3F7YC

Kcsa potassium channel in the partially open state with 17 a opening at t112
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
RAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title KcsA Potassium channel in the partially open state with 17 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3f7yC00
3KG2A 4P30A 3FB7C 4XDJA 2QKSA 3F7VC 1J95A 3FB8C 5KUKA 3F5WC 3IFXA 4WFGA 5BZBA 1JVMA 2EILC 1R3IC 2X6BA 3FB5C 4JTCB 4LBEC 4JTDB 2ITCC 4MVRA 2ITDC 4F4LA 3OUFA 3ZRSA 3E86A 4PA4A 4RUEA 2IH1C 4ZBMA 4GX2A 4MVOA 3SYCA 2EIKC 4P9PA 4MVSA 4G28B 4RAIA 4TWKA 3OUSA 4OXSA 2KB1A 4GX1A 4RUFA 5B1BC 5EBWC 3SPJA 3STLC 1R3LC 2NLJC 3SPCA 5IY5C 2A9HA 5EK0A 1V54C 4R6ZA 1OCOC 2AHYA 2ATKC 4R7CA 2WLHA 2Q6AA 4WFEA 3VOUA 4PA9A 4UUJC 2DWDC 1QLEC 3LDEA 3TETA 3SPGA 5KUMA 2WLNA 4I9WA 5E1AC 4MW8A 3K08A 4PA7A 3STZC 4CBCA 2H8PC 1ORQC 3X2QC 3LUTB 2WLJA 3ABLC 3AG1C 5B1AC 3F7YC 5J9PC 2ZD9A 2X6CA 4QNHB 1K4CC 2HJFC 1P7BA 1R3KC 2X6AA 3LNMB 3RW0A 3SPIA 4R8CA 3E8BA 4GX0A 5CBHA 4HZ3A 3GB7C 2A79B 2EIJC 2WLMA 3EFFK 4LP8A 3ASNC 4PDRA 4H33A 2IH3C 4PDVA 3LDDA 4R50A 1LNQA 4PDMA 3K06A 2WLIA 1ZWIC 4MSWC 5EBLC 3E8GA 4J9ZB 3WG7C 1KKDA 2WLIB 4GX5A 3R65A 5EBMC 2DYSC 3T4DA 4J9YB 3HPLC 3K03A 3E8FA 4HYOA 4P9OA 2ZXWC 4H37A 4MVUA 3E89A 2Q68A 2HVKC 3ZJZA 3ASOC 3LDCA 1OCCC 1XL6A 1OCZC 2A0LA 2OCCC 3OR7C 2P7TC 4PA6A 2K1EA 4MTFA 3SYAA 4JTAB 3SYQA 3FB6C 5CBGA 3E8HA 4MW3A 4G27B 2WLKA 5B3SC 1R3JC 2BOBC 2QTOA 3K0DA 3BEHA 3ABMC 3AG4C 4XDLA 4MVQA 3TCUA 4KFMA 2EIMC 2HVJC 4WFFA 2DYRC 2BOCC 2Q69A 2Y69C 5EC1C 3SYOA 5CBFA 4WFHA 3RVYA 3SYPA 3SJQC 3UM7A 1M56C 4BW5A 1K4DC 2R9RB 2HG5C 3OGCC 5EC2C 1XL4A 2JK5C 3E83A 2WLLA 3T1CA 3UKMA 4X89A 3K04A 2WLLB 3AG3C 4MTOA 2Q67A 4MVZA 4QE7A 3RBZA 3T2MA 4RO2A 2HFEC 1OCRC 4X88A 2W0FC 1G4YB 3OR6C 3ABKC 1M57C 3K0GA 2EINC 4MS2A 1V55C 2AHZA 4MTGA 4QE9A 3SPHA 3T4ZA 4PA3A 3JYCA 4LCUC 4DXWA 3PJSK 4XDKA 3RVZA 3IGAC 2DWEC 2YEVA 4PDLA 4P2ZA 4EKWA 1S5HC 1BL8A 4X8AA 3AG2C 4MVMA
chains in the Genus database with same CATH superfamily
5FL7G 2RDCA 5IWAO 4AQYO 1JVMA 2X6BA 2OTLV 4JTCB 3ZHVA 2OIGA 2GUZB 2W0XA 3E86A 5B3SB 5JQGA 5JH7B 3JCUZ 1SETA 2JVDA 4RUFA 4DW1A 4DV0O 5IY5C 1A32A 4R6ZA 1CP9A 3U10A 3VQXA 2VQEO 1JJOA 3IAYA 3CE2A 2CAZC 3RGBA 3R66A 4HNAB 5B66Z 3AK2A 2RQ6A 3T1HO 5KX5B 2X6AA 3CXCU 2UXXA 2F66C 1MABG 4YHHB 1KKDA 3WG7C 1OCOB 2XAHA 1JOYA 2WLIB 3BVOA 5J2TB 3AK3A 2KKWA 1EN5A 2Q68A 3LDCA 5IJ9B 5KA5A 2ZE8A 3G4SV 2LW1A 2BOBC 2QTOA 4JI0O 2F4VB 2HLDG 3ABMC 4LFBO 4UCVA 1XNRO 3SYPA 3RVYA 2MW2B 1NVPD 2P5OA 4LF7B 4LF6O 3AK1A 2WLLA 1H2GA 1EBOA 1YF2A 1ZSPA 4EEQA 3RBZA 1HR0B 4LWSB 1GTOA 1G4YB 4ABMA 1FXHA 1Z5WA 3BA9A 3DC6A 4GT1A 3VQWA 1VF7A 3B77A 2IU0A 2YC0A 3BABA 1IBMO 4X20B 4DK1A 1F7YA 3JARB 2YIBD 1SKVA 3D3QA 2JS3A 3BPZA 1Q90D 4P30A 2EZOA 2XAFA 1ZLZA 1BQ0A 1WP7A 2EILC 1R3IC 1FFXA 2YICA 1SQBH 1M57B 2FL4A 1TA8A 1WPBA 4H13B 1JQ0A 2EZPA 1SZTA 5LP6A 1K34A 4PA9A 2L6LA 4MT8A 4JPRA 4YHHO 3N27A 5EIBD 3W7WA 2H8PC 1HP8A 4JI6O 2BSKB 2IJIA 3ABTA 1P7BA 4CS3A 1DK1A 2A3QA 5KHIA 4HZ3A 2VWKA 3JASB 2YSUB 2FYUH 3KZIZ 4DYLA 2PF4E 3H9VA 4FLYA 1E79G 1M4UA 5LYJA 4JAVA 2F4VO 4F6RA 1BZKA 1UPGA 1OCZC 2HP8A 4LF8B 4QGPA 4WBNA 4LF7O 3CC2V 4X1IB 4DUZB 5CA1A 4IHJB 5B1BB 1HR0O 2BOCC 2Q69A 5EC1C 1K4DC 5LA6B 2N04A 4LNUB 1NVPB 1K33A 4IT5A 4X1KA 5JJJB 4Q20A 1J5EB 2YS8A 2Z5UA 1S0VA 4DV5B 4LH6A 3Q4HA 2IU3A 4O4IA 3ZRWA 1IZ3A 3JALB 1GKFA 2G38A 3IGAC 5CB4A 3D36C 3CJHA 2XAGA 2XASA 3CEIA 5IT9N 3OTFA 3OTOB 3J81N 3H01A 3CCQV 2QWOB 3FB8C 4MVRA 4F4LA 1OV9A 3A8TA 1PPJH 3CSXA 3OD4A 3WU2Z 3IC7A 2PI4A 4GLXA 1M9NA 2YDEA 3N2KA 3K5LA 1Q6UA 2QWRB 5D5QA 1WLEA 3RN4A 5K1PA 4AILC 5KUMA 3QNEA 1QVGU 1FFTB 3OEEG 1N34B 3X2QC 2P4VA 1K4CC 4I0XB 5KLVH 2OWOA 2LJ2A 3CCJV 2EIKB 3L72H 1R6KA 4JYYA 2FTKA 1SC5B 1K5SA 2E3CA 4LF8O 4O4LA 3MHSC 2QM4A 1GO3F 1ZWIC 4JI4B 2XUMA 1I5YA 1NR7A 3RFRA 1DF4A 1Q7YW 2QGNA 3T4DA 4DUZO 5ITZA 2DJVA 2PTMA 1KP2A 4LF4B 1O9HA 1CEZA 1WPXA 1W0KG 4JZGA 3L70H 2P7TC 4MTFA 4BAYA 4JTAB 2P67A 2L35A 1P7GA 1SF9A 1J5EO 2HJDA 2RCVA 1N0JA 2HVJC 4YIPA 4DV5O 1JFFA 3TK1A 4JYAB 1Y74B 2LGWA 1SQFA 3ZHRA 3QG5A 3HKDB 3NXSA 1ZL8B 1GN6A 1VQ9V 1QVFU 4ZHQB 1Y76B 4UV9A 1B6QA 4YIOA 5CMUA 2ZE7A 2R72A 2Y69B 3ZCCA 4NTYA 3JAWA 3LNNA 3L73H 1VQMV 1BL8A 4UCSA 1NTMH 4D7TA 2YXLA 5BZBA 1KECA 4F6EA 2XTAA 3JD3A 1HNZB 4EB6B 5LOVB 1N34O 3UO3A 2VQFO 3OUSA 3SPJA 4U3JA 1GM7A 2DN9A 3FD9A 2AHYA 4Z1MG 3JCZA 4K0KB 3AG2B 1N0NA 4L8JA 4O4JB 4HBNA 5KMGB 4JI4O 4FFKA 1PL4A 3MHHC 2DMXA 3UT5B 1XILA 4LF4O 3CYOA 2LGQA 2GHYA 3E8BA 4LP8A 5LMNO 2P06A 4X9QA 5FNVB 1JX9A 1NTKH 1LNQA 2W6JG 2P22C 2PUSA 3B09A 1YITV 1BT8A 1IX9A 4FM2A 3CRQA 2UXNA 4KHPO 1W0JG 1N36B 3ZN0A 3L74H 4JYAO 1RM1B 2K1EA 3SYQA 2CUGA 2GDSA 2WLKA 5B3SC 4U3FH 2EIJB 1AP5A 1M93A 3DXRB 1IXMA 4UB8Z 4JZ2A 1T5EA 4JI2B 2ZQMA 1GM8A 3E83A 3UKMA 1S77D 2DW4A 1MG1A 5J2UA 4CC5A 3AEIA 4O2AA 3E22A 4KUMA 4JF3A 4PHZA 4RO2A 3K79A 2EINC 2F43G 1US6A 5C93A 4NVPA 2XAJA 3ETQA 3UCSC 2YEVB 1HNZO 4FLVA 1S5HC 1ZAUA 1BS3A 5HFMA 4HAMA 2GSMB 3F5WC 5IYCO 1UFIA 3I5DA 1XUQA 4B3RB 3H1KH 4JTDB 4K0KO 1B06A 3BCCH 2W6IG 4TT3G 5JQGB 3ETGA 2EBOA 3ZBHA 1U96A 4D7SA 3RYFA 4E2LA 4MW8A 1ORQC 4DR5B 2WLJA 2X6CA 2ZKOA 1BCCH 2DQ0A 3CCMV 1NT2B 1N36O 1Y67A 4JASA 3K06A 3B8MA 1YSCA 3KKYA 4CZZA 3TXQA 1AB3A 1ENVA 4U7OA 1XL6A 1M90W 4OX9B 2JEXA 4JYCA 5LXTA 1B04A 4JI2O 2CTQA 4JI5B 4GYCB 1R3JC 3BHPA 3IJ4A 2B1GA 4QIWF 3ICXA 2QKAA 4I4TA 3SR2C 1N32B 2Q7EA 1OZ0A 5L3DA 2JK5C 4FMTA 2WLLB 2OCCB 1QLNA 3HKEA 1CXZB 3JSNA 5GTIZ 4FLXA 1L0LH 3SPHA 4GKKB 1GK9A 4UVCA 4B3RO 4DRXA 3RVZA 4TUYA 3NR7A 3FYIB 3O65A 1BHBA 1CPYA 3RYCB 3P30A 1G6UA 4UV8A 1AVMA 4UB6Z 4ZOLA 1KQSU 3QO5A 1SRYA 1BMFG 1FFXB 1K3EA 1XREA 1OCRB 2LFSA 4DV2B 3ABKB 2QM8A 3ZMTA 2O57A 3OUFA 4RUEA 1N8RW 1G8MA 1IBLB 4TWKA 3D36A 2WWWA 5B1BC 4DR2B 1FJGB 2ADPA 4LF9O 2ZE5A 3RYIA 1FXKC 1W59A 4UUJC 5LP6B 5E1AC 1GN3A 4DR1B 1S3JA 5KHHA 5GONA 5CBHA 3SPIA 3K58A 4JV5B 4OX9O 2A79B 2PYLA 4N21A 1XQ8A 4Z2WA 4BWAA 4U7NA 3OMIB 1VQ5V 4I9QA 4O2BA 3E8FA 4H37A 4ASUG 2HVKC 3QO8A 2ZDIC 2H3OA 1N32O 4F6RB 3E35A 4YJ2A 3AG1B 5B1AB 2Y4UA 3SYAA 1JA8A 2YXYA 1WA8A 4WBNB 3BEHA 4DR3B 4FM1A 3ABUA 4WFFA 5EZYA 1JR9A 4DK0A 4UCRA 1V54B 3JD0A 1SQPH 1BE3H 2DYSB 1NBMG 3CCSV 1SQVH 4GKKO 4E4EA 1NJIW 1MNGA 1L0NH 4X1KB 5EIBC 5BY1A 4FK5C 2E75B 2KSDA 1Y4MA 4DR6B 3BAAA 1N33B 4QPKA 4DV7B 2CH7B 3Q4HB 4O4IB 3ZRWB 4DV1B 1TUEB 3PJSK 4JI3B 1G1XB 4DV2O 3A0BZ 4TV9A 5CB4B 3MAQA 3CJHB 1RP3B 3PN1A 4BR6A 1AJQA 2EULA 1IBLO 4DR2O 1FJGO 1I7FA 1Q82W 1E1QG 4EFBA 4LH7A 2AW9A 5IYZA 1MZFA 3K5NA 4LFCB 5L3GA 1QHTA 4FJCC 1V55B 2V4DA 1GN2A 4P9PA 4NKGB 5H6RA 4DW0A 3JD4A 1IDSA 2A9HA 3KCYA 5BR8B 2ATKC 4R7CA 4JV5O 3N2KB 3GWKC 3VQVA 4I9WA 4YJ3A 1F23A 4ICGA 3LUTB 1GN4A 2VRZA 3CXHF 1KC8W 3JAKA 2A06H 1I94B 2WLMA 3ASNC 3JATB 5LMUB 3BRCA 4UFZA 5EBLC 4O4LB 2X0LA 4CH5A 2V1DA 3HB3B 3ZHUA 4GX5A 3R65A 1NS1A 3TGUH 4C7UA 2Q73A 5B1OA 2E74B 4DR3O 5ITZB 5CA0A 3IC9A 1DLBA 3CC4V 4K8ZA 3FKSG 3ABLB 3BY6A 3SJBC 1EN6A 1Q6IA 2A0LA 1VQPV 5CBGA 3K5OA 4B3TB 2M6YA 2IBZH 3TCUA 1WP8A 2Q7GA 4X62B 4DR6O 1JFFB 2PGGA 1SQXH 4DV7O 4DV1O 2ZXWB 3M99B 4FZ1A 3CRRA 3FX7A 1S5JA 2VWJA 2K9PA 4NTWA 2FKXA 2Q67A 4L87A 2Y48A 4YY3B 2OTJV 3DSQA 3T4ZA 1XI1A 1KP3A 3LSUA 2D2CB 3QTCA 3MD0A 4LFCO 4P2ZA 3UQ8A 3OE7G 3JAWB 3CX5F 1YJ9V 3K5MA 4FVMA 1EFRG 2QDOA 3IFXA 5BR8O 4UVAA 2JIZG 4B7EA 3MDSA 2QSAA 2PY5A 4MVOA 1FAFA 4A5UB 4IYHA 1YJNV 4OXSA 5EBWC 1P84F 4U3JB 4H44B 5EK0A 1L8DA 1I94O 1SA0A 3H1JH 1AR5A 3SPGA 1PNKA 5LMUO 2R9AA 4CBCA 3HKCA 3L9DA 4TV8B 5J9PC 2ZD9A 4QNHB 2E76B 1QR9A 1JCHA 1XMQB 5KAFZ 2KG7A 5IY5B 2PYJA 2WSSG 4MSWC 4ZI7A 2NNUA 4B3TO 4B7KA 2OIEA 1MOFA 4WFAV 4X62O 3ASOC 1PL0A 1OCCC 1FXVA 1Q86W 2Q0AA 4JAAA 1H38A 3C3TA 5E79Z 3FB6C 1LUVA 4PI0A 1VIBA 5LHIA 3K0DA 2FMLA 3B4SA 4BIOA 3WG7B 2EIMC 3SJQC 3G67A 4YY3O 2BE3A 2NN4A 2ZT9B 1QLEB 5DECA 1THZA 5J2UB 1K7DA 3AG3C 4MTOA 3ZEDA 3J80N 2CTPA 4O2AB 1YCIA 3E22B 4MVZA 2HFEC 1NH2D 1K97A 2EJ7A 2AHZA 3D8CA 1P4RA 1ZTEA 2QWNB 3K57A 2Q4PA 4UCOA 3E2EA 3AG4C 1WB7A 4EFEA 4I5SA 1XMOB 1XOUA 4CH4A 1VQ8V 1LUWA 4PD4F 1QR8A 1SERA 2UUAB 2Y4TA 3OTOO 4JI8B 3ZRSA 4PA4A 3CCEV 4ZBMA 5B1NA 2N05A 4IGGA 4I55A 4IIJA 1SQQH 5JJNB 1D5AA 2DYRB 3RT3C 3B2EE 4UCTA 1XMQO 1MZEA 2AGAA 3RYFB 2LW7A 3WB2A 2EILB 1F51A 4JI1B 2QE7G 1GH6A 3AG7A 1R3KC 3LNMB 3RW0A 2B5UA 4Q6GA 3EHBB 4DUYB 1FXKA 4LNUA 1YVWA 2JGUA 2YIDA 3EVKA 4X66B 3P3NA 4W4LA 2XNDG 3E89A 3CHXA 2B1IA 3G80A 3C90A 3ETEA 4PI2A 4GCZA 5LXTB 2IJKA 1U97A 2DOSA 5KHJA 4FLTA 2Q7HA 3ZX6A 2ZR3A 2C2AA 3FFQA 4K8XA 5JCOC 4I4TB 4WFHA 1M56C 2JEUA 1ROPA 1RSOA 5CA3A 2ZDIA 5L3FA 3K04A 1OCZB 4NB5A 1XMOO 4X88A 3HKBA 4X64B 3HKEB 3L71H 4OGQB 4OPHA 5EYPA 4QE9A 5K1XA 1NH2B 2YI8A 4LCUC 4YXWG 1TUBA 4X1YA 4TUYB 1S72V 5KHGA 2DQ3A 1NR1A 3KG2A 4CS2A 1H2LA 2BTQA 3F7VC 1R1BA 4I0XA 4ZOLB 1IBKB 3GWOA 1H2MA 4JAUA 2PZSA 4JI1O 2QTSA 1NU1H 2F1MA 3ETDA 2NLJC 5C8YA 4CC6A 1V54C 1OCOC 2R70A 1PP9H 2DWDC 2HKOA 1AP6A 2F93B 3RYIB 2Q9LA 4DUYO 3K08A 3TXSA 2FB5A 2LO1A 4X66O 1GMGA 4O4HA 2ZR2A 3EFFK 1VQ6V 1PV0A 2IH3C 4K3AA 2OT5A 4CH6A 5EBMC 5GW7A 3I56V 2EJRA 3HKDA 4J9YB 4O2BB 3C3SA 3CD6V 4G2KA 3X2QB 3ZJZA 5BXZA 4DR4B 2QEXV 2JJ2G 4YJ2B 2UU9B 1EM1A 1WN7A 2CK3G 1WA8B 4W4KA 1XEQA 4DV3B 1P49A 3P3PA 4X64O 5EZYB 3DTUB 4J80A 2JDIG 4MTXA 2LP7A 3TJTA 1D5NA 1HW7A 4ZIBA 4QJFB 3APQA 1OJHA 5LGTA 1DTOA 2IW5A 1SESA 1M57C 4I7ZB 4UCUA 3KCXA 1IBKO 3B40A 4J11A 1JPXA 1AI6A 1AILA 1YIJV 4TV9B 2HEPA 4MVMA 1ZX3A 1R73A 1L1FA 3FB7C 3VQYA 1F4MA 4CS4A 4WFGA 1WJZA 1TGOA 5KA6A 1EN4A 5IYZB 2ODMA 2ITDC 3H1LH 3CMAV 1H8HG 2IH1C 4GX2A 2D3OW 2R9IA 3U11A 3K59A 4DV6B 2DE0X 2Y0IA 1PNMA 2V7QG 5FPOA 5D5PA 2ILMA 2WLNA 2ADQB 1UJWB 1K8AW 4YJ3B 1AJNA 4WF9V 3WB0A 1KB9F 1VF5B 1Y6XA 1TVKA 5CN0A 3JAKB 3DXRA 1SS3A 5HFLA 3CS5A 3RYHA 4DR5O 2Q0OC 1HNWB 4PDMA 2ZNIA 5IYDO 4DV3O 5JVDA 4P9OA 4AI8A 5CA0B 4LFBB 2CTWA 4AHCA 2QKCA 1VQ7V 4G27B 1FYJA 4NR1A 1HDJA 3ZMSA 3S3WA 1MMMA 2QWQB 5FPRA 1SQGA 4LF6B 3SGIA 2JRIA 4X65B 1NTZH 4JI5O 4B08A 3SDLA 3OGCC 1XL4A 3FAVA 5LYJB 4I50A 4LFAB 1Q3EA 1IBMB 3JD2A 1BSMA 3OR6C 3UO2A 1KUQA 4H0LB 5JJEB 4D6TH 5L3BA 5CA1B 4UXNA 1F4NA 1EZVH 2Q5ZA 3N2GA 1VF6C 4DV6O 3K9AA 2IJJA 5KUKA 2BCCH 1NZ6A 1Z5VA 4QPJA 2BTOA 1PM9A 1GAXA 3LSQA 2EINB 1BGYH 4ZKIA 3SYCA 2EIKC 2JJ1G 3STLC 2KB1A 4JI6B 4XBFA 4WFEA 1YI2V 1QLEC 5A9GA 1SA0B 1HNWO 1O9GA 4GKJB 1Z2GA 4DV4B 3HKCB 1WB8A 2GTSA 4B3MB 4TSFG 4RWUA 5GTHZ 5H9CA 2JGDA 4LF5B 4PDRA 3ZHSA 4DR1O 2KG7B 2X7RB 1GM9A 3CC7V 2N74A 3CRMA 4ZI7B 1B3QA 3BFRA 5F2VO 3P32A 4X65O 4FFBA 2XAQA 2ZM6B 3ZRVA 1VP7A 3W7TA 2AXTZ 3OM3B 3CP1A 4LFAO 3CCRV 1YZBA 4PJ0Z 2DYRC 2Y69C 3VBBA 5CBFA 5LGNA 2XHBA 4B3SB 3RYCA 4J41A 5IJ0A 2Y0PA 5EC2C 4BIUA 3JSLA 3OAAG 4UVBA 5BMVA 2ETNA 3JYCA 5JCOA 2ZNJA 2GBOA 1COWG 1EZJA 4LC1A 1XDCA 1N33O 1IVSA 3JD1A 3AG2C 4FPPA 1Q81W 1VMGA 2QJ1A 2WA3A 4JI3O 3GVMA 1MSDA 2IJHA 5B5EZ 2P6JA 2GUZA 5JH7A 1YTFD 4GKJO 5LGUA 4MVSA 4G28B 4RAIA 1PD3A 4DV4O 3QO7A 4I55B 4IIJB 1R3LC 4B3MO 1YXBA 1AR4A 1M5IA 1KU9A 2Q6AA 4LF5O 1VQOV 2E5LB 1H2KA 3G71V 3CCLV 4HNAA 4PA7A 3STZC 3HR0A 1AI7A 1QNMA 3SJCC 1VQKV 4KL1A 5JWPA 1RM1C 2UXCB 2HJFC 5KX5A 4RQEA 4KP4A 1XHZA 2UXBB 5DEDA 2AZ0A 2UUBB 2H94A 3OMNB 3GB7C 2EIJC 2ZM6O 3JAMN 4GUNA 4H33A 2LFRA 1XHXA 2WLIA 4WFBV 2HR3A 5J2TA 1LR1A 2ZINA 1FXKB 4NTXA 5A2QN 4GZRB 1VARA 1QU7A 3EXAA 5IJ9A 3OMAB 4B3SO 3CB2A 3ZIAG 3WFVA 2CH7A 1W2BU 1HWYA 1Y66A 3CRAA 3DC5A 2XT9A 1YHQV 4TQDA 3CRCA 2HG5C 4TQFA 1RSOB 3CWBH 2B9ZA 1KYOF 3W7UA 4LWSA 2WPDG 3HKBB 5EYPB 3U0ZA 3ZS8C 1AI5A 2OCHA 2F95B 4X20A 4PDLA 3A0RA 5TISZ 1YDXA 3JARA 1TUBB 1DGSA 4X1YB 4X8AA 4LR3A 1K9MW 1N4CA 1QQCA 4NXNB 2QKSA 5DN6G 2OYQA 2BTQB 3ZMZA 2VQFB 3O9OA 5LHHA 3ZHTA 2E5LO 2LQTA 1PNLA 2P4KA 2QM7A 3THOA 1JMKC 3JATA 4PV1B 1YTFB 3ABMB 3G6EV 1RPOA 2UXCO 2UXBO 2UUBO 5C8YB 2CTRA 1DF5A 2WAMA 1RPRA 4J7ZA 3TETA 1VQLV 4NYKA 5LMNB 2BSKA 2Q8VA 5H5NA 4FIPC 2AZ2A 3A2FA 3OT7A 1URFA 2CGOA 1MA1A 3JASA 2IM9A 4J42A 4O4HB 4KHPB 4PDVA 3M8AA 1AR1B 1Q8IA 4N23A 4J9ZB 3CCVV 1E1RG 2F23A 3WB1A 4NXMB 3FYEB 1MSWD 1SZXA 2VS0A 2OCCC 3OEHG 1FKAO 4X1IA 3S3XA 1HNXB 1I08A 3APOA 4IHJA 3ASNB 3ZMVA 4XDLA 2Z0AA 4MVQA 2A7WA 3OW2U 3W7XA 3SYOA 4CH3A 3QF7A 3UM7A 5LA6A 2R9RB 2M7WA 1M1KW 1K5QA 3A0HZ 1FPOA 1I5XA 4QE7A 1QBZA 1OCRC 2W0FC 3ABKC 3K0GA 5IYBO 3L75H 3LSSA 4NXNO 1NQTA 4WCEV 4MTGA 1X59A 3JALA 3RWRD 1XNQB 4XDKA 3ZRXA 2DWEC 3D3IA 3H1HH 1X4TA 1FD9A 2YIBA 3T1YB 5KAIZ 5LP6C 1H2NA 4BIZA 4XDJA 4TV8A 1YJWV 3ML0A 2ZE6A 3FB5C 4LBEC 5IDJA 2ITCC 1GRJA 1VEWA 1WAZA 2YUAA 2ZIMA 1YEWA 4GX1A 2UUAO 3SPCA 3J7AU 2ARHA 4JI8O 4DRXB 3VOUA 4RQFA 1VF6A 3LDEA 1XBLA 1Q43A 4J7KA 2UXDB 2ZIOA 1VQNV 3AG1C 5B1AC 3F7YC 5L3CA 2HHHB 1PKXA 1JJ2U 2NR5A 2MK3A 1TVKB 4R8CA 4JI7B 4GX0A 4NXMO 1IURA 1R6NA 4IYIA 1NKDA 2RNBA 3RYHB 4Z1VA 1HNXO 3E8GA 3SJAC 5L3EA 2DYSC 3HPLC 3K03A 5JVDB 4PELA 3BA8A 2QWPB 2P90A 4DR7B 3OR7C 3E8HA 4BW9A 4MW3A 2GV9A 1V9PA 5GONB 2QA4V 5H6QA 1Q6HA 1H2SB 1Y74A 4BW5A 1BQZA 2EX3A 1AJPA 1H8EG 2YXHA 1XNQO 4FZ0A 4DO2A 3ASOB 2RMKB 4X89A 3FAVB 1OCCB 1ZL8A 4I50B 3ZMUA 3T1YO 5H2FZ 1KMIZ 3CMEV 4ZHQA 1Y76A 3M7MX 3F5TA 1V55C 4MS2A 1AROP 2RN9A 1K73W 2EIMB 4EKWA 3G6BA 3K9SA 1KD1W 1TAEA 2CE4A 2KQXA 3LDDA 4JGSA 3B8NA 3ZN1A 1K92A 1QCEA 2WA4A 3N2GB 4KXRA 1KBHA 1J95A 3AG3B 3H1IH 4IL6Z 1WNSA 4LF9B 2PI5A 4EB6A 3QVNA 5LOVA 4FM0A 3I55V 1Q5OA 1RFYA 2UUCB 3K3WA 2UXDO 1FS0G 5AG2A 1D2DA 4FLWA 1NI8A 5IWAB 2HHHO 5IE9A 2XOKG 4AQYB 2WLHA 3AG4B 4JI7O 4O4JA 5KMGA 4FLUA 2RJZA 2JS5A 3OGIB 1IXBA 3CPWU 3DGEA 4J7JA 3ABLC 5LL6Y 1BHAA 3UT5A 4DV0B 3W7SA 2JGDB 2VQEB 5FNVA 4DR7O 4R50A 1KKCA 4JYBA 1ZUQA 4TOIA 5FLXN 4J10A 2ZCEA 3OFNG 4HYOA 2CGNA 3T1HB 1R6TA 2ZXWC 4MVUA 4FFBB 2YI9A 4PA6A 1S76D 4K35A 1OHHG 4DR4O 4KFMA 3ZHQA 5KHKA 5LHGA 2UU9O 1S5LZ 5LBQA 1VQ4V 2Z3YA 5IJ0B 3T1CA 3CCUV 2GTAA 5DM6V 4JI0B 1I0HA 3T2MA 5BMVB 1XNRB 4FLZA 1AI4A 4PA3A 4DXWA 2QR4A 2YEVA 2YIAA 2CDYA 1M56B 2UUCO 4OPAA
chains in the Genus database with same CATH topology
5FL7G 5HFMA 4HAMA 2GSMB 3F5WC 2IJHA 1JVMA 1VQ8V 1QR8A 1SERA 2X6BA 5IYCO 4JTCB 2OTLV 4JTDB 2P6JA 3ZRSA 2W6IG 3E86A 4PA4A 3CCEV 4ZBMA 5B1NA 5B3SB 1YTFD 5LGUA 4MVSA 4G28B 4RAIA 1PD3A 1SETA 4RUFA 4TT3G 3QO7A 1R3LC 5IY5C 3ETGA 2DYRB 4R6ZA 1CP9A 2EBOA 2Q6AA 1VQOV 4E2LA 3G71V 3CCLV 4MW8A 4PA7A 3STZC 1AI7A 2EILB 1ORQC 1F51A 2WLJA 2QE7G 1VQKV 2X6CA 1RM1C 2HJFC 4RQEA 4KP4A 1R3KC 3CXCU 2X6AA 3LNMB 2H94A 3OMNB 3RW0A 2UXXA 2DQ0A 3CCMV 1MABG 3GB7C 2B5UA 2EIJC 3EHBB 4JASA 4H33A 2LFRA 3K06A 2WLIA 4WFBV 1FXKA 1OCOB 2XAHA 3B8MA 3WG7C 2HR3A 1YSCA 2WLIB 1JOYA 1FXKB 4CZZA 2XNDG 3E89A 2Q68A 2B1IA 1ENVA 3ETEA 3OMAB 3LDCA 4U7OA 1XL6A 1M90W 2JEXA 5KA5A 4JYCA 3ZIAG 4GCZA 3WFVA 2IJKA 1W2BU 3G4SV 1HWYA 1Y66A 1R3JC 2BOBC 2QTOA 2B1GA 2HLDG 3ABMC 4QIWF 2ZR3A 2C2AA 1YHQV 4WFHA 3RVYA 3SYPA 1M56C 2JEUA 1KKDA 1OZ0A 1ROPA 5L3DA 1NVPD 2HG5C 5CA3A 2JK5C 2ZDIA 4FMTA 2WLLA 5L3FA 1H2GA 1EBOA 3K04A 2WLLB 1OCZB 2OCCB 3W7UA 2WPDG 3RBZA 1QLNA 4X88A 1GTOA 1G4YB 1FXHA 4QE9A 1NH2B 3SPHA 4GT1A 1GK9A 4UVCA 4LCUC 1AI5A 3B77A 2IU0A 4YXWG 3RVZA 4PDLA 3A0RA 3FYIB 1S72V 4X8AA 1CPYA 1BHBA 1K9MW 2DQ3A 1NR1A 3KG2A 3P30A 4P30A 4UV8A 2EZOA 2QKSA 3F7VC 5DN6G 2XAFA 3ZMZA 2EILC 1R3IC 1KQSU 3QO5A 1SRYA 1BMFG 1K3EA 5LHHA 1OCRB 2LFSA 1PNLA 3ABKB 1M57B 2QM8A 3GWOA 3ZMTA 2QM7A 3OUFA 4RUEA 1N8RW 1G8MA 4JAUA 4TWKA 3D36A 2WWWA 3ABMB 5B1BC 1YTFB 3G6EV 1RPOA 1JQ0A 2NLJC 3ETDA 2EZPA 1V54C 1OCOC 1SZTA 1FXKC 1K34A 4PA9A 1DF5A 2DWDC 2HKOA 4UUJC 2WAMA 1RPRA 3TETA 4MT8A 4JPRA 5E1AC 1VQLV 3K08A 3W7WA 2H8PC 1S3JA 2IJIA 3ABTA 1GMGA 1P7BA 4FIPC 5CBHA 3SPIA 4HZ3A 2A79B 2ZR2A 3EFFK 1VQ6V 2YSUB 2IH3C 4PDVA 4N21A 2OT5A 1AR1B 4N23A 4J9ZB 3CCVV 1E1RG 4U7NA 5EBMC 5GW7A 1E79G 3OMIB 2EJRA 4JAVA 4J9YB 3I56V 1VQ5V 3E8FA 4H37A 4ASUG 3CD6V 3FYEB 2HVKC 3QO8A 4G2KA 3X2QB 2ZDIC 3ZJZA 1MSWD 2QEXV 3E35A 1OCZC 3AG1B 5B1AB 2JJ2G 2OCCC 3OEHG 3SYAA 3CC2V 2CK3G 3ASNB 3BEHA 3ZMVA 5B1BB 4XDLA 3OW2U 4MVQA 3ABUA 4WFFA 2BOCC 2Q69A 5EC1C 3SYOA 1V54B 3W7XA 3JD0A 3DTUB 3UM7A 1K4DC 1NBMG 2DYSB 2JDIG 3CCSV 4MTXA 2LP7A 2M7WA 2R9RB 1NVPB 1K33A 1NJIW 4QJFB 1M1KW 4Q20A 1K5QA 5LGTA 4FK5C 1I5XA 1DTOA 2Z5UA 1Y4MA 4QE7A 1QBZA 1OCRC 1S0VA 2IW5A 2W0FC 1SESA 1M57C 3ABKC 3K0GA 3LSSA 5IYBO 1NQTA 2IU3A 4QPKA 4MTGA 3ZRWA 4WCEV 3ZRWB 1GKFA 1TUEB 3PJSK 4XDKA 3ZRXA 3IGAC 1JPXA 1AI6A 2DWEC 2XAGA 1YIJV 3D3IA 2XASA 1AJQA 4MVMA 3H01A 4BIZA 3CCQV 1R73A 1L1FA 3FB7C 4XDJA 1Q82W 1E1QG 1F4MA 3FB8C 1YJWV 4WFGA 3ML0A 3FB5C 4LBEC 5IDJA 5KA6A 2ITCC 4MVRA 2ITDC 4F4LA 3CMAV 5L3GA 4FJCC 1H8HG 1V55B 2IH1C 4GX2A 4P9PA 3IC7A 2PI4A 2D3OW 2R9IA 5H6RA 4GX1A 1M9NA 3JD4A 3SPCA 2A9HA 1PNMA 2ATKC 4R7CA 2V7QG 3VOUA 4RQFA 1WLEA 3LDEA 5KUMA 2WLNA 3QNEA 4I9WA 1QVGU 1FFTB 3OEEG 1F23A 1UJWB 1K8AW 3X2QC 3LUTB 1AJNA 4WF9V 1VQNV 3AG1C 5B1AC 3F7YC 5L3CA 1K4CC 1PKXA 1KC8W 1JJ2U 5CN0A 2MK3A 3CCJV 4R8CA 2EIKB 4GX0A 1R6KA 2FTKA 2WLMA 5HFLA 1R6NA 1K5SA 3ASNC 1NKDA 3MHSC 4PDMA 1GO3F 5EBLC 1ZWIC 2X0LA 1I5YA 3E8GA 1NR7A 2V1DA 3HB3B 4GX5A 1DF4A 3R65A 5L3EA 1Q7YW 2DYSC 5IYDO 3T4DA 3HPLC 3K03A 5B1OA 1KP2A 4P9OA 4PELA 1DLBA 1CEZA 3CC4V 1WPXA 3FKSG 3ABLB 3BY6A 1W0KG 2P90A 2A0LA 3OR7C 2P7TC 1VQPV 4MTFA 4BAYA 4JTAB 5CBGA 3E8HA 2P67A 4MW3A 1VQ7V 4G27B 3ZMSA 3TCUA 2HVJC 2QA4V 5H6QA 3TK1A 4BW5A 1H8EG 1AJPA 3OGCC 2ZXWB 1XL4A 3M99B 4DO2A 3ASOB 4X89A 1OCCB 3NXSA 3ZMUA 2Q67A 3CMEV 4L87A 3JD2A 1Q81W 1VQ9V 1QVFU 2Y48A 3OR6C 4UV9A 4MS2A 1B6QA 1V55C 2OTJV 3T4ZA 1AROP 1KP3A 5CMUA 1K73W 2EIMB 3MD0A 2Y69B 3ZCCA 5L3BA 4P2ZA 4EKWA 4UXNA 3OE7G 1F4NA 1VQMV 1KD1W 1BL8A 1YJ9V 3LDDA 4JGSA 3B8NA 3ZN1A 1K92A 1QCEA 1EFRG 1J95A 3AG3B 2IJJA 3IFXA 3K9AA 5BZBA 1KECA 5KUKA 4UVAA 2JIZG 4QPJA 3LSQA 2PI5A 3JD3A 2EINB 3I55V 4ZKIA 3SYCA 4MVOA 3K3WA 2EIKC 1FS0G 2JJ1G 3OUSA 2KB1A 4OXSA 3SPJA 3STLC 5EBWC 1YJNV 1GM7A 5EK0A 2XOKG 4XBFA 2AHYA 4WFEA 4Z1MG 2WLHA 3AG4B 3JCZA 1YI2V 3AG2B 1QLEC 3SPGA 3CPWU 1PNKA 3DGEA 4CBCA 3MHHC 3ABLC 1BHAA 5J9PC 2ZD9A 3JD1A 4QNHB 4TSFG 3CYOA 1QR9A 2GHYA 3E8BA 5H9CA 1JCHA 3W7SA 4LP8A 4PDRA 5IY5B 4R50A 1JX9A 1LNQA 2W6JG 2WSSG 4MSWC 4JYBA 2X7RB 1GM9A 3CC7V 2NNUA 1YITV 3OFNG 4HYOA 1MOFA 2ZXWC 4MVUA 4WFAV 3P32A 2UXNA 1W0JG 3ASOC 1PL0A 1OCCC 3ZN0A 2XAQA 1FXVA 1Q86W 1H38A 3ZRVA 4PA6A 1RM1B 2K1EA 3SYQA 3W7TA 3FB6C 1S76D 2WLKA 1OHHG 3OM3B 5B3SC 2EIJB 3CP1A 3K0DA 5LHIA 1IXMA 4KFMA 3WG7B 3CCRV 2EIMC 2DYRC 2Y69C 3VBBA 5CBFA 5LHGA 5LGNA 3SJQC 1VQ4V 5LBQA 2Z3YA 1QLEB 5EC2C 4BIUA 2ZQMA 1GM8A 3E83A 3T1CA 3UKMA 3CCUV 1S77D 1THZA 1MG1A 2DW4A 3AEIA 1K7DA 3AG3C 3OAAG 4MTOA 5DM6V 4UVBA 4KUMA 4JF3A 4MVZA 3T2MA 4RO2A 2HFEC 1NH2D 3K79A 1K97A 2EINC 2AHZA 2F43G 1P4RA 5C93A 1AI4A 4PA3A 3JYCA 2XAJA 4DXWA 2YEVA 1COWG 1EZJA 1M56B 2YEVB 4LC1A 3E2EA 1S5HC 3AG4C 4I5SA 3AG2C 4FPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KG2 A;  4P30 A;  3FB7 C;  4XDJ A;  2QKS A;  3F7V C;  1J95 A;  3FB8 C;  5KUK A;  3F5W C;  3IFX A;  4WFG A;  5BZB A;  1JVM A;  2EIL C;  1R3I C;  2X6B A;  3FB5 C;  4JTC B;  4LBE C;  4JTD B;  2ITC C;  4MVR A;  2ITD C;  4F4L A;  3OUF A;  3ZRS A;  3E86 A;  4PA4 A;  4RUE A;  2IH1 C;  4ZBM A;  4GX2 A;  4MVO A;  3SYC A;  2EIK C;  4P9P A;  4MVS A;  4G28 B;  4RAI A;  4TWK A;  3OUS A;  4OXS A;  2KB1 A;  4GX1 A;  4RUF A;  5B1B C;  5EBW C;  3SPJ A;  3STL C;  1R3L C;  2NLJ C;  3SPC A;  5IY5 C;  2A9H A;  5EK0 A;  1V54 C;  4R6Z A;  1OCO C;  2AHY A;  2ATK C;  4R7C A;  2WLH A;  2Q6A A;  4WFE A;  3VOU A;  4PA9 A;  4UUJ C;  2DWD C;  1QLE C;  3LDE A;  3TET A;  3SPG A;  5KUM A;  2WLN A;  4I9W A;  5E1A C;  4MW8 A;  3K08 A;  4PA7 A;  3STZ C;  4CBC A;  2H8P C;  1ORQ C;  3X2Q C;  3LUT B;  2WLJ A;  3ABL C;  3AG1 C;  5B1A C;  3F7Y C;  5J9P C;  2ZD9 A;  2X6C A;  4QNH B;  1K4C C;  2HJF C;  1P7B A;  1R3K C;  2X6A A;  3LNM B;  3RW0 A;  3SPI A;  4R8C A;  3E8B A;  4GX0 A;  5CBH A;  4HZ3 A;  3GB7 C;  2A79 B;  2EIJ C;  2WLM A;  3EFF K;  4LP8 A;  3ASN C;  4PDR A;  4H33 A;  2IH3 C;  4PDV A;  3LDD A;  4R50 A;  1LNQ A;  4PDM A;  3K06 A;  2WLI A;  1ZWI C;  4MSW C;  5EBL C;  3E8G A;  4J9Z B;  3WG7 C;  1KKD A;  2WLI B;  4GX5 A;  3R65 A;  5EBM C;  2DYS C;  3T4D A;  4J9Y B;  3HPL C;  3K03 A;  3E8F A;  4HYO A;  4P9O A;  2ZXW C;  4H37 A;  4MVU A;  3E89 A;  2Q68 A;  2HVK C;  3ZJZ A;  3ASO C;  3LDC A;  1OCC C;  1XL6 A;  1OCZ C;  2A0L A;  2OCC C;  3OR7 C;  2P7T C;  4PA6 A;  2K1E A;  4MTF A;  3SYA A;  4JTA B;  3SYQ A;  3FB6 C;  5CBG A;  3E8H A;  4MW3 A;  4G27 B;  2WLK A;  5B3S C;  1R3J C;  2BOB C;  2QTO A;  3K0D A;  3BEH A;  3ABM C;  3AG4 C;  4XDL A;  4MVQ A;  3TCU A;  4KFM A;  2EIM C;  2HVJ C;  4WFF A;  2DYR C;  2BOC C;  2Q69 A;  2Y69 C;  5EC1 C;  3SYO A;  5CBF A;  4WFH A;  3RVY A;  3SYP A;  3SJQ C;  3UM7 A;  1M56 C;  4BW5 A;  1K4D C;  2R9R B;  2HG5 C;  3OGC C;  5EC2 C;  1XL4 A;  2JK5 C;  3E83 A;  2WLL A;  3T1C A;  3UKM A;  4X89 A;  3K04 A;  2WLL B;  3AG3 C;  4MTO A;  2Q67 A;  4MVZ A;  4QE7 A;  3RBZ A;  3T2M A;  4RO2 A;  2HFE C;  1OCR C;  4X88 A;  2W0F C;  1G4Y B;  3OR6 C;  3ABK C;  1M57 C;  3K0G A;  2EIN C;  4MS2 A;  1V55 C;  2AHZ A;  4MTG A;  4QE9 A;  3SPH A;  3T4Z A;  4PA3 A;  3JYC A;  4LCU C;  4DXW A;  3PJS K;  4XDK A;  3RVZ A;  3IGA C;  2DWE C;  2YEV A;  4PDL A;  4P2Z A;  4EKW A;  1S5H C;  1BL8 A;  4X8A A;  3AG2 C;  4MVM A; 
#chains in the Genus database with same CATH topology
 5FL7 G;  2RDC A;  5IWA O;  4AQY O;  1JVM A;  2X6B A;  2OTL V;  4JTC B;  3ZHV A;  2OIG A;  2GUZ B;  2W0X A;  3E86 A;  5B3S B;  5JQG A;  5JH7 B;  3JCU Z;  1SET A;  2JVD A;  4RUF A;  4DW1 A;  4DV0 O;  5IY5 C;  1A32 A;  4R6Z A;  1CP9 A;  3U10 A;  3VQX A;  2VQE O;  1JJO A;  3IAY A;  3CE2 A;  2CAZ C;  3RGB A;  3R66 A;  4HNA B;  5B66 Z;  3AK2 A;  2RQ6 A;  3T1H O;  5KX5 B;  2X6A A;  3CXC U;  2UXX A;  2F66 C;  1MAB G;  4YHH B;  1KKD A;  3WG7 C;  1OCO B;  2XAH A;  1JOY A;  2WLI B;  3BVO A;  5J2T B;  3AK3 A;  2KKW A;  1EN5 A;  2Q68 A;  3LDC A;  5IJ9 B;  5KA5 A;  2ZE8 A;  3G4S V;  2LW1 A;  2BOB C;  2QTO A;  4JI0 O;  2F4V B;  2HLD G;  3ABM C;  4LFB O;  4UCV A;  1XNR O;  3SYP A;  3RVY A;  2MW2 B;  1NVP D;  2P5O A;  4LF7 B;  4LF6 O;  3AK1 A;  2WLL A;  1H2G A;  1EBO A;  1YF2 A;  1ZSP A;  4EEQ A;  3RBZ A;  1HR0 B;  4LWS B;  1GTO A;  1G4Y B;  4ABM A;  1FXH A;  1Z5W A;  3BA9 A;  3DC6 A;  4GT1 A;  3VQW A;  1VF7 A;  3B77 A;  2IU0 A;  2YC0 A;  3BAB A;  1IBM O;  4X20 B;  4DK1 A;  1F7Y A;  3JAR B;  2YIB D;  1SKV A;  3D3Q A;  2JS3 A;  3BPZ A;  1Q90 D;  4P30 A;  2EZO A;  2XAF A;  1ZLZ A;  1BQ0 A;  1WP7 A;  2EIL C;  1R3I C;  1FFX A;  2YIC A;  1SQB H;  1M57 B;  2FL4 A;  1TA8 A;  1WPB A;  4H13 B;  1JQ0 A;  2EZP A;  1SZT A;  5LP6 A;  1K34 A;  4PA9 A;  2L6L A;  4MT8 A;  4JPR A;  4YHH O;  3N27 A;  5EIB D;  3W7W A;  2H8P C;  1HP8 A;  4JI6 O;  2BSK B;  2IJI A;  3ABT A;  1P7B A;  4CS3 A;  1DK1 A;  2A3Q A;  5KHI A;  4HZ3 A;  2VWK A;  3JAS B;  2YSU B;  2FYU H;  3KZI Z;  4DYL A;  2PF4 E;  3H9V A;  4FLY A;  1E79 G;  1M4U A;  5LYJ A;  4JAV A;  2F4V O;  4F6R A;  1BZK A;  1UPG A;  1OCZ C;  2HP8 A;  4LF8 B;  4QGP A;  4WBN A;  4LF7 O;  3CC2 V;  4X1I B;  4DUZ B;  5CA1 A;  4IHJ B;  5B1B B;  1HR0 O;  2BOC C;  2Q69 A;  5EC1 C;  1K4D C;  5LA6 B;  2N04 A;  4LNU B;  1NVP B;  1K33 A;  4IT5 A;  4X1K A;  5JJJ B;  4Q20 A;  1J5E B;  2YS8 A;  2Z5U A;  1S0V A;  4DV5 B;  4LH6 A;  3Q4H A;  2IU3 A;  4O4I A;  3ZRW A;  1IZ3 A;  3JAL B;  1GKF A;  2G38 A;  3IGA C;  5CB4 A;  3D36 C;  3CJH A;  2XAG A;  2XAS A;  3CEI A;  5IT9 N;  3OTF A;  3OTO B;  3J81 N;  3H01 A;  3CCQ V;  2QWO B;  3FB8 C;  4MVR A;  4F4L A;  1OV9 A;  3A8T A;  1PPJ H;  3CSX A;  3OD4 A;  3WU2 Z;  3IC7 A;  2PI4 A;  4GLX A;  1M9N A;  2YDE A;  3N2K A;  3K5L A;  1Q6U A;  2QWR B;  5D5Q A;  1WLE A;  3RN4 A;  5K1P A;  4AIL C;  5KUM A;  3QNE A;  1QVG U;  1FFT B;  3OEE G;  1N34 B;  3X2Q C;  2P4V A;  1K4C C;  4I0X B;  5KLV H;  2OWO A;  2LJ2 A;  3CCJ V;  2EIK B;  3L72 H;  1R6K A;  4JYY A;  2FTK A;  1SC5 B;  1K5S A;  2E3C A;  4LF8 O;  4O4L A;  3MHS C;  2QM4 A;  1GO3 F;  1ZWI C;  4JI4 B;  2XUM A;  1I5Y A;  1NR7 A;  3RFR A;  1DF4 A;  1Q7Y W;  2QGN A;  3T4D A;  4DUZ O;  5ITZ A;  2DJV A;  2PTM A;  1KP2 A;  4LF4 B;  1O9H A;  1CEZ A;  1WPX A;  1W0K G;  4JZG A;  3L70 H;  2P7T C;  4MTF A;  4BAY A;  4JTA B;  2P67 A;  2L35 A;  1P7G A;  1SF9 A;  1J5E O;  2HJD A;  2RCV A;  1N0J A;  2HVJ C;  4YIP A;  4DV5 O;  1JFF A;  3TK1 A;  4JYA B;  1Y74 B;  2LGW A;  1SQF A;  3ZHR A;  3QG5 A;  3HKD B;  3NXS A;  1ZL8 B;  1GN6 A;  1VQ9 V;  1QVF U;  4ZHQ B;  1Y76 B;  4UV9 A;  1B6Q A;  4YIO A;  5CMU A;  2ZE7 A;  2R72 A;  2Y69 B;  3ZCC A;  4NTY A;  3JAW A;  3LNN A;  3L73 H;  1VQM V;  1BL8 A;  4UCS A;  1NTM H;  4D7T A;  2YXL A;  5BZB A;  1KEC A;  4F6E A;  2XTA A;  3JD3 A;  1HNZ B;  4EB6 B;  5LOV B;  1N34 O;  3UO3 A;  2VQF O;  3OUS A;  3SPJ A;  4U3J A;  1GM7 A;  2DN9 A;  3FD9 A;  2AHY A;  4Z1M G;  3JCZ A;  4K0K B;  3AG2 B;  1N0N A;  4L8J A;  4O4J B;  4HBN A;  5KMG B;  4JI4 O;  4FFK A;  1PL4 A;  3MHH C;  2DMX A;  3UT5 B;  1XIL A;  4LF4 O;  3CYO A;  2LGQ A;  2GHY A;  3E8B A;  4LP8 A;  5LMN O;  2P06 A;  4X9Q A;  5FNV B;  1JX9 A;  1NTK H;  1LNQ A;  2W6J G;  2P22 C;  2PUS A;  3B09 A;  1YIT V;  1BT8 A;  1IX9 A;  4FM2 A;  3CRQ A;  2UXN A;  4KHP O;  1W0J G;  1N36 B;  3ZN0 A;  3L74 H;  4JYA O;  1RM1 B;  2K1E A;  3SYQ A;  2CUG A;  2GDS A;  2WLK A;  5B3S C;  4U3F H;  2EIJ B;  1AP5 A;  1M93 A;  3DXR B;  1IXM A;  4UB8 Z;  4JZ2 A;  1T5E A;  4JI2 B;  2ZQM A;  1GM8 A;  3E83 A;  3UKM A;  1S77 D;  2DW4 A;  1MG1 A;  5J2U A;  4CC5 A;  3AEI A;  4O2A A;  3E22 A;  4KUM A;  4JF3 A;  4PHZ A;  4RO2 A;  3K79 A;  2EIN C;  2F43 G;  1US6 A;  5C93 A;  4NVP A;  2XAJ A;  3ETQ A;  3UCS C;  2YEV B;  1HNZ O;  4FLV A;  1S5H C;  1ZAU A;  1BS3 A;  5HFM A;  4HAM A;  2GSM B;  3F5W C;  5IYC O;  1UFI A;  3I5D A;  1XUQ A;  4B3R B;  3H1K H;  4JTD B;  4K0K O;  1B06 A;  3BCC H;  2W6I G;  4TT3 G;  5JQG B;  3ETG A;  2EBO A;  3ZBH A;  1U96 A;  4D7S A;  3RYF A;  4E2L A;  4MW8 A;  1ORQ C;  4DR5 B;  2WLJ A;  2X6C A;  2ZKO A;  1BCC H;  2DQ0 A;  3CCM V;  1NT2 B;  1N36 O;  1Y67 A;  4JAS A;  3K06 A;  3B8M A;  1YSC A;  3KKY A;  4CZZ A;  3TXQ A;  1AB3 A;  1ENV A;  4U7O A;  1XL6 A;  1M90 W;  4OX9 B;  2JEX A;  4JYC A;  5LXT A;  1B04 A;  4JI2 O;  2CTQ A;  4JI5 B;  4GYC B;  1R3J C;  3BHP A;  3IJ4 A;  2B1G A;  4QIW F;  3ICX A;  2QKA A;  4I4T A;  3SR2 C;  1N32 B;  2Q7E A;  1OZ0 A;  5L3D A;  2JK5 C;  4FMT A;  2WLL B;  2OCC B;  1QLN A;  3HKE A;  1CXZ B;  3JSN A;  5GTI Z;  4FLX A;  1L0L H;  3SPH A;  4GKK B;  1GK9 A;  4UVC A;  4B3R O;  4DRX A;  3RVZ A;  4TUY A;  3NR7 A;  3FYI B;  3O65 A;  1BHB A;  1CPY A;  3RYC B;  3P30 A;  1G6U A;  4UV8 A;  1AVM A;  4UB6 Z;  4ZOL A;  1KQS U;  3QO5 A;  1SRY A;  1BMF G;  1FFX B;  1K3E A;  1XRE A;  1OCR B;  2LFS A;  4DV2 B;  3ABK B;  2QM8 A;  3ZMT A;  2O57 A;  3OUF A;  4RUE A;  1N8R W;  1G8M A;  1IBL B;  4TWK A;  3D36 A;  2WWW A;  5B1B C;  4DR2 B;  1FJG B;  2ADP A;  4LF9 O;  2ZE5 A;  3RYI A;  1FXK C;  1W59 A;  4UUJ C;  5LP6 B;  5E1A C;  1GN3 A;  4DR1 B;  1S3J A;  5KHH A;  5GON A;  5CBH A;  3SPI A;  3K58 A;  4JV5 B;  4OX9 O;  2A79 B;  2PYL A;  4N21 A;  1XQ8 A;  4Z2W A;  4BWA A;  4U7N A;  3OMI B;  1VQ5 V;  4I9Q A;  4O2B A;  3E8F A;  4H37 A;  4ASU G;  2HVK C;  3QO8 A;  2ZDI C;  2H3O A;  1N32 O;  4F6R B;  3E35 A;  4YJ2 A;  3AG1 B;  5B1A B;  2Y4U A;  3SYA A;  1JA8 A;  2YXY A;  1WA8 A;  4WBN B;  3BEH A;  4DR3 B;  4FM1 A;  3ABU A;  4WFF A;  5EZY A;  1JR9 A;  4DK0 A;  4UCR A;  1V54 B;  3JD0 A;  1SQP H;  1BE3 H;  2DYS B;  1NBM G;  3CCS V;  1SQV H;  4GKK O;  4E4E A;  1NJI W;  1MNG A;  1L0N H;  4X1K B;  5EIB C;  5BY1 A;  4FK5 C;  2E75 B;  2KSD A;  1Y4M A;  4DR6 B;  3BAA A;  1N33 B;  4QPK A;  4DV7 B;  2CH7 B;  3Q4H B;  4O4I B;  3ZRW B;  4DV1 B;  1TUE B;  3PJS K;  4JI3 B;  1G1X B;  4DV2 O;  3A0B Z;  4TV9 A;  5CB4 B;  3MAQ A;  3CJH B;  1RP3 B;  3PN1 A;  4BR6 A;  1AJQ A;  2EUL A;  1IBL O;  4DR2 O;  1FJG O;  1I7F A;  1Q82 W;  1E1Q G;  4EFB A;  4LH7 A;  2AW9 A;  5IYZ A;  1MZF A;  3K5N A;  4LFC B;  5L3G A;  1QHT A;  4FJC C;  1V55 B;  2V4D A;  1GN2 A;  4P9P A;  4NKG B;  5H6R A;  4DW0 A;  3JD4 A;  1IDS A;  2A9H A;  3KCY A;  5BR8 B;  2ATK C;  4R7C A;  4JV5 O;  3N2K B;  3GWK C;  3VQV A;  4I9W A;  4YJ3 A;  1F23 A;  4ICG A;  3LUT B;  1GN4 A;  2VRZ A;  3CXH F;  1KC8 W;  3JAK A;  2A06 H;  1I94 B;  2WLM A;  3ASN C;  3JAT B;  5LMU B;  3BRC A;  4UFZ A;  5EBL C;  4O4L B;  2X0L A;  4CH5 A;  2V1D A;  3HB3 B;  3ZHU A;  4GX5 A;  3R65 A;  1NS1 A;  3TGU H;  4C7U A;  2Q73 A;  5B1O A;  2E74 B;  4DR3 O;  5ITZ B;  5CA0 A;  3IC9 A;  1DLB A;  3CC4 V;  4K8Z A;  3FKS G;  3ABL B;  3BY6 A;  3SJB C;  1EN6 A;  1Q6I A;  2A0L A;  1VQP V;  5CBG A;  3K5O A;  4B3T B;  2M6Y A;  2IBZ H;  3TCU A;  1WP8 A;  2Q7G A;  4X62 B;  4DR6 O;  1JFF B;  2PGG A;  1SQX H;  4DV7 O;  4DV1 O;  2ZXW B;  3M99 B;  4FZ1 A;  3CRR A;  3FX7 A;  1S5J A;  2VWJ A;  2K9P A;  4NTW A;  2FKX A;  2Q67 A;  4L87 A;  2Y48 A;  4YY3 B;  2OTJ V;  3DSQ A;  3T4Z A;  1XI1 A;  1KP3 A;  3LSU A;  2D2C B;  3QTC A;  3MD0 A;  4LFC O;  4P2Z A;  3UQ8 A;  3OE7 G;  3JAW B;  3CX5 F;  1YJ9 V;  3K5M A;  4FVM A;  1EFR G;  2QDO A;  3IFX A;  5BR8 O;  4UVA A;  2JIZ G;  4B7E A;  3MDS A;  2QSA A;  2PY5 A;  4MVO A;  1FAF A;  4A5U B;  4IYH A;  1YJN V;  4OXS A;  5EBW C;  1P84 F;  4U3J B;  4H44 B;  5EK0 A;  1L8D A;  1I94 O;  1SA0 A;  3H1J H;  1AR5 A;  3SPG A;  1PNK A;  5LMU O;  2R9A A;  4CBC A;  3HKC A;  3L9D A;  4TV8 B;  5J9P C;  2ZD9 A;  4QNH B;  2E76 B;  1QR9 A;  1JCH A;  1XMQ B;  5KAF Z;  2KG7 A;  5IY5 B;  2PYJ A;  2WSS G;  4MSW C;  4ZI7 A;  2NNU A;  4B3T O;  4B7K A;  2OIE A;  1MOF A;  4WFA V;  4X62 O;  3ASO C;  1PL0 A;  1OCC C;  1FXV A;  1Q86 W;  2Q0A A;  4JAA A;  1H38 A;  3C3T A;  5E79 Z;  3FB6 C;  1LUV A;  4PI0 A;  1VIB A;  5LHI A;  3K0D A;  2FML A;  3B4S A;  4BIO A;  3WG7 B;  2EIM C;  3SJQ C;  3G67 A;  4YY3 O;  2BE3 A;  2NN4 A;  2ZT9 B;  1QLE B;  5DEC A;  1THZ A;  5J2U B;  1K7D A;  3AG3 C;  4MTO A;  3ZED A;  3J80 N;  2CTP A;  4O2A B;  1YCI A;  3E22 B;  4MVZ A;  2HFE C;  1NH2 D;  1K97 A;  2EJ7 A;  2AHZ A;  3D8C A;  1P4R A;  1ZTE A;  2QWN B;  3K57 A;  2Q4P A;  4UCO A;  3E2E A;  3AG4 C;  1WB7 A;  4EFE A;  4I5S A;  1XMO B;  1XOU A;  4CH4 A;  1VQ8 V;  1LUW A;  4PD4 F;  1QR8 A;  1SER A;  2UUA B;  2Y4T A;  3OTO O;  4JI8 B;  3ZRS A;  4PA4 A;  3CCE V;  4ZBM A;  5B1N A;  2N05 A;  4IGG A;  4I55 A;  4IIJ A;  1SQQ H;  5JJN B;  1D5A A;  2DYR B;  3RT3 C;  3B2E E;  4UCT A;  1XMQ O;  1MZE A;  2AGA A;  3RYF B;  2LW7 A;  3WB2 A;  2EIL B;  1F51 A;  4JI1 B;  2QE7 G;  1GH6 A;  3AG7 A;  1R3K C;  3LNM B;  3RW0 A;  2B5U A;  4Q6G A;  3EHB B;  4DUY B;  1FXK A;  4LNU A;  1YVW A;  2JGU A;  2YID A;  3EVK A;  4X66 B;  3P3N A;  4W4L A;  2XND G;  3E89 A;  3CHX A;  2B1I A;  3G80 A;  3C90 A;  3ETE A;  4PI2 A;  4GCZ A;  5LXT B;  2IJK A;  1U97 A;  2DOS A;  5KHJ A;  4FLT A;  2Q7H A;  3ZX6 A;  2ZR3 A;  2C2A A;  3FFQ A;  4K8X A;  5JCO C;  4I4T B;  4WFH A;  1M56 C;  2JEU A;  1ROP A;  1RSO A;  5CA3 A;  2ZDI A;  5L3F A;  3K04 A;  1OCZ B;  4NB5 A;  1XMO O;  4X88 A;  3HKB A;  4X64 B;  3HKE B;  3L71 H;  4OGQ B;  4OPH A;  5EYP A;  4QE9 A;  5K1X A;  1NH2 B;  2YI8 A;  4LCU C;  4YXW G;  1TUB A;  4X1Y A;  4TUY B;  1S72 V;  5KHG A;  2DQ3 A;  1NR1 A;  3KG2 A;  4CS2 A;  1H2L A;  2BTQ A;  3F7V C;  1R1B A;  4I0X A;  4ZOL B;  1IBK B;  3GWO A;  1H2M A;  4JAU A;  2PZS A;  4JI1 O;  2QTS A;  1NU1 H;  2F1M A;  3ETD A;  2NLJ C;  5C8Y A;  4CC6 A;  1V54 C;  1OCO C;  2R70 A;  1PP9 H;  2DWD C;  2HKO A;  1AP6 A;  2F93 B;  3RYI B;  2Q9L A;  4DUY O;  3K08 A;  3TXS A;  2FB5 A;  2LO1 A;  4X66 O;  1GMG A;  4O4H A;  2ZR2 A;  3EFF K;  1VQ6 V;  1PV0 A;  2IH3 C;  4K3A A;  2OT5 A;  4CH6 A;  5EBM C;  5GW7 A;  3I56 V;  2EJR A;  3HKD A;  4J9Y B;  4O2B B;  3C3S A;  3CD6 V;  4G2K A;  3X2Q B;  3ZJZ A;  5BXZ A;  4DR4 B;  2QEX V;  2JJ2 G;  4YJ2 B;  2UU9 B;  1EM1 A;  1WN7 A;  2CK3 G;  1WA8 B;  4W4K A;  1XEQ A;  4DV3 B;  1P49 A;  3P3P A;  4X64 O;  5EZY B;  3DTU B;  4J80 A;  2JDI G;  4MTX A;  2LP7 A;  3TJT A;  1D5N A;  1HW7 A;  4ZIB A;  4QJF B;  3APQ A;  1OJH A;  5LGT A;  1DTO A;  2IW5 A;  1SES A;  1M57 C;  4I7Z B;  4UCU A;  3KCX A;  1IBK O;  3B40 A;  4J11 A;  1JPX A;  1AI6 A;  1AIL A;  1YIJ V;  4TV9 B;  2HEP A;  4MVM A;  1ZX3 A;  1R73 A;  1L1F A;  3FB7 C;  3VQY A;  1F4M A;  4CS4 A;  4WFG A;  1WJZ A;  1TGO A;  5KA6 A;  1EN4 A;  5IYZ B;  2ODM A;  2ITD C;  3H1L H;  3CMA V;  1H8H G;  2IH1 C;  4GX2 A;  2D3O W;  2R9I A;  3U11 A;  3K59 A;  4DV6 B;  2DE0 X;  2Y0I A;  1PNM A;  2V7Q G;  5FPO A;  5D5P A;  2ILM A;  2WLN A;  2ADQ B;  1UJW B;  1K8A W;  4YJ3 B;  1AJN A;  4WF9 V;  3WB0 A;  1KB9 F;  1VF5 B;  1Y6X A;  1TVK A;  5CN0 A;  3JAK B;  3DXR A;  1SS3 A;  5HFL A;  3CS5 A;  3RYH A;  4DR5 O;  2Q0O C;  1HNW B;  4PDM A;  2ZNI A;  5IYD O;  4DV3 O;  5JVD A;  4P9O A;  4AI8 A;  5CA0 B;  4LFB B;  2CTW A;  4AHC A;  2QKC A;  1VQ7 V;  4G27 B;  1FYJ A;  4NR1 A;  1HDJ A;  3ZMS A;  3S3W A;  1MMM A;  2QWQ B;  5FPR A;  1SQG A;  4LF6 B;  3SGI A;  2JRI A;  4X65 B;  1NTZ H;  4JI5 O;  4B08 A;  3SDL A;  3OGC C;  1XL4 A;  3FAV A;  5LYJ B;  4I50 A;  4LFA B;  1Q3E A;  1IBM B;  3JD2 A;  1BSM A;  3OR6 C;  3UO2 A;  1KUQ A;  4H0L B;  5JJE B;  4D6T H;  5L3B A;  5CA1 B;  4UXN A;  1F4N A;  1EZV H;  2Q5Z A;  3N2G A;  1VF6 C;  4DV6 O;  3K9A A;  2IJJ A;  5KUK A;  2BCC H;  1NZ6 A;  1Z5V A;  4QPJ A;  2BTO A;  1PM9 A;  1GAX A;  3LSQ A;  2EIN B;  1BGY H;  4ZKI A;  3SYC A;  2EIK C;  2JJ1 G;  3STL C;  2KB1 A;  4JI6 B;  4XBF A;  4WFE A;  1YI2 V;  1QLE C;  5A9G A;  1SA0 B;  1HNW O;  1O9G A;  4GKJ B;  1Z2G A;  4DV4 B;  3HKC B;  1WB8 A;  2GTS A;  4B3M B;  4TSF G;  4RWU A;  5GTH Z;  5H9C A;  2JGD A;  4LF5 B;  4PDR A;  3ZHS A;  4DR1 O;  2KG7 B;  2X7R B;  1GM9 A;  3CC7 V;  2N74 A;  3CRM A;  4ZI7 B;  1B3Q A;  3BFR A;  5F2V O;  3P32 A;  4X65 O;  4FFB A;  2XAQ A;  2ZM6 B;  3ZRV A;  1VP7 A;  3W7T A;  2AXT Z;  3OM3 B;  3CP1 A;  4LFA O;  3CCR V;  1YZB A;  4PJ0 Z;  2DYR C;  2Y69 C;  3VBB A;  5CBF A;  5LGN A;  2XHB A;  4B3S B;  3RYC A;  4J41 A;  5IJ0 A;  2Y0P A;  5EC2 C;  4BIU A;  3JSL A;  3OAA G;  4UVB A;  5BMV A;  2ETN A;  3JYC A;  5JCO A;  2ZNJ A;  2GBO A;  1COW G;  1EZJ A;  4LC1 A;  1XDC A;  1N33 O;  1IVS A;  3JD1 A;  3AG2 C;  4FPP A;  1Q81 W;  1VMG A;  2QJ1 A;  2WA3 A;  4JI3 O;  3GVM A;  1MSD A;  2IJH A;  5B5E Z;  2P6J A;  2GUZ A;  5JH7 A;  1YTF D;  4GKJ O;  5LGU A;  4MVS A;  4G28 B;  4RAI A;  1PD3 A;  4DV4 O;  3QO7 A;  4I55 B;  4IIJ B;  1R3L C;  4B3M O;  1YXB A;  1AR4 A;  1M5I A;  1KU9 A;  2Q6A A;  4LF5 O;  1VQO V;  2E5L B;  1H2K A;  3G71 V;  3CCL V;  4HNA A;  4PA7 A;  3STZ C;  3HR0 A;  1AI7 A;  1QNM A;  3SJC C;  1VQK V;  4KL1 A;  5JWP A;  1RM1 C;  2UXC B;  2HJF C;  5KX5 A;  4RQE A;  4KP4 A;  1XHZ A;  2UXB B;  5DED A;  2AZ0 A;  2UUB B;  2H94 A;  3OMN B;  3GB7 C;  2EIJ C;  2ZM6 O;  3JAM N;  4GUN A;  4H33 A;  2LFR A;  1XHX A;  2WLI A;  4WFB V;  2HR3 A;  5J2T A;  1LR1 A;  2ZIN A;  1FXK B;  4NTX A;  5A2Q N;  4GZR B;  1VAR A;  1QU7 A;  3EXA A;  5IJ9 A;  3OMA B;  4B3S O;  3CB2 A;  3ZIA G;  3WFV A;  2CH7 A;  1W2B U;  1HWY A;  1Y66 A;  3CRA A;  3DC5 A;  2XT9 A;  1YHQ V;  4TQD A;  3CRC A;  2HG5 C;  4TQF A;  1RSO B;  3CWB H;  2B9Z A;  1KYO F;  3W7U A;  4LWS A;  2WPD G;  3HKB B;  5EYP B;  3U0Z A;  3ZS8 C;  1AI5 A;  2OCH A;  2F95 B;  4X20 A;  4PDL A;  3A0R A;  5TIS Z;  1YDX A;  3JAR A;  1TUB B;  1DGS A;  4X1Y B;  4X8A A;  4LR3 A;  1K9M W;  1N4C A;  1QQC A;  4NXN B;  2QKS A;  5DN6 G;  2OYQ A;  2BTQ B;  3ZMZ A;  2VQF B;  3O9O A;  5LHH A;  3ZHT A;  2E5L O;  2LQT A;  1PNL A;  2P4K A;  2QM7 A;  3THO A;  1JMK C;  3JAT A;  4PV1 B;  1YTF B;  3ABM B;  3G6E V;  1RPO A;  2UXC O;  2UXB O;  2UUB O;  5C8Y B;  2CTR A;  1DF5 A;  2WAM A;  1RPR A;  4J7Z A;  3TET A;  1VQL V;  4NYK A;  5LMN B;  2BSK A;  2Q8V A;  5H5N A;  4FIP C;  2AZ2 A;  3A2F A;  3OT7 A;  1URF A;  2CGO A;  1MA1 A;  3JAS A;  2IM9 A;  4J42 A;  4O4H B;  4KHP B;  4PDV A;  3M8A A;  1AR1 B;  1Q8I A;  4N23 A;  4J9Z B;  3CCV V;  1E1R G;  2F23 A;  3WB1 A;  4NXM B;  3FYE B;  1MSW D;  1SZX A;  2VS0 A;  2OCC C;  3OEH G;  1FKA O;  4X1I A;  3S3X A;  1HNX B;  1I08 A;  3APO A;  4IHJ A;  3ASN B;  3ZMV A;  4XDL A;  2Z0A A;  4MVQ A;  2A7W A;  3OW2 U;  3W7X A;  3SYO A;  4CH3 A;  3QF7 A;  3UM7 A;  5LA6 A;  2R9R B;  2M7W A;  1M1K W;  1K5Q A;  3A0H Z;  1FPO A;  1I5X A;  4QE7 A;  1QBZ A;  1OCR C;  2W0F C;  3ABK C;  3K0G A;  5IYB O;  3L75 H;  3LSS A;  4NXN O;  1NQT A;  4WCE V;  4MTG A;  1X59 A;  3JAL A;  3RWR D;  1XNQ B;  4XDK A;  3ZRX A;  2DWE C;  3D3I A;  3H1H H;  1X4T A;  1FD9 A;  2YIB A;  3T1Y B;  5KAI Z;  5LP6 C;  1H2N A;  4BIZ A;  4XDJ A;  4TV8 A;  1YJW V;  3ML0 A;  2ZE6 A;  3FB5 C;  4LBE C;  5IDJ A;  2ITC C;  1GRJ A;  1VEW A;  1WAZ A;  2YUA A;  2ZIM A;  1YEW A;  4GX1 A;  2UUA O;  3SPC A;  3J7A U;  2ARH A;  4JI8 O;  4DRX B;  3VOU A;  4RQF A;  1VF6 A;  3LDE A;  1XBL A;  1Q43 A;  4J7K A;  2UXD B;  2ZIO A;  1VQN V;  3AG1 C;  5B1A C;  3F7Y C;  5L3C A;  2HHH B;  1PKX A;  1JJ2 U;  2NR5 A;  2MK3 A;  1TVK B;  4R8C A;  4JI7 B;  4GX0 A;  4NXM O;  1IUR A;  1R6N A;  4IYI A;  1NKD A;  2RNB A;  3RYH B;  4Z1V A;  1HNX O;  3E8G A;  3SJA C;  5L3E A;  2DYS C;  3HPL C;  3K03 A;  5JVD B;  4PEL A;  3BA8 A;  2QWP B;  2P90 A;  4DR7 B;  3OR7 C;  3E8H A;  4BW9 A;  4MW3 A;  2GV9 A;  1V9P A;  5GON B;  2QA4 V;  5H6Q A;  1Q6H A;  1H2S B;  1Y74 A;  4BW5 A;  1BQZ A;  2EX3 A;  1AJP A;  1H8E G;  2YXH A;  1XNQ O;  4FZ0 A;  4DO2 A;  3ASO B;  2RMK B;  4X89 A;  3FAV B;  1OCC B;  1ZL8 A;  4I50 B;  3ZMU A;  3T1Y O;  5H2F Z;  1KMI Z;  3CME V;  4ZHQ A;  1Y76 A;  3M7M X;  3F5T A;  1V55 C;  4MS2 A;  1ARO P;  2RN9 A;  1K73 W;  2EIM B;  4EKW A;  3G6B A;  3K9S A;  1KD1 W;  1TAE A;  2CE4 A;  2KQX A;  3LDD A;  4JGS A;  3B8N A;  3ZN1 A;  1K92 A;  1QCE A;  2WA4 A;  3N2G B;  4KXR A;  1KBH A;  1J95 A;  3AG3 B;  3H1I H;  4IL6 Z;  1WNS A;  4LF9 B;  2PI5 A;  4EB6 A;  3QVN A;  5LOV A;  4FM0 A;  3I55 V;  1Q5O A;  1RFY A;  2UUC B;  3K3W A;  2UXD O;  1FS0 G;  5AG2 A;  1D2D A;  4FLW A;  1NI8 A;  5IWA B;  2HHH O;  5IE9 A;  2XOK G;  4AQY B;  2WLH A;  3AG4 B;  4JI7 O;  4O4J A;  5KMG A;  4FLU A;  2RJZ A;  2JS5 A;  3OGI B;  1IXB A;  3CPW U;  3DGE A;  4J7J A;  3ABL C;  5LL6 Y;  1BHA A;  3UT5 A;  4DV0 B;  3W7S A;  2JGD B;  2VQE B;  5FNV A;  4DR7 O;  4R50 A;  1KKC A;  4JYB A;  1ZUQ A;  4TOI A;  5FLX N;  4J10 A;  2ZCE A;  3OFN G;  4HYO A;  2CGN A;  3T1H B;  1R6T A;  2ZXW C;  4MVU A;  4FFB B;  2YI9 A;  4PA6 A;  1S76 D;  4K35 A;  1OHH G;  4DR4 O;  4KFM A;  3ZHQ A;  5KHK A;  5LHG A;  2UU9 O;  1S5L Z;  5LBQ A;  1VQ4 V;  2Z3Y A;  5IJ0 B;  3T1C A;  3CCU V;  2GTA A;  5DM6 V;  4JI0 B;  1I0H A;  3T2M A;  5BMV B;  1XNR B;  4FLZ A;  1AI4 A;  4PA3 A;  4DXW A;  2QR4 A;  2YEV A;  2YIA A;  2CDY A;  1M56 B;  2UUC O;  4OPA A; 
#chains in the Genus database with same CATH homology
 5FL7 G;  5HFM A;  4HAM A;  2GSM B;  3F5W C;  2IJH A;  1JVM A;  1VQ8 V;  1QR8 A;  1SER A;  2X6B A;  5IYC O;  4JTC B;  2OTL V;  4JTD B;  2P6J A;  3ZRS A;  2W6I G;  3E86 A;  4PA4 A;  3CCE V;  4ZBM A;  5B1N A;  5B3S B;  1YTF D;  5LGU A;  4MVS A;  4G28 B;  4RAI A;  1PD3 A;  1SET A;  4RUF A;  4TT3 G;  3QO7 A;  1R3L C;  5IY5 C;  3ETG A;  2DYR B;  4R6Z A;  1CP9 A;  2EBO A;  2Q6A A;  1VQO V;  4E2L A;  3G71 V;  3CCL V;  4MW8 A;  4PA7 A;  3STZ C;  1AI7 A;  2EIL B;  1ORQ C;  1F51 A;  2WLJ A;  2QE7 G;  1VQK V;  2X6C A;  1RM1 C;  2HJF C;  4RQE A;  4KP4 A;  1R3K C;  3CXC U;  2X6A A;  3LNM B;  2H94 A;  3OMN B;  3RW0 A;  2UXX A;  2DQ0 A;  3CCM V;  1MAB G;  3GB7 C;  2B5U A;  2EIJ C;  3EHB B;  4JAS A;  4H33 A;  2LFR A;  3K06 A;  2WLI A;  4WFB V;  1FXK A;  1OCO B;  2XAH A;  3B8M A;  3WG7 C;  2HR3 A;  1YSC A;  2WLI B;  1JOY A;  1FXK B;  4CZZ A;  2XND G;  3E89 A;  2Q68 A;  2B1I A;  1ENV A;  3ETE A;  3OMA B;  3LDC A;  4U7O A;  1XL6 A;  1M90 W;  2JEX A;  5KA5 A;  4JYC A;  3ZIA G;  4GCZ A;  3WFV A;  2IJK A;  1W2B U;  3G4S V;  1HWY A;  1Y66 A;  1R3J C;  2BOB C;  2QTO A;  2B1G A;  2HLD G;  3ABM C;  4QIW F;  2ZR3 A;  2C2A A;  1YHQ V;  4WFH A;  3RVY A;  3SYP A;  1M56 C;  2JEU A;  1KKD A;  1OZ0 A;  1ROP A;  5L3D A;  1NVP D;  2HG5 C;  5CA3 A;  2JK5 C;  2ZDI A;  4FMT A;  2WLL A;  5L3F A;  1H2G A;  1EBO A;  3K04 A;  2WLL B;  1OCZ B;  2OCC B;  3W7U A;  2WPD G;  3RBZ A;  1QLN A;  4X88 A;  1GTO A;  1G4Y B;  1FXH A;  4QE9 A;  1NH2 B;  3SPH A;  4GT1 A;  1GK9 A;  4UVC A;  4LCU C;  1AI5 A;  3B77 A;  2IU0 A;  4YXW G;  3RVZ A;  4PDL A;  3A0R A;  3FYI B;  1S72 V;  4X8A A;  1CPY A;  1BHB A;  1K9M W;  2DQ3 A;  1NR1 A;  3KG2 A;  3P30 A;  4P30 A;  4UV8 A;  2EZO A;  2QKS A;  3F7V C;  5DN6 G;  2XAF A;  3ZMZ A;  2EIL C;  1R3I C;  1KQS U;  3QO5 A;  1SRY A;  1BMF G;  1K3E A;  5LHH A;  1OCR B;  2LFS A;  1PNL A;  3ABK B;  1M57 B;  2QM8 A;  3GWO A;  3ZMT A;  2QM7 A;  3OUF A;  4RUE A;  1N8R W;  1G8M A;  4JAU A;  4TWK A;  3D36 A;  2WWW A;  3ABM B;  5B1B C;  1YTF B;  3G6E V;  1RPO A;  1JQ0 A;  2NLJ C;  3ETD A;  2EZP A;  1V54 C;  1OCO C;  1SZT A;  1FXK C;  1K34 A;  4PA9 A;  1DF5 A;  2DWD C;  2HKO A;  4UUJ C;  2WAM A;  1RPR A;  3TET A;  4MT8 A;  4JPR A;  5E1A C;  1VQL V;  3K08 A;  3W7W A;  2H8P C;  1S3J A;  2IJI A;  3ABT A;  1GMG A;  1P7B A;  4FIP C;  5CBH A;  3SPI A;  4HZ3 A;  2A79 B;  2ZR2 A;  3EFF K;  1VQ6 V;  2YSU B;  2IH3 C;  4PDV A;  4N21 A;  2OT5 A;  1AR1 B;  4N23 A;  4J9Z B;  3CCV V;  1E1R G;  4U7N A;  5EBM C;  5GW7 A;  1E79 G;  3OMI B;  2EJR A;  4JAV A;  4J9Y B;  3I56 V;  1VQ5 V;  3E8F A;  4H37 A;  4ASU G;  3CD6 V;  3FYE B;  2HVK C;  3QO8 A;  4G2K A;  3X2Q B;  2ZDI C;  3ZJZ A;  1MSW D;  2QEX V;  3E35 A;  1OCZ C;  3AG1 B;  5B1A B;  2JJ2 G;  2OCC C;  3OEH G;  3SYA A;  3CC2 V;  2CK3 G;  3ASN B;  3BEH A;  3ZMV A;  5B1B B;  4XDL A;  3OW2 U;  4MVQ A;  3ABU A;  4WFF A;  2BOC C;  2Q69 A;  5EC1 C;  3SYO A;  1V54 B;  3W7X A;  3JD0 A;  3DTU B;  3UM7 A;  1K4D C;  1NBM G;  2DYS B;  2JDI G;  3CCS V;  4MTX A;  2LP7 A;  2M7W A;  2R9R B;  1NVP B;  1K33 A;  1NJI W;  4QJF B;  1M1K W;  4Q20 A;  1K5Q A;  5LGT A;  4FK5 C;  1I5X A;  1DTO A;  2Z5U A;  1Y4M A;  4QE7 A;  1QBZ A;  1OCR C;  1S0V A;  2IW5 A;  2W0F C;  1SES A;  1M57 C;  3ABK C;  3K0G A;  3LSS A;  5IYB O;  1NQT A;  2IU3 A;  4QPK A;  4MTG A;  3ZRW A;  4WCE V;  3ZRW B;  1GKF A;  1TUE B;  3PJS K;  4XDK A;  3ZRX A;  3IGA C;  1JPX A;  1AI6 A;  2DWE C;  2XAG A;  1YIJ V;  3D3I A;  2XAS A;  1AJQ A;  4MVM A;  3H01 A;  4BIZ A;  3CCQ V;  1R73 A;  1L1F A;  3FB7 C;  4XDJ A;  1Q82 W;  1E1Q G;  1F4M A;  3FB8 C;  1YJW V;  4WFG A;  3ML0 A;  3FB5 C;  4LBE C;  5IDJ A;  5KA6 A;  2ITC C;  4MVR A;  2ITD C;  4F4L A;  3CMA V;  5L3G A;  4FJC C;  1H8H G;  1V55 B;  2IH1 C;  4GX2 A;  4P9P A;  3IC7 A;  2PI4 A;  2D3O W;  2R9I A;  5H6R A;  4GX1 A;  1M9N A;  3JD4 A;  3SPC A;  2A9H A;  1PNM A;  2ATK C;  4R7C A;  2V7Q G;  3VOU A;  4RQF A;  1WLE A;  3LDE A;  5KUM A;  2WLN A;  3QNE A;  4I9W A;  1QVG U;  1FFT B;  3OEE G;  1F23 A;  1UJW B;  1K8A W;  3X2Q C;  3LUT B;  1AJN A;  4WF9 V;  1VQN V;  3AG1 C;  5B1A C;  3F7Y C;  5L3C A;  1K4C C;  1PKX A;  1KC8 W;  1JJ2 U;  5CN0 A;  2MK3 A;  3CCJ V;  4R8C A;  2EIK B;  4GX0 A;  1R6K A;  2FTK A;  2WLM A;  5HFL A;  1R6N A;  1K5S A;  3ASN C;  1NKD A;  3MHS C;  4PDM A;  1GO3 F;  5EBL C;  1ZWI C;  2X0L A;  1I5Y A;  3E8G A;  1NR7 A;  2V1D A;  3HB3 B;  4GX5 A;  1DF4 A;  3R65 A;  5L3E A;  1Q7Y W;  2DYS C;  5IYD O;  3T4D A;  3HPL C;  3K03 A;  5B1O A;  1KP2 A;  4P9O A;  4PEL A;  1DLB A;  1CEZ A;  3CC4 V;  1WPX A;  3FKS G;  3ABL B;  3BY6 A;  1W0K G;  2P90 A;  2A0L A;  3OR7 C;  2P7T C;  1VQP V;  4MTF A;  4BAY A;  4JTA B;  5CBG A;  3E8H A;  2P67 A;  4MW3 A;  1VQ7 V;  4G27 B;  3ZMS A;  3TCU A;  2HVJ C;  2QA4 V;  5H6Q A;  3TK1 A;  4BW5 A;  1H8E G;  1AJP A;  3OGC C;  2ZXW B;  1XL4 A;  3M99 B;  4DO2 A;  3ASO B;  4X89 A;  1OCC B;  3NXS A;  3ZMU A;  2Q67 A;  3CME V;  4L87 A;  3JD2 A;  1Q81 W;  1VQ9 V;  1QVF U;  2Y48 A;  3OR6 C;  4UV9 A;  4MS2 A;  1B6Q A;  1V55 C;  2OTJ V;  3T4Z A;  1ARO P;  1KP3 A;  5CMU A;  1K73 W;  2EIM B;  3MD0 A;  2Y69 B;  3ZCC A;  5L3B A;  4P2Z A;  4EKW A;  4UXN A;  3OE7 G;  1F4N A;  1VQM V;  1KD1 W;  1BL8 A;  1YJ9 V;  3LDD A;  4JGS A;  3B8N A;  3ZN1 A;  1K92 A;  1QCE A;  1EFR G;  1J95 A;  3AG3 B;  2IJJ A;  3IFX A;  3K9A A;  5BZB A;  1KEC A;  5KUK A;  4UVA A;  2JIZ G;  4QPJ A;  3LSQ A;  2PI5 A;  3JD3 A;  2EIN B;  3I55 V;  4ZKI A;  3SYC A;  4MVO A;  3K3W A;  2EIK C;  1FS0 G;  2JJ1 G;  3OUS A;  2KB1 A;  4OXS A;  3SPJ A;  3STL C;  5EBW C;  1YJN V;  1GM7 A;  5EK0 A;  2XOK G;  4XBF A;  2AHY A;  4WFE A;  4Z1M G;  2WLH A;  3AG4 B;  3JCZ A;  1YI2 V;  3AG2 B;  1QLE C;  3SPG A;  3CPW U;  1PNK A;  3DGE A;  4CBC A;  3MHH C;  3ABL C;  1BHA A;  5J9P C;  2ZD9 A;  3JD1 A;  4QNH B;  4TSF G;  3CYO A;  1QR9 A;  2GHY A;  3E8B A;  5H9C A;  1JCH A;  3W7S A;  4LP8 A;  4PDR A;  5IY5 B;  4R50 A;  1JX9 A;  1LNQ A;  2W6J G;  2WSS G;  4MSW C;  4JYB A;  2X7R B;  1GM9 A;  3CC7 V;  2NNU A;  1YIT V;  3OFN G;  4HYO A;  1MOF A;  2ZXW C;  4MVU A;  4WFA V;  3P32 A;  2UXN A;  1W0J G;  3ASO C;  1PL0 A;  1OCC C;  3ZN0 A;  2XAQ A;  1FXV A;  1Q86 W;  1H38 A;  3ZRV A;  4PA6 A;  1RM1 B;  2K1E A;  3SYQ A;  3W7T A;  3FB6 C;  1S76 D;  2WLK A;  1OHH G;  3OM3 B;  5B3S C;  2EIJ B;  3CP1 A;  3K0D A;  5LHI A;  1IXM A;  4KFM A;  3WG7 B;  3CCR V;  2EIM C;  2DYR C;  2Y69 C;  3VBB A;  5CBF A;  5LHG A;  5LGN A;  3SJQ C;  1VQ4 V;  5LBQ A;  2Z3Y A;  1QLE B;  5EC2 C;  4BIU A;  2ZQM A;  1GM8 A;  3E83 A;  3T1C A;  3UKM A;  3CCU V;  1S77 D;  1THZ A;  1MG1 A;  2DW4 A;  3AEI A;  1K7D A;  3AG3 C;  3OAA G;  4MTO A;  5DM6 V;  4UVB A;  4KUM A;  4JF3 A;  4MVZ A;  3T2M A;  4RO2 A;  2HFE C;  1NH2 D;  3K79 A;  1K97 A;  2EIN C;  2AHZ A;  2F43 G;  1P4R A;  5C93 A;  1AI4 A;  4PA3 A;  3JYC A;  2XAJ A;  4DXW A;  2YEV A;  1COW G;  1EZJ A;  1M56 B;  2YEV B;  4LC1 A;  3E2E A;  1S5H C;  3AG4 C;  4I5S A;  3AG2 C;  4FPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...