2OCCB

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 67
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2occB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2occB02
2WSDA 1DYZA 1A8ZA 3H4HA 1WS8A 2FQFA 2GIMA 1PLCA 3ABMB 2UXGA 5EHFA 2J57A 1PF3A 2CUAA 4E9WA 4E9SA 1B3IA 3S8GB 3PCYA 4DP2X 1KCBA 1SHWA 1W8EA 2UXTA 2ZWNA 3PAUA 1SF3A 1KYAA 1AS6A 2GI0A 1VLXA 1CUOA 1NTDA 3UADA 2VW6A 1ILUA 3WG7B 1OCRB 1A4AA 3NSFA 4YSTA 3AG2B 3X1BA 3HB3B 1NIDA 2VW7A 2Y1AA 1PNCA 5D4JA 4BDVB 1IKOP 3NJMA 4E9YA 1XB6A 2HZHA 2R7EB 1A3ZA 1TEFA 2IH8A 1TKWA 1M57B 3QJUB 5F7AA 1ZDQA 1CYWA 1OF0A 1WA1X 3QJVB 4AX3A 3NJKA 1GSKA 1L9OA 2YEVB 1I53A 4DPAX 1JVOA 2AANA 3CDZB 3H56A 3QJQB 1A4CA 2UXVA 4HIPA 1EHKB 3WKPA 4GYBA 4QKTA 2BW4A 3AZUA 3DKHA 2BW5A 5AZUA 3NP4A 4ENZA 1SF5A 2QT6A 5I5JA 1AG6A 2FT8A 1RZQA 4K9JA 2UX6A 4N4YB 3NJFA 2W88A 4UANA 4P5RA 1HAWA 2IWEA 2QPDB 4N8UA 2YAHA 4DP0X 3CVBA 1ZV2A 2N0MA 2JXMA 1JZEA 1SFDA 1W6WA 3FU7B 4KNUA 2BWDA 4CSPA 4YSSA 3FSVA 5I5IA 1JERA 3WNJA 2FTAA 4P5SA 2I85A 2PP7A 2WO3B 1L9PA 2FT6A 1OE1A 3EF4A 2UX7A 3QJTB 4AKPA 3FS9A 4KOCA 2HLEB 1J9SA 2FT7A 3FPXA 1F56A 3ABGA 3DTUB 2DYRB 3JTBA 1YLBB 3IE9A 4G71B 3WIAA 4Q8BA 1NIFA 1GR7A 4F2FA 1JXGA 2CCWA 4KOBA 4KO7A 2IDSA 3EH4B 4UF7C 3NP3A 1PZBA 2CBPA 1KBWA 2CJ3A 2BZCA 3EHBB 1AS8A 3NJJA 3OMIB 5B1AB 2QPEB 1WA2X 3CDZA 2VSKB 3WKQA 3NYKA 3AG4B 1DZ0A 3AW5A 1AQ8A 3PLYA 4BWTA 2EINB 1KDJA 1ZDSA 4YSRA 2FQEA 1ET5A 2XV2A 1KGYE 2DV6A 1NIEA 1TU2A 2H5UA 4W1TA 1CURA 1MZZA 1IUZA 5I6OA 1AAJA 1GY1A 2PPFA 2BP0A 4A2HA 1E30A 2XXGA 8PAZA 2YQBA 5B1JA 2CAKA 3T9WA 3TASA 1NDTA 4FAAB 1ZIBA 1OCZB 4ZK8A 4F2EA 2YXVA 3H4FA 1PCSA 1XB3A 4G7SB 5E9NA 1XB8A 4F7KA 2ZOOA 1PLAA 4HZ1A 4G72B 3AG3B 3ZX1A 3EH5B 3KW7A 4YSAA 1V10A 2BHFA 1JZHA 2H47C 2PP9A 3T71A 5I5MA 4BXSV 4L0PB 1NWPA 1J5DA 2PPAA 2VMJA 1BYPA 1PAZA 2IWFA 1ETJA 5I28A 2XX0A 2YARA 6PCYA 2RACA 3S3CB 1ASPA 3FQYA 1AR1B 1N70A 4HHGA 4Q89A 3RYMA 3X1EA 1WAEA 1NPNA 4E9RA 1SDDA 7PAZA 4M4RB 5B3SB 5B7EA 4DP9X 4TXVB 2YAQA 1IBYA 3IN0A 2P80A 3NJHA 1GS6X 1JZIA 3CVCA 4CSZA 1GW0A 5I6NA 3S8FB 3U25A 1V54B 2GSMB 1J9QA 2HX8A 5ANHA 3FQ2A 3ASOB 1QHQA 4G70B 4G7QB 1X9RA 2IDTA 1A4BA 1XMEB 1PY0A 2Q9OA 2FWLB 4HHWA 1RKRA 4A2DA 1SHXA 3FYIB 1ZPUA 2XX1A 5TK4A 1J9TA 1OOWA 5PAZA 4NAJA 3QQXA 2UXFA 4YVNA 3T6VA 3ZIYA 4AZUA 1NPJA 2VM3A 2XYBA 3IEAA 4GP4B 1CC3A 4A2EA 3GXUB 3NJIA 2DWSA 1OE3A 2DY2A 3NJLA 2BWIA 1BQRA 1BEXA 3SBPA 2OJ1A 3UAEA 1V55B 1NZRA 2HX7A 3HEIB 4YSDA 4DP7X 3ERXA 3AG1B 1BXVA 1URIA 2AZUA 2VN3A 4NB7A 4A67A 3MBWB 3S3DB 2I7SA 2OV0A 3ABLB 4HALA 3WNIA 3QJRB 3V9EA 1NICA 1ADWA 4DP6X 5PCYA 1OCOB 5AKRA 4DP4X 3X2QB 2PLTA 4E9VA 2Q5BA 9PCYA 4M3HA 1GY2A 1BAWA 2IDUA 2IH9A 2PP8A 1KCWA 1J5CA 2IAAC 1M56B 2W8CA 3V9CA 2TSAA 1MG2C 1N68A 3FYEB 2FQDA 2VW4A 4X4KA 1AZRA 1IBZA 4KO5A 2YAFA 3G5WA 3X1GA 4YSCA 3UACA 3OQRA 2I7OA 2B3IA 3FU7A 3FT0A 4QLWA 3ZDWA 3FSWA 4A2GA 2GC7C 1L9RA 4AI7A 1OV8A 2VM4A 2EIMB 5F7BA 1AOZA 5I26A 2TSBA 3NJNA 3UGEA 2EILB 3MX0B 1E67A 3UABA 3FU8A 4BWUA 2PCFA 3GDCA 3PPSA 3NSCA 3S3BB 1AZBA 1PNDA 1JVLA 2QDVA 3OM3B 1NINA 4YL4A 3SBQA 5B7MA 3SQRA 2HRGA 1L9TA 3N55A 5D4IA 1BYOA 1ASOA 4UAHA 4DPCX 2XLLA 2GHZA 3FPYA 2XXFA 3GYRA 3OMAB 3CG8A 3FSAA 3QPKA 4DP8X 2XV3A 1KBVA 2XVBA 1TEGA 2PCYA 2IDQA 3TBCA 2YAPA 3L45A 3T6ZA 1E5YA 3CZUB 4NERA 3ABKB 3ASNB 3DIVA 2MRYA 1KV7A 2YXWA 4PAZA 1AACA 1MG3C 2J55A 4HCFA 2PPCA 4JHUA 2J5WA 1A65A 2P80D 2ZONA 4BWWA 2HX9A 1GS8A 4KNSA 4DP1X 2YAMA 3WI9A 1ET7A 1OE2A 3NJGA 1CYXA 4JKNA 4E9XA 1J9RA 4KO9A 2WO2B 2PPEA 1PMYA 2X88A 3KW8A 2GBAA 1PLBA 1JXFA 2B08A 3C75A 1AZNA 3OMNB 3IBOA 1FA4A 2GB2A 4HCIA 4BK5C 4W9ZA 2AFNA 1OCCB 1HFUA 5FC9A 2YAOA 4GXFA 4GP5B 1BXUA 3BVDB 5B7FA 1IC0A 6PAZA 1FWXA 3EH3B 2XUWA 3X1FA 1NIAA 2YAEA 3NT0A 1KDIA 2PPDA 4KO6A 4EF3A 1WS7A 4YSQA 4GY4A 4DPBX 3AY2A 1ILSA 1ASQA 1L9SA 3ZBMA 1PZAA 2FNWA 5AFAA 2OCCB 5A7EA 3TBBA 2FJSA 1RCYA 1JXDA 1UATA 1HAUA 3D12B 1BQ5A 3NSDA 1JZGA 3T6XA 1SFHA 2AZAA 4HAKA 2BP8A 4BXVA 1AANA 4WTQA 2IDFA 1W6LA 1QLEB 2JKWA 2EIKB 4KNTA 2VSMB 1GYCA 1FFTB 1JZFA 3PAVA 4A2FA 1BQKA 1SJMA 4PCYA 2JFCA 4JHVA 4YSPA 1QNIA 3T6WA 3TU6A 2IWKA 4AKOA 1JOIA 4YSEA 1R1CA 2E86A 3IN2A 3N2JA 1NIBA 5I6PA 1AZCA 3TA4D 5I6MA 1BXAA 2LLNA 1GS7A 1EZLA 2NRDA 2XU9A 4FA7B 5TK2A 2DYSB 4HCGA 2Y69B 1MDAA 4BDVA 3UAAA 1E5ZA 2BZ7A 4GP8B 1ET8A 2BP8B 1PZCA 1SDDB 2EIJB 2J56A 3OD3A 4A68A 1ZIAA 2DWTA 1M9WA 1E65A 2BO0A 1SNRA 2HXAA 2R7EA 2H3XC 4E9QA 1T5KA 1WA0X 1X9UA 5B1KA 4YVUA 1MZYA 3NSYA 1AIZA 5D4HA 5I6KA 1NWOA 3FQ1A 3FSZA 2HRHA 4A66A 5B1JC 2CALA 4AKQA 4YSOA 2FQGA 3BQVA 4G7RB 4DP5X 3PXLA 7PCYA 2BP0B 1JZJA 3CVDA 2GC4C 4WKXA 4E9TA 2A3TA 3PAZA 5IY5B 3JT2A 4MFHA 5B1BB 2X87A 5I6LA 2XWZA 2MTAA 2XV0A 1L9QA 2QDWA 1AS7A 4RH4A 1RZPA 3FU9A 1AG0A 4YSUA 3X1NA 5LDUA 1ID2A 3QJSB 3SBRA 2ZXWB 1AZUA 2AVFA
chains in the Genus database with same CATH superfamily
4TKWA 3D52A 5I82A 2CXGA 2EO9A 3UTTA 3BPLB 5TF1H 3B56A 3U0PB 5LG1A 3B43A 1A4JA 4OT1L 1DUZA 2BVQA 2QLYA 2VR8A 4AGMA 4UQ3B 4L1SA 2L6LA 4H8PA 2VQ4A 3VTMA 4KZDL 3JALA 4JI2B 4ODSL 2YMOA 4P46C 1ZAGA 3ZZ1A 2DWDA 5BUGA 1QQDA 3QEQD 1BGYH 5DUJA 4DR5O 4KI1A 5DDHB 2BSSA 4O2FB 1U8IB 1DBML 5KUKA 2NT0A 2ADIB 5LNEA 4PS4H 3EGSA 4LVNC 3FZUD 3TVMC 2EDHA 1B4RA 1J05B 4PJ5B 5JO5B 4UDTB 1HK6A 3D39A 4N6RB 1W8NA 4P3DA 4GLRH 5I1GL 3IDNB 3QJUB 1Y07A 4RUFA 4Y5XA 2F15A 1ZDQA 3FL7A 1WA1X 3WFBH 3O6KL 3RTQA 1AP5A 4Z3HA 3BO8A 4Z7WB 4XMTA 2OMXB 4M8RA 3B9KB 2X12A 1R3HB 4PJFE 1NC2A 4OZIF 4A55A 1XAKA 5JHDA 4FIPC 4FJCC 5AZUA 3HN5A 5AVRB 1YY8A 5C07D 5DS2A 1MRDL 5HI3D 2Q7YB 3LQMA 4KTDL 1MFBH 2QQNH 1G7LB 3NJFA 5EWIH 1ODUA 4UANA 3X2QC 4ANUA 5CO1A 5EA0H 1U8OB 2DD8H 3P4MB 5DS1A 2VLLA 5E9DD 3R8BB 1HINL 3LQAC 4YMPA 4LF8B 1YCSA 1AP2B 3PP4L 3WFBL 1KIUB 4YSSA 4N2OA 3HJ0A 2B7DT 2HN7B 3NPSC 4FCHA 4H25B 3BGFB 3FSOA 4ADGA 2QM4A 1DCLA 4IU2A 3ZRWB 3WEOA 1S7QB 2YIBA 3L81A 3FS9A 1FL6A 1EN5A 3E7JA 2ADIA 5J56B 5KBNC 2QHRH 4V1DA 5EDXA 3UYRH 3PJSA 3K72A 4LFHG 1TYEB 3IJ9A 2M8XA 5CBFA 3B2DC 1BZ7B 4APQC 1TJHL 3LS5L 2ZOUA 2MNJB 3DYOA 5JR1L 4DR6O 3WJMA 3BPNB 3PHQA 4GQ9L 2AXFB 3II3A 1FZMB 1WBYB 4O58L 4ORGA 4AVHA 4FYTA 3SN6N 5FM5M 5JUEL 1Y0LA 2MNUA 2BVEA 3ARED 3PABB 3FTXA 2XHBA 1HXKA 4BE5A 5DHYA 1H2NA 5GRJH 1NGXA 1WA2X 2OTUB 1MFNA 3CDZA 1P5UC 2VSKB 2F5AL 2P4KA 2QMKA 3CRAA 3FFCD 4OV6F 1YNTA 4X7CC 3ZT5A 2D0HA 3PL6D 4BWTA 3D85B 1IGIH 2HUHA 3A4AA 4PRNB 1GGBL 1X5YA 2EDTA 4LOUC 5DK2A 2AAAA 3ILDA 3CN2A 3PDDA 3BQUC 2VABB 1OV9A 1AAJA 1DVZA 4BINA 3J80N 2AKRA 4BHUA 4OD2B 3H3PH 2QDOA 1QSFD 4M6MH 1YDXA 1JTOA 2N04A 1WPXA 4ODTH 5IB4A 5CA1A 1CXKA 2OCFD 1OP3H 2JCCA 5BV7B 4Z7VA 3NIFB 4GO9A 2FSEB 2Q87A 1OAZL 1G7PA 1OCZB 1QI4A 2YGOA 4F2EA 2WJ7A 4URKA 4HGMA 3WMSA 4PRIE 1FIGH 1M7DB 4H26B 4HWZA 3H1LH 4ONGH 1AQDB 3M17A 4LSVH 1R4XA 2R15A 3REVB 3EOYG 3AG3B 3DJ9A 3ZX1A 4AXWB 4BE6A 3VD4A 3KW7A 4CBZA 2VZSA 3KYNB 4YSAA 3RY5A 3TC9A 3QDJB 3CU1A 3C90A 3NXSA 4HXBH 4K07A 4R4BA 1H3TA 3MLWL 5EU3B 3VU1A 4ODWA 1OSPH 4NZUH 3RWFA 4BXSV 2D7NA 4Q9RL 5D7JD 4OZFA 2Z7YA 3BEWB 4IHJB 2JB6B 2DYRC 2IJ0C 3OSVA 1XIWA 3A6CH 5C09D 3CN4A 3IDGB 3QR2A 1A7PH 4N86A 1JD7A 1TJHH 3FB7A 3K8KA 2YLKA 4HHGA 4PVMA 4QXUL 2I32A 1O9WA 4GG6B 5IMOB 2J2ZA 5FA3B 5J11C 1TJIL 4EDWL 3PGCA 1A7PL 2XDHA 1A0QH 2XAQA 3EO0A 1TPXB 1JZIA 4CSZA 3LQZB 1X4YA 1GW0A 4GO8A 4XO9A 4C83A 1DLFL 4M93B 1GAFL 3VRLE 4F91B 2A73A 2R0ZH 4TL4A 2A4CA 3ZHDA 3SPVB 2KPNA 3CE2A 1X9RA 4HXBL 5GZOA 4BIKA 2WBXA 2X4SA 4LASL 1JGLH 2NNXA 4JFYB 1CICD 3ZDZF 1FBIL 4HHWA 4D94A 4UVCA 3V4PL 2IV8A 3WEAA 5E70A 4Y19E 2XX1A 1TEYA 5I1EH 3MLUL 1UA7A 3RTQB 3V4VH 1A3LL 1CLOH 5IJ0B 1DP0A 4J42A 4QXGH 1G6RL 4BSVB 4JMNA 4U7NA 2OMZA 4QMEA 4BSWB 1OE3A 2B1HL 4EVNA 1FLRH 1VPOH 3UPCA 3S36H 3CCRV 3CD6V 4JZOA 3FZUC 3TVMD 4N6RA 5IBTL 4HWEH 4LRNH 2A7BA 3BW9A 3QSKB 4ZBJA 4Z3GA 1PNKA 1FZKA 2HVKB 1NUGA 3SE8L 5FCSH 3K79A 1WEJH 4AIXA 5I73B 1JYWA 2XWTA 5KJRL 3DXRB 2YKLH 1BZ9A 2A6IB 2F7RA 2XETA 3I6KA 4JRFA 4KH9A 5FNVB 4PA4A 3GHEH 5LKNA 3KR3L 3JALB 1U8LB 2FX8H 3HE7C 3NDZE 4PJHE 4R6ZA 2N7BA 5PCYA 5HI5D 4Z8FH 3GWKC 1SOXA 3UQ8A 4YR6A 4M3HA 2R29L 4FLQA 3OKOA 4U1MB 4N6QA 5BVPH 3VA2C 3GMOB 3KJ4B 1XGYL 2YC1A 2GI7A 3U10A 3TO4C 1K6QL 3PF2A 1N68A 1YNKL 1NUFA 1IAIM 4S2SB 5D5ME 3T1WA 5HHQA 4Y4KC 3BDXA 4JFWA 2BSKB 2EO1A 2R4RH 2CQVA 4FZEL 4CDGC 3N1MC 3B9KD 4ILDA 3ZDYB 3GO1L 3Q6GH 2CG9X 5FYKD 5KSUB 1OV8A 3GI8L 4KGLA 3P3YA 1AGFA 1FAIH 4MLSA 1H3GA 1MCBA 4P5TD 4OFYD 1WA8A 3EYUH 2Y7QB 3CXFA 4GKSB 1RK1B 3T2NL 4BZ2H 1EAPA 4G83A 3OL2A 3W39A 3CCMV 1ZHBB 2X2JA 3UAJA 1NJIW 1OJHA 5I8KH 1QW9A 1BFTA 3AACA 1NEZA 1QA9A 1E3FA 5DN6G 2WXFA 1XWVA 3T2NH 4ATWA 4ZUUB 3WEXA 3S0PA 2HRGA 4Q97A 2MCPH 3B9VA 5CSZA 3CVIL 3IPFA 1RUAH 3VACA 3O3DA 2CDFA 5HDBE 2P67A 1E27A 1MCKA 1MJUH 4G1MB 5CGTA 5HGHA 3KLAB 5ICXB 3P3UA 1YUHA 5EORH 4IK7A 4AIEA 2YFNA 4YXLL 3P73A 1BF5A 4KJYB 4YHOL 1O7DE 1DJZA 5JOPE 4HFUL 1QSEB 1AQKH 1BBDL 2AEQH 2E56A 2NY5L 1NAMA 1XL6A 3B34A 4X8XA 5CGYD 3DO7B 3EAKA 4X5XB 1IGFH 2ZXWC 3G5XB 1N6UA 3Q2WA 3ZR5A 4Z0BH 3QQ9D 4ES8A 5JPMC 3ABKB 2NLJA 3CDGA 2E6JA 4RZCB 1I8LA 2QVMA 4NO0D 1OP3K 3ZBHA 3KEDA 3JATA 1JMXA 4XOAA 1I8AA 3CNKA 4E5XG 3ILPB 1PJ9A 2A4EA 5MI0C 3GLDA 2WIIA 2K9PA 4KUCF 1MCIA 1CYXA 5ICUA 4ADJA 4FMVA 4EQ3A 1NDMB 2ADGA 3T8XB 1E9PB 3KDMB 2C3VB 4PS3A 4AENA 1V7NL 1UXSA 2ZQMA 1F1DA 4NDMA 2NTSP 4JYCA 5CUSL 2X44D 5IQ7L 1G5GA 3PREA 4CS2A 4J23A 3W9EB 1YPZA 4WY7L 5HGBB 1KZYA 2QTEA 1R6TA 2LABA 4XN2A 2FGZA 4GXFA 1HH9B 2UUDK 4NUQA 4Y4HC 1BIIA 1INDL 5C07E 1MVUB 1SM3L 2QADD 3FH8A 3O0LA 6PAZA 4U7MA 2H2PC 2CH7A 1RZGA 3F7LA 2OIGA 1FFNB 2B15A 4XB8A 1WB7A 4W68A 4DW1A 2N1KA 2R29A 1YYMH 1QR9A 3ZN0A 4ZUSA 4IBSA 2XFXB 5BS0E 4YY3O 1FVDA 1U6AH 3AY2A 4I48B 1L0XA 3LNEA 3T8MA 1EDHA 1QFOA 4DQAA 5K9QG 5EUOE 2EYRA 1LVEA 1UADC 4YHIA 3W9DA 3G5YA 3UPRB 3NRPA 3GF8A 2EJ7A 3B3IA 1QEXA 4JDTL 1DLFH 4B0MM 4GBXA 4PGEA 2ZCEA 2AHZA 1QBAA 2DLGA 4TSCL 3NSDA 1SZNA 5B38B 3BXNB 2GJJA 1U8QA 4HFWB 4D9LH 1CGWA 2J44A 4CL7A 1TIUA 4HSCX 5I0VA 5C07B 4WTQA 4FFYL 2IW5A 4KUMA 1GH6A 2BIPA 2E3VA 2FJGA 2DKSA 4CRPA 1UWXK 1FGNH 1RQ5A 1Y1UA 4EZLA 2YXHA 1UCTA 3D7PA 1UQSA 4WU5B 5IBUG 4AHCA 3AQXA 1SUHA 2L7JA 5E94B 1FZJB 1PDKA 3PJLA 5CZVH 1CYGA 4OQTA 5L88H 1IGCH 4AG4H 1DGSA 4A2FA 3LSSA 4HMDA 2RH0A 2ICWA 5J57B 2BSED 2IWKA 5HHVH 1D5BB 1ECZA 4WW2A 3BFRA 3JD1A 4OGQB 2PCPB 3IN2A 3OZ9H 3K91A 2LR4A 2DQHL 2X7LB 5K69A 4HCRL 4JRXE 5H8DA 1M05B 2E9IA 4DV0O 2XBDA 3H8NA 3U4BL 1S8DA 2X9ZA 3ZU8A 1CDCA 1F3JB 5EIQA 4QOKE 1A2YA 1JNLH 4WI6A 3HAEH 1BFVL 3L3GB 1MCJA 5FO7A 4F7EB 2YEVA 3CH1B 5FA4B 1WVZA 3Q13A 3W2DH 4ODHH 2DQ0A 3TN0D 1D5MA 2DM3A 3KBFA 2IANB 4F37F 4Y7OC 2FO4B 1GZQA 4WGVB 5H35A 3BFWA 1SKVA 4BCZA 2NQCA 2H8PA 4YQXH 3TNMB 3HE7D 3I2CH 3ZZLA 2F1BA 4H13B 2R7EA 4AGQA 4E9QA 4UOW1 1KCVL 2AI0L 1OAKH 2PXYC 1WAZA 3FU0A 2EVJA 3AQZA 4GZRB 4TUUA 4R8CA 2KDGA 1RI8A 4U1GC 2D7OA 2LTQB 1XH2A 4XP6H 5D4HA 3WD5L 1HSBA 5AVWB 3QPXL 2XZCL 3E1ZA 4M8QB 4HYTB 3IU4H 1SQPH 2ZCHH 4ZFQA 5I8OL 2ZUYA 2BOBA 4DP5X 3VRJA 1JZJA 15C8H 4PB0L 3ZDZE 4MJJA 5TDNA 4MFHA 4EZKA 4J1UB 1FNSL 5F7EL 4U7OA 5I8CA 1ODAA 4NQCD 1OZUA 2XFGB 1CGVA 2E76C 1YDPB 4MAYC 5A3IC 5DQ9A 5B66Z 3SBRA 3ZDYF 5I6XC 2IANE 2VLME 4H0LC 5I1KL 2F8OA 3VQVA 5F1IA 2BDNH 3UYPB 1FAKT 2VITA 1VQ8V 1X5AA 4HP5A 4I2XA 5C08D 1SLUA 4AEHL 4GAJH 2Z91A 3HKBB 4NNXB 3NMEA 3MRRB 3FFDA 3JARB 5EHFA 1VCBC 4XP5L 1B3IA 5DZOA 3TJEH 1VACA 4R9HA 2NYYD 4G2KA 5EIIG 1JA8A 4MLIA 5K33A 2YD1A 4RBPK 2VW6A 3BH8A 1XGPA 3ZMSA 1TTRA 4NOFA 5HGDB 2EDLA 4X9HA 4ZMNA 5IJBC 2MEJB 4N3UA 4ZUVA 1WZLA 3ZL4L 5ITZB 2XA8H 2HP4A 5I66A 2DWYA 1VFBA 1GVIA 4QTHA 3VXUA 3ZDXB 2WYHA 5D6CB 1BDYA 3SD2A 4FG0A 1HDMB 1XB6A 4LDCA 1DDTA 3GKZA 4NP4H 1QOKA 4NQDA 5F1NB 5BV7L 1KUQA 2O5NA 4FNLL 1DLHB 3VE0A 1YMHA 1ZEAL 2CUMA 3DTXB 5FOBB 3BDYH 1OF0A 1S7RA 1SJVA 3D51A 2QGBA 2FD6L 4TSAH 1P5UB 3OGIB 3BSGA 2GT9B 5HVWA 4DPAX 1IJ9A 3QJQB 4TLUA 2QTVA 4KXZI 3DSQA 2XT9A 4XCEB 3WTVA 2LO1A 3BVOA 3CP1A 3J7AU 1I9RH 1Z9LA 1LNUA 3BPNC 1UWGH 3VI4A 2FT8A 5HHNB 3MV9D 4ZX6A 2K78A 1SJXA 3L3DB 3SYCA 1MCDA 4HQQH 1TTAA 1MFDH 3HS9A 1FL3B 3BEVA 1MI5A 3WJLA 1HOCB 3QVNA 4QF1A 4PS7A 2VLKB 4V1DE 5GS0L 3DI2B 4XPHL 4M9PA 1IEBA 2QBWA 3RP1A 5HHOE 4HHAB 5D71H 3U83A 1PZ3A 5F96H 5F89B 2CBOA 2KQMA 2WV3A 4GAJL 2BIIA 4Y2DA 5LGHH 4OZGF 3S37L 5GW7A 1E28A 1E9QA 1KCRH 2CHXA 5EDSA 4JI3B 3T1FA 4AQEB 4Z5RA 1SOKA 4RRPG 4AWJC 3MLPA 4OX9O 2BOCB 5CMUA 3UXFA 3QG7H 1DQIA 3OW2U 1AHMA 5C0JB 2VKXA 5BMFL 4G71B 2R27A 4XDLA 4Q8BA 2OCJA 1KIQA 4NKDB 1PBYA 5DMGC 5DRNB 4KRPC 3S36X 3Q3GA 1SQBH 2WGNB 3MNVA 3GNMH 5KSBB 3L1FA 4D8PB 1CG9A 3NP3A 2CU9A 1FP5A 3NCBB 5KTEL 1X3DA 2CBPA 1AI5A 4E68A 1KBWA 5IB1A 3HB3D 2DQ3A 4X65B 3C8KA 5G4MA 4YO0A 2VE6A 5GS1B 4JMXA 1WNSA 4U1GB 1IBGH 2DBLH 5CJQH 5FW7A 4E41A 3AK1A 3P9MA 5IMLB 1VQ9V 4L8BA 5MEND 4JBSA 1ZWIA 5FAAA 5TE6H 1XH3A 3GT6A 3EJRA 3ARYA 1KEGH 1OB1B 2ZKHH 4FHJA 4ZXBC 1FV1A 3U7YH 4KI5E 2H5UA 4JI6B 1JD9A 1Q94A 1ZLDA 4CMHC 3MD0A 1KBGH 1AHWB 3IT8D 4NTYA 1RHHA 4WNSA 3IKCB 1WICA 4QTIL 1GC1C 3C9NA 4CGTA 4NX0A 2IOIA 3QQ4B 2Y6SD 2FLRT 1GOGA 1T66C 4WEMB 4JAMA 4ZK8A 1AY1H 1T0MA 2AQ3A 2WKOA 4XPAL 5DUBB 3GRGA 2CA3A 2D3NA 1OGAA 3APCA 3ULUF 3N3EA 3BZ5A 5ENWA 4LCWA 1GK9A 3OPUA 4FG4A 5HHVL 4G72B 1M6OB 1I8LC 3VG0L 2HEPA 3HC3H 4LSSL 4Y9BA 2APXA 1FJ1B 1INEL 1JPTL 3BPLC 1LHZA 2IPTL 4O58H 4P59L 3IDGA 4ZO7A 1SVZA 4X4MA 2F5BH 4GUQA 5JHDD 1QO3A 4XP4H 1YPZE 2XN1A 3SGKA 1QR4A 4PLKC 3P77B 1DVFB 5AWNH 4KUZH 5FPIA 1JHLL 1H6EA 5KX5A 4I0PB 4RMUA 3KXFA 1WAEA 5CKAA 2XQBL 1OCWL 3ZKND 1BLNA 4ZFOL 1M57C 4TXVB 4N0UE 1PIFA 4R96A 1IBYA 3LNIA 5EEYA 4HH9A 2BVPA 4OIIH 4YBQC 1ZPLA 1N67A 2XVGA 3NJHA 4WHYH 3LDEA 5DK0A 5H2BB 4AJYV 2WXOA 4L3AA 3AXLB 1BM7A 3HZVB 2WBWB 5GZNC 1T03H 1HWWA 4MA3B 2G0LA 4H37A 1KYOJ 4OD2A 3ME0A 3R7RA 1PNLA 4X42A 1IAII 4JFDD 4NCDA 4HG4K 1JN6A 2VLJA 4O2CB 4KMQA 4WI0B 2P8MB 5E9AA 2NX5D 2HVJC 1U8MA 2FEDC 4IOIB 4KXBA 1ACCA 2FHFA 2WSSG 1KEMH 1MJJA 5JHLH 1YNLL 3K5SA 1BJ8A 1CC3A 1NCOA 3TZVD 2XBTA 3SDDB 3FTGA 2KG7B 4L4TA 3ARSA 3B7UX 2Q8AL 3CEIA 3D4ZA 4W6XB 1UT9A 4HAFA 2K8QA 3HEIB 3AY4A 3ULAB 1JFFB 3QCTH 2KERA 2ZWZA 3FB5C 5JZ7D 2IALA 3U9UB 4FD0A 3QDAA 4QHMA 4LNRA 3EO9L 3RE0A 1S7UB 2DW5A 4NM8H 1QLRA 2ZUSA 5ITBL 1HC1A 5FUZH 4H8WL 4U1HB 2GBUA 1BD2E 1JZ6A 4FQIL 2ZWLT 5GHWH 1QP1A 4KJPC 3KD4A 3V0JA 3D8MA 2EVGA 3LKNB 4GUOA 1NICA 4X6EA 5E56A 4ECNA 2D0GA 3HG0A 5DA0B 2AMUA 5EEXA 4DOHE 3PE9A 5BZWA 1MCEA 4FQPA 1X4TA 4NXNO 2COVD 5GGUA 2OMVA 4JPVH 4HJEA 3M7MX 4B50A 3I6LD 1FPOA 2ATKB 1U8CB 1J5HA 4QRPD 1N18A 1HXMA 4DGVH 2WQUA 4QRPE 1TQWA 4Q52A 3TZVC 2VZUA 4E41B 1MCRA 1CE1H 1KLGA 3X1GA 1NSNH 4DK3A 4P99A 1WC7A 4AYSA 4LLYA 5FYJL 5CD5D 1WFUA 4QLWA 2V4DA 4AV0A 4NQUA 3HLAA 5KVGL 2J3SA 3E8UH 4I3SL 5C0EB 4P9MH 4GSXA 5DMKA 2ZG3A 2TSBA 3S8WA 1T20A 2RQ8A 3GMNB 3ASOC 2EILB 5JQ6H 3MRLA 4PY7B 2JQAA 3AXLA 5FHBL 3LIZL 4Y8DC 1BREA 1HNZO 5SWSA 4DV6B 4IRJC 2N7SA 1V7MH 5FX3A 5ECJE 3QQ3B 2Q2LA 3GMPB 4GSQA 5AOZA 1XR8A 5LBSA 2XIIA 3SY0A 1JL8A 4WFGE 4DR2B 4RFNB 1AR4A 3RWHA 2XPGB 1L9TA 3N55A 3TYGL 1KJVB 2XLLA 3CWGA 3U6XA 2HTKD 3L75H 2WA4A 3OKMA 4N2HA 2EEBA 3KCPA 1K5SA 1Z9OA 1BQHA 5JW5A 4POUB 5LMUO 2GK0A 2O4EA 2EH8L 1VCAA 3KPLA 4LLVB 2WC7A 5CINH 1KBVA 1GIGH 1JJOA 3L74H 1EZJA 1GL4B 4I3RH 4JPSA 4DN4L 3BHBB 2R69H 4EE2A 3CU7A 1LILA 4LL9A 8FABA 2PCYA 4ZPVB 3CN1A 4WWKD 3CSTA 4GIOA 3WTSA 1A9VA 3G67A 2ADJB 4MVZA 3ARGC 4EI0A 4HCFA 5FKPA 2VO5A 4P2RA 2NNAB 5EBGA 4BWWA 5I24A 3L95A 3VXRD 3MNZB 1VP7A 2DJUA 2ZXEB 4AEHH 4HAGA 4DR5B 4ZQKA 5A2FA 1WK0A 4ISVB 2UVEA 2XACC 4MVOA 1P84F 1J0KA 3MBXL 3QCVL 4M7ZB 3KE0A 5KVEH 4YPJA 2AK1L 2OR9L 4YL9A 1TVHA 1MFCH 2DWXA 4KO9A 4F24A 3QIBB 3G6JF 4HWEL 4PW9A 1ZHKB 3O2DA 5IOPB 4G80B 3TN0A 2P7TC 5DD6B 4JO3L 4Z1PA 4GW5B 5D1QE 5J2UA 1RH8A 1YEKH 2V4LA 4XBEL 4LZKA 4J80A 2KZ1B 4D0DB 2WLMA 4GW1A 4LKXB 4BK5C 5LXGL 5EC2A 4Y5XC 15C8L 4QHPA 3W3BA 2AFNA 3FQWB 4ELKA 4L8BB 5D6CA 1DSWA 3FT3B 4U6YB 1NBMG 1WIOA 2XA3A 3G5ZA 4BKSC 2GW5A 4QXTB 1I3RA 4KROB 4BCXA 1KLUB 3FUIA 3QEQB 1ZLEA 3LAFA 1BGXH 1M53A 3BVWA 5JDSA 1DEEA 4QE7A 2PPDA 3C8KB 3KGRA 1XGPB 4EF3A 1WS7A 5HYSB 1MCWM 2E9WA 4NQDD 5DJCB 4JI3O 1RMFL 3B40A 3WYRA 3N85H 5GS3A 5FO8A 2MCAA 5K93A 3GHBL 3LQAL 4MJID 3L9BA 1PZ5B 3BH9B 2F23A 4MJIE 2FJSA 1FYJA 1BHGA 3MLVL 1DBJL 1NC4B 3FQNB 1I85C 3NZHH 1I0HA 3BAAA 4UCRA 1QUPA 3Q6FA 2IH1C 3QFGA 5TQ2L 5IUSA 4MDJB 3JWOH 1J5EO 2BPBA 4KKAD 1OM9A 5D7HA 3ZVVA 5FLVA 4PA9A 4AQEA 5D96B 5ADOH 4CDHA 3BISA 5D2NE 1JS4A 5DQJA 3MRNA 4Y2DB 4J3TA 2VC2H 3QORC 1C5BH 5IEHB 5B39A 4PR5A 3EYVB 2W91A 1R34A 3RZCA 4NEHB 3U79A 1GYCA 1K3IA 1H15A 3QZWG 4ZX4A 2WLYA 3T1HB 3MA9H 1E2VA 3LPOA 4WAFA 1NGZB 3VGAB 4XMWA 4KJWC 4YSPA 4XVSL 3VXNB 3OLGA 4UOZA 5L6YH 1JNNH 5FR3A 5A6MA 3SY6A 4KAQL 5KYXA 1CTOA 1B9ZA 4EFBA 1JPGA 2YN3A 4WGKA 2K45A 3IJSA 5I9QB 4WUUA 3JWOL 3NAAL 1GKOA 5D2NC 1E40A 2XU9A 2Y36L 5E4IA 1XR9B 5CILL 3MNVB 1SGKA 1KECA 2CLZA 2OSYA 2FUTA 2QKIC 1MJ8H 5B1OA 4I1NB 4JREC 5AVUB 1P5UA 1OHQA 2XYCA 4TV9A 2IANA 1Q0EA 2XKSA 3TJPA 2ZIDA 2OFQA 1BFOA 4HS3B 4M5SA 4JYAO 4H8WC 3DTXA 3K58A 1JZDC 1K33A 4OI7A 3BMWA 5DU7A 1U8JB 2BCMA 1RFYA 3BGMA 2FX7L 3WENA 4U1IB 5EYPA 2WP3O 3E38A 1HDMA 5EOTA 2C26A 1S8DB 2YMXH 2P90A 4GUCA 4QJFB 4HS8L 4PRID 4HKJA 5I6KA 4X1KB 4CILA 2I5YH 4WK2B 1ZSDA 5HGDA 4U6XA 3SDXF 2HRHA 3PWPB 2MK3A 1D5BA 4WW2B 1EFXA 5D1ZD 5ID1B 3NN8B 4FULA 5C1MB 3R06B 7PCYA 3GPSA 5I1GH 4I9WA 3C08H 3ZYOA 1FF5A 3PP3K 4R7XA 2DMCA 3ZXAC 4YIQA 5EU7C 4OM1H 3EDKA 1NFDF 2AV1B 5BOJA 2Q2EB 5J11B 4P5MA 3VD5A 3IGUA 1OP5K 2VH5H 5EMYA 2FB4H 2E5EA 3QHFH 5DWPA 5JW4M 3RNQB 2GT9A 1AHWA 1J8RA 1H0DA 2VDOL 2GFBA 2Q0OC 3Q2CA 1KBBA 1FV1B 1OAQH 4LAJH 2J7LA 4MYPA 2MCMA 4E9WA 2XWXA 4E9SA 5KSBF 3W0WA 1B0RB 3Q44A 3WEMA 2LVEA 5AUMB 4XPBL 1W8EA 4JVWA 5HDQH 4XXDA 2JIZG 1U2HA 3SGEI 4J5VA 2I60H 5EU5A 4YOKA 3WXWL 1OLZA 4Y0GA 1LXMA 1A4AA 2VDKH 2UXCO 1U8KB 1YECH 2WB7A 4GUPA 3MV9B 4IIQB 3SB3A 2PR9A 4RGOL 4XNQB 1P0SE 2XV6B 4P2YA 2KQXA 2BSRA 4NBZB 3HPLA 1LYQA 4HKZA 1IKOP 5DZNA 3ZSTA 5E1QA 1A3ZA 2D3OW 1VACB 4JI5B 3MA7B 3TBSB 2YZ8A 4H20H 3HKZA 1AKPA 5DRNA 2M26A 2UUDH 4B41A 1REIA 4KBPA 3JASA 4NNYA 3I3EA 4Y1AB 5GRVL 3GD1C 3VMNA 3SE6A 5DECA 2WB1A 3T2OA 1XMQO 3BAJA 3DX8B 4KRNA 1KWGA 5ESAA 1IEAA 1WTGT 1HHHA 1SJEA 3DX9A 3LN4A 4EUPG 1NOLA 1HHGB 3MYZA 1RM1C 1ZT1B 1U8PA 3P3SA 2ATKC 5IG7A 1CDBA 5DJDB 3B5HA 3RIAF 1GGYA 2JCCF 3MRQA 2X9XA 4D9RE 4KDTC 2RD0A 2ARJB 2OP4H 4KK6D 1FYTB 2IAMD 5E2TH 2R0WL 1N64L 4P5RA 3TZVB 2EIEA 4NQEE 4OZGE 5FCUH 1TETL 2JXMA 1KJ3H 2N0MA 3L3DA 4MCYB 4XCFL 2XTJE 1FZJA 1PDKB 3ARUA 3CPUA 4JW3A 5FYLH 5HHOD 1CI5A 1ZE3H 5IW1A 4JRYD 2P8PA 4FP8L 2W1NA 3WKMH 3LNMB 3E8FA 4YXHH 4F7MB 5E6YA 2DQJH 2CBQA 4JFOA 3QO0B 1LWHA 2VB5A 2Z7UA 3JV4B 1FZOB 3WB2A 1UH3A 2HLEB 2XIDA 3O4LE 4KPHH 5GHWL 3MV8E 1TETH 3KG5A 3SDDC 1BZQK 3JTBA 1YLBB 3DV4B 4HPYH 5FF6B 3GXIA 1Z5YD 3CZLA 4HMCA 4ONFL 1IBKO 3GI9L 4AK2A 1ZGLM 2Q7AA 2EXWC 2P5EA 1CFBA 1NMCC 4H7VA 4G9FB 5CJOL 3ASWA 4KOBA 3EJPA 2DQJL 3RHWF 4QJ5B 3R4RA 1K34A 1RK1A 3F7VA 4JR9H 2BSTB 2N1TE 1HNWB 4QXVA 3ZTNL 4JG0H 5E9DB 4ZTOL 2BVUA 3CFBA 5FYLL 4WI7A 3UP1A 4ZNEA 2CR0A 3W0WE 4HIXL 3ARBC 2EUXA 5C6PB 1HHGA 4Q14A 4YE4L 5LAPA 1OT2A 1XSIA 2B20A 4O5LH 4LL1A 3C2AL 2FUQA 5JW4Q 1PTZA 3FHEA 3MV7D 4J27A 4P5KB 3MRCA 3VXOB 1GZHA 3L5XL 5ABZA 1T89A 4M6OL 3ARRA 3ZHKA 4QRSB 2Z9TA 4KK9C 3FUMA 2NUPB 4P8QA 5CF3A 2A6DB 1PS3A 3L1EA 2CRIA 4HGWA 4R7DA 4CAGA 5B3JF 5DJZA 2DTML 4RQFA 3EUUA 3B8YA 1B9KA 1US6A 2RMKB 2BP0A 4PJHF 3LVTA 4NO3B 5K9KB 5IW6B 5HYSA 3R66A 3QUMH 3GTTA 1QHPA 3BAWA 2CCVA 1AO7A 3GUFA 1NDTA 4UTBL 1CD1B 5ANMA 3U0WH 5DD1H 3KWUA 2WQRA 1YDPA 5EF3A 1WAAE 1KLUA 3K9AA 1YEEL 3BI9X 4DVBA 1KENH 4NJ9H 4C4BA 4DGIH 3HRZC 1LO2L 2XWTB 2YXVA 2AGJH 3MRDA 5IWLC 1H5BB 3W0WB 2W0PA 5E9NA 4JFQA 4Q6GA 4NXNB 3B9AA 3A6CL 3APNA 5TPWH 3SKNA 2Z3FA 3N40P 4IIQA 3T0AA 3G5XA 4UILL 2JKXA 5KJ4A 2X70A 4QHUB 5C7ZA 2HFTA 2YLHA 1OW0A 2CGZA 1AXSB 3QIBA 3FUNA 1KIRB 2I24N 2EYSA 2X4TB 5BVPL 3FFCA 4HQQL 2OULB 5I0DA 4X5WA 3A3YB 3C8HA 2AXTZ 4G8IA 1Y1DA 1JG9A 4JFYA 3BAEH 3R65A 3QUXC 5GS0H 1TT6A 3SPVA 3QFDA 3UO8B 2RQEA 1UH4A 1EFXB 3FONB 5ID1A 5GRUH 1RJZB 4U6XB 4ZPVA 4NPYA 3K6SB 1QTSA 5EU6D 1P4UA 1J9QA 2HX8A 4YXKL 5GS1C 3MLXH 3QIWC 5LB1A 2Y1YA 5E7BA 3BN9D 5IIEA 5LQBL 1JQ0A 3HG5A 1MAKA 2AAVA 2L7QA 4MYWB 4WZ9A 1PY0A 1QBLL 5F9OH 3NQKA 2F7PA 3L2NA 3U4AA 1MLBB 1QKZH 2YK1L 4X5XA 2SEBB 3BCDA 3HAEG 2OL3H 3OR6A 4NAJA 4YVNA 3RWHB 5C0RH 1BF8A 3RVVC 3TO4D 5BRZE 2IFFL 3ZRSA 4GP4B 1ZGLP 4KNQA 2QGEA 2CDEB 2DRUA 4DK6A 3MGOA 2B3RA 5F21B 1M7UA 3T0BA 1CPUA 2X0WA 4UXNA 2MKWA 3NJLA 2Y3AA 2CCLA 4G6AD 4N8CL 1NCIA 3HRZB 4YDVA 5SWSB 2Z6FA 3OKOB 3SBPA 1HT6A 1LD9A 3KLSA 5D93C 2Y06H 2HX7A 5C7XL 1A6TB 3EOTL 3CC1A 3BXNA 4HFWA 2EDRA 4Z3FA 1E7VA 1D7FA 3CWBH 1RUPL 3GLZA 4MB1A 2V5MA 1L0YA 3IETA 5BUPA 5B21A 3PV6A 5KOVC 2P5OA 1D5XB 3SO5A 1N7MH 4EUPB 1ETZB 1EXGA 3EIFA 4MWFA 2ED7A 5HXMA 1EWHA 4QWWC 2ATAA 3EOTH 4I48A 1IB5A 2PYFB 4YIPA 2WKLA 3RTQD 4DV3O 4PJ7F 1PPJH 1V55C 2LT9A 2B5IB 3HNTH 4LVOB 5IEHA 3HCVA 4QI3A 5E9DE 2OTWA 4CGUB 2IAAC 1IFRA 4L8CA 1MVUA 5L8JB 2IAMC 1XGZA 5I1DA 1H19A 3RZCB 1A7RL 2UY7B 4LWSA 3LQAH 3HKEA 2G2RA 2JJTC 3BE1L 3MC0A 3FT0A 5J0BA 4YGAB 4A2GA 2F6AA 3B2VL 2X4SB 5AOJA 3KWVA 4DUYB 4X0NA 3IDJB 3RVUC 2XZAL 4P2RE 3RG1C 3RZWA 2WTRA 2CWRA 4WWPA 1JFQL 2NR6D 1UEMA 3GSOA 3PPSA 3HMWH 8CGTA 1UKTA 4FQXA 1OF2A 2I26N 2JS5A 4W9CC 5FA3A 3WELA 3OR7B 4NHUB 1B4JH 1BSMA 2P8MA 5CNHA 3T3PB 2FH8A 2JIXD 5HHOB 2Y07H 4G82A 4Y19A 4NHCH 2AQTA 3WHXB 3RGHA 3H2WA 3OC5A 2H2SC 4QRAA 4NQSB 2QKAA 4BSWA 2YOCA 3OZ9L 3SE9H 1QSEA 4GKLA 3G6BA 3PWVA 4JFZL 4WQOA 4X4XB 5AYUH 3H9SE 4IK6A 3C5JA 5GGSY 2R0LH 1J7VR 1O5DT 1FG2A 1NCGA 5KTEH 4LVHC 5ICXA 2YAPA 2P4VA 2Q69A 1M90W 4AXWA 1L9NA 3CYOA 2WYZA 5CSZB 3DIVA 1IC7H 2MRYA 4N2NA 2J55A 4P2RB 4WTZA 3L7EA 2DQCL 1X5FA 2ZXGA 1NEZG 3M45A 4TUKH 3H1KH 4M56A 3U4EA 4KMTL 1BX2A 1X59A 4ODBD 4BR6A 4YEFA 3WNLA 3DHMA 3OXSB 1CFTA 2UYLA 3NFSH 5GJTH 3F62A 1ZHBA 4OZ4A 4WEBL 3SEPA 2FBJH 3DXAB 2BTQB 4E9XA 5C86A 1IJNA 1DR9A 4OJFL 3RWJB 3QI9D 1MHPL 4Z7NE 1RZKC 2AQ2A 5IMOA 3LDCA 4G2AA 4Y4HA 3MCKB 4AJVA 1GTOA 1PKQA 5JW5B 5IFHH 3D07A 3OTFA 1FA4A 5I8OH 4GH7B 4X65O 5C71A 4FQLL 5ENWB 4HOMA 3X3FL 1NBCA 5GSRA 4JNXA 4Y2DD 5JO5A 1OCOC 1G9NL 4X4ZA 5SX5H 4WO4D 3AC0A 1FWXA 3FONA 4KTDH 4OFIA 4OZFH 5BRPA 2YAEA 3AMKA 1RZ8A 1J0HA 3V7MA 1A3RL 3CUPA 3PGDA 4JI4B 4WSKA 2WXJA 2IADB 1NMCB 1MI5E 3ETSA 3WIHL 5BS0D 3P1VA 5C2UB 4YR6B 3E8BA 1Z9MA 3PHQB 2NZIA 3ZBMA 1KPVB 1PFCA 4RMWA 2CUIA 3NZUA 4O00A 4PVNA 5BZDA 3E3QC 3OTTA 4Y1AD 1F90L 1Q94B 3QBTB 4JM4H 4HSQA 3VI4E 5HVGB 3TT3H 5IQ7H 1E8XA 2XQYG 1NMAL 3ES6A 3PYCA 4G6KH 3VG9C 3MLRL 4Z7VB 1HAUA 4XOCA 3W82A 4YEEA 1XMOO 4HOXA 5IKCA 1FZKB 2HVKA 3AB0B 4HAKA 5K1PA 4JFVA 2YRPA 1R3LC 5JWPA 4WKZA 3HLAB 4WTXA 4NWUL 3GSNL 5I18H 4ZMPA 2WLJA 4LDLB 1F4HA 4WSJA 4LCUC 1GM9A 2B4CL 4HIJA 4MVBD 2VTFA 1DN0A 1AGCB 1IVLA 4MQ7B 3ELQA 4U3XA 3ZKXC 3EGDA 4QNPE 1CP9A 3PQYE 4K71C 4XMUA 5D8JH 4M7JH 2E3CA 4P2QE 4Y5VC 5TF0A 2MNWA 3CMGA 4Z3JA 3IJYB 2XG4B 4DV1O 3MRPA 2M1KA 1PSKH 4HEPA 4B53A 1A4KB 5TQ0L 1WV7T 4YDIL 5D4QA 2WAMA 1YRKA 4F3FA 2I9TB 1DQTA 3EDJA 4X6EB 2EKSB 1GS7A 2OMYB 1FD9A 1USZA 2WVSA 3F7VC 4RX4A 4TNEA 1G1XB 4TPRH 4FNTA 2ZZUT 4LHUG 1TCMA 2O5ZH 4QLRA 2FR4B 2CM5A 2Z35B 3OJDA 2WM0A 3F84A 3MROB 3B2UC 3SE4C 1QX1A 4M6NL 4GP8B 5DCCA 3HI1B 5HJ3B 4QF1B 1ET8A 2YPKA 3VXSA 1K3ZA 3MRGB 4YDKH 2J25A 3QCTL 2VDLL 4JO1H 5JOEA 5EIBD 1RFDL 1TO5A 2O6CA 4ZXBA 3O6FB 1IM9B 5CD3B 1U96A 4TPRL 2H3XC 2IJKA 4B6ZA 1RUKH 3CCUV 5JQGA 4PJ5A 2ENQA 1BL8A 4FQCL 2YA1A 4RBPH 2E7DA 4M6OH 3Q0HA 3CFNA 2NNFA 1E2ZA 1YF2A 4DEUA 4YSOA 4G7RB 4OJYA 4ZAKB 4CN1A 3REVA 3PAZA 2R69A 1WCBB 4JO2L 5B4MD 3UTSD 4APXA 5MEQB 4K9EH 2Q8BL 3QXAA 4G6MH 5FWQA 4OBSA 3UTSE 3HRZA 1B6DA 5DZPA 4OZHE 3PIQA 3D87B 2J72A 4N0CC 1VIWA 3X1NA 2P8PB 3RIFK 1Y6KR 3M1OA 3L72H 2ZXWB 1QNMA 2R9RB 4HBCL 3WE6B 1FDLL 4BZ1A 5ACZB 3RFZA 5FGSA 1NPUA 3EJYD 4KK5C 2GJZB 1AE6L 3DDGA 3RUGB 4XHJC 3WHXA 2O5XL 3RDJA 3QORD 3H4HA 3RDTA 1ED3B 5I66B 3KCXA 3LNGA 4BIUA 1E5AA 3TOPA 5KG9A 3K6FA 1CGYA 4YHHB 2GITB 4MD4A 1F4XL 2CJSA 3MMEA 4N85A 4YUEL 4AM0Q 3PAUA 1CDUA 1SEQL 2IXQA 2OLDA 4TQ8A 3MBED 4CVUA 1DTOA 1FDLH 1NGYB 3QW9A 3SDXA 3CXCU 4XWOD 1TZOA 3UADA 3WGVB 4Z6AT 5CFAA 4L2LA 1OCRB 4JFDE 1MCHA 4FI7A 3RNKB 4KC3B 3VQXA 3DX1A 2J5LC 4I2XB 1NIDA 1RZFL 2VITB 1Y0LB 5BVJA 2Y1AA 3MGTA 5JHLA 4CH6A 4M93C 4XTRC 1W2KT 3NIFE 5CGYC 1PLGL 2J1WA 3VFVA 4K5LA 1T5WB 5LMNO 4CH4A 1MEXL 4NO5B 4D9QE 1MOEA 3EH1A 1G7QA 1RIHH 3BRCA 5FKAA 5EEZA 3NOIA 5AW5B 2Z0UA 1WZAA 1MA1A 2FWOA 4HKZB 3VRIB 1L0LH 3RUGE 1PX4A 4KJPD 3TF4A 3N27A 5DC4B 4EJ1C 4LFCB 3E9TA 3MVSA 5I2IA 3ULUE 1LK3L 1CFNA 1FL5B 4CSSA 3MJWA 1BV8A 1R6NA 3GWOA 1A9BA 4JQXC 3VD3A 5EEVA 2NYKA 4HD9A 4YO0B 3DKHA 1NCWH 2F53D 1I8UA 3MU3A 5CILH 5D1ZA 1BOYA 4H25A 1P4LA 5GS2H 3AY4C 1JK8B 4TQFA 3QUZA 5TE6L 3RIFF 5JJNB 1RZQA 5E8PB 2QSVA 4FOMA 1E8YA 4LLMB 3TNMA 3WG7C 3K03A 1CD8A 3ARXA 4WV1B 4OKVA 3CLFL 3MAQA 25C8L 4Y2DC 4PJ8D 4Z7WF 1W6WA 2QADC 3WXWH 3FSVA 3MA9L 2QSTA 3WNJA 3NEXA 1IGTA 4X64B 3CSGA 3L4YA 3ABMC 1RD6A 5J5EA 4GRMA 5KSAD 2FATH 3KPMA 5D7JC 3EF4A 2WOBA 4YWGH 4NRZA 4Y5YC 4PD4K 1F11A 1G9HA 3K0GA 3U0TB 1F51A 1R3LB 3QDMB 4LCYB 3OR6B 1TCRB 4M03A 2Y6TE 2BOCA 4HULB 3ZJZA 5BRQA 3VXUE 1JCVA 1S9XA 5SWZD 5JNYA 3FOMB 3FQRA 4JI8O 1NIFA 1S78D 4PJCB 4RMSA 4LU5H 2YEQA 5DFTA 5I6LA 4PU2A 2CCWA 2VXQL 2XWJA 4Y4FA 2NY1B 4JKPH 2CR3A 1ZVSA 5TH2B 4QPEA 2JJTA 4D7TA 4JASA 2W80C 1KLFA 4PV8A 1AXTL 1PZBA 1KTJA 1P84K 4DR2O 4E5XA 1D6VL 1FFPB 1UQSB 1YAIA 4H8HA 5IB2A 3Q01A 5DZLA 2E5LB 3O8XC 4C56E 3RZCD 1Q6HA 4O2FA 2UXNA 5D7IB 4X6FB 4DKFH 1OY3B 1UB5A 2QGDA 4XMPL 1XQ4A 2DWDB 1GGIH 2CA4A 3I6GA 3VYPA 1R5IB 3KLDA 4X9BA 1A4JB 2JJSC 2CKBA 5I1CL 2G2PA 4KI5D 1IUZA 3IJSB 2RCSL 2Q3ZA 1YEIL 2V9TA 2ZNXA 4G6AC 3BA8A 2WXIA 3QB7C 4ONOA 5FYJE 3BKYL 3VXUB 3K80A 5IROD 2IPUK 3ETDA 2LU7A 3D05A 4DGYL 1S7XB 3TV8A 3TYFA 3VXQA 3K8MA 1KCUL 3SQOH 4FAAB 3NZSA 4DV7B 1GRWA 1Y6NR 1QSFB 4I9WE 4M7LT 1IQWL 1NCCH 2O6DA 1RZJL 1J5EB 1EGJA 1MPAL 1UM4H 5GRVK 1DQLH 4Z78A 4OGAD 4FGMA 3KHOA 4N9GA 3RWDA 1PL4A 3V0VA 4Z0XA 3NGBB 4PJIB 3C60B 1ECYA 2XNAA 4UNIA 3VGBA 2W5PA 1TZ8A 4CADA 2VRKA 4X6DA 1DQLL 3UG3A 3GB7C 4EBQL 1NAMH 4NNXA 1HWGB 3V0IA 1ES0B 3X3GL 2AGJL 3KPRD 4DZ8A 2BHFA 3KPRE 5IWAB 5F2VO 2F58H 1IRAY 1HXYB 2R9HD 3T71A 5CP7B 3ZPDA 4FM2A 2V3DA 1NGWA 4L0PB 1EAOA 4V33A 2G4EA 4ANXA 1FFXA 5LOVB 2M83A 3ZTDC 4NZRH 5DO8A 2YD3A 3B6SA 4EN3C 3T1CA 5H6QA 1YHQV 1T83C 3ATDA 3G7TA 3NCCB 5DUML 3FQYA 4K0KB 3S35H 4IJ3B 5E1IA 2GHYA 3AEIA 1Q0XH 2OYPA 1GSMA 1MPAH 3CPWU 4OLZH 4P2QA 1MHEA 4EFEA 4EVNB 3TCLB 3IN0A 2FEJA 4J12A 1UWEL 1N32B 5CEXB 1EO7A 3S4SA 4KKLD 4J3OF 2KUTA 4JM4L 4MNGB 4GG6F 1J0ZA 1P7KB 1NAMB 1J87A 1T6BX 1GKEA 1FYHB 2JE8A 3DURB 3EYFB 3FQWA 3MREA 5LG6A 5JQ6L 1SN0A 4N0FA 2JGUA 1F6LL 1X4ZA 4DR7O 2I07B 4O4LA 2ITCC 5G5DB 1U3YA 3W7WA 2FWLB 1LR1A 5IVXE 4HVBA 3N0AA 3RI5F 1A8JH 1KCSL 3BCFA 4PY8I 2A6KA 3EYOB 4R7CA 1T1ZB 3MR9A 1ZVYA 3AB0C 4KK6C 4C56A 2CJUH 3IEAA 3T77B 3V4VA 3WFZA 3RBSA 1RZKH 4TNFA 3MNZA 1CFSA 2H0JA 2EDFA 3GPEA 2DIBA 1KTRL 4GIAA 4NN6C 4GAFB 2WW8A 4MCYA 1C12B 2OMWA 4ZRGA 3OX8B 3R0MA 2ZWYA 5ETUB 4IHOA 3W2DL 1NFIB 1VGKB 3FB5B 4YXHL 2QV4A 4HALA 2HVBA 4TUYB 1GOHA 4I4TA 4PJ7E 4ZFZA 1SHSA 3RIKA 4LNUB 3VXMD 4A37A 4BK8A 4ODSH 2KH2B 1M05A 3VNYA 1K97A 5D2LE 1OCOB 3US1A 3MV9E 1CTMA 3X2QB 1OTTD 1XGTA 4NNPH 2Q5BA 4OD1L 4R7NA 5E94A 2A74B 1Q8IA 1X9QA 3OG6B 4U1IA 2JB5L 3LKSB 3CZFA 1IAOB 2VLKD 2XCMC 3WEBA 1GM8A 5D2NA 2PP8A 2AHYA 1MFVA 2X4UA 4U1MA 5C0GA 1J5CA 4L4VA 3ZYJA 3VWKB 1U3HA 3BAIA 1IBZA 5CZVL 3QCUH 2PF6A 2YAFA 1XR9A 3IDMA 3KM2A 4KJQC 4AY0A 1IAIH 2C8NA 2XOTA 4OB5L 1S9YB 1XNQO 1F8TL 4TUOB 3VFRA 2H2PD 4HUCA 2C2AA 5JCOC 2OMUA 2P52A 4IMKA 1MIEL 3X11A 4OU3A 2B2XH 43C9A 4IIJB 4B3MO 5D70L 5I26A 3NJNA 4X6DF 3ZUNC 4W4OC 2YGPA 1J1OL 3NSXA 2R8SL 1FNFA 3NH7H 3VXSE 1RUML 1IO4C 2ZM6B 4MNQB 2XN0A 1QFWH 1MFAH 1DHKA 2XZAH 3W9DB 2PYEE 2D0FA 4F7TA 2H9GB 5AZ2L 1IKFH 3OB0H 3OM3B 4PJ7A 4A1RA 1AKJB 1E4WL 4Q2ZA 1BGXL 1Y18A 5IB3B 1FFNA 3D8CA 5C9JA 2ICCA 4HXAL 5M7QA 1Z32X 5F7MC 3RNQA 1UD4A 2ZTBA 4KVPA 5JPMA 4UMSA 4U2YA 1II4E 3FSAA 1RZFH 4JFDA 4DVRL 1PQZB 4JAVA 1XOUA 3FMGL 4ZG1A 1NC4A 3FQNA 3EOAB 4FQ1H 2Y7MA 3Q7JA 1XNRB 3U82B 3WN5A 4X8JA 5EO9A 3RFZC 1TO4A 1E5YA 3BEHA 2JKJA 4QHMB 1C7SA 2V7QG 2GBVA 2H6OA 2QVFB 1JR9A 4XVJH 4HLZH 2ZIOA 1AXIB 3L3OA 2NY3D 1NDMA 3DA0A 4FXTA 3T8XA 1I1CA 1IGFL 1JSYA 2ESVA 1XREA 2XSKA 4IOSA 4MNQE 4QHKJ 5E00A 2Y48A 1XIWB 2G3MA 4D9QD 4QPKA 1W0WA 4QXTA 2VZVA 3CXDH 3C6SA 3Q8EA 4I55A 4PJAB 5J12C 3SDCA 4Z76B 1P49A 3MHHC 1KC5L 3JVGC 1DQVA 5EORL 3AK2A 4QTIH 4ELKB 5JTWA 2ZKWA 4QCIA 5CB4B 2P26A 2QQLL 3HC4H 3GBMH 5FPOA 2OZ4A 5DEZA 4TLKA 3EBAA 1JXFA 2GUZB 5CA0A 1TYRA 4HDIA 4F58L 3H42L 3SYAA 3ALXA 4UWQB 1YY9D 4PJXA 5DEGA 4FL4B 5DD1L 1HFUA 1N33O 2LAAA 4XZ4A 3P73B 3D9AL 5IVXB 5IUCA 1KTLB 3FBKA 2BH0A 1BVKA 3FT2B 3P30H 2Q4PA 3MRJA 1K7DA 4R84A 1N0XH 1CLZH 1QBLH 4KP4A 4LF7O 3B7RL 4L5FL 1TQCC 2G75B 2JELH 4JJ5A 1EAPB 5CBAA 5DM6V 4N24A 4UQBA 3GHPA 1T5XA 3ZEDA 1JI1A 1AYOA 4XN7A 1WD9A 4DJMA 5IJKC 4I0PA 1NEZB 1QA9B 1F4WL 1UUSA 3OTOO 2EDWA 3H54A 2CH8A 2R56L 4S1DD 4X6CF 3N43F 3G80A 5HHPA 2EVFA 4F1ZA 4I8DA 4MS2A 4M8VA 1BQ5A 4WFEE 2BSKA 2R2BB 2L0DA 4GRLD 4R26H 5HY9A 4GKKB 4FFKA 2UUAO 3MRNB 5BCAA 1OCWH 3EJCA 3OAYH 1UCBH 1PAMA 1QZ1A 4E4EA 3C6LA 4RAHA 3BUPA 2F1AA 3N2KB 3JWOC 3MLSH 2Y5EA 5DZAA 3TP4A 4PGDA 5FYKU 5ILTL 1PZ5A 3BH9A 2NW3B 3HS0A 1IQDA 3SDAB 3CFUA 5AB9A 3GXTA 4BBWA 2HKAA 3RGVB 3O65A 3UG5A 3VMPA 3EFFB 4LSSH 4WHTB 1J12A 3QNFA 4MX7A 3BFQG 1S9WB 1G1YA 3P2BA 1DBJH 3SDAA 4LQFL 2CUGA 5DUPH 1XEQA 4L2YA 3OEHG 4KVCL 4PJDB 2ZP8A 1E5BA 3QEQA 4H8WH 4OLWL 4NN7B 4XNXL 4LLYB 4ZSOA 3VQYA 2K3HA 3AG7A 4U6YA 4I0XB 4NUJA 1A3RH 3ARDD 1ZWIB 4UDUA 4XXWA 2WVVA 5F70A 5H5NA 2OQJB 3ROLA 4DK5A 2YI8A 2EYTB 2IF7A 4K3DL 5B3JE 4D0DA 1ORQC 4XAWH 5JA8B 1WITA 2J56A 3BIKA 3HE6B 3KYKL 3VFTB 2ETNA 4FLXA 1F90H 2A9BA 3OJVC 1VA9A 3K81A 4OFVA 2DJ4A 3L70H 4CS3A 5BR8O 1I1RA 3CC2V 4P4RB 2F7OA 4CW1B 4DN3L 1J8HE 1HCZA 2BFVL 2VMFA 1YI2V 1HEZA 3LKOA 3PWLA 5EIIB 3THMH 2P48B 2N01B 4X7TB 2E7LC 3JWNC 4ZQKB 2V8LA 3WFDH 4L4JA 2X0LA 4C4KT 5C0DA 1MXDA 5CJ5A 2F0CA 4MAYA 4CU7A 4FZ0A 1MRCL 3QEUB 3C60C 5E2JA 1N8ZB 1AD0A 3ZMUA 1BZDA 1JV2A 2BNRB 4JO8A 4KKCC 2H94A 2XKNB 3Q8AA 3H9VA 2O6FA 4HETA 2MOGA 3KYMA 1T7XA 3LEYH 1VQMV 5SV3A 3CCJV 3QUXD 4XCCL 4FFZH 4BH8B 3IFLH 3OXRB 2QDWA 4GEJA 1TLKA 8FABB 2GG1A 3ARDC 4PJXB 5KAIZ 5IHHA 5KSAC 4OZFB 3SGJA 1FXVA 3P3RA 4GKJB 1NQBA 5DVLA 2XXCB 4U3CA 3GSRA 5E99H 1UGKA 3CRRA 4XPBH 5D7LD 3ZSSA 2JJ2G 2FQFA 3L7FA 1K8DA 2OW6A 3K71A 2FRGP 2XPGA 4LSTH 4UIMA 2V2TA 3EG9B 1M7DA 1M7IB 1SN2A 2BNRE 3EGXA 3QI9C 4XWGH 2OX5B 3S8GB 2XN9D 4FQ1L 4WENB 2Q9LA 1OSPL 4NZUL 4A38A 2XXMB 1AJ7H 1CUOA 2DWEA 1XHXA 1ZMYA 5EG6C 3UTTE 2D8KA 5C0AD 5AAMA 3NSFA 4PJHB 1Y66A 2ZWKA 4YSTA 3ULUL 2DEWX 1KMGA 3BP7A 5I0YA 3ZE1F 2OJZL 1YMHB 3MRHA 5DZ9A 2WOYA 2NY1C 5FOBA 1OAKL 1SPDA 4L48A 4ATTA 1VERA 5L2KA 4UV7H 3CC7V 5C0IB 2NZ1A 3LXCA 3QDGA 4FC3E 3SCMA 3TXQA 3LS4L 1K85A 5B8CC 1YC8A 4B3TO 3QJVB 3APFA 4J3OH 4I3SH 4E42A 3U4KA 4OCRH 3CFDA 1JV5A 1NFDA 1T1YA 5T3ZL 3JV6A 5IGXH 3QJFA 2AANA 1JTTA 1FO0L 3LZPA 4QWWD 5E8EB 4PRHD 3GK8H 3VB9A 3LPPA 3FJTA 3UPAA 1ZTXL 3RYFB 5C0BD 5JUEH 4Q0XH 3OZLA 4ENZA 2NY4D 4RGOH 4JUTA 4QDGA 1EAQA 2YXLA 3KPQB 1JX9A 5I30H 3ZZSA 3MJ9H 2AXWA 4NQDB 5D55A 4PI2A 4DKTA 5FS5A 2AABL 4IKIA 3LKQA 3CPLB 3Q1EA 3CVBA 4JI8B 1ZV2A 2Q6AA 4GSDH 2HMIC 1RHHB 1WZ1H 1WAPA 4HZLA 1I1YB 1Z5WA 3HN8A 1Y6MR 5CINL 4Y5YB 1EXHA 1AYRA 2QKIB 1ORSB 4HDIB 4NO2A 3X14B 3CK0L 1KSRA 3QZBA 4LVEA 2LGNA 1J9SA 3FPXA 4UQIM 3LEXA 4DV2O 5EU6B 1XQ8A 4DUYO 3F7QA 5GRZA 4NJAH 4ETQB 4JM2A 2YJLA 3S37H 5FECA 5JXEA 2CO2A 1P4RA 1U2YA 4OZFG 3ZLQC 1JXGA 3P0GB 5DYOB 2VDNB 4LCWE 3JSNA 4H0GA 5JIQA 4O02B 3GSQB 3O4OB 5DJ2A 2KL6A 2JJUA 5I76A 4XRCA 1XH0A 5KHGA 2F4VB 4N0UA 1MF2L 2A3QA 3D50A 3NSJA 4RDBA 2BNRA 1GZQB 1JF1B 3OAZH 2OZ4H 3FOLA 1CFSB 5FPRA 1T03L 3R1GH 2HH0L 2UV3A 2QQNL 3CH1A 3OAUL 4P2OD 5EWIL 5FA4A 1K4CB 5E1HB 1YY8B 3AW5A 3UZEC 4M5YH 1KGIA 4FADA 5KSVB 1KDJA 4PG9A 3M6DA 4OF3A 4LOVA 4WCYH 4N8VA 4Y5XB 4BW9A 2EEDA 4A7VA 2A6KB 3ABTA 5E2UH 2WZAA 2V7HB 2WWNA 4UNTA 5DT1H 4NQEA 1Z9NA 2EIZA 2WWKT 1GM7A 3MLXL 5E1AA 3LZRA 1P4IL 4O4LB 2BRQA 3VQ2C 3Q05A 1IXMA 5AOIA 3N2GA 3STLC 5FUCE 2J5LB 3TASA 5BS0B 2Y36H 1KUMA 5BV7H 2DLFL 2B9BA 1DE4A 1BLIA 3PY9A 3BRDA 1BD2A 1RZ7L 2P5WD 1B06A 5DJYA 4KZDH 4UDTA 4L8SA 4V2CB 4WU5A 4IIJA 4DVRH 2ZKOA 1VZIA 3QQ4A 1JNNL 5DMYA 3C5SA 3GGWB 1DUYA 2RFXB 4N2BA 5EZYB 2VR3A 3OKYA 3BKCL 4JM0A 1KIPB 4TUJB 3DGCR 4LF5O 1Z5VA 3B77A 3C8DA 1DSYA 1JZHA 3HZKB 2H47C 4N5EC 2PP9A 3J8F7 1UM5H 1LO5A 3HG1E 1X6LA 2UXBB 2J43A 1DLHA 3BZFB 1HDJA 4QRQB 1A1OA 2FCBA 3J07A 5IMMB 3G5YB 1QHOA 3S3CB 1RERA 5CJXC 1N70A 3US9A 3F85A 4FTVA 4CADB 4JI1O 1QI5A 1FGVH 2VJ0A 1AQHA 4UTAH 1XGTB 4R7NB 1NCDL 2TAAA 5GS1A 2C3GA 2ZOWA 3ZL2A 1WGVA 5HYQA 2W9LA 4JDVB 4ZTPH 5CBEB 1VHPA 4YHML 3KJ6L 3I50L 4ES9A 1IT9L 1C8QA 3D34A 5DLLA 2AC0A 1JZ7A 1LNQA 1DVXA 3T6QC 4XBGB 1HILA 2VSCA 5EBWB 2DBLL 1YY9C 3ASOB 2CBTA 4DO6A 3IFNH 1MWAH 5CZXD 5MERA 4G43A 1BXXA 4C54A 3DRTA 1EVTC 3HKCB 2A9MH 2PW1A 3FTYA 4X7FC 5KAQG 4AZ8A 3FN3A 2NR5A 1MHHB 3QNYA 2LU5A 3LV3B 3ZCCA 5J1AB 2WLHA 3B7YA 5EK0A 2Y24A 3GNML 4FDWA 3T6VA 2ADGB 4PBDA 3AU0A 1F42A 3I74A 1KTKE 3AXIA 1EIBA 3L3IA 3BY6A 3H6JA 2AJZA 3CHQA 4ONHB 1H6FA 1IAKA 3HE6C 3B2PA 5I1IH 4XBMA 5CEZE 1NZRA 3DIFB 5CR8A 1DBBH 4TTGA 3Q5TA 3HR5B 4ZOEA 5AWNL 5IB2B 3JAWB 3GBNH 4NKIL 1CE1L 4HGKC 3TCTA 2VGLM 3BT2H 3EJJX 3ZUCA 3ZT6A 4CC4A 3S9DB 4GRLC 4P5TA 2XZQL 3UOAB 1UURA 3WNIA 4HLEA 1P7KA 5AVZB 4LF3A 1GMEA 1HSBB 1NBZA 3L5JA 4KKNA 5HHNA 2QWOB 2P22C 1JPTH 1GN2A 1I7TA 2Q0ZX 4QOKD 4U3SB 4UT9L 2CK3G 1FC1A 1OAUL 3MLSL 5IK3A 2DMKA 4JYBA 4X62B 2CK0L 4ZMVA 1RJLB 2Q10A 1KXHA 1X9LA 4JKKA 4YDLB 1UCBL 2PY5A 4CC0A 1Y6XA 3QI9B 2W8CA 1SQGA 1MG2C 1S2EA 2N3JA 1NANH 1I7UA 3MJ8B 4B9FA 4PV9A 3IVKB 1T1WA 4FPPA 2R0WH 4UCOA 1JUFB 2FWSA 4UQAA 2B3IA 1A6PA 1H9VA 4YHMH 3BQUA 3HMWL 3QXVA 4DK1A 5TDOB 3N0PB 4LF9B 2Y7QA 1AR2A 1UZ6E 2MHAB 1FBIH 3B37A 1TPXC 2GC7C 1HQ4B 1NH2B 1GN6A 1XBDA 3ARDB 4PJGE 4XI5D 3TNNA 1LMKA 5LBSL 3IMSA 3FB8B 3ASNC 3MRBA 4M6AA 3VD0A 3ZQXA 2AQQA 5FYLE 3HZYA 2VDLH 4JO1L 4JFXA 3JUZA 2DQTL 5T1DH 3AJ7A 5C92A 1NBYA 4LFBO 2F74A 2O72A 1K5WA 1CDIA 2C9AA 1RUKL 3W1ZA 5JXAH 1FL5A 4P9ML 3AM8A 2CDYA 2GSIA 4N2FA 2UU9O 3R19A 3CXHK 3X11B 3GMOA 4AILC 2E4FA 3J27A 2YXYA 1CDHA 5AL0A 3GBDA 1SZXA 3NRQA 3REWA 1DUYB 4GXUN 4FLVA 3LSUA 2DQCH 4ZPTB 1PSKL 5LWYH 4M1DH 2VR4A 4HK0A 2ITDC 1H2LA 5JW4R 4BA8A 1TEGA 2X0VA 4RDQG 4X6FA 3UKMA 1QWHA 5BVJB 1A66A 1QYGH 3LN9A 4TTDC 5HYJA 4R4FL 1IBMB 2O30A 1U4FA 1DTUA 1VDGA 1G7HB 1VF5C 5BV7C 5IVZB 1VQ5V 4HLZG 4XNAA 5E6IA 3IMUA 4DRXA 5LCVH 4K7FA 3QUMA 2V2WA 1UB6A 1SC5B 4Q4EA 3U30B 1ZHNA 2L8AA 3A4DA 3AWGA 2CE6A 5F88A 2R2HA 3LEVL 4POZC 4BD4A 3RTLA 4OR1A 3SE8H 2X6UA 3WLWD 4GX1A 2VUYA 3QDMA 4LCYA 3RA7L 3QC5X 2D2OA 2GBAA 2Q76A 2IOOA 3TTSA 1H8SA 4B27A 1FVCA 4ZIBA 2NQDA 5I1HL 2GB2A 4B96A 3BD4A 3T1HO 2A73B 2YAOA 5JPNA 4Y89A 1GO3F 3DBSA 3DRQA 4F5CA 1AIFA 1F3JA 3MZTA 1N4CA 4KL1A 3MYJA 3X1FA 5A2KH 4KK8C 1KG0A 2ARJQ 4GIPD 3JD4A 3P69A 2IH1A 4JZNA 2VCOA 5D1ZC 3P0VH 2DJSA 3RQ3A 1RJLA 4DPRA 3ILQC 1JNLL 5IV2B 2YZ1A 1GZPB 4YAQA 3QUHA 3DOIA 1F13A 5L3DA 5HJGA 3FAVB 4DEPC 2B39A 3D36C 2VOTA 3HMXA 5CD3A 3D85D 1T7WA 4NUGH 4TV3A 4ODWB 3LDBC 4I0KA 1SFHA 4ZFGL 3MTRA 3PS6A 4X9YA 3QIUD 3JAWA 3VXSB 4E36A 4JFEE 4GX2A 2OSLB 4RFOL 1WD8A 2BX5A 3MJ9L 4RMRA 1QLEB 5FV2A 1URZA 2JKWA 2WINA 2XZZA 4IRSA 1U8QB 2EUVA 3QF7A 3SKJL 2EE0A 2GIYA 5FFGA 2JKRM 5ADOL 4I7ZC 5I0ZA 1JZFA 3L4ZA 4FNUA 4FFYA 5CIPB 4B9CA 3LKQB 3LXAA 4LF8O 4HU2A 3P9LB 3QJXA 4UINL 1NKGA 3CFQA 2VNCA 1KCRL 1UOLA 4MXVF 1UFGA 1NIBA 2DJMA 2V5SA 1NGYA 3AT8A 3CFKB 3PWJA 3UCQA 4KTEH 1IKNC 1U4EA 3MJ7A 3I9AA 5KSUA 5DEFA 1OANA 5E8OA 4WDIB 4HUXB 1FHNA 3VDCA 3WL9B 1H3WM 1P69B 3QDGB 4FA7B 2DTSA 2FLBT 4XNUH 2NNUA 3APQA 5IQMA 4ZOAA 1BS3A 4QRUB 3UZVA 1ACXA 1JV5B 1NFDB 1CGXA 1T66D 4LLWB 5DXWA 3VXQB 4C58B 5ACZA 5HHQB 3RFZB 1ZXQA 1A6ZA 1F02I 4JY5L 1QTPA 2APVA 2Y07L 3C09B 2ZKXA 3GEWB 1Y76A 4Z1MG 4L29A 1VQPV 3ES6B 1FE8L 4ZMAT 2C9RA 3DSFH 1ZK5A 4QOKA 3WIHA 2A9NH 1AMXA 2AXFA 2EICA 4ORGB 3KMDA 4YBLB 5CN0A 4XGZB 1M1SA 5B1KA 1GCYA 4JY5H 1ZANL 3BP7B 1GGCH 2Y2TA 4M61A 2OXGB 3HFMH 4UFZA 4JG0L 4P2OC 1A32A 4KTEL 4Y88A 3BE1H 4PS4L 3V8OA 5FNVA 4JFHE 1BZ9B 3I6KB 4PJHA 1I31A 5KVFH 3N41F 3NK4A 4AM0A 3SPGA 2YICA 3C5SB 3GGWA 5ICYA 1GTNA 4X5LA 4WKXA 4J8RB 1NFDE 5HHMD 3STZC 5D2LB 3EG9A 3ZKNC 3QXUA 4K55A 4S1RL 4RISL 4NKGB 4JZOB 3O3EA 1FPTH 3FU9A 4UM9D 1RULH 4BSVA 2HN7A 3GLEA 3B2UD 3UIZA 2GVYA 1KELH 4AGOA 1TJGL 5JNYB 1G0DA 2AMGA 1QSVA 3CRQA 5HGHB 2WWWA 1DYZA 4XC1H 2MPVA 4R83A 3VFSB 4UTBH 4OZIE 4QGTA 3T04D 5GQBA 4GRMB 3PCYA 5L4IA 1I8IB 3L5WB 3HPLC 4HYOA 4FX5A 4PMEA 5AW8B 1KYAA 4UU9B 4LF5B 5AVVB 3W39B 1NTDA 3MJ6A 3L2MA 3F05A 3UDWC 3IDXH 1S7SA 3UYOD 35C8H 3NZ8B 4N0UB 2B9AA 1QLEC 3BKYH 4FKEA 1LDSA 4L37A 4CC6A 2P24B 1C16B 2W0FC 1INDH 2NUTA 4F9LA 2VLJE 3KH3A 1MW0A 4BDVB 1FNLA 5D6DA 3PL6C 1YJNV 4ZTPL 3EBHA 1F6AA 4PIRF 2IH8A 2WBJB 2Q86B 5E6IC 5DYOA 3BGAA 1JZ8A 1A5FH 1YYML 3VFTA 3SR2C 4MT8A 2JGDB 3ZHRA 1CYWA 2O26U 2J4WH 1CFNB 4UB0H 3RA7H 5KHJA 1L9OA 2ENYA 3PDGA 2X41A 3W57A 3EKCA 4ZFFA 4UB6Z 3OR7A 4AE1A 4B60A 2YIDA 3QUZC 1EHKB 3BRFA 3C87A 3RVZA 3EUDA 1N6VA 3S5LA 1BD2D 4KKQA 2WQWA 4NO5A 3VFVB 2HJDA 3PPEA 4M43H 4TQHA 3TIDA 3CSFA 4PRBA 3N40F 2X2IA 4QRRB 5D2LF 3CPLA 3LNHA 4R4FH 4JPWH 2IWEA 1FRGL 4ASUG 3VO0A 1N0JA 4L4TE 5KSBE 5DJXA 4L4VE 4OCWH 1SFDA 3W7SA 1G4YB 1CWVA 3CAFA 3B9EA 3AGWA 3QHFL 4I1RA 4LBEA 5IBLC 4P5SA 3LKRA 1F6AB 1YMME 2Y69C 2XIBA 4X1IA 1AILA 1KB9K 3MV8D 3QZMA 2WLIB 1KJMB 3U30C 1DBBL 3FQ4A 2MOQA 5DEJA 3CFKA 4WI4A 4MAZA 3WE6A 2V37A 3NIGB 3VGGA 1G6RA 3TPKA 4PHZA 4EIBA 2CHZA 5LWYL 1YEJL 4OD3H 3OXSA 4QRPB 3DX2A 1CCZA 4L3FA 3L8QA 5GGTA 3EH4B 3MLUH 4IMKC 1F7YA 1I8MB 4PYHA 1GZHC 3BVVA 4JTAB 1HINH 2BC4A 2HFEB 4HJSA 3SDXE 4C83B 3U11A 5BJTB 3RBZA 3SPJA 3QXTA 5I75C 2GAZA 3LKPA 3ZKSD 3P4OB 3NJJA 5E8NB 2IGFL 4OV5B 5LNDA 1UD5A 1NCHA 3FTVA 3VI3E 1YEDB 3RU8H 4MJ6A 3TCUA 2UXDO 3J2PA 5E4AA 4X50A 4IBVA 2NTFB 5ES4B 3PLYA 1H3VA 3MV7E 2EINB 1ZDSA 5C8YA 2HJLB 4N25A 3ESUF 4HV8B 3WB0A 4NQSA 1IIIA 2V2TB 4I77H 1VRSA 3RI5K 3AM8C 1TJIH 5T33H 3NFSL 1IAMA 1U8HB 3ETEA 1Q9KB 1FFQA 3L5XH 3QS3A 4U1LB 5GJTL 3V0WL 1XF2A 1CXIA 1GY1A 3DDFA 3AAZB 3FO2B 4OW6A 4N0RA 3O45B 1IM3D 3UTQB 3DGGA 3BZDA 4NHUA 4AL8C 8PAZA 2IH1B 3F6LA 4JZNB 1J5OL 1HP8A 3HUJB 4RO2A 4BIZA 4ZKIA 1FQ9C 1I7ZA 1S7SB 3FQXA 3MQIA 2FBRA 4MMYB 3NR7A 4MSWA 5CXPA 2W6IG 5DHXB 4F15B 3K6SA 1DQQB 2EDXA 4KROD 2WNKA 4G9DA 3CQQA 5IF0A 2X6VA 2OM5A 3H4FA 4YJZL 4CVXB 1YN6A 2JLLA 1KTDB 1PEZA 3O8XD 1X5KA 1S9VB 4ZAKD 4ODUA 4JY6B 4BQ9A 5IFAH 1EHAA 5JJJB 2XG4A 1ITCA 3M07A 4X8JB 3GHEL 2CTPA 1S0VA 5GGTL 3SDCC 4MS6A 4KZCA 4MQ7A 4X1IB 4ZXBD 5CCHE 4B9IA 3IC7A 2ZYIA 1J5OH 4X6BB 1J1OH 4M6ML 3HUJE 4L5FE 4B7LA 6PCYA 4HZ3A 3PAYA 3TEXA 1Y18B 4HNAB 1RIVH 3X1EA 1MAMH 2V33A 4NM4L 4N1HB 4XCFH 4GKJO 1KEGL 3IS0X 3SKNB 3UTPE 2EC9U 3F3HA 2AQSA 2EXWD 5I15L 1XMQB 4AE0A 1IAIL 3ATAA 4MNQA 4NUJB 5EU6E 4LB8A 1ZV5A 3FO9A 3V5KA 2YQGA 2BJML 1F5WA 2ITCA 1Q90A 2GPZA 4I85A 3TIDB 4BRJA 3OHXC 5TGBA 5JOFB 4CVZA 1B4LA 2OXGA 1EDYA 3BAKA 4PP2A 5DMIH 1N19A 2IDTA 1WWWX 3W11D 3EJZC 4QIRA 2Y5TB 1K2DB 4X66B 2A0LC 4UZUA 1XMEB 3D08A 1XCQA 2X4UB 3CDFA 1ZA3B 3F83A 5C0GB 1RZ8B 4ZI7A 3GJEA 4P23D 4QAMB 5L3BA 3ARQA 2A6DA 3HS0B 2NW3A 1Q86W 3QQXA 1Z6JT 4O02H 2VWEC 4LLWA 3OKNB 2DM2A 4PJDF 1FHGA 4MJIB 2OPCA 1PD0A 1F4YH 1J11A 3C6LB 4W9LC 4PJIF 5C0CD 1UHVA 3FU5A 4KTYA 4WWID 5F1SA 3M1BB 1W72H 3GXDA 4DO4A 4NUGL 1BXVA 1WRFA 3GMQB 4LFCO 1VEWA 4HWBA 3ZN1A 3MOAL 5D71L 5HY9B 3PFQA 3MBWB 1UM5L 4A7GF 4RMBA 5CN2A 1J95A 2Y06L 3QDHA 3QJRB 5JDJA 3KVPA 1RJZA 1E8ZA 4KI5F 3VXME 1XGYH 5ETUA 2FIKB 1GTFA 1QFPA 1OCRC 3L4TA 2YRBA 4WFHE 4CSTA 1HKLL 4XNBA 5JHDB 4QR7A 2WINB 3EO1B 2AXGB 4LPVA 3TO4B 1J10A 1FNEA 5H2FZ 5IEKA 4J10A 1KCWA 2NY5H 3FFCB 4MXVE 4DV2B 5IZ7A 4TSFG 5KAQF 5C09B 1HZHH 3NABL 4J6IA 1T1ZA 3MR9B 4WWOA 2EXYD 3P4LA 3V6OE 1ZKAA 1JFQH 3EADA 4Y4HD 1N34B 2UUCO 3QUMB 5LGTA 1BMZA 2LJ2A 4IGBD 5GS2D 2DM7A 1VKXA 2OZ4L 3IFPA 3HBGA 4N2MA 1Z2KA 1JK9A 4M29A 4XNUL 4OSUL 1CR9H 5LGUA 1IC4L 5INDB 3G6EV 1G7HA 4H1LH 3VVVA 1GJUA 2CRYA 3F12A 2QGCA 3QJZA 4NRYA 4YHPB 2Q67A 1DLBA 5ACMA 3ABKC 5ANME 3ILQD 1CR9L 1IC4H 4UZSA 3NEOA 5DJDA 1W0WB 1IAKB 4QRBA 1NMBH 1X7QB 2EACA 1SY6H 5D72L 2VIRB 3V4PH 2FBOJ 2ZCZA 5A2BA 1TTCA 3ZE0F 4YDNA 4X88A 1MJ8L 2XPYA 3D25A 4JYYA 2YMXL 3MRKA 2ZQKA 4ZPTA 4AQAB 2PYED 5FDWA 5JW4N 3HNSH 4UI2A 1T04B 2ZKYA 1BYOA 4I87A 1NKDA 1EZVY 1XF3A 1HVXA 2NDFA 3BKJL 1F1AA 4WVRA 3SDYL 4R7DB 5ESVB 5K39B 3WN5B 3D69A 3MRMB 4JM2F 1TVKB 2JS3A 2PW2A 5IYZA 3SGDH 4W9HC 3UZVB 2BY0A 2EADA 4HJTA 3JYBA 3RWDB 4AV5A 1N3NA 5GGVY 5I1DB 4Z77A 3T4AB 3QO5A 3HNSL 5EPMB 4QHNA 1IGYB 4F7CB 4M3KB 1MCLA 3WL9A 4K8RL 1ZTMA 1VF6A 4QHLA 5FYJD 4PRPA 4FTDA