3F7YC

Kcsa potassium channel in the partially open state with 17 a opening at t112
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
b'RAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
molecule tags Membrane protein/metal transport
source organism Streptomyces lividans
publication title KcsA Potassium channel in the partially open state with 17 A opening at T112
rcsb
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3f7yC00
4P9PA 3T4DA 1XL6A 3E8GA 4PA4A 3OUFA 1V55C 4LP8A 4CBCA 2K1EA 3AG1C 5KUKA 3E8BA 3T1CA 4PA6A 2IH3C 3UKMA 4WFGA 3T2MA 4HYOA 3K0GA 3RVYA 1OCCC 3SYQA 3ABKC 4JTCB 2ZXWC 3SPJA 4MVUA 5B1BC 2HG5C 3JYCA 4MW8A 4OXSA 4P30A 3R65A 3FB7C 3T4ZA 2ZD9A 3K03A 5KUMA 4MVMA 4X8AA 3K06A 4EKWA 4DXWA 1G4YB 2Y69C 4JTDB 4MVSA 4GX2A 1P7BA 4XDKA 4ZBMA 5CBGA 1R3KC 2KB1A 4HZ3A 3HPLC 3KG2A 3LDCA 3K0DA 4PDRA 1QLEC 3WG7C 4MW3A 4QE9A 5EC2C 4JTAB 3F7VC 4GX0A 2A0LA 3BEHA 3LUTB 3RBZA 2X6CA 5BZBA 5IY5C 1R3LC 2WLLB 2EIJC 4PA3A 3STLC 2H8PC 4G28B 3TCUA 2EIKC 4PDVA 4RUFA 1JVMA 4LCUC 5B3SC 1BL8A 2EIMC 2P7TC 3OR6C 1V54C 3FB5C 4RAIA 4P2ZA 2HJFC 4RUEA 4QNHB 3FB6C 1ZWIC 5EK0A 3ZRSA 4J9ZB 4X88A 3E8FA 3ZJZA 2X6AA 3E83A 4PA9A 1K4CC 4MVRA 5E1AC 5CBFA 1ORQC 4G27B 2A79B 3IGAC 4TWKA 3RW0A 2EILC 3ASNC 4XDJA 3SPHA 4PA7A 2BOCC 2WLLA 4XDLA 2ITDC 4UUJC 2BOBC 3F7YC 4R8CA 3SYOA 4MS2A 2OCCC 3X2QC 1KKDA 3STZC 4H37A 2WLIB 4X89A 3TETA 2AHYA 5EBWC 3LNMB 2HVKC 3AG3C 4MTGA 3K04A 4MTOA 2AHZA 2DYRC 5EBMC 1OCOC 3F5WC 4LBEC 3OGCC 3OR7C 4GX1A 2X6BA 4WFHA 5J9PC 3GB7C 2WLHA 2WLKA 1R3JC 4GX5A 2DWDC 1M56C 4WFFA 2Q68A 2ITCC 2Q6AA 4H33A 4R6ZA 5EBLC 5B1AC 4MVQA 2IH1C 3IFXA 3OUSA 1OCRC 2HVJC 4J9YB 3FB8C 2DYSC 5EC1C 2ATKC 3AG2C 3ABLC 3AG4C 2NLJC 1K4DC 3PJSK 3LDDA 2WLJA 2W0FC 4KFMA 3SYAA 4R50A 3LDEA 4PDMA 3SYPA 4WFEA 3SPIA 2QTOA 3SPCA 3ASOC 3ABMC 5CBHA 4MVZA 3SYCA 4F4LA 1R3IC 2QKSA 2WLMA 4QE7A 1LNQA 2DWEC 2JK5C 3K08A 4RO2A 3E86A 2Q67A 4MTFA 3VOUA 1J95A 2YEVA 1M57C 1XL4A 2R9RB 1OCZC 4BW5A 2WLNA 2Q69A 2EINC 3EFFK 4PDLA 3RVZA 3SJQC 2HFEC 4MVOA 4P9OA 1S5HC 4MSWC 3E89A 2WLIA 4R7CA 3SPGA 4I9WA 3UM7A 2A9HA 3E8HA
chains in the Genus database with same CATH superfamily
2Q7HA 5LMUO 2RDCA 3K0GA 4AI8A 5C8YB 4CS3A 4DV1B 4GYCB 1OJHA 1J5EB 3FB7C 4OX9O 1QVFU 3D36A 2Y69C 5LMUB 4EFBA 5CBGA 4H0LB 5KA5A 1M9NA 1MOFA 1TUBB 4B3RB 2QWNB 3CHXA 1XEQA 4UCTA 5CB4A 2OWOA 4DR4B 4QIWF 1FYJA 2X6CA 4UCOA 5HFMA 2H8PC 1I5XA 3JD2A 3G4SV 1QQCA 3FB6C 5E79Z 2RCVA 2GV9A 3E8FA 3OMNB 5C8YA 5L3BA 5JJNB 2BOCC 2C2AA 4XDLA 2CGNA 3SYOA 1M1KW 4E2LA 1HNXO 4FMTA 1B3QA 3PN1A 4J10A 1TUBA 4DO2A 2PI4A 2XHBA 1NVPD 3H1IH 4YJ2A 5B5EZ 1Q6UA 3D3IA 4YY3B 4NXNO 3FYEB 1NR7A 1ZSPA 1XDCA 4J7ZA 1BQ0A 5CN0A 4MVQA 3JD1A 1RP3B 4JI0O 1KU9A 3ABKB 2CE4A 1WLEA 2DYSC 5EC1C 3C3TA 4NKGB 3TXQA 2EJ7A 4DV7O 4PD4F 3OM3B 3SPCA 1AI5A 1N4CA 1XMOB 1SZTA 3KZIZ 1AJPA 2XAJA 3E86A 2QKAA 2IM9A 3JARA 1YJ9V 5JJJB 4KP4A 5JH7B 3BVOA 3AG2B 4PI0A 1N34B 4CC5A 3H1KH 2RNBA 4JI3B 1LUVA 2Y0IA 4JASA 3JAKB 5FPRA 1QR8A 2UUAB 1N32O 2NNUA 1XI1A 3U10A 2P67A 4P30A 4MW8A 3T4ZA 1VF6C 3JD3A 3CCMV 1QVGU 4FLYA 2Q7GA 3K9AA 1VQ7V 2ZCEA 4U7NA 2Y4TA 4QE9A 1XMQB 3ZHQA 2CTPA 3OTOO 1Y76B 3AG3B 3Q4HB 2EILB 2LGWA 1NVPB 4YHHB 1IX9A 3AK3A 1ZWIC 4DR2O 5KHHA 2D2CB 3CJHB 1NI8A 4IT5A 4HNAA 5E1AC 2QSAA 4KHPO 4PA7A 4FZ1A 1I08A 3F7YC 2AW9A 4MS2A 2NR5A 1QU7A 5IYCO 4O2AA 3TETA 3OTOB 2HR3A 1KBHA 1XQ8A 3CRMA 3OGCC 3JCUZ 1H2SB 5J9PC 4LWSB 4EEQA 5D5PA 4O4HA 3ZHRA 4DV4O 5JCOA 4FFKA 1O9GA 3HKEA 4JI7B 2ITCC 1XMOO 1D5AA 2XAHA 4J9YB 1HW7A 3ETDA 4DV2O 1Q86W 4AQYO 3AG2C 4ZIBA 1FAFA 4KFMA 4PDMA 2YXYA 4JPRA 2WLMA 2HKOA 2CDYA 1QLNA 1J95A 3K5NA 1XL4A 4B3RO 1SQPH 1GM8A 1XL6A 5KUKA 3WU2Z 1OHHG 4AQYB 1VQ6V 3ZHUA 1R73A 1E1QG 2OIEA 4OXSA 1HNZO 4MVMA 1OCOB 2YXLA 1BSMA 4ZBMA 2XAQA 2QJ1A 2XOKG 3IAYA 3CYOA 1FXHA 3LDCA 3E2EA 2QM8A 2P5OA 4LH7A 3CCVV 2WLLB 3ZBHA 2A3QA 3O9OA 5B3SC 1CEZA 2FMLA 4DV7B 2GDSA 2R9AA 3HB3B 5KX5B 3A2FA 1I0HA 3JCZA 3F5TA 2XAGA 2ITDC 4IYHA 3TK1A 4MTXA 5LA6A 2IJIA 3G67A 2ZINA 5KAIZ 4JI7O 1ZAUA 4K3AA 2QGNA 2YXHA 2EIMB 4UXNA 4I55B 1IBKB 3APOA 4TUYA 2RQ6A 1NTMH 1LUWA 4LBEC 5LGTA 1H2NA 3GB7C 3ETEA 2VQFO 1AJNA 4LFCB 2CK3G 2Q6AA 4IIJA 3M99B 1F4NA 1FPOA 2QM7A 1Q7YW 3W7UA 4UVBA 1XOUA 1SETA 1EZJA 4BW9A 4WFAV 5IYZB 3SJBC 4ZI7B 2UXDB 5BR8O 2YUAA 1XNRB 1OCZB 1M57B 2WLNA 2GTSA 4DR4O 3I5DA 4JI6B 3ABLB 1WJZA 4R7CA 1H2MA 4DV0B 1G6UA 4B3TO 1YITV 4NXMO 1M56B 4X65B 3ZHVA 4HNAB 3ZHSA 1AVMA 5LHGA 4ZOLB 2OT5A 4O2AB 2W6IG 4DR5O 2PY5A 4DV0O 2KB1A 1NZ6A 4O4LB 1P49A 3RWRD 2Q9LA 3K5LA 2CTQA 3OEHG 4JI2O 4D7TA 1AR4A 4DV4B 1AI7A 2EIMC 1V54C 4RAIA 2E76B 3LSUA 2MK3A 1PM9A 2EBOA 3OW2U 4PA9A 2BTOA 3ASNC 2EIKB 1SERA 2OCCC 3SGIA 3CB2A 2ADQB 2ZT9B 3CXHF 2IJKA 3AK1A 1E79G 3K04A 5LHHA 5BR8B 1PL0A 1Y76A 2P06A 2AGAA 4ZKIA 5GTIZ 2FB5A 1I94O 1IBLB 1PNKA 3TGUH 4W4LA 2HJDA 5B1AC 4B7KA 2XTAA 1URFA 3L72H 4NB5A 2LJ2A 3U11A 4YJ3B 2AZ2A 3PJSK 2LW7A 4C7UA 1Q81W 3LDEA 3SYPA 5KLVH 3T1HB 2F4VB 2Q7EA 1ENVA 5LP6B 3FYIB 4UVAA 3QO5A 2W0XA 1L0LH 4BR6A 3CE2A 1SQFA 1W0KG 4MVOA 1WPBA 3E89A 5EYPA 3SPGA 5FL7G 2BTQA 4PA4A 4LP8A 4B7EA 3T1CA 1NS1A 1K34A 3JYCA 3KCXA 2GBOA 3FAVB 3H1LH 1YTFD 4DXWA 1K5SA 4LF7B 1IBMB 3C90A 4HZ3A 3QF7A 4MW3A 1D2DA 3RYFA 1EN6A 5JVDA 1G1XB 1MA1A 4X1YA 3RBZA 3EHBB 2UUCO 4RWUA 3TCUA 2IU0A 2CAZC 3L75H 1Z2GA 2HJFC 2CUGA 4Z2WA 2Q73A 2X0LA 5LL6Y 1JFFB 4JI4B 2A79B 2JS5A 3UO2A 1HR0O 1DF5A 2JRIA 4LF5O 1E1RG 1AI4A 1I7FA 1AROP 2AHYA 2Q5ZA 3D36C 4CZZA 1VQPV 2JJ1G 4TV9A 2UXXA 4FM1A 5CA1B 5J2TB 5LMNB 2XNDG 3CCQV 2GTAA 5TISZ 1SZXA 4ZI7A 2P6JA 1KECA 2OCHA 3CC7V 4FZ0A 4QPJA 3OUSA 4UCVA 4CH4A 4X62B 2N74A 2NLJC 2QM4A 2LFRA 4IIJB 4QPKA 4TSFG 5L3EA 1OCRB 2YC0A 5GTHZ 1S77D 4LNUB 3MHHC 1NH2D 4PELA 4P9PA 2DYRB 1GH6A 3JALB 1VQMV 2QE7G 3SYQA 2XASA 3ABKC 3WB0A 1R6KA 1HR0B 2UUBO 1AP5A 3FFQA 1KB9F 2JIZG 4B08A 5AG2A 2MW2B 4NYKA 2QR4A 4JV5O 1JOYA 3JD0A 3OTFA 1ZL8A 2EIJB 4N21A 4W4KA 1TVKA 4DRXB 4DR3O 3L74H 3H9VA 5L3CA 1V9PA 1JCHA 5IY5C 3BY6A 1IVSA 4P2ZA 2DE0X 3OMAB 3P32A 4JI1B 2RN9A 1ORQC 2GUZA 4XDJA 3VQVA 1H8HG 2V1DA 3ZRVA 2QWRB 3LSQA 1KKDA 1L1FA 2YIDA 4O2BA 2OYQA 5JH7A 4DR3B 2B5UA 2KG7A 3CMAV 1NQTA 4H33A 4FM2A 5KA6A 3MAQA 3K58A 2EULA 2IH1C 1SQBH 1T5EA 4IHJB 4K0KB 4UVCA 1GM9A 3ZMSA 3ABLC 3AG4C 1PD3A 2EZOA 3G71V 2UU9O 2W0FC 4FLTA 4TV8B 1DF4A 4J7KA 3RFRA 2JK5C 2HEPA 1S5LZ 5IDJA 2GSMB 3EFFK 1KUQA 4LF4B 1ZX3A 4CC6A 1VQ8V 1YVWA 4J41A 2IW5A 1GMGA 2BSKA 3HKDB 3NXSA 5GONA 5KHGA 1YEWA 4BIZA 3K03A 3U0ZA 3CWBH 1CPYA 1S76D 4JI4O 5ITZB 1M5IA 4BWAA 3NR7A 3KG2A 1Q43A 2A0LA 3ZHTA 2Z0AA 1N0NA 1XBLA 4DV6O 3ZN1A 4FLZA 3D3QA 4JI8O 1FS0G 4K8ZA 4G28B 3Q4HA 1R6TA 1AP6A 3QNEA 4EB6B 1ZUQA 1SQGA 2Q0OC 2G38A 5DM6V 1VQ4V 4GKJB 4GLXA 4BAYA 2CH7B 1Y74A 3JATA 4X89A 3T1YB 4X64B 2KQXA 4X20A 3CCUV 2P22C 2ZR2A 4HAMA 1G8MA 1YSCA 3BHPA 1N34O 4GCZA 1OCOC 2Y0PA 3ZRWB 2PF4E 1HWYA 2WSSG 3ASOB 2VS0A 1SA0B 4X64O 1J5EO 5JWPA 1DGSA 2YDEA 4X20B 3B09A 5CA3A 4WF9V 1VP7A 3BA9A 2DYSB 3L9DA 2KSDA 4LF7O 3UO3A 3CMEV 2YEVB 1KD1W 1H38A 3ABMC 5B1NA 4QE7A 4EB6A 2DWEC 1MNGA 4AILC 4D7SA 1UJWB 1RPOA 4PHZA 2YEVA 2R72A 2Q69A 2UXDO 4DV3B 3C3SA 4B3SO 1P4RA 1P7GA 4DR7B 3RYCA 2VWJA 2ZR3A 3UKMA 4WFGA 3CRAA 4DUZB 4YJ2B 2HHHB 3RVYA 4DV1O 5KX5A 3T1HO 2F4VO 5B66Z 1N32B 5B1BC 3ZN0A 4J80A 4X8AA 3WB1A 4B3TB 3OGIB 4JTDB 3QG5A 5B3SB 1SS3A 5DN6G 1FJGO 4O2BB 2B1GA 5K1PA 5IT9N 4UCUA 3F7VC 5LA6B 5CB4B 3BEHA 5L3GA 1Q5OA 2EIKC 1GAXA 4DUZO 4LF6O 2R9IA 4JAAA 1GN4A 5EK0A 5LBQA 3G6EV 3E83A 1K4CC 1XNQB 2ZDIA 2EILC 4I9QA 2UUBB 4X1IA 2Z3YA 2F1MA 3QTCA 5D5QA 3H1HH 1ZL8B 2P4VA 2WLIB 1YIJV 1COWG 4LFAO 2OIGA 5EBWC 1K3EA 2ARHA 2HVKC 5LYJA 3WFVA 2Q4PA 3HKEB 4CH5A 2VRZA 3JAKA 1RSOB 4LF6B 1PNMA 2NN4A 4JI6O 1IBKO 1WA8A 4WFHA 2ZQMA 1XNRO 1Z5VA 1RM1C 4WFFA 5H6QA 1OCRC 4ZHQB 3K5OA 4GZRB 3A0RA 1Y66A 2Y4UA 3ZMUA 2ZNIA 3OT7A 2L6LA 4J7JA 2ETNA 3WB2A 4UCSA 1SESA 1W59A 5EYPB 3VQXA 4U3JA 4QNHB 1W0JG 3RVZA 2PGGA 3B2EE 3E22B 1K33A 3UT5B 2EX3A 3FAVA 5JVDB 3IC7A 5DEDA 1VQ9V 5LP6A 1V55C 4FPPA 3E8BA 4FIPC 3G6BA 1XREA 3P30A 1PP9H 1VMGA 4ABMA 3CJHA 1OCCC 2HG5C 3R65A 5KUMA 4DW1A 4EKWA 1PPJH 3W7XA 2UXNA 4Q6GA 4XDKA 2LP7A 3I55V 4Q20A 2N04A 3ABTA 4UFZA 3M7MX 5H5NA 2JJ2G 1NTKH 3ZS8C 3ZEDA 4B3MB 3J7AU 3STLC 1QHTA 4LCUC 4FVMA 2XUMA 3AK2A 4BIOA 5CMUA 2VWKA 3N2GA 2YS8A 1IBMO 4TWKA 3SPHA 4UUJC 1H8EG 1MZFA 4LC1A 4R8CA 4DK1A 3CCSV 1TVKB 3X2QC 1N33O 3AG1B 2F93B 2BCCH 3RYHB 3LNNA 1Y67A 4KL1A 1AB3A 2JGDB 1S5JA 1YXBA 2JS3A 2RJZA 3JSNA 4UV8A 3I56V 1GM7A 5HFLA 5LYJB 2Q0AA 2QWPB 1JA8A 2PTMA 3IFXA 3FB8C 1VQLV 4JZ2A 4UV9A 2H3OA 2QA4V 4RQFA 5KMGA 1U97A 5FNVB 1UPGA 1RFYA 3LDDA 4DR6B 1GK9A 3ASOC 1YJNV 1IURA 4DV6B 4RO2A 1TAEA 1M57C 2R9RB 2B9ZA 1CP9A 1JR9A 2EJRA 4ICGA 2HFEC 4LFBB 4PI2A 1YZBA 4Z1VA 4I9WA 2A9HA 1ZLZA 4OX9B 2IH3C 4LF9O 5L3DA 2E5LO 4MVUA 2UUAO 4K8XA 3GWKC 4LFCO 4I0XA 1EZVH 2QWOB 2HLDG 1G4YB 4MVSA 3ASNB 1KYOF 3S3XA 3CC4V 3M8AA 5EC2C 1QBZA 5IJ9B 4GX0A 3OEEG 3LUTB 4I50A 3K59A 3WG7B 4YXWG 4PDVA 4DR1O 4J11A 4GKKB 1MABG 1N8RW 4JI1O 1IDSA 3E35A 5CBFA 5CA0A 1PV0A 4G27B 3RW0A 1B06A 3SDLA 3BA8A 1THZA 4I4TA 3AEIA 1GN2A 2ILMA 1PL4A 4MTOA 2DN9A 3HKBB 3TJTA 5A9GA 1JQ0A 3F5WC 1BS3A 2ZNJA 3VQWA 1FXKA 1K8AW 2M7WA 3T1YO 3JD4A 3CRQA 4J42A 4R6ZA 1GTOA 2YSUB 2ZIOA 1FXVA 1BQZA 2IU3A 2P90A 1VQOV 1JJ2U 4R50A 4NVPA 3CCEV 4WFEA 5C93A 2PI5A 4UB8Z 5CBHA 4MVZA 2IBZH 2QKSA 4LF9B 3N2KB 3IC9A 4DYLA 3K08A 4MTFA 5GW7A 4QJFB 2DMXA 1S5HC 4O4HB 3JAWA 1Q6IA 4CH3A 3E8GA 3OUFA 3VBBA 4CBCA 1WP7A 1VQ5V 1BHAA 4PA6A 4FJCC 2PYLA 3A0HZ 2QTSA 2WAMA 1YI2V 3HR0A 4ZHQA 3SPJA 1B04A 4NTWA 1MSDA 4IHJA 4I7ZB 4BIUA 3K06A 4F6RB 1I5YA 3ZMZA 3APQA 1F4MA 4OPHA 1NTZH 4XBFA 2JDIG 1B6QA 1K73W 4DV3O 5EZYB 2E74B 3BRCA 4LWSA 3X2QB 3CP1A 3CPWU 2EIJC 4JI8B 2L35A 1MZEA 2UUCB 4RUEA 5LMNO 1YHQV 4L8JA 4DK0A 2CTRA 4J9ZB 3DC5A 3ZJZA 4H44B 2PUSA 5B1BB 4K0KO 2LGQA 1DTOA 2ZXWB 1K97A 1SRYA 2WA4A 1N0JA 5EIBD 1L0NH 3BAAA 4F6EA 1V54B 4DUYO 1NU1H 5J2UA 4X1KB 1LR1A 2LQTA 2LFSA 4NXNB 4FLVA 2AHZA 5EBMC 1V55B 1FFTB 4ZOLA 3FX7A 3RYFB 3CC2V 3JAWB 4U3FH 4LFAB 4IGGA 2K9PA 2F43G 5KMGB 2IJHA 3S3WA 2ODMA 3B8NA 3L73H 5LOVA 1SQXH 3HKDA 3SJAC 3CCRV 2EINB 2YIBA 1US6A 2QTOA 3RYCB 2QEXV 1X59A 5KHIA 1K7DA 5JJEB 4JAUA 2VQEB 5BMVB 1ROPA 4ASUG 5DECA 5LXTA 1OCZC 1RM1B 4X66B 3RT3C 3VQYA 1X4TA 4D6TH 4CS2A 4YIOA 3ETQA 2LO1A 3T2MA 3DXRA 4K35A 4HYOA 1N33B 4DR1B 1BMFG 1D5NA 1O9HA 1BT8A 2ADPA 5IWAB 4JV5B 1VF6A 3CD6V 5BZBA 2KG7B 1R3LC 3HKBA 4JGSA 5FPOA 4HBNA 3BFRA 3MD0A 1Q90D 1WPXA 1BL8A 1Y4MA 2X7RB 1WN7A 2IJJA 4X88A 4JZGA 2ZDIC 4MVRA 1S0VA 3DXRB 2UXCB 2WWWA 3JALA 5H9CA 2WLLA 2EZPA 2BOBC 4DRXA 2ZE6A 1VF7A 4FFBB 4H37A 3A0BZ 3H1JH 1PKXA 4NTYA 3L71H 5IYDO 4Z1MG 3W7WA 3CX5F 3ETGA 1TGOA 3IJ4A 1AJQA 2GHYA 2X6BA 1FXKC 2ZIMA 5CA1A 5J2TA 1VARA 3B40A 1SF9A 2QDOA 4JYCA 5BY1A 1IXBA 2Q68A 2VQEO 4LR3A 1EBOA 2DJVA 2KKWA 3JASA 5IJ0A 3CEIA 1GKFA 1AILA 2ATKC 2CTWA 1SC5B 1U96A 3MDSA 4GT1A 4I50B 3ZRWA 2QKCA 3SYCA 1F7YA 4JYAB 2BTQB 3W7SA 1KKCA 1R6NA 2E3CA 4P9OA 4MSWC 4DR6O 5BXZA 3K5MA 3UM7A 1QNMA 5KAFZ 3K9SA 2K1EA 3L70H 3UQ8A 4DR5B 3ZIAG 2JEXA 2FKXA 1WAZA 2M6YA 2ZE7A 5IYZA 1JFFA 4X65O 4JTCB 4WCEV 1KMIZ 1BCCH 1KP2A 3N2GB 1N36O 1VQKV 1IBLO 2YIAA 2DQ3A 3BABA 1XNQO 5LGUA 1R3KC 5IY5B 4UB6Z 3HPLC 1H2LA 5IJ9A 1QLEC 1A32A 4JYYA 2O57A 3B4SA 3RYIB 2Z5UA 3RYHA 3K3WA 4RUFA 1KC8W 2P7TC 3OR6C 3RN4A 2ZKOA 2JEUA 3K79A 4JF3A 1M93A 1BE3H 1AR5A 5EIBC 4O4JB 2FTKA 2GUZB 3ZRXA 4LH6A 1HNXB 3STZC 1NKDA 4IYIA 1FFXA 2ZM6O 1Y6XA 3UT5A 3AG3C 4MTGA 3EXAA 4OPAA 1HNWO 3OR7C 1FFXB 4GX1A 3BCCH 4FFBA 1GN6A 4N23A 1K9MW 2UXBO 2FYUH 1NR1A 4U3JB 2N05A 2RMKB 4FK5C 1K92A 1VIBA 5K1XA 1SQQH 4KXRA 3SR2C 1OV9A 3N27A 3RYIA 1YCIA 3SYAA 1OZ0A 5JQGA 3ZMVA 1W2BU 2PZSA 1HDJA 4B3MO 1ZTEA 4BW5A 2JGUA 4YJ3A 5KHJA 1TUEB 4OGQB 3AG7A 3ABMB 3HKCB 1NH2B 3T4DA 3MHSC 4FLUA 4AHCA 1HNZB 1EN4A 1MSWD 4X1KA 1JPXA 2A06H 4JAVA 4TQFA 2VQFB 3E22A 2UXCO 4NR1A 1GRJA 4X1IB 3DSQA 4DV2B 1H2KA 3K0DA 5BMVA 2YICA 4NTXA 4YHHO 4L87A 3CCJV 1QLEB 1AI6A 4GUNA 2ZM6B 2WPDG 4TV9B 2E5LB 1PNLA 2PYJA 4NXMB 3G80A 3JASB 5IJ0B 1WB8A 2DOSA 1WB7A 5B1OA 3SJCC 1YF2A 1JJOA 3LSSA 3CRCA 1GN3A 4PJ0Z 5A2QN 1P84F 3LNMB 1TA8A 1SQVH 4FLXA 1CXZB 4YY3O 1YDXA 3N2KA 2WLKA 5L3FA 4X62O 2BE3A 1R3JC 4GX5A 4JI2B 2DWDC 1M56C 5KHKA 4UCRA 1FJGB 1S3JA 3GWOA 1VF5B 1H2GA 1DK1A 2D3OW 4FLWA 2WLJA 1VEWA 5B1AB 4CS4A 1SA0A 2JGDA 3SPIA 1F23A 1S72V 5FLXN 1AR1B 2QWQB 2YI9A 2Q67A 4IL6Z 2JVDA 3SJQC 4PDLA 2B1IA 3OFNG 4FM0A 5H2FZ 3JARB 4I55A 4O4IB 4X66O 1KQSU 3E8HA 4LFBO 4WBNB 2LW1A 3ICXA 3ZX6A 1YTFB 2OTLV 4LF8O 1GO3F 1QR9A 1HP8A 4H13B 2OTJV 1Y74B 1I94B 3QVNA 2CH7A 1YJWV 5H6RA 4X9QA 1Q6HA 1XILA 5LXTB 1M4UA 4DR2B 3WG7C 3CCLV 1F51A 2DW4A 4I5SA 4LF8B 3P3PA 1R1BA 2YI8A 4YIPA 1JVMA 1EN5A 1HNWB 4I0XB 1WP8A 3JATB 2X6AA 3ML0A 5GONB 3ABUA 4DV5O 4LF4O 1XUQA 3GVMA 3CS5A 2XAFA 4KUMA 4GKJO 3THOA 4TOIA 5IYBO 3O65A 1Q82W 3B77A 3RGBA 2ZE8A 1BGYH 2DQ0A 3B8MA 1Q8IA 5J2UB 2AZ0A 1QCEA 5IE9A 2P4KA 3J80N 3D8CA 1RPRA 4DW0A 3OMIB 2YIBD 5EBLC 5LOVB 3BPZA 3UCSC 1XHZA 5LP6C 2V4DA 3J81N 3ZMTA 2FL4A 5JQGB 3JAMN 1K4DC 3KKYA 2BSKB 1N36B 3AG4B 3H01A 2XT9A 1WA8B 3OAAG 4JI5B 1WNSA 2UXBB 1LNQA 3HKCA 1UFIA 3VOUA 4JYAO 1FD9A 4JYBA 5ITZA 4U7OA 2E75B 2WLIA 3CRRA 1FXKB 2V7QG 4MT8A 4E4EA 5JCOC 3AG1C 4DUYB 3DC6A 4JI0B 4TQDA 3KCYA 2ZXWC 5F2VO 2ZD9A 4KHPB 2OCCB 1K5QA 4GX2A 1P7BA 3A8TA 4O4JA 1NBMG 2F66C 3FD9A 4PDRA 4TT3G 4X1YB 3QO7A 2W6JG 2F95B 4JTAB 2CGOA 4O4IA 1DLBA 4O4LA 4PA3A 4TUYB 1MMMA 3QO8A 1Q3EA 5FNVA 1VQNV 3FB5C 1MG1A 2Y69B 3ZRSA 4JI3O 1M90W 2H94A 2ZE5A 4PV1B 4GKKO 3DTUB 1OCCB 3IGAC 4A5UB 4CH6A 1SKVA 1XHXA 2A7WA 3OE7G 5EZYA 1NJIW 3ZCCA 3W7TA 3JSLA 2R70A 2WA3A 4G2KA 4JI5O 4F6RA 2DYRC 3DGEA 1BZKA 2AXTZ 2F23A 3OD4A 2WLHA 1EM1A 4TV8A 2Y48A 1NT2B 2HP8A 1XMQO 5CA0B 4WBNA 1KP3A 1BHBA 4EFEA 1JMKC 2HVJC 2UU9B 5LHIA 1FKAO 3FKSG 4DR7O 3P3NA 3EVKA 2Q8VA 2HHHO 4F4LA 1R3IC 4QGPA 1RSOA 4RQEA 1IZ3A 4LNUA 1JX9A 1IXMA 2EINC 5LGNA 4LF5B 1EFRG 3CXCU 3TXSA 5IWAO 4DV5B 1L8DA 1Z5WA 3R66A 3K57A 4B3SB 3CSXA 4WFBV 4I4TB
chains in the Genus database with same CATH topology
1VQ9V 4PA4A 1V55C 4FPPA 4LP8A 2K1EA 3E8BA 4FIPC 3T1CA 3ZIAG 2JEXA 1K34A 3P30A 3K0GA 1OCCC 4JTCB 4WCEV 2HG5C 3JYCA 1KP2A 3R65A 3FB7C 1VQKV 5KUMA 4EKWA 1YTFD 4DXWA 2DQ3A 1QVFU 3D36A 3W7XA 2Y69C 1K5SA 2UXNA 5LGUA 4XDKA 5CBGA 1R3KC 2LP7A 5KA5A 5IY5B 1M9NA 3I55V 4HZ3A 1MOFA 3HPLC 4Q20A 1QLEC 4MW3A 3ABTA 2JJ2G 4QIWF 3RBZA 3EHBB 2X6CA 5HFMA 3STLC 2H8PC 2Z5UA 3TCUA 3K3WA 1I5XA 2IU0A 4RUFA 3JD2A 4LCUC 1KC8W 2P7TC 3OR6C 2HJFC 3G4SV 2JEUA 3FB6C 3K79A 4JF3A 5CMUA 2X0LA 3E8FA 3OMNB 2A79B 4TWKA 5L3BA 3SPHA 3ZRXA 2FTKA 2BOCC 2C2AA 4UUJC 1DF5A 1H8EG 4LC1A 4R8CA 4XDLA 3SYOA 3CCSV 1M1KW 4E2LA 3X2QC 3STZC 1E1RG 1AI4A 3AG1B 1NKDA 4FMTA 1AROP 2AHYA 4CZZA 1VQPV 2JJ1G 4DO2A 2PI4A 3AG3C 4MTGA 1NVPD 2UXXA 3OR7C 3D3IA 4GX1A 2XNDG 3CCQV 3FYEB 4N23A 1NR7A 1K9MW 2P6JA 4UV8A 1KECA 3I56V 1GM7A 5HFLA 4MVQA 1NR1A 5CN0A 3CC7V 3JD1A 4QPJA 4FK5C 3IFXA 3OUSA 3ABKB 3FB8C 1VQLV 4UV9A 1K92A 1WLEA 2DYSC 5EC1C 2QA4V 4RQFA 2NLJC 2LFRA 3LDDA 4QPKA 3SYAA 1OZ0A 1GK9A 4TSFG 3OM3B 3SPCA 3ASOC 3ZMVA 1W2BU 1AI5A 5L3EA 1OCRB 1YJNV 1SZTA 1AJPA 2XAJA 4RO2A 3E86A 1M57C 2R9RB 4BW5A 1CP9A 1YJ9V 2EJRA 1S77D 2HFEC 3MHHC 4KP4A 1TUEB 1NH2D 3AG2B 3ABMB 4PELA 4I9WA 2A9HA 1NH2B 4P9PA 3T4DA 3MHSC 2DYRB 4JASA 2IH3C 1QR8A 2NNUA 1MSWD 1VQMV 2QE7G 3SYQA 2XASA 3ABKC 5L3DA 4MVUA 2P67A 1R6KA 4P30A 4MW8A 3T4ZA 3JD3A 3CCMV 1JPXA 1QVGU 4JAVA 2HLDG 1G4YB 2JIZG 4MVSA 3ASNB 1JOYA 3K9AA 3JD0A 3K0DA 1VQ7V 4U7NA 3CC4V 2EIJB 4QE9A 4L87A 4N21A 5EC2C 1QBZA 3CCJV 4GX0A 3OEEG 3LUTB 3WG7B 1QLEB 1AI6A 4YXWG 3AG3B 2WPDG 5L3CA 1JCHA 4PDVA 2EILB 5IY5C 3BY6A 1PNLA 1NVPB 4P2ZA 1ZWIC 1MABG 3OMAB 3P32A 1N8RW 3E35A 5B1OA 5CBFA 5E1AC 1ORQC 4G27B 3RW0A 4XDJA 1H8HG 2V1DA 4PA7A 3F7YC 3ZRVA 3LSSA 4WFBV 4MS2A 1THZA 3LSQA 1KKDA 1L1FA 5IYCO 3AEIA 3TETA 2B5UA 3LNMB 2HR3A 4MTOA 1JQ0A 3F5WC 3OGCC 5J9PC 3CMAV 1FXKA 1NQTA 1K8AW 2WLKA 5L3FA 2M7WA 3JD4A 1R3JC 4GX5A 2DWDC 1M56C 2ITCC 4H33A 4R6ZA 1GTOA 2YSUB 5KA6A 1FXVA 2XAHA 2IH1C 4J9YB 3ETDA 1S3JA 3GWOA 1Q86W 2IU3A 4UVCA 3AG2C 1GM9A 3ZMSA 1H2GA 3ABLC 3AG4C 1PD3A 2D3OW 2EZOA 3G71V 2P90A 2WLJA 2W0FC 5B1AB 4KFMA 1VQOV 1JJ2U 4R50A 4PDMA 3CCEV 4WFEA 5C93A 4JPRA 3SPIA 1F23A 2PI5A 1DF4A 5CBHA 1S72V 4MVZA 2QKSA 2WLMA 1AR1B 5IDJA 2HKOA 2JK5C 3K08A 2Q67A 2GSMB 1QLNA 4MTFA 5GW7A 1J95A 1XL4A 3EFFK 3SJQC 4PDLA 4QJFB 2B1IA 3OFNG 1S5HC 1GM8A 1KQSU 3E8HA 1XL6A 3E8GA 5KUKA 1OHHG 3OUFA 3VBBA 4CBCA 1VQ8V 2IW5A 1VQ5V 1BHAA 4PA6A 1GMGA 4FJCC 1VQ6V 3NXSA 2WAMA 1R73A 1YI2V 1E1QG 3SPJA 4BIZA 1YTFB 2OTLV 4OXSA 1GO3F 1QR9A 3K03A 4MVMA 4BIUA 3K06A 2OTJV 1I5YA 1CPYA 1OCOB 1S76D 3ZMZA 1YJWV 1F4MA 4ZBMA 5H6RA 2XAQA 2XOKG 4XBFA 2JDIG 3CYOA 1FXHA 1B6QA 3KG2A 3LDCA 1K73W 3WG7C 3CCLV 3E2EA 2QM8A 1F51A 2DW4A 2A0LA 4I5SA 3X2QB 3CCVV 2WLLB 3CP1A 2EIJC 3CPWU 3ZN1A 1FS0G 4G28B 1JVMA 5B3SC 4RUEA 1CEZA 1YHQV 3QNEA 4J9ZB 3HB3B 3ZJZA 2X6AA 3ML0A 5B1BB 5DM6V 2ZXWB 1DTOA 3JCZA 1K97A 1SRYA 3ABUA 1VQ4V 2XAGA 2ITDC 3TK1A 4MTXA 4BAYA 2IJIA 2XAFA 4KUMA 1V54B 4X89A 2EIMB 5IYBO 3CCUV 4UXNA 1Q82W 3B77A 2ZR2A 4HAMA 1G8MA 1YSCA 2LFSA 2DQ0A 3B8MA 2AHZA 4GCZA 1V55B 5EBMC 1OCOC 1FFTB 4LBEC 5LGTA 1QCEA 3GB7C 3ZRWB 3CC2V 3ETEA 1AJNA 1HWYA 2WSSG 3ASOB 1RPRA 2CK3G 2F43G 3OMIB 2Q6AA 3M99B 5EBLC 1F4NA 2QM7A 1Q7YW 2IJHA 3W7UA 4UVBA 5CA3A 4WF9V 1SETA 1EZJA 2DYSB 3B8NA 3ZMTA 1K4DC 4WFAV 3CMEV 2YEVB 3CCRV 2EINB 3AG4B 3H01A 1KD1W 1H38A 2QTOA 3OAAG 2QEXV 3ABMC 5B1NA 1K7DA 4QE7A 1LNQA 4JAUA 2DWEC 1UJWB 1ROPA 4ASUG 1RPOA 1OCZB 3VOUA 1M57B 2YEVA 1OCZC 2WLNA 2Q69A 4JYBA 1RM1B 4U7OA 3ABLB 2WLIA 4R7CA 1P4RA 1FXKB 2V7QG 4MT8A 3AG1C 2ZR3A 3UKMA 1YITV 4WFGA 1M56B 3T2MA 4HYOA 3RVYA 1BMFG 2ZXWC 5B1BC 5LHGA 2OT5A 2ZD9A 3ZN0A 4X8AA 2W6IG 2OCCB 1K5QA 4JTDB 4GX2A 1P7BA 2KB1A 5B3SB 5DN6G 1NBMG 2B1GA 4PDRA 4TT3G 3QO7A 3CD6V 2W6JG 4JTAB 3F7VC 5BZBA 3BEHA 3OEHG 1DLBA 5L3GA 1R3LC 4JGSA 4PA3A 3MD0A 3QO8A 2EIKC 1AI7A 1WPXA 1BL8A 2EIMC 1VQNV 1Y4MA 1V54C 3FB5C 1MG1A 4RAIA 2R9IA 2X7RB 2Y69B 2MK3A 2EBOA 5EK0A 2IJJA 4X88A 3ZRSA 5LBQA 3G6EV 3OW2U 1M90W 3E83A 2ZDIC 2H94A 1K4CC 4PA9A 4MVRA 1S0VA 2ZDIA 3DTUB 1OCCB 3IGAC 2WWWA 2EILC 3ASNC 2EIKB 5H9CA 2WLLA 1SERA 2EZPA 2BOBC 3OE7G 2Z3YA 2OCCC 1NJIW 4H37A 2WLIB 1YIJV 3ZCCA 1COWG 1PKXA 5EBWC 3W7TA 5IYDO 1K3EA 2HVKC 2IJKA 4Z1MG 1E79G 3K04A 3WFVA 5LHHA 4G2KA 1PL0A 3W7WA 3ETGA 2DYRC 1AJQA 2GHYA 4ZKIA 3DGEA 1PNMA 2X6BA 1FXKC 4WFHA 2WLHA 2Y48A 1PNKA 2ZQMA 4JYCA 1RM1C 4WFFA 2Q68A 5B1AC 1EBOA 1KP3A 5H6QA 1BHBA 1OCRC 2HVJC 1GKFA 5LHIA 2ATKC 3A0RA 3FKSG 1Y66A 3PJSK 1Q81W 3ZMUA 3LDEA 3SYPA 4GT1A 3ZRWA 1ENVA 3SYCA 4F4LA 1R3IC 3FYIB 4UVAA 3W7SA 3QO5A 4RQEA 1SESA 4QNHB 1R6NA 1JX9A 1W0JG 1IXMA 2EINC 3RVZA 5LGNA 1W0KG 4MVOA 1EFRG 1K33A 4P9OA 3CXCU 4MSWC 3E89A 3SPGA 5FL7G 3UM7A 3IC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9P A;  3T4D A;  1XL6 A;  3E8G A;  4PA4 A;  3OUF A;  1V55 C;  4LP8 A;  4CBC A;  2K1E A;  3AG1 C;  5KUK A;  3E8B A;  3T1C A;  4PA6 A;  2IH3 C;  3UKM A;  4WFG A;  3T2M A;  4HYO A;  3K0G A;  3RVY A;  1OCC C;  3SYQ A;  3ABK C;  4JTC B;  2ZXW C;  3SPJ A;  4MVU A;  5B1B C;  2HG5 C;  3JYC A;  4MW8 A;  4OXS A;  4P30 A;  3R65 A;  3FB7 C;  3T4Z A;  2ZD9 A;  3K03 A;  5KUM A;  4MVM A;  4X8A A;  3K06 A;  4EKW A;  4DXW A;  1G4Y B;  2Y69 C;  4JTD B;  4MVS A;  4GX2 A;  1P7B A;  4XDK A;  4ZBM A;  5CBG A;  1R3K C;  2KB1 A;  4HZ3 A;  3HPL C;  3KG2 A;  3LDC A;  3K0D A;  4PDR A;  1QLE C;  3WG7 C;  4MW3 A;  4QE9 A;  5EC2 C;  4JTA B;  3F7V C;  4GX0 A;  2A0L A;  3BEH A;  3LUT B;  3RBZ A;  2X6C A;  5BZB A;  5IY5 C;  1R3L C;  2WLL B;  2EIJ C;  4PA3 A;  3STL C;  2H8P C;  4G28 B;  3TCU A;  2EIK C;  4PDV A;  4RUF A;  1JVM A;  4LCU C;  5B3S C;  1BL8 A;  2EIM C;  2P7T C;  3OR6 C;  1V54 C;  3FB5 C;  4RAI A;  4P2Z A;  2HJF C;  4RUE A;  4QNH B;  3FB6 C;  1ZWI C;  5EK0 A;  3ZRS A;  4J9Z B;  4X88 A;  3E8F A;  3ZJZ A;  2X6A A;  3E83 A;  4PA9 A;  1K4C C;  4MVR A;  5E1A C;  5CBF A;  1ORQ C;  4G27 B;  2A79 B;  3IGA C;  4TWK A;  3RW0 A;  2EIL C;  3ASN C;  4XDJ A;  3SPH A;  4PA7 A;  2BOC C;  2WLL A;  4XDL A;  2ITD C;  4UUJ C;  2BOB C;  3F7Y C;  4R8C A;  3SYO A;  4MS2 A;  2OCC C;  3X2Q C;  1KKD A;  3STZ C;  4H37 A;  2WLI B;  4X89 A;  3TET A;  2AHY A;  5EBW C;  3LNM B;  2HVK C;  3AG3 C;  4MTG A;  3K04 A;  4MTO A;  2AHZ A;  2DYR C;  5EBM C;  1OCO C;  3F5W C;  4LBE C;  3OGC C;  3OR7 C;  4GX1 A;  2X6B A;  4WFH A;  5J9P C;  3GB7 C;  2WLH A;  2WLK A;  1R3J C;  4GX5 A;  2DWD C;  1M56 C;  4WFF A;  2Q68 A;  2ITC C;  2Q6A A;  4H33 A;  4R6Z A;  5EBL C;  5B1A C;  4MVQ A;  2IH1 C;  3IFX A;  3OUS A;  1OCR C;  2HVJ C;  4J9Y B;  3FB8 C;  2DYS C;  5EC1 C;  2ATK C;  3AG2 C;  3ABL C;  3AG4 C;  2NLJ C;  1K4D C;  3PJS K;  3LDD A;  2WLJ A;  2W0F C;  4KFM A;  3SYA A;  4R50 A;  3LDE A;  4PDM A;  3SYP A;  4WFE A;  3SPI A;  2QTO A;  3SPC A;  3ASO C;  3ABM C;  5CBH A;  4MVZ A;  3SYC A;  4F4L A;  1R3I C;  2QKS A;  2WLM A;  4QE7 A;  1LNQ A;  2DWE C;  2JK5 C;  3K08 A;  4RO2 A;  3E86 A;  2Q67 A;  4MTF A;  3VOU A;  1J95 A;  2YEV A;  1M57 C;  1XL4 A;  2R9R B;  1OCZ C;  4BW5 A;  2WLN A;  2Q69 A;  2EIN C;  3EFF K;  4PDL A;  3RVZ A;  3SJQ C;  2HFE C;  4MVO A;  4P9O A;  1S5H C;  4MSW C;  3E89 A;  2WLI A;  4R7C A;  3SPG A;  4I9W A;  3UM7 A;  2A9H A;  3E8H A; 
#chains in the Genus database with same CATH topology
 2Q7H A;  5LMU O;  2RDC A;  3K0G A;  4AI8 A;  5C8Y B;  4CS3 A;  4DV1 B;  4GYC B;  1OJH A;  1J5E B;  3FB7 C;  4OX9 O;  1QVF U;  3D36 A;  2Y69 C;  5LMU B;  4EFB A;  5CBG A;  4H0L B;  5KA5 A;  1M9N A;  1MOF A;  1TUB B;  4B3R B;  2QWN B;  3CHX A;  1XEQ A;  4UCT A;  5CB4 A;  2OWO A;  4DR4 B;  4QIW F;  1FYJ A;  2X6C A;  4UCO A;  5HFM A;  2H8P C;  1I5X A;  3JD2 A;  3G4S V;  1QQC A;  3FB6 C;  5E79 Z;  2RCV A;  2GV9 A;  3E8F A;  3OMN B;  5C8Y A;  5L3B A;  5JJN B;  2BOC C;  2C2A A;  4XDL A;  2CGN A;  3SYO A;  1M1K W;  4E2L A;  1HNX O;  4FMT A;  1B3Q A;  3PN1 A;  4J10 A;  1TUB A;  4DO2 A;  2PI4 A;  2XHB A;  1NVP D;  3H1I H;  4YJ2 A;  5B5E Z;  1Q6U A;  3D3I A;  4YY3 B;  4NXN O;  3FYE B;  1NR7 A;  1ZSP A;  1XDC A;  4J7Z A;  1BQ0 A;  5CN0 A;  4MVQ A;  3JD1 A;  1RP3 B;  4JI0 O;  1KU9 A;  3ABK B;  2CE4 A;  1WLE A;  2DYS C;  5EC1 C;  3C3T A;  4NKG B;  3TXQ A;  2EJ7 A;  4DV7 O;  4PD4 F;  3OM3 B;  3SPC A;  1AI5 A;  1N4C A;  1XMO B;  1SZT A;  3KZI Z;  1AJP A;  2XAJ A;  3E86 A;  2QKA A;  2IM9 A;  3JAR A;  1YJ9 V;  5JJJ B;  4KP4 A;  5JH7 B;  3BVO A;  3AG2 B;  4PI0 A;  1N34 B;  4CC5 A;  3H1K H;  2RNB A;  4JI3 B;  1LUV A;  2Y0I A;  4JAS A;  3JAK B;  5FPR A;  1QR8 A;  2UUA B;  1N32 O;  2NNU A;  1XI1 A;  3U10 A;  2P67 A;  4P30 A;  4MW8 A;  3T4Z A;  1VF6 C;  3JD3 A;  3CCM V;  1QVG U;  4FLY A;  2Q7G A;  3K9A A;  1VQ7 V;  2ZCE A;  4U7N A;  2Y4T A;  4QE9 A;  1XMQ B;  3ZHQ A;  2CTP A;  3OTO O;  1Y76 B;  3AG3 B;  3Q4H B;  2EIL B;  2LGW A;  1NVP B;  4YHH B;  1IX9 A;  3AK3 A;  1ZWI C;  4DR2 O;  5KHH A;  2D2C B;  3CJH B;  1NI8 A;  4IT5 A;  4HNA A;  5E1A C;  2QSA A;  4KHP O;  4PA7 A;  4FZ1 A;  1I08 A;  3F7Y C;  2AW9 A;  4MS2 A;  2NR5 A;  1QU7 A;  5IYC O;  4O2A A;  3TET A;  3OTO B;  2HR3 A;  1KBH A;  1XQ8 A;  3CRM A;  3OGC C;  3JCU Z;  1H2S B;  5J9P C;  4LWS B;  4EEQ A;  5D5P A;  4O4H A;  3ZHR A;  4DV4 O;  5JCO A;  4FFK A;  1O9G A;  3HKE A;  4JI7 B;  2ITC C;  1XMO O;  1D5A A;  2XAH A;  4J9Y B;  1HW7 A;  3ETD A;  4DV2 O;  1Q86 W;  4AQY O;  3AG2 C;  4ZIB A;  1FAF A;  4KFM A;  4PDM A;  2YXY A;  4JPR A;  2WLM A;  2HKO A;  2CDY A;  1QLN A;  1J95 A;  3K5N A;  1XL4 A;  4B3R O;  1SQP H;  1GM8 A;  1XL6 A;  5KUK A;  3WU2 Z;  1OHH G;  4AQY B;  1VQ6 V;  3ZHU A;  1R73 A;  1E1Q G;  2OIE A;  4OXS A;  1HNZ O;  4MVM A;  1OCO B;  2YXL A;  1BSM A;  4ZBM A;  2XAQ A;  2QJ1 A;  2XOK G;  3IAY A;  3CYO A;  1FXH A;  3LDC A;  3E2E A;  2QM8 A;  2P5O A;  4LH7 A;  3CCV V;  2WLL B;  3ZBH A;  2A3Q A;  3O9O A;  5B3S C;  1CEZ A;  2FML A;  4DV7 B;  2GDS A;  2R9A A;  3HB3 B;  5KX5 B;  3A2F A;  1I0H A;  3JCZ A;  3F5T A;  2XAG A;  2ITD C;  4IYH A;  3TK1 A;  4MTX A;  5LA6 A;  2IJI A;  3G67 A;  2ZIN A;  5KAI Z;  4JI7 O;  1ZAU A;  4K3A A;  2QGN A;  2YXH A;  2EIM B;  4UXN A;  4I55 B;  1IBK B;  3APO A;  4TUY A;  2RQ6 A;  1NTM H;  1LUW A;  4LBE C;  5LGT A;  1H2N A;  3GB7 C;  3ETE A;  2VQF O;  1AJN A;  4LFC B;  2CK3 G;  2Q6A A;  4IIJ A;  3M99 B;  1F4N A;  1FPO A;  2QM7 A;  1Q7Y W;  3W7U A;  4UVB A;  1XOU A;  1SET A;  1EZJ A;  4BW9 A;  4WFA V;  5IYZ B;  3SJB C;  4ZI7 B;  2UXD B;  5BR8 O;  2YUA A;  1XNR B;  1OCZ B;  1M57 B;  2WLN A;  2GTS A;  4DR4 O;  3I5D A;  4JI6 B;  3ABL B;  1WJZ A;  4R7C A;  1H2M A;  4DV0 B;  1G6U A;  4B3T O;  1YIT V;  4NXM O;  1M56 B;  4X65 B;  3ZHV A;  4HNA B;  3ZHS A;  1AVM A;  5LHG A;  4ZOL B;  2OT5 A;  4O2A B;  2W6I G;  4DR5 O;  2PY5 A;  4DV0 O;  2KB1 A;  1NZ6 A;  4O4L B;  1P49 A;  3RWR D;  2Q9L A;  3K5L A;  2CTQ A;  3OEH G;  4JI2 O;  4D7T A;  1AR4 A;  4DV4 B;  1AI7 A;  2EIM C;  1V54 C;  4RAI A;  2E76 B;  3LSU A;  2MK3 A;  1PM9 A;  2EBO A;  3OW2 U;  4PA9 A;  2BTO A;  3ASN C;  2EIK B;  1SER A;  2OCC C;  3SGI A;  3CB2 A;  2ADQ B;  2ZT9 B;  3CXH F;  2IJK A;  3AK1 A;  1E79 G;  3K04 A;  5LHH A;  5BR8 B;  1PL0 A;  1Y76 A;  2P06 A;  2AGA A;  4ZKI A;  5GTI Z;  2FB5 A;  1I94 O;  1IBL B;  1PNK A;  3TGU H;  4W4L A;  2HJD A;  5B1A C;  4B7K A;  2XTA A;  1URF A;  3L72 H;  4NB5 A;  2LJ2 A;  3U11 A;  4YJ3 B;  2AZ2 A;  3PJS K;  2LW7 A;  4C7U A;  1Q81 W;  3LDE A;  3SYP A;  5KLV H;  3T1H B;  2F4V B;  2Q7E A;  1ENV A;  5LP6 B;  3FYI B;  4UVA A;  3QO5 A;  2W0X A;  1L0L H;  4BR6 A;  3CE2 A;  1SQF A;  1W0K G;  4MVO A;  1WPB A;  3E89 A;  5EYP A;  3SPG A;  5FL7 G;  2BTQ A;  4PA4 A;  4LP8 A;  4B7E A;  3T1C A;  1NS1 A;  1K34 A;  3JYC A;  3KCX A;  2GBO A;  3FAV B;  3H1L H;  1YTF D;  4DXW A;  1K5S A;  4LF7 B;  1IBM B;  3C90 A;  4HZ3 A;  3QF7 A;  4MW3 A;  1D2D A;  3RYF A;  1EN6 A;  5JVD A;  1G1X B;  1MA1 A;  4X1Y A;  3RBZ A;  3EHB B;  2UUC O;  4RWU A;  3TCU A;  2IU0 A;  2CAZ C;  3L75 H;  1Z2G A;  2HJF C;  2CUG A;  4Z2W A;  2Q73 A;  2X0L A;  5LL6 Y;  1JFF B;  4JI4 B;  2A79 B;  2JS5 A;  3UO2 A;  1HR0 O;  1DF5 A;  2JRI A;  4LF5 O;  1E1R G;  1AI4 A;  1I7F A;  1ARO P;  2AHY A;  2Q5Z A;  3D36 C;  4CZZ A;  1VQP V;  2JJ1 G;  4TV9 A;  2UXX A;  4FM1 A;  5CA1 B;  5J2T B;  5LMN B;  2XND G;  3CCQ V;  2GTA A;  5TIS Z;  1SZX A;  4ZI7 A;  2P6J A;  1KEC A;  2OCH A;  3CC7 V;  4FZ0 A;  4QPJ A;  3OUS A;  4UCV A;  4CH4 A;  4X62 B;  2N74 A;  2NLJ C;  2QM4 A;  2LFR A;  4IIJ B;  4QPK A;  4TSF G;  5L3E A;  1OCR B;  2YC0 A;  5GTH Z;  1S77 D;  4LNU B;  3MHH C;  1NH2 D;  4PEL A;  4P9P A;  2DYR B;  1GH6 A;  3JAL B;  1VQM V;  2QE7 G;  3SYQ A;  2XAS A;  3ABK C;  3WB0 A;  1R6K A;  1HR0 B;  2UUB O;  1AP5 A;  3FFQ A;  1KB9 F;  2JIZ G;  4B08 A;  5AG2 A;  2MW2 B;  4NYK A;  2QR4 A;  4JV5 O;  1JOY A;  3JD0 A;  3OTF A;  1ZL8 A;  2EIJ B;  4N21 A;  4W4K A;  1TVK A;  4DRX B;  4DR3 O;  3L74 H;  3H9V A;  5L3C A;  1V9P A;  1JCH A;  5IY5 C;  3BY6 A;  1IVS A;  4P2Z A;  2DE0 X;  3OMA B;  3P32 A;  4JI1 B;  2RN9 A;  1ORQ C;  2GUZ A;  4XDJ A;  3VQV A;  1H8H G;  2V1D A;  3ZRV A;  2QWR B;  3LSQ A;  1KKD A;  1L1F A;  2YID A;  4O2B A;  2OYQ A;  5JH7 A;  4DR3 B;  2B5U A;  2KG7 A;  3CMA V;  1NQT A;  4H33 A;  4FM2 A;  5KA6 A;  3MAQ A;  3K58 A;  2EUL A;  2IH1 C;  1SQB H;  1T5E A;  4IHJ B;  4K0K B;  4UVC A;  1GM9 A;  3ZMS A;  3ABL C;  3AG4 C;  1PD3 A;  2EZO A;  3G71 V;  2UU9 O;  2W0F C;  4FLT A;  4TV8 B;  1DF4 A;  4J7K A;  3RFR A;  2JK5 C;  2HEP A;  1S5L Z;  5IDJ A;  2GSM B;  3EFF K;  1KUQ A;  4LF4 B;  1ZX3 A;  4CC6 A;  1VQ8 V;  1YVW A;  4J41 A;  2IW5 A;  1GMG A;  2BSK A;  3HKD B;  3NXS A;  5GON A;  5KHG A;  1YEW A;  4BIZ A;  3K03 A;  3U0Z A;  3CWB H;  1CPY A;  1S76 D;  4JI4 O;  5ITZ B;  1M5I A;  4BWA A;  3NR7 A;  3KG2 A;  1Q43 A;  2A0L A;  3ZHT A;  2Z0A A;  1N0N A;  1XBL A;  4DV6 O;  3ZN1 A;  4FLZ A;  3D3Q A;  4JI8 O;  1FS0 G;  4K8Z A;  4G28 B;  3Q4H A;  1R6T A;  1AP6 A;  3QNE A;  4EB6 B;  1ZUQ A;  1SQG A;  2Q0O C;  2G38 A;  5DM6 V;  1VQ4 V;  4GKJ B;  4GLX A;  4BAY A;  2CH7 B;  1Y74 A;  3JAT A;  4X89 A;  3T1Y B;  4X64 B;  2KQX A;  4X20 A;  3CCU V;  2P22 C;  2ZR2 A;  4HAM A;  1G8M A;  1YSC A;  3BHP A;  1N34 O;  4GCZ A;  1OCO C;  2Y0P A;  3ZRW B;  2PF4 E;  1HWY A;  2WSS G;  3ASO B;  2VS0 A;  1SA0 B;  4X64 O;  1J5E O;  5JWP A;  1DGS A;  2YDE A;  4X20 B;  3B09 A;  5CA3 A;  4WF9 V;  1VP7 A;  3BA9 A;  2DYS B;  3L9D A;  2KSD A;  4LF7 O;  3UO3 A;  3CME V;  2YEV B;  1KD1 W;  1H38 A;  3ABM C;  5B1N A;  4QE7 A;  4EB6 A;  2DWE C;  1MNG A;  4AIL C;  4D7S A;  1UJW B;  1RPO A;  4PHZ A;  2YEV A;  2R72 A;  2Q69 A;  2UXD O;  4DV3 B;  3C3S A;  4B3S O;  1P4R A;  1P7G A;  4DR7 B;  3RYC A;  2VWJ A;  2ZR3 A;  3UKM A;  4WFG A;  3CRA A;  4DUZ B;  4YJ2 B;  2HHH B;  3RVY A;  4DV1 O;  5KX5 A;  3T1H O;  2F4V O;  5B66 Z;  1N32 B;  5B1B C;  3ZN0 A;  4J80 A;  4X8A A;  3WB1 A;  4B3T B;  3OGI B;  4JTD B;  3QG5 A;  5B3S B;  1SS3 A;  5DN6 G;  1FJG O;  4O2B B;  2B1G A;  5K1P A;  5IT9 N;  4UCU A;  3F7V C;  5LA6 B;  5CB4 B;  3BEH A;  5L3G A;  1Q5O A;  2EIK C;  1GAX A;  4DUZ O;  4LF6 O;  2R9I A;  4JAA A;  1GN4 A;  5EK0 A;  5LBQ A;  3G6E V;  3E83 A;  1K4C C;  1XNQ B;  2ZDI A;  2EIL C;  4I9Q A;  2UUB B;  4X1I A;  2Z3Y A;  2F1M A;  3QTC A;  5D5Q A;  3H1H H;  1ZL8 B;  2P4V A;  2WLI B;  1YIJ V;  1COW G;  4LFA O;  2OIG A;  5EBW C;  1K3E A;  2ARH A;  2HVK C;  5LYJ A;  3WFV A;  2Q4P A;  3HKE B;  4CH5 A;  2VRZ A;  3JAK A;  1RSO B;  4LF6 B;  1PNM A;  2NN4 A;  4JI6 O;  1IBK O;  1WA8 A;  4WFH A;  2ZQM A;  1XNR O;  1Z5V A;  1RM1 C;  4WFF A;  5H6Q A;  1OCR C;  4ZHQ B;  3K5O A;  4GZR B;  3A0R A;  1Y66 A;  2Y4U A;  3ZMU A;  2ZNI A;  3OT7 A;  2L6L A;  4J7J A;  2ETN A;  3WB2 A;  4UCS A;  1SES A;  1W59 A;  5EYP B;  3VQX A;  4U3J A;  4QNH B;  1W0J G;  3RVZ A;  2PGG A;  3B2E E;  3E22 B;  1K33 A;  3UT5 B;  2EX3 A;  3FAV A;  5JVD B;  3IC7 A;  5DED A;  1VQ9 V;  5LP6 A;  1V55 C;  4FPP A;  3E8B A;  4FIP C;  3G6B A;  1XRE A;  3P30 A;  1PP9 H;  1VMG A;  4ABM A;  3CJH A;  1OCC C;  2HG5 C;  3R65 A;  5KUM A;  4DW1 A;  4EKW A;  1PPJ H;  3W7X A;  2UXN A;  4Q6G A;  4XDK A;  2LP7 A;  3I55 V;  4Q20 A;  2N04 A;  3ABT A;  4UFZ A;  3M7M X;  5H5N A;  2JJ2 G;  1NTK H;  3ZS8 C;  3ZED A;  4B3M B;  3J7A U;  3STL C;  1QHT A;  4LCU C;  4FVM A;  2XUM A;  3AK2 A;  4BIO A;  5CMU A;  2VWK A;  3N2G A;  2YS8 A;  1IBM O;  4TWK A;  3SPH A;  4UUJ C;  1H8E G;  1MZF A;  4LC1 A;  4R8C A;  4DK1 A;  3CCS V;  1TVK B;  3X2Q C;  1N33 O;  3AG1 B;  2F93 B;  2BCC H;  3RYH B;  3LNN A;  1Y67 A;  4KL1 A;  1AB3 A;  2JGD B;  1S5J A;  1YXB A;  2JS3 A;  2RJZ A;  3JSN A;  4UV8 A;  3I56 V;  1GM7 A;  5HFL A;  5LYJ B;  2Q0A A;  2QWP B;  1JA8 A;  2PTM A;  3IFX A;  3FB8 C;  1VQL V;  4JZ2 A;  4UV9 A;  2H3O A;  2QA4 V;  4RQF A;  5KMG A;  1U97 A;  5FNV B;  1UPG A;  1RFY A;  3LDD A;  4DR6 B;  1GK9 A;  3ASO C;  1YJN V;  1IUR A;  4DV6 B;  4RO2 A;  1TAE A;  1M57 C;  2R9R B;  2B9Z A;  1CP9 A;  1JR9 A;  2EJR A;  4ICG A;  2HFE C;  4LFB B;  4PI2 A;  1YZB A;  4Z1V A;  4I9W A;  2A9H A;  1ZLZ A;  4OX9 B;  2IH3 C;  4LF9 O;  5L3D A;  2E5L O;  4MVU A;  2UUA O;  4K8X A;  3GWK C;  4LFC O;  4I0X A;  1EZV H;  2QWO B;  2HLD G;  1G4Y B;  4MVS A;  3ASN B;  1KYO F;  3S3X A;  3CC4 V;  3M8A A;  5EC2 C;  1QBZ A;  5IJ9 B;  4GX0 A;  3OEE G;  3LUT B;  4I50 A;  3K59 A;  3WG7 B;  4YXW G;  4PDV A;  4DR1 O;  4J11 A;  4GKK B;  1MAB G;  1N8R W;  4JI1 O;  1IDS A;  3E35 A;  5CBF A;  5CA0 A;  1PV0 A;  4G27 B;  3RW0 A;  1B06 A;  3SDL A;  3BA8 A;  1THZ A;  4I4T A;  3AEI A;  1GN2 A;  2ILM A;  1PL4 A;  4MTO A;  2DN9 A;  3HKB B;  3TJT A;  5A9G A;  1JQ0 A;  3F5W C;  1BS3 A;  2ZNJ A;  3VQW A;  1FXK A;  1K8A W;  2M7W A;  3T1Y O;  3JD4 A;  3CRQ A;  4J42 A;  4R6Z A;  1GTO A;  2YSU B;  2ZIO A;  1FXV A;  1BQZ A;  2IU3 A;  2P90 A;  1VQO V;  1JJ2 U;  4R50 A;  4NVP A;  3CCE V;  4WFE A;  5C93 A;  2PI5 A;  4UB8 Z;  5CBH A;  4MVZ A;  2IBZ H;  2QKS A;  4LF9 B;  3N2K B;  3IC9 A;  4DYL A;  3K08 A;  4MTF A;  5GW7 A;  4QJF B;  2DMX A;  1S5H C;  4O4H B;  3JAW A;  1Q6I A;  4CH3 A;  3E8G A;  3OUF A;  3VBB A;  4CBC A;  1WP7 A;  1VQ5 V;  1BHA A;  4PA6 A;  4FJC C;  2PYL A;  3A0H Z;  2QTS A;  2WAM A;  1YI2 V;  3HR0 A;  4ZHQ A;  3SPJ A;  1B04 A;  4NTW A;  1MSD A;  4IHJ A;  4I7Z B;  4BIU A;  3K06 A;  4F6R B;  1I5Y A;  3ZMZ A;  3APQ A;  1F4M A;  4OPH A;  1NTZ H;  4XBF A;  2JDI G;  1B6Q A;  1K73 W;  4DV3 O;  5EZY B;  2E74 B;  3BRC A;  4LWS A;  3X2Q B;  3CP1 A;  3CPW U;  2EIJ C;  4JI8 B;  2L35 A;  1MZE A;  2UUC B;  4RUE A;  5LMN O;  1YHQ V;  4L8J A;  4DK0 A;  2CTR A;  4J9Z B;  3DC5 A;  3ZJZ A;  4H44 B;  2PUS A;  5B1B B;  4K0K O;  2LGQ A;  1DTO A;  2ZXW B;  1K97 A;  1SRY A;  2WA4 A;  1N0J A;  5EIB D;  1L0N H;  3BAA A;  4F6E A;  1V54 B;  4DUY O;  1NU1 H;  5J2U A;  4X1K B;  1LR1 A;  2LQT A;  2LFS A;  4NXN B;  4FLV A;  2AHZ A;  5EBM C;  1V55 B;  1FFT B;  4ZOL A;  3FX7 A;  3RYF B;  3CC2 V;  3JAW B;  4U3F H;  4LFA B;  4IGG A;  2K9P A;  2F43 G;  5KMG B;  2IJH A;  3S3W A;  2ODM A;  3B8N A;  3L73 H;  5LOV A;  1SQX H;  3HKD A;  3SJA C;  3CCR V;  2EIN B;  2YIB A;  1US6 A;  2QTO A;  3RYC B;  2QEX V;  1X59 A;  5KHI A;  1K7D A;  5JJE B;  4JAU A;  2VQE B;  5BMV B;  1ROP A;  4ASU G;  5DEC A;  5LXT A;  1OCZ C;  1RM1 B;  4X66 B;  3RT3 C;  3VQY A;  1X4T A;  4D6T H;  4CS2 A;  4YIO A;  3ETQ A;  2LO1 A;  3T2M A;  3DXR A;  4K35 A;  4HYO A;  1N33 B;  4DR1 B;  1BMF G;  1D5N A;  1O9H A;  1BT8 A;  2ADP A;  5IWA B;  4JV5 B;  1VF6 A;  3CD6 V;  5BZB A;  2KG7 B;  1R3L C;  3HKB A;  4JGS A;  5FPO A;  4HBN A;  3BFR A;  3MD0 A;  1Q90 D;  1WPX A;  1BL8 A;  1Y4M A;  2X7R B;  1WN7 A;  2IJJ A;  4X88 A;  4JZG A;  2ZDI C;  4MVR A;  1S0V A;  3DXR B;  2UXC B;  2WWW A;  3JAL A;  5H9C A;  2WLL A;  2EZP A;  2BOB C;  4DRX A;  2ZE6 A;  1VF7 A;  4FFB B;  4H37 A;  3A0B Z;  3H1J H;  1PKX A;  4NTY A;  3L71 H;  5IYD O;  4Z1M G;  3W7W A;  3CX5 F;  3ETG A;  1TGO A;  3IJ4 A;  1AJQ A;  2GHY A;  2X6B A;  1FXK C;  2ZIM A;  5CA1 A;  5J2T A;  1VAR A;  3B40 A;  1SF9 A;  2QDO A;  4JYC A;  5BY1 A;  1IXB A;  2Q68 A;  2VQE O;  4LR3 A;  1EBO A;  2DJV A;  2KKW A;  3JAS A;  5IJ0 A;  3CEI A;  1GKF A;  1AIL A;  2ATK C;  2CTW A;  1SC5 B;  1U96 A;  3MDS A;  4GT1 A;  4I50 B;  3ZRW A;  2QKC A;  3SYC A;  1F7Y A;  4JYA B;  2BTQ B;  3W7S A;  1KKC A;  1R6N A;  2E3C A;  4P9O A;  4MSW C;  4DR6 O;  5BXZ A;  3K5M A;  3UM7 A;  1QNM A;  5KAF Z;  3K9S A;  2K1E A;  3L70 H;  3UQ8 A;  4DR5 B;  3ZIA G;  2JEX A;  2FKX A;  1WAZ A;  2M6Y A;  2ZE7 A;  5IYZ A;  1JFF A;  4X65 O;  4JTC B;  4WCE V;  1KMI Z;  1BCC H;  1KP2 A;  3N2G B;  1N36 O;  1VQK V;  1IBL O;  2YIA A;  2DQ3 A;  3BAB A;  1XNQ O;  5LGU A;  1R3K C;  5IY5 B;  4UB6 Z;  3HPL C;  1H2L A;  5IJ9 A;  1QLE C;  1A32 A;  4JYY A;  2O57 A;  3B4S A;  3RYI B;  2Z5U A;  3RYH A;  3K3W A;  4RUF A;  1KC8 W;  2P7T C;  3OR6 C;  3RN4 A;  2ZKO A;  2JEU A;  3K79 A;  4JF3 A;  1M93 A;  1BE3 H;  1AR5 A;  5EIB C;  4O4J B;  2FTK A;  2GUZ B;  3ZRX A;  4LH6 A;  1HNX B;  3STZ C;  1NKD A;  4IYI A;  1FFX A;  2ZM6 O;  1Y6X A;  3UT5 A;  3AG3 C;  4MTG A;  3EXA A;  4OPA A;  1HNW O;  3OR7 C;  1FFX B;  4GX1 A;  3BCC H;  4FFB A;  1GN6 A;  4N23 A;  1K9M W;  2UXB O;  2FYU H;  1NR1 A;  4U3J B;  2N05 A;  2RMK B;  4FK5 C;  1K92 A;  1VIB A;  5K1X A;  1SQQ H;  4KXR A;  3SR2 C;  1OV9 A;  3N27 A;  3RYI A;  1YCI A;  3SYA A;  1OZ0 A;  5JQG A;  3ZMV A;  1W2B U;  2PZS A;  1HDJ A;  4B3M O;  1ZTE A;  4BW5 A;  2JGU A;  4YJ3 A;  5KHJ A;  1TUE B;  4OGQ B;  3AG7 A;  3ABM B;  3HKC B;  1NH2 B;  3T4D A;  3MHS C;  4FLU A;  4AHC A;  1HNZ B;  1EN4 A;  1MSW D;  4X1K A;  1JPX A;  2A06 H;  4JAV A;  4TQF A;  2VQF B;  3E22 A;  2UXC O;  4NR1 A;  1GRJ A;  4X1I B;  3DSQ A;  4DV2 B;  1H2K A;  3K0D A;  5BMV A;  2YIC A;  4NTX A;  4YHH O;  4L87 A;  3CCJ V;  1QLE B;  1AI6 A;  4GUN A;  2ZM6 B;  2WPD G;  4TV9 B;  2E5L B;  1PNL A;  2PYJ A;  4NXM B;  3G80 A;  3JAS B;  5IJ0 B;  1WB8 A;  2DOS A;  1WB7 A;  5B1O A;  3SJC C;  1YF2 A;  1JJO A;  3LSS A;  3CRC A;  1GN3 A;  4PJ0 Z;  5A2Q N;  1P84 F;  3LNM B;  1TA8 A;  1SQV H;  4FLX A;  1CXZ B;  4YY3 O;  1YDX A;  3N2K A;  2WLK A;  5L3F A;  4X62 O;  2BE3 A;  1R3J C;  4GX5 A;  4JI2 B;  2DWD C;  1M56 C;  5KHK A;  4UCR A;  1FJG B;  1S3J A;  3GWO A;  1VF5 B;  1H2G A;  1DK1 A;  2D3O W;  4FLW A;  2WLJ A;  1VEW A;  5B1A B;  4CS4 A;  1SA0 A;  2JGD A;  3SPI A;  1F23 A;  1S72 V;  5FLX N;  1AR1 B;  2QWQ B;  2YI9 A;  2Q67 A;  4IL6 Z;  2JVD A;  3SJQ C;  4PDL A;  2B1I A;  3OFN G;  4FM0 A;  5H2F Z;  3JAR B;  4I55 A;  4O4I B;  4X66 O;  1KQS U;  3E8H A;  4LFB O;  4WBN B;  2LW1 A;  3ICX A;  3ZX6 A;  1YTF B;  2OTL V;  4LF8 O;  1GO3 F;  1QR9 A;  1HP8 A;  4H13 B;  2OTJ V;  1Y74 B;  1I94 B;  3QVN A;  2CH7 A;  1YJW V;  5H6R A;  4X9Q A;  1Q6H A;  1XIL A;  5LXT B;  1M4U A;  4DR2 B;  3WG7 C;  3CCL V;  1F51 A;  2DW4 A;  4I5S A;  4LF8 B;  3P3P A;  1R1B A;  2YI8 A;  4YIP A;  1JVM A;  1EN5 A;  1HNW B;  4I0X B;  1WP8 A;  3JAT B;  2X6A A;  3ML0 A;  5GON B;  3ABU A;  4DV5 O;  4LF4 O;  1XUQ A;  3GVM A;  3CS5 A;  2XAF A;  4KUM A;  4GKJ O;  3THO A;  4TOI A;  5IYB O;  3O65 A;  1Q82 W;  3B77 A;  3RGB A;  2ZE8 A;  1BGY H;  2DQ0 A;  3B8M A;  1Q8I A;  5J2U B;  2AZ0 A;  1QCE A;  5IE9 A;  2P4K A;  3J80 N;  3D8C A;  1RPR A;  4DW0 A;  3OMI B;  2YIB D;  5EBL C;  5LOV B;  3BPZ A;  3UCS C;  1XHZ A;  5LP6 C;  2V4D A;  3J81 N;  3ZMT A;  2FL4 A;  5JQG B;  3JAM N;  1K4D C;  3KKY A;  2BSK B;  1N36 B;  3AG4 B;  3H01 A;  2XT9 A;  1WA8 B;  3OAA G;  4JI5 B;  1WNS A;  2UXB B;  1LNQ A;  3HKC A;  1UFI A;  3VOU A;  4JYA O;  1FD9 A;  4JYB A;  5ITZ A;  4U7O A;  2E75 B;  2WLI A;  3CRR A;  1FXK B;  2V7Q G;  4MT8 A;  4E4E A;  5JCO C;  3AG1 C;  4DUY B;  3DC6 A;  4JI0 B;  4TQD A;  3KCY A;  2ZXW C;  5F2V O;  2ZD9 A;  4KHP B;  2OCC B;  1K5Q A;  4GX2 A;  1P7B A;  3A8T A;  4O4J A;  1NBM G;  2F66 C;  3FD9 A;  4PDR A;  4TT3 G;  4X1Y B;  3QO7 A;  2W6J G;  2F95 B;  4JTA B;  2CGO A;  4O4I A;  1DLB A;  4O4L A;  4PA3 A;  4TUY B;  1MMM A;  3QO8 A;  1Q3E A;  5FNV A;  1VQN V;  3FB5 C;  1MG1 A;  2Y69 B;  3ZRS A;  4JI3 O;  1M90 W;  2H94 A;  2ZE5 A;  4PV1 B;  4GKK O;  3DTU B;  1OCC B;  3IGA C;  4A5U B;  4CH6 A;  1SKV A;  1XHX A;  2A7W A;  3OE7 G;  5EZY A;  1NJI W;  3ZCC A;  3W7T A;  3JSL A;  2R70 A;  2WA3 A;  4G2K A;  4JI5 O;  4F6R A;  2DYR C;  3DGE A;  1BZK A;  2AXT Z;  2F23 A;  3OD4 A;  2WLH A;  1EM1 A;  4TV8 A;  2Y48 A;  1NT2 B;  2HP8 A;  1XMQ O;  5CA0 B;  4WBN A;  1KP3 A;  1BHB A;  4EFE A;  1JMK C;  2HVJ C;  2UU9 B;  5LHI A;  1FKA O;  3FKS G;  4DR7 O;  3P3N A;  3EVK A;  2Q8V A;  2HHH O;  4F4L A;  1R3I C;  4QGP A;  1RSO A;  4RQE A;  1IZ3 A;  4LNU A;  1JX9 A;  1IXM A;  2EIN C;  5LGN A;  4LF5 B;  1EFR G;  3CXC U;  3TXS A;  5IWA O;  4DV5 B;  1L8D A;  1Z5W A;  3R66 A;  3K57 A;  4B3S B;  3CSX A;  4WFB V;  4I4T B; 
#chains in the Genus database with same CATH homology
 1VQ9 V;  4PA4 A;  1V55 C;  4FPP A;  4LP8 A;  2K1E A;  3E8B A;  4FIP C;  3T1C A;  3ZIA G;  2JEX A;  1K34 A;  3P30 A;  3K0G A;  1OCC C;  4JTC B;  4WCE V;  2HG5 C;  3JYC A;  1KP2 A;  3R65 A;  3FB7 C;  1VQK V;  5KUM A;  4EKW A;  1YTF D;  4DXW A;  2DQ3 A;  1QVF U;  3D36 A;  3W7X A;  2Y69 C;  1K5S A;  2UXN A;  5LGU A;  4XDK A;  5CBG A;  1R3K C;  2LP7 A;  5KA5 A;  5IY5 B;  1M9N A;  3I55 V;  4HZ3 A;  1MOF A;  3HPL C;  4Q20 A;  1QLE C;  4MW3 A;  3ABT A;  2JJ2 G;  4QIW F;  3RBZ A;  3EHB B;  2X6C A;  5HFM A;  3STL C;  2H8P C;  2Z5U A;  3TCU A;  3K3W A;  1I5X A;  2IU0 A;  4RUF A;  3JD2 A;  4LCU C;  1KC8 W;  2P7T C;  3OR6 C;  2HJF C;  3G4S V;  2JEU A;  3FB6 C;  3K79 A;  4JF3 A;  5CMU A;  2X0L A;  3E8F A;  3OMN B;  2A79 B;  4TWK A;  5L3B A;  3SPH A;  3ZRX A;  2FTK A;  2BOC C;  2C2A A;  4UUJ C;  1DF5 A;  1H8E G;  4LC1 A;  4R8C A;  4XDL A;  3SYO A;  3CCS V;  1M1K W;  4E2L A;  3X2Q C;  3STZ C;  1E1R G;  1AI4 A;  3AG1 B;  1NKD A;  4FMT A;  1ARO P;  2AHY A;  4CZZ A;  1VQP V;  2JJ1 G;  4DO2 A;  2PI4 A;  3AG3 C;  4MTG A;  1NVP D;  2UXX A;  3OR7 C;  3D3I A;  4GX1 A;  2XND G;  3CCQ V;  3FYE B;  4N23 A;  1NR7 A;  1K9M W;  2P6J A;  4UV8 A;  1KEC A;  3I56 V;  1GM7 A;  5HFL A;  4MVQ A;  1NR1 A;  5CN0 A;  3CC7 V;  3JD1 A;  4QPJ A;  4FK5 C;  3IFX A;  3OUS A;  3ABK B;  3FB8 C;  1VQL V;  4UV9 A;  1K92 A;  1WLE A;  2DYS C;  5EC1 C;  2QA4 V;  4RQF A;  2NLJ C;  2LFR A;  3LDD A;  4QPK A;  3SYA A;  1OZ0 A;  1GK9 A;  4TSF G;  3OM3 B;  3SPC A;  3ASO C;  3ZMV A;  1W2B U;  1AI5 A;  5L3E A;  1OCR B;  1YJN V;  1SZT A;  1AJP A;  2XAJ A;  4RO2 A;  3E86 A;  1M57 C;  2R9R B;  4BW5 A;  1CP9 A;  1YJ9 V;  2EJR A;  1S77 D;  2HFE C;  3MHH C;  4KP4 A;  1TUE B;  1NH2 D;  3AG2 B;  3ABM B;  4PEL A;  4I9W A;  2A9H A;  1NH2 B;  4P9P A;  3T4D A;  3MHS C;  2DYR B;  4JAS A;  2IH3 C;  1QR8 A;  2NNU A;  1MSW D;  1VQM V;  2QE7 G;  3SYQ A;  2XAS A;  3ABK C;  5L3D A;  4MVU A;  2P67 A;  1R6K A;  4P30 A;  4MW8 A;  3T4Z A;  3JD3 A;  3CCM V;  1JPX A;  1QVG U;  4JAV A;  2HLD G;  1G4Y B;  2JIZ G;  4MVS A;  3ASN B;  1JOY A;  3K9A A;  3JD0 A;  3K0D A;  1VQ7 V;  4U7N A;  3CC4 V;  2EIJ B;  4QE9 A;  4L87 A;  4N21 A;  5EC2 C;  1QBZ A;  3CCJ V;  4GX0 A;  3OEE G;  3LUT B;  3WG7 B;  1QLE B;  1AI6 A;  4YXW G;  3AG3 B;  2WPD G;  5L3C A;  1JCH A;  4PDV A;  2EIL B;  5IY5 C;  3BY6 A;  1PNL A;  1NVP B;  4P2Z A;  1ZWI C;  1MAB G;  3OMA B;  3P32 A;  1N8R W;  3E35 A;  5B1O A;  5CBF A;  5E1A C;  1ORQ C;  4G27 B;  3RW0 A;  4XDJ A;  1H8H G;  2V1D A;  4PA7 A;  3F7Y C;  3ZRV A;  3LSS A;  4WFB V;  4MS2 A;  1THZ A;  3LSQ A;  1KKD A;  1L1F A;  5IYC O;  3AEI A;  3TET A;  2B5U A;  3LNM B;  2HR3 A;  4MTO A;  1JQ0 A;  3F5W C;  3OGC C;  5J9P C;  3CMA V;  1FXK A;  1NQT A;  1K8A W;  2WLK A;  5L3F A;  2M7W A;  3JD4 A;  1R3J C;  4GX5 A;  2DWD C;  1M56 C;  2ITC C;  4H33 A;  4R6Z A;  1GTO A;  2YSU B;  5KA6 A;  1FXV A;  2XAH A;  2IH1 C;  4J9Y B;  3ETD A;  1S3J A;  3GWO A;  1Q86 W;  2IU3 A;  4UVC A;  3AG2 C;  1GM9 A;  3ZMS A;  1H2G A;  3ABL C;  3AG4 C;  1PD3 A;  2D3O W;  2EZO A;  3G71 V;  2P90 A;  2WLJ A;  2W0F C;  5B1A B;  4KFM A;  1VQO V;  1JJ2 U;  4R50 A;  4PDM A;  3CCE V;  4WFE A;  5C93 A;  4JPR A;  3SPI A;  1F23 A;  2PI5 A;  1DF4 A;  5CBH A;  1S72 V;  4MVZ A;  2QKS A;  2WLM A;  1AR1 B;  5IDJ A;  2HKO A;  2JK5 C;  3K08 A;  2Q67 A;  2GSM B;  1QLN A;  4MTF A;  5GW7 A;  1J95 A;  1XL4 A;  3EFF K;  3SJQ C;  4PDL A;  4QJF B;  2B1I A;  3OFN G;  1S5H C;  1GM8 A;  1KQS U;  3E8H A;  1XL6 A;  3E8G A;  5KUK A;  1OHH G;  3OUF A;  3VBB A;  4CBC A;  1VQ8 V;  2IW5 A;  1VQ5 V;  1BHA A;  4PA6 A;  1GMG A;  4FJC C;  1VQ6 V;  3NXS A;  2WAM A;  1R73 A;  1YI2 V;  1E1Q G;  3SPJ A;  4BIZ A;  1YTF B;  2OTL V;  4OXS A;  1GO3 F;  1QR9 A;  3K03 A;  4MVM A;  4BIU A;  3K06 A;  2OTJ V;  1I5Y A;  1CPY A;  1OCO B;  1S76 D;  3ZMZ A;  1YJW V;  1F4M A;  4ZBM A;  5H6R A;  2XAQ A;  2XOK G;  4XBF A;  2JDI G;  3CYO A;  1FXH A;  1B6Q A;  3KG2 A;  3LDC A;  1K73 W;  3WG7 C;  3CCL V;  3E2E A;  2QM8 A;  1F51 A;  2DW4 A;  2A0L A;  4I5S A;  3X2Q B;  3CCV V;  2WLL B;  3CP1 A;  2EIJ C;  3CPW U;  3ZN1 A;  1FS0 G;  4G28 B;  1JVM A;  5B3S C;  4RUE A;  1CEZ A;  1YHQ V;  3QNE A;  4J9Z B;  3HB3 B;  3ZJZ A;  2X6A A;  3ML0 A;  5B1B B;  5DM6 V;  2ZXW B;  1DTO A;  3JCZ A;  1K97 A;  1SRY A;  3ABU A;  1VQ4 V;  2XAG A;  2ITD C;  3TK1 A;  4MTX A;  4BAY A;  2IJI A;  2XAF A;  4KUM A;  1V54 B;  4X89 A;  2EIM B;  5IYB O;  3CCU V;  4UXN A;  1Q82 W;  3B77 A;  2ZR2 A;  4HAM A;  1G8M A;  1YSC A;  2LFS A;  2DQ0 A;  3B8M A;  2AHZ A;  4GCZ A;  1V55 B;  5EBM C;  1OCO C;  1FFT B;  4LBE C;  5LGT A;  1QCE A;  3GB7 C;  3ZRW B;  3CC2 V;  3ETE A;  1AJN A;  1HWY A;  2WSS G;  3ASO B;  1RPR A;  2CK3 G;  2F43 G;  3OMI B;  2Q6A A;  3M99 B;  5EBL C;  1F4N A;  2QM7 A;  1Q7Y W;  2IJH A;  3W7U A;  4UVB A;  5CA3 A;  4WF9 V;  1SET A;  1EZJ A;  2DYS B;  3B8N A;  3ZMT A;  1K4D C;  4WFA V;  3CME V;  2YEV B;  3CCR V;  2EIN B;  3AG4 B;  3H01 A;  1KD1 W;  1H38 A;  2QTO A;  3OAA G;  2QEX V;  3ABM C;  5B1N A;  1K7D A;  4QE7 A;  1LNQ A;  4JAU A;  2DWE C;  1UJW B;  1ROP A;  4ASU G;  1RPO A;  1OCZ B;  3VOU A;  1M57 B;  2YEV A;  1OCZ C;  2WLN A;  2Q69 A;  4JYB A;  1RM1 B;  4U7O A;  3ABL B;  2WLI A;  4R7C A;  1P4R A;  1FXK B;  2V7Q G;  4MT8 A;  3AG1 C;  2ZR3 A;  3UKM A;  1YIT V;  4WFG A;  1M56 B;  3T2M A;  4HYO A;  3RVY A;  1BMF G;  2ZXW C;  5B1B C;  5LHG A;  2OT5 A;  2ZD9 A;  3ZN0 A;  4X8A A;  2W6I G;  2OCC B;  1K5Q A;  4JTD B;  4GX2 A;  1P7B A;  2KB1 A;  5B3S B;  5DN6 G;  1NBM G;  2B1G A;  4PDR A;  4TT3 G;  3QO7 A;  3CD6 V;  2W6J G;  4JTA B;  3F7V C;  5BZB A;  3BEH A;  3OEH G;  1DLB A;  5L3G A;  1R3L C;  4JGS A;  4PA3 A;  3MD0 A;  3QO8 A;  2EIK C;  1AI7 A;  1WPX A;  1BL8 A;  2EIM C;  1VQN V;  1Y4M A;  1V54 C;  3FB5 C;  1MG1 A;  4RAI A;  2R9I A;  2X7R B;  2Y69 B;  2MK3 A;  2EBO A;  5EK0 A;  2IJJ A;  4X88 A;  3ZRS A;  5LBQ A;  3G6E V;  3OW2 U;  1M90 W;  3E83 A;  2ZDI C;  2H94 A;  1K4C C;  4PA9 A;  4MVR A;  1S0V A;  2ZDI A;  3DTU B;  1OCC B;  3IGA C;  2WWW A;  2EIL C;  3ASN C;  2EIK B;  5H9C A;  2WLL A;  1SER A;  2EZP A;  2BOB C;  3OE7 G;  2Z3Y A;  2OCC C;  1NJI W;  4H37 A;  2WLI B;  1YIJ V;  3ZCC A;  1COW G;  1PKX A;  5EBW C;  3W7T A;  5IYD O;  1K3E A;  2HVK C;  2IJK A;  4Z1M G;  1E79 G;  3K04 A;  3WFV A;  5LHH A;  4G2K A;  1PL0 A;  3W7W A;  3ETG A;  2DYR C;  1AJQ A;  2GHY A;  4ZKI A;  3DGE A;  1PNM A;  2X6B A;  1FXK C;  4WFH A;  2WLH A;  2Y48 A;  1PNK A;  2ZQM A;  4JYC A;  1RM1 C;  4WFF A;  2Q68 A;  5B1A C;  1EBO A;  1KP3 A;  5H6Q A;  1BHB A;  1OCR C;  2HVJ C;  1GKF A;  5LHI A;  2ATK C;  3A0R A;  3FKS G;  1Y66 A;  3PJS K;  1Q81 W;  3ZMU A;  3LDE A;  3SYP A;  4GT1 A;  3ZRW A;  1ENV A;  3SYC A;  4F4L A;  1R3I C;  3FYI B;  4UVA A;  3W7S A;  3QO5 A;  4RQE A;  1SES A;  4QNH B;  1R6N A;  1JX9 A;  1W0J G;  1IXM A;  2EIN C;  3RVZ A;  5LGN A;  1W0K G;  4MVO A;  1EFR G;  1K33 A;  4P9O A;  3CXC U;  4MSW C;  3E89 A;  3SPG A;  5FL7 G;  3UM7 A;  3IC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...