2OCCB

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
total genus 67
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2occB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2occB02
4YSUA 4W9ZA 4YSDA 2QPEB 2VW6A 5D4HA 4HHGA 1JZEA 1AIZA 3ASOB 1HAUA 4HZ1A 4A2EA 3FU9A 1UATA 3ZX1A 3UAAA 3FYIB 2E86A 4KOCA 3T9WA 1B3IA 2H47C 3NJNA 1KV7A 1ILUA 1A4BA 2PLTA 3WNIA 4DP2X 2ZOOA 7PCYA 1FWXA 1V55B 4WKXA 2FTAA 1DZ0A 1A4AA 3IBOA 2GI0A 3H4FA 2FQFA 3NSYA 1BYPA 4BXVA 3T71A 3U25A 4K9JA 3UACA 3NP4A 3DTUB 2IH8A 3TBBA 2BHFA 3TA4D 5I6NA 1FFTB 1CYXA 3SBRA 3ASNB 4GP5B 1CC3A 4UANA 5F7BA 1MDAA 1PCSA 1A8ZA 2GB2A 2LLNA 2VSKB 3FQ1A 1NWPA 2XXGA 4GP4B 3CVDA 3WKPA 1GR7A 1V10A 1FA4A 1NIEA 3EHBB 2DWSA 5D4JA 4F7KA 1OE1A 3NJLA 1NIDA 2PP9A 4F2EA 4BDVA 3ABMB 1WS8A 2HRHA 4DP7X 3BQVA 3EH5B 2CALA 2CCWA 1ASPA 2XUWA 4Q89A 2XYBA 1AR1B 1QNIA 2FNWA 3IE9A 3T6XA 3UGEA 4YL4A 2UX6A 3SBQA 1BQ5A 5B1KA 3S3CB 2I7SA 2YQBA 3V9CA 1W8EA 1OOWA 2RACA 2XVBA 1IBZA 4KO7A 5AKRA 3WIAA 1AZUA 1ID2A 2BW4A 2UXVA 4BDVB 3X1FA 3NSCA 5B7MA 1PZCA 4G70B 1L9RA 1SJMA 1WA1X 2IDTA 1TU2A 4YSSA 4GXFA 1PMYA 3H4HA 3X2QB 1KDIA 2Y69B 2VW4A 3QPKA 3S8GB 2YAPA 2W8CA 1OCZB 2IDUA 2CBPA 2QPDB 2YEVB 1JXGA 4F2FA 2HLEB 1SF3A 2PCFA 5I6KA 4YSAA 3CDZA 4AX3A 2PPDA 2Q9OA 2WO3B 1JXDA 1M9WA 1SHXA 4L0PB 3ABKB 2EINB 4AKOA 1SNRA 1PF3A 1MZYA 5A7EA 4ZK8A 4E9XA 4CSPA 1JOIA 2DYRB 2AVFA 2YXVA 2PPFA 4RH4A 3G5WA 1T5KA 2FWLB 1KYAA 4YSPA 2AZAA 9PCYA 2JXMA 3CDZB 4G7SB 4BK5C 1SF5A 5TK4A 1OCOB 4DPAX 1GY1A 5B1JC 3FT0A 3OD3A 1CYWA 4DP6X 1AG6A 2FQDA 1E5YA 3GYRA 1TEFA 3C75A 5I28A 1IUZA 3X1BA 1AS6A 2FQGA 4JHVA 1WAEA 5B1BB 3ERXA 2IWKA 4YVNA 4DPBX 1KCWA 1WA0X 1W6WA 1GS6X 1WA2X 1XB3A 3UADA 4A2GA 4KNSA 4YVUA 2B3IA 4G7RB 1ET8A 2A3TA 1AS7A 2YAHA 4YSCA 3OMNB 3FSZA 3FSVA 5B7EA 3NJHA 4A2FA 2CJ3A 1IC0A 3OQRA 4NERA 3HEIB 1ASQA 1NDTA 1DYZA 1TKWA 3GDCA 3ABGA 2FJSA 3AW5A 1TEGA 2GHZA 4GYBA 2H5UA 2QDWA 4KNTA 1J9SA 1J9TA 3N55A 1I53A 2HXAA 3NT0A 4AI7A 1RCYA 1BEXA 4E9YA 5I26A 1JZIA 4A67A 1ZPUA 2VSMB 4A68A 1L9QA 1XMEB 1AZRA 1OCRB 1AOZA 2BP0A 1KCBA 3NP3A 3S3BB 2HX8A 2IWFA 1A3ZA 2UXGA 1E5ZA 1NINA 5IY5B 1KBWA 2UXTA 1JVLA 3NJKA 2DYSB 4DP1X 4E9WA 1NTDA 2HX7A 3NJGA 7PAZA 3NJMA 2OCCB 2JKWA 5E9NA 4EF3A 5EHFA 1ET5A 3AG4B 2ZONA 3D12B 1CUOA 4HALA 1AZNA 4YSQA 2GSMB 1AAJA 3OM3B 3DIVA 1L9TA 1E67A 2BP0B 2YXWA 1WS7A 3UAEA 4N8UA 3NSFA 4BWWA 1IKOP 1AS8A 4UAHA 3PAVA 3S3DB 2XU9A 3WG7B 1SFHA 6PCYA 4E9TA 1NPJA 3NSDA 4BWTA 2FT7A 5B3SB 3MX0B 3X1NA 2WO2B 2PP8A 3FPYA 2DV6A 3FQYA 2B08A 1GY2A 2IDFA 1W6LA 1SHWA 3X1EA 4AZUA 5PCYA 5B7FA 2J55A 2PPAA 4G7QB 3NYKA 1A4CA 1JZJA 1V54B 2CUAA 1OE2A 4PAZA 1RKRA 1N70A 5PAZA 4UF7C 3FYEB 3TBCA 3OMAB 4JHUA 3QJSB 5B1JA 1L9SA 1PNDA 2AZUA 5I5IA 3AG2B 2OV0A 2BZCA 1ZDSA 3EH4B 2XLLA 4GP8B 1MG2C 2XX1A 2EIJB 1L9PA 1IBYA 2DY2A 3BVDB 4QKTA 2FT8A 1X9UA 4AKQA 1AACA 4QLWA 2W88A 5I5MA 1KBVA 4DP9X 2BW5A 2Y1AA 4HHWA 5F7AA 1PLCA 1ZIBA 2J57A 3NJJA 2YAMA 3HB3B 2QT6A 1HAWA 1AG0A 2BZ7A 2I85A 4BXSV 3AY2A 1J5CA 3CVCA 3WI9A 2QDVA 3PAUA 1F56A 1GS8A 3QJUB 2YAFA 4A2HA 3CG8A 1E30A 4YSRA 1PNCA 3OMIB 2GBAA 2FQEA 3T6ZA 1ADWA 4W1TA 1GSKA 3CZUB 2X87A 3H56A 1GW0A 1SDDA 4HCIA 4P5SA 1RZQA 2PCYA 1ETJA 4GY4A 1OF0A 2VMJA 4YSEA 3AG1B 1RZPA 3PCYA 1ASOA 4KNUA 4NAJA 1M57B 2IDQA 2X88A 2MRYA 1ZV2A 3FU7A 4KO9A 2JFCA 8PAZA 2XV3A 3V9EA 4CSZA 4DP4X 4DPCX 4YSTA 1PZBA 1EZLA 3DKHA 1QHQA 1VLXA 2AFNA 3N2JA 3TU6A 1BQRA 2CAKA 1J9RA 2ZWNA 1SDDB 2BP8A 3X1GA 1OE3A 2H3XC 2XV0A 4NB7A 2J5WA 3AG3B 1PLAA 2HRGA 4KO5A 2UXFA 6PAZA 3KW7A 2VN3A 3FU7B 4E9SA 3UABA 1ET7A 1JZGA 1OV8A 1JERA 2XWZA 3QJQB 3FQ2A 4KO6A 1KGYE 4FA7B 1ZIAA 2PP7A 5D4IA 2UX7A 3AZUA 4A66A 1PY0A 2BO0A 2BP8B 3IEAA 3TASA 2J56A 2YAEA 3WKQA 4HCFA 5B1AB 1EHKB 5I6PA 1SFDA 3ABLB 1QLEB 1AZBA 3CVBA 3NJFA 1YLBB 2NRDA 2IWEA 2YAOA 1JZFA 5AZUA 4DP0X 1A65A 1NPNA 3PLYA 4E9VA 1XB6A 4BWUA 3PXLA 1NIFA 5LDUA 2XX0A 1X9RA 1OCCB 1BXAA 1J9QA 3QJTB 1GYCA 4E9QA 4HAKA 2WSDA 2R7EA 4YSOA 1GS7A 3S8FB 1BXVA 1ZDQA 4TXVB 5FC9A 1NZRA 2P80D 5I6OA 4A2DA 2AANA 3IN0A 5I6LA 2XV2A 2OJ1A 1NWOA 2TSAA 2XXFA 4P5RA 4MFHA 4DP5X 1BAWA 3PAZA 4FAAB 3KW8A 2EIMB 3T6VA 4ENZA 4JKNA 2VM4A 3ZIYA 1PLBA 2VW7A 1BXUA 2R7EB 5ANHA 4G72B 1PAZA 5TK2A 1N68A 2YAQA 3NJIA 4AKPA 3QJRB 1AZCA 2HX9A 5I5JA 2FT6A 2I7OA 3FU8A 1JZHA 1HFUA 1J5DA 3MBWB 1L9OA 2BWDA 1XB8A 4HCGA 1URIA 1MG3C 1R1CA 1NIBA 2Q5BA 5I6MA 4M4RB 4N4YB 1BYOA 2N0MA 2PPCA 2TSBA 3FS9A 3ZBMA 2IAAC 3EF4A 3IN2A 4WTQA 4M3HA 2IH9A 1NIAA 2MTAA 3JTBA 2GC4C 2GC7C 3FPXA 4HIPA 1AQ8A 1JXFA 3QQXA 3RYMA 1MZZA 2GIMA 3ZDWA 3EH3B 3WNJA 2DWTA 2YARA 5AFAA 1M56B 1E65A 1AANA 1JVOA 2PPEA 4Q8BA 2EILB 2ZXWB 3SBPA 3JT2A 3FSAA 3QJVB 4X4KA 3SQRA 2P80A 2HZHA 4G71B 4E9RA 1BQKA 3T6WA 3FSWA 1CURA 3L45A 1PZAA 1NICA 2EIKB 1KDJA 3PPSA 1ILSA 2VM3A 2BWIA 4DP8X 4KOBA 4PCYA 3GXUB 2IDSA
chains in the Genus database with same CATH superfamily
1NJIW 3GXTA 1QSVA 3GBLA 1KPUB 4UVCA 3L48A 3IU4H 3MJ9H 3RTQA 2LLLA 4HFWB 4ODSL 4IIZA 1KCVL 4M03A 1EVTC 3F01A 3FK3A 5JHDA 1T5EA 3CVHA 3NCWA 1I85A 4PG2A 2Z91B 4S1DD 4HKXA 2KQXA 2UY7A 4JFDB 1ZTXL 1OB1B 4GMTL 1WVZA 4I7ZC 3WV0A 4KY2A 3C6LC 2RJMA 1N32B 4PJ8D 4E41D 5KSVA 5JPNB 5BVPH 1FWXA 1CK0L 3U1QA 4NQCB 4YK4C 4JFWA 3BUIA 5FPOA 3CP1A 1HCVA 1MG1A 1YYLH 2DQGL 2ICES 4I9QA 2QEJA 1E4KA 5KSBE 1VQ6V 3JAKA 3GZKA 4OCSH 4G3YL 5GS0D 2W0LA 5I9QC 4KVCH 2YRPA 3ROLB 1JYWA 1K6QL 3R19A 3GMLB 1FC2D 1G7QA 1CC3A 2VXVL 2VMDA 2K1EA 4LSTL 1MDAA 1Z9SA 2X70A 3T2NL 3LH2H 5FUZH 1NCWL 3DO4A 3FQ1A 3MROB 4GP4B 5EZPA 4QXGH 4MJ5B 3WKPA 3CRRA 1V10A 3CFKA 3F7VA 3UBFA 3ZOAA 3STBA 2VC2H 3EHBB 1S0VA 4M6MH 2DWSA 2ZD9A 3QI9C 3VFMA 5CKAA 5EU6B 1YMHA 2PMZA 4BDVA 1CGXA 4WEEA 4X50A 5DYOA 2PYED 4DP7X 2PW1A 4MS6A 1IM3B 1E4WL 2WXJA 3S35X 3QARA 3RBGA 3C87A 4KKAD 1DVFD 3CXCU 4K0KO 1KPRB 3RY6A 3GSOA 1H3PH 1K34A 5C08A 1IB5A 3S5YA 4FNLL 4I89A 2H0EA 1HCYA 1KJ2L 1OOWA 2FVNA 4I88A 4N6RA 1T1YB 3IBEA 4X7TA 4WWID 2BVUA 2BNQA 2Y36H 2K9UA 4K55A 4P23C 1C7TA 4G43A 5FWRA 1OTTD 4DV4B 3V95A 3S37L 1KIUA 4IRJD 1G4MA 3GUTB 1LO4H 3H4HA 1K97A 4CJ0A 5EOTB 5KBLA 1CICC 3BPNC 4L4TE 3L5WB 2X2JA 3X12A 2PWDA 4DN3H 4PBXA 1W72L 1XR9A 1H3GA 4KK9D 4LLUB 1SLVA 4RZCB 1Z6JT 1T5XB 3MLSL 2CIKA 4GKZA 2BSCA 5H6RA 2PCFA 4YSAA 4JZJB 1ND0A 1I8LA 1LEGB 3VGFA 1IX2A 4IHOB 4PVBA 3CCEV 2ITDC 3N41B 3LHAA 3ESVF 4L0PB 4ZXBC 1UFUA 4ZMPA 1F6FB 1A1MB 1TZIA 3A4FA 3CZKA 3BOVA 3Q13A 4PJ8B 4E41B 2AAVA 1IIIA 3G9VA 4WSJA 3SGEH 1T7XA 4XPGH 5KVFH 4KFMA 2PPFA 4TLSA 4KQ4H 4M29A 3G5WA 5ENWA 3DXAD 3H9HB 1MSPA 1YN6B 3KVDD 4YAQA 1I9JH 2B5UA 2OW7A 2XN9D 5DFTA 4JQIL 4R8WH 3VG0L 4OUUA 2CNYA 3T4ZA 2ITCC 1JFHA 1GY1A 15C8H 5IREA 1IFGA 1KCRH 3MMEB 4ZW7A 4AY0A 3TH3T 1WISA 4JE0A 3CHPA 4HGWB 4LNRA 5BQ7A 4ODWB 2BFVH 4MMXA 5IM7A 4H88H 5KYNA 5FFOA 2VL5B 5B21A 2J8OA 5I1AB 2EDEA 3F64A 4NQVA 2HPOA 1XXFC 2PYEB 3EBHA 2DH2A 4B3MO 3TJPA 1SJEB 1FPTL 4N85A 3SBWA 3SD5A 4E36A 1CDHA 2E6QA 2VQFB 2EDRA 4DV2B 3VDBA 1DVFB 3OMNB 4JAMB 4R7DA 1NCTA 1MQKL 1SEQL 2GJRA 5CP3H 2DKMA 5JCOC 1JGEB 1H15A 3ARZA 4JANB 3FCTA 3O6FB 4HKJA 4TV3A 3RPIA 5C0BA 1WEJH 2ZXBA 3DVFA 2Q20A 4WI7A 1DYZA 1E9OB 1FNEB 4ACTA 1KYFA 3HPLB 3PJSA 3ZE2F 1TMQA 3B2UC 4LLYA 4Y4KD 1NOLA 1FFXA 1TQUA 3OR7A 4DVBA 4EI5C 2G5UA 3PJNA 1K2DB 2YD0A 5E8EB 1TVKA 5IMLB 1CZ8L 4IRJB 1TUPA 1ONQA 2V8LA 2EYTB 2Z35B 2P45B 3RWRD 1ZPUA 1MFBH 3O2DA 3QQ9D 5I26A 2Y24A 2GJ6B 4AZ8A 3K5OA 5ANMA 3F6IA 3QFDB 1BMWA 3SYQA 1BZ8A 2B20A 2IWFA 2Y7QB 4BZ1L 2A77L 1FN4A 2UXGA 4ERSL 3K6OA 5DJAA 4Y5VC 4D6TH 2V5RA 5GSRA 3DHJA 4DP1X 1EAPA 3K0YA 3SY6A 5T3ZH 3IJSA 4UT6A 4WI8A 1PEZA 5A2FA 1KXQE 2Z31D 4PA6A 4POUB 1U6AH 3KDMB 4MSWA 1KNOA 5B1AC 4TSAH 2R2HB 5E9AA 3U46A 3CX2A 1EJ8A 4UV9A 1K4DB 3ZS8C 3G4SV 1V8HA 2BY1A 3GXDA 5IJCC 1MWAA 1IT9H 1I31A 2P4VA 2BP0B 3MRJB 2EXYC 4WNQA 3FRPB 1M2VB 2XN9B 2X28A 3U10A 3GXNA 5FYJH 4JM4L 3LQZB 2JQAA 3PL6A 1RIVH 4RDQG 4P30A 1QEWB 4OVVA 5CCGE 4YDNA 5DQDL 1ZHLA 3VFRB 1ZLEA 2XZZA 3FTGB 5JIMA 1F7YA 2Z93A 2CMRH 5JXEC 5EK0A 2J7LA 3IFXA 5E6ID 2ZIOA 1LQBC 2AV7A 3JWNG 5DRXA 1Q81W 4QRRD 1Z5HA 4B9PA 4P48A 4XCCL 4X7EC 5JH7A 2HFEC 4LDCA 2AJZA 5LUMA 1OW0A 4D94A 2R1XA 2X6CA 1Y74A 3FOMB 2CO3A 5E5UB 3MJ8A 4YHNB 1MZFA 2D31A 1CLCA 1HL8A 1RKRA 2YN3A 4M7JL 5IVZB 2WZPD 2E7LC 2CLZA 1UWFA 5EYPA 5ACMA 2DEYX 4PJ7B 3G5YA 2Q1EA 4K9EH 5SWQA 3GS4A 3UMTA 1A6AA 3OPZL 1R3HA 4E2OA 5CD5C 1S8DB 3WY1A 1MCIA 4FZ8H 3UDWC 3B8MA 4BH7A 3TXSA 3EYFB 3W0WE 3B4NA 1I9EA 2C9UA 1FXKC 2OXGB 4NWUH 1FJ1B 2VIRA 2L7UA 3HC3H 1WH0A 2GIYA 1Z5WA 3TEYA 2KBGA 2NY3D 4PM1A 4LK4A 1JF1A 2LFEA 4Y4KB 5JQ6H 1DFBL 2AHYA 3KPSB 3S48A 5I5MA 1IEHA 3HE7D 3UO2A 2C3XA 4X5XB 1ZIBA 2CDGB 1RZ8B 4DZ8A 2QKSA 2WTOA 1GYWA 4JV5B 2LV4A 3L3OC 3N41F 4JFFE 4Z7OF 2CDFB 4N2LA 3SDDC 4PI0A 3MRQA 3VE0B 3WHXB 4M93B 3BISA 1X3DA 4XCYB 3WUWB 1J5CA 4K07A 3SODB 3DO7B 2JI1A 1UADC 1WCBA 2V2XA 5LG1A 1VGEH 2CUHA 2IDCA 4W9CC 4MMYB 4I2XB 4M1CC 3WEAA 1GOFA 3PWPB 5CJQH 1RURL 3LQAL 1P5VA 1MFMA 1I8MB 4CKVX 1PNCA 3BN9D 1JOYA 1T1WA 1TLKA 2RDCA 1TQVA 4PJAB 4XVSL 1AKPA 2XFGB 1HNWB 1QBBA 3GIVB 1Z2KA 3O8XC 2X6AA 5SWSB 4MMZC 3UYPA 3V6OA 4QRPA 2ZXEB 3ZHSA 4UM9B 4GS7B 4PLKD 4P3DA 1O9GA 4OCRH 5KBKA 3QUXD 3A2FA 3RIAF 1OWRM 1MRCL 3APMA 2FX9H 5B8CC 4X65B 1CD9B 1QO3B 1A6VH 2Q87A 4XN9A 4NXMO 3ALPA 4NGHL 5KWYC 4FZEL 3BA8A 1KWKA 1XEQA 5EZOL 2VITB 4OJAA 3WFHA 2PWGA 2VAAB 5FA3A 1AIFA 2AEQL 4KK6C 4LP5A 3RVWD 2ED7A 4RWUA 1CPYA 4A7VA 4ANXA 2O5ZL 3FU6A 3MU3A 5E6IB 4GAJL 2ENJA 3K4ZA 4QRRB 5E24E 3CSBA 2FNBA 1QSEE 3GBEA 1LJMA 3K0DA 4EI0A 4C58B 1BX2A 1YY9C 2WBWB 4IRSD 3KEDA 3C9NB 4PJCE 4PIRF 3RDJA 1D2PA 5HDRA 5KVDL 4G6JL 4OZFG 3KW7A 4HNAA 4FLRA 1V55C 5CSZB 4GKNB 5C07A 3U7YL 2F8OA 5HJ3B 5HDQL 4N2CA 3GBDA 4KXBA 5J0BA 1CGYA 5D8JH 1IAIM 4M02A 1ZIAA 3U9PH 1OWWA 2VN4A 4Z77B 5GJTL 1TUBB 1N8ZB 3G71V 4PDMA 1I9IL 4ALAL 4I48B 4K3EL 2W9DL 2YAEA 3PP4L 2A9MH 5FHAH 4PS3A 1H2SB 2NW3A 2IAMC 5I15L 3C8DA 1N19A 1PZUB 1AZBA 3PNRB 5CWSB 1GGYA 4KMLB 1M53A 2ENYA 2B5IB 4I0XB 4WU7B 4IEFB 4ZODA 1YCSA 4OU3A 2FB5A 3HBGA 5BW7C 2EDTA 3FUIA 3JATA 1DBMH 1W2BU 1BXAA 1ZA3B 2ADIA 5EU4B 4PV9A 5LXGH 3P0VH 5SX5K 3FAXA 1BJMA 5F71A 3NR7A 4F1ZA 1IVTA 5I2IB 3U2JA 1NTKH 3ORJA 5LN8A 3GK8L 4FLQA 4YBQC 1AO7A 1YQVL 2FL5A 1KJ2A 2E4TA 2DJMA 2Y1VA 4OT1L 2TSAA 3SGKC 1JYVA 1VADB 5D7KE 1YYMH 3T0EA 5DS8B 4FAAB 3GGWB 4O2BA 1ZLVK 1B0RB 3HAEB 5BMFH 4BFIA 4ETYA 5HYSB 3ICXA 1OT2A 2FRGP 5CHNA 4XCEB 4FE9A 1JGUL 3GB7A 2HP4A 1BIIA 5JQGA 1UWXK 3QUMH 5TK2A 4AEEA 3GSVA 2YAQA 3QUXB 4GG6E 1LO0L 1FIEA 4ZTOL 3FW6A 1M5IA 1W72A 3BFOA 2UXBO 4K7FA 1DBJL 4PJ5E 5DHXB 5MEND 1A6ZA 2CAZC 1IAOB 3L4VA 4GEIA 4NQCE 4IU2B 4WNSA 4YR6B 4Q6YA 1WQVT 1YC8A 3PDGA 4M4RB 3B2EE 4X6FA 3WB2A 2AJSH 3SDLA 1MIMH 3MO1A 4JRXE 4X8JB 3VMNA 4PJ7F 1KT2A 3B3IB 3ULSB 4F5CA 1A47A 12E8L 4FNUA 1DQMH 5DEGA 4U6YB 4FQCL 3PGCA 5AEAA 4OM1H 5CILL 1DUYB 2G75B 5D5MF 1CFNA 5DA4A 3UAJC 2L35A 2E59A 4ABQA 3ABUA 3C09B 2WN3A 5HYJD 4XO4A 4ZFQA 3QIUC 4ZOAA 1AP2B 1MZZA 4JFUA 2C4FT 3EH3B 2AZ2A 2VO8A 1NAKL 4JRYA 4JQIA 4GW1A 2YARA 2Y6SD 1JVOA 2V2TB 4GXUN 3OR6B 4YLCA 3TEUA 3MRNA 4HYOA 4P46C 5K1VA 4NWTH 2HZHA 4QTIH 3ZRCC 1OT1A 4EI6A 3PXJA 1SQVH 3JXAA 4G9DB 4WI6A 1G9ML 3KWWB 1DLFH 1FYTB 4H44C 4NC0B 3UYOD 2CXGA 1VF7A 3WFDL 3WYRA 4UV4H 3RDTD 3QUYB 4GUCA 5MERA 4EKXA 1BREA 3I2CH 3AK3A 4XMTA 3LKRA 2WQVA 3A4AA 4XBGA 2DM3A 4IIJB 4KOBA 2XBZA 1LD9A 2CPUA 4U1LB 4IIQB 4UQ3B 4JPRA 1XCTA 2ETNA 5FLXN 2H3KA 5GPRA 1U3HC 3VFWA 3QYMA 4PJAF 1BQUA 4Q6IC 4HPHA 1RULL 4O2EA 3CQFA 1TQTA 1MKFA 3E80A 3ZYJA 1AGEB 4WW2B 1KWGA 1YY8A 5DJXB 3BQUC 3A67L 1P7KB 1ZT7A 3QO8A 4B3SB 1UTDA 5DD0H 1YUKB 4NCC1 5DJ0B 2WVUA 1ZGLB 4LCWE 4PN6A 3RIAK 2R69H 2WO4A 2PZSA 3CHSA 2G2NA 2F7PA 3RLSA 1I8KB 4FLVA 4NN7B 4D9QD 2CLVB 1MNNA 3F00A 1KXTB 1XHHA 4AV4A 4JI6B 5EEWA 3EYSH 1XHXA 2OMWB 4EN2A 5AAWA 1JI1A 2AC0A 4LWSB 5F7MC 5AVQB 2OK0H 1LWRA 2F95B 5ICYB 1R5VA 4GAGL 3SE3A 4FI6A 4PI2A 3DYMA 2FAUA 4UU9A 1AGBA 5D1XC 3AADB 4GP5B 5C0CA 3L17A 1GM9A 2AVGA 3RYCA 1XIWC 1NFDB 5LAXB 2PCXA 3TZVA 1KYUA 1NWPA 1OB0A 4GRMA 4NN6B 4LFAB 1OVZA 4X5RA 5LCVH 5ISZA 3KWUA 3RNKA 1ML0A 5FGCE 3ZHFA 4PA7A 3B7UX 4Y7MA 5ICXB 4F8NA 1TOXA 2ZM6O 2VDNL 2WLIB 5IT9N 3BDYH 5CLTA 5EOCJ 5LVEA 2EJ7A 1ID5I 2AJ3B 3IE4A 4GX1A 3BT2L 1XUQA 2ZG2A 2CALA 3G5ZA 1DQLL 2BOCB 3C5JB 2X4RB 3L1EA 4L3ED 4PJBA 4AQ8C 2X6BA 1CE6A 4PJEE 3IGAC 3REVB 1KLGB 2X4UA 2X3AA 3HMXH 2YJQA 3VX0A 3MODL 1Q82W 3PXHA 3NIGB 3U36A 1RUPL 3DRTA 2GTQA 3GMPB 1EEQA 5E8PA 5HGGS 3VXRE 3D3VA 1G9HA 5AKRA 2BTQA 4MX7A 3ECUA 3DOSB 3WDHA 1KB5B 2EDLA 3EH1A 3N2KB 4JN2A 1PSKH 1PAMA 3RDTB 1U97A 3D8MA 2YS8A 5DSCA 4O51B 4MYPA 5I30H 3T1HB 4J41A 3ZMRA 3TCXA 4ORGB 3CFEA 4K71C 1TU2A 4UILL 1FAIL 2P26A 3EYUL 5C0EB 1CU4L 3MUY1 1EDYA 4TVSa 2IDUA 1RUML 4AQ1C 2OMUA 4HJJL 2DQEH 2RQ6A 1YJ9V 5ITFA 1RZKH 3UH8A 1BS3A 5LGYA 1USQA 2D3OW 3HG1B 3JQOB 3VRJB 2ERJC 3VSQA 1SS3A 1WJ3A 3UKMA 1UXWB 3PAYA 5AKSA 5MEPB 4AX3A 3K5MA 1NKRA 5J2UA 5INDA 4K3DH 4LPWA 3MXWH 5D1QA 1YCIA 2O6PA 3ABKB 1NBMG 1FBIL 2JNZA 1M7DA 2ROXA 3BGMA 3FH7A 1FVCB 4X7SH 3ZPDA 4BSVA 1DEEA 3MNWB 3GLDA 3MV7A 1C5CH 4PPTA 4IBZA 2AVFA 5AWNH 3ULUC 1RIHH 1VF5C 1QLFA 2VSDA 5LKNA 1YPZB 1TENA 2F58H 1SQMA 2XC8A 1VQ8V 2JJWA 3OV6A 3VA2C 4ELME 4RAVB 5GZND 1BVKA 3DIFA 4FFWC 2PNDA 1ERNA 1MSDA 2NSMA 4N0RA 4JYCA 3DX6A 4Y2OB 1HS6A 5H35A 4JY4A 2W0FB 4K8RH 4OJDH 3UCQA 3Q1EA 1FHNA 1WAAA 1U8JB 2B2XH 1VPOL 5IMKB 5B1BB 4O5LL 4OFIA 4L5FH 3ZL1A 4JMNA 3B7SA 4DPBX 2KPNA 4ZUUA 4M3KB 1DO6A 3C6SA 3FMGH 4RMVA 4ODUB 3MRBA 3D0LA 3BPCB 1RUAH 3G6JE 2JXMB 5DJDA 4FXLA 4FQXA 2A3TA 3IFNH 2YEZB 4JO4L 3SOBL 1FZMB 1IQWL 2BRRL 4N2EA 5IJKC 4UBDD 4PD4F 3FULA 1EZSA 2EX3A 3AREB 1ZJAA 1JBJA 4DV7O 3QAQA 1DE4A 4N8PA 3L9DA 2ICWB 5I1KH 3LDBB 1BSMA 4FFYL 3T3PF 1EBAA 3U6XS 1SOXA 3QIWA 4PWHA 3VYNA 2G2PA 1HJCA 5T1KB 1B90A 2FJSA 4X1IA 3AW5A 3PWJA 4TLUA 4WW2F 2LE9A 3FU0A 2Y07H 2AJXH 1U95A 4MZIA 5LGJB 1HYSC 1F23A 4AI7A 2HXAA 1V5JA 1NT2B 2G3NA 5FL7G 2X40A 1DTOA 4ONGH 4P3WA 4E9YA 4N5UA 1CLYH 4P4KC 5FM4A 4BRJA 1U8PB 3RGVD 1MFUA 4X4ME 4OLUH 5K69A 1LEIA 4WW1B 3KLQA 4FXTA 1HSBA 3SKMA 4AYEC 2P46B 1A3ZA 4OLYH 1Y4MA 2LU4A 4U3SB 1B2YA 3NJKA 4V2CB 2DYSB 1N0LB 3FOLB 4GH7B 4RRPG 4YIQB 1TVHA 4PS4H 3GLEA 5DD1H 4RO2A 5I1EL 3BSHA 1I3GH 2I26N 2P5OA 3DX1A 3B7RL 4GLRI 2R0LH 3VFPB 4I2XE 2EE2A 1NFDF 4H8VA 2R2BA 1AR5A 4PW9A 1QLEC 1THAA 4ENED 4YSQA 4KZDH 2BX5A 1XREA 2Z64C 1TJHH 3HJ0A 1VERA 1EQWA 2F53D 2HFFB 2WUCH 2ZT9C 4MAYD 4Z76A 1LWJA 5JUEL 3FUDA 4UAHA 3T3PE 5CINL 4BFFA 4D9RE 1JGIA 2A0LC 5FNVB 2XG4B 4M6OL 9CGTA 4YUEL 1NLBH 4H8WH 1M6OB 2JRIA 4IHJB 4HBCH 5M7QA 4G2KA 2PP8A 5AB0A 1QVOB 1FLRH 2YXHA 4ODTL 4AZUA 3MDJA 5JDSA 1VCAA 2XIIA 4DUXA 3DURB 1JHTA 4WWKD 1Y76B 1NAMA 3FFCD 3GSRB 1UFIA 1VRSA 5IMOA 1T7VA 3P4NB 1R19A 4PJDB 3MJWA 3VXMB 1VARA 2R4RL 2V17L 3FH5A 3KD4A 3FYEB 3Q8EA 4IS6B 5M95B 1Z9PA 1ETB1 4NPKA 3OMAB 1ZS8A 3FTSA 3BUQA 4P2OD 4XXDA 1BFVH 3UBXB 4KDVA 1O0VA 2NT0A 5A2BA 1IEBA 2VO5A 5DECA 3ILPB 2WXHA 1L9SA 5GRWA 1DSFH 1INEL 1ZD6A 2YZ1A 3H0TA 4FMVA 4LF6O 2Z7YA 4X9IA 2WWKO 3WAJA 1DHKA 4B6ZA 3LV3B 3FX7A 3OF6D 4HULB 2JS3A 5I75C 4XVOA 4AJWA 4QLWA 4Y19A 4Z7UE 3QG7H 4GW5B 2ZNWA 5IBLC 3NCCB 2OBGA 5I8OL 2G0KA 2C4XA 3BVUA 3KDPB 1OAQL 1IZJA 2PF6A 3RBZA 1OPGH 3RGVB 3GSNH 1JPXA 2AXHA 2CJUL 1I82A 4NM4H 4PJIA 3QDGA 3HI1B 3QEQA 1AVAA 4M8RA 1U3ZA 2ENPA 4JM0A 3RL2A 1R0AL 3E0GA 3ETBJ 4LF5B 5CO1A 4F2ME 1HI6A 2WZ0A 2EILC 2YR3A 5F3HB 3GSWB 3J07A 2M7WA 2V5TA 4YC2B 3K0WA 4XMWA 1QTPA 3RAJH 4HD5A 3VQLA 3WIFA 1B6UA 3BZ5A 3MACL 5CBAB 3HBZA 4GG8A 3S96B 2ZE6A 4X9HA 5E23A 1KTRL 1ETJA 2A4ZA 2VUYA 2Z34A 4YSEA 3KYMA 3MTXA 2F53B 4NJAL 4MAYB 2PTVA 2HKOA 4FYTA 3E8FA 1TTRA 1MHCA 4UFZA 3RIFK 2C26A 4F57L 1P7QD 4PJ0Z 2WUBL 4YLBA 4BZYA 1G4RA 4R7CA 3BP7B 4NN5B 1G7JA 1NCHA 4JFXB 3ZQXA 2I07B 3ZRSA 3L1FA 4MDJA 3IXAB 5E2UH 5IHUL 4X6DA 3VWJC 2N4IA 2FO8A 4NM8L 4YDJB 3NA4A 3X1GA 4DK3A 2A06H 1JTOA 5IE9A 4WWKB 5HYQA 2EVHA 1J0YA 3VXUE 4BCYA 3FFCB 1FNGB 4PJFE 4GRWH 4L0YA 4LB8A 1PIFA 1UJ3B 3SPIA 3ABTA 4JZGA 3CCJV 2VDQL 3JV5A 5FDWA 1EFXD 1OEZW 1DFXA 2CHZA 4O2FB 1K33A 4UCOA 5I8KL 3RVUC 1TSRA 5E4EC 3ARUA 4JREC 3LDCA 4P2OB 4XVJH 1L5GB 3O4LE 4L2LA 4GW4A 3ZKMC 3VFNA 3E2HC 1S9WB 3WUZA 1VJSA 1NCJA 2GCYA 5FS5A 4A7SA 2FO4B 2Z8WC 1JL8A 5EDSA 3OKDA 4JG0L 4AYGA 1M7UA 2F4VB 5EU3B 3T65A 4OPAA 4JI6O 4HCFA 3L4TA 3S3WA 5AZ2L 1ITBB 3WOVA 5J06A 1PLGH 1EEZB 2I60H 1INDL 1HJBC 4XGZB 3K6DA 1JGDB 1T7WA 1QNZH 2JTDA 5BZWA 4BWUA 1UM5H 2VDRB 2PO6C 1J18A 1MH5A 4Y8DC 2AJYL 3MR9B 5T8IA 3BYTA 2VXTL 3M17B 3QDMA 4J23A 1GZPB 3OHXA 2FX8H 3NK3A 1D9KA 3NIFB 2BS9A 3B2MA 5E94A 4J9YB 4NPYB 4L2YA 1AR1C 1F3JA 2BIHA 2K3TA 1BHGA 2WINA 4EJ1C 3F12A 4CDHA 4JI0O 1QCEA 4UTBL 2B9BA 1TITA 3QQ3A 3CRMA 2VM4A 3MZGB 5FGBA 4B7KA 2YBRA 2WXOA 3HE6A 1V3LA 2ZOLB 3BP5A 4HS6B 5D6CB 5JW4N 3DSNB 3M99B 3IJ8A 5T5NG 1AVMA 4J11A 1HXKA 1X5LA 1N68A 2LU7A 2V2WA 5K59E 3BIAX 1GTNA 2E9GA 1J1OL 3E3QE 4PRAB 4AITA 4DVRL 1ZHBA 4I0PB 4P4RA 3BPLC 5CSGA 1RSFA 4KK8C 4IRZH 3GBMH 2ARHA 2E75C 2VLRE 3HTLX 2YUVA 2CR0A 4E5XB 1FO0L 4WFFA 2M1KA 1PPIA 2AW2A 3VXOB 3NPSB 4RGNE 2HJFA 4PJDF 2APSA 4R97B 4UQ2A 3UO3A 2BSRB 3P77A 2AERT 5AG9A 1H8NA 2LLGA 3NCYS 4OGYL 1ZX3A 2H6PB 3IJYB 3O3BB 2KKWA 4LSUH 3WE6B 4V1DA 4FMFA 3TFKD 2AEPL 3A3YB 1J05B 3ZTJH 5L7XH 1E9QB 3GO1H 1IC7L 4D3CL 3M1CA 3UFIA 3RYMA 3KPRA 4Y9GA 1V3MA 5IVXB 3B7YA 2P8MB 3OSKA 1A3RH 3I9GL 1JP5A 2DYRC 3NSXA 4QXTB 1EAOA 4LF4B 4R7VA 2GK0B 4PVMA 1M90W 5C71A 1SGKA 2HP8A 2B1HL 3G5XA 2YI9A 2AK4B 4EXKA 1FNAA 4ZAKD 5HFMA 4XPBL 2MKLC 1CFTB 2K6WA 1J8HE 2P80A 4NFBA 4KJPC 3VXQB 1F02I 5IKCA 2EBOA 4D8PA 3M6DA 4LEOA 2VR9A 5L4IA 1K5WA 3ZMNA 1EA9C 4NSKA 4RMQA 4YE4H 4Z3TA 4KRPC 1H2GA 3TPKA 2ZWLT 4NBYB 5BJTB 1ORQC 4CC4C 1J12A 1L3WA 3L9EA 2MCMA 1U92B 1TTGA 3EIFA 3TO4A 2DYPD 2XTJB 1U93A 4RLDA 4DGIH 3CSYB 1UD5A 4AVIA 4UOZA 2FLRT 1NBVH 2K7PA 3D06A 5KAQG 5IT2H 4URTB 3BIKB 3K08A 2VGLM 3FU9A 1S7QB 1YNTB 1J95A 4W9IC 3VD0A 2W6IG 4OKDA 1DJWA 4FFYA 3MLVL 2R15A 4Z95H 4X0KA 3MRFA 3NJNA 1KV7A 1I75A 3WNIA 5DJ2B 5E95B 3PHOA 2MK3A 3E7JA 3DPBA 1IC4L 2RMKB 1R73A 1X5XA 2DLFH 4YHYC 1E2VA 3U30C 1DJYA 2CGZA 4WKXA 2R0KH 5F7FA 5F7HA 5EEZA 2GQHA 4MZ2A 2P06A 2XY1A 4H25A 4YGVB 3RY4A 1KGIA 3JD3A 3CSTA 4OLXH 1AROP 1FFQA 3U25A 3EFFB 5ACLA 2FJHB 3CC5B 3OVUB 1KIPB 2IH8A 5DRWB 3JD1A 5LP6A 1MNUL 5A6LA 1A9EA 1NDGA 5SX4I 2Q8AL 1DJIA 1RXLA 1HHGA 4U6HB 1YEHH 3GMOB 1B3QA 4X62B 1FL3B 4Y5YB 2QA4V 3V9FA 2E8YA 1NUNB 4WNJA 3HKBA 5IY5C 4HSAC 4QRFA 5CJOL 4JZOB 1BFOA 4LCYA 1FA4A 3AGWA 1CLVA 4XXCA 3RPBA 1DN0B 2K0RA 4RGOH 5ECGA 4G80B 4HUUA 4UMSA 5IQNA 3C90A 1HW7A 3HKZA 2VDPH 4Z7WB 2BVQB 2F19L 1G94A 1KN4H 3VXTA 1G7PA 3H7LA 3NFPA 1BQ5A 2OSLB 1KPVA 4OAWA 5JW3L 4O2CB 5KVEE 3EJJX 4ZAKB 3S3CB 1A2YA 1T66D 2X9ZA 4DZBB 3WNLA 4OCYH 2FEEL 2PYJA 4L8SC 3NCJH 2JGDB 3OE7G 4GRLD 3OAWA 3QWOB 4QIRA 2YMXH 5ID1B 1OHHG 2I25N 2CDEB 5D7LD 2XNAB 4DEUA 1NI8A 4KWUA 5EIVA 2FB4L 4I3RL 5F6HI 3V0JA 1RFDL 4MJIE 2HHHO 1YEGH 1P7BA 1UM4L 4NENA 2PWFA 1KDIA 35C8L 1R5WB 3S8GB 1U2CA 3O6LH 2ALAA 4X7DC 1N9PA 5AVVB 3HLAA 5BPPA 4MJ6A 2CO6B 2AXGA 4LFBB 1R3JC 2BIIA 5C2BH 4NQDA 4HC1H 4XPFL 3VNYA 1RZGB 1O7SA 1EO8H 1RLBA 4Z3JA 5DMKA 3OGCC 3QDJA 2WO3B 1SXSA 3B56A 4PB9L 1F6LL 2DLGA 1X5IA 1XH3A 1N4XL 4NT6A 3S34L 3UTOA 4KL1A 4IOFD 5I66B 1ESOA 1U8KB 3CRAA 1XAKA 43CAB 1HWWA 4JEGB 1Y0LB 4QUOA 4WO4D 5I1DA 4BA8A 3L5IA 1JOIA 5L3BA 3DX4A 4HJGB 1Y7VA 4BZ2L 1OO2A 1MLBA 4DW2L 1B06A 2XYCA 1F86A 4QDGA 1A7RH 4B9ZA 3MRGA 1JUFB 2NY6C 2O6EA 4NTWA 1OCOB 4RFNB 1RZFH 4L4VE 3MKGA 4POYA 4FG4A 3KBPA 5BV7H 2XVGA 2ZP8A 5IVXF 1KYOJ 1DBKH 1YEKH 4JLRA 1FFNB 4P2QD 3BKJL 4J7RA 2BSED 3O41A 5J1AA 2FQGA 2HWZL 3B9KD 3F8UB 2PTUA 2YUXA 3MQIA 4P9ML 2DL2A 5JOPE 2IWKA 5B1OA 4G8GA 4XPHH 2BWQA 5C8JA 5IF0B 2Y6TE 2BFGA 1QSFD 3OKKB 3G6AB 1TZHA 2R8SL 1EZJA 1SPDA 5EBMB 3T0BA 1C5DA 3G6BA 1JHLL 4LSSH 3RIKA 3QUZD 4K3JH 2EO1A 1I7UA 4NTYA 1MI5D 1DQQA 1QLRB 4QHPA 2CBMA 1U8LB 4YHML 5D1ZD 4EKJA 3QHTC 1TTBA 2WTRB 4MHHG 4WFBV 3HEIB 3V4VH 1A7PL 5ESAA 4PGBA 4OLEA 4DV0B 4D0CA 3GKWL 1I1FB 3ZHUA 1ZHNA 3LJ3A 3QYCA 3PV7A 3FTXA 1YNTF 2ZKHL 2IJ0C 1GGIH 1RCYA 3B5GA 4TTGA 1RJLA 1SQBH 4YJZL 4YJ3A 3ZRXA 5AAPA 1MVUA 5I1LB 1VQMV 3ZTNL 1KMGA 5LA6A 4WZ9A 4YIOA 2FSEA 4X9GA 2YPVH 3BWSA 3L3DB 3G5VB 2WZ5A 3ARPA 3AAZA 4AYID 5I0VA 2BHUA 2NNFA 3G80A 2PW2B 1EV2E 1GM7A 3FSOA 3V5HA 1PX8A 1TETH 1RL1A 2C1PB 4U1HA 4B9CA 4OKVB 1NTDA 3UO1H 5KVGH 3Q43A 5FXCH 4L8CA 1QPXA 2HVKC 3MX0A 5B39A 4OGQB 5DR5H 5E9NA 3QA3B 2WBKA 4KJYB 4WO4B 5HHVH 2GBVA 2WQSA 2VRAA 4HS8H 1CUOA 2GSGA 1U3YA 1B88A 1UOLA 4LARH 2HT4D 1KN2H 2FE0A 4XN8A 1C5BH 4JQXA 5H94A 3WTYA 4I3SH 3DIVA 3BLPX 1NC4B 2O5XH 4IBYA 4YXWG 3GKZA 2XA8L 1QWHA 3QZWB 3U0WL 4JPWH 4GZRB 1J0KA 4ZW6A 3WB0A 3PWLB 2OIEA 5EG6C 2YPKA 2NZ9C 4LCCC 3H6JA 1PD1A 2HRPH 2QHRL 1S7SB 1IKFH 5E00A 2J8UE 2I9TA 5JDJA 4XHJC 1P5UC 1BPLB 3WL9B 4FLSA 3BSZL 3RA7H 4UTBA 5KOMC 2QMKA 1ZA6B 2FECL 2GABA 2JLLA 4WI2A 4ANVA 4P2QB 2XVLA 4TUJA 4WHTA 1D7BA 1MCLA 3MLUL 4G6KH 4JJ5B 3VXSD 4PJGF 5B7FA 1JXJA 4CW1A 1SJXA 3ZMEA 1L6ZA 5BOJA 1OGAE 2VDKL 4NQED 3T77B 1K8AW 5K1JA 2KB1A 1DJSA 1QSFB 3HKCB 4JASA 3TESA 4X4YB 1RZJC 4UQDA 4TQEH 1E5AA 1T1XB 2QWRB 3CCSV 1X5AA 1ZE3C 1NGZB 1NMCB 4U1IB 5GGQL 5I19L 5T33H 2NR6C 3K7UA 1N5AA 1YEJH 1SY6L 1MI5B 1JK9B 1FO0A 2R29A 5KA5A 1QHTA 3EO9L 3MRDA 5D1ZB 3VXPB 2CU9A 3ZE0E 2MOQA 2X4OB 3I50H 5DFWH 1WTLA 3UTPE 3VFTA 1GYAA 3VRLF 1MG2C 3KS0H 1UUNA 5EIIB 3LZOA 5I1GL 4KMQA 3QSKB 3DPDA 3BABA 1F18A 1X9UA 3QE5A 4LVHC 4OBRA 2QKIC 3UZQA 1KG0B 4P2ZA 3SDCC 2IMNA 3CIAA 4G8IA 4UV8A 2HLDG 4M43H 1KJ3H 3U0TB 2VMEA 2Y1AA 3BMVA 2BVOB 1PLCA 4K23L 1WBZA 4GQ9L 2Y2TA 1ENVA 5CJXC 5CZXD 4H5SA 5C0FA 3QXAA 3OZKA 1DQDL 5TTRA 3QFJA 3WI9A 2OTUB 1JJUA 5CIPB 4MB5A 3V6BR 3GQFA 4FCAA 3MN8A 5DZAA 3IGUA 1WJZA 2OJEB 1MCOH 1XSOA 2TRYA 5JR1L 4FJCC 5BXFA 4JAAA 3NIFE 3X3FH 5LXTA 4P2AA 4TSBL 3IXTA 4X6EA 5GGRA 2AF2A 4O4YL 4CC0A 4FQIH 4PJXF 3CZUB 4MNQA 5C3TA 1S9VB 4RRPA 5T1LA 3POCA 4NO3B 1WF5A 2EIKC 2MEJB 3B2VH 1K73W 3H7BB 1JZ2A 3UTQA 5CEZE 4K73A 4U3JA 2NX5A 1B4TA 2H32A 3BCCH 1QZ1A 3CDGA 3F7YA 3K2UH 1EM1A 3KCPA 1ETZB 3HZKB 3EXAA 3SCMB 3H1KH 2YBGA 1Z0MA 2X3CA 4Z7NE 2JFCA 3WD5L 1AYRA 1CXIA 1MW2A 2ZKMX 1KBBA 4OTXH 7PCYA 4I87A 3V9EA 4OV5A 2JKSA 2BIOA 5KUMA 1WLHA 2P5PA 2ZXGA 5I16B 3KNBB 3DKHA 3B5TA 3CHXA 4PUBL 3K06A 2N56A 3RU8H 5AVWB 4L23A 1BT8A 3P2DA 4PSRA 1N6UA 1PZ5A 2ZOWA 1OE3A 4CGTA 3OXSA 4NQEB 4I4TA 3U4BL 1JZDC 4HT1L 1WFMA 1UB6A 1FG2B 3Q8BA 3NGBB 1GGUA 1MCKA 2NSXA 5JPNC 1KJMB 2NNRA 4RX4D 3L5XL 1US6A 4IBVA 1ZMYA 3UTTE 1I1AD 1JZGA 1PG7W 4JK0D 5SWZB 1QI5A 1KGYE 4HUKB 4EBQH 2ZSVA 3WIHH 1NDMB 5I17B 3HRZB 3NABL 4XNMB 1MCEA 4L87A 1CEZA 5D72L 4ZS6D 4DR7O 2JTYA 3BPZA 4IK7A 3BH4A 2NUPB 4HFUL 4LF3B 1OF2B 4BRVA 3SKJH 2QVKA 4MBRA 5I6PA 5LGHL 1QVGU 1RHFA 1N0XH 2GBUA 3LKSB 5KS9E 2XPGB 5ESQA 3W5NA 3GJEA 3FB7A 4PJ6A 1CPUA 1UACL 1R3LA 3R4RA 1SA0A 4EZMA 4S2SB 3ZT6A 2X89A 3NZUA 3B5HA 3EHBC 4AJYV 5CZRA 2P7TB 5KW9H 2QJDA 4TVPE 3IJHB 3V79C 1TO5A 4KQ0A 4X62O 1ZDQA 2A83B 1RK0B 4TXVB 3R8BB 1NZRA 3B83A 3W2DH 2IQAB 1RZJL 2CR6A 1G6RB 2JK5B 5DUBB 5GGSA 3CXDH 2C7UB 1WIUA 2BOBA 2D3JA 4JPQA 3WEXA 5I8CB 2FEEI 3F7KA 3V4UH 4PG9B 2ZWYA 4DP5X 2DJSA 1P4IL 4KXAA 4I77L 1BPVA 3NPZB 1GN3A 1VIBA 2F7OA 2EDNA 1IGJB 4N2MA 4QRUB 1JK8B 1KEMH 4I18B 4F7MB 4TYUA 2ZNIA 4PJ9B 4A7GA 3MNDA 2HT2D 2MNJB 4BUGA 1XTMA 4OF7A 2IV9A 3TM6A 4N20A 2O61A 3MLWL 1MEXH 2VAJA 3NQKA 4TLTA 5KSBA 2CIIA 5IWAB 4N0UE 3E8VA 4XOBA 4N0YH 5L6YL 1CBVH 2R9HD 2RBLA 3LSOB 1YJDH 2FT6A 5J2TA 4CBPA 5DUMH 1S7VB 5HDOA 1D5AA 1DQJB 3V0DA 3CPLA 4DTGL 2XAFA 1D5XB 5BRPA 3BZEA 4XP6L 4NZRH 4X8CA 4Q56A 5TE6H 3E6FA 4S1QL 1JFQH 2APVA 3BKML 2E8ZA 3OJVC 5H37A 4IBQA 1WV7T 4JZJC 4JI8O 1ZXKA 4JKPH 5GRUH 2P8LA 5F7EL 3SDYL 4C8XA 3MV9B 4OF3A 3TBWB 1QD0A 4Y0GA 4ZZKA 3LPWA 4UIKH 1TTUA 1XGRA 3MLRH 4BZ2A 3TCLA 3GD1C 4PJ8C 3I75A 3ARBA 4GKJO 4WFGE 2NDFA 1F58H 1I1AB 1ORQA 5F7UA 1R6KA 5AFAA 2OMYA 3RZCA 3HS0B 1NGQL 4OLWL 1AANA 4V33A 1CQYA 1FRGH 4HEPG 1KXVC 3L4XA 3P30H 4RQQB 1HINL 3TIEA 5GS0C 1S6NA 1AR4A 2ADFH 1AE6L 2AI0H 2VZ3A 3JT2A 1M05B 4MA8L 4MXVF 4J12A 4FP8L 3N3EA 4WTXA 4AYSA 1OQXA 3WTSA 3WXWH 4Z7WE 1NH6A 4NKMB 3L45A 5GS1A 3O2VH 3L8QA 3PPSA 1DEDA 2Z1KA 2OYPA 2OSWA 1F11A 1UUSA 3ZBHA 5F0MB 3S5LG 5DK2B 2QADD 1C16B 1TJXA 2W88A 4NZUH 4UTCA 5CZKA 4JZNA 4U7NA 4BK4A 4L4TA 2GG1A 5C08D 5F6HJ 1X5ZA 2MOVA 4Z18A 3P0YH 2WAQA 4QNPE 1GH7A 4KKAC 2XG5A 1DVFC 5TQ0L 2RGSA 2ZTBA 1NCAL 2GHYA 1T22B 1UM6L 1FFOB 4HIJB 4CADB 2VLME 2DWXA 4HWZA 1NSNH 4NAMA 3WNOA 2RNBA 2OMNA 1WB8A 3S4SG 4NDMB 4X8XA 3O6FC 4P5MA 3UERA 3G04B 4PY8I 4LOUD 4B5EA 5CGMA 3HPLC 4ZW3A 4Q9CA 1E40A 3SJCC 2NXZD 1Q8IA 3RTQB 2X9YA 1TAEA 5ETUA 3VD4A 2VQTA 4CAGA 4IRJC 3TS8A 3FO2A 5JHDB 2R1WA 3CVHB 3E8GA 4J6IA 4MVBD 4HKXB 1TJGH 1HH9A 2QFPA 2UY7B 3LNHA 2WNWA 1NANH 5D7JA 4J2QA 4BGDA 1N33O 3A24A 5KSVB 4KRMB 5IBTH 5FYJU 2CLRA 3EGSA 2ZUWA 4JRLA 2ZDIA 3VFUA 4F7KA 4S1SL 5CCHE 3R18A 1K3EA 3JAKB 1CR9L 2HRHA 4OFYD 4F9PA 5KTEL 2PETA 2DTML 4M7LH 5C70A 2ZP0T 4Q89A 4LSRL 4WI4A 4CH4A 4ZFZA 1QNIA 1G7QB 1VIWA 4LRIA 3UGEA 1K4DC 3TEXA 2X1XR 3NN8A 1Z9SB 2X70B 2AQNA 1JHKL 4PRPD 3BSZA 5AOKA 4LIQL 3VQ1C 4AL8C 4LOFA 2FECI 1PKXA 1TQCB 2DIAA 1SLXA 1M7IA 3CFKB 2ZCKH 3F7VB 4WV1A 1IBZA 5HDBB 3QF7A 3SE4A 5E2TH 4HHAA 1KIRA 2UXVA 4KDTA 3VFMB 3M7FB 1YMHB 4KKLD 4BDVB 2O93L 4RESB 5DYOB 4O2AA 1F4HA 2PW1B 3LNEA 3IAGC 1KCLA 3DHUA 3QTCA 2CH8A 3O6MH 2X0LA 2IDTA 4LBAA 2APBA 2ATAA 3RT3C 1IXMA 3GSOB 2Y4UA 2YAPA 5C08B 1E1QG 1S7RA 1SY6A 4U6VH 5AKTA 1CTMA 1QTYT 3RG1C 5IG7A 3D52A 4WO0A 5DJ8A 1JXGA 4X1KA 3O0RH 4N6RB 4X7TB 5C0BD 4FIPC 4PCTA 4POZC 2YEQA 2BNQB 1THCA 1J5OH 1JXDA 1YNLH 4I1RA 1Q43A 1WCQA 3ARRA 5C93A 4H26A 4G43B 1W0KG 2XZAL 5GTHZ 4BIZA 32C2A 1KIUB 3ULAB 3CXFA 5DURB 2DQDL 3IMRA 1KXQA 1N3NA 2AXWA 5E51A 3D4YA 3GLAA 3HAEG 4ZT1A 3TVMA 1MZYA 1UCBL 3I6LE 4FL4B 1BM7A 3IF1A 3X12B 1GXEA 4Y4KC 1ZLWH 1J10A 1XR9B 3NRFA 3PGDA 5CA3A 1AD0A 1K9TA 4U1MA 2WMPA 1WK0A 2CIKB 3TIDA 4GKZB 5CMAA 1S7TA 4BQ8A 2LVEA 3T09A 5JIPA 3RILA 3X13A 3T1WA 2PCFB 3RVVC 3UIZA 1ND0B 5LGTA 3PHQA 3QQ9C 3TJEH 1G4YB 2HLFC 4XB7A 5KJRH 2KZBA 2OCFD 4M93C 3BIBX 1KCUL 1CYWA 5EZLA 2XRAH 5E5LA 1PG7L 2MNWA 1TZIB 4TQPA 2ADJA 2AXTZ 1Z3GH 3ZW3A 3ISRA 1CK0H 4FNSA 1KBPA 4JHVA 4PRNA 2IGFH 2NY1D 4HCRH 2UU9B 4LASH 2JELL 3JSLA 1I4FA 1R6VA 5ENWB 3EBGA 1U58A 4G3YH 1M71A 4YAQB 1XB3A 3BKCH 2ENQA 1BYNA 4X66O 3DMMA 3VFGH 4OUUB 2MTPA 2YAHA 4FKHA 1QP1A 4GS7C 4OR1A 2YPLD 3H9SE 1JGVH 3MRIA 4JFTA 3T8VA 2WC7A 5I1CH 5FHBH 2VDML 2XKSA 4XAKE 3BMWA 2B16A 5BQ7B 1NCWH 2CJ3A 1MAMH 4LNRB 2EUVA 4LFCB 4MMXB 5IM7B 4H0IA 4F92B 4QEGA 3W0WA 4D7SA 4NKIL 4RMTA 4Z7IA 5C0GA 2FR4A 1TKWA 4NQVB 1IBFA 3VI3F 5KVMC 4OZIB 3C3SA 3QP3A 1AQDA 1LM8V 2ZP9A 4XXWC 2H5UA 3ZUNC 4DCQA 3F04A 4FI7A 4FQLH 5E6IC 5BRZD 1QYGH 3VMOA 4R7DB 4LLMA 3U9UA 3WDIA 1WPXA 1NKDA 1FXHA 5TDPA 5HYFA 4JFFA 3E22A 1H15B 4PLJD 4CU8A 4YZWA 1UXSA 1OCRB 4P99A 3FCTB 4HKJB 3RPIB 2DD8L 3NIDF 5C0BB 1Z32X 5F9DC 1BZDA 2D03H 2AEIT 3K81A 3PJSB 1NINA 1CXLA 3ZHLA 3JUZA 4LLYB 3GM8A 1AILA 4Q4IA 1FFXB 3OR7B 4DVBB 5I0DA 1CG9A 2AXFA 4OM0L 4JL1A 1V05A 3NJGA 5H2BA 4RRPM 4YEFA 2HJKA 4MVRA 3BN3B 1TVKB 1VHPA 4ODBD 1OANA 1MNGA 2NY5H 1ONQB 2AQ1A 1L9NA 3VTTA 4JI5O 1MZEA 4M3JA 1AZNA 1RHHA 2RALA 3BD4A 4X89A 1F3DJ 4AZ8B 5ANMB 2DWDA 4PSPA 2B5IC 4B3RO 1G9NC 1RP8A 3UAEA 4XDKA 2NY7L 3ZE2E 5G4OA 4PRBA 1IKOP 1FN4B 5A2IH 2OSYA 3QCTL 5DJAB 1LO2H 5GSRB 4FULA 1EAPB 1NPJA 3HR5A 2DDQL 2IGTA 1S5LZ 3IJSB 2N0KA 2C1OA 4J5VA 1PX4A 1MY7A 1EHAA 1R3IH 1JVMA 1GC1L 4MSWB 2XZQH 1KNOB 3DA0A 3C8KA 4QRPD 1G7IA 43C9A 4DR2B 2X0UA 1LO3L 3U46B 2NY1B 1QSEA 1MWAB 3ES6A 3OKEA 4WNQB 4NS0A 2VRZA 4PJCA 5HDBF 2R4SL 3D9AH 4FOMA 4LESA 4ELKA 4UF7C 1YYCA 4K94L 3PL6B 4HETA 4EN3A 3QUXC 2ZJSH 4ZJ9A 1CFVH 1ZHLB 3FO0L 3QORA 1I5YA 2Z93B 3LEYL 2EE9A 4DW0A 2MJWA 2AV7B 5DRXB 4XCNA 4EMZA 3MA9L 1NCDL 4MD4A 1J87A 2WQUA 5JH7B 1VFMA 4WIQA 2AJZB 2A7BA 1W0JG 3IFPA 4MJJA 4OFVA 4ORZC 3RVWC 2R1XB 3ZHVA 1Y74B 2K6ZA 3BT0A 4HUMB 4KROD 2A9NL 1KBVA 2D31B 2CHXA 4JZ2A 4LL4A 1GPOH 2CLZB 2A1WH 3A22A 3UIYA 1SDAB 2V7NA 3G5YB 5LBVA 4BFKA 1MQKH 2LAAA 1WFOA 1A6AB 1R3HB 5MP6L 3E2EA 4GIAA 3C09C 4KKCD 4BH7B 4NCC2 5J12B 1A3QA 3VGDA 4XCFL 1CGWA 4QRTA 5D93B 1LNUA 4MAUL 1G0DA 1ROWA 4FYQA 2EEDA 4HJUA 2VIRB 3ZO9A 4Q52A 4XNUH 4F20A 5KBDA 3OR6C 1QU7A 4BIUA 1JF1B 1G5AA 3BAIA 2E4FA 3MDSA 2BH0A 1M2OA 2B77A 2CKBL 4XO9A 1RSOA 2BVPA 4BM7A 1GSKA 3VGEA 3ECBA 4DZ8B 2QWQB 3ZIMA 2CK0L 4XMPL 2ORBH 5HP5A 4PWGA 2HKHL 3MRQB 3QUYC 2X6VA 2P47B 1HOEA 2IJIA 4GG6A 4OGXH 3IKCA 4HPYH 4QKXB 3GPSA 4TULL 1RZPA 3CFNA 2V2XB 1WCBB 1AO7D 2XFXA 3OAUH 2XN2A 4IIQC 4BZ1H 4Z7VE 4UWQB 3QJHA 2B7DT 4PJ5A 1P5VB 1QFUH 3PREA 3T0ED 1EWHA 4UTAH 1PKQE 1T1WB 3IM1A 4DPCX 2VRKA 3HMWH 4WW2C 4R0LA 1O7VA 5FM5M 2IQ9L 1AGDA 3BP4A 4JRXA 3UYPB 4QRPB 2D7TH 1CJYA 1NEUA 4P3DB 4LU5L 5C0AE 1KTBA 4OCXL 4AENA 3MUUA 3TPUA 1YECL 1GH6A 1YEEH 4XC1H 4NN7C 5KSUA 3ESMA 4JM4H 3WFHB 2OAAA 3G67A 2ICEA 5FA3B 1WDAA 3RB5A 2XWZA 1AIFB 3APQA 5DQDH 4XNQA 2Z9TA 3RTLA 1FNSH 4FGMA 4FA7B 1KLFA 2M2DA 2VL4A 2V7QG 3GUFA 1BQHG 1NCOA 4LSQH 2CA3A 2YA0A 2PCPA 3R8QA 3MAQA 4OZHF 4XNYL 3LXUX 4C4KO 1BX2B 3UYRH 3Q8AA 4KROB 3V4PH 1D5BA 2EDHA 4NLAA 1IRAY 2CE6A 4NN6C 4HNAB 2WXQA 5ITBL 4ICXA 1XMQO 3N40P 5C07B 2EXWD 1IBLB 1J0HA 4QAMB 5IHHA 2P44B 4FVMA 4TUUA 2VDOL 1S7WA 3OPZH 1NMAH 2I69A 3GMNA 4JFED 5CU5A 2DF3A 4CVWA 2F61A 4HUWA 3LS4H 2BOCC 4J2XA 3SO3B 3WFVA 1UD6A 3BHBA 3ESPA 3FFOA 3LNGA 4UB6Z 4CC1A 1XL6A 3FONA 2NW3B 1XGQA 2N1KA 3QT2A 4KXDA 4L8DA 4PRDA 4BFNA 1W0VA 1BAWA 1SEBA 3RX9A 4LCWA 3UP6A 1WD9A 2ZIMA 1A6UL 1Q0XL 4DKEH 1MF2L 3C6LD 3JATB 4GNKB 1WD8A 5IHWA 2ADIB 3FB8A 4PV9B 3KBHE 4JDTH 5ANHA 4ALAH 5FFLA 3CZNA 3RDTC 2OL3A 3DUUA 4TQIA 5KBMA 2PN5A 3N85H 5I1JL 2EDWA 4PY8J 4D8OA 1AO7B 3R06A 1EN5A 4CN6A 2FL5B 3EOBA 1KJ2B 3IDXH 3MGOA 2Q6WA 4YDVA 1JZHA 2HLAA 1L9OA 4KX7A 3T0EB 4QJ5B 5J9PA 4O2BB 5GRVL 4MS8D 4BFIB 4JG1H 1IAKA 3ULVE 4PREA 5LMNO 2N0MA 2W91A 5CHNB 2JB5L 4AE1A 3KH3A 3CLEL 3GB7B 5JHDE 5JQGB 1RMFL 3GSVB 3AWGA 4QOKD 2VT0A 4BWAA 5DC4B 4NZ8A 4JDEA 3QI9D 1JWSA 1W72B 3SO5A 3KGSA 4AH2A 2GEQA 3ABKC 3SQOH 3DXAE 1VQNV 3MCYA 3OLEA 4K7FB 4YHZH 2GIMA 5DFAA 2K78A 1NH2D 2WPGA 3WU1A 1A6ZB 1IZ3A 4DXWA 2WKOA 4PJEA 5C0CD 5B5EZ 1TO4A 2V7HA 2P4AB 2VERA 3ML9A 4X6FB 3EDJA 3WBDA 4AQZA 1CXKA 3QO0A 4GBXA 3Q9QA 1XNRO 2D9QB 4F15B 3MO1B 4GXVH 2DB8A 1KT2B 3LRLA 5FIEA 5ISZD 4H20H 5DEGB 4NZTL 3VXRA 3PGCB 3OX8A 4EOWL 4J39A 4OJFH 1CFNB 4F7EA 2W0FC 3JBG7 2X41A 4UT9H 2MFNA 4ONFH 3EYOA 3SKOA 3R0NA 4A39A 1A6TA 2DQUH 2W92A 3CZFA 3APCA 3QNXA 4JRYB 5B1BC 2WY3B 4GW1B 4L8BA 4J42A 2WQRA 2Y23A 2QELA 3U4KA 3MRNB 3U7WL 3LN9A 2X4SA 4MCMA 3QEGH 5FUOL 3H1LH 5B4MD 5D5ME 4J10A 2J73A 2VM9A 2IGLA 4EI6B 2YRLA 3D3VD 4DUVA 4Q14A 2XQYK 3T1FA 1SOSA 3UAAA 5CP7A 4J8RA 5MERB 3TO2A 3AREC 2RR3A 3LKRB 5CLYA 3DDFA 4XBGB 3DSFH 4YXLH 2QQNH 3S3PA 1A4BA 1LD9B 3HNTL 4P8QA 3LDBC 1XCTB 2P5WE 2JJUA 4FNTA 1A1NA 3T3MB 3M07A 4KHTH 3VFWB 5I24A 2O1AA 2DQ6A 4O2EB 1SHSA 5B3NA 2ZCLL 4W9EC 5DEZA 3LKQA 1YY8B 4R4FL 4DR1O 1ZT7B 4TNWF 4ELMA 3I56V 4J27A 5EZIL 4F7CA 4G2AA 2IV8A 2J3SA 1SQQH 1FFTB 1CYXA 1JR9A 1Q0YL 4TOIA 2ZZUT 3V7AE 4ZX3A 2BE3A 2JEXA 3V52H 2GIXA 2NNAA 5I23A 4QE7A 4QAWA 1GR7A 2XKUA 5KUKA 3MV7D 2DYSC 1NIEA 5D4JA 4BQ6A 1OE1A 4M6NH 3FT2A 3TFBA 1FH5L 3BQVA 1R5VB 3RFZA 3G6JA 1UG9A 2EDKA 5FGRA 2R0ZL 4UU9B 1AGBB 5C0CB 4N68A 1PY4A 4HEME 1OTUC 3RYCB 1RZ7L 2P49B 3KPPA 1HR0B 3G6DL 2DH3A 2RB8A 3FJTA 4UOW1 3TZVB 2FBJH 4GRMB 5GZNC 3RNKB 2YQBA 5ISZB 4YDMA 5DTFA 1T2QL 3WIAA 4PRID 4WEBL 2Z8SA 4HAMA 4HEPA 5GRYA 3ZE1B 3QCUL 3GTNA 1N18A 5L2KD 2WLJA 1MCPL 3B2UD 5KVFE 3G5ZB 3WJLC 2JCCE 5IB5A 1D2OA 3ENEA 3HUJE 2NY2D 4PJBB 3SHSA 1CE6B 2WSSG 2F74A 3JZ7A 1J7VR 3HFMH 4W9FC 2IG2H 4MZ3A 4ZO7A 2X10A 2X4UB 5LDSA 2ATKA 1UJWB 2OZ4L 4OZIE 2GUOA 3U36B 2HT3C 2WXLA 3S5LA 3DRTB 3SY0A 3N2GA 5E8PB 3D3VB 1ROPA 2BTQB 2E27H 4MX7B 3ETBF 4P3CL 4JN2B 1OTSC 5K93A 5DJZA 3CMOH 5DSCB 4MA3A 3ARSA 5A16A 3WMSA 3CFEB 1TU2B 4R6ZA 3ARGA 4FS0A 2IBZY 4X2UA 2W9EH 4YDKH 1AJ7H 2HRLA 4JBSA 4OVUA 3O2WL 2YXVA 2OMUB 3S4SA 3SDAA 4QF1A 4HXBL 4KP4A 3D36A 4N5ED 2VQ1A 5IB1A 2FGWH 5ITFB 4HOXA 4YLQT 2DQCH 4EE2A 2AZAA 5I18L 3H2QA 4X64B 5K9JL 1UXLA 3O9WA 5J2UB 1QW9A 3IDJA 3NH7L 5EDXA 3RGVC 5INDB 3CFUA 3PUUA 1J0IA 5ANME 5KVEL 1T5WA 1WZAA 3MLPA 5D1QB 2D7NA 3GZPA 3BKYH 5I28A 3BGMB 1M7DB 5AYUL 4BSVB 2CKBA 5TPWH 1HP8A 1DEEB 2I27N 4JO2L 4NLHA 1GVIA 1OM3H 1O6SA 3MV7B 4RQEA 1ZT4A 1F4MA 1QLFB 1WAPA 2Z8VC 1AI1H 3D48R 4YC2C 3D8CA 4HLZH 2DLTA 1E7VA 1S3KL 3UADA 1JD7A 1BVKB 1VQ4V 4KNSA 3DIFB 4X88A 1YNKL 5IB4A 1ACYL 2LVCA 5KMGA 3QZBA 1NJ9A 3OXRA 5F0PB 5DFVC 3DX6B 4UM8A 4ENEC 5H35B 4JY4B 4P5TA 1ITCA 3AS1A 2VZSA 1WZ1L 3I3DA 4NOFA 2J6EL 3N5AA 2E0PA 3RRQA 4XVTH 4MAYC 2AS5M 5FCUL 5JHLL 5T3ZE 4Q20A 3EYQC 3BE1L 1P4BL 3WO4B 1HN1A 5HJ3A 5HY9A 5HPMA 3IMUA 4ZUUB 3BT2H 3C6SB 4CC6A 4GKLA 4NN5C 2GHZA 3MRBB 3D0LB 4Y16A 3F5WA 1DQLH 4Z7UA 5DJDB 1IAMA 2NY2B 4FQXB 3N42B 4O58L 2O57A 1P53A 2H26A 1JVKA 3ZYOA 2QGDA 2KT6A 4WWKC 4AYBA 1Z5LA 4HF5H 4N26A 1S9XA 2HG0A 2GJPA 2WZ6A 2XWDA 3LX9A 3MBEA 3BVOA 5FYJE 3SDDD 2XPYA 4JG5A 1UJ3C 2MQCA 1DE4B 1TTFA 3T3MF 4L1DA 5TFSH 3CSXA 4F9LC 2HX8A 3QIWB 4WI5A 4WF9V 2YD1A 4P2OC 3PWJB 4X1IB 4M1CD 2ZXDA 1KBWA 4F2MA 2WQAA 3LZFH 1U95B 1YZZA 1A7OL 1A6WH 4JI2B 3N27A 1KEGL 2IW5A 1QACA 5I82A 1HIML 3O8XD 1HZHL 5EC2A 4YQXL 5A2QN 2FD6H 4MQ7A 5DS2A 4P9HL 1LEIB 3QDGD 5H5NA 2VXSH 4ZSOE 3QC6X 1HSBB 2V37A 1YO4A 3SKMB 1FVDA 3LRSA 3TCTA 3ZHDA 1MFAH 4F58H 2PI4A 3H42L 1TVHB 5IWLC 4ILDA 3EOTL 2D2OA 1GM8A 4BWTA 4IYHA 1A7QH 1DL7H 1SXCA 4KI1A 3QS3A 3GRWL 2B08A 2IDFA 5G55A 3S2AA 2PWHA 1CGVA 3RX5A 1QNMA 2HEPA 4I50A 3WSQL 1TYJA 2R2BB 4OUOA 4BELD 2P1YA 2D0HA 4ODHH 2C3HA 3NYKA 2AQRA 2QGBA 5DWUL 2JLPA 3VXUA 4PJFA 3QWNA 2DQIL 4Z76B 1D6EA 6CGTA 2OP4L 4BIOA 5I8EA 1VQ5V 2UZIH 3ZE1F 4C47A 3UJIH 4LSPH 3ZRWA 4OZFH 4Y5XA 5MENE 2J88H 4WJG3 1P1ZA 3O4LA 5EN2A 1C9SA 1QBLH 4PJBF 3CBRA 2B0SH 1UXMA 4OIIL 1V7NH 3CPUA 3LMJH 4I0PC 4TRPL 4XWGH 5JDSB 4K2UH 3CWBH 1VPOH 3CYOA 1ZDSA 2D8KA 4NUGL 5F9OL 5FO8A 1MIEL 1IM9D 1Z9NA 5A2CA 2EIJB 1IBYA 1JHTB 3ZHQA 2GW5A 3THML 1JGLH 2FT8A 3ZIAG 1NAMB 1L0QA 1XNQO 3NPSC 3WTWA 1EBOA 5IMOB 4R97C 5DUJA 3CIQA 3FUJA 1Z1WA 3CN1A 3CDCA 5HYJE 5GGVL 4L1TA 3CEIA 5F1KC 4Q0XH 1WP8A 4G9DA 1ZS8B 1VEMA 4UAOB 4XXDB 2WWNA 4JN1L 5EBWA 2I85A 1IEBB 1SHMA 4BXSV 3AY2A 1WG3A 2CJTA 2AK1H 3H0TB 4YZFE 3WY3A 3PGFH 3U7AA 2HSIA 5EUOE 4A2HA 4X9YA 2YN5A 3E1ZA 4APQA 5FLVA 5FWQA 1VQ7V 2CTRA 1BECA 4Y19B 5GS2D 1S46A 3T6QC 4TUYA 5HHXH 1X9LA 3OAYH 3FHEA 3VD9A 1KIQA 1CXEA 4OFDA 1VSCA 2WM0A 1WGVA 4ZOCA 3P32A 1EO7A 4WFEA 1JTPA 2VMJA 3QDGB 2X7RB 2YKLH 3QEQB 4PJIB 4XE0A 3C08H 5CR1A 3BRFA 1QR1A 3CFDB 1W0YT 4KNUA 5EU7E 1M57B 3RL2B 1PL3A 2MRYA 3QG6A 1HI6B 2VLRA 2XTJC 1IKNC 4OZGE 5L4JA 1GMGA 3INUL 4AW4A 4G28B 1W59A 3ARXA 4OFPA 1NBCA 3VX1A 2Y0PA 3WIFB 4F27A 2G38A 4PY7A 2IF7A 4GG8B 3ZZLA 2BP8A 3CAFA 4FHBD 4JO3L 4D9QE 5A2KH 5EO9A 4AVJA 1A02N 4YFLI 1MUJA 3KYMB 1T21A 2Q3ZA 1U8NA 1U8OA 1I8MA 2L3BA 1VB9A 4N23A 3K2IA 1J5EB 3L3GA 1KQSU 5CINH 5BVJA 4E4EA 1MHCB 3QIUD 3UCSC 1Z9MA 3UABA 1MHEA 4WFFD 2CK2A 3Q6GH 4JI3B 4A7QA 1G7JB 3N42F 4ZZFA 4I55A 4DUZB 1F4YH 4ODTH 4MDJB 5TE7L 5C2UB 1D6VH 4P46D 4X6DB 5E8DH 5E2VH 1J8HA 1J8RA 1EJOL 3WKML 4OLZH 5KHIA 3EFOA 3PY9A 5HYQB 4J6RH 3UXFA 1DR9A 4H8PA 1EHKB 4Y5YC 5KYUA 4WI3A 3LIZL 3ABLB 1FF5A 1FFRA 3NJFA 3OG6B 4KTDL 1KD1W 5ADOL 3JAWA 4GSXA 5FDWB 2DICA 2J1ZA 5LDUA 1LGVA 2YC0A 4L3EE 4Y4HA 3ULUH 4GW4B 4I5BA 3Q1SH 3NZHL 1U3HD 4YSOA 3VFNB 3ZRFC 2NMSA 5CEZL 2GCYB 4LOEA 5IBUG 2AHIA 5FC9A 3RWJA 2I5YL 2P80D 1L6PA 4U2ZA 4A2DA 3OKDB 4GRWB 2HB0A 1T4WA 1UEMA 4DKFH 4RISH 3T65B 1GZQA 2H8PA 4C83A 5EC1A 4RFOH 5TE4L 2VDNB 1XSKA 4FK5C 3SPJA 2YD5A 3D69A 5IESL 4ZAKC 2VXQL 3T2LA 3T6VA 5BZWB 3QXVA 4LQ1A 4PGJA 4FG6C 5I8OH 3VVVA 3ZDYE 1MH5B 3OC5A 1CDGA 4N2GA 1RVFH 3RQ3A 3QDMB 2XAGA 4KTYA 3OHXB 5EFIA 1D9KB 1SM3L 4L9LA 2OZ4A 4M7ZB 2ETWA 5E94B 2NT1A 2Y7OA 1F3JB 2RA1A 4Y4FA 5AZEL 3WN5A 2WINB 3DO3A 1HH6B 3F12B 2OJZH 1KY7A 5D1XD 5D2LF 5I6MA 2PWEA 3QQ3B 1P69B 1KYOF 1XIWD 1ZOXA 1FIGH 1NTZH 2YBRB 1XQ4A 3HE6B 4Y8AA 2EH7H 3BP5B 3ZU8A 2XWJA 1XCXA 2V2WB 1NIAA 4TQFA 3Q2NA 2BSSA 2GC7C 4UT7L 5BO0D 1ZHBB 3TWCH 3SGJA 1JXFA 4KI5C 4P4RB 5HJBA 4Z7QB 3JVGA 3RYHA 4TVPL 5HDWA 3MBXH 3AM8A 1RI8A 3FDWA 2HJFB 3CSGA 3R1GL 4Q6GA 1QTSA 4TUKL 3JVFC 3SBPA 2EXTA 3P77B 4AMWA 3SQRA 4NM8H 3D2UA 2Z0UA 4JKMA 3RP1A 1OCOC 4RFNC 4V1DB 3T6WA 3FSWA 1KC5L 2B3RA 1WN7A 1H3WM 1YDXA 2EH8H 1BQHA 5GSVA 4KZEL 1CVRA 3KPRB 4AE0A 7FABL 2IAND 4HOZA 2Y1ZA 2WKLA 4MJIA 4XX1E 4W9ZA 2EDBA 4X64O 3AWFA 1QLEH 2W60A 3BUTA 4JFSA 2P22C 4LSVH 3RWIA 3G5XB 4M1GL 2N04A 1NVPD 2J6EA 5IJVA 1SETA 5EBMC 2TRHA 5JHLA 1BF2A 5IKCB 1KACB 3HZ3A 4D8PB 1Q8MA 2HH0H 4L9DA 4LEOB 4PJIF 3W56A 4NSKB 4XX5A 1INDH 1EMTL 3U6XA 1BBDL 4RAHA 1LHZA 5F7YC 4FZ1A 4LF8B 4R96A 5DLML 5KBNC 1BQLL 3LNIA 4NX0A 3MRCA 4OI8A 4W9KC 3TO4B 5ADPH 2VXTH 1DZ0A 1U93B 2EUXA 1CQKA 4DSYA 1JMKC 4NZJA 2UXCO 1CFSA 2R27A 1W8OA 4YJ2A 4PJHE 4WHYG 4IT5A 3EJUA 2EJ1A 1OZ0A 5JJEB 2OT5A 4YL9A 3TK1A 1MCHA 1NFIA 5AVSB 5HD8D 1CDYA 3OZLA 4FFWD 4MKTA 2ESVE 3QDJD 3N1PC 1NL0H 1BLNA 1H8SA 1A9BA 4L4VA 3MRFB 1PCSA 4X0KB 1WUZA 4B0MM 3S7GA 1OAXH 2NZIA 1K9MW 3PHOB 2ZUXA 1BJ8A 3DPBB 5FF6A 3F7PC 5F7NC 4MJ2A 4KHPO 1XT5A 4H25B 4DFHA 1E4XL 2F54D 4K15A 4A6YH 4G8EA 1J1OH 1T3FA 2HUEA 5D9SA 1VF6A 4IOFC 4PB0H 3T8MA 4OGQC 4RDQF 3WXVH 5LP6B 3N1MC 2NYKA 4WO4C 2JV6A 5BRQA 1NDGB 3QR0A 4PGZA 4HJSA 1N7MH 1HHGB 1SZTA 3P4MA 1DJGA 4WTWA 1X5FA 3MLYH 4ZG1A 1AZZC 4JG9A 2YDEA 2NSQA 1G0YR 1I94B 3GRWA 3GEFA 1FJGO 3HKBB 2VWEE 3OUSA 3GINA 2XZCL 4IGBA 2XWEA 1BFOB 4LCYB 4G8GD 4JX0A 1AZUA 2Z3FA 4HXAL 1SJVA 3UBXI 4HUUB 4S10A 3KCYA 3BUDA 3RB7A 3K4AA 4LH6A 1S3JA 1HYSD 4K4KA 4ES8A 4JFHD 1GGBH 4GXFA 4A04A 3VXTB 3CCRV 2Y69B 2WA3A 1G7PB 3ILQD 3NFPB 3QHFL 5A40E 4MWFA 4KU1A 1KPVB 2Q3AA 1IC1A 2B1HH 4OAWB 4P4KD 4BUQA 3D51A 1A2YB 5JHMA 2J4WH 4MCZA 5AB9A 1NMCC 2WNKA 4YBLB 4ZX5A 4ASUG 3HR6A 5ICZA 5BS0E 5D1ZC 1E4HA 4L5FE 5DHVA 3RVZA 2WXKA 1D3CA 2QVFB 3TN0A 4NENB 1T03L 3JASA 2WYTA 4LF9O 1JI2A 2V4LA 3HLAB 3RI5F 4MJ6B 4PA3A 2QL1A 2VSCA 2QLVB 4LRNH 1EGJH 2AXGB 4RH4A 4U7MA 3RGHA 4CILA 3P2BA 5DT1L 4NQDB 1B2WL 1M7XA 1QBML 4TL5A 1XR8A 1A7NL 1TPXB 3WB1A 1UKSA 5DMKB 3QDJB 2J8UA 2Q6AA 2A0LD 3D39E 3C5SA 3MLVH 1OAKH 1R34A 5B1JC 4DPAX 4MVMA 1AGFA 3T0VA 1XH3B 4NT6B 3N1FC 4KX9A 4XMUA 4MTGA 1JD9A 4ZUTA 1CI5A 1IC4H 1P0SE 1SN0A 1TEFA 4KAQH 4TV8A 4AMKL 1IGMH 4JE4B 1AS6A 5I1DB 3IJ7A 4UB0L 3BDXA 2EEXA 3DJSA 1L0XA 1DANT 3L4UA 5ALCL 3WLWC 3ZTEA 1OGAA 2B4CC 1XDTT 1WA2X 4TSFG 3HIZA 3UCRA 3K59A 1EHLH 1MLBB 2YD7A 3H3BC 5E1GA 2VQEO 5J1SC 2XI9A 3MRGB 1I7FA 1BOGA 4BHUI 3T4DA 3MYZA 3LKOA 2UUAB 4LF7B 4WUUD 1NOAA 3FKSG 1T6VN 3AFLA 3H54A 4AILC 2XWBA 1OAUL 4G11A 4JLRB 4Q97A 5BZDA 5J1AB 3O41B 2XDHA 5GW7A 3KYKL 1HE7A 3SCMC 1XBDA 2OMZA 4G8GB 1Z5YD 4HIQA 3ABGA 5C8JB 1D5IL 1X59A 1WZMA 4JDVA 3VACA 4F37F 1TZHB 1KENL 3X11A 3D07A 3U2IA 1HNZO 1C5DB 1J9TA 2BJML 1JZ8A 4W6XB 5GGRY 4BE5A 3FUFA 4MT8A 5A9GA 4OH2A 4AJVA 1I7UB 4GAYA 4A67A 1DQQB 3JYBA 1S4IA 4DR4B 2OR9L 3ECWA 4Z8FL 3NGBC 4DGYL 2CGRH 2N1TE 4JHBA 2RH0A 1P7HL 2AJVL 3FU3A 4PGBB 5ESAB 1BVOA 1UOVA 1NUGA 2ED9A 3GJFH 1ZHNB 2UXTA 3LHPH 4LLQA 3L75H 4LAQL 2VJXA 4ZQTA 1AQKH 1GZPA 2WXPA 3HRZC 1ZSDA 3LIZA 4AQAA 2VDQB 1VFAA 3ATDA 2EC9U 1YIJV 2X1QA 1RJLB 1T0OA 5FYLH 4YJ3B 3MOAH 4F33A 1LDPL 3O3AA 1AAJA 1MVUB 1L9TA 2J43A 5LA6B 4XBPA 2FSEB 2G4EA 3HNSH 3QFJD 3WENA 4DV6O 4MVQA 2CUIA 2L8AA 2QV4A 3AAZB 4JR9H 4KK5C 4JPKL 3BPOB 2P7TC 2XETA 3V5HB 2WXMA 2P8PA 3S9DB 4U1HB 2WAMA 4KQ3L 5B3SB 5CZVL 5B39B 3MX0B 4DO5A 2WO2B 4L8CB 5DF0A 4U1SA 2VXQA 4UYQA 1BW8A 2JK5C 1SHWA 4MNQD 2MPAH 2GSGB 4NAQA 4F91B 3CRCA 1AFVH 1UA6L 3LN5A 4UIMA 5T1LD 4QO1A 3VWJD 3DJRA 5ILTL 1JPST 5E1QA 4WK0B 3MLXL 3WO3B 2YPKB 1DDHA 3FN9A 4DK5A 4PAZA 3RVYA 3NA9L 4I18C 4DV3O 1LVEA 5E00B 3M7MX 4PJ9C 2I9TB 3UTTA 3RVUD 5F21B 2Y9RT 4YPGA 5F96L 3VD3A 1LP9E 3ETDA 2FWOA 3ZKMD 4TUJB 4WHTB 4JM2A 5C97A 4CW1B 1G7MA 3BVDB 3JALA 4D9LL 5GGSY 4PMFA 4ACPA 2ZG3A 1T89A 1X7TA 1JN6A 2GK0A 3PNWA 2R8SH 1G6UA 5KS9A 5IHBA 5LMUO 4AEIH 3BEVA 3E89A 1BMFG 2JJ2G 3NZSA 3WFEH 5KSAA 4LC1A 1N5AB 1KOAA 1HQRA 4HWBL 1FO0B 2Y22A 3MRDB 4CSTA 3UEQA 4G59C 4PJGE 3BAAA 5EF3A 3K79A 1A7PH 2VDLL 4H8UA 3VFTB 3DVGA 1I1AC 3QRGL 3HS0C 3UZQB 1U92A 2ZOUA 1VZGA 2RIKA 4GSRA 1KCSL 1GKOA 3AY4C 4G8IB 5DVOA 4A7UA 2K7QA 2W9LA 4NNYA 4WI0A 4ZS6C 1WBZB 1HNFA 5JIDA 2X89D 4GRWE 1GRJA 5HI4C 2Q7HA 1SQPH 3OJ2C 5IQ7L 4H5SB 1FL6A 2UXDB 2X4TA 5KA6A 2J6WA 2PCYA 3QXAB 4P5SA 5C0FB 1OF0A 1MWOA 1IJNA 4W81A 3VRLE 3V7AG 4LPCA 1E6OH 2WXIA 3QFJB 4HK3J 4N0UA 2IDQA 3SJVD 3L5JA 5LBSL 2X88A 1ZL8A 4W9DC 5D7SL 4NO2A 4MLIA 1DCEA 2BCMA 5TF0A 5BXFB 3TT1H 5LXTB 4TTDC 1PZBA 3DTXA 3IXTB 4X6EB 5GGRB 4B7IA 2BDNL 4X4ZA 4MNQB 1BQRA 1D5ZA 3R7RA 5T1LB 4H1LH 4X9BA 5FYLD 3O65A 4UQCA 3UTQB 2LGWA 1ZANH 4OX9O 5LQBL 3AG3B 4U3JB 2NX5B 5GQBA 4NC1E 2H32B 1PJ9A 1JCVA 1FLTX 1Y66A 2OIGA 1AY1L 1JPTH 3CDGB 3F7YB 2XQBH 3IDYB 3KCPB 4WFGA 1F4XL 3BAWA