4MSWC

Y78 ester mutant of kcsa in high k+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
102
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 43
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mswC00
1LNQA 4X8AA 4MVQA 2K1EA 3ZRSA 3SYCA 2WLJA 2DYSC 4LP8A 3SYOA 4WFEA 1K4CC 4P2ZA 2AHYA 3SYAA 4RUFA 3E86A 3E83A 2WLLB 2A0LA 4H33A 3ASNC 3FB7C 3OGCC 4GX1A 2W0FC 1OCRC 1OCCC 2HJFC 2OCCC 3FB8C 4J9ZB 3UM7A 2ZXWC 5CBGA 5CBHA 3SPCA 5EBMC 2X6AA 5BZBA 2Q6AA 3JYCA 2JK5C 3X2QC 2DYRC 1XL6A 3ABLC 4EKWA 1OCZC 4RAIA 4LBEC 4QE9A 3AG3C 1XL4A 1ZWIC 3R65A 5EK0A 3K03A 4XDJA 2A9HA 3EFFK 4GX0A 4MS2A 5B1BC 4QNHB 4BW5A 1KKDA 4RUEA 3ASOC 2WLNA 2WLLA 3OUFA 1R3KC 1S5HC 2ATKC 3IGAC 3RVYA 3TCUA 4MTFA 4CBCA 3K0DA 4WFGA 4MW8A 4HYOA 4JTAB 1J95A 2X6CA 3AG4C 5J9PC 4R8CA 1BL8A 3SPHA 4X88A 4MW3A 4PA3A 2Q69A 2KB1A 2BOBC 2Q67A 3K0GA 4G27B 4MVUA 4XDLA 3K06A 4PA4A 3RVZA 3OR7C 1ORQC 4MVSA 3LDCA 4PDMA 4OXSA 3RBZA 2EINC 4R7CA 2HG5C 2WLHA 3STZC 3WG7C 3AG2C 1K4DC 4PDRA 4F4LA 1M56C 3AG1C 3F7YC 2Q68A 2ITCC 2DWEC 2QKSA 2BOCC 2ITDC 2WLIA 3ABKC 3E8HA 4PDVA 4TWKA 3T4ZA 3SPGA 3FB6C 3F5WC 4MTOA 2EILC 5KUMA 2WLIB 1V55C 3E8BA 3HPLC 4P9PA 1P7BA 5B3SC 3T4DA 2HVKC 2WLMA 3K04A 3VOUA 5EBLC 5KUKA 1R3IC 1QLEC 4H37A 1R3LC 1R3JC 3LDDA 2P7TC 3E89A 3SPIA 4ZBMA 4JTCB 3FB5C 2A79B 4LCUC 4PA6A 4PDLA 4RO2A 5IY5C 4PA7A 2QTOA 2R9RB 3LUTB 4I9WA 2HFEC 2EIJC 4GX2A 3GB7C 3E8GA 2Y69C 4HZ3A 3SJQC 5EC2C 3LNMB 2ZD9A 1OCOC 4MVRA 3UKMA 4X89A 3SPJA 1M57C 3STLC 2IH3C 3LDEA 4GX5A 4R6ZA 4DXWA 3ZJZA 2H8PC 1JVMA 3ABMC 3E8FA 1V54C 4J9YB 4JTDB 3K08A 2EIMC 3BEHA 4MSWC 2X6BA 3T1CA 2HVJC 4PA9A 4MVOA 4P9OA 4R50A 3SYPA 3TETA 3PJSK 1G4YB 3IFXA 3OR6C 4UUJC 2EIKC 3RW0A 4MTGA 4G28B 2YEVA 4MVZA 2IH1C 4P30A 5EBWC 3OUSA 5CBFA 5E1AC 5EC1C 4MVMA 2AHZA 3F7VC 4KFMA 2WLKA 4QE7A 3T2MA 2DWDC 2NLJC 4WFFA 4XDKA 3SYQA 3KG2A 4WFHA 5B1AC
chains in the Genus database with same CATH superfamily
3P3NA 1FXHA 1Y74B 4DR4B 4P2ZA 1Z5VA 2ZINA 4JV5B 2IW5A 1Q6IA 1OCCC 3IC7A 4X1IA 2UUAB 1SQGA 2CTQA 2YI9A 2AW9A 4JAVA 1YSCA 4DR2B 4LF4O 3WFVA 2DYRC 1H2LA 4IHJA 1EZJA 1BHAA 2Z5UA 1NR7A 2ZCEA 4WFBV 4MS2A 4GZRB 4BW5A 4RUEA 1IXBA 1K33A 2EBOA 5J2TA 4I0XB 2ZIOA 3OFNG 2Y4UA 4N21A 4ZHQB 4PHZA 1YHQV 3UT5A 1HNXO 4LF5O 4DRXB 1US6A 2YXLA 3H1JH 1YVWA 2YIBD 4XDLA 3AG2B 2HR3A 4YHHB 3U10A 2OTLV 3MAQA 4K35A 3K3WA 3P30A 4JI6B 3UQ8A 3WB2A 3GWKC 3S3XA 5KUMA 4B3MO 1BQ0A 1H38A 1YITV 3C90A 1GTOA 1V55C 3SR2C 3CE2A 5BXZA 5EYPB 3K04A 2BCCH 3O9OA 1URFA 5CMUA 1AP6A 1XREA 3SPIA 4YY3O 1OCOB 1KBHA 2EIJC 2Y69C 3SJQC 1IURA 4DV1B 5ITZA 4IL6Z 3KCXA 3E8FA 3KKYA 4JTDB 1Z2GA 5CA3A 3TETA 4IIJB 3H1IH 1YEWA 5EBWC 2OYQA 1ZL8A 4KFMA 1DGSA 4WFHA 4X65O 4YJ2B 5KHIA 1FJGB 3ZHTA 2F4VO 4LP8A 3JCZA 4LFBO 1COWG 3N2GB 2HP8A 1L8DA 1Y4MA 4DW0A 2VQEB 1MNGA 1ZAUA 1YJWV 1OCZC 1XL4A 4EFBA 1RPRA 3ZX6A 3HKEB 3QG5A 1K73W 1KMIZ 2GTSA 3QTCA 2ZR2A 4K0KB 3TCUA 2IM9A 2IBZH 3LSQA 4JI0B 1J95A 2V4DA 4TUYA 1XUQA 4GYCB 2Q73A 5BMVB 2HEPA 5LHHA 2R9AA 1GRJA 2QE7G 4J7ZA 3HKBA 3K5LA 4EFEA 3RBZA 2ZDIA 1FXKA 2V1DA 4J7KA 5LHIA 5B1AC 3RYHA 1HNXB 3OTOO 3GWOA 3RWRD 2BTQA 4I4TB 2YIBA 4P9PA 3B09A 4LFCB 3SDLA 5LMNB 2UU9O 1F7YA 4H37A 1R3LC 5EIBC 1I7FA 2RCVA 2WWWA 3L72H 1WA8A 2HFEC 4J80A 4X66B 3STLC 2Q0OC 4OPAA 3JSLA 3LDEA 5FNVB 3W7XA 3CCUV 2YI8A 3JASB 3QO5A 4UVBA 4MVOA 2ZM6O 1QVGU 4O4LA 5C8YB 2YUAA 1IBMB 1ZSPA 5LXTB 4O2BA 1S77D 2DYSC 4RUFA 2QGNA 4X1KA 5IYZA 2ZXWB 1JR9A 5GONB 1NTKH 4TQDA 4BIOA 2KG7A 3K58A 1J5EO 3X2QB 1OV9A 1VP7A 1XNRB 4X65B 4X1IB 2OIEA 3CCVV 5AG2A 1EFRG 5CB4A 5JJNB 4LFBB 3WB0A 4IHJB 2QEXV 4B3SO 3OT7A 2OTJV 2UXCO 2ATKC 3H9VA 4F6RA 4CBCA 5IWAB 3VBBA 2BE3A 4DV7B 5J2TB 2M6YA 3OEEG 4ZOLA 1K3EA 3UT5B 4FLUA 4DV2O 2RJZA 4OXSA 2EINC 4R7CA 3NXSA 4I7ZB 1Q6HA 3AG1C 2PF4E 5B3SB 1EN5A 4GKKB 5H6QA 1BCCH 5KA5A 4H13B 1RSOB 3CX5F 3JATA 3FB5C 4JYAO 1M9NA 1RM1B 3BVOA 3OTOB 3L70H 2P6JA 2GUZB 3CCSV 2EIMC 4JI8O 4NB5A 2FL4A 2Q4PA 5IYBO 4CC5A 5LP6C 2JEUA 1PV0A 4UUJC 2N74A 3CRAA 2Q9LA 2YDEA 1P4RA 3BCCH 4I50A 3KG2A 3CEIA 1P84F 2EULA 3JD1A 1GN3A 3SYAA 1KU9A 2ZM6B 1VF6A 4FPPA 5F2VO 1HDJA 4D7TA 2JJ2G 3UM7A 3TXSA 1NTZH 1S5LZ 3M7MX 1V9PA 1CXZB 4QE9A 1ZWIC 3CWBH 1XMOB 2JIZG 3ZHSA 3N27A 1J5EB 1FXVA 4LFAB 4PJ0Z 1XNQO 2UUBO 1AB3A 1F4MA 4X64O 4DV5B 4TUYB 2RQ6A 3IAYA 1DF5A 2B1GA 2WPDG 1D5AA 3HB3B 1SQQH 3HKBB 2EJRA 4TOIA 5KA6A 1FXKB 4CH5A 4ZHQA 3RYHB 1G6UA 1IXMA 1P7BA 3VOUA 5BY1A 2DQ0A 4LCUC 4PD4F 1SQXH 3G71V 5CN0A 2QTOA 3VQWA 4DV4B 1N33O 5LBQA 1GN6A 4I9WA 5EZYB 1NI8A 3BY6A 4TV8A 5LMUO 3SPJA 3W7UA 3JD3A 5L3BA 5DECA 1QQCA 2R70A 5EYPA 1NS1A 4A5UB 3QO8A 4G2KA 2X6BA 1G8MA 2W6JG 4NKGB 3PN1A 5L3CA 1SA0A 2VQFO 2YSUB 1PP9H 1DLBA 1BQZA 2EIKC 3RGBA 2YEVA 5DM6V 4BIZA 3G67A 4MVMA 3QVNA 2AHZA 4O4LB 4WFFA 5KAIZ 1HNWO 3TGUH 4JI8B 3ZRSA 1IZ3A 3CRMA 3SYOA 1K8AW 1OCRB 4O2BB 1XHZA 2XAHA 2Q7HA 5LA6A 3TXQA 2UXDB 1H2NA 1U96A 4X1KB 3BA9A 2X6AA 4QJFB 4DV3B 3H1LH 3JYCA 2JK5C 3G4SV 5B1BB 1YDXA 3ABLC 1HNZO 2KKWA 4RAIA 3CB2A 3AG3C 4KP4A 4LWSA 2OT5A 3IJ4A 4CS4A 4XDJA 4YJ2A 2R72A 3EFFK 1LUVA 4JF3A 1KD1W 4CH6A 5CB4B 2PUSA 1KKCA 3P32A 2ZKOA 2V7QG 5J2UB 4JTAB 1N0NA 1FS0G 3J7AU 4FIPC 4F6RB 4NVPA 4WBNA 1FKAO 2Q69A 1D5NA 2EIJB 3K0GA 5KAFZ 3TK1A 3D3IA 1M56B 1XNQB 4DR7O 4ZOLB 3HKEA 1T5EA 3JD2A 3DTUB 4KHPO 3D3QA 2Q68A 4Q6GA 3ZEDA 3BAAA 5JH7A 4MT8A 2LFSA 3F5WC 3ZIAG 3T1HB 1EZVH 4MTOA 2E3CA 4X64B 4GLXA 1N8RW 4U7NA 1K5SA 2FB5A 5BMVA 2JEXA 2Q8VA 1CEZA 2QDOA 1WNSA 4ZBMA 1R6TA 1OZ0A 4GKJO 4GUNA 1GMGA 4J42A 1K34A 1VF7A 4AILC 3CCQV 3SJBC 1YCIA 3L71H 5D5PA 1JX9A 3ABMB 3CHXA 3SJAC 4LF6O 1M4UA 1V54C 4DR6O 1S5JA 2CGNA 1YI2V 1XDCA 1AR4A 1LR1A 1ZUQA 4FM1A 1N32O 1F51A 3A0RA 3T2MA 2QM4A 1P7GA 2VS0A 5FNVA 2P4VA 2X0LA 4ZI7B 4JYCA 4DK0A 2WLJA 3ZHQA 2VQFB 1KUQA 1K92A 3OGCC 5JCOA 4WCEV 2YXYA 1Q43A 1KYOF 5KHHA 1HR0O 5B1AB 1WB8A 1XL6A 1D2DA 1H2SB 2VWJA 1SC5B 1XBLA 3MD0A 2LGQA 4NXNO 1S5HC 3OEHG 5GONA 3RYCA 2CAZC 4HYOA 2IJHA 4LH6A 1YJNV 5J9PC 1HNZB 4X88A 3DXRA 3D36C 2YIAA 4FLXA 1O9HA 1L0LH 3K06A 1ORQC 3CC7V 5LGNA 5B1NA 1BT8A 3ABKC 4PDVA 1EN4A 1QCEA 1HW7A 3E8BA 4Z2WA 1VQ5V 3AEIA 2D3OW 4JAUA 3OGIB 3AK1A 4PA6A 4FLZA 3JAWA 2N04A 3JAKB 2JS5A 2DYSB 3ZS8C 1SQPH 1AJPA 4PELA 3LNMB 4F6EA 2CTWA 4X89A 2G38A 4ZKIA 4TV8B 4E2LA 2LJ2A 3U0ZA 1RSOA 4DR1B 2DQ3A 4X1YB 3SJCC 5B66Z 2IH1C 4UFZA 1SA0B 4FZ1A 4K8XA 1FPOA 2WLKA 2YEVB 4QGPA 1PPJH 1N0JA 3T1YO 1NZ6A 3RYFB 1MABG 4DR6B 2GUZA 3OW2U 4JI7B 3QF7A 3E83A 4H33A 4GX1A 2OCCC 4CC6A 3FFQA 3SPCA 5LA6B 4QIWF 3DC5A 3H1HH 1KECA 1IBKO 4LWSB 3ASOC 3BABA 1S0VA 3K9AA 3K0DA 2P5OA 4AQYO 4O2AA 5LOVA 4UCRA 4WBNB 1TA8A 2YIDA 1MOFA 4CS3A 1Y76A 5IJ0B 1XOUA 3E8HA 5LL6Y 2ITDC 2WLIA 1NH2D 1VQLV 3E2EA 1OJHA 2ARHA 5JH7B 2Y0IA 1K9MW 5BR8O 4LF4B 2WSSG 3ZRWA 2QJ1A 4FM2A 1B04A 1QLEC 1R3IC 2PI5A 2MK3A 1TUBA 4JTCB 4RO2A 4NTYA 4PI0A 2FYUH 5JJJB 2ZD9A 3CC2V 2DJVA 3A0HZ 2FMLA 4GX5A 4DXWA 4LF5B 2QKCA 4O4HA 1RFYA 4EB6B 1ZLZA 3FYIB 4I55B 1B06A 3W7SA 2D2CB 4PI2A 5EZYA 4O4IA 4IYHA 5E1AC 1JQ0A 4RQFA 2NLJC 3ZMTA 4B3MB 1HWYA 1LUWA 3CMAV 1VQKV 4B3RO 2Q5ZA 2ZE8A 3SYCA 4WFEA 1TGOA 2WLLB 4YY3B 4LNUA 3APQA 5L3GA 2Q0AA 3FB8C 1XQ8A 1NT2B 1VQ6V 4L8JA 1L0NH 3UO2A 1I5XA 2UXBO 2IJKA 1Q5OA 1JPXA 2QWOB 5JWPA 4K8ZA 1K5QA 2JS3A 1R1BA 1XEQA 3SPHA 3RYCB 2P67A 5HFLA 5EIBD 5TISZ 1BMFG 5KMGA 3BPZA 3DXRB 3C3TA 3A0BZ 1AROP 2F4VB 2QKAA 1IX9A 3K57A 4UVAA 3AG2C 4X20B 4C7UA 4CH4A 4B08A 5J2UA 4H0LB 3CJHA 4NR1A 3KCYA 1Y6XA 2EIKB 3T4DA 5GW7A 4JASA 5KUKA 2ZE5A 4MTXA 2HJDA 3E89A 4FM0A 3WU2Z 2VRZA 1NKDA 4PA7A 1BE3H 3LSSA 3JAWB 3B2EE 4HBNA 3ETGA 1OCOC 1N34O 1KB9F 4R6ZA 2Z3YA 3EXAA 1JFFA 3OMNB 5FLXN 3ABLB 3G80A 3MDSA 1A32A 1GH6A 1JCHA 4MTGA 2IU3A 4P30A 1E1QG 2WA4A 4DUZO 2QA4V 2WA3A 3L75H 1E79G 4EEQA 4GCZA 2UU9B 1EBOA 3ZCCA 3CCRV 2FKXA 2YS8A 1QBZA 4BIUA 4DV0O 4IT5A 3OAAG 2Q6AA 2A3QA 4BR6A 2AZ0A 4B3RB 4LBEC 3R65A 4LH7A 1AVMA 2EX3A 3K03A 4ZI7A 1VQMV 1GO3F 3JSNA 1GAXA 4OX9O 4U3FH 2YICA 3AG4B 1GM8A 1UPGA 3LNNA 1F23A 2W6IG 3OMIB 1QR8A 4WF9V 1BL8A 2HHHO 2QM7A 1PM9A 4ABMA 1YTFD 1EN6A 2XAGA 4JZ2A 1WJZA 3RVZA 5LGTA 4O2AB 5LOVB 1R6NA 1VARA 3F7YC 1V54B 1Y76B 4UB6Z 1RPOA 3K79A 2EILC 4H44B 2IU0A 2YXHA 4YJ3A 2WLIB 2EJ7A 4JYBA 3FKSG 2PZSA 3G6EV 1QNMA 4TV9B 3ZRWB 1UFIA 3CCJV 1QLNA 1R6KA 4B3SB 1TUBB 2XAFA 4JI3O 2UXCB 1AI7A 4MVRA 4QPJA 3F5TA 3BEHA 4MSWC 4JI4O 1SQFA 3M8AA 4O4HB 4DV2B 2CTPA 3K9SA 3JAKA 1N34B 3CD6V 4NXMO 2QWQB 4DUYO 1MMMA 2XNDG 4JI2O 2DWDC 4O4IB 4KXRA 1LNQA 5DN6G 3RFRA 2H94A 2JJ1G 3K59A 4HAMA 1OCCB 5JQGB 4X1YA 3E86A 1RP3B 5IJ9A 4JYAB 5A2QN 1EM1A 2HJFC 2E5LO 1SKVA 4KL1A 1BSMA 2LO1A 1L1FA 5IE9A 2DYRB 2ZXWC 4LNUB 4W4LA 1SZXA 4AHCA 2OCHA 3X2QC 1P49A 1YZBA 3RYFA 1H2MA 2L6LA 3B77A 5EK0A 1S72V 2PI4A 2A9HA 1MZFA 4FK5C 4LF9O 3ZN1A 3VQXA 1XMQO 2ADQB 1FFXA 5IYDO 1G1XB 4B7EA 4UVCA 1SESA 2X6CA 5IT9N 4R8CA 4YIOA 1THZA 4X9QA 4MW3A 1GKFA 1W0JG 2Q67A 3IC9A 4MVSA 3CCMV 4LF7O 1FAFA 5GTIZ 5KMGB 3WG7C 2Z0AA 1PNMA 1H8EG 2Q7GA 2PY5A 2QKSA 3BA8A 1V55B 4J7JA 3BRCA 4L87A 2QM8A 2RMKB 5B3SC 1TAEA 2HVKC 1M5IA 2RNBA 3H01A 3CJHB 1KP2A 4FFBA 4K3AA 4HNAA 1TUEB 4JV5O 4FLTA 4UCSA 4RWUA 3DGEA 5IJ0A 2Y69B 2PTMA 3CRCA 2UUBB 4CS2A 4FVMA 4DR2O 1RM1C 1NH2B 2KSDA 3VQYA 3I55V 5LP6A 3ZMSA 1Y67A 2OCCB 1B6QA 3K08A 3MHHC 1WAZA 4JPRA 3CS5A 1JFFB 1SF9A 3OE7G 1G4YB 2OIGA 5CBFA 2CH7B 2XT9A 3AG7A 1BS3A 1NR1A 4MVQA 4EB6A 3CXCU 2AHYA 1PL4A 4I55A 5LYJB 1NBMG 5JJEB 4JI6O 3DC6A 2EZPA 4DUYB 1N33B 4FLVA 5CA1A 4JI2B 2F93B 1OCZB 2OWOA 1PNKA 2NR5A 3A2FA 2N05A 5LMUB 3JALA 1FD9A 2L35A 3G6BA 3E35A 4QNHB 4B7KA 1KKDA 2JGUA 2AXTZ 3ZHRA 2WLLA 3OUFA 3RVYA 1QLEB 1ENVA 2NN4A 2MW2B 2JVDA 3GVMA 1HNWB 4UV9A 4LF9B 4E4EA 3JD0A 3ZMVA 4ZIBA 2XTAA 1XMQB 2JRIA 4TWKA 5FL7G 3CXHF 1GN4A 2ZDIC 1FXKC 2JGDB 3O65A 4TQFA 5L3FA 1FJGO 1KC8W 4YJ3B 3LDDA 4D7SA 1YXBA 5KLVH 4PDLA 4IGGA 4NTWA 4FLWA 3HR0A 4X20A 2R9RB 3LUTB 1AR5A 2CGOA 2VQEO 4DYLA 5EC2C 2B1IA 1H8HG 1VQ8V 2W0XA 4LR3A 1Q82W 1M1KW 1IDSA 1AI4A 4DR7B 4K0KO 2QSAA 3SYPA 2DN9A 4FJCC 4JI0O 3RW0A 4G28B 5GTHZ 4KHPB 3L9DA 4JI1O 4XDKA 3OMAB 1ZTEA 4X8AA 3TJTA 4BAYA 2ZIMA 2UXXA 4CZZA 3RT3C 3VQVA 2F1MA 3ASNC 4GKJB 4O4JA 1OCRC 1MSDA 2RDCA 5IJ9B 1H2GA 5EBMC 5BZBA 4JYYA 4NTXA 1AJQA 4LFCO 5LMNO 3ETDA 4EKWA 5B1BC 4LF6B 4DR5O 4JZGA 2WLNA 1R3KC 2BTOA 3P3PA 4MW8A 4X66O 5K1PA 4KUMA 1N32B 3MHSC 1FFXB 2P4KA 1NU1H 2EINB 4DO2A 2LQTA 1S3JA 1JJ2U 3AG1B 2UXNA 3LDCA 3STZC 4LC1A 1M56C 1IBMO 2PGGA 4UXNA 3BFRA 1MG1A 4X62O 3SGIA 2E76B 1HR0B 3HPLC 3NR7A 1YTFB 3HKCA 5EBLC 1GK9A 3BHPA 4UCTA 1DTOA 4FFBB 5IY5C 1WP7A 4HNAB 2LW7A 4B3TO 2P90A 4RQEA 1XNRO 1Q7YW 4NXNB 3E8GA 2E74B 3ETQA 3HKDB 3S3WA 1JA8A 3UKMA 2F43G 1M57C 3CCEV 2EIMB 3N2KA 5KX5A 3ABMC 4OPHA 5LP6B 4XBFA 3CC4V 4TV9A 2IJIA 2M7WA 2HVJC 4JGSA 5IWAO 4P9OA 4DV7O 1VF5B 3OR6C 2UUCO 2ZE7A 5LHGA 5K1XA 1TVKA 3CCLV 3L74H 5KHJA 1XI1A 3SYQA 2ZNIA 1PL0A 2ILMA 1Q6UA 1K4CC 2HLDG 1JOYA 1CPYA 2XOKG 4UCVA 1PNLA 2AGAA 5CBGA 5CBHA 4GKKO 2GV9A 4JI1B 1VF6C 5JVDB 5CA1B 5L3EA 2EILB 4GX0A 1Z5WA 3JALB 1F4NA 3WB1A 5JQGA 3D36A 4WFAV 5H9CA 1N36O 1NQTA 5H6RA 3ABUA 3THOA 3DSQA 2BOBC 4DR5B 3T1YB 2F95B 4PA4A 3ETEA 1SS3A 2VWKA 4PDMA 2WLHA 1MZEA 4F4LA 3FX7A 2ITCC 5KHGA 3T4ZA 2BOCC 1GN2A 3SPGA 1DF4A 2CDYA 3ZMUA 2Y0PA 1W59A 3W7WA 1Q8IA 2LGWA 1R3JC 1AI5A 1I5YA 3LSUA 2GSMB 1IBKB 2Y4TA 3B8NA 2PYJA 4GX2A 1YF2A 4X62B 1E1RG 1AP5A 5DEDA 2A7WA 3ZRVA 4JAAA 3ZRXA 1XMOO 3EHBB 1SRYA 2GHYA 4AQYB 4PV1B 1IVSA 4B3TB 4LFAO 2CE4A 1WN7A 4UCOA 3A8TA 4U3JA 5IYCO 4R50A 3IFXA 1SQVH 1VIBA 5EC1C 1WB7A 4DW1A 4DV5O 3R66A 5CA0A 1OHHG 5BR8B 2ZR3A 2K1EA 1FFTB 4J11A 4IYIA 2BSKA 3KZIZ 2UUCB 2A0LA 1Q90D 2E75B 3ZN0A 2QWPB 4YXWG 3UO3A 4AI8A 2XAJA 1S76D 3AG3B 4O4JB 3WG7B 3E22A 2CH7A 3OM3B 1O9GA 3K5MA 2QTSA 1W2BU 1I94O 1IBLO 1VQPV 4YIPA 1VQNV 1ZX3A 2DE0X 4ICGA 5LGUA 1Q86W 2CTRA 4DV4O 1WP8A 5LYJA 3QNEA 4J10A 3IGAC 1VQ9V 4MTFA 1WLEA 1XILA 4QPKA 1NVPB 1R73A 2ZT9B 1SZTA 2LP7A 5H2FZ 1VEWA 3FAVA 2YC0A 4MVUA 2ETNA 5HFMA 3I56V 1N4CA 1Q81W 1N36B 4TT3G 2XASA 3RYIA 2QR4A 2NNUA 5IDJA 3FB6C 4DV6O 2GDSA 5ITZB 2H3OA 3RN4A 3H1KH 2WLMA 2UXBB 2P7TC 3HKCB 1CP9A 3Q4HA 4FZ0A 3ZMZA 2UXDO 5B5EZ 4TSFG 4UCUA 1FYJA 1ZL8B 4DV3O 2GTAA 2KQXA 3JARA 2P22C 2LW1A 3ML0A 1BHBA 1NTMH 1WPXA 2IH3C 2JGDA 1X4TA 2H8PC 2X7RB 3M99B 3JCUZ 3N2KB 5KX5B 1KQSU 1JMKC 4U7OA 4GT1A 1U97A 3PJSK 2WAMA 2DOSA 4DK1A 4W4KA 2CK3G 4QE7A 2O57A 1Y74A 2ZE6A 2XUMA 1TVKB 4N23A 4NYKA 4BWAA 1AI6A 4FLYA 1W0KG 2ODMA 3T1HO 3ABTA 2RN9A 2Y48A 1X59A 4I9QA 5C93A 1I08A 1AR1B 3CRRA 5D5QA 1BGYH 1DK1A 5JCOC 4UB8Z 3D8CA 5KHKA 1SQBH 4I0XA 1K7DA 4D6TH 4WFGA 2XHBA 1GM7A 4DRXA 3ZHVA 2BTQB 3EVKA 1I94B 1IBLB 4DUZB 2XAQA 3L73H 4LF8O 3ABKB 3CP1A 3CYOA 1K4DC 4DR3O 1WA8B 1QHTA 4I5SA 4JI5O 4DV0B 1ROPA 2CUGA 4Z1VA 3JAMN 1SETA 1YIJV 3QO7A 2JDIG 3OTFA 4DV6B 3K5NA 4OX9B 2LFRA 4HZ3A 1Q3EA 2C2AA 2ZNJA 2ADPA 3B8MA 3ASNB 1M90W 3U11A 3ZJZA 2HHHB 1QVFU 4BW9A 4IIJA 5FPRA 1VQOV 3T1CA 4FMTA 5IYZB 4DR4O 2B9ZA 3B4SA 4PA9A 2KG7B 2DMXA 4Q20A 3CRQA 3I5DA 4U3JB 4ASUG 3OUSA 4FFKA 1AILA 2F66C 3F7VC 1QR9A 3HKDA 2UUAO 2EZOA 2F23A 4OGQB 1HP8A 4UV8A 5CA0B 1BZKA 3N2GA 3AK3A 2P06A 3FYEB 3FB7C 2W0FC 1QU7A 2K9PA 2BSKB 2QWRB 3CSXA 4J9ZB 5H5NA 4JI3B 1PD3A 3K5OA 2A06H 2HKOA 1K97A 3E22B 3ASOB 3W7TA 4CH3A 4JI4B 4YHHO 1MA1A 3UCSC 1YJ9V 3AG4C 2DW4A 5IY5B 3J80N 4NXMB 3J81N 4Z1MG 4PA3A 5JVDA 2KB1A 3ICXA 2PYLA 2GBOA 4DR1O 4G27B 2R9IA 3FD9A 1NVPD 1XHXA 2FTKA 1GM9A 3JATB 3OR7C 1M57B 2ZQMA 2HG5C 3FAVB 4PDRA 2DWEC 1SERA 4I4TA 3ZHUA 1M93A 2QWNB 2E5LB 3CPWU 3B40A 3RYIB 4J41A 4LF8B 1UJWB 3JD4A 4JI7O 4DV1O 1NJIW 5E79Z 1WPBA 1VMGA 4DR3B 2IJJA 1PKXA 2A79B 3CMEV 4JI5B 3Q4HB 5B1OA 3GB7C 1I0HA 4I50B 3AK2A 1KP3A 3JARB 3OD4A 1JVMA 3JASA 4J9YB 1VQ7V 5A9GA 3APOA 1VQ4V 1B3QA 1MSWD 4LF7B 5C8YA 1AJNA 1H2KA 5FPOA 5LXTA 4MVZA 2B5UA 1Y66A 2AZ2A 1JJOA 3ZBHA 5L3DA 3C3SA 2Q7EA
chains in the Genus database with same CATH topology
4GCZA 1FXHA 3ZRSA 3SYOA 1K8AW 1EBOA 1K4CC 1OCRB 4P2ZA 3ZCCA 3CCRV 2HLDG 2XAHA 1JOYA 1CPYA 2IW5A 1OCCC 2XOKG 3IC7A 1PNLA 5CBGA 1QBZA 4BIUA 5CBHA 3OAAG 2X6AA 4JAVA 2Q6AA 1YSCA 4QJFB 3JYCA 2JK5C 3WFVA 3G4SV 2DYRC 5B1BB 3ABLC 4RAIA 4LBEC 3AG3C 3R65A 1EZJA 4KP4A 1BHAA 2OT5A 2Z5UA 1NR7A 3K03A 4XDJA 5L3EA 2EILB 3EFFK 4GX0A 4MS2A 4WFBV 4BW5A 1VQMV 4JF3A 1GO3F 1KD1W 1F4NA 4RUEA 1K33A 2EBOA 3D36A 4WFAV 5H9CA 3AG4B 1NQTA 3OFNG 3P32A 2V7QG 1GM8A 4N21A 1F23A 2W6IG 4JTAB 5H6RA 3OMIB 3ABUA 1FS0G 4FIPC 1QR8A 1YHQV 4WF9V 1BL8A 2QM7A 2Q69A 1YTFD 2BOBC 2EIJB 3K0GA 2XAGA 3TK1A 4XDLA 3AG2B 2HR3A 3ETEA 4PA4A 3D3IA 1M56B 3RVZA 5LGTA 2OTLV 4PDMA 2WLHA 3JD2A 3DTUB 4F4LA 1R6NA 3K3WA 3P30A 3F7YC 2ITCC 2Q68A 1V54B 3T4ZA 2BOCC 3SPGA 4MT8A 1DF4A 2LFSA 1RPOA 3F5WC 3K79A 4MTOA 2EILC 3ZIAG 5KUMA 3ZMUA 1N8RW 4U7NA 2IU0A 1K5SA 1H38A 1YITV 2WLIB 1GTOA 1V55C 2JEXA 1CEZA 4JYBA 3W7WA 3K04A 3FKSG 3G6EV 1R3JC 5CMUA 1AI5A 1I5YA 2GSMB 3SPIA 4ZBMA 3ZRWB 1OZ0A 3CCJV 1QLNA 1GMGA 1R6KA 1K34A 3B8NA 2XAFA 1OCOB 3CCQV 4GX2A 2EIJC 1AI7A 1E1RG 2Y69C 3SJQC 1JX9A 3ZRVA 3ZRXA 4MVRA 3ABMB 3EHBB 4QPJA 1SRYA 2GHYA 3E8FA 1V54C 4JTDB 3BEHA 4MSWC 1YI2V 5CA3A 5IYCO 4R50A 3TETA 3IFXA 5EBWC 1F51A 3CD6V 5EC1C 3A0RA 4KFMA 3T2MA 2XNDG 2DWDC 4WFHA 1OHHG 2X0LA 1LNQA 5DN6G 4JYCA 2ZR3A 2H94A 2JJ1G 2K1EA 1FFTB 2WLJA 4LP8A 4HAMA 1OCCB 3JCZA 3E86A 1K92A 2A0LA 3ZN0A 1COWG 3OGCC 4YXWG 2XAJA 2HJFC 4WCEV 1L1FA 2DYRB 2ZXWC 1Y4MA 1S76D 3AG3B 3WG7B 3X2QC 3OM3B 5B1AB 1YJWV 1XL6A 1OCZC 1XL4A 1W2BU 3B77A 5EK0A 1VQPV 1S72V 2PI4A 2A9HA 1VQNV 1RPRA 1Q86W 5LGUA 4FK5C 1K73W 3ZN1A 3QNEA 3MD0A 1S5HC 3OEHG 2ZR2A 3IGAC 3TCUA 4MTFA 1VQ9V 1WLEA 3LSQA 5IYDO 4HYOA 2IJHA 1YJNV 4UVCA 1J95A 4QPKA 1SESA 2X6CA 5J9PC 1NVPB 4R8CA 1R73A 4X88A 1THZA 1SZTA 4MW3A 2LP7A 1GKFA 1W0JG 2Q67A 5LHHA 4MVUA 2QE7G 3K06A 4MVSA 1ORQC 3CCMV 3CC7V 5LGNA 5HFMA 3RBZA 3I56V 2ZDIA 1FXKA 1Q81W 3WG7C 2V1DA 5B1NA 1PNMA 1H8EG 4TT3G 2XASA 5LHIA 5B1AC 3ABKC 4PDVA 2QKSA 1V55B 1QCEA 2NNUA 3FB6C 5IDJA 4L87A 3GWOA 2QM8A 3E8BA 1VQ5V 4P9PA 3AEIA 5B3SC 2HVKC 2WLMA 3H01A 1KP2A 2D3OW 4H37A 4JAUA 1R3LC 2P7TC 1TUEB 1CP9A 4PA6A 3ZMZA 2WWWA 3DGEA 2Y69B 2HFEC 2DYSB 4TSFG 1RM1C 1NH2B 1AJPA 4PELA 3LNMB 3ML0A 1BHBA 4X89A 3STLC 3I55V 3ZMSA 1WPXA 2IH3C 3LDEA 4ZKIA 3W7XA 2OCCB 2H8PC 3CCUV 4E2LA 2X7RB 3M99B 1B6QA 3K08A 3MHHC 2DQ3A 4JPRA 1KQSU 3OE7G 3QO5A 4U7OA 4GT1A 4UVBA 4MVOA 3PJSK 1G4YB 1QVGU 2WAMA 2IH1C 5CBFA 2CK3G 4QE7A 2WLKA 2YEVB 1MABG 4N23A 3OW2U 1AI6A 1NR1A 4MVQA 1S77D 2DYSC 3CXCU 2AHYA 4RUFA 3E83A 4H33A 1NBMG 2ZXWB 4GX1A 2EZPA 2OCCC 1W0KG 3X2QB 3ABTA 2Y48A 1OCZB 3SPCA 5C93A 4QIWF 1PNKA 1AR1B 3CCVV 1KECA 1EFRG 3E35A 4QNHB 1K7DA 1KKDA 2QEXV 3ASOC 2WLLA 3OUFA 2OTJV 2ATKC 1S0VA 3RVYA 3K9AA 1QLEB 3VBBA 4CBCA 3K0DA 4WFGA 1ENVA 1GM7A 3OEEG 2XAQA 1K3EA 4UV9A 1MOFA 3JD0A 3ZMVA 3ABKB 4OXSA 3CP1A 2EINC 4R7CA 3NXSA 3CYOA 1K4DC 3AG1C 3E8HA 4TWKA 5FL7G 2ITDC 2WLIA 4I5SA 1NH2D 1VQLV 3E2EA 5B3SB 2ZDIC 1FXKC 5H6QA 1ROPA 1K9MW 2WSSG 3ZRWA 5L3FA 1KC8W 5KA5A 1QLEC 1R3IC 2PI5A 3LDDA 1SETA 2MK3A 1YIJV 4JTCB 3FB5C 3QO7A 4PDLA 1M9NA 2JDIG 4RO2A 1RM1B 2R9RB 3LUTB 2LFRA 4HZ3A 5EC2C 2B1IA 2C2AA 2ZD9A 3CC2V 3B8MA 3ASNB 1M90W 1H8HG 4GX5A 4DXWA 2P6JA 1VQ8V 3ZJZA 1QVFU 3CCSV 2EIMC 1Q82W 1M1KW 1VQOV 3FYIB 3T1CA 5IYBO 4FMTA 1AI4A 3W7SA 2JEUA 4PA9A 3SYPA 4Q20A 4UUJC 4FJCC 3RW0A 4G28B 4ASUG 3OUSA 5E1AC 3F7VC 1JQ0A 1P4RA 1QR9A 4RQFA 2NLJC 2EZOA 3ZMTA 4XDKA 1HWYA 3KG2A 3OMAB 3CMAV 4UV8A 4X8AA 1VQKV 4BAYA 3SYCA 2UXXA 4CZZA 4WFEA 3JD1A 3SYAA 2WLLB 4FPPA 3FYEB 3ASNC 3FB7C 5L3GA 2W0FC 1OCRC 3FB8C 4J9ZB 2JJ2G 3UM7A 1H2GA 5EBMC 5BZBA 1VQ6V 1AJQA 1PD3A 3ETDA 2HKOA 4EKWA 1I5XA 1K97A 2IJKA 4QE9A 1ZWIC 2JIZG 3ASOB 1JPXA 5B1BC 3W7TA 1FXVA 1K5QA 2WLNA 1R3KC 4MW8A 1YJ9V 1F4MA 4KUMA 3AG4C 2DW4A 3MHSC 5IY5B 3SPHA 2P67A 5HFLA 4PA3A 4Z1MG 2KB1A 1BMFG 2EINB 4G27B 2R9IA 4DO2A 1NVPD 2FTKA 1S3JA 1JJ2U 1DF5A 1GM9A 3OR7C 2B1GA 3AG1B 2WPDG 2UXNA 3LDCA 1M57B 1AROP 2ZQMA 2HG5C 3STZC 4UVAA 3AG2C 3HB3B 4LC1A 2EJRA 4PDRA 1M56C 2DWEC 5KA6A 1SERA 1FXKB 3CPWU 4UXNA 1MG1A 1IXMA 3HPLC 1P7BA 2EIKB 3JD4A 1UJWB 3T4DA 5GW7A 1YTFB 3VOUA 1NJIW 5EBLC 4JASA 1GK9A 5KUKA 4MTXA 3E89A 2IJJA 2DQ0A 1PKXA 1DTOA 2A79B 4LCUC 1NKDA 5IY5C 3G71V 4PA7A 5CN0A 2QTOA 5LBQA 3CMEV 3LSSA 2P90A 4I9WA 4RQEA 1Q7YW 5B1OA 3GB7C 3E8GA 3BY6A 3ETGA 1OCOC 3UKMA 3SPJA 2F43G 1M57C 3CCEV 2EIMB 1KP3A 4R6ZA 2Z3YA 3W7UA 3JD3A 5L3BA 1JVMA 3ABMC 4J9YB 1VQ7V 4XBFA 3QO8A 4G2KA 3CC4V 2X6BA 3OMNB 1G8MA 2W6JG 1VQ4V 5L3CA 2IJIA 1MSWD 2M7WA 2HVJC 4JGSA 3ABLB 2YSUB 4P9OA 1AJNA 1DLBA 3OR6C 2EIKC 1JCHA 4MTGA 2IU3A 2YEVA 4MVZA 4P30A 2B5UA 1Y66A 5LHGA 5DM6V 1E1QG 4BIZA 4MVMA 3CCLV 2AHZA 2QA4V 4WFFA 5L3DA 3SYQA 1PL0A 1E79G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNQ A;  4X8A A;  4MVQ A;  2K1E A;  3ZRS A;  3SYC A;  2WLJ A;  2DYS C;  4LP8 A;  3SYO A;  4WFE A;  1K4C C;  4P2Z A;  2AHY A;  3SYA A;  4RUF A;  3E86 A;  3E83 A;  2WLL B;  2A0L A;  4H33 A;  3ASN C;  3FB7 C;  3OGC C;  4GX1 A;  2W0F C;  1OCR C;  1OCC C;  2HJF C;  2OCC C;  3FB8 C;  4J9Z B;  3UM7 A;  2ZXW C;  5CBG A;  5CBH A;  3SPC A;  5EBM C;  2X6A A;  5BZB A;  2Q6A A;  3JYC A;  2JK5 C;  3X2Q C;  2DYR C;  1XL6 A;  3ABL C;  4EKW A;  1OCZ C;  4RAI A;  4LBE C;  4QE9 A;  3AG3 C;  1XL4 A;  1ZWI C;  3R65 A;  5EK0 A;  3K03 A;  4XDJ A;  2A9H A;  3EFF K;  4GX0 A;  4MS2 A;  5B1B C;  4QNH B;  4BW5 A;  1KKD A;  4RUE A;  3ASO C;  2WLN A;  2WLL A;  3OUF A;  1R3K C;  1S5H C;  2ATK C;  3IGA C;  3RVY A;  3TCU A;  4MTF A;  4CBC A;  3K0D A;  4WFG A;  4MW8 A;  4HYO A;  4JTA B;  1J95 A;  2X6C A;  3AG4 C;  5J9P C;  4R8C A;  1BL8 A;  3SPH A;  4X88 A;  4MW3 A;  4PA3 A;  2Q69 A;  2KB1 A;  2BOB C;  2Q67 A;  3K0G A;  4G27 B;  4MVU A;  4XDL A;  3K06 A;  4PA4 A;  3RVZ A;  3OR7 C;  1ORQ C;  4MVS A;  3LDC A;  4PDM A;  4OXS A;  3RBZ A;  2EIN C;  4R7C A;  2HG5 C;  2WLH A;  3STZ C;  3WG7 C;  3AG2 C;  1K4D C;  4PDR A;  4F4L A;  1M56 C;  3AG1 C;  3F7Y C;  2Q68 A;  2ITC C;  2DWE C;  2QKS A;  2BOC C;  2ITD C;  2WLI A;  3ABK C;  3E8H A;  4PDV A;  4TWK A;  3T4Z A;  3SPG A;  3FB6 C;  3F5W C;  4MTO A;  2EIL C;  5KUM A;  2WLI B;  1V55 C;  3E8B A;  3HPL C;  4P9P A;  1P7B A;  5B3S C;  3T4D A;  2HVK C;  2WLM A;  3K04 A;  3VOU A;  5EBL C;  5KUK A;  1R3I C;  1QLE C;  4H37 A;  1R3L C;  1R3J C;  3LDD A;  2P7T C;  3E89 A;  3SPI A;  4ZBM A;  4JTC B;  3FB5 C;  2A79 B;  4LCU C;  4PA6 A;  4PDL A;  4RO2 A;  5IY5 C;  4PA7 A;  2QTO A;  2R9R B;  3LUT B;  4I9W A;  2HFE C;  2EIJ C;  4GX2 A;  3GB7 C;  3E8G A;  2Y69 C;  4HZ3 A;  3SJQ C;  5EC2 C;  3LNM B;  2ZD9 A;  1OCO C;  4MVR A;  3UKM A;  4X89 A;  3SPJ A;  1M57 C;  3STL C;  2IH3 C;  3LDE A;  4GX5 A;  4R6Z A;  4DXW A;  3ZJZ A;  2H8P C;  1JVM A;  3ABM C;  3E8F A;  1V54 C;  4J9Y B;  4JTD B;  3K08 A;  2EIM C;  3BEH A;  4MSW C;  2X6B A;  3T1C A;  2HVJ C;  4PA9 A;  4MVO A;  4P9O A;  4R50 A;  3SYP A;  3TET A;  3PJS K;  1G4Y B;  3IFX A;  3OR6 C;  4UUJ C;  2EIK C;  3RW0 A;  4MTG A;  4G28 B;  2YEV A;  4MVZ A;  2IH1 C;  4P30 A;  5EBW C;  3OUS A;  5CBF A;  5E1A C;  5EC1 C;  4MVM A;  2AHZ A;  3F7V C;  4KFM A;  2WLK A;  4QE7 A;  3T2M A;  2DWD C;  2NLJ C;  4WFF A;  4XDK A;  3SYQ A;  3KG2 A;  4WFH A;  5B1A C; 
#chains in the Genus database with same CATH topology
 3P3N A;  1FXH A;  1Y74 B;  4DR4 B;  4P2Z A;  1Z5V A;  2ZIN A;  4JV5 B;  2IW5 A;  1Q6I A;  1OCC C;  3IC7 A;  4X1I A;  2UUA B;  1SQG A;  2CTQ A;  2YI9 A;  2AW9 A;  4JAV A;  1YSC A;  4DR2 B;  4LF4 O;  3WFV A;  2DYR C;  1H2L A;  4IHJ A;  1EZJ A;  1BHA A;  2Z5U A;  1NR7 A;  2ZCE A;  4WFB V;  4MS2 A;  4GZR B;  4BW5 A;  4RUE A;  1IXB A;  1K33 A;  2EBO A;  5J2T A;  4I0X B;  2ZIO A;  3OFN G;  2Y4U A;  4N21 A;  4ZHQ B;  4PHZ A;  1YHQ V;  3UT5 A;  1HNX O;  4LF5 O;  4DRX B;  1US6 A;  2YXL A;  3H1J H;  1YVW A;  2YIB D;  4XDL A;  3AG2 B;  2HR3 A;  4YHH B;  3U10 A;  2OTL V;  3MAQ A;  4K35 A;  3K3W A;  3P30 A;  4JI6 B;  3UQ8 A;  3WB2 A;  3GWK C;  3S3X A;  5KUM A;  4B3M O;  1BQ0 A;  1H38 A;  1YIT V;  3C90 A;  1GTO A;  1V55 C;  3SR2 C;  3CE2 A;  5BXZ A;  5EYP B;  3K04 A;  2BCC H;  3O9O A;  1URF A;  5CMU A;  1AP6 A;  1XRE A;  3SPI A;  4YY3 O;  1OCO B;  1KBH A;  2EIJ C;  2Y69 C;  3SJQ C;  1IUR A;  4DV1 B;  5ITZ A;  4IL6 Z;  3KCX A;  3E8F A;  3KKY A;  4JTD B;  1Z2G A;  5CA3 A;  3TET A;  4IIJ B;  3H1I H;  1YEW A;  5EBW C;  2OYQ A;  1ZL8 A;  4KFM A;  1DGS A;  4WFH A;  4X65 O;  4YJ2 B;  5KHI A;  1FJG B;  3ZHT A;  2F4V O;  4LP8 A;  3JCZ A;  4LFB O;  1COW G;  3N2G B;  2HP8 A;  1L8D A;  1Y4M A;  4DW0 A;  2VQE B;  1MNG A;  1ZAU A;  1YJW V;  1OCZ C;  1XL4 A;  4EFB A;  1RPR A;  3ZX6 A;  3HKE B;  3QG5 A;  1K73 W;  1KMI Z;  2GTS A;  3QTC A;  2ZR2 A;  4K0K B;  3TCU A;  2IM9 A;  2IBZ H;  3LSQ A;  4JI0 B;  1J95 A;  2V4D A;  4TUY A;  1XUQ A;  4GYC B;  2Q73 A;  5BMV B;  2HEP A;  5LHH A;  2R9A A;  1GRJ A;  2QE7 G;  4J7Z A;  3HKB A;  3K5L A;  4EFE A;  3RBZ A;  2ZDI A;  1FXK A;  2V1D A;  4J7K A;  5LHI A;  5B1A C;  3RYH A;  1HNX B;  3OTO O;  3GWO A;  3RWR D;  2BTQ A;  4I4T B;  2YIB A;  4P9P A;  3B09 A;  4LFC B;  3SDL A;  5LMN B;  2UU9 O;  1F7Y A;  4H37 A;  1R3L C;  5EIB C;  1I7F A;  2RCV A;  2WWW A;  3L72 H;  1WA8 A;  2HFE C;  4J80 A;  4X66 B;  3STL C;  2Q0O C;  4OPA A;  3JSL A;  3LDE A;  5FNV B;  3W7X A;  3CCU V;  2YI8 A;  3JAS B;  3QO5 A;  4UVB A;  4MVO A;  2ZM6 O;  1QVG U;  4O4L A;  5C8Y B;  2YUA A;  1IBM B;  1ZSP A;  5LXT B;  4O2B A;  1S77 D;  2DYS C;  4RUF A;  2QGN A;  4X1K A;  5IYZ A;  2ZXW B;  1JR9 A;  5GON B;  1NTK H;  4TQD A;  4BIO A;  2KG7 A;  3K58 A;  1J5E O;  3X2Q B;  1OV9 A;  1VP7 A;  1XNR B;  4X65 B;  4X1I B;  2OIE A;  3CCV V;  5AG2 A;  1EFR G;  5CB4 A;  5JJN B;  4LFB B;  3WB0 A;  4IHJ B;  2QEX V;  4B3S O;  3OT7 A;  2OTJ V;  2UXC O;  2ATK C;  3H9V A;  4F6R A;  4CBC A;  5IWA B;  3VBB A;  2BE3 A;  4DV7 B;  5J2T B;  2M6Y A;  3OEE G;  4ZOL A;  1K3E A;  3UT5 B;  4FLU A;  4DV2 O;  2RJZ A;  4OXS A;  2EIN C;  4R7C A;  3NXS A;  4I7Z B;  1Q6H A;  3AG1 C;  2PF4 E;  5B3S B;  1EN5 A;  4GKK B;  5H6Q A;  1BCC H;  5KA5 A;  4H13 B;  1RSO B;  3CX5 F;  3JAT A;  3FB5 C;  4JYA O;  1M9N A;  1RM1 B;  3BVO A;  3OTO B;  3L70 H;  2P6J A;  2GUZ B;  3CCS V;  2EIM C;  4JI8 O;  4NB5 A;  2FL4 A;  2Q4P A;  5IYB O;  4CC5 A;  5LP6 C;  2JEU A;  1PV0 A;  4UUJ C;  2N74 A;  3CRA A;  2Q9L A;  2YDE A;  1P4R A;  3BCC H;  4I50 A;  3KG2 A;  3CEI A;  1P84 F;  2EUL A;  3JD1 A;  1GN3 A;  3SYA A;  1KU9 A;  2ZM6 B;  1VF6 A;  4FPP A;  5F2V O;  1HDJ A;  4D7T A;  2JJ2 G;  3UM7 A;  3TXS A;  1NTZ H;  1S5L Z;  3M7M X;  1V9P A;  1CXZ B;  4QE9 A;  1ZWI C;  3CWB H;  1XMO B;  2JIZ G;  3ZHS A;  3N27 A;  1J5E B;  1FXV A;  4LFA B;  4PJ0 Z;  1XNQ O;  2UUB O;  1AB3 A;  1F4M A;  4X64 O;  4DV5 B;  4TUY B;  2RQ6 A;  3IAY A;  1DF5 A;  2B1G A;  2WPD G;  1D5A A;  3HB3 B;  1SQQ H;  3HKB B;  2EJR A;  4TOI A;  5KA6 A;  1FXK B;  4CH5 A;  4ZHQ A;  3RYH B;  1G6U A;  1IXM A;  1P7B A;  3VOU A;  5BY1 A;  2DQ0 A;  4LCU C;  4PD4 F;  1SQX H;  3G71 V;  5CN0 A;  2QTO A;  3VQW A;  4DV4 B;  1N33 O;  5LBQ A;  1GN6 A;  4I9W A;  5EZY B;  1NI8 A;  3BY6 A;  4TV8 A;  5LMU O;  3SPJ A;  3W7U A;  3JD3 A;  5L3B A;  5DEC A;  1QQC A;  2R70 A;  5EYP A;  1NS1 A;  4A5U B;  3QO8 A;  4G2K A;  2X6B A;  1G8M A;  2W6J G;  4NKG B;  3PN1 A;  5L3C A;  1SA0 A;  2VQF O;  2YSU B;  1PP9 H;  1DLB A;  1BQZ A;  2EIK C;  3RGB A;  2YEV A;  5DM6 V;  4BIZ A;  3G67 A;  4MVM A;  3QVN A;  2AHZ A;  4O4L B;  4WFF A;  5KAI Z;  1HNW O;  3TGU H;  4JI8 B;  3ZRS A;  1IZ3 A;  3CRM A;  3SYO A;  1K8A W;  1OCR B;  4O2B B;  1XHZ A;  2XAH A;  2Q7H A;  5LA6 A;  3TXQ A;  2UXD B;  1H2N A;  1U96 A;  4X1K B;  3BA9 A;  2X6A A;  4QJF B;  4DV3 B;  3H1L H;  3JYC A;  2JK5 C;  3G4S V;  5B1B B;  1YDX A;  3ABL C;  1HNZ O;  2KKW A;  4RAI A;  3CB2 A;  3AG3 C;  4KP4 A;  4LWS A;  2OT5 A;  3IJ4 A;  4CS4 A;  4XDJ A;  4YJ2 A;  2R72 A;  3EFF K;  1LUV A;  4JF3 A;  1KD1 W;  4CH6 A;  5CB4 B;  2PUS A;  1KKC A;  3P32 A;  2ZKO A;  2V7Q G;  5J2U B;  4JTA B;  1N0N A;  1FS0 G;  3J7A U;  4FIP C;  4F6R B;  4NVP A;  4WBN A;  1FKA O;  2Q69 A;  1D5N A;  2EIJ B;  3K0G A;  5KAF Z;  3TK1 A;  3D3I A;  1M56 B;  1XNQ B;  4DR7 O;  4ZOL B;  3HKE A;  1T5E A;  3JD2 A;  3DTU B;  4KHP O;  3D3Q A;  2Q68 A;  4Q6G A;  3ZED A;  3BAA A;  5JH7 A;  4MT8 A;  2LFS A;  3F5W C;  3ZIA G;  3T1H B;  1EZV H;  4MTO A;  2E3C A;  4X64 B;  4GLX A;  1N8R W;  4U7N A;  1K5S A;  2FB5 A;  5BMV A;  2JEX A;  2Q8V A;  1CEZ A;  2QDO A;  1WNS A;  4ZBM A;  1R6T A;  1OZ0 A;  4GKJ O;  4GUN A;  1GMG A;  4J42 A;  1K34 A;  1VF7 A;  4AIL C;  3CCQ V;  3SJB C;  1YCI A;  3L71 H;  5D5P A;  1JX9 A;  3ABM B;  3CHX A;  3SJA C;  4LF6 O;  1M4U A;  1V54 C;  4DR6 O;  1S5J A;  2CGN A;  1YI2 V;  1XDC A;  1AR4 A;  1LR1 A;  1ZUQ A;  4FM1 A;  1N32 O;  1F51 A;  3A0R A;  3T2M A;  2QM4 A;  1P7G A;  2VS0 A;  5FNV A;  2P4V A;  2X0L A;  4ZI7 B;  4JYC A;  4DK0 A;  2WLJ A;  3ZHQ A;  2VQF B;  1KUQ A;  1K92 A;  3OGC C;  5JCO A;  4WCE V;  2YXY A;  1Q43 A;  1KYO F;  5KHH A;  1HR0 O;  5B1A B;  1WB8 A;  1XL6 A;  1D2D A;  1H2S B;  2VWJ A;  1SC5 B;  1XBL A;  3MD0 A;  2LGQ A;  4NXN O;  1S5H C;  3OEH G;  5GON A;  3RYC A;  2CAZ C;  4HYO A;  2IJH A;  4LH6 A;  1YJN V;  5J9P C;  1HNZ B;  4X88 A;  3DXR A;  3D36 C;  2YIA A;  4FLX A;  1O9H A;  1L0L H;  3K06 A;  1ORQ C;  3CC7 V;  5LGN A;  5B1N A;  1BT8 A;  3ABK C;  4PDV A;  1EN4 A;  1QCE A;  1HW7 A;  3E8B A;  4Z2W A;  1VQ5 V;  3AEI A;  2D3O W;  4JAU A;  3OGI B;  3AK1 A;  4PA6 A;  4FLZ A;  3JAW A;  2N04 A;  3JAK B;  2JS5 A;  2DYS B;  3ZS8 C;  1SQP H;  1AJP A;  4PEL A;  3LNM B;  4F6E A;  2CTW A;  4X89 A;  2G38 A;  4ZKI A;  4TV8 B;  4E2L A;  2LJ2 A;  3U0Z A;  1RSO A;  4DR1 B;  2DQ3 A;  4X1Y B;  3SJC C;  5B66 Z;  2IH1 C;  4UFZ A;  1SA0 B;  4FZ1 A;  4K8X A;  1FPO A;  2WLK A;  2YEV B;  4QGP A;  1PPJ H;  1N0J A;  3T1Y O;  1NZ6 A;  3RYF B;  1MAB G;  4DR6 B;  2GUZ A;  3OW2 U;  4JI7 B;  3QF7 A;  3E83 A;  4H33 A;  4GX1 A;  2OCC C;  4CC6 A;  3FFQ A;  3SPC A;  5LA6 B;  4QIW F;  3DC5 A;  3H1H H;  1KEC A;  1IBK O;  4LWS B;  3ASO C;  3BAB A;  1S0V A;  3K9A A;  3K0D A;  2P5O A;  4AQY O;  4O2A A;  5LOV A;  4UCR A;  4WBN B;  1TA8 A;  2YID A;  1MOF A;  4CS3 A;  1Y76 A;  5IJ0 B;  1XOU A;  3E8H A;  5LL6 Y;  2ITD C;  2WLI A;  1NH2 D;  1VQL V;  3E2E A;  1OJH A;  2ARH A;  5JH7 B;  2Y0I A;  1K9M W;  5BR8 O;  4LF4 B;  2WSS G;  3ZRW A;  2QJ1 A;  4FM2 A;  1B04 A;  1QLE C;  1R3I C;  2PI5 A;  2MK3 A;  1TUB A;  4JTC B;  4RO2 A;  4NTY A;  4PI0 A;  2FYU H;  5JJJ B;  2ZD9 A;  3CC2 V;  2DJV A;  3A0H Z;  2FML A;  4GX5 A;  4DXW A;  4LF5 B;  2QKC A;  4O4H A;  1RFY A;  4EB6 B;  1ZLZ A;  3FYI B;  4I55 B;  1B06 A;  3W7S A;  2D2C B;  4PI2 A;  5EZY A;  4O4I A;  4IYH A;  5E1A C;  1JQ0 A;  4RQF A;  2NLJ C;  3ZMT A;  4B3M B;  1HWY A;  1LUW A;  3CMA V;  1VQK V;  4B3R O;  2Q5Z A;  2ZE8 A;  3SYC A;  4WFE A;  1TGO A;  2WLL B;  4YY3 B;  4LNU A;  3APQ A;  5L3G A;  2Q0A A;  3FB8 C;  1XQ8 A;  1NT2 B;  1VQ6 V;  4L8J A;  1L0N H;  3UO2 A;  1I5X A;  2UXB O;  2IJK A;  1Q5O A;  1JPX A;  2QWO B;  5JWP A;  4K8Z A;  1K5Q A;  2JS3 A;  1R1B A;  1XEQ A;  3SPH A;  3RYC B;  2P67 A;  5HFL A;  5EIB D;  5TIS Z;  1BMF G;  5KMG A;  3BPZ A;  3DXR B;  3C3T A;  3A0B Z;  1ARO P;  2F4V B;  2QKA A;  1IX9 A;  3K57 A;  4UVA A;  3AG2 C;  4X20 B;  4C7U A;  4CH4 A;  4B08 A;  5J2U A;  4H0L B;  3CJH A;  4NR1 A;  3KCY A;  1Y6X A;  2EIK B;  3T4D A;  5GW7 A;  4JAS A;  5KUK A;  2ZE5 A;  4MTX A;  2HJD A;  3E89 A;  4FM0 A;  3WU2 Z;  2VRZ A;  1NKD A;  4PA7 A;  1BE3 H;  3LSS A;  3JAW B;  3B2E E;  4HBN A;  3ETG A;  1OCO C;  1N34 O;  1KB9 F;  4R6Z A;  2Z3Y A;  3EXA A;  1JFF A;  3OMN B;  5FLX N;  3ABL B;  3G80 A;  3MDS A;  1A32 A;  1GH6 A;  1JCH A;  4MTG A;  2IU3 A;  4P30 A;  1E1Q G;  2WA4 A;  4DUZ O;  2QA4 V;  2WA3 A;  3L75 H;  1E79 G;  4EEQ A;  4GCZ A;  2UU9 B;  1EBO A;  3ZCC A;  3CCR V;  2FKX A;  2YS8 A;  1QBZ A;  4BIU A;  4DV0 O;  4IT5 A;  3OAA G;  2Q6A A;  2A3Q A;  4BR6 A;  2AZ0 A;  4B3R B;  4LBE C;  3R65 A;  4LH7 A;  1AVM A;  2EX3 A;  3K03 A;  4ZI7 A;  1VQM V;  1GO3 F;  3JSN A;  1GAX A;  4OX9 O;  4U3F H;  2YIC A;  3AG4 B;  1GM8 A;  1UPG A;  3LNN A;  1F23 A;  2W6I G;  3OMI B;  1QR8 A;  4WF9 V;  1BL8 A;  2HHH O;  2QM7 A;  1PM9 A;  4ABM A;  1YTF D;  1EN6 A;  2XAG A;  4JZ2 A;  1WJZ A;  3RVZ A;  5LGT A;  4O2A B;  5LOV B;  1R6N A;  1VAR A;  3F7Y C;  1V54 B;  1Y76 B;  4UB6 Z;  1RPO A;  3K79 A;  2EIL C;  4H44 B;  2IU0 A;  2YXH A;  4YJ3 A;  2WLI B;  2EJ7 A;  4JYB A;  3FKS G;  2PZS A;  3G6E V;  1QNM A;  4TV9 B;  3ZRW B;  1UFI A;  3CCJ V;  1QLN A;  1R6K A;  4B3S B;  1TUB B;  2XAF A;  4JI3 O;  2UXC B;  1AI7 A;  4MVR A;  4QPJ A;  3F5T A;  3BEH A;  4MSW C;  4JI4 O;  1SQF A;  3M8A A;  4O4H B;  4DV2 B;  2CTP A;  3K9S A;  3JAK A;  1N34 B;  3CD6 V;  4NXM O;  2QWQ B;  4DUY O;  1MMM A;  2XND G;  4JI2 O;  2DWD C;  4O4I B;  4KXR A;  1LNQ A;  5DN6 G;  3RFR A;  2H94 A;  2JJ1 G;  3K59 A;  4HAM A;  1OCC B;  5JQG B;  4X1Y A;  3E86 A;  1RP3 B;  5IJ9 A;  4JYA B;  5A2Q N;  1EM1 A;  2HJF C;  2E5L O;  1SKV A;  4KL1 A;  1BSM A;  2LO1 A;  1L1F A;  5IE9 A;  2DYR B;  2ZXW C;  4LNU B;  4W4L A;  1SZX A;  4AHC A;  2OCH A;  3X2Q C;  1P49 A;  1YZB A;  3RYF A;  1H2M A;  2L6L A;  3B77 A;  5EK0 A;  1S72 V;  2PI4 A;  2A9H A;  1MZF A;  4FK5 C;  4LF9 O;  3ZN1 A;  3VQX A;  1XMQ O;  2ADQ B;  1FFX A;  5IYD O;  1G1X B;  4B7E A;  4UVC A;  1SES A;  2X6C A;  5IT9 N;  4R8C A;  4YIO A;  1THZ A;  4X9Q A;  4MW3 A;  1GKF A;  1W0J G;  2Q67 A;  3IC9 A;  4MVS A;  3CCM V;  4LF7 O;  1FAF A;  5GTI Z;  5KMG B;  3WG7 C;  2Z0A A;  1PNM A;  1H8E G;  2Q7G A;  2PY5 A;  2QKS A;  3BA8 A;  1V55 B;  4J7J A;  3BRC A;  4L87 A;  2QM8 A;  2RMK B;  5B3S C;  1TAE A;  2HVK C;  1M5I A;  2RNB A;  3H01 A;  3CJH B;  1KP2 A;  4FFB A;  4K3A A;  4HNA A;  1TUE B;  4JV5 O;  4FLT A;  4UCS A;  4RWU A;  3DGE A;  5IJ0 A;  2Y69 B;  2PTM A;  3CRC A;  2UUB B;  4CS2 A;  4FVM A;  4DR2 O;  1RM1 C;  1NH2 B;  2KSD A;  3VQY A;  3I55 V;  5LP6 A;  3ZMS A;  1Y67 A;  2OCC B;  1B6Q A;  3K08 A;  3MHH C;  1WAZ A;  4JPR A;  3CS5 A;  1JFF B;  1SF9 A;  3OE7 G;  1G4Y B;  2OIG A;  5CBF A;  2CH7 B;  2XT9 A;  3AG7 A;  1BS3 A;  1NR1 A;  4MVQ A;  4EB6 A;  3CXC U;  2AHY A;  1PL4 A;  4I55 A;  5LYJ B;  1NBM G;  5JJE B;  4JI6 O;  3DC6 A;  2EZP A;  4DUY B;  1N33 B;  4FLV A;  5CA1 A;  4JI2 B;  2F93 B;  1OCZ B;  2OWO A;  1PNK A;  2NR5 A;  3A2F A;  2N05 A;  5LMU B;  3JAL A;  1FD9 A;  2L35 A;  3G6B A;  3E35 A;  4QNH B;  4B7K A;  1KKD A;  2JGU A;  2AXT Z;  3ZHR A;  2WLL A;  3OUF A;  3RVY A;  1QLE B;  1ENV A;  2NN4 A;  2MW2 B;  2JVD A;  3GVM A;  1HNW B;  4UV9 A;  4LF9 B;  4E4E A;  3JD0 A;  3ZMV A;  4ZIB A;  2XTA A;  1XMQ B;  2JRI A;  4TWK A;  5FL7 G;  3CXH F;  1GN4 A;  2ZDI C;  1FXK C;  2JGD B;  3O65 A;  4TQF A;  5L3F A;  1FJG O;  1KC8 W;  4YJ3 B;  3LDD A;  4D7S A;  1YXB A;  5KLV H;  4PDL A;  4IGG A;  4NTW A;  4FLW A;  3HR0 A;  4X20 A;  2R9R B;  3LUT B;  1AR5 A;  2CGO A;  2VQE O;  4DYL A;  5EC2 C;  2B1I A;  1H8H G;  1VQ8 V;  2W0X A;  4LR3 A;  1Q82 W;  1M1K W;  1IDS A;  1AI4 A;  4DR7 B;  4K0K O;  2QSA A;  3SYP A;  2DN9 A;  4FJC C;  4JI0 O;  3RW0 A;  4G28 B;  5GTH Z;  4KHP B;  3L9D A;  4JI1 O;  4XDK A;  3OMA B;  1ZTE A;  4X8A A;  3TJT A;  4BAY A;  2ZIM A;  2UXX A;  4CZZ A;  3RT3 C;  3VQV A;  2F1M A;  3ASN C;  4GKJ B;  4O4J A;  1OCR C;  1MSD A;  2RDC A;  5IJ9 B;  1H2G A;  5EBM C;  5BZB A;  4JYY A;  4NTX A;  1AJQ A;  4LFC O;  5LMN O;  3ETD A;  4EKW A;  5B1B C;  4LF6 B;  4DR5 O;  4JZG A;  2WLN A;  1R3K C;  2BTO A;  3P3P A;  4MW8 A;  4X66 O;  5K1P A;  4KUM A;  1N32 B;  3MHS C;  1FFX B;  2P4K A;  1NU1 H;  2EIN B;  4DO2 A;  2LQT A;  1S3J A;  1JJ2 U;  3AG1 B;  2UXN A;  3LDC A;  3STZ C;  4LC1 A;  1M56 C;  1IBM O;  2PGG A;  4UXN A;  3BFR A;  1MG1 A;  4X62 O;  3SGI A;  2E76 B;  1HR0 B;  3HPL C;  3NR7 A;  1YTF B;  3HKC A;  5EBL C;  1GK9 A;  3BHP A;  4UCT A;  1DTO A;  4FFB B;  5IY5 C;  1WP7 A;  4HNA B;  2LW7 A;  4B3T O;  2P90 A;  4RQE A;  1XNR O;  1Q7Y W;  4NXN B;  3E8G A;  2E74 B;  3ETQ A;  3HKD B;  3S3W A;  1JA8 A;  3UKM A;  2F43 G;  1M57 C;  3CCE V;  2EIM B;  3N2K A;  5KX5 A;  3ABM C;  4OPH A;  5LP6 B;  4XBF A;  3CC4 V;  4TV9 A;  2IJI A;  2M7W A;  2HVJ C;  4JGS A;  5IWA O;  4P9O A;  4DV7 O;  1VF5 B;  3OR6 C;  2UUC O;  2ZE7 A;  5LHG A;  5K1X A;  1TVK A;  3CCL V;  3L74 H;  5KHJ A;  1XI1 A;  3SYQ A;  2ZNI A;  1PL0 A;  2ILM A;  1Q6U A;  1K4C C;  2HLD G;  1JOY A;  1CPY A;  2XOK G;  4UCV A;  1PNL A;  2AGA A;  5CBG A;  5CBH A;  4GKK O;  2GV9 A;  4JI1 B;  1VF6 C;  5JVD B;  5CA1 B;  5L3E A;  2EIL B;  4GX0 A;  1Z5W A;  3JAL B;  1F4N A;  3WB1 A;  5JQG A;  3D36 A;  4WFA V;  5H9C A;  1N36 O;  1NQT A;  5H6R A;  3ABU A;  3THO A;  3DSQ A;  2BOB C;  4DR5 B;  3T1Y B;  2F95 B;  4PA4 A;  3ETE A;  1SS3 A;  2VWK A;  4PDM A;  2WLH A;  1MZE A;  4F4L A;  3FX7 A;  2ITC C;  5KHG A;  3T4Z A;  2BOC C;  1GN2 A;  3SPG A;  1DF4 A;  2CDY A;  3ZMU A;  2Y0P A;  1W59 A;  3W7W A;  1Q8I A;  2LGW A;  1R3J C;  1AI5 A;  1I5Y A;  3LSU A;  2GSM B;  1IBK B;  2Y4T A;  3B8N A;  2PYJ A;  4GX2 A;  1YF2 A;  4X62 B;  1E1R G;  1AP5 A;  5DED A;  2A7W A;  3ZRV A;  4JAA A;  3ZRX A;  1XMO O;  3EHB B;  1SRY A;  2GHY A;  4AQY B;  4PV1 B;  1IVS A;  4B3T B;  4LFA O;  2CE4 A;  1WN7 A;  4UCO A;  3A8T A;  4U3J A;  5IYC O;  4R50 A;  3IFX A;  1SQV H;  1VIB A;  5EC1 C;  1WB7 A;  4DW1 A;  4DV5 O;  3R66 A;  5CA0 A;  1OHH G;  5BR8 B;  2ZR3 A;  2K1E A;  1FFT B;  4J11 A;  4IYI A;  2BSK A;  3KZI Z;  2UUC B;  2A0L A;  1Q90 D;  2E75 B;  3ZN0 A;  2QWP B;  4YXW G;  3UO3 A;  4AI8 A;  2XAJ A;  1S76 D;  3AG3 B;  4O4J B;  3WG7 B;  3E22 A;  2CH7 A;  3OM3 B;  1O9G A;  3K5M A;  2QTS A;  1W2B U;  1I94 O;  1IBL O;  1VQP V;  4YIP A;  1VQN V;  1ZX3 A;  2DE0 X;  4ICG A;  5LGU A;  1Q86 W;  2CTR A;  4DV4 O;  1WP8 A;  5LYJ A;  3QNE A;  4J10 A;  3IGA C;  1VQ9 V;  4MTF A;  1WLE A;  1XIL A;  4QPK A;  1NVP B;  1R73 A;  2ZT9 B;  1SZT A;  2LP7 A;  5H2F Z;  1VEW A;  3FAV A;  2YC0 A;  4MVU A;  2ETN A;  5HFM A;  3I56 V;  1N4C A;  1Q81 W;  1N36 B;  4TT3 G;  2XAS A;  3RYI A;  2QR4 A;  2NNU A;  5IDJ A;  3FB6 C;  4DV6 O;  2GDS A;  5ITZ B;  2H3O A;  3RN4 A;  3H1K H;  2WLM A;  2UXB B;  2P7T C;  3HKC B;  1CP9 A;  3Q4H A;  4FZ0 A;  3ZMZ A;  2UXD O;  5B5E Z;  4TSF G;  4UCU A;  1FYJ A;  1ZL8 B;  4DV3 O;  2GTA A;  2KQX A;  3JAR A;  2P22 C;  2LW1 A;  3ML0 A;  1BHB A;  1NTM H;  1WPX A;  2IH3 C;  2JGD A;  1X4T A;  2H8P C;  2X7R B;  3M99 B;  3JCU Z;  3N2K B;  5KX5 B;  1KQS U;  1JMK C;  4U7O A;  4GT1 A;  1U97 A;  3PJS K;  2WAM A;  2DOS A;  4DK1 A;  4W4K A;  2CK3 G;  4QE7 A;  2O57 A;  1Y74 A;  2ZE6 A;  2XUM A;  1TVK B;  4N23 A;  4NYK A;  4BWA A;  1AI6 A;  4FLY A;  1W0K G;  2ODM A;  3T1H O;  3ABT A;  2RN9 A;  2Y48 A;  1X59 A;  4I9Q A;  5C93 A;  1I08 A;  1AR1 B;  3CRR A;  5D5Q A;  1BGY H;  1DK1 A;  5JCO C;  4UB8 Z;  3D8C A;  5KHK A;  1SQB H;  4I0X A;  1K7D A;  4D6T H;  4WFG A;  2XHB A;  1GM7 A;  4DRX A;  3ZHV A;  2BTQ B;  3EVK A;  1I94 B;  1IBL B;  4DUZ B;  2XAQ A;  3L73 H;  4LF8 O;  3ABK B;  3CP1 A;  3CYO A;  1K4D C;  4DR3 O;  1WA8 B;  1QHT A;  4I5S A;  4JI5 O;  4DV0 B;  1ROP A;  2CUG A;  4Z1V A;  3JAM N;  1SET A;  1YIJ V;  3QO7 A;  2JDI G;  3OTF A;  4DV6 B;  3K5N A;  4OX9 B;  2LFR A;  4HZ3 A;  1Q3E A;  2C2A A;  2ZNJ A;  2ADP A;  3B8M A;  3ASN B;  1M90 W;  3U11 A;  3ZJZ A;  2HHH B;  1QVF U;  4BW9 A;  4IIJ A;  5FPR A;  1VQO V;  3T1C A;  4FMT A;  5IYZ B;  4DR4 O;  2B9Z A;  3B4S A;  4PA9 A;  2KG7 B;  2DMX A;  4Q20 A;  3CRQ A;  3I5D A;  4U3J B;  4ASU G;  3OUS A;  4FFK A;  1AIL A;  2F66 C;  3F7V C;  1QR9 A;  3HKD A;  2UUA O;  2EZO A;  2F23 A;  4OGQ B;  1HP8 A;  4UV8 A;  5CA0 B;  1BZK A;  3N2G A;  3AK3 A;  2P06 A;  3FYE B;  3FB7 C;  2W0F C;  1QU7 A;  2K9P A;  2BSK B;  2QWR B;  3CSX A;  4J9Z B;  5H5N A;  4JI3 B;  1PD3 A;  3K5O A;  2A06 H;  2HKO A;  1K97 A;  3E22 B;  3ASO B;  3W7T A;  4CH3 A;  4JI4 B;  4YHH O;  1MA1 A;  3UCS C;  1YJ9 V;  3AG4 C;  2DW4 A;  5IY5 B;  3J80 N;  4NXM B;  3J81 N;  4Z1M G;  4PA3 A;  5JVD A;  2KB1 A;  3ICX A;  2PYL A;  2GBO A;  4DR1 O;  4G27 B;  2R9I A;  3FD9 A;  1NVP D;  1XHX A;  2FTK A;  1GM9 A;  3JAT B;  3OR7 C;  1M57 B;  2ZQM A;  2HG5 C;  3FAV B;  4PDR A;  2DWE C;  1SER A;  4I4T A;  3ZHU A;  1M93 A;  2QWN B;  2E5L B;  3CPW U;  3B40 A;  3RYI B;  4J41 A;  4LF8 B;  1UJW B;  3JD4 A;  4JI7 O;  4DV1 O;  1NJI W;  5E79 Z;  1WPB A;  1VMG A;  4DR3 B;  2IJJ A;  1PKX A;  2A79 B;  3CME V;  4JI5 B;  3Q4H B;  5B1O A;  3GB7 C;  1I0H A;  4I50 B;  3AK2 A;  1KP3 A;  3JAR B;  3OD4 A;  1JVM A;  3JAS A;  4J9Y B;  1VQ7 V;  5A9G A;  3APO A;  1VQ4 V;  1B3Q A;  1MSW D;  4LF7 B;  5C8Y A;  1AJN A;  1H2K A;  5FPO A;  5LXT A;  4MVZ A;  2B5U A;  1Y66 A;  2AZ2 A;  1JJO A;  3ZBH A;  5L3D A;  3C3S A;  2Q7E A; 
#chains in the Genus database with same CATH homology
 4GCZ A;  1FXH A;  3ZRS A;  3SYO A;  1K8A W;  1EBO A;  1K4C C;  1OCR B;  4P2Z A;  3ZCC A;  3CCR V;  2HLD G;  2XAH A;  1JOY A;  1CPY A;  2IW5 A;  1OCC C;  2XOK G;  3IC7 A;  1PNL A;  5CBG A;  1QBZ A;  4BIU A;  5CBH A;  3OAA G;  2X6A A;  4JAV A;  2Q6A A;  1YSC A;  4QJF B;  3JYC A;  2JK5 C;  3WFV A;  3G4S V;  2DYR C;  5B1B B;  3ABL C;  4RAI A;  4LBE C;  3AG3 C;  3R65 A;  1EZJ A;  4KP4 A;  1BHA A;  2OT5 A;  2Z5U A;  1NR7 A;  3K03 A;  4XDJ A;  5L3E A;  2EIL B;  3EFF K;  4GX0 A;  4MS2 A;  4WFB V;  4BW5 A;  1VQM V;  4JF3 A;  1GO3 F;  1KD1 W;  1F4N A;  4RUE A;  1K33 A;  2EBO A;  3D36 A;  4WFA V;  5H9C A;  3AG4 B;  1NQT A;  3OFN G;  3P32 A;  2V7Q G;  1GM8 A;  4N21 A;  1F23 A;  2W6I G;  4JTA B;  5H6R A;  3OMI B;  3ABU A;  1FS0 G;  4FIP C;  1QR8 A;  1YHQ V;  4WF9 V;  1BL8 A;  2QM7 A;  2Q69 A;  1YTF D;  2BOB C;  2EIJ B;  3K0G A;  2XAG A;  3TK1 A;  4XDL A;  3AG2 B;  2HR3 A;  3ETE A;  4PA4 A;  3D3I A;  1M56 B;  3RVZ A;  5LGT A;  2OTL V;  4PDM A;  2WLH A;  3JD2 A;  3DTU B;  4F4L A;  1R6N A;  3K3W A;  3P30 A;  3F7Y C;  2ITC C;  2Q68 A;  1V54 B;  3T4Z A;  2BOC C;  3SPG A;  4MT8 A;  1DF4 A;  2LFS A;  1RPO A;  3F5W C;  3K79 A;  4MTO A;  2EIL C;  3ZIA G;  5KUM A;  3ZMU A;  1N8R W;  4U7N A;  2IU0 A;  1K5S A;  1H38 A;  1YIT V;  2WLI B;  1GTO A;  1V55 C;  2JEX A;  1CEZ A;  4JYB A;  3W7W A;  3K04 A;  3FKS G;  3G6E V;  1R3J C;  5CMU A;  1AI5 A;  1I5Y A;  2GSM B;  3SPI A;  4ZBM A;  3ZRW B;  1OZ0 A;  3CCJ V;  1QLN A;  1GMG A;  1R6K A;  1K34 A;  3B8N A;  2XAF A;  1OCO B;  3CCQ V;  4GX2 A;  2EIJ C;  1AI7 A;  1E1R G;  2Y69 C;  3SJQ C;  1JX9 A;  3ZRV A;  3ZRX A;  4MVR A;  3ABM B;  3EHB B;  4QPJ A;  1SRY A;  2GHY A;  3E8F A;  1V54 C;  4JTD B;  3BEH A;  4MSW C;  1YI2 V;  5CA3 A;  5IYC O;  4R50 A;  3TET A;  3IFX A;  5EBW C;  1F51 A;  3CD6 V;  5EC1 C;  3A0R A;  4KFM A;  3T2M A;  2XND G;  2DWD C;  4WFH A;  1OHH G;  2X0L A;  1LNQ A;  5DN6 G;  4JYC A;  2ZR3 A;  2H94 A;  2JJ1 G;  2K1E A;  1FFT B;  2WLJ A;  4LP8 A;  4HAM A;  1OCC B;  3JCZ A;  3E86 A;  1K92 A;  2A0L A;  3ZN0 A;  1COW G;  3OGC C;  4YXW G;  2XAJ A;  2HJF C;  4WCE V;  1L1F A;  2DYR B;  2ZXW C;  1Y4M A;  1S76 D;  3AG3 B;  3WG7 B;  3X2Q C;  3OM3 B;  5B1A B;  1YJW V;  1XL6 A;  1OCZ C;  1XL4 A;  1W2B U;  3B77 A;  5EK0 A;  1VQP V;  1S72 V;  2PI4 A;  2A9H A;  1VQN V;  1RPR A;  1Q86 W;  5LGU A;  4FK5 C;  1K73 W;  3ZN1 A;  3QNE A;  3MD0 A;  1S5H C;  3OEH G;  2ZR2 A;  3IGA C;  3TCU A;  4MTF A;  1VQ9 V;  1WLE A;  3LSQ A;  5IYD O;  4HYO A;  2IJH A;  1YJN V;  4UVC A;  1J95 A;  4QPK A;  1SES A;  2X6C A;  5J9P C;  1NVP B;  4R8C A;  1R73 A;  4X88 A;  1THZ A;  1SZT A;  4MW3 A;  2LP7 A;  1GKF A;  1W0J G;  2Q67 A;  5LHH A;  4MVU A;  2QE7 G;  3K06 A;  4MVS A;  1ORQ C;  3CCM V;  3CC7 V;  5LGN A;  5HFM A;  3RBZ A;  3I56 V;  2ZDI A;  1FXK A;  1Q81 W;  3WG7 C;  2V1D A;  5B1N A;  1PNM A;  1H8E G;  4TT3 G;  2XAS A;  5LHI A;  5B1A C;  3ABK C;  4PDV A;  2QKS A;  1V55 B;  1QCE A;  2NNU A;  3FB6 C;  5IDJ A;  4L87 A;  3GWO A;  2QM8 A;  3E8B A;  1VQ5 V;  4P9P A;  3AEI A;  5B3S C;  2HVK C;  2WLM A;  3H01 A;  1KP2 A;  2D3O W;  4H37 A;  4JAU A;  1R3L C;  2P7T C;  1TUE B;  1CP9 A;  4PA6 A;  3ZMZ A;  2WWW A;  3DGE A;  2Y69 B;  2HFE C;  2DYS B;  4TSF G;  1RM1 C;  1NH2 B;  1AJP A;  4PEL A;  3LNM B;  3ML0 A;  1BHB A;  4X89 A;  3STL C;  3I55 V;  3ZMS A;  1WPX A;  2IH3 C;  3LDE A;  4ZKI A;  3W7X A;  2OCC B;  2H8P C;  3CCU V;  4E2L A;  2X7R B;  3M99 B;  1B6Q A;  3K08 A;  3MHH C;  2DQ3 A;  4JPR A;  1KQS U;  3OE7 G;  3QO5 A;  4U7O A;  4GT1 A;  4UVB A;  4MVO A;  3PJS K;  1G4Y B;  1QVG U;  2WAM A;  2IH1 C;  5CBF A;  2CK3 G;  4QE7 A;  2WLK A;  2YEV B;  1MAB G;  4N23 A;  3OW2 U;  1AI6 A;  1NR1 A;  4MVQ A;  1S77 D;  2DYS C;  3CXC U;  2AHY A;  4RUF A;  3E83 A;  4H33 A;  1NBM G;  2ZXW B;  4GX1 A;  2EZP A;  2OCC C;  1W0K G;  3X2Q B;  3ABT A;  2Y48 A;  1OCZ B;  3SPC A;  5C93 A;  4QIW F;  1PNK A;  1AR1 B;  3CCV V;  1KEC A;  1EFR G;  3E35 A;  4QNH B;  1K7D A;  1KKD A;  2QEX V;  3ASO C;  2WLL A;  3OUF A;  2OTJ V;  2ATK C;  1S0V A;  3RVY A;  3K9A A;  1QLE B;  3VBB A;  4CBC A;  3K0D A;  4WFG A;  1ENV A;  1GM7 A;  3OEE G;  2XAQ A;  1K3E A;  4UV9 A;  1MOF A;  3JD0 A;  3ZMV A;  3ABK B;  4OXS A;  3CP1 A;  2EIN C;  4R7C A;  3NXS A;  3CYO A;  1K4D C;  3AG1 C;  3E8H A;  4TWK A;  5FL7 G;  2ITD C;  2WLI A;  4I5S A;  1NH2 D;  1VQL V;  3E2E A;  5B3S B;  2ZDI C;  1FXK C;  5H6Q A;  1ROP A;  1K9M W;  2WSS G;  3ZRW A;  5L3F A;  1KC8 W;  5KA5 A;  1QLE C;  1R3I C;  2PI5 A;  3LDD A;  1SET A;  2MK3 A;  1YIJ V;  4JTC B;  3FB5 C;  3QO7 A;  4PDL A;  1M9N A;  2JDI G;  4RO2 A;  1RM1 B;  2R9R B;  3LUT B;  2LFR A;  4HZ3 A;  5EC2 C;  2B1I A;  2C2A A;  2ZD9 A;  3CC2 V;  3B8M A;  3ASN B;  1M90 W;  1H8H G;  4GX5 A;  4DXW A;  2P6J A;  1VQ8 V;  3ZJZ A;  1QVF U;  3CCS V;  2EIM C;  1Q82 W;  1M1K W;  1VQO V;  3FYI B;  3T1C A;  5IYB O;  4FMT A;  1AI4 A;  3W7S A;  2JEU A;  4PA9 A;  3SYP A;  4Q20 A;  4UUJ C;  4FJC C;  3RW0 A;  4G28 B;  4ASU G;  3OUS A;  5E1A C;  3F7V C;  1JQ0 A;  1P4R A;  1QR9 A;  4RQF A;  2NLJ C;  2EZO A;  3ZMT A;  4XDK A;  1HWY A;  3KG2 A;  3OMA B;  3CMA V;  4UV8 A;  4X8A A;  1VQK V;  4BAY A;  3SYC A;  2UXX A;  4CZZ A;  4WFE A;  3JD1 A;  3SYA A;  2WLL B;  4FPP A;  3FYE B;  3ASN C;  3FB7 C;  5L3G A;  2W0F C;  1OCR C;  3FB8 C;  4J9Z B;  2JJ2 G;  3UM7 A;  1H2G A;  5EBM C;  5BZB A;  1VQ6 V;  1AJQ A;  1PD3 A;  3ETD A;  2HKO A;  4EKW A;  1I5X A;  1K97 A;  2IJK A;  4QE9 A;  1ZWI C;  2JIZ G;  3ASO B;  1JPX A;  5B1B C;  3W7T A;  1FXV A;  1K5Q A;  2WLN A;  1R3K C;  4MW8 A;  1YJ9 V;  1F4M A;  4KUM A;  3AG4 C;  2DW4 A;  3MHS C;  5IY5 B;  3SPH A;  2P67 A;  5HFL A;  4PA3 A;  4Z1M G;  2KB1 A;  1BMF G;  2EIN B;  4G27 B;  2R9I A;  4DO2 A;  1NVP D;  2FTK A;  1S3J A;  1JJ2 U;  1DF5 A;  1GM9 A;  3OR7 C;  2B1G A;  3AG1 B;  2WPD G;  2UXN A;  3LDC A;  1M57 B;  1ARO P;  2ZQM A;  2HG5 C;  3STZ C;  4UVA A;  3AG2 C;  3HB3 B;  4LC1 A;  2EJR A;  4PDR A;  1M56 C;  2DWE C;  5KA6 A;  1SER A;  1FXK B;  3CPW U;  4UXN A;  1MG1 A;  1IXM A;  3HPL C;  1P7B A;  2EIK B;  3JD4 A;  1UJW B;  3T4D A;  5GW7 A;  1YTF B;  3VOU A;  1NJI W;  5EBL C;  4JAS A;  1GK9 A;  5KUK A;  4MTX A;  3E89 A;  2IJJ A;  2DQ0 A;  1PKX A;  1DTO A;  2A79 B;  4LCU C;  1NKD A;  5IY5 C;  3G71 V;  4PA7 A;  5CN0 A;  2QTO A;  5LBQ A;  3CME V;  3LSS A;  2P90 A;  4I9W A;  4RQE A;  1Q7Y W;  5B1O A;  3GB7 C;  3E8G A;  3BY6 A;  3ETG A;  1OCO C;  3UKM A;  3SPJ A;  2F43 G;  1M57 C;  3CCE V;  2EIM B;  1KP3 A;  4R6Z A;  2Z3Y A;  3W7U A;  3JD3 A;  5L3B A;  1JVM A;  3ABM C;  4J9Y B;  1VQ7 V;  4XBF A;  3QO8 A;  4G2K A;  3CC4 V;  2X6B A;  3OMN B;  1G8M A;  2W6J G;  1VQ4 V;  5L3C A;  2IJI A;  1MSW D;  2M7W A;  2HVJ C;  4JGS A;  3ABL B;  2YSU B;  4P9O A;  1AJN A;  1DLB A;  3OR6 C;  2EIK C;  1JCH A;  4MTG A;  2IU3 A;  2YEV A;  4MVZ A;  4P30 A;  2B5U A;  1Y66 A;  5LHG A;  5DM6 V;  1E1Q G;  4BIZ A;  4MVM A;  3CCL V;  2AHZ A;  2QA4 V;  4WFF A;  5L3D A;  3SYQ A;  1PL0 A;  1E79 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...