YB 1GM8A 1MABG 2Y69B 3LSSA 1SRYA 2LP7A 4JAUA 4E2LA 2QM7A 4PDLA 2P7TC 5EC1C 2EIKB 3K79A 2EILC 4P30A 2EIMC 5CMUA 5EBWC 1VQOV 3OR6C 3OFNG 3MD0A 1VQ5V 3OGCC 4MSWC 3ZRVA 3G6EV 4JPRA 2EBOA 2IW5A 4GCZA 1JX9A 1GKFA 3CC4V 1VQ9V 3OMAB 2OTJV 3DGEA 2EINB 2IJHA 3AG1C 2QA4V 1GTOA 1ZWIC 1AJNA 1SZTA 5L3FA 3OW2U 1RPRA 1YITV 1IXMA 4QIWF 1P4RA 2WLMA 1OCCB 4LP8A 3RBZA 2B1IA 1KP2A 1JQ0A 4PA7A 1V54B 1M57B 2FTKA 1H8EG 3TETA 4MTXA 3JD2A 2QKSA 4MTGA 2PI5A 3GWOA 3SYOA 3K3WA 2GHYA 3STLC 2ITDC 1K5SA 1NH2D 5EK0A 4MVQA 3SPJA 4GT1A 1M90W 1B6QA 1S5HC 1K33A 1CEZA 1FS0G 4QJFB 2JEXA 4UVAA 2WAMA 1VQNV 5EC2C 1QLNA 2JDIG 4GX5A 2ZR2A 3X2QC 1LNQA 2X6AA 4UVBA 4FMTA 3CMEV 2WLIB 1K34A 1AI7A 3CCQV 1L1FA 3ABTA 2HKOA 5H9CA 3LDCA 3MHHC 3OMNB 5IY5C 5BZBA 2Q69A 1V55C 2WLLB 4X8AA 3ETGA 3FYEB 2R9RB 1J95A 1UJWB 1MG1A 3CC2V 3ABUA 3CYOA 1KC8W 2D3OW 4ZBMA 2EIKC 3LDDA 1R6NA 3LDEA 4WFFA 4J9ZB 5IYBO 1KKDA 4XBFA 5CBGA 5L3CA 1K4CC 2WLKA 2KB1A 4ASUG 1YTFD 3QO8A 4PA4A 4UVCA 3E8FA 3ZRXA 5HFLA 1VQMV 5IY5B 3ABKC 4WFEA 5CBHA 2IJJA 5KUKA 1FXHA 3E83A 3CP1A 2ATKC 3T4DA 1GMGA 4LC1A 5B3SC 1EZJA 1OCOC 1PD3A 1Q86W 4Q20A 2QM8A 1NVPD 4L87A 3SPCA 5IDJA 2NNUA 1K9MW 3CXCU 1CP9A 2XAQA 3ZMSA 2HG5C 4EKWA 5LGNA 3OEEG 3CCVV 3SYCA 1AI6A 3BY6A 1W0JG 3M99B 4MW8A 2WLIA 3P32A 1Y66A 2X6CA 5L3GA 2A9HA 3JD1A 1R6KA 4BIUA 1AI4A 3W7WA 1MOFA 2A0LA 3P30A 2WLLA 3ASOC 1G8MA 2Z5UA 3OUSA 4X89A 5KUMA 2LFRA 1VQ7V 2ZD9A 1F23A 5LHIA 2DYRB 1I5YA 4JYCA 1S77D 3UM7A 4JTAB 2DYSB 3BEHA 4MTOA 3PJSK 4RAIA 1Q82W 1VQ8V 2XAFA 4R50A 3K9AA 2CK3G 3WG7C 4QE7A 1GM9A 4YXWG 3E2EA 1AI5A 3QO7A 3HPLC 2DW4A 1PKXA 4R6ZA 1ENVA 1W2BU 3CCLV 1QLEC 4DO2A 1P7BA 1YJ9V 5IYCO 1BHAA 3ZRWB 1R73A 1K3EA 2X7RB 3RW0A 3OUFA 1Q81W 3ZMUA 2UXNA 1M57C 2DYRC 3FYIB 2DQ0A 4BW5A 3LUTB 4P2ZA 1QVFU 4GX0A 1QVGU 1OCZC 1VQKV 2WSSG 3SYPA 4JYBA 2ZXWC 3ASNC 5KA5A 4JAVA 1YIJV 3OM3B 3JCZA 4WCEV 1K4DC 2NLJC 1XL4A 1V54C 1JCHA 4I5SA 3CC7V 4H37A 3OEHG 3OAAG 4QNHB 1EBOA 4MW3A 4N23A 1K8AW 4P9OA 2EILB 4KP4A 1RM1C 2MK3A 1EFRG 4CBCA 5KA6A 1H8HG 4LBEC 1M9NA 3K08A 1NVPB 2EIJC 3LSQA 3ETEA 2IU3A 2OT5A 3B8NA 1DLBA 1S3JA 4LCUC 4XDLA 4QPJA 2A79B 3FB8C 4P9PA 3FB7C 5B3SB 3KG2A 1QBZA 3CCEV 2HVKC 4G27B 2W6IG 1QR9A 5H6RA 2Q67A 4PA6A 3SYAA 2HJFC 4F4LA 1XL6A 3ABKB 3W7XA 2HLDG 3JD3A 4R8CA 3ZRWA 2QEXV 2P67A 4J9YB 3AG4B 4WFBV 1NKDA 3UKMA 3ZMZA 2ZDIC 2W0FC 1OCZB 1Y4MA 2Q6AA 4MS2A 4XDKA 2QE7G 2QTOA 2V7QG 3E89A 3H01A 3WFVA 3T1CA 1YJWV 1E1RG 2X6BA 3K0GA 2UXXA 3OMIB 2YEVA 1YJNV 3E8GA 3FB5C 3W7SA 3ZMVA 2BOBC 1RPOA 1JOYA 4ZKIA 1R3IC 2XAHA 1FXKA 3SYQA 3CMAV 3E35A 4WFAV 5LGUA 1GM7A 2YEVB 1SETA 2XASA 4UUJC 3ASOB 3F7YC 3LNMB 3QNEA 4MVRA 1ROPA 2XAGA 2DWEC 3E86A 4UXNA 2DQ3A 1AROP 1GO3F 5H6QA 3DTUB 5IYDO 1K7DA 3G71V 2HFEC 3WG7B 3T2MA 3CD6V 1THZA 4HAMA 5GW7A 2IJIA 3K0DA 2OCCB 1OCOB 4TWKA 4MVZA 4Z1MG 3CCJV 3E8BA 1YSCA 4JGSA 4TSFG 3W7UA 2R9IA 4PELA 4RQEA 1DF4A 2Y48A 4HYOA 1K92A 2XNDG 1VQ6V 3ABLB 2Y69C 3SJQC 4MVSA 4FK5C 3TCUA 2IH1C 1NQTA 3I55V 1YTFB 2ZQMA 3ABMB 1AJQA 4QPKA 1S0VA 4WFGA 1ORQC 1OCCC 3F5WC 1MSWD 3FB6C 3ASNB 2ZXWB 4RUFA 1N8RW 2WWWA 4GX2A 3AEIA 1KP3A 2B5UA 3A0RA 1QR8A 3JYCA 1R3LC 3ABMC 2WLHA 3EFFK 3AG2C 3K06A 1RM1B 4OXSA 4PDRA 3X2QB 3STZC 1SESA 2OCCC 1OZ0A 2F43G 3ZJZA 3D3IA 2EIJB 1TUEB 4MT8A 3CCRV 1PNMA 5CA3A 1E1QG 1FXVA 2M7WA 5B1OA 3ABLC 4UV9A 2ZDIA 2BOCC 5EBMC 2WPDG 2LFSA 1KECA 4DXWA 4G2KA 4MTFA 4JASA 5LGTA 5C93A 5EBLC 5LHGA 3HB3B 4KUMA 4PA9A 3JD4A 2YSUB 3SPHA 2IH3C 1VQ4V 1V55B 3JD0A 4PA3A 4H33A 1QLEB 1F4NA 1BL8A 3ML0A 2JEUA 3MHSC 1NR1A 5L3EA 1W0KG 4HZ3A 1WLEA 2DYSC 5E1AC 3CCMV 2WLJA 1NBMG 1PNKA 3ZMTA 1COWG 3IFXA 3OE7G 3D36A 4FJCC 5LHHA 4JTCB 2P6JA 1E79G 5L3BA 3AG2B 5L3DA 5B1AC 3RVZA 1M1KW 2W6JG 1FXKB 1F51A 2EJRA 1I5XA 2AHYA 1PNLA 4U7OA 2GSMB 1HWYA 3AG3C 4XDJA 4CZZA 4GX1A 5LBQA 3E8HA 2IU0A 2Z3YA 4MVUA 4WFHA 4TT3G 1Q7YW 2ZR3A 3EHBB 2P90A 1VQPV 1S72V 4R7CA 1JJ2U 4N21A 3SPGA 3ZIAG 3T4ZA 3W7TA 1FXKC 2EZOA 4JF3A 1PL0A 3AG4C 1NR7A 1KD1W 2ITCC 2H94A 1AR1B 4FPPA 4KFMA 2XOKG 1KQSU 4I9WA 4PDMA 1DTOA 3ZCCA 3R65A 3ZN0A 5B1AB 2EIMB 4UV8A 4QE9A 5B1NA 1VQLV 1H38A 3AG3B 1H2GA 1OCRB 1AJPA 1M56B 5B1BB 3TK1A 3QO5A 1FFTB 4PDVA 4BIZA 4MVMA 2Q68A 2HVJC 3B8MA 1JVMA 3IC7A 5FL7G 3CCSV 2V1DA 2HR3A 2JJ1G 4FIPC 1K73W 3I56V 3CPWU 3VBBA 4RUEA 2C2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4D C;  1LNQ A;  2NLJ C;  4GX2 A;  4JTD B;  4X88 A;  1XL4 A;  2H8P C;  1V54 C;  2X6A A;  4RO2 A;  4H37 A;  2WLI B;  4MVO A;  2JK5 C;  4QNH B;  4MW3 A;  3JYC A;  1R3L C;  3ABM C;  2WLH A;  3LDC A;  5IY5 C;  3EFF K;  4P9O A;  5BZB A;  3RVY A;  3AG2 C;  2Q69 A;  3K06 A;  3VOU A;  2WLN A;  1V55 C;  2WLL B;  4OXS A;  4PDR A;  4X8A A;  3STZ C;  2R9R B;  4CBC A;  1J95 A;  3OR7 C;  2OCC C;  3IGA C;  4LBE C;  3K08 A;  3K03 A;  2AHZ A;  3ZJZ A;  2EIJ C;  5J9P C;  4ZBM A;  3SPI A;  4LCU C;  2EIK C;  4XDL A;  2DWD C;  3K04 A;  3LDD A;  3LDE A;  4WFF A;  2K1E A;  4J9Z B;  1M56 C;  1KKD A;  2A79 B;  3ABL C;  5CBG A;  2BOC C;  3FB8 C;  1K4C C;  3F7V C;  3FB7 C;  2WLK A;  2KB1 A;  4G28 B;  4P9P A;  3KG2 A;  5EBM C;  5CBF A;  4DXW A;  2HVK C;  4G27 B;  4MTF A;  4PA4 A;  3E8F A;  5EBL C;  2Q67 A;  4PA6 A;  3ABK C;  1R3K C;  4PA9 A;  4WFE A;  5CBH A;  3SYA A;  2HJF C;  4F4L A;  1XL6 A;  3SPH A;  1OCR C;  1R3J C;  2IH3 C;  4R8C A;  5B1B C;  4PA3 A;  5KUK A;  4H33 A;  3E83 A;  3GB7 C;  1BL8 A;  2ATK C;  4J9Y B;  3T4D A;  2EIN C;  3ZRS A;  3UKM A;  5B3S C;  2W0F C;  1G4Y B;  1OCO C;  4HZ3 A;  2Q6A A;  4MS2 A;  2DYS C;  4PDL A;  2P7T C;  4XDK A;  5E1A C;  5EC1 C;  3SPC A;  2QTO A;  3E89 A;  2EIL C;  4P30 A;  2HG5 C;  2EIM C;  2X6B A;  2WLJ A;  5EBW C;  3K0G A;  3T1C A;  4EKW A;  2YEV A;  3SYC A;  3E8G A;  3FB5 C;  3OR6 C;  3IFX A;  4MW8 A;  2WLI A;  2X6C A;  2BOB C;  2A9H A;  4JTC B;  3OGC C;  4MSW C;  1R3I C;  2A0L A;  5B1A C;  3RVZ A;  3SYQ A;  2AHY A;  2WLL A;  3ASO C;  3AG3 C;  4UUJ C;  4XDJ A;  3OUS A;  4X89 A;  5KUM A;  3F7Y C;  3AG1 C;  4GX1 A;  3E8H A;  3LNM B;  4MVR A;  4MVU A;  2ZD9 A;  4WFH A;  2DWE C;  3E86 A;  1ZWI C;  3UM7 A;  4JTA B;  3BEH A;  4MTO A;  4R7C A;  3PJS K;  4RAI A;  2HFE C;  3SPG A;  2WLM A;  4R50 A;  4LP8 A;  3RBZ A;  3T4Z A;  3T2M A;  4PA7 A;  3AG4 C;  3WG7 C;  3X2Q C;  2ITC C;  3TET A;  3K0D A;  4QE7 A;  4KFM A;  4TWK A;  4I9W A;  4MVZ A;  4PDM A;  2QKS A;  3HPL C;  3R65 A;  4MTG A;  4R6Z A;  3E8B A;  4QE9 A;  3SYO A;  1QLE C;  1P7B A;  4HYO A;  3STL C;  2ITD C;  3RW0 A;  5EK0 A;  4MVQ A;  3OUF A;  3SPJ A;  2Y69 C;  1M57 C;  1S5H C;  2DYR C;  4MVS A;  4PDV A;  4MVM A;  2IH1 C;  2Q68 A;  2HVJ C;  3SJQ C;  1JVM A;  3TCU A;  4BW5 A;  3LUT B;  4P2Z A;  4GX0 A;  1OCZ C;  5EC2 C;  4WFG A;  1ORQ C;  1OCC C;  3SYP A;  2ZXW C;  3ASN C;  3F5W C;  4GX5 A;  4RUE A;  3FB6 C;  4RUF A; 
#chains in the Genus database with same CATH topology
 4BWA A;  4JTD B;  4X88 A;  4JAA A;  2OTL V;  4DV0 B;  1J5E B;  2YI9 A;  1SQX H;  3VOU A;  5DM6 V;  2PTM A;  2JIZ G;  4K8X A;  4RQF A;  1VF6 A;  4WF9 V;  3IGA C;  1NT2 B;  3QVN A;  4JI3 B;  2AW9 A;  4DV7 B;  3K59 A;  2NR5 A;  3IC9 A;  1YHQ V;  5A2Q N;  1M56 C;  3ETD A;  5CBF A;  4I9Q A;  1XNQ O;  1WPB A;  1O9H A;  4CC5 A;  5DN6 G;  3ZBH A;  1OCR C;  3GB7 C;  1WJZ A;  1JPX A;  1MSD A;  2ODM A;  1G4Y B;  1GM8 A;  1SRY A;  4FLW A;  4HNA A;  2QM7 A;  4PDL A;  1Y76 B;  2EIK B;  5CMU A;  5EBW C;  3WB1 A;  3K57 A;  1HP8 A;  1VQO V;  3OFN G;  1HR0 O;  2FYU H;  1JX9 A;  4LFA B;  5IE9 A;  3OMA B;  2VQE B;  2OIG A;  4LF9 O;  3DGE A;  2EIN B;  3H1J H;  2QA4 V;  4B3T B;  4PI2 A;  2ZE5 A;  1QHT A;  5LMN O;  1YIT V;  3WB0 A;  3BVO A;  3RT3 C;  3KCX A;  3JAW A;  5FPR A;  4WBN A;  2FTK A;  4NR1 A;  1NS1 A;  2QKS A;  3GWO A;  5H2F Z;  2ITD C;  5EK0 A;  2VQE O;  1AVM A;  1S5H C;  1IBK O;  3HKB A;  4FZ1 A;  2CH7 A;  2F4V O;  3WB2 A;  2KSD A;  4FMT A;  2WLI B;  1ZX3 A;  1AI7 A;  2PF4 E;  3CCQ V;  2HKO A;  5KHG A;  5H9C A;  3LDC A;  5IYZ A;  3OMN B;  3T1H B;  5IY5 C;  2BSK A;  5J2U A;  2UUC B;  4AI8 A;  2Q69 A;  5LMU O;  5IJ0 B;  4X8A A;  3THO A;  4F6R A;  3FYE B;  1NU1 H;  3QF7 A;  2BE3 A;  1MG1 A;  2UU9 O;  2AGA A;  3JSN A;  4TOI A;  2D3O W;  3E22 A;  1U96 A;  2EIK C;  4WBN B;  1K4C C;  1AP5 A;  1YTF D;  1RP3 B;  2HEP A;  5HFL A;  2PYJ A;  3RYF B;  5LMN B;  4JV5 O;  2LW1 A;  2ATK C;  1KUQ A;  4CC6 A;  1PD3 A;  4LFC B;  4L8J A;  2E75 B;  3BAA A;  3ZMS A;  5JH7 A;  2HG5 C;  2Q7H A;  5LGN A;  3OEE G;  3CCV V;  1IUR A;  4B7K A;  1AI6 A;  4MW8 A;  1Y66 A;  1YEW A;  1Q43 A;  2A9H A;  4J7K A;  5KMG B;  1R6K A;  3C90 A;  2JGD A;  3W7W A;  4LH6 A;  4DW0 A;  1M5I A;  2YC0 A;  5LXT B;  3OUS A;  4EB6 B;  2YUA A;  2LFR A;  1FJG B;  3QTC A;  1HDJ A;  1I5Y A;  4X66 B;  4JTA B;  3PJS K;  4RAI A;  2Q7G A;  2XAF A;  4R50 A;  4JI5 B;  3L71 H;  1LR1 A;  4X64 O;  3K9A A;  5LA6 A;  3OTF A;  4QE7 A;  4YXW G;  3E2E A;  1AI5 A;  1PKX A;  4ZIB A;  3Q4H B;  4DO2 A;  1YJ9 V;  2YIB A;  1R73 A;  1HNZ B;  2QWN B;  2XTA A;  1WAZ A;  3HKE B;  3LUT B;  4YY3 B;  2WSS G;  2UXB B;  4O2A B;  2BTQ A;  2NLJ C;  4H37 A;  4CH6 A;  3OEH G;  3OAA G;  3BAB A;  1K8A W;  5JQG B;  5LOV A;  4P9O A;  1S5J A;  2QR4 A;  2OYQ A;  4KP4 A;  2M6Y A;  2F95 B;  3J7A U;  4UCV A;  4YHH O;  3B8N A;  1H2L A;  1S3J A;  1IXB A;  2ARH A;  3ZHQ A;  4DV6 B;  2Q9L A;  4AQY O;  4DV0 O;  2A79 B;  3JAM N;  4UCO A;  1QBZ A;  1ZTE A;  1CXZ B;  5EZY A;  4CS4 A;  3SYA A;  4DR1 B;  1R1B A;  4R8C A;  4WFB V;  1NKD A;  3UKM A;  1LUW A;  4TUY B;  2F93 B;  2QTO A;  2V7Q G;  3WFV A;  3T1C A;  2X6B A;  2UXX A;  3CJH A;  3OTO B;  5LYJ A;  3UO2 A;  1KBH A;  4NXM B;  2YEV B;  1SET A;  3RYC B;  1JJO A;  4DV2 O;  2R9A A;  1XNR B;  3LNM B;  3QNE A;  5GTH Z;  2XAG A;  5AG2 A;  4ICG A;  1ARO P;  2HFE C;  3S3W A;  3WG7 B;  1WP7 A;  2UUB B;  3CD6 V;  4DV4 O;  4K0K O;  4TWK A;  4B3R O;  2QJ1 A;  3APO A;  2YIC A;  2XND G;  1YF2 A;  2Y69 C;  2ZIM A;  1I94 B;  4FK5 C;  1KU9 A;  1BE3 H;  4QPK A;  3EVK A;  1S0V A;  4WFG A;  3A0H Z;  1QU7 A;  4UCS A;  2P4K A;  4GX2 A;  1KP3 A;  3CRA A;  1N34 O;  5K1X A;  1R3L C;  2CE4 A;  1N32 B;  3EFF K;  5LOV B;  3K06 A;  2LW7 A;  3STZ C;  4JI3 O;  4J7J A;  3D3I A;  1TUE B;  3KKY A;  5ITZ A;  3CCR V;  1PNM A;  4QGP A;  5B1O A;  2Q0A A;  4UV9 A;  2ZDI A;  3N2K A;  4DUY B;  2WPD G;  1VP7 A;  1ZAU A;  4UCR A;  4B3T O;  2CTQ A;  5LGT A;  2VQF O;  2Q0O C;  3HB3 B;  4CS3 A;  3SPH A;  1TUB A;  3JD0 A;  4NB5 A;  1QLE B;  5C8Y A;  4JI7 O;  2Q4P A;  1NR1 A;  3ZHV A;  4C7U A;  1HNX B;  4FM0 A;  3K5O A;  5BMV B;  4DV5 O;  3CHX A;  1NI8 A;  3SJA C;  1KMI Z;  5LHH A;  3QG5 A;  1V9P A;  2P6J A;  5LP6 A;  1M1K W;  2W6J G;  2EJR A;  2AHY A;  3U11 A;  3AG3 C;  4XDJ A;  3HKC B;  4TT3 G;  2P90 A;  3BA8 A;  3JAT B;  1VQP V;  1VIB A;  1EN4 A;  4I0X B;  1JJ2 U;  2BSK B;  4N21 A;  3FFQ A;  3SPG A;  3ZIA G;  3N2K B;  1W59 A;  3BHP A;  3VQW A;  2H94 A;  1AR1 B;  4FPP A;  5K1P A;  2XOK G;  3ZCC A;  4B3M B;  2EIM B;  4QE9 A;  1H38 A;  3H1H H;  5C8Y B;  1OCR B;  1M56 B;  4J42 A;  2RMK B;  4PDV A;  4MVM A;  2YS8 A;  4B7E A;  1VEW A;  1Q6H A;  2JJ1 G;  3H1K H;  3I56 V;  3CPW U;  2LQT A;  2JJ2 G;  1US6 A;  2H8P C;  1G1X B;  2EUL A;  4RO2 A;  2UUC O;  4MVO A;  2OWO A;  4JYA O;  1XHX A;  4J10 A;  2XAJ A;  1KYO F;  4B3M O;  1QQC A;  2QWO B;  2UXB O;  4OGQ B;  1BT8 A;  1X4T A;  1DGS A;  3G4S V;  3K03 A;  4DR7 O;  2PI4 A;  4NXN O;  2X0L A;  3ZN1 A;  5J9P C;  3B4S A;  3SPI A;  1XRE A;  4X1Y B;  2DWD C;  2RN9 A;  4GYC B;  1K5Q A;  3RYI A;  2K1E A;  1BHB A;  1NH2 B;  5B5E Z;  2BTO A;  3FKS G;  4NKG B;  4GKJ B;  1R3K C;  3K5L A;  1FPO A;  5B1B C;  5HFM A;  1TVK A;  3ZRS A;  1YXB A;  3AG1 B;  3FD9 A;  1FKA O;  2QDO A;  4E2L A;  2F4V B;  2JRI A;  2LP7 A;  2P7T C;  5EC1 C;  3Q4H A;  3K79 A;  5CA1 A;  4P30 A;  3JAK B;  5JCO C;  2P22 C;  1VQ5 V;  4MSW C;  2DN9 A;  3CC4 V;  4I55 A;  3DC6 A;  5IWA B;  1VQ9 V;  2OTJ V;  2L35 A;  2G38 A;  3AG1 C;  4U3J A;  4LNU A;  2ZCE A;  3G80 A;  1ZWI C;  1AJN A;  1SZT A;  4BW9 A;  5L3F A;  3OW2 U;  3T1Y B;  4QIW F;  2RJZ A;  4UB6 Z;  1I08 A;  3RBZ A;  1KKC A;  1JQ0 A;  1KP2 A;  4PA7 A;  1SA0 B;  1L8D A;  4LF5 O;  1V54 B;  1M57 B;  3TET A;  4DV3 O;  4MTX A;  1D2D A;  1AP6 A;  3JCU Z;  2ZM6 O;  3J80 N;  4QJF B;  1KB9 F;  2JEX A;  4UVA A;  1VQN V;  3B09 A;  4DUY O;  1SKV A;  2JDI G;  3H1L H;  4PV1 B;  3JAK A;  4LF4 O;  3HKB B;  1L1F A;  3ABT A;  4FM2 A;  2WLL B;  4U3J B;  1MNG A;  1WNS A;  1H2M A;  2R9R B;  3RGB A;  3ZX6 A;  5BY1 A;  1J95 A;  2ZIO A;  2HHH B;  4NYK A;  4I4T B;  5FLX N;  2IBZ H;  4YJ3 A;  1IBK B;  3RYC A;  3T1H O;  1H2S B;  4XBF A;  1PL4 A;  2CTR A;  2WLK A;  2KB1 A;  4FLX A;  3UO3 A;  3E22 B;  5GON B;  3ZRX A;  1VF5 B;  2PGG A;  3BFR A;  3ABK C;  4WFE A;  2L6L A;  2IJJ A;  2F66 C;  1FXH A;  4JI6 B;  1GMG A;  1IBL B;  1PM9 A;  1Q86 W;  2QM8 A;  1NVP D;  3SPC A;  1YZB A;  1WA8 B;  3D3Q A;  5CA1 B;  1N36 O;  1MA1 A;  1MZF A;  1JMK C;  5L3G A;  4IIJ B;  4JI4 O;  1D5A A;  1AI4 A;  4DRX B;  1JFF A;  4AQY B;  2CTP A;  1G8M A;  5KUM A;  2ZD9 A;  5KMG A;  5FNV A;  4LNU B;  2B9Z A;  1I0H A;  5IJ9 A;  4TV8 B;  4MTO A;  1Q82 W;  3LSU A;  5LXT A;  4TV9 B;  3L74 H;  2CK3 G;  3WG7 C;  2UU9 B;  2ADP A;  1GM9 A;  3ZHS A;  3M8A A;  5CA0 A;  3HPL C;  2DW4 A;  4UCU A;  3ZHU A;  1W2B U;  2QM4 A;  4DR7 B;  2ZNJ A;  3RW0 A;  3OUF A;  4ZI7 B;  4GX0 A;  4EFE A;  2N05 A;  3SYP A;  4JYB A;  2ZE8 A;  1YIJ V;  3MAQ A;  3CRR A;  1K4D C;  4UCT A;  1XL4 A;  1JCH A;  2KG7 A;  4F6E A;  4QNH B;  4GKJ O;  3P3P A;  1VAR A;  1GRJ A;  1O9G A;  2CTW A;  4CBC A;  5KA6 A;  1N33 B;  4J41 A;  2FL4 A;  2EIJ C;  3LSQ A;  2IU3 A;  2OT5 A;  1DLB A;  4XDL A;  2Q5Z A;  3K58 A;  4P9P A;  1SQV H;  4CH5 A;  2GUZ B;  1MZE A;  1XHZ A;  3FAV B;  4X1K A;  5GON A;  4GLX A;  1AB3 A;  2HJF C;  2HLD G;  2QEX V;  3ZRW A;  2LGQ A;  2P67 A;  3AG4 B;  1T5E A;  2FML A;  4TQF A;  1N32 O;  1OCZ B;  1Y4M A;  5EIB D;  2EJ7 A;  2ZKO A;  5JVD B;  1YDX A;  1YJW V;  4LR3 A;  4DR1 O;  1YJN V;  3FB5 C;  3ZMV A;  4IYI A;  1Q5O A;  1RPO A;  3OD4 A;  4LF8 O;  2PZS A;  5EYP A;  1FXK A;  2DMX A;  4DRX A;  3E35 A;  5KX5 B;  1OV9 A;  1GM7 A;  2CAZ C;  3ASO B;  4HBN A;  3JAS A;  1ROP A;  4K0K B;  4IYH A;  3E86 A;  1GO3 F;  5IJ9 B;  5KLV H;  1K7D A;  3G71 V;  4DUZ O;  1THZ A;  4HAM A;  4OPH A;  2IJI A;  3K0D A;  4AIL C;  1PV0 A;  2OCC B;  2Y4U A;  4JI2 O;  3E8B A;  4TSF G;  4X1I A;  4JI6 O;  3W7U A;  2R9I A;  4ZHQ B;  1DF4 A;  1SC5 B;  1K92 A;  1VQ6 V;  3ABL B;  3SJQ C;  4GKK O;  1AJQ A;  3D8C A;  2ADQ B;  1OCC C;  4JI4 B;  1MSW D;  3FB6 C;  2ZXW B;  1N8R W;  2WWW A;  3AEI A;  4D7S A;  1B04 A;  4B3S O;  4DK1 A;  2B5U A;  3A0R A;  2A06 H;  4X20 B;  3ABM C;  3AG2 C;  1RM1 B;  3SGI A;  2QWP B;  5TIS Z;  3JAS B;  1SES A;  2OCC C;  3CRC A;  4JV5 B;  1X59 A;  3T1Y O;  1OZ0 A;  2F43 G;  2CDY A;  3CWB H;  2EIJ B;  3HKD B;  4OPA A;  1HNZ O;  5CA3 A;  4YIP A;  5F2V O;  1BZK A;  1EM1 A;  3N27 A;  5CB4 B;  3VQY A;  3MDS A;  2LFS A;  2P06 A;  5C93 A;  5ITZ B;  4KUM A;  1N36 B;  5BMV A;  1TA8 A;  4PA3 A;  3JAL A;  4X65 B;  2H3O A;  4O2A A;  1BL8 A;  4DUZ B;  4FFK A;  2Q73 A;  5L3E A;  1AR5 A;  4HZ3 A;  1WLE A;  5E1A C;  1SQF A;  2F23 A;  1NBM G;  4O4L B;  3ICX A;  3ZMT A;  1COW G;  1I94 O;  2HP8 A;  2PUS A;  5GTI Z;  3IFX A;  4FJC C;  1XUQ A;  1GAX A;  2FKX A;  2E5L O;  1E79 G;  4X65 O;  3GVM A;  5L3B A;  3RVZ A;  2Y4T A;  1I5X A;  1P84 F;  1PNL A;  4U7O A;  2KQX A;  1HWY A;  3DSQ A;  2VQF B;  4GX1 A;  4MVU A;  1Q7Y W;  2KKW A;  4DV4 B;  3K5N A;  1ZLZ A;  2QKA A;  4R7C A;  1TGO A;  1IX9 A;  3W7T A;  4JF3 A;  4DV3 B;  1FD9 A;  4DV7 O;  4H44 B;  1KD1 W;  4DK0 A;  1Y6X A;  4I9W A;  4NTX A;  5B1A B;  3A8T A;  4BR6 A;  1VQL V;  4KHP O;  2Z0A A;  1J5E O;  3AG3 B;  1H2G A;  3OTO O;  4CH3 A;  3B8M A;  4DW1 A;  4JZG A;  4B3S B;  2A7W A;  3L72 H;  4TQD A;  1QCE A;  5CN0 A;  5KAF Z;  1CPY A;  3K9S A;  4K8Z A;  2WLN A;  3BA9 A;  2YXY A;  4D7T A;  4BAY A;  3RYI B;  1NJI W;  1Y74 B;  1F4M A;  1FYJ A;  1WB8 A;  4H13 B;  3OGI B;  3ZED A;  1XEQ A;  2AHZ A;  2IJK A;  4JYA B;  2UXC B;  3TJT A;  3K04 A;  4B3R B;  1WPX A;  1OHH G;  4AHC A;  1RSO A;  5J2T A;  1L0L H;  1YI2 V;  1IBM O;  1DF5 A;  1VF6 C;  2EIN C;  1SQQ H;  1MAB G;  3H9V A;  3JAR B;  1B06 A;  2EIL C;  2EIM C;  1AR4 A;  4CS2 A;  1Q6U A;  2E74 B;  1IBM B;  3MD0 A;  2PYL A;  2ZT9 B;  3UT5 A;  4JPR A;  1ZL8 B;  2IW5 A;  4GCZ A;  2W0X A;  1GKF A;  2QTS A;  1H2K A;  1GTO A;  4JZ2 A;  4LF5 B;  1GN6 A;  4JI5 O;  2WLM A;  2B1I A;  1XIL A;  1M93 A;  3JD2 A;  4MTG A;  1N34 B;  2PY5 A;  1XNQ B;  4E4E A;  5JJJ B;  4RWU A;  1SA0 A;  3K3W A;  2GHY A;  3STL C;  1NH2 D;  1K5S A;  4EEQ A;  2GUZ A;  4GT1 A;  1M90 W;  1B6Q A;  1K33 A;  3U0Z A;  1FS0 G;  3HKE A;  1CEZ A;  4HNA B;  2WAM A;  5EC2 C;  1N0N A;  5LP6 B;  1QLN A;  4GX5 A;  2ZR2 A;  1P49 A;  3X2Q C;  4JYY A;  2RCV A;  3ETQ A;  2RNB A;  2O57 A;  3KZI Z;  4UVB A;  1K34 A;  3C3S A;  5JVD A;  3MHH C;  3SR2 C;  1XMQ B;  3AK2 A;  2RDC A;  3RYH B;  1UJW B;  4J7Z A;  3CC2 V;  3CYO A;  5EYP B;  4ZBM A;  4DV2 B;  3LDD A;  3LDE A;  4WFF A;  4NXN B;  2LO1 A;  5L3C A;  2WA4 A;  5JJN B;  4ASU G;  1RSO B;  5J2T B;  4PA4 A;  4UVC A;  3E8F A;  5EZY B;  4LF4 B;  1VQM V;  5IY5 B;  4UFZ A;  3E83 A;  1IDS A;  1NZ6 A;  3J81 N;  1FJG O;  5B3S C;  4IIJ A;  1EZJ A;  1SS3 A;  4O4J A;  4L87 A;  1K9M W;  4ZHQ A;  3CRQ A;  5FPO A;  2XAQ A;  3CXC U;  1DK1 A;  3SYC A;  1W0J G;  2WLI A;  5IWA O;  2K9P A;  3JD1 A;  3IAY A;  4FVM A;  1WA8 A;  2CUG A;  4F6R B;  2Z5U A;  1F23 A;  2DYR B;  4JYC A;  3UM7 A;  1VQ8 V;  3CE2 A;  1XMO O;  3NR7 A;  4YJ2 B;  2YXH A;  3CB2 A;  5FNV B;  4LF6 B;  1U97 A;  1BQ0 A;  4KL1 A;  3QO7 A;  1GN3 A;  2Y0P A;  1ENV A;  3CCL V;  1SZX A;  1P7B A;  3BCC H;  1BHA A;  2X7R B;  1Q81 W;  3ZMU A;  2YIA A;  1M57 C;  1BSM A;  2DYR C;  4BW5 A;  1OCZ C;  4JI1 B;  1VQK V;  1FAF A;  3ASN C;  5KA5 A;  4J11 A;  4I55 B;  3JCZ A;  3JSL A;  4WCE V;  1V54 C;  3DXR A;  4I5S A;  4ZI7 A;  1Z5V A;  3M7M X;  4FLY A;  4PI0 A;  2YDE A;  1XMQ O;  4FM1 A;  3N2G B;  4FLT A;  1RM1 C;  1EFR G;  5KHH A;  1L0N H;  1H8H G;  4LBE C;  3K08 A;  2ZM6 B;  4LF7 B;  4LCU C;  4QPJ A;  5DED A;  3FB8 C;  3FB7 C;  5B3S B;  2ETN A;  4G27 B;  2XHB A;  2W6I G;  1QR9 A;  3H1I H;  5BXZ A;  4F4L A;  4LWS A;  3W7X A;  1WP8 A;  1SQG A;  3K5M A;  2ZDI C;  3FAV A;  4X1K B;  5KHI A;  2Q6A A;  5DEC A;  1GN4 A;  4LF6 O;  5JWP A;  3OMI B;  3E8G A;  3W7S A;  2LGW A;  4FLV A;  2BOB C;  3UQ8 A;  2P4V A;  2E3C A;  2QSA A;  2XAH A;  1A32 A;  3RFR A;  1WN7 A;  5LGU A;  2XAS A;  1G6U A;  3JAT A;  2DWE C;  4UXN A;  5H6Q A;  1AIL A;  5IYD O;  1S5L Z;  4JI0 B;  2F1M A;  5LP6 C;  4X1I B;  3T2M A;  5GW7 A;  2YXL A;  4X64 B;  3AK1 A;  1ZUQ A;  3CCJ V;  1URF A;  4PEL A;  4RQE A;  4HYO A;  3AK3 A;  4NVP A;  2IH1 C;  3I55 V;  3VQX A;  1LUV A;  1XOU A;  2VWJ A;  4X20 A;  1UFI A;  2AXT Z;  3ASN B;  4RUF A;  2BTQ B;  1HNW B;  1TAE A;  5EIB C;  2BCC H;  1YVW A;  4LFB O;  3JYC A;  4TV8 A;  2WLH A;  4Q6G A;  3WU2 Z;  4O4I B;  1Y67 A;  3S3X A;  4OXS A;  4PDR A;  3X2Q B;  1BGY H;  5B66 Z;  1WB7 A;  3UT5 B;  1ZL8 A;  4X1Y A;  2D2C B;  2OIE A;  3CSX A;  4YHH B;  5IT9 N;  4GUN A;  1E1Q G;  1FXV A;  3JAL B;  5EBM C;  4DV6 O;  3CEI A;  4JAS A;  4LF9 B;  5EBL C;  5LHG A;  1BQZ A;  3JD4 A;  2YSU B;  5KHK A;  1TVK B;  2IH3 C;  1VQ4 V;  1V55 B;  5CB4 A;  4H33 A;  4IHJ B;  4X62 B;  5LL6 Y;  3ZS8 C;  3ML0 A;  2GTA A;  1XMO B;  2DYS C;  4PD4 F;  3L9D A;  2WLJ A;  4DR3 O;  3CJH B;  2VWK A;  3OE7 G;  4OX9 B;  1JA8 A;  3PN1 A;  5BR8 B;  4JTC B;  1B3Q A;  1EZV H;  4DV1 O;  1MMM A;  5L3D A;  1F51 A;  2GSM B;  3HR0 A;  4CZZ A;  5LBQ A;  3E8H A;  2IU0 A;  2Z3Y A;  2ZR3 A;  3EHB B;  1FFX A;  5KHJ A;  5D5Q A;  2UUB O;  3G67 A;  5J2U B;  1IBL O;  2R72 A;  3T4Z A;  2EZO A;  4DR2 O;  2R70 A;  1NR7 A;  2OCH A;  1H2N A;  3VQV A;  2AZ0 A;  1KQS U;  4OX9 O;  1XI1 A;  4PDM A;  1DTO A;  3R65 A;  1D5N A;  5B1N A;  4I50 B;  3F5T A;  4IHJ A;  1AJP A;  3TK1 A;  3QO5 A;  1FFT B;  2Y0I A;  3FX7 A;  2Q68 A;  3IC7 A;  4DR6 B;  2HR3 A;  4FIP C;  3RYF A;  1K73 W;  3VBB A;  5KX5 A;  3A2F A;  3BPZ A;  2GDS A;  4CH4 A;  2JK5 C;  2EZP A;  3RWR D;  2UXD O;  5JH7 B;  3RVY A;  4O4I A;  1K97 A;  1XBL A;  4LH7 A;  1SER A;  3OR7 C;  2B1G A;  1BMF G;  3NXS A;  4B08 A;  1SQP H;  1S76 D;  4DR4 O;  5E79 Z;  4K35 A;  4FFB A;  1UPG A;  3F7V C;  4KXR A;  3CCU V;  4G28 B;  4UB8 Z;  3B77 A;  4W4K A;  4I50 A;  1R3J C;  1TUB B;  2ZE7 A;  1GK9 A;  4U7N A;  1RFY A;  2Y69 B;  3LSS A;  2HJD A;  4JAU A;  3DC5 A;  3OR6 C;  5JJE B;  2DOS A;  1NTZ H;  3TGU H;  4DYL A;  3OGC C;  3ZRV A;  3G6E V;  2EBO A;  1SF9 A;  3L70 H;  4GZR B;  4ZOL A;  2IJH A;  3R66 A;  3RN4 A;  3HKC A;  4LF8 B;  2UUA O;  5JQG A;  1RPR A;  1FFX B;  1IXM A;  1P4R A;  4FFB B;  1OCC B;  4YJ3 B;  2XUM A;  4LP8 A;  3CS5 A;  1F7Y A;  1BS3 A;  1H8E G;  2XT9 A;  4X9Q A;  1VF7 A;  2PI5 A;  3JAW B;  3SYO A;  2RQ6 A;  4MVQ A;  3SPJ A;  4I7Z B;  5H5N A;  3UCS C;  2JS5 A;  1M4U A;  5IYZ B;  1LNQ A;  2Q7E A;  2WA3 A;  2X6A A;  1OJH A;  3CME V;  3RYH A;  1HW7 A;  5JCO A;  2CH7 B;  3B40 A;  4IGG A;  5BZB A;  1IVS A;  2N74 A;  1V55 C;  5LYJ B;  3ETG A;  4A5U B;  4FLU A;  3ABU A;  1KC8 W;  4DR4 B;  5LMU B;  5IJ0 A;  1GN2 A;  1R6N A;  2IM9 A;  2GTS A;  4J9Z B;  5IYB O;  1KKD A;  4TV9 A;  5CBG A;  3D36 C;  3TXS A;  3QO8 A;  3CRM A;  4NTW A;  4O4J B;  5CBH A;  2UUA B;  5KUK A;  3I5D A;  4PHZ A;  4EFB A;  3CP1 A;  3T4D A;  1I7F A;  4LC1 A;  4JI2 B;  4PJ0 Z;  5KAI Z;  1Q3E A;  1OCO C;  2LJ2 A;  1NTK H;  3CX5 F;  2JGU A;  4Q20 A;  4O2B B;  5IDJ A;  2NNU A;  2A3Q A;  1CP9 A;  4EKW A;  1HNW O;  3BY6 A;  3M99 B;  3GWK C;  3P32 A;  2X6C A;  1ZSP A;  4BIU A;  1MOF A;  2A0L A;  3P30 A;  2WLL A;  3ASO C;  4X89 A;  1VQ7 V;  4NXM O;  5LHI A;  5LA6 B;  1S77 D;  1BCC H;  2DYS B;  3BEH A;  3EXA A;  3BRC A;  4EB6 A;  3A0B Z;  2CGN A;  3JAR A;  3B2E E;  4R6Z A;  4DR5 O;  3IJ4 A;  1QLE C;  5IYC O;  3ZRW B;  1K3E A;  1Z5W A;  2UXN A;  3DXR B;  3FYI B;  2DQ0 A;  3SJB C;  4P2Z A;  1QVF U;  3APQ A;  4O2B A;  2GBO A;  2VRZ A;  1QVG U;  2ZXW C;  1JR9 A;  4JAV A;  3OM3 B;  3N2G A;  4LF7 O;  3CC7 V;  4X62 O;  3O65 A;  1EBO A;  4MW3 A;  4N23 A;  4JI8 O;  4IL6 Z;  2EIL B;  4DR5 B;  1R6T A;  2MK3 A;  2MW2 B;  2YI8 A;  2E76 B;  1M9N A;  1NVP B;  2ZIN A;  4I4T A;  3ETE A;  3HKD A;  4YIO A;  5D5P A;  2GV9 A;  4LWS B;  2QKC A;  2UXD B;  4X66 O;  1XQ8 A;  2V4D A;  3KG2 A;  3LNN A;  3CCE V;  2HVK C;  4I0X A;  5H6R A;  2Q67 A;  4PA6 A;  4TUY A;  1XL6 A;  3ABK B;  3JD3 A;  4BIO A;  4J9Y B;  2YID A;  4DR2 B;  4H0L B;  3ZMZ A;  2W0F C;  4LFA O;  4MS2 A;  4XDK A;  2QE7 G;  1EN6 A;  3E89 A;  4GKK B;  3H01 A;  1E1R G;  1XNR O;  5BR8 O;  3K0G A;  2YEV A;  2KG7 B;  1JOY A;  4NTY A;  4ZKI A;  4DV5 B;  4JI1 O;  4IT5 A;  1SQB H;  1R3I C;  3O9O A;  3SYQ A;  3CMA V;  1PP9 H;  4WFA V;  1N4C A;  1Q8I A;  1JFF B;  3L75 H;  3ZHT A;  4UUJ C;  1N0J A;  3AG7 A;  3F7Y C;  4MVR A;  1Q6I A;  4O4H B;  2DQ3 A;  1HR0 B;  4W4L A;  3DTU B;  2NN4 A;  3KCY A;  2QWQ B;  2QWR B;  2ILM A;  1OCO B;  4LFC O;  2P5O A;  2DE0 X;  4MVZ A;  4Z1V A;  4Z1M G;  5CA0 B;  4K3A A;  1YSC A;  4JGS A;  3P3N A;  3C3T A;  2YIB D;  2Y48 A;  5A9G A;  1P7G A;  4MVS A;  3TCU A;  2ZNI A;  4DR3 B;  1NQT A;  1YTF B;  2ZQM A;  3ABM B;  1ORQ C;  2VS0 A;  2JGD B;  1QNM A;  3F5W C;  4ABM A;  4Z2W A;  4O4L A;  1XDC A;  3SDL A;  4JI8 B;  1Z2G A;  1QR8 A;  4YJ2 A;  1GH6 A;  3ZJZ A;  4U3F H;  1NTM H;  4FZ0 A;  4MT8 A;  2AZ2 A;  4ZOL B;  2M7W A;  3ABL C;  2BOC C;  3SJC C;  1YCI A;  2EX3 A;  1KEC A;  3OT7 A;  4DXW A;  4DR6 O;  4G2K A;  4MTF A;  4JI0 O;  1PPJ H;  3G6B A;  4PA9 A;  2HHH O;  4LFB B;  4KHP B;  1F4N A;  1IZ3 A;  2JEU A;  3MHS C;  3CXH F;  1W0K G;  2JS3 A;  4DV1 B;  4YY3 O;  3CCM V;  1PNK A;  2CGO A;  3D36 A;  1VMG A;  4JI7 B;  3AG2 B;  5B1A C;  1FXK B;  1HNX O;  1Q90 D;  4D6T H;  2FB5 A;  2JVD A;  2UXC O;  4WFH A;  2N04 A;  1Y74 A;  3L73 H;  4O4H A;  1S72 V;  1EN5 A;  1FXK C;  1PL0 A;  3AG4 C;  2DJV A;  2ITC C;  4J80 A;  3U10 A;  2E5L B;  4KFM A;  3ZN0 A;  4UV8 A;  3ZHR A;  2ZE6 A;  5B1B B;  1N33 O;  4FLZ A;  4BIZ A;  2QGN A;  2HVJ C;  1JVM A;  5FL7 G;  3CCS V;  2V1D A;  2Q8V A;  1Y76 A;  3TXQ A;  4RUE A;  2C2A A; 
#chains in the Genus database with same CATH homology
 2JJ2 G;  4JTD B;  4X88 A;  2H8P C;  4RO2 A;  2OTL V;  4MVO A;  1QCE A;  2JK5 C;  2EZP A;  5CN0 A;  2XAJ A;  1CPY A;  3RVY A;  3VOU A;  2WLN A;  1K97 A;  4BAY A;  5DM6 V;  1NJI W;  1SER A;  2JIZ G;  1F4M A;  4RQF A;  3OR7 C;  2B1G A;  4WF9 V;  3IGA C;  3G4S V;  3K03 A;  2PI4 A;  2AHZ A;  2X0L A;  3ZN1 A;  5J9P C;  1BMF G;  2IJK A;  3NXS A;  3SPI A;  1S76 D;  2DWD C;  3K04 A;  1WPX A;  1K5Q A;  1YHQ V;  2K1E A;  1OHH G;  1M56 C;  1BHB A;  1NH2 B;  3ETD A;  3F7V C;  3CCU V;  4G28 B;  5CBF A;  3B77 A;  3FKS G;  1YI2 V;  5DN6 G;  1R3K C;  1DF5 A;  1OCR C;  1R3J C;  5B1B C;  5HFM A;  1GK9 A;  3GB7 C;  4U7N A;  3ZRS A;  2EIN C;  3AG1 B;  1JPX A;  1G4Y B;  1GM8 A;  1MAB G;  2Y69 B;  3LSS A;  1SRY A;  2LP7 A;  4JAU A;  4E2L A;  2QM7 A;  4PDL A;  2P7T C;  5EC1 C;  2EIK B;  3K79 A;  2EIL C;  4P30 A;  2EIM C;  5CMU A;  5EBW C;  1VQO V;  3OR6 C;  3OFN G;  3MD0 A;  1VQ5 V;  3OGC C;  4MSW C;  3ZRV A;  3G6E V;  4JPR A;  2EBO A;  2IW5 A;  4GCZ A;  1JX9 A;  1GKF A;  3CC4 V;  1VQ9 V;  3OMA B;  2OTJ V;  3DGE A;  2EIN B;  2IJH A;  3AG1 C;  2QA4 V;  1GTO A;  1ZWI C;  1AJN A;  1SZT A;  5L3F A;  3OW2 U;  1RPR A;  1YIT V;  1IXM A;  4QIW F;  1P4R A;  2WLM A;  1OCC B;  4LP8 A;  3RBZ A;  2B1I A;  1KP2 A;  1JQ0 A;  4PA7 A;  1V54 B;  1M57 B;  2FTK A;  1H8E G;  3TET A;  4MTX A;  3JD2 A;  2QKS A;  4MTG A;  2PI5 A;  3GWO A;  3SYO A;  3K3W A;  2GHY A;  3STL C;  2ITD C;  1K5S A;  1NH2 D;  5EK0 A;  4MVQ A;  3SPJ A;  4GT1 A;  1M90 W;  1B6Q A;  1S5H C;  1K33 A;  1CEZ A;  1FS0 G;  4QJF B;  2JEX A;  4UVA A;  2WAM A;  1VQN V;  5EC2 C;  1QLN A;  2JDI G;  4GX5 A;  2ZR2 A;  3X2Q C;  1LNQ A;  2X6A A;  4UVB A;  4FMT A;  3CME V;  2WLI B;  1K34 A;  1AI7 A;  3CCQ V;  1L1F A;  3ABT A;  2HKO A;  5H9C A;  3LDC A;  3MHH C;  3OMN B;  5IY5 C;  5BZB A;  2Q69 A;  1V55 C;  2WLL B;  4X8A A;  3ETG A;  3FYE B;  2R9R B;  1J95 A;  1UJW B;  1MG1 A;  3CC2 V;  3ABU A;  3CYO A;  1KC8 W;  2D3O W;  4ZBM A;  2EIK C;  3LDD A;  1R6N A;  3LDE A;  4WFF A;  4J9Z B;  5IYB O;  1KKD A;  4XBF A;  5CBG A;  5L3C A;  1K4C C;  2WLK A;  2KB1 A;  4ASU G;  1YTF D;  3QO8 A;  4PA4 A;  4UVC A;  3E8F A;  3ZRX A;  5HFL A;  1VQM V;  5IY5 B;  3ABK C;  4WFE A;  5CBH A;  2IJJ A;  5KUK A;  1FXH A;  3E83 A;  3CP1 A;  2ATK C;  3T4D A;  1GMG A;  4LC1 A;  5B3S C;  1EZJ A;  1OCO C;  1PD3 A;  1Q86 W;  4Q20 A;  2QM8 A;  1NVP D;  4L87 A;  3SPC A;  5IDJ A;  2NNU A;  1K9M W;  3CXC U;  1CP9 A;  2XAQ A;  3ZMS A;  2HG5 C;  4EKW A;  5LGN A;  3OEE G;  3CCV V;  3SYC A;  1AI6 A;  3BY6 A;  1W0J G;  3M99 B;  4MW8 A;  2WLI A;  3P32 A;  1Y66 A;  2X6C A;  5L3G A;  2A9H A;  3JD1 A;  1R6K A;  4BIU A;  1AI4 A;  3W7W A;  1MOF A;  2A0L A;  3P30 A;  2WLL A;  3ASO C;  1G8M A;  2Z5U A;  3OUS A;  4X89 A;  5KUM A;  2LFR A;  1VQ7 V;  2ZD9 A;  1F23 A;  5LHI A;  2DYR B;  1I5Y A;  4JYC A;  1S77 D;  3UM7 A;  4JTA B;  2DYS B;  3BEH A;  4MTO A;  3PJS K;  4RAI A;  1Q82 W;  1VQ8 V;  2XAF A;  4R50 A;  3K9A A;  2CK3 G;  3WG7 C;  4QE7 A;  1GM9 A;  4YXW G;  3E2E A;  1AI5 A;  3QO7 A;  3HPL C;  2DW4 A;  1PKX A;  4R6Z A;  1ENV A;  1W2B U;  3CCL V;  1QLE C;  4DO2 A;  1P7B A;  1YJ9 V;  5IYC O;  1BHA A;  3ZRW B;  1R73 A;  1K3E A;  2X7R B;  3RW0 A;  3OUF A;  1Q81 W;  3ZMU A;  2UXN A;  1M57 C;  2DYR C;  3FYI B;  2DQ0 A;  4BW5 A;  3LUT B;  4P2Z A;  1QVF U;  4GX0 A;  1QVG U;  1OCZ C;  1VQK V;  2WSS G;  3SYP A;  4JYB A;  2ZXW C;  3ASN C;  5KA5 A;  4JAV A;  1YIJ V;  3OM3 B;  3JCZ A;  4WCE V;  1K4D C;  2NLJ C;  1XL4 A;  1V54 C;  1JCH A;  4I5S A;  3CC7 V;  4H37 A;  3OEH G;  3OAA G;  4QNH B;  1EBO A;  4MW3 A;  4N23 A;  1K8A W;  4P9O A;  2EIL B;  4KP4 A;  1RM1 C;  2MK3 A;  1EFR G;  4CBC A;  5KA6 A;  1H8H G;  4LBE C;  1M9N A;  3K08 A;  1NVP B;  2EIJ C;  3LSQ A;  3ETE A;  2IU3 A;  2OT5 A;  3B8N A;  1DLB A;  1S3J A;  4LCU C;  4XDL A;  4QPJ A;  2A79 B;  3FB8 C;  4P9P A;  3FB7 C;  5B3S B;  3KG2 A;  1QBZ A;  3CCE V;  2HVK C;  4G27 B;  2W6I G;  1QR9 A;  5H6R A;  2Q67 A;  4PA6 A;  3SYA A;  2HJF C;  4F4L A;  1XL6 A;  3ABK B;  3W7X A;  2HLD G;  3JD3 A;  4R8C A;  3ZRW A;  2QEX V;  2P67 A;  4J9Y B;  3AG4 B;  4WFB V;  1NKD A;  3UKM A;  3ZMZ A;  2ZDI C;  2W0F C;  1OCZ B;  1Y4M A;  2Q6A A;  4MS2 A;  4XDK A;  2QE7 G;  2QTO A;  2V7Q G;  3E89 A;  3H01 A;  3WFV A;  3T1C A;  1YJW V;  1E1R G;  2X6B A;  3K0G A;  2UXX A;  3OMI B;  2YEV A;  1YJN V;  3E8G A;  3FB5 C;  3W7S A;  3ZMV A;  2BOB C;  1RPO A;  1JOY A;  4ZKI A;  1R3I C;  2XAH A;  1FXK A;  3SYQ A;  3CMA V;  3E35 A;  4WFA V;  5LGU A;  1GM7 A;  2YEV B;  1SET A;  2XAS A;  4UUJ C;  3ASO B;  3F7Y C;  3LNM B;  3QNE A;  4MVR A;  1ROP A;  2XAG A;  2DWE C;  3E86 A;  4UXN A;  2DQ3 A;  1ARO P;  1GO3 F;  5H6Q A;  3DTU B;  5IYD O;  1K7D A;  3G71 V;  2HFE C;  3WG7 B;  3T2M A;  3CD6 V;  1THZ A;  4HAM A;  5GW7 A;  2IJI A;  3K0D A;  2OCC B;  1OCO B;  4TWK A;  4MVZ A;  4Z1M G;  3CCJ V;  3E8B A;  1YSC A;  4JGS A;  4TSF G;  3W7U A;  2R9I A;  4PEL A;  4RQE A;  1DF4 A;  2Y48 A;  4HYO A;  1K92 A;  2XND G;  1VQ6 V;  3ABL B;  2Y69 C;  3SJQ C;  4MVS A;  4FK5 C;  3TCU A;  2IH1 C;  1NQT A;  3I55 V;  1YTF B;  2ZQM A;  3ABM B;  1AJQ A;  4QPK A;  1S0V A;  4WFG A;  1ORQ C;  1OCC C;  3F5W C;  1MSW D;  3FB6 C;  3ASN B;  2ZXW B;  4RUF A;  1N8R W;  2WWW A;  4GX2 A;  3AEI A;  1KP3 A;  2B5U A;  3A0R A;  1QR8 A;  3JYC A;  1R3L C;  3ABM C;  2WLH A;  3EFF K;  3AG2 C;  3K06 A;  1RM1 B;  4OXS A;  4PDR A;  3X2Q B;  3STZ C;  1SES A;  2OCC C;  1OZ0 A;  2F43 G;  3ZJZ A;  3D3I A;  2EIJ B;  1TUE B;  4MT8 A;  3CCR V;  1PNM A;  5CA3 A;  1E1Q G;  1FXV A;  2M7W A;  5B1O A;  3ABL C;  4UV9 A;  2ZDI A;  2BOC C;  5EBM C;  2WPD G;  2LFS A;  1KEC A;  4DXW A;  4G2K A;  4MTF A;  4JAS A;  5LGT A;  5C93 A;  5EBL C;  5LHG A;  3HB3 B;  4KUM A;  4PA9 A;  3JD4 A;  2YSU B;  3SPH A;  2IH3 C;  1VQ4 V;  1V55 B;  3JD0 A;  4PA3 A;  4H33 A;  1QLE B;  1F4N A;  1BL8 A;  3ML0 A;  2JEU A;  3MHS C;  1NR1 A;  5L3E A;  1W0K G;  4HZ3 A;  1WLE A;  2DYS C;  5E1A C;  3CCM V;  2WLJ A;  1NBM G;  1PNK A;  3ZMT A;  1COW G;  3IFX A;  3OE7 G;  3D36 A;  4FJC C;  5LHH A;  4JTC B;  2P6J A;  1E79 G;  5L3B A;  3AG2 B;  5L3D A;  5B1A C;  3RVZ A;  1M1K W;  2W6J G;  1FXK B;  1F51 A;  2EJR A;  1I5X A;  2AHY A;  1PNL A;  4U7O A;  2GSM B;  1HWY A;  3AG3 C;  4XDJ A;  4CZZ A;  4GX1 A;  5LBQ A;  3E8H A;  2IU0 A;  2Z3Y A;  4MVU A;  4WFH A;  4TT3 G;  1Q7Y W;  2ZR3 A;  3EHB B;  2P90 A;  1VQP V;  1S72 V;  4R7C A;  1JJ2 U;  4N21 A;  3SPG A;  3ZIA G;  3T4Z A;  3W7T A;  1FXK C;  2EZO A;  4JF3 A;  1PL0 A;  3AG4 C;  1NR7 A;  1KD1 W;  2ITC C;  2H94 A;  1AR1 B;  4FPP A;  4KFM A;  2XOK G;  1KQS U;  4I9W A;  4PDM A;  1DTO A;  3ZCC A;  3R65 A;  3ZN0 A;  5B1A B;  2EIM B;  4UV8 A;  4QE9 A;  5B1N A;  1VQL V;  1H38 A;  3AG3 B;  1H2G A;  1OCR B;  1AJP A;  1M56 B;  5B1B B;  3TK1 A;  3QO5 A;  1FFT B;  4PDV A;  4BIZ A;  4MVM A;  2Q68 A;  2HVJ C;  3B8M A;  1JVM A;  3IC7 A;  5FL7 G;  3CCS V;  2V1D A;  2HR3 A;  2JJ1 G;  4FIP C;  1K73 W;  3I56 V;  3CPW U;  3VBB A;  4RUE A;  2C2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...