3H9VA

Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 3.1 angstroms
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
330
structure length
329
Chain Sequence
GTLNRFTQALVIAYVIGYVFVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords P2X purinoceptor
publication title Crystal structure of the ATP-gated P2X(4) ion channel in the closed state.
pubmed doi rcsb
source organism Danio rerio
total genus 68
structure length 329
sequence length 330
ec nomenclature
pdb deposition date 2009-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 3h9vA01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 3h9vA02
4DW0A 3I5DA 4DW1A 3H9VA
chains in the Genus database with same CATH superfamily
4DO2A 2IJHA 2VWKA 4LFBB 3OFNG 3HKBB 2JJ1G 4IT5A 2QWRB 1Y74A 2EIKB 3APOA 4HYOA 1OZ0A 1XNRB 4BW5A 1QR8A 2A3QA 2WLLA 5IE9A 4TOIA 4FLTA 2BTQA 2EIJB 3I56V 5CA0B 5KA6A 2AZ2A 1GN3A 4LNUB 2QWPB 2KQXA 2QR4A 4LWSA 2IW5A 4DV1O 1H8EG 2RCVA 4DYLA 1VQKV 4DK0A 2QWQB 1FFTB 1N34B 2P7TC 3LSUA 2ZIMA 3ZMVA 2ZCEA 1Q6UA 2ADPA 4BR6A 1F4MA 2EILC 3JD0A 1P7GA 1OCRB 3ETEA 4MT8A 5LXTA 2HFEC 1XNQB 2GHYA 4JI4O 2F4VO 1K4DC 5KLVH 2EZPA 4D7TA 3DSQA 2XNDG 1SC5B 3ZMUA 5IJ9A 2P67A 1ZSPA 4JPRA 4JYBA 1S77D 1JR9A 3SPIA 3ZRXA 1GH6A 1QHTA 4TV9B 3VQXA 2PZSA 2UXBO 1K92A 4LF8B 1Y66A 1P4RA 3HPLC 2DYRB 3SJBC 4MSWC 2LFSA 2YC0A 3AG2C 1SQPH 3OGCC 5JCOC 1FJGO 3TETA 2RQ6A 4X1KA 3RYIB 3A2FA 1K34A 1JOYA 3ZRVA 4FZ0A 2NLJC 1S5HC 4JI6O 4W4LA 3EHBB 1R6NA 3W7SA 3HKCA 3OMAB 1PM9A 1Q82W 1K9MW 1ORQC 5CB4A 1CPYA 2CTWA 2LGWA 1I94O 3LDDA 1PNKA 1AB3A 2LP7A 4MVMA 4G27B 4JYAB 2ZE5A 2Z5UA 1XILA 1MSWD 2ZD9A 4YHHB 5LGNA 4X9QA 3ABTA 3JASB 5J9PC 2B1GA 5LMUO 3O9OA 4XDKA 3OTOO 4JZGA 1FD9A 3K08A 1JMKC 1OCCC 4YJ3A 1WNSA 2X7RB 3FX7A 3CPWU 1LR1A 1WPXA 1AR1B 4UVAA 4PDVA 1VQ7V 3OW2U 5FLXN 1BL8A 4NTWA 4O4LB 2YXHA 2CGNA 3K06A 2OIEA 2KSDA 4TV8B 5CBFA 2Q5ZA 4HNAB 4ZBMA 4KFMA 4PA6A 2YSUB 4JI5O 3WB2A 3E22B 2HKOA 1B06A 4X20A 4ZOLA 1N36O 5B3SC 4OPAA 1TUBA 1IZ3A 1GM9A 3ZHRA 4DV6O 4UCRA 1VIBA 1AVMA 2DYSB 2JS5A 3ABKB 4R50A 4I4TB 3JD4A 3VQYA 2QJ1A 1IXBA 4H33A 5GW7A 4KL1A 4IIJA 4HAMA 3E2EA 1B6QA 1TAEA 3JAWB 4U7NA 2Q0AA 1JX9A 1R1BA 3BAAA 5IWAO 1VQ9V 1QLEB 1MSDA 2R9RB 3ABMB 2ZM6O 3X2QC 4JI1B 3HKEB 4DUYB 1S5JA 2LJ2A 3RYHA 2LW1A 2GUZB 2XAFA 2UU9O 3VBBA 2CK3G 2WLIB 4P9OA 1SS3A 1OCZC 5H2FZ 4QE9A 1HNZO 3QTCA 3CX5F 3E8HA 1M5IA 1URFA 1I0HA 1FKAO 2IU0A 3SPGA 4RQEA 2QM4A 4UCSA 2QKCA 1IVSA 2PUSA 1KECA 4WFAV 1JCHA 3RYFB 4MTGA 2QTOA 1VEWA 1VQNV 3R66A 4J9ZB 3SYQA 4K0KB 4B3RB 3CE2A 5JH7B 4R8CA 4YJ2B 2F95B 5LGUA 1RM1B 1KYOF 2R72A 3ZHQA 1XMQO 5JVDA 5DEDA 5JWPA 1XUQA 4HBNA 4FPPA 1P49A 2E3CA 1VMGA 1MNGA 3DXRA 3WG7C 1Q3EA 3OUFA 1YHQV 2RDCA 2E76B 2DWDC 4I55A 2XT9A 2Q6AA 3UT5B 1ZL8B 2AW9A 1HR0O 5IYZB 2JS3A 1YXBA 1FXKB 1PL0A 3N2KB 3KCXA 4TT3G 2D2CB 2EULA 4CH3A 2G38A 2EINC 2HP8A 1N33O 1Y67A 2R9AA 3K5MA 3CMAV 4R7CA 2AXTZ 2ZDIC 4FM2A 4X66O 3OD4A 3K5NA 4NXMO 1XBLA 4DUZO 3T1CA 4BIOA 4TWKA 5A9GA 1I7FA 3QO8A 5EC1C 3LDEA 5CA1A 4MVOA 1Q86W 3OM3B 1KP2A 1H2NA 1S76D 4ASUG 1W2BU 1PP9H 5LA6B 4IL6Z 2B1IA 2ZNIA 2PYJA 3P3NA 5IY5C 1OJHA 1SRYA 1N32B 1ZTEA 4X1YA 3CHXA 3ZN1A 4UUJC 1TVKA 2YIBA 5KMGB 2Q67A 5KHGA 1WA8B 4EKWA 4PI2A 1G8MA 1HNXO 4PDMA 1QLNA 4AQYB 3CC2V 4BAYA 1Q5OA 2F43G 2ZR3A 4TUYB 5LHHA 1JJOA 1VQ5V 2Q7GA 3RN4A 3FYIB 1WB7A 4JYCA 4X62O 3BEHA 4E2LA 4JV5B 5IYBO 2QKSA 2Y69C 3ZN0A 3T1YB 3G6EV 3THOA 3D36C 2YEVB 2BSKB 4JYYA 3IFXA 2JGDB 1F51A 2FB5A 3C3SA 4JI7O 3SPHA 1US6A 2QM7A 2XOKG 2Y4TA 3HKDA 2QWOB 2FMLA 1Y74B 4Q20A 4PJ0Z 4X64O 4LR3A 1O9GA 1I08A 3SDLA 2WLLB 1S5LZ 4JTCB 3PN1A 4F4LA 4DR7O 2BTQB 1MG1A 3AG7A 4U3FH 3U11A 1IBLO 4YXWG 4LWSB 4FFBA 2PYLA 1BMFG 1SQQH 4GKJO 2Q9LA 3NR7A 2PTMA 1PNMA 4IHJA 4UVCA 1VQLV 4KXRA 2DW4A 1AI4A 1XMOO 5IJ0A 2GDSA 2IBZH 1KB9F 5CMUA 2WLNA 1NS1A 4UV8A 4PDLA 4U7OA 2GV9A 4LF6O 4B3MO 5LXTB 2OTJV 4UV9A 1ZX3A 3AG3C 1YTFB 2ATKC 1GTOA 3AG1C 3ZMSA 3T2MA 4LH7A 2CTQA 2GSMB 4FK5C 3ETDA 2P6JA 1OCOB 5IJ9B 5EYPA 3B8MA 3QNEA 4K8ZA 1YJNV 5B1BC 3ABLB 1VF7A 3W7XA 3CJHB 2JRIA 1W59A 3H01A 2C2AA 1H38A 4DV2O 1XDCA 1VF5B 1Q6IA 3ZBHA 5GTHZ 4O4JA 4N21A 1M56B 1WP7A 1JJ2U 4NR1A 1Q8IA 3L71H 4NTYA 1S0VA 4DV1B 2RN9A 1M93A 2HR3A 4DRXA 1QLEC 2EX3A 4JAAA 4LF7O 4I9WA 5LMNO 1M9NA 3HKCB 1F7YA 4E4EA 4DR6B 1V54B 1QVFU 5JJEB 2ZE7A 3L70H 3E8GA 1BHBA 4BIZA 2MK3A 2JEXA 3JD3A 4JI4B 2CUGA 5JCOA 2L6LA 1K7DA 5J2UA 3WB1A 1YIJV 3JAMN 1N0JA 4IGGA 3VQVA 2V4DA 3H9VA 1LUVA 4X1IB 1S72V 5BY1A 1UFIA 5B1OA 3Q4HA 5H9CA 3SJAC 4G2KA 5D5PA 3LDCA 4YJ3B 4DR1O 4LF4B 4DR2O 2OTLV 2WA4A 3UKMA 4DR4O 2EIMC 2ZXWC 4J9YB 3HR0A 1PL4A 3CMEV 1BSMA 4OPHA 3SYOA 1IDSA 3CWBH 4MVQA 2RJZA 3ASNB 1AR4A 3AG4C 1GAXA 3GWKC 2PF4E 1PKXA 4I50A 4PV1B 3CRCA 3OEHG 5KX5A 1H2GA 1R3IC 3ASOC 2AHZA 5FL7G 3APQA 4FVMA 4JTDB 3SGIA 3L9DA 1AI6A 4X20B 4ZOLB 3FYEB 2X0LA 1TUBB 2ZIOA 4X65O 1I94B 3JAKA 4AI8A 4KHPO 3P3PA 1BHAA 2H3OA 2DMXA 4DR3B 1QU7A 4OGQB 5GONA 2FL4A 2IM9A 5LMUB 3RVYA 1RPRA 4IIJB 2VQEB 4FLUA 3OTOB 5J2TA 1Q90D 3BPZA 3CRAA 1Y76A 4PELA 2OCCC 5KAFZ 4ZHQA 3RGBA 2HJDA 3ZHUA 3OR7C 1YITV 3RYHB 1YJWV 5EBWC 3KKYA 1Z5WA 5LP6A 5H6QA 3TXQA 2W0FC 4Z1VA 2A7WA 4NXNO 4LF9B 4DK1A 1KC8W 2ZE6A 2Q73A 4O4IB 2CGOA 4DV7B 4Q6GA 5CA3A 3E35A 1HP8A 3LSSA 4GLXA 3A0HZ 1EFRG 3QF7A 1NBMG 2UXNA 2YIDA 3JCZA 5CBGA 5LHIA 2LFRA 1XNRO 1AI7A 5B5EZ 1M57C 4IYHA 4BIUA 3AK1A 2E74B 3S3WA 5JVDB 4NB5A 1DK1A 3UQ8A 3LUTB 2Z3YA 2Y0PA 1NU1H 1IBMB 1HW7A 3SR2C 1N0NA 4MVSA 4G28B 2ADQB 1I5YA 4JI0O 2P06A 3JYCA 2ZM6B 1FPOA 4I55B 1VP7A 1K5QA 3DGEA 5FNVA 1N34O 3JATA 2M7WA 4CC5A 1DTOA 1HNZB 4UB8Z 4FLWA 1TUEB 1Y6XA 5IYDO 3RYCA 3ZHVA 4X89A 1XNQO 4O2BA 5KUKA 2GTSA 4MW8A 2F23A 3ZHSA 4LCUC 1EN4A 3KCYA 5EBLC 4B3SB 4JI2B 5CA1B 5BMVA 3C90A 2XAHA 1FFXA 4GCZA 1V9PA 2OYQA 4DW1A 1XEQA 1NH2B 4JTAB 4PDRA 2ZDIA 1YTFD 1FXVA 4DXWA 4KP4A 1CEZA 2R70A 1NTZH 4YIPA 2Q4PA 1EN6A 1YSCA 5EIBD 3CCMV 1AI5A 2CE4A 2CH7A 1K4CC 2VS0A 1K3EA 4YIOA 1HR0B 1R3LC 4LF5B 4X1YB 4HZ3A 3ZIAG 3RBZA 3WU2Z 1TVKB 2LO1A 3IAYA 3L72H 2ODMA 4I0XA 3EXAA 1N33B 5KAIZ 3OEEG 3RVZA 2EJRA 4QPJA 2K9PA 4WBNA 3F5WC 1S3JA 3MD0A 4BW9A 2GBOA 1ZUQA 3F5TA 4GZRB 4JYAO 1H2SB 3J7AU 1VQ8V 1SZXA 3OTFA 4GX1A 5KHHA 4TSFG 4EB6A 2HEPA 1U96A 3F7YC 2UUAB 3CD6V 4CS4A 1L8DA 2FKXA 3JSNA 1H2MA 2UXDB 1N4CA 3HKDB 5K1XA 1LNQA 1MZEA 4O2AA 5BR8B 3ZHTA 3E89A 2Z0AA 1G1XB 3CRQA 3JD1A 3DC5A 5K1PA 1I5XA 2MW2B 1SA0A 3ZCCA 3FFQA 3D36A 1WB8A 4Z1MG 4BWAA 3H1HH 3T1HB 1SQBH 5C8YA 4JAVA 1IXMA 2XAJA 3K5LA 4FFBB 1HNXB 2ZNJA 4GYCB 2DE0X 2PI5A 3JALA 3HB3B 1FYJA 1WN7A 1HNWB 1K5SA 3TXSA 2EIKC 4I9QA 1IX9A 5IJ0B 1M1KW 3CCEV 3AK3A 4LFCB 4X8AA 2ITCC 4GX5A 2L35A 5L3EA 2X6CA 4H37A 4GUNA 2EIJC 5EK0A 2UXCB 2N04A 3OT7A 4OXSA 1U97A 3DC6A 1IBKO 1X59A 4NTXA 5CBHA 4PA7A 1XQ8A 5EYPB 5LYJA 4JI1O 3K0GA 4JI8B 3FB8C 4DUYO 1K33A 2EILB 1KD1W 1GM7A 4J11A 5HFLA 1TA8A 3ZMZA 5ITZA 1Q43A 2ZT9B 4GKKB 2V1DA 3STZC 4FJCC 3PJSK 2A9HA 3ZS8C 3L75H 1OCRC 4O4JB 4RQFA 3QO7A 1UJWB 3G71V 3MAQA 1MOFA 5EZYA 4YY3B 3CEIA 1T5EA 4DRXB 2Q8VA 5KA5A 2LQTA 1NR1A 4DV4B 4K0KO 3G67A 4B3RO 3CP1A 3A8TA 1PD3A 3B4SA 4B3MB 3SYAA 4UB6Z 3AG2B 3IC9A 1M4UA 3CCLV 1KP3A 5L3BA 2XTAA 5J2UB 2DYRC 5IT9N 2M6YA 4DR5B 2A06H 4AHCA 1FAFA 3CXHF 4N23A 4B3TB 3Q4HB 3I5DA 1GRJA 1K97A 1NVPD 3IJ4A 4JASA 2Y48A 4B08A 3T4ZA 4DV2B 2IH3C 5KHJA 2AGAA 4LFAO 5E79Z 1RFYA 3G6BA 2YS8A 1ROPA 2WPDG 5H6RA 1W0JG 4EFEA 4LF7B 4DV0B 4I50B 5KX5B 1EM1A 1GKFA 1OCCB 3AK2A 3U0ZA 3SJQC 1YJ9V 4F6EA 1AR5A 2WA3A 5FPOA 2HVKC 4J42A 1VQ4V 2LW7A 2YXLA 1NTMH 2PGGA 3MHSC 4QGPA 3NXSA 1YDXA 2VQFB 3JAKB 4MTFA 3E83A 5B1AB 1BT8A 4CZZA 2XAQA 4PA3A 3LNNA 2QTSA 1D5NA 5KUMA 2WLHA 1MA1A 2W6JG 5GONB 3UO3A 2N74A 5J2TB 4UFZA 2KG7A 2DWEC 2X6BA 1HDJA 3B40A 3A0RA 1SQGA 1J5EO 2Q69A 3UO2A 3QO5A 5BXZA 5B3SB 4B7EA 1Y76B 2ZKOA 1ZWIC 3ZJZA 4DR4B 1BE3H 1PNLA 4ZHQB 4AQYO 1NH2D 2IU3A 2ZR2A 1OV9A 1L1FA 4UCUA 4WCEV 1QR9A 3CRMA 1R3JC 3N2GA 5LP6B 2DYSC 3ABKC 2WAMA 4WFEA 3LSQA 1YVWA 4JV5O 2HVJC 1V55B 1R73A 2YI8A 3T1YO 1YEWA 5DECA 1AROP 2CDYA 4CS3A 3R65A 2YIBD 1SQFA 2ILMA 3BA8A 4X1KB 3X2QB 2O57A 3RW0A 2FYUH 2IJIA 1JPXA 2Q7HA 2QE7G 3ABMC 2NR5A 2H8PC 1GN4A 4OX9O 1QVGU 3BVOA 2IJJA 3E8FA 1OCZB 5CB4B 3JARA 4J80A 1IURA 3TK1A 4QNHB 2UUBO 2JK5C 3CYOA 4PI0A 2JDIG 2F4VB 1XOUA 2HHHO 4NKGB 1F23A 2QWNB 2BE3A 5JQGA 4Z2WA 4CC6A 4IYIA 1DF4A 2Y4UA 4JI3O 2DJVA 1AJPA 2E5LO 2V7QG 2X6AA 3KZIZ 5FNVB 3RFRA 2UUCO 4F6RA 1G4YB 2H94A 4QJFB 2WLKA 1RM1C 2UXBB 4DW0A 2IH1C 4J10A 3RYCB 1WLEA 3QG5A 2YEVA 1GN2A 3ICXA 2JJ2G 5D5QA 1FJGB 4O2BB 3T4DA 3BABA 3H1JH 4K35A 3FKSG 1EBOA 1EZVH 1L0NH 4U3JA 3L73H 4EFBA 2Q0OC 4JI6B 1VF6C 1NT2B 1YCIA 4DV3O 4DV5O 4JF3A 4CBCA 2Y0IA 2EINB 3K0DA 1FXKC 4KUMA 5BMVB 2DQ3A 4XDJA 1FFXB 4MVRA 1RSOA 3W7UA 4FZ1A 4NYKA 4UVBA 4QIWF 4FLYA 1AP6A 4ZI7A 1WAZA 2P22C 2VWJA 1KKDA 2ETNA 1R6TA 4JI0B 4FLVA 1YZBA 2XAGA 2CH7B 3G80A 3MHHC 1Q7YW 2RMKB 2F93B 3OE7G 3S3XA 4ABMA 4RO2A 5L3GA 1RPOA 4I0XB 4DR6O 2GTAA 2PI4A 1KUQA 1AILA 1Z5VA 1DF5A 1L0LH 4UXNA 3UM7A 1OHHG 1QNMA 4WBNB 1JFFA 1Y4MA 1GM8A 1Q81W 4PD4F 3SYPA 5JJNB 1P7BA 3K9AA 1BS3A 3M99B 5IY5B 3H1KH 4LC1A 2WSSG 4JI5B 4RAIA 2OIGA 4EB6B 1XHZA 4FFKA 1X4TA 1JA8A 1H2KA 3ZRWA 1N36B 3ZMTA 5L3CA 2QEXV 3CJHA 1QBZA 2WLMA 4LF4O 4LFBO 2NNUA 4WF9V 4DV6B 3E86A 3FAVA 4O2AB 1NVPB 2QM8A 4PA9A 4J7KA 1VQOV 2Y69B 1LUWA 1SA0B 3CB2A 4WFHA 3F7VC 3TCUA 3CRRA 1H8HG 3WB0A 3SPJA 3K58A 1SERA 4O4HA 5BZBA 5IWAB 5C8YB 3DXRB 4FM1A 1GO3F 3BRCA 2HJFC 1JQ0A 3JALB 3OUSA 1GN6A 4H0LB 2EBOA 1WJZA 2KB1A 2UU9B 2AHYA 2LGQA 4QPKA 3SPCA 4DR3O 3GB7C 1KKCA 4K8XA 4PA4A 5LOVA 4H44B 1HWYA 4X1IA 4AILC 2VQEO 4GX2A 2E75B 2YUAA 5KHKA 3B8NA 4J7JA 3J80N 4LBEC 1FXHA 3OMIB 2F66C 3HKBA 3CS5A 5LYJB 1EZJA 2OWOA 3FB6C 4WFFA 1KBHA 3WFVA 4K3AA 1A32A 5B1NA 1XMQB 5B1AC 2R9IA 1MMMA 1SQVH 5ITZB 2QKAA 4TQDA 3AG3B 3K04A 5CA0A 1P84F 5LHGA 4JZ2A 4LF8O 3AG1B 4LNUA 4GT1A 2IJKA 4LF9O 3KG2A 3MDSA 4C7UA 4UCTA 5EZYB 2N05A 4DV7O 4ZKIA 1R3KC 3RT3C 3H1IH 5EIBC 4A5UB 3CCVV 2QA4V 5B1BB 1OCOC 3IGAC 5GTIZ 2RNBA 1AP5A 1E79G 3A0BZ 1W0KG 3ABLC 3GWOA 5LP6C 4D6TH 4JAUA 3W7TA 2DN9A 4GX0A 4R6ZA 1PV0A 5AG2A 1BGYH 1PPJH 2XHBA 1V55C 2CTRA 3AEIA 1MABG 2JIZG 3JD2A 3D3QA 2B9ZA 4X66B 3CSXA 4FLXA 1IBKB 3G4SV 1M56C 4P30A 4NXMB 1IBMO 5KHIA 1F4NA 4YHHO 2XUMA 4DUZB 5H5NA 2YIAA 2ZE8A 2Q7EA 2BTOA 2A79B 5C93A 3SYCA 1V54C 4CH6A 1N8RW 1KQSU 4TV9A 1D2DA 4FIPC 1AJNA 3UCSC 3K5OA 1M90W 3GVMA 1Q6HA 2WWWA 5DM6V 1BCCH 1WP8A 1XREA 3O65A 5CN0A 4D7SA 4O4IA 1G6UA 3RYIA 3TGUH 1EN5A 5E1AC 3CCQV 3ML0A 3BCCH 4ZIBA 1CP9A 3FB5C 5LL6Y 1GK9A 4UCVA 4B3SO 2K1EA 3QVNA 4MVZA 4JI2O 2EIMB 2ZXWB 3K3WA 4IHJB 4RWUA 3N27A 2JVDA 3ZEDA 1VQ6V 3ZRSA 4X62B 5FPRA 2BOCC 3U10A 4RUEA 3AG4B 3K59A 3CCJV 3CC4V 3J81N 2NN4A 2QDOA 3JASA 3P30A 1BQZA 3ASOB 3ASNC 4MS2A 2KG7B 1E1QG 1SKVA 3BA9A 4EEQA 4LF5O 1DLBA 4JI7B 4XBFA 2KKWA 3RWRD 2QGNA 1THZA 3CCRV 2B5UA 2FTKA 1NKDA 2YDEA 3OGIB 4X64B 3L74H 4LFAB 2DQ0A 4MW3A 5LBQA 5IYCO 3N2GB 1COWG 2HG5C 3ETGA 1SETA 4O4LA 1R6KA 2VRZA 4DR7B 1NI8A 4I5SA 4TV8A 4TQFA 2Q68A 3STLC 4FLZA 4HNAA 2DOSA 1BQ0A 3P32A 3D8CA 1IBLB 3M7MX 3E22A 2OCCB 3BHPA 1XL6A 1NTKH 2UUAO 4GKJB 2A0LA 2WLJA 1GMGA 1O9HA 4X88A 2UXDO 5B66Z 1XMOB 1SQXH 4CS2A 2BOBC 2EJ7A 2ITDC 5BR8O 3E8BA 4I4TA 1RP3B 5L3DA 3JARB 4WFBV 2YICA 4LF6B 1BZKA 3JAWA 4CH4A 3JSLA 3T1HO 1J5EB 1YI2V 1WPBA 1VARA 1E1RG 2W6IG 3LNMB 2PY5A 5JQGB 4P9PA 2ZQMA 3HKEA 3OAAG 2JEUA 1HNWO 1ZLZA 1M57B 4W4KA 2GUZA 4F6RB 2WLIA 5EC2C 2D3OW 1K8AW 4LFCO 4MTXA 3TJTA 4B7KA 1JVMA 5LGTA 4H13B 1J95A 2XASA 3OMNB 5HFMA 5L3FA 1XI1A 4I7ZB 2UXCO 1CXZB 3FD9A 4U3JB 4ICGA 3OR6C 3RYFA 2W0XA 5LMNB 4OX9B 3C3TA 4UCOA 3ETQA 4J41A 4WFGA 4JI8O 5JH7A 1B04A 3VQWA 2ZINA 5TISZ 4YJ2A 1YF2A 4PHZA 1VQMV 3B77A 2UUBB 1FS0G 2AZ0A 1ZAUA 1RSOB 1QQCA 1NZ6A 4GKKO 2HHHB 2YI9A 2P4VA 4ZI7B 2P90A 5EBMC 5F2VO 4L87A 2OT5A 5DN6G 4JGSA 1UPGA 2EZOA 3B09A 3BFRA 1VF6A 3CCSV 3CCUV 3K57A 3DTUB 1AJQA 1NR7A 1D5AA 2P5OA 4RUFA 4YY3O 4JI3B 5A2QN 4NVPA 2E5LB 1VQPV 3UT5A 3ABUA 1ZL8A 2P4KA 1N32O 2UUCB 1MZFA 4XDLA 5IYZA 1ENVA 1KU9A 4DV4O 1XHXA 3M8AA 4DR1B 1FXKA 4DR2B 3N2KA 2UXXA 2QSAA 2BCCH 2F1MA 2OCHA 3H1LH 1JFFB 3ZX6A 2JGUA 2CAZC 1SESA 3EVKA 4DR5O 4DV3B 4DV5B 2YXYA 1H2LA 4B3TO 3D3IA 4LP8A 3ZRWB 1B3QA 4X65B 4CH5A 4KHPB 3BY6A 3FAVB 4QE7A 1SZTA 3B2EE 4FM0A 3FB7C 1TGOA 1KMIZ 4FMTA 5LA6A 3I55V 1K73W 1QCEA 3CXCU 3JCUZ 4O4HB 4DV0O 4L8JA 2ARHA 3K9SA 5KMGA 3CC7V 4LH6A 1WA8A 1SF9A 2HLDG 3EFFK 4TUYA 5IDJA 3VOUA 3JATB 1NJIW 5JJJB 2VQFO 1NQTA 4P2ZA 3K03A 3K79A 4NXNB 4MTOA 3IC7A 5LOVB 1DGSA 4MVUA 2CTPA 3WG7B 3W7WA 1XL4A 1Z2GA 2BSKA 4J7ZA 3SJCC 2JGDA
chains in the Genus database with same CATH topology
4DW0A 3I5DA 4DW1A 3H9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DW0 A;  3I5D A;  4DW1 A;  3H9V A; 
#chains in the Genus database with same CATH topology
 4DO2 A;  2IJH A;  2VWK A;  4LFB B;  3OFN G;  3HKB B;  2JJ1 G;  4IT5 A;  2QWR B;  1Y74 A;  2EIK B;  3APO A;  4HYO A;  1OZ0 A;  1XNR B;  4BW5 A;  1QR8 A;  2A3Q A;  2WLL A;  5IE9 A;  4TOI A;  4FLT A;  2BTQ A;  2EIJ B;  3I56 V;  5CA0 B;  5KA6 A;  2AZ2 A;  1GN3 A;  4LNU B;  2QWP B;  2KQX A;  2QR4 A;  4LWS A;  2IW5 A;  4DV1 O;  1H8E G;  2RCV A;  4DYL A;  1VQK V;  4DK0 A;  2QWQ B;  1FFT B;  1N34 B;  2P7T C;  3LSU A;  2ZIM A;  3ZMV A;  2ZCE A;  1Q6U A;  2ADP A;  4BR6 A;  1F4M A;  2EIL C;  3JD0 A;  1P7G A;  1OCR B;  3ETE A;  4MT8 A;  5LXT A;  2HFE C;  1XNQ B;  2GHY A;  4JI4 O;  2F4V O;  1K4D C;  5KLV H;  2EZP A;  4D7T A;  3DSQ A;  2XND G;  1SC5 B;  3ZMU A;  5IJ9 A;  2P67 A;  1ZSP A;  4JPR A;  4JYB A;  1S77 D;  1JR9 A;  3SPI A;  3ZRX A;  1GH6 A;  1QHT A;  4TV9 B;  3VQX A;  2PZS A;  2UXB O;  1K92 A;  4LF8 B;  1Y66 A;  1P4R A;  3HPL C;  2DYR B;  3SJB C;  4MSW C;  2LFS A;  2YC0 A;  3AG2 C;  1SQP H;  3OGC C;  5JCO C;  1FJG O;  3TET A;  2RQ6 A;  4X1K A;  3RYI B;  3A2F A;  1K34 A;  1JOY A;  3ZRV A;  4FZ0 A;  2NLJ C;  1S5H C;  4JI6 O;  4W4L A;  3EHB B;  1R6N A;  3W7S A;  3HKC A;  3OMA B;  1PM9 A;  1Q82 W;  1K9M W;  1ORQ C;  5CB4 A;  1CPY A;  2CTW A;  2LGW A;  1I94 O;  3LDD A;  1PNK A;  1AB3 A;  2LP7 A;  4MVM A;  4G27 B;  4JYA B;  2ZE5 A;  2Z5U A;  1XIL A;  1MSW D;  2ZD9 A;  4YHH B;  5LGN A;  4X9Q A;  3ABT A;  3JAS B;  5J9P C;  2B1G A;  5LMU O;  3O9O A;  4XDK A;  3OTO O;  4JZG A;  1FD9 A;  3K08 A;  1JMK C;  1OCC C;  4YJ3 A;  1WNS A;  2X7R B;  3FX7 A;  3CPW U;  1LR1 A;  1WPX A;  1AR1 B;  4UVA A;  4PDV A;  1VQ7 V;  3OW2 U;  5FLX N;  1BL8 A;  4NTW A;  4O4L B;  2YXH A;  2CGN A;  3K06 A;  2OIE A;  2KSD A;  4TV8 B;  5CBF A;  2Q5Z A;  4HNA B;  4ZBM A;  4KFM A;  4PA6 A;  2YSU B;  4JI5 O;  3WB2 A;  3E22 B;  2HKO A;  1B06 A;  4X20 A;  4ZOL A;  1N36 O;  5B3S C;  4OPA A;  1TUB A;  1IZ3 A;  1GM9 A;  3ZHR A;  4DV6 O;  4UCR A;  1VIB A;  1AVM A;  2DYS B;  2JS5 A;  3ABK B;  4R50 A;  4I4T B;  3JD4 A;  3VQY A;  2QJ1 A;  1IXB A;  4H33 A;  5GW7 A;  4KL1 A;  4IIJ A;  4HAM A;  3E2E A;  1B6Q A;  1TAE A;  3JAW B;  4U7N A;  2Q0A A;  1JX9 A;  1R1B A;  3BAA A;  5IWA O;  1VQ9 V;  1QLE B;  1MSD A;  2R9R B;  3ABM B;  2ZM6 O;  3X2Q C;  4JI1 B;  3HKE B;  4DUY B;  1S5J A;  2LJ2 A;  3RYH A;  2LW1 A;  2GUZ B;  2XAF A;  2UU9 O;  3VBB A;  2CK3 G;  2WLI B;  4P9O A;  1SS3 A;  1OCZ C;  5H2F Z;  4QE9 A;  1HNZ O;  3QTC A;  3CX5 F;  3E8H A;  1M5I A;  1URF A;  1I0H A;  1FKA O;  2IU0 A;  3SPG A;  4RQE A;  2QM4 A;  4UCS A;  2QKC A;  1IVS A;  2PUS A;  1KEC A;  4WFA V;  1JCH A;  3RYF B;  4MTG A;  2QTO A;  1VEW A;  1VQN V;  3R66 A;  4J9Z B;  3SYQ A;  4K0K B;  4B3R B;  3CE2 A;  5JH7 B;  4R8C A;  4YJ2 B;  2F95 B;  5LGU A;  1RM1 B;  1KYO F;  2R72 A;  3ZHQ A;  1XMQ O;  5JVD A;  5DED A;  5JWP A;  1XUQ A;  4HBN A;  4FPP A;  1P49 A;  2E3C A;  1VMG A;  1MNG A;  3DXR A;  3WG7 C;  1Q3E A;  3OUF A;  1YHQ V;  2RDC A;  2E76 B;  2DWD C;  4I55 A;  2XT9 A;  2Q6A A;  3UT5 B;  1ZL8 B;  2AW9 A;  1HR0 O;  5IYZ B;  2JS3 A;  1YXB A;  1FXK B;  1PL0 A;  3N2K B;  3KCX A;  4TT3 G;  2D2C B;  2EUL A;  4CH3 A;  2G38 A;  2EIN C;  2HP8 A;  1N33 O;  1Y67 A;  2R9A A;  3K5M A;  3CMA V;  4R7C A;  2AXT Z;  2ZDI C;  4FM2 A;  4X66 O;  3OD4 A;  3K5N A;  4NXM O;  1XBL A;  4DUZ O;  3T1C A;  4BIO A;  4TWK A;  5A9G A;  1I7F A;  3QO8 A;  5EC1 C;  3LDE A;  5CA1 A;  4MVO A;  1Q86 W;  3OM3 B;  1KP2 A;  1H2N A;  1S76 D;  4ASU G;  1W2B U;  1PP9 H;  5LA6 B;  4IL6 Z;  2B1I A;  2ZNI A;  2PYJ A;  3P3N A;  5IY5 C;  1OJH A;  1SRY A;  1N32 B;  1ZTE A;  4X1Y A;  3CHX A;  3ZN1 A;  4UUJ C;  1TVK A;  2YIB A;  5KMG B;  2Q67 A;  5KHG A;  1WA8 B;  4EKW A;  4PI2 A;  1G8M A;  1HNX O;  4PDM A;  1QLN A;  4AQY B;  3CC2 V;  4BAY A;  1Q5O A;  2F43 G;  2ZR3 A;  4TUY B;  5LHH A;  1JJO A;  1VQ5 V;  2Q7G A;  3RN4 A;  3FYI B;  1WB7 A;  4JYC A;  4X62 O;  3BEH A;  4E2L A;  4JV5 B;  5IYB O;  2QKS A;  2Y69 C;  3ZN0 A;  3T1Y B;  3G6E V;  3THO A;  3D36 C;  2YEV B;  2BSK B;  4JYY A;  3IFX A;  2JGD B;  1F51 A;  2FB5 A;  3C3S A;  4JI7 O;  3SPH A;  1US6 A;  2QM7 A;  2XOK G;  2Y4T A;  3HKD A;  2QWO B;  2FML A;  1Y74 B;  4Q20 A;  4PJ0 Z;  4X64 O;  4LR3 A;  1O9G A;  1I08 A;  3SDL A;  2WLL B;  1S5L Z;  4JTC B;  3PN1 A;  4F4L A;  4DR7 O;  2BTQ B;  1MG1 A;  3AG7 A;  4U3F H;  3U11 A;  1IBL O;  4YXW G;  4LWS B;  4FFB A;  2PYL A;  1BMF G;  1SQQ H;  4GKJ O;  2Q9L A;  3NR7 A;  2PTM A;  1PNM A;  4IHJ A;  4UVC A;  1VQL V;  4KXR A;  2DW4 A;  1AI4 A;  1XMO O;  5IJ0 A;  2GDS A;  2IBZ H;  1KB9 F;  5CMU A;  2WLN A;  1NS1 A;  4UV8 A;  4PDL A;  4U7O A;  2GV9 A;  4LF6 O;  4B3M O;  5LXT B;  2OTJ V;  4UV9 A;  1ZX3 A;  3AG3 C;  1YTF B;  2ATK C;  1GTO A;  3AG1 C;  3ZMS A;  3T2M A;  4LH7 A;  2CTQ A;  2GSM B;  4FK5 C;  3ETD A;  2P6J A;  1OCO B;  5IJ9 B;  5EYP A;  3B8M A;  3QNE A;  4K8Z A;  1YJN V;  5B1B C;  3ABL B;  1VF7 A;  3W7X A;  3CJH B;  2JRI A;  1W59 A;  3H01 A;  2C2A A;  1H38 A;  4DV2 O;  1XDC A;  1VF5 B;  1Q6I A;  3ZBH A;  5GTH Z;  4O4J A;  4N21 A;  1M56 B;  1WP7 A;  1JJ2 U;  4NR1 A;  1Q8I A;  3L71 H;  4NTY A;  1S0V A;  4DV1 B;  2RN9 A;  1M93 A;  2HR3 A;  4DRX A;  1QLE C;  2EX3 A;  4JAA A;  4LF7 O;  4I9W A;  5LMN O;  1M9N A;  3HKC B;  1F7Y A;  4E4E A;  4DR6 B;  1V54 B;  1QVF U;  5JJE B;  2ZE7 A;  3L70 H;  3E8G A;  1BHB A;  4BIZ A;  2MK3 A;  2JEX A;  3JD3 A;  4JI4 B;  2CUG A;  5JCO A;  2L6L A;  1K7D A;  5J2U A;  3WB1 A;  1YIJ V;  3JAM N;  1N0J A;  4IGG A;  3VQV A;  2V4D A;  3H9V A;  1LUV A;  4X1I B;  1S72 V;  5BY1 A;  1UFI A;  5B1O A;  3Q4H A;  5H9C A;  3SJA C;  4G2K A;  5D5P A;  3LDC A;  4YJ3 B;  4DR1 O;  4LF4 B;  4DR2 O;  2OTL V;  2WA4 A;  3UKM A;  4DR4 O;  2EIM C;  2ZXW C;  4J9Y B;  3HR0 A;  1PL4 A;  3CME V;  1BSM A;  4OPH A;  3SYO A;  1IDS A;  3CWB H;  4MVQ A;  2RJZ A;  3ASN B;  1AR4 A;  3AG4 C;  1GAX A;  3GWK C;  2PF4 E;  1PKX A;  4I50 A;  4PV1 B;  3CRC A;  3OEH G;  5KX5 A;  1H2G A;  1R3I C;  3ASO C;  2AHZ A;  5FL7 G;  3APQ A;  4FVM A;  4JTD B;  3SGI A;  3L9D A;  1AI6 A;  4X20 B;  4ZOL B;  3FYE B;  2X0L A;  1TUB B;  2ZIO A;  4X65 O;  1I94 B;  3JAK A;  4AI8 A;  4KHP O;  3P3P A;  1BHA A;  2H3O A;  2DMX A;  4DR3 B;  1QU7 A;  4OGQ B;  5GON A;  2FL4 A;  2IM9 A;  5LMU B;  3RVY A;  1RPR A;  4IIJ B;  2VQE B;  4FLU A;  3OTO B;  5J2T A;  1Q90 D;  3BPZ A;  3CRA A;  1Y76 A;  4PEL A;  2OCC C;  5KAF Z;  4ZHQ A;  3RGB A;  2HJD A;  3ZHU A;  3OR7 C;  1YIT V;  3RYH B;  1YJW V;  5EBW C;  3KKY A;  1Z5W A;  5LP6 A;  5H6Q A;  3TXQ A;  2W0F C;  4Z1V A;  2A7W A;  4NXN O;  4LF9 B;  4DK1 A;  1KC8 W;  2ZE6 A;  2Q73 A;  4O4I B;  2CGO A;  4DV7 B;  4Q6G A;  5CA3 A;  3E35 A;  1HP8 A;  3LSS A;  4GLX A;  3A0H Z;  1EFR G;  3QF7 A;  1NBM G;  2UXN A;  2YID A;  3JCZ A;  5CBG A;  5LHI A;  2LFR A;  1XNR O;  1AI7 A;  5B5E Z;  1M57 C;  4IYH A;  4BIU A;  3AK1 A;  2E74 B;  3S3W A;  5JVD B;  4NB5 A;  1DK1 A;  3UQ8 A;  3LUT B;  2Z3Y A;  2Y0P A;  1NU1 H;  1IBM B;  1HW7 A;  3SR2 C;  1N0N A;  4MVS A;  4G28 B;  2ADQ B;  1I5Y A;  4JI0 O;  2P06 A;  3JYC A;  2ZM6 B;  1FPO A;  4I55 B;  1VP7 A;  1K5Q A;  3DGE A;  5FNV A;  1N34 O;  3JAT A;  2M7W A;  4CC5 A;  1DTO A;  1HNZ B;  4UB8 Z;  4FLW A;  1TUE B;  1Y6X A;  5IYD O;  3RYC A;  3ZHV A;  4X89 A;  1XNQ O;  4O2B A;  5KUK A;  2GTS A;  4MW8 A;  2F23 A;  3ZHS A;  4LCU C;  1EN4 A;  3KCY A;  5EBL C;  4B3S B;  4JI2 B;  5CA1 B;  5BMV A;  3C90 A;  2XAH A;  1FFX A;  4GCZ A;  1V9P A;  2OYQ A;  4DW1 A;  1XEQ A;  1NH2 B;  4JTA B;  4PDR A;  2ZDI A;  1YTF D;  1FXV A;  4DXW A;  4KP4 A;  1CEZ A;  2R70 A;  1NTZ H;  4YIP A;  2Q4P A;  1EN6 A;  1YSC A;  5EIB D;  3CCM V;  1AI5 A;  2CE4 A;  2CH7 A;  1K4C C;  2VS0 A;  1K3E A;  4YIO A;  1HR0 B;  1R3L C;  4LF5 B;  4X1Y B;  4HZ3 A;  3ZIA G;  3RBZ A;  3WU2 Z;  1TVK B;  2LO1 A;  3IAY A;  3L72 H;  2ODM A;  4I0X A;  3EXA A;  1N33 B;  5KAI Z;  3OEE G;  3RVZ A;  2EJR A;  4QPJ A;  2K9P A;  4WBN A;  3F5W C;  1S3J A;  3MD0 A;  4BW9 A;  2GBO A;  1ZUQ A;  3F5T A;  4GZR B;  4JYA O;  1H2S B;  3J7A U;  1VQ8 V;  1SZX A;  3OTF A;  4GX1 A;  5KHH A;  4TSF G;  4EB6 A;  2HEP A;  1U96 A;  3F7Y C;  2UUA B;  3CD6 V;  4CS4 A;  1L8D A;  2FKX A;  3JSN A;  1H2M A;  2UXD B;  1N4C A;  3HKD B;  5K1X A;  1LNQ A;  1MZE A;  4O2A A;  5BR8 B;  3ZHT A;  3E89 A;  2Z0A A;  1G1X B;  3CRQ A;  3JD1 A;  3DC5 A;  5K1P A;  1I5X A;  2MW2 B;  1SA0 A;  3ZCC A;  3FFQ A;  3D36 A;  1WB8 A;  4Z1M G;  4BWA A;  3H1H H;  3T1H B;  1SQB H;  5C8Y A;  4JAV A;  1IXM A;  2XAJ A;  3K5L A;  4FFB B;  1HNX B;  2ZNJ A;  4GYC B;  2DE0 X;  2PI5 A;  3JAL A;  3HB3 B;  1FYJ A;  1WN7 A;  1HNW B;  1K5S A;  3TXS A;  2EIK C;  4I9Q A;  1IX9 A;  5IJ0 B;  1M1K W;  3CCE V;  3AK3 A;  4LFC B;  4X8A A;  2ITC C;  4GX5 A;  2L35 A;  5L3E A;  2X6C A;  4H37 A;  4GUN A;  2EIJ C;  5EK0 A;  2UXC B;  2N04 A;  3OT7 A;  4OXS A;  1U97 A;  3DC6 A;  1IBK O;  1X59 A;  4NTX A;  5CBH A;  4PA7 A;  1XQ8 A;  5EYP B;  5LYJ A;  4JI1 O;  3K0G A;  4JI8 B;  3FB8 C;  4DUY O;  1K33 A;  2EIL B;  1KD1 W;  1GM7 A;  4J11 A;  5HFL A;  1TA8 A;  3ZMZ A;  5ITZ A;  1Q43 A;  2ZT9 B;  4GKK B;  2V1D A;  3STZ C;  4FJC C;  3PJS K;  2A9H A;  3ZS8 C;  3L75 H;  1OCR C;  4O4J B;  4RQF A;  3QO7 A;  1UJW B;  3G71 V;  3MAQ A;  1MOF A;  5EZY A;  4YY3 B;  3CEI A;  1T5E A;  4DRX B;  2Q8V A;  5KA5 A;  2LQT A;  1NR1 A;  4DV4 B;  4K0K O;  3G67 A;  4B3R O;  3CP1 A;  3A8T A;  1PD3 A;  3B4S A;  4B3M B;  3SYA A;  4UB6 Z;  3AG2 B;  3IC9 A;  1M4U A;  3CCL V;  1KP3 A;  5L3B A;  2XTA A;  5J2U B;  2DYR C;  5IT9 N;  2M6Y A;  4DR5 B;  2A06 H;  4AHC A;  1FAF A;  3CXH F;  4N23 A;  4B3T B;  3Q4H B;  3I5D A;  1GRJ A;  1K97 A;  1NVP D;  3IJ4 A;  4JAS A;  2Y48 A;  4B08 A;  3T4Z A;  4DV2 B;  2IH3 C;  5KHJ A;  2AGA A;  4LFA O;  5E79 Z;  1RFY A;  3G6B A;  2YS8 A;  1ROP A;  2WPD G;  5H6R A;  1W0J G;  4EFE A;  4LF7 B;  4DV0 B;  4I50 B;  5KX5 B;  1EM1 A;  1GKF A;  1OCC B;  3AK2 A;  3U0Z A;  3SJQ C;  1YJ9 V;  4F6E A;  1AR5 A;  2WA3 A;  5FPO A;  2HVK C;  4J42 A;  1VQ4 V;  2LW7 A;  2YXL A;  1NTM H;  2PGG A;  3MHS C;  4QGP A;  3NXS A;  1YDX A;  2VQF B;  3JAK B;  4MTF A;  3E83 A;  5B1A B;  1BT8 A;  4CZZ A;  2XAQ A;  4PA3 A;  3LNN A;  2QTS A;  1D5N A;  5KUM A;  2WLH A;  1MA1 A;  2W6J G;  5GON B;  3UO3 A;  2N74 A;  5J2T B;  4UFZ A;  2KG7 A;  2DWE C;  2X6B A;  1HDJ A;  3B40 A;  3A0R A;  1SQG A;  1J5E O;  2Q69 A;  3UO2 A;  3QO5 A;  5BXZ A;  5B3S B;  4B7E A;  1Y76 B;  2ZKO A;  1ZWI C;  3ZJZ A;  4DR4 B;  1BE3 H;  1PNL A;  4ZHQ B;  4AQY O;  1NH2 D;  2IU3 A;  2ZR2 A;  1OV9 A;  1L1F A;  4UCU A;  4WCE V;  1QR9 A;  3CRM A;  1R3J C;  3N2G A;  5LP6 B;  2DYS C;  3ABK C;  2WAM A;  4WFE A;  3LSQ A;  1YVW A;  4JV5 O;  2HVJ C;  1V55 B;  1R73 A;  2YI8 A;  3T1Y O;  1YEW A;  5DEC A;  1ARO P;  2CDY A;  4CS3 A;  3R65 A;  2YIB D;  1SQF A;  2ILM A;  3BA8 A;  4X1K B;  3X2Q B;  2O57 A;  3RW0 A;  2FYU H;  2IJI A;  1JPX A;  2Q7H A;  2QE7 G;  3ABM C;  2NR5 A;  2H8P C;  1GN4 A;  4OX9 O;  1QVG U;  3BVO A;  2IJJ A;  3E8F A;  1OCZ B;  5CB4 B;  3JAR A;  4J80 A;  1IUR A;  3TK1 A;  4QNH B;  2UUB O;  2JK5 C;  3CYO A;  4PI0 A;  2JDI G;  2F4V B;  1XOU A;  2HHH O;  4NKG B;  1F23 A;  2QWN B;  2BE3 A;  5JQG A;  4Z2W A;  4CC6 A;  4IYI A;  1DF4 A;  2Y4U A;  4JI3 O;  2DJV A;  1AJP A;  2E5L O;  2V7Q G;  2X6A A;  3KZI Z;  5FNV B;  3RFR A;  2UUC O;  4F6R A;  1G4Y B;  2H94 A;  4QJF B;  2WLK A;  1RM1 C;  2UXB B;  4DW0 A;  2IH1 C;  4J10 A;  3RYC B;  1WLE A;  3QG5 A;  2YEV A;  1GN2 A;  3ICX A;  2JJ2 G;  5D5Q A;  1FJG B;  4O2B B;  3T4D A;  3BAB A;  3H1J H;  4K35 A;  3FKS G;  1EBO A;  1EZV H;  1L0N H;  4U3J A;  3L73 H;  4EFB A;  2Q0O C;  4JI6 B;  1VF6 C;  1NT2 B;  1YCI A;  4DV3 O;  4DV5 O;  4JF3 A;  4CBC A;  2Y0I A;  2EIN B;  3K0D A;  1FXK C;  4KUM A;  5BMV B;  2DQ3 A;  4XDJ A;  1FFX B;  4MVR A;  1RSO A;  3W7U A;  4FZ1 A;  4NYK A;  4UVB A;  4QIW F;  4FLY A;  1AP6 A;  4ZI7 A;  1WAZ A;  2P22 C;  2VWJ A;  1KKD A;  2ETN A;  1R6T A;  4JI0 B;  4FLV A;  1YZB A;  2XAG A;  2CH7 B;  3G80 A;  3MHH C;  1Q7Y W;  2RMK B;  2F93 B;  3OE7 G;  3S3X A;  4ABM A;  4RO2 A;  5L3G A;  1RPO A;  4I0X B;  4DR6 O;  2GTA A;  2PI4 A;  1KUQ A;  1AIL A;  1Z5V A;  1DF5 A;  1L0L H;  4UXN A;  3UM7 A;  1OHH G;  1QNM A;  4WBN B;  1JFF A;  1Y4M A;  1GM8 A;  1Q81 W;  4PD4 F;  3SYP A;  5JJN B;  1P7B A;  3K9A A;  1BS3 A;  3M99 B;  5IY5 B;  3H1K H;  4LC1 A;  2WSS G;  4JI5 B;  4RAI A;  2OIG A;  4EB6 B;  1XHZ A;  4FFK A;  1X4T A;  1JA8 A;  1H2K A;  3ZRW A;  1N36 B;  3ZMT A;  5L3C A;  2QEX V;  3CJH A;  1QBZ A;  2WLM A;  4LF4 O;  4LFB O;  2NNU A;  4WF9 V;  4DV6 B;  3E86 A;  3FAV A;  4O2A B;  1NVP B;  2QM8 A;  4PA9 A;  4J7K A;  1VQO V;  2Y69 B;  1LUW A;  1SA0 B;  3CB2 A;  4WFH A;  3F7V C;  3TCU A;  3CRR A;  1H8H G;  3WB0 A;  3SPJ A;  3K58 A;  1SER A;  4O4H A;  5BZB A;  5IWA B;  5C8Y B;  3DXR B;  4FM1 A;  1GO3 F;  3BRC A;  2HJF C;  1JQ0 A;  3JAL B;  3OUS A;  1GN6 A;  4H0L B;  2EBO A;  1WJZ A;  2KB1 A;  2UU9 B;  2AHY A;  2LGQ A;  4QPK A;  3SPC A;  4DR3 O;  3GB7 C;  1KKC A;  4K8X A;  4PA4 A;  5LOV A;  4H44 B;  1HWY A;  4X1I A;  4AIL C;  2VQE O;  4GX2 A;  2E75 B;  2YUA A;  5KHK A;  3B8N A;  4J7J A;  3J80 N;  4LBE C;  1FXH A;  3OMI B;  2F66 C;  3HKB A;  3CS5 A;  5LYJ B;  1EZJ A;  2OWO A;  3FB6 C;  4WFF A;  1KBH A;  3WFV A;  4K3A A;  1A32 A;  5B1N A;  1XMQ B;  5B1A C;  2R9I A;  1MMM A;  1SQV H;  5ITZ B;  2QKA A;  4TQD A;  3AG3 B;  3K04 A;  5CA0 A;  1P84 F;  5LHG A;  4JZ2 A;  4LF8 O;  3AG1 B;  4LNU A;  4GT1 A;  2IJK A;  4LF9 O;  3KG2 A;  3MDS A;  4C7U A;  4UCT A;  5EZY B;  2N05 A;  4DV7 O;  4ZKI A;  1R3K C;  3RT3 C;  3H1I H;  5EIB C;  4A5U B;  3CCV V;  2QA4 V;  5B1B B;  1OCO C;  3IGA C;  5GTI Z;  2RNB A;  1AP5 A;  1E79 G;  3A0B Z;  1W0K G;  3ABL C;  3GWO A;  5LP6 C;  4D6T H;  4JAU A;  3W7T A;  2DN9 A;  4GX0 A;  4R6Z A;  1PV0 A;  5AG2 A;  1BGY H;  1PPJ H;  2XHB A;  1V55 C;  2CTR A;  3AEI A;  1MAB G;  2JIZ G;  3JD2 A;  3D3Q A;  2B9Z A;  4X66 B;  3CSX A;  4FLX A;  1IBK B;  3G4S V;  1M56 C;  4P30 A;  4NXM B;  1IBM O;  5KHI A;  1F4N A;  4YHH O;  2XUM A;  4DUZ B;  5H5N A;  2YIA A;  2ZE8 A;  2Q7E A;  2BTO A;  2A79 B;  5C93 A;  3SYC A;  1V54 C;  4CH6 A;  1N8R W;  1KQS U;  4TV9 A;  1D2D A;  4FIP C;  1AJN A;  3UCS C;  3K5O A;  1M90 W;  3GVM A;  1Q6H A;  2WWW A;  5DM6 V;  1BCC H;  1WP8 A;  1XRE A;  3O65 A;  5CN0 A;  4D7S A;  4O4I A;  1G6U A;  3RYI A;  3TGU H;  1EN5 A;  5E1A C;  3CCQ V;  3ML0 A;  3BCC H;  4ZIB A;  1CP9 A;  3FB5 C;  5LL6 Y;  1GK9 A;  4UCV A;  4B3S O;  2K1E A;  3QVN A;  4MVZ A;  4JI2 O;  2EIM B;  2ZXW B;  3K3W A;  4IHJ B;  4RWU A;  3N27 A;  2JVD A;  3ZED A;  1VQ6 V;  3ZRS A;  4X62 B;  5FPR A;  2BOC C;  3U10 A;  4RUE A;  3AG4 B;  3K59 A;  3CCJ V;  3CC4 V;  3J81 N;  2NN4 A;  2QDO A;  3JAS A;  3P30 A;  1BQZ A;  3ASO B;  3ASN C;  4MS2 A;  2KG7 B;  1E1Q G;  1SKV A;  3BA9 A;  4EEQ A;  4LF5 O;  1DLB A;  4JI7 B;  4XBF A;  2KKW A;  3RWR D;  2QGN A;  1THZ A;  3CCR V;  2B5U A;  2FTK A;  1NKD A;  2YDE A;  3OGI B;  4X64 B;  3L74 H;  4LFA B;  2DQ0 A;  4MW3 A;  5LBQ A;  5IYC O;  3N2G B;  1COW G;  2HG5 C;  3ETG A;  1SET A;  4O4L A;  1R6K A;  2VRZ A;  4DR7 B;  1NI8 A;  4I5S A;  4TV8 A;  4TQF A;  2Q68 A;  3STL C;  4FLZ A;  4HNA A;  2DOS A;  1BQ0 A;  3P32 A;  3D8C A;  1IBL B;  3M7M X;  3E22 A;  2OCC B;  3BHP A;  1XL6 A;  1NTK H;  2UUA O;  4GKJ B;  2A0L A;  2WLJ A;  1GMG A;  1O9H A;  4X88 A;  2UXD O;  5B66 Z;  1XMO B;  1SQX H;  4CS2 A;  2BOB C;  2EJ7 A;  2ITD C;  5BR8 O;  3E8B A;  4I4T A;  1RP3 B;  5L3D A;  3JAR B;  4WFB V;  2YIC A;  4LF6 B;  1BZK A;  3JAW A;  4CH4 A;  3JSL A;  3T1H O;  1J5E B;  1YI2 V;  1WPB A;  1VAR A;  1E1R G;  2W6I G;  3LNM B;  2PY5 A;  5JQG B;  4P9P A;  2ZQM A;  3HKE A;  3OAA G;  2JEU A;  1HNW O;  1ZLZ A;  1M57 B;  4W4K A;  2GUZ A;  4F6R B;  2WLI A;  5EC2 C;  2D3O W;  1K8A W;  4LFC O;  4MTX A;  3TJT A;  4B7K A;  1JVM A;  5LGT A;  4H13 B;  1J95 A;  2XAS A;  3OMN B;  5HFM A;  5L3F A;  1XI1 A;  4I7Z B;  2UXC O;  1CXZ B;  3FD9 A;  4U3J B;  4ICG A;  3OR6 C;  3RYF A;  2W0X A;  5LMN B;  4OX9 B;  3C3T A;  4UCO A;  3ETQ A;  4J41 A;  4WFG A;  4JI8 O;  5JH7 A;  1B04 A;  3VQW A;  2ZIN A;  5TIS Z;  4YJ2 A;  1YF2 A;  4PHZ A;  1VQM V;  3B77 A;  2UUB B;  1FS0 G;  2AZ0 A;  1ZAU A;  1RSO B;  1QQC A;  1NZ6 A;  4GKK O;  2HHH B;  2YI9 A;  2P4V A;  4ZI7 B;  2P90 A;  5EBM C;  5F2V O;  4L87 A;  2OT5 A;  5DN6 G;  4JGS A;  1UPG A;  2EZO A;  3B09 A;  3BFR A;  1VF6 A;  3CCS V;  3CCU V;  3K57 A;  3DTU B;  1AJQ A;  1NR7 A;  1D5A A;  2P5O A;  4RUF A;  4YY3 O;  4JI3 B;  5A2Q N;  4NVP A;  2E5L B;  1VQP V;  3UT5 A;  3ABU A;  1ZL8 A;  2P4K A;  1N32 O;  2UUC B;  1MZF A;  4XDL A;  5IYZ A;  1ENV A;  1KU9 A;  4DV4 O;  1XHX A;  3M8A A;  4DR1 B;  1FXK A;  4DR2 B;  3N2K A;  2UXX A;  2QSA A;  2BCC H;  2F1M A;  2OCH A;  3H1L H;  1JFF B;  3ZX6 A;  2JGU A;  2CAZ C;  1SES A;  3EVK A;  4DR5 O;  4DV3 B;  4DV5 B;  2YXY A;  1H2L A;  4B3T O;  3D3I A;  4LP8 A;  3ZRW B;  1B3Q A;  4X65 B;  4CH5 A;  4KHP B;  3BY6 A;  3FAV B;  4QE7 A;  1SZT A;  3B2E E;  4FM0 A;  3FB7 C;  1TGO A;  1KMI Z;  4FMT A;  5LA6 A;  3I55 V;  1K73 W;  1QCE A;  3CXC U;  3JCU Z;  4O4H B;  4DV0 O;  4L8J A;  2ARH A;  3K9S A;  5KMG A;  3CC7 V;  4LH6 A;  1WA8 A;  1SF9 A;  2HLD G;  3EFF K;  4TUY A;  5IDJ A;  3VOU A;  3JAT B;  1NJI W;  5JJJ B;  2VQF O;  1NQT A;  4P2Z A;  3K03 A;  3K79 A;  4NXN B;  4MTO A;  3IC7 A;  5LOV B;  1DGS A;  4MVU A;  2CTP A;  3WG7 B;  3W7W A;  1XL4 A;  1Z2G A;  2BSK A;  4J7Z A;  3SJC C;  2JGD A; 
#chains in the Genus database with same CATH homology
 4DW0 A;  3I5D A;  4DW1 A;  3H9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...