4MSWC

Y78 ester mutant of kcsa in high k+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
total genus 43
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mswC00
1R3KC 3ASNC 3T4ZA 1OCCC 4H33A 4MVRA 1KKDA 1OCRC 3ASOC 4J9YB 4R6ZA 3FB5C 1K4DC 2HVJC 2A79B 4P2ZA 2KB1A 4RUFA 3UM7A 3WG7C 1R3LC 3VOUA 2QTOA 3ABMC 4PA9A 3SPCA 1J95A 4X89A 3ZJZA 4ZBMA 2OCCC 3OUFA 4PA3A 4X88A 3LNMB 5B1AC 5KUMA 4WFEA 3T2MA 3RBZA 1M56C 4GX5A 4H37A 4MVOA 4PDVA 2WLJA 3TETA 3OR7C 3LDEA 4QE9A 4P9PA 1P7BA 3STZC 3OR6C 3FB7C 4WFHA 1JVMA 1V55C 2ATKC 4G27B 1OCOC 3AG2C 2HVKC 2HG5C 4JTCB 4MVZA 1ZWIC 2H8PC 2DYSC 2EILC 3K0GA 2AHYA 5EK0A 2A0LA 5CBFA 2DWDC 5CBHA 2EIMC 3K08A 3JYCA 1V54C 2Q69A 2IH1C 3LDDA 4MVSA 3SPIA 3SYCA 5E1AC 4MS2A 1ORQC 3T4DA 3EFFK 2X6CA 3BEHA 1OCZC 4R50A 4HYOA 3K04A 4PA7A 4CBCA 4G28B 3LUTB 4MVMA 2JK5C 3T1CA 4LBEC 4XDKA 4PDLA 3SYPA 2WLNA 3X2QC 3F7VC 2WLIB 2AHZA 2Q68A 4TWKA 3ZRSA 1R3IC 3K0DA 3SPJA 2ZD9A 2WLIA 4LCUC 5EBWC 1XL4A 3K06A 4MTOA 4UUJC 1R3JC 2WLMA 3RVYA 2ITCC 3ABKC 3AG3C 3F7YC 3E8BA 3OGCC 3R65A 4I9WA 2BOBC 2BOCC 1XL6A 5BZBA 2EIJC 4QNHB 3SPGA 4LP8A 3HPLC 4R7CA 2Q6AA 4MVQA 3SYAA 3F5WC 1M57C 4F4LA 4XDLA 3PJSK 3IFXA 4MSWC 2WLLA 4P30A 3RVZA 2HJFC 4X8AA 4R8CA 5KUKA 3GB7C 2DYRC 4RUEA 5EC2C 4DXWA 1LNQA 2X6BA 3E83A 4KFMA 3KG2A 4JTAB 4PA6A 4HZ3A 3STLC 5CBGA 4MVUA 3K03A 4MW3A 3SJQC 4P9OA 2DWEC 3UKMA 2WLHA 2R9RB 3E8FA 3ABLC 3RW0A 3E8GA 5IY5C 2IH3C 2A9HA 3E8HA 3E86A 4MTFA 4RO2A 5B3SC 5J9PC 4OXSA 2HFEC 4PA4A 3FB6C 4PDMA 5EBLC 2ITDC 3LDCA 4GX1A 3OUSA 4XDJA 2WLLB 2ZXWC 2QKSA 2NLJC 2Q67A 2P7TC 4MTGA 4EKWA 4RAIA 2EINC 1G4YB 2EIKC 1S5HC 2K1EA 4WFFA 3AG4C 3SYOA 1K4CC 2X6AA 2WLKA 4GX0A 4J9ZB 4JTDB 5B1BC 5EBMC 2Y69C 1BL8A 3AG1C 3FB8C 1QLEC 4PDRA 4QE7A 3SPHA 4BW5A 4MW8A 3IGAC 4WFGA 3SYQA 3TCUA 5EC1C 2W0FC 4GX2A 2YEVA 3E89A
chains in the Genus database with same CATH superfamily
3HKCB 3ZN1A 1PNKA 1U96A 4AI8A 2HHHO 4BAYA 2OTLV 1SESA 1BE3H 3SPCA 1H8HG 3OUFA 4TV9B 2LJ2A 3CC2V 1FYJA 5B1OA 1JMKC 3QTCA 4EFEA 4GKJO 4WFHA 2EULA 2UUCB 4JI5B 2DQ3A 1AR5A 4A5UB 1JFFA 1VQOV 1XMOB 3CCVV 4TV9A 1I94O 2Q69A 2RJZA 1OHHG 3BAAA 1NQTA 4FLVA 4DV2O 1Q8IA 3TXSA 1XNQO 4DV3O 1H2GA 2QM4A 5EIBD 1W0JG 2FTKA 4DR3O 3K0DA 4LFCB 2F43G 3CP1A 4I55A 3MHHC 1XDCA 2O57A 4EB6A 4F6RA 3VQVA 1B06A 3NR7A 4PI0A 3T1YB 2GTAA 5IT9N 4X62O 2IBZH 4LH6A 4X66O 4ZOLA 5CBGA 2E75B 3B2EE 3LSSA 1VEWA 1N0JA 2P4VA 3K5OA 4RO2A 1JJ2U 3JAKB 3OTFA 1KECA 4YXWG 2FMLA 2QKSA 4FFKA 4EKWA 2WLKA 1HR0O 4JI4O 1WJZA 1JPXA 3HR0A 1AI4A 4L87A 1BQ0A 3BPZA 1WA8B 3ASNC 1OCRC 3OMAB 2A79B 3UM7A 3ZHVA 1QU7A 1K5QA 4FMTA 4OX9O 5BR8O 3L73H 2A3QA 3OEHG 2UXDB 2V4DA 1TUEB 3S3WA 5L3GA 1R73A 2LGQA 3IC7A 3PN1A 1O9HA 2UXDO 2EZOA 2GV9A 1YSCA 4ZI7B 5CBHA 1HNZB 2YI9A 4MS2A 1NVPD 5DECA 5JVDB 4TV8B 4FPPA 4YJ2A 3B8NA 3OMIB 4UVCA 3W7WA 4GLXA 1AILA 2BE3A 1PPJH 1AJNA 4FM2A 1EBOA 2WLIA 2GDSA 2N74A 1SZXA 1RSOA 5CN0A 2UXXA 1AP5A 3APOA 2CTWA 1KYOF 1XNQB 2GSMB 1NU1H 3H1KH 4MVQA 3DXRB 1DGSA 1VF6C 4N23A 2UXCO 2CK3G 1H2MA 3CHXA 1EZJA 4O4IB 5C93A 3OFNG 4LF6B 4D7TA 3JCUZ 1JR9A 2F1MA 4YY3O 1BCCH 1EM1A 1GO3F 1WB8A 2P4KA 4O4IA 1OJHA 3VQWA 3EVKA 2UUAO 2M6YA 1S72V 4LC1A 1VMGA 2QWQB 4O2BA 1K4DC 2NN4A 2QEXV 1XEQA 2QTOA 3FD9A 1SS3A 1MG1A 4LNUA 4X89A 1IURA 4DR2O 2ADQB 1FJGO 1RSOB 5IJ0A 5LP6B 1VQMV 3UT5B 3ETDA 4GX5A 2ETNA 3G4SV 3ZRVA 2LQTA 4X9QA 1YTFB 5H9CA 1VQNV 4JAAA 3CC4V 4JTCB 4D6TH 4JGSA 1IBKO 3MHSC 4ZHQB 5K1PA 2ZT9B 2ZE6A 2ZNIA 3T4DA 4B7KA 1FFXA 1EFRG 3K9SA 3X2QB 2ZIOA 2Q0AA 5JCOC 4GUNA 4PA7A 1JJOA 3L71H 1PD3A 1OCCB 4ZHQA 2FKXA 1VIBA 5EZYB 3SDLA 1QLEB 1NJIW 3ABKC 2Y69B 4FVMA 5LGUA 4QNHB 2GBOA 3FKSG 3RYFA 3QO8A 3CCSV 1GM9A 1I7FA 3K59A 4TOIA 3E35A 3IAYA 4HZ3A 4E4EA 1KP3A 5IYZB 1XI1A 2DW4A 4JASA 5IYZA 3Q4HB 5IY5C 4BIUA 4AQYO 2JEXA 1IBMB 2F4VO 4CC5A 2IJKA 3ZRWA 1YJ9V 4I0XA 2X6AA 2IM9A 4U3JA 4IGGA 1DTOA 4PDRA 4IHJA 1N34O 2VWKA 3CRAA 1SETA 4N21A 3E2EA 2QKCA 1GM7A 2V1DA 1KKDA 1K3EA 3HKCA 2JDIG 1WB7A 1BZKA 1WP8A 3AK3A 3SJBC 4J7JA 4ZOLB 1NTKH 1N8RW 3H1JH 3LNMB 2DN9A 2XAHA 1NTZH 4NXNB 4B3TO 1E1QG 4DR6O 1AJQA 2LW7A 3DSQA 1JVMA 4I50A 1PP9H 2R70A 4HNAB 2E5LO 2AHYA 4JI7B 5LA6A 3SPIA 5LL6Y 1N33B 3KZIZ 4LF9O 2GUZA 2R9IA 5J2UA 1RPRA 3W7SA 3WG7B 4MVMA 2PGGA 1YXBA 2A7WA 1Y76B 3GWKC 5LHIA 3E22B 3E22A 1JX9A 2Q68A 3ETQA 3ZRSA 1GK9A 2W6JG 1JFFB 4I55B 4LWSA 3ZHUA 3A2FA 3K57A 3K5MA 4DR4O 3T1YO 1N36O 1COWG 3MD0A 1JQ0A 1Q81W 4FM1A 4DR4B 1EN4A 4BW9A 4NYKA 4P30A 2HJFC 3UO2A 4R8CA 2VQEO 4LWSB 5EC2C 4UB8Z 2EJRA 4KFMA 2BSKB 1SQGA 2VQEB 4JI8O 4FZ0A 3OEEG 2OIGA 1WPBA 1A32A 2YC0A 1OCRB 4KHPB 3G71V 1XMOO 3CJHB 2P7TC 4MTGA 3U11A 4RAIA 1NKDA 1QR8A 2EIJB 3ZMSA 3BVOA 2QM7A 3C3SA 5LBQA 4BW5A 1LR1A 2Z3YA 1M5IA 1GN2A 4NXMB 2YEVA 2AGAA 1TVKB 3T4ZA 4BWAA 1UPGA 2YUAA 2YIDA 2CUGA 1XHZA 1X4TA 2YXHA 1J95A 4PD4F 2OYQA 5IYDO 3TETA 1V54B 2DYRB 2XHBA 2F66C 3AG2B 4DUYO 2ZE5A 2YDEA 1OV9A 3AG2C 2QM8A 4J80A 3CRCA 1YDXA 1NVPB 4EFBA 4MVSA 1V54C 1NS1A 2QE7G 2QWRB 5IYCO 3SJAC 2YSUB 3ABMB 4DUZO 1H2KA 4O2BB 2RMKB 4W4LA 1Q86W 2QGNA 4MT8A 1R3IC 1B3QA 3CRQA 1XL4A 4PELA 4X64B 1R3JC 3WU2Z 3BY6A 3ZHRA 1JCHA 2EIJC 4CH6A 1RPOA 2LFSA 4R7CA 3GB7C 3QO7A 1AB3A 3S3XA 1LNQA 2ARHA 4RWUA 3K5NA 1K7DA 3K3WA 5H2FZ 1XNRB 1FKAO 1KU9A 5LMNO 3E86A 4X20B 2PYJA 5J9PC 1SQVH 4PA4A 4FLTA 1Q5OA 3DXRA 5BR8B 2NLJC 4NR1A 4ZI7A 5JQGA 3EHBB 2Q9LA 4DV3B 3P30A 3IGAC 3C90A 2B5UA 1FXKB 3ZHTA 1R3KC 3RYIA 4G2KA 2Y0IA 4XBFA 4DR2B 1KD1W 4B3RO 5KHGA 1R3LC 3JSLA 4DUZB 2QJ1A 4PA9A 4X1IB 1NZ6A 2CTQA 4WFEA 3A8TA 2EBOA 4TT3G 5K1XA 2DOSA 4NXMO 2EIMB 4FM0A 2ATKC 1WLEA 4IT5A 1P84F 3H01A 3RYCB 1AI7A 3ZRXA 2Y0PA 1ORQC 5IJ9A 1XQ8A 1ZLZA 1VQ7V 4GKKO 1OCZC 1Z5WA 4BIZA 5L3FA 3IJ4A 3LUTB 4X64O 3F7VC 1VQKV 1H8EG 3CCRV 1Y66A 5IJ9B 2WLMA 5JJEB 1MABG 1XHXA 3RN4A 2EILB 4MTXA 3B4SA 4JI6O 4MSWC 4JAVA 4X8AA 4JTAB 4X65O 3STLC 1YCIA 4KL1A 1G6UA 1GM8A 4JF3A 4ABMA 3FAVB 2A9HA 5B3SC 3ZMUA 4GX1A 4JV5B 4UCSA 3N27A 1FXHA 2EINC 2K1EA 1SKVA 3SYOA 4JTDB 5B1BB 2ZINA 2BTQA 2KQXA 5EBMC 3WB1A 1QLEC 3HKBB 4U7NA 2EIKB 4LF7B 4WFGA 2CGNA 4RUEA 1K97A 3OGIB 1OCCC 2FYUH 5J2TB 1O9GA 1P49A 1CXZB 4PA3A 2ZCEA 5LYJB 1GN6A 3RWRD 3OR7C 4I4TB 1MSDA 5KAIZ 4I7ZB 1SZTA 3K0GA 3QG5A 1YI2V 4FK5C 4NKGB 2KSDA 4JI1B 3SYCA 5LP6C 2JJ1G 2WA4A 1BT8A 1ZX3A 1H2SB 2E3CA 4JI3O 4I50B 4G28B 1TA8A 5CB4A 1AR4A 4DV1B 2ZNJA 4FFBB 4Q20A 3SPJA 4DW0A 3P3PA 5KHJA 2RNBA 1YZBA 1W59A 3EXAA 3RVYA 5KHHA 4JI6B 1F51A 4AQYB 2QWNB 3CE2A 3HKEA 3Q4HA 1QNMA 3AK2A 2Q6AA 4PV1B 4WCEV 3MAQA 4XDLA 4LF7O 4PI2A 1FXVA 3E83A 3G67A 2QDOA 2BSKA 3T1HO 4CC6A 4C7UA 1GMGA 1HR0B 4DR6B 5IE9A 4JYCA 3APQA 2IW5A 4O4LA 1PL4A 3QO5A 1NH2B 3FB6C 4EEQA 3LDCA 1SRYA 3RYHB 2WLLB 4LF5B 4UCUA 1ZTEA 4LF8O 2EIKC 5E79Z 3AG4C 4YJ3A 4X65B 2Y4TA 3SPHA 3JAWA 3ZMTA 5CA3A 1HP8A 3CJHA 3AK1A 4J9YB 4RUFA 3GVMA 1IBMO 2F4VB 3CWBH 1WAZA 1H38A 3JD3A 1IBKB 4UV8A 1M4UA 4DV4B 4DK0A 1M9NA 3CB2A 1HNWO 4ZIBA 3ZHSA 2Z5UA 2KG7B 1HNWB 2HHHB 1SF9A 1M90W 1U97A 3B09A 4AHCA 1VQ6V 1IVSA 1X59A 1MA1A 2FB5A 2IJIA 3K58A 4DV6B 3EFFK 4J41A 4DV1O 3JD4A 3J80N 3RFRA 4H13B 1GN4A 1VP7A 3RYIB 3L75H 2UUCO 3RYHA 2ZIMA 1N34B 1BQZA 2WPDG 1DF5A 2XAJA 4YJ3B 5FPOA 5B5EZ 4LFBO 1QR9A 3OMNB 4RQFA 3OGCC 4I9WA 3SR2C 2PZSA 2HJDA 3JAKA 2UUBB 3N2KB 2X0LA 5D5QA 1LUVA 2Q7GA 4DXWA 2EJ7A 2MK3A 4KP4A 2CH7B 2LW1A 3K79A 5A9GA 1XBLA 3G6EV 2YEVB 2XT9A 1TVKA 3ZEDA 2P5OA 5EYPA 1M57B 2ZM6O 2CGOA 2Q67A 4LR3A 1G4YB 2R72A 4FJCC 1RM1B 5CA0A 4DR1B 2RQ6A 3FB8C 2YIAA 5EC1C 5IDJA 5JVDA 5GTHZ 1AR1B 3ETEA 4R6ZA 2L6LA 2QWOB 5KMGA 1FFTB 2YICA 4B3SB 1MOFA 1KBHA 2B1GA 1HNXB 1N33O 1S3JA 5DM6V 2ZQMA 2F93B 1MZFA 3OT7A 1XREA 3CCQV 4X1YB 4JYBA 2ILMA 4PHZA 4IIJA 2A0LA 4GKKB 4ICGA 4UCVA 5LP6A 4TQFA 2UXNA 1BGYH 1XUQA 2Q7HA 3HKBA 5L3CA 3GWOA 3ZX6A 4LF6O 3BEHA 4GT1A 4X1YA 2VQFB 2ZDIC 1ROPA 3CXHF 3SJCC 5GONA 1ZL8A 5EIBC 4IIJB 4NVPA 4JI4B 1AI6A 5IYBO 2ODMA 3AG3C 4FLXA 3ICXA 4RQEA 1RM1C 3ZMZA 2OIEA 5BZBA 1XL6A 5B66Z 1Z2GA 1RP3B 3SYAA 1M57C 4F4LA 2DYRC 1M56B 4MW3A 3HKDB 5JJNB 1ENVA 3HKDA 3RT3C 2D2CB 5CA1A 4JYYA 4YHHB 1HNZO 1MSWD 1KQSU 3ZMVA 1HWYA 5TISZ 3JARA 3JASB 1I5YA 2JJ2G 4LNUB 1BL8A 2DQ0A 3SYQA 4LH7A 4D7SA 5KA5A 4GKJB 4H33A 4MVRA 3MDSA 2E74B 2HVJC 4K0KB 4J10A 3CCUV 5H6QA 3LSUA 4CZZA 4J11A 4H37A 3WB2A 2PI4A 1GKFA 1Q43A 2VWJA 4X1KA 4DR5O 3NXSA 1H2LA 4X1KB 3F5TA 1OCOC 2A06H 2HG5C 1Y74A 2DYSC 2W0XA 2YS8A 4JI0B 1PM9A 3ABUA 5EZYA 1JA8A 2IH1C 1SQXH 1Y67A 2Y4UA 2OCCB 2LFRA 1QVFU 4FLYA 3LSQA 3TGUH 1BMFG 1QVGU 3ZS8C 3SYPA 1AJPA 2XASA 4Z1VA 4AILC 3O9OA 5JJJB 3L70H 5LOVB 1R1BA 4GZRB 3DTUB 4DV5O 5KHKA 4OX9B 4DRXA 2Q4PA 3D3IA 1WN7A 1DF4A 4DRXB 3DGEA 3F5WC 3H9VA 4KHPO 2HLDG 4U3FH 5LOVA 4J7ZA 2K9PA 1Q6IA 4F6RB 5B1AB 4IYHA 3G6BA 4JI2O 3ML0A 4E2LA 3OAAG 4YHHO 1Q3EA 4KUMA 1G1XB 4W4KA 3W7UA 1SA0B 3VBBA 3CD6V 1E1RG 3AG7A 1AROP 5LHHA 1K9MW 2YIBD 1Q7YW 1WP7A 5F2VO 1GH6A 2LGWA 3JAWB 1D5AA 2NNUA 1VQ4V 1PNMA 4K8ZA 3N2GA 2GTSA 4O2AB 3ABTA 5FLXN 3E89A 4QPJA 3FFQA 3ASOC 3TJTA 4DK1A 5IY5B 1I5XA 3VOUA 1HW7A 2ZR3A 3HB3B 4HNAA 1MNGA 1YJNV 4IYIA 2B1IA 4DR5B 1DLBA 3W7TA 2Z0AA 1R6KA 2GUZB 1YVWA 3H1HH 3K5LA 4P9PA 1WNSA 4GYCB 3JCZA 5LMUB 2PTMA 4MVZA 3M8AA 4O4HB 2KG7A 3ZCCA 4L8JA 5FNVA 1GRJA 5FNVB 1FJGB 3JYCA 5JH7B 1EN6A 1Q90D 4YIPA 5CA0B 5L3DA 4EB6B 5DEDA 4CS4A 4UCTA 4LFAB 4UVBA 4O4HA 3H1LH 4OPAA 3X2QC 2UXCB 3CCEV 1XMQO 2GHYA 2ZD9A 3ETGA 3JAMN 4MTOA 4LF9B 4B7EA 4DV2B 4WF9V 1SQFA 2WA3A 2BOCC 2CDYA 4O2AA 4LF8B 1SQPH 3VQYA 1J5EB 2PUSA 3OTOB 4DV7B 1NT2B 3IFXA 3N2KA 2WLLA 4WFBV 3AEIA 4WFAV 4H44B 1QCEA 3CX5F 1I0HA 4UCRA 3SJQC 4CS3A 3L9DA 1VARA 4CH3A 3E8FA 1MZEA 1NR1A 1PKXA 4LF5O 1M1KW 3ASOB 4JI7O 3CRRA 2UU9B 2CAZC 1Q6HA 1NBMG 4LF4B 1Y6XA 2P06A 2JS3A 4X20A 1E79G 5CBFA 1N32B 2RDCA 4O4JA 4DW1A 1VQPV 1OZ0A 4FLWA 3H1IH 2QTSA 1VF6A 4Q6GA 1UFIA 3IC9A 2ZE7A 2MW2B 1OCZB 3ZHQA 1L0NH 5H6RA 4Z1MG 3ZJZA 2CTPA 4X88A 5B1AC 4GCZA 1I08A 4O4JB 4PDVA 1FS0G 3QNEA 4TV8A 2HEPA 3SGIA 3D36C 3FB7C 4YJ2B 4JYAB 1V55C 3THOA 1XOUA 3I55V 5LXTB 1Z5VA 2EIMC 3BFRA 1K34A 3OW2U 4X1IA 2OT5A 2C2AA 2IU3A 2ZKOA 3P3NA 4NTYA 2QSAA 2AZ2A 1IBLO 3CS5A 4UCOA 4JI5O 4JZ2A 3T1CA 1PL0A 4LBEC 2CTRA 2VRZA 3RYCA 2OTJV 3DC6A 5EBWC 2X7RB 2RN9A 4J42A 1QBZA 1F7YA 4TUYB 2UUBO 3E8BA 5KHIA 2ZM6B 4DV6O 3R65A 5ITZA 4Z2WA 2DYSB 1L0LH 3SPGA 3HPLC 1OCOB 3TK1A 3K9AA 5C8YA 2XAFA 2FL4A 3W7XA 3C3TA 3R66A 1UJWB 4LFCO 5JQGB 2YXLA 2PI5A 4PA6A 1CP9A 4MVUA 3K03A 1IXBA 1KB9F 2H3OA 2WLHA 2UU9O 4B3SO 2P90A 3ABLC 2E76B 3RW0A 2JRIA 1J5EO 2JGDB 3ASNB 2ZXWC 4DR7B 4QIWF 1SC5B 1NTMH 1K4CC 4UVAA 4JI8B 3B8MA 5CA1B 4UV9A 1BSMA 2VS0A 1DK1A 4ZKIA 3D8CA 3OD4A 5IJ0B 2W0FC 4B3TB 1ZAUA 3CEIA 5D5PA 4ASUG 2DJVA 4WBNA 1YEWA 3ABMC 5KAFZ 2UUAB 1M56C 3UQ8A 1QLNA 5B1NA 5LYJA 4MVOA 2JGUA 2WLJA 4QE9A 4JZGA 2UXBO 1L8DA 5KA6A 2JS5A 1F23A 1YITV 4DO2A 4G27B 3ZRWB 1TGOA 1Y74B 1H2NA 2QKAA 2DMXA 4JPRA 1F4MA 2X6CA 3CSXA 3CYOA 3U0ZA 4DUYB 3K04A 1KUQA 2JK5C 3RYFB 1R6NA 4TWKA 2P6JA 5LA6B 4B08A 1T5EA 1TAEA 4UB6Z 3HKEB 1I94B 4B3RB 4K0KO 2ZXWB 1W0KG 5H5NA 3RVZA 1KP2A 4OPHA 2XTAA 1QQCA 4WBNB 3ZN0A 4CS2A 2AW9A 3ABLB 2AZ0A 5BMVB 2BCCH 4U3JB 1GTOA 3FX7A 1NH2D 4DR1O 1VQLV 1L1FA 3KCYA 2IH3C 3U10A 3BA9A 2D3OW 2YIBA 2HFEC 4OXSA 2XAGA 4PDMA 4UFZA 5J2TA 4JI0O 3ZBHA 1SERA 1YTFD 1LUWA 1PV0A 4I0XB 1S5HC 4J9ZB 4DR3B 3OE7G 2L35A 3N2GB 1Y4MA 4QE7A 3P32A 4TSFG 1FPOA 1M93A 1FAFA 2CE4A 1AVMA 4O4LB 3CMEV 4HAMA 2IJJA 2ZDIA 4HBNA 3WG7C 4CH5A 5KLVH 5KUMA 3ZIAG 4DV5B 1VQ8V 1IX9A 4X66B 1KMIZ 2JEUA 3KKYA 3JATA 1ZSPA 1EN5A 3JATB 3OR6C 5GTIZ 1V55B 3D36A 2EX3A 4DYLA 1K92A 2PYLA 3T1HB 1Y76A 2KKWA 2H94A 2WSSG 1B04A 5HFMA 2RCVA 5E1AC 4DV0O 2JVDA 5J2UB 5LHGA 3QF7A 4R50A 1N4CA 4HYOA 3FYEB 1WA8A 1SA0A 3J7AU 4NB5A 1P4RA 2P22C 2WLNA 5JH7A 1NI8A 1YHQV 3D3QA 3B77A 1EZVH 3F7YC 5LGNA 3BA8A 3A0HZ 2HR3A 4NTWA 4YY3B 4BR6A 2DE0X 5KUKA 1K33A 5LXTA 1ZUQA 5L3EA 2X6BA 2OWOA 2M7WA 3JALA 4OGQB 4P9OA 4I5SA 5HFLA 3CCJV 3UKMA 2B9ZA 4NTXA 2R9RB 5GW7A 3E8HA 1R6TA 3CPWU 1S0VA 3CRMA 3L74H 3CC7V 4LF4O 2LP7A 3DC5A 2EZPA 2Q0OC 4FIPC 3BRCA 3OUSA 4JI1O 3WB0A 1P7GA 1THZA 1TUBB 2N05A 3AG1B 1S5JA 2Q73A 2Y69C 1FD9A 3ABKB 3AG4B 1BHBA 4K8XA 4MW8A 2YXYA 1S77D 3JD0A 2HP8A 4GX2A 5DN6G 4JV5O 3M7MX 4DV0B 2ADPA 4P2ZA 2KB1A 1TUBA 2XAQA 3O65A 1KKCA 2AXTZ 1KC8W 3M99B 3RBZA 4JYAO 4UXNA 1CEZA 2N04A 3LDEA 1P7BA 1VF7A 3FYIB 5KMGB 2VQFO 4JI3B 1ZWIC 4FZ1A 5EK0A 2DWDC 4FLUA 1IBLB 3K08A 3JALB 4LFAO 2R9AA 2JIZG 4DV4O 2P67A 3LNNA 4PJ0Z 2QR4A 1K8AW 2YI8A 4CBCA 5LMUO 2G38A 2WLIB 2AHZA 2IU0A 4H0LB 4LCUC 3K06A 4YIOA 1GAXA 1WPXA 2ITCC 2CH7A 3OTOO 4DV7O 5A2QN 3OM3B 1SQQH 1IXMA 1VF5B 2V7QG 1AP6A 3QVNA 2IJHA 1ZL8B 4LP8A 5ITZB 1D2DA 1VQ5V 2XNDG 5L3BA 1G8MA 5EYPB 4B3MB 5GONB 1YF2A 2ZE8A 1HDJA 1N32O 1XMQB 2WAMA 1YJWV 5IWAO 4IL6Z 3CMAV 1IDSA 3RGBA 2PY5A 5LGTA 5IWAB 5KX5A 3J81N 2W6IG 2QWPB 1PNLA 4CH4A 4K3AA 5AG2A 5EBLC 3BABA 1FXKA 2ITDC 5C8YB 4KXRA 3JD1A 1K5SA 4BIOA 1AI5A 3BHPA 2PF4E 5FL7G 1XNRO 1N0NA 5B1BC 3AG1C 1K73W 2HKOA 1RFYA 2EINB 4QJFB 3TCUA 3VQXA 4K35A 3B40A 4I9QA 2JGDA 3FB5C 4F6EA 3I5DA 5B3SB 1B6QA 4TQDA 4LFBB 3JASA 1BS3A 4JAUA 3CCMV 3JARB 3CXCU 4ZBMA 2OCCC 1JOYA 2UXBB 3T2MA 2NR5A 1FFXB 1W2BU 3UT5A 3STZC 1Q6UA 1V9PA 1S76D 5FPRA 3TXQA 1YIJV 5JCOA 2HVKC 1GN3A 2H8PC 2EILC 2XOKG 3G80A 3L72H 3LDDA 5CMUA 1Q82W 3JD2A 2Q8VA 1HNXO 4TUYA 1N36B 2E5LB 4I4TA 2WWWA 5KX5B 1BHAA 1US6A 1QHTA 3CCLV 5JWPA 4XDKA 1XILA 2XUMA 4PDLA 4NXNO 3WFVA 4QGPA 4UUJC 1VQ9V 1SQBH 4B3MO 2OCHA 1F4NA 2BOBC 2Q5ZA 4JI2B 2Y48A 1IZ3A 3A0RA 4J7KA 3KCXA 2QA4V 3PJSK 4FFBA 2Q7EA 2F95B 3JSNA 5BXZA 3UO3A 5BMVA 3KG2A 1D5NA 1S5LZ 2BTQB 4U7OA 2ZR2A 2DWEC 1URFA 4X62B 3FAVA 3A0BZ 4DR7O 3E8GA 4MTFA 1CPYA 4FLZA 3BCCH 3UCSC 5CB4B 2LO1A 1NR7A 4XDJA 1FXKC 3I56V 4WFFA 4GX0A 2F23A 5LMNB 3AG3B 4QPKA 4IHJB 5BY1A 2BTOA 1MMMA
chains in the Genus database with same CATH topology
3T4ZA 3ETEA 4R6ZA 3ZN1A 1FFTB 1PNKA 4ASUG 3ABMC 4BAYA 1SESA 2OTLV 3SPCA 1H8HG 1J95A 3OUFA 1MOFA 3CC2V 5B1OA 2B1GA 1M56C 1S3JA 5B1NA 5DM6V 4MVOA 3TETA 5IYDO 2WLJA 1V54B 1QLNA 2ZQMA 4QE9A 2DYRB 5KA6A 3CCQV 1F23A 1AR1B 3AG2B 4WFHA 4DO2A 1YITV 4G27B 4JYBA 3AG2C 2QM8A 2DQ3A 2A0LA 3ZRWB 1NVPB 1VQOV 3CCVV 4MVSA 1V54C 2Q69A 2QE7G 1OHHG 2UXNA 4JPRA 1F4MA 1NQTA 3GWOA 5L3CA 5IYCO 2X6CA 3BEHA 3CYOA 2YSUB 4GT1A 3ABMB 2ZDIC 3K04A 1ROPA 1Q86W 2JK5C 1H2GA 1R6NA 1W0JG 2FTKA 4MT8A 1AI6A 5IYBO 4TWKA 1R3IC 3K0DA 2P6JA 1XL4A 2F43G 4PELA 3CP1A 3MHHC 1R3JC 3AG3C 3BY6A 4RQEA 1RM1C 3ZMZA 1JCHA 5BZBA 1XL6A 2EIJC 1RPOA 2LFSA 4R7CA 2ZXWB 1W0KG 3SYAA 1M57C 4F4LA 3RVZA 1KP2A 3GB7C 2DYRC 3QO7A 1LNQA 3ZN0A 1M56B 3ABLB 5CBGA 4MW3A 1K7DA 3K3WA 3LSSA 1GTOA 1NH2D 1ENVA 1VQLV 1L1FA 2IH3C 3E86A 4RO2A 1JJ2U 5J9PC 2D3OW 4OXSA 2HFEC 4PA4A 2XAGA 4PDMA 1KECA 1SERA 1YTFD 4YXWG 4EKWA 2QKSA 2NLJC 1MSWD 1KQSU 3ZMVA 1HWYA 1S5HC 3EHBB 2WLKA 4J9ZB 3OE7G 1I5YA 2JJ2G 1BL8A 1JPXA 1Y4MA 4QE7A 2DQ0A 3P30A 3P32A 4TSFG 1AI4A 3IGAC 4L87A 3SYQA 2B5UA 1FXKB 5KA5A 1R3KC 3ASNC 4G2KA 4H33A 4MVRA 3CMEV 1OCRC 3OMAB 2HVJC 4HAMA 4XBFA 2A79B 2IJJA 2ZDIA 1KD1W 3UM7A 3WG7C 1R3LC 3CCUV 4PA9A 5H6QA 1K5QA 4FMTA 5KUMA 3ZIAG 1VQ8V 4WFEA 2JEUA 4CZZA 3OEHG 4H37A 2EBOA 2PI4A 4TT3G 2EIMB 1TUEB 1GKFA 3OR6C 3NXSA 5L3GA 3D36A 1V55B 2ATKC 1WLEA 1OCOC 1R73A 3IC7A 2HG5C 1K92A 2EZOA 2DYSC 1YSCA 3H01A 2H94A 2WSSG 5CBHA 1AI7A 3ABUA 3ZRXA 5HFMA 2IH1C 5E1AC 4MS2A 1ORQC 1NVPD 2OCCB 5LHGA 2LFRA 1QVFU 1VQ7V 1OCZC 3LSQA 4R50A 4HYOA 3FYEB 4FPPA 3B8NA 3OMIB 4UVCA 3W7WA 4BIZA 1P4RA 5L3FA 3LUTB 1BMFG 1QVGU 3SYPA 1AJPA 2WLNA 3F7VC 2XASA 1VQKV 1EBOA 2WLIA 1YHQV 1H8EG 3CCRV 1Y66A 3B77A 2WLMA 1MABG 3DTUB 5CN0A 3F7YC 5LGNA 2UXXA 2EILB 4MTXA 2HR3A 2GSMB 3D3IA 1DF4A 3DGEA 4MVQA 3F5WC 4MSWC 4JAVA 4N23A 5KUKA 1K33A 4X8AA 2HLDG 2CK3G 5L3EA 2X6BA 2M7WA 4JTAB 3STLC 1EZJA 5B1AB 4P9OA 4I5SA 5HFLA 3CCJV 3UKMA 1GM8A 5GW7A 5C93A 2R9RB 3ML0A 3OAAG 4JF3A 4E2LA 3OFNG 4KUMA 2A9HA 3E8HA 5B3SC 3W7UA 3CPWU 3VBBA 3ZMUA 1S0VA 3CC7V 2LP7A 2EZPA 4GX1A 3CD6V 1E1RG 4FIPC 1AROP 3OUSA 5LHHA 1K9MW 1GO3F 1FXHA 2EINC 1Q7YW 1THZA 2K1EA 3AG1B 3SYOA 4JTDB 5B1BB 5EBMC 2Y69C 3ABKB 1VQ4V 3AG4B 1QLEC 2NNUA 4U7NA 2EIKB 1BHBA 1PNMA 4MW8A 4WFGA 1S77D 3JD0A 3ABTA 4GX2A 4LC1A 3E89A 4QPJA 1K97A 4RUEA 5DN6G 1S72V 1OCCC 3ASOC 1K4DC 4P2ZA 2KB1A 5IY5B 2QEXV 1I5XA 2XAQA 3VOUA 2QTOA 2ZR3A 3HB3B 1YJNV 1MG1A 4X89A 4PA3A 2B1IA 1KC8W 1DLBA 3M99B 3W7TA 3RBZA 1R6KA 1VQMV 3ETDA 4GX5A 4UXNA 3OR7C 3LDEA 3G4SV 4P9PA 1P7BA 1CEZA 3ZRVA 3FYIB 3JCZA 1YTFB 5H9CA 1VQNV 3CC4V 1SZTA 4JTCB 4MVZA 1ZWIC 3K0GA 4JGSA 5EK0A 3ZCCA 1YI2V 2DWDC 4FK5C 3MHSC 3K08A 3JYCA 3SYCA 2JIZG 3T4DA 2P67A 2JJ1G 5L3DA 1EFRG 3X2QB 4UVBA 1K8AW 4PA7A 4CBCA 4G28B 1PD3A 1OCCB 3X2QC 2WLIB 2AHZA 3CCEV 2IU0A 2GHYA 4Q20A 3SPJA 2ZD9A 3ETGA 4LCUC 3K06A 4MTOA 1QLEB 3RVYA 1NJIW 1WPXA 2ITCC 2Y69B 3ABKC 1F51A 3OM3B 4WF9V 1IXMA 2BOCC 5LGUA 2V7QG 4QNHB 3FKSG 4LP8A 2IJHA 1VQ5V 2XNDG 2Q6AA 5L3BA 1G8MA 3QO8A 4WCEV 3CCSV 4XDLA 3IFXA 2WLLA 4WFBV 1GM9A 3AEIA 1FXVA 4WFAV 3E83A 1QCEA 2WAMA 1YJWV 3E35A 4HZ3A 3SJQC 1KP3A 1GMGA 3CMAV 2DW4A 3E8FA 4JASA 4JYCA 5LGTA 2W6IG 1NR1A 1PKXA 5IY5C 2IW5A 1PNLA 4BIUA 1M1KW 3QO5A 5EBLC 1NH2B 3ASOB 3FB6C 1FXKA 2ITDC 3LDCA 1SRYA 2WLLB 2JEXA 3JD1A 1K5SA 1NBMG 2IJKA 3ZRWA 1AI5A 2EIKC 3AG4C 1YJ9V 2X6AA 5FL7G 5B1BC 1DTOA 4PDRA 3AG1C 3SPHA 1K73W 2HKOA 3ZMTA 2EINB 1E79G 4QJFB 1SETA 3TCUA 5CBFA 4N21A 5CA3A 3E2EA 1GM7A 1VQPV 2V1DA 1OZ0A 1KKDA 1K3EA 4J9YB 2JDIG 3FB5C 5B3SB 4RUFA 1B6QA 4JAUA 3CCMV 1OCZB 5H6RA 1H38A 3JD3A 4Z1MG 3ZJZA 4ZBMA 3CXCU 2OCCC 4X88A 1N8RW 3LNMB 5B1AC 1JOYA 4UV8A 3T2MA 2XAHA 1M9NA 4GCZA 1W2BU 4PDVA 1FS0G 3QNEA 3STZC 1S76D 1E1QG 1AJQA 3FB7C 1JVMA 1V55C 2Z5UA 3I55V 1YIJV 2HVKC 2H8PC 2EILC 2XOKG 2AHYA 1M90W 1VQ6V 2EIMC 3LDDA 3SPIA 1K34A 5CMUA 3OW2U 3JD2A 1Q82W 2OT5A 2C2AA 2IJIA 2IU3A 3EFFK 2R9IA 1RPRA 2WWWA 3W7SA 3JD4A 1BHAA 3WG7B 4MVMA 3T1CA 1PL0A 3CCLV 4LBEC 4XDKA 5LHIA 4PDLA 3WFVA 1JX9A 2Q68A 2OTJV 3ZRSA 1GK9A 2W6JG 2WPDG 5EBWC 1DF5A 2X7RB 2XAJA 4UUJC 1QBZA 1VQ9V 1QR9A 3E8BA 3OMNB 4RQFA 3OGCC 3R65A 4I9WA 1COWG 1F4NA 1JQ0A 2BOBC 3MD0A 2DYSB 3SPGA 2Y48A 1Q81W 3HPLC 1OCOB 3TK1A 3K9AA 3A0RA 2XAFA 2QA4V 2X0LA 3W7XA 3PJSK 4P30A 2HJFC 4R8CA 1UJWB 5EC2C 4DXWA 2EJRA 5IDJA 4KFMA 3KG2A 2MK3A 2PI5A 4PA6A 1CP9A 4MVUA 3K03A 4KP4A 4U7OA 2ZR2A 2DWEC 2WLHA 3K79A 3OEEG 2P90A 3ABLC 3G6EV 2YEVB 3RW0A 3E8GA 4MTFA 1CPYA 1OCRB 3G71V 3ASNB 1NR7A 1M57B 4XDJA 1FXKC 2ZXWC 2Q67A 2P7TC 4MTGA 4QIWF 4RAIA 3I56V 1G4YB 1NKDA 1QR8A 4WFFA 2EIJB 4FJCC 1K4CC 3ZMSA 4GX0A 4UVAA 2QM7A 1RM1B 3B8MA 5LBQA 3AG3B 4BW5A 3FB8C 2Z3YA 4QPKA 4UV9A 4ZKIA 5EC1C 2W0FC 1AJNA 2YEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3K C;  3ASN C;  3T4Z A;  1OCC C;  4H33 A;  4MVR A;  1KKD A;  1OCR C;  3ASO C;  4J9Y B;  4R6Z A;  3FB5 C;  1K4D C;  2HVJ C;  2A79 B;  4P2Z A;  2KB1 A;  4RUF A;  3UM7 A;  3WG7 C;  1R3L C;  3VOU A;  2QTO A;  3ABM C;  4PA9 A;  3SPC A;  1J95 A;  4X89 A;  3ZJZ A;  4ZBM A;  2OCC C;  3OUF A;  4PA3 A;  4X88 A;  3LNM B;  5B1A C;  5KUM A;  4WFE A;  3T2M A;  3RBZ A;  1M56 C;  4GX5 A;  4H37 A;  4MVO A;  4PDV A;  2WLJ A;  3TET A;  3OR7 C;  3LDE A;  4QE9 A;  4P9P A;  1P7B A;  3STZ C;  3OR6 C;  3FB7 C;  4WFH A;  1JVM A;  1V55 C;  2ATK C;  4G27 B;  1OCO C;  3AG2 C;  2HVK C;  2HG5 C;  4JTC B;  4MVZ A;  1ZWI C;  2H8P C;  2DYS C;  2EIL C;  3K0G A;  2AHY A;  5EK0 A;  2A0L A;  5CBF A;  2DWD C;  5CBH A;  2EIM C;  3K08 A;  3JYC A;  1V54 C;  2Q69 A;  2IH1 C;  3LDD A;  4MVS A;  3SPI A;  3SYC A;  5E1A C;  4MS2 A;  1ORQ C;  3T4D A;  3EFF K;  2X6C A;  3BEH A;  1OCZ C;  4R50 A;  4HYO A;  3K04 A;  4PA7 A;  4CBC A;  4G28 B;  3LUT B;  4MVM A;  2JK5 C;  3T1C A;  4LBE C;  4XDK A;  4PDL A;  3SYP A;  2WLN A;  3X2Q C;  3F7V C;  2WLI B;  2AHZ A;  2Q68 A;  4TWK A;  3ZRS A;  1R3I C;  3K0D A;  3SPJ A;  2ZD9 A;  2WLI A;  4LCU C;  5EBW C;  1XL4 A;  3K06 A;  4MTO A;  4UUJ C;  1R3J C;  2WLM A;  3RVY A;  2ITC C;  3ABK C;  3AG3 C;  3F7Y C;  3E8B A;  3OGC C;  3R65 A;  4I9W A;  2BOB C;  2BOC C;  1XL6 A;  5BZB A;  2EIJ C;  4QNH B;  3SPG A;  4LP8 A;  3HPL C;  4R7C A;  2Q6A A;  4MVQ A;  3SYA A;  3F5W C;  1M57 C;  4F4L A;  4XDL A;  3PJS K;  3IFX A;  4MSW C;  2WLL A;  4P30 A;  3RVZ A;  2HJF C;  4X8A A;  4R8C A;  5KUK A;  3GB7 C;  2DYR C;  4RUE A;  5EC2 C;  4DXW A;  1LNQ A;  2X6B A;  3E83 A;  4KFM A;  3KG2 A;  4JTA B;  4PA6 A;  4HZ3 A;  3STL C;  5CBG A;  4MVU A;  3K03 A;  4MW3 A;  3SJQ C;  4P9O A;  2DWE C;  3UKM A;  2WLH A;  2R9R B;  3E8F A;  3ABL C;  3RW0 A;  3E8G A;  5IY5 C;  2IH3 C;  2A9H A;  3E8H A;  3E86 A;  4MTF A;  4RO2 A;  5B3S C;  5J9P C;  4OXS A;  2HFE C;  4PA4 A;  3FB6 C;  4PDM A;  5EBL C;  2ITD C;  3LDC A;  4GX1 A;  3OUS A;  4XDJ A;  2WLL B;  2ZXW C;  2QKS A;  2NLJ C;  2Q67 A;  2P7T C;  4MTG A;  4EKW A;  4RAI A;  2EIN C;  1G4Y B;  2EIK C;  1S5H C;  2K1E A;  4WFF A;  3AG4 C;  3SYO A;  1K4C C;  2X6A A;  2WLK A;  4GX0 A;  4J9Z B;  4JTD B;  5B1B C;  5EBM C;  2Y69 C;  1BL8 A;  3AG1 C;  3FB8 C;  1QLE C;  4PDR A;  4QE7 A;  3SPH A;  4BW5 A;  4MW8 A;  3IGA C;  4WFG A;  3SYQ A;  3TCU A;  5EC1 C;  2W0F C;  4GX2 A;  2YEV A;  3E89 A; 
#chains in the Genus database with same CATH topology
 3HKC B;  3ZN1 A;  1PNK A;  1U96 A;  4AI8 A;  2HHH O;  4BAY A;  2OTL V;  1SES A;  1BE3 H;  3SPC A;  1H8H G;  3OUF A;  4TV9 B;  2LJ2 A;  3CC2 V;  1FYJ A;  5B1O A;  1JMK C;  3QTC A;  4EFE A;  4GKJ O;  4WFH A;  2EUL A;  2UUC B;  4JI5 B;  2DQ3 A;  1AR5 A;  4A5U B;  1JFF A;  1VQO V;  1XMO B;  3CCV V;  4TV9 A;  1I94 O;  2Q69 A;  2RJZ A;  1OHH G;  3BAA A;  1NQT A;  4FLV A;  4DV2 O;  1Q8I A;  3TXS A;  1XNQ O;  4DV3 O;  1H2G A;  2QM4 A;  5EIB D;  1W0J G;  2FTK A;  4DR3 O;  3K0D A;  4LFC B;  2F43 G;  3CP1 A;  4I55 A;  3MHH C;  1XDC A;  2O57 A;  4EB6 A;  4F6R A;  3VQV A;  1B06 A;  3NR7 A;  4PI0 A;  3T1Y B;  2GTA A;  5IT9 N;  4X62 O;  2IBZ H;  4LH6 A;  4X66 O;  4ZOL A;  5CBG A;  2E75 B;  3B2E E;  3LSS A;  1VEW A;  1N0J A;  2P4V A;  3K5O A;  4RO2 A;  1JJ2 U;  3JAK B;  3OTF A;  1KEC A;  4YXW G;  2FML A;  2QKS A;  4FFK A;  4EKW A;  2WLK A;  1HR0 O;  4JI4 O;  1WJZ A;  1JPX A;  3HR0 A;  1AI4 A;  4L87 A;  1BQ0 A;  3BPZ A;  1WA8 B;  3ASN C;  1OCR C;  3OMA B;  2A79 B;  3UM7 A;  3ZHV A;  1QU7 A;  1K5Q A;  4FMT A;  4OX9 O;  5BR8 O;  3L73 H;  2A3Q A;  3OEH G;  2UXD B;  2V4D A;  1TUE B;  3S3W A;  5L3G A;  1R73 A;  2LGQ A;  3IC7 A;  3PN1 A;  1O9H A;  2UXD O;  2EZO A;  2GV9 A;  1YSC A;  4ZI7 B;  5CBH A;  1HNZ B;  2YI9 A;  4MS2 A;  1NVP D;  5DEC A;  5JVD B;  4TV8 B;  4FPP A;  4YJ2 A;  3B8N A;  3OMI B;  4UVC A;  3W7W A;  4GLX A;  1AIL A;  2BE3 A;  1PPJ H;  1AJN A;  4FM2 A;  1EBO A;  2WLI A;  2GDS A;  2N74 A;  1SZX A;  1RSO A;  5CN0 A;  2UXX A;  1AP5 A;  3APO A;  2CTW A;  1KYO F;  1XNQ B;  2GSM B;  1NU1 H;  3H1K H;  4MVQ A;  3DXR B;  1DGS A;  1VF6 C;  4N23 A;  2UXC O;  2CK3 G;  1H2M A;  3CHX A;  1EZJ A;  4O4I B;  5C93 A;  3OFN G;  4LF6 B;  4D7T A;  3JCU Z;  1JR9 A;  2F1M A;  4YY3 O;  1BCC H;  1EM1 A;  1GO3 F;  1WB8 A;  2P4K A;  4O4I A;  1OJH A;  3VQW A;  3EVK A;  2UUA O;  2M6Y A;  1S72 V;  4LC1 A;  1VMG A;  2QWQ B;  4O2B A;  1K4D C;  2NN4 A;  2QEX V;  1XEQ A;  2QTO A;  3FD9 A;  1SS3 A;  1MG1 A;  4LNU A;  4X89 A;  1IUR A;  4DR2 O;  2ADQ B;  1FJG O;  1RSO B;  5IJ0 A;  5LP6 B;  1VQM V;  3UT5 B;  3ETD A;  4GX5 A;  2ETN A;  3G4S V;  3ZRV A;  2LQT A;  4X9Q A;  1YTF B;  5H9C A;  1VQN V;  4JAA A;  3CC4 V;  4JTC B;  4D6T H;  4JGS A;  1IBK O;  3MHS C;  4ZHQ B;  5K1P A;  2ZT9 B;  2ZE6 A;  2ZNI A;  3T4D A;  4B7K A;  1FFX A;  1EFR G;  3K9S A;  3X2Q B;  2ZIO A;  2Q0A A;  5JCO C;  4GUN A;  4PA7 A;  1JJO A;  3L71 H;  1PD3 A;  1OCC B;  4ZHQ A;  2FKX A;  1VIB A;  5EZY B;  3SDL A;  1QLE B;  1NJI W;  3ABK C;  2Y69 B;  4FVM A;  5LGU A;  4QNH B;  2GBO A;  3FKS G;  3RYF A;  3QO8 A;  3CCS V;  1GM9 A;  1I7F A;  3K59 A;  4TOI A;  3E35 A;  3IAY A;  4HZ3 A;  4E4E A;  1KP3 A;  5IYZ B;  1XI1 A;  2DW4 A;  4JAS A;  5IYZ A;  3Q4H B;  5IY5 C;  4BIU A;  4AQY O;  2JEX A;  1IBM B;  2F4V O;  4CC5 A;  2IJK A;  3ZRW A;  1YJ9 V;  4I0X A;  2X6A A;  2IM9 A;  4U3J A;  4IGG A;  1DTO A;  4PDR A;  4IHJ A;  1N34 O;  2VWK A;  3CRA A;  1SET A;  4N21 A;  3E2E A;  2QKC A;  1GM7 A;  2V1D A;  1KKD A;  1K3E A;  3HKC A;  2JDI G;  1WB7 A;  1BZK A;  1WP8 A;  3AK3 A;  3SJB C;  4J7J A;  4ZOL B;  1NTK H;  1N8R W;  3H1J H;  3LNM B;  2DN9 A;  2XAH A;  1NTZ H;  4NXN B;  4B3T O;  1E1Q G;  4DR6 O;  1AJQ A;  2LW7 A;  3DSQ A;  1JVM A;  4I50 A;  1PP9 H;  2R70 A;  4HNA B;  2E5L O;  2AHY A;  4JI7 B;  5LA6 A;  3SPI A;  5LL6 Y;  1N33 B;  3KZI Z;  4LF9 O;  2GUZ A;  2R9I A;  5J2U A;  1RPR A;  3W7S A;  3WG7 B;  4MVM A;  2PGG A;  1YXB A;  2A7W A;  1Y76 B;  3GWK C;  5LHI A;  3E22 B;  3E22 A;  1JX9 A;  2Q68 A;  3ETQ A;  3ZRS A;  1GK9 A;  2W6J G;  1JFF B;  4I55 B;  4LWS A;  3ZHU A;  3A2F A;  3K57 A;  3K5M A;  4DR4 O;  3T1Y O;  1N36 O;  1COW G;  3MD0 A;  1JQ0 A;  1Q81 W;  4FM1 A;  4DR4 B;  1EN4 A;  4BW9 A;  4NYK A;  4P30 A;  2HJF C;  3UO2 A;  4R8C A;  2VQE O;  4LWS B;  5EC2 C;  4UB8 Z;  2EJR A;  4KFM A;  2BSK B;  1SQG A;  2VQE B;  4JI8 O;  4FZ0 A;  3OEE G;  2OIG A;  1WPB A;  1A32 A;  2YC0 A;  1OCR B;  4KHP B;  3G71 V;  1XMO O;  3CJH B;  2P7T C;  4MTG A;  3U11 A;  4RAI A;  1NKD A;  1QR8 A;  2EIJ B;  3ZMS A;  3BVO A;  2QM7 A;  3C3S A;  5LBQ A;  4BW5 A;  1LR1 A;  2Z3Y A;  1M5I A;  1GN2 A;  4NXM B;  2YEV A;  2AGA A;  1TVK B;  3T4Z A;  4BWA A;  1UPG A;  2YUA A;  2YID A;  2CUG A;  1XHZ A;  1X4T A;  2YXH A;  1J95 A;  4PD4 F;  2OYQ A;  5IYD O;  3TET A;  1V54 B;  2DYR B;  2XHB A;  2F66 C;  3AG2 B;  4DUY O;  2ZE5 A;  2YDE A;  1OV9 A;  3AG2 C;  2QM8 A;  4J80 A;  3CRC A;  1YDX A;  1NVP B;  4EFB A;  4MVS A;  1V54 C;  1NS1 A;  2QE7 G;  2QWR B;  5IYC O;  3SJA C;  2YSU B;  3ABM B;  4DUZ O;  1H2K A;  4O2B B;  2RMK B;  4W4L A;  1Q86 W;  2QGN A;  4MT8 A;  1R3I C;  1B3Q A;  3CRQ A;  1XL4 A;  4PEL A;  4X64 B;  1R3J C;  3WU2 Z;  3BY6 A;  3ZHR A;  1JCH A;  2EIJ C;  4CH6 A;  1RPO A;  2LFS A;  4R7C A;  3GB7 C;  3QO7 A;  1AB3 A;  3S3X A;  1LNQ A;  2ARH A;  4RWU A;  3K5N A;  1K7D A;  3K3W A;  5H2F Z;  1XNR B;  1FKA O;  1KU9 A;  5LMN O;  3E86 A;  4X20 B;  2PYJ A;  5J9P C;  1SQV H;  4PA4 A;  4FLT A;  1Q5O A;  3DXR A;  5BR8 B;  2NLJ C;  4NR1 A;  4ZI7 A;  5JQG A;  3EHB B;  2Q9L A;  4DV3 B;  3P30 A;  3IGA C;  3C90 A;  2B5U A;  1FXK B;  3ZHT A;  1R3K C;  3RYI A;  4G2K A;  2Y0I A;  4XBF A;  4DR2 B;  1KD1 W;  4B3R O;  5KHG A;  1R3L C;  3JSL A;  4DUZ B;  2QJ1 A;  4PA9 A;  4X1I B;  1NZ6 A;  2CTQ A;  4WFE A;  3A8T A;  2EBO A;  4TT3 G;  5K1X A;  2DOS A;  4NXM O;  2EIM B;  4FM0 A;  2ATK C;  1WLE A;  4IT5 A;  1P84 F;  3H01 A;  3RYC B;  1AI7 A;  3ZRX A;  2Y0P A;  1ORQ C;  5IJ9 A;  1XQ8 A;  1ZLZ A;  1VQ7 V;  4GKK O;  1OCZ C;  1Z5W A;  4BIZ A;  5L3F A;  3IJ4 A;  3LUT B;  4X64 O;  3F7V C;  1VQK V;  1H8E G;  3CCR V;  1Y66 A;  5IJ9 B;  2WLM A;  5JJE B;  1MAB G;  1XHX A;  3RN4 A;  2EIL B;  4MTX A;  3B4S A;  4JI6 O;  4MSW C;  4JAV A;  4X8A A;  4JTA B;  4X65 O;  3STL C;  1YCI A;  4KL1 A;  1G6U A;  1GM8 A;  4JF3 A;  4ABM A;  3FAV B;  2A9H A;  5B3S C;  3ZMU A;  4GX1 A;  4JV5 B;  4UCS A;  3N27 A;  1FXH A;  2EIN C;  2K1E A;  1SKV A;  3SYO A;  4JTD B;  5B1B B;  2ZIN A;  2BTQ A;  2KQX A;  5EBM C;  3WB1 A;  1QLE C;  3HKB B;  4U7N A;  2EIK B;  4LF7 B;  4WFG A;  2CGN A;  4RUE A;  1K97 A;  3OGI B;  1OCC C;  2FYU H;  5J2T B;  1O9G A;  1P49 A;  1CXZ B;  4PA3 A;  2ZCE A;  5LYJ B;  1GN6 A;  3RWR D;  3OR7 C;  4I4T B;  1MSD A;  5KAI Z;  4I7Z B;  1SZT A;  3K0G A;  3QG5 A;  1YI2 V;  4FK5 C;  4NKG B;  2KSD A;  4JI1 B;  3SYC A;  5LP6 C;  2JJ1 G;  2WA4 A;  1BT8 A;  1ZX3 A;  1H2S B;  2E3C A;  4JI3 O;  4I50 B;  4G28 B;  1TA8 A;  5CB4 A;  1AR4 A;  4DV1 B;  2ZNJ A;  4FFB B;  4Q20 A;  3SPJ A;  4DW0 A;  3P3P A;  5KHJ A;  2RNB A;  1YZB A;  1W59 A;  3EXA A;  3RVY A;  5KHH A;  4JI6 B;  1F51 A;  4AQY B;  2QWN B;  3CE2 A;  3HKE A;  3Q4H A;  1QNM A;  3AK2 A;  2Q6A A;  4PV1 B;  4WCE V;  3MAQ A;  4XDL A;  4LF7 O;  4PI2 A;  1FXV A;  3E83 A;  3G67 A;  2QDO A;  2BSK A;  3T1H O;  4CC6 A;  4C7U A;  1GMG A;  1HR0 B;  4DR6 B;  5IE9 A;  4JYC A;  3APQ A;  2IW5 A;  4O4L A;  1PL4 A;  3QO5 A;  1NH2 B;  3FB6 C;  4EEQ A;  3LDC A;  1SRY A;  3RYH B;  2WLL B;  4LF5 B;  4UCU A;  1ZTE A;  4LF8 O;  2EIK C;  5E79 Z;  3AG4 C;  4YJ3 A;  4X65 B;  2Y4T A;  3SPH A;  3JAW A;  3ZMT A;  5CA3 A;  1HP8 A;  3CJH A;  3AK1 A;  4J9Y B;  4RUF A;  3GVM A;  1IBM O;  2F4V B;  3CWB H;  1WAZ A;  1H38 A;  3JD3 A;  1IBK B;  4UV8 A;  1M4U A;  4DV4 B;  4DK0 A;  1M9N A;  3CB2 A;  1HNW O;  4ZIB A;  3ZHS A;  2Z5U A;  2KG7 B;  1HNW B;  2HHH B;  1SF9 A;  1M90 W;  1U97 A;  3B09 A;  4AHC A;  1VQ6 V;  1IVS A;  1X59 A;  1MA1 A;  2FB5 A;  2IJI A;  3K58 A;  4DV6 B;  3EFF K;  4J41 A;  4DV1 O;  3JD4 A;  3J80 N;  3RFR A;  4H13 B;  1GN4 A;  1VP7 A;  3RYI B;  3L75 H;  2UUC O;  3RYH A;  2ZIM A;  1N34 B;  1BQZ A;  2WPD G;  1DF5 A;  2XAJ A;  4YJ3 B;  5FPO A;  5B5E Z;  4LFB O;  1QR9 A;  3OMN B;  4RQF A;  3OGC C;  4I9W A;  3SR2 C;  2PZS A;  2HJD A;  3JAK A;  2UUB B;  3N2K B;  2X0L A;  5D5Q A;  1LUV A;  2Q7G A;  4DXW A;  2EJ7 A;  2MK3 A;  4KP4 A;  2CH7 B;  2LW1 A;  3K79 A;  5A9G A;  1XBL A;  3G6E V;  2YEV B;  2XT9 A;  1TVK A;  3ZED A;  2P5O A;  5EYP A;  1M57 B;  2ZM6 O;  2CGO A;  2Q67 A;  4LR3 A;  1G4Y B;  2R72 A;  4FJC C;  1RM1 B;  5CA0 A;  4DR1 B;  2RQ6 A;  3FB8 C;  2YIA A;  5EC1 C;  5IDJ A;  5JVD A;  5GTH Z;  1AR1 B;  3ETE A;  4R6Z A;  2L6L A;  2QWO B;  5KMG A;  1FFT B;  2YIC A;  4B3S B;  1MOF A;  1KBH A;  2B1G A;  1HNX B;  1N33 O;  1S3J A;  5DM6 V;  2ZQM A;  2F93 B;  1MZF A;  3OT7 A;  1XRE A;  3CCQ V;  4X1Y B;  4JYB A;  2ILM A;  4PHZ A;  4IIJ A;  2A0L A;  4GKK B;  4ICG A;  4UCV A;  5LP6 A;  4TQF A;  2UXN A;  1BGY H;  1XUQ A;  2Q7H A;  3HKB A;  5L3C A;  3GWO A;  3ZX6 A;  4LF6 O;  3BEH A;  4GT1 A;  4X1Y A;  2VQF B;  2ZDI C;  1ROP A;  3CXH F;  3SJC C;  5GON A;  1ZL8 A;  5EIB C;  4IIJ B;  4NVP A;  4JI4 B;  1AI6 A;  5IYB O;  2ODM A;  3AG3 C;  4FLX A;  3ICX A;  4RQE A;  1RM1 C;  3ZMZ A;  2OIE A;  5BZB A;  1XL6 A;  5B66 Z;  1Z2G A;  1RP3 B;  3SYA A;  1M57 C;  4F4L A;  2DYR C;  1M56 B;  4MW3 A;  3HKD B;  5JJN B;  1ENV A;  3HKD A;  3RT3 C;  2D2C B;  5CA1 A;  4JYY A;  4YHH B;  1HNZ O;  1MSW D;  1KQS U;  3ZMV A;  1HWY A;  5TIS Z;  3JAR A;  3JAS B;  1I5Y A;  2JJ2 G;  4LNU B;  1BL8 A;  2DQ0 A;  3SYQ A;  4LH7 A;  4D7S A;  5KA5 A;  4GKJ B;  4H33 A;  4MVR A;  3MDS A;  2E74 B;  2HVJ C;  4K0K B;  4J10 A;  3CCU V;  5H6Q A;  3LSU A;  4CZZ A;  4J11 A;  4H37 A;  3WB2 A;  2PI4 A;  1GKF A;  1Q43 A;  2VWJ A;  4X1K A;  4DR5 O;  3NXS A;  1H2L A;  4X1K B;  3F5T A;  1OCO C;  2A06 H;  2HG5 C;  1Y74 A;  2DYS C;  2W0X A;  2YS8 A;  4JI0 B;  1PM9 A;  3ABU A;  5EZY A;  1JA8 A;  2IH1 C;  1SQX H;  1Y67 A;  2Y4U A;  2OCC B;  2LFR A;  1QVF U;  4FLY A;  3LSQ A;  3TGU H;  1BMF G;  1QVG U;  3ZS8 C;  3SYP A;  1AJP A;  2XAS A;  4Z1V A;  4AIL C;  3O9O A;  5JJJ B;  3L70 H;  5LOV B;  1R1B A;  4GZR B;  3DTU B;  4DV5 O;  5KHK A;  4OX9 B;  4DRX A;  2Q4P A;  3D3I A;  1WN7 A;  1DF4 A;  4DRX B;  3DGE A;  3F5W C;  3H9V A;  4KHP O;  2HLD G;  4U3F H;  5LOV A;  4J7Z A;  2K9P A;  1Q6I A;  4F6R B;  5B1A B;  4IYH A;  3G6B A;  4JI2 O;  3ML0 A;  4E2L A;  3OAA G;  4YHH O;  1Q3E A;  4KUM A;  1G1X B;  4W4K A;  3W7U A;  1SA0 B;  3VBB A;  3CD6 V;  1E1R G;  3AG7 A;  1ARO P;  5LHH A;  1K9M W;  2YIB D;  1Q7Y W;  1WP7 A;  5F2V O;  1GH6 A;  2LGW A;  3JAW B;  1D5A A;  2NNU A;  1VQ4 V;  1PNM A;  4K8Z A;  3N2G A;  2GTS A;  4O2A B;  3ABT A;  5FLX N;  3E89 A;  4QPJ A;  3FFQ A;  3ASO C;  3TJT A;  4DK1 A;  5IY5 B;  1I5X A;  3VOU A;  1HW7 A;  2ZR3 A;  3HB3 B;  4HNA A;  1MNG A;  1YJN V;  4IYI A;  2B1I A;  4DR5 B;  1DLB A;  3W7T A;  2Z0A A;  1R6K A;  2GUZ B;  1YVW A;  3H1H H;  3K5L A;  4P9P A;  1WNS A;  4GYC B;  3JCZ A;  5LMU B;  2PTM A;  4MVZ A;  3M8A A;  4O4H B;  2KG7 A;  3ZCC A;  4L8J A;  5FNV A;  1GRJ A;  5FNV B;  1FJG B;  3JYC A;  5JH7 B;  1EN6 A;  1Q90 D;  4YIP A;  5CA0 B;  5L3D A;  4EB6 B;  5DED A;  4CS4 A;  4UCT A;  4LFA B;  4UVB A;  4O4H A;  3H1L H;  4OPA A;  3X2Q C;  2UXC B;  3CCE V;  1XMQ O;  2GHY A;  2ZD9 A;  3ETG A;  3JAM N;  4MTO A;  4LF9 B;  4B7E A;  4DV2 B;  4WF9 V;  1SQF A;  2WA3 A;  2BOC C;  2CDY A;  4O2A A;  4LF8 B;  1SQP H;  3VQY A;  1J5E B;  2PUS A;  3OTO B;  4DV7 B;  1NT2 B;  3IFX A;  3N2K A;  2WLL A;  4WFB V;  3AEI A;  4WFA V;  4H44 B;  1QCE A;  3CX5 F;  1I0H A;  4UCR A;  3SJQ C;  4CS3 A;  3L9D A;  1VAR A;  4CH3 A;  3E8F A;  1MZE A;  1NR1 A;  1PKX A;  4LF5 O;  1M1K W;  3ASO B;  4JI7 O;  3CRR A;  2UU9 B;  2CAZ C;  1Q6H A;  1NBM G;  4LF4 B;  1Y6X A;  2P06 A;  2JS3 A;  4X20 A;  1E79 G;  5CBF A;  1N32 B;  2RDC A;  4O4J A;  4DW1 A;  1VQP V;  1OZ0 A;  4FLW A;  3H1I H;  2QTS A;  1VF6 A;  4Q6G A;  1UFI A;  3IC9 A;  2ZE7 A;  2MW2 B;  1OCZ B;  3ZHQ A;  1L0N H;  5H6R A;  4Z1M G;  3ZJZ A;  2CTP A;  4X88 A;  5B1A C;  4GCZ A;  1I08 A;  4O4J B;  4PDV A;  1FS0 G;  3QNE A;  4TV8 A;  2HEP A;  3SGI A;  3D36 C;  3FB7 C;  4YJ2 B;  4JYA B;  1V55 C;  3THO A;  1XOU A;  3I55 V;  5LXT B;  1Z5V A;  2EIM C;  3BFR A;  1K34 A;  3OW2 U;  4X1I A;  2OT5 A;  2C2A A;  2IU3 A;  2ZKO A;  3P3N A;  4NTY A;  2QSA A;  2AZ2 A;  1IBL O;  3CS5 A;  4UCO A;  4JI5 O;  4JZ2 A;  3T1C A;  1PL0 A;  4LBE C;  2CTR A;  2VRZ A;  3RYC A;  2OTJ V;  3DC6 A;  5EBW C;  2X7R B;  2RN9 A;  4J42 A;  1QBZ A;  1F7Y A;  4TUY B;  2UUB O;  3E8B A;  5KHI A;  2ZM6 B;  4DV6 O;  3R65 A;  5ITZ A;  4Z2W A;  2DYS B;  1L0L H;  3SPG A;  3HPL C;  1OCO B;  3TK1 A;  3K9A A;  5C8Y A;  2XAF A;  2FL4 A;  3W7X A;  3C3T A;  3R66 A;  1UJW B;  4LFC O;  5JQG B;  2YXL A;  2PI5 A;  4PA6 A;  1CP9 A;  4MVU A;  3K03 A;  1IXB A;  1KB9 F;  2H3O A;  2WLH A;  2UU9 O;  4B3S O;  2P90 A;  3ABL C;  2E76 B;  3RW0 A;  2JRI A;  1J5E O;  2JGD B;  3ASN B;  2ZXW C;  4DR7 B;  4QIW F;  1SC5 B;  1NTM H;  1K4C C;  4UVA A;  4JI8 B;  3B8M A;  5CA1 B;  4UV9 A;  1BSM A;  2VS0 A;  1DK1 A;  4ZKI A;  3D8C A;  3OD4 A;  5IJ0 B;  2W0F C;  4B3T B;  1ZAU A;  3CEI A;  5D5P A;  4ASU G;  2DJV A;  4WBN A;  1YEW A;  3ABM C;  5KAF Z;  2UUA B;  1M56 C;  3UQ8 A;  1QLN A;  5B1N A;  5LYJ A;  4MVO A;  2JGU A;  2WLJ A;  4QE9 A;  4JZG A;  2UXB O;  1L8D A;  5KA6 A;  2JS5 A;  1F23 A;  1YIT V;  4DO2 A;  4G27 B;  3ZRW B;  1TGO A;  1Y74 B;  1H2N A;  2QKA A;  2DMX A;  4JPR A;  1F4M A;  2X6C A;  3CSX A;  3CYO A;  3U0Z A;  4DUY B;  3K04 A;  1KUQ A;  2JK5 C;  3RYF B;  1R6N A;  4TWK A;  2P6J A;  5LA6 B;  4B08 A;  1T5E A;  1TAE A;  4UB6 Z;  3HKE B;  1I94 B;  4B3R B;  4K0K O;  2ZXW B;  1W0K G;  5H5N A;  3RVZ A;  1KP2 A;  4OPH A;  2XTA A;  1QQC A;  4WBN B;  3ZN0 A;  4CS2 A;  2AW9 A;  3ABL B;  2AZ0 A;  5BMV B;  2BCC H;  4U3J B;  1GTO A;  3FX7 A;  1NH2 D;  4DR1 O;  1VQL V;  1L1F A;  3KCY A;  2IH3 C;  3U10 A;  3BA9 A;  2D3O W;  2YIB A;  2HFE C;  4OXS A;  2XAG A;  4PDM A;  4UFZ A;  5J2T A;  4JI0 O;  3ZBH A;  1SER A;  1YTF D;  1LUW A;  1PV0 A;  4I0X B;  1S5H C;  4J9Z B;  4DR3 B;  3OE7 G;  2L35 A;  3N2G B;  1Y4M A;  4QE7 A;  3P32 A;  4TSF G;  1FPO A;  1M93 A;  1FAF A;  2CE4 A;  1AVM A;  4O4L B;  3CME V;  4HAM A;  2IJJ A;  2ZDI A;  4HBN A;  3WG7 C;  4CH5 A;  5KLV H;  5KUM A;  3ZIA G;  4DV5 B;  1VQ8 V;  1IX9 A;  4X66 B;  1KMI Z;  2JEU A;  3KKY A;  3JAT A;  1ZSP A;  1EN5 A;  3JAT B;  3OR6 C;  5GTI Z;  1V55 B;  3D36 A;  2EX3 A;  4DYL A;  1K92 A;  2PYL A;  3T1H B;  1Y76 A;  2KKW A;  2H94 A;  2WSS G;  1B04 A;  5HFM A;  2RCV A;  5E1A C;  4DV0 O;  2JVD A;  5J2U B;  5LHG A;  3QF7 A;  4R50 A;  1N4C A;  4HYO A;  3FYE B;  1WA8 A;  1SA0 A;  3J7A U;  4NB5 A;  1P4R A;  2P22 C;  2WLN A;  5JH7 A;  1NI8 A;  1YHQ V;  3D3Q A;  3B77 A;  1EZV H;  3F7Y C;  5LGN A;  3BA8 A;  3A0H Z;  2HR3 A;  4NTW A;  4YY3 B;  4BR6 A;  2DE0 X;  5KUK A;  1K33 A;  5LXT A;  1ZUQ A;  5L3E A;  2X6B A;  2OWO A;  2M7W A;  3JAL A;  4OGQ B;  4P9O A;  4I5S A;  5HFL A;  3CCJ V;  3UKM A;  2B9Z A;  4NTX A;  2R9R B;  5GW7 A;  3E8H A;  1R6T A;  3CPW U;  1S0V A;  3CRM A;  3L74 H;  3CC7 V;  4LF4 O;  2LP7 A;  3DC5 A;  2EZP A;  2Q0O C;  4FIP C;  3BRC A;  3OUS A;  4JI1 O;  3WB0 A;  1P7G A;  1THZ A;  1TUB B;  2N05 A;  3AG1 B;  1S5J A;  2Q73 A;  2Y69 C;  1FD9 A;  3ABK B;  3AG4 B;  1BHB A;  4K8X A;  4MW8 A;  2YXY A;  1S77 D;  3JD0 A;  2HP8 A;  4GX2 A;  5DN6 G;  4JV5 O;  3M7M X;  4DV0 B;  2ADP A;  4P2Z A;  2KB1 A;  1TUB A;  2XAQ A;  3O65 A;  1KKC A;  2AXT Z;  1KC8 W;  3M99 B;  3RBZ A;  4JYA O;  4UXN A;  1CEZ A;  2N04 A;  3LDE A;  1P7B A;  1VF7 A;  3FYI B;  5KMG B;  2VQF O;  4JI3 B;  1ZWI C;  4FZ1 A;  5EK0 A;  2DWD C;  4FLU A;  1IBL B;  3K08 A;  3JAL B;  4LFA O;  2R9A A;  2JIZ G;  4DV4 O;  2P67 A;  3LNN A;  4PJ0 Z;  2QR4 A;  1K8A W;  2YI8 A;  4CBC A;  5LMU O;  2G38 A;  2WLI B;  2AHZ A;  2IU0 A;  4H0L B;  4LCU C;  3K06 A;  4YIO A;  1GAX A;  1WPX A;  2ITC C;  2CH7 A;  3OTO O;  4DV7 O;  5A2Q N;  3OM3 B;  1SQQ H;  1IXM A;  1VF5 B;  2V7Q G;  1AP6 A;  3QVN A;  2IJH A;  1ZL8 B;  4LP8 A;  5ITZ B;  1D2D A;  1VQ5 V;  2XND G;  5L3B A;  1G8M A;  5EYP B;  4B3M B;  5GON B;  1YF2 A;  2ZE8 A;  1HDJ A;  1N32 O;  1XMQ B;  2WAM A;  1YJW V;  5IWA O;  4IL6 Z;  3CMA V;  1IDS A;  3RGB A;  2PY5 A;  5LGT A;  5IWA B;  5KX5 A;  3J81 N;  2W6I G;  2QWP B;  1PNL A;  4CH4 A;  4K3A A;  5AG2 A;  5EBL C;  3BAB A;  1FXK A;  2ITD C;  5C8Y B;  4KXR A;  3JD1 A;  1K5S A;  4BIO A;  1AI5 A;  3BHP A;  2PF4 E;  5FL7 G;  1XNR O;  1N0N A;  5B1B C;  3AG1 C;  1K73 W;  2HKO A;  1RFY A;  2EIN B;  4QJF B;  3TCU A;  3VQX A;  4K35 A;  3B40 A;  4I9Q A;  2JGD A;  3FB5 C;  4F6E A;  3I5D A;  5B3S B;  1B6Q A;  4TQD A;  4LFB B;  3JAS A;  1BS3 A;  4JAU A;  3CCM V;  3JAR B;  3CXC U;  4ZBM A;  2OCC C;  1JOY A;  2UXB B;  3T2M A;  2NR5 A;  1FFX B;  1W2B U;  3UT5 A;  3STZ C;  1Q6U A;  1V9P A;  1S76 D;  5FPR A;  3TXQ A;  1YIJ V;  5JCO A;  2HVK C;  1GN3 A;  2H8P C;  2EIL C;  2XOK G;  3G80 A;  3L72 H;  3LDD A;  5CMU A;  1Q82 W;  3JD2 A;  2Q8V A;  1HNX O;  4TUY A;  1N36 B;  2E5L B;  4I4T A;  2WWW A;  5KX5 B;  1BHA A;  1US6 A;  1QHT A;  3CCL V;  5JWP A;  4XDK A;  1XIL A;  2XUM A;  4PDL A;  4NXN O;  3WFV A;  4QGP A;  4UUJ C;  1VQ9 V;  1SQB H;  4B3M O;  2OCH A;  1F4N A;  2BOB C;  2Q5Z A;  4JI2 B;  2Y48 A;  1IZ3 A;  3A0R A;  4J7K A;  3KCX A;  2QA4 V;  3PJS K;  4FFB A;  2Q7E A;  2F95 B;  3JSN A;  5BXZ A;  3UO3 A;  5BMV A;  3KG2 A;  1D5N A;  1S5L Z;  2BTQ B;  4U7O A;  2ZR2 A;  2DWE C;  1URF A;  4X62 B;  3FAV A;  3A0B Z;  4DR7 O;  3E8G A;  4MTF A;  1CPY A;  4FLZ A;  3BCC H;  3UCS C;  5CB4 B;  2LO1 A;  1NR7 A;  4XDJ A;  1FXK C;  3I56 V;  4WFF A;  4GX0 A;  2F23 A;  5LMN B;  3AG3 B;  4QPK A;  4IHJ B;  5BY1 A;  2BTO A;  1MMM A; 
#chains in the Genus database with same CATH homology
 3T4Z A;  3ETE A;  4R6Z A;  3ZN1 A;  1FFT B;  1PNK A;  4ASU G;  3ABM C;  4BAY A;  1SES A;  2OTL V;  3SPC A;  1H8H G;  1J95 A;  3OUF A;  1MOF A;  3CC2 V;  5B1O A;  2B1G A;  1M56 C;  1S3J A;  5B1N A;  5DM6 V;  4MVO A;  3TET A;  5IYD O;  2WLJ A;  1V54 B;  1QLN A;  2ZQM A;  4QE9 A;  2DYR B;  5KA6 A;  3CCQ V;  1F23 A;  1AR1 B;  3AG2 B;  4WFH A;  4DO2 A;  1YIT V;  4G27 B;  4JYB A;  3AG2 C;  2QM8 A;  2DQ3 A;  2A0L A;  3ZRW B;  1NVP B;  1VQO V;  3CCV V;  4MVS A;  1V54 C;  2Q69 A;  2QE7 G;  1OHH G;  2UXN A;  4JPR A;  1F4M A;  1NQT A;  3GWO A;  5L3C A;  5IYC O;  2X6C A;  3BEH A;  3CYO A;  2YSU B;  4GT1 A;  3ABM B;  2ZDI C;  3K04 A;  1ROP A;  1Q86 W;  2JK5 C;  1H2G A;  1R6N A;  1W0J G;  2FTK A;  4MT8 A;  1AI6 A;  5IYB O;  4TWK A;  1R3I C;  3K0D A;  2P6J A;  1XL4 A;  2F43 G;  4PEL A;  3CP1 A;  3MHH C;  1R3J C;  3AG3 C;  3BY6 A;  4RQE A;  1RM1 C;  3ZMZ A;  1JCH A;  5BZB A;  1XL6 A;  2EIJ C;  1RPO A;  2LFS A;  4R7C A;  2ZXW B;  1W0K G;  3SYA A;  1M57 C;  4F4L A;  3RVZ A;  1KP2 A;  3GB7 C;  2DYR C;  3QO7 A;  1LNQ A;  3ZN0 A;  1M56 B;  3ABL B;  5CBG A;  4MW3 A;  1K7D A;  3K3W A;  3LSS A;  1GTO A;  1NH2 D;  1ENV A;  1VQL V;  1L1F A;  2IH3 C;  3E86 A;  4RO2 A;  1JJ2 U;  5J9P C;  2D3O W;  4OXS A;  2HFE C;  4PA4 A;  2XAG A;  4PDM A;  1KEC A;  1SER A;  1YTF D;  4YXW G;  4EKW A;  2QKS A;  2NLJ C;  1MSW D;  1KQS U;  3ZMV A;  1HWY A;  1S5H C;  3EHB B;  2WLK A;  4J9Z B;  3OE7 G;  1I5Y A;  2JJ2 G;  1BL8 A;  1JPX A;  1Y4M A;  4QE7 A;  2DQ0 A;  3P30 A;  3P32 A;  4TSF G;  1AI4 A;  3IGA C;  4L87 A;  3SYQ A;  2B5U A;  1FXK B;  5KA5 A;  1R3K C;  3ASN C;  4G2K A;  4H33 A;  4MVR A;  3CME V;  1OCR C;  3OMA B;  2HVJ C;  4HAM A;  4XBF A;  2A79 B;  2IJJ A;  2ZDI A;  1KD1 W;  3UM7 A;  3WG7 C;  1R3L C;  3CCU V;  4PA9 A;  5H6Q A;  1K5Q A;  4FMT A;  5KUM A;  3ZIA G;  1VQ8 V;  4WFE A;  2JEU A;  4CZZ A;  3OEH G;  4H37 A;  2EBO A;  2PI4 A;  4TT3 G;  2EIM B;  1TUE B;  1GKF A;  3OR6 C;  3NXS A;  5L3G A;  3D36 A;  1V55 B;  2ATK C;  1WLE A;  1OCO C;  1R73 A;  3IC7 A;  2HG5 C;  1K92 A;  2EZO A;  2DYS C;  1YSC A;  3H01 A;  2H94 A;  2WSS G;  5CBH A;  1AI7 A;  3ABU A;  3ZRX A;  5HFM A;  2IH1 C;  5E1A C;  4MS2 A;  1ORQ C;  1NVP D;  2OCC B;  5LHG A;  2LFR A;  1QVF U;  1VQ7 V;  1OCZ C;  3LSQ A;  4R50 A;  4HYO A;  3FYE B;  4FPP A;  3B8N A;  3OMI B;  4UVC A;  3W7W A;  4BIZ A;  1P4R A;  5L3F A;  3LUT B;  1BMF G;  1QVG U;  3SYP A;  1AJP A;  2WLN A;  3F7V C;  2XAS A;  1VQK V;  1EBO A;  2WLI A;  1YHQ V;  1H8E G;  3CCR V;  1Y66 A;  3B77 A;  2WLM A;  1MAB G;  3DTU B;  5CN0 A;  3F7Y C;  5LGN A;  2UXX A;  2EIL B;  4MTX A;  2HR3 A;  2GSM B;  3D3I A;  1DF4 A;  3DGE A;  4MVQ A;  3F5W C;  4MSW C;  4JAV A;  4N23 A;  5KUK A;  1K33 A;  4X8A A;  2HLD G;  2CK3 G;  5L3E A;  2X6B A;  2M7W A;  4JTA B;  3STL C;  1EZJ A;  5B1A B;  4P9O A;  4I5S A;  5HFL A;  3CCJ V;  3UKM A;  1GM8 A;  5GW7 A;  5C93 A;  2R9R B;  3ML0 A;  3OAA G;  4JF3 A;  4E2L A;  3OFN G;  4KUM A;  2A9H A;  3E8H A;  5B3S C;  3W7U A;  3CPW U;  3VBB A;  3ZMU A;  1S0V A;  3CC7 V;  2LP7 A;  2EZP A;  4GX1 A;  3CD6 V;  1E1R G;  4FIP C;  1ARO P;  3OUS A;  5LHH A;  1K9M W;  1GO3 F;  1FXH A;  2EIN C;  1Q7Y W;  1THZ A;  2K1E A;  3AG1 B;  3SYO A;  4JTD B;  5B1B B;  5EBM C;  2Y69 C;  3ABK B;  1VQ4 V;  3AG4 B;  1QLE C;  2NNU A;  4U7N A;  2EIK B;  1BHB A;  1PNM A;  4MW8 A;  4WFG A;  1S77 D;  3JD0 A;  3ABT A;  4GX2 A;  4LC1 A;  3E89 A;  4QPJ A;  1K97 A;  4RUE A;  5DN6 G;  1S72 V;  1OCC C;  3ASO C;  1K4D C;  4P2Z A;  2KB1 A;  5IY5 B;  2QEX V;  1I5X A;  2XAQ A;  3VOU A;  2QTO A;  2ZR3 A;  3HB3 B;  1YJN V;  1MG1 A;  4X89 A;  4PA3 A;  2B1I A;  1KC8 W;  1DLB A;  3M99 B;  3W7T A;  3RBZ A;  1R6K A;  1VQM V;  3ETD A;  4GX5 A;  4UXN A;  3OR7 C;  3LDE A;  3G4S V;  4P9P A;  1P7B A;  1CEZ A;  3ZRV A;  3FYI B;  3JCZ A;  1YTF B;  5H9C A;  1VQN V;  3CC4 V;  1SZT A;  4JTC B;  4MVZ A;  1ZWI C;  3K0G A;  4JGS A;  5EK0 A;  3ZCC A;  1YI2 V;  2DWD C;  4FK5 C;  3MHS C;  3K08 A;  3JYC A;  3SYC A;  2JIZ G;  3T4D A;  2P67 A;  2JJ1 G;  5L3D A;  1EFR G;  3X2Q B;  4UVB A;  1K8A W;  4PA7 A;  4CBC A;  4G28 B;  1PD3 A;  1OCC B;  3X2Q C;  2WLI B;  2AHZ A;  3CCE V;  2IU0 A;  2GHY A;  4Q20 A;  3SPJ A;  2ZD9 A;  3ETG A;  4LCU C;  3K06 A;  4MTO A;  1QLE B;  3RVY A;  1NJI W;  1WPX A;  2ITC C;  2Y69 B;  3ABK C;  1F51 A;  3OM3 B;  4WF9 V;  1IXM A;  2BOC C;  5LGU A;  2V7Q G;  4QNH B;  3FKS G;  4LP8 A;  2IJH A;  1VQ5 V;  2XND G;  2Q6A A;  5L3B A;  1G8M A;  3QO8 A;  4WCE V;  3CCS V;  4XDL A;  3IFX A;  2WLL A;  4WFB V;  1GM9 A;  3AEI A;  1FXV A;  4WFA V;  3E83 A;  1QCE A;  2WAM A;  1YJW V;  3E35 A;  4HZ3 A;  3SJQ C;  1KP3 A;  1GMG A;  3CMA V;  2DW4 A;  3E8F A;  4JAS A;  4JYC A;  5LGT A;  2W6I G;  1NR1 A;  1PKX A;  5IY5 C;  2IW5 A;  1PNL A;  4BIU A;  1M1K W;  3QO5 A;  5EBL C;  1NH2 B;  3ASO B;  3FB6 C;  1FXK A;  2ITD C;  3LDC A;  1SRY A;  2WLL B;  2JEX A;  3JD1 A;  1K5S A;  1NBM G;  2IJK A;  3ZRW A;  1AI5 A;  2EIK C;  3AG4 C;  1YJ9 V;  2X6A A;  5FL7 G;  5B1B C;  1DTO A;  4PDR A;  3AG1 C;  3SPH A;  1K73 W;  2HKO A;  3ZMT A;  2EIN B;  1E79 G;  4QJF B;  1SET A;  3TCU A;  5CBF A;  4N21 A;  5CA3 A;  3E2E A;  1GM7 A;  1VQP V;  2V1D A;  1OZ0 A;  1KKD A;  1K3E A;  4J9Y B;  2JDI G;  3FB5 C;  5B3S B;  4RUF A;  1B6Q A;  4JAU A;  3CCM V;  1OCZ B;  5H6R A;  1H38 A;  3JD3 A;  4Z1M G;  3ZJZ A;  4ZBM A;  3CXC U;  2OCC C;  4X88 A;  1N8R W;  3LNM B;  5B1A C;  1JOY A;  4UV8 A;  3T2M A;  2XAH A;  1M9N A;  4GCZ A;  1W2B U;  4PDV A;  1FS0 G;  3QNE A;  3STZ C;  1S76 D;  1E1Q G;  1AJQ A;  3FB7 C;  1JVM A;  1V55 C;  2Z5U A;  3I55 V;  1YIJ V;  2HVK C;  2H8P C;  2EIL C;  2XOK G;  2AHY A;  1M90 W;  1VQ6 V;  2EIM C;  3LDD A;  3SPI A;  1K34 A;  5CMU A;  3OW2 U;  3JD2 A;  1Q82 W;  2OT5 A;  2C2A A;  2IJI A;  2IU3 A;  3EFF K;  2R9I A;  1RPR A;  2WWW A;  3W7S A;  3JD4 A;  1BHA A;  3WG7 B;  4MVM A;  3T1C A;  1PL0 A;  3CCL V;  4LBE C;  4XDK A;  5LHI A;  4PDL A;  3WFV A;  1JX9 A;  2Q68 A;  2OTJ V;  3ZRS A;  1GK9 A;  2W6J G;  2WPD G;  5EBW C;  1DF5 A;  2X7R B;  2XAJ A;  4UUJ C;  1QBZ A;  1VQ9 V;  1QR9 A;  3E8B A;  3OMN B;  4RQF A;  3OGC C;  3R65 A;  4I9W A;  1COW G;  1F4N A;  1JQ0 A;  2BOB C;  3MD0 A;  2DYS B;  3SPG A;  2Y48 A;  1Q81 W;  3HPL C;  1OCO B;  3TK1 A;  3K9A A;  3A0R A;  2XAF A;  2QA4 V;  2X0L A;  3W7X A;  3PJS K;  4P30 A;  2HJF C;  4R8C A;  1UJW B;  5EC2 C;  4DXW A;  2EJR A;  5IDJ A;  4KFM A;  3KG2 A;  2MK3 A;  2PI5 A;  4PA6 A;  1CP9 A;  4MVU A;  3K03 A;  4KP4 A;  4U7O A;  2ZR2 A;  2DWE C;  2WLH A;  3K79 A;  3OEE G;  2P90 A;  3ABL C;  3G6E V;  2YEV B;  3RW0 A;  3E8G A;  4MTF A;  1CPY A;  1OCR B;  3G71 V;  3ASN B;  1NR7 A;  1M57 B;  4XDJ A;  1FXK C;  2ZXW C;  2Q67 A;  2P7T C;  4MTG A;  4QIW F;  4RAI A;  3I56 V;  1G4Y B;  1NKD A;  1QR8 A;  4WFF A;  2EIJ B;  4FJC C;  1K4C C;  3ZMS A;  4GX0 A;  4UVA A;  2QM7 A;  1RM1 B;  3B8M A;  5LBQ A;  3AG3 B;  4BW5 A;  3FB8 C;  2Z3Y A;  4QPK A;  4UV9 A;  4ZKI A;  5EC1 C;  2W0F C;  1AJN A;  2YEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...