4MSWC

Y78 ester mutant of kcsa in high k+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 43
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mswC00
3K06A 3SYCA 3UM7A 4JTCB 4MW3A 2Q68A 3K0GA 3OR6C 1J95A 1OCZC 5CBGA 2WLMA 3ZJZA 2HFEC 4MVQA 2WLHA 3K0DA 3OUSA 1S5HC 2W0FC 3SPCA 2Q67A 4HZ3A 1R3KC 2HJFC 4ZBMA 3HPLC 4JTDB 4MVSA 3IGAC 2WLIA 4XDJA 2WLLA 4MTOA 3E8HA 2P7TC 3E86A 3F5WC 4PDMA 5J9PC 2WLJA 4QE7A 4MVOA 3AG2C 3ABLC 5E1AC 2H8PC 3K04A 5EBWC 2X6CA 4PA4A 4X89A 4OXSA 3SPIA 4GX1A 2ZD9A 4P9PA 3TETA 4LP8A 4H37A 2Q69A 2QTOA 2IH3C 2WLIB 2ITCC 4GX5A 2WLLB 4CBCA 2BOCC 2WLKA 2YEVA 4WFGA 2QKSA 2DWEC 3ASOC 5EBLC 4RO2A 2Q6AA 2Y69C 3T4DA 3E89A 4PDRA 1KKDA 4GX0A 2K1EA 2ITDC 4MVRA 4UUJC 1LNQA 2OCCC 3PJSK 1V54C 3BEHA 1R3IC 4HYOA 4LCUC 4XDKA 3RVZA 3ZRSA 4EKWA 1OCOC 3RW0A 3AG4C 1JVMA 2DWDC 4F4LA 4J9YB 3T1CA 3JYCA 2EIKC 4WFHA 3FB6C 4G28B 4MS2A 1P7BA 3ABMC 4MVZA 1OCCC 3X2QC 5B1AC 4QE9A 3F7VC 1V55C 2A0LA 3E83A 4I9WA 4R6ZA 4WFEA 5EK0A 4X8AA 4MTFA 1BL8A 4RAIA 4RUFA 4G27B 2EIMC 2AHYA 4PA6A 2EILC 4JTAB 4PDVA 1XL4A 4KFMA 1XL6A 4LBEC 1K4DC 4MVUA 4PA3A 3SPHA 3SPGA 3K08A 3LDDA 4MTGA 5EC2C 3T4ZA 1G4YB 4MVMA 4DXWA 1ORQC 3UKMA 3RVYA 3GB7C 1OCRC 2X6AA 2AHZA 3AG3C 4PDLA 4XDLA 3SJQC 3SPJA 5IY5C 4P30A 2A79B 3FB7C 4PA7A 4R8CA 2DYRC 2A9HA 3RBZA 5EBMC 5BZBA 4WFFA 2X6BA 3IFXA 4P2ZA 4GX2A 3STLC 2NLJC 3LNMB 3OUFA 3EFFK 3E8FA 3SYOA 4QNHB 1QLEC 1M56C 3AG1C 3FB5C 2DYSC 5KUKA 4RUEA 2WLNA 3ABKC 3LUTB 4X88A 4MW8A 3LDEA 2HVKC 3OGCC 4R50A 4BW5A 2HVJC 2R9RB 3ASNC 3E8BA 3E8GA 3OR7C 3SYQA 3LDCA 4MSWC 2JK5C 3SYPA 4R7CA 4J9ZB 1R3JC 3FB8C 2ZXWC 2EINC 4PA9A 1M57C 3VOUA 5EC1C 1R3LC 3STZC 3WG7C 5CBFA 2KB1A 2ATKC 2EIJC 3K03A 5B3SC 3R65A 1K4CC 3T2MA 5KUMA 4P9OA 2IH1C 4H33A 3SYAA 1ZWIC 2BOBC 5B1BC 3KG2A 3TCUA 4TWKA 2HG5C 3F7YC 5CBHA
chains in the Genus database with same CATH superfamily
3ETQA 1QR9A 3OD4A 3RYHB 4YHHO 4QIWF 5H6RA 3UM7A 4LWSB 1IBKO 3OGIB 3E22A 3OR6C 1K73W 3B77A 3K0DA 3OTOB 1F7YA 4JYBA 5LGNA 1Q82W 1R6NA 5FLXN 1KUQA 1I5YA 1OZ0A 1ZLZA 1QBZA 3E86A 2QDOA 4AQYB 4UCVA 1PKXA 5E1AC 1BS3A 2IU0A 2Y69B 5BMVB 1NR7A 1H2SB 1EN4A 3D8CA 4J10A 4X62B 4EEQA 1N36B 3AG4B 1RFYA 2ITDC 1PP9H 3ZX6A 4LH7A 3RVZA 1FAFA 4MS2A 1P7BA 1R1BA 3K3WA 5KLVH 2GHYA 4B3TO 4J7ZA 3HKEA 1RM1B 1I7FA 4DUZB 2AHYA 5IY5B 1K4DC 3QG5A 1WPBA 1XMQO 4DXWA 2VS0A 2UUAB 2VWKA 3LSUA 4P30A 4FLYA 4PA7A 2DYRC 1N4CA 1LUVA 1OHHG 3BA9A 3ML0A 4QPJA 4UXNA 2KG7A 2HHHB 3T1HB 5KUKA 5LP6B 1Y74B 3WB1A 3CMEV 4PHZA 3FX7A 1FXKC 3LNNA 1VQMV 5EIBD 5JJEB 1TUEB 1BZKA 4EB6B 4D7SA 2EIJC 4IHJA 3T2MA 4DV1B 1L0NH 1PNLA 1NVPB 1VQ8V 1CP9A 4I9QA 2B1IA 3T1YO 4TV9B 4J11A 2KKWA 2AZ0A 2UXDO 2GUZA 4JTCB 1N32B 3HKBA 4TOIA 2ARHA 3ZJZA 5EYPB 4DW0A 3ABLB 3HPLC 5LOVB 5E79Z 4JGSA 3P30A 2ADQB 2JJ1G 2P7TC 1YHQV 2BSKB 1IBMO 3JD1A 4MVOA 4O4LB 5FNVA 5KX5B 2L6LA 2E75B 3PN1A 4FMTA 3H1JH 3ASOC 4NVPA 4O4JB 4FFKA 1BE3H 2CTPA 4FFBB 1MSWD 5KHKA 2FL4A 4OPAA 3G71V 3HB3B 3Q4HA 1MMMA 2ZE7A 3I5DA 3X2QC 3E83A 2QJ1A 4DR3O 3QO5A 2JIZG 4KUMA 1SESA 4TUYB 2JDIG 4DR4B 2E5LO 3IAYA 1XL4A 4LBEC 1XEQA 1AVMA 5GTIZ 3K08A 2JVDA 4TV8B 4JI6O 2WSSG 5KAIZ 3RVYA 3JARA 2QWOB 4DV2B 5HFLA 2YSUB 3H9VA 4DV6B 1HR0O 3M7MX 3P32A 3QF7A 4RUEA 4H44B 4GT1A 4I4TA 3JAMN 4O4HA 4DV3O 4NTWA 4RQEA 3FB8C 2ZXWC 3K57A 1K97A 1M57C 2XAGA 3VOUA 4LF4O 2X0LA 4WFBV 3A2FA 4UB6Z 1SQXH 1XILA 3D36C 3SYAA 1GN6A 4CH4A 1OCZB 1Y66A 5GTHZ 2Y0IA 3K0GA 4QPKA 4FLXA 4GKKO 4YY3O 1XBLA 4H13B 5IT9N 5GONA 3AG2B 4BIOA 5FPOA 1VQ6V 4MVSA 3TXSA 2UXBB 4CC6A 1Q7YW 2IU3A 1F51A 3SPIA 3CC2V 4P9PA 5IJ9B 4IYIA 3BY6A 3M99B 1AR5A 3HKCA 4LFBO 2QKSA 2DWEC 2WPDG 1TUBB 1NH2B 4FM2A 2R9AA 3AK2A 3W7WA 2PYLA 2YS8A 4LF8O 2XTAA 1V54C 3TGUH 2JRIA 2CH7B 1JJ2U 1K92A 3VBBA 4WBNA 3K58A 4WFEA 1BL8A 4PD4F 2Y4TA 1FD9A 3B8MA 2QWPB 4LF5O 2CAZC 5LBQA 3VQXA 4KFMA 4X20A 2F93B 1NBMG 2ZCEA 1M9NA 2X6AA 5CA0B 4JAVA 3SPJA 1FYJA 4TQDA 1WA8A 1ZAUA 2A9HA 3RBZA 2N05A 4P2ZA 3CPWU 2QKCA 3ZMUA 3SJCC 1YF2A 2F95B 2HVKC 2PTMA 1MZFA 3LDCA 4MSWC 5IE9A 1DF5A 2A7WA 5LXTB 3JCZA 4LWSA 2EJ7A 1XREA 5JCOC 1JX9A 2DQ0A 1YTFD 2LGWA 1ZWIC 5LHIA 4BWAA 2Y4UA 5C8YB 4FM1A 4J42A 1VQNV 4NTXA 2PF4E 2WLMA 1W0JG 1G8MA 2EINB 1YI2V 3OFNG 3ZMSA 3VQYA 1RSOB 1B06A 5BMVA 1Q90D 3CP1A 4XDJA 5CN0A 4I55B 4PDMA 2F23A 1XDCA 2QM7A 2V4DA 4DV4B 4AHCA 1G6UA 1QQCA 4LP8A 4H37A 2IH3C 1FJGB 3SJAC 4LFAB 3B40A 1XHXA 2F66C 1XNQB 1FFTB 1TGOA 2ZNJA 5F2VO 1QVGU 3G67A 2GUZB 1FKAO 2Q0OC 1S76D 2EIKC 2BCCH 1K8AW 1N33B 1AR4A 2RQ6A 3ZRXA 1N0JA 2UUBO 2PGGA 1BQZA 2QKAA 4CS3A 2VQFO 4PDVA 3QVNA 1Q6UA 2LW7A 2DYRB 5FNVB 1SS3A 1SRYA 2OCHA 3DC6A 3UKMA 5LP6A 1Y74A 3AG3C 4JAUA 3WU2Z 2AGAA 2Z5UA 4X66O 4JV5B 4GX2A 1I94B 2PY5A 4NXNB 1NI8A 3MD0A 1FXKB 1M4UA 1Q6IA 4EB6A 5H9CA 5K1PA 4DV5O 1K5QA 1YXBA 1EFRG 2EIJB 1JFFA 3SYPA 1AI6A 4TV9A 3WFVA 1PD3A 4J9ZB 4IGGA 4B7KA 5EC1C 3WG7C 4BW9A 2F4VO 2P06A 3FFQA 2OIEA 3JD2A 1PM9A 2ZIOA 1M1KW 4DR1B 3TCUA 4TWKA 3DC5A 5LOVA 2HG5C 1BMFG 3N2KA 2ZE8A 5CBHA 3ASNB 2P6JA 3JAWA 4JYAO 4ZI7B 2BSKA 3JARB 1J95A 4FLWA 2PZSA 4X1KB 5KX5A 1JCHA 1R3KC 1YZBA 2IJJA 4MTOA 1ZTEA 4J41A 4O4JA 2UXNA 3ASOB 2V1DA 2KQXA 2P22C 2ZE5A 4I4TB 3RGBA 2XAQA 4FFBA 4LF7B 2WLIB 4TQFA 2WLLB 4CS2A 2PYJA 1SERA 3ZRVA 4JI4B 3T4DA 1NR1A 2OCCC 3ZEDA 4NXMB 4TUYA 3QTCA 4AI8A 1F23A 2GSMB 4TV8A 2VWJA 1GRJA 3ABMC 2QA4V 1F4NA 5EK0A 1GN4A 4RUFA 4JI1O 3SJBC 1TVKB 3THOA 2EILC 5IWAO 1IBKB 4IYHA 2ZDIA 3UCSC 1VQ5V 2RDCA 2YICA 4Q6GA 3FB7C 1AROP 5LGUA 3TK1A 3CRCA 3OUFA 4J7KA 1BHBA 1D5NA 1QLEC 1M56C 3CE2A 2DQ3A 3ZHVA 1FXHA 3ABKC 3CCJV 1NZ6A 4W4KA 4XBFA 1XI1A 1M57B 1T5EA 2CTQA 5LGTA 3OR7C 1DF4A 2ODMA 1VF6A 2Y48A 4JI0O 3JD0A 4FIPC 4WBNB 2HP8A 4I7ZB 4OPHA 4JI8O 1PPJH 3OAAG 2EZPA 5CBFA 4Q20A 3K03A 2AZ2A 3CC4V 4Z1VA 3CJHB 2ZM6B 1H38A 5FPRA 4B3TB 1Q81W 1HNZO 1UPGA 3WB0A 1GO3F 1WLEA 2LP7A 3U11A 3CCVV 2ZQMA 2ZR2A 3B8NA 4JTDB 5B1BB 3O65A 1TUBA 4QE7A 1SETA 1GN3A 4GX1A 3K9AA 5CB4B 2ILMA 3TJTA 2CH7A 1VMGA 2QE7G 1R73A 4NTYA 2Q6AA 1URFA 2Q7GA 1KMIZ 1Q8IA 2JGUA 4EFEA 1A32A 3AK3A 5IYCO 1M5IA 5L3CA 2QWQB 4MTXA 4K35A 1CXZB 4LFCB 3F7VC 4B3RB 4UCUA 1AI7A 5CA0A 2EX3A 4JI3O 5C93A 2QGNA 4X64B 2UXDB 5LL6Y 4PA3A 2NNUA 3RWRD 5J2TA 1IXMA 4G2KA 1XUQA 4PDLA 3ZMZA 1HNWB 2FMLA 3ZCCA 1Q3EA 4K3AA 5BR8B 3LSQA 4WFFA 2N74A 4FZ0A 2YXHA 5LXTA 4O4IA 4CH3A 1IZ3A 3NXSA 3CYOA 3CX5F 4C7UA 2NR5A 3QO8A 3E8BA 4PELA 4DUYB 4LF6B 1I5XA 4GKJB 3KCYA 2WA4A 5C8YA 5DEDA 2JS3A 3AG7A 3O9OA 1RSOA 4KL1A 1AP6A 3OEHG 2XT9A 4F6RA 3K06A 2HLDG 1OV9A 5LYJB 1JQ0A 4I55A 4DYLA 2GDSA 1MA1A 1QLNA 3EXAA 1QR8A 4ZHQB 2W0FC 3SPCA 1ZL8B 4E2LA 2O57A 1VEWA 3CXCU 1PL0A 1N8RW 1FPOA 4UV9A 2QEXV 1AILA 1BHAA 1JFFB 2YIBA 1R6TA 1EM1A 1VQKV 1HR0B 1RPOA 4DR2O 1DTOA 3OTOO 1TAEA 3HR0A 1MNGA 4GX0A 5EIBC 1XQ8A 2EIKB 3JATB 4O2BA 4AQYO 1WP8A 3VQVA 3L71H 5A9GA 3N2KB 4HNAB 3B09A 4HBNA 1OCOC 3JAWB 4BIZA 3ZHQA 4IIJB 1OCCC 5B1AC 4X62O 2A0LA 1U97A 4DV0O 2YXYA 4OX9O 3P3NA 3W7TA 2RJZA 5B1NA 3IC7A 3SPGA 2Q0AA 1FXKA 1ORQC 3CRQA 3OMIB 5AG2A 2QSAA 4K0KO 1KKCA 1PNMA 2PUSA 3IFXA 3CCQV 3STLC 3CRAA 3AG1C 2CE4A 2DYSC 2WLNA 3M8AA 3LDEA 1HNXB 2NN4A 2CK3G 4JF3A 3WG7B 2UUAO 5CA1B 2CGNA 4X1IA 2QM4A 1AI4A 4ZI7A 3CB2A 3G6EV 2ATKC 3E35A 5B3SC 4X1KA 3OMNB 2HHHO 1YITV 5DECA 1HW7A 4L8JA 1E79G 2W0XA 3F7YC 2P67A 3NR7A 4BAYA 4JI2O 4FLZA 4MW3A 3UO3A 4TSFG 2CDYA 1EBOA 2R9IA 4LF5B 2OT5A 4X9QA 3W7UA 4BR6A 3RYIB 2WLIA 4DV1O 2WLLA 3ABUA 3E8HA 3A0RA 1L8DA 3F5WC 3DGEA 4B3SO 1N34B 1P4RA 2LQTA 4J7JA 2IW5A 1N32O 4OXSA 1JPXA 4HAMA 2LFSA 1P49A 5JWPA 3G4SV 1J5EB 3DTUB 4Z2WA 2K1EA 2LO1A 3CHXA 2Q7EA 3BEHA 2LFRA 1R3IC 2JEUA 1TVKA 4DV7B 1GN2A 2YIDA 1Z5WA 3FB6C 3CCEV 5LA6B 3K79A 4R6ZA 1FS0G 4YIPA 1AI5A 2EIMC 3FAVB 2FYUH 2DJVA 2Q5ZA 4JTAB 4LC1A 1YCIA 2YI8A 2OTJV 4DR6O 2EULA 4DR7B 3B4SA 1M56B 2VQEB 1E1RG 1V55B 2QTSA 3ETEA 5LMNO 3LNMB 4NB5A 3D36A 3E8FA 2ZKOA 4QNHB 4DR4O 2XAFA 2Q4PA 4FPPA 5TISZ 3UQ8A 2YXLA 2UUCB 1OCRB 2YDEA 3K5LA 1AJNA 1W59A 1NJIW 4DV2O 1U96A 3CJHA 1VARA 4FLUA 5BXZA 1BSMA 5CMUA 1K4CC 4LNUA 1XMOB 4P9OA 4UVCA 4H33A 4UCRA 1QCEA 3QO7A 2YC0A 5JVDB 5J2TB 3K04A 1SZTA 1Q5OA 1NU1H 4CC5A 5B5EZ 1WPXA 3I56V 3RFRA 2UU9B 2Q67A 4ZBMA 5CB4A 1NTMH 4O4IB 4IT5A 4JPRA 1Q6HA 3AEIA 3CD6V 3TXQA 5ITZA 2UXXA 2YIAA 4GX5A 4RO2A 3UT5A 1KKDA 1E1QG 3GWKC 1VQOV 1LNQA 1RM1C 1M90W 2UXBO 1Q43A 4F6RB 1GKFA 3K59A 3H1HH 4UVBA 2IJIA 4J9YB 1K3EA 1H2KA 4B3MB 4EFBA 4X8AA 3SGIA 2EBOA 4K8XA 5IYDO 1MOFA 3GWOA 2CGOA 1VP7A 3ZIAG 1NVPD 4JZGA 4LF9O 1LR1A 2B5UA 3IJ4A 1CEZA 5FL7G 5BZBA 2B1GA 4JI7B 4FZ1A 3H1IH 1P7GA 4O2BB 3C90A 4DR5B 4MW8A 5L3DA 2Z3YA 2HVJC 2ZINA 4RQFA 3ZRWB 4R7CA 4YJ3B 2R70A 1BGYH 1TA8A 4PA9A 5LYJA 1UFIA 5B1OA 3BHPA 5KUMA 4ASUG 4ZHQA 3CCUV 1ZL8A 1SQFA 3JSNA 2XOKG 3SYCA 2Q9LA 1LUWA 3BAAA 3ETDA 4UB8Z 2XHBA 2UXCB 2HJFC 5IWAB 1SKVA 1EZJA 4ICGA 2DN9A 1KP3A 5JJJB 5EBWC 4PA4A 3JATA 3J80N 4X1IB 4HNAA 4ABMA 2Q69A 3BCCH 1OCOB 4IIJA 3HKDB 1Z5VA 3D3QA 1Y6XA 1YDXA 3B2EE 1XNRB 3K5NA 1OCCB 4DV4O 5B1AB 1YJNV 3ZRSA 1D2DA 5LMUB 2HKOA 4JI8B 2FKXA 3OW2U 5KMGB 4WFHA 3ABTA 3JASB 1FJGO 3A0BZ 3CWBH 2RN9A 4MTFA 2ZT9B 4LFAO 1Y67A 3AK1A 3OEEG 1XNQO 1GM8A 1IBLO 1GTOA 4PA6A 2BTQB 4NR1A 1Q86W 2Q8VA 4MVUA 1XL6A 3CS5A 3ZHRA 1FFXA 3LDDA 1QNMA 4D6TH 3SJQC 3A0HZ 1VQ4V 3MHHC 3X2QB 5L3EA 5IYZB 1N33O 5CA1A 3ZN0A 4FJCC 1VQ9V 5EZYB 3IC9A 4FLVA 1AR1B 4R50A 4BW5A 4UCTA 4JI5O 4YHHB 1QVFU 3JSLA 2JK5C 2GBOA 2A06H 1K33A 5H2FZ 2DMXA 2H3OA 1KQSU 1O9GA 4JV5O 1I94O 4NXNO 1VQ7V 3STZC 1JOYA 1NH2D 3WB2A 2IH1C 4BIUA 1O9HA 3RYIA 4YIOA 4I50B 1W2BU 2ZXWB 3JAKA 3OUSA 1YSCA 2JGDB 2ZE6A 3RYCB 3K5OA 2GTSA 3ETGA 4DR1O 1WP7A 4FLTA 3TETA 2B9ZA 2WLKA 2YEVA 5LHGA 2JJ2G 3E89A 5DM6V 1D5AA 1IDSA 4LNUB 5LA6A 4A5UB 4UUJC 4UCOA 1RPRA 3FAVA 1XMQB 1G1XB 3ZS8C 5GW7A 4YJ2A 2DWDC 3G6BA 2KSDA 2EIMB 1I0HA 4PI2A 2W6IG 1W0KG 1PV0A 1B04A 4JI4O 4RAIA 1Z2GA 1V54B 1KD1W 2HR3A 3FYEB 4U3FH 3L72H 5ITZB 3GB7C 1SQPH 2E3CA 2CTWA 2E76B 1GM7A 2N04A 3UT5B 3EFFK 5JQGB 5H5NA 3T1YB 2WWWA 4DR2B 2R9RB 4W4LA 1S5LZ 4DRXB 5JVDA 4DW1A 1B3QA 1YIJV 1GMGA 3CRRA 2EINC 1MG1A 4I0XB 1IXBA 2D2CB 3KZIZ 1WB7A 2P5OA 2BOBC 4KHPO 1IBMB 2YIBD 5CA3A 2M6YA 5K1XA 3OMAB 3I55V 4DV0B 4OX9B 3FYIB 3K5MA 3CMAV 4D7TA 4GYCB 4J80A 1KYOF 4K0KB 2WLJA 3KCXA 2ZM6O 4O2AA 4JYCA 1COWG 3DXRB 2IBZH 2XNDG 4DR3B 2IM9A 1S3JA 1YTFB 3L75H 2E5LB 4PV1B 3P3PA 4GLXA 4HYOA 1EN6A 4X65O 2W6JG 4JI6B 1SF9A 5IYBO 3OE7G 3CC7V 2LGQA 5B66Z 4KP4A 4F6EA 2EZOA 2G38A 1SQGA 1ROPA 4JI2B 3SPHA 3BPZA 3OM3B 4MTGA 5EC2C 2ETNA 1VIBA 2P4KA 1JA8A 2V7QG 4LFCO 4DV3B 5BY1A 4B3RO 4LF4B 3ZRWA 3BABA 4B3SB 2LW1A 4U3JB 4WF9V 1M93A 2XUMA 4YJ3A 3SYOA 3J7AU 4X64O 2YI9A 1N36O 2H94A 3AG3B 3GVMA 3ICXA 1SC5B 3ASNC 4CH6A 1HNWO 4GKKB 5BR8O 4YY3B 5D5PA 1Y4MA 4AILC 4U7OA 3N27A 4UFZA 1FXVA 3R65A 3OT7A 2HJDA 2MK3A 2ZIMA 4H0LB 1FFXB 4DUZO 3MDSA 4FK5C 3OTFA 4DUYO 4LF6O 1DGSA 3L74H 4GKJO 4E4EA 4PJ0Z 5CBGA 1DLBA 3JALA 1S5JA 1HP8A 2JEXA 4LFBB 1ZUQA 2RMKB 4LF8B 4DR6B 1I08A 3RT3C 3HKDA 2H8PC 4CH5A 3T1HO 4CS4A 4X89A 2RCVA 5LMNB 1K7DA 1AP5A 2ITCC 2AXTZ 5KAFZ 1IVSA 5JJNB 5KMGA 3JASA 3U0ZA 3VQWA 4CZZA 3PJSK 4U7NA 1GM9A 4XDKA 4EKWA 5IJ0A 2BTQA 3L70H 5L3FA 5JH7B 3JYCA 2EJRA 2Q73A 1YJWV 3JAKB 1NTKH 1XHZA 3ZHSA 4X1YB 2OCCB 5IYZA 1KBHA 4ZOLB 1S72V 5EZYA 2QR4A 5J2UB 2AHZA 4XDLA 3ABMB 2P4VA 3A8TA 4FVMA 4R8CA 2YEVB 2F43G 1RP3B 2NLJC 3R66A 2EILB 3FB5C 3N2GA 3H01A 4YJ2B 3E8GA 3SYQA 2IJKA 4TT3G 1R3JC 1VQPV 4I50A 1L1FA 1R3LC 3J81N 1QLEB 2XASA 3ABKB 1V9PA 1XOUA 4QGPA 5B1BC 3KG2A 3ZBHA 5KA6A 2JGDA 3EVKA 5KHGA 1HNXO 3RYCA 3CCLV 1AJPA 1BCCH 1EN5A 2HFEC 4GCZA 1JJOA 5LHHA 4LF9B 4HZ3A 3RYFA 4YXWG 2ZNIA 2FB5A 5KHJA 1SQVH 4LH6A 5J9PC 1Y76A 3E22B 4DV6O 2L35A 5HFMA 2X6CA 3SDLA 3EHBB 3ZHTA 2OIGA 1H2MA 4CBCA 1QU7A 2BOCC 5EBLC 2WAMA 2GTAA 2Y69C 3LSSA 2UUBB 2M7WA 2DW4A 3CRMA 4MVRA 2VQFB 4GZRB 1N34O 1HDJA 4LCUC 1KU9A 1S77D 4UV8A 1NQTA 1UJWB 3AG4C 2DE0X 1EZVH 3T1CA 4G28B 1PL4A 2QM8A 1SA0A 2VRZA 4X66B 4I9WA 1KECA 2Y0PA 1J5EO 2P90A 3MHSC 4JZ2A 2WA3A 4DV5B 3S3XA 3BFRA 2CTRA 3T4ZA 5JQGA 3RYHA 1S0VA 1H2GA 1B6QA 4O2AB 4NKGB 4DV7O 5IY5C 3HKEB 2MW2B 4N23A 5EBMC 2X6BA 4DRXA 1VF5B 2CUGA 4FM0A 1DK1A 2F4VB 2FTKA 1WB8A 3CCMV 4I0XA 3LUTB 4X88A 2C2AA 3FKSG 1YVWA 2F1MA 4JYAB 1H2LA 1X59A 4WCEV 4DR7O 3CEIA 4RWUA 2VQEO 1P84F 5LP6C 4GUNA 3BRCA 2KG7B 4LR3A 3APQA 1YEWA 5JCOA 1NS1A 3S3WA 4K8ZA 5DN6G 2UUCO 3CXHF 1F4MA 2Q68A 4IHJB 2JS5A 1N0NA 1IBLB 2WLHA 1S5HC 1YJ9V 1NT2B 3DXRA 2XAHA 1XMOO 5D5QA 3H1LH 4JYYA 1X4TA 3HKBB 3ABLC 4IL6Z 1JR9A 1GH6A 2UU9O 1CPYA 3JCUZ 4WFGA 4JI1B 4OGQB 2ADPA 4JI5B 1MABG 2AW9A 4B08A 3RW0A 3UO2A 4WFAV 1BT8A 4F4LA 1WJZA 3ZN1A 3JALB 1THZA 1WAZA 2K9PA 1SZXA 4U3JA 2BTOA 3Q4HB 3JD4A 1KP2A 1G4YB 2HEPA 3L9DA 4JI0B 1SQQH 4Z1MG 2E74B 1GAXA 3ZMVA 2A3QA 4B3MO 5EYPA 1KB9F 5KHHA 4I5SA 2OTLV 3H1KH 1GK9A 1HWYA 4O4LA 3OGCC 3FD9A 4NYKA 5IJ0B 2ZDIC 3C3SA 1L0LH 1NTZH 1KC8W 1HNZB 2D3OW 2X7RB 1R6KA 3G80A 1JMKC 4JI7O 4JASA 2KB1A 3AG1B 2DYSB 3BVOA 1OJHA 2Z0AA 3SR2C 5L3GA 4DO2A 4DR5O 4O4HB 2QWNB 3K9SA 1OCZC 4MVQA 1VF6C 2OWOA 4DK0A 1H8EG 5B3SB 4L87A 3IGAC 3MAQA 3N2GB 3C3TA 3AG2C 1ENVA 4MT8A 3RN4A 1VQLV 1MSDA 1ZX3A 5GONB 2ZD9A 2QWRB 2QTOA 3JD3A 3ZMTA 2UXCO 5JH7A 1K34A 4PDRA 2LJ2A 4JI3B 4ZKIA 4JAAA 1H8HG 4B7EA 1K5SA 4X1YA 3QNEA 5KHIA 2GV9A 1JVMA 3HKCB 4ZOLA 5L3BA 1SQBH 3KKYA 4UCSA 1AJQA 1IURA 4QJFB 4MVZA 4QE9A 1V55C 5J2UA 1MZEA 3RYFB 4KHPB 1WNSA 4G27B 2OYQA 2YUAA 1PNKA 1XNRO 1Y76B 4N21A 2PI5A 5H6QA 4MVMA 5LMUO 4DK1A 3CSXA 1OCRC 1US6A 3D3IA 2A79B 2BE3A 3ZHUA 3BA8A 2RNBA 2XAJA 4UVAA 4X20B 1AB3A 4LF7O 2Q7HA 3W7XA 5KA5A 1NKDA 3U10A 2DOSA 1WA8B 5IDJA 3CCRV 2R72A 1BQ0A 3L73H 4NXMO 3E2EA 4ZIBA 5IJ9A 4PI0A 1VF7A 2ZR3A 1QHTA 1SA0B 3W7SA 1H2NA 1K9MW 4KXRA 2IJHA 3DSQA 2PI4A 4X65B 3CCSV 1IX9A 5A2QN 1ZSPA 3APOA 3F5TA 1WN7A
chains in the Genus database with same CATH topology
3ASNB 2P6JA 1QR9A 4FK5C 4QIWF 5H6RA 3UM7A 3OR6C 1WPXA 1J95A 5CBGA 1DLBA 3I56V 1K73W 3B77A 3K0DA 2JEXA 1JCHA 2Q67A 1R3KC 4ZBMA 4JYBA 5LGNA 1Q82W 1R6NA 1I5YA 2IJJA 1OZ0A 4MTOA 1QBZA 4JPRA 3E86A 1PKXA 2UXNA 3AEIA 5E1AC 2H8PC 2V1DA 3ASOB 2IU0A 3CD6V 2Y69B 4X89A 2XAQA 1K7DA 1NR7A 2UXXA 2WLIB 4GX5A 2ITCC 2WLLB 1SERA 4RO2A 3ZRVA 3T4DA 1KKDA 1NR1A 3AG4B 1E1QG 1VQOV 2ITDC 1LNQA 2OCCC 4CZZA 1RM1C 1M90W 3PJSK 4U7NA 1GM9A 4XDKA 3RVZA 4EKWA 1GKFA 1F23A 2IJIA 4UVBA 4J9YB 5L3FA 3JYCA 2EJRA 2GSMB 1YJWV 1K3EA 4MS2A 1P7BA 3ABMC 2QA4V 1F4NA 3K3WA 5EK0A 2GHYA 4X8AA 2EBOA 4RUFA 5IYDO 1MOFA 2OCCB 1RM1B 2AHYA 3GWOA 5IY5B 2EILC 3ZIAG 1NVPD 1S72V 1K4DC 2B5UA 2ZDIA 1VQ5V 4DXWA 1CEZA 2AHZA 4XDLA 3ABMB 4P30A 5FL7G 3FB7C 1AROP 4PA7A 2DYRC 4R8CA 5BZBA 3TK1A 5LGUA 2YEVB 2F43G 2B1GA 2NLJC 1OHHG 3OUFA 2EILB 3ML0A 1BHBA 4QPJA 4UXNA 1QLEC 1M56C 3FB5C 2DQ3A 5KUKA 3CCJV 1FXHA 3ABKC 3CMEV 4MW8A 5L3DA 4XBFA 3H01A 1M57B 2Z3YA 2HVJC 5LGTA 1FXKC 3E8GA 3OR7C 3SYQA 1DF4A 2IJKA 1VQMV 2Y48A 3ZRWB 3JD0A 4TT3G 4R7CA 4RQFA 4FIPC 1R3JC 1VQPV 1TUEB 4PA9A 1L1FA 1R3LC 3OAAG 2EZPA 5CBFA 2EIJC 1QLEB 3K03A 2XASA 4Q20A 5B1OA 3T2MA 5KUMA 3ABKB 4ASUG 5KA6A 5B1BC 3KG2A 3CCUV 1PNLA 1NVPB 1VQ8V 1CP9A 3CC4V 2B1IA 3CCLV 2XOKG 3SYCA 1AJPA 1H38A 4JTCB 3ETDA 1Q81W 3ZJZA 2HFEC 4GCZA 1GO3F 1WLEA 2LP7A 5LHHA 3CCVV 4HZ3A 2ZQMA 2HJFC 2ZR2A 3ABLB 3HPLC 3B8NA 4JTDB 4YXWG 5B1BB 1EZJA 4JGSA 3P30A 2JJ1G 2P7TC 1YHQV 5J9PC 4QE7A 3JD1A 4MVOA 5HFMA 1SETA 1KP3A 5EBWC 2X6CA 4PA4A 4GX1A 3EHBB 3K9AA 4FMTA 2Q69A 4CBCA 2BOCC 2QE7G 1R73A 5EBLC 2WAMA 3ASOC 2Q6AA 2Y69C 3LSSA 1OCOB 2M7WA 2DW4A 4MVRA 1OCCB 4LCUC 5B1AB 1YJNV 3ZRSA 5IYCO 1S77D 4UV8A 1NQTA 1MSWD 2HKOA 3AG4C 5L3CA 1UJWB 3OW2U 3T1CA 4MTXA 3G71V 3HB3B 4WFHA 3ABTA 4G28B 2QM8A 3X2QC 3F7VC 3E83A 4I9WA 1AI7A 1KECA 4MTFA 2P90A 2JIZG 3MHSC 3QO5A 3OEEG 1SESA 1GM8A 4KUMA 5C93A 1GTOA 2JDIG 4PA6A 1Q86W 1XL4A 4MVUA 1XL6A 4LBEC 4PA3A 2NNUA 3K08A 1IXMA 3LDDA 4G2KA 3T4ZA 1S0VA 1H2GA 1B6QA 2WSSG 3RVYA 4PDLA 3SJQC 3ZMZA 5IY5C 3ZCCA 1VQ4V 3MHHC 3X2QB 4N23A 5L3EA 5EBMC 3LSQA 2X6BA 4WFFA 5HFLA 3ZN0A 2YSUB 2FTKA 4FJCC 3CCMV 1VQ9V 3P32A 4RUEA 3LUTB 4X88A 2C2AA 3NXSA 3FKSG 1AR1B 3CYOA 4GT1A 4R50A 4BW5A 3QO8A 3E8BA 4PELA 1QVFU 4WCEV 2JK5C 1I5XA 1K33A 4RQEA 3FB8C 2ZXWC 1KQSU 1K97A 1M57C 2XAGA 3VOUA 1VQ7V 2X0LA 3STZC 1JOYA 4WFBV 1NH2D 2IH1C 3SYAA 1OCZB 4BIUA 3OEHG 5DN6G 1Y66A 3K06A 2HLDG 1JQ0A 1F4MA 2Q68A 3K0GA 4QPKA 1W2BU 2ZXWB 1QLNA 2WLHA 1QR8A 3OUSA 1S5HC 1YSCA 2W0FC 3SPCA 1YJ9V 3AG2B 1VQ6V 2XAHA 4E2LA 4MVSA 3CXCU 1PL0A 3ETGA 1N8RW 4UV9A 1Q7YW 2QEXV 3ABLC 2IU3A 1F51A 3SPIA 1BHAA 3CC2V 4P9PA 3TETA 3BY6A 1VQKV 1CPYA 1RPOA 1DTOA 2WLKA 2YEVA 3M99B 2JJ2G 2QKSA 2DWEC 2WPDG 4WFGA 5LHGA 3E89A 5DM6V 4GX0A 1NH2B 3W7WA 4UUJC 2EIKB 1V54C 1MABG 1RPRA 1OCOC 3RW0A 4BIZA 5GW7A 4WFAV 2DWDC 1JJ2U 4F4LA 2EIMB 1K92A 3ZN1A 3VBBA 2W6IG 1OCCC 1THZA 1W0KG 5B1AC 2A0LA 4WFEA 1BL8A 4RAIA 3B8MA 3W7TA 5LBQA 1V54B 1KD1W 4KFMA 5B1NA 2HR3A 3IC7A 3FYEB 3SPGA 3JD4A 1KP2A 1FXKA 1NBMG 1G4YB 1M9NA 1ORQC 3OMIB 3GB7C 2X6AA 4JAVA 3SPJA 4Z1MG 3ZMVA 1GM7A 2A9HA 1PNMA 3RBZA 3IFXA 4P2ZA 3CCQV 3CPWU 3STLC 4I5SA 3EFFK 2OTLV 3AG1C 2DYSC 3ZMUA 1GK9A 2WLNA 1HWYA 2WWWA 2HVKC 3LDEA 3OGCC 2CK3G 2ZDIC 4JF3A 3WG7B 2R9RB 3LDCA 4MSWC 1KC8W 2D3OW 2X7RB 1YIJV 1AI4A 1R6KA 1GMGA 1DF5A 2EINC 3JCZA 1MG1A 4JASA 3G6EV 2KB1A 1JX9A 2ATKC 3E35A 5B3SC 3AG1B 2DQ0A 2DYSB 1YTFD 3OMNB 5L3GA 1YITV 1ZWIC 2BOBC 4DO2A 5LHIA 1E79G 5CA3A 3F7YC 2P67A 4BAYA 3OMAB 4MW3A 3I55V 4TSFG 1VQNV 1OCZC 2WLMA 1W0JG 1G8MA 2EINB 3FYIB 1EBOA 4MVQA 2R9IA 1YI2V 3OFNG 3ZMSA 3CMAV 1H8EG 2OT5A 5B3SB 4L87A 3CP1A 3W7UA 3IGAC 2WLIA 4XDJA 2WLLA 3ABUA 3E8HA 3A0RA 3F5WC 5CN0A 3DGEA 4PDMA 2WLJA 1P4RA 2QM7A 3AG2C 1ENVA 4MT8A 2IW5A 1VQLV 4JYCA 1COWG 4OXSA 2ZD9A 1JPXA 4LP8A 4H37A 4HAMA 2QTOA 2IH3C 2LFSA 3JD3A 2XNDG 3ZMTA 1K34A 4PDRA 3G4SV 3DTUB 4ZKIA 2K1EA 1FFTB 1S3JA 1YTFB 1H8HG 3BEHA 2LFRA 1R3IC 4HYOA 1K5SA 2JEUA 3QNEA 1QVGU 2W6JG 1JVMA 5L3BA 1AJQA 1S76D 2EIKC 3FB6C 4QJFB 3CCEV 5IYBO 4MVZA 3K79A 3OE7G 3CC7V 4QE9A 1K8AW 1V55C 4R6ZA 1FS0G 4KP4A 3ZRXA 2EZOA 1AI5A 2EIMC 4G27B 1ROPA 4JTAB 4PDVA 3SPHA 1PNKA 4LC1A 2PI5A 4N21A 2DYRB 3OM3B 4MTGA 5EC2C 5H6QA 4MVMA 2OTJV 1SRYA 3UKMA 1OCRC 3AG3C 4JAUA 1M56B 2V7QG 3D3IA 1E1RG 1V55B 2A79B 2Z5UA 3ETEA 2XAJA 4UVAA 4GX2A 3ZRWA 3LNMB 3MD0A 3D36A 3E8FA 4WF9V 1FXKB 3SYOA 4QNHB 3W7XA 5KA5A 2XAFA 4FPPA 5H9CA 1NKDA 1K5QA 5IDJA 3CCRV 2H94A 1OCRB 3AG3B 3ASNC 1EFRG 2EIJB 1AJNA 3SYPA 1NJIW 3E2EA 1AI6A 3WFVA 2ZR3A 1PD3A 4J9ZB 3W7SA 5CMUA 1Y4MA 5EC1C 1K9MW 3WG7C 4U7OA 1FXVA 2IJHA 3R65A 1K4CC 2PI4A 4P9OA 3JD2A 4UVCA 2MK3A 4H33A 3CCSV 1M1KW 1QCEA 3QO7A 3TCUA 4TWKA 2HG5C 1BMFG 3K04A 1SZTA 5CBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K06 A;  3SYC A;  3UM7 A;  4JTC B;  4MW3 A;  2Q68 A;  3K0G A;  3OR6 C;  1J95 A;  1OCZ C;  5CBG A;  2WLM A;  3ZJZ A;  2HFE C;  4MVQ A;  2WLH A;  3K0D A;  3OUS A;  1S5H C;  2W0F C;  3SPC A;  2Q67 A;  4HZ3 A;  1R3K C;  2HJF C;  4ZBM A;  3HPL C;  4JTD B;  4MVS A;  3IGA C;  2WLI A;  4XDJ A;  2WLL A;  4MTO A;  3E8H A;  2P7T C;  3E86 A;  3F5W C;  4PDM A;  5J9P C;  2WLJ A;  4QE7 A;  4MVO A;  3AG2 C;  3ABL C;  5E1A C;  2H8P C;  3K04 A;  5EBW C;  2X6C A;  4PA4 A;  4X89 A;  4OXS A;  3SPI A;  4GX1 A;  2ZD9 A;  4P9P A;  3TET A;  4LP8 A;  4H37 A;  2Q69 A;  2QTO A;  2IH3 C;  2WLI B;  2ITC C;  4GX5 A;  2WLL B;  4CBC A;  2BOC C;  2WLK A;  2YEV A;  4WFG A;  2QKS A;  2DWE C;  3ASO C;  5EBL C;  4RO2 A;  2Q6A A;  2Y69 C;  3T4D A;  3E89 A;  4PDR A;  1KKD A;  4GX0 A;  2K1E A;  2ITD C;  4MVR A;  4UUJ C;  1LNQ A;  2OCC C;  3PJS K;  1V54 C;  3BEH A;  1R3I C;  4HYO A;  4LCU C;  4XDK A;  3RVZ A;  3ZRS A;  4EKW A;  1OCO C;  3RW0 A;  3AG4 C;  1JVM A;  2DWD C;  4F4L A;  4J9Y B;  3T1C A;  3JYC A;  2EIK C;  4WFH A;  3FB6 C;  4G28 B;  4MS2 A;  1P7B A;  3ABM C;  4MVZ A;  1OCC C;  3X2Q C;  5B1A C;  4QE9 A;  3F7V C;  1V55 C;  2A0L A;  3E83 A;  4I9W A;  4R6Z A;  4WFE A;  5EK0 A;  4X8A A;  4MTF A;  1BL8 A;  4RAI A;  4RUF A;  4G27 B;  2EIM C;  2AHY A;  4PA6 A;  2EIL C;  4JTA B;  4PDV A;  1XL4 A;  4KFM A;  1XL6 A;  4LBE C;  1K4D C;  4MVU A;  4PA3 A;  3SPH A;  3SPG A;  3K08 A;  3LDD A;  4MTG A;  5EC2 C;  3T4Z A;  1G4Y B;  4MVM A;  4DXW A;  1ORQ C;  3UKM A;  3RVY A;  3GB7 C;  1OCR C;  2X6A A;  2AHZ A;  3AG3 C;  4PDL A;  4XDL A;  3SJQ C;  3SPJ A;  5IY5 C;  4P30 A;  2A79 B;  3FB7 C;  4PA7 A;  4R8C A;  2DYR C;  2A9H A;  3RBZ A;  5EBM C;  5BZB A;  4WFF A;  2X6B A;  3IFX A;  4P2Z A;  4GX2 A;  3STL C;  2NLJ C;  3LNM B;  3OUF A;  3EFF K;  3E8F A;  3SYO A;  4QNH B;  1QLE C;  1M56 C;  3AG1 C;  3FB5 C;  2DYS C;  5KUK A;  4RUE A;  2WLN A;  3ABK C;  3LUT B;  4X88 A;  4MW8 A;  3LDE A;  2HVK C;  3OGC C;  4R50 A;  4BW5 A;  2HVJ C;  2R9R B;  3ASN C;  3E8B A;  3E8G A;  3OR7 C;  3SYQ A;  3LDC A;  4MSW C;  2JK5 C;  3SYP A;  4R7C A;  4J9Z B;  1R3J C;  3FB8 C;  2ZXW C;  2EIN C;  4PA9 A;  1M57 C;  3VOU A;  5EC1 C;  1R3L C;  3STZ C;  3WG7 C;  5CBF A;  2KB1 A;  2ATK C;  2EIJ C;  3K03 A;  5B3S C;  3R65 A;  1K4C C;  3T2M A;  5KUM A;  4P9O A;  2IH1 C;  4H33 A;  3SYA A;  1ZWI C;  2BOB C;  5B1B C;  3KG2 A;  3TCU A;  4TWK A;  2HG5 C;  3F7Y C;  5CBH A; 
#chains in the Genus database with same CATH topology
 3ETQ A;  1QR9 A;  3OD4 A;  3RYH B;  4YHH O;  4QIW F;  5H6R A;  3UM7 A;  4LWS B;  1IBK O;  3OGI B;  3E22 A;  3OR6 C;  1K73 W;  3B77 A;  3K0D A;  3OTO B;  1F7Y A;  4JYB A;  5LGN A;  1Q82 W;  1R6N A;  5FLX N;  1KUQ A;  1I5Y A;  1OZ0 A;  1ZLZ A;  1QBZ A;  3E86 A;  2QDO A;  4AQY B;  4UCV A;  1PKX A;  5E1A C;  1BS3 A;  2IU0 A;  2Y69 B;  5BMV B;  1NR7 A;  1H2S B;  1EN4 A;  3D8C A;  4J10 A;  4X62 B;  4EEQ A;  1N36 B;  3AG4 B;  1RFY A;  2ITD C;  1PP9 H;  3ZX6 A;  4LH7 A;  3RVZ A;  1FAF A;  4MS2 A;  1P7B A;  1R1B A;  3K3W A;  5KLV H;  2GHY A;  4B3T O;  4J7Z A;  3HKE A;  1RM1 B;  1I7F A;  4DUZ B;  2AHY A;  5IY5 B;  1K4D C;  3QG5 A;  1WPB A;  1XMQ O;  4DXW A;  2VS0 A;  2UUA B;  2VWK A;  3LSU A;  4P30 A;  4FLY A;  4PA7 A;  2DYR C;  1N4C A;  1LUV A;  1OHH G;  3BA9 A;  3ML0 A;  4QPJ A;  4UXN A;  2KG7 A;  2HHH B;  3T1H B;  5KUK A;  5LP6 B;  1Y74 B;  3WB1 A;  3CME V;  4PHZ A;  3FX7 A;  1FXK C;  3LNN A;  1VQM V;  5EIB D;  5JJE B;  1TUE B;  1BZK A;  4EB6 B;  4D7S A;  2EIJ C;  4IHJ A;  3T2M A;  4DV1 B;  1L0N H;  1PNL A;  1NVP B;  1VQ8 V;  1CP9 A;  4I9Q A;  2B1I A;  3T1Y O;  4TV9 B;  4J11 A;  2KKW A;  2AZ0 A;  2UXD O;  2GUZ A;  4JTC B;  1N32 B;  3HKB A;  4TOI A;  2ARH A;  3ZJZ A;  5EYP B;  4DW0 A;  3ABL B;  3HPL C;  5LOV B;  5E79 Z;  4JGS A;  3P30 A;  2ADQ B;  2JJ1 G;  2P7T C;  1YHQ V;  2BSK B;  1IBM O;  3JD1 A;  4MVO A;  4O4L B;  5FNV A;  5KX5 B;  2L6L A;  2E75 B;  3PN1 A;  4FMT A;  3H1J H;  3ASO C;  4NVP A;  4O4J B;  4FFK A;  1BE3 H;  2CTP A;  4FFB B;  1MSW D;  5KHK A;  2FL4 A;  4OPA A;  3G71 V;  3HB3 B;  3Q4H A;  1MMM A;  2ZE7 A;  3I5D A;  3X2Q C;  3E83 A;  2QJ1 A;  4DR3 O;  3QO5 A;  2JIZ G;  4KUM A;  1SES A;  4TUY B;  2JDI G;  4DR4 B;  2E5L O;  3IAY A;  1XL4 A;  4LBE C;  1XEQ A;  1AVM A;  5GTI Z;  3K08 A;  2JVD A;  4TV8 B;  4JI6 O;  2WSS G;  5KAI Z;  3RVY A;  3JAR A;  2QWO B;  4DV2 B;  5HFL A;  2YSU B;  3H9V A;  4DV6 B;  1HR0 O;  3M7M X;  3P32 A;  3QF7 A;  4RUE A;  4H44 B;  4GT1 A;  4I4T A;  3JAM N;  4O4H A;  4DV3 O;  4NTW A;  4RQE A;  3FB8 C;  2ZXW C;  3K57 A;  1K97 A;  1M57 C;  2XAG A;  3VOU A;  4LF4 O;  2X0L A;  4WFB V;  3A2F A;  4UB6 Z;  1SQX H;  1XIL A;  3D36 C;  3SYA A;  1GN6 A;  4CH4 A;  1OCZ B;  1Y66 A;  5GTH Z;  2Y0I A;  3K0G A;  4QPK A;  4FLX A;  4GKK O;  4YY3 O;  1XBL A;  4H13 B;  5IT9 N;  5GON A;  3AG2 B;  4BIO A;  5FPO A;  1VQ6 V;  4MVS A;  3TXS A;  2UXB B;  4CC6 A;  1Q7Y W;  2IU3 A;  1F51 A;  3SPI A;  3CC2 V;  4P9P A;  5IJ9 B;  4IYI A;  3BY6 A;  3M99 B;  1AR5 A;  3HKC A;  4LFB O;  2QKS A;  2DWE C;  2WPD G;  1TUB B;  1NH2 B;  4FM2 A;  2R9A A;  3AK2 A;  3W7W A;  2PYL A;  2YS8 A;  4LF8 O;  2XTA A;  1V54 C;  3TGU H;  2JRI A;  2CH7 B;  1JJ2 U;  1K92 A;  3VBB A;  4WBN A;  3K58 A;  4WFE A;  1BL8 A;  4PD4 F;  2Y4T A;  1FD9 A;  3B8M A;  2QWP B;  4LF5 O;  2CAZ C;  5LBQ A;  3VQX A;  4KFM A;  4X20 A;  2F93 B;  1NBM G;  2ZCE A;  1M9N A;  2X6A A;  5CA0 B;  4JAV A;  3SPJ A;  1FYJ A;  4TQD A;  1WA8 A;  1ZAU A;  2A9H A;  3RBZ A;  2N05 A;  4P2Z A;  3CPW U;  2QKC A;  3ZMU A;  3SJC C;  1YF2 A;  2F95 B;  2HVK C;  2PTM A;  1MZF A;  3LDC A;  4MSW C;  5IE9 A;  1DF5 A;  2A7W A;  5LXT B;  3JCZ A;  4LWS A;  2EJ7 A;  1XRE A;  5JCO C;  1JX9 A;  2DQ0 A;  1YTF D;  2LGW A;  1ZWI C;  5LHI A;  4BWA A;  2Y4U A;  5C8Y B;  4FM1 A;  4J42 A;  1VQN V;  4NTX A;  2PF4 E;  2WLM A;  1W0J G;  1G8M A;  2EIN B;  1YI2 V;  3OFN G;  3ZMS A;  3VQY A;  1RSO B;  1B06 A;  5BMV A;  1Q90 D;  3CP1 A;  4XDJ A;  5CN0 A;  4I55 B;  4PDM A;  2F23 A;  1XDC A;  2QM7 A;  2V4D A;  4DV4 B;  4AHC A;  1G6U A;  1QQC A;  4LP8 A;  4H37 A;  2IH3 C;  1FJG B;  3SJA C;  4LFA B;  3B40 A;  1XHX A;  2F66 C;  1XNQ B;  1FFT B;  1TGO A;  2ZNJ A;  5F2V O;  1QVG U;  3G67 A;  2GUZ B;  1FKA O;  2Q0O C;  1S76 D;  2EIK C;  2BCC H;  1K8A W;  1N33 B;  1AR4 A;  2RQ6 A;  3ZRX A;  1N0J A;  2UUB O;  2PGG A;  1BQZ A;  2QKA A;  4CS3 A;  2VQF O;  4PDV A;  3QVN A;  1Q6U A;  2LW7 A;  2DYR B;  5FNV B;  1SS3 A;  1SRY A;  2OCH A;  3DC6 A;  3UKM A;  5LP6 A;  1Y74 A;  3AG3 C;  4JAU A;  3WU2 Z;  2AGA A;  2Z5U A;  4X66 O;  4JV5 B;  4GX2 A;  1I94 B;  2PY5 A;  4NXN B;  1NI8 A;  3MD0 A;  1FXK B;  1M4U A;  1Q6I A;  4EB6 A;  5H9C A;  5K1P A;  4DV5 O;  1K5Q A;  1YXB A;  1EFR G;  2EIJ B;  1JFF A;  3SYP A;  1AI6 A;  4TV9 A;  3WFV A;  1PD3 A;  4J9Z B;  4IGG A;  4B7K A;  5EC1 C;  3WG7 C;  4BW9 A;  2F4V O;  2P06 A;  3FFQ A;  2OIE A;  3JD2 A;  1PM9 A;  2ZIO A;  1M1K W;  4DR1 B;  3TCU A;  4TWK A;  3DC5 A;  5LOV A;  2HG5 C;  1BMF G;  3N2K A;  2ZE8 A;  5CBH A;  3ASN B;  2P6J A;  3JAW A;  4JYA O;  4ZI7 B;  2BSK A;  3JAR B;  1J95 A;  4FLW A;  2PZS A;  4X1K B;  5KX5 A;  1JCH A;  1R3K C;  1YZB A;  2IJJ A;  4MTO A;  1ZTE A;  4J41 A;  4O4J A;  2UXN A;  3ASO B;  2V1D A;  2KQX A;  2P22 C;  2ZE5 A;  4I4T B;  3RGB A;  2XAQ A;  4FFB A;  4LF7 B;  2WLI B;  4TQF A;  2WLL B;  4CS2 A;  2PYJ A;  1SER A;  3ZRV A;  4JI4 B;  3T4D A;  1NR1 A;  2OCC C;  3ZED A;  4NXM B;  4TUY A;  3QTC A;  4AI8 A;  1F23 A;  2GSM B;  4TV8 A;  2VWJ A;  1GRJ A;  3ABM C;  2QA4 V;  1F4N A;  5EK0 A;  1GN4 A;  4RUF A;  4JI1 O;  3SJB C;  1TVK B;  3THO A;  2EIL C;  5IWA O;  1IBK B;  4IYH A;  2ZDI A;  3UCS C;  1VQ5 V;  2RDC A;  2YIC A;  4Q6G A;  3FB7 C;  1ARO P;  5LGU A;  3TK1 A;  3CRC A;  3OUF A;  4J7K A;  1BHB A;  1D5N A;  1QLE C;  1M56 C;  3CE2 A;  2DQ3 A;  3ZHV A;  1FXH A;  3ABK C;  3CCJ V;  1NZ6 A;  4W4K A;  4XBF A;  1XI1 A;  1M57 B;  1T5E A;  2CTQ A;  5LGT A;  3OR7 C;  1DF4 A;  2ODM A;  1VF6 A;  2Y48 A;  4JI0 O;  3JD0 A;  4FIP C;  4WBN B;  2HP8 A;  4I7Z B;  4OPH A;  4JI8 O;  1PPJ H;  3OAA G;  2EZP A;  5CBF A;  4Q20 A;  3K03 A;  2AZ2 A;  3CC4 V;  4Z1V A;  3CJH B;  2ZM6 B;  1H38 A;  5FPR A;  4B3T B;  1Q81 W;  1HNZ O;  1UPG A;  3WB0 A;  1GO3 F;  1WLE A;  2LP7 A;  3U11 A;  3CCV V;  2ZQM A;  2ZR2 A;  3B8N A;  4JTD B;  5B1B B;  3O65 A;  1TUB A;  4QE7 A;  1SET A;  1GN3 A;  4GX1 A;  3K9A A;  5CB4 B;  2ILM A;  3TJT A;  2CH7 A;  1VMG A;  2QE7 G;  1R73 A;  4NTY A;  2Q6A A;  1URF A;  2Q7G A;  1KMI Z;  1Q8I A;  2JGU A;  4EFE A;  1A32 A;  3AK3 A;  5IYC O;  1M5I A;  5L3C A;  2QWQ B;  4MTX A;  4K35 A;  1CXZ B;  4LFC B;  3F7V C;  4B3R B;  4UCU A;  1AI7 A;  5CA0 A;  2EX3 A;  4JI3 O;  5C93 A;  2QGN A;  4X64 B;  2UXD B;  5LL6 Y;  4PA3 A;  2NNU A;  3RWR D;  5J2T A;  1IXM A;  4G2K A;  1XUQ A;  4PDL A;  3ZMZ A;  1HNW B;  2FML A;  3ZCC A;  1Q3E A;  4K3A A;  5BR8 B;  3LSQ A;  4WFF A;  2N74 A;  4FZ0 A;  2YXH A;  5LXT A;  4O4I A;  4CH3 A;  1IZ3 A;  3NXS A;  3CYO A;  3CX5 F;  4C7U A;  2NR5 A;  3QO8 A;  3E8B A;  4PEL A;  4DUY B;  4LF6 B;  1I5X A;  4GKJ B;  3KCY A;  2WA4 A;  5C8Y A;  5DED A;  2JS3 A;  3AG7 A;  3O9O A;  1RSO A;  4KL1 A;  1AP6 A;  3OEH G;  2XT9 A;  4F6R A;  3K06 A;  2HLD G;  1OV9 A;  5LYJ B;  1JQ0 A;  4I55 A;  4DYL A;  2GDS A;  1MA1 A;  1QLN A;  3EXA A;  1QR8 A;  4ZHQ B;  2W0F C;  3SPC A;  1ZL8 B;  4E2L A;  2O57 A;  1VEW A;  3CXC U;  1PL0 A;  1N8R W;  1FPO A;  4UV9 A;  2QEX V;  1AIL A;  1BHA A;  1JFF B;  2YIB A;  1R6T A;  1EM1 A;  1VQK V;  1HR0 B;  1RPO A;  4DR2 O;  1DTO A;  3OTO O;  1TAE A;  3HR0 A;  1MNG A;  4GX0 A;  5EIB C;  1XQ8 A;  2EIK B;  3JAT B;  4O2B A;  4AQY O;  1WP8 A;  3VQV A;  3L71 H;  5A9G A;  3N2K B;  4HNA B;  3B09 A;  4HBN A;  1OCO C;  3JAW B;  4BIZ A;  3ZHQ A;  4IIJ B;  1OCC C;  5B1A C;  4X62 O;  2A0L A;  1U97 A;  4DV0 O;  2YXY A;  4OX9 O;  3P3N A;  3W7T A;  2RJZ A;  5B1N A;  3IC7 A;  3SPG A;  2Q0A A;  1FXK A;  1ORQ C;  3CRQ A;  3OMI B;  5AG2 A;  2QSA A;  4K0K O;  1KKC A;  1PNM A;  2PUS A;  3IFX A;  3CCQ V;  3STL C;  3CRA A;  3AG1 C;  2CE4 A;  2DYS C;  2WLN A;  3M8A A;  3LDE A;  1HNX B;  2NN4 A;  2CK3 G;  4JF3 A;  3WG7 B;  2UUA O;  5CA1 B;  2CGN A;  4X1I A;  2QM4 A;  1AI4 A;  4ZI7 A;  3CB2 A;  3G6E V;  2ATK C;  3E35 A;  5B3S C;  4X1K A;  3OMN B;  2HHH O;  1YIT V;  5DEC A;  1HW7 A;  4L8J A;  1E79 G;  2W0X A;  3F7Y C;  2P67 A;  3NR7 A;  4BAY A;  4JI2 O;  4FLZ A;  4MW3 A;  3UO3 A;  4TSF G;  2CDY A;  1EBO A;  2R9I A;  4LF5 B;  2OT5 A;  4X9Q A;  3W7U A;  4BR6 A;  3RYI B;  2WLI A;  4DV1 O;  2WLL A;  3ABU A;  3E8H A;  3A0R A;  1L8D A;  3F5W C;  3DGE A;  4B3S O;  1N34 B;  1P4R A;  2LQT A;  4J7J A;  2IW5 A;  1N32 O;  4OXS A;  1JPX A;  4HAM A;  2LFS A;  1P49 A;  5JWP A;  3G4S V;  1J5E B;  3DTU B;  4Z2W A;  2K1E A;  2LO1 A;  3CHX A;  2Q7E A;  3BEH A;  2LFR A;  1R3I C;  2JEU A;  1TVK A;  4DV7 B;  1GN2 A;  2YID A;  1Z5W A;  3FB6 C;  3CCE V;  5LA6 B;  3K79 A;  4R6Z A;  1FS0 G;  4YIP A;  1AI5 A;  2EIM C;  3FAV B;  2FYU H;  2DJV A;  2Q5Z A;  4JTA B;  4LC1 A;  1YCI A;  2YI8 A;  2OTJ V;  4DR6 O;  2EUL A;  4DR7 B;  3B4S A;  1M56 B;  2VQE B;  1E1R G;  1V55 B;  2QTS A;  3ETE A;  5LMN O;  3LNM B;  4NB5 A;  3D36 A;  3E8F A;  2ZKO A;  4QNH B;  4DR4 O;  2XAF A;  2Q4P A;  4FPP A;  5TIS Z;  3UQ8 A;  2YXL A;  2UUC B;  1OCR B;  2YDE A;  3K5L A;  1AJN A;  1W59 A;  1NJI W;  4DV2 O;  1U96 A;  3CJH A;  1VAR A;  4FLU A;  5BXZ A;  1BSM A;  5CMU A;  1K4C C;  4LNU A;  1XMO B;  4P9O A;  4UVC A;  4H33 A;  4UCR A;  1QCE A;  3QO7 A;  2YC0 A;  5JVD B;  5J2T B;  3K04 A;  1SZT A;  1Q5O A;  1NU1 H;  4CC5 A;  5B5E Z;  1WPX A;  3I56 V;  3RFR A;  2UU9 B;  2Q67 A;  4ZBM A;  5CB4 A;  1NTM H;  4O4I B;  4IT5 A;  4JPR A;  1Q6H A;  3AEI A;  3CD6 V;  3TXQ A;  5ITZ A;  2UXX A;  2YIA A;  4GX5 A;  4RO2 A;  3UT5 A;  1KKD A;  1E1Q G;  3GWK C;  1VQO V;  1LNQ A;  1RM1 C;  1M90 W;  2UXB O;  1Q43 A;  4F6R B;  1GKF A;  3K59 A;  3H1H H;  4UVB A;  2IJI A;  4J9Y B;  1K3E A;  1H2K A;  4B3M B;  4EFB A;  4X8A A;  3SGI A;  2EBO A;  4K8X A;  5IYD O;  1MOF A;  3GWO A;  2CGO A;  1VP7 A;  3ZIA G;  1NVP D;  4JZG A;  4LF9 O;  1LR1 A;  2B5U A;  3IJ4 A;  1CEZ A;  5FL7 G;  5BZB A;  2B1G A;  4JI7 B;  4FZ1 A;  3H1I H;  1P7G A;  4O2B B;  3C90 A;  4DR5 B;  4MW8 A;  5L3D A;  2Z3Y A;  2HVJ C;  2ZIN A;  4RQF A;  3ZRW B;  4R7C A;  4YJ3 B;  2R70 A;  1BGY H;  1TA8 A;  4PA9 A;  5LYJ A;  1UFI A;  5B1O A;  3BHP A;  5KUM A;  4ASU G;  4ZHQ A;  3CCU V;  1ZL8 A;  1SQF A;  3JSN A;  2XOK G;  3SYC A;  2Q9L A;  1LUW A;  3BAA A;  3ETD A;  4UB8 Z;  2XHB A;  2UXC B;  2HJF C;  5IWA B;  1SKV A;  1EZJ A;  4ICG A;  2DN9 A;  1KP3 A;  5JJJ B;  5EBW C;  4PA4 A;  3JAT A;  3J80 N;  4X1I B;  4HNA A;  4ABM A;  2Q69 A;  3BCC H;  1OCO B;  4IIJ A;  3HKD B;  1Z5V A;  3D3Q A;  1Y6X A;  1YDX A;  3B2E E;  1XNR B;  3K5N A;  1OCC B;  4DV4 O;  5B1A B;  1YJN V;  3ZRS A;  1D2D A;  5LMU B;  2HKO A;  4JI8 B;  2FKX A;  3OW2 U;  5KMG B;  4WFH A;  3ABT A;  3JAS B;  1FJG O;  3A0B Z;  3CWB H;  2RN9 A;  4MTF A;  2ZT9 B;  4LFA O;  1Y67 A;  3AK1 A;  3OEE G;  1XNQ O;  1GM8 A;  1IBL O;  1GTO A;  4PA6 A;  2BTQ B;  4NR1 A;  1Q86 W;  2Q8V A;  4MVU A;  1XL6 A;  3CS5 A;  3ZHR A;  1FFX A;  3LDD A;  1QNM A;  4D6T H;  3SJQ C;  3A0H Z;  1VQ4 V;  3MHH C;  3X2Q B;  5L3E A;  5IYZ B;  1N33 O;  5CA1 A;  3ZN0 A;  4FJC C;  1VQ9 V;  5EZY B;  3IC9 A;  4FLV A;  1AR1 B;  4R50 A;  4BW5 A;  4UCT A;  4JI5 O;  4YHH B;  1QVF U;  3JSL A;  2JK5 C;  2GBO A;  2A06 H;  1K33 A;  5H2F Z;  2DMX A;  2H3O A;  1KQS U;  1O9G A;  4JV5 O;  1I94 O;  4NXN O;  1VQ7 V;  3STZ C;  1JOY A;  1NH2 D;  3WB2 A;  2IH1 C;  4BIU A;  1O9H A;  3RYI A;  4YIO A;  4I50 B;  1W2B U;  2ZXW B;  3JAK A;  3OUS A;  1YSC A;  2JGD B;  2ZE6 A;  3RYC B;  3K5O A;  2GTS A;  3ETG A;  4DR1 O;  1WP7 A;  4FLT A;  3TET A;  2B9Z A;  2WLK A;  2YEV A;  5LHG A;  2JJ2 G;  3E89 A;  5DM6 V;  1D5A A;  1IDS A;  4LNU B;  5LA6 A;  4A5U B;  4UUJ C;  4UCO A;  1RPR A;  3FAV A;  1XMQ B;  1G1X B;  3ZS8 C;  5GW7 A;  4YJ2 A;  2DWD C;  3G6B A;  2KSD A;  2EIM B;  1I0H A;  4PI2 A;  2W6I G;  1W0K G;  1PV0 A;  1B04 A;  4JI4 O;  4RAI A;  1Z2G A;  1V54 B;  1KD1 W;  2HR3 A;  3FYE B;  4U3F H;  3L72 H;  5ITZ B;  3GB7 C;  1SQP H;  2E3C A;  2CTW A;  2E76 B;  1GM7 A;  2N04 A;  3UT5 B;  3EFF K;  5JQG B;  5H5N A;  3T1Y B;  2WWW A;  4DR2 B;  2R9R B;  4W4L A;  1S5L Z;  4DRX B;  5JVD A;  4DW1 A;  1B3Q A;  1YIJ V;  1GMG A;  3CRR A;  2EIN C;  1MG1 A;  4I0X B;  1IXB A;  2D2C B;  3KZI Z;  1WB7 A;  2P5O A;  2BOB C;  4KHP O;  1IBM B;  2YIB D;  5CA3 A;  2M6Y A;  5K1X A;  3OMA B;  3I55 V;  4DV0 B;  4OX9 B;  3FYI B;  3K5M A;  3CMA V;  4D7T A;  4GYC B;  4J80 A;  1KYO F;  4K0K B;  2WLJ A;  3KCX A;  2ZM6 O;  4O2A A;  4JYC A;  1COW G;  3DXR B;  2IBZ H;  2XND G;  4DR3 B;  2IM9 A;  1S3J A;  1YTF B;  3L75 H;  2E5L B;  4PV1 B;  3P3P A;  4GLX A;  4HYO A;  1EN6 A;  4X65 O;  2W6J G;  4JI6 B;  1SF9 A;  5IYB O;  3OE7 G;  3CC7 V;  2LGQ A;  5B66 Z;  4KP4 A;  4F6E A;  2EZO A;  2G38 A;  1SQG A;  1ROP A;  4JI2 B;  3SPH A;  3BPZ A;  3OM3 B;  4MTG A;  5EC2 C;  2ETN A;  1VIB A;  2P4K A;  1JA8 A;  2V7Q G;  4LFC O;  4DV3 B;  5BY1 A;  4B3R O;  4LF4 B;  3ZRW A;  3BAB A;  4B3S B;  2LW1 A;  4U3J B;  4WF9 V;  1M93 A;  2XUM A;  4YJ3 A;  3SYO A;  3J7A U;  4X64 O;  2YI9 A;  1N36 O;  2H94 A;  3AG3 B;  3GVM A;  3ICX A;  1SC5 B;  3ASN C;  4CH6 A;  1HNW O;  4GKK B;  5BR8 O;  4YY3 B;  5D5P A;  1Y4M A;  4AIL C;  4U7O A;  3N27 A;  4UFZ A;  1FXV A;  3R65 A;  3OT7 A;  2HJD A;  2MK3 A;  2ZIM A;  4H0L B;  1FFX B;  4DUZ O;  3MDS A;  4FK5 C;  3OTF A;  4DUY O;  4LF6 O;  1DGS A;  3L74 H;  4GKJ O;  4E4E A;  4PJ0 Z;  5CBG A;  1DLB A;  3JAL A;  1S5J A;  1HP8 A;  2JEX A;  4LFB B;  1ZUQ A;  2RMK B;  4LF8 B;  4DR6 B;  1I08 A;  3RT3 C;  3HKD A;  2H8P C;  4CH5 A;  3T1H O;  4CS4 A;  4X89 A;  2RCV A;  5LMN B;  1K7D A;  1AP5 A;  2ITC C;  2AXT Z;  5KAF Z;  1IVS A;  5JJN B;  5KMG A;  3JAS A;  3U0Z A;  3VQW A;  4CZZ A;  3PJS K;  4U7N A;  1GM9 A;  4XDK A;  4EKW A;  5IJ0 A;  2BTQ A;  3L70 H;  5L3F A;  5JH7 B;  3JYC A;  2EJR A;  2Q73 A;  1YJW V;  3JAK B;  1NTK H;  1XHZ A;  3ZHS A;  4X1Y B;  2OCC B;  5IYZ A;  1KBH A;  4ZOL B;  1S72 V;  5EZY A;  2QR4 A;  5J2U B;  2AHZ A;  4XDL A;  3ABM B;  2P4V A;  3A8T A;  4FVM A;  4R8C A;  2YEV B;  2F43 G;  1RP3 B;  2NLJ C;  3R66 A;  2EIL B;  3FB5 C;  3N2G A;  3H01 A;  4YJ2 B;  3E8G A;  3SYQ A;  2IJK A;  4TT3 G;  1R3J C;  1VQP V;  4I50 A;  1L1F A;  1R3L C;  3J81 N;  1QLE B;  2XAS A;  3ABK B;  1V9P A;  1XOU A;  4QGP A;  5B1B C;  3KG2 A;  3ZBH A;  5KA6 A;  2JGD A;  3EVK A;  5KHG A;  1HNX O;  3RYC A;  3CCL V;  1AJP A;  1BCC H;  1EN5 A;  2HFE C;  4GCZ A;  1JJO A;  5LHH A;  4LF9 B;  4HZ3 A;  3RYF A;  4YXW G;  2ZNI A;  2FB5 A;  5KHJ A;  1SQV H;  4LH6 A;  5J9P C;  1Y76 A;  3E22 B;  4DV6 O;  2L35 A;  5HFM A;  2X6C A;  3SDL A;  3EHB B;  3ZHT A;  2OIG A;  1H2M A;  4CBC A;  1QU7 A;  2BOC C;  5EBL C;  2WAM A;  2GTA A;  2Y69 C;  3LSS A;  2UUB B;  2M7W A;  2DW4 A;  3CRM A;  4MVR A;  2VQF B;  4GZR B;  1N34 O;  1HDJ A;  4LCU C;  1KU9 A;  1S77 D;  4UV8 A;  1NQT A;  1UJW B;  3AG4 C;  2DE0 X;  1EZV H;  3T1C A;  4G28 B;  1PL4 A;  2QM8 A;  1SA0 A;  2VRZ A;  4X66 B;  4I9W A;  1KEC A;  2Y0P A;  1J5E O;  2P90 A;  3MHS C;  4JZ2 A;  2WA3 A;  4DV5 B;  3S3X A;  3BFR A;  2CTR A;  3T4Z A;  5JQG A;  3RYH A;  1S0V A;  1H2G A;  1B6Q A;  4O2A B;  4NKG B;  4DV7 O;  5IY5 C;  3HKE B;  2MW2 B;  4N23 A;  5EBM C;  2X6B A;  4DRX A;  1VF5 B;  2CUG A;  4FM0 A;  1DK1 A;  2F4V B;  2FTK A;  1WB8 A;  3CCM V;  4I0X A;  3LUT B;  4X88 A;  2C2A A;  3FKS G;  1YVW A;  2F1M A;  4JYA B;  1H2L A;  1X59 A;  4WCE V;  4DR7 O;  3CEI A;  4RWU A;  2VQE O;  1P84 F;  5LP6 C;  4GUN A;  3BRC A;  2KG7 B;  4LR3 A;  3APQ A;  1YEW A;  5JCO A;  1NS1 A;  3S3W A;  4K8Z A;  5DN6 G;  2UUC O;  3CXH F;  1F4M A;  2Q68 A;  4IHJ B;  2JS5 A;  1N0N A;  1IBL B;  2WLH A;  1S5H C;  1YJ9 V;  1NT2 B;  3DXR A;  2XAH A;  1XMO O;  5D5Q A;  3H1L H;  4JYY A;  1X4T A;  3HKB B;  3ABL C;  4IL6 Z;  1JR9 A;  1GH6 A;  2UU9 O;  1CPY A;  3JCU Z;  4WFG A;  4JI1 B;  4OGQ B;  2ADP A;  4JI5 B;  1MAB G;  2AW9 A;  4B08 A;  3RW0 A;  3UO2 A;  4WFA V;  1BT8 A;  4F4L A;  1WJZ A;  3ZN1 A;  3JAL B;  1THZ A;  1WAZ A;  2K9P A;  1SZX A;  4U3J A;  2BTO A;  3Q4H B;  3JD4 A;  1KP2 A;  1G4Y B;  2HEP A;  3L9D A;  4JI0 B;  1SQQ H;  4Z1M G;  2E74 B;  1GAX A;  3ZMV A;  2A3Q A;  4B3M O;  5EYP A;  1KB9 F;  5KHH A;  4I5S A;  2OTL V;  3H1K H;  1GK9 A;  1HWY A;  4O4L A;  3OGC C;  3FD9 A;  4NYK A;  5IJ0 B;  2ZDI C;  3C3S A;  1L0L H;  1NTZ H;  1KC8 W;  1HNZ B;  2D3O W;  2X7R B;  1R6K A;  3G80 A;  1JMK C;  4JI7 O;  4JAS A;  2KB1 A;  3AG1 B;  2DYS B;  3BVO A;  1OJH A;  2Z0A A;  3SR2 C;  5L3G A;  4DO2 A;  4DR5 O;  4O4H B;  2QWN B;  3K9S A;  1OCZ C;  4MVQ A;  1VF6 C;  2OWO A;  4DK0 A;  1H8E G;  5B3S B;  4L87 A;  3IGA C;  3MAQ A;  3N2G B;  3C3T A;  3AG2 C;  1ENV A;  4MT8 A;  3RN4 A;  1VQL V;  1MSD A;  1ZX3 A;  5GON B;  2ZD9 A;  2QWR B;  2QTO A;  3JD3 A;  3ZMT A;  2UXC O;  5JH7 A;  1K34 A;  4PDR A;  2LJ2 A;  4JI3 B;  4ZKI A;  4JAA A;  1H8H G;  4B7E A;  1K5S A;  4X1Y A;  3QNE A;  5KHI A;  2GV9 A;  1JVM A;  3HKC B;  4ZOL A;  5L3B A;  1SQB H;  3KKY A;  4UCS A;  1AJQ A;  1IUR A;  4QJF B;  4MVZ A;  4QE9 A;  1V55 C;  5J2U A;  1MZE A;  3RYF B;  4KHP B;  1WNS A;  4G27 B;  2OYQ A;  2YUA A;  1PNK A;  1XNR O;  1Y76 B;  4N21 A;  2PI5 A;  5H6Q A;  4MVM A;  5LMU O;  4DK1 A;  3CSX A;  1OCR C;  1US6 A;  3D3I A;  2A79 B;  2BE3 A;  3ZHU A;  3BA8 A;  2RNB A;  2XAJ A;  4UVA A;  4X20 B;  1AB3 A;  4LF7 O;  2Q7H A;  3W7X A;  5KA5 A;  1NKD A;  3U10 A;  2DOS A;  1WA8 B;  5IDJ A;  3CCR V;  2R72 A;  1BQ0 A;  3L73 H;  4NXM O;  3E2E A;  4ZIB A;  5IJ9 A;  4PI0 A;  1VF7 A;  2ZR3 A;  1QHT A;  1SA0 B;  3W7S A;  1H2N A;  1K9M W;  4KXR A;  2IJH A;  3DSQ A;  2PI4 A;  4X65 B;  3CCS V;  1IX9 A;  5A2Q N;  1ZSP A;  3APO A;  3F5T A;  1WN7 A; 
#chains in the Genus database with same CATH homology
 3ASN B;  2P6J A;  1QR9 A;  4FK5 C;  4QIW F;  5H6R A;  3UM7 A;  3OR6 C;  1WPX A;  1J95 A;  5CBG A;  1DLB A;  3I56 V;  1K73 W;  3B77 A;  3K0D A;  2JEX A;  1JCH A;  2Q67 A;  1R3K C;  4ZBM A;  4JYB A;  5LGN A;  1Q82 W;  1R6N A;  1I5Y A;  2IJJ A;  1OZ0 A;  4MTO A;  1QBZ A;  4JPR A;  3E86 A;  1PKX A;  2UXN A;  3AEI A;  5E1A C;  2H8P C;  2V1D A;  3ASO B;  2IU0 A;  3CD6 V;  2Y69 B;  4X89 A;  2XAQ A;  1K7D A;  1NR7 A;  2UXX A;  2WLI B;  4GX5 A;  2ITC C;  2WLL B;  1SER A;  4RO2 A;  3ZRV A;  3T4D A;  1KKD A;  1NR1 A;  3AG4 B;  1E1Q G;  1VQO V;  2ITD C;  1LNQ A;  2OCC C;  4CZZ A;  1RM1 C;  1M90 W;  3PJS K;  4U7N A;  1GM9 A;  4XDK A;  3RVZ A;  4EKW A;  1GKF A;  1F23 A;  2IJI A;  4UVB A;  4J9Y B;  5L3F A;  3JYC A;  2EJR A;  2GSM B;  1YJW V;  1K3E A;  4MS2 A;  1P7B A;  3ABM C;  2QA4 V;  1F4N A;  3K3W A;  5EK0 A;  2GHY A;  4X8A A;  2EBO A;  4RUF A;  5IYD O;  1MOF A;  2OCC B;  1RM1 B;  2AHY A;  3GWO A;  5IY5 B;  2EIL C;  3ZIA G;  1NVP D;  1S72 V;  1K4D C;  2B5U A;  2ZDI A;  1VQ5 V;  4DXW A;  1CEZ A;  2AHZ A;  4XDL A;  3ABM B;  4P30 A;  5FL7 G;  3FB7 C;  1ARO P;  4PA7 A;  2DYR C;  4R8C A;  5BZB A;  3TK1 A;  5LGU A;  2YEV B;  2F43 G;  2B1G A;  2NLJ C;  1OHH G;  3OUF A;  2EIL B;  3ML0 A;  1BHB A;  4QPJ A;  4UXN A;  1QLE C;  1M56 C;  3FB5 C;  2DQ3 A;  5KUK A;  3CCJ V;  1FXH A;  3ABK C;  3CME V;  4MW8 A;  5L3D A;  4XBF A;  3H01 A;  1M57 B;  2Z3Y A;  2HVJ C;  5LGT A;  1FXK C;  3E8G A;  3OR7 C;  3SYQ A;  1DF4 A;  2IJK A;  1VQM V;  2Y48 A;  3ZRW B;  3JD0 A;  4TT3 G;  4R7C A;  4RQF A;  4FIP C;  1R3J C;  1VQP V;  1TUE B;  4PA9 A;  1L1F A;  1R3L C;  3OAA G;  2EZP A;  5CBF A;  2EIJ C;  1QLE B;  3K03 A;  2XAS A;  4Q20 A;  5B1O A;  3T2M A;  5KUM A;  3ABK B;  4ASU G;  5KA6 A;  5B1B C;  3KG2 A;  3CCU V;  1PNL A;  1NVP B;  1VQ8 V;  1CP9 A;  3CC4 V;  2B1I A;  3CCL V;  2XOK G;  3SYC A;  1AJP A;  1H38 A;  4JTC B;  3ETD A;  1Q81 W;  3ZJZ A;  2HFE C;  4GCZ A;  1GO3 F;  1WLE A;  2LP7 A;  5LHH A;  3CCV V;  4HZ3 A;  2ZQM A;  2HJF C;  2ZR2 A;  3ABL B;  3HPL C;  3B8N A;  4JTD B;  4YXW G;  5B1B B;  1EZJ A;  4JGS A;  3P30 A;  2JJ1 G;  2P7T C;  1YHQ V;  5J9P C;  4QE7 A;  3JD1 A;  4MVO A;  5HFM A;  1SET A;  1KP3 A;  5EBW C;  2X6C A;  4PA4 A;  4GX1 A;  3EHB B;  3K9A A;  4FMT A;  2Q69 A;  4CBC A;  2BOC C;  2QE7 G;  1R73 A;  5EBL C;  2WAM A;  3ASO C;  2Q6A A;  2Y69 C;  3LSS A;  1OCO B;  2M7W A;  2DW4 A;  4MVR A;  1OCC B;  4LCU C;  5B1A B;  1YJN V;  3ZRS A;  5IYC O;  1S77 D;  4UV8 A;  1NQT A;  1MSW D;  2HKO A;  3AG4 C;  5L3C A;  1UJW B;  3OW2 U;  3T1C A;  4MTX A;  3G71 V;  3HB3 B;  4WFH A;  3ABT A;  4G28 B;  2QM8 A;  3X2Q C;  3F7V C;  3E83 A;  4I9W A;  1AI7 A;  1KEC A;  4MTF A;  2P90 A;  2JIZ G;  3MHS C;  3QO5 A;  3OEE G;  1SES A;  1GM8 A;  4KUM A;  5C93 A;  1GTO A;  2JDI G;  4PA6 A;  1Q86 W;  1XL4 A;  4MVU A;  1XL6 A;  4LBE C;  4PA3 A;  2NNU A;  3K08 A;  1IXM A;  3LDD A;  4G2K A;  3T4Z A;  1S0V A;  1H2G A;  1B6Q A;  2WSS G;  3RVY A;  4PDL A;  3SJQ C;  3ZMZ A;  5IY5 C;  3ZCC A;  1VQ4 V;  3MHH C;  3X2Q B;  4N23 A;  5L3E A;  5EBM C;  3LSQ A;  2X6B A;  4WFF A;  5HFL A;  3ZN0 A;  2YSU B;  2FTK A;  4FJC C;  3CCM V;  1VQ9 V;  3P32 A;  4RUE A;  3LUT B;  4X88 A;  2C2A A;  3NXS A;  3FKS G;  1AR1 B;  3CYO A;  4GT1 A;  4R50 A;  4BW5 A;  3QO8 A;  3E8B A;  4PEL A;  1QVF U;  4WCE V;  2JK5 C;  1I5X A;  1K33 A;  4RQE A;  3FB8 C;  2ZXW C;  1KQS U;  1K97 A;  1M57 C;  2XAG A;  3VOU A;  1VQ7 V;  2X0L A;  3STZ C;  1JOY A;  4WFB V;  1NH2 D;  2IH1 C;  3SYA A;  1OCZ B;  4BIU A;  3OEH G;  5DN6 G;  1Y66 A;  3K06 A;  2HLD G;  1JQ0 A;  1F4M A;  2Q68 A;  3K0G A;  4QPK A;  1W2B U;  2ZXW B;  1QLN A;  2WLH A;  1QR8 A;  3OUS A;  1S5H C;  1YSC A;  2W0F C;  3SPC A;  1YJ9 V;  3AG2 B;  1VQ6 V;  2XAH A;  4E2L A;  4MVS A;  3CXC U;  1PL0 A;  3ETG A;  1N8R W;  4UV9 A;  1Q7Y W;  2QEX V;  3ABL C;  2IU3 A;  1F51 A;  3SPI A;  1BHA A;  3CC2 V;  4P9P A;  3TET A;  3BY6 A;  1VQK V;  1CPY A;  1RPO A;  1DTO A;  2WLK A;  2YEV A;  3M99 B;  2JJ2 G;  2QKS A;  2DWE C;  2WPD G;  4WFG A;  5LHG A;  3E89 A;  5DM6 V;  4GX0 A;  1NH2 B;  3W7W A;  4UUJ C;  2EIK B;  1V54 C;  1MAB G;  1RPR A;  1OCO C;  3RW0 A;  4BIZ A;  5GW7 A;  4WFA V;  2DWD C;  1JJ2 U;  4F4L A;  2EIM B;  1K92 A;  3ZN1 A;  3VBB A;  2W6I G;  1OCC C;  1THZ A;  1W0K G;  5B1A C;  2A0L A;  4WFE A;  1BL8 A;  4RAI A;  3B8M A;  3W7T A;  5LBQ A;  1V54 B;  1KD1 W;  4KFM A;  5B1N A;  2HR3 A;  3IC7 A;  3FYE B;  3SPG A;  3JD4 A;  1KP2 A;  1FXK A;  1NBM G;  1G4Y B;  1M9N A;  1ORQ C;  3OMI B;  3GB7 C;  2X6A A;  4JAV A;  3SPJ A;  4Z1M G;  3ZMV A;  1GM7 A;  2A9H A;  1PNM A;  3RBZ A;  3IFX A;  4P2Z A;  3CCQ V;  3CPW U;  3STL C;  4I5S A;  3EFF K;  2OTL V;  3AG1 C;  2DYS C;  3ZMU A;  1GK9 A;  2WLN A;  1HWY A;  2WWW A;  2HVK C;  3LDE A;  3OGC C;  2CK3 G;  2ZDI C;  4JF3 A;  3WG7 B;  2R9R B;  3LDC A;  4MSW C;  1KC8 W;  2D3O W;  2X7R B;  1YIJ V;  1AI4 A;  1R6K A;  1GMG A;  1DF5 A;  2EIN C;  3JCZ A;  1MG1 A;  4JAS A;  3G6E V;  2KB1 A;  1JX9 A;  2ATK C;  3E35 A;  5B3S C;  3AG1 B;  2DQ0 A;  2DYS B;  1YTF D;  3OMN B;  5L3G A;  1YIT V;  1ZWI C;  2BOB C;  4DO2 A;  5LHI A;  1E79 G;  5CA3 A;  3F7Y C;  2P67 A;  4BAY A;  3OMA B;  4MW3 A;  3I55 V;  4TSF G;  1VQN V;  1OCZ C;  2WLM A;  1W0J G;  1G8M A;  2EIN B;  3FYI B;  1EBO A;  4MVQ A;  2R9I A;  1YI2 V;  3OFN G;  3ZMS A;  3CMA V;  1H8E G;  2OT5 A;  5B3S B;  4L87 A;  3CP1 A;  3W7U A;  3IGA C;  2WLI A;  4XDJ A;  2WLL A;  3ABU A;  3E8H A;  3A0R A;  3F5W C;  5CN0 A;  3DGE A;  4PDM A;  2WLJ A;  1P4R A;  2QM7 A;  3AG2 C;  1ENV A;  4MT8 A;  2IW5 A;  1VQL V;  4JYC A;  1COW G;  4OXS A;  2ZD9 A;  1JPX A;  4LP8 A;  4H37 A;  4HAM A;  2QTO A;  2IH3 C;  2LFS A;  3JD3 A;  2XND G;  3ZMT A;  1K34 A;  4PDR A;  3G4S V;  3DTU B;  4ZKI A;  2K1E A;  1FFT B;  1S3J A;  1YTF B;  1H8H G;  3BEH A;  2LFR A;  1R3I C;  4HYO A;  1K5S A;  2JEU A;  3QNE A;  1QVG U;  2W6J G;  1JVM A;  5L3B A;  1AJQ A;  1S76 D;  2EIK C;  3FB6 C;  4QJF B;  3CCE V;  5IYB O;  4MVZ A;  3K79 A;  3OE7 G;  3CC7 V;  4QE9 A;  1K8A W;  1V55 C;  4R6Z A;  1FS0 G;  4KP4 A;  3ZRX A;  2EZO A;  1AI5 A;  2EIM C;  4G27 B;  1ROP A;  4JTA B;  4PDV A;  3SPH A;  1PNK A;  4LC1 A;  2PI5 A;  4N21 A;  2DYR B;  3OM3 B;  4MTG A;  5EC2 C;  5H6Q A;  4MVM A;  2OTJ V;  1SRY A;  3UKM A;  1OCR C;  3AG3 C;  4JAU A;  1M56 B;  2V7Q G;  3D3I A;  1E1R G;  1V55 B;  2A79 B;  2Z5U A;  3ETE A;  2XAJ A;  4UVA A;  4GX2 A;  3ZRW A;  3LNM B;  3MD0 A;  3D36 A;  3E8F A;  4WF9 V;  1FXK B;  3SYO A;  4QNH B;  3W7X A;  5KA5 A;  2XAF A;  4FPP A;  5H9C A;  1NKD A;  1K5Q A;  5IDJ A;  3CCR V;  2H94 A;  1OCR B;  3AG3 B;  3ASN C;  1EFR G;  2EIJ B;  1AJN A;  3SYP A;  1NJI W;  3E2E A;  1AI6 A;  3WFV A;  2ZR3 A;  1PD3 A;  4J9Z B;  3W7S A;  5CMU A;  1Y4M A;  5EC1 C;  1K9M W;  3WG7 C;  4U7O A;  1FXV A;  2IJH A;  3R65 A;  1K4C C;  2PI4 A;  4P9O A;  3JD2 A;  4UVC A;  2MK3 A;  4H33 A;  3CCS V;  1M1K W;  1QCE A;  3QO7 A;  3TCU A;  4TWK A;  2HG5 C;  1BMF G;  3K04 A;  1SZT A;  5CBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...