4MSWC

Y78 ester mutant of kcsa in high k+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mswC00
4UUJC 4WFFA 2BOCC 2WLLA 2EIMC 1R3JC 2ITCC 3LUTB 4PA3A 1OCOC 5EBLC 4PA4A 2ZXWC 4J9ZB 4LBEC 2WLJA 4J9YB 4MVOA 3RVYA 4F4LA 2IH3C 4H33A 4LCUC 3ASNC 4MVZA 4P9OA 3RVZA 4QE9A 4MVRA 2HFEC 5E1AC 1OCZC 3AG2C 3K03A 2WLIA 4JTAB 4MTOA 3SYOA 3ZJZA 2HG5C 5B1AC 5IY5C 1P7BA 2A9HA 3E86A 2DWEC 2DYRC 3E8GA 4PA9A 3T1CA 5EC1C 1R3IC 2Q68A 2QKSA 4PA7A 1M57C 4QE7A 5CBFA 1JVMA 3AG1C 4G27B 3FB6C 2K1EA 2ZD9A 4PA6A 3WG7C 4JTDB 3ABKC 2A79B 4MTGA 2WLKA 2A0LA 3T4ZA 3UM7A 3T4DA 2W0FC 3LDDA 2HVKC 2HJFC 4ZBMA 2R9RB 2ATKC 5EK0A 4EKWA 5CBHA 2IH1C 2WLMA 3AG3C 3LDEA 3FB7C 4MTFA 2KB1A 4HYOA 4X89A 4XDKA 3K08A 1V54C 2EIJC 3TCUA 4P2ZA 1R3LC 4JTCB 3SPJA 1R3KC 3K0GA 1OCCC 4LP8A 1OCRC 2Q69A 3RBZA 1KKDA 4QNHB 3FB8C 2QTOA 4TWKA 4OXSA 3SJQC 1XL6A 3OR7C 2X6BA 4CBCA 3R65A 4KFMA 4MVMA 3E83A 5KUKA 3KG2A 4MVUA 4MS2A 3K04A 3UKMA 3T2MA 4RUEA 2NLJC 4RAIA 4G28B 1M56C 3FB5C 3TETA 4PDVA 3PJSK 2JK5C 1XL4A 3K06A 4GX0A 4H37A 3SYCA 3E89A 3OUFA 3SYPA 5J9PC 3GB7C 3X2QC 1ZWIC 2Q6AA 2WLNA 3F7VC 3RW0A 3LDCA 3SPHA 3F5WC 5B3SC 2EILC 2ITDC 4P30A 4PDMA 2Y69C 4RUFA 5B1BC 3E8HA 5BZBA 2P7TC 3E8BA 3SPCA 3VOUA 4DXWA 2X6AA 3EFFK 2EIKC 3ZRSA 3SYQA 1V55C 3OUSA 4R7CA 1J95A 2DYSC 3IGAC 4PDLA 3ABMC 4XDJA 2HVJC 3SPGA 4RO2A 3STZC 3OR6C 1S5HC 4X8AA 1K4DC 4I9WA 4R6ZA 4XDLA 4P9PA 1K4CC 3JYCA 4R50A 4MW3A 4WFGA 3OGCC 3AG4C 4MW8A 2AHYA 2BOBC 3HPLC 4MVSA 1QLEC 2DWDC 4HZ3A 5EBMC 1LNQA 2WLLB 3K0DA 4MVQA 2YEVA 5KUMA 3E8FA 4WFEA 1G4YB 4GX1A 5CBGA 3STLC 2X6CA 4MSWC 1ORQC 3BEHA 4WFHA 2H8PC 2OCCC 2WLHA 3ABLC 3F7YC 4GX2A 4PDRA 4R8CA 2EINC 5EBWC 3SPIA 3IFXA 2AHZA 3SYAA 3LNMB 4BW5A 3ASOC 2WLIB 4GX5A 4X88A 5EC2C 1BL8A 2Q67A
chains in the Genus database with same CATH superfamily
3ETGA 4K3AA 4PA3A 5C8YB 1W0KG 3OM3B 3ZMUA 1RM1B 1ROPA 1S72V 3AG2C 2WLIA 3OT7A 2HLDG 3PN1A 2DWEC 3B4SA 2DQ3A 4FFBA 2JGDA 3QVNA 5L3CA 4KHPO 4EEQA 2DE0X 3C90A 1YZBA 3LSSA 1GH6A 1FXVA 2HVKC 1XBLA 1MNGA 3LSUA 4RQFA 2UU9O 4DYLA 4X89A 2Q73A 4XDKA 1SESA 4NXNB 1AVMA 2QTOA 2QWRB 4DV1B 3I5DA 1UPGA 1XNQB 5IYDO 1DK1A 2XOKG 3I56V 1FXKA 5JH7B 1H8EG 1R6KA 3BA9A 3CRQA 4ZIBA 4LF6O 1AR5A 1ZWIC 4AQYO 2RQ6A 3U11A 3RW0A 3LDCA 4FMTA 4O4JB 1DGSA 3C3TA 3D3QA 5B1BC 3FX7A 5BMVA 1VQLV 3L73H 2XAGA 3EFFK 5JVDB 1K92A 3JD1A 2E5LO 2CTQA 2XAQA 1HW7A 3APQA 2HVJC 4TV8A 1N36B 2Q7GA 1IDSA 1HNZO 4I0XB 4XDLA 4ASUG 4X65B 4DUZB 2OTJV 1VQOV 4B3SB 1SF9A 2BOBC 3CMAV 2WLLB 4K0KB 4NR1A 3RFRA 1G4YB 2RDCA 2X6CA 1LUVA 4WFHA 5LOVB 1R1BA 3JATB 2FTKA 1JQ0A 1JX9A 1N33O 2BOCC 1O9HA 4DV7O 2QSAA 2Y48A 1K7DA 4TUYB 4ICGA 1V54B 2UXDO 1VQ4V 1X59A 4EFBA 2KSDA 2ILMA 4PA7A 1NKDA 2FB5A 3RYFA 2CH7B 1NTMH 1KP2A 2UXXA 2A06H 2PYLA 1GN4A 4EB6A 2JS3A 4JYAB 4G2KA 3MDSA 4FLWA 3M8AA 2LP7A 5IE9A 1Z5WA 1FFXB 5LGNA 3H1KH 2DQ0A 4YJ2B 3P32A 4JI7B 1XREA 3JASA 1NS1A 1OCCC 3U10A 3RYIA 1WAZA 2LW1A 4MVMA 5H5NA 3DSQA 1MSWD 4FPPA 4LF9B 4DR7O 1BQZA 4H37A 1R6NA 1VF6A 3FAVA 5JWPA 1GM9A 1X4TA 1F7YA 4IL6Z 4PHZA 3TGUH 3ZRVA 3CCEV 2PZSA 1US6A 4DXWA 1H2SB 4JI8B 2XAHA 3QNEA 1NBMG 1K4DC 3ZCCA 3BHPA 4C7UA 3G6EV 1S77D 1ZL8B 3IC7A 5HFMA 1M57B 2VQEB 4X66O 3HPLC 2JDIG 1WNSA 4WFEA 4GX1A 4DR4B 4QGPA 2GTSA 5KLVH 5H6RA 1PD3A 2V7QG 4OX9B 1L0NH 4WBNA 4X1YB 4GLXA 3FKSG 4FVMA 3OTFA 1PNKA 3CCRV 3W7TA 1EM1A 1GRJA 3OMAB 2WLJA 4J7KA 1YTFB 1IBMO 3QG5A 1OCZC 1HDJA 4CC5A 4B08A 2KG7B 2EJRA 1I0HA 1AJNA 4X1KB 3ZRXA 3ABTA 2ZINA 1SERA 2IJJA 3JAKA 1MMMA 4X64O 2DOSA 2FKXA 2NR5A 1OHHG 5IJ9A 2ZM6B 4GKKB 3J80N 4HYOA 1P4RA 1NH2D 2Z0AA 2WAMA 5FPOA 3SPJA 3K0GA 4K35A 1OJHA 4DV4B 2UUCO 5KUKA 1WJZA 2VQFB 2QWNB 1AR1B 1G8MA 1EZJA 1M56C 2B9ZA 3FB5C 2IM9A 3BRCA 5KMGB 3N27A 2XHBA 4JI0O 4ABMA 5DM6V 3B77A 1BCCH 3G67A 4YY3B 1HWYA 1QVFU 1I5YA 3E8HA 1CXZB 1YEWA 2H3OA 4LF7B 4DR6O 3KCYA 1V55C 2ZE8A 3CCUV 2QTSA 4I4TA 2F95B 4DK1A 2YIAA 5CA1B 1Q5OA 3R66A 1Q82W 3MAQA 3AG4C 5EYPA 2CDYA 3ABKB 4NVPA 2W0XA 4MSWC 2A3QA 5LHGA 3CMEV 1AROP 3TXSA 3HKBB 3MHHC 1H38A 3CE2A 3IC9A 3AK2A 3CC4V 2BSKB 5FNVB 1QNMA 4MVRA 5BY1A 3K5OA 3EVKA 2GBOA 3ZRWA 4FK5C 1QR8A 3TK1A 4JTDB 5GTIZ 3WFVA 3N2KA 3A0HZ 3P30A 5IT9N 3B8MA 2ATKC 1XDCA 2XASA 1VP7A 4X62B 3X2QB 3ZHRA 1W59A 2WLMA 1BS3A 1H2KA 1IURA 4MTFA 1D5NA 1TVKB 4O2BA 2Q8VA 3TCUA 4IT5A 5LXTA 1AI6A 5L3FA 4TWKA 1GO3F 3DGEA 3K9SA 4LF5B 5J2UB 3CX5F 2YXYA 4CH5A 2PGGA 4U3JA 2OIGA 1ZLZA 2Q0OC 3RT3C 1XL4A 3JAWB 2YIBD 4CS3A 3F7VC 2RJZA 2EILC 4J41A 4LH6A 5H9CA 4F6EA 2UXCO 2YICA 4TV9B 1ZUQA 5BZBA 4CH4A 1PL0A 1Y66A 4CS4A 1D5AA 3SYQA 3OUSA 4LWSB 4LF4O 3CRRA 4CZZA 4R6ZA 1CEZA 4NXMB 1QLEC 1K97A 1GN2A 3JARB 4RQEA 3ABUA 1QBZA 3D3IA 3A2FA 2OCCC 2WLHA 4PDRA 5LMUO 5KA5A 4Q6GA 4UCVA 4X88A 2ARHA 1MZFA 3K57A 5EBLC 4PA4A 1P7GA 3CRMA 2OT5A 1VQ6V 2JS5A 2QE7G 3H1LH 2UXBB 4KHPB 2Q0AA 4JZGA 4U3JB 4I7ZB 1H8HG 3BY6A 1L1FA 5J2TB 4PA6A 2BCCH 3WG7C 4XBFA 4IHJA 3ML0A 1BT8A 4UCOA 2F23A 3CSXA 4ZBMA 3HKCB 4LFAO 2B1GA 3AG3B 4JZ2A 5EK0A 2EBOA 5KHKA 4UCUA 1EN5A 4UV8A 3RYCB 4JI1O 1VQMV 3BAAA 3K08A 4FZ1A 3M99B 3Q4HA 1Y76B 1KYOF 1E79G 1M4UA 1TUBA 3R65A 3KG2A 2GUZB 4RUEA 5L3BA 1JFFA 4AQYB 1YTFD 3SDLA 2ZCEA 5LA6A 4NTWA 4RWUA 1VARA 3T1HO 4DR5O 5JQGA 3JD0A 1N34B 3QO7A 1J95A 4JASA 1XOUA 1ENVA 3I55V 4Z1MG 4X8AA 2GV9A 5IJ0A 3O65A 1K4CC 2YXHA 4MW8A 4FLYA 3WB0A 4GCZA 5BR8B 3HR0A 5GONA 4ZKIA 5B5EZ 5LP6C 3ETQA 3NXSA 3LNMB 3RYHA 1YHQV 1YF2A 1SQFA 4LCUC 3ASNC 4E2LA 1QR9A 1Q86W 1XNRO 3N2GA 1WLEA 1NJIW 5L3DA 3CC2V 1NH2B 5EC1C 1TA8A 1AI7A 3CJHB 1YIJV 1JVMA 3P3PA 4WF9V 2YI8A 3FB6C 3LSQA 4DW0A 2W0FC 5FPRA 1CP9A 2B5UA 4X1IA 4D7SA 3E22B 5IWAO 2OIEA 3UT5B 2KB1A 3WB2A 5EZYA 1NZ6A 1KBHA 4DV3B 4L8JA 1WA8A 4BAYA 1R3KC 2ZT9B 2NNUA 4DR1O 1SA0A 5E79Z 2DYSB 3ETDA 3SJQC 4WFBV 4YJ3B 3ABMB 1Q6HA 3DC6A 1XMQB 1RP3B 4B3MO 1XILA 1XMOO 4G28B 3FFQA 4GKJB 5KHJA 1BMFG 3J7AU 1N0JA 3OE7G 1M93A 1P84F 4KL1A 5CN0A 3JALA 2EIMB 2EIKC 5H2FZ 2ZNIA 2RNBA 3KKYA 2P6JA 4JF3A 1GKFA 3IGAC 2YEVB 1S3JA 3HKEB 3CD6V 4I50B 3B40A 3UO3A 1YJNV 4UB6Z 3CC7V 4MVSA 3AG1B 2OTLV 4JYBA 1M5IA 2WSSG 3BEHA 1HP8A 3ABLC 1J5EB 2EINC 3IFXA 2AHZA 4DV0B 5CA0A 3ASOC 2WLIB 3SJCC 3ZHTA 2Z5UA 4FLTA 4FFBB 2JGDB 4A5UB 2LO1A 2AZ2A 2WWWA 2ZXWC 4LBEC 4DV5O 3K03A 5B1AC 1P7BA 2A9HA 2DYRC 1XQ8A 1QVGU 4QPKA 5D5QA 4JI6O 1MZEA 1XHZA 3UM7A 3T4DA 3B8NA 2PY5A 3LDDA 1N4CA 1FPOA 4UFZA 1NVPD 2HHHB 4K8XA 4B3RO 2GHYA 2ZNJA 4CH6A 1D2DA 2P4VA 1U97A 3JSLA 3KZIZ 5LMNO 1R3LC 4HAMA 1FXKB 4NYKA 2UUAB 3FB8C 2X6BA 2RN9A 2DMXA 2WA4A 2XUMA 4KFMA 1I94B 4FLXA 1AI4A 5CB4A 5D5PA 1OZ0A 5BMVB 4RAIA 1WB8A 3TETA 1FJGB 1YXBA 1O9GA 3K9AA 5JJEB 1UFIA 4JI5O 4TV8B 1MSDA 1Q6UA 4TT3G 4UXNA 4FZ0A 1HR0O 1IZ3A 1IBLO 3RWRD 2N05A 1OCOB 4TQFA 5GW7A 1JCHA 3JCZA 1B6QA 2PF4E 1L8DA 5HFLA 2QA4V 1EBOA 5LP6A 4O4HA 4LNUA 5KAFZ 4BIZA 3ICXA 4B3TB 1IBKB 4IYHA 1AB3A 2BTQA 3OGCC 2WA3A 5IYZA 2DJVA 3ZN1A 4LC1A 1BGYH 3EXAA 3TJTA 4WFAV 5H6QA 4BWAA 5KUMA 3D8CA 2DN9A 4GX2A 3UQ8A 2CE4A 2EJ7A 3CEIA 1EZVH 2YS8A 5A9GA 4GZRB 3FD9A 3RYFB 2EIJB 1Y6XA 5BXZA 4EB6B 2GDSA 5LGTA 2HR3A 5IY5C 2Y0PA 3T1CA 4NXNO 4ZHQA 2IU0A 4TSFG 4G27B 1SQVH 4Q20A 1JJOA 1RSOA 4DR2B 4DV1O 1G6UA 5A2QN 4NTYA 3JASB 5ITZA 1XNQO 2LW7A 5LHHA 2MW2B 2IH1C 3GWKC 3AG3C 3RYIB 1K73W 2VRZA 2Y69B 4BW9A 4X20A 3ZX6A 1OCRB 1AJQA 3NR7A 3K58A 3OMNB 3JSNA 4ZOLA 1AJPA 4DR3B 3FYIB 4LF8O 1H2MA 3FAVB 3OR7C 1BSMA 4CBCA 3T2MA 3L71H 2Q7EA 5K1PA 3SYCA 4X65O 3SPHA 4DUZO 3F5WC 3ZHUA 5B3SC 4B3SO 1K5SA 4K0KO 2FYUH 1N32B 1CPYA 4EFEA 2FMLA 3OMIB 1SETA 2UXNA 2ZDIC 3ZS8C 4L87A 3AG2B 2E75B 2G38A 3OFNG 1KUQA 1Q90D 2YDEA 5JJJB 4ZI7A 2QM8A 1H2LA 4JI2B 3HKDA 3W7SA 3TXQA 5CMUA 1RPRA 4WBNB 1NI8A 1I7FA 5B66Z 1YJ9V 4TOIA 3W7XA 3BABA 2H8PC 1SQXH 1SZTA 1ZSPA 4GX5A 4O2AA 2ADQB 3GVMA 4WFFA 3OEEG 2R9IA 1JJ2U 3RVYA 1VQ9V 3JAKB 4P9OA 2ZKOA 4NB5A 3CS5A 4JTAB 3ZJZA 3FYEB 3CWBH 3W7WA 1SRYA 5IJ9B 1VF7A 3QO8A 4LFAB 3WU2Z 3ZIAG 4NTXA 4LF9O 2QR4A 1YSCA 2M6YA 5B1BB 1RM1C 4DRXA 2HKOA 2E74B 3RBZA 3DXRA 1JMKC 4OXSA 2IJKA 3E83A 3K04A 3A0RA 3THOA 1JOYA 3E35A 3L75H 4UCSA 1KECA 2PI4A 3SYPA 3B2EE 1UJWB 1GMGA 2Q6AA 4DR5B 2UUBB 1K8AW 2K9PA 4JAVA 4JI3O 4I4TB 2JIZG 5FLXN 2ITDC 2VQEO 4P30A 4IIJA 4AHCA 4MT8A 3RGBA 1HNWB 3SPCA 4DUYB 4UVAA 4DR4O 1URFA 4U7NA 2HEPA 2P06A 4O4IA 2OWOA 1XEQA 5EYPB 4XDJA 2E76B 4OX9O 3QTCA 2F93B 5L3GA 2EX3A 1PV0A 4KXRA 4R50A 4OPHA 4LFCB 2Z3YA 4KP4A 2CAZC 2IJHA 2QWQB 2QDOA 4JYCA 3ZMTA 1Z5VA 3L74H 3H1HH 1XI1A 3L70H 3CCJV 1HNXB 4J10A 3ZRWB 3H01A 4J9YB 4YXWG 4H33A 1NVPB 1RFYA 1WP7A 2ZM6O 4JI4O 3N2KB 3SYOA 4GKKO 1OCCB 4JGSA 4WCEV 1P49A 2ZD9A 3CCQV 4DV4O 2ADPA 2WLKA 3VBBA 4O2BB 2IU3A 5F2VO 5LXTB 5CA3A 3OD4A 4GT1A 1MG1A 3T1YO 4JPRA 5CBHA 4W4LA 4K8ZA 1WPXA 1QU7A 1V54C 2LGQA 1YCIA 2CGOA 2VWKA 1U96A 4I55A 4O4LA 3VQVA 5DECA 3K3WA 1FKAO 5EIBD 3K79A 2HP8A 4CS2A 1BE3H 1H2NA 2UU9B 2NLJC 1B3QA 3K06A 4GUNA 3SGIA 5LYJA 5IDJA 3ZHSA 2X7RB 3G4SV 2WPDG 2ZDIA 2QKAA 1KU9A 1QCEA 1I5XA 4H0LB 4CH3A 2A7WA 1Y74A 2QGNA 4HNAA 4BIOA 4R7CA 3OGIB 2Q5ZA 4LFBO 1QQCA 1OCZB 4LF6B 1EN6A 3JYCA 1R73A 2P22C 2XAFA 4FFKA 3K0DA 2F66C 1XUQA 5KX5A 3CRCA 2E5LB 5EBWC 2Q67A 2V4DA 5DN6G 4DV5B 2BE3A 3LUTB 1HNZB 2QJ1A 2L35A 4X62O 2GSMB 4PJ0Z 1BZKA 4IHJB 1IXBA 1VIBA 4F6RA 1R6TA 2YSUB 1GAXA 2D2CB 1M57C 2EZOA 5C8YA 4U3FH 4FIPC 5GTHZ 4J7ZA 1N33B 1G1XB 1GN6A 1Z2GA 4DV7B 1M56B 3CP1A 3Q4HB 3K5LA 2R9RB 1SQPH 1EFRG 3ZHVA 2UXDB 3FB7C 1TUBB 4UCRA 3BA8A 1B06A 2CTPA 1JFFB 3CCMV 1OCRC 4J11A 1V55B 3BVOA 3VQXA 1FS0G 4CC6A 2PYJA 1VQPV 1JR9A 4MVUA 3G80A 5LA6B 2JEUA 4NKGB 1NR1A 5DEDA 2LJ2A 3AG4B 3DTUB 4PDVA 5J9PC 5JQGB 3E89A 1WP8A 4DV2O 3APOA 4NXMO 1AP6A 1HR0B 3H1JH 2CGNA 5JH7A 2LGWA 2IW5A 4QPJA 5IJ0B 1FXHA 2F4VO 2O57A 3MD0A 4DR7B 4O4JA 1ZTEA 4TQDA 5FL7G 5GONB 3STZC 3OR6C 1S5HC 4P9PA 3OTOO 1KQSU 2ZQMA 4UB8Z 5JVDA 1S0VA 2F43G 3RYHB 4MVQA 2XTAA 2UXBO 5CBGA 3SJAC 4R8CA 4I0XA 4N21A 2MK3A 4LH7A 3N2GB 1WB7A 2W6IG 1FAFA 1DF5A 1BL8A 1YJWV 3SJBC 2YIDA 1E1QG 3BPZA 2WLLA 2ODMA 1F51A 2Y4UA 2IH3C 4MVZA 5LOVA 4X66B 3JATA 3ZN0A 2N04A 2HG5C 3U0ZA 3CB2A 1KKCA 2KKWA 4X1IB 2P90A 4PELA 4TUYA 1QHTA 3ABKC 2IBZH 3CRAA 5EZYB 2YIBA 1S76D 1WPBA 4DV6O 4B7KA 1WA8B 4FJCC 1F23A 1VQ8V 2P67A 2F1MA 1SA0B 2YUAA 3CCVV 2CH7A 1IBMB 4PI0A 1MABG 5LGUA 2M7WA 2EILB 4FM1A 4OGQB 3MHSC 3A0BZ 4P2ZA 3O9OA 1F4NA 3ZHQA 5JCOC 4LF8B 3JCUZ 4X64B 1Q43A 1FFXA 3GWOA 1N8RW 1N34O 4YJ2A 1NQTA 2Q4PA 2P4KA 2R70A 4GX0A 3CXHF 2JK5C 1QLEB 1TGOA 3JALB 3JD2A 3PJSK 4JV5O 3GB7C 3X2QC 3B09A 2OCCB 4PV1B 2UUCB 1M9NA 1N0NA 1Q7YW 2ETNA 5BR8O 5JJNB 2LFSA 2R72A 2P7TC 4GYCB 1LR1A 3QO5A 1M1KW 1IX9A 1VMGA 4RO2A 3W7UA 4I9WA 4JI0B 2JEXA 5CA0B 4JAAA 1FFTB 5KHGA 3ZMVA 2DWDC 4YIOA 4YHHO 1LNQA 3WG7B 4DR6B 3SR2C 1ZL8A 1BHAA 2H94A 4FLUA 2C2AA 3JAMN 2ZE7A 5C93A 2FL4A 4BIUA 4MVOA 4F4LA 5KAIZ 2XNDG 4QE9A 1OV9A 4X1YA 1R3IC 2ZR2A 2RCVA 4DV3O 1VQKV 1TUEB 4YIPA 1XMQO 2KG7A 1I08A 4X1KA 1NU1H 5AG2A 3H1IH 2Y0IA 5CB4B 4GKJO 1S5LZ 2CTRA 1GM7A 1M90W 1XL6A 2PUSA 2QM7A 1VEWA 2JRIA 1AR4A 1TAEA 4DO2A 4JI3B 1AILA 4DW1A 3S3XA 4JYYA 4FLVA 2OYQA 4RUFA 5LP6B 1K3EA 5TISZ 1THZA 4O4HB 4LNUB 3WB1A 3ZBHA 5KMGA 2BTQB 1BHBA 1J5EO 3ZRSA 5IYZB 4DV0O 2QKCA 4AI8A 3C3SA 3AEIA 3ASNB 3SPGA 3VQWA 1PNMA 2X0LA 1N36O 1SQQH 1KC8W 4MW3A 1BQ0A 1YVWA 1SC5B 4Z2WA 4AILC 2RMKB 3D36C 2UXCB 3AG7A 3AK1A 2D3OW 1IVSA 1ORQC 5CA1A 1VQ7V 3ETEA 2YXLA 1Q81W 4J42A 3K5NA 1K34A 3KCXA 4LF4B 4ZHQB 3F5TA 4JI4B 3RVZA 3CXCU 2HHHO 1RSOB 3HKBA 3CCLV 3E86A 4PA9A 5ITZB 2HJDA 2AXTZ 4QE7A 5CBFA 2BSKA 5L3EA 1YDXA 5LMUB 5FNVA 1Q6IA 2UUAO 3T4ZA 2EZPA 5JCOA 1F4MA 3A8TA 1KMIZ 2JJ1G 4X20B 3T1YB 1COWG 4UVBA 4QJFB 4BR6A 1I94O 4JYAO 4ZOLB 3ZMSA 4EKWA 2YC0A 1FJGO 1K33A 3IJ4A 2PI5A 1SQBH 2AZ0A 1QLNA 2QWPB 4IYIA 4LR3A 2IJIA 2JJ2G 4I5SA 2EIKB 2R9AA 3EHBB 4UCTA 1FD9A 4JI7O 5K1XA 4QNHB 1KKDA 1B04A 1FYJA 1TVKA 3OW2U 1GTOA 2DW4A 1SKVA 3IAYA 4U7OA 4JI1B 1H2GA 4B3TO 1IBKO 5LBQA 2VS0A 5J2UA 1E1RG 3ABLB 2EINB 4JAUA 3ASOB 2ZIOA 3E8BA 1DF4A 2QEXV 3JAWA 1DLBA 1DTOA 4ZI7B 1L0LH 3HKDB 4LFBB 2E3CA 1W2BU 2ZXWB 1GN3A 2DYSC 4PD4F 2CUGA 3ABMC 4JI8O 3UO2A 1SQGA 1NTKH 4TV9A 3S3WA 3G6BA 5B1AB 3P3NA 2DYRB 4O2AB 4E4EA 5KHIA 3T1HB 4LWSA 1YITV 4B7EA 2PTMA 3OAAG 4W4KA 2LQTA 2Q7HA 5EC2C 1GM8A 2GTAA 2JGUA 4UVCA 2Y4TA 4KUMA 4UUJC 1JPXA 2EIMC 4DR2O 1R3JC 4I9QA 3JARA 1LUWA 2ITCC 2XT9A 4J9ZB 2N74A 5E1AC 2HFEC 4MTOA 1WN7A 1Y4MA 2CTWA 3E8GA 4PI2A 1YI2V 2Q68A 2QKSA 3AG1C 2K1EA 3CPWU 3CHXA 2A79B 4DR3O 5KHHA 3QF7A 3L72H 3ZMZA 4DRXB 2HJFC 3E2EA 2CK3G 3AK3A 3DXRB 1PP9H 5J2TA 1XNRB 2XAJA 3BCCH 3BFRA 3HB3B 3UCSC 3HKCA 4JTCB 2ZE6A 4LP8A 5IYCO 1RPOA 5KA6A 4J7JA 3CYOA 1AP5A 3JD3A 1ZAUA 1MOFA 2NN4A 3RYCA 1N32O 4QIWF 4MS2A 4IIJB 1MA1A 2OCHA 1Y76A 5IWAB 4DV2B 2VQFO 1SS3A 2V1DA 3M7MX 3OUFA 1KB9F 1ZX3A 4O4IB 1EN4A 4JI2O 2GUZA 4DR1B 4PDMA 2F4VB 2Q9LA 1V9PA 2EULA 1FXKC 3VOUA 4YY3O 1PPJH 2X6AA 3D36A 4B3MB 1XMOB 4LF7O 2YI9A 2AW9A 3OTOB 2JVDA 1NR7A 1Y67A 5IY5B 1PKXA 4WFGA 4J80A 1Q3EA 4DK0A 5EBMC 1KP3A 3E8FA 1GK9A 3F7YC 5B1OA 2W6JG 3OEHG 2QM4A 2QWOB 3RN4A 1OCOC 1XHXA 2L6LA 3JD4A 1NT2B 1KD1W 3K5MA 5IYBO 1Q8IA 1T5EA 1AI5A 1PNLA 1PM9A 2BTOA 4MTGA 1W0JG 2A0LA 4DV6B 1NTZH 1K5QA 4I55B 3CJHA 1A32A 4O4LB 5B1NA 5EIBC 5LHIA 2LFRA 3LDEA 2VWJA 5B3SB 3ZEDA 4H44B 3DC5A 3J81N 2EIJC 2UUBO 1SZXA 4FM2A 4Z1VA 4JI6B 1PL4A 2Q69A 5LYJB 4N23A 3E22A 1HNWO 3UT5A 4DUYO 2AGAA 3UKMA 4MTXA 4JV5B 4LF5O 2ZE5A 4B3RB 3LNNA 1VF5B 4FM0A 3K59A 4D7TA 5LL6Y 1Y74B 4YJ3A 4HNAB 2WLNA 5LMNB 4LFCO 4HBNA 4X9QA 3G71V 2Y69C 4OPAA 4H13B 2ZR3A 4FLZA 3H9VA 1JA8A 4IGGA 1S5JA 3L9DA 2P5OA 2ZIMA 2KQXA 1IXMA 1VF6C 1VQNV 4PDLA 5KX5B 1HNXO 3CCSV 4YHHB 1K9MW 2AHYA 4JI5B 4HZ3A 2YEVA 3STLC 3HKEA 1IBLB 1VQ5V 4I50A 3SPIA 3SYAA 4BW5A 4F6RB 3VQYA 4D6TH 2B1IA 4UV9A
chains in the Genus database with same CATH topology
3ETGA 4WFFA 5C93A 4PA3A 5EBLC 3OEEG 2R9IA 4PA4A 1W0KG 1JJ2U 3OM3B 3RVYA 3ZMUA 4MVOA 4BIUA 1ROPA 4F4LA 1RM1B 1VQ9V 2XNDG 2OT5A 1S72V 4P9OA 1VQ6V 4QE9A 2QE7G 3AG2C 2WLIA 4JTAB 3ZJZA 2HLDG 2DWEC 3FYEB 2DQ3A 1R3IC 5L3CA 1H8HG 2ZR2A 3BY6A 1SRYA 3W7WA 1L1FA 3LSSA 4PA6A 1VQKV 3WG7C 3QO8A 4XBFA 1TUEB 3ML0A 3ZIAG 1FXVA 2HVKC 4ZBMA 2B1GA 3AG3B 4RQFA 5EK0A 2EBOA 1YSCA 4UV8A 1VQMV 4X89A 5B1BB 1RM1C 4XDKA 3K08A 1SESA 3M99B 2HKOA 1GM7A 3RBZA 1M90W 1E79G 2QTOA 4OXSA 1XL6A 2QM7A 3R65A 2IJKA 3E83A 3KG2A 3K04A 5IYDO 3A0RA 4RUEA 2XOKG 3I56V 1FXKA 1JOYA 3E35A 5L3BA 1YTFD 1H8EG 1R6KA 1KECA 4DO2A 2PI4A 3SYPA 1UJWB 1GMGA 1ZWIC 2Q6AA 3RW0A 1K8AW 3LDCA 4JAVA 4FMTA 2JIZG 2ITDC 4P30A 4RUFA 5B1BC 1K3EA 1THZA 4MT8A 1VQLV 3SPCA 4UVAA 2XAGA 1BHBA 3EFFK 1K92A 3JD0A 3JD1A 4U7NA 3ZRSA 3QO7A 1J95A 2XAQA 4JASA 4XDJA 3AEIA 2HVJC 1ENVA 3ASNB 3SPGA 1PNMA 3I55V 4Z1MG 4X8AA 5L3GA 4XDLA 2X0LA 4ASUG 1K4CC 4R50A 2Z3YA 4MW3A 1KC8W 2OTJV 1VQOV 4MW8A 2BOBC 4KP4A 2WLLB 3CMAV 2IJHA 4GCZA 4JYCA 1G4YB 3ZMTA 4ZKIA 2X6CA 2D3OW 1ORQC 4WFHA 3NXSA 3LNMB 3ETEA 1VQ7V 1Q81W 3CCJV 2FTKA 1K34A 1JQ0A 1JX9A 2BOCC 1YHQV 3ZRWB 2Y48A 3H01A 1K7DA 4J9YB 4YXWG 4H33A 1V54B 4LCUC 3ASNC 3RVZA 1QR9A 4E2LA 3CXCU 1NVPB 1Q86W 1VQ4V 3SYOA 3CCLV 1OCCB 4JGSA 1WLEA 1NJIW 3E86A 4PA9A 5L3DA 3CC2V 1NH2B 4WCEV 5EC1C 1AI7A 4PA7A 4QE7A 5CBFA 1JVMA 1NKDA 5L3EA 4WF9V 1YIJV 2UXXA 1KP2A 3FB6C 2ZD9A 3LSQA 3CCQV 3T4ZA 2WLKA 2EZPA 3VBBA 1F4MA 2W0FC 2JJ1G 2IU3A 1COWG 4UVBA 1CP9A 2B5UA 4G2KA 4QJFB 5CA3A 1BHAA 4GT1A 3ZMSA 1MG1A 4EKWA 4JPRA 5CBHA 1WPXA 2LP7A 2KB1A 1K33A 2PI5A 5LGNA 1QLNA 1V54C 2DQ0A 2IJIA 3P32A 2JJ2G 4BAYA 1R3KC 2EIKB 4I5SA 1OCCC 2NNUA 3EHBB 1KKDA 4QNHB 3K3WA 2DYSB 3ETDA 3SJQC 4WFBV 3ABMB 4MVMA 3K79A 3OW2U 1MSWD 1GTOA 4FPPA 2DW4A 2NLJC 4G28B 4U7OA 4H37A 3K06A 1H2GA 1R6NA 5IDJA 2X7RB 3G4SV 2WPDG 2ZDIA 1GM9A 5LBQA 1BMFG 1E1RG 3ABLB 1QCEA 3ZRVA 1I5XA 2EINB 4JAUA 3ASOB 3OE7G 3CCEV 3E8BA 1DF4A 5CN0A 4DXWA 2QEXV 1DLBA 1DTOA 2EIMB 2EIKC 2XAHA 2P6JA 4JF3A 1W2BU 2ZXWB 1GKFA 4R7CA 2DYSC 3IGAC 2YEVB 1S3JA 3ABMC 3CD6V 1OCZB 3QNEA 1NBMG 1K4DC 3ZCCA 5B1AB 3G6EV 3JYCA 2DYRB 1S77D 5HFMA 1R73A 3IC7A 1YJNV 2XAFA 1M57B 3CC7V 3HPLC 4MVSA 3AG1B 2OTLV 3K0DA 1YITV 2JDIG 3OAAG 4WFEA 4GX1A 4JYBA 2WSSG 3BEHA 3ABLC 5EBWC 2EINC 5H6RA 3IFXA 2AHZA 3ASOC 1GM8A 2WLIB 1PD3A 2V7QG 2Z5UA 4UVCA 2Q67A 5EC2C 4KUMA 5DN6G 4UUJC 1JPXA 2EIMC 1R3JC 3FKSG 1PNKA 2ITCC 3LUTB 3CCRV 3W7TA 2WWWA 2ZXWC 3OMAB 4J9ZB 2WLJA 4LBEC 2GSMB 1YTFB 5E1AC 2HFEC 1OCZC 3K03A 4MTOA 1Y4MA 5B1AC 1P7BA 2YSUB 2A9HA 3E8GA 2DYRC 2EJRA 1YI2V 2Q68A 1AJNA 2QKSA 1QVGU 1M57C 2EZOA 3ZRXA 4QPKA 3ABTA 3AG1C 4FIPC 1SERA 2IJJA 2K1EA 3CPWU 2A79B 3UM7A 3T4DA 3B8NA 3ZMZA 1M56B 3LDDA 3CP1A 2HJFC 3E2EA 2R9RB 1EFRG 2CK3G 1NVPD 1OHHG 2XAJA 3FB7C 2GHYA 4HYOA 1P4RA 1NH2D 3HB3B 2WAMA 1R3LC 4HAMA 1FXKB 4JTCB 3SPJA 3K0GA 4LP8A 5IYCO 1RPOA 1OCRC 5KA6A 3CYOA 1V55B 3CCMV 3FB8C 3JD3A 1MOFA 1FS0G 2X6BA 1VQPV 4KFMA 5KUKA 4MVUA 4QIWF 4MS2A 1AI4A 2JEUA 1NR1A 1OZ0A 1AR1B 1G8MA 1EZJA 4RAIA 1M56C 3FB5C 3AG4B 3DTUB 4PDVA 3TETA 3K9AA 5J9PC 2V1DA 3E89A 3OUFA 5DM6V 3B77A 4PDMA 1HWYA 1QVFU 1I5YA 3E8HA 2IW5A 4QPJA 4TT3G 4UXNA 1FXKC 1FXHA 3VOUA 2X6AA 3D36A 1OCOB 1V55C 3MD0A 5GW7A 1JCHA 3JCZA 3CCUV 1B6QA 5HFLA 2QA4V 5FL7G 1EBOA 3STZC 3OR6C 1S5HC 1NR7A 4BIZA 5IY5B 4P9PA 1PKXA 1KQSU 4WFGA 2ZQMA 3OGCC 1S0VA 1Q82W 3AG4C 2F43G 5EBMC 3ZN1A 4LC1A 1KP3A 4MVQA 4WFAV 5H6QA 5KUMA 3E8FA 3ABKB 5CBGA 4MSWC 1GK9A 5LHGA 4GX2A 4R8CA 3F7YC 4N21A 2MK3A 3CMEV 1AROP 2W6IG 5B1OA 1DF5A 1BL8A 2W6JG 3MHHC 3OEHG 1H38A 1YJWV 1E1QG 2WLLA 1F51A 3CC4V 1OCOC 2IH3C 2EIJB 4MVZA 3JD4A 4MVRA 1KD1W 3ZN0A 5LGTA 2HG5C 2HR3A 5IY5C 5IYBO 3T1CA 3ZRWA 2P90A 2IU0A 4PELA 4FK5C 1QR8A 1AI5A 4TSFG 4G27B 1PNLA 3TK1A 4JTDB 3ABKC 4MTGA 4Q20A 3WFVA 1W0JG 2A0LA 1S76D 1K5QA 3P30A 4FJCC 3B8MA 1F23A 1VQ8V 2ATKC 2P67A 2XASA 5LHHA 3X2QB 5B1NA 5LHIA 3CCVV 2IH1C 1MABG 2LFRA 2WLMA 3AG3C 3LDEA 5LGUA 2M7WA 5B3SB 4MTFA 1K73W 2EILB 2Y69B 3MHSC 3TCUA 2EIJC 4P2ZA 1OCRB 1F4NA 1AJQA 1AI6A 3OMNB 2Q69A 5L3FA 1AJPA 3FYIB 4N23A 4TWKA 3OR7C 4CBCA 1GO3F 3DGEA 3GWOA 1N8RW 3UKMA 3T2MA 4MTXA 1NQTA 3PJSK 2JK5C 1XL4A 1QLEB 3JD2A 4GX0A 3SYCA 3GB7C 3X2QC 2WLNA 3F7VC 3SPHA 3G71V 3F5WC 5B3SC 2EILC 2OCCB 5H9CA 2Y69C 1M9NA 1K5SA 1Q7YW 2LFSA 2ZR3A 2P7TC 5BZBA 1PL0A 1CPYA 1Y66A 3QO5A 3SYQA 3OUSA 1M1KW 1IXMA 3OMIB 1VQNV 4PDLA 1SETA 2UXNA 2ZDIC 4RO2A 3W7UA 4L87A 3AG2B 4CZZA 4I9WA 4R6ZA 2JEXA 3OFNG 3CCSV 1CEZA 1K9MW 2QM8A 1FFTB 3W7SA 2AHYA 3ZMVA 1QLEC 1RPRA 1K97A 2DWDC 1LNQA 4HZ3A 5CMUA 2YEVA 3WG7B 4RQEA 3ABUA 1YJ9V 1QBZA 3D3IA 3STLC 3W7XA 1VQ5V 2H8PC 2OCCC 2WLHA 4PDRA 3SPIA 5KA5A 3SYAA 4BW5A 1SZTA 4GX5A 4X88A 2B1IA 2H94A 4UV9A 2C2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUJ C;  4WFF A;  2BOC C;  2WLL A;  2EIM C;  1R3J C;  2ITC C;  3LUT B;  4PA3 A;  1OCO C;  5EBL C;  4PA4 A;  2ZXW C;  4J9Z B;  4LBE C;  2WLJ A;  4J9Y B;  4MVO A;  3RVY A;  4F4L A;  2IH3 C;  4H33 A;  4LCU C;  3ASN C;  4MVZ A;  4P9O A;  3RVZ A;  4QE9 A;  4MVR A;  2HFE C;  5E1A C;  1OCZ C;  3AG2 C;  3K03 A;  2WLI A;  4JTA B;  4MTO A;  3SYO A;  3ZJZ A;  2HG5 C;  5B1A C;  5IY5 C;  1P7B A;  2A9H A;  3E86 A;  2DWE C;  2DYR C;  3E8G A;  4PA9 A;  3T1C A;  5EC1 C;  1R3I C;  2Q68 A;  2QKS A;  4PA7 A;  1M57 C;  4QE7 A;  5CBF A;  1JVM A;  3AG1 C;  4G27 B;  3FB6 C;  2K1E A;  2ZD9 A;  4PA6 A;  3WG7 C;  4JTD B;  3ABK C;  2A79 B;  4MTG A;  2WLK A;  2A0L A;  3T4Z A;  3UM7 A;  3T4D A;  2W0F C;  3LDD A;  2HVK C;  2HJF C;  4ZBM A;  2R9R B;  2ATK C;  5EK0 A;  4EKW A;  5CBH A;  2IH1 C;  2WLM A;  3AG3 C;  3LDE A;  3FB7 C;  4MTF A;  2KB1 A;  4HYO A;  4X89 A;  4XDK A;  3K08 A;  1V54 C;  2EIJ C;  3TCU A;  4P2Z A;  1R3L C;  4JTC B;  3SPJ A;  1R3K C;  3K0G A;  1OCC C;  4LP8 A;  1OCR C;  2Q69 A;  3RBZ A;  1KKD A;  4QNH B;  3FB8 C;  2QTO A;  4TWK A;  4OXS A;  3SJQ C;  1XL6 A;  3OR7 C;  2X6B A;  4CBC A;  3R65 A;  4KFM A;  4MVM A;  3E83 A;  5KUK A;  3KG2 A;  4MVU A;  4MS2 A;  3K04 A;  3UKM A;  3T2M A;  4RUE A;  2NLJ C;  4RAI A;  4G28 B;  1M56 C;  3FB5 C;  3TET A;  4PDV A;  3PJS K;  2JK5 C;  1XL4 A;  3K06 A;  4GX0 A;  4H37 A;  3SYC A;  3E89 A;  3OUF A;  3SYP A;  5J9P C;  3GB7 C;  3X2Q C;  1ZWI C;  2Q6A A;  2WLN A;  3F7V C;  3RW0 A;  3LDC A;  3SPH A;  3F5W C;  5B3S C;  2EIL C;  2ITD C;  4P30 A;  4PDM A;  2Y69 C;  4RUF A;  5B1B C;  3E8H A;  5BZB A;  2P7T C;  3E8B A;  3SPC A;  3VOU A;  4DXW A;  2X6A A;  3EFF K;  2EIK C;  3ZRS A;  3SYQ A;  1V55 C;  3OUS A;  4R7C A;  1J95 A;  2DYS C;  3IGA C;  4PDL A;  3ABM C;  4XDJ A;  2HVJ C;  3SPG A;  4RO2 A;  3STZ C;  3OR6 C;  1S5H C;  4X8A A;  1K4D C;  4I9W A;  4R6Z A;  4XDL A;  4P9P A;  1K4C C;  3JYC A;  4R50 A;  4MW3 A;  4WFG A;  3OGC C;  3AG4 C;  4MW8 A;  2AHY A;  2BOB C;  3HPL C;  4MVS A;  1QLE C;  2DWD C;  4HZ3 A;  5EBM C;  1LNQ A;  2WLL B;  3K0D A;  4MVQ A;  2YEV A;  5KUM A;  3E8F A;  4WFE A;  1G4Y B;  4GX1 A;  5CBG A;  3STL C;  2X6C A;  4MSW C;  1ORQ C;  3BEH A;  4WFH A;  2H8P C;  2OCC C;  2WLH A;  3ABL C;  3F7Y C;  4GX2 A;  4PDR A;  4R8C A;  2EIN C;  5EBW C;  3SPI A;  3IFX A;  2AHZ A;  3SYA A;  3LNM B;  4BW5 A;  3ASO C;  2WLI B;  4GX5 A;  4X88 A;  5EC2 C;  1BL8 A;  2Q67 A; 
#chains in the Genus database with same CATH topology
 3ETG A;  4K3A A;  4PA3 A;  5C8Y B;  1W0K G;  3OM3 B;  3ZMU A;  1RM1 B;  1ROP A;  1S72 V;  3AG2 C;  2WLI A;  3OT7 A;  2HLD G;  3PN1 A;  2DWE C;  3B4S A;  2DQ3 A;  4FFB A;  2JGD A;  3QVN A;  5L3C A;  4KHP O;  4EEQ A;  2DE0 X;  3C90 A;  1YZB A;  3LSS A;  1GH6 A;  1FXV A;  2HVK C;  1XBL A;  1MNG A;  3LSU A;  4RQF A;  2UU9 O;  4DYL A;  4X89 A;  2Q73 A;  4XDK A;  1SES A;  4NXN B;  1AVM A;  2QTO A;  2QWR B;  4DV1 B;  3I5D A;  1UPG A;  1XNQ B;  5IYD O;  1DK1 A;  2XOK G;  3I56 V;  1FXK A;  5JH7 B;  1H8E G;  1R6K A;  3BA9 A;  3CRQ A;  4ZIB A;  4LF6 O;  1AR5 A;  1ZWI C;  4AQY O;  2RQ6 A;  3U11 A;  3RW0 A;  3LDC A;  4FMT A;  4O4J B;  1DGS A;  3C3T A;  3D3Q A;  5B1B C;  3FX7 A;  5BMV A;  1VQL V;  3L73 H;  2XAG A;  3EFF K;  5JVD B;  1K92 A;  3JD1 A;  2E5L O;  2CTQ A;  2XAQ A;  1HW7 A;  3APQ A;  2HVJ C;  4TV8 A;  1N36 B;  2Q7G A;  1IDS A;  1HNZ O;  4I0X B;  4XDL A;  4ASU G;  4X65 B;  4DUZ B;  2OTJ V;  1VQO V;  4B3S B;  1SF9 A;  2BOB C;  3CMA V;  2WLL B;  4K0K B;  4NR1 A;  3RFR A;  1G4Y B;  2RDC A;  2X6C A;  1LUV A;  4WFH A;  5LOV B;  1R1B A;  3JAT B;  2FTK A;  1JQ0 A;  1JX9 A;  1N33 O;  2BOC C;  1O9H A;  4DV7 O;  2QSA A;  2Y48 A;  1K7D A;  4TUY B;  4ICG A;  1V54 B;  2UXD O;  1VQ4 V;  1X59 A;  4EFB A;  2KSD A;  2ILM A;  4PA7 A;  1NKD A;  2FB5 A;  3RYF A;  2CH7 B;  1NTM H;  1KP2 A;  2UXX A;  2A06 H;  2PYL A;  1GN4 A;  4EB6 A;  2JS3 A;  4JYA B;  4G2K A;  3MDS A;  4FLW A;  3M8A A;  2LP7 A;  5IE9 A;  1Z5W A;  1FFX B;  5LGN A;  3H1K H;  2DQ0 A;  4YJ2 B;  3P32 A;  4JI7 B;  1XRE A;  3JAS A;  1NS1 A;  1OCC C;  3U10 A;  3RYI A;  1WAZ A;  2LW1 A;  4MVM A;  5H5N A;  3DSQ A;  1MSW D;  4FPP A;  4LF9 B;  4DR7 O;  1BQZ A;  4H37 A;  1R6N A;  1VF6 A;  3FAV A;  5JWP A;  1GM9 A;  1X4T A;  1F7Y A;  4IL6 Z;  4PHZ A;  3TGU H;  3ZRV A;  3CCE V;  2PZS A;  1US6 A;  4DXW A;  1H2S B;  4JI8 B;  2XAH A;  3QNE A;  1NBM G;  1K4D C;  3ZCC A;  3BHP A;  4C7U A;  3G6E V;  1S77 D;  1ZL8 B;  3IC7 A;  5HFM A;  1M57 B;  2VQE B;  4X66 O;  3HPL C;  2JDI G;  1WNS A;  4WFE A;  4GX1 A;  4DR4 B;  4QGP A;  2GTS A;  5KLV H;  5H6R A;  1PD3 A;  2V7Q G;  4OX9 B;  1L0N H;  4WBN A;  4X1Y B;  4GLX A;  3FKS G;  4FVM A;  3OTF A;  1PNK A;  3CCR V;  3W7T A;  1EM1 A;  1GRJ A;  3OMA B;  2WLJ A;  4J7K A;  1YTF B;  1IBM O;  3QG5 A;  1OCZ C;  1HDJ A;  4CC5 A;  4B08 A;  2KG7 B;  2EJR A;  1I0H A;  1AJN A;  4X1K B;  3ZRX A;  3ABT A;  2ZIN A;  1SER A;  2IJJ A;  3JAK A;  1MMM A;  4X64 O;  2DOS A;  2FKX A;  2NR5 A;  1OHH G;  5IJ9 A;  2ZM6 B;  4GKK B;  3J80 N;  4HYO A;  1P4R A;  1NH2 D;  2Z0A A;  2WAM A;  5FPO A;  3SPJ A;  3K0G A;  4K35 A;  1OJH A;  4DV4 B;  2UUC O;  5KUK A;  1WJZ A;  2VQF B;  2QWN B;  1AR1 B;  1G8M A;  1EZJ A;  1M56 C;  2B9Z A;  3FB5 C;  2IM9 A;  3BRC A;  5KMG B;  3N27 A;  2XHB A;  4JI0 O;  4ABM A;  5DM6 V;  3B77 A;  1BCC H;  3G67 A;  4YY3 B;  1HWY A;  1QVF U;  1I5Y A;  3E8H A;  1CXZ B;  1YEW A;  2H3O A;  4LF7 B;  4DR6 O;  3KCY A;  1V55 C;  2ZE8 A;  3CCU V;  2QTS A;  4I4T A;  2F95 B;  4DK1 A;  2YIA A;  5CA1 B;  1Q5O A;  3R66 A;  1Q82 W;  3MAQ A;  3AG4 C;  5EYP A;  2CDY A;  3ABK B;  4NVP A;  2W0X A;  4MSW C;  2A3Q A;  5LHG A;  3CME V;  1ARO P;  3TXS A;  3HKB B;  3MHH C;  1H38 A;  3CE2 A;  3IC9 A;  3AK2 A;  3CC4 V;  2BSK B;  5FNV B;  1QNM A;  4MVR A;  5BY1 A;  3K5O A;  3EVK A;  2GBO A;  3ZRW A;  4FK5 C;  1QR8 A;  3TK1 A;  4JTD B;  5GTI Z;  3WFV A;  3N2K A;  3A0H Z;  3P30 A;  5IT9 N;  3B8M A;  2ATK C;  1XDC A;  2XAS A;  1VP7 A;  4X62 B;  3X2Q B;  3ZHR A;  1W59 A;  2WLM A;  1BS3 A;  1H2K A;  1IUR A;  4MTF A;  1D5N A;  1TVK B;  4O2B A;  2Q8V A;  3TCU A;  4IT5 A;  5LXT A;  1AI6 A;  5L3F A;  4TWK A;  1GO3 F;  3DGE A;  3K9S A;  4LF5 B;  5J2U B;  3CX5 F;  2YXY A;  4CH5 A;  2PGG A;  4U3J A;  2OIG A;  1ZLZ A;  2Q0O C;  3RT3 C;  1XL4 A;  3JAW B;  2YIB D;  4CS3 A;  3F7V C;  2RJZ A;  2EIL C;  4J41 A;  4LH6 A;  5H9C A;  4F6E A;  2UXC O;  2YIC A;  4TV9 B;  1ZUQ A;  5BZB A;  4CH4 A;  1PL0 A;  1Y66 A;  4CS4 A;  1D5A A;  3SYQ A;  3OUS A;  4LWS B;  4LF4 O;  3CRR A;  4CZZ A;  4R6Z A;  1CEZ A;  4NXM B;  1QLE C;  1K97 A;  1GN2 A;  3JAR B;  4RQE A;  3ABU A;  1QBZ A;  3D3I A;  3A2F A;  2OCC C;  2WLH A;  4PDR A;  5LMU O;  5KA5 A;  4Q6G A;  4UCV A;  4X88 A;  2ARH A;  1MZF A;  3K57 A;  5EBL C;  4PA4 A;  1P7G A;  3CRM A;  2OT5 A;  1VQ6 V;  2JS5 A;  2QE7 G;  3H1L H;  2UXB B;  4KHP B;  2Q0A A;  4JZG A;  4U3J B;  4I7Z B;  1H8H G;  3BY6 A;  1L1F A;  5J2T B;  4PA6 A;  2BCC H;  3WG7 C;  4XBF A;  4IHJ A;  3ML0 A;  1BT8 A;  4UCO A;  2F23 A;  3CSX A;  4ZBM A;  3HKC B;  4LFA O;  2B1G A;  3AG3 B;  4JZ2 A;  5EK0 A;  2EBO A;  5KHK A;  4UCU A;  1EN5 A;  4UV8 A;  3RYC B;  4JI1 O;  1VQM V;  3BAA A;  3K08 A;  4FZ1 A;  3M99 B;  3Q4H A;  1Y76 B;  1KYO F;  1E79 G;  1M4U A;  1TUB A;  3R65 A;  3KG2 A;  2GUZ B;  4RUE A;  5L3B A;  1JFF A;  4AQY B;  1YTF D;  3SDL A;  2ZCE A;  5LA6 A;  4NTW A;  4RWU A;  1VAR A;  3T1H O;  4DR5 O;  5JQG A;  3JD0 A;  1N34 B;  3QO7 A;  1J95 A;  4JAS A;  1XOU A;  1ENV A;  3I55 V;  4Z1M G;  4X8A A;  2GV9 A;  5IJ0 A;  3O65 A;  1K4C C;  2YXH A;  4MW8 A;  4FLY A;  3WB0 A;  4GCZ A;  5BR8 B;  3HR0 A;  5GON A;  4ZKI A;  5B5E Z;  5LP6 C;  3ETQ A;  3NXS A;  3LNM B;  3RYH A;  1YHQ V;  1YF2 A;  1SQF A;  4LCU C;  3ASN C;  4E2L A;  1QR9 A;  1Q86 W;  1XNR O;  3N2G A;  1WLE A;  1NJI W;  5L3D A;  3CC2 V;  1NH2 B;  5EC1 C;  1TA8 A;  1AI7 A;  3CJH B;  1YIJ V;  1JVM A;  3P3P A;  4WF9 V;  2YI8 A;  3FB6 C;  3LSQ A;  4DW0 A;  2W0F C;  5FPR A;  1CP9 A;  2B5U A;  4X1I A;  4D7S A;  3E22 B;  5IWA O;  2OIE A;  3UT5 B;  2KB1 A;  3WB2 A;  5EZY A;  1NZ6 A;  1KBH A;  4DV3 B;  4L8J A;  1WA8 A;  4BAY A;  1R3K C;  2ZT9 B;  2NNU A;  4DR1 O;  1SA0 A;  5E79 Z;  2DYS B;  3ETD A;  3SJQ C;  4WFB V;  4YJ3 B;  3ABM B;  1Q6H A;  3DC6 A;  1XMQ B;  1RP3 B;  4B3M O;  1XIL A;  1XMO O;  4G28 B;  3FFQ A;  4GKJ B;  5KHJ A;  1BMF G;  3J7A U;  1N0J A;  3OE7 G;  1M93 A;  1P84 F;  4KL1 A;  5CN0 A;  3JAL A;  2EIM B;  2EIK C;  5H2F Z;  2ZNI A;  2RNB A;  3KKY A;  2P6J A;  4JF3 A;  1GKF A;  3IGA C;  2YEV B;  1S3J A;  3HKE B;  3CD6 V;  4I50 B;  3B40 A;  3UO3 A;  1YJN V;  4UB6 Z;  3CC7 V;  4MVS A;  3AG1 B;  2OTL V;  4JYB A;  1M5I A;  2WSS G;  3BEH A;  1HP8 A;  3ABL C;  1J5E B;  2EIN C;  3IFX A;  2AHZ A;  4DV0 B;  5CA0 A;  3ASO C;  2WLI B;  3SJC C;  3ZHT A;  2Z5U A;  4FLT A;  4FFB B;  2JGD B;  4A5U B;  2LO1 A;  2AZ2 A;  2WWW A;  2ZXW C;  4LBE C;  4DV5 O;  3K03 A;  5B1A C;  1P7B A;  2A9H A;  2DYR C;  1XQ8 A;  1QVG U;  4QPK A;  5D5Q A;  4JI6 O;  1MZE A;  1XHZ A;  3UM7 A;  3T4D A;  3B8N A;  2PY5 A;  3LDD A;  1N4C A;  1FPO A;  4UFZ A;  1NVP D;  2HHH B;  4K8X A;  4B3R O;  2GHY A;  2ZNJ A;  4CH6 A;  1D2D A;  2P4V A;  1U97 A;  3JSL A;  3KZI Z;  5LMN O;  1R3L C;  4HAM A;  1FXK B;  4NYK A;  2UUA B;  3FB8 C;  2X6B A;  2RN9 A;  2DMX A;  2WA4 A;  2XUM A;  4KFM A;  1I94 B;  4FLX A;  1AI4 A;  5CB4 A;  5D5P A;  1OZ0 A;  5BMV B;  4RAI A;  1WB8 A;  3TET A;  1FJG B;  1YXB A;  1O9G A;  3K9A A;  5JJE B;  1UFI A;  4JI5 O;  4TV8 B;  1MSD A;  1Q6U A;  4TT3 G;  4UXN A;  4FZ0 A;  1HR0 O;  1IZ3 A;  1IBL O;  3RWR D;  2N05 A;  1OCO B;  4TQF A;  5GW7 A;  1JCH A;  3JCZ A;  1B6Q A;  2PF4 E;  1L8D A;  5HFL A;  2QA4 V;  1EBO A;  5LP6 A;  4O4H A;  4LNU A;  5KAF Z;  4BIZ A;  3ICX A;  4B3T B;  1IBK B;  4IYH A;  1AB3 A;  2BTQ A;  3OGC C;  2WA3 A;  5IYZ A;  2DJV A;  3ZN1 A;  4LC1 A;  1BGY H;  3EXA A;  3TJT A;  4WFA V;  5H6Q A;  4BWA A;  5KUM A;  3D8C A;  2DN9 A;  4GX2 A;  3UQ8 A;  2CE4 A;  2EJ7 A;  3CEI A;  1EZV H;  2YS8 A;  5A9G A;  4GZR B;  3FD9 A;  3RYF B;  2EIJ B;  1Y6X A;  5BXZ A;  4EB6 B;  2GDS A;  5LGT A;  2HR3 A;  5IY5 C;  2Y0P A;  3T1C A;  4NXN O;  4ZHQ A;  2IU0 A;  4TSF G;  4G27 B;  1SQV H;  4Q20 A;  1JJO A;  1RSO A;  4DR2 B;  4DV1 O;  1G6U A;  5A2Q N;  4NTY A;  3JAS B;  5ITZ A;  1XNQ O;  2LW7 A;  5LHH A;  2MW2 B;  2IH1 C;  3GWK C;  3AG3 C;  3RYI B;  1K73 W;  2VRZ A;  2Y69 B;  4BW9 A;  4X20 A;  3ZX6 A;  1OCR B;  1AJQ A;  3NR7 A;  3K58 A;  3OMN B;  3JSN A;  4ZOL A;  1AJP A;  4DR3 B;  3FYI B;  4LF8 O;  1H2M A;  3FAV B;  3OR7 C;  1BSM A;  4CBC A;  3T2M A;  3L71 H;  2Q7E A;  5K1P A;  3SYC A;  4X65 O;  3SPH A;  4DUZ O;  3F5W C;  3ZHU A;  5B3S C;  4B3S O;  1K5S A;  4K0K O;  2FYU H;  1N32 B;  1CPY A;  4EFE A;  2FML A;  3OMI B;  1SET A;  2UXN A;  2ZDI C;  3ZS8 C;  4L87 A;  3AG2 B;  2E75 B;  2G38 A;  3OFN G;  1KUQ A;  1Q90 D;  2YDE A;  5JJJ B;  4ZI7 A;  2QM8 A;  1H2L A;  4JI2 B;  3HKD A;  3W7S A;  3TXQ A;  5CMU A;  1RPR A;  4WBN B;  1NI8 A;  1I7F A;  5B66 Z;  1YJ9 V;  4TOI A;  3W7X A;  3BAB A;  2H8P C;  1SQX H;  1SZT A;  1ZSP A;  4GX5 A;  4O2A A;  2ADQ B;  3GVM A;  4WFF A;  3OEE G;  2R9I A;  1JJ2 U;  3RVY A;  1VQ9 V;  3JAK B;  4P9O A;  2ZKO A;  4NB5 A;  3CS5 A;  4JTA B;  3ZJZ A;  3FYE B;  3CWB H;  3W7W A;  1SRY A;  5IJ9 B;  1VF7 A;  3QO8 A;  4LFA B;  3WU2 Z;  3ZIA G;  4NTX A;  4LF9 O;  2QR4 A;  1YSC A;  2M6Y A;  5B1B B;  1RM1 C;  4DRX A;  2HKO A;  2E74 B;  3RBZ A;  3DXR A;  1JMK C;  4OXS A;  2IJK A;  3E83 A;  3K04 A;  3A0R A;  3THO A;  1JOY A;  3E35 A;  3L75 H;  4UCS A;  1KEC A;  2PI4 A;  3SYP A;  3B2E E;  1UJW B;  1GMG A;  2Q6A A;  4DR5 B;  2UUB B;  1K8A W;  2K9P A;  4JAV A;  4JI3 O;  4I4T B;  2JIZ G;  5FLX N;  2ITD C;  2VQE O;  4P30 A;  4IIJ A;  4AHC A;  4MT8 A;  3RGB A;  1HNW B;  3SPC A;  4DUY B;  4UVA A;  4DR4 O;  1URF A;  4U7N A;  2HEP A;  2P06 A;  4O4I A;  2OWO A;  1XEQ A;  5EYP B;  4XDJ A;  2E76 B;  4OX9 O;  3QTC A;  2F93 B;  5L3G A;  2EX3 A;  1PV0 A;  4KXR A;  4R50 A;  4OPH A;  4LFC B;  2Z3Y A;  4KP4 A;  2CAZ C;  2IJH A;  2QWQ B;  2QDO A;  4JYC A;  3ZMT A;  1Z5V A;  3L74 H;  3H1H H;  1XI1 A;  3L70 H;  3CCJ V;  1HNX B;  4J10 A;  3ZRW B;  3H01 A;  4J9Y B;  4YXW G;  4H33 A;  1NVP B;  1RFY A;  1WP7 A;  2ZM6 O;  4JI4 O;  3N2K B;  3SYO A;  4GKK O;  1OCC B;  4JGS A;  4WCE V;  1P49 A;  2ZD9 A;  3CCQ V;  4DV4 O;  2ADP A;  2WLK A;  3VBB A;  4O2B B;  2IU3 A;  5F2V O;  5LXT B;  5CA3 A;  3OD4 A;  4GT1 A;  1MG1 A;  3T1Y O;  4JPR A;  5CBH A;  4W4L A;  4K8Z A;  1WPX A;  1QU7 A;  1V54 C;  2LGQ A;  1YCI A;  2CGO A;  2VWK A;  1U96 A;  4I55 A;  4O4L A;  3VQV A;  5DEC A;  3K3W A;  1FKA O;  5EIB D;  3K79 A;  2HP8 A;  4CS2 A;  1BE3 H;  1H2N A;  2UU9 B;  2NLJ C;  1B3Q A;  3K06 A;  4GUN A;  3SGI A;  5LYJ A;  5IDJ A;  3ZHS A;  2X7R B;  3G4S V;  2WPD G;  2ZDI A;  2QKA A;  1KU9 A;  1QCE A;  1I5X A;  4H0L B;  4CH3 A;  2A7W A;  1Y74 A;  2QGN A;  4HNA A;  4BIO A;  4R7C A;  3OGI B;  2Q5Z A;  4LFB O;  1QQC A;  1OCZ B;  4LF6 B;  1EN6 A;  3JYC A;  1R73 A;  2P22 C;  2XAF A;  4FFK A;  3K0D A;  2F66 C;  1XUQ A;  5KX5 A;  3CRC A;  2E5L B;  5EBW C;  2Q67 A;  2V4D A;  5DN6 G;  4DV5 B;  2BE3 A;  3LUT B;  1HNZ B;  2QJ1 A;  2L35 A;  4X62 O;  2GSM B;  4PJ0 Z;  1BZK A;  4IHJ B;  1IXB A;  1VIB A;  4F6R A;  1R6T A;  2YSU B;  1GAX A;  2D2C B;  1M57 C;  2EZO A;  5C8Y A;  4U3F H;  4FIP C;  5GTH Z;  4J7Z A;  1N33 B;  1G1X B;  1GN6 A;  1Z2G A;  4DV7 B;  1M56 B;  3CP1 A;  3Q4H B;  3K5L A;  2R9R B;  1SQP H;  1EFR G;  3ZHV A;  2UXD B;  3FB7 C;  1TUB B;  4UCR A;  3BA8 A;  1B06 A;  2CTP A;  1JFF B;  3CCM V;  1OCR C;  4J11 A;  1V55 B;  3BVO A;  3VQX A;  1FS0 G;  4CC6 A;  2PYJ A;  1VQP V;  1JR9 A;  4MVU A;  3G80 A;  5LA6 B;  2JEU A;  4NKG B;  1NR1 A;  5DED A;  2LJ2 A;  3AG4 B;  3DTU B;  4PDV A;  5J9P C;  5JQG B;  3E89 A;  1WP8 A;  4DV2 O;  3APO A;  4NXM O;  1AP6 A;  1HR0 B;  3H1J H;  2CGN A;  5JH7 A;  2LGW A;  2IW5 A;  4QPJ A;  5IJ0 B;  1FXH A;  2F4V O;  2O57 A;  3MD0 A;  4DR7 B;  4O4J A;  1ZTE A;  4TQD A;  5FL7 G;  5GON B;  3STZ C;  3OR6 C;  1S5H C;  4P9P A;  3OTO O;  1KQS U;  2ZQM A;  4UB8 Z;  5JVD A;  1S0V A;  2F43 G;  3RYH B;  4MVQ A;  2XTA A;  2UXB O;  5CBG A;  3SJA C;  4R8C A;  4I0X A;  4N21 A;  2MK3 A;  4LH7 A;  3N2G B;  1WB7 A;  2W6I G;  1FAF A;  1DF5 A;  1BL8 A;  1YJW V;  3SJB C;  2YID A;  1E1Q G;  3BPZ A;  2WLL A;  2ODM A;  1F51 A;  2Y4U A;  2IH3 C;  4MVZ A;  5LOV A;  4X66 B;  3JAT A;  3ZN0 A;  2N04 A;  2HG5 C;  3U0Z A;  3CB2 A;  1KKC A;  2KKW A;  4X1I B;  2P90 A;  4PEL A;  4TUY A;  1QHT A;  3ABK C;  2IBZ H;  3CRA A;  5EZY B;  2YIB A;  1S76 D;  1WPB A;  4DV6 O;  4B7K A;  1WA8 B;  4FJC C;  1F23 A;  1VQ8 V;  2P67 A;  2F1M A;  1SA0 B;  2YUA A;  3CCV V;  2CH7 A;  1IBM B;  4PI0 A;  1MAB G;  5LGU A;  2M7W A;  2EIL B;  4FM1 A;  4OGQ B;  3MHS C;  3A0B Z;  4P2Z A;  3O9O A;  1F4N A;  3ZHQ A;  5JCO C;  4LF8 B;  3JCU Z;  4X64 B;  1Q43 A;  1FFX A;  3GWO A;  1N8R W;  1N34 O;  4YJ2 A;  1NQT A;  2Q4P A;  2P4K A;  2R70 A;  4GX0 A;  3CXH F;  2JK5 C;  1QLE B;  1TGO A;  3JAL B;  3JD2 A;  3PJS K;  4JV5 O;  3GB7 C;  3X2Q C;  3B09 A;  2OCC B;  4PV1 B;  2UUC B;  1M9N A;  1N0N A;  1Q7Y W;  2ETN A;  5BR8 O;  5JJN B;  2LFS A;  2R72 A;  2P7T C;  4GYC B;  1LR1 A;  3QO5 A;  1M1K W;  1IX9 A;  1VMG A;  4RO2 A;  3W7U A;  4I9W A;  4JI0 B;  2JEX A;  5CA0 B;  4JAA A;  1FFT B;  5KHG A;  3ZMV A;  2DWD C;  4YIO A;  4YHH O;  1LNQ A;  3WG7 B;  4DR6 B;  3SR2 C;  1ZL8 A;  1BHA A;  2H94 A;  4FLU A;  2C2A A;  3JAM N;  2ZE7 A;  5C93 A;  2FL4 A;  4BIU A;  4MVO A;  4F4L A;  5KAI Z;  2XND G;  4QE9 A;  1OV9 A;  4X1Y A;  1R3I C;  2ZR2 A;  2RCV A;  4DV3 O;  1VQK V;  1TUE B;  4YIP A;  1XMQ O;  2KG7 A;  1I08 A;  4X1K A;  1NU1 H;  5AG2 A;  3H1I H;  2Y0I A;  5CB4 B;  4GKJ O;  1S5L Z;  2CTR A;  1GM7 A;  1M90 W;  1XL6 A;  2PUS A;  2QM7 A;  1VEW A;  2JRI A;  1AR4 A;  1TAE A;  4DO2 A;  4JI3 B;  1AIL A;  4DW1 A;  3S3X A;  4JYY A;  4FLV A;  2OYQ A;  4RUF A;  5LP6 B;  1K3E A;  5TIS Z;  1THZ A;  4O4H B;  4LNU B;  3WB1 A;  3ZBH A;  5KMG A;  2BTQ B;  1BHB A;  1J5E O;  3ZRS A;  5IYZ B;  4DV0 O;  2QKC A;  4AI8 A;  3C3S A;  3AEI A;  3ASN B;  3SPG A;  3VQW A;  1PNM A;  2X0L A;  1N36 O;  1SQQ H;  1KC8 W;  4MW3 A;  1BQ0 A;  1YVW A;  1SC5 B;  4Z2W A;  4AIL C;  2RMK B;  3D36 C;  2UXC B;  3AG7 A;  3AK1 A;  2D3O W;  1IVS A;  1ORQ C;  5CA1 A;  1VQ7 V;  3ETE A;  2YXL A;  1Q81 W;  4J42 A;  3K5N A;  1K34 A;  3KCX A;  4LF4 B;  4ZHQ B;  3F5T A;  4JI4 B;  3RVZ A;  3CXC U;  2HHH O;  1RSO B;  3HKB A;  3CCL V;  3E86 A;  4PA9 A;  5ITZ B;  2HJD A;  2AXT Z;  4QE7 A;  5CBF A;  2BSK A;  5L3E A;  1YDX A;  5LMU B;  5FNV A;  1Q6I A;  2UUA O;  3T4Z A;  2EZP A;  5JCO A;  1F4M A;  3A8T A;  1KMI Z;  2JJ1 G;  4X20 B;  3T1Y B;  1COW G;  4UVB A;  4QJF B;  4BR6 A;  1I94 O;  4JYA O;  4ZOL B;  3ZMS A;  4EKW A;  2YC0 A;  1FJG O;  1K33 A;  3IJ4 A;  2PI5 A;  1SQB H;  2AZ0 A;  1QLN A;  2QWP B;  4IYI A;  4LR3 A;  2IJI A;  2JJ2 G;  4I5S A;  2EIK B;  2R9A A;  3EHB B;  4UCT A;  1FD9 A;  4JI7 O;  5K1X A;  4QNH B;  1KKD A;  1B04 A;  1FYJ A;  1TVK A;  3OW2 U;  1GTO A;  2DW4 A;  1SKV A;  3IAY A;  4U7O A;  4JI1 B;  1H2G A;  4B3T O;  1IBK O;  5LBQ A;  2VS0 A;  5J2U A;  1E1R G;  3ABL B;  2EIN B;  4JAU A;  3ASO B;  2ZIO A;  3E8B A;  1DF4 A;  2QEX V;  3JAW A;  1DLB A;  1DTO A;  4ZI7 B;  1L0L H;  3HKD B;  4LFB B;  2E3C A;  1W2B U;  2ZXW B;  1GN3 A;  2DYS C;  4PD4 F;  2CUG A;  3ABM C;  4JI8 O;  3UO2 A;  1SQG A;  1NTK H;  4TV9 A;  3S3W A;  3G6B A;  5B1A B;  3P3N A;  2DYR B;  4O2A B;  4E4E A;  5KHI A;  3T1H B;  4LWS A;  1YIT V;  4B7E A;  2PTM A;  3OAA G;  4W4K A;  2LQT A;  2Q7H A;  5EC2 C;  1GM8 A;  2GTA A;  2JGU A;  4UVC A;  2Y4T A;  4KUM A;  4UUJ C;  1JPX A;  2EIM C;  4DR2 O;  1R3J C;  4I9Q A;  3JAR A;  1LUW A;  2ITC C;  2XT9 A;  4J9Z B;  2N74 A;  5E1A C;  2HFE C;  4MTO A;  1WN7 A;  1Y4M A;  2CTW A;  3E8G A;  4PI2 A;  1YI2 V;  2Q68 A;  2QKS A;  3AG1 C;  2K1E A;  3CPW U;  3CHX A;  2A79 B;  4DR3 O;  5KHH A;  3QF7 A;  3L72 H;  3ZMZ A;  4DRX B;  2HJF C;  3E2E A;  2CK3 G;  3AK3 A;  3DXR B;  1PP9 H;  5J2T A;  1XNR B;  2XAJ A;  3BCC H;  3BFR A;  3HB3 B;  3UCS C;  3HKC A;  4JTC B;  2ZE6 A;  4LP8 A;  5IYC O;  1RPO A;  5KA6 A;  4J7J A;  3CYO A;  1AP5 A;  3JD3 A;  1ZAU A;  1MOF A;  2NN4 A;  3RYC A;  1N32 O;  4QIW F;  4MS2 A;  4IIJ B;  1MA1 A;  2OCH A;  1Y76 A;  5IWA B;  4DV2 B;  2VQF O;  1SS3 A;  2V1D A;  3M7M X;  3OUF A;  1KB9 F;  1ZX3 A;  4O4I B;  1EN4 A;  4JI2 O;  2GUZ A;  4DR1 B;  4PDM A;  2F4V B;  2Q9L A;  1V9P A;  2EUL A;  1FXK C;  3VOU A;  4YY3 O;  1PPJ H;  2X6A A;  3D36 A;  4B3M B;  1XMO B;  4LF7 O;  2YI9 A;  2AW9 A;  3OTO B;  2JVD A;  1NR7 A;  1Y67 A;  5IY5 B;  1PKX A;  4WFG A;  4J80 A;  1Q3E A;  4DK0 A;  5EBM C;  1KP3 A;  3E8F A;  1GK9 A;  3F7Y C;  5B1O A;  2W6J G;  3OEH G;  2QM4 A;  2QWO B;  3RN4 A;  1OCO C;  1XHX A;  2L6L A;  3JD4 A;  1NT2 B;  1KD1 W;  3K5M A;  5IYB O;  1Q8I A;  1T5E A;  1AI5 A;  1PNL A;  1PM9 A;  2BTO A;  4MTG A;  1W0J G;  2A0L A;  4DV6 B;  1NTZ H;  1K5Q A;  4I55 B;  3CJH A;  1A32 A;  4O4L B;  5B1N A;  5EIB C;  5LHI A;  2LFR A;  3LDE A;  2VWJ A;  5B3S B;  3ZED A;  4H44 B;  3DC5 A;  3J81 N;  2EIJ C;  2UUB O;  1SZX A;  4FM2 A;  4Z1V A;  4JI6 B;  1PL4 A;  2Q69 A;  5LYJ B;  4N23 A;  3E22 A;  1HNW O;  3UT5 A;  4DUY O;  2AGA A;  3UKM A;  4MTX A;  4JV5 B;  4LF5 O;  2ZE5 A;  4B3R B;  3LNN A;  1VF5 B;  4FM0 A;  3K59 A;  4D7T A;  5LL6 Y;  1Y74 B;  4YJ3 A;  4HNA B;  2WLN A;  5LMN B;  4LFC O;  4HBN A;  4X9Q A;  3G71 V;  2Y69 C;  4OPA A;  4H13 B;  2ZR3 A;  4FLZ A;  3H9V A;  1JA8 A;  4IGG A;  1S5J A;  3L9D A;  2P5O A;  2ZIM A;  2KQX A;  1IXM A;  1VF6 C;  1VQN V;  4PDL A;  5KX5 B;  1HNX O;  3CCS V;  4YHH B;  1K9M W;  2AHY A;  4JI5 B;  4HZ3 A;  2YEV A;  3STL C;  3HKE A;  1IBL B;  1VQ5 V;  4I50 A;  3SPI A;  3SYA A;  4BW5 A;  4F6R B;  3VQY A;  4D6T H;  2B1I A;  4UV9 A; 
#chains in the Genus database with same CATH homology
 3ETG A;  4WFF A;  5C93 A;  4PA3 A;  5EBL C;  3OEE G;  2R9I A;  4PA4 A;  1W0K G;  1JJ2 U;  3OM3 B;  3RVY A;  3ZMU A;  4MVO A;  4BIU A;  1ROP A;  4F4L A;  1RM1 B;  1VQ9 V;  2XND G;  2OT5 A;  1S72 V;  4P9O A;  1VQ6 V;  4QE9 A;  2QE7 G;  3AG2 C;  2WLI A;  4JTA B;  3ZJZ A;  2HLD G;  2DWE C;  3FYE B;  2DQ3 A;  1R3I C;  5L3C A;  1H8H G;  2ZR2 A;  3BY6 A;  1SRY A;  3W7W A;  1L1F A;  3LSS A;  4PA6 A;  1VQK V;  3WG7 C;  3QO8 A;  4XBF A;  1TUE B;  3ML0 A;  3ZIA G;  1FXV A;  2HVK C;  4ZBM A;  2B1G A;  3AG3 B;  4RQF A;  5EK0 A;  2EBO A;  1YSC A;  4UV8 A;  1VQM V;  4X89 A;  5B1B B;  1RM1 C;  4XDK A;  3K08 A;  1SES A;  3M99 B;  2HKO A;  1GM7 A;  3RBZ A;  1M90 W;  1E79 G;  2QTO A;  4OXS A;  1XL6 A;  2QM7 A;  3R65 A;  2IJK A;  3E83 A;  3KG2 A;  3K04 A;  5IYD O;  3A0R A;  4RUE A;  2XOK G;  3I56 V;  1FXK A;  1JOY A;  3E35 A;  5L3B A;  1YTF D;  1H8E G;  1R6K A;  1KEC A;  4DO2 A;  2PI4 A;  3SYP A;  1UJW B;  1GMG A;  1ZWI C;  2Q6A A;  3RW0 A;  1K8A W;  3LDC A;  4JAV A;  4FMT A;  2JIZ G;  2ITD C;  4P30 A;  4RUF A;  5B1B C;  1K3E A;  1THZ A;  4MT8 A;  1VQL V;  3SPC A;  4UVA A;  2XAG A;  1BHB A;  3EFF K;  1K92 A;  3JD0 A;  3JD1 A;  4U7N A;  3ZRS A;  3QO7 A;  1J95 A;  2XAQ A;  4JAS A;  4XDJ A;  3AEI A;  2HVJ C;  1ENV A;  3ASN B;  3SPG A;  1PNM A;  3I55 V;  4Z1M G;  4X8A A;  5L3G A;  4XDL A;  2X0L A;  4ASU G;  1K4C C;  4R50 A;  2Z3Y A;  4MW3 A;  1KC8 W;  2OTJ V;  1VQO V;  4MW8 A;  2BOB C;  4KP4 A;  2WLL B;  3CMA V;  2IJH A;  4GCZ A;  4JYC A;  1G4Y B;  3ZMT A;  4ZKI A;  2X6C A;  2D3O W;  1ORQ C;  4WFH A;  3NXS A;  3LNM B;  3ETE A;  1VQ7 V;  1Q81 W;  3CCJ V;  2FTK A;  1K34 A;  1JQ0 A;  1JX9 A;  2BOC C;  1YHQ V;  3ZRW B;  2Y48 A;  3H01 A;  1K7D A;  4J9Y B;  4YXW G;  4H33 A;  1V54 B;  4LCU C;  3ASN C;  3RVZ A;  1QR9 A;  4E2L A;  3CXC U;  1NVP B;  1Q86 W;  1VQ4 V;  3SYO A;  3CCL V;  1OCC B;  4JGS A;  1WLE A;  1NJI W;  3E86 A;  4PA9 A;  5L3D A;  3CC2 V;  1NH2 B;  4WCE V;  5EC1 C;  1AI7 A;  4PA7 A;  4QE7 A;  5CBF A;  1JVM A;  1NKD A;  5L3E A;  4WF9 V;  1YIJ V;  2UXX A;  1KP2 A;  3FB6 C;  2ZD9 A;  3LSQ A;  3CCQ V;  3T4Z A;  2WLK A;  2EZP A;  3VBB A;  1F4M A;  2W0F C;  2JJ1 G;  2IU3 A;  1COW G;  4UVB A;  1CP9 A;  2B5U A;  4G2K A;  4QJF B;  5CA3 A;  1BHA A;  4GT1 A;  3ZMS A;  1MG1 A;  4EKW A;  4JPR A;  5CBH A;  1WPX A;  2LP7 A;  2KB1 A;  1K33 A;  2PI5 A;  5LGN A;  1QLN A;  1V54 C;  2DQ0 A;  2IJI A;  3P32 A;  2JJ2 G;  4BAY A;  1R3K C;  2EIK B;  4I5S A;  1OCC C;  2NNU A;  3EHB B;  1KKD A;  4QNH B;  3K3W A;  2DYS B;  3ETD A;  3SJQ C;  4WFB V;  3ABM B;  4MVM A;  3K79 A;  3OW2 U;  1MSW D;  1GTO A;  4FPP A;  2DW4 A;  2NLJ C;  4G28 B;  4U7O A;  4H37 A;  3K06 A;  1H2G A;  1R6N A;  5IDJ A;  2X7R B;  3G4S V;  2WPD G;  2ZDI A;  1GM9 A;  5LBQ A;  1BMF G;  1E1R G;  3ABL B;  1QCE A;  3ZRV A;  1I5X A;  2EIN B;  4JAU A;  3ASO B;  3OE7 G;  3CCE V;  3E8B A;  1DF4 A;  5CN0 A;  4DXW A;  2QEX V;  1DLB A;  1DTO A;  2EIM B;  2EIK C;  2XAH A;  2P6J A;  4JF3 A;  1W2B U;  2ZXW B;  1GKF A;  4R7C A;  2DYS C;  3IGA C;  2YEV B;  1S3J A;  3ABM C;  3CD6 V;  1OCZ B;  3QNE A;  1NBM G;  1K4D C;  3ZCC A;  5B1A B;  3G6E V;  3JYC A;  2DYR B;  1S77 D;  5HFM A;  1R73 A;  3IC7 A;  1YJN V;  2XAF A;  1M57 B;  3CC7 V;  3HPL C;  4MVS A;  3AG1 B;  2OTL V;  3K0D A;  1YIT V;  2JDI G;  3OAA G;  4WFE A;  4GX1 A;  4JYB A;  2WSS G;  3BEH A;  3ABL C;  5EBW C;  2EIN C;  5H6R A;  3IFX A;  2AHZ A;  3ASO C;  1GM8 A;  2WLI B;  1PD3 A;  2V7Q G;  2Z5U A;  4UVC A;  2Q67 A;  5EC2 C;  4KUM A;  5DN6 G;  4UUJ C;  1JPX A;  2EIM C;  1R3J C;  3FKS G;  1PNK A;  2ITC C;  3LUT B;  3CCR V;  3W7T A;  2WWW A;  2ZXW C;  3OMA B;  4J9Z B;  2WLJ A;  4LBE C;  2GSM B;  1YTF B;  5E1A C;  2HFE C;  1OCZ C;  3K03 A;  4MTO A;  1Y4M A;  5B1A C;  1P7B A;  2YSU B;  2A9H A;  3E8G A;  2DYR C;  2EJR A;  1YI2 V;  2Q68 A;  1AJN A;  2QKS A;  1QVG U;  1M57 C;  2EZO A;  3ZRX A;  4QPK A;  3ABT A;  3AG1 C;  4FIP C;  1SER A;  2IJJ A;  2K1E A;  3CPW U;  2A79 B;  3UM7 A;  3T4D A;  3B8N A;  3ZMZ A;  1M56 B;  3LDD A;  3CP1 A;  2HJF C;  3E2E A;  2R9R B;  1EFR G;  2CK3 G;  1NVP D;  1OHH G;  2XAJ A;  3FB7 C;  2GHY A;  4HYO A;  1P4R A;  1NH2 D;  3HB3 B;  2WAM A;  1R3L C;  4HAM A;  1FXK B;  4JTC B;  3SPJ A;  3K0G A;  4LP8 A;  5IYC O;  1RPO A;  1OCR C;  5KA6 A;  3CYO A;  1V55 B;  3CCM V;  3FB8 C;  3JD3 A;  1MOF A;  1FS0 G;  2X6B A;  1VQP V;  4KFM A;  5KUK A;  4MVU A;  4QIW F;  4MS2 A;  1AI4 A;  2JEU A;  1NR1 A;  1OZ0 A;  1AR1 B;  1G8M A;  1EZJ A;  4RAI A;  1M56 C;  3FB5 C;  3AG4 B;  3DTU B;  4PDV A;  3TET A;  3K9A A;  5J9P C;  2V1D A;  3E89 A;  3OUF A;  5DM6 V;  3B77 A;  4PDM A;  1HWY A;  1QVF U;  1I5Y A;  3E8H A;  2IW5 A;  4QPJ A;  4TT3 G;  4UXN A;  1FXK C;  1FXH A;  3VOU A;  2X6A A;  3D36 A;  1OCO B;  1V55 C;  3MD0 A;  5GW7 A;  1JCH A;  3JCZ A;  3CCU V;  1B6Q A;  5HFL A;  2QA4 V;  5FL7 G;  1EBO A;  3STZ C;  3OR6 C;  1S5H C;  1NR7 A;  4BIZ A;  5IY5 B;  4P9P A;  1PKX A;  1KQS U;  4WFG A;  2ZQM A;  3OGC C;  1S0V A;  1Q82 W;  3AG4 C;  2F43 G;  5EBM C;  3ZN1 A;  4LC1 A;  1KP3 A;  4MVQ A;  4WFA V;  5H6Q A;  5KUM A;  3E8F A;  3ABK B;  5CBG A;  4MSW C;  1GK9 A;  5LHG A;  4GX2 A;  4R8C A;  3F7Y C;  4N21 A;  2MK3 A;  3CME V;  1ARO P;  2W6I G;  5B1O A;  1DF5 A;  1BL8 A;  2W6J G;  3MHH C;  3OEH G;  1H38 A;  1YJW V;  1E1Q G;  2WLL A;  1F51 A;  3CC4 V;  1OCO C;  2IH3 C;  2EIJ B;  4MVZ A;  3JD4 A;  4MVR A;  1KD1 W;  3ZN0 A;  5LGT A;  2HG5 C;  2HR3 A;  5IY5 C;  5IYB O;  3T1C A;  3ZRW A;  2P90 A;  2IU0 A;  4PEL A;  4FK5 C;  1QR8 A;  1AI5 A;  4TSF G;  4G27 B;  1PNL A;  3TK1 A;  4JTD B;  3ABK C;  4MTG A;  4Q20 A;  3WFV A;  1W0J G;  2A0L A;  1S76 D;  1K5Q A;  3P30 A;  4FJC C;  3B8M A;  1F23 A;  1VQ8 V;  2ATK C;  2P67 A;  2XAS A;  5LHH A;  3X2Q B;  5B1N A;  5LHI A;  3CCV V;  2IH1 C;  1MAB G;  2LFR A;  2WLM A;  3AG3 C;  3LDE A;  5LGU A;  2M7W A;  5B3S B;  4MTF A;  1K73 W;  2EIL B;  2Y69 B;  3MHS C;  3TCU A;  2EIJ C;  4P2Z A;  1OCR B;  1F4N A;  1AJQ A;  1AI6 A;  3OMN B;  2Q69 A;  5L3F A;  1AJP A;  3FYI B;  4N23 A;  4TWK A;  3OR7 C;  4CBC A;  1GO3 F;  3DGE A;  3GWO A;  1N8R W;  3UKM A;  3T2M A;  4MTX A;  1NQT A;  3PJS K;  2JK5 C;  1XL4 A;  1QLE B;  3JD2 A;  4GX0 A;  3SYC A;  3GB7 C;  3X2Q C;  2WLN A;  3F7V C;  3SPH A;  3G71 V;  3F5W C;  5B3S C;  2EIL C;  2OCC B;  5H9C A;  2Y69 C;  1M9N A;  1K5S A;  1Q7Y W;  2LFS A;  2ZR3 A;  2P7T C;  5BZB A;  1PL0 A;  1CPY A;  1Y66 A;  3QO5 A;  3SYQ A;  3OUS A;  1M1K W;  1IXM A;  3OMI B;  1VQN V;  4PDL A;  1SET A;  2UXN A;  2ZDI C;  4RO2 A;  3W7U A;  4L87 A;  3AG2 B;  4CZZ A;  4I9W A;  4R6Z A;  2JEX A;  3OFN G;  3CCS V;  1CEZ A;  1K9M W;  2QM8 A;  1FFT B;  3W7S A;  2AHY A;  3ZMV A;  1QLE C;  1RPR A;  1K97 A;  2DWD C;  1LNQ A;  4HZ3 A;  5CMU A;  2YEV A;  3WG7 B;  4RQE A;  3ABU A;  1YJ9 V;  1QBZ A;  3D3I A;  3STL C;  3W7X A;  1VQ5 V;  2H8P C;  2OCC C;  2WLH A;  4PDR A;  3SPI A;  5KA5 A;  3SYA A;  4BW5 A;  1SZT A;  4GX5 A;  4X88 A;  2B1I A;  2H94 A;  4UV9 A;  2C2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...