3H9VA

Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 3.1 angstroms
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
330
structure length
329
Chain Sequence
GTLNRFTQALVIAYVIGYVFVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P2X purinoceptor
publication title Crystal structure of the ATP-gated P2X(4) ion channel in the closed state.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
total genus 68
structure length 329
sequence length 330
ec nomenclature
pdb deposition date 2009-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 3h9vA01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 3h9vA02
3I5DA 3H9VA 4DW0A 4DW1A
chains in the Genus database with same CATH superfamily
3ASNB 5EZYA 1Q7YW 2YIBD 4YY3B 1NZ6A 1VEWA 1HNWB 1XHZA 3ASOB 3L71H 2IJIA 3L70H 4DK0A 1WAZA 3BVOA 2UUCB 1HR0O 3SPIA 4J9ZB 4H13B 3ABUA 4Z1VA 1S5HC 5EC1C 1QVGU 2JS5A 3CD6V 3CCLV 3E89A 4P30A 1GRJA 3QF7A 3MAQA 4QIWF 4YY3O 4ZI7A 2ZE6A 3S3XA 2ZM6O 2EIMB 1FJGB 1HNWO 3CMEV 4F6RA 3D36A 2JJ1G 2UUCO 1URFA 4UCSA 3RYCA 2PTMA 1NU1H 1QVFU 3IFXA 4X65B 1YTFB 4JTAB 4PV1B 5E79Z 3ICXA 1EN5A 5E1AC 4UUJC 3H1HH 4H0LB 1WA8B 4J7ZA 2DMXA 5H6RA 2BSKB 1FJGO 2VWJA 4I5SA 1IVSA 1XQ8A 2DN9A 3KCYA 2HLDG 3G71V 3C90A 2CGOA 4X9QA 5GTHZ 4MVUA 2FTKA 2IM9A 5BR8B 4DV3B 1PNMA 2M6YA 2E3CA 2RDCA 4MVOA 4R50A 4ZKIA 4I0XB 1DF4A 4AI8A 3ZN0A 4X65O 3ZHUA 1EM1A 5C8YA 3H1IH 1H38A 2OWOA 4MSWC 1NTZH 1Q43A 1G6UA 4N23A 4C7UA 2Y4UA 3ZHVA 1AROP 4TUYA 4EEQA 3O9OA 1PM9A 2WPDG 4P2ZA 5J2TA 1Q5OA 4X20A 1JA8A 1VF7A 3SYOA 1BCCH 4CH5A 4LWSB 4O4JB 5A2QN 3M99B 3FB7C 5J9PC 1K4DC 3HKEB 5BR8O 5H2FZ 1K5QA 1TUEB 5DM6V 4D7TA 4E2LA 4P9PA 2LW7A 5A9GA 3ZHRA 5JCOC 1LR1A 4J42A 1YEWA 5KMGB 1FPOA 2WWWA 1SZTA 2DW4A 1OJHA 2OCCB 1OCCB 1EBOA 3ZCCA 4MW8A 4HNAB 2EINC 4QPJA 3LDDA 3H1JH 3FAVA 1GH6A 1Y76A 2RN9A 3JD3A 3B8MA 1PV0A 3GVMA 5KX5B 2DYSB 1NI8A 4WBNA 1ZTEA 2WLIB 1M90W 4W4KA 1MSDA 1SRYA 1W0KG 2X6CA 1G8MA 5CN0A 5B1BB 2E5LB 3FX7A 5F2VO 1GKFA 1VQLV 2W0XA 5LHGA 5JVDA 4GX1A 2D2CB 4X1KA 2XAJA 1U97A 3G4SV 1SQGA 2QTOA 3OMNB 1H2LA 5JH7B 3E8GA 2HP8A 2QA4V 4YJ3A 5CA1B 1FAFA 2ZCEA 1N0JA 1KKCA 1NH2D 4FLTA 1OZ0A 2NR5A 4MTOA 1A32A 5IJ0A 1D2DA 4I9WA 4JTCB 1FFTB 3I55V 1AJNA 1WPXA 5IYDO 5EYPA 1S72V 2MK3A 4FM2A 3ZEDA 1KBHA 1NKDA 3OM3B 4F6EA 5KA6A 2E5LO 1P49A 1VF5B 3ML0A 1OHHG 2V4DA 1BT8A 4LF7B 3HKDA 1YF2A 2DE0X 2W6IG 1P4RA 3X2QC 2PYLA 3H01A 4GUNA 5IJ9B 2Q4PA 4IT5A 1N33B 1SQVH 2GSMB 2QJ1A 4LNUA 3OAAG 5KUMA 2GUZA 1E1RG 2Y69B 4UVCA 3BA8A 5CBFA 4I50B 2NLJC 3GWOA 4F4LA 4FLWA 2UXBO 2ZD9A 4TV9A 4K3AA 5H9CA 1JFFB 2XAFA 2BOCC 2Y0PA 4YIPA 4I4TB 4NVPA 5CA0B 4GT1A 4TV8B 3U10A 3T1HB 4LF7O 1VQNV 3HKCA 2UXDB 2IH3C 2DQ0A 1R6NA 4MTXA 1Q8IA 4NTYA 5ITZB 1CEZA 2XOKG 2Q9LA 3ABMC 1PPJH 2P06A 4PA9A 1N33O 4AILC 4DR6O 4JTDB 2H3OA 1PP9H 3RWRD 3E86A 2ZR3A 1L8DA 3AG4B 1KD1W 1WP7A 2YICA 1GN6A 1V54B 1IDSA 2F23A 3SPJA 5FNVA 3ABKB 1BMFG 2ZDIA 4X66B 5H6QA 3E22A 5JWPA 3ZBHA 5GONA 2YSUB 3STLC 4PDMA 3T1HO 2F1MA 5DEDA 1M57B 2UXDO 1P7BA 5C8YB 1PKXA 5B3SB 2O57A 2QTSA 3K9AA 1M56B 1P7GA 4PI2A 1MSWD 2CUGA 1BQZA 4CZZA 2EJRA 1KQSU 1WNSA 1QLEB 1SC5B 4RUEA 5B1AB 1VQPV 4FJCC 2CAZC 1M57C 1GTOA 1GAXA 3ZMVA 2A7WA 4X66O 2CK3G 3B2EE 3OMAB 3OTFA 3AG2B 2V1DA 5KLVH 2WLJA 3QO5A 4DV4B 3M7MX 1YJ9V 1VP7A 3QVNA 2GHYA 1G1XB 4KHPB 5L3BA 3RYHA 2CTQA 2XHBA 5IY5C 5JJJB 1K73W 1EZVH 5CB4B 2H8PC 3STZC 3UM7A 3AG3B 1F7YA 4CC5A 1SESA 2GTAA 2EIJB 2NN4A 3GWKC 4CS3A 1UPGA 1KU9A 3EHBB 3OR6C 1K5SA 1OCRB 4CS4A 5B5EZ 2Q0AA 4L87A 5LHHA 2UUBB 3SGIA 3JAKB 4JGSA 1BGYH 2GTSA 4DV4O 4DR5B 1V55B 5LGTA 3FYEB 4L8JA 1FYJA 4JYCA 3OEEG 1QLNA 1J95A 1R3JC 1TA8A 4KHPO 2JVDA 4X1IA 2QKAA 2P4KA 3EXAA 3CB2A 2CTPA 3UKMA 1OCZC 4YJ3B 2CH7B 1BZKA 2Q68A 4OGQB 3RN4A 1AI4A 2BCCH 5IJ0B 4XDJA 4I0XA 3P30A 1BHAA 4O2BB 4LF5B 2UUBO 3FFQA 2YXLA 4DR5O 4MS2A 2AXTZ 4JI7B 2F95B 4GKKB 1HNZB 5JCOA 1BL8A 4CS2A 1M1KW 4PA4A 5DN6G 5TISZ 5LA6B 4PDVA 1LUWA 1B3QA 3OW2U 4LWSA 4O4JA 4PA7A 1Z5VA 1GN4A 4MW3A 4AQYB 2Z5UA 2N74A 3MDSA 3HKEA 4U3FH 2PZSA 4TV9B 5LGUA 2LFSA 2P22C 1Q90D 3CPWU 3WU2Z 4LF5O 5KMGA 3JD2A 4LH6A 2WLLB 2JJ2G 3ABTA 4HNAA 5FLXN 4JI7O 4GKKO 1HNZO 2JRIA 1I5XA 1FKAO 2QSAA 1DTOA 4HZ3A 3DC6A 4UV8A 2VQEB 5KX5A 1N0NA 4FZ0A 4MTFA 2WLIA 4DR7B 4QNHB 2IJKA 4AQYO 4PDRA 4FIPC 2ZXWC 2IW5A 4DW1A 3WB1A 4MVMA 4KFMA 2CTRA 5B1OA 2QDOA 2FKXA 1H8EG 1NR1A 2OTLV 3CRCA 5GONB 1H8HG 3AG1C 1M4UA 3F5WC 3E35A 5J2UB 4LF8B 2DWDC 4X1YA 4CH4A 3NXSA 5JH7A 1M5IA 3M8AA 4IHJB 3SJBC 3CWBH 4RQEA 4UCRA 2ARHA 1YITV 5CA1A 3BA9A 2Q0OC 2VQEO 3CRMA 1Q6IA 1H2MA 3CXHF 3LDCA 1DK1A 4A5UB 1AI5A 1MOFA 5L3GA 1I94B 1PL0A 2HEPA 5K1XA 1VQKV 3OFNG 4ZOLB 3CC4V 4DV7B 1GM7A 1Y67A 3BFRA 3CYOA 2M7WA 5IJ9A 3B8NA 4LF8O 3CS5A 2AZ2A 2P6JA 3FKSG 1AP5A 1HDJA 1MZEA 4I50A 4TSFG 5LMNB 3JASB 3E2EA 4NTWA 4LFBB 1JFFA 3CJHB 3RYHB 1THZA 2XTAA 4QGPA 4BWAA 1IZ3A 4UV9A 1I94O 1B06A 4I4TA 4IGGA 5KAFZ 5CA0A 3IC9A 4TV8A 4DV7O 4AHCA 4JI4B 3ZRWA 4QE9A 2AHYA 1YXBA 1I0HA 4DK1A 4X62B 1MMMA 5ITZA 2WLNA 2B9ZA 4GX5A 3TJTA 3G67A 1IBMB 4FLYA 3DXRA 4TWKA 1K9MW 5LMNO 1SZXA 4PD4F 4J7JA 4YIOA 1AP6A 5D5PA 4X1IB 4KUMA 4DR2B 2ZR2A 1VQMV 1PD3A 5IT9N 2CTWA 4FPPA 3CCJV 3SPGA 1VQ7V 3OUFA 2ZT9B 4RO2A 1HP8A 4K0KB 2QKSA 4JI4O 3KKYA 1EN6A 4X62O 3F7VC 4CH6A 5LP6C 1ZLZA 3CCVV 1ZWIC 3QG5A 1S77D 1IBMO 1ZL8B 1WPBA 5B1NA 3JCZA 5L3DA 3OGCC 1QR8A 4O4LB 3QNEA 1JVMA 3R66A 2P4VA 1W2BU 4MTGA 2YIAA 2FL4A 5JQGB 1RSOA 2EINB 2PI4A 2Q6AA 1B6QA 4GX2A 2Z3YA 4DR2O 5LXTB 2LGWA 3A0RA 1VMGA 4Z2WA 1N8RW 4OX9B 3ABLC 3H1KH 1AI6A 1XILA 4DRXB 4DV3O 1IXMA 1XL4A 2QR4A 2ZNIA 4LFCB 1KYOF 1T5EA 3W7XA 4RAIA 1COWG 2LQTA 4WFAV 1CP9A 1UJWB 5EBMC 1KKDA 1S3JA 5FL7G 2AZ0A 2VRZA 5KHIA 4XBFA 5D5QA 3LNNA 5CB4A 1OCOB 3CHXA 3RBZA 2JGUA 4IIJA 1MG1A 2ITDC 2Q69A 1Q6UA 3J80N 2UUAB 5EBWC 4OX9O 2R72A 5BXZA 3C3TA 1SKVA 3SJCC 3BEHA 2PI5A 4LFCO 3JAKA 5CMUA 4JI2B 3MD0A 3CRQA 1VQ8V 4UVBA 3K03A 3K06A 1K33A 2FMLA 4JYYA 3OUSA 1OCOC 3A8TA 2A9HA 4FLXA 3E8HA 1VQ5V 3OMIB 4ZHQB 4B08A 3AK1A 1JR9A 4X1YB 3LUTB 4ASUG 2CH7A 5H5NA 2B1IA 3X2QB 3K5OA 4PDLA 4G27B 1AJQA 2IBZH 1HW7A 2QKCA 2ZIOA 4JPRA 1XOUA 3JARA 4O2BA 2B1GA 2QWPB 1S76D 1WP8A 1XREA 1N34B 3BPZA 3ZHQA 2HHHB 4JI2O 4LFAB 2PY5A 1AI7A 3P3PA 3CCUV 1L0NH 3DGEA 4JI6B 1BSMA 3S3WA 3DC5A 2HKOA 5LA6A 1XMOB 4DV6B 3LNMB 2UXCB 4FM0A 3ABMB 4JF3A 3K57A 3CCSV 1QR9A 2F43G 1KUQA 3HB3B 3CRRA 4Q20A 4BW9A 1D5NA 1GK9A 4UFZA 2WLLA 1N34O 4ZBMA 1IX9A 2HHHO 3BRCA 3WG7C 3TETA 4LFAO 3K0DA 4MVSA 3ZRWB 4DW0A 2IH1C 1L1FA 4LR3A 2KB1A 4NR1A 3AK3A 2QWOB 4JI6O 5KHGA 2UU9B 3B40A 1XMOO 3LSSA 4G2KA 5LYJA 4DV6O 4B3RB 3DXRB 1XDCA 3HKBA 3CC2V 1Y66A 1FXKC 2BOBC 5C93A 3DSQA 1PNKA 3CSXA 2UXCO 3T1CA 4YXWG 4UB8Z 1VF6C 1CPYA 4NXMB 1E1QG 2RMKB 2ZNJA 1DLBA 1CXZB 3BHPA 2YEVA 3C3SA 4KXRA 5LOVB 5JJNB 1NTMH 3QO8A 3SYQA 3SDLA 1FFXB 1JPXA 4O4HA 3UQ8A 3BAAA 3VQYA 4O2AB 5J2UA 5BMVB 1EFRG 4FK5C 3GB7C 4YJ2B 2GDSA 4IHJA 2NNUA 3F5TA 1KECA 2KKWA 2F66C 3QTCA 4E4EA 2UU9O 2IU0A 4B3RO 1Q6HA 4K8XA 3CRAA 4NXMO 4ZOLA 4FFBB 1RSOB 4I7ZB 1IBKB 2LGQA 4UCOA 5IY5B 3E8FA 3VQXA 5KHKA 4FLVA 3T1YB 3K59A 2WA4A 3LSUA 3G6EV 2EILC 4B3TB 1Y74B 2P90A 2OTJV 4B3MB 3JASA 5L3CA 3LSQA 3CJHA 1M9NA 4ZIBA 3IC7A 3MHSC 5KUKA 4O4IB 4IIJB 4RUFA 3WFVA 2YS8A 2ZINA 1R6TA 1IBKO 3W7TA 3CMAV 4J11A 3TXQA 2Y4TA 1OCZB 2DOSA 3T1YO 3L72H 2C2AA 3CC7V 2JIZG 4OPHA 3CXCU 2LJ2A 3P3NA 2L35A 5LP6A 1NH2B 3OD4A 5KHJA 2ZKOA 3W7SA 4B3TO 1YIJV 1VARA 1XHXA 1LUVA 4B3MO 2MW2B 2KG7B 3K9SA 2K9PA 3N27A 1SQPH 3JD0A 3SYAA 3UO2A 3MHHC 1RM1B 1NBMG 4R6ZA 4RQFA 1SQQH 4QPKA 1SQBH 1QQCA 3N2KA 4EFBA 4LH7A 3RW0A 3CP1A 3JARB 1KMIZ 1K8AW 4X88A 1Y4MA 2HR3A 2ZE5A 4CBCA 1RP3B 2WLMA 1ZL8A 1AB3A 2QGNA 1GMGA 3SYCA 1RM1C 2WSSG 2H94A 3ETDA 3JAWB 3RYFB 2ZIMA 4O4LA 5EIBC 1IXBA 3THOA 5JQGA 5B66Z 1FXHA 2AGAA 3ETGA 5LBQA 3EVKA 5FPRA 1K92A 3KG2A 1F51A 5LXTA 1UFIA 2P67A 3JATB 1SQFA 4DXWA 2EIKC 4JAAA 4DRXA 1KP2A 3ZRSA 3JALB 1SA0A 2EBOA 2UXNA 2K1EA 2XAQA 3ZX6A 3G6BA 4LC1A 2QM8A 1XL6A 3K5LA 4GCZA 1GM9A 2Q7HA 1YJWV 2PUSA 2ZXWB 3L74H 4PA3A 3TXSA 3VQVA 4J7KA 2A0LA 5K1PA 4PELA 3JYCA 2X0LA 4LCUC 3N2GB 2AW9A 3CCRV 4JI8B 1YVWA 4NB5A 2GBOA 3AG1B 1KC8W 5LYJB 1MABG 2RQ6A 3OTOB 3HKBB 5FPOA 4UCVA 1QCEA 1D5AA 3RYIB 5IYZA 5KA5A 4EFEA 2LP7A 2YIBA 2N04A 2E75B 3SR2C 4Q6GA 4NYKA 3JD4A 3CCMV 4B7KA 2FB5A 4JI0B 2YEVB 1IURA 2QM4A 2LW1A 2OT5A 2FYUH 4O4HB 2HJFC 1X59A 4ZHQA 3L9DA 3B77A 1XNQB 3HPLC 4DR1B 1Z2GA 2DYRC 4JI8O 1NVPD 3AG7A 2YI9A 3B4SA 3AEIA 2OYQA 1JMKC 2ILMA 2JGDA 3OTOO 4UB6Z 3P32A 2Z0AA 4DR7O 2JS3A 2DJVA 2E74B 2R70A 1SF9A 1Z5WA 4JI5B 1IBLB 4KP4A 3R65A 2N05A 2XAGA 2ZM6B 3ZMTA 4JI0O 2YXHA 2WAMA 4WFEA 2ATKC 3U11A 1NT2B 2JEUA 2W6JG 3ETEA 2ZDIC 5DECA 3O65A 5IE9A 3K3WA 1XNQO 4FLZA 1XUQA 4DYLA 3UT5B 3K04A 4DR1O 3LDEA 1R73A 1BS3A 2YUAA 4BW5A 2P5OA 3ASNC 1YJNV 4Z1MG 5CBHA 1I7FA 3OE7G 4X8AA 1TUBB 3SPHA 4KL1A 3RFRA 1FXKA 2X6AA 5BY1A 3NR7A 1W0JG 1IBLO 4JI5O 3RVZA 1Q82W 1L0LH 2QEXV 4NKGB 3ASOC 1VF6A 4HBNA 4DO2A 1SS3A 4N21A 2AHZA 3ZS8C 1DGSA 4GX0A 1Q81W 1GN3A 4BIUA 2X6BA 3SJAC 3WB2A 3Q4HA 2XUMA 4DV2B 4EB6B 5LP6B 1S5LZ 2YXYA 4LFBO 2EIMC 4I55B 3UCSC 5BZBA 4EKWA 1VQ6V 5LOVA 1TGOA 1FFXA 2B5UA 4O2AA 3N2KB 4R7CA 5BMVA 1U96A 1KP3A 4R8CA 4YJ2A 2GV9A 2JK5C 1B04A 2LO1A 4WCEV 4P9OA 3ABLB 1R1BA 3SJQC 4FVMA 1I5YA 1AJPA 2Y48A 4B7EA 2IU3A 4DV2O 2QWQB 5LL6Y 2IJJA 1NR7A 1JJOA 3J81N 4FFBA 4LF6B 4X89A 4DUYB 1NTKH 2ODMA 4GLXA 1I08A 4BR6A 1TVKB 1K97A 3FD9A 1EN4A 2A79B 4K0KO 2EULA 1F4NA 1N32B 1WN7A 4DV5B 1R3KC 1LNQA 4PJ0Z 4GYCB 1SA0B 4BIZA 1WJZA 1YI2V 1VQOV 1OV9A 4DV1B 1R6KA 1Y74A 4FM1A 2RCVA 4H44B 2PYJA 4U3JA 2R9RB 3RT3C 1NS1A 2XT9A 2HG5C 5EC2C 3CCQV 3ZMUA 1WB8A 4JAVA 2ITCC 2R9IA 4H37A 1PNLA 1H2GA 3IAYA 4O4IA 4LF6O 2CE4A 4DUYO 1TAEA 1JJ2U 3I56V 3IJ4A 3PJSK 4J41A 5KHHA 3OR7C 5IYZB 3K5NA 1R3IC 4X64B 1BHBA 1N32O 4UXNA 4DV5O 1NVPB 3BCCH 1QNMA 3H1LH 4LP8A 3D3QA 1RPOA 1H2SB 5IYCO 4DV1O 4CC6A 3CEIA 2RJZA 1JQ0A 5JJEB 3TK1A 2KG7A 2ZQMA 4FMTA 2XNDG 4LF9B 3L75H 1GO3F 2OCCC 1OCCC 2BTQA 1FXVA 4JZ2A 2Q67A 3B09A 1FS0G 1SETA 3IGAC 4D6TH 4DR3B 2X7RB 2EZOA 2WLKA 3A0BZ 4GZRB 1SERA 2JGDB 3H9VA 4J10A 2UUAO 2YC0A 5KAIZ 1NJIW 3ZRVA 1XBLA 4PHZA 2DYSC 2CGNA 5EZYB 4X64O 3K5MA 3APQA 5LMUB 1QHTA 5EIBD 5HFMA 3J7AU 4JI3B 2QWNB 3I5DA 3JAWA 3RYFA 1MA1A 5B1BC 4K35A 3L73H 2UXBB 4LF4B 4HAMA 3AK2A 2F4VB 3K08A 3FYIB 4WFGA 4LF9O 3WG7B 2Q7EA 1ZAUA 1N4CA 2DWEC 2LFRA 3A0HZ 4PI0A 4FFKA 2A06H 2W0FC 3BY6A 4DR3O 3D3IA 3JATA 1FD9A 1K3EA 2WLHA 2BE3A 3SYPA 1ORQC 3APOA 4H33A 2UXXA 4WFHA 3JALA 3OT7A 1FXKB 2ZE8A 2D3OW 1R3LC 1ROPA 4DR6B 5LMUO 1O9GA 2WA3A 4MT8A 4ZI7B 4JI3O 2Y0IA 4TOIA 4JYAB 2F93B 1AR1B 2OIGA 2VQFB 3N2GA 4LF4O 1MNGA 4F6RB 4ABMA 4BIOA 2F4VO 1BQ0A 4LBEC 3PN1A 3Q4HB 5CA3A 2ADQB 2HJDA 4MVZA 3WB0A 3RYCB 1MZFA 1JCHA 3RYIA 4XDLA 3JAMN 2JEXA 1H2KA 2Y69C 4GKJB 3ETQA 3G80A 1S0VA 1YSCA 1J5EB 1YZBA 1PL4A 3FB8C 2YI8A 4J80A 2Q7GA 3D36C 3U0ZA 3RVYA 4JYAO 2XAHA 3F7YC 2VQFO 2JDIG 4UCTA 3E83A 1NQTA 4UVAA 1ENVA 3DTUB 2CDYA 2HFEC 1X4TA 1JX9A 3K58A 4RWUA 2G38A 3E8BA 1EZJA 2DQ3A 1O9HA 3SPCA 3T4ZA 2EILB 4PA6A 3W7WA 3TCUA 4NTXA 4GKJO 1SQXH 4DV0B 3JCUZ 3KZIZ 2XASA 3AG4C 2ADPA 1J5EO 1V54C 4TUYB 2QM7A 3ABKC 3JSLA 2HVKC 1K4CC 5J2TB 1QBZA 4IYIA 3QO7A 1DF5A 4X20B 2EJ7A 4MVQA 3UT5A 3ZMSA 1M93A 1P84F 4ICGA 5CBGA 4JZGA 4JASA 1YHQV 4YHHB 4WFBV 2PGGA 3RGBA 2IJHA 4U3JB 5B3SC 2L6LA 4J9YB 1TUBA 5HFLA 1M56C 1AVMA 5IWAB 2YIDA 1N36B 3HR0A 1ZX3A 3ZRXA 2A3QA 4DV0O 1US6A 1QLEC 5B1AC 1VQ9V 1WB7A 1AR5A 1E79G 5GTIZ 2PF4E 4G28B 3FAVB 2P7TC 1K7DA 1Y76B 1G4YB 3ZJZA 4DR4B 3VQWA 3AG2C 3ZIAG 4EB6A 5IDJA 4YHHO 3K79A 1XNRB 4QJFB 4WBNB 5IYBO 4I55A 2BTQB 2EX3A 1S5JA 5IWAO 4MVRA 1BE3H 1N36O 3BABA 2KQXA 4CH3A 1WA8A 4HYOA 5JVDB 1XMQB 2EZPA 2OCHA 3K0GA 3AG3C 4X1KB 2BSKA 4NXNB 4W4LA 4TT3G 3JD1A 3ZN1A 3D8CA 1XEQA 2EIJC 2Q8VA 1YTFD 2EIKB 5LGNA 1K34A 4DR4O 1RPRA 2VWKA 1OCRC 4JI1B 4TQDA 5EBLC 1Q3EA 1YCIA 1V55C 1XNRO 1JOYA 1WLEA 1ZUQA 2Q73A 3ZHTA 4IYHA 5EYPB 1AILA 3FB6C 2KSDA 2E76B 3UO3A 4XDKA 1TVKA 3OEHG 3HKDB 1Y6XA 1XMQO 3JSNA 2OIEA 1XI1A 4B3SB 4NXNO 1V9PA 4WF9V 3VBBA 1YDXA 4DUZB 1H2NA 5GW7A 4BAYA 1AR4A 4JYBA 4IL6Z 3VOUA 1F23A 4LNUB 2GUZB 4UCUA 1GN2A 1HNXB 3CE2A 1F4MA 2VS0A 4JI1O 3W7UA 1KB9F 1RFYA 2V7QG 2QE7G 4JV5B 1W59A 3T4DA 5L3EA 3A2FA 2YDEA 3ZHSA 4U7NA 5L3FA 4I9QA 3TGUH 2DYRB 1QU7A 5LHIA 3HKCB 1Q86W 3CCEV 4B3SO 4OXSA 3EFFK 3FB5C 4DUZO 4JAUA 5EK0A 4U7OA 1GM8A 2RNBA 2QWRB 2ZE7A 2ETNA 1VIBA 1HWYA 3CX5F 3KCXA 4FZ1A 2Q5ZA 1HNXO 1VQ4V 3ZMZA 4FLUA 2BTOA 5AG2A 1HR0B 4K8ZA 3T2MA 4JV5O 5FNVB 2HVJC 1ZSPA 3OGIB 2R9AA 4TQFA 4D7SA 3E22B 4OPAA 4QE7A 4WFFA
chains in the Genus database with same CATH topology
3I5DA 3H9VA 4DW0A 4DW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5D A;  3H9V A;  4DW0 A;  4DW1 A; 
#chains in the Genus database with same CATH topology
 3ASN B;  5EZY A;  1Q7Y W;  2YIB D;  4YY3 B;  1NZ6 A;  1VEW A;  1HNW B;  1XHZ A;  3ASO B;  3L71 H;  2IJI A;  3L70 H;  4DK0 A;  1WAZ A;  3BVO A;  2UUC B;  1HR0 O;  3SPI A;  4J9Z B;  4H13 B;  3ABU A;  4Z1V A;  1S5H C;  5EC1 C;  1QVG U;  2JS5 A;  3CD6 V;  3CCL V;  3E89 A;  4P30 A;  1GRJ A;  3QF7 A;  3MAQ A;  4QIW F;  4YY3 O;  4ZI7 A;  2ZE6 A;  3S3X A;  2ZM6 O;  2EIM B;  1FJG B;  1HNW O;  3CME V;  4F6R A;  3D36 A;  2JJ1 G;  2UUC O;  1URF A;  4UCS A;  3RYC A;  2PTM A;  1NU1 H;  1QVF U;  3IFX A;  4X65 B;  1YTF B;  4JTA B;  4PV1 B;  5E79 Z;  3ICX A;  1EN5 A;  5E1A C;  4UUJ C;  3H1H H;  4H0L B;  1WA8 B;  4J7Z A;  2DMX A;  5H6R A;  2BSK B;  1FJG O;  2VWJ A;  4I5S A;  1IVS A;  1XQ8 A;  2DN9 A;  3KCY A;  2HLD G;  3G71 V;  3C90 A;  2CGO A;  4X9Q A;  5GTH Z;  4MVU A;  2FTK A;  2IM9 A;  5BR8 B;  4DV3 B;  1PNM A;  2M6Y A;  2E3C A;  2RDC A;  4MVO A;  4R50 A;  4ZKI A;  4I0X B;  1DF4 A;  4AI8 A;  3ZN0 A;  4X65 O;  3ZHU A;  1EM1 A;  5C8Y A;  3H1I H;  1H38 A;  2OWO A;  4MSW C;  1NTZ H;  1Q43 A;  1G6U A;  4N23 A;  4C7U A;  2Y4U A;  3ZHV A;  1ARO P;  4TUY A;  4EEQ A;  3O9O A;  1PM9 A;  2WPD G;  4P2Z A;  5J2T A;  1Q5O A;  4X20 A;  1JA8 A;  1VF7 A;  3SYO A;  1BCC H;  4CH5 A;  4LWS B;  4O4J B;  5A2Q N;  3M99 B;  3FB7 C;  5J9P C;  1K4D C;  3HKE B;  5BR8 O;  5H2F Z;  1K5Q A;  1TUE B;  5DM6 V;  4D7T A;  4E2L A;  4P9P A;  2LW7 A;  5A9G A;  3ZHR A;  5JCO C;  1LR1 A;  4J42 A;  1YEW A;  5KMG B;  1FPO A;  2WWW A;  1SZT A;  2DW4 A;  1OJH A;  2OCC B;  1OCC B;  1EBO A;  3ZCC A;  4MW8 A;  4HNA B;  2EIN C;  4QPJ A;  3LDD A;  3H1J H;  3FAV A;  1GH6 A;  1Y76 A;  2RN9 A;  3JD3 A;  3B8M A;  1PV0 A;  3GVM A;  5KX5 B;  2DYS B;  1NI8 A;  4WBN A;  1ZTE A;  2WLI B;  1M90 W;  4W4K A;  1MSD A;  1SRY A;  1W0K G;  2X6C A;  1G8M A;  5CN0 A;  5B1B B;  2E5L B;  3FX7 A;  5F2V O;  1GKF A;  1VQL V;  2W0X A;  5LHG A;  5JVD A;  4GX1 A;  2D2C B;  4X1K A;  2XAJ A;  1U97 A;  3G4S V;  1SQG A;  2QTO A;  3OMN B;  1H2L A;  5JH7 B;  3E8G A;  2HP8 A;  2QA4 V;  4YJ3 A;  5CA1 B;  1FAF A;  2ZCE A;  1N0J A;  1KKC A;  1NH2 D;  4FLT A;  1OZ0 A;  2NR5 A;  4MTO A;  1A32 A;  5IJ0 A;  1D2D A;  4I9W A;  4JTC B;  1FFT B;  3I55 V;  1AJN A;  1WPX A;  5IYD O;  5EYP A;  1S72 V;  2MK3 A;  4FM2 A;  3ZED A;  1KBH A;  1NKD A;  3OM3 B;  4F6E A;  5KA6 A;  2E5L O;  1P49 A;  1VF5 B;  3ML0 A;  1OHH G;  2V4D A;  1BT8 A;  4LF7 B;  3HKD A;  1YF2 A;  2DE0 X;  2W6I G;  1P4R A;  3X2Q C;  2PYL A;  3H01 A;  4GUN A;  5IJ9 B;  2Q4P A;  4IT5 A;  1N33 B;  1SQV H;  2GSM B;  2QJ1 A;  4LNU A;  3OAA G;  5KUM A;  2GUZ A;  1E1R G;  2Y69 B;  4UVC A;  3BA8 A;  5CBF A;  4I50 B;  2NLJ C;  3GWO A;  4F4L A;  4FLW A;  2UXB O;  2ZD9 A;  4TV9 A;  4K3A A;  5H9C A;  1JFF B;  2XAF A;  2BOC C;  2Y0P A;  4YIP A;  4I4T B;  4NVP A;  5CA0 B;  4GT1 A;  4TV8 B;  3U10 A;  3T1H B;  4LF7 O;  1VQN V;  3HKC A;  2UXD B;  2IH3 C;  2DQ0 A;  1R6N A;  4MTX A;  1Q8I A;  4NTY A;  5ITZ B;  1CEZ A;  2XOK G;  2Q9L A;  3ABM C;  1PPJ H;  2P06 A;  4PA9 A;  1N33 O;  4AIL C;  4DR6 O;  4JTD B;  2H3O A;  1PP9 H;  3RWR D;  3E86 A;  2ZR3 A;  1L8D A;  3AG4 B;  1KD1 W;  1WP7 A;  2YIC A;  1GN6 A;  1V54 B;  1IDS A;  2F23 A;  3SPJ A;  5FNV A;  3ABK B;  1BMF G;  2ZDI A;  4X66 B;  5H6Q A;  3E22 A;  5JWP A;  3ZBH A;  5GON A;  2YSU B;  3STL C;  4PDM A;  3T1H O;  2F1M A;  5DED A;  1M57 B;  2UXD O;  1P7B A;  5C8Y B;  1PKX A;  5B3S B;  2O57 A;  2QTS A;  3K9A A;  1M56 B;  1P7G A;  4PI2 A;  1MSW D;  2CUG A;  1BQZ A;  4CZZ A;  2EJR A;  1KQS U;  1WNS A;  1QLE B;  1SC5 B;  4RUE A;  5B1A B;  1VQP V;  4FJC C;  2CAZ C;  1M57 C;  1GTO A;  1GAX A;  3ZMV A;  2A7W A;  4X66 O;  2CK3 G;  3B2E E;  3OMA B;  3OTF A;  3AG2 B;  2V1D A;  5KLV H;  2WLJ A;  3QO5 A;  4DV4 B;  3M7M X;  1YJ9 V;  1VP7 A;  3QVN A;  2GHY A;  1G1X B;  4KHP B;  5L3B A;  3RYH A;  2CTQ A;  2XHB A;  5IY5 C;  5JJJ B;  1K73 W;  1EZV H;  5CB4 B;  2H8P C;  3STZ C;  3UM7 A;  3AG3 B;  1F7Y A;  4CC5 A;  1SES A;  2GTA A;  2EIJ B;  2NN4 A;  3GWK C;  4CS3 A;  1UPG A;  1KU9 A;  3EHB B;  3OR6 C;  1K5S A;  1OCR B;  4CS4 A;  5B5E Z;  2Q0A A;  4L87 A;  5LHH A;  2UUB B;  3SGI A;  3JAK B;  4JGS A;  1BGY H;  2GTS A;  4DV4 O;  4DR5 B;  1V55 B;  5LGT A;  3FYE B;  4L8J A;  1FYJ A;  4JYC A;  3OEE G;  1QLN A;  1J95 A;  1R3J C;  1TA8 A;  4KHP O;  2JVD A;  4X1I A;  2QKA A;  2P4K A;  3EXA A;  3CB2 A;  2CTP A;  3UKM A;  1OCZ C;  4YJ3 B;  2CH7 B;  1BZK A;  2Q68 A;  4OGQ B;  3RN4 A;  1AI4 A;  2BCC H;  5IJ0 B;  4XDJ A;  4I0X A;  3P30 A;  1BHA A;  4O2B B;  4LF5 B;  2UUB O;  3FFQ A;  2YXL A;  4DR5 O;  4MS2 A;  2AXT Z;  4JI7 B;  2F95 B;  4GKK B;  1HNZ B;  5JCO A;  1BL8 A;  4CS2 A;  1M1K W;  4PA4 A;  5DN6 G;  5TIS Z;  5LA6 B;  4PDV A;  1LUW A;  1B3Q A;  3OW2 U;  4LWS A;  4O4J A;  4PA7 A;  1Z5V A;  1GN4 A;  4MW3 A;  4AQY B;  2Z5U A;  2N74 A;  3MDS A;  3HKE A;  4U3F H;  2PZS A;  4TV9 B;  5LGU A;  2LFS A;  2P22 C;  1Q90 D;  3CPW U;  3WU2 Z;  4LF5 O;  5KMG A;  3JD2 A;  4LH6 A;  2WLL B;  2JJ2 G;  3ABT A;  4HNA A;  5FLX N;  4JI7 O;  4GKK O;  1HNZ O;  2JRI A;  1I5X A;  1FKA O;  2QSA A;  1DTO A;  4HZ3 A;  3DC6 A;  4UV8 A;  2VQE B;  5KX5 A;  1N0N A;  4FZ0 A;  4MTF A;  2WLI A;  4DR7 B;  4QNH B;  2IJK A;  4AQY O;  4PDR A;  4FIP C;  2ZXW C;  2IW5 A;  4DW1 A;  3WB1 A;  4MVM A;  4KFM A;  2CTR A;  5B1O A;  2QDO A;  2FKX A;  1H8E G;  1NR1 A;  2OTL V;  3CRC A;  5GON B;  1H8H G;  3AG1 C;  1M4U A;  3F5W C;  3E35 A;  5J2U B;  4LF8 B;  2DWD C;  4X1Y A;  4CH4 A;  3NXS A;  5JH7 A;  1M5I A;  3M8A A;  4IHJ B;  3SJB C;  3CWB H;  4RQE A;  4UCR A;  2ARH A;  1YIT V;  5CA1 A;  3BA9 A;  2Q0O C;  2VQE O;  3CRM A;  1Q6I A;  1H2M A;  3CXH F;  3LDC A;  1DK1 A;  4A5U B;  1AI5 A;  1MOF A;  5L3G A;  1I94 B;  1PL0 A;  2HEP A;  5K1X A;  1VQK V;  3OFN G;  4ZOL B;  3CC4 V;  4DV7 B;  1GM7 A;  1Y67 A;  3BFR A;  3CYO A;  2M7W A;  5IJ9 A;  3B8N A;  4LF8 O;  3CS5 A;  2AZ2 A;  2P6J A;  3FKS G;  1AP5 A;  1HDJ A;  1MZE A;  4I50 A;  4TSF G;  5LMN B;  3JAS B;  3E2E A;  4NTW A;  4LFB B;  1JFF A;  3CJH B;  3RYH B;  1THZ A;  2XTA A;  4QGP A;  4BWA A;  1IZ3 A;  4UV9 A;  1I94 O;  1B06 A;  4I4T A;  4IGG A;  5KAF Z;  5CA0 A;  3IC9 A;  4TV8 A;  4DV7 O;  4AHC A;  4JI4 B;  3ZRW A;  4QE9 A;  2AHY A;  1YXB A;  1I0H A;  4DK1 A;  4X62 B;  1MMM A;  5ITZ A;  2WLN A;  2B9Z A;  4GX5 A;  3TJT A;  3G67 A;  1IBM B;  4FLY A;  3DXR A;  4TWK A;  1K9M W;  5LMN O;  1SZX A;  4PD4 F;  4J7J A;  4YIO A;  1AP6 A;  5D5P A;  4X1I B;  4KUM A;  4DR2 B;  2ZR2 A;  1VQM V;  1PD3 A;  5IT9 N;  2CTW A;  4FPP A;  3CCJ V;  3SPG A;  1VQ7 V;  3OUF A;  2ZT9 B;  4RO2 A;  1HP8 A;  4K0K B;  2QKS A;  4JI4 O;  3KKY A;  1EN6 A;  4X62 O;  3F7V C;  4CH6 A;  5LP6 C;  1ZLZ A;  3CCV V;  1ZWI C;  3QG5 A;  1S77 D;  1IBM O;  1ZL8 B;  1WPB A;  5B1N A;  3JCZ A;  5L3D A;  3OGC C;  1QR8 A;  4O4L B;  3QNE A;  1JVM A;  3R66 A;  2P4V A;  1W2B U;  4MTG A;  2YIA A;  2FL4 A;  5JQG B;  1RSO A;  2EIN B;  2PI4 A;  2Q6A A;  1B6Q A;  4GX2 A;  2Z3Y A;  4DR2 O;  5LXT B;  2LGW A;  3A0R A;  1VMG A;  4Z2W A;  1N8R W;  4OX9 B;  3ABL C;  3H1K H;  1AI6 A;  1XIL A;  4DRX B;  4DV3 O;  1IXM A;  1XL4 A;  2QR4 A;  2ZNI A;  4LFC B;  1KYO F;  1T5E A;  3W7X A;  4RAI A;  1COW G;  2LQT A;  4WFA V;  1CP9 A;  1UJW B;  5EBM C;  1KKD A;  1S3J A;  5FL7 G;  2AZ0 A;  2VRZ A;  5KHI A;  4XBF A;  5D5Q A;  3LNN A;  5CB4 A;  1OCO B;  3CHX A;  3RBZ A;  2JGU A;  4IIJ A;  1MG1 A;  2ITD C;  2Q69 A;  1Q6U A;  3J80 N;  2UUA B;  5EBW C;  4OX9 O;  2R72 A;  5BXZ A;  3C3T A;  1SKV A;  3SJC C;  3BEH A;  2PI5 A;  4LFC O;  3JAK A;  5CMU A;  4JI2 B;  3MD0 A;  3CRQ A;  1VQ8 V;  4UVB A;  3K03 A;  3K06 A;  1K33 A;  2FML A;  4JYY A;  3OUS A;  1OCO C;  3A8T A;  2A9H A;  4FLX A;  3E8H A;  1VQ5 V;  3OMI B;  4ZHQ B;  4B08 A;  3AK1 A;  1JR9 A;  4X1Y B;  3LUT B;  4ASU G;  2CH7 A;  5H5N A;  2B1I A;  3X2Q B;  3K5O A;  4PDL A;  4G27 B;  1AJQ A;  2IBZ H;  1HW7 A;  2QKC A;  2ZIO A;  4JPR A;  1XOU A;  3JAR A;  4O2B A;  2B1G A;  2QWP B;  1S76 D;  1WP8 A;  1XRE A;  1N34 B;  3BPZ A;  3ZHQ A;  2HHH B;  4JI2 O;  4LFA B;  2PY5 A;  1AI7 A;  3P3P A;  3CCU V;  1L0N H;  3DGE A;  4JI6 B;  1BSM A;  3S3W A;  3DC5 A;  2HKO A;  5LA6 A;  1XMO B;  4DV6 B;  3LNM B;  2UXC B;  4FM0 A;  3ABM B;  4JF3 A;  3K57 A;  3CCS V;  1QR9 A;  2F43 G;  1KUQ A;  3HB3 B;  3CRR A;  4Q20 A;  4BW9 A;  1D5N A;  1GK9 A;  4UFZ A;  2WLL A;  1N34 O;  4ZBM A;  1IX9 A;  2HHH O;  3BRC A;  3WG7 C;  3TET A;  4LFA O;  3K0D A;  4MVS A;  3ZRW B;  4DW0 A;  2IH1 C;  1L1F A;  4LR3 A;  2KB1 A;  4NR1 A;  3AK3 A;  2QWO B;  4JI6 O;  5KHG A;  2UU9 B;  3B40 A;  1XMO O;  3LSS A;  4G2K A;  5LYJ A;  4DV6 O;  4B3R B;  3DXR B;  1XDC A;  3HKB A;  3CC2 V;  1Y66 A;  1FXK C;  2BOB C;  5C93 A;  3DSQ A;  1PNK A;  3CSX A;  2UXC O;  3T1C A;  4YXW G;  4UB8 Z;  1VF6 C;  1CPY A;  4NXM B;  1E1Q G;  2RMK B;  2ZNJ A;  1DLB A;  1CXZ B;  3BHP A;  2YEV A;  3C3S A;  4KXR A;  5LOV B;  5JJN B;  1NTM H;  3QO8 A;  3SYQ A;  3SDL A;  1FFX B;  1JPX A;  4O4H A;  3UQ8 A;  3BAA A;  3VQY A;  4O2A B;  5J2U A;  5BMV B;  1EFR G;  4FK5 C;  3GB7 C;  4YJ2 B;  2GDS A;  4IHJ A;  2NNU A;  3F5T A;  1KEC A;  2KKW A;  2F66 C;  3QTC A;  4E4E A;  2UU9 O;  2IU0 A;  4B3R O;  1Q6H A;  4K8X A;  3CRA A;  4NXM O;  4ZOL A;  4FFB B;  1RSO B;  4I7Z B;  1IBK B;  2LGQ A;  4UCO A;  5IY5 B;  3E8F A;  3VQX A;  5KHK A;  4FLV A;  3T1Y B;  3K59 A;  2WA4 A;  3LSU A;  3G6E V;  2EIL C;  4B3T B;  1Y74 B;  2P90 A;  2OTJ V;  4B3M B;  3JAS A;  5L3C A;  3LSQ A;  3CJH A;  1M9N A;  4ZIB A;  3IC7 A;  3MHS C;  5KUK A;  4O4I B;  4IIJ B;  4RUF A;  3WFV A;  2YS8 A;  2ZIN A;  1R6T A;  1IBK O;  3W7T A;  3CMA V;  4J11 A;  3TXQ A;  2Y4T A;  1OCZ B;  2DOS A;  3T1Y O;  3L72 H;  2C2A A;  3CC7 V;  2JIZ G;  4OPH A;  3CXC U;  2LJ2 A;  3P3N A;  2L35 A;  5LP6 A;  1NH2 B;  3OD4 A;  5KHJ A;  2ZKO A;  3W7S A;  4B3T O;  1YIJ V;  1VAR A;  1XHX A;  1LUV A;  4B3M O;  2MW2 B;  2KG7 B;  3K9S A;  2K9P A;  3N27 A;  1SQP H;  3JD0 A;  3SYA A;  3UO2 A;  3MHH C;  1RM1 B;  1NBM G;  4R6Z A;  4RQF A;  1SQQ H;  4QPK A;  1SQB H;  1QQC A;  3N2K A;  4EFB A;  4LH7 A;  3RW0 A;  3CP1 A;  3JAR B;  1KMI Z;  1K8A W;  4X88 A;  1Y4M A;  2HR3 A;  2ZE5 A;  4CBC A;  1RP3 B;  2WLM A;  1ZL8 A;  1AB3 A;  2QGN A;  1GMG A;  3SYC A;  1RM1 C;  2WSS G;  2H94 A;  3ETD A;  3JAW B;  3RYF B;  2ZIM A;  4O4L A;  5EIB C;  1IXB A;  3THO A;  5JQG A;  5B66 Z;  1FXH A;  2AGA A;  3ETG A;  5LBQ A;  3EVK A;  5FPR A;  1K92 A;  3KG2 A;  1F51 A;  5LXT A;  1UFI A;  2P67 A;  3JAT B;  1SQF A;  4DXW A;  2EIK C;  4JAA A;  4DRX A;  1KP2 A;  3ZRS A;  3JAL B;  1SA0 A;  2EBO A;  2UXN A;  2K1E A;  2XAQ A;  3ZX6 A;  3G6B A;  4LC1 A;  2QM8 A;  1XL6 A;  3K5L A;  4GCZ A;  1GM9 A;  2Q7H A;  1YJW V;  2PUS A;  2ZXW B;  3L74 H;  4PA3 A;  3TXS A;  3VQV A;  4J7K A;  2A0L A;  5K1P A;  4PEL A;  3JYC A;  2X0L A;  4LCU C;  3N2G B;  2AW9 A;  3CCR V;  4JI8 B;  1YVW A;  4NB5 A;  2GBO A;  3AG1 B;  1KC8 W;  5LYJ B;  1MAB G;  2RQ6 A;  3OTO B;  3HKB B;  5FPO A;  4UCV A;  1QCE A;  1D5A A;  3RYI B;  5IYZ A;  5KA5 A;  4EFE A;  2LP7 A;  2YIB A;  2N04 A;  2E75 B;  3SR2 C;  4Q6G A;  4NYK A;  3JD4 A;  3CCM V;  4B7K A;  2FB5 A;  4JI0 B;  2YEV B;  1IUR A;  2QM4 A;  2LW1 A;  2OT5 A;  2FYU H;  4O4H B;  2HJF C;  1X59 A;  4ZHQ A;  3L9D A;  3B77 A;  1XNQ B;  3HPL C;  4DR1 B;  1Z2G A;  2DYR C;  4JI8 O;  1NVP D;  3AG7 A;  2YI9 A;  3B4S A;  3AEI A;  2OYQ A;  1JMK C;  2ILM A;  2JGD A;  3OTO O;  4UB6 Z;  3P32 A;  2Z0A A;  4DR7 O;  2JS3 A;  2DJV A;  2E74 B;  2R70 A;  1SF9 A;  1Z5W A;  4JI5 B;  1IBL B;  4KP4 A;  3R65 A;  2N05 A;  2XAG A;  2ZM6 B;  3ZMT A;  4JI0 O;  2YXH A;  2WAM A;  4WFE A;  2ATK C;  3U11 A;  1NT2 B;  2JEU A;  2W6J G;  3ETE A;  2ZDI C;  5DEC A;  3O65 A;  5IE9 A;  3K3W A;  1XNQ O;  4FLZ A;  1XUQ A;  4DYL A;  3UT5 B;  3K04 A;  4DR1 O;  3LDE A;  1R73 A;  1BS3 A;  2YUA A;  4BW5 A;  2P5O A;  3ASN C;  1YJN V;  4Z1M G;  5CBH A;  1I7F A;  3OE7 G;  4X8A A;  1TUB B;  3SPH A;  4KL1 A;  3RFR A;  1FXK A;  2X6A A;  5BY1 A;  3NR7 A;  1W0J G;  1IBL O;  4JI5 O;  3RVZ A;  1Q82 W;  1L0L H;  2QEX V;  4NKG B;  3ASO C;  1VF6 A;  4HBN A;  4DO2 A;  1SS3 A;  4N21 A;  2AHZ A;  3ZS8 C;  1DGS A;  4GX0 A;  1Q81 W;  1GN3 A;  4BIU A;  2X6B A;  3SJA C;  3WB2 A;  3Q4H A;  2XUM A;  4DV2 B;  4EB6 B;  5LP6 B;  1S5L Z;  2YXY A;  4LFB O;  2EIM C;  4I55 B;  3UCS C;  5BZB A;  4EKW A;  1VQ6 V;  5LOV A;  1TGO A;  1FFX A;  2B5U A;  4O2A A;  3N2K B;  4R7C A;  5BMV A;  1U96 A;  1KP3 A;  4R8C A;  4YJ2 A;  2GV9 A;  2JK5 C;  1B04 A;  2LO1 A;  4WCE V;  4P9O A;  3ABL B;  1R1B A;  3SJQ C;  4FVM A;  1I5Y A;  1AJP A;  2Y48 A;  4B7E A;  2IU3 A;  4DV2 O;  2QWQ B;  5LL6 Y;  2IJJ A;  1NR7 A;  1JJO A;  3J81 N;  4FFB A;  4LF6 B;  4X89 A;  4DUY B;  1NTK H;  2ODM A;  4GLX A;  1I08 A;  4BR6 A;  1TVK B;  1K97 A;  3FD9 A;  1EN4 A;  2A79 B;  4K0K O;  2EUL A;  1F4N A;  1N32 B;  1WN7 A;  4DV5 B;  1R3K C;  1LNQ A;  4PJ0 Z;  4GYC B;  1SA0 B;  4BIZ A;  1WJZ A;  1YI2 V;  1VQO V;  1OV9 A;  4DV1 B;  1R6K A;  1Y74 A;  4FM1 A;  2RCV A;  4H44 B;  2PYJ A;  4U3J A;  2R9R B;  3RT3 C;  1NS1 A;  2XT9 A;  2HG5 C;  5EC2 C;  3CCQ V;  3ZMU A;  1WB8 A;  4JAV A;  2ITC C;  2R9I A;  4H37 A;  1PNL A;  1H2G A;  3IAY A;  4O4I A;  4LF6 O;  2CE4 A;  4DUY O;  1TAE A;  1JJ2 U;  3I56 V;  3IJ4 A;  3PJS K;  4J41 A;  5KHH A;  3OR7 C;  5IYZ B;  3K5N A;  1R3I C;  4X64 B;  1BHB A;  1N32 O;  4UXN A;  4DV5 O;  1NVP B;  3BCC H;  1QNM A;  3H1L H;  4LP8 A;  3D3Q A;  1RPO A;  1H2S B;  5IYC O;  4DV1 O;  4CC6 A;  3CEI A;  2RJZ A;  1JQ0 A;  5JJE B;  3TK1 A;  2KG7 A;  2ZQM A;  4FMT A;  2XND G;  4LF9 B;  3L75 H;  1GO3 F;  2OCC C;  1OCC C;  2BTQ A;  1FXV A;  4JZ2 A;  2Q67 A;  3B09 A;  1FS0 G;  1SET A;  3IGA C;  4D6T H;  4DR3 B;  2X7R B;  2EZO A;  2WLK A;  3A0B Z;  4GZR B;  1SER A;  2JGD B;  3H9V A;  4J10 A;  2UUA O;  2YC0 A;  5KAI Z;  1NJI W;  3ZRV A;  1XBL A;  4PHZ A;  2DYS C;  2CGN A;  5EZY B;  4X64 O;  3K5M A;  3APQ A;  5LMU B;  1QHT A;  5EIB D;  5HFM A;  3J7A U;  4JI3 B;  2QWN B;  3I5D A;  3JAW A;  3RYF A;  1MA1 A;  5B1B C;  4K35 A;  3L73 H;  2UXB B;  4LF4 B;  4HAM A;  3AK2 A;  2F4V B;  3K08 A;  3FYI B;  4WFG A;  4LF9 O;  3WG7 B;  2Q7E A;  1ZAU A;  1N4C A;  2DWE C;  2LFR A;  3A0H Z;  4PI0 A;  4FFK A;  2A06 H;  2W0F C;  3BY6 A;  4DR3 O;  3D3I A;  3JAT A;  1FD9 A;  1K3E A;  2WLH A;  2BE3 A;  3SYP A;  1ORQ C;  3APO A;  4H33 A;  2UXX A;  4WFH A;  3JAL A;  3OT7 A;  1FXK B;  2ZE8 A;  2D3O W;  1R3L C;  1ROP A;  4DR6 B;  5LMU O;  1O9G A;  2WA3 A;  4MT8 A;  4ZI7 B;  4JI3 O;  2Y0I A;  4TOI A;  4JYA B;  2F93 B;  1AR1 B;  2OIG A;  2VQF B;  3N2G A;  4LF4 O;  1MNG A;  4F6R B;  4ABM A;  4BIO A;  2F4V O;  1BQ0 A;  4LBE C;  3PN1 A;  3Q4H B;  5CA3 A;  2ADQ B;  2HJD A;  4MVZ A;  3WB0 A;  3RYC B;  1MZF A;  1JCH A;  3RYI A;  4XDL A;  3JAM N;  2JEX A;  1H2K A;  2Y69 C;  4GKJ B;  3ETQ A;  3G80 A;  1S0V A;  1YSC A;  1J5E B;  1YZB A;  1PL4 A;  3FB8 C;  2YI8 A;  4J80 A;  2Q7G A;  3D36 C;  3U0Z A;  3RVY A;  4JYA O;  2XAH A;  3F7Y C;  2VQF O;  2JDI G;  4UCT A;  3E83 A;  1NQT A;  4UVA A;  1ENV A;  3DTU B;  2CDY A;  2HFE C;  1X4T A;  1JX9 A;  3K58 A;  4RWU A;  2G38 A;  3E8B A;  1EZJ A;  2DQ3 A;  1O9H A;  3SPC A;  3T4Z A;  2EIL B;  4PA6 A;  3W7W A;  3TCU A;  4NTX A;  4GKJ O;  1SQX H;  4DV0 B;  3JCU Z;  3KZI Z;  2XAS A;  3AG4 C;  2ADP A;  1J5E O;  1V54 C;  4TUY B;  2QM7 A;  3ABK C;  3JSL A;  2HVK C;  1K4C C;  5J2T B;  1QBZ A;  4IYI A;  3QO7 A;  1DF5 A;  4X20 B;  2EJ7 A;  4MVQ A;  3UT5 A;  3ZMS A;  1M93 A;  1P84 F;  4ICG A;  5CBG A;  4JZG A;  4JAS A;  1YHQ V;  4YHH B;  4WFB V;  2PGG A;  3RGB A;  2IJH A;  4U3J B;  5B3S C;  2L6L A;  4J9Y B;  1TUB A;  5HFL A;  1M56 C;  1AVM A;  5IWA B;  2YID A;  1N36 B;  3HR0 A;  1ZX3 A;  3ZRX A;  2A3Q A;  4DV0 O;  1US6 A;  1QLE C;  5B1A C;  1VQ9 V;  1WB7 A;  1AR5 A;  1E79 G;  5GTI Z;  2PF4 E;  4G28 B;  3FAV B;  2P7T C;  1K7D A;  1Y76 B;  1G4Y B;  3ZJZ A;  4DR4 B;  3VQW A;  3AG2 C;  3ZIA G;  4EB6 A;  5IDJ A;  4YHH O;  3K79 A;  1XNR B;  4QJF B;  4WBN B;  5IYB O;  4I55 A;  2BTQ B;  2EX3 A;  1S5J A;  5IWA O;  4MVR A;  1BE3 H;  1N36 O;  3BAB A;  2KQX A;  4CH3 A;  1WA8 A;  4HYO A;  5JVD B;  1XMQ B;  2EZP A;  2OCH A;  3K0G A;  3AG3 C;  4X1K B;  2BSK A;  4NXN B;  4W4L A;  4TT3 G;  3JD1 A;  3ZN1 A;  3D8C A;  1XEQ A;  2EIJ C;  2Q8V A;  1YTF D;  2EIK B;  5LGN A;  1K34 A;  4DR4 O;  1RPR A;  2VWK A;  1OCR C;  4JI1 B;  4TQD A;  5EBL C;  1Q3E A;  1YCI A;  1V55 C;  1XNR O;  1JOY A;  1WLE A;  1ZUQ A;  2Q73 A;  3ZHT A;  4IYH A;  5EYP B;  1AIL A;  3FB6 C;  2KSD A;  2E76 B;  3UO3 A;  4XDK A;  1TVK A;  3OEH G;  3HKD B;  1Y6X A;  1XMQ O;  3JSN A;  2OIE A;  1XI1 A;  4B3S B;  4NXN O;  1V9P A;  4WF9 V;  3VBB A;  1YDX A;  4DUZ B;  1H2N A;  5GW7 A;  4BAY A;  1AR4 A;  4JYB A;  4IL6 Z;  3VOU A;  1F23 A;  4LNU B;  2GUZ B;  4UCU A;  1GN2 A;  1HNX B;  3CE2 A;  1F4M A;  2VS0 A;  4JI1 O;  3W7U A;  1KB9 F;  1RFY A;  2V7Q G;  2QE7 G;  4JV5 B;  1W59 A;  3T4D A;  5L3E A;  3A2F A;  2YDE A;  3ZHS A;  4U7N A;  5L3F A;  4I9Q A;  3TGU H;  2DYR B;  1QU7 A;  5LHI A;  3HKC B;  1Q86 W;  3CCE V;  4B3S O;  4OXS A;  3EFF K;  3FB5 C;  4DUZ O;  4JAU A;  5EK0 A;  4U7O A;  1GM8 A;  2RNB A;  2QWR B;  2ZE7 A;  2ETN A;  1VIB A;  1HWY A;  3CX5 F;  3KCX A;  4FZ1 A;  2Q5Z A;  1HNX O;  1VQ4 V;  3ZMZ A;  4FLU A;  2BTO A;  5AG2 A;  1HR0 B;  4K8Z A;  3T2M A;  4JV5 O;  5FNV B;  2HVJ C;  1ZSP A;  3OGI B;  2R9A A;  4TQF A;  4D7S A;  3E22 B;  4OPA A;  4QE7 A;  4WFF A; 
#chains in the Genus database with same CATH homology
 3I5D A;  3H9V A;  4DW0 A;  4DW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...