2OCCB

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2occB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2occB02
3EH3B 5AKRA 3HB3B 1T5KA 3NJGA 1NIBA 1NTDA 1N68A 1OE2A 3D12B 4QLWA 1UATA 1MDAA 1GY1A 3CVDA 1SDDA 2BHFA 4DP1X 3FS9A 3S3CB 2PP9A 4DPCX 1ET8A 4KOBA 2OCCB 1WA0X 3X2QB 3IN0A 1JZFA 1ASPA 1OF0A 2IWFA 2I85A 2IDUA 3QPKA 2VW7A 4DP4X 3G5WA 3BQVA 5I5IA 2DY2A 2CAKA 4YSOA 4G72B 1KCBA 1JXDA 1PF3A 2ZWNA 4BWWA 1N70A 4CSPA 3NJFA 2BWIA 1KDIA 4F2FA 6PAZA 3S8GB 3AW5A 3X1BA 1ZPUA 5I26A 1NPNA 3CG8A 1XMEB 2EIKB 2I7OA 5PCYA 3QJVB 2AVFA 1GR7A 2YAPA 2HLEB 4AX3A 1CYWA 1IBYA 1FFTB 3FYEB 3MBWB 1NIDA 3OMAB 4W9ZA 1TEGA 4N8UA 3SBQA 5F7AA 1A4BA 2PP8A 1JZEA 2B3IA 2HX8A 2BO0A 5I6PA 2PPDA 1ILSA 1MG2C 2NRDA 3C75A 1ET5A 5B1KA 3H56A 3NJIA 1A4AA 2FQFA 1ZDQA 3AY2A 3QJRB 1SHXA 4A2DA 1KBVA 2DWTA 3ABMB 1SF5A 3NJKA 4HCGA 3QJSB 4E9TA 1PLBA 4KO9A 2VMJA 4JHUA 1JXFA 1KCWA 1ETJA 1OE3A 3AG1B 3FSAA 5IY5B 5I6OA 1AANA 2GB2A 1SNRA 2YAEA 2YAHA 3CVCA 2XYBA 1L9SA 1GYCA 1AZRA 2J5WA 3U25A 2AANA 2BP0B 2DYSB 1SFDA 2TSAA 1ASQA 3QJTB 4E9YA 1AZNA 1J9RA 4BXVA 2YEVB 4P5SA 2GHZA 1BXUA 2YXVA 5B7MA 3EF4A 3NSDA 3EH5B 1M9WA 3NJHA 2HX7A 3NJNA 3UAAA 2E86A 1AACA 2IDQA 2GC4C 3NSYA 1A3ZA 4KO5A 4AZUA 2AFNA 3OMNB 1SJMA 2R7EB 4NB7A 3WNJA 4YSEA 5I5MA 3AG2B 4A2HA 3NP3A 2EINB 4KO7A 1IC0A 5AFAA 3T6WA 1SF3A 1JZIA 1OV8A 1OCCB 2QDWA 2XV2A 1KGYE 2H5UA 4HAKA 1J5DA 1AS7A 1DZ0A 1TU2A 4M4RB 2GI0A 2UXVA 4JKNA 3PCYA 4UF7C 1WS8A 1PZBA 4E9VA 4AKPA 2QPEB 2GIMA 1BYPA 2BP0A 2YXWA 2XXFA 2IWKA 1E30A 5B7EA 2FT8A 2XU9A 1BAWA 5LDUA 2PP7A 5B1AB 1BQRA 5B3SB 1AZUA 2H3XC 3X1GA 5I5JA 2P80D 2J57A 1CURA 2UX6A 3T6XA 1FA4A 3DTUB 4QKTA 3ABKB 1V55B 1GS6X 4HCIA 4K9JA 5TK2A 3JTBA 1RZPA 4G7RB 6PCYA 1TKWA 3HEIB 3ABLB 4AKQA 4E9XA 3OMIB 3UGEA 5A7EA 3S3DB 1F56A 1VLXA 2UX7A 3PAZA 1JXGA 1JVOA 2PCFA 1GS7A 1PMYA 4A2FA 1IKOP 2FQEA 2FT6A 1CUOA 4DP9X 8PAZA 1PAZA 1KDJA 4GXFA 3TASA 1AG6A 3X1EA 1BQKA 4DP7X 1W6LA 3KW8A 1ZIBA 2HRGA 4WTQA 2CUAA 4DP8X 1YLBB 2IDTA 3OM3B 2DYRB 3H4FA 2DWSA 5B1JC 2YARA 5FC9A 1L9OA 1HAUA 2WO2B 2B08A 4ZK8A 1QNIA 2X88A 3X1FA 2OJ1A 3NYKA 1FWXA 1X9RA 2QT6A 4NERA 1AQ8A 1KBWA 1OOWA 3NJLA 5PAZA 4GP4B 4YSCA 4P5RA 4DPAX 3H4HA 1TEFA 1PLCA 1PLAA 1SHWA 2YAOA 4HZ1A 1PZCA 4PCYA 4F7KA 1JZGA 2BW5A 4YSRA 3V9CA 1A8ZA 1NPJA 2XV0A 3GDCA 7PCYA 4GP5B 2OV0A 5TK4A 3N2JA 4BXSV 2J56A 1JVLA 3AZUA 1E5YA 1HAWA 3ZDWA 1SFHA 1IBZA 4BK5C 2JXMA 4A68A 2FQGA 3S3BB 1WS7A 1OCOB 1M56B 2YAMA 1JERA 4DP0X 4KNSA 1EHKB 1NIFA 1NINA 3DKHA 4CSZA 7PAZA 4UANA 4AKOA 4FA7B 4BWTA 3IBOA 1J9QA 3CDZB 3ABGA 3EH4B 4TXVB 5I6LA 1XB8A 3UACA 5I28A 1AAJA 1E65A 1DYZA 2FT7A 4HCFA 2X87A 3PLYA 2AZUA 1GS8A 1BQ5A 2XUWA 2CCWA 5EHFA 1JOIA 3ZBMA 3IN2A 4MFHA 2HXAA 3BVDB 1A4CA 3PPSA 3FSVA 3IE9A 2GC7C 3T6ZA 3PAVA 2GSMB 4BDVB 2IWEA 3FU7B 5I6NA 3GYRA 1ZV2A 2IDSA 1MG3C 2Q9OA 1ADWA 5B1JA 3FU8A 3NSCA 4KOCA 2PPCA 3NJJA 1KYAA 3FU9A 3FPYA 2QPDB 3OD3A 2CALA 4G71B 4YSTA 3UABA 2DV6A 2HX9A 4WKXA 2A3TA 3UAEA 1ZDSA 2YQBA 4DP6X 4YSPA 2VSKB 4YL4A 4A67A 2AZAA 1ET7A 2BP8B 4HIPA 2VW6A 3QJQB 3QQXA 3T71A 4N4YB 5AZUA 1AS6A 2TSBA 4YVUA 1V10A 4Q8BA 1NWPA 4KNTA 2RACA 1E5ZA 3TBCA 3NP4A 2FWLB 4JHVA 4L0PB 5I6KA 1V54B 1QHQA 4EF3A 3WIAA 2R7EA 3ZX1A 1ID2A 4A66A 3FU7A 1WAEA 4YVNA 2BWDA 1NZRA 2UXFA 2LLNA 2Y1AA 2W8CA 3WKPA 2IH9A 4E9QA 2Q5BA 3L45A 2XWZA 2XX1A 2PLTA 3WNIA 1OE1A 5D4IA 1GW0A 5D4HA 1OCRB 4M3HA 2FTAA 4GY4A 2YAQA 2MRYA 2WO3B 3GXUB 4NAJA 2PCYA 2BP8A 2CBPA 3PAUA 4UAHA 3ASOB 1I53A 1OCZB 1PCSA 2H47C 1JZJA 4F2EA 1L9RA 4ENZA 2XLLA 1AIZA 2XV3A 2PPAA 2FQDA 1XB3A 2QDVA 2IH8A 4DPBX 1J9SA 1L9PA 4DP2X 3ERXA 4AI7A 2EIJB 3WG7B 1NWOA 1XB6A 1RCYA 2XXGA 2VM3A 4Q89A 3WKQA 1AZBA 2GBAA 4RH4A 3NT0A 4E9WA 3V9EA 4KNUA 4G7SB 1ILUA 2ZONA 5E9NA 4GP8B 1WA1X 5D4JA 3FPXA 2XX0A 2CJ3A 1CC3A 2JKWA 3S8FB 4A2GA 4PAZA 2IDFA 1IUZA 1WA2X 2WSDA 4DP5X 3FT0A 1AG0A 1BXAA 4KO6A 4HHWA 2BZ7A 4G7QB 1PY0A 4W1TA 3RYMA 2EIMB 1CYXA 2ZOOA 1RKRA 3IEAA 3FYIB 5ANHA 1NDTA 3T6VA 1RZQA 1AZCA 4E9RA 1NICA 3NJMA 2VW4A 4HALA 4X4KA 2XVBA 1KV7A 1PNDA 5B1BB 2PPFA 1EZLA 3MX0B 2EILB 2VSMB 1W8EA 3PXLA 2J55A 1BEXA 1BYOA 1QLEB 1BXVA 3JT2A 3DIVA 2IAAC 2Y69B 3SBPA 1M57B 1GY2A 2VM4A 2YAFA 1AOZA 4A2EA 2N0MA 4YSAA 3QJUB 3ZIYA 5I6MA 4YSSA 1MZYA 1R1CA 2ZXWB 1AR1B 1B3IA 3SBRA 1W6WA 1J9TA 2W88A 4YSUA 1NIAA 3TBBA 2P80A 1NIEA 3SQRA 5F7BA 3TU6A 9PCYA 3OQRA 3CDZA 3CVBA 2FNWA 1SDDB 3UADA 3X1NA 1J5CA 1L9QA 1ASOA 3NSFA 1MZZA 1L9TA 2MTAA 3AG3B 1E67A 4YSQA 1JZHA 3ASNB 1PNCA 2VN3A 3FQ1A 4FAAB 2JFCA 3FSZA 4G70B 2HZHA 3TA4D 1AS8A 3EHBB 3WI9A 1A65A 2PPEA 1GSKA 2BZCA 3AG4B 4BWUA 2BW4A 5B7FA 2I7SA 4HHGA 4GYBA 4BDVA 2HRHA 1PZAA 3KW7A 3FSWA 3CZUB 3FQYA 3T9WA 3N55A 2UXGA 4YSDA 3FQ2A 1URIA 1X9UA 1ZIAA 4E9SA 2FJSA 1HFUA 2UXTA
chains in the Genus database with same CATH superfamily
3DOHA 3MLTB 4YIQB 3MRRB 5ACZA 1CD1A 5MENB 1AB3A 4UDUB 4DV1O 3W9EB 1DQDH 3THOA 2OR9H 4RMRA 4WW1A 3VFPB 4ONGH 1CFVH 1G43A 1J12A 4UQ3B 5HHPB 3IN0A 3O3BA 3VAEA 4HUUA 4OCMC 4OGQB 4A7UA 4DO5A 1IGTA 2ITDB 4JDTL 3OMZA 3V0VB 5A40E 5JDSB 1L7IL 2Q6WA 2NUPB 3G5WA 1TCMA 4JRFA 2XA3A 2R1XA 3RUGF 1TTRA 1UJ3B 3HPJA 3ORJA 4Q14A 3LPFA 3IT8D 2A6DA 1E6JH 2HN7A 5IT2L 4G6FD 1UZ8A 1PJ9A 2JXMB 4N8CH 4DK6A 3WS3A 2FK9A 3CFIC 3GXTA 5L88H 3CK0H 3GLZA 3KLAA 4HMDA 1NPNA 3AREC 2DQCH 4M62H 4YBQD 2ZX6A 2EIKB 1U8MA 1IQWL 2BVPA 4DV4B 4I3SH 2P9RA 4JRYE 4NXNB 5LGHL 1FVCA 2V37A 1P2CB 4MHHI 2Q0OC 2J12B 3GMOA 4FTVD 5I8KL 3DX3A 1RSOA 1H0DA 4FQLL 4DH2A 2QE7G 3FFOA 4UOW0 1BF8A 5EBWC 5C92A 2YPVL 5F3HA 1ZEAH 4J1UB 2O57A 3CPUA 5ICYB 3AWEA 3IWUA 1VFBB 2BSKB 4C55A 1RULH 4ZX3A 3VG9B 3V8CA 4GW5A 1I8MA 4FQQB 5K59E 4MS8C 2OZ4A 1GPOH 2A9CA 2F54D 3KPOA 2OYKA 1NBMG 3VXUD 1MRDL 4G5AA 1QNZL 2BMKA 1JG9A 5F7FA 3ZZQA 4N6QA 4GO9A 3V55A 1NOAA 4L05A 1GL4B 2HT2D 4BH8B 4AW4A 2B5IB 4X80L 3H9VA 1T7VA 2X4QA 5DTFA 3LSSA 4KP4A 3SHSA 5EORL 4GB9A 2YD9A 4QEGA 2YAEA 1G87A 3NPSB 2VB5A 3MVSA 3V7MA 3V5KA 3ZGHA 5L2KA 1GGYA 1AZRA 3RIAF 5A7BA 3T1YO 3CFQA 3L4CA 4ANXA 2EIZA 4B9IA 1XI1A 5K33A 5IB5A 2LT9A 3QEHA 5D70H 3G6JF 3H7BB 3D34A 3FF8A 1BXUA 1IC7H 2UXBO 4P2QD 4AJYV 1F4AA 1FGVL 4I9WE 3D4CA 3SQOH 2IANE 1QVOB 3EFFB 3W5MA 1Q9KA 1T5XA 1CDBA 4FE9A 4X9IA 3TEWA 4K94L 2Q4PA 1SDYA 2OX5A 2E75B 2WWKO 2FO4A 1ZS8A 3PGDA 5IHUL 5HGGS 2VSCA 4M8UA 5FNVA 3WHE0 3Q3GB 1P7HL 4DV3B 3GMQA 3IMRA 4OZHE 2VDNB 2MTPA 3OKEB 1TA8A 2WP3T 2Z8WC 4KHTH 4ZNEA 4MJIB 5EN2B 2VRKA 3RVTD 1BQHB 1PZBA 2QGCA 3ARTA 4KXAA 4XTRC 1I9RH 4DO4A 1AO7D 4TUUA 1B9ZA 1LP9B 5FOJA 3GHEL 4G2AA 2X9YA 5EBLC 3HR5B 4OXSA 2AEPL 3IU3B 1WAPA 1ZT1A 2AKRB 3X12A 1GJWA 1DVUA 2Y36L 3W39B 1ES0A 4X6CB 1S5HA 4HU8A 2VDPH 1VIBA 1PZ2A 3D39D 1DJHA 1NC2A 2R23A 4CMMA 5DFVC 5HHXL 1EHNA 4YDIH 4UU9A 4BE6A 2GBTA 3QNZA 4F8PA 1LEKB 3S3XA 4D7PA 4Z8FH 2CO7B 2N0KA 4RUEA 1PG7H 1YI2V 3WIFB 4LF6B 5AG2A 4PJBB 4WEMB 1O9HA 5L3BA 3WO4B 1OAXH 1JWSB 1NM9A 1DLFL 5AYTA 4ZFZA 4X66O 4IEFA 4I2XE 1I8LC 5T8IA 4I18A 4I4TA 2VLJD 1GS7A 2VUYA 3LH8A 4JHZA 5ICZA 5BQ7B 4TV9B 1KDJA 1BQKA 1RQ5A 1QX1A 4X7DC 1RMFL 4DV1B 3T2OA 3IXAA 4GSRA 4QGTA 5FB8B 2Y7LA 3CCLV 3NN8B 4CA4A 3G5ZB 1RZJL 5HTSA 2X6AA 3GSWA 2NN4A 1KEGH 1XH3B 2OZNA 3J81N 1FUNA 3C6LD 3HMWL 2HKAA 3HHSB 3OR7B 4KUCD 5DK0B 4ZFQA 3SE4C 3HOGA 2OJ1A 1O6VA 2E9BA 5E6ZA 1YQVH 4OF3A 1TSRA 2QTSA 3LRLA 4K8RC 3TFKC 1MCOH 2APTA 4AL8C 4XMLH 2G0KA 2IFFL 3PIQA 3ULVE 5EPMA 3G67A 1ACYH 1TTFA 5BRZB 4PCYA 1QR8A 3FONA 5LHGA 3O11B 1NGWA 1VFOA 4NZFA 1EJOH 3DJSA 4JYYA 1YSCA 2YGVA 4QXUL 3OZ9H 1WN7A 1TJIL 1JTOA 3BSGA 2GIYA 5KYUB 3KYOA 3BUBA 3PWPD 4LFCB 3CFJA 4TNEA 5HHME 2PYFA 5JPNA 3DTXA 1MIEL 3MV8E 4QHNB 4QRPE 1MJ7H 4HWBL 3WHXA 2YXLA 2X4UB 4ZTOL 2WA4A 2PTUA 2PCPB 3UEZA 2DYPD 4WWKB 3VQ1C 1A02N 3ZE0B 2RCVA 1XQ8A 1E4XH 2B1HL 3BVNB 4Q6YA 2VR6A 1BREA 2CO2A 3F7YA 4IBTA 4IKKA 1FZJB 4XNXL 2R1WB 2WXKA 1QA9A 4PG2C 4MCMA 1C5DB 5IJDC 3QQ3B 1NH6A 3TYGH 2JJSC 5I6LA 1F4XH 2WXPA 1XGTB 2D7QA 4I55B 4IS6A 5I1EH 1INQA 4AYFB 4GKZB 1OAZH 2OQJA 4AILC 3FT1A 4GUNA 2R2EB 4NUPA 1WCBB 4R4FL 4G3YL 1X44A 1JDDA 2CMRL 1EO5A 2BIQA 3U2JA 3PDDA 2GPZA 2X42A 2JB5L 1GZQB 3NFNA 5FO8B 4B3SO 2HB0A 4LOVA 1UWGL 2XN9A 4EN3C 2MWCA 1NBVL 3C9NB 5E8EB 3EXAA 4OPHA 3F5WA 3T6ZA 3GMRB 3HVNA 3MNWA 1K4DC 4OBRA 3QGVA 2YICA 2B15A 3AMLA 4LARL 2LW7A 5TE6L 5BS0A 1MG3C 1ADWA 3QNXB 2YEQA 4LAQL 4PJ0Z 4WFHD 2D31B 3CCMV 1MCLA 3WN5A 1KYAA 5C2BH 1VP7A 2O5XL 3EBIA 3EKCA 1MFCL 1E4KA 5BZZA 1MPAL 2CH8A 3FB6C 4P46D 4RGND 1TQBB 5JOPD 3A47A 1NCAL 2H0PA 5D1ZC 2OTWB 1GZHA 2AHYA 4HOZA 4APQD 3FUJA 2Y6SD 1N8OE 4NCC2 5TPWL 2Q0AA 4ZMLA 2J20A 3ZCCA 3EO1A 3GXIA 1FYJA 4F37K 5JNYB 1GMIA 5FR3A 2FWLB 3OAYH 4HV8B 1J05B 1OCWH 2EIJC 1KPUA 1R3KC 1QHQA 4TVPD 1N5AA 1FVEB 3QXTA 4JL1A 5D1XE 5H2BA 4YX2L 3W0WB 2BRQA 2E7HA 2Z4TA 3RP1A 3FHQA 1AGBA 3SKOA 3VCLA 2A0LC 5KYNA 3QO5A 3W7UA 2BRRH 3UTOA 5C1MB 1EA9C 3NIDB 5J6SA 4LLVB 1ULVA 4BBWA 1RIHL 2G38A 4E42A 2X2HA 4NHUA 4RFNB 5LDSA 3MGOA 3BEVA 4P9OA 1QRNB 4L9LC 2JMRA 2X4SA 5D4IA 1K73W 4MVSA 1UEMA 2QHRL 2CLRA 2WLKA 4IIZA 4Y16C 3QIWC 3K04A 4DVBB 4PTTA 1X5FA 3BP7B 5EBMC 1XTLA 4MD5A 3UCSC 1U92B 4IRJD 4UOW1 1FKAO 1HKLH 2WAHA 5FM5M 3N06B 5FOBA 4ZXBB 3TNMB 1EGJL 2WLNA 4OVUA 5DUML 5C6WH 3HPLC 1ZA3A 1BE3H 1SQXH 2IW5A 4TULH 1P4BL 3CFBA 4DN4H 2FO1A 1HYRC 1KC8W 3ZYIA 4NPYB 4X1KA 2ZE0A 2O6EA 4X66B 5A2BA 2VNCA 4XCEB 2F54A 3BABA 2XV3A 2FQDA 1Y74B 3QJHA 3VXUA 3WE6B 5D96C 4IKNA 3CQPA 5D1ZI 4BIZA 1A6VH 2PI5A 1KCSH 3ERXA 5CA0B 4NENB 1L5GB 4DP2X 4PVBA 1B2WL 2J8OA 3QP3A 5C7XH 4N23A 1GO3F 2GBAA 1WZMA 2WLMA 3QZNA 1T0NA 1OAUL 1FRGH 4S11A 1YDPA 2ZONA 1AKJB 1Q9LB 3G9VA 1NGYA 2HFTA 5EV7A 2EXWD 1AR2A 2XX0A 4D7TA 2DRUA 3AROA 3E9UA 5BV7C 4MVBD 3O2VL 3DETC 2QQKH 3W56A 5I9QC 2Y7OA 4K8RH 2ATKA 2XRAH 1FNEB 4XVJL 5E00B 2F5AL 4MVRA 2A1WL 2F5BH 3D4GA 3I6SA 4NKMB 4JFSA 4KO6A 5T1KD 2BOCA 2NQ3A 3CCQV 1AR1C 1ZVYA 1IM9B 2JB6B 3BWZA 2WSPA 4YDKL 3EJZD 3ZJZA 1R5WB 4B0MB 1N5YL 4HUWA 3WN6A 3O0RL 4P2QA 1WT5A 1MAML 1E27B 1XEDA 2J4WH 3LKOB 4Y4HC 2FBJH 3NCYP 4CW1A 4HG4K 3FAVA 3D0LA 5E1AB 1NCWL 5LG6A 1FN4A 4UCTA 5CSZB 3V52H 3A6BH 4JMNA 3UERA 1ZTMA 4N0FB 1DQTA 3PXLA 2IJ0C 5T3XE 1GAXA 4M1DH 2BIMA 2DLGA 4AEIH 1JNLL 1H9DA 5IJKC 5DVPA 3WU2Z 1BXVA 3ZMVA 5CLXA 1G6VK 4FJ6A 3DIVA 1JRHI 5I8CA 3FFDB 3T8MA 5FK9A 3WHE1 3W5NA 1DUZA 2CA3A 3QNFA 2EDDA 5AOIA 2GV9A 3HS0B 3QXVA 4WSJA 3VGAB 1BOGB 3PNWA 4OF0A 4EKWA 4YSAA 2WLIA 1AO7A 2NSQA 5F1OB 5LXTB 4ZFOL 4YXKL 1DUYB 2DWEA 3KWVA 4GXUM 4K15A 3RI5K 3CLFH 3H3PL 4XBFA 4O2BA 3EZ8A 1LILA 3FCSA 3LY6A 2C5DC 4DZ8B 4YSUA 1DO6A 3FN3A 1F3DH 4PRID 4XNQB 3D39A 1FAFA 1NTKH 4JFHE 3HRZA 3TWCL 4FF9A 5FO7A 2V4DA 1GJIA 4B3SB 25C8L 3BLKA 3VD3A 2HMID 4EVNB 5DZOA 4UFZA 3UADA 1NSNH 3U79A 1ML0A 1P4LA 2OCCC 4LLAA 3OKKB 4JI6O 1U91A 1EZVH 4YPGA 2D7PA 2C1PA 5LG1A 3SODB 1QFWL 3DMMB 3NSXA 1JPSL 3SGKC 5C0EA 3VB9A 3ASNB 4G8GB 5DRZB 5ERWA 4BSVB 1LNUB 1UD4A 2X10A 3F58H 4P4KB 1QFOA 4PJEF 5BMFL 3WKML 5I2IB 4LU5H 4EO5A 5AENA 4YIPA 4H1LG 4S2SA 3IGFA 4ELKB 4I50A 2BZCA 1OK0A 2VLJA 1R0AH 3RTLA 3MCLL 5CKAA 2ICES 4NTWA 3CJJA 4HKXA 3U46A 4FDWA 1ZOXA 4NJ9L 4F93B 1GAFL 4GQ9L 1NAMH 2D0GA 3H01A 3QUYB 4FVMA 3FTGA 2LQTA 2DBLH 2KHAA 3GXFA 2XTJD 4LGSB 3QIBC 4AIXA 3VDAA 1C1EL 1L6XA 1EFXD 2KMWA 5JW3H 3H9ZA 2WCGA 1URIA 3UMTA 2EDOA 2OR8A 4HFWA 4J3OC 2CUHA 3QCTL 3C6LA 5JJEB 4NZ8A 1BFOA 1N68A 1VZGA 1U3HD 3LIZH 1W15A 4G7VH 3D2UB 4K3JL 3LZPA 1CFTA 1HIMH 1KNOA 2ZCHL 4TLKA 4JFFE 4PJXE 3BPLB 2ZWLT 1UT1A 1VQPV 5BPPA 1P84K 2N56A 4DV0B 2DQEH 2AQSA 3ELQA 3AADB 3CSXA 3ESPA 4OZGE 4WBNA 3KPRD 4GBXB 4X20B 1CPUA 4MASA 1VEPA 3I6LD 1CBVL 3CE1A 1IQDB 1N8RW 1OLLA 1MHCA 2H32B 5E24E 1JCHA 2CAZC 5C07D 3ASWA 1M42A 3SKNA 4JFZH 2IH3C 1GIGL 5M95B 5DHYA 5IBLD 3J7AU 1JXDA 1EWHA 1K9MW 2Y06H 4QO1A 5TE7H 2ZXGA 4IGBC 3FNKA 4UQBA 2MQGA 3NEEA 3QQ4A 5IQ7L 1DHKA 1JGLH 2EH8L 2VERA 3PWPA 3AG1C 1Y0LA 4F2FA 4M5ZL 5I26A 4H26B 4PR5A 5JQHC 1H2GA 1S72V 3E8FA 3R7RA 4RZKA 4Z3TA 5AVWB 4BQ6A 2DYPA 4HWZB 1CLYL 2P4VA 4NSKA 4GAYB 3EYOB 2IU0A 1U58B 3AAZB 3JXAA 2CD0A 3FQXB 3II2A 1FFTB 3VGHA 1RJZB 2E9JA 4AQ1C 4K94C 3FB8A 4XPFH 1A4BA 3B7YA 5AVSB 3S4SG 3VM7A 5CBAA 2EVGA 3DO7B 1WZ1H 3FZUC 4NGHH 3RUGE 2PPDA 3K2KA 4IBVA 3MCKA 3JARA 2WGXA 3VGFA 4TV8B 2IOOA 4N2MA 1H3UA 2Y4UA 5DMGC 3FFCB 1T1YA 3DIFB 1B4TA 5C8YA 3MLSH 4XOAA 4KK5C 4KJPD 5JIKA 3WFHA 4HCGA 5I30L 1PEZA 4L23A 3CS5A 5D5MF 2XWTA 5DJXB 4ZFOB 3VMOA 5A16A 2DE0X 2ZXAA 4LLDA 1K33A 1DBBL 2QQQA 2O6CA 4OSUH 1UXSB 3ROLB 1MFEH 5DHVH 3D4ZA 3SJQC 1WITA 3L3OC 4WFFD 4QUOA 5FA4B 2H7WA 4JZOA 5HDBF 4WFHA 2GKIA 3B9DA 4XRCB 1J0HA 3UM7A 4HIJB 3TT3L 4AQ8C 1GYCA 1HNFA 1QLFB 4L4VE 1WH0A 3CSYA 2ZICA 3ECBA 4P46A 4E9YA 4PLKC 4IRZL 4R9HA 4FYSA 2V17H 4XN5A 4APQA 2GUOA 4YE0A 2UUCO 3GBDA 4MMZA 5F0JB 1P7GA 4U7KA 3MI6A 4TOYL 3CH1A 5GW7A 3S5ZA 2UY6B 2KKQA 4ACTA 5J13B 3BWAB 1EX0A 4L3EE 3RA7H 1SJHB 1O9WA 5DCCA 2IDQA 4HS3A 4ADJA 5FW6A 1TFHA 4Z7UE 5K9OB 3B2UD 4R0LC 4XC3H 5BUAA 4NB7A 4FLXA 4U6XB 5F9AC 3IC7A 1RZJC 4LF8O 4I1NB 4ZQKB 4YXLL 1A9EB 3O6LH 4LC1A 2Z35B 4J4PD 4WU7A 4NNYB 4D7BA 1RK0A 2NX5E 1EV2E 4MGXA 6CGTA 4IIJA 5DJAA 4X42A 4TQDA 1HR0O 1QASA 3PCYA 2P24A 1B88A 1F0LA 4TTDC 5CO1A 1N32B 2JJTA 2YD5A 1AHMA 2DQUH 4I1RA 4IMKC 5GGTA 4IRJA 4M6NL 2Z31B 4JI6B 4BFKA 3LJ3A 3B2EE 4QGYA 5T5FL 4IBWA 2ICWJ 5CP7B 3X1GA 5H4ZA 2BPBA 4MDRA 1N6QL 1D5RA 1CURA 4U6YA 4RMSA 4I0PD 3WNPA 2OMWB 2Z5UA 1IGCH 4LRIC 5CGMA 4NKDA 3D85B 4I4WB 4F6RB 3OC5A 3VD9A 3MXVL 2GAZB 4EB6A 2Y24A 4NRYA 4TSCH 3JD4A 3ABLB 4PI2A 4EI6A 2PWDA 4AKQA 2M8XA 3OMIB 4MQXC 3OPZH 3H3KA 3MLRH 5GGRB 3RB5A 4LF3A 2LO1A 2BCCH 5C2UB 3QG6B 4GEJA 4IDJL 3MRFB 2G75B 3D1MC 1Q82W 5JXAH 2LV4A 4PJCB 5K1JA 5EDXA 1PKXA 2Q0ZX 5LL6Y 1H15A 1C5BH 3T1CA 1ZLSL 4A2FA 1A14L 4DR6O 1PTZA 2FQEA 4FYQA 3CD4A 3KNBA 4HPOH 4Y5VB 3LDDA 3K0DA 5D5QA 3M8AA 1E9QA 4Z7WB 3K71A 2D3NA 1MCWW 4TSBL 3O6FB 5T1KA 1T2QL 1LK3H 3DPBA 1L9OA 2WO2B 3BUQA 4AYSA 2R4RH 4ZK8A 1OM3L 3LPOA 2DS4A 2P5WB 3D3VE 3MMEB 3TCLB 1TPXB 4G43B 3EJUA 2YA1A 1VA9A 4A2MA 3MRDA 5KVFH 5KYWA 1HCFX 1OOWA 5FL7G 2XQBH 4NN7C 4PJ8D 4UYQA 4PS8A 1YYMH 1HSBA 3NGBC 5GS1C 4KY2A 3QIUC 2YAOA 1MHPH 1PZCA 4Y4FB 1OB1A 5AB1A 4Y19B 3TCXA 3GSVB 4RZCA 5F0LB 4ATTA 3DV6A 3GDCA 2CKBL 3CX5J 2OP4H 1YAIA 4Y9FA 5KVGL 5GONA 2DMHA 2MCPH 5DGRA 1A6WH 1FAIL 2ZOLB 1T21A 4YHYC 2Y4SA 3ZT5A 1N0XH 3AG2C 1AP2A 4M1CC 3ZDWA 4YY3O 2YEZA 4WLCA 4TSAH 5G5DA 3TVMD 4Z7QE 4G8EA 4W68A 2FB4L 1I3GH 2OSLA 1K4CA 4A68A 3CXHK 4O02L 3T65B 5J1TC 4HKBB 4XGZB 3CE2A 1QW9A 1S7SB 1Q1JH 4FFYH 4KNSA 3B4SA 4W9JC 1BZ8A 3TONA 4ZI7A 2WKOF 1FC1A 3ULAB 4AKOA 5C0FA 4RFEB 4ZIBA 1VDGA 2E4FA 1LP9F 2IGLA 2FR4A 3RYCA 1Z5VA 5ABAA 3MRPB 1H2SB 1AD9A 1YEJL 2IOIA 4MMXC 3KYKH 5DFWH 3UACA 5IDJA 2LR4A 1M05A 3PWVA 4IBUA 4QT5A 4HCFA 4DEPB 4X6CF 2JI3A 2K1MA 5F6HI 1Q0XL 2ZKYA 2JGDA 3RKDC 5IEKA 5E2VL 3VNZA 1GN4A 4ZW8A 2X4OB 1I4FB 4UDTA 4ODWA 3CC5B 5IB4A 3UO8B 1MFMA 4TRPL 4X9HA 4FJCC 4Z7IA 1V54C 1THZA 3UO3A 3KEDA 4OLVL 4XXWC 4Q6IC 4E5XB 3EUDA 1MJ8H 4X4YA 3B9KB 2R4SL 2QSVA 4DQAA 2BVQA 1MRCL 3FU7B 3RNQB 3VYOA 2YBRA 3GYRA 2R56H 3MNZA 4UV9A 4K71C 4PJBF 4UB0L 4OLZL 1LMKA 4GMTH 2VDOL 5F9DC 1ZXQA 1EFXA 2QQNL 3FU8A 2BC4B 3NSCA 1HW7A 4LDEB 4QRSB 3KGRA 2UUCB 1WV7T 1NS1A 4GRLB 1E9PA 4U6TA 5I1AB 2EADA 1U3HA 3IJ8A 3I56V 2C9RA 5DC9B 4MDIB 2BNUB 4CADB 1BBDL 3V0EA 4NUQA 4ZW5A 4NN6B 4MTXA 3JYCA 4RAVA 4A63A 3PHQB 4G6KH 1P6WA 4XBEH 3N9GH 5IJ9A 2FGWL 3K6OA 4NYLA 3HE6B 3KPRA 4O2CB 5ALBL 3IDYC 4JHWL 3KWTA 3X11B 1S76D 3HE7D 3ZKQD 3T1WA 4HBCH 2TRHA 4OT1H 3HI1B 3FTWA 3OR6C 1Q0EA 5C07A 4A6YA 1J0ZA 3MYJA 4OGZA 4BFGA 1S7RB 4M00A 4L8SC 1UB5B 3SPVB 3ULUD 4TUYA 1A6UL 3HZYA 2BTOA 2CKNA 3S5LB 4AYMC 2FX8H 4EFBA 1TSHA 1ID2A 4EBQL 4HW6A 2JJWA 2LTQC 5C0ND 2WC7A 3DOIA 3G71V 2Z7ZA 5DRWA 1TTUA 1A25A 2EDXA 4PJIA 4PY8I 3MLUL 2EDRA 2JI1A 2QSCH 4DKAA 3IDGB 2XWZA 3U2IA 1VADB 3FRPG 3HCVA 2UUDK 4XZUA 5GZNC 3SO5A 3ARXA 3VGGA 5BUGA 3CRMA 5DVMA 3L4VA 1NGQL 2JKTM 5L3FA 4EN2A 2COVD 3KBFA 1TJGL 3UTTE 1I3RB 3TGUH 3CB2A 2DH3A 2O1AA 4UT7H 2BERA 3X3GL 2B9BA 4ZTPH 3ZE0F 5GJSL 3JV0A 2WWMD 3KPPB 2CKBB 1OCZB 5CJXA 1IKNC 4ZPVA 3PWUA 2ZKOA 1UA6L 1L7TL 1OXYA 4APXB 2KPNA 4P0DA 4A7GA 3MYZA 4NQCD 2NY1D 3DVFA 3S36H 4DR6B 2HTKD 4RWHA 5ETUA 2ORBL 3JALA 3GXNA 3O45B 5CXPA 2I69A 5IHHA 2G0LA 2Z0BA 4O02B 4ABUA 3O3AA 4P2YA 1QD0A 2XXGA 3CN0A 4UIMB 4WFFA 3GI9L 1EN6A 2V6HA 4V1DE 3B5HA 3U0WH 3OHXC 1I7RA 3REVB 3SDXE 4OD1H 1LLAA 3KGTA 1NMBH 3NCMA 2OZ4L 1S9VA 4X1IA 4XXCA 4IL6Z 1U8KB 4B3VA 4RFOH 1KELH 3E80A 3RWGA 1UM6H 4HEPA 1TZOA 4RAUA 4DP5X 1P5UA 2K8QA 2HJKB 3CD6V 2NY6B 1IJNA 1A7RH 3WMPA 2MQCA 3D69A 4P4RA 3TJHD 2UUBO 3D30A 1RHHB 2CDFA 4WO4B 5EU5B 1RZGB 1Q0YH 2N59A 1RKRA 3BFOA 3CIAA 1NEZA 3CLEL 5CJQL 4F7EA 4R50A 2LGNA 2KUTA 2KQNA 3R7QA 4H44B 1UZGA 3NJMA 2N4IA 4L0ZA 2EE3A 3E3QC 1KEMH 2V3DA 2IADB 1UYWH 2VW4A 1RZKL 2GJ6B 4KWUA 1KV7A 4U3SA 3S35X 3WDIA 1TUBA 1PIGA 2OW7A 4LE8A 2Y0SA 3D9AH 4YY3B 4FJZA 2RCSH 3TFBA 1SHSA 4IDLA 2WIIA 1BYOA 3PABB 1EO8L 4G9FB 1QEWB 3U1SL 5A2IH 2VDOB 3O6KH 1DZBA 5AD0B 5CZRA 2ZKHH 3WJJC 4J4PA 5T1LD 3K81A 5JOEA 1BG1A 4UIKL 4J27A 2XDHA 4MCYA 3DX4A 2GTZB 4G11A 4TQFA 1W0WB 4DUYB 3GSUA 1VQ9V 1RV6X 4N2AA 4U6HA 2N0MA 4WI0A 4CL7A 5IJCC 2Z7UA 1S6NA 3VI3A 3FKUS 5DUBA 1HCYA 5EF3A 2Y1VA 1MHEB 4HC1H 1T3FB 4N1EA 1KLGA 1BZEA 3WLBA 1URLA 3L95A 4WGWB 3NIDF 1R1CA 4H25A 1MLCB 2C9UA 3CBJB 3GUTA 1BZDA 1DQJA 3V6BR 3G5YB 4FNTA 5DURD 2XY1A 5F7BA 3CEIA 4GINA 5IF0A 4I0PA 4Z3FA 1MUJA 3WGUB 4KXCA 5ACZB 2X70A 4M61A 1CD1B 4GKNB 5FGBC 4MNQE 1QWNA 3KR3L 2V7NA 4HJ0D 3MRCA 3MXWL 2VAAA 5LXVA 3PN1A 1M7IA 3GNML 3SGJC 4YSQA 1HQRB 4HUUB 4PVLA 4FAAB 4JKPL 2OL3H 1H19A 3QPQD 5JW5A 2Q6WB 2HH0H 3WSQH 4OGYL 2BY1A 3TLRA 2QGNA 3TPUB 1PSKH 4QAWA 4Q9RL 1RUMH 2R1XB 2YPLD 4ZS6D 5T3ZL 4X2UA 4JHAL 2A6DB 3GBNH 5E23A 2HN7B 3U11A 1PZAA 3PHSA 4U1LA 2VDRH 4PW4A 3WS3B 3QEGL 3N55A 1FBIL 4QJFB 4IU2B 4FC3E 1U8MB 1F4WL 4KXDA 2BVPB 2DOSA 1QVFU 2IM9A 1IBDA 1U3NA 3MLWL 3P9MA 5SX4H 4E9SA 2FJSA 3AVEA 1XNQO 1OAQH 5CZXC 3CSFA 1L0LH 1UB6A 5AKRA 1F6AB 1UATA 3B9VA 1XOUA 3C09B 3LZRA 4KKCC 2OFQA 3C90A 3O6ML 5F3HB 4ELMA 4PJ8A 2CGRL 3BN9D 4X7TA 4G6AC 1F1GA 2BK8A 3D0VA 2JLPA 1CT8A 1PD3A 1DEDA 4GW5B 2AXFA 4P04A 2D2CC 2BSSB 4LAJH 4PJ5A 5DLLA 4OLYH 2G30A 1KYOF 2BMKB 2P7TB 4FG6D 5J1AA 3LHPH 2F53D 3AM8A 4ZD3H 2IV8A 5E1HB 1PZ3A 4P23D 1N70A 3GMLB 5KW9H 5EEZA 3ROOB 3GVMA 3TVMA 1QU7A 1KDIA 5EZJB 2X4QB 4YK4C 5IY5C 3OVUB 4XDJA 3STLC 2RB8A 1XMEB 1Z5LA 1HSAA 3BCCH 5F2VO 2VSDA 2WMPB 3ARUA 4KZDH 4FFBA 1B6UA 3HS8A 5DFAA 4X65O 3FB5C 3QNEA 1RJLA 1AQHA 5BOZG 5L2KB 3CRAA 3FAWA 4PRDA 4N21A 3DJRA 3LKQA 2YD3A 5HFLA 2EIZB 2H3OA 3C3TA 4J28A 1BAGA 2HVKA 3PDOA 3JATA 3EBHA 2PWGA 1PL3A 2KB1A 3V4PA 2ZJSL 3R4DA 3QEHB 2XI9A 4F92B 1KB5H 4YHML 1JF5A 5K1PA 4CKVX 1OTTD 3E2HB 2VN5A 2J5LB 3ARGC 4R6ZA 1OL0A 3HC0B 4QHMB 2DM3A 5ESAA 1F02I 3QPXL 4HAFA 1XBLA 4A2DA 1CLZL 3PF2A 4TNGA 4AJVA 1T5XB 2CR3A 3QULB 1ZLVH 1UZ6F 2AAAA 3TESA 3OT7A 4G6ML 2ZNXA 4F9PA 2OTPA 2OX5B 1O7SA 5HYIA 5CA3A 3N27A 5KN5A 3PGDB 2XVLA 2R29H 1B3JA 5DDHA 4PJFE 4F7PA 4L8CB 2H0FA 4B9FA 1ETJA 5FNVB 2UUBB 3QQDA 5EO9A 4ZFFA 5GHWH 1AANA 2KZKA 4O5LL 1JTTA 4D0DA 1WIPA 1JNHA 1AYRA 2J88L 2E3VA 3VI4F 5CN2A 2A74A 4JN2A 5LMUB 1HZLA 3BUYB 3CFDA 5JJNB 2CDEA 1HILA 4ODSH 5GGUA 1ZT1B 2XWBA 1B4RA 2VDKB 3LCYA 3F7VC 4MHHG 5CBEA 3X12B 2P47B 1VGKA 2V2WA 5IWLC 3TA3B 1LO0L 4S1QH 1SVZA 4PGDB 4YBLB 4HSQA 3FDWA 2B1OA 1AROP 2R23B 4CMMB 2UXDO 3RB7A 3HE7A 2QADD 1TTCA 1ROPA 3D36A 4AE0A 4AE1A 5E1QA 5CFHA 2EXYC 4F1ZA 3ALPA 3FCUB 3VTTA 5IFAL 4JQIA 2AVGA 2J21A 3ARPA 4KO7A 3UTZA 4B7LA 4X5LA 4AQOA 4ZFZB 3IRPX 2W1NA 4I4TB 5F72S 4H8UA 3RPKA 5IUSA 5KVDE 3UQ8A 4RETB 2ZG3A 3A8TA 4MTFA 1CGVA 2JS3A 4LLQA 5DZPA 4Z7VB 4N5ED 5HYSB 1KLFA 1K5WA 3IXAB 3ZRCC 4JDEA 5MENE 5B7EA 1JFQH 2Q7GA 3O41A 4CU7A 2Q8AH 1A2YA 3LRSA 2WLYA 4PH8A 3I9GL 2DD8H 1E90A 2DEXX 4H0LC 5DJ0A 3IVKA 3OWEA 3JAMN 1S9KC 1A6AB 2BJML 2UX6A 4GW4A 2FMLA 5F3FA 2HUHA 3TN0C 2PYED 4XP6L 1EN5A 4YQXH 4QKTA 3ABKB 4NQCA 3RZCB 2L7JA 3AABA 3N1GC 3JVGA 5DLML 5INCA 1RUQL 1V7MH 1OPGL 1W80A 5INDA 3KLQA 2EUZA 2YPKB 5A7EA 5KOVC 4DR4O 1THCA 1F45A 1NGWB 1T5WA 3C6EA 5E94A 5I1CH 3QA3A 2WYIA 4HU2A 4J3SA 3OJ2C 4J5VA 4R26H 4RLDA 1IKOP 4DGYL 1XNQB 4G7YH 2QM8A 3QFJE 4GXFA 3X1EA 2C9AA 5AZ2H 3KYOB 1FO0H 3S96A 2HRGA 3CFJB 4NO3A 4KPHL 2PYFB 1JX9A 1FNSL 1M56C 1FHGA 4N2KA 4N6RA 1UUNA 2YARA 4BD4A 5KMGA 3ZL4L 2B08A 5HGDB 5FUZH 4Y5YB 1NGZA 1OAYH 3HLKA 1E3ZA 4HLZH 3MRHB 1U30A 4P3CL 1EXUA 2ZP0T 4AV4A 3AWFA 2G3XA 1KB3A 3UCRA 2ARJQ 2YUWA 3BW9A 1L9NA 2X0WA 1SYSA 4IS6B 3LB6D 4X5XB 5LUMA 1INQB 3KVQA 3NG5A 2H8PB 2OQJB 1G1KA 4R2GC 3AK1A 2AI0H 5EUKA 5KTEH 2W07B 3I3DA 3NFNB 4OM0H 3OSKA 2NCMA 4M6MH 3ISYA 3BAEH 5T5NF 1BECA 2ALWA 3F5WB 4PCTA 1I9JH 1FFOA 2IG2H 4MNGB 3MNWB 1N67A 2H45A 4WF9V 5I66B 5LOVA 1TCRA 1OCCC 4TVSa 3OUSA 2FKXA 4P2CG 2EDMA 3E22A 3RY6C 3PWNA 4DP0X 4KJQD 1X4YA 4R97B 4KH9A 5FGRA 2YD7A 2XN1A 4G1EA 3WN5B 1JK8A 5TISZ 4FKHA 4JI4O 3A23A 4CS2A 2FD6L 5FCUL 5JUEL 3ELAT 5KS9A 5DHEA 1I1CA 3UTPE 1YY8A 3Q1SH 2AHZA 5I1JH 5J89A 3PYCA 4K3DH 2WK2A 3ECQA 4OIFA 2DWYA 4DSYA 4NJAH 3ATFA 3NZHL 3PLYA 2IH1A 4Y2LA 3UROR 4KXBA 5AZEH 1KV3A 1QI3A 5EK0A 1SM3L 5C93A 1BWWA 2XUWA 3LKRA 4P9HL 1J1PL 4WJ5A 3IDIA 3NDYE 3VVWA 3F6LA 2YHGA 5B66Z 2YPLA 1YY9D 2CXKA 2EIEA 3O4LD 4MJIE 3N42B 1D6EA 3APDA 3CZNA 5H2BB 3ZDZB 1RERA 1ZUQA 1AGBB 2NR6D 3TC9A 3U30B 1LP9E 4UB8Z 4PJCF 2IDSA 3U4KA 4ERSH 1QLEL 4NQDE 4UV7L 4E42B 3O2WH 4NHUB 4A04A 3MGOB 3BEVB 5E2JA 4I48B 2R70A 1F90L 2X4SB 1CD0A 1BSIA 3EDEA 1QKZL 1G6RH 5ENWB 2UXDB 2CLRB 2V3EA 4OV5A 3BPZA 5H9CA 1UHVA 4PTTB 1UFIA 1JPST 3O3DB 2CM5A 2HJFC 1ZV5A 3K6FA 2DYRC 4MD5B 5IK3A 3TV3L 1BFSA 3QRGH 5FOBB 4WEBL 4YL4A 3OGOE 1XL4A 2XKSA 3D48R 1ZANL 4LRNH 2Q87A 3CFBB 3QQXA 2NXYD 4N4YB 5IQMA 3EO9H 1L0YA 4FFVD 2F54B 3F84A 4MB5A 3B56A 4FLHA 1I7TA 3VXUB 3OQ3B 5ELIA 3RBZA 3AGWA 3RYIB 3ZRWB 1KJMB 4D3CL 3ISRA 3EYSH 3K4ZA 4PP1D 2P28B 2R7EA 5DVNA 3U6XS 4TL5A 1ETB1 4P23A 5E99L 2EO1A 5I0VA 1P53A 4L87A 3RG1C 4K0KO 3S97C 3JD1A 1FNLA 3GIZH 3ZTEA 3EXJA 3D5OF 4G5ZH 1T0NB 4M7LH 3MHSC 1XF4B 2Y1AA 2G2NA 4DR7B 4IBLT 2F19L 1GMEA 1GYUA 4CH3A 3MR9A 4QAMB 5B4MC 1I1YA 1U96A 4K2UL 1RURL 4JO2H 5I6XC 4GAFB 3IS0X 4FD0A 1UVQA 4D8OA 3RJDA 4HJIA 2YAQA 2KERA 4BFIB 3ZL2A 1R3HA 3GB7B 3GLAA 2BOCB 2YS8A 3O3UN 3PRZA 4AMWA 2EIDA 2CCLA 4TUJA 5BRZE 1PCSA 3BHBA 4DR4B 4B5EA 2EH7L 1N34O 1HWGB 3EGDB 1Z9LA 1Y18A 3FAVB 2NY5H 3D0LB 3ARVA 1FN4B 3M88A 4MSWB 3VRIB 3DK0A 1L9PA 3VFWA 4JFDD 1XB6A 2OMYA 4F5CE 3KCPA 3G5XA 2FWOA 2VMFA 3R19A 3ETBF 1H8HG 4B9YA 3BPNC 1U8OA 3BT2H 4JS7A 4OZHA 4E9WA 4P5TD 5I8CB 4JREB 4X7FC 5FK9B 4JAUA 3MFGB 1AJNA 1OEZW 1MA1A 2JJVA 1E8WA 2C7UB 3FPXA 3QI9B 4ZMQA 5LLIC 5JOFA 5E79Z 3FQTA 3PNWB 2HHHO 2WLIB 3JWNE 2VRAA 4JPWL 5KX5A 1W59A 1FCCA 2ZF8A 2DWEB 3RVXD 1OV9A 1VKXA 2ZXEB 1TIUA 1S5HC 4ZSOB 2WYTA 1FNGA 3FCSB 4LBEA 1C9SA 3P30A 2HFGH 2WQSA 2DQFA 1XF1A 4TYUA 3S3SA 2B2XL 2YLKA 1BQUA 3HRZB 5FO7B 2RDCA 1JCKA 1CFQB 4JR9L 3J7HA 4PJDE 4QE7A 3ZS8C 4JI0B 1F1AA 1KJ2A 4JZJA 2YUZA 5L3CA 2EVFA 1MCQA 3OEEG 2ZCLL 4NAMA 2C1PB 3GMPA 4WV1A 5GGRY 1BEXA 5C0EB 3H42H 1NI8A 2DQIH 2EZ0D 4PJ7A 1DDTA 1QLEB 3MJ8A 2YUXA 3WDHA 4YWGH 4I18C 4JFQB 3ZSTA 2NLJA 5JYMA 4G9DA 1AILA 3TIDA 2FHFA 4S2SB 4AZ8A 1Q3EA 3ETGA 4I50B 2VLJB 4F58L 3F12A 4A2EA 2FL4A 3LSOA 1TJXA 2OCFD 3MJ6A 3ZIYA 5I1IL 4C4KT 4ODHH 3BSHA 4TVPL 2V4LA 3C5JB 3C5SA 2V8LA 3W11C 1BVNP 4F4LA 3DO4A 3F7PC 3MV9D 2OIGA 3SBRA 2RR3A 2WXQA 4H1LA 1O7VA 5MERA 5TJWK 4DN3H 5HYJD 3C6LB 2P52A 1UM4H 2PYEA 2W0FA 5CUSL 4KQ3L 2KDGA 5DRNA 1EERB 4UTAA 4AYBA 1CFTB 3ARSA 3BISA 2K70A 2CHDA 4HP5A 5GGTL 4Z3JA 2UU9O 1DDHB 3MAQA 4HXBL 1KFGA 5FW7A 3WLWD 2AGAA 2R0KL 4QTIL 3FQ1A 2HRPL 4DFHA 3RPBA 1TOXA 4WBNB 1N26A 2UZIL 5DQJB 5GJTL 1A4JB 3ARFC 3FSZA 4FMFA 1PX4A 3ILPB 2UZPA 3SQBB 1LO2L 1MHCB 3CMEV 2PPEA 3NIDE 5KBLA 4MCNA 1I9IH 4X6BA 5D93C 4BWUA 3DSNA 5J12C 4ZOLA 3SYOA 5CMAA 4HH8A 4OI8A 1QRNE 2H0EA 3I02A 4QO1B 3EJPA 2OTLV 4TUOB 4AEHH 4J9YB 3QQ4B 3RJOA 4ICXA 3STZB 5JPNC 3PWPB 1AMYA 3QH3A 4DVRH 4WFED 2CTQA 1B04A 3DNKA 1XGYH 4PR5B 1MWAH 4XVSH 4B95C 4KVNL 4JRXE 4FQHA 1ZWIC 2DYPB 4EZJA 2GDSA 1BJ8A 4C54A 3TPKA 4CKQA 2CTPA 3PL6C 3UBXI 1ERNA 4ADIA 4EOWH 1H9VA 2OPCA 5CM1A 5CBAB 3EJYC 3KPNA 4B9JA 4FPPA 1UD6A 4KOBA 1RK7A 4XVUC 3SJBC 5IJBC 2F68X 1PDKB 4UBDC 1VZHA 2A73B 1JZFA 2AJXH 4K0KB 4Y7MA 3TO2B 2WBXA 2VW7A 4OUOA 4S10A 3SPHA 1E2VA 3ABMC 1T1YB 5LA6A 2DTML 2EE6A 5MEPA 2CO6A 3H9SE 3S4SA 3WFHB 3I2CL 4RWYL 5B38G 3WFDH 4FFKA 1KCBA 1BQZA 1TQWA 4GKSB 5A16B 4EUPA 3PHAA 4LLDB 4D8PB 4JAMB 1UOLA 2FEJA 4HULB 2X05A 5CN3A 3CHSA 4JZOB 2FUTA 4AIZA 2BNRD 2W38A 2HG5A 2V33A 1X5YA 5GRVK 5FPIA 5B5EZ 5I19L 3AS2A 4KU1A 3LDBC 5DN6G 3ZKND 1XGPB 3GJFB 1JZEA 4BH7A 4GRWB 4KBPA 3TTYA 3OLIA 3ECBB 3SO3B 1KCKA 3SKJH 4MJ6B 1D5IH 1RPKA 2FHBA 2P90A 4M7LT 4M7ZB 3AK3A 2GUOB 4YAQA 4GIOA 3US1A 3MUHL 2Y07H 2ROYA 2PO6B 4WTXA 4N1HB 3U1QA 3TH4T 3TBSA 1EEQA 3CH1B 5HVFB 2Y1ZA 5A9GA 2ERJC 1QHPA 3BVXA 4JE0A 1I0HA 1SF5A 3NJKA 4QRRE 4CN1A 1D9KB 4HS3B 4MVOA 2EICA 4PUBL 1ZL8B 4E9TA 1JHTB 3AG3C 1PLGL 3DGGA 3VXNB 4KO9A 2R69H 3DRQA 5E4EB 4N2EA 2NR6A 2EZPA 3DHMA 1HX0A 4OFYA 3DX9B 4YBQC 3OE7G 1CMOA 4WU7B 1QI4A 5IM7A 3EFOA 1KXTA 4WHYH 3LNIA 1RK0B 4DRXA 2L35A 4IIJB 5DJAB 5DS8A 2AW9A 5FUOL 1M7DA 2MOVA 1P4RA 3TZVC 5JLZA 4MD0B 3LVEA 1JD7A 5D7KE 3U25A 3HKDA 4KKRA 4BGLA 2BCMA 4BIOA 1Z5HA 2KI6A 1ZD6A 2V5MA 3ZW3A 4BXVA 1CR9L 1AXSA 1R3LA 2JELH 4LDLB 4BCYA 4DK0A 1U8NB 3DWTA 5KEZA 6TAAA 4PWHA 5I1GH 5BXZA 3GI8H 4Y2DC 1S0VA 1S3KH 5LJYH 4G42B 2D4FA 4PJ9C 4DKEL 1DVSA 4EB6B 4XMPL 3OMNB 3M86A 1DBKL 2LFEA 4J3OG 1SXAA 3BIKB 4N8VA 3MDSA 1TEYA 4OGQC 4ZAKD 1UXLA 3GBMH 4LF3B 4NHCH 5HBBA 2AHIA 4OCWL 4DKTA 3RT3C 3RAJH 4JM0A 4XAWL 5CILH 5E4AA 1GKFA 1HDJA 1BF2A 3F05A 4HAKA 1H15B 4I87A 3TXAA 4LGRB 5JQ6L 3JVFC 5D9SB 3UZQA 3K8KA 4JVPA 3KNBB 2ATKC 4A6YL 1X5MA 1V7NL 3D0AA 4OU3A 2LVEA 1E9QB 2BIHA 3AXHA 4Y0GA 1CK0H 1WB8A 5DMIL 3RYFA 5KAIZ 1MEXL 2VERN 3CTTA 2XT1B 3BESR 3DYPA 4N0UA 4BCXA 3WTSA 1L6PA 2GI7A 5LDUA 3CLWA 5T1KB 5B1AB 2UU9B 3DPBB 3HKBB 3RGVB 3VH8A 2R27A 1LO4L 4XP4H 2MKWA 1QQDA 3QAZC 2VIRB 5C09D 4KK6D 2B16A 3DA0A 3O3EA 3MODH 4HZLA 4XHJD 5E70A 1CJYA 2OBGA 4NNPL 3B9EA 4UQ2B 3OGCC 5KYWB 1ONQB 3U36B 2Q1EA 2X40A 3IU4H 4QJ4B 1AGEA 4XNZC 3V9FA 4BSJA 4N5UA 2PR4H 4PV8A 4XO3A 4JFDA 2JIXB 1NDMA 5TGBA 1IGMH 1U2YA 2XZAL 4DT2A 4PB0L 3AWGA 1B0WA 3DC6A 2ZUQB 4RZCB 2IBBA 4P5TA 3BP4B 1D2OA 1SXSA 4AMKH 3D18A 1ACXA 5E6SB 5GONB 2EO7A 3MREA 5HDWA 3IDNA 3WUWA 5FHBH 3RVTC 1T21B 1MSDA 2R39A 3NABL 1PAZA 3PREA 4CVXA 5KSVB 1O6SA 3TASA 3BZ4A 1AP2B 3M1BB 3UG3A 2YEZB 5L9DL 4Q0XH 5G5DB 3RPIB 4DGUA 3SE6A 4F33A 2HJDA 3IAPA 2FYYA 1UD5A 7FABH 4LSDA 4X9GA 5CINL 2BOBC 1M9NA 4UVCA 3WJMA 4M9OA 3PQYE 3I6KA 3EH1A 5BZDA 5C0FB 2D9CA 2GYSA 5E2UH 3V6ZA 3SJAC 3UYRH 4TF4A 3CXFA 5F97E 5B39B 2H26A 4BAYA 4MQSB 4H33A 5I1HH 5GISH 3ZKMD 4KZEL 1M05B 3PWVB 4QT5B 1IXBA 1OP5K 3WTUA 4JN1H 1HCVA 1GYWA 5IEKB 1BX2B 1OT1A 1NZ6A 2WXNA 3T0ED 3V9CA 1A8ZA 1NPJA 1DQML 3L7EB 4QMEA 3PGFL 5AVQB 5IB4B 1DR9A 1YITV 3N2JA 4M1GL 5DJDA 3HZVA 3HUJA 1WNSA 2RH0A 4JB9L 5HDRA 2R83A 2DB8A 4WSGA 4HGWA 2E75C 2JJUA 4PLNC 3ZHLA 1GGBH 2BVQB 1J8HD 1KTCA 5AYUL 5EZOL 2QGEA 2YBRB 1NFIB 2LE9A 2IGFL 3PUUA 4U1JA 2XTJB 3RE0A 5L3EA 4GXUN 3MV9A 4NFDA 3U0TA 5C6TL 3JTSB 5DD6A 4MMYA 1QPXA 5CWSB 1T1ZA 1F97A 4X64O 4HIEA 4Z7VF 5HYJA 1I8IA 3CBRA 3VMPA 3MU3A 5EEXA 2V9QA 4JGSA 5D7SL 1WA8B 4N2OA 1EHLH 1N64L 3VFOA 4HJJL 3BVUA 2N1TE 5DVOA 4OD3H 5SV3A 3P4NB 5IJ9B 3QQNA 4JTCB 4NYLB 2ZXQA 2CUIA 3P69A 3SKUD 1SMOA 3K5SA 4QXGL 4WUUB 5DWUL 1X4TA 4A6YB 3K5OA 2H4EA 3MYJB 4U0RC 1S7QA 5LGJB 4TUYB 3HZYB 4K23H 3LVTA 1J1OL 4F9LA 1NCBL 2R2HA 1HTYA 4RNRA 1R24A 1DSFH 3QDJE 3CHPA 3TJEL 4WFEA 2WXIA 1TQTA 3Q6FA 1T03H 1J8KA 1TJHH 4JCWA 5EUOA 4PJIB 4KMLB 4HJUA 2J3SA 4WEUD 1VEMA 2WVVA 4KKAC 4AG4L 1S7WA 2GTWA 3BJ91 3FB8C 1F3JB 1FLTX 3DJTA 4UILH 3K0GA 3GMMA 4UT9H 3ZHTA 3OD4A 4W9HC 1BMGA 4YSPA 1H38A 2CO3A 1Q9WA 2YR3A 5L2JB 1HNXB 1JD9A 1ORQA 3OR7C 5FYKH 3N1FC 5CGBA 4ZPVB 3PWUB 2TSBA 4Q8BA 1NWPA 4JG1H 4XPTL 4PJCE 2BSTB 2NZ9C 3GBEA 5I82A 1TLKA 5ETUB 4BUHA 1KBGL 5IBUG 4FIPC 1AGCA 1P1ZB 2FX9L 3L3JA 4KI1A 5J11B 1OSEA 4Q97A 4LNRA 1IT9L 4PRPB 1H6UA 1BVKA 3O3AB 1A0QL 4Z7WE 5AEAA 1BQLH 2FRGP 2RFXA 1WP8A 1WHOA 1FORH 1SQ2N 3ARED 3KM2A 2VQ4A 3WKPA 1IGFL 3AU1A 4FEMA 1S9VB 3HKCA 5EU7E 4YJ3A 4NQED 2BNRA 1P49A 1OE1A 1GH6A 4FZEH 4XCCH 1GMGA 2J1ZA 2Y23A 4CVUA 4M3HA 3G6AB 5LNEA 2ZOKA 1O5DT 4ORGB 4P46C 4RGNC 1NMAL 1H6EA 3ARDC 3Q5OA 3LNNA 1YEDB 1WAAE 1QYGH 2WO3B 5IYBO 3D69B 4P4RB 4APQC 4L4TB 4LCYB 1SY6H 1CGSH 3MBXL 2CBPA 2CDFB 3FB7A 4KROC 4MMZC 3T6QC 2AJYH 4L8DB 4QRQA 4B60A 2PNDA 5BW7A 1KGCD 4YBHA 1J0JA 4GCZA 5TH2A 4F7EB 3MRLB 1JDAA 4JAVA 4MS8D 4ALAL 4LEEA 2F08A 2XG5A 3QHZH 3N91A 3K6IA 3PXJA 1S7XA 1J1XH 2WOBA 4P2AA 1TO4A 2RJZA 1TUBB 3UJJH 2EKJA 1IM3D 2OLDA 5IYZA 3WNLA 3NFSL 3OKOA 2WIIB 4IQHA 5HGHA 3NCXA 2AABH 3V4PL 3UG5A 3A21A 1HKFA 2WGNB 4DZBA 3H0TA 5KYYA 1HNGA 2OWOA 2X5PA 3CFEA 1YMHA 2ID5A 3MHZA 5JIIA 4MCYB 4YNYA 3B37A 3A22A 4NWTH 2NY0B 4U6HB 3N42F 4WI0B 4TL4A 4PDVA 2CJTA 5F6IC 3ZDZF 5DO8A 1LD9A 1SOKA 3LQZA 3QDGB 1AG0A 4IRJC 4NT6A 4OJFL 2FTKA 6FABL 2QWRB 4LKCA 3WLBB 3L95B 4H20L 1GHFL 5CB4A 1E28A 2K9UA 3GUTB 2OTUA 1DQJB 1TAEA 5ANHA 4M5SA 1SHMA 5IF0B 1AZCA 4X9BA 4AOFA 1M7UA 4I0PB 4KX7A 2ZWKA 2QWQB 1MUJB 4C83A 1LQSR 2WXFA 4GT7A 2KT6A 2IDCA 3VXRE 2OIEA 1Q4NX 4FK5C 4P30A 4PV1C 5FYJH 4XWGL 3IGUA 1W8EA 2VLRE 2ZNJA 4ZAKA 5FX3A 1M7IB 2AJVH 4XX1E 4WI9A 1WFUA 2VDNH 3UTSB 4NTYA 5JW5B 2Y69B 1KENL 4OZFH 5D7JB 5JHDE 2EYSB 2A9NH 5IFHH 1R1BA 1H2LA 4X64B 1H6FA 4MZIA 4ZI8A 3E8UL 4HQQH 1OSZB 4NKIH 1NU1H 2NY7L 2O61B 4YPJA 3ULUL 4DF9A 5D2NC 4JQIL 4B53A 3F83A 1ZGLM 4UB6Z 4N3TA 5IP4A 3C87A 1ZLUH 3P9MB 1D5AA 2IF7A 1QSFB 1FXKC 1KF9B 3L3HA 3BGMA 1IC5H 1F11B 1A9BA 2QKIA 5C09A 1KIUB 3CDZA 1ACZA 1W9XA 1UACL 3X1NA 3VG0L 3L1OH 4BQ9A 4ELMB 1XAUA 2YOAA 1IQWH 3NSFA 4PJ8B 4TNVK 4WFGE 1N4XL 3QORC 4U1MA 2XZQL 1E67A 4OLWH 1H5BA 3D0VB 1JR9A 2OXHB 3QRFM 4UOQA 4PJ5B 3HZKB 1TG8A 4IOFC 3JAKA 1YEFH 1EZUA 5I0ZA 4BHUI 4NZTL 2A9ML 4QTHA 5J1AB 2WLJA 3ZHQA 3P9LA 1IGJA 1QTYT 2GSGA 1K4CC 3KW7A 2R15A 4XNYL 3TVMB 5IVXA 1PGRB 2YZ1A 3FQYA 4ZMPA 5HSFA 4DUVA 1AE6H 4AVHA 4KHXH 2IU3A 3SKMA 1Z5LB 2DICA 4NO5A 1SN5A 5B8CA 4FFBB 1X9UA 4GI9A 3VRJA 4JFED 1T0MA 4U7NA 2VDMH 1NTDA 4PRDB 1TGOA 2W9DH 4PDRA 5KVGE 3RLSA 3VD4A 4GPVA 3OLEA 2BHFA 2WZ0A 4K8RD 3JATB 3TFKD 5I1DA 3T3PB 4N22A 5FYKU 3MV01 1NCCL 1JCVA 4LF5O 3X2QB 4LIQL 2VWEC 1U42A 3QXUA 2EJ1A 2LW3A 2DLFL 4PJAE 4Q2ZB 3T0EA 3MO1B 5I5IA 5I75B 1YECH 4FYRA 3HC4L 2D3OW 2E74C 3WUZA 5A6MA 4R7NA 1O9ZA 4GKKO 4UVAA 5DUPH 4XAKD 1K6QH 1PG7X 3OGIB 2HT3D 4NC1C 4XVTH 5TDPA 3R8QA 4JKLA 5KN5B 5ISZB 1J8HA 4MA1C 4TPRH 3NCJL 5I16A 1ADQL 2JKXA 1XGUA 5DDHB 4DGIH 4F7PB 1VMGA 2WPDG 5HHQA 2F8IA 4JI7O 3NZSA 1K8DB 4WQOA 3L5JA 3QQDB 5CJ8A 5EO9B 4D9RE 4ZODA 3A6CL 2VQFO 4ZFFB 2AVFA 3HS0C 4OY9A 3ZPDA 2QMJA 1MELA 1A5FH 3MFFA 2VAJA 1U3HC 2EDFA 2DJ4A 4JN2B 3ILQC 1TEGA 1FL5A 3VFSB 1AMXA 3CFDB 1KCVL 1QLNA 2CDEB 3DSQA 2Y0PA 2KC0A 3CSBA 2VLKE 2XWBB 5GGUB 5HDOA 4K5PA 4Z78B 5CBEB 2Y7NA 4JPKL 1N6VA 3K3WA 1RFDL 1OWRM 1NKDA 2V2WB 2YD0A 3CMGA 4FQ1H 4C56E 1Q6HA 4ZYKA 4PS7A 1WVZA 4HMEA 3TOPA 2Q73A 3CCHA 4OCXL 5EO1A 3LPPA 3NIFB 1KYOJ 2MH4A 2XZCL 3HE7B 2UWEE 5IBLC 1MNUH 3IJSB 5KOMC 4JO3H 5IHZB 4GAAA 2EINC 3G3LA 5M94B 2IPKA 5JO5B 3DX7A 4FQCL 3ULSA 3NIGB 2XV6B 4NVPA 3MNDA 1SQMA 4O4YL 3UTZB 4JDZB 4R7LA 4YJ2B 4K8XA 2WNWA 4XMKH 1DBML 3GTVA 4UQIM 1XIWC 1OARL 3GSNH 4NPKA 3PHOA 2VXSH 5CEZH 4HT1H 1UJWB 3L9RA 1HOEA 4LLQB 2VXQH 4W9IC 4XCYA 1BZQK 3RI5F 1CXHA 2HAZA 1RZFH 3CDFA 4JDEB 3TO4B 4JLRA 1TZHB 3EDKA 3UBHA 3TEYA 5D1ZD 3PWLA 2D0HA 4P5SA 4HOMA 3LRSB 5ITFA 1Y4MA 2ADJA 2Q7NA 5DJ0B 1MOEA 3VXMD 5AW0B 5L4IA 5AB9A 4FCAA 1LO5A 5F7NC 1VFAB 2H6PA 2CXGA 1F4YH 4LLWA 2CCVA 1THAA 5FYJU 1YPZA 4KJPC 4NQCB 4MZRA 4MA7L 2NY1B 5C0CB 3QE5A 3TBTB 5I8EB 3CFTA 4JZNB 3JD3A 2APVA 5LCVH 3CN2A 5I5MA 3FOLA 5B1OA 3R4RA 5FO9A 4ILDA 4V1DA 5INDB 2VZ1A 5E94B 1T5WB 4AK1A 3AREA 1YIJV 2AQTA 3ZKXB 1KGYE 3F7RA 5JIDA 3H8NA 4J39A 1TU2A 4PY7B 3SDYH 2GI0A 1RSFA 3BO8B 3BSZH 4GQPH 3V0FA 1U97A 1F1DA 2CDGA 3WKYA 1P5UC 1PQZA 2IAMC 1VPOH 3N40P 1RU9L 3QIWD 4WU5B 4Y16D 5K39A 1VF6A 3FT4A 1MCHA 3OAYK 3V0JA 4E4EA 4HLZG 1N4CA 2WUBL 4M02A 2JV6A 2LFRA 4NQSA 1BD2D 1MFDH 3X13A 4BQ8A 1PYWB 3N2GA 4OUUA 1D5ZA 1DLHA 1TQVA 2MEJB 1WGOA 4LVOC 2E6PA 4TN9A 3MLYH 3ZT7A 4PRAA 4GRWF 5MHSD 4LMQI 1R5IA 2PW2A 1T7YA 3BW9B 1A3RH 4HZAA 2DLTA 2F58L 1IM3A 4ZTOH 3V0WH 3EOTL 4GSDL 3C8KA 1FIGL 4J4PC 2YLHA 3Q2WA 5D6CA 3DECA 5EUKB 3VFVA 4ATWA 3OZLA 3M17A 5TFSH 3GS7A 2J44A 4M48H 2ETNA 5EIIG 1FZMA 2EDTA 4M4RA 1P5VA 2FT6A 3E1F1 4NP4L 2CPUA 3L6FB 5T1DH 4ODXA 5L2KE 5DQDL 2JQAA 1FFOB 5F7EL 1ZIBA 3U4BL 4DP8X 4NM4L 4KI5C 4MVQA 5LOVB 3VQYA 1TCRB 1FFNB 4RGOL 4XBGB 3MTXA 4LF5B 4MKTA 4XX1G 1QBBA 3KJ6L 2WNKA 4PJHA 3B34A 1EXHA 2ZXDA 4KVCH 1JK8B 5TDNB 1ZT4A 3HBQA 1SQQH 4MNQA 3O9WB 2ZM6O 4Y4HD 4XPAL 3L5IA 5KS9B 1GYAA 1YY8B 3C60B 3SE9L 4FYTA 4G83A 4WSKA 4GKKB 1JPTL 1UCBL 2M26A 4ZG1A 1JZ4A 2HP4A 4XN8A 3T2NL 4NFCA 5AW2B 3S37L 1C5CH 4Y5XA 4MB1A 3SE3C 3FO2B 3K6SA 1G4RA 1I94O 4GG6A 4JI7B 1WC7A 4O4IB 2D2OA 2GG1A 3P30L 4PI0A 4LPXA 3LKRB 2VQFB 3NOIA 4WJ5B 3PU7A 4L1HA 3VGBA 1Z5WA 2YIBD 1J5IA 4ZOAA 3NACH 4AW7A 3BZ5A 2DQDL 3QDMD 1KJ2L 4ZNEE 1A1NA 2F0CA 4JYBA 3TXQA 3OJMB 2AZ0A 1FYTD 2ODIA 3NMEA 5C0DB 3MRGA 1JV2A 1JOYA 1EBOA 5EC1A 3BGFB 4IJ3C 3ETSA 2P5PA 3FO9A 1Z2GA 5DJYA 7PAZA 1U93B 4UANA 5T1MA 5CA1B 2YGPA 4YX2H 3X14B 2XFXA 3MBWA 4OV5B 2E5LO 1JHKH 1MW3A 5AW6B 5A2KH 4PREB 1FCGA 2GBUA 2J7LA 3L9BA 5T3ZE 4OCSH 1SQVH 3APQA 3NH7H 2DI8A 3EDFA 4DOHB 3TEUA 2ZPKH 4HEMA 5IKCA 3MN8A 1DK1A 3DO3A 3F7QA 1RJYB 1GGIL 3VO0A 3TF4A 1JHLH 1KB9K 4AH2B 3KL0A 2QHRH 3D4YA 3GINA 2CCWA 4DUZO 1I8LA 2H1PH 4KMQA 1BEYH 4CVZB 4CC5A 3BP5A 1FFQA 1FF5A 3AM8C 3ABLC 1WIUA 1OF2A 1ZSDA 3IE9A 4UTAL 2BWQA 3ES6B 4Q4EA 1NLBH 1C12B 2ZTBA 3FN9A 1UENA 3OKNB 1XX9C 3QIBD 2YD8A 3W2DH 3RBGA 4OGAD 5JTWA 4N20A 3P9WB 1FG2A 4LLMA 1A1MA 4KUMA 4YC2B 4JFEA 2QPDB 1OCRC 1HU8A 1WEJH 2W60B 2Z91A 5DS1A 3SE4A 4IGGA 1G1CA 1WUNT 2ETWA 1Z9PA 4KY1L 2HVKC 2XT9A 4TT3G 1UVQB 2HX9A 4WKXA 5I18H 1TVDA 3ZIAG 1VSCA 1R3HB 1U95A 2YQBA 4CC6A 2VSKB 5C0RL 1IBLO 2AEWA 2VDLH 1QOKA 3QJQB 4ZUWA 4EEEA 4R83A 3BHBB 5AZUA 4GRMA 5AVRB 3EFDH 2H94A 4WFBV 1DBJL 3M6DA 1QFUL 4MWFA 3S98A 2AQRA 1MAJA 2GBVA 1GGTA 3FQNA 2G3NA 4KMTL 4ZO9A 2IPTH 2B0SH 1J95A 1KYFA 2WAQA 4GOSA 1CTNA 1UWEL 4F9PC 1AY1H 1SXCA 2YQGA 4N9GB 3VFWB 3L5WA 3BIBX 4JHBA 4IGBD 4PRBA 1A7NH 1F7YA 3B43A 2CIIA 3KCPB 4GKJO 2FWOB 4G8FA 5FXCH 3UEQA 2RALA 2BWDA 1DL7L 5T33H 4KTEL 4FLOA 3F85A 4OZHB 3D3IA 3I75B 4DK5A 1AKPA 3LRHA 2KDYA 4H8HA 4XCFH 2A74C 3F8UB 2QVKA 2O5YH 1CE1H 3EGXA 1D7FA 2DWDC 4JI5B 4GY4A 5KX5B 2LGWA 1JVKA 1NLDH 3GMNB 5CGYD 1X7TA 2JJSA 4HHAA 2ODHA 2IJJA 4IRSC 3FZUD 3CIQA 5GRXG 1KBBA 3SB3A 2GEQA 4LBEB 5F9OH 4Q56A 1IGIL 5C6PB 1P7KA 3SR2C 3B77A 3GSOA 1LVEA 4BR6A 5DMGD 4ENZA 2XLLA 1BJMA 4FNRA 4QY8B 5IOPA 5E9DD 1CLCA 4PW9A 4YHKL 5B3JE 5F2FA 4JZJB 3IMVA 2AEQH 1KJ2B 5LAPA 2XN9E 4AI7A 3ZZLA 1REIA 2Z9TA 3RQ3A 5IW1A 4AM0Q 3BUDA 2ADFL 1BS3A 2VM3A 3WKQA 1SQBH 4YE4H 3ME0A 1Q8IA 4PJ7B 2GK0B 1IX2A 5IBTH 1VERA 2P8LA 3MJ8B 3N2KB 3K5RA 3TWCH 4OCYL 3LMJH 4UCFA 4G7SB 1ILUA 3VFGL 1RZ7L 4WNSA 2NLJB 5G4OA 1W72H 5BS0E 3TIDB 3MJ7A 4PS4H 1EEUA 1IU1A 4UAOB 2EEBA 2O5ZL 3SDCC 1MFBL 12E8H 3WS6C 2ZM6B 3LSOB 3BD5A 1VF7A 5BO1L 3CCVV 3M7MX 4U3HA 3SGDI 1G9NC 4FLVA 3FT9A 1SOQA 4LL4A 2CU9A 3FB6A 3S35H 3C5SB 3OB0K 4NC2B 3EBGA 4PLKD 1S4IA 3QARA 5D1ZA 4AYEC 4G7QB 1UWXK 5I1KL 1NAMA 3V6FA 4X99A 1CU4L 1KJVB 4H1LB 1EDHA 3LRKA 3VXMA 4EI5B 1I94B 3TGXA 2XWJA 5GRUL 1NFKA 2Y22A 2DIEA 3K3QA 4NZDA 4QNPF 4HPHA 3KJ4C 1DJWA 5EEWA 3AK2A 2GHWB 2HTKC 4FXGA 3PG2A 2ZSWA 2A9DA 1PNDA 1LEGA 5B1BB 2E47A 1EZLA 3LIZA 4OD2A 1R3KA 5EOCH 2EILB 1Q7YW 3CSPA 4HS8L 3ETBJ 1Q86W 4FL4B 4H13C 4D0BB 4U6VL 1CGYA 2OMZA 4QLRA 4A7GF 2WVUA 3GHBH 4X6BB 2CLVA 1AQDA 4QF1B 2QVFB 3DSNB 4LFAO 4ZOLB 1VF5C 2R2CA 1VRSA 5CMAB 3I02B 1HNZO 3FRUA 3L70H 2E5LB 3IFNL 1YO4A 4FTVE 4TTDD 5K1XA 4Y16A 2ZD9A 3MLVH 3L7FA 5IWAO 3ZHUA 3MV8B 3QIWA 4QRPB 3GGWA 3QH3B 4WO0A 4CU8A 1GTOA 4RUFA 3TJHC 1NH2B 2VZSA 5EC2A 3CC7V 4FMKA 1VQ4V 1I1AD 4AVKA 2W88A 3IMWA 1CDUA 1RY7B 4FQHB 2NY4B 1BD2A 5EBGA 5GRVL 2VRZA 5FDWA 3OQRA 3BIAX 4UM8A 3JSLA 2HKHH 4EIZC 5KVEH 3FL7A 2F54E 3CVIL 5AW3B 3VXUE 3KPNB 1ED3A 1UTDA 1DVFB 2ZWZA 4KV5F 5AW9B 2GFBB 3N43F 3QSKB 4U0QB 3D25A 1EBPA 3EJJX 5TE4L 4HK0B 4FX5A 1PNCA 3WCYA 3MLPA 1A7QH 4NZUH 4MNHA 2ZUYA 1W2KT 4D7SA 4HF5H 4RBPH 4NNXA 5MEPB 1SJXA 3LD8C 3AG4B 3S4SB 5B7FA 1LNQA 2VXUH 3QJXA 3GIVA 3TIEA 5TF1L 4GYBA 4MTOA 3P77B 3WFVA 3FSWA 4PVMA 4RAHA 2E7MA 5E8DL 1YMMD 2JKLA 4K7FA 3C5XA 1J0IA 1G7QB 2UXGA 5ESQA 5D2LE 3WD5L 3SCMC 2MJWA 5DHVA 4QRBA 1IBLB 1R47A 3EZJB 1J10A 3VJ6A 3AACA 5B38A 3MJ9H 5F71A 2YMOA 3WEMA 2Q7HA 4DR3O 1U8CA 2HG5B 3FUHA 3IKCB 3MA9L 4P2QE 4PB9H 3BT0A 1H2KA 3VXSD 1MDAA 1F4HA 3O2DH 4Y4HA 3EOBA 2GCYA 4DP1X 1OK8A 4BH7B 3RWHA 3L4YA 4RMVA 4QE9A 1RUPH 4E41D 4ZW6A 3SGDH 4WHCA 2IH1C 4JV5B 3JTTA 1YNKH 4MRBA 4GKJB 5F1IA 5FYLH 3QIUD 4YAQB 3T0XA 3TF7C 3QPQC 3TH3T 4QOKD 3TBSB 5IJKA 3K08A 2ESVD 3MKKA 2W0PA 1VGEL 1P7QB 4QCIA 4HIXL 5D1XB 1X6LA 3J2PA 2YIBA 4G1MA 4WHYG 2JCCA 3QDMA 3DGGB 3PFUA 1F6LL 2YD2A 3DRQB 3MAWA 5CMUA 1AO7E 3KYMA 1FYTA 3GT6A 3ZUCA 5FO2A 4NIKB 5EOQL 3RHWK 4NBXB 3LQAH 2DQMA 1J18A 4K7PX 5L3GA 2F43G 5IM7B 1NGPL 3EFOB 3HC2A 1KXTB 4HX1B 1TYEB 4IYKA 2G5UA 5DS8B 5DSCA 3DXRB 2Y4TA 1M7DB 3NVQA 4BZ2H 5IV2A 3CZEA 1KBHA 3D39E 3QAQA 1RK1A 3LN4B 4RESB 4LASH 5ADOL 3QXAB 4N8UA 3LOWA 3HKDB 1YJNV 2BO0A 3HLAA 1JPFA 4U1HB 4MJ5B 1JMKC 2YN5A 1YDXA 3BN9C 5I6PA 1CWVA 4LCUA 1YJDL 1T20A 2ICCA 2C4FT 5D1QC 4OV6F 5B1KA 4LNUA 4YHOL 4P2OB 3SGKA 3UBXG 4JFPA 2QLVB 4FQIL 2NXYB 4GXVL 4NZRL 1E43A 2JKSA 2MNUA 3UGXA 2CHWA 4J9ZB 4J42A 3FT3A 4NLAA 2G3ZA 2VLJE 2W65A 3KEHA 1G9NH 3L9YA 4P23C 5IVOA 3V5HB 4HJ1A 4ELMF 3ZY7A 2HVJB 2NXZC 4CILA 1OANA 4HNAA 3ARRA 3EYUH 1S9YA 1WZKA 3HG3A 1A7BA 3MRNA 1ZJAA 1M6OA 2GABA 5CR1A 4QDGA 1LK2A 3QIBA 2VOTA 4QXWA 4CSZA 2FATL 3E86A 4LPWA 3MLXH 3CXCU 1RUKL 3BD4A 3MUUA 3UZQB 3GK8H 4I3RL 5K69A 2H2SC 4M7KH 2WP3O 4MAYB 4CU6A 3MOBL 3K5NA 1L0PA 2DYSB 4TQEH 3RYFB 3PXHA 5EF1A 4S0HA 4N0UB 2C7FA 2HSIA 5JR1H 5IB2A 4UTCA 1BHAA 3HMXH 3HKZA 4JRLA 1QBML 4E0RB 1OTTC 1FSKC 3QFGA 4PGBA 1HZHL 3MUY1 1YEHL 4Y4KC 8FABA 5TQ0L 3DHJA 3WNMA 3ZMTA 1CQYA 4XPBL 3UO1H 1GTFA 2X1PA 4ABMA 3O3EB 4HZLB 3C09C 2IQ9H 4ODTH 1WRFA 1FH5H 4OKVA 2IH3A 1Y76A 4LFAB 3T3PF 4FLSA 3LDCA 3MX0A 4UINL 1AGEB 2W91A 3V7AE 4JFDB 4IGBA 1RIVH 4O00A 3VD5A 5TGBB 5D5PA 2Q2LA 2M1KA 4K3EH 1KN4H 3PWPE 5D6DC 4PLJD 4QHLA 1A6ZA 4K9EL 4POUB 5D8JH 4C47A 4AT6A 2CLZB 2XTLA 3D18B 2GJJA 1H3GA 3A0OA 3MREB 3IDNB 3HI5L 2BTQB 4DV6B 1GC1H 1WS8A 4NUJA 4UF7C 2DLEA 5GZND 3BZ4B 4WW2C 4E9VA 5JHLH 4K0OA 4XP1H 1JVMA 4AQ1A 2IWKA 2CDYA 3JUYA 1NMCB 2FYYB 5I74C 1OY3B 3WFCL 2PP7A 4GMSL 1YRKA 3NESA 1RIUH 3WJMB 3Q44A 4WHDA 5DR5L 5K1NA 4J3UA 2CG9X 4XNAA 2YMXH 5DJ6A 4H8QA 1ND0A 1LDPL 4FFYA 2QM7A 3SYQA 2CK0H 2J8HA 4G6JL 5F9JA 2QADC 5E9DA 4FLRA 2P8PA 4MBRA 2V7HB 1S7TA 2ZE8A 4FXKA 2VH5L 4OBSA 2H26B 4G7RB 2QGBA 2XSKA 4N0YL 2B77A 4WV1C 3VFTB 2A6KB 3BUTA 4ZZKA 4E9XA 4Z18A 1TTGA 5E5UB 1EK3A 4GUOA 1JUFB 1QPKA 5SWSD 2VR9A 3L3OA 3NIFF 3QUGA 2G60H 2WWOA 3CVHH 4ODVL 3S3WA 2PCFA 3G08A 5DJDB 3FO0H 1X59A 3C2AH 4BKLA 4WFHE 3LXBA 4HGWB 3K58A 4AQ8A 1I8UA 2R9HC 3HG1D 4E2OA 3WFEL 5L88L 5IHBA 3PJSK 3NIGF 2XWRA 1OCOC 4GRWE 5BRPA 4HUNB 4RGNE 7TAAA 2XIDA 3A4DA 3MBED 3U0TB 5JOPE 5DD6B 2B7DT 3FO1B 3ZRSA 5I24A 4OLVH 5C8JA 2W0FC 1T7WA 5F1NA 3K5MA 5HYJB 1I8IB 2XBDA 3BKMH 4Z3HA 5ILTL 2YRPA 4AQYO 4NI3A 2OSXA 5IW3A 1KBWA 1P0SE 1I1RA 1HXKA 3NJLA 1BWMA 1DFBL 4Q20A 4R0LA 3D7PA 1FGNL 4OZGB 4TVPE 4Y2NA 1EAPB 3L4TA 43C9A 4X98A 4KUZL 2YK1L 4XR8C 3VDCA 2J1KA 2ZT9C 1M4KA 3IXTA 2G2PA 4Y1AD 1HI6B 4PJGA 3G5VA 3HHRB 4V2BA 5L6YH 1BM3H 1B4LA 2R2HB 1DQDL 2OR9L 4IMKA 1WS7A 4H40A 3Q6FB 4ONGL 1CFVL 1XR9A 5DT1H 5IYCO 1I1AA 3LYRA 3FU6A 4K3HA 2ZE6A 1I1FA 2WQAA 2LP7A 1NIFA 5LQBL 3DBSA 3DX8A 2WVVB 4UV4H 1JFFB 3MDJA 2Q7AA 1S7WB 3H2PA 4GAJH 4PIBA 3EH4B 3GMMB 5JQGA 2WBKA 4NN5B 4PTUB 4M8VA 4XMUA 3VUAA 3DC0A 4GQQA 1MQ8A 1MVFA 1DANU 2NSXA 1E6JL 4H88H 4ANKA 2Y7QA 4PIRF 2O93L 4N8CL 2N1KA 3FRPB 5DI8B 1R6KA 3CK0L 1D7BA 1FLRH 2DQCL 4M62L 3CCUV 3TL5A 3E38A 1R3JA 4I3SL 1GW6A 4GNKB 3W81A 4LESA 1SA0B 3SDLA 5C3IA 4OVVA 4Y2OA 5F0MB 5HHOD 3PJSA 3CN1A 3FXIC 3L3JB 4BDVB 1OT4A 3U0ZA 4AENA 4LNRB 1N0LA 3OKDA 2W9LA 4OB5H 1BVKB 4JI1O 1YMMA 3HG4A 1ZV2A 1ZEAL 2HFEB 3HAEB 2EBOA 2YA0A 2MW2B 2DQHH 4KJQC 3HKFA 2QMKA 3S2AA 4X4MA 1RULL 3NJJA 3HKCB 3PFQA 4JFWA 2WBWB 4N87A 2NNUA 4L4VB 3ZHKA 3RVUD 5TF0A 2FCBA 1XREA 3VXSA 1GPOL 4YXWG 2ICEC 3LN9A 1ETZB 1M3IA 3IMSA 2F1MA 4FM0A 1IAII 1MXDA 4K55A 4E41A 3NJVA 4J3WA 3V5DA 3SOBH 2HT4C 3GSQB 3WEXA 2ZUWA 4XT1C 3QIUA 5GS1A 4P59H 1MFNA 2ZYHA 1N2RA 3MRBB 1SQGA 4QOKA 1V10A