2OCCB

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
b'MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2occB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2occB02
1GR7A 3QQXA 2QPDB 2BO0A 4E9QA 3TA4D 2CALA 2PPEA 1PCSA 2XV3A 3FSZA 1AZCA 4KOCA 2YXWA 1NICA 2UXFA 1JZFA 2WSDA 4E9RA 2FNWA 4JHUA 1ASOA 2VM3A 2VW4A 3D12B 3V9EA 1PZBA 4CSZA 4YSCA 2HX9A 1J9TA 3CG8A 4F7KA 2MTAA 2FT8A 1ILUA 1E5ZA 3U25A 4UANA 4HZ1A 2DYSB 1NTDA 2B08A 4DP1X 1CUOA 3PXLA 2DWTA 3WIAA 1V55B 3HEIB 2XLLA 2GI0A 2LLNA 3FS9A 1AOZA 2OV0A 4AX3A 1WA2X 3NJLA 1SNRA 1BXAA 1JOIA 4AI7A 2AVFA 3SQRA 4GYBA 2UXVA 5I5JA 1OF0A 1GS7A 3X1FA 3ZIYA 3PAUA 3AY2A 3FU9A 1J5CA 1T5KA 4BXVA 2YXVA 1SF3A 2CBPA 2NRDA 4YSTA 5F7BA 5E9NA 1KBWA 4W9ZA 1V10A 1X9UA 1QLEB 1KCBA 3ZX1A 1N68A 2QT6A 1M57B 2W88A 1NIFA 4FAAB 2YEVB 2IWEA 2DY2A 1KBVA 3FSVA 1I53A 1JZIA 2PPCA 4AKOA 1CURA 3V9CA 1N70A 3OMIB 4RH4A 4K9JA 4DPAX 2H3XC 4YSOA 1GSKA 1J5DA 1W6WA 2IH8A 2P80A 1GY1A 4AKQA 2WO3B 4E9VA 4HCFA 3S8GB 6PCYA 2IDUA 2Y69B 4A68A 1L9PA 5I26A 3NJMA 3ASNB 3WG7B 3MX0B 3PPSA 5LDUA 1AACA 2HRHA 2VW7A 4HIPA 2BHFA 1XB8A 1JXGA 2PP8A 3NJNA 4PCYA 1GY2A 1RCYA 2PP7A 1BQRA 2QPEB 3PLYA 3ABLB 3SBPA 3FQYA 2J5WA 1ASPA 2Q9OA 5B1JC 2IDQA 1KGYE 1RZPA 3NJHA 3NSYA 2IDSA 1NWOA 2J56A 1NDTA 3GDCA 2ZONA 4UAHA 4JHVA 4YSEA 4X4KA 3OD3A 2YARA 4FA7B 5B7MA 1WA1X 2PPFA 3CVBA 5D4JA 1A3ZA 2WO2B 3T6ZA 2P80D 4YSPA 1GYCA 8PAZA 1B3IA 3WKQA 2YAFA 2BWDA 2XYBA 1BYOA 4HCGA 1E67A 3EHBB 1ETJA 5B1KA 3ABGA 2YAOA 4NB7A 3TBBA 1OOWA 3X1GA 4P5SA 3T9WA 2QDVA 3UAEA 5EHFA 1JVLA 2W8CA 3T6XA 1SFDA 2XXGA 3FPXA 2VN3A 3CDZA 1F56A 3OMAB 2IWFA 4TXVB 1FA4A 1BEXA 1SDDB 2Q5BA 4HAKA 5I6MA 2EIMB 4Q89A 4A66A 2I7OA 3DIVA 1KCWA 1JXDA 3T6VA 1OE3A 3CDZB 1SF5A 5I5IA 1PZAA 2BP8A 2H5UA 1A65A 4YSRA 1PZCA 2TSAA 4E9WA 1L9TA 2AFNA 4E9XA 4GXFA 1AAJA 3X2QB 1L9SA 1SHWA 1HAWA 1OE2A 3SBQA 5B1AB 1MZYA 2J57A 3FQ1A 1BXUA 3UADA 2IDFA 4BDVA 3AG3B 4PAZA 5D4HA 2IWKA 3OM3B 2BP8B 3AG4B 2BP0A 2AZUA 3FQ2A 2MRYA 4ENZA 3UACA 2B3IA 5TK4A 3S3BB 1URIA 3JTBA 3DTUB 2BZ7A 4YSAA 1JZGA 1ET5A 1PLBA 2PCFA 4A2HA 3EH4B 5I6LA 5TK2A 4BDVB 3HB3B 1V54B 2PP9A 4KNTA 4A2EA 1NIAA 3EH3B 2PLTA 2BP0B 3KW8A 2AANA 1A8ZA 3EH5B 2FT7A 1CYXA 2DV6A 1OCZB 4BWUA 4M4RB 6PAZA 1IUZA 1TKWA 2HLEB 1PF3A 1M56B 4HCIA 2PPAA 3MBWB 3ZBMA 1PY0A 4KO7A 4E9TA 2YQBA 3NT0A 3PAVA 1HFUA 2UXTA 4A2GA 3ASOB 3QJTB 1XMEB 1JZJA 5I6KA 4ZK8A 2EIJB 2ZXWB 5B3SB 1JZEA 4NAJA 3BQVA 4A67A 4M3HA 4E9SA 1WS8A 3DKHA 2XV2A 5AZUA 1AIZA 2DWSA 1SJMA 2AZAA 1KDJA 2HX7A 1KV7A 1MG3C 2UX7A 4MFHA 5D4IA 4CSPA 4DP9X 1NZRA 3X1BA 1AS8A 1RKRA 2I7SA 2XX1A 3AG2B 2HRGA 4YSUA 2BZCA 2XVBA 3UGEA 1QNIA 1ASQA 2IH9A 2YAEA 1JXFA 3NP3A 1EHKB 4QKTA 3PCYA 1AG0A 1BQKA 1QHQA 4N8UA 3CVDA 4DP4X 1AZNA 5B7FA 2XWZA 2X87A 3FSWA 4KNUA 5F7AA 1L9QA 3N2JA 3NSFA 3ABKB 1AS7A 3TU6A 1GS8A 3UABA 5B7EA 1KYAA 1A4CA 1EZLA 1E5YA 1PMYA 4WKXA 4AKPA 4KO6A 4NERA 2GC7C 2JFCA 4YL4A 3FYEB 2QDWA 2FTAA 1ZIAA 2PCYA 2OJ1A 3FSAA 2VM4A 2TSBA 1SDDA 1FFTB 2CAKA 4WTQA 1OCCB 4BK5C 1ZDQA 3ABMB 3X1EA 1DZ0A 5I6PA 2FQGA 2H47C 2XU9A 4G71B 3NP4A 4E9YA 2JXMA 3NJGA 3OQRA 4W1TA 4DP2X 4UF7C 3QJQB 1NIDA 2BW4A 2BWIA 1BXVA 4YSDA 1XB3A 1AG6A 2OCCB 2EIKB 1JZHA 4DP5X 1GS6X 4G70B 3X1NA 4HHWA 1ET8A 1ET7A 2FQDA 3FU8A 9PCYA 2RACA 4BWTA 3NJIA 2FT6A 3T71A 1CC3A 4BWWA 4A2FA 3NJKA 3NSDA 5A7EA 1W6LA 2R7EA 2VMJA 3TBCA 2FWLB 2GB2A 1E30A 1NINA 4G7QB 5I5MA 1WAEA 3NJFA 3NJJA 2CJ3A 1HAUA 1FWXA 1OCRB 1WS7A 5PAZA 1MZZA 1AR1B 2YAPA 2ZOOA 4KO5A 1MDAA 2R7EB 5AKRA 3QJVB 4BXSV 4DPBX 1IC0A 1ID2A 4JKNA 3WI9A 5IY5B 1IBZA 1M9WA 4GP4B 2EINB 2CUAA 2GBAA 3FT0A 1BQ5A 4Q8BA 4P5RA 3FYIB 3PAZA 5PCYA 2EILB 2VW6A 1AZUA 1A4AA 2VSMB 2N0MA 4YSSA 4QLWA 3SBRA 1E65A 3FPYA 4G7SB 1PLAA 1NPNA 2CCWA 3QJRB 2GIMA 4YVNA 5B1JA 3FU7A 2DYRB 4KOBA 1ZV2A 2HXAA 1L9RA 5ANHA 3IE9A 4G7RB 3RYMA 1JVOA 1UATA 1WA0X 1NPJA 3BVDB 1TEFA 5I6NA 3IEAA 1PNDA 1PAZA 3H56A 4YVUA 2A3TA 2VSKB 3FU7B 1MG2C 1PLCA 1AQ8A 4KO9A 3T6WA 5FC9A 7PAZA 1OCOB 1NIBA 1AZRA 5I28A 3TASA 1AANA 3NSCA 3NYKA 4DP8X 2GHZA 1ILSA 2FJSA 1JERA 1GW0A 4HALA 3S8FB 1NIEA 3QJUB 3QPKA 4GP8B 3S3DB 2UXGA 1BYPA 1AS6A 3QJSB 1PNCA 1NWPA 3OMNB 3AZUA 3WNJA 4L0PB 4GP5B 5AFAA 1BAWA 3AG1B 3L45A 1VLXA 2Y1AA 3CZUB 1A4BA 2XXFA 3IN2A 4DP7X 4DP0X 1J9SA 3IBOA 4YSQA 1SHXA 2J55A 2XUWA 3WKPA 1OE1A 4N4YB 2FQFA 1J9RA 2YAQA 3AW5A 4A2DA 4DP6X 1ZPUA 4G72B 1YLBB 1ZDSA 1AZBA 3EF4A 4DPCX 3CVCA 4HHGA 2UX6A 1L9OA 2E86A 1OV8A 2GSMB 4F2EA 1ZIBA 2HZHA 3S3CB 1IBYA 1J9QA 1TEGA 2FQEA 1ADWA 3JT2A 2ZWNA 3C75A 1CYWA 3ERXA 3GXUB 1XB6A 4KNSA 2HX8A 3GYRA 2I85A 3ZDWA 2BW5A 2YAHA 1SFHA 4F2FA 1DYZA 3IN0A 2YAMA 2GC4C 1R1CA 2JKWA 3H4FA 4GY4A 2PPDA 2XV0A 1RZQA 2X88A 3WNIA 1IKOP 1TU2A 1KDIA 1X9RA 3G5WA 3N55A 3UAAA 4AZUA 2IDTA 3KW7A 2XX0A 3H4HA 1W8EA 2IAAC 5B1BB 4EF3A 5I6OA 7PCYA
chains in the Genus database with same CATH superfamily
3SPJA 1R5WA 3BQUB 4LF3A 4NKOA 1P9MA 4PJ5D 4JPRA 4PU2A 3UJIH 2NCEA 4EI6B 5GGRA 3KG2A 1THZA 2CALA 2O5NA 2Y07L 3BZ4B 1YEFL 2C7UA 2Y0SA 3DHPA 3F85A 5I17B 2IH1C 1SMDA 1Q82W 3MUJA 4JZ2A 3GM8A 3NFPA 4ZW5A 5J6GA 2OIGA 2CO7A 1N67A 1I8KA 5IB1A 2FBJH 2D7MA 1IVLA 1G94A 3D12B 1I1YB 5I1GH 2WUBH 3ZMUA 3HPLA 3ILEA 2WLIA 3B7SA 4PJFF 4QPKA 2XI9A 3H2QA 2DH2A 2E74B 4RGOL 2WZPD 1RSOB 1S6NA 3AXIA 4ALAC 4R2GD 3QXUA 1E4JA 3D39D 3B9KC 4O58L 1OD9A 2D73A 4XNUL 4XN4A 3OKMA 1N3NA 1QFOA 4K8RL 5KLVH 1JOIA 1UYWH 4Y4HB 3SB3A 1SLVA 5A6LA 1E9OA 3DGDA 3VI3B 1X44A 5I6XB 4EKWA 4L0YA 2E9WA 3T04D 4R7LA 1KEML 3A22A 2GAZA 2DQCH 2WLZA 4QDGA 4OVUA 2AITA 3AG7A 4QMEA 2NNUA 3HRZC 4H8HA 1WJ3A 3ULVF 2C3HA 3EYFA 1KBWA 4YIOA 1X9UA 2V8LA 3JXAA 1TUPA 3OV6A 4X5QA 2EDYA 4QHKI 1LYQA 2RALA 4HCRA 3BEHA 2YA2A 3HZKA 4S11A 5CBAA 1QZ1A 1SMAA 5JDSA 2P43B 4RLDA 3VFWA 1TMCB 1X9QA 3L3GA 4UT7H 1AIFB 5CBEA 1ACXA 4ANVA 2ZKHL 1I9RH 3B8SA 2Z31D 3KPMB 3NR7A 4O2BB 2YSTA 1BGYH 4YSOA 2ORBH 1UEYA 1Q72H 3IF1A 1X4XA 1C8PA 2BXYA 5EU4A 3BVXA 3VFSA 1KN4L 2LQRA 3QZOA 5ENWA 3NFNA 3VYNA 3VVVA 1QBAA 1R9FA 1YPZE 1OCWL 2P9RA 3WU1A 1JDAA 4IW4C 1XR8B 3NXSA 1ITCA 1JV2B 4GSQA 5JW4N 3G80A 1BBDL 4IHBA 4ZO6A 4JJHA 2F8OA 4JDTL 1P84J 2F0CA 3G5XA 4JG0H 4YDKH 2XA3A 1S2EA 2N74A 2IANB 3UTTB 4J4PA 4ZKIA 1E4XH 1LD9B 1NL0H 3MLRH 1VJSA 1KJVB 2B3RA 1XNQB 4GH7B 4JKLA 2OTJV 3B9AA 4F15C 4X9QA 2BWQA 3U4BH 5EUKB 4B3TO 4UQEA 4L8CA 4GT1A 2D7QA 2NXZC 3MV7E 1NWOA 3HCVB 1QWNA 1GN6A 3FN0L 1QSVA 3JWDL 4UAHA 1O5DT 3CBJB 1J1PL 3DGCR 3UROR 1BM3L 4J3OF 3B8YA 1YEKH 3IRPX 1ULVA 3S48A 3AACA 1CPUA 5F1NB 1XCQA 4H5SB 4DJMA 1FYTB 3FRUA 3CFIC 4I50A 1YXBA 1FP5A 4X7SH 1CXHA 5JH7A 2B1AH 3C5ZD 1NCWH 4KK9C 4ODTH 3N1GC 3THMH 2HVJC 2ZDIA 3AWFA 4AIOA 3X17A 4N2IA 1KCSL 2FB4H 3AADB 4LEEA 4WCYL 4IRJA 3CFBB 5JJJB 2WBWB 2QLYA 1B3IA 3X3FL 3O11A 1BD2E 4RWHA 2XYBA 1KGIA 3MRNA 4H13B 2X5PA 2ZX7A 4XNMA 5C07D 5ECGA 4Z95L 2RNBA 4KX9A 3BH9A 3NMEA 5T1LB 1M7DA 2QL1A 1N8ZB 2VQEB 2VLJB 1KWGA 4LFCO 3CDZA 5AEAA 5EOCL 1S7VA 1LLAA 2J1WA 3SEPA 1A66A 1FA4A 1B4RA 4WI3A 5D1XE 3Q9PA 1IGTB 5IW6A 4I85A 2VITA 3MHSC 5DJXB 3OJMB 2MOGA 2LOEA 2YXFA 3HE7D 3L1OH 3LPWA 4NC0B 2XFXA 1EUUA 3DX9A 3KHQA 5FUCE 3EYSH 1H0DB 1ECYA 2NY6C 3DSFH 1ZEAL 3DMMC 1AHWC 1MCWW 4PTTA 5JQHC 4JRXB 4F58H 2I26N 2ZJSL 2FR4B 4L1BA 5HYFA 3N43B 2PETA 4LSQL 2ZX6A 5IG7B 3WS6A 1HH9B 5AB1A 4WGKA 3ZU8A 5LHGA 2IXQB 1TR7A 4DXWA 1CICC 5D4HA 1D5AA 3TGUH 3OM3B 2R0WH 2WY3B 1M9NA 5T3XD 4F24A 3RZWA 4KQ4H 5HHOB 4H8VA 3QP3A 2XZAH 4JO2H 4RA3A 4XOEA 4UB8Z 3VM5A 1A6PA 4NXKA 2HFFB 3ZDXB 4ZX3A 4I3GA 4P2RA 2VMDA 2DS4A 4MX7B 4XNZB 1DQIA 1H8NA 4BDVB 1SRDA 2Q8VA 1HT6A 3QEQE 3ZRSA 1F6FB 3MMEA 1TETH 2QEJA 3PV6A 2MOQA 4PFEA 3TC9A 4ZFOA 4Z0XB 3IM1A 4ERSL 2UUAO 2D7NA 2YO3A 4NHCL 1RP3B 5GW7A 2B8OT 2HLEB 5FGRA 5SWZD 4HPOL 3LUTB 4PJ9B 3R4DA 3X11A 3O81A 5AB9A 2PPAA 4ZFOL 5IY5C 2QQNH 5J89A 3DJSA 3D3QA 1FAIL 4XMXA 1W91A 3J2PA 1JI2A 5LBSL 1SZTA 1E4WH 4WEMB 4EDXA 1CLVA 5IVZA 5DZJA 3QDGD 4MJ5B 1MFVA 2WYZA 1OM9A 1SXNA 3ASOB 4AGNA 3MRJA 4JHAL 4ENEC 4PUBH 4FQ2H 2EIJB 4CSTA 5KYWB 3NIDB 4KY2A 1SOQA 4LBEC 4K7PH 3CC1A 3VXUB 4G83A 4M1GH 4W6WB 1U8CB 4EVNA 1XI1A 1FIGL 2R0ZH 2HX7A 1RHHA 2UX7A 2LTQC 2ZXDA 4LP4A 4UU9B 1KTDB 2PN5A 4CSPA 1AGEA 1YJDH 3D2UD 4LCUB 4PWJA 3X1BA 4DH2A 3B2XA 2K6ZA 3CFJB 1PIFA 1PLGL 3RYHB 3GMNB 3S4SG 4HF5H 1QRNE 2B4CL 2BHZA 1DZBA 1NAKL 4X65B 2DLHA 5IHHA 2P7TA 3R4RA 4B53A 2BZCA 3UGEA 3EYOA 5EU7C 4YDMA 5D7JC 2AXTZ 1HEHC 1VFAB 2EXSA 3O4LD 5DJ2B 5I1EL 2CKBL 1OCOC 2ZCHH 1XCTA 3ECWA 2VDKB 3L7EB 4UV7H 2BCKA 2FDBP 1PVHA 2EICA 4WUKH 4JDVA 3T4AB 3O9WB 5MENE 4IBTA 1JK8B 3OTOB 3ALXA 1EZLA 3P4NB 1T0OA 1KB5B 2Q7NA 5KSVB 2FH8A 4MSWB 5AZEH 4IKKA 2X4QA 2XN1A 1JGLH 2Q76A 1ODUA 5KW9H 4EMZA 2N59A 3IMVA 3ZXAC 2QVTA 2XWRA 4RFEA 5AW6B 1S3KH 1SDDA 1RJYA 3WBDA 1IBDA 4OF7A 3AREA 5IIEB 3JD3A 1NMCC 2AEOA 1AFVH 4RZKA 4WFED 5JHDE 3D3VE 3F7PC 3O6KH 1AJNA 4DR2B 1PL3A 3VD9A 1FZKB 3KCYA 1BZ9B 4PG9B 5HYSB 5IHWA 2FO4B 3ZR5A 1YA5A 1QMUA 2VO5A 3UTQA 1J05B 2FIRT 4U1KB 4W1TA 4E9YA 1TO5A 3C2AH 5BRZD 4A7VA 4ONGL 1GC1C 5FKPB 1WP7A 5HGBB 5IEHA 3MOBL 4JDEA 3Q8AA 3MQIA 4EIGB 3LIZH 2PF6A 4TNWF 5CMAB 3X1NA 3ZKND 2IAMC 2WXKA 3QIWC 4L9LC 4JE4B 1ET7A 5E03A 2O5ZH 2HFTA 5EBLC 1UC6A 1BVNP 5IZ7A 2HPOA 5L7XH 3CCQV 5D1ZD 1CC3A 5E6RB 4R83A 4QRSA 1CFBA 4NWUH 5AW4B 1INDH 3RVVC 3UXFA 1I8IA 4UDTA 2HLFD 3OPUA 5FB8B 1D5MA 2IV8A 1ZVSA 4YXWG 1ZS8A 4DGWC 5I5MA 2XKSA 3FUJA 1ITBB 3KWWA 1WS7A 3RI5K 4JFHE 3INUH 3KXFE 1ZT7B 4FA8A 1AR1B 4HQQH 1Z3RA 2R0LL 2ZOOA 2ZNXA 4L8BB 3R7QA 5JPNC 5F3HB 4K4KA 4M29A 1Z5HA 2WQWA 3DUUB 4Z7VE 2EX3A 4XWOD 3G08B 1ICTA 5L6YL 3MBXH 4ZXBA 5BXZA 1JXJA 1AE6H 3FB5A 1QPXA 2NQ3A 3DYPA 3FRPG 1J5OH 3ELAT 4M5YL 3F6JA 2VDKH 2Y4SA 4ODXA 5HD8D 4XAKE 3W57A 3GUTA 2N0MA 4PY8I 2B20A 4X6FB 2YGNA 4IOIB 1KPVB 1W59A 1PSKH 7CGTA 4KTDH 2ITDC 5JLZA 1HJCA 4YVNA 4UZGA 5D2LB 3LDEA 1RZ8A 4U31A 1LMKA 2IOMA 3DI3B 2DW5A 3MNZB 1UOVA 2BPBA 2G75A 4IOFC 1KKCA 2NY7H 3RWIA 2B14A 3ASWA 4JFQB 3WTXA 3PWPD 4WUUB 5TE7H 2APSA 4MD0B 2XXCB 1XMOB 1ZT1B 2J8UB 3NEXA 4RGND 3SO3B 5H37A 5I71C 1OTTC 5DDHA 3HR5B 2D03H 3UEZA 1QA9B 2HVJA 3MRLA 1PAZA 5IVXE 1PLCA 3TZVD 4F9PA 3G3LA 3D25A 4BIZA 2EKSB 3BWAA 1SXAA 5CUSH 5DD3L 4HP5A 1B04A 3UJJL 3R8QA 3UC0L 2Q6WB 5T5NF 4IHOB 1KPRB 1IURA 1KTJA 4KJYA 1JWUA 5AKSA 2IU0A 3GIZH 1OCZC 3FD9A 4WWPA 1SYVA 3A6CH 2X09A 4R0LB 5ISZD 4Z7UF 4J8RA 3MNWA 2AHZA 1K7DA 4JRYD 1WUZA 4DT2A 2ERJC 2ICWI 3NDZE 3MBED 1DQQB 4CU8A 3GMLB 4GW5B 4Y4FD 3VQYA 2R0KH 4RRPM 4U3SB 1CDGA 1E2WA 1S7RA 2GCYA 3UAJD 5E2TL 3ZW3A 1J88A 4YFEA 1ZVYA 3RTQB 3FL7A 3TXSA 2KZ1B 4YHIA 4QJ4B 3ULVL 4G72B 3KPNA 1GK9A 3DMMA 2IM9A 5D1QA 1RK0A 1N5YL 2BSRA 3KAAA 2UUCO 2YWZA 2VR3A 1NT2B 4HEPA 3STLB 2OMZA 3IK2A 1EJFA 4FLXA 2X1PA 3OLIA 4MD4B 3AAZA 1JN6B 3GI8L 2XVGA 4XCNA 1PZ3A 4I0PA 4GT0A 2VUKA 2F5BL 3RJOA 4DESA 1BFOA 3MDSA 2W65B 1EHNA 1U8MA 3QIBD 1R3JC 1S9WB 2KH2B 2G5BB 4WJ5B 3PNRB 4M7JH 4ES9A 5KSBF 1ZSDB 3UYPA 1YNTA 1MFMA 4M7LL 4AYBA 4TF4A 1CBVL 2D0HA 1QHTA 1RZKC 3BHBB 5EIBD 4S1RL 3QDJE 3VXOB 2Y6SD 2IQ9L 4NXMO 5E6IC 2V5TA 5IVOA 4PJHF 4EI5B 2F8XC 3QUYB 1D5BA 1WAZA 4GXVH 4DRXB 2WW8A 4I1PA 3LZRA 1QHOA 2X6BA 1IBMO 5ID1B 2EDQA 3N1PC 2FJGB 3QRGH 4PJAE 4RAVB 2XBZA 1IKFH 3B2UC 3CMEV 2P28B 5J2UB 2XTSA 4TUYB 1NCOA 3FFCE 2HKHL 1JK9A 3EDEA 1ZHNB 3T0EA 3FONB 1NH6A 3MRIA 3HN5A 4A6YB 1LXMA 2HRLA 1TTUA 4MJ4A 2VXSH 1QABA 1EDYA 1NBYB 5AD0B 4DTGH 1DJYA 1PX3A 4LBEA 1R5WB 2ZOKB 4LF3B 4NKOB 4S0HA 4U3JB 1LQSR 4GAGH 4P9ML 5GGRB 3T2NH 1B3QA 2W92A 4X4XA 4DO2A 5BS0A 3D30A 5GJTL 2AK1L 3NFPB 5J6GB 1IZ3A 4OSUH 2CO7B 4YHNB 2LLNA 5LG1A 3KL5A 2ATKB 1BSIA 1FO0A 1U8IA 2CMRL 2YD3A 3MCKA 3PXJA 5GRZA 2Q8AH 3HPLB 4L4VA 5EZOH 2WLIB 1KT2A 2Y48A 5E08H 3DK0A 4UQ2A 3HVDA 2CH7A 4PA6A 2YJLA 1FO0L 1AGCA 4PWGA 1YYMH 5D7JA 2HHHO 1CXLA 3RVXD 1RL1A 4L3ED 2ZNJA 3VH8A 3CRMA 1NKDA 3QCUH 4JZNA 3B3BA 3OKMB 1N3NB 4WF9V 4KI1A 2AW9A 1K4CA 2BIMA 2V2TB 3KBHE 1JMZA 2WO4A 1D6VL 3MRFB 2TAAA 1E9OB 3NIFE 4OD3L 2I9LA 4DSYA 2E7LC 4TUJA 4KL1A 5HHMB 1F4YL 4BKLA 4FTVA 4LCCC 4LARL 2GAZB 4B3VA 1Y67A 2DBLL 2IBZY 3HB3C 2EINC 4B08A 3MLXH 3C8KA 3RVWC 3KM1A 3HKFA 1HESA 3KDMA 3EYFB 3WD5L 1VAHA 1UD8A 3KYOA 5I8OH 4GMTH 2H6PA 3GWOA 3ESVF 1UH3A 1XCWA 4AUJA 5EU5A 4KUCD 4HCFA 3FMGH 4HULB 3CFQA 3HZKB 5CBAB 3U0PA 1D9KD 4ZHQA 1UB5A 2YLHA 4GQZA 3FB7A 2ZNIA 3VFWB 4LSTL 2YSUB 1T7WA 3PL6C 3F7QA 3L3GB 4P23D 5AVWB 5CBEB 3CFKA 3H9SA 2GTWA 1OAKL 4OLYH 2AABL 3IF1B 1LWHA 5CEZH 1NGXA 5B39G 5EU4B 2EIEA 1V27A 3AXHA 2NY1D 5ENWB 3NFNB 3LB6D 3P9WB 2R9HC 4IKJA 3GWKC 1UHVA 2BS71 2NY2D 1I3VA 3JVFC 2IAMA 2MH4A 1UGNA 3BP5A 4QT5A 5DVMA 1DQDL 2Q9OA 3GBNL 5KVMC 1OJHA 4A6YH 1JHTA 1K5NB 3CZNA 2H2SD 2J56A 4X5PA 1KIPB 4KK6D 5CA0A 2OTWA 3K6FA 3U9UB 4UV9A 2PYJA 4G3YL 4IK6A 4PJCF 4OKDA 3ARWA 4JKKA 4ZUSA 2H0JA 4HMCA 1DVYA 4M03A 2A83A 2E6JA 3HE6D 3ZR6A 2HFGH 1FS0G 3KPLA 1L0XA 4LLVA 1DQVA 4L8CB 3L5JA 4QTHB 2H9GA 2WO2B 1XEQA 1RPUA 3U9PH 4KX8A 3PRZA 4NQXA 1H2SB 3KCPA 4B3SB 4MMXC 4RGOH 3EJZD 5JPNA 2IDCA 4JI2B 3I75A 1XVSA 1XCQB 3T0VA 3FRUB 2CR0A 3EHBB 4I50B 1KELL 2EC8A 1CGSL 3ABGA 5JH7B 4JBSA 5EN3A 1SRYA 3VQWA 5J9PC 4K8RH 1TZGL 4IRZL 4CDGC 4H2AA 1TA8A 1DN2A 2LGWA 4ODSH 1MVFA 3T6XA 1SFDA 1N0XL 2GTZA 3L70H 3K5LA 4IRJB 1KEMH 1JF1A 1GMIA 4PWKA 3O11B 2VRQA 2C9UA 2ZAHA 5AVSB 6FABL 3MRNB 5KUKA 1TITA 4QYAA 3JT0A 4XNMB 3DRTA 4MJHA 1ODAA 1MWAL 3ZHTA 3D4CA 3N0AA 4EZLA 3BH9B 4G42A 4RDQG 2A9NL 1M7DB 2QM7A 3VA2C 1HL4A 2AERT 2PCPA 3DJ9A 4Z3TA 3T6VA 3BN9D 1LO2L 3CDZB 1S7VB 1P6AB 3ZDZB 2DI8A 4WEUD 3U1PA 3V52L 3TH2T 3ZE1B 5IW6B 2VITB 4UMGA 5I8KL 3EDJA 1FNLA 4Y5XC 1L9SA 4LOFA 4MVQA 3Q8EA 4KK5D 5L3CA 3WJLC 2XFXB 1QSZA 4ZX5A 3DX9B 1QO3A 4X8CA 4RISH 1S7TA 4TL5A 4X9GA 1OCWH 5ALBL 5HDWA 5A2BA 2M83A 3AG4B 4F4LA 1SJXA 4PV8A 4PTTB 2CGRH 2MRYA 2EQDA 1BBDH 1GOGA 2N4IA 1VZGA 2WK2A 2OSYA 4JFTA 4Y8AA 4X62O 3K9AA 4R26L 5LCVA 4XMPH 4JGMA 1HZKA 3KZIZ 3S97C 3AB0B 5K9QG 1I8UA 5B21A 5D7IA 2X2UA 2DL9A 1EEYA 2I9TB 5FV1L 4A7GF 1TF4A 5LCVL 4XBGA 4WI7A 1S7QA 3U83A 3E8UH 1WHPA 4DF9A 2B1IA 2RH0A 1OZTG 4NQCA 2ZR3A 1TVKA 1TKWA 3I9IA 4P2RB 2EYSA 1UWEL 2UXDB 2PW2A 1OAXH 3JWDH 3GPEA 3ZBMA 5H94A 1J1PH 2CO4A 4LSDA 4PRIA 1WRFA 3MMEB 3WFBL 4BFOA 4G6ML 3PV6B 4N0CD 3RFRA 4DV7B 3UO1L 4UVCA 2G4EA 4ZFOB 35C8H 3I6SA 4P5MA 3HR0A 1CYGA 4OQ1A 1J48A 3UIYA 5I6KA 1D2PA 4HJJH 2OFQA 4YMPA 3X11B 4FMVA 3LSQA 5F9WB 2IJKA 5DA0B 2ESVD 3X3FH 4WIQA 5HY9A 4EDXB 5IVZB 2KKQA 2YGQA 4KI5D 5AVTB 2DYRC 4YY3B 4ZW7A 1R3JA 4Z95H 5K59E 3VXMA 3MRJB 2DICA 1CVSC 4Z5RA 1QKZL 3WUWA 4F7PB 1WIOA 4M8UA 1GGIL 1RUQL 1B6UA 4WI4A 5EOCH 5I0DA 3QO0A 4EVNB 2P5WA 1YY8A 2FD6H 2ZXBA 3REVA 1AGEB 2CR6A 1EHKB 3FHQA 5BO1L 3GSXA 4WFBV 5D7EA 3RZCC 5CFAA 4KXRA 1NFDA 1JYVA 1MRCL 1BHAA 4DK1A 3QUML 3W7WA 4FQLL 4CN6A 2ETNA 3TU6A 4TVPD 2P7TB 1ZEAH 3M88A 3LVEA 3CLFH 4BFKA 1JYXA 3ILDA 1OHQA 2WXHA 2YRZA 3EYOB 3VQVA 2PYFA 3BH8A 3GINA 2ZJSH 1PKQE 1PMYA 5BUAA 3PABA 3Q43A 4KO6A 4DZ8A 4XN1A 4LSQH 3W11C 4YL4A 4MMZC 4UUJB 3CDGA 4LFAO 3B9DA 1N0JA 3CDYA 1M9SA 1XCTB 1I9IL 1UM5H 2QDWA 3ABTA 1FH5H 2BCKB 3KGUA 3T0AA 3UPCA 1EEZA 2BNQE 4JDVB 2BVPA 3GLDA 1QFPA 2TSBA 4MA3A 5BOPA 3EJQA 5JIIA 4TT3G 5IYBO 1GN2A 2H0PA 2D4FA 3AQZA 2LT9A 3RKDC 3TCTA 3G6BA 2IF7A 1PYWA 3OJDA 4EEEA 4FFVC 2X4QB 4G9DB 3I9AA 2X4RA 1GXEA 3X1EA 2Q76B 1VQLV 4M5ZL 5E8OA 2XU9A 3RIFK 4J1UA 4E42A 4RFEB 5K1PA 4PTUB 1RJYB 1MAML 2WQXA 4DP2X 4QGYA 4FL4B 1JFHA 3AREB 1JGVL 3CIAA 3KVQA 4IKIA 1AG6A 1KC5L 2YD6A 5C6PB 4LB8A 4MQSB 4DUYO 5BZBA 4LDEB 3MRRA 3QFGA 2FQDA 4HPOH 1VPOL 2WBXA 1FAIH 1EQWA 2RACA 4NN5C 1ETB1 3UTQB 3ZDYE 4P3CL 4XBPA 3G04A 4OKVA 2MFNA 4UM9B 1AJQA 2K70A 1LO5B 4ZSOB 3EO9L 2J72A 4YO0A 5IEHB 2E6QA 1BZ7A 4JDEB 2YEQA 3QPXL 1XH1A 3VVWA 4LCCA 4GT7A 2V1DA 3PIQA 1ML0A 3HG0A 5CSGA 4OD1L 2K78A 5LOVA 5T3ZH 1J0KA 5HDBE 2G5RA 5F8RC 4L1TA 3LH2L 3ULUD 5H6RA 2MQ0A 2Z93A 4QRSB 4JG5A 4QD2E 2Y7OA 4ZFQA 1I8IB 4UDTB 4HOXA 2Z35A 4JKNA 1D5MB 2CCLA 4PDVA 2O6EA 2L4OA 1Q6UA 1ZVSB 1YEJL 3JWNC 4PB0L 2MPAL 1TJGL 4I3RL 3H1KH 4P5RA 5CCKH 2A38A 3ATBA 2FJHA 3ETBF 4PJHA 2XHNA 1A4AA 4JV5O 1SUJA 5HGHA 2EXWC 1PD3A 5L3EA 3PP4H 5IB3A 4JPSA 2YZ8A 4ZXBB 5LVEA 2EJ1A 1JSYA 2Y3NA 3FB5B 4XC1L 4KOBA 2ADIA 5DJDB 1HNXO 1UWGH 3LRHA 4MAYC 4F37K 4X20A 2ZE0A 4ODXB 3GUTB 3TBWA 4AK2A 3OLEA 3WGVB 2WVSA 4POZD 3TVMA 5IGXH 1WFNA 2V0AA 5CBGA 3T2MA 2YIBA 5JLZB 4F15B 4GG6A 1GW6A 1KCLA 3S5YA 4PJ5E 1RZ8B 1CMOA 4GX0A 5GRXG 4DR1B 4OX9B 3BVUA 2DLEA 3OF6D 1O6VA 2B7DT 3RWIB 2G75B 5F97E 2CBMA 2JCCA 3II3A 1BG1A 2X9YA 5CA1A 2GHZA 4X8XA 3WFCL 5DDHB 1QI4A 3LEXA 1HIML 3MRLB 2NR6D 4ILDA 5HDOA 4ONGH 4PJFB 4FVMA 3NCEB 3D25B 3MOBH 4QE7A 3BWAB 1OW0C 5ANMA 4X5XA 3IDMA 1PNCA 4ETYA 1CVRA 4HHAA 4YQXL 3BABA 1S5HA 3D39E 4Y89A 4Z8FH 3CEIA 1UD4A 1G5AA 6CGTA 4KJYB 4ANUA 1JWUB 1E7VA 2K3TA 3HBPA 4J41A 3JAMN 4QRRE 2EZ0D 2KQNA 1P2CA 3JAWA 4IRSA 4W93A 2LU3A 3APMA 3MNWB 4LOEA 4OCYL 3CDFA 4G7YL 2YOCA 3T2LA 4CW1A 4YXLL 5MP6L 4NCDA 5JIDA 3B8NA 3M1CA 2Z6FA 3S5LG 2E7BA 3S36X 4RO2A 2DAVA 4CILA 2VLLA 1DLBA 3AFLA 3BPLB 2A1WL 1CDIA 4Y5XA 2XQYA 1S7RB 4AIXA 4QXVA 4QAWA 4LLUA 2R0LH 3L75H 1ADQA 1BP3B 4N90D 4U1LA 4GKKO 4HLEA 4YHIB 5FFGA 3KPNB 4UNIA 4KNSA 3DMMB 3V0IA 4X64B 1HP8A 4WK0B 5D1QB 2QVFB 5L6YH 1RK0B 4N2CA 2BSRB 1ADQL 2YAHA 4GQPH 1NEPA 4CSSA 3DXRA 1D2DA 1X6LA 4J3XA 2CBTA 2OMZB 3FUEA 4E41E 3HKBA 4MBRA 2JV6A 5DD0H 5BV7B 3QRLA 3SE4C 3AAZB 1ZHBB 1L3WA 4MQ7A 4XCNB 4KFMA 4I0PB 1PPJH 2DKUA 4KQ0A 5HYIA 1BFOB 1VIWA 2X88A 1U8MB 1X9RA 1B0RA 1SVBA 1AVAA 5KA5A 5J3HC 1EPFA 3T3MB 4AGOA 1R73A 2XWTA 1RJCA 1YNTB 2J21A 3UYPB 1U8HA 4EF3A 4IIZA 4JJ5A 3T8MA 5DJCB 2E7CA 5FYJL 2JQMA 4G11A 3UERA 4PJCA 4WSGA 4NXNO 2QPDB 3EG9A 1XXDC 2JKJA 1D5BB 1R19A 4AGLA 3EH2A 4O5LH 1K33A 2C9XA 4IHJA 1LK3H 1NAML 3DNKA 1NTZH 1HHKA 1A4JA 1XGRA 3B83A 3DETD 5I1JH 1VQ9V 1M53A 4JHUA 5H37H 5DD3H 2MNUA 3AM8C 3FTUA 1PZBA 2GTQA 4CSZA 3O45A 3QZMA 4GO6B 2R1XA 3A0OA 1JK9B 3T0EB 4HZ1A 4JASA 4CVXA 4DP1X 5DVKA 3MRIB 4RUFA 1I3GL 5F9AC 1I94O 1RURH 4XHJC 2Y9RT 3W9DA 2VDQB 4TM9A 3GXPA 3S2CA 5CA3A 1Y18A 5TDNA 2XWXA 4AX3A 1JV5B 2WCSA 4QLRA 4BK4A 4JGJA 3WE1A 2ZUVA 3Q5TA 5F1KC 4B41A 4DR7O 2F23A 4KK8D 5EEXA 4LZKA 5I5JA 4X4XB 5C07E 1QTPA 5EIIG 3FOLA 4ZUTA 3NJVA 1NGYA 1ZVHA 4G1EA 2JE8A 1AO7E 1A6UL 1CCZA 1UQSA 1HU8A 2O30A 3MCKB 1FO0B 1U8IB 2DMBA 3CZKA 3RU8L 2CBPA 1KYOJ 3QWQB 3MLVH 4ZMYA 2DMCA 3RZCA 1VFOA 4L4VB 3O8XC 2W6JG 2K1EA 5BW7A 5FO7A 5ALCL 4UQ2B 2C3VA 5HGDB 3C60D 2CH7B 2H6UA 1AGCB 2Q3XA 3B56A 4HJIA 1YYLL 2VL5A 1JFFA 4NKQB 1JZIA 3VH8B 2WIMA 2GEEA 4XPGL 3QZBA 4UQDA 1EEUA 3LNEA 4JZNB 5BCAA 3WNKA 5EEZA 1Q0YL 1K4CB 5D6DC 3UBGA 1U96A 1MCBA 2WWOA 3I02A 3GMQA 4L4TA 3N06B 2UYLA 4TUJB 4XRCA 3ZJZA 4BKLB 5BV7H 1R5IA 3J07A 4FTVB 4JM2F 1UA6H 3S8GB 4YIQA 3K59A 1US6A 1KY6A 2CK0H 2A2QT 4LF4B 2E9BA 3C8KB 3H3BC 3RYFA 4R8WL 3VXNA 4YWGL 5JZ7D 3CSPA 1MXGA 2R29A 3KDMB 4KMLB 3SODB 1CIUA 3KYOB 3F84A 4CU7A 1P7GA 1IC4L 2IQ9H 2HJFA 2NY4C 2PP8A 2ID5A 3JWOH 5JYLA 4WFFA 5EU5B 5C0RL 4CS4A 3GC3A 3U0PB 1ROCA 3ZMEA 4JTAB 5C0DA 5AL0A 1VFBB 3IGAC 3G4SV 1A5FH 1UB5B 3R19A 3IKKA 3FB7B 1JNLH 3CGTA 3F6IA 4OBRA 3SBPA 3AS2A 2E6PA 4X66O 2ZG3A 1G9ML 3CFKB 3H9SB 2CCVA 3SJVD 3OLDA 3GS4A 2GTWB 1BAFH 1YEEH 1RZPA 2RAMA 4G28B 3L5HA 2DTML 5E6UB 1NGXB 5HDQL 4KZEL 3WELA 4ZTPL 5C08D 3R18A 4X4YA 4FIPC 1JGUL 4A7QA 4MCMA 2JQAA 2MQGA 4LF5B 2IAMB 5SWZE 4I0KA 4J3OH 4KXAA 4MVOA 3BP5B 3QDHA 4QT5B 4M1DL 5J12C 1A3ZA 2IV9A 2R2EB 4F9LC 1JHTB 4IL6Z 2FX9L 4P9MH 2GFBA 4K7PY 2WQVA 4NUMA 3TYGL 2VDQH 4BZ1A 3RAJL 3A0HZ 5CA0B 4ZFGL 4HLZH 3NACL 4GKNA 2AK1H 4ZUSB 5IW1A 2A83B 5GS1C 2DEWX 4K7FA 1BYOA 4HGKC 2CMRH 4JY5H 3KPOA 1CF8L 4LLVB 2QTVA 4QTFA 2H3KA 2ZUXA 2HJDA 3MZGB 3PWNA 2H9GB 3H53A 3B5HA 4HJUA 3EJYC 4HZ3A 4NQXB 4MJ6A 3Q06A 4KVNL 1FO0H 3KCPB 1DUYA 1E6JL 3OGOE 4TV3A 4EZKA 3LV3A 5JPNB 1T20A 3I75B 4B97A 3ETGA 3KLDA 4WWKC 2EJRA 1VQPV 4Q89A 4Y2NA 1CG9A 1GAFL 2W60B 2YUWA 2ED6A 2ZAGA 3ARDC 3QQ9C 4OD3H 3RJDA 1D6VH 3QISA 2ZOLA 4N3TA 5B1OA 4K3EH 5KVDH 1F4YH 2NNAA 2GTZB 2VJ8A 4OQTA 1F4XL 1MWAB 1JF1B 4CC0A 3IAQA 5LQBL 5FPIA 3NIGB 4BFFA 4ZMXA 3S96B 1Z3GL 5HYEA 4UQAA 3W38A 4Z7VF 5KVGE 2GY7B 3DRTB 3WD5H 4UILH 1JJOA 4E36A 3X2QB 3B5GA 3TS8A 2QE7G 3BT2H 3T0WA 4HC1L 2PCPB 3WNMA 4LSTH 5F44A 5CJXC 2AZUA 1NR7A 2A0LC 4JEGB 4OPHA 3IAPA 3SKJH 2EXYC 3OL2A 1O75A 2J8HA 4PLKD 4L2YA 1PG7X 2AABH 2EH8H 1S7WB 1IKNA 2CSPA 3VRJA 3VXTA 2Y0PA 5TK2A 3GTNA 1OW0A 1S7TB 2PP9A 4WFEE 3SE3C 1NIAA 3K6DA 4PV8B 1A6WL 2AANA 3EH5B 4ECNA 1DQDH 3V10A 4RMVA 1LO3H 1EEQA 1OCZB 1Y7VA 4B9KC 3O3BA 6PAZA 4NKIL 4NQTA 3K80A 5FECA 1FCCA 5KAQG 2LLGA 5IVXF 2VXTL 1E79G 4WFHD 1AGDA 1GJUA 2LW7A 4G6FB 5D7IB 4FLVA 1HHGA 1EEYB 5T33L 1GSMA 1A7RH 2LABA 4ZRGA 2NUTA 5I5RA 5CLZA 4XBGB 1S7QB 1KYFA 4FPPA 4NGHH 3QI9C 1JZ7A 2OPCA 2E0PA 5HDRA 3M1OA 2ZP8A 4NQCB 4AM0A 1TVKB 5EBMC 1TKWB 1U93A 2FX8H 3LVTA 5J6SA 2EYSB 3U6XA 5F2VO 2PW2B 5H94B 5D7LB 4PRIB 1DVFA 1WS8A 4IIQC 4NZRL 4NO0A 5E2VL 5CN3A 3TIEA 2V2XA 2AZAA 5CP7B 1KELH 1DUZB 1TYRA 4P5MB 2P24A 3K8MA 2FX7L 4WFAV 3CFEA 4JFPA 3CUPA 2VO8A 3ES6A 1CIDA 4APQC 2BS9A 2ICWA 2XTJD 3K3WA 2C3GA 2W07A 3KWVA 3V4UH 1QLEC 4QRUA 2IBZX 4JYAB 2YUZA 4FQHA 3SDXE 1BM7A 4XH2A 6FABH 2R23A 4QNHB 5CB4A 4TSFG 3CSTA 2Q86A 1F11A 2IH9A 3GHBL 1JXFA 2D3VA 1A14L 1MWAH 3GKWH 2DE0X 1QQCA 3VXMB 4Z5RB 2A9NH 3WUWB 1W0VA 3ARTA 2Q5ZA 1LO2H 2XWZA 4TQFA 5F7AA 2WNKA 1L9QA 3LZOA 3OHMB 4O2EA 2P5WB 3RWEA 2Z65C 4A2MA 1YY8B 3ZMNA 1YPZA 2B4CC 4CDHA 4YHHO 3ARRA 3REVB 4EQ2A 2K8MA 1NFDB 4DETA 5EULV 2N7BA 4JI0B 3PWPE 5FYKE 3AM8A 2ZYSA 1YYCA 5GRYA 3ZE0B 1L0YA 1SN5A 4RGNE 5FYLL 2Z7ZA 3CZSA 3X3GL 2PYFB 3BH8B 4Y4KD 3QHZL 3RUGE 2QQLL 3PABB 5DUPH 3KR3H 2OTUA 4R26H 3CDGB 4YDJA 1DJXA 2NCMA 2QELA 4AGMA 5DGRA 5C8YA 3TJPA 2QADB 1HOCA 4M56A 1EEZB 3MV7A 3OSVA 2EIBA 4MA3B 4UF7C 2BWIA 5LCVH 3NESA 1S3JA 3FF8A 4KZCA 4Q6GA 1LGVA 1PYWB 3OJDB 4I89A 1ZL8A 4G70B 4DP5X 3BSZL 5T1JA 5ISZE 5E56A 2CDEA 4EIZC 5E8OB 1UWEH 2E9IA 4LLMA 1HR0B 4XT1C 4J1UB 4E42B 3OC5A 4F8PA 1WZ1L 3EYQD 4TQEL 3GFUA 1T6VN 3NG5A 3UO1H 3VDAA 1RUML 5DI8A 1E4KA 4PD4K 1BD2A 2BDNL 2OT5A 3VWKA 4PGZA 1YEWA 5HHPA 3MRRB 4F1ZA 2ETWA 5TF0A 4LCWD 5T1MA 5DC9B 1C9SA 4O2FA 4JPVL 3NZUA 1AB3A 4OKVB 4OLXL 4KKAD 3ZHUA 1AMXA 2LVCA 4YO0B 4KO5A 2WLNA 1BZ7B 5ITBL 4RIRA 4LCCB 3A67L 4H25A 5B1BC 2ENJA 3PIQB 5D1XA 3QO5A 1QKZH 3UO3A 1LK2A 1M9WA 3DVIA 2EINB 5LOVB 5ADOL 5GS0D 2LQTA 3ZBHA 3VUAA 1GGIH 2ZR2A 4XE0A 5KJ7E 1R3IL 1YEHL 2O26U 1T03L 3IXAB 2YGOA 5F0MB 1G1YA 2Z93B 2G3XA 3NIFF 1AMYA 2UZXA 1DQTA 3IGAA 4ZDHA 5JO5A 3LXCA 4FQLH 4N5ED 3VMPA 3GZQA 3FU7A 3BLPX 4BIKA 2FJHB 4PJHB 1DLFL 3I50L 5TE6L 3NSJA 1AXIB 4A5UB 5HGHB 4LVOC 1I9IH 5D8JL 2ZKOA 1KUQA 1S72V 5JW4R 5IB3B 5DYFA 5F6IB 4MLSA 1I9JL 2JJVA 1PNDA 2YA0A 3L5XL 3J7AU 2ADIB 2NN4A 1IM9D 5AYQA 2OYPA 3QEQA 2NXYD 4X20B 5JXEC 3TBWB 3CBRA 1HSBB 1RY7B 3TVMB 4DW2H 1AJ7L 5FGBC 5F7HA 4M5ZH 4PJ8C 4ADGA 5GS1A 4LCIH 3B77A 2WUCL 4FQXD 4XN7A 3N44B 2B1GA 3LCYA 1MAMH 1HZLA 1GCYA 4GP8B 3GGWA 3GKZA 5MERA 1JGVH 3DSNA 4UNVA 5EG6C 4YLCA 4EKXA 1KC5H 1RZ7L 2JCCB 3AT8A 2LVEA 4AT6A 2X0VA 2Y0IA 1A9EA 3L5WA 3WNJA 3D0AA 2YC1A 2FECL 3II1A 2C26A 3V7MA 4G82A 5CA1B 3W82A 3QXTA 4DV5O 1VPOH 3CPLA 4NQDD 2XXFA 5LGNA 1MQKH 5F9JA 3ARDA 1HHHA 2EDJA 5GRVL 3WFEL 4AEFA 2XXMB 3W7UA 3EO9H 5I75B 5D93C 5ANMB 5HPMA 2W81C 4X5XB 1E50A 3IDMB 5C09E 4HHAB 1S5HB 4L3EE 5KUMA 4BW9A 2YS4A 3C09C 1IGFL 2WBJD 4MCNA 1H2GA 4OD1H 3CXDL 5GZOD 5I66A 4ZD3L 1DHKA 3OKOA 3SYQA 1EANA 3JAWB 1P2CB 3LH2H 4IRSB 3CVIL 1QRNA 1SA0A 1K4DC 4TQ8A 2WD0A 3ZN6A 3F7VC 1GM8A 1I7ZA 2JCWA 3JT2A 5CGYD 4YHZH 3ERXA 3CVHA 5CJXA 1FGNH 4FNSA 1CP9A 4PJBE 3IJSA 3DROB 2WZ6A 3CX5K 3ULVC 4Y5XB 2QPUA 4IDLA 1MF2L 2WV3A 2YSSA 5FFOA 4LLUB 4QEGA 3PN1A 5BO0D 3ECVA 5MENA 2APBA 3F58L 4X4ME 1AXTL 5ELIA 2BVOA 3WY3A 4EE2A 2Y1VA 1M42A 2NZ9D 3WO3B 1QFHA 5ADPL 3RWDA 3FQXA 1VF5B 3ARFD 2GV9A 4J80A 5LP6A 3FT1A 4M43H 5LN4A 1H5BA 3DXRB 3KW7A 4FLHA 1NR1A 4K5PA 1TOXA 2YD4A 3UTSB 3HKBB 4I9WD 4NPKA 3VMOA 3BZDA 1Q8MA 4MQ7B 3O6LL 1OXYA 4P9HH 3TA4D 4MJJA 3QEGL 5JHLL 1BV8A 4A38A 3P3TA 3P4MB 3CRCA 5JHDA 3D3VA 1B0RB 5GGRY 4E9RA 1U8JA 2AZ2A 2XWTB 1R6TA 4EUPA 4ICGA 1N4XL 4LKCA 1U8HB 3EYVA 4JJ5B 3BDYH 5TF1L 4XTRD 4FM2A 2FK9A 4QXWA 4YSCA 4PJCB 3WJMA 3RWHA 2GHYA 3EG9B 4IIQA 1JZ4A 1E5ZA 5CIPA 3U25A 3WFCH 1BBJA 3E2HC 4GO9A 3WO4C 2XTAA 5JPMA 1JE6A 4IHJB 4OJFL 3NGBB 1HHKB 1A4JB 1XGRB 4NQVA 2DM4A 2P45B 1PNLA 2DJSA 3SE6A 5DQJA 4TV8A 2VR4A 2OLDA 4TLSA 3LS5L 4AQEA 5HVWA 3O45B 3KYKH 2R1XB 4J9ZB 1CFVL 4IEFA 3HPJA 5IJCC 2AJVH 4GW4A 4CVXB 1G6UA 5B1AC 2HLDG 3IMWA 3AY2A 4GKLA 1F5WA 3FUNA 3AG3C 1YNKL 4QHKJ 4ZO9A 2AHYA 5FM4A 1CQYA 4OCYH 5TDNB 1Y18B 2CRZA 2O93L 2NX5D 5AW5B 3SDAA 4LFCB 1MJUH 3KXFA 4YXLH 1U9KA 5T1KA 3JD4A 1WAAE 3HKCA 4DR4B 1G4MA 4R4FH 1YVLA 2DQMA 3UM7A 1WISA 2W0XA 3TURA 4X8AA 1R33A 1JVMA 3FOLB 4LHUA 4XO8A 3G6JE 5E00B 1NGYB 2A1WH 1UM6L 2CK2A 4G1EB 4B96A 1IE5A 5K59F 1V3KA 3BAIA 3EVKA 1OO2A 4NZTH 2ZAIA 3RZCB 4XCEA 5IJ0A 3JZYA 4U2YA 4DPAX 5CJ5A 1HKFA 4FLWA 3FT9A 5FO7B 4AC4A 2P80A 5B3NA 5EC2C 2C3VB 5I9QC 1I7TA 3DX2A 3WLBA 3RDTA 1CLOH 3ESMA 1ADQH 1OLZA 4P2OB 3WB2A 3P3UA 3WTWA 1M56C 2VL5B 1NCCH 1KXHA 1UJWB 3LHPL 1X7SA 2JELL 2OJZL 4IM8A 4JFSA 5C0CE 2F9BT 5ES4B 4H1LG 1VA9A 3MHHC 3CNKA 3S88L 3LTVA 4L4TB 3I02B 1II4E 3VW3L 3GMQB 4O2AA 1YMMD 2UYLB 4MXQD 4XRCB 2D0GA 2D8KA 2YJQA 5HYQA 1R5IB 2PP7A 4Z77A 4YIQB 3DPBA 2VDLB 5TTRA 2VRKA 4DKEL 1SHMA 4KY1L 4LIQE 5LXGL 3VXNB 1N18A 3RYFB 3FQYA 5D5MF 3L3HB 1Q6HA 1KCVL 1A1NA 2MTPA 3QXWA 4EIBA 1OQOA 1TFPA 5IVXA 4O4YL 2RIKA 4Z18A 1SMOA 2HJFB 2IDSA 4LOVA 5D1ZI 5AVVB 3ZPDA 3WXVH 1NJ9A 3OGCC 4KRNA 1F6AA 5C0DB 1TUBA 4YSEA 3JBG7 3S3JA 2YARA 3QO7A 3TJEL 3TJHC 5I18L 4P4RB 3GS0A 1DGSA 4U7OA 2E9JA 2VZTA 1Z66A 1AKJD 3DVGA 4PM1A 4X6DE 3R7RA 4X4YB 4W4KA 2JI1A 5CP3A 4PGJA 1I3GH 4X0NA 4MKMA 1VSCA 1PCXA 2BWDA 1E67A 3EOAA 1ETJA 5G5DA 1WFOA 3U4EA 3A4DA 2ESVE 5DVPA 4M8VA 4GRWE 2WTOA 5DECA 3DA0A 4Y9FA 2YLKA 4M61B 1J0ZA 2X4OA 3FTZA 3CU7A 3VFPA 4LFHG 3QIUD 3ZDYF 5L3DA 1I31A 3HG1E 4FQQA 4KI5E 5FXCH 4X7FC 1AQDA 4DK0A 4WFGE 5IW1B 1BEXA 4HAKA 4K7FB 2KB1A 3AWGA 3KPOB 3RU8H 3ZKXB 5FUZL 1SOKA 4R90L 1Y74A 3PWNB 4GRLC 4UV4H 3RIAF 5ALCH 5HDBF 3VFTA 1KCWA 1HNYA 3QUXA 1XREA 1AILA 3EBAA 4MJ6B 1M1XA 3ARBC 1DUYB 5GGVH 5KYNA 1WGVA 3LV3B 1YYLH 2DQ6A 1PZAA 2AJYL 1T20B 3JSLA 2IPKA 4XPGH 3QQ4A 3GUFA 1SEBA 4UB0L 4Y88A 4B9FA 5AWNL 1CG9B 1SOXA 1ZGLP 4TVPE 1NC2D 2C9RA 4ZQTA 2EIKC 1NFIA 2ZOLB 1G1XB 2ZX9A 2NNAB 3DDFA 3QDJA 4OGXH 4HNAA 4NR1A 5EUOE 3ZRFC 3NQIA 4QI3A 4PVBA 1FGVL 5JXEA 2NY6D 4JUTA 3G7TA 4F57H 1Q0XL 1TCMA 4GKOA 1PU0A 3M7FB 4K5OA 2WLLA 4KROD 4PJ8A 4G7VL 3S4SA 5HYSG 3C6LD 1BMFG 1IC4H 2E75B 1TNMA 2VDLH 3F5WB 4GI8A 3ZQ9A 1I1RA 2VSDA 4PJAA 3HBQA 5C0RH 1ZANH 4DZBA 3MBWA 2CA4A 4LT7A 3FFCA 1CD8A 2QPSA 1FC1A 1H38A 1U8QA 3GI9L 4HH9A 1BL8A 3K2KA 4PGCA 3U1QA 1U3YA 3H3PL 4XCFL 4RDQF 3VRJB 3VXTB 2XN9D 3E83A 3HBGA 5HDQH 4Y16B 4HJTA 3V4PA 1MCOL 3D8CA 1JCKA 3LQAH 1Z5WA 4E9TA 2C1OA 4WHTA 2J8OA 3APQA 5IHZA 4M1DH 1XCXA 1WO2A 2PXYA 3P0YH 3BAKA 3O3BB 2DQHL 4F7EA 3D36A 3TYGH 5FECB 3RAJH 1WBZA 2XZQH 1AR4A 4HUWA 4AK1A 4ZFGH 4ZMWA 1MCQA 1AGDB 2QV2A 1I3UA 3BYYA 1NKGA 1HHGB 3I56V 3TCLA 2NUTB 4QHUA 1CF8H 4BZ1H 2DRUA 2EJ7A 2ZG1A 1S5LZ 4GSRA 3WYRA 3ULUE 1U93B 2YN3A 4KHTH 3C3SA 4NDMA 3N42F 1C5CH 3N40P 3GXIA 1DVFB 1EO5A 1Z5LA 4OM0L 4LNUA 2Y25A 4NO0B 4WLCA 4YZFE 3TN0A 3TIEB 2V2XB 4XO9A 5CEXA 5I30L 1E3ZA 1GAFH 3CFEB 4JFPB 3CUPB 4AVKA 1O5PA 3ZKMD 1GO3F 3WMPA 2W07B 3BD4A 2P4KA 3C12A 3U0ZA 2O6DA 3D05A 4QRUB 5B7FA 5LQBH 4FQHB 3TF7C 4R7CA 1UJTA 4JMXA 1E5AA 3KPPA 4XH2B 2E3VA 5CB4B 2R23B 4LRIA 1FN4A 1Z3GH 2HTLC 3FSOA 2Q86B 3WHXA 4FK5C 4JK0D 1K2DA 4G2KA 2V5SA 4OQTH 2WCGA 3D85A 4JZOB 5DD1L 1ED3A 1FBIL 1LQBC 2VJXA 2FLMA 1W0VB 3V0FA 1MEXL 3ARGD 4HC1H 2IALA 4I3SH 2QGBA 2MKLC 3VDBA 2VM4A 2DQ0A 1B6QA 3RWEB 1T1ZA 4M1CD 2XASA 3K6OA 1MFAL 1YPZB 1HWHB 2DJMA 2QGEA 1ZLVK 1ZDQA 2FUTA 4DOHE 1G9NH 5E8DL 5LGJA 2OSXA 4G71B 1XF1A 4B3RO 1MOFA 1HTYA 2R4RH 3KYNA 3L1EA 4IGGA 3FQ4A 1MSWD 5I19L 1N12A 4IMKC 1PIGA 2JXMA 2ZUSA 4MZRA 4NP4L 1A6WH 4GI9A 5JXAL 3GTVA 4OAWB 5IDJA 2FHCA 3RI5F 4HDIA 2JKIS 4EEQA 2XBDA 2YHGA 2OTUB 4K7PX 3NZHL 3QUZD 4YDJB 4NKIH 4R5TA 5EU3A 5C8YB 2JLLA 3ILQD 2OK0L 3QHFH 1XEUA 3BCDA 4OFDA 3MV7B 3IDUA 1AD0A 2GVYA 4GBXA 1UOWA 1MCNA 3PJSA 4AEHH 2H7WA 3EGDB 4BQBA 2R7EA 1YJNV 1FV1B 1ZL8B 2VOTA 3SOTA 2OYQA 1UCBL 4FX5A 4P99A 4A37A 2CDEB 2PCXA 3KVPA 1LEIA 3TT3L 1MFCL 4LLMB 3STBA 1VF6C 3GNML 1HAUA 2X12A 1K3ZA 5F1OB 3TH4T 2ZKYA 2WNWA 3D48R 2YN5A 5DI8B 1BD2B 4YAQA 3VWKB 4C56D 1DJHA 2Q2LA 4ZNEE 4J10A 1FI8C 5HHPB 1CL7L 1PJWA 4KUZL 5T1MB 5B66Z 4PY8J 4WZ9A 4O2FB 5E5MA 3H42H 3FYIB 1T0MA 1X5FA 3OB0H 1IAKA 1TQCC 3GHBH 3GO1H 2VSMB 4H25B 3IJHA 5D1XB 3K5MA 4HJ0D 4W9FC 2KLSA 3TGXA 1LK2B 2KDGA 1EFXD 3QVNA 3QJRB 5C0BD 4TUKH 3HKEA 1NVPD 2RCSL 25C8L 4NXMB 5GHWL 3NEEA 5DMJB 5IBTL 3SDDC 1TQUA 4XVTH 5FV2A 1SEQH 1JNNL 3IE9A 1DJSA 1W8NA 3N1MC 2UZXB 4K0OA 4XOBA 3IGAB 1MIEL 1H6FA 4JVPA 4ZDHB 5CFHA 3IGLA 3DX0A 2EDKA 5JO5B 4AVJA 1M7XA 2QA4V 2W0FC 2VZ3A 2VSKB 5EC1C 3FU7B 3X3GH 4IOFD 4KO9A 1A3LL 4GYCB 1MPAH 4J42A 2NTFA 1XBLA 2V9TA 1MRDH 3H1IH 3LXAA 1OTTD 1WPXA 4LPYA 4BINA 4U7MA 3VSTA 1DE4A 2ICWJ 1JDDA 4ZIBA 4MNQD 4U6VL 4I77H 5C70A 4K9EC 1K85A 1P7QB 1NC4A 4AOFA 2C3WA 1BAWA 3C87A 5GS1B 4FJZA 3BFWA 2IBBA 3NCBB 4O4IA 4XI5C 3VD3A 4GRLA 3GGWB 5MERB 3DSNB 2XAQA 2F54D 3PWLA 4GKZA 3SDYL 2MCPL 2X6VA 2WPDG 1PKOA 3UDWC 2VM9A 4WENB 3DECA 1A9EB 3L5WB 2YC1B 3MYJA 4OCXL 3JSNA 4X1YA 4XXCC 4NCC1 1HN1A 3CPLB 2QSCL 4KKCD 1E2VA 5F9JB 5CM1A 1HHHB 3IRCA 2HUHA 4IU3B 2R15A 4U6YA 2PI4A 3SYCA 1MCRA 2KC0A 2ZE6A 5HPMB 1ADWA 4PELA 1KFAL 4PRAB 5C7ZA 4XBEL 3Q4HA 3SGJA 3SZKC 3T3PF 3GXUB 1AD9A 1BPLB 5TH2B 5I66B 1HCFX 3FC8A 3GIVA 5MEOB 3T6QC 2A6JA 4XAWH 3JD1A 1T03H 3OKOB 4JREC 3WEOA 4UZSA 4N2FA 3CQFA 1QRNB 1SA0B 1EAJA 2YAMA 1I7ZB 1OZ0A 2GIXA 3MAWA 4XDJA 1QVOB 3CVHB 1PKQA 3HE7C 3E0GA 3AUVA 3IJSB 1Z0MA 3D08A 2XN2A 4Y2OA 4PCTA 3T8XA 2YSSB 3SN6N 2BNQA 5HSFA 3F65A 5I6OA 1DLFH 4C54A 5MENB 1IBGL 1MCCA 2X89A 2BVOB 2MHAA 3VGHA 4FKEA 4KXCA 3H1HH 3V6FA 5E6ID 3SYAA 3BT0A 3O3EA 2PPEA 3SJVE 5IROA 2F58L 4F8QA 1NCHA 3FQXB 3RWDB 1VP7A 5LP6B 3ABMC 1H5BB 4MKTA 3L5XH 2R72A 4PJDF 2FGWL 2GSIA 4QCIA 2DLGA 3SJQC 4IBLT 4LL4A 2XWCA 5C08E 4PI0A 2P42B 4JM4H 1JWSA 1WV7T 4L0ZA 1NTDA 2WUCH 5JHDB 3D3VB 1NGQH 3Q1SH 5C0AD 3BPZA 1U8JB 2YUXA 2GI0A 3LZFL 3N1FC 4LKCB 3EYVB 4RSVA 5B39A 4UNTA 5A2IH 1MJ7L 3WJMB 3RWHB 1SVZA 4IIQB 3T1WA 5DFAA 5CIPB 4GYBA 3VGBA 1HNZB 1BBJB 2L7QA 4Z1PA 2XIDA 4OB5H 5JPMB 1XGPB 2P49B 4M8RA 3WFEH 4NQVB 4TOIA 1SF3A 5DQJB 4TV8B 4MW3A 5F7BA 4AQEB 1DF4A 1FE8L 3HS0C 1QLEB 4PBXA 4W9ZA 2G0KA 4Y19D 2HT4D 4IEFB 1IGFH 5G55A 2JK5C 3HPJB 5K9OA 4MVZA 2Q3AA 5E99H 4ZW6A 1IXMA 2W88A 3HHRB 1NIFA 4GW4B 4M6AA 3CFTA 2GJZA 5DXWA 1XEDA 1KGWA 2XZCL 3GLAA 2O4EA 4HIQA 4TLUA 1N70A 3KLAA 4MYWB 2E5LB 1L6XA 1ZLEA 2H0EA 3SDAB 3BWZA 3CN3A 3KXFB 1TFHA 5T1KB 5TQ2L 3FOMA 3HKCB 3BO8A 1J18A 4OGYL 3SDXF 4E9VA 5BR8B 1SKVA 6PCYA 4Z7VB 4K3DH 5JR1L 4AH2A 1MF2H 3CVHH 3WE6A 5LDUA 4TNVK 4GG8A 4XCEB 5IJ0B 1UUNA 1U8OA 2A6KA 1LNQA 2VLKE 3F58H 4LDOB 3TWCL 4OLEA 1XB8A 2C9SA 1QD0A 4IMKA 5CXPA 3SSGA 3RE0A 1I7TB 5ADPH 3RDTB 2ZQMA 1BQHG 2CGOA 3WFDL 3ABLB 2J44A 3PL6D 5IFAL 4HUVB 4L37B 1GZQA 1DVZA 4F93B 4RQFA 4PJ5A 5IQLA 2VXVL 3QAZB 4PP2A 4CN1A 5CKAA 3PDDA 1MUJA 5HYQB 5FDYA 5IJ9A 4Z77B 4CC6A 1YDXA 3BVWA 2A77L 2J1XA 3OD3A 1N4XH 2EE0A 4WEBL 4WFHE 1A1NB 4BM7A 5IVXB 5HVFB 1N7MH 2WWKO 3NA9H 1F8TL 1G9MC 2ZX5A 1NJ9B 4PJGF 2ED7A 1F6AB 1IBLB 1HDJA 3D39A 3L9EA 3MV8D 1TUBB 4OJFH 3WY1A 8PAZA 3CFNA 1KEGL 3QH3A 4L8JA 2K4AA 2NLJC 2DLFL 5CIPH 4QRRA 5D6CA 3LS5H 2OULB 1XX9C 2XT1B 1E42A 5I15H 3FX7A 2OZ4A 1CFVH 2L6LA 4PRBA 3ZKNC 1Q90D 3L16A 2JNZA 4OXSA 1UH4A 3DVGB 3OKEA 3ZYIA 3UX9B 3K6NA 2VWEE 1G6RA 4DPRA 3MGOA 1XNRO 2VN3A 2IWFA 1QLEH 2ZE8A 3F00A 4X83A 3SOBH 1KENL 2XTJE 3EOAB 4MJ2A 5G5DB 3P2BA 3U4EB 2EE3A 5D1ZC 2ADGA 4JCMA 3I9PA 2X4OB 1OCCC 1Q5OA 3VFPB 4YGAB 2HLFC 5MEQA 3RWJA 1NGPL 1QLFA 1UM6H 1OE3A 3IDYB 1OPGL 4Q14A 2QFRA 2X2JA 2Z31A 5I1IL 4FLOA 4N1HB 1UD6A 4BZ2L 4FLUA 1Y74B 1J12A 5GXBB 2XIIA 3VFTB 1OB0A 3QUXB 5EC1A 2G9KA 2YI9A 1BEYL 1M1XB 3LX9A 1WB8A 1X5HA 3L95A 4UINH 4XWOC 4YL9A 2EVFA 5KHKA 3DX7A 2VLJD 3K8LA 4QOKE 2IPKB 3QQ4B 2QTOA 1SEBB 4MASA 4P07A 2BY1A 2GDSA 4Z7OE 5B8CA 5HD8C 3VW3H 1NFIB 1E28A 2VLMD 2JJWA 1UGKA 2PCFA 1QAWA 4WI6A 3QDJB 2OSLA 3T8VA 4HNAB 1RZJL 4NLHA 4DKEH 3JTTB 4KY1H 5F1IA 2VUYA 5LXGH 2B9AA 4HH8A 2BMKA 3MUY1 4LASL 4MXWL 1P5UC 4KDTC 1GYVA 3G5ZB 4WW1A 1JCVA 4IYKA 3S4SB 3RA7H 4MDJA 4O4YH 3F7YB 1ORSA 3TA3D 3BPNB 4PJAB 1PF3A 5C2BL 2ZICA 4B95C 4Z76A 1K8DB 5CZVL 4DZBB 3MBWB 4RGNC 3H2PA 1ZWIA 3VX1A 1F3JA 1F4WL 3FFCB 4TV9A 1SOSA 1AGBA 3HOGA 3C5ZA 1G9HA 1MCIA 5CLTA 3TJEH 5CF3A 1U8QB 2QZQA 4JHZA 4XXCA 5I18H 3TZVC 4HH9B 1CD0A 1ZTXL 3ZKSD 4PGCB 4JF3A 2D9CA 1LDSA 2ZT9C 4L1DA 2K0RA 1URZA 3QXDA 3NCXA 1CS6A 2G3NA 5DYOA 5D93B 4CGUB 3VGFA 1Y0LA 3V4PB 1ZK5A 4Q9RL 1AIZA 2C1OB 2WXLA 2WVTA 5C07A 1LILA 1QW9A 3LKRB 4LCWE 2WN2A 5IHZB 3B2PA 1A9BB 2PXYB 1AO7A 1BOGA 3CMGA 4HKBA 2V2WA 4RFNB 5CP3H 1B0GA 1GL4B 4P06A 1AS8A 2JS3A 1FHNA 1FXKA 1RKRA 1WBZB 2QSVA 4HUWB 4GS7C 4Y4FC 3DUHA 4YHPA 3U6XS 4FLYA 3ZYOA 3TCLB 3P11L 3HE7A 1I1AD 1JTPA 2VERA 2YIHA 4QKTA 3P30L 2UXNA 3ALPA 3U30C 4G6AC 3I9GH 3B5TA 2QZ5A 1TEYA 3NEOA 5I1KH 4FQJL 5A2FA 2YQ2A 1UOLA 3NIFB 3VXUD 3TN0B 1Z5LB 3NSFA 4LNUB 1M4KA 3SGKA 3PFQA 5CEXB 1IVSA 4K5MA 4AKPA 3L6FB 1JHKL 4XP4L 1BS3A 4PJBF 1Z1WA 4F33A 5C0EA 3V7AG 3K5SA 1NM4A 3ZMSA 3LEVL 2XAHA 1DSWA 5EN2A 4DYLA 5JUEH 1O7DC 1H15A 3FSAA 3UP1A 3QIBC 3DBSA 4F8NA 2PR4L 1Q4NX 3KPPB 4I48A 1FN4B 3WHXB 1K2DB 1PG7W 1GMEA 2KKWA 4LFBO 1BX2A 2A74A 4BK5C 3CSBA 2CZNA 3D85B 4OZIE 4UCTA 5EIBC 1TQVA 2Y6SC 2IALB 3OGIB 2HEPA 4MLIA 5IKCA 3O9WD 1PY9A 2R9AA 1QP1A 3F12A 5FHBL 2BW4A 1PY4A 4K3HA 1T1ZB 1HW7A 3DJRA 4RNRA 2NDFA 1GS6X 4M6NL 5L2KD 5SWZA 3LEYL 1JF6A 3G9VA 4XCFH 1QVGU 2C4FT 1ET8A 4Q74A 5LGJB 3FRPB 5KANI 3H1JH 3BKCH 5AW8B 3WAJA 3KYNB 3QK0A 3V5DA 2WXOA 2JXMB 1MVYA 4BWTA 5C7XL 4KGJA 1ZGLA 5A7EA 2DW4A 4ONFH 4J23A 1RH8A 4NQDE 4XN5A 4JFXA 1J1XL 1ZD6A 4HDIB 3O2VL 4PGDA 3V4PH 2GT9A 1CL7I 1CXIA 2FWLB 3RB7A 2O61B 5EU3B 4JI5O 2X42A 3ARPA 1XR9A 3D4ZA 2DWDA 1ZA3A 1AD0B 3ATDA 3K72A 2XPGA 3MRKA 4GBXB 1O9VA 2FIKA 2HJKB 3JD2A 3F05A 1V3LA 3EGSA 2R7EB 3KZ8A 2OXGA 4FN0A 2X1XR 5FO2A 4ESKA 2IVFC 3HHSA 2Y06L 4F37F 4Q20A 1LEIB 1N6VA 2ED8A 1K5QA 2XYCA 4LH6A 2JEXA 5LBQA 4OM0H 3PAZA 4EN3B 3IDNB 3RVXC 43C9A 4KRLB 5I9QB 1I1CA 2IFFL 3VWJA 3SBRA 3GBLA 4AYDC 4F7CA 1F00I 4NUGL 4G7SB 1TPXB 3FHEA 3ZQXA 3G6JF 3CXHJ 4LQFL 3J8F7 1USQA 2AK4D 2OXHA 5E5MB 3LNMB 5H9CA 1P84F 4NLAA 2Y7QA 2DYSC 1T0MB 3WU2Z 3QYMA 1UT1A 2DQGL 2FJFA 3I6KA 1AR1D 3S5LA 3VD5A 5KVGL 4G7RB 2ODHA 3BZEA 4HETA 1ZRUA 5FHAL 1R3IC 5I1HH 3WB1A 1L0QA 2APVA 2B2XH 1FBIH 1NUGA 5DD1H 1FFQA 4I9WE 1MEXH 3U1SL 1XUQA 2JVDA 1A25A 2F1EA 5JOEA 5AYUL 4DW1A 2FWOA 4NXNB 4RESB 4AYID 1H3PL 1E5BA 1D9KC 1WCQA 1CEZA 3PWVA 4MAYD 4WTWA 4RCAA 4WFEA 4Q52A 2VDOL 1MFAH 3ETEA 4P23C 1AANA 2YS8A 2ADQB 2VABA 1LP9E 2YPKA 5ESQB 5IE9A 1WLHA 2L7EA 4ZQKA 5AAMC 2QDOA 5A2QN 2B5IC 2NLJA 2CE4A 4BFGA 5BRZA 5I19H 4MXVF 1KCRH 4Z7WE 5AVUB 3OAUH 3LB6C 1FSKB 5KSAB 4D9QD 2NY2C 3GSWA 3OHXC 3QFDA 2NTFB 4X9BA 4C83A 3U0TB 3MV01 4XNXH 3PHAA 3F7KA 1RIHH 3B7RL 1H2MA 2H2SC 1DE4B 1VLXA 4I9QA 4KK6C 4H8QA 2B59A 1RIVL 3IBOA 3L3JA 2AV7A 5SX4I 5D2NC 2OWOA 5KOMC 2XQYK 3U7YL 1CFSA 1VCAA 2IMMA 3HE6C 4G43A 5G4NA 1NC4B 1ZDSA 3GEWB 4DPCX 5IFHL 1LR1A 4PSRA 2WP3T 4JO5A 2QVKA 3GWJA 4NKDA 2WVVA 1YHQV 1LEKA 4GRLB 3EJZC 3CHPA 3U46B 1SBSL 3I6GA 1HHJA 1UWXH 4GKZB 4GRWF 2P67A 4N22A 3RFZC 1OARH 1DVSA 3SDXA 3C75A 1CYWA 2Z91A 1U91A 3MYJB 2BSCA 2HX8A 4LL1A 4RMBA 4X1YB 1UA3A 4XDLA 2I85A 1I85A 4W9IC 5A16A 1ZSHA 3IAYA 4H0IA 1QNZL 2HH0H 5C3TA 1CLZL 4U6YB 1DBMH 4H88L 4F3FA 1DYZA 2F18A 3J7HA 3VXRD 3F64A 3IJ7A 1UJ3C 5EIIA 3Q4HB 3RTQD 2HT2C 1CDUA 1AD9B 4M62L 4RMWA 2RQEA 5LNGA 3ZOAA 1RXLA 2YKLH 1TU2A 2A6JB 2O57A 2VQFO 25C8H 2RJMA 2V5YA 3EOYG 4FEIA 3WY4A 4PEEA 2YXMA 3BN9C 3GSVB 4HGMA 3PWPA 3OD4A 3MRHA 7PCYA 1AQHA 3LD8B 4Y2DC 4IQHA 4JZGA 1MIEH 2V3DA 2BO0A 2VDRB 1VFMA 4XMVA 3RUGA 4MB4A 5C3IA 1MDTA 1NICA 4KK5C 1KG0A 4DERA 4Z7QE 5FYKL 3TZVA 3T1YB 4Y2OB 3SKMA 3MO1A 3T8XB 1H6TA 2V7QG 2FVNA 1RPRA 3OTTA 1A3LH 2BNQB 2ZUQB 2FNWA 2NY5L 2RN9A 1ASOA 4MCZA 1DL7L 2YPVA 3B37A 4ELMF 3HTLX 2MHAB 3K79A 3UPAA 3RHWF 3V6FB 4F7KA 3NCFB 4WO0A 2CTRA 3O3EB 4EI5D 3K6SA 5ISZA 5F6HI 3V5KA 4CVUA 3ZTCC 3GM0A 5FYJU 5C6TL 5DT1L 4L5FE 5EO0A 2V9UA 1MREL 5CEZD 2GSIB 2IPUK 4NUQA 4QCIB 1AOZA 2YPLD 3E3QC 1GJIA 3RVZA 3MBEA 3APOA 1BXAA 4OIAA 1RFDH 4AI7A 4Y4FA 1W0KG 1SLWA 4MCYA 4X9IA 1LL1A 1JWSB 3TT1H 3WGUB 4GB9A 2QSAA 3LQMA 4OJEH 3IMBA 2A3QA 3UAJA 4MS8D 3CZFA 3DV4A 5BMVA 3QR2A 4XHJD 3MJ7A 4OFYD 1RAMA 1A6VL 2ZSVB 3SDYH 5KMGA 5CWSA 4JUSA 3ZDYB 2JSFA 4N0CC 5B39B 1CXEA 5GRUH 2RHEA 4G8GD 2WOYA 4OCXH 4NT6A 5M7QA 3SKOA 1EVTC 2WKGA 2BOCA 3F83A 5AAWC 5I2IB 2VZOA 5FF6A 1HCVA 4RGMB 4Z2WA 2F53D 3HG2A 3LPPA 2FO8A 2VL4A 1SJEA 1S46A 5HDBB 1KB3A 4K94C 1R3KC 4XBEH 3O8XD 4G6JL 2J71A 4TVSa 4KI5C 1W6WA 1NTKH 1OAYL 4JR9L 3V0AC 2Y5EA 5E6YA 1X7QA 5K9OB 1TUEB 4KWUA 4K8RD 1NUFA 2GJZB 2IJ0C 4BK5A 4A68A 2IJIA 4HKZA 1AKPA 5F0LB 2FEDD 3DRQB 3PP3H 3PHSA 3PPSA 3KLAB 4HK0A 2AC0A 2AI0H 4AIEA 2CJUL 3DARA 1MLCA 2ICEA 4TS6A 3FOMB 4HIEA 2X10A 3BO8B 1ZK9A 3T1FA 1M1SA 3RWCA 4HXAH 1ZJAA 3MUZ1 5F9OL 4JI4O 3OXSA 4AH2B 4K8ZA 4R4BA 3HNVL 3WE6B 2VDRH 1DFBH 4WI0A 4GG8B 2F19H 4HWBA 1U8OB 2A6KB 2FYUH 4Y7OC 1CBJA 3MKGA 4LAQL 2NY4D 1JBJA 3B34A 2ZP0T 1U2YA 2H8PC 3N43F 2B0SH 1OQXA 4X4KA 3L3DA 4GSDL 2EULA 1BFVL 2FGWH 3AG2C 2EBOA 1BF2A 1GZQB 2DBJA 2XN9E 4PVMA 4AMKL 3CCEV 1T5XA 4JL2A 3CVBA 5FCUH 1G87A 2QM4A 1N2RB 2CRYA 4JTDB 1NLDL 5HHNA 3WCYA 1MUJB 3BWUC 4MTGA 1BJMA 2IH3B 4WRLA 4UOZA 3EOTH 5ETUA 1NGZA 2F7OA 5IJ9B 1UZ8A 5E6ZA 1DQLL 2BNUA 3SY0A 3IGFA 3LZFH 5B1KA 3FQUA 1BMGA 4C4UA 1S3RA 2ISDA 1OM3L 1F3DH 1R75A 2G30A 1SZXA 1YMHA 4MDIA 4P5SA 1MJ7H 3WIHL 1FDLL 4Q2ZA 1R3LC 4OZGE 5C09A 4R2GB 2BHUA 4LLAA 5AVXB 3D39B 4L3EA 2CXGA 4ONHA 1XGUA 3SJBC 2O6CA 2Q5BA 3CC4V 3QH3B 3V0EA 1N36B 1U8PA 5I6MA 1UD2A 2H4EA 4QRRB 5HHQA 5D6CB 4JI3O 2IIJA 4NRZA 4NX0A 1FE8H 1G0DA 2ICCA 2NPLX 4PRBB 3OAZK 4GKJO 5BRPA 3OKEB 2VXUH 4ZO8A 1KTLB 3UBXG 3MGOB 2BRRH 5AVYB 5I5IA 2BP8A 3JARA 2CM6A 4TSCL 4WWKD 2VDML 4YSRA 1WFIA 1H3WM 3ULUC 3NH7H 2ADGB 4S2SA 4WKZA 3WSQH 5DURD 5DHXB 3BP6A 2UWEE 5TQ2H 43CAA 3LKQA 5FAAA 3WUZA 2J57A 4OGYH 3JZ7A 3QCVL 3V0DA 2BVYA 4X4MA 2ZP9A 4NFCA 3CE1A 3FFDA 3L4YA 5AQ0A 3UADA 5JIQA 2KYIA 3RWJB 5MEQB 1QLFB 4P23A 5I82A 5JR1H 2AMUA 4E4EA 5FW7A 5I1CH 2BP0A 2Z31B 2OL3L 4W6XB 2QJ1A 3BWSA 3VACA 3TWCH 4DGVL 1T80A 2WQ8A 1MFNA 4E41B 1DLHB 3KWXA 4QHNA 5EC1B 4KPHL 2E27L 2E59A 4DGYL 2M26A 5INCB 1HCYA 1MRFH 3L95B 5D96B 1KXVC 3WFDH 3DURA 3DX7B 4I9XA 5IFAH 2PLTA 3CDCA 4KJQD 5CZXD 5T1DL 4XODA 1DANT 4R7DA 1IDSA 1R24A 1FYJA 1ZT4A 3HBZA 4RZCA 5B8CB 1J5EB 1UACH 1RZGB 4BWUA 2OI9B 1RM1C 2C9QA 1LO4L 4BA8A 2PCFB 3PYCA 3CD6V 4FNLH 2E7HA 2OSLB 4WY7L 1WFJA 5E4AA 4LPVA 1JPSL 4ZAKD 3KCXA 2A77H 4D94A 5F1IB 4P46C 2KERA 2CTQA 2X05A 3AT9A 2JKSA 5DHVH 2BMKB 2NUPB 3Q9QA 4LGPB 4I55A 2JJ1G 4WW1B 1CI5A 4A2GA 2SODB 2EO1A 1IC1A 1ORSB 2X0WA 1MCDA 5B3SB 3BP7A 3OB0K 4Z76B 3EUUA 3RY5A 3E38A 3RFZA 1KB9J 1ZWIB 2H2PD 3ULSA 1F3JB 1OAQL 1MLBA 2EEDA 3PV7A 4TV9B 2B1HH 3C5ZB 1KEGH 3D7PA 2QJDA 3UG3A 2NR6C 4X6CE 1P7BA 1K6QH 3INOA 3QI9D 4DEPB 1CLYL 3L9DA 1NZRA 3KYAA 1MH5A 3C5JA 2WUBL 4QKXB 4BCZA 5EYPA 3QXDB 4QXGH 3NABH 3E8HA 5DYOB 1Y0LB 5F7EL 3RX9A 4C56E 1UJ3A 1WAAA 4A2LA 1SJVA 4JYBA 1KENH 5C07B 1M57C 4LVNB 1DVXA 2EZ0C 4PLJD 5J06A 3G6JA 3B43A 1AO7B 1BOGB 2DIAA 5LBVA 3BAJA 4HKBB 5IB5A 2V2WB 1N33B 4APQD 4DP4X 2E4FA 1D3CA 2F7IA 1FXKB 5KVFE 1AZNA 1NGPH 2B39A 3LOWA 5JOFB 4YHPB 4Q9CA 1HL9A 3ABKB 2AQQA 4PJ7E 4ZODA 2DQCL 4FFWD 5JIKA 3WN5A 1PZSA 1L7IH 2AW2A 4NC2B 4WKXA 5IHUH 3P3SA 2NYZA 4WU5A 2A73A 1GGBH 3QO1A 3CHRA 4QHLA 4X5LA 5C0CA 1HJBC 3DC5A 3TO4C 3SOBL 3TV3H 1P4UA 1YTFB 1UM4H 4HUCA 4FLRA 15C8H 1VGKA 3ZJAA 1EXUA 4KU1A 1W9XA 5LL6Y 2FL5B 3O0LA 3Q2WA 2E76B 2B77A 4OZHE 5E79Z 5E9DE 3FUFA 5IQNA 2WYTA 4BBWA 4JO1H 2PNDA 4UT7L 4OUUA 1TAEA 2YICA 1BZEA 4F33B 5C0EB 3ABMB 5E8EA 1DEDA 5EN2B 1COBA 4N2HA 1H15B 5DM6V 1RZJH 5AZ2H 5J57B 4I48B 3V4VA 5HI5C 4ELKB 4LASH 1XB3A 3FUHA 3K2IA 4XMZA 1JZHA 2I07A 1BX2B 4NN6C 2A74B 4KKBC 4MNQE 1WEJH 3MRPA 5C2BH 1GVIA 2YIAA 4JG0L 3MROB 1F4WH 1JRHI 12E8H 4EKJA 5IKCB 1QU7A 3F12B 3MCYA 4H44B 1QTYT 4DV5B 1E4XL 1GZHA 3MLRL 4X6DA 5AW3B 4RNRB 3DETC 4QNPF 4JI8B 1TVDA 3HMXA 4JI1O 5SWZB 3U4BL 1DQML 1O6TA 1RI8A 5F7UA 2F54E 3MDJA 1BFSA 3QULA 4AL8C 4D7BA 4ZMAT 2ESVA 1Q81W 4WO4B 2VJ0A 2YK1L 4JPWH 4J11A 2CJ3A 3UBFA 3V5DB 2X1WL 4Y5YC 3HG1A 1QFWI 3PQYD 2EVIA 1ZGLB 1YEKL 1MDAA 4JFXB 4YXHL 3S0PA 1IC0A 4PGDB 2ITCA 3RPKA 2B1AL 1EAQA 1NCWL 1FXVA 1IBZA 2X2YA 4K35A 3BKML 4NIKB 4TUUA 2DWDB 2FB4L 3CLEL 1ZA3B 1Z0NA 3K72B 3RVYA 1X5XA 2XPGB 3GMMA 3MRKB 1UURA 2FIKB 4UM9D 2VW6A 4ASUG 3P11H 4YS4A 1BMWA 4OW6A 2OXGB 4JW3A 1VEPA 5AKTA 2JJSA 3P30H 4NZDA 2NNRA