2OCCB

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 67
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2occB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2occB02
3PCYA 2DWSA 2I7SA 5I5JA 1IBZA 4PCYA 2XU9A 1GYCA 4F2EA 3OMIB 3WKPA 1FWXA 2PPFA 4G7RB 4BWTA 2B08A 2DYRB 1PY0A 2LLNA 5D4IA 4E9WA 3NSCA 3UGEA 2YAMA 4AKQA 2EIMB 4GY4A 4YSDA 1ID2A 5E9NA 3G5WA 1JZEA 2FWLB 3FSWA 2ZONA 1JZIA 1TU2A 5D4JA 2XVBA 1R1CA 4X4KA 1V10A 4A67A 2YAFA 2IDFA 5A7EA 1ZIAA 3BVDB 1PAZA 3ABGA 4HIPA 2YEVB 1AANA 2XWZA 3CVBA 3D12B 3NYKA 2BP0A 3U25A 1PCSA 3PAVA 1NTDA 1ET8A 1WS8A 2VW4A 3EHBB 1MDAA 2FT6A 1KBWA 1N68A 1E30A 4YL4A 2DY2A 2GC7C 2EIKB 2IWFA 1BAWA 1JERA 4WTQA 4EF3A 5B1KA 3QJQB 1W6LA 1NWOA 2PLTA 3V9EA 1RKRA 1AAJA 1WS7A 1J9SA 2HX7A 1J9TA 1MG3C 3AW5A 3CDZA 1BXAA 2NRDA 4DP5X 2HX9A 2HZHA 3T71A 1URIA 3NT0A 4HZ1A 5TK4A 3QJUB 2QPDB 2OCCB 1AG0A 2PCYA 1CUOA 1I53A 1NIDA 3FU7B 1KYAA 2P80D 2P80A 1SHWA 2WO3B 5PAZA 3ASOB 3QJRB 2HRHA 4BWUA 2J55A 1A8ZA 1RZPA 3GXUB 4GXFA 3WKQA 1AZBA 1WA0X 3NJNA 1BXUA 2YAQA 4G71B 4E9QA 3WI9A 4E9XA 1FA4A 5I6PA 3S8GB 1J5CA 3HB3B 1GY1A 3NJLA 4YSPA 1M57B 1TEGA 3FSAA 4KOBA 4AKPA 1GS8A 1W6WA 1BQ5A 4NAJA 2XXFA 4DP6X 1AACA 1AS7A 3OMAB 5F7AA 2VW6A 1GR7A 4MFHA 3T6ZA 3PAZA 4N8UA 2BP0B 1ZIBA 3PAUA 3UAEA 1NPNA 2Q5BA 1WAEA 1AQ8A 1VLXA 4DPCX 4CSPA 1A3ZA 2DWTA 2CUAA 1MG2C 1OE3A 2R7EB 3QJTB 3CVCA 3H4HA 3SBQA 3WNJA 2UXGA 1F56A 1MZZA 3GDCA 4YSOA 2VW7A 5AFAA 2PCFA 3ZBMA 2EILB 4A2DA 2IWKA 5B1AB 3AG3B 3AG2B 4YVNA 1E67A 3DTUB 1RZQA 2PP7A 1JVOA 2PPEA 1SF3A 2YARA 4GP8B 1ZDQA 4ENZA 1IKOP 2Y69B 2B3IA 2RACA 2Q9OA 1CURA 2JFCA 4N4YB 1QLEB 1PMYA 1EHKB 5B3SB 1SJMA 1CYXA 3FPYA 3QJSB 1NIBA 4A2GA 5FC9A 3UABA 1HAUA 2HLEB 4YSUA 3X1BA 3IEAA 2QDWA 1X9RA 3S8FB 4E9YA 3AZUA 4E9TA 1JZFA 3AY2A 1ET5A 3EH5B 4NERA 4M3HA 3IN0A 3T6WA 1SDDA 2XV3A 2UXFA 3WG7B 1ZDSA 1J5DA 8PAZA 3T6XA 1JXGA 2VSKB 1GSKA 2GHZA 2FQFA 4YSCA 2EINB 4DPBX 1L9PA 3OMNB 2YAEA 3WIAA 4A66A 7PCYA 2DV6A 3CVDA 1M9WA 2YXWA 3ABMB 2IDTA 1KBVA 4AX3A 1J9RA 3GYRA 2XXGA 4Q8BA 2YAPA 2IDQA 2YAHA 4YVUA 2ZXWB 5ANHA 1IUZA 1AZUA 3QPKA 3QQXA 3IBOA 1PLBA 3DKHA 1A4CA 4QLWA 1A4BA 5LDUA 1X9UA 4K9JA 1MZYA 2R7EA 4YSRA 1A4AA 4DP1X 2FT8A 4W1TA 1E65A 2GIMA 2IDUA 1AZCA 3ABLB 5I6OA 4HCFA 3N2JA 1AIZA 3NJHA 4E9VA 2J5WA 2PPCA 5I26A 2BWDA 2H5UA 2BZ7A 3ASNB 1KCBA 4BDVB 2BZCA 1GW0A 3FSZA 5AZUA 5B1BB 1KGYE 2FNWA 4UANA 4M4RB 2YQBA 2IWEA 1BQRA 1ETJA 1ASOA 1PNCA 2VM3A 2AFNA 1OCRB 5B7EA 3T9WA 5I5MA 2UXVA 3X1FA 1B3IA 4BK5C 3EH4B 2PPAA 2PPDA 2FQGA 3HEIB 2VSMB 3KW8A 3TA4D 2OV0A 1PZBA 1PZAA 3NJIA 4W9ZA 4HAKA 3JT2A 1ZPUA 5B7FA 1XMEB 1T5KA 1OCZB 4RH4A 2QPEB 1PF3A 1SHXA 1XB8A 3FU8A 3MX0B 1SF5A 2VM4A 3NJGA 3ZDWA 3PLYA 3CDZB 2MTAA 3SQRA 4G7QB 4DP9X 1FFTB 2JXMA 3OD3A 4HHGA 1HAWA 2A3TA 1PLAA 1IBYA 4G70B 4TXVB 1BXVA 2W88A 3DIVA 2BW5A 2TSAA 3FQYA 2IH9A 4HCGA 4KO6A 2FQEA 2VN3A 4QKTA 3CZUB 2UXTA 5I5IA 1KDIA 3PXLA 7PAZA 3QJVB 3SBPA 2CBPA 1A65A 4BDVA 3NJMA 1GS6X 2CAKA 4A2FA 4AZUA 3TU6A 2OJ1A 4JHVA 1V55B 3FT0A 3NSYA 1OF0A 2BO0A 1UATA 1SFHA 2I7OA 3FYEB 2BP8B 3FQ2A 4GP5B 4AKOA 1M56B 1QNIA 4NB7A 2GBAA 4P5SA 4YSTA 3NJFA 4AI7A 2HRGA 3TASA 2YXVA 4UAHA 1PZCA 1N70A 2AANA 3BQVA 3UACA 1AZNA 1L9RA 4KNTA 4WKXA 3T6VA 5B7MA 4JHUA 4HHWA 4BXSV 1BYPA 3ZX1A 1AOZA 3CG8A 2FT7A 2XUWA 2I85A 2IDSA 1KCWA 4DP4X 4F2FA 3UAAA 2GC4C 3FSVA 2PP8A 3S3CB 1XB3A 4KNSA 1BQKA 3ERXA 2BW4A 1ILUA 1L9SA 2CALA 1NICA 1JXFA 4HCIA 3N55A 5I6NA 9PCYA 1ILSA 1WA1X 2J56A 3IE9A 6PAZA 1OE1A 4BWWA 3X1GA 2CJ3A 1KDJA 2AZUA 3PPSA 2HXAA 3JTBA 4G72B 1SNRA 3WNIA 2DYSB 4A2HA 1TEFA 3FU7A 4G7SB 2MRYA 1JOIA 2Y1AA 2H3XC 3MBWB 1EZLA 1ZV2A 4KNUA 2FQDA 4L0PB 3FQ1A 5I28A 1L9QA 1OCOB 5B1JA 2BHFA 4E9RA 3KW7A 1CYWA 3AG4B 3X1NA 2XX0A 5I6MA 2GB2A 2WSDA 2ZWNA 2TSBA 5B1JC 1NPJA 3S3DB 2GI0A 2YAOA 6PCYA 1SFDA 2X87A 2XLLA 2JKWA 1SDDB 4A68A 2IH8A 3RYMA 4FAAB 1J9QA 3NSFA 4YSQA 1RCYA 4Q89A 1NDTA 3NJJA 3X1EA 2ZOOA 4GP4B 1AS6A 4GYBA 3NP3A 4CSZA 5AKRA 1WA2X 3FPXA 4A2EA 3FS9A 5IY5B 2QT6A 4FA7B 2W8CA 1V54B 1NIAA 4DP7X 4P5RA 1IC0A 4YSSA 1ET7A 2XX1A 1OCCB 2XV0A 3FU9A 1KV7A 3ZIYA 2UX6A 4YSEA 4PAZA 3IN2A 2HX8A 2AZAA 4HALA 2H47C 4KOCA 2IAAC 1TKWA 1GS7A 4YSAA 4JKNA 5TK2A 3S3BB 4E9SA 4DP8X 1L9OA 3FYIB 4DPAX 4UF7C 3TBCA 2E86A 1NZRA 1NIEA 1E5YA 3EH3B 1DZ0A 2CCWA 3NJKA 3TBBA 1AZRA 4KO5A 3SBRA 2BWIA 4DP0X 3OQRA 1BEXA 1HFUA 1NINA 1E5ZA 3ABKB 3NSDA 1AS8A 1OE2A 1JVLA 3OM3B 2EIJB 1JXDA 2AVFA 3H4FA 1NWPA 4F7KA 1GY2A 5I6KA 1ASPA 1JZJA 5D4HA 2QDVA 3NP4A 3C75A 3AG1B 2GSMB 4KO7A 3UADA 1OV8A 4DP2X 3V9CA 3X2QB 1PLCA 5PCYA 1W8EA 1QHQA 1NIFA 5I6LA 2FJSA 1ADWA 4BXVA 3EF4A 5F7BA 2UX7A 1CC3A 2BP8A 4ZK8A 1BYOA 1XB6A 2X88A 1JZGA 2FTAA 1AG6A 2N0MA 1L9TA 2XV2A 2VMJA 1DYZA 2PP9A 2WO2B 5EHFA 4KO9A 1JZHA 1PNDA 2J57A 1AR1B 1YLBB 3L45A 2XYBA 1OOWA 3H56A 1ASQA
chains in the Genus database with same CATH superfamily
3PREA 2WLLB 3FN0L 5KYYA 2UUDK 4QPJA 1X4TA 5LN8A 5AALA 4ZW6A 4WEUD 4JFDD 2WQ8A 5ADPH 3WKPA 5J57B 2XWCA 3KVPA 3WY2A 2B5UA 3CCMV 4EBQL 1JVMA 1MFEL 2CTQA 1P4IH 2B08A 3QUMA 2EH7H 3RKPA 2EUZA 4IKKA 4TUKH 2OMVB 5CR8A 3K80A 5IY5C 5K93A 1LO2L 3D5OF 5D1ZD 5CN0A 1KJMB 1NMCC 1TA8A 5F3HB 4F15B 1RULH 3E2EA 3TNMB 3QG7L 4FG6D 3SDYH 1CGXA 1PY9A 4UXNA 4TRPL 4OUUB 3K1DA 3KJ6L 5B39G 1OL0A 4LPXA 4P2AA 3W38A 5A7EA 3VFTB 4QRTB 2FBOJ 1TZOA 2CBTA 3LYRA 4RSVA 5AAWC 5BVJA 1K5QA 1AANA 2XWZA 3OTOO 2XSKA 3CVBA 3DOSA 1U8JB 1Y18A 4HDIA 2OL3B 4W4OA 5BOZG 2Y7MA 1OAYL 1G9EA 2J21A 4ZUSB 3G80A 4UBDC 5B3SC 3H0TB 5E8DL 4QT5A 4BFEA 1AKJA 2BSSB 3B9DA 4BH7A 5DRNB 4WVRA 1E27B 3WAKA 4YY3B 1YAIA 2ZF8A 4JFVA 3RWEB 3PQYA 3L7EB 5J13C 1IAIL 4MD4A 4N6RB 1NWOA 3Q0HA 3QHFL 4ZFOB 1TLMA 2YXLA 3L5XL 2XWRA 1YHQV 2Y9RT 3BDXA 4Y9FA 3TPUB 4YPJA 3VRJA 5C9JB 4A7VA 4G8IB 1IU1A 4NM8L 4K8RC 3DWTA 2NXYB 4Y19B 4HX1A 3DMMC 3M46A 4UTBA 5FR3A 3FU7B 1I1CA 2WP3O 4BFRA 4LFAO 2A6JB 4MB3A 3FONA 1H15B 4PJAF 4K8ZA 1HC1A 4X0KA 5LOVB 1NCBH 3P30H 1JPEA 3CH8A 1PKQB 3ASOB 2CBOA 2AVGA 1HH6A 1B0RB 4AYSA 3Q7JA 1T0OA 1JUFA 3IPEA 1TAEA 1AGEB 1TYRA 1WA0X 2FBJL 3ET9F 4O2CB 5C0RL 4G71B 5CJ5A 1LEKA 4HXBL 1K72A 4RETB 4E9XA 1FA4A 3HB3B 2P48B 4XN4A 2ATKB 3MXVL 1U9KA 4LQFL 4M6AA 5DMGC 3ARPA 2M8XA 4XX5A 4KI5F 1T03H 1ZKAA 2A0LC 4NLAA 4U2ZA 1GN4A 4XX1G 1FJGB 3IVKA 4GUQA 4YH6A 2J7LA 4QAMB 1G6RA 4BYHA 1KMIZ 3ML0A 1UD6A 3IFNH 1EJOL 4ZW8A 3T4ZA 2UWEB 2X0WA 1M7DA 3GMLA 3ETSA 5A3ID 3T3PF 3IMUA 4GSDL 5HI5D 4ZZFA 1CLOH 1SRYA 1IURA 1CTMA 2VDPB 4MJIA 5TH2A 1BHAA 3RIFK 3FN3A 1C8PA 3FBQA 2MIZA 4CSPA 1B4LA 3L95A 2CUAA 1JGUL 3ARDC 1D2OA 2DS4A 2OTUA 4K3EL 1GIGH 5L8LB 3WNJA 5EU5A 1JNLL 1RUKL 2Z31D 5JIDA 5AYTA 4P59L 1S4IA 4MZIA 2EILB 1Q9WA 4KDVA 4QHKJ 2APTA 3CVHL 3KPMA 4DEPB 4IYIA 1Y76A 3BQUD 5I1DB 2E7MA 3BA8A 2BIMA 2ZG2A 3HNTL 3ZE2F 4G83A 1JVKA 1YZBA 4PUBH 1IILE 1SJHB 3L3KB 3BAYA 3P4LA 4MMZA 4AXWA 1B9KA 4YE4L 3Q8BA 4QRBA 3WN6A 3GO1H 1DE4A 1SQBH 4L4TE 3VM5A 1F6LL 1T1ZB 2J8UE 1LK2A 5C0EB 4IRZL 2A7WA 2Y6SC 4FG2A 1L0YA 3JVGA 3IEAA 4H5SA 5H9CA 1K8AW 2JTDA 4ZT1A 2PYLA 2AQQA 2EYRB 1XL4A 2X2JA 3NIFB 3WOVA 2QLYA 1HHIB 3BYTA 2RTTA 2XZQL 4XI5C 1MJ8H 5GPRA 1CFSA 1YYMH 2X28A 3M7FB 2A77H 3MLVL 2E9WA 1IBKO 5KAQF 1X3DA 2A9AA 4I7ZC 2IH1B 5HVWA 2IW5A 2BS8A 3GD1C 4LP4A 4KHPB 4GFXA 4PJEB 5KTEH 4GG6F 3AFLA 3W0WB 4D0DA 3MYJB 3T6XA 1A1MA 2HLAA 4AENB 2FQFA 4QXUH 2J8UA 3FRPB 4NQVA 2VZTA 4DQAA 1NMBH 4EZJA 5LAXA 5E8DH 2NY1D 2FEJA 3QISA 1AGFB 4HLZH 2V2TA 4Z0BL 3T0WA 3BKYL 3CVDA 1GM7A 4WV1A 4GSUA 1Q1PA 3HKBB 3GSOA 4U3XA 2Z4QA 2FYVA 1Z5VA 2XTJE 4UB6Z 1FSKB 4KPHH 2IDQA 2W95A 3K2KA 2ZXWB 2AHZA 3QO0B 1KIUA 1RIVL 5FNVB 2V9UA 1HXMB 2JIXA 1YJWV 3FQ4A 1RJZA 2Z64C 3BI9X 4YPGB 1I7FA 3GBDA 1IBFA 3JD2A 4J3OH 3KS0J 1OW0C 2X7RB 4XVUD 4DP1X 2YRLA 3TFBA 1DQDL 4G5ZH 3QG6B 5KSAB 3CC5B 4AM0A 5BY1A 5HGAB 1AIZA 3TYGL 5L4FA 3RWDA 4XH2B 2XN2A 1KWKA 1GN2A 2BWDA 1N67A 2TRYA 5JPMB 1N6QH 2ZSVA 4MJ2A 5CR1A 1GSMA 5J2TB 5K1XA 2QKIB 4HAGA 2A6IB 1BZEA 3FCBA 4P23D 5EYPB 2ITDA 1PD3A 2WNWA 3C6LD 4M8QA 4UANA 4M4RB 3RBGA 3V5KB 5AAPA 3EOTL 3KLHC 1SYSA 1QW8A 3BKCH 3PIQA 1V55C 2APXA 4K8RD 2AJXH 2Q7NA 1OB0A 2Y2WA 5I24A 1AIFB 1F5WA 4QNPE 3ZL4H 1FFNB 5C0CD 3E6HB 3MMEA 1P6AB 1EO7A 2PPAA 2FQGA 5IP4A 5KW9H 1TKWB 1PZAA 2J71A 4WI4A 5E7BA 4PDLA 2WBKA 4HPYL 1XMQO 1A7NL 3Q4HA 1TPXB 2XOKG 3O11B 5I17A 2I60H 3BZFA 4I5BB 4TLTA 3TVMD 2X12A 2Q2EB 5DR5L 2F7QA 4NEHB 4AEFA 5LGTA 2BRRH 4NRZA 5DMGD 4KK6C 3MX0B 2H6UA 1CD1A 3NA4A 2FB4L 2Y36H 3PLYA 5GRWA 4FG4A 1M7DB 3RYCB 2EEBA 3CVIL 4PYGA 3F7VA 1XCQA 1D2DA 2Y0PA 4PLKC 4IJ3C 3HRZB 3EUDA 3SDDC 4N85A 4WCEV 1CD9B 2OCJA 2BTQB 5A3IC 4E0RA 5GSRA 1HIMH 5DRWB 1TMCB 5TQ0L 5KBLA 4LXFA 3QEQB 4BQCA 2VXQH 4J7KA 2XBDA 3QJVB 1OP5K 2R0ZH 1OP3H 5B22A 2QR4A 1GS6X 4AWJC 3WU2Z 2CAKA 1S76D 5DJDB 3A5VA 4AE1A 5HDBF 4AGLA 2ZNWA 4TQEH 3DRTB 4JI1B 3BSZH 1PKQE 1BZOA 1MRCH 4XCFH 3K5LA 5BQ7B 1NH2D 1JR9A 3V0AC 2OI9B 2A1WH 3HJ0A 3FUMA 1WSST 5JO5A 4J7ZA 4H1LA 3VRJB 1U8LA 2N7AA 4GKLA 1YMME 2DJ4A 1MSWD 3NCJL 5KMGA 3RTQD 3Q44A 4HS6A 4AQAB 4B53A 2VDPL 3HUJF 4IBZA 1EUTA 1KSRA 2JQAA 3ARGA 3T3PB 3KZIZ 3L3DB 3OX8B 5C07D 2RNBA 4K0KO 5C0AD 5IB2B 4N8CL 2WQVA 4P2RE 2H6OA 1F58H 3GKWL 4PD4F 5CBEB 5AW5B 5C0FB 4O2AA 2WVTA 3HKZA 1G9NC 1BE3H 2OW7A 4QRTA 5FYKL 5BVJB 4HPOL 1YEFL 2DKUA 5B38G 3WJMB 3QFJD 3DHMA 1OGSA 3BSGA 4BZ1H 3F01A 5AOKA 4QOKD 3L70H 5F1SA 4UQAA 3OQ3B 5DUMH 1DQDH 1IKFL 1T83C 1HQRB 2D03H 2WC7A 2XG5B 3FU0A 3RX9A 3JWDL 1RIUL 2DM7A 1XF2B 1T7ZA 6PAZA 2BSCA 4S1SH 4PJAB 4BFOA 2NY1C 5CU5A 2PWFA 3TM6A 3ZN1A 3CX5K 4LPTA 4P04A 1EM1A 1JNNH 4G6AD 5EU3B 2H9GA 3BEHA 4F8LA 2E75B 3HMXL 2OMTA 4K3EH 4G82A 1JOIA 1BQZA 4KXDA 5I6XB 1WRFA 2OMZB 1YEEL 4FNLH 3SKJL 2XPZA 4FFZH 1RVFL 2SEBB 2XIIA 3X12A 3QZBA 4IMKA 4A7UA 4EN3D 4LPUA 3GS7A 4ODSL 5HBBA 1ZT1A 1CYWA 3B43A 4WUUE 3ZTCC 3DV4B 3TURA 2FSDA 4JO4L 5JR1L 3QULB 2JIXD 2IWGA 1MHPL 2GI0A 3QEHB 1AO7A 2XLLA 3D7PA 5DQDH 4QNHB 4ECNA 3X2QC 3L4TA 4JQIH 5D1XB 2VR9A 3BVXA 2VZ1A 2XVKA 3WGVB 2QJ1A 1LYQA 2BVPA 1MIEH 5E5RB 5BRZD 3RL2B 1VCBC 3T4DA 2ZKHL 4XNAA 2VERA 3B9AA 1LMKA 1NAMB 4Y89A 5AENA 2R9IA 3L3GB 2DE0X 3AXLA 4FXGA 1LQSR 3ZL1A 4M48L 3IDYB 5DGQA 1O6SA 1VEPA 3LN5A 2R0KH 5EZJA 1FBIL 5JQ6L 3VXUE 2BVQA 3QORD 4WLCA 2QT6A 2ARJA 1D9KA 4ANWA 4KY2A 4R8WL 4DP7X 1Q6HA 2LR4A 4FQXD 4LF3B 4IGBD 3R4RA 3FU9A 4X99A 5AYUL 3SO3B 4PAZA 3QDGE 3C08H 5E2JA 1LDPL 1KFAL 4Y9CA 4PRPE 2B15A 3BH9A 5JPMA 4FLZA 3QHZH 3TBTB 5CUSH 2Q0OC 3B6SA 3KYNB 4PS4H 2OK0L 4Z7WE 3WEAA 5F1NB 4AQ1B 4MMXC 3WEXB 1RZGB 5MERA 1OCWH 2RJZA 5DEFB 5C97A 2EJ7A 3N2KA 2KKWA 1XNQO 2AW2A 3I6GA 1AP6A 4NO0A 2BK8A 1BGXH 5CINL 2YN3A 1NBQA 3ARFA 1T20A 4P2CG 5E2TH 1FFPB 2N4IA 1EEYB 4L4VA 2OTJV 1WZAA 5JH7B 3BQUA 2JJVA 3G6DL 1Y74B 5EC1C 4L0YA 5TH2B 4IBTA 4ZTPH 4CZZA 2HTKC 2GJJA 1NZ6A 3ZRXA 1G1YA 4R2GC 5GZND 3OR6C 3QDGB 2HAZA 4TNWF 4YAQB 4A38A 5KSAA 4M5YH 2VLJD 1KLUB 3SYAA 2H1XA 2XAQA 2GITA 4K94H 4S2SB 3D0LB 3QZMA 3JTSA 3TEXA 2P5EB 3PNWB 1CFSB 5IYCO 5PCYA 1W8EA 4B9JA 3VW3H 3QUXC 1G1CA 2EUWA 5AVYB 4JDVA 1O5PA 3VSVA 2PO6C 4LLYA 4H26B 2UU9B 2ZX5A 3E9UA 5F1IA 2IV9A 4ZD3L 3GLDA 4PJIE 4X0KB 3D85B 3EGDA 3HKCA 5DRXA 4CBPA 2I9LA 3DETD 3HNSH 3ZE1F 2V5RA 1XR9B 2HEPA 1K4DB 4KKZA 1K7DA 5BQDA 5ETUB 5T3XD 4ONOA 2VXTH 2DWSA 2H3NA 3QNEA 1HYSC 4FA6A 3QUHA 1VFBB 2IBZY 4RFEA 4DUYO 4ZFOA 1KB9F 2DD8L 1R6NA 2XPGA 4EFBA 2BXYA 4BE5A 3ECUA 1SYVA 1PY0A 2LLNA 2QWPB 3ULUD 3WJLC 4FNLL 1KGWA 5JPNC 2HPTA 4F57L 5I19H 5IR1B 5KHHA 4P9OA 4ASUG 1A6UL 4HT1L 5E2WH 1RD6A 1AJ7H 2CE6A 2XKNB 5KZCB 1JZEA 3RWFB 3RFZA 1KTDB 2FWLB 2OPCA 3CCLV 5EBLA 1I8IA 4TNGA 5C0IB 2EDNA 3FAVA 4M5TA 5G4OA 3SDCB 1OAYH 4DV0B 5CCJA 4AK1A 1AQKL 1W59A 5EWIH 1TITA 4F5CE 2JKIS 2DWEA 1JRHH 1UWYA 2WANA 5JMOC 4FABH 3J80N 1FJGO 4LCCC 2CQVA 3D05A 3WXVL 3GLEA 2HB0A 1XCTA 2HH0H 5DVPA 2ZOKB 4OJCA 3PAVA 1J88A 2WXHA 5B4MD 3E1ZA 2Y72A 4EN3C 5B1OA 1PTZA 4HZLB 4LH6A 2GC7C 3AB0C 3AU1A 1JERA 3JXAA 1H6EA 4UT6A 2X38A 1HR0B 1MQKL 4HUXA 5E6YA 5DUBA 4TN9A 4LL4A 5BW7A 1R5WA 3ZMUA 3PGCA 1U91B 3JWOC 5J06A 3M1CA 1NVPB 1G7JA 1SA0B 1MG3C 2YI9A 3KYAA 2F1EA 4NPYA 5IB5B 4AJ0A 4F92B 1UA6L 5IVXB 1MIML 2W9DH 4N0FB 4ZO9A 1A1NB 1CGUA 4ISVB 5JW4M 1E7UA 3GMRA 3X17A 3KLKA 5FV1L 1YSCA 4CNIB 4JM2C 1LD9A 1UQSA 3PHAA 1YEGH 3M6DA 4S1DC 4NQTA 2UY6A 1CICA 3QJRB 2HG5C 3G5YB 3HG1B 3KLLA 5TE7L 1P5VA 5FHAL 3V6OC 3WIFA 2PY5A 2X4TA 4F33A 3OGCB 1DVZA 4CH5A 1S78D 1UJWB 1A6TA 2VLRB 4MDJB 4HHAA 4JR9H 1YSOA 2YUVA 1Q0YH 4U1GC 1TCRB 1FVDA 4XMWA 2VN5A 4HKBA 3RBZA 4NAJA 3UBXI 1AR1C 1AACA 6CGTA 4DR7B 3DOHA 1PNKA 2EIBA 4ZSOA 4CS4A 1MJ7L 4A5UB 3PAZA 3SKNA 2JK5B 1JPSL 3JWOL 5E8PA 3MLZH 1F4HA 2WN3A 4JI3B 4W6XB 4IIQC 1WV7T 1B2YA 2YUWA 3QJFA 4PRHD 4IK6A 3UMNA 2NY6C 1S5IL 3GUTA 4OLEA 1QPXA 2P52A 4KBPA 2YKKA 1N2RB 4DPCX 2HMIC 3EYQD 3EADA 1RVFH 4NO0D 1X5ZA 5BZDB 2PW1B 2NXZC 4UTAA 2WBJD 1CGWA 1S5JA 3WS6A 1GKEA 1XAKA 4XVOA 2YD7A 1AKJB 2VW7A 2AAVA 3LQAL 2K7PA 3PUUA 3D9AL 4QY8A 3VD2A 4R2GD 4ZOLA 2PN5A 4Y4HD 3WNKA 4AI8A 3CSYA 1KB3A 4NUGH 5JHLH 2N7BA 3S4SA 1XHHA 5FA3B 3AG2B 4GRWB 4HDIB 4YVNA 5CBAA 2XVLA 3L9BA 5I71C 4QO1A 3UDWA 4NGHL 2V1DA 3H6AA 4OD2A 1QLEB 2VAJA 2WBJB 1MF2H 1MZEA 5B3SB 3CLFL 1IX2A 3ES6A 3NCXA 5EBMA 3FO2B 3S3PA 4WI8A 2W6JG 3QI9C 4JUTA 4F80A 2HLEB 4PRIB 1Q1JL 4Y4HB 3N43B 5DJXA 5T1LB 3GXTA 5GRZA 2GJRA 2QGDA 5IQNA 3IFPB 1BOYA 1MWAH 4Q4EA 5DFVD 1QEWB 1PPIA 2EEAA 4OCSH 5HGDA 2VQFO 1LNUA 2FJHB 2XETA 5FPRA 5BPPA 4PJ5A 1NMAH 3BPOC 4W68A 1JIBA 4Z7OE 3QVNA 1T80A 3QHZL 4PV9B 2GSIB 1YTFD 3MNMA 3N50A 1ZA6A 1SM3L 3SODB 1GMIA 3HZYA 4W4LA 2IJ0C 3BOVA 4YX2L 5AG8A 5AL0A 2VISB 2OQJB 2VABB 1URZA 2ZWKA 4JY4B 5FX3A 1HH9A 4H2CA 4XNBA 1QTSA 3HG5A 1RIHH 3L3DA 3QNZA 3S5LB 4RBPH 1TVKB 1M9WA 4ES9A 1K5WA 3MR9A 2VQTA 4ZZKA 3CMAV 4OF6A 5BUGA 1GO3F 4N2MA 3LZOA 3VQYA 5E8OA 1KXHA 4Z3JA 5GS1B 1QO3A 4G42B 1ED3A 1BREA 3G5YA 3AAZA 4JI7B 3IU4L 1CK0H 4BUHA 1TQCC 1MZYA 1DBBL 3G5ZB 3NCWA 5FF6B 2J88H 5J5EA 4XNYL 2F5AL 4AQ8A 1T7VA 3QFJA 5CFAA 3K71B 1W72A 2AQ1A 5H4ZA 3AMKA 5JHDB 2E5EA 2B39A 1N0XH 4GT0A 1MFBL 3IXTA 4QGPA 4O58H 1WLEA 3PHSA 1TF4A 4WHTB 3FTWA 5BZWB 3F7RA 1CL7L 3EO0A 5HTSA 4PJ8A 4UM8B 1R5WB 3PGCB 4Y5XA 2CLVA 5AZUA 5LBVA 3ARBA 4JFFA 3EJTA 1MY5A 3SQBB 4LEOB 2ADIA 3GIZH 4MMXA 4ODHL 3CRRA 4Y16C 2V9QA 3ATBA 3MLSH 4PJ8D 1ETJA 1EEUA 3TA3D 3D85A 1WLHA 4R4FL 3G5XA 3O6MH 2KDYA 4CH4A 4WJKB 2OYKA 3STLA 1Q6UA 1GAXA 1JGLL 2X53A 3DPBA 3SGKC 1TNNA 4N0UE 3LDDA 4MXVE 5EOQL 5HHXL 3ROOB 2NPLX 2L7JA 4PDVA 2IPKA 2WXFA 3JV4A 4K8RL 4IJTA 4OM0L 5DU7A 5I5RA 2KC0A 5AZEL 4QYOA 2GTWA 3K2MC 4TUOA 1OGTB 5IW6B 2JF1A 5HFLA 3Q3GA 3MROA 3QFJE 1MELA 1RK1A 3O4LB 5D1QA 4Z9KB 3O3BA 5IMLB 5E99H 4JQVC 4QF1B 3W11C 2LU4A 3HHSA 4UV4H 3VXME 1LEGA 4X4XB 4XNXL 4LGPB 4DP9X 3PHOA 1LHZA 1E3ZA 3BVWA 1YN7B 1OTTC 5CA0B 3TZVC 3HHRB 4G70B 4TXVB 5T1KA 5LGNA 2IAMC 2JB6A 2DYSC 3I3BA 3MXWH 2FQEA 4OBRA 1CS6A 3O4OC 4EIGB 1WPXA 3P0VH 4QRSB 4U3JB 2Z3YA 1MXGA 1GOHA 1RHHA 1RUAL 5I15H 4J12A 3KPRE 3K6SA 3JWDC 4L9LC 1MNNA 2DF3A 3DX4A 4WDIA 2P22C 1DJXA 3EFFA 3TU6A 2P46B 4KMQA 4BJLA 5IKCB 3MO1A 4JHZA 3LTVA 5F2FA 1QR8A 2D7QA 3EGXA 1BZKA 4GP5B 1RUQL 1YMMD 2J8UF 4O4JA 2G4EA 4NZTL 3MUGB 4ZBMA 2M6YA 2IQ9L 2ZTBA 4J8QA 3IU3A 4LPYA 4GAAA 2OYQA 3N06B 4ZXBD 2BRRL 2HCZX 3D0LA 3R18A 1OZUA 1Y6MR 5B39A 1HXKA 4I1PA 3TBWB 3VXSE 3EYVA 4IU2B 3X3GL 5IHBA 3TIDA 4YX2H 4X7SL 3GC3A 4YAQA 4XVJH 4XXWC 4BR6A 4BQ9A 3MJ6A 3ZTDC 4PJCE 3SJVE 3MV01 4J3TA 4DGYH 4KNQA 2FIKA 1OT1A 1QFWH 1U41A 1UM4H 4C83B 2RCSH 1AO7B 3CRQA 4UT6L 1X5GA 1S7RA 4JZGA 5KYWA 1REIA 1RIUH 2VC2B 1W15A 4N0RA 4L8DA 5E1AA 3VGAC 3UAAA 1F23A 2ZUYA 1Z6JT 2JCCB 1CTNA 4JM0A 1F1GA 3VXOA 2ZDIA 5L2KB 1W0VA 3BP4A 3D0VB 4B3MB 1BDYA 3C09B 4XHJD 2NR5A 4HWUA 1L9SA 2EE9A 4WJ5B 4HCIA 3JAWA 2JJSA 3ZUCA 2IOMA 4LCYA 2E8ZA 3TV3H 4GMSL 1WJ3A 3WTYA 4XCNB 4ENEC 2BS71 1RP9A 2CJ3A 5LO7A 4HZ3A 3U6RA 1UEMA 3LV3A 3JTBA 3PIQB 2DQ6A 4MQ7A 1CFQA 1CL7I 3U7YH 4MMZB 2G75A 4JRXA 3M8AA 4A6YL 3QZWG 4PRBB 5EIQA 3CFNA 1U8QB 5IIEB 2QSTA 3U7WH 2XAHA 1UOVA 1XCXA 3D9AH 2Q6WA 2A5UA 3ZKXB 4OKDA 2HG5A 3KW7A 5IK3B 1S72V 4ZG1A 2YPKB 3O6FB 5I6MA 4UTBH 3H1JH 1UACL 4WGVB 4CC4C 2TSBA 4YK4C 2E9BA 1ETA1 2R1XA 3BVVA 5GGQH 1EBPA 4PJ7F 3AWEA 1IBKB 3IMRA 2ZXQA 2F5BL 3R7RA 2EE0A 3GZPA 1AGDB 4KHPO 3UKMA 5D1XA 3NSFA 2C1OB 1ZHLA 4TUYB 4PVMA 3NJJA 3X1EA 1NCHA 3UAJD 3BAAA 3DARA 1EEQA 4XP6H 5LNEA 1WHOA 5ICZA 4ERSH 2EEXA 5FUCC 1NTKH 4CSZA 3MA7A 5CLYA 3BRDA 3NOIA 4JHBA 3BVUA 3O6FD 4JDEB 4UTAH 1RZKH 4NQXA 4BGLA 4FHBD 5IY5B 2UUBO 4OCSL 1AGCB 32C2A 4PA7A 5T3XE 5LBQA 5KG9B 3L2LA 4OPAA 2G0KA 4HJJH 4XPGH 5TDPB 5DJ6B 1JZ7A 1WB7A 1IBGH 2Q73A 2CO3A 4PTUB 1NGQH 4MA1C 4U3SA 2ZUUA 2C5DC 4ZPVA 1F4WH 2QZ5A 1AVAA 4MMYB 4YBQD 3FL7A 3ATDA 2ZE7A 1X5IA 3LPFA 4R96B 1HQRA 2XG5A 4JQIA 1V9PA 2NYZA 1UVQB 2EYRA 2D2OA 1NIEA 4U3SB 3VYNA 3EH3B 5DLML 5IWLC 1QFWI 1HHKB 4PP2B 2A7BA 3TBBA 1FV1A 1U3HB 2R0WL 1TJHH 3VXMA 1A2YA 5CD3B 1GZPB 3O8XD 3CGTA 4G3YH 1AI1H 4LLVA 1E50A 1SOKA 1E5AA 4HG4J 3DUSA 3HZ3A 3PABB 2GG1A 2ENPA 2XRAH 3ZHQA 4ZMTA 2BNRD 2YUXA 5J7CC 2VZOA 1JTOA 5KYWB 2EIJB 2AVFA 4XTRC 3PQYB 3P9MA 1XGQB 4XVSH 1ZHLB 4X98B 5DRNA 1G5GA 3ML9A 1FJ1A 5DHYA 4KO7A 3LZPA 3UADA 3NZ8B 2E7BA 3UZVA 2B1AL 5I6XC 1HWHB 3C08L 3QZOA 1FLRL 2NW2A 1F45A 4WJ5A 1XD1A 1OM3L 1IT9H 4KC3B 5D5QA 4GJTB 3EYFA 2WLHA 3PDOA 2IGFL 5ITBL 4OIFA 2EDXA 4A2MA 3GPSA 1XB6A 3IGLA 1MXDA 2FTAA 1BVOA 2UZXB 3QH3A 2N0MA 1MFNA 1BZ7A 5JOPE 1D5XB 1I1AC 2OQJA 2QV2A 2VABA 3F5WA 3QHTC 3CFTA 4KRPD 4Q2ZA 1NGPH 2J57A 4ZXBA 5LG6A 2DEXX 3BSHA 3MRBB 5CU9A 3WHXB 5F93C 4HWEL 5CLXA 2IEPA 3B7RL 2OSXA 3B2DC 2XN0A 2X1PA 3BWAB 2C9UA 2J72A 5E5LA 4M43L 4WTWA 3ZXAC 2Q87A 4LSUL 5JW3H 5E4AA 3TEZA 4QDGA 1UXSA 2BVYA 4HK3N 4XP1H 5LBSL 3IJYB 1OZTG 1U2YA 5HGDB 1P6FA 2R1YB 3LIZH 4KVCH 5HDQH 1VQ9V 1D5AA 1SXZA 3QRGH 5KSUA 1NTZH 4AZ8A 3BP4B 2CBQA 2FATL 5A9GA 4YDMA 3DC6A 3IJ4A 3AY4A 4Y2NA 5FLXN 1T2XA 1IFRA 1U8KB 2Q76A 2HH0L 2APBA 4O02L 4LVOB 4IS6A 1UACH 2IV8A 1VENA 1H2KA 4POUB 3HR0A 5FM5O 2XVBA 3LKQA 3HRPA 4KI5C 4KTYA 4M5SA 3HAEG 2W0XA 3N9GH 4GCZA 1B6DA 1ZEAL 3MLWH 4Y1AD 3O6LH 3DX6A 3I74A 3ABGA 5BXZA 5AVSB 4AV5A 4TQPA 3VDAA 4F7CA 5JUEL 1PV0A 2A6DA 4UVAA 2KQMA 3GSVB 3MRHA 3OD4A 3ARDD 3VXNB 2E6JA 1I8MA 2ICWA 1NJ9B 1W2KT 3RGVB 1KB5B 1N68A 2YQGA 4GSDH 1IXBA 1RUQH 2HFFB 2EIKB 5MI0C 1QA9A 2WPGA 3IRCA 4WTQA 5D7LB 4EF3A 5LHDA 3DPBB 1HESA 1TVHB 4OGQC 4B60A 4W9GC 1ONQB 1K4CC 2AKRB 3Q9QA 4PG2A 5D7KD 5DFTA 3WV0A 5KOMC 4XBPB 5DD5H 1IKNC 1GAFH 2HX9A 3GJEB 3LHPH 2D3VA 4QRQA 5BNXD 3MROB 2XWTA 3GRBA 4HZ1A 2FH6A 3O3BB 5IMLA 5FYLD 1DE4B 4Z76A 3UZQA 5B66Z 1KJ2H 2CBMA 4R90H 4V1DE 5EEUA 4LSVL 5D7IB 4GI6A 1G7IA 3BAWA 1NC4A 1RULL 3W2DH 4N86A 2LAAA 5SWZB 3UQ8A 4JRXE 4J3WA 4XC1L 1BXUA 4XAWH 4H8UA 4MAUH 2VN6A 4IM8A 1HZKA 2XAJA 3GXFA 4GRLB 2HJLB 4KK9C 4PV8A 4JZJB 1UH2A 2R23A 1BQ5A 3HN5A 5F7AA 4YBQC 3A4AA 4UYQA 2DMKA 1MABG 1F3DH 3Q3GB 3MN8A 4FJ6A 4ZOBA 2BSTA 3UAEA 3KPPB 1O9HA 1OSZB 3MOBH 4L0ZA 4GBXB 4M7LT 4NC0B 4ETQB 3PUCA 4P5KB 2ZSWA 1MG2C 3QFJB 2YS8A 1JFHA 2QKIC 1LO4L 5DVNA 4Y2DB 1WTGT 4QOKB 1YNLH 1ZJAA 5EZLB 1F56A 3GSWB 3SDCC 2EZOA 4OJDH 1N8OE 2WKOA 4L1BA 4PRIE 4Q74A 5ESAA 4NUMA 4S1RH 2NR6C 3ME0A 2VUYA 1PZ3A 4UTCA 4LVHB 3HAEB 5HDRA 4JFZL 4FFKA 1JPXA 3MHZA 4JZNA 4YL9A 5GS2D 1ZGLA 5HHQB 3KPPA 1B3QA 2CHDA 4Z7UE 3JSNA 4KK5D 2JFCA 4KJQD 1P53A 1EHKB 1GMGA 4HUUB 5SX5K 3C6LC 4U7OA 3OR7C 3O6KL 2K3TA 3IDJB 2XJKA 4GIPD 3IVKB 1A14L 4JZ2A 2X9ZA 5D6CB 3D3VA 2EJRA 1NFDB 2Y1VA 3RJDA 5DDHB 3CYOA 3FD9A 3CN0A 3SOBH 3P0YH 2R27A 3QZLA 2H45A 4PJFF 4WU5B 3GIZL 3ARDA 3DC0A 3ZMZA 2XWJA 4JRYE 1F4WL 1LTXA 1PKQA 3R19A 1ZWIA 1CE1L 4YHOL 2C9AA 2VT0A 3C6SB 4J4PC 5LXGH 5JZ7C 4IRSD 3TVMC 1YEIL 4KXAA 3PWUB 2ZE6A 1UD5A 2CJUH 2QGCA 4FEIA 2D7PA 3DOSB 5CN2A 5SWSE 4CMMB 5BJTB 1GKFA 3D33A 4YHZH 1JFQL 5JQIB 2WAQA 1CDUA 2CU9A 4RVBA 3E35A 4Z3EA 3SDDB 4NHCH 1JPTL 2CIIB 4MT8A 5EN3A 2PWGA 3AQXA 1J9RA 3VG9C 2EZ0D 3NR7A 5SV4A 3ZTNL 2XXGA 5CEXB 1QRKA 4XP9H 4MVSA 1XF4B 2DM2A 1YPZE 4IKNA 5ANHA 4F9PC 2Z3FA 3G6EV 5KYXA 5D7IE 5LMUO 3DKHA 1EVTC 1WQVT 1R4XA 1S8DB 1AHKA 3QJOA 4OLWH 3S88H 4RZCA 4Z5RA 3MRHB 4ZFFB 3OG6B 4IIQB 3OGCA 1N8RW 4CADB 4XXDB 2FJFB 1DSWA 4J6RH 1X5MA 2DAVA 4L4TD 2V5SA 4V1DD 4OR1A 5AW4B 3WY3A 2F18A 2G5UA 4RGMC 3IS0X 4MXVF 4LAJH 3OB0K 4XZUA 4BDVB 5JH7A 3BQUB 4KGJA 1NBZB 3NA9L 3OJ2C 3TO4A 4OZIF 4B3RB 1G6RH 1OM9A 4I13B 2XZQH 4ZSOB 4L4VB 3WFEL 4AEHL 3FB7A 5IB3A 4ZOLB 4FL4C 1T66C 3KGUA 3LKOB 2AJ3A 1BQRA 2OJZH 1X5FA 2CIKA 1MI5D 4PRPD 1WZKA 4PG2C 1N3NB 3V6BR 3WS6C 3NIDB 4Z6AT 1MH5A 1MRDH 4JDZB 3IXAB 2FL4A 4XRCA 3QDAA 2Y7OA 4WW2F 3JZYA 3KW8A 3TBTA 2Z65C 2CA3A 4PJCF 5DYOA 1ZPUA 2D9QB 1CCZA 1NM9A 1W8NA 4GW4A 4FN0A 4GT1A 3VXMD 4PWGA 4KKQA 4JKWA 1XB8A 1JX9A 4P4KC 4ELKA 1VP7A 4HUNB 2VM4A 4AEIL 3ZDWA 4RMWA 3CAFA 1UM4L 1KJMA 1ZD6A 4S0HA 2HRPL 3QSKB 4UVBA 1R24A 3PJSA 4FADA 3Q06A 1HAWA 4TNWK 2X70A 5JA8B 1DUZA 4QHKI 1EBAA 5E51A 1BXVA 1U8OA 4DUWA 3AS2A 4NTXA 3ETTA 2PYFB 4HCGA 1ZCRA 1D5BA 1U95B 3RIAK 3MBED 4BZ1L 4Z7VA 4IDJH 3S3WA 3GTNA 2WCSA 4HF5H 4CNIA 1SYVB 3JAMN 1T1XA 3B1TA 3CE2A 4R83A 1BLNB 2PTMA 1AY1L 3SBPA 1XQ8A 3QZWB 4XCCL 4EEQA 5C07A 5L0QB 2EABA 4G1MB 2NNAB 2Z8RA 3QARA 3SDCD 5FOBB 4BFBD 2B9BA 1SFHA 1OGAD 3FQ2A 4N2CA 1QZ1A 4X8CA 3H9VA 5EUKB 2NR6D 1ZLWK 2IM9A 2K45A 1XR8A 1MAML 5EEYA 3SDCA 3QDJB 1T6BX 4RIRB 4OIAA 4R84A 4NB7A 2ADGA 3MNVA 1SJEB 4JFEA 1XGTB 5EU4A 3ARTA 1E3XA 1Q8MA 3WFCL 1CFMA 3VMPA 1TTFA 2X40A 2RMKB 2BLFA 2ZUWA 2PYED 2LTQC 1HHJB 1F8TH 2WLNA 4D6TH 1B0WA 3MGTB 3JUYA 1UT1A 3WJJA 4Y8AA 2X41A 2CWRA 4WKXA 1X7QA 5G4MA 1D9KD 4HHWA 3ATEA 4AQ1C 3P02A 4HXBH 4H1LG 5CA1A 4K07A 5HFMA 2W0FA 1FL5A 4OQTL 4DP4X 4J41A 4M1GH 3T0EB 3QZNA 2E0PA 3F58H 3E8GA 3TYGH 4CJ1A 3GRWL 1R3JC 25C8L 2CKNA 4PJHA 4X8JB 3A6BL 1G7PA 1DSYA 4YHMH 1ITCA 5DEJA 1CJYA 1ILUA 3CFUA 3C5ZB 3WNLA 3BRCA 2A0LA 2R0LL 2JNZA 4FKKA 5BV7H 1K4CA 3OR6B 1JHLH 3MA9H 1BF5A 5D7LA 4CC0A 3ZDZF 3L3IA 1QA9B 3QR0A 4JI0B 1QW9A 3LEYL 2P8PB 4KJYA 3I9GL 4JI7O 2F54A 1UJ3C 4RAHA 5DZAA 5T3ZL 1ACYH 1WT5C 3HLAA 1TEFA 2YGQA 4JFOB 5AAMC 3U1SL 1UXSB 1JWUB 3LCYA 4N2HA 3VXSA 2ZCLH 2ZE0A 4FG0A 4J3OF 3T4YB 3NRPA 3BAEH 3JASB 2B3RA 4HKZA 4PHZA 1S2EA 2LW7A 4X88A 1FH5L 2ODIA 2DW5A 3RNKA 3E89A 3VI4F 3TN0B 5ISZB 5E4IA 2GB2A 4ZX5A 4TQIA 3R66A 4J23A 4LSTH 5FGRA 3S3DB 1FUNA 3E8VA 5I18H 6PCYA 3JATB 3EKCA 5CCKH 2AJZB 1KELH 2JKNA 1PL4A 1ZVSA 4Y4KA 3ZTEA 3APOA 3I6GB 2BNRE 3B77A 4NO0B 4YS4A 1YMMA 2P5PA 2NY7L 3Q8AA 4LCYB 4OLYL 1KGJA 1LM8V 3Q43A 1XUQA 2FSEA 2PMZA 4K9EC 3K0GA 3BGFC 4X6FA 2LAGB 3DROB 3KDMA 3VH8B 2R2CA 4LGRB 3MFFB 1TZHA 3GB7B 4MWFB 1HCFX 1V54B 3GMQA 2VC2H 1E90A 5LCVA 2A77L 1ET7A 4DVRL 5E8NA 1X5XA 1DEEA 2J6WA 4WK4B 1Z9SA 1C08B 1HWGB 2YWYA 4F5CA 1HYSD 2NY4D 1DFXA 2X44D 1QR1A 2ENQA 4OGZA 2E74B 3A4EA 3JYBA 3BC9A 2OMZA 5ALCH 5LN4A 1U58B 2GYSA 4JG0L 3JD0A 4QRPB 2EIMC 2ADPA 2UXNA 3CJHB 4G3YL 3ZDXE 2HT3C 1R3KB 1AIFA 2AGJH 1DLHA 2VYRE 4ODXB 3TBCA 4XCCH 3ZRFC 1NZRA 3RN4A 1SEQH 4B9KC 4CC4A 3DX8A 1WBZB 1ULVA 1CLVA 4G80B 4OZHE 5CP3A 1UA3A 4GX1A 5MEND 3SE8L 2PYEA 1UB6B 1X5HA 5E08H 1W0KG 1N7ML 4NZFA 1MHPH 4Q4IA 4C4KT 1KBGH 4FLXA 1KN2L 4FNQA 3TN0A 1CBVH 3OKMB 1E4KA 4FFBB 3C09C 2E56A 3QYNA 4MJ5B 4UT7H 4BK8A 3DUSB 4O00A 4AY0A 1KENH 2AJUL 3VFOA 3PS6A 2NY0B 1Q81W 3E1F1 2P4KA 4JKKA 4EN3B 3R0NA 4PIRF 1OARH 3DX0A 3QP3A 5D4HA 4X2UA 5B4MC 3VFPB 3C75A 1KIPB 4PJAA 1F18A 3SE3C 3F12B 4WEBL 2M1KA 3MOQA 4M8RA 3QUKB 3VFVB 2JQZA 3ZE1E 1RK0B 4B9CA 4DP2X 4GQ9H 3DO3A 2HUEA 1IFGA 3S35X 2X4NA 2VJ8A 1IKFH 4U3HA 5CMAA 2O5ZL 3FB8C 4WEMB 1MWAL 3HVNA 4FX5A 3DJRA 4LVEA 3TPKA 4LLVB 2YS4A 3IDMB 4N2FA 5KVDL 1UM6L 4WCYH 5DLMH 3QQ9C 4EN2A 3CS5A 2EH7L 2Q4PA 3G6JF 3NN8B 2Q68A 4YNYB 1DBAL 3SBWA 1D5NA 3I6SA 1FO0B 2PETA 2NT0A 1U33A 3C5SB 5IHUH 2XHNA 5DI8B 1KXVA 3IDUA 1T3FA 2JJTA 3DGGA 4HUKB 1DJHA 4M6NL 4MCYA 5D72L 3TGXA 4U1GB 5HYFA 4NCDA 2NX5B 5MEQA 3TL5A 4ZKIA 1CICC 1ICTA 3MUZ1 2VXSH 2VL4A 3PQYE 3QIBD 1BBDL 3KYMB 4HIQA 5I9QB 2D3OW 3CZNA 4HW6A 4GY4A 4X6DF 2W92A 2YSSB 1FH5H 5IJ0B 1S7UB 3L5WA 2QA4V 5IFJB 1I85A 4FD0A 4PLJC 4LLWB 1BHBA 2NY5L 4PJ6A 5HHOB 3FB7C 1IFHL 1W0VB 5FYJU 2H3OA 4C4KO 4JQVA 1OPGL 3QYCA 2CKBH 3EDFA 4O2FB 3BVDB 2ADFH 3N41F 1U8HB 2VXQL 1QLRA 2EXWC 1R73A 1MCLA 2V7HB 3QG7H 5CEZL 3VXUA 3CU1A 3EYQC 3U25A 2HMID 4TOYL 4FQLH 1AD0B 3WEMA 4JI3O 3T2NL 1QLEC 1EFXA 2WUCH 3FMGH 1FNAA 1IGTA 3SEPA 4MQ7B 3HS0B 4P2RB 1QHOA 4YL4A 3WIIL 2DY2A 3PWVB 3BEVB 1HJBC 4LIQL 4OD3H 2EVFA 5JWPA 2JV6A 2J4WL 3QWRD 4ABQA 1AI6A 1J95A 5F0JB 1YDPB 2F7PA 4Z95H 2FEEL 5HHNA 1WS7A 3QEQD 1NCWH 3CDZA 1DANU 1DF4A 3S5LA 1RUPL 5E70A 4ZW7A 3TYFB 2GIXA 1RURH 3BPOB 2DBLL 2WY3B 4JY5H 4MMZC 1DSFH 4IRJA 2B0SL 4PV1C 5D7JB 3KGSA 1KULA 1R33A 2XXMB 2EDJA 3F05A 4XDJA 3ZMTA 3AADB 1GJWA 2XWEA 2B5IC 4FQ1H 1K5NA 3VH8A 1BF8A 5B21A 3ZX6A 1BMZA 1U21A 2HJFB 3BPCB 4XMPH 4IRSA 2OJEA 3L54A 4QRRB 1BM3H 2V37A 5CHNB 3M1OA 4QHPA 1Z5LB 3F65A 4MZ3A 5I6PA 1SDYA 1T7WA 1NI8A 2WSKA 3LS4H 3SGEH 3LDEA 1QR1B 5G55A 4OX9B 1J0KA 2V7NB 2EDRA 2VQEB 1GS8A 2E27H 2QR0B 1OLZA 2EDYA 2ROXA 2VW6A 3P54A 1I08A 4UOQA 2PUQT 4N8UA 2QQQA 4PBVC 1E6JH 1KZQA 1S7SA 2BP0B 4HGMA 1AO7D 4LE8A 2KYIA 3MHSC 1HJCA 3NCMA 2ETNA 3PJLA 4X6FB 4QXGL 4ZMWA 4CC1A 5T1MB 5CEZE 1SXBA 4AGOA 1EJ6A 3N04A 1FL6A 3UOAB 3NIFE 1FDLL 5HHMB 5ANMA 4FJYA 4Y9EA 5E2TL 3UBFA 3LZFL 3L7EA 1KB9J 1AI4A 1XF5B 3H4HA 5I1GH 3QIUA 1KXTA 1BP3B 3KYKH 2BS9A 1MZZA 4QHUA 3VXRB 4APXB 2HHHB 3JV6B 5DC0A 1CLZH 3ETDA 4N90E 4LSTL 5IDJA 2L4OA 5DQJA 1QASA 4GMTL 5KBMA 4ZTOH 4A2DA 1MVUB 4DOHB 3GSOB 5A2IH 4R4BB 1GK9A 5D93B 3DTUB 1H6UA 1SHMA 3MRQB 5JDSA 3EBHA 3LKPA 5EV7A 4MAUL 5JNYB 2Q9OA 4MNQE 4PWEA 4ZYKB 2C9RA 2VMFA 3T8MA 2CLVB 4APQC 3A0BZ 2YQ2A 1MSDA 1BVNT 3K5RA 3AT0A 4Y16D 4FLRA 4PJ8C 4Y5XC 3FUFA 3S4SG 1FVDB 2X2IA 1PLGL 2IH1A 1ZANL 1K4CB 3S8FB 3R8QA 5JJEB 1W2BU 4DVRH 5D96C 1BECA 3BXNA 3RUGA 5IW3A 1QZNA 2DKMA 4NERA 1IQDB 1YNTF 5GS0L 3ZGIA 3TLRA 1E8XA 4IRZH 2GY7B 3TZVB 4F6EA 1JFQH 2EO9A 2UY6B 5CKAA 5C08D 3QWOA 4NZ8A 4KTGA 3A67L 3H55A 1M57C 1MOEA 4XC3L 4GX5A 4BELD 1JK9A 4N9GB 1QX1A 3N6YA 5C0EA 1JI1A 3O6ML 5K9JH 1DFBH 1RU9H 2X42A 3FNKA 3HNVH 5I1KH 2BWQA 3ZYZA 5F88B 4OT1H 3S9DB 3QIBC 3VWJD 1GOFA 1MJ8L 2GCYB 2EXSA 2OXHB 2XNAA 4A66A 2VDNB 1ECYA 3FAXA 3NPZB 5DJAA 2CTPA 4N0CC 2A9NH 2ZICA 1W80A 3PV6B 3QNXA 1VESA 4N68A 1PGRB 2D0HA 2YC0A 1EERB 4NUGL 4LKXB 5IYZB 4G5ZL 4HJ0C 4G8GA 4OQ1A 2Z6FA 2LVCA 3TZVD 3VFNA 5M95B 3CVHH 4N1HB 5DT1H 1S5HA 4BA0A 3M86A 3FFOA 3K5MA 15C8L 2GI7A 3KLAB 3B5HA 1FG2B 3FO1A 5C8YB 4GLRI 1EAQA 3HMWH 2W81C 5JJNB 4BZ2H 2F93B 1AZCA 1A9BA 4HWZA 2BHYA 4HCFA 1OSPL 1XSIA 3BPZA 2XN9A 4I5SA 3PJSB 1H9VA 6FABH 4PGBB 1YJDC 4LOUD 3KPSB 1PEZA 3NACL 1HKLH 3LKNA 2FLBT 4J3SA 5F7UA 3E8FA 2BZCA 1GW0A 4E5XA 4DV1B 2CKBA 4PGEB 1MJUL 4PELA 1KGYE 3T65B 1WWBX 4LSSL 2R56H 2ZOLB 4J8RB 1LNQA 4IRZA 1P7KB 5E2VH 5IJVB 1IGYA 3QDGD 2WZ6A 5HYSB 4XNQB 4BHUA 5KSAD 5ABDE 2E27L 2FWOA 2XKSA 2ZUXA 1R1BA 3DX9A 4ODWB 4AYID 4JKMA 4N2OA 4LLUA 5K9KB 4KITB 2J43A 1OAQH 2YHGA 2C26A 2CO1A 2UXVA 4LL1A 1CFTA 2NY3B 3HEIB 4O2CA 1PS3A 1KPUB 1WNSA 3WDJA 1TVKA 2W91A 1CMOA 2PXYD 2Z1KA 3LXUX 2YEVA 2P5ED 3CN1A 1BLIA 3SJCC 3Q8FA 3K72B 4AEIH 2OYPA 4QT5B 1VQOV 4OFQA 3STZC 5B7FA 5DSCB 3B2XA 3UZQB 4PJXE 4Z7WA 2R1WA 4Y1AA 1YPZF 5CZKA 5CEZD 4L48A 3KPNB 4RSYA 3TO4B 1F41A 3UTSA 5C0GA 5LG1A 4FZEH 2H32H 2CAZC 3QJFB 3CNKA 2CZNA 1N33O 3I85A 2MMXA 4MAZA 2JXMA 5KVFE 2ZCKH 2AV7A 4JFHD 4IDJL 4X9QA 5H35B 1PNMA 4Z3GA 3LNMB 4J9YB 1OAXH 1QSEA 1J5EB 3RFZC 3GI9L 1SQXH 2ZKWA 3BX7C 3L17A 1L8DA 4FTDA 2CIKB 4JLRA 1P84F 2YJQA 4F7TB 4EI5C 3NEXA 4YHHO 4HHAB 3QEGL 3N40P 4XXCC 5KVGE 3VD9A 2QQKH 4QHMA 1MWAA 2YD5A 1OQOA 5L3EA 1B4JH 2P44B 3FF7A 1VB9A 4GMSH 1ORSB 2Z91B 1SN0A 3T2PA 4WZ9A 3R8BB 1OP3K 2N74A 4TVPL 4JI6B 2C3XA 2XAFA 3HHMA 2JJTC 3T3MB 4PJGA 1IM9B 4OM1L 5B8CC 3WLBB 3CFBA 3IETA 3VFMA 4A7GA 2FO1A 1Q6IA 2ZT9C 3LMJL 5DD3L 2R0ZL 3DK2A 2WXOA 4YO0A 4O02B 5EA0H 4OX9O 4AI7A 1E2VA 3QDME 2HHHO 4Z7UF 3GJFH 4HC1A 3FQRB 3DXAA 4DW0A 5KVFL 4FQ1L 4XGZA 4QXWA 4MVUA 2F61A 3CV5A 2BTOA 1HOCA 3MJ8B 2EYSB 2AS5M 2QWOB 4G7VH 5IESL 4DWHA 5CEYA 4AYDC 3E6FA 2YPLA 4JRFA 1EH9A 4UM9B 4PHXA 5EN2A 3RAJH 4NYLB 4GX0A 1QUPA 4XP6L 2GTSA 1JCKA 3OF6A 4OLXH 4JI2B 1K2DA 3PE9A 1V3LA 5D70L 3WE6B 3RTQB 4DTGL 2JCCE 4AIZB 3V6ZA 3S3CB 3T1CA 1E4XH 3NMEA 4X4YB 1SA0A 3VXRE 5C2BL 3N91A 4GT7A 4WU5A 3EZ8A 5LWYL 3W7TA 2ZD9A 1NICA 1MNGA 2BNQB 2D31B 1N0JA 3BT0A 5C08A 1T89A 3VXPB 4I50A 4MNGA 4D3CL 2CRZA 1WPCA 4NRYA 5HD8C 3JTTA 3LNFA 4HU8A 4JGJA 4YY3O 4Y1TA 4P2YA 4MKTA 4N1CA 3LN4B 1RPOA 1AI5A 2WYZA 1TFHA 3MBWB 2MHAA 3D8CA 1NCGA 4B7KA 1KC5H 4I89A 3FX7A 4J28A 3BRGC 4X6EB 5F0PB 2AXFA 2EIJC 2Q0ZX 3DPDA 4PG9A 1AHMA 5TF1L 2JGDB 1IGJB 2EQDA 1PZSA 4HCRL 4JCLA 3FB6C 5K9OB 2LU5A 3C3TA 2EJ1A 5EU3A 3IJHA 3HFFA 5CP7A 4NZJA 2W0FC 4M93C 4JV5B 3RURA 1N5YH 4P46D 4X5WB 1P5UB 3KPRB 1UFGA 4Q89A 3IJSB 3QQ4A 4NN5B 3PP4H 5L0QC 3GEFA 4O58L 4I0PA 1BWMA 2ZX6A 1N0NA 3AACA 3ZT6A 1G9MH 5ISZE 2MTPA 3V6FA 3DV6A 2ZUTA 4LB8A 1X5AA 5KYUB 3V0WH 4BCZA 1F3RB 4B3EA 3LXCA 3KBHE 3ARQA 1I1AD 2D3LA 4MA7L 4A7SA 4P0DA 2YA1A 4UDTA 2BHZA 1IM3A 4NN6B 3BN9C 3WSQH 5KSBA 4WJG3 3PWUA 1YNKH 3CPUA 4LF4B 4JM4H 2FX9H 1WBXA 2BXZA 3EGDB 2VDMB 2HX8A 3CCSV 2GJZA 5D2NB 2H47C 3GMOA 2QHRH 4KOCA 1DUYB 3UIZA 2YD8A 5FB8A 3TEYA 4OLVL 2N04A 5DHVB 3S5ZA 3CD6V 2XTLA 3EDDA 4JKNA 3GZQA 3S3BB 3WUWA 2IXQB 2IADB 3JAKB 4I55B 3LEXB 5BMVA 4DO4A 5CZXC 1U8LB 5T5NF 5D6CA 4M6NH 4A37A 4DN4H 4IGBB 1DVXA 2XZCH 5MEPB 2M83A 5HI4C 3OHXB 3ZDXB 3CSPA 3VFNB 4KI5D 4F7CB 4KZEL 1I0HA 2OL3L 3VE0B 2JGDA 1JOYA 1URFA 4EI5D 4J2QA 4DKFH 1OE2A 1P7GA 4L3EB 1C7SA 2IFFL 4MGXA 2UZYB 1LJMA 2F66C 4PY7A 4U6HA 1DDTA 3Q01A 4XR8C 1EHXA 1PQZA 4EI5A 3D4CA 4G8FA 5EZOL 1A9BB 3VM7A 3MJ7A 4NO2A 4HJGA 4KDWA 4PUBL 1I3GH 3LAFA 1U8CA 3QEQA 2QDVA 3G6DH 1MFAH 4L1TA 4AYMC 5BR8B 1I8KA 4CVZB 2XBZA 4OIBA 3W9EB 4DAGH 1OV8A 5IM7A 3X3FL 4Z3FA 1I7UB 2Y4UA 2F0CA 5E2UH 2C4FU 2I9TA 4BXVA 4XCYA 3RE0A 4PJDE 4JL1A 4JI1O 4OD3L 1FYTB 2EX3A 1MA1A 2DD8H 4BZ1A 4LRIA 2AXGB 4JRWA 4I9WD 3UYRH 4FJZA 2GCYA 1WDAA 5JHDD 2PP9A 1QLEH 3HUJE 3QEQE 1N64H 2Q7YB 1T7YA 1OB1B 5CJQL 1ASQA 5FO7A 1N7MH 4PCYA 4PGDB 5JHMA 2XU9A 2F7RA 3RLSA 1GYCA 3MV7A 4H88H 4F2EA 4Z1PA 4K3DH 1JXJA 3GINA 2V33A 3DOIA 4AQYO 3UCSC 3BD5A 3E6HA 3MMEB 4AV0A 1H8HG 3OJDA 5IROC 5CCGE 3RT3C 2E9IA 2WCGA 3D85D 3GMMB 4BBWA 3L9RB 1F4AA 4YBLC 4LSPL 4YSDA 3WUZA 3ARBD 4JFFD 1R3JA 1TTCA 1KIQA 2P5WB 4Q52A 4LBEC 1CPUA 4NBYB 1OLLA 4TQHA 5GONB 3TA3A 4Z7NB 2HT4D 4OW6A 4U4BA 1IC5L 4YIOA 1DBKL 4AIXA 4GBXC 1DL7H 5HD8D 4DV5O 3AREC 4DVBB 3OC8A 2G38A 5KJRH 3D12B 1JFFB 1IT9L 1ZHNA 4MDIA 4FQPA 4EXKA 1DO5A 1GHFL 1HHHA 3WNMA 4CDGC 3U0PA 4WTXA 2O57A 3POHA 4HLZG 1ADQH 3U46A 1E30A 3GMPA 2A9HA 4GKJB 2YC1B 4NQDA 1BEYL 4EJ1C 3VU2A 3DVGB 4DUZB 1E9QA 4PW3A 4MQXC 3CXDH 4JI2O 2YLHA 2A74A 3S37L 3SN6N 4JKPL 3BT2H 1XNRO 2X2YA 4WF9V 2NCEA 4N90D 5JYMA 4P3DA 4U1MB 1TYJA 5L3FA 1VPOH 1NEPA 3OR7B 4PD4K 2H32A 4U6YB 4OUOA 4XVJL 1KTLA 5KHGA 1PP9H 1NIDA 2VDLL 5JOPD 3WB2A 4HPYH 5IBTH 4F27A 1M05B 3C9NA 4GQPH 2MCAA 1NGWA 5J56B 3ROOA 1XOUA 1FYJA 1IFHH 2VL5A 1NBMG 1MIMH 2W9DL 3KGRA 3MV8D 5A2FA 1HDMA 3WMQA 1RK7A 4LKCB 12E8H 2YI8A 4QRAA 1KNOB 5D70H 3TT1L 1A7BA 1GY1A 2C1OA 3NSXA 1S9VB 3FQNB 1A02N 1J5EO 1XGYL 4NO3A 3L4UA 1Y0LB 3DO7A 4GXUM 3VFPA 4KOBA 4OCXL 2WV3A 1KCUL 4J4PD 4X6DA 2H26B 2JIZG 2CD0A 1RI8A 2PWEA 5D2LB 4O2AB 2Q7EA 4W9LC 4NJ9L 4BIOA 3QNYB 4GIAA 1M1XA 4JI5O 3T6ZA 4NC2B 4PJEE 3K0DA 4Q2ZB 4H25A 3ZKNC 5EIIG 5E1HB 1EEZA 5FHBL 3CD4A 1F51A 5HHPB 1NSNL 3O2DH 3ELQA 2E4TA 3MNDA 3I56V 2ESVE 3CZKA 1QQCA 4XBFA 3GIVB 3U36A 2IPTH 1FZJA 1NGYB 5A43C 4RAIA 4N1EA 3QJTB 3G6AB 2R2HA 4MZ2A 4DR4O 1IAKA 4I0CC 4Q6IB 4UOZA 2R8SH 1QBLL 4BZ2A 5H6QA 3RZCB 2VITB 4MTGA 2Z8WC 3I02A 2YRPA 1HILB 4LLQA 5AFAA 3VI3B 3IE4A 2C2AA 1MFCH 1U8MB 1JV5A 4E41E 4PRHB 1ND0A 1THCA 1WFJA 1BYNA 5EC2C 2X2HA 2Q7GA 2YARA 2ZXBA 1IKOP 1TJGH 3MQIA 4HWBH 4KI1A 4PJ9C 1PJ9A 4HV8B 2NY4B 5T33H 3RYFB 1P84J 1A7PL 1NIBA 3LPGA 3W7SA 1G7MA 2HVKC 4UTAL 1QCEA 4QLRA 1T66D 3O11A 4ZDHA 3L9DA 1LO2H 3DX3A 4QRPD 4Y0GA 4PJ5B 4FJCC 3WY4A 5GGVY 1TENA 2CGRL 3FQNA 5DVLA 1EDQA 2ISDA 3BUBA 1J1PL 4PI2A 1E43A 2BY1A 2GVYA 2IFGA 5EIIA 3FTGB 2WCPA 4F7PB 2WK2A 1KP2A 1NANI 3OMZA 3UT5B 5FUZL 3U4KA 1DBKH 3TBWA 4ANXA 2G2PA 2H0JA 4HUMB 3ZQWA 4YXKL 3HTLX 2DWDB 2D7MA 2QADD 2AJZA 1UEYA 5DRZB 1R5IA 2UXFA 5KBNC 3CFEB 3FONB 5CMUA 1ZDSA 2AEQL 1J5DA 4YNYA 1JXGA 1N5AA 3MA9L 4LNUA 2VDQB 5IROD 4EN3A 1QAWA 4CU7A 5ACMA 3MGOB 4JFPA 5T1KD 2BMKB 1P4LB 1QSFE 3G5VA 4FQQB 4OF5A 3M45A 3MDJA 3SCMB 5HYSG 3UEQA 2V2TB 1DANT 3DX7A 1AXSB 1TJHL 2CDFB 4YDJB 1E6OL 4URTB 5J12B 2JVDA 1G0XA 1TZAA 3WGUB 5I1IL 3C5JB 3HZMB 4Q8BA 5SWZE 1IJ9A 2BH0A 2Q8AL 5JORB 4KZCA 4GBXD 4FZEL 1FZOB 2ZNXA 1CXFA 1TQTA 4W70A 4AGPA 4R0LA 4WU7B 5AD0B 5ADOL 1ID5I 3D34A 1VQ8V 1BBJB 4M5ZH 4CGUB 3WXWL 4PA6A 5AB0A 1DQMH 3BIAX 4ZNCD 2ENSA 2WJ7A 1R19A 5EZOH 4LF5B 1TTBA 5T1KB 1QMUA 4U7MA 3IGAA 1D5MB 3ZRWB 2VDLH 3IMWA 2VS0A 3C90A 4NKDA 4UBDD 1LEIB 2R39A 1FORL 1SXCA 4LMQE 3WKYA 2VO5A 5FGBC 5J9PA 4YDJA 2ZKHH 1XBDA 2D03L 4IW4C 2QQKL 1D7FA 1NPUA 5C0RH 5SWQB 3KWUA 5DJYA 1HL9A 4U3JA 3FOMA 1U0QA 3R06A 3V4UH 5DK2B 4EZLA 2YD9A 1B3JA 3P4MA 3H9SD 4MS2A 1KKDA 3ESVF 4JPVL 2W07A 5EO0A 5B3JE 2AXHA 3TESA 3VGFA 2UZPA 4FLTA 2HLFD 3X1FA 1PX4A 3W5MA 4BK5C 5CZVL 2XN1A 4FXLA 4MDIB 3HNSL 2VXVL 4Y16A 5EIVA 5ID0A 4F9PA 3KLQA 3WFDH 4LEXH 1YEKH 3CP1A 3QIWB 3OSVA 2FO4B 4MLSA 4LEOA 1EGJH 1D6EB 1A3QA 2ZX8A 3GZOA 4PJ8B 4Y5XB 2Z7UA 3SPVA 3T77A 2XWXA 3QA3B 4MQTB 4OZHF 2UZYA 3RVZA 3AM8C 4L3EA 4LF7B 4K7PL 1G7JB 1TFPA 2OMBA 4NPYB 1M1SA 3THML 5IB5A 3L73H 2O5XH 5AVTB 1UM5L 5F9JA 2AV1B 3RGBA 3LD8C 5C09E 3MCLL 1K8IA 1TETH 5CIPB 5DHXB 4M1CC 5HI5C 1C16A 5I8KH 2F54B 3NABL 4L9DA 3DGEA 2ZE8A 1JRHL 4LSSH 3ZYIA 1RUMH 3Q1SL 4DV6O 2DQJH 1ZLVK 2WXRA 5JLZB 1RZJC 3RDTC 3G4SV 1FXKC 1QI5A 2ITCA 4UB8Z 2QJDA 3HKEA 2IAMA 2WN2A 3NJMA 4WEBH 2OMNA 4TSFG 5H37H 5B3JF 3C2SA 5DVMA 2AXGA 5BZZA 4JPWH 4LOFA 3HE7A 3L81A 1COWG 4OGAC 3HKFA 3FYEB 5GZOA 1W72B 1MCOH 4FZ8H 4BV1A 5L88H 1E9PB 2EULA 5C92A 4DHLA 5LXGL 3CMOH 3Q5TA 4K9EH 5IQOA 2BSEA 5J6HB 2FX8H 1V54C 1RLBA 5CA1B 4QTIL 1I5YA 3CFKA 1N6UA 3M17A 2QPUA 3K4AA 4EZMA 4MNQA 1UOWA 4K3JL 3TCXA 1P1ZA 4PVNA 3WYRA 1L9RA 1AGBB 3WEOA 1BAGA 2CM6A 1JPST 2XPGB 2JKJA 4U1LB 3F6LA 3U48A 3OTFA 4TUJA 3IDGB 1IEAA 1CXKA 1GYVA 2LLLA 4WSGA 1YITV 4HVBA 5CCKL 1OF2A 3ZX1A 2R29H 1A22B 1FO0L 4IRJC 2VDNH 5GTHZ 3EF7A 4KHTH 1N8ZB 2ZJSH 3INOA 3RYIA 2AEIT 4JFXB 1Q72H 4GUNA 1BZ9A 3WFVA 1ZA6B 4BK4A 3FBKA 4XXWA 4TPRL 3GMNA 5I82A 4HX1B 3W56A 3I6LD 3L3OA 1A0QH 5TFSL 5IFAL 3FF8A 3B2MA 4LSDA 3WXWH 2I69A 5JXEC 3V6FB 1FRGL 2WTRB 1R3KC 1OP9A 2FZ3A 1JXFA 1R3LC 2KSDA 1TTAA 3P77B 9PCYA 4ZUVB 5BS0D 1JGVL 1DQVA 2XV6B 5SWZD 5F7MC 5F3BB 1WFOA 1Q90A 5EA0L 1WD8A 4A1RA 5AW0B 5FEBA 1ROPA 3QNFA 5FYJH 5I1EL 5KVGL 3F7KA 3H0TA 2F6AA 4A2HA 4AVJA 5CGYC 1SOSA 3RPKA 3FU7A 4JE4B 3OFNG 3VH8G 4PD4J 1MCPL 1EZLA 3HI1B 4ZS6D 3EFDL 3LY6A 4ADJA 3BLBA 1J5OL 3AS1A 4DVBA 2QM7A 3P0GB 2WOYA 3S96B 2OTPA 3HC3L 4J42A 2DQDH 4OVVA 2XX0A 4UDUA 3VAEA 5FA4B 4FFYA 4IMKC 4FTVB 1YUKB 3UCQA 5AWNL 3L74H 1E27A 1JDDA 1ZT4A 1R3HA 1C5DB 4JW3A 1P2CA 1L0PA 1YY9C 3DX8B 2ODMA 4KXZI 3T2LA 4AVKA 5F1NA 5B38B 5I76A 1A6TB 1C1EL 3P4OB 2E7DA 5C08B 3H9SE 2ZOOA 4P23C 4GP4B 4WW1B 4F7EA 3UBXB 4XRCB 1OHQA 2DTMH 3CLFH 3CC1A 3GDBA 4NN7C 4PJHF 3VRIB 4PS3A 3ZTJH 1AJPA 4LP8A 4G8GD 4C47A 3UPRA 2PI4A 1UFUA 5LCVH 5FL7G 4ANKA 5E8PB 3VD1A 3AUWB 1D9KB 2FWSA 1Z2KA 2HLFC 4JFYB 1JZ3A 5JPMC 1KV7A 1NBZA 1Z66A 1Q0XL 3IN2A 3BMVA 2YEQA 4XNMB 2AZAA 3HR6A 3RIFF 1TJMA 3AS3A 5T8IA 4A7GF 3OXRB 4G1EB 2EYSA 3FXIC 3K3WA 3SZKC 4LFCO 4RRPG 4RMSA 1H3WM 5LGKA 4OZGE 4F7EB 1BQHB 2DIBA 3TXAA 5EC2A 4KK6D 3RWJB 5GTIZ 3HBZA 1YIJV 1E5YA 4KI5E 3VI4A 2H8PC 2C9SA 3P9LB 4XOEA 2IANB 2OP4H 5FKPA 3TNNB 3RTQA 1LQBC 4IMLB 3FB7B 5FUOH 1S9WA 5IB3B 2Q69A 4HSAC 1E9OA 5D7KE 5CEXA 4JFYA 4K9EL 1HNZO 2VRAA 4X1YA 4YHLH 2Q86A 4M1CD 4W4NA 5I74C 4PREB 1H5BB 4AGQA 3SDAC 3D2TA 3ML8A 3EOAB 3F00A 1BZ9B 4JR9L 4KKCC 4PGZA 5E23A 4YHPB 3VXSB 3W9DB 5H37A 1GY2A 5I6KA 2X05A 3SDYL 1CI5A 2R15A 2PW2A 3LH2H 2B5IB 2AJSL 3O8XB 3LVEA 4JFWA 3ABZA 4XVTL 5B8CA 2NT1A 1DTOA 1Q1JH 3GKZA 1IXMA 4ZO7A 1R3IC 1ADWA 3NK4A 4BWAA 3CHPA 4XPGL 2NXYC 2OTWB 2AJVH 2UX7A 4EO5A 1CC3A 1IO4C 1RZ7L 1R5VB 4DR1B 1KGCD 1CU4H 3BIKB 3ZHUA 4LIQH 1JGDB 4PJDA 3V0FA 4WFGD 5EFIB 1DYZA 5GJTL 3M7MX 4B5ZA 1S46A 3IYLW 3V6OE 2W0FB 1G1XB 2AGJL 3B2EE 3OTTA 4FTVE 4JAMA 4M93B 3RYIB 2XZCL 4FNRA 1CFVH 2YBGA 2WIMA 4GAYA 3BZDA 3CZLA 4XBPA 4JM2F 2X6MA 3RU8H 4B0MB 4V2BA 1PG7H 2Y06L 2WSSG 3MPCA 4XPTH 2FWOB 1FAFA 2QM8A 1X7SA 2N1TE 4ONFL 3FUDA 3MV8E 2K9UA 5IJVA 2MEJB 4Z7QF 2LOEA 3QAQA 1NUNB 2PF6A 2VDQH 4KDTA 2YIDA 4H37A 4W9KC 3FQXA 4NQQA 3UG5A 5D4JA 5FO8B 1QSFA 4J1UA 1HQ4B 1NLDH 2I32A 1RZKC 2EDLA 2Z7YA 4NKOB 1FPOA 1A1NA 4DR3B 4ISVA 2NCMA 1A8JH 1ZIAA 4LNRB 4X9FA 4X83A 5C0ND 1CR9L 1WB8A 1Z1WA 2VDRL 2P24B 1LL1A 1BLNA 2PWDA 3CXDL 2GEEA 3FQUA 3US0A 3TF7C 1B2WH 4H40A 2FT6A 4APQB 3VWKC 4GO6B 4DZBB 2ZG3A 3GQFA 5CWSB 2RHEA 5IQLA 2WGXA 1M71B 4C55A 3CZFA 1O75A 4X5PA 3NVQA 1P7KA 4TSBH 4CRPA 3HZKB 4AH2A 3T1YB 1PDKA 3ZHFA 5JW5A 1W0WB 2KQXA 4WV1C 2X5PA 3JWNG 1F4XH 4OLUL 3ZTJG 4DP5X 3GWOA 3UTPE 1QR4A 1S9XB 3KAAA 4NWTL 3NCFB 2IG2L 5HHME 2JCWA 4H20L 1DO6A 3QJUB 2QPDB 4NDMB 3TBSB 4AUYA 5LDSA 2J1KA 2NQDA 2P8MA 4APQD 3IMSA 4I87A 4OM0H 2P80D 3FAVB 1EXUB 2K6YA 4GKSA 4J27A 2A4CA 5PAZA 2ATAA 3WJJC 3ILQC 2YR3A 3LHPL 4PV8B 2J55A 4MX7A 3MRIA 4XWOD 4KTEL 1K8IB 4JVPA 4Y4FA 1P4BH 3MRRB 3TH3T 4E9QA 2IH1C 5KJRL 2BVPB 1OPGH 2PO6A 1ODAA 5DEGB 4NCC1 3F7YC 3V55A 1IGCH 1IQWH 5LXTB 2C1PB 2CGRH 2Y25A 4Q6KA 1W6WA 3WXVH 2IJKA 2ORBH 2GSGB 4LCUC 4MFHA 3C5JA 4ODTL 2YLKA 3HG1E 1NBYA 3D8MA 2AZ0A 2DIAA 3QRFM 2WP3T 1VFAA 2BCKA 4M62H 3US1A 3L1FA 1Q94B 3LH2L 3MRLA 3QJHA 1PNLA 3QPQC 2XFGB 3PL6D 4NUJA 2K9FB 2DWTA 4WUUD 5LNDA 1Y6NR 4NQUA 4YBLB 3OF6D 3EO9H 3RUGB 4K8RH 4E41D 4I3SL 3KWTA 1ZA3A 2L0DA 1TVBA 2B4CL 3FQTB 3H9ZA 3MGAA 3ZY7A 3A4DA 2BVUA 4EIZC 1T0NA 1XF4A 2XN9E 4WF7A 2FYYA 5DZNA 3AREB 1E0OB 2YMXH 4PA9A 1QUNB 1ZDQA 4LSVH 5L3GA 1TMQA 3QI9A 1K5NB 2X7LA 4A2LA 5JA9A 4OB5L 4G27B 1EGJA 4E41B 4Z23A 1KGIA 4Y2DD 1S7WA 4ELDA 4BZ2L 1E7VA 3PWJA 3QUXD 5HVGB 1MCDA 4XN2A 1HAUA 3N42F 2XY2A 4HUCA 4NSKB 3BJ91 3W39A 4GAFB 3DX1A 2P9RA 4KUMA 2VCOA 4U1JB 1N18A 5HHOE 3VX0A 3FTGA 1HHGB 4K71C 3T04D 3DJZA 4OZGA 3VI3A 3KYNA 4GAGL 3NBNA 3QFDB 2ZKMX 3IN0A 4N87A 1OK8A 1TPXC 3WN5B 2PXYC 4JRXD 1Y1DA 3FT9A 4XXCA 4PFEA 3RVXC 3UH8A 5LGJA 4BKLA 4FI8A 3V95A 4KXCA 5E4OA 5E7FA 5EDXA 1CFNA 1U8PB 3IDJA 5C09A 4WI6A 2GHZA 2KMWA 4W9DC 1XMOB 3JV5A 4PGEA 3ULUC 5IVNA 1RZIB 4ZQKB 1JYXA 1QLRB 1DBJH 3WG7C 2YAEA 2X0LA 1L6ZA 1XZ0A 2XZAL 4P07A 1JNLH 3WTSA 1FQ9C 1L5GA 1EEZB 1H8LA 3O3AB 1GJIA 4R7VA 1C5CL 2XBTA 2YIAA 2WVVB 5CGTA 1QSEE 4YHLL 3FT3B 1YDXA 5EZIH 4NQEE 4RGOH 4DGYL 3KYOA 3QZPA 3QC6X 3V4VA 4U0RB 5IF0A 1HTYA 4CMHC 4RRPM 5E0FA 1PLBA 4RWYL 1L0XA 1H3UA 4Z7OB 1N19A 1U4EA 3W3BA 5DD0H 2Y07L 3JSLA 5E9DE 1AXTH 2PR4L 2WBXA 1J8KA 1NAKL 1WF5A 4UIMA 3BA9A 5GGSB 4BINA 5KAIZ 5D7JA 1T3FB 2AXTZ 4F6RB 5DA0B 3VWKD 4U1KB 3PP3K 4DR6O 1ETZB 1XTLA 4P2QD 4CBZA 5IMMA 3EYUH 3GS0A 2WXGA 5IQMA 3B9KA 1U3YA 4OU3A 4O4LA 4J10A 3OTOB 4HISA 4M3JA 5DJ6A 5IG7B 5B1BB 1A4JB 1DJGA 1PX3A 3HC0A 5HYQB 1Q82W 2FD6L 2G5RA 1YJNV 5KG9A 2NW3B 4TLSA 4DZ8A 4X64B 1F90L 1PNCA 2ZX9A 4ZQTA 4IBUA 4HS3B 4HJJL 4ELMB 4QXGH 5ILTL 1OCRB 4ODVH 3HRZA 3RNQB 1VQ4V 2R9RB 2JI2A 4IKIA 4LEEA 3RVVD 5DJ8A 3LMJH 1QQDB 2DQTH 3NJIA 4GS7B 1N4XL 1U36A 4LRIC 4L23A 3WJMA 4TTDD 4IHJB 5F96H 4UQ3A 5IQ7L 1HNXB 3D52A 3GHBL 9CGTA 1BFSA 4JVWA 2Z0UA 1S78C 1VGKB 2FVNA 4WGWB 3UJJH 2E47A 4PRPB 5TDNA 3CB2A 4M4PA 1WAAA 1JA8A 4RMQA 4JI6O 1RIVH 3LXAA 1AZVA 5IJ0A 2MTAA 3L5WB 4G7QB 2YDEA 1NCOA 2C4XA 3TJPA 2FEDD 3SE4C 3GSRA 1JS4A 4ZFOL 2YJLA 3ULAB 5EK0A 4PIBA 43C9A 1UTDA 1OSPH 1EAPA 1QI3A 1UB6A 2IH3B 3S37X 3L4CA 1JHKH 5D2LE 4NFDA 5EUOF 3IC7A 2M7WA 2QMKA 4KO6A 4R0LB 4JFDA 5AD0A 3CZUB 4XHQA 1K3ZA 3PL6C 4PPTA 5BXFA 2DLFL 1A4KB 3D87B 1I3GL 4ZUUB 3VSQA 1YEFH 1XH0A 3KPQA 4K3GA 1V5JA 5J2TA 5C6PB 2FX8L 2J2ZA 3C8KB 2Q10A 4A2FA 4NN5C 1PW3A 3KXFE 3DIFB 3BVOA 1Y07A 2LQRA 3HLKA 4QRRE 1R47A 3NSYA 4FLWA 4PMEA 2WINA 3OKMA 3CN3A 5HHOD 4ZFQA 3N27A 3CC7V 2FYYB 1XXFC 2KQNA 4LNUB 4DR2B 1AD9B 1CP9A 3D25A 3FO0L 4FLSA 4QXTB 1VSCA 4EOWH 3HNVL 1EXGA 4GMTH 4YSTA 1JNHA 4NIKB 2QGEA 3NJFA 4MD5B 4XZ4A 2HRGA 2QKAA 2YXVA 2JKSA 4ZIBA 1FVCB 2HN7B 1QQDA 2QVTA 1WCQA 2W9LA 4H8WC 4TV3A 5DMKA 1E8YA 3SKMA 1U96A 2NXZB 4IHOA 1ROCA 1INQB 1Q9LB 1S7VA 4LF8O 5GGTA 3JBG7 1TR7A 3IJYA 3ZQ9A 3I9PA 4R4ND 3V4PA 3JSSA 3MCLH 3AS0A 2HJFA 2YSTA 5CZRA 5ID1B 1R6VA 2ADIB 4KK8C 4EPSA 4NQVB 1PFCA 4WWKA 3JVFC 5DFVC 1G4MA 2XUWA 4GSQA 4H0HB 4NNXA 5DGRA 2IDSA 3MRNA 5GRVK 2L6LA 1AD9A 4XNZB 1OCZC 3H6JA 3TO2A 1KU9A 1GGIH 3HBPA 3BAXA 1I1YB 4WNQA 2XDHA 3V0WL 4C54A 4C59B 5T1DL 3WIHL 1SETA 2Y07H 2UUBB 1BJMA 1UXWA 2NNUA 4F37K 3N55A 3U0ZA 5D4QA 2E75C 2PNDA 5D7EA 2JKTM 4ODUA 3RUGF 2YGPA 4PCTA 4IBSA 3UIYA 4ESKA 5LHGA 2ICWI 5BZBA 2HXAA