4MSWC

Y78 ester mutant of kcsa in high k+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
total genus 43
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mswC00
2ZD9A 2Y69C 3K08A 4ZBMA 3STLC 3OUFA 4H33A 3SPHA 3ASNC 4P9OA 4KFMA 1XL6A 3OR7C 4MVQA 3X2QC 5J9PC 1OCZC 3LUTB 3SYAA 5BZBA 4HYOA 1OCRC 4PA4A 2A9HA 3ZJZA 2BOCC 3SJQC 4P9PA 4P2ZA 1R3KC 3RBZA 3SYPA 1M56C 3ABMC 3AG2C 1ZWIC 3E8GA 4WFFA 2EIJC 4JTCB 4R8CA 4F4LA 1JVMA 4WFGA 3SYOA 4PA6A 4BW5A 4RUEA 4MTOA 4PDRA 3RVZA 2WLKA 4LP8A 4MW3A 2Q6AA 3AG1C 2DWDC 4PDMA 4WFEA 2IH1C 4QE7A 2WLNA 3ASOC 2WLLA 3AG3C 3E86A 1XL4A 2Q68A 3FB7C 3SPGA 3SPIA 5CBHA 2NLJC 4MVOA 4GX2A 2HFEC 3K04A 3PJSK 3RVYA 1K4DC 3E8BA 1P7BA 4MS2A 4MSWC 2WLJA 3SYQA 2WLHA 1QLEC 1BL8A 1M57C 2Q69A 2YEVA 4CBCA 5B1BC 4I9WA 3ABLC 4GX5A 4PA3A 3T4DA 2DYSC 3JYCA 4MVUA 1KKDA 1ORQC 3UKMA 4LBEC 3LDEA 4HZ3A 3F7YC 5CBGA 1V55C 2X6BA 4PA7A 4PDVA 4P30A 3STZC 3T2MA 4RO2A 2QKSA 4EKWA 1OCCC 5CBFA 3FB8C 2EIKC 2DWEC 2WLMA 2A0LA 1K4CC 4J9YB 4XDKA 3IFXA 1R3IC 1R3LC 1V54C 2DYRC 3LNMB 4R50A 5KUKA 2WLLB 5KUMA 2Q67A 2HVJC 4G27B 5EBWC 2OCCC 2X6CA 4X88A 3T4ZA 1S5HC 3K0DA 4GX1A 2WLIA 2ITDC 4X8AA 2K1EA 4X89A 5EBLC 2JK5C 4GX0A 3OUSA 4MTGA 2EILC 4MTFA 2EINC 3ABKC 3IGAC 1LNQA 4PDLA 3T1CA 4XDLA 4MVZA 1G4YB 2ZXWC 3WG7C 2ATKC 2HG5C 1J95A 2EIMC 2QTOA 3KG2A 4XDJA 3SPJA 4QE9A 4DXWA 2HVKC 2W0FC 3AG4C 3OGCC 3R65A 3E83A 1OCOC 3UM7A 3ZRSA 4H37A 3LDDA 5B1AC 5EC2C 5IY5C 4R7CA 3TETA 4R6ZA 4MW8A 3K03A 5EC1C 3SYCA 3FB6C 2P7TC 3GB7C 3EFFK 4J9ZB 2WLIB 3LDCA 5EK0A 3F7VC 2AHZA 4LCUC 4JTDB 3VOUA 3E89A 2AHYA 4G28B 1R3JC 2H8PC 2KB1A 2R9RB 2X6AA 4TWKA 4MVRA 3F5WC 4OXSA 4RAIA 3SPCA 3OR6C 5EBMC 4UUJC 4MVMA 3FB5C 4PA9A 4WFHA 2BOBC 4JTAB 3K06A 3BEHA 5B3SC 3HPLC 4MVSA 4RUFA 2HJFC 4QNHB 2ITCC 2A79B 5E1AC 3E8HA 3K0GA 3E8FA 3RW0A 3TCUA 2IH3C
chains in the Genus database with same CATH superfamily
4B7KA 1YJ9V 1SERA 3OUFA 2YXHA 3SPHA 1IBMB 3X2QC 4DV6O 5H2FZ 2ZM6B 2NNUA 1NT2B 1R3KC 4WFFA 4YHHO 2QSAA 4JTCB 2QR4A 1ROPA 1Y76A 5EIBD 5EZYB 1DLBA 1EM1A 2CH7B 5D5PA 1EN5A 2CGNA 2QA4V 4KL1A 2GV9A 1Y67A 5L3DA 1SQPH 1VMGA 1JR9A 1BL8A 3EXAA 4F6RA 4X1IB 4ZHQA 1US6A 2R9IA 1KKDA 4QJFB 2DYSB 3STZC 5CA0B 3E35A 4FK5C 4K0KO 4NXMO 4DUZB 2DWEC 2WAMA 2UXDO 2AXTZ 1R3IC 2UU9B 5J2TA 1ZX3A 2Y69B 3W7TA 5LMNO 5LHGA 2WLIA 4X8AA 4YIOA 2QWQB 5IJ9A 1LNQA 3B40A 4JI1O 1JOYA 4J7KA 1JJOA 2EIJB 2GUZB 2QKCA 4PHZA 1EN6A 3OGCC 4QPJA 1EBOA 1G8MA 5B1AC 1FXKC 4K35A 2CK3G 2E3CA 3ETDA 4BIOA 2DOSA 3H1HH 3BY6A 1GN4A 3H1LH 4AQYO 1RPRA 2BCCH 2Y0PA 2R9RB 4RQEA 1UPGA 2FL4A 2E76B 3LSUA 3HR0A 3RWRD 1CXZB 3HPLC 1SQBH 4X20A 1K7DA 1Q8IA 2A06H 1F23A 4JI2B 1SS3A 2ZD9A 2F4VB 4ZBMA 4H33A 1M56B 1FXKB 1FFTB 2WA3A 1EZJA 2A9HA 1FXVA 1PNKA 4P2ZA 2ADQB 3ZRVA 5DEDA 1FD9A 3OM3B 2FB5A 3ZS8C 1H2MA 4WBNA 1WN7A 2FKXA 4FM0A 3Q4HA 3HKCA 1TA8A 2ZCEA 4MT8A 4DR4O 3AG3C 4K8ZA 1LUWA 4KHPB 3RFRA 5KHIA 1W59A 4ASUG 1NQTA 1P7BA 3E8BA 1XI1A 4PA3A 2Q7GA 1D2DA 2Q7EA 2P4KA 4BIUA 3BVOA 4TUYB 4PDVA 1HR0O 5JH7A 2JS5A 5KX5B 3LSSA 3N27A 4DV1O 2YXYA 3IFXA 5KMGB 3D3QA 2E5LB 1TUBA 1S5HC 1SQVH 1YCIA 4X89A 5EBLC 3MHHC 4GX0A 3OUSA 4MTFA 2OYQA 5CB4B 1Q5OA 4KP4A 2JGDB 4Q6GA 4EFBA 1MA1A 1WA8B 2ZKOA 4D7TA 4BAYA 4TQFA 1JMKC 2P7TC 5JJJB 1PNMA 4Z2WA 3G6BA 1GKFA 5EK0A 3F7VC 2LFRA 2ZM6O 2LP7A 3B8NA 4MVRA 2CTRA 4O4IB 4AHCA 1YHQV 3NXSA 1QR9A 2LJ2A 3RYHA 4IHJB 5B3SC 3RYIB 1P7GA 1OZ0A 2JGDA 3E8FA 4CZZA 1S3JA 1WPBA 2QE7G 1YDXA 2ZIMA 2Q73A 4J80A 2EIKB 1KKCA 4DK0A 2ZDIC 1VF5B 2XAJA 2WPDG 5KHHA 2CTWA 1WAZA 2JEUA 1Y4MA 3FB7C 2P4VA 2XNDG 3HKBA 2A3QA 4TOIA 4MSWC 4JI3B 4ZKIA 4CBCA 3T4DA 1IURA 1YITV 4TV8A 3LDEA 3Q4HB 1A32A 3BHPA 5CBGA 1G1XB 1FS0G 1MZEA 4OPHA 3K9AA 3N2KB 2YXLA 4JI2O 1M57B 2GDSA 2PUSA 5JVDA 5CA3A 3ZRXA 3G6EV 1VIBA 2MW2B 4LR3A 1N33B 1DF4A 1L8DA 1Q43A 3ZMUA 2KG7B 4TUYA 4AQYB 1VQ9V 2ZIOA 3FX7A 5LA6B 5LBQA 2DW4A 1V54B 2DYRB 2CTPA 3ETGA 3ZRSA 1SRYA 5EC2C 5JQGA 2CGOA 5EC1C 3VBBA 4N21A 3N2KA 1AB3A 3JD1A 2CUGA 2H94A 1M93A 1N34O 3FKSG 3H1KH 2Q0AA 3B8MA 3S3XA 3BAAA 4X1KA 5LMNB 1N0JA 1S76D 1N0NA 2N74A 3W7XA 4L87A 1NBMG 1MMMA 4TV9A 3I55V 3UQ8A 2PZSA 2A79B 3JSLA 2IJKA 2VQFO 1FYJA 2L35A 3KZIZ 4O2BA 4KFMA 3AK2A 4P9OA 4I0XB 1OCZC 1N34B 3JCZA 5FL7G 1HNWO 3TXSA 2DMXA 4PD4F 3E8GA 4PI2A 1FAFA 4NXNB 4GKKO 4DR5B 1Q81W 2Q6AA 3RYIA 2UUAO 1NTMH 1HNXO 4GYCB 2OTJV 3VQWA 3ZHSA 3AK3A 2ZE6A 5ITZA 5BMVA 1I08A 2Z0AA 1JA8A 1WP8A 4X1YB 4YHHB 4YJ2A 1FFXB 2BSKB 3HKEA 3JD0A 2XHBA 4JV5O 1XNRO 4LF8O 2N05A 2UXBB 1N4CA 2K1EA 2VWJA 2IU0A 1Q6UA 5IT9N 4JI3O 1K5SA 4LNUA 4FLTA 2HHHO 3PN1A 2BTQA 3T1HB 1UFIA 1AP6A 1TUBB 2HJDA 3E83A 5B1AB 3FYIB 2QDOA 4H37A 4EFEA 4WCEV 4O4HB 1XBLA 3H9VA 4R7CA 4DUYO 5CB4A 3K03A 2Y4TA 3QO8A 1SA0B 2RN9A 1Y76B 2UXXA 2MK3A 4H44B 1Q82W 4RAIA 3OR6C 4J7JA 1N36O 4DV2B 4YJ3B 5KX5A 3CCLV 3H1JH 5E1AC 3ICXA 4ZHQB 3O65A 2YI9A 2HP8A 3RGBA 3ASNC 3P3NA 3RYFA 3D3IA 3RYHB 4AI8A 4J10A 3AG2C 3BRCA 1AI7A 2EBOA 2PYJA 1I94B 2DWDC 1YSCA 4DR1B 4WFEA 5IYZA 5LOVA 3C3TA 3TGUH 3SPGA 1AJPA 3JAKB 4UCSA 1O9GA 1Q86W 2OT5A 1ZUQA 4X1YA 2GUZA 1R6TA 1PNLA 2JJ1G 2X0LA 4I9WA 1IX9A 2E5LO 1TGOA 2B1IA 4LBEC 4X20B 4FZ0A 4H0LB 2W6JG 1AR4A 2YIBA 4RO2A 1H2GA 1JCHA 1NR1A 4JPRA 1M5IA 5ITZB 2YSUB 3CRAA 4J9YB 1PV0A 1E1QG 2WLLB 2HVJC 5LOVB 5LYJA 1P4RA 1XMQB 4NTXA 4YJ2B 4MTGA 2F95B 2BE3A 5CA1B 4MVZA 4U3JB 1SQFA 1S0VA 2QTOA 3DGEA 4XDJA 4FLZA 3JATA 2Q8VA 4DR4B 1BSMA 4IHJA 2W0FC 3AG4C 1P49A 1FPOA 1U96A 5IY5C 1D5NA 2QEXV 5JWPA 2ZQMA 2WA4A 3AG1B 5GW7A 4UCTA 1V55B 2RNBA 4X66O 3C90A 5IYDO 1W0KG 4JF3A 2JRIA 2YIBD 2QKAA 4MVMA 4JI7O 2M7WA 3FB5C 2XAHA 3D36A 3H1IH 1BCCH 4X65B 2F93B 3SDLA 1YJWV 4X65O 3ZMZA 2QWOB 5IWAO 3STLC 1YJNV 1AR1B 2P5OA 5BZBA 3LUTB 4EB6A 5GTIZ 4YJ3A 2QM7A 4HYOA 4ZIBA 1OJHA 2ZT9B 1X59A 4OPAA 1JVMA 3WG7B 4JAAA 2PYLA 4QE7A 2WLNA 1EFRG 2AGAA 1XL4A 4ZOLB 4MVOA 5JVDB 1URFA 3IC7A 3BFRA 4MS2A 3P3PA 5DM6V 1EZVH 4UB8Z 3IAYA 4GX5A 3CCEV 2VRZA 1FJGO 1WB8A 1XILA 5BXZA 3UT5A 2Q9LA 4TT3G 4K0KB 4EKWA 4C7UA 3X2QB 5IE9A 3OMNB 2PI4A 4G27B 4IT5A 4I0XA 1R6KA 1LR1A 1SKVA 2BSKA 2ITDC 3HKEB 2L6LA 5GTHZ 1BE3H 2YIAA 1DTOA 4HAMA 4PV1B 3K79A 3T1CA 4GLXA 2B1GA 1J5EB 2EIMC 3RYCB 4DR1O 4LFCB 1QR8A 4WFAV 5L3EA 3UCSC 5KHKA 3J80N 3ABTA 3EFFK 2ZXWB 2Z5UA 1NVPD 2KB1A 3CEIA 1W0JG 3OTOB 3CXCU 4JI0B 2BOBC 4JTAB 2CAZC 3T1YO 3IJ4A 3JATB 3JD4A 3JARB 4DV1B 1MSWD 3K08A 4HBNA 1KQSU 1Q6IA 2LGWA 4JYAB 1JFFA 2ZINA 1SZTA 4JAUA 3DXRA 1FJGB 3RN4A 4LF5B 3MD0A 1FXHA 2YI8A 1GN2A 4R8CA 3QNEA 4PA6A 1JPXA 4PDRA 4DV4O 3W7UA 3ZRWA 1YI2V 3ZMTA 4UXNA 3SPIA 4J42A 2VS0A 2Q68A 2YICA 1COWG 2VQEO 1AVMA 3ABMB 1KC8W 1K3EA 2WLJA 4KXRA 3OW2U 1QLEC 3H01A 2CTQA 2Y48A 5JQGB 3E22B 2R72A 1THZA 1V55C 2X6BA 2YDEA 1HP8A 1GH6A 1XNRB 1BS3A 4DR3O 5CBFA 2EIKC 1GO3F 2ZE5A 2A0LA 1I5YA 1KB9F 4CS2A 1V54C 3LNMB 1EN4A 4ZOLA 1AR5A 2OCHA 3ZBHA 5CMUA 5LMUO 1Y74B 4GX1A 4HNAB 4KUMA 1SA0A 3FD9A 1B6QA 3L74H 4GUNA 3O9OA 2Q0OC 3ABKC 2QM8A 2ATKC 4IL6Z 3SPJA 4LC1A 4QE9A 1IBKB 5BMVB 4RQFA 4NXNO 4WFBV 1T5EA 4DV3O 3KCXA 1BGYH 3QO7A 3OE7G 3G67A 4DR7O 3A2FA 1CPYA 4JI1B 2QWRB 2IJHA 3JD2A 4D7SA 1VQKV 2Q4PA 4OXSA 4JI8B 1S72V 1XMQO 5AG2A 2UU9O 1BT8A 1L0NH 2QGNA 1H38A 2ITCC 2R9AA 4NXMB 4W4KA 2F43G 1KP2A 4U7OA 3U10A 3DXRB 1I5XA 3CCMV 1MZFA 4B7EA 4LF6O 2GTSA 3ZJZA 4DR7B 3AG4B 4Z1MG 1M56C 1S5JA 4F4LA 2OIGA 2E74B 4PELA 4GKJB 4FZ1A 4RUEA 1BMFG 2WLKA 4MW3A 2QTSA 5JCOC 3TJTA 1NKDA 5BR8O 4FLWA 1E1RG 4UVBA 5H6RA 4FM2A 3G80A 4LF9O 5JH7B 1YIJV 2JIZG 5CA1A 5LMUB 1TAEA 4DW1A 3CRMA 1YEWA 2AZ0A 4DR3B 1IBLO 1JX9A 2WLMA 3WU2Z 1SZXA 2Y4UA 2X6CA 4O4JA 3M8AA 1XHZA 1VQMV 2ZR2A 3IGAC 5KA5A 3JASB 3GWKC 2YEVB 1K33A 2FMLA 3JCUZ 2ETNA 3CMAV 2ZE7A 2EJRA 3JAWA 4R6ZA 2ZNIA 2JDIG 4DV5O 3GB7C 4J7ZA 4I55B 1E79G 1IXMA 3K5OA 2UXCO 1YTFB 2LFSA 1R3JC 1TUEB 3ZN1A 1XHXA 4TWKA 1AROP 5IJ0B 1YTFD 4PA9A 1KUQA 1SQGA 2A7WA 3BEHA 2UXBO 5K1PA 1NTZH 3SJAC 3APOA 1Z5WA 2HJFC 1Q90D 4W4LA 3JAKA 1XOUA 1BHBA 4IYIA 2Y69C 5J2UA 3OR7C 5J9PC 5LP6A 3SYAA 3K5MA 1GAXA 3B2EE 4LF9B 1AILA 4WFGA 4ZI7B 1Z5VA 3OEHG 4LFCO 4YY3B 2IH1C 3L72H 2WLLA 5IDJA 3OGIB 3JD3A 5FNVB 1K4DC 5EYPB 1QLNA 1IXBA 2XTAA 3D8CA 2ODMA 4GT1A 3ASOB 4U3JA 3AK1A 4I9QA 5A2QN 1VQ5V 1S77D 3G71V 3QVNA 3CMEV 1HR0B 5HFMA 4XDKA 1R3LC 5KUKA 3W7SA 4Z1VA 3OMAB 4LNUB 3K5NA 3K0DA 4DK1A 2ARHA 3EHBB 5IYBO 1XEQA 3B09A 5DECA 4PDLA 1G4YB 5H6QA 4B3TB 2HG5C 4DV7O 1WNSA 4F6RB 3CCJV 4DV3B 1Y74A 4NVPA 5JJEB 4FLVA 1OCZB 3FB6C 1VF7A 4FFKA 3AG7A 2AW9A 3LDCA 4JTDB 4LWSA 3AEIA 4JI4O 3SR2C 5HFLA 1AI5A 5JJNB 2UUBO 3VQYA 3DTUB 2KQXA 4WFHA 3CC7V 2V4DA 1KP3A 4O2BB 1GM8A 5EIBC 1PM9A 4CH5A 2N04A 2X7RB 3E8HA 1MABG 2PF4E 3C3SA 2JVDA 5LL6Y 1XL6A 4LF7B 1BQ0A 1XREA 2XAGA 4YXWG 4JI4B 4O4LB 3SYPA 1ZWIC 1ZSPA 4MTOA 2VQEB 4JZGA 1B3QA 5B1BB 3JSNA 3E2EA 5B1NA 4GX2A 3K04A 3CRQA 4NR1A 4TSFG 3VQVA 4ABMA 5LGTA 2R70A 2WLHA 3NR7A 1M57C 4NTYA 3J81N 2LO1A 3A0BZ 4BIZA 5L3BA 2RJZA 3F7YC 1QCEA 3ZHUA 4DUZO 1ZL8B 1NH2D 4JYCA 2UUCO 4CS3A 1ZLZA 4TQDA 2DYRC 3T1YB 5LHIA 1PD3A 2O57A 1B06A 2VWKA 1SQXH 4LFBB 1SC5B 3ZHQA 4JI5B 1PL0A 2EILC 4JI6B 3P30A 1Z2GA 4QPKA 3ZIAG 4EEQA 4DR2O 3AG2B 1W2BU 3K5LA 3MAQA 1VF6C 1CP9A 1OCOB 1I7FA 4O2AB 3L75H 4IIJB 2IM9A 1GTOA 4DR2B 1PKXA 3FYEB 2G38A 4E2LA 2H8PC 4DV6B 3OEEG 4FPPA 3F5WC 1M9NA 4JI5O 1JJ2U 4GCZA 5EBMC 2B5UA 4O4HA 4I4TA 1B04A 1QQCA 2UUCB 1X4TA 4JYYA 3TCUA 4DYLA 2ZNJA 2OCCB 3W7WA 1N36B 1WP7A 5KA6A 2DQ3A 2LQTA 2EJ7A 2GHYA 2UXCB 4P9PA 1H2KA 3ABMC 1K9MW 3CRRA 1RPOA 3KKYA 1YF2A 4KHPO 4HNAA 4JGSA 1R6NA 4B3MO 3QG5A 1M4UA 4NYKA 1VEWA 5DN6G 4DW0A 5B3SB 3CX5F 3T1HO 1HDJA 3SJCC 4BW9A 2EULA 3SYQA 1HWYA 5FPOA 3UT5B 2D2CB 1HNZO 3M7MX 3CHXA 5IYZB 4LF7O 1MG1A 3ZMSA 3S3WA 4UCUA 1VQ6V 4B3RO 5JCOA 4OX9O 1TVKB 3ZMVA 5IWAB 4DR6O 5EYPA 4G2KA 1CEZA 3GVMA 2UXNA 4AILC 1K4CC 4O4IA 2P90A 3CB2A 3CS5A 3VQXA 1D5AA 1DF5A 4PJ0Z 3ZHTA 5LP6B 5B5EZ 5KAIZ 3CE2A 5TISZ 2UUBB 1VQ7V 4DRXA 2EINC 1HW7A 3APQA 3FAVB 2YS8A 4FMTA 4NTWA 1XDCA 1I0HA 1OCOC 3OTFA 4IYHA 2UUAB 1AP5A 4CS4A 1AI4A 4B3SO 4MW8A 4ICGA 2RDCA 1AJNA 4LF4O 3OMIB 2OWOA 3CC2V 5KHGA 3OT7A 3A0HZ 2DJVA 4B08A 1QBZA 5FPRA 5LP6C 3HKBB 1N32O 1VQOV 1PP9H 1GM7A 5C93A 4UVCA 3FFQA 1O9HA 3L71H 1G6UA 4RUFA 3RW0A 3SJBC 4O2AA 1KYOF 5KHJA 4UCRA 1RFYA 4I50B 1H2NA 1P84F 4X64O 2XUMA 2CE4A 2LGQA 3K9SA 1SF9A 2EIJC 3SYOA 1XMOO 4NB5A 3CD6V 3ETEA 4I55A 1SETA 1WLEA 1IBKO 3ASOC 1NVPB 3N2GA 4YY3O 1MSDA 1QU7A 2ZR3A 4CH3A 1KD1W 1RSOB 1GK9A 2PI5A 2YEVA 5E79Z 2P67A 1GN6A 1ORQC 2C2AA 5IJ9B 2ILMA 3T2MA 2JEXA 2JJ2G 2YIDA 4DR6B 1OCRB 1K73W 5LXTB 4B3RB 1RM1C 3CCUV 3RT3C 2Q67A 4N23A 3ZX6A 2GSMB 1HNZB 4DV2O 3E22A 5KMGA 3CXHF 3A0RA 3HKDB 2Z3YA 5L3FA 3OD4A 3CSXA 1R73A 1RP3B 1FFXA 3TETA 3BPZA 3U11A 5IYCO 4E4EA 4DRXB 3TXQA 2IJJA 4ZI7A 4G28B 4JYAO 2X6AA 1F4MA 3SPCA 4O4LA 4UCVA 4L8JA 5LGUA 4QNHB 3BA9A 4LF8B 1IBLB 3K0GA 1S5LZ 4UFZA 4JASA 2QWNB 5B66Z 1U97A 4JV5B 4MVQA 1YZBA 5IY5B 1SESA 2OIEA 5L3GA 2BOCC 1XQ8A 4BW5A 1UJWB 2GBOA 3RVZA 3ZEDA 2H3OA 1VARA 2V7QG 2JGUA 4PDMA 3WB1A 4PI0A 5LYJB 1SQQH 2Q5ZA 2LW1A 4IIJA 1HNXB 2NLJC 2HFEC 1J5EO 3K3WA 5FLXN 4DR5O 3RVYA 4GKJO 4DV0O 4JI6O 5B1BC 3SGIA 4OGQB 1YVWA 4X64B 2F1MA 4LF6B 3JYCA 3EVKA 2E75B 4HZ3A 3B4SA 2EZPA 4PA7A 2YUAA 1DGSA 1NZ6A 2QKSA 2VQFB 1Y66A 3CJHA 2DN9A 4DO2A 2HKOA 1H8EG 3N2GB 3L9DA 5EBWC 4LWSB 4LFAO 1PL4A 1N32B 1XUQA 1TVKA 1L0LH 2JK5C 4JI8O 3ETQA 1QVFU 4X9QA 1NJIW 1VQNV 5L3CA 1NI8A 3MHSC 3WG7C 4JZ2A 3KG2A 1R1BA 1KU9A 4QIWF 4K8XA 1VQPV 4BR6A 4NKGB 5LXTA 3SYCA 1MOFA 3JALA 2XASA 4J41A 3QTCA 3WB2A 4J9ZB 1NH2B 2OTLV 1IDSA 2AHZA 5J2TB 4JYBA 2AHYA 2GTAA 4UUJC 3ASNB 4FM1A 4X62B 1N33O 3ZCCA 2ZDIA 4H13B 1KECA 2QWPB 4J11A 4X62O 2IH3C 3ZHRA 1H2LA 1YXBA 4FFBB 4JI7B 2K9PA 2XOKG 2WSSG 4FIPC 1OCRC 3D36C 5IJ0A 4K3AA 3RBZA 5GONA 2M6YA 1K5QA 1ZL8A 1BQZA 5KLVH 4XBFA 3CCVV 1QVGU 3E86A 4B3MB 1QLEB 4B3TO 3PJSK 1MNGA 1Q6HA 1F51A 1NR7A 3M99B 3R66A 4LF5O 3TK1A 2DYSC 4MVUA 3UKMA 1M90W 2UXDB 4P30A 4LH6A 5LHHA 1RSOA 5A9GA 1Y6XA 3FB8C 3I56V 2BTOA 5FNVA 1GRJA 2W6IG 3UO2A 1GM9A 1L1FA 3JASA 4JI0O 1AJQA 3OTOO 2JS3A 4XDLA 4CH6A 1VQ4V 2DQ0A 1JQ0A 3B77A 3ZHVA 1KBHA 4I4TB 3CC4V 4IGGA 5CA0A 4DXWA 2HVKC 2IU3A 2V1DA 1PPJH 4UV8A 1VQ8V 3HKCB 2RMKB 2WLIB 3LNNA 2EX3A 3E89A 5C8YB 1VP7A 5LGNA 1IBMO 4I7ZB 2EZOA 4X1IA 3JAWB 4LFBO 3GWOA 4UCOA 3BABA 2NN4A 2EILB 4FFBA 2ADPA 3ABUA 2ZE8A 3UO3A 2HEPA 4TV9B 5EZYA 1Q3EA 1QHTA 3G4SV 1RM1B 1BHAA 2XAFA 4A5UB 3FAVA 2XAQA 3SJQC 2CH7A 1NTKH 1LUVA 1ZAUA 3CRCA 5C8YA 3RYFB 3QO5A 3DC6A 2WWWA 5CBHA 1H8HG 2HR3A 3JARA 2HHHB 1WA8A 3P32A 4UB6Z 3RYCA 5H9CA 1XNQB 1OCCB 3ABLC 1NS1A 2FYUH 1KMIZ 1IVSA 4FLXA 1ENVA 3J7AU 1V9PA 3HB3B 3CP1A 4CC6A 4WBNB 3A8TA 3WFVA 2F4VO 3ML0A 2EINB 5KAFZ 1OV9A 3HKDA 1DK1A 5K1XA 1OCCC 2HLDG 3ABLB 1WPXA 4I5SA 5H5NA 1NU1H 2Y0IA 2RCVA 5F2VO 4FVMA 5KUMA 1IZ3A 4YIPA 3T4ZA 3LSQA 4F6EA 3CCSV 3AG3B 1N8RW 3K58A 2ZXWC 3BA8A 5BR8B 4X66B 1JFFB 3UM7A 3R65A 1K97A 2BTQB 3BCCH 3LDDA 1XMOB 5B1OA 4GKKB 3WB0A 5D5QA 2FTKA 1WB7A 2P06A 1K8AW 2P22C 4DV7B 4LCUC 3JAMN 1HNWB 3VOUA 3ZRWB 3K57A 2IW5A 4UVAA 2KKWA 3CPWU 1VF6A 4LFAB 4EB6B 1BZKA 4MTXA 1FXKA 2B9ZA 3CJHB 3KCYA 3THOA 2DE0X 5LA6A 3ABKB 1GN3A 3CCQV 3K06A 4U3FH 1FKAO 1WJZA 4Q20A 4PA4A 3CYOA 1VQLV 5CN0A 4LF4B 5BY1A 4DV0B 2KG7A 4B3SB 3L73H 4LP8A 3AG1C 1Q7YW 4U7NA 4O4JB 1GMGA 3U0ZA 3JALB 1M1KW 1H2SB 3QF7A 5GONB 1QNMA 1I94O 2EIMB 4GZRB 1K92A 2Q69A 3OAAG 4RWUA 2IJIA 4CH4A 4FJCC 2Q7HA 4UV9A 3MDSA 4WF9V 4X1KB 4OX9B 3CCRV 2PY5A 4R50A 4FLYA 3OFNG 2KSDA 1K34A 2OCCC 4X88A 4LH7A 4FLUA 1XNQO 2IBZH 2PTMA 1ZTEA 2F66C 2XT9A 4TV8B 3IC9A 1J95A 4DV5B 4D6TH 2P6JA 3K59A 3DC5A 2QJ1A 5J2UB 4DUYB 3ZN0A 4DV4B 2LW7A 1F4NA 2AZ2A 2QM4A 2CDYA 2D3OW 1F7YA 2NR5A 3CWBH 2PGGA 3I5DA 2RQ6A 2W0XA 1OHHG 3L70H 3F5TA 4CC5A 4JAVA 3DSQA 2F23A 4BWAA 1AI6A 4I50A 2YC0A 4MVSA 4QGPA
chains in the Genus database with same CATH topology
4JASA 2Y69C 1YJ9V 1SERA 3OUFA 3SPHA 3ASNC 4MVQA 3OR7C 3D3IA 3X2QC 5IY5B 5J9PC 1SESA 3SYAA 2NNUA 2BOCC 5L3GA 1R3KC 4WFFA 3AG2C 4JTCB 4BW5A 4WFGA 1UJWB 1AI7A 1ROPA 2EBOA 3RVZA 3OEHG 2V7QG 2DWDC 1YSCA 4PDMA 4WFEA 2IH1C 1DLBA 2WLLA 5IDJA 3SPGA 1AJPA 2NLJC 3JD3A 2HFEC 2QA4V 1Q86W 3K3WA 2OT5A 3RVYA 1K4DC 5L3DA 1QLNA 1BL8A 1PNLA 2JJ1G 2X0LA 5B1BC 4I9WA 4GT1A 3ASOB 3JYCA 2R9IA 1KKDA 2B1IA 4LBEC 4HZ3A 2EZPA 4PA7A 2W6JG 4QJFB 2DYSB 1VQ5V 3STZC 4RO2A 2QKSA 1S77D 1H2GA 1JCHA 1Y66A 3E35A 1NR1A 4FK5C 3G71V 4JPRA 2DWEC 2YSUB 2WAMA 4J9YB 4DO2A 3CMEV 2HKOA 5HFMA 4XDKA 1R3IC 1R3LC 1H8EG 5KUKA 3W7SA 1E1QG 2WLLB 2HVJC 3OMAB 5EBWC 2Y69B 3K0DA 3W7TA 5LHGA 2WLIA 4X8AA 1P4RA 3EHBB 2JK5C 5IYBO 1QVFU 1NJIW 4MTGA 1VQNV 1LNQA 4PDLA 5L3CA 4MVZA 1G4YB 3MHSC 3WG7C 5H6QA 1JOYA 2HG5C 1S0VA 2QTOA 3DGEA 3KG2A 4XDJA 2EIJB 3CCJV 2W0FC 3AG4C 3OGCC 4QIWF 4QPJA 1EBOA 1VQPV 1G8MA 5B1AC 1FXKC 5IY5C 2CK3G 1OCZB 2QEXV 3ETDA 3SYCA 2ZQMA 3FB6C 3AG1B 5GW7A 1MOFA 2XASA 1V55B 4J9ZB 1NH2B 3LDCA 2OTLV 3BY6A 2AHZA 4JTDB 4JYBA 3AEIA 2AHYA 5IYDO 1RPRA 1W0KG 2R9RB 1AI5A 4JF3A 5HFLA 4RQEA 4UUJC 3ASNB 4MVMA 2M7WA 3FB5C 2XAHA 3D36A 3DTUB 4WFHA 3CC7V 1KP3A 3ZCCA 2ZDIA 3HPLC 1GM8A 1YJWV 1KECA 1K7DA 2X7RB 1F23A 3E8HA 2IH3C 1MABG 3ZMZA 2ZD9A 3STLC 4ZBMA 1YJNV 1AR1B 4H33A 2XOKG 1XL6A 1M56B 1FXKB 1FFTB 5BZBA 3LUTB 2WSSG 2XAGA 4FIPC 2QM7A 1OCRC 4HYOA 1EZJA 2A9HA 4YXWG 1FXVA 1PNKA 4P2ZA 3RBZA 3SYPA 1ZWIC 1K5QA 1JVMA 3WG7B 3ZRVA 3OM3B 4MTOA 4QE7A 5B1BB 2WLNA 4XBFA 1EFRG 3CCVV 1QVGU 4MT8A 3AG3C 3E86A 1XL4A 3E2EA 5B1NA 1QLEB 4MVOA 4GX2A 3K04A 3PJSK 4TSFG 3IC7A 4ASUG 4MS2A 1NQTA 1P7BA 3E8BA 5DM6V 5LGTA 2WLHA 1M57C 1F51A 1NR7A 4GX5A 3M99B 4PA3A 3TK1A 2DYSC 3CCEV 4MVUA 4BIUA 3UKMA 4BIZA 5L3BA 1M90W 3F7YC 4PDVA 4P30A 1QCEA 5LHHA 4TT3G 4EKWA 1NH2D 3FB8C 3I56V 4JYCA 3LSSA 3X2QB 3IFXA 2DYRC 3OMNB 2PI4A 4G27B 2W6IG 5LHIA 1PD3A 1R6KA 1S5HC 1GM9A 1L1FA 2ITDC 1AJQA 4X89A 5EBLC 3MHHC 4GX0A 1PL0A 3OUSA 1DTOA 2EILC 4MTFA 4HAMA 3P30A 3K79A 4QPKA 3T1CA 4XDLA 3ZIAG 2B1GA 1VQ4V 4KP4A 2DQ0A 1JQ0A 3B77A 3AG2B 2EIMC 1W2BU 3CC4V 4DXWA 2HVKC 2IU3A 2V1DA 1QR8A 1CP9A 4WFAV 1OCOB 5L3EA 4UV8A 4BAYA 1VQ8V 2P7TC 3ABTA 1PNMA 3EFFK 2ZXWB 2WLIB 1GTOA 1GKFA 5EK0A 1PKXA 3F7VC 2LFRA 3FYEB 2Z5UA 1NVPD 3E89A 2LP7A 4E2LA 3B8NA 2H8PC 2KB1A 3OEEG 4FPPA 5LGNA 4MVRA 3F5WC 1M9NA 1W0JG 2EZOA 4GCZA 5EBMC 1YHQV 1JJ2U 2B5UA 3NXSA 1QR9A 3CXCU 2BOBC 3GWOA 4JTAB 5B3SC 3JD4A 1OZ0A 1MSWD 2EILB 3TCUA 3E8FA 4CZZA 3ABUA 1S3JA 2OCCB 2QE7G 3W7WA 3K08A 3G4SV 1KQSU 1RM1B 5KA6A 2DQ3A 4JAUA 1BHAA 1SZTA 2XAFA 2EIKB 2XAQA 3SJQC 2GHYA 3MD0A 4P9PA 1FXHA 2ZDIC 3ABMC 1K9MW 4R8CA 1RPOA 2XAJA 3QNEA 4PA6A 1JPXA 4PDRA 2WPDG 3W7UA 3ZRWA 1YI2V 4JGSA 1R6NA 3ZMTA 2JEUA 3QO5A 1Y4MA 4UXNA 3SPIA 3FB7C 2Q68A 2WWWA 5CBHA 2XNDG 5DN6G 5B3SB 1COWG 1H8HG 2HR3A 3ABMB 4MSWC 1KC8W 3P32A 1K3EA 2WLJA 3OW2U 3SYQA 1HWYA 5H9CA 1QLEC 4ZKIA 4CBCA 1OCCB 3ABLC 3T4DA 3H01A 2Y48A 1YITV 1ENVA 3LDEA 1MG1A 3HB3B 3ZMSA 3CP1A 5CBGA 1THZA 1V55C 2X6BA 1VQ6V 3WFVA 3ML0A 3ZMVA 1FS0G 2EINB 4G2KA 1OCCC 2HLDG 3ABLB 2UXNA 3K9AA 5CBFA 1CEZA 2EIKC 1GO3F 1WPXA 4I5SA 2A0LA 1M57B 1K4CC 1I5YA 5CA3A 2P90A 1V54C 3LNMB 3ZRXA 3G6EV 1DF5A 5KUMA 1DF4A 5CMUA 3T4ZA 3LSQA 4GX1A 3ZMUA 4KUMA 3CCSV 3AG3B 1B6QA 1VQ7V 1N8RW 2EINC 3ABKC 2QM8A 1VQ9V 2ZXWC 2ATKC 3SPJA 5LBQA 2DW4A 1V54B 4LC1A 2DYRB 4FMTA 4QE9A 3ETGA 3UM7A 3ZRSA 3R65A 1OCOC 1SRYA 1K97A 4RQFA 3LDDA 5EC2C 5B1OA 1AI4A 4MW8A 5EC1C 4WFBV 3VBBA 4N21A 2FTKA 3JD1A 1AJNA 1K8AW 2H94A 3QO7A 4LCUC 3OE7G 3OMIB 3VOUA 3ZRWB 1CPYA 2IW5A 3FKSG 2IJHA 3JD2A 4UVAA 3CC2V 1QBZA 1VQKV 4OXSA 1S72V 3B8MA 3CPWU 1VQOV 1GM7A 5C93A 4MTXA 1S76D 4UVCA 1FXKA 3W7XA 3ABKB 4L87A 3CCQV 1NBMG 4RUFA 3I55V 1H38A 2ITCC 2A79B 3RW0A 2IJKA 3K06A 2F43G 1KP2A 4U7OA 4P9OA 1I5XA 4KFMA 3CCMV 4Q20A 1OCZC 4PA4A 3JCZA 3CYOA 5FL7G 5CN0A 3ZJZA 1VQLV 3AG4B 4Z1MG 1M56C 3E8GA 2EIJC 4F4LA 3SYOA 4PELA 4RUEA 1BMFG 2WLKA 4LP8A 4MW3A 1Q81W 2Q6AA 3AG1C 3CD6V 1Q7YW 4U7NA 3ETEA 1GMGA 1SETA 1WLEA 2OTJV 3ASOC 1NVPB 1M1KW 1NKDA 2EIMB 1E1RG 4UVBA 2ZR3A 5H6RA 1KD1W 1GK9A 2PI5A 1YIJV 2YEVA 1K92A 2Q69A 3OAAG 2IJIA 2P67A 2JIZG 1ORQC 4FJCC 2C2AA 4UV9A 3JD0A 4WF9V 3T2MA 2JEXA 2JJ2G 1OCRB 1K73W 1JX9A 2WLMA 3CCRV 1RM1C 3CCUV 4R50A 3OFNG 1K34A 2Q67A 2OCCC 2X6CA 4N23A 4X88A 2GSMB 1VQMV 2ZR2A 2K1EA 2IU0A 1K5SA 3IGAC 5KA5A 1J95A 3A0RA 2YEVB 1K33A 2P6JA 2Z3YA 5L3FA 3E83A 5B1AB 3FYIB 4H37A 1R73A 4WCEV 3CMAV 2EJRA 3ZN0A 4R7CA 1F4NA 3TETA 4R6ZA 3K03A 5IYCO 2JDIG 2D3OW 3GB7C 3QO8A 1E79G 1IXMA 1YTFB 2IJJA 2UXXA 4G28B 2LFSA 1R3JC 2MK3A 1TUEB 3ZN1A 2X6AA 1F4MA 1Q82W 1OHHG 4TWKA 4RAIA 3SPCA 1AROP 3OR6C 1YTFD 4JAVA 4PA9A 3BEHA 5LGUA 1AI6A 2HJFC 4QNHB 3CCLV 5E1AC 3K0GA 4MVSA 1BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZD9 A;  2Y69 C;  3K08 A;  4ZBM A;  3STL C;  3OUF A;  4H33 A;  3SPH A;  3ASN C;  4P9O A;  4KFM A;  1XL6 A;  3OR7 C;  4MVQ A;  3X2Q C;  5J9P C;  1OCZ C;  3LUT B;  3SYA A;  5BZB A;  4HYO A;  1OCR C;  4PA4 A;  2A9H A;  3ZJZ A;  2BOC C;  3SJQ C;  4P9P A;  4P2Z A;  1R3K C;  3RBZ A;  3SYP A;  1M56 C;  3ABM C;  3AG2 C;  1ZWI C;  3E8G A;  4WFF A;  2EIJ C;  4JTC B;  4R8C A;  4F4L A;  1JVM A;  4WFG A;  3SYO A;  4PA6 A;  4BW5 A;  4RUE A;  4MTO A;  4PDR A;  3RVZ A;  2WLK A;  4LP8 A;  4MW3 A;  2Q6A A;  3AG1 C;  2DWD C;  4PDM A;  4WFE A;  2IH1 C;  4QE7 A;  2WLN A;  3ASO C;  2WLL A;  3AG3 C;  3E86 A;  1XL4 A;  2Q68 A;  3FB7 C;  3SPG A;  3SPI A;  5CBH A;  2NLJ C;  4MVO A;  4GX2 A;  2HFE C;  3K04 A;  3PJS K;  3RVY A;  1K4D C;  3E8B A;  1P7B A;  4MS2 A;  4MSW C;  2WLJ A;  3SYQ A;  2WLH A;  1QLE C;  1BL8 A;  1M57 C;  2Q69 A;  2YEV A;  4CBC A;  5B1B C;  4I9W A;  3ABL C;  4GX5 A;  4PA3 A;  3T4D A;  2DYS C;  3JYC A;  4MVU A;  1KKD A;  1ORQ C;  3UKM A;  4LBE C;  3LDE A;  4HZ3 A;  3F7Y C;  5CBG A;  1V55 C;  2X6B A;  4PA7 A;  4PDV A;  4P30 A;  3STZ C;  3T2M A;  4RO2 A;  2QKS A;  4EKW A;  1OCC C;  5CBF A;  3FB8 C;  2EIK C;  2DWE C;  2WLM A;  2A0L A;  1K4C C;  4J9Y B;  4XDK A;  3IFX A;  1R3I C;  1R3L C;  1V54 C;  2DYR C;  3LNM B;  4R50 A;  5KUK A;  2WLL B;  5KUM A;  2Q67 A;  2HVJ C;  4G27 B;  5EBW C;  2OCC C;  2X6C A;  4X88 A;  3T4Z A;  1S5H C;  3K0D A;  4GX1 A;  2WLI A;  2ITD C;  4X8A A;  2K1E A;  4X89 A;  5EBL C;  2JK5 C;  4GX0 A;  3OUS A;  4MTG A;  2EIL C;  4MTF A;  2EIN C;  3ABK C;  3IGA C;  1LNQ A;  4PDL A;  3T1C A;  4XDL A;  4MVZ A;  1G4Y B;  2ZXW C;  3WG7 C;  2ATK C;  2HG5 C;  1J95 A;  2EIM C;  2QTO A;  3KG2 A;  4XDJ A;  3SPJ A;  4QE9 A;  4DXW A;  2HVK C;  2W0F C;  3AG4 C;  3OGC C;  3R65 A;  3E83 A;  1OCO C;  3UM7 A;  3ZRS A;  4H37 A;  3LDD A;  5B1A C;  5EC2 C;  5IY5 C;  4R7C A;  3TET A;  4R6Z A;  4MW8 A;  3K03 A;  5EC1 C;  3SYC A;  3FB6 C;  2P7T C;  3GB7 C;  3EFF K;  4J9Z B;  2WLI B;  3LDC A;  5EK0 A;  3F7V C;  2AHZ A;  4LCU C;  4JTD B;  3VOU A;  3E89 A;  2AHY A;  4G28 B;  1R3J C;  2H8P C;  2KB1 A;  2R9R B;  2X6A A;  4TWK A;  4MVR A;  3F5W C;  4OXS A;  4RAI A;  3SPC A;  3OR6 C;  5EBM C;  4UUJ C;  4MVM A;  3FB5 C;  4PA9 A;  4WFH A;  2BOB C;  4JTA B;  3K06 A;  3BEH A;  5B3S C;  3HPL C;  4MVS A;  4RUF A;  2HJF C;  4QNH B;  2ITC C;  2A79 B;  5E1A C;  3E8H A;  3K0G A;  3E8F A;  3RW0 A;  3TCU A;  2IH3 C; 
#chains in the Genus database with same CATH topology
 4B7K A;  1YJ9 V;  1SER A;  3OUF A;  2YXH A;  3SPH A;  1IBM B;  3X2Q C;  4DV6 O;  5H2F Z;  2ZM6 B;  2NNU A;  1NT2 B;  1R3K C;  4WFF A;  4YHH O;  2QSA A;  4JTC B;  2QR4 A;  1ROP A;  1Y76 A;  5EIB D;  5EZY B;  1DLB A;  1EM1 A;  2CH7 B;  5D5P A;  1EN5 A;  2CGN A;  2QA4 V;  4KL1 A;  2GV9 A;  1Y67 A;  5L3D A;  1SQP H;  1VMG A;  1JR9 A;  1BL8 A;  3EXA A;  4F6R A;  4X1I B;  4ZHQ A;  1US6 A;  2R9I A;  1KKD A;  4QJF B;  2DYS B;  3STZ C;  5CA0 B;  3E35 A;  4FK5 C;  4K0K O;  4NXM O;  4DUZ B;  2DWE C;  2WAM A;  2UXD O;  2AXT Z;  1R3I C;  2UU9 B;  5J2T A;  1ZX3 A;  2Y69 B;  3W7T A;  5LMN O;  5LHG A;  2WLI A;  4X8A A;  4YIO A;  2QWQ B;  5IJ9 A;  1LNQ A;  3B40 A;  4JI1 O;  1JOY A;  4J7K A;  1JJO A;  2EIJ B;  2GUZ B;  2QKC A;  4PHZ A;  1EN6 A;  3OGC C;  4QPJ A;  1EBO A;  1G8M A;  5B1A C;  1FXK C;  4K35 A;  2CK3 G;  2E3C A;  3ETD A;  4BIO A;  2DOS A;  3H1H H;  3BY6 A;  1GN4 A;  3H1L H;  4AQY O;  1RPR A;  2BCC H;  2Y0P A;  2R9R B;  4RQE A;  1UPG A;  2FL4 A;  2E76 B;  3LSU A;  3HR0 A;  3RWR D;  1CXZ B;  3HPL C;  1SQB H;  4X20 A;  1K7D A;  1Q8I A;  2A06 H;  1F23 A;  4JI2 B;  1SS3 A;  2ZD9 A;  2F4V B;  4ZBM A;  4H33 A;  1M56 B;  1FXK B;  1FFT B;  2WA3 A;  1EZJ A;  2A9H A;  1FXV A;  1PNK A;  4P2Z A;  2ADQ B;  3ZRV A;  5DED A;  1FD9 A;  3OM3 B;  2FB5 A;  3ZS8 C;  1H2M A;  4WBN A;  1WN7 A;  2FKX A;  4FM0 A;  3Q4H A;  3HKC A;  1TA8 A;  2ZCE A;  4MT8 A;  4DR4 O;  3AG3 C;  4K8Z A;  1LUW A;  4KHP B;  3RFR A;  5KHI A;  1W59 A;  4ASU G;  1NQT A;  1P7B A;  3E8B A;  1XI1 A;  4PA3 A;  2Q7G A;  1D2D A;  2Q7E A;  2P4K A;  4BIU A;  3BVO A;  4TUY B;  4PDV A;  1HR0 O;  5JH7 A;  2JS5 A;  5KX5 B;  3LSS A;  3N27 A;  4DV1 O;  2YXY A;  3IFX A;  5KMG B;  3D3Q A;  2E5L B;  1TUB A;  1S5H C;  1SQV H;  1YCI A;  4X89 A;  5EBL C;  3MHH C;  4GX0 A;  3OUS A;  4MTF A;  2OYQ A;  5CB4 B;  1Q5O A;  4KP4 A;  2JGD B;  4Q6G A;  4EFB A;  1MA1 A;  1WA8 B;  2ZKO A;  4D7T A;  4BAY A;  4TQF A;  1JMK C;  2P7T C;  5JJJ B;  1PNM A;  4Z2W A;  3G6B A;  1GKF A;  5EK0 A;  3F7V C;  2LFR A;  2ZM6 O;  2LP7 A;  3B8N A;  4MVR A;  2CTR A;  4O4I B;  4AHC A;  1YHQ V;  3NXS A;  1QR9 A;  2LJ2 A;  3RYH A;  4IHJ B;  5B3S C;  3RYI B;  1P7G A;  1OZ0 A;  2JGD A;  3E8F A;  4CZZ A;  1S3J A;  1WPB A;  2QE7 G;  1YDX A;  2ZIM A;  2Q73 A;  4J80 A;  2EIK B;  1KKC A;  4DK0 A;  2ZDI C;  1VF5 B;  2XAJ A;  2WPD G;  5KHH A;  2CTW A;  1WAZ A;  2JEU A;  1Y4M A;  3FB7 C;  2P4V A;  2XND G;  3HKB A;  2A3Q A;  4TOI A;  4MSW C;  4JI3 B;  4ZKI A;  4CBC A;  3T4D A;  1IUR A;  1YIT V;  4TV8 A;  3LDE A;  3Q4H B;  1A32 A;  3BHP A;  5CBG A;  1G1X B;  1FS0 G;  1MZE A;  4OPH A;  3K9A A;  3N2K B;  2YXL A;  4JI2 O;  1M57 B;  2GDS A;  2PUS A;  5JVD A;  5CA3 A;  3ZRX A;  3G6E V;  1VIB A;  2MW2 B;  4LR3 A;  1N33 B;  1DF4 A;  1L8D A;  1Q43 A;  3ZMU A;  2KG7 B;  4TUY A;  4AQY B;  1VQ9 V;  2ZIO A;  3FX7 A;  5LA6 B;  5LBQ A;  2DW4 A;  1V54 B;  2DYR B;  2CTP A;  3ETG A;  3ZRS A;  1SRY A;  5EC2 C;  5JQG A;  2CGO A;  5EC1 C;  3VBB A;  4N21 A;  3N2K A;  1AB3 A;  3JD1 A;  2CUG A;  2H94 A;  1M93 A;  1N34 O;  3FKS G;  3H1K H;  2Q0A A;  3B8M A;  3S3X A;  3BAA A;  4X1K A;  5LMN B;  1N0J A;  1S76 D;  1N0N A;  2N74 A;  3W7X A;  4L87 A;  1NBM G;  1MMM A;  4TV9 A;  3I55 V;  3UQ8 A;  2PZS A;  2A79 B;  3JSL A;  2IJK A;  2VQF O;  1FYJ A;  2L35 A;  3KZI Z;  4O2B A;  4KFM A;  3AK2 A;  4P9O A;  4I0X B;  1OCZ C;  1N34 B;  3JCZ A;  5FL7 G;  1HNW O;  3TXS A;  2DMX A;  4PD4 F;  3E8G A;  4PI2 A;  1FAF A;  4NXN B;  4GKK O;  4DR5 B;  1Q81 W;  2Q6A A;  3RYI A;  2UUA O;  1NTM H;  1HNX O;  4GYC B;  2OTJ V;  3VQW A;  3ZHS A;  3AK3 A;  2ZE6 A;  5ITZ A;  5BMV A;  1I08 A;  2Z0A A;  1JA8 A;  1WP8 A;  4X1Y B;  4YHH B;  4YJ2 A;  1FFX B;  2BSK B;  3HKE A;  3JD0 A;  2XHB A;  4JV5 O;  1XNR O;  4LF8 O;  2N05 A;  2UXB B;  1N4C A;  2K1E A;  2VWJ A;  2IU0 A;  1Q6U A;  5IT9 N;  4JI3 O;  1K5S A;  4LNU A;  4FLT A;  2HHH O;  3PN1 A;  2BTQ A;  3T1H B;  1UFI A;  1AP6 A;  1TUB B;  2HJD A;  3E83 A;  5B1A B;  3FYI B;  2QDO A;  4H37 A;  4EFE A;  4WCE V;  4O4H B;  1XBL A;  3H9V A;  4R7C A;  4DUY O;  5CB4 A;  3K03 A;  2Y4T A;  3QO8 A;  1SA0 B;  2RN9 A;  1Y76 B;  2UXX A;  2MK3 A;  4H44 B;  1Q82 W;  4RAI A;  3OR6 C;  4J7J A;  1N36 O;  4DV2 B;  4YJ3 B;  5KX5 A;  3CCL V;  3H1J H;  5E1A C;  3ICX A;  4ZHQ B;  3O65 A;  2YI9 A;  2HP8 A;  3RGB A;  3ASN C;  3P3N A;  3RYF A;  3D3I A;  3RYH B;  4AI8 A;  4J10 A;  3AG2 C;  3BRC A;  1AI7 A;  2EBO A;  2PYJ A;  1I94 B;  2DWD C;  1YSC A;  4DR1 B;  4WFE A;  5IYZ A;  5LOV A;  3C3T A;  3TGU H;  3SPG A;  1AJP A;  3JAK B;  4UCS A;  1O9G A;  1Q86 W;  2OT5 A;  1ZUQ A;  4X1Y A;  2GUZ A;  1R6T A;  1PNL A;  2JJ1 G;  2X0L A;  4I9W A;  1IX9 A;  2E5L O;  1TGO A;  2B1I A;  4LBE C;  4X20 B;  4FZ0 A;  4H0L B;  2W6J G;  1AR4 A;  2YIB A;  4RO2 A;  1H2G A;  1JCH A;  1NR1 A;  4JPR A;  1M5I A;  5ITZ B;  2YSU B;  3CRA A;  4J9Y B;  1PV0 A;  1E1Q G;  2WLL B;  2HVJ C;  5LOV B;  5LYJ A;  1P4R A;  1XMQ B;  4NTX A;  4YJ2 B;  4MTG A;  2F95 B;  2BE3 A;  5CA1 B;  4MVZ A;  4U3J B;  1SQF A;  1S0V A;  2QTO A;  3DGE A;  4XDJ A;  4FLZ A;  3JAT A;  2Q8V A;  4DR4 B;  1BSM A;  4IHJ A;  2W0F C;  3AG4 C;  1P49 A;  1FPO A;  1U96 A;  5IY5 C;  1D5N A;  2QEX V;  5JWP A;  2ZQM A;  2WA4 A;  3AG1 B;  5GW7 A;  4UCT A;  1V55 B;  2RNB A;  4X66 O;  3C90 A;  5IYD O;  1W0K G;  4JF3 A;  2JRI A;  2YIB D;  2QKA A;  4MVM A;  4JI7 O;  2M7W A;  3FB5 C;  2XAH A;  3D36 A;  3H1I H;  1BCC H;  4X65 B;  2F93 B;  3SDL A;  1YJW V;  4X65 O;  3ZMZ A;  2QWO B;  5IWA O;  3STL C;  1YJN V;  1AR1 B;  2P5O A;  5BZB A;  3LUT B;  4EB6 A;  5GTI Z;  4YJ3 A;  2QM7 A;  4HYO A;  4ZIB A;  1OJH A;  2ZT9 B;  1X59 A;  4OPA A;  1JVM A;  3WG7 B;  4JAA A;  2PYL A;  4QE7 A;  2WLN A;  1EFR G;  2AGA A;  1XL4 A;  4ZOL B;  4MVO A;  5JVD B;  1URF A;  3IC7 A;  3BFR A;  4MS2 A;  3P3P A;  5DM6 V;  1EZV H;  4UB8 Z;  3IAY A;  4GX5 A;  3CCE V;  2VRZ A;  1FJG O;  1WB8 A;  1XIL A;  5BXZ A;  3UT5 A;  2Q9L A;  4TT3 G;  4K0K B;  4EKW A;  4C7U A;  3X2Q B;  5IE9 A;  3OMN B;  2PI4 A;  4G27 B;  4IT5 A;  4I0X A;  1R6K A;  1LR1 A;  1SKV A;  2BSK A;  2ITD C;  3HKE B;  2L6L A;  5GTH Z;  1BE3 H;  2YIA A;  1DTO A;  4HAM A;  4PV1 B;  3K79 A;  3T1C A;  4GLX A;  2B1G A;  1J5E B;  2EIM C;  3RYC B;  4DR1 O;  4LFC B;  1QR8 A;  4WFA V;  5L3E A;  3UCS C;  5KHK A;  3J80 N;  3ABT A;  3EFF K;  2ZXW B;  2Z5U A;  1NVP D;  2KB1 A;  3CEI A;  1W0J G;  3OTO B;  3CXC U;  4JI0 B;  2BOB C;  4JTA B;  2CAZ C;  3T1Y O;  3IJ4 A;  3JAT B;  3JD4 A;  3JAR B;  4DV1 B;  1MSW D;  3K08 A;  4HBN A;  1KQS U;  1Q6I A;  2LGW A;  4JYA B;  1JFF A;  2ZIN A;  1SZT A;  4JAU A;  3DXR A;  1FJG B;  3RN4 A;  4LF5 B;  3MD0 A;  1FXH A;  2YI8 A;  1GN2 A;  4R8C A;  3QNE A;  4PA6 A;  1JPX A;  4PDR A;  4DV4 O;  3W7U A;  3ZRW A;  1YI2 V;  3ZMT A;  4UXN A;  3SPI A;  4J42 A;  2VS0 A;  2Q68 A;  2YIC A;  1COW G;  2VQE O;  1AVM A;  3ABM B;  1KC8 W;  1K3E A;  2WLJ A;  4KXR A;  3OW2 U;  1QLE C;  3H01 A;  2CTQ A;  2Y48 A;  5JQG B;  3E22 B;  2R72 A;  1THZ A;  1V55 C;  2X6B A;  2YDE A;  1HP8 A;  1GH6 A;  1XNR B;  1BS3 A;  4DR3 O;  5CBF A;  2EIK C;  1GO3 F;  2ZE5 A;  2A0L A;  1I5Y A;  1KB9 F;  4CS2 A;  1V54 C;  3LNM B;  1EN4 A;  4ZOL A;  1AR5 A;  2OCH A;  3ZBH A;  5CMU A;  5LMU O;  1Y74 B;  4GX1 A;  4HNA B;  4KUM A;  1SA0 A;  3FD9 A;  1B6Q A;  3L74 H;  4GUN A;  3O9O A;  2Q0O C;  3ABK C;  2QM8 A;  2ATK C;  4IL6 Z;  3SPJ A;  4LC1 A;  4QE9 A;  1IBK B;  5BMV B;  4RQF A;  4NXN O;  4WFB V;  1T5E A;  4DV3 O;  3KCX A;  1BGY H;  3QO7 A;  3OE7 G;  3G67 A;  4DR7 O;  3A2F A;  1CPY A;  4JI1 B;  2QWR B;  2IJH A;  3JD2 A;  4D7S A;  1VQK V;  2Q4P A;  4OXS A;  4JI8 B;  1S72 V;  1XMQ O;  5AG2 A;  2UU9 O;  1BT8 A;  1L0N H;  2QGN A;  1H38 A;  2ITC C;  2R9A A;  4NXM B;  4W4K A;  2F43 G;  1KP2 A;  4U7O A;  3U10 A;  3DXR B;  1I5X A;  3CCM V;  1MZF A;  4B7E A;  4LF6 O;  2GTS A;  3ZJZ A;  4DR7 B;  3AG4 B;  4Z1M G;  1M56 C;  1S5J A;  4F4L A;  2OIG A;  2E74 B;  4PEL A;  4GKJ B;  4FZ1 A;  4RUE A;  1BMF G;  2WLK A;  4MW3 A;  2QTS A;  5JCO C;  3TJT A;  1NKD A;  5BR8 O;  4FLW A;  1E1R G;  4UVB A;  5H6R A;  4FM2 A;  3G80 A;  4LF9 O;  5JH7 B;  1YIJ V;  2JIZ G;  5CA1 A;  5LMU B;  1TAE A;  4DW1 A;  3CRM A;  1YEW A;  2AZ0 A;  4DR3 B;  1IBL O;  1JX9 A;  2WLM A;  3WU2 Z;  1SZX A;  2Y4U A;  2X6C A;  4O4J A;  3M8A A;  1XHZ A;  1VQM V;  2ZR2 A;  3IGA C;  5KA5 A;  3JAS B;  3GWK C;  2YEV B;  1K33 A;  2FML A;  3JCU Z;  2ETN A;  3CMA V;  2ZE7 A;  2EJR A;  3JAW A;  4R6Z A;  2ZNI A;  2JDI G;  4DV5 O;  3GB7 C;  4J7Z A;  4I55 B;  1E79 G;  1IXM A;  3K5O A;  2UXC O;  1YTF B;  2LFS A;  1R3J C;  1TUE B;  3ZN1 A;  1XHX A;  4TWK A;  1ARO P;  5IJ0 B;  1YTF D;  4PA9 A;  1KUQ A;  1SQG A;  2A7W A;  3BEH A;  2UXB O;  5K1P A;  1NTZ H;  3SJA C;  3APO A;  1Z5W A;  2HJF C;  1Q90 D;  4W4L A;  3JAK A;  1XOU A;  1BHB A;  4IYI A;  2Y69 C;  5J2U A;  3OR7 C;  5J9P C;  5LP6 A;  3SYA A;  3K5M A;  1GAX A;  3B2E E;  4LF9 B;  1AIL A;  4WFG A;  4ZI7 B;  1Z5V A;  3OEH G;  4LFC O;  4YY3 B;  2IH1 C;  3L72 H;  2WLL A;  5IDJ A;  3OGI B;  3JD3 A;  5FNV B;  1K4D C;  5EYP B;  1QLN A;  1IXB A;  2XTA A;  3D8C A;  2ODM A;  4GT1 A;  3ASO B;  4U3J A;  3AK1 A;  4I9Q A;  5A2Q N;  1VQ5 V;  1S77 D;  3G71 V;  3QVN A;  3CME V;  1HR0 B;  5HFM A;  4XDK A;  1R3L C;  5KUK A;  3W7S A;  4Z1V A;  3OMA B;  4LNU B;  3K5N A;  3K0D A;  4DK1 A;  2ARH A;  3EHB B;  5IYB O;  1XEQ A;  3B09 A;  5DEC A;  4PDL A;  1G4Y B;  5H6Q A;  4B3T B;  2HG5 C;  4DV7 O;  1WNS A;  4F6R B;  3CCJ V;  4DV3 B;  1Y74 A;  4NVP A;  5JJE B;  4FLV A;  1OCZ B;  3FB6 C;  1VF7 A;  4FFK A;  3AG7 A;  2AW9 A;  3LDC A;  4JTD B;  4LWS A;  3AEI A;  4JI4 O;  3SR2 C;  5HFL A;  1AI5 A;  5JJN B;  2UUB O;  3VQY A;  3DTU B;  2KQX A;  4WFH A;  3CC7 V;  2V4D A;  1KP3 A;  4O2B B;  1GM8 A;  5EIB C;  1PM9 A;  4CH5 A;  2N04 A;  2X7R B;  3E8H A;  1MAB G;  2PF4 E;  3C3S A;  2JVD A;  5LL6 Y;  1XL6 A;  4LF7 B;  1BQ0 A;  1XRE A;  2XAG A;  4YXW G;  4JI4 B;  4O4L B;  3SYP A;  1ZWI C;  1ZSP A;  4MTO A;  2VQE B;  4JZG A;  1B3Q A;  5B1B B;  3JSN A;  3E2E A;  5B1N A;  4GX2 A;  3K04 A;  3CRQ A;  4NR1 A;  4TSF G;  3VQV A;  4ABM A;  5LGT A;  2R70 A;  2WLH A;  3NR7 A;  1M57 C;  4NTY A;  3J81 N;  2LO1 A;  3A0B Z;  4BIZ A;  5L3B A;  2RJZ A;  3F7Y C;  1QCE A;  3ZHU A;  4DUZ O;  1ZL8 B;  1NH2 D;  4JYC A;  2UUC O;  4CS3 A;  1ZLZ A;  4TQD A;  2DYR C;  3T1Y B;  5LHI A;  1PD3 A;  2O57 A;  1B06 A;  2VWK A;  1SQX H;  4LFB B;  1SC5 B;  3ZHQ A;  4JI5 B;  1PL0 A;  2EIL C;  4JI6 B;  3P30 A;  1Z2G A;  4QPK A;  3ZIA G;  4EEQ A;  4DR2 O;  3AG2 B;  1W2B U;  3K5L A;  3MAQ A;  1VF6 C;  1CP9 A;  1OCO B;  1I7F A;  4O2A B;  3L75 H;  4IIJ B;  2IM9 A;  1GTO A;  4DR2 B;  1PKX A;  3FYE B;  2G38 A;  4E2L A;  2H8P C;  4DV6 B;  3OEE G;  4FPP A;  3F5W C;  1M9N A;  4JI5 O;  1JJ2 U;  4GCZ A;  5EBM C;  2B5U A;  4O4H A;  4I4T A;  1B04 A;  1QQC A;  2UUC B;  1X4T A;  4JYY A;  3TCU A;  4DYL A;  2ZNJ A;  2OCC B;  3W7W A;  1N36 B;  1WP7 A;  5KA6 A;  2DQ3 A;  2LQT A;  2EJ7 A;  2GHY A;  2UXC B;  4P9P A;  1H2K A;  3ABM C;  1K9M W;  3CRR A;  1RPO A;  3KKY A;  1YF2 A;  4KHP O;  4HNA A;  4JGS A;  1R6N A;  4B3M O;  3QG5 A;  1M4U A;  4NYK A;  1VEW A;  5DN6 G;  4DW0 A;  5B3S B;  3CX5 F;  3T1H O;  1HDJ A;  3SJC C;  4BW9 A;  2EUL A;  3SYQ A;  1HWY A;  5FPO A;  3UT5 B;  2D2C B;  1HNZ O;  3M7M X;  3CHX A;  5IYZ B;  4LF7 O;  1MG1 A;  3ZMS A;  3S3W A;  4UCU A;  1VQ6 V;  4B3R O;  5JCO A;  4OX9 O;  1TVK B;  3ZMV A;  5IWA B;  4DR6 O;  5EYP A;  4G2K A;  1CEZ A;  3GVM A;  2UXN A;  4AIL C;  1K4C C;  4O4I A;  2P90 A;  3CB2 A;  3CS5 A;  3VQX A;  1D5A A;  1DF5 A;  4PJ0 Z;  3ZHT A;  5LP6 B;  5B5E Z;  5KAI Z;  3CE2 A;  5TIS Z;  2UUB B;  1VQ7 V;  4DRX A;  2EIN C;  1HW7 A;  3APQ A;  3FAV B;  2YS8 A;  4FMT A;  4NTW A;  1XDC A;  1I0H A;  1OCO C;  3OTF A;  4IYH A;  2UUA B;  1AP5 A;  4CS4 A;  1AI4 A;  4B3S O;  4MW8 A;  4ICG A;  2RDC A;  1AJN A;  4LF4 O;  3OMI B;  2OWO A;  3CC2 V;  5KHG A;  3OT7 A;  3A0H Z;  2DJV A;  4B08 A;  1QBZ A;  5FPR A;  5LP6 C;  3HKB B;  1N32 O;  1VQO V;  1PP9 H;  1GM7 A;  5C93 A;  4UVC A;  3FFQ A;  1O9H A;  3L71 H;  1G6U A;  4RUF A;  3RW0 A;  3SJB C;  4O2A A;  1KYO F;  5KHJ A;  4UCR A;  1RFY A;  4I50 B;  1H2N A;  1P84 F;  4X64 O;  2XUM A;  2CE4 A;  2LGQ A;  3K9S A;  1SF9 A;  2EIJ C;  3SYO A;  1XMO O;  4NB5 A;  3CD6 V;  3ETE A;  4I55 A;  1SET A;  1WLE A;  1IBK O;  3ASO C;  1NVP B;  3N2G A;  4YY3 O;  1MSD A;  1QU7 A;  2ZR3 A;  4CH3 A;  1KD1 W;  1RSO B;  1GK9 A;  2PI5 A;  2YEV A;  5E79 Z;  2P67 A;  1GN6 A;  1ORQ C;  2C2A A;  5IJ9 B;  2ILM A;  3T2M A;  2JEX A;  2JJ2 G;  2YID A;  4DR6 B;  1OCR B;  1K73 W;  5LXT B;  4B3R B;  1RM1 C;  3CCU V;  3RT3 C;  2Q67 A;  4N23 A;  3ZX6 A;  2GSM B;  1HNZ B;  4DV2 O;  3E22 A;  5KMG A;  3CXH F;  3A0R A;  3HKD B;  2Z3Y A;  5L3F A;  3OD4 A;  3CSX A;  1R73 A;  1RP3 B;  1FFX A;  3TET A;  3BPZ A;  3U11 A;  5IYC O;  4E4E A;  4DRX B;  3TXQ A;  2IJJ A;  4ZI7 A;  4G28 B;  4JYA O;  2X6A A;  1F4M A;  3SPC A;  4O4L A;  4UCV A;  4L8J A;  5LGU A;  4QNH B;  3BA9 A;  4LF8 B;  1IBL B;  3K0G A;  1S5L Z;  4UFZ A;  4JAS A;  2QWN B;  5B66 Z;  1U97 A;  4JV5 B;  4MVQ A;  1YZB A;  5IY5 B;  1SES A;  2OIE A;  5L3G A;  2BOC C;  1XQ8 A;  4BW5 A;  1UJW B;  2GBO A;  3RVZ A;  3ZED A;  2H3O A;  1VAR A;  2V7Q G;  2JGU A;  4PDM A;  3WB1 A;  4PI0 A;  5LYJ B;  1SQQ H;  2Q5Z A;  2LW1 A;  4IIJ A;  1HNX B;  2NLJ C;  2HFE C;  1J5E O;  3K3W A;  5FLX N;  4DR5 O;  3RVY A;  4GKJ O;  4DV0 O;  4JI6 O;  5B1B C;  3SGI A;  4OGQ B;  1YVW A;  4X64 B;  2F1M A;  4LF6 B;  3JYC A;  3EVK A;  2E75 B;  4HZ3 A;  3B4S A;  2EZP A;  4PA7 A;  2YUA A;  1DGS A;  1NZ6 A;  2QKS A;  2VQF B;  1Y66 A;  3CJH A;  2DN9 A;  4DO2 A;  2HKO A;  1H8E G;  3N2G B;  3L9D A;  5EBW C;  4LWS B;  4LFA O;  1PL4 A;  1N32 B;  1XUQ A;  1TVK A;  1L0L H;  2JK5 C;  4JI8 O;  3ETQ A;  1QVF U;  4X9Q A;  1NJI W;  1VQN V;  5L3C A;  1NI8 A;  3MHS C;  3WG7 C;  4JZ2 A;  3KG2 A;  1R1B A;  1KU9 A;  4QIW F;  4K8X A;  1VQP V;  4BR6 A;  4NKG B;  5LXT A;  3SYC A;  1MOF A;  3JAL A;  2XAS A;  4J41 A;  3QTC A;  3WB2 A;  4J9Z B;  1NH2 B;  2OTL V;  1IDS A;  2AHZ A;  5J2T B;  4JYB A;  2AHY A;  2GTA A;  4UUJ C;  3ASN B;  4FM1 A;  4X62 B;  1N33 O;  3ZCC A;  2ZDI A;  4H13 B;  1KEC A;  2QWP B;  4J11 A;  4X62 O;  2IH3 C;  3ZHR A;  1H2L A;  1YXB A;  4FFB B;  4JI7 B;  2K9P A;  2XOK G;  2WSS G;  4FIP C;  1OCR C;  3D36 C;  5IJ0 A;  4K3A A;  3RBZ A;  5GON A;  2M6Y A;  1K5Q A;  1ZL8 A;  1BQZ A;  5KLV H;  4XBF A;  3CCV V;  1QVG U;  3E86 A;  4B3M B;  1QLE B;  4B3T O;  3PJS K;  1MNG A;  1Q6H A;  1F51 A;  1NR7 A;  3M99 B;  3R66 A;  4LF5 O;  3TK1 A;  2DYS C;  4MVU A;  3UKM A;  1M90 W;  2UXD B;  4P30 A;  4LH6 A;  5LHH A;  1RSO A;  5A9G A;  1Y6X A;  3FB8 C;  3I56 V;  2BTO A;  5FNV A;  1GRJ A;  2W6I G;  3UO2 A;  1GM9 A;  1L1F A;  3JAS A;  4JI0 O;  1AJQ A;  3OTO O;  2JS3 A;  4XDL A;  4CH6 A;  1VQ4 V;  2DQ0 A;  1JQ0 A;  3B77 A;  3ZHV A;  1KBH A;  4I4T B;  3CC4 V;  4IGG A;  5CA0 A;  4DXW A;  2HVK C;  2IU3 A;  2V1D A;  1PPJ H;  4UV8 A;  1VQ8 V;  3HKC B;  2RMK B;  2WLI B;  3LNN A;  2EX3 A;  3E89 A;  5C8Y B;  1VP7 A;  5LGN A;  1IBM O;  4I7Z B;  2EZO A;  4X1I A;  3JAW B;  4LFB O;  3GWO A;  4UCO A;  3BAB A;  2NN4 A;  2EIL B;  4FFB A;  2ADP A;  3ABU A;  2ZE8 A;  3UO3 A;  2HEP A;  4TV9 B;  5EZY A;  1Q3E A;  1QHT A;  3G4S V;  1RM1 B;  1BHA A;  2XAF A;  4A5U B;  3FAV A;  2XAQ A;  3SJQ C;  2CH7 A;  1NTK H;  1LUV A;  1ZAU A;  3CRC A;  5C8Y A;  3RYF B;  3QO5 A;  3DC6 A;  2WWW A;  5CBH A;  1H8H G;  2HR3 A;  3JAR A;  2HHH B;  1WA8 A;  3P32 A;  4UB6 Z;  3RYC A;  5H9C A;  1XNQ B;  1OCC B;  3ABL C;  1NS1 A;  2FYU H;  1KMI Z;  1IVS A;  4FLX A;  1ENV A;  3J7A U;  1V9P A;  3HB3 B;  3CP1 A;  4CC6 A;  4WBN B;  3A8T A;  3WFV A;  2F4V O;  3ML0 A;  2EIN B;  5KAF Z;  1OV9 A;  3HKD A;  1DK1 A;  5K1X A;  1OCC C;  2HLD G;  3ABL B;  1WPX A;  4I5S A;  5H5N A;  1NU1 H;  2Y0I A;  2RCV A;  5F2V O;  4FVM A;  5KUM A;  1IZ3 A;  4YIP A;  3T4Z A;  3LSQ A;  4F6E A;  3CCS V;  3AG3 B;  1N8R W;  3K58 A;  2ZXW C;  3BA8 A;  5BR8 B;  4X66 B;  1JFF B;  3UM7 A;  3R65 A;  1K97 A;  2BTQ B;  3BCC H;  3LDD A;  1XMO B;  5B1O A;  4GKK B;  3WB0 A;  5D5Q A;  2FTK A;  1WB7 A;  2P06 A;  1K8A W;  2P22 C;  4DV7 B;  4LCU C;  3JAM N;  1HNW B;  3VOU A;  3ZRW B;  3K57 A;  2IW5 A;  4UVA A;  2KKW A;  3CPW U;  1VF6 A;  4LFA B;  4EB6 B;  1BZK A;  4MTX A;  1FXK A;  2B9Z A;  3CJH B;  3KCY A;  3THO A;  2DE0 X;  5LA6 A;  3ABK B;  1GN3 A;  3CCQ V;  3K06 A;  4U3F H;  1FKA O;  1WJZ A;  4Q20 A;  4PA4 A;  3CYO A;  1VQL V;  5CN0 A;  4LF4 B;  5BY1 A;  4DV0 B;  2KG7 A;  4B3S B;  3L73 H;  4LP8 A;  3AG1 C;  1Q7Y W;  4U7N A;  4O4J B;  1GMG A;  3U0Z A;  3JAL B;  1M1K W;  1H2S B;  3QF7 A;  5GON B;  1QNM A;  1I94 O;  2EIM B;  4GZR B;  1K92 A;  2Q69 A;  3OAA G;  4RWU A;  2IJI A;  4CH4 A;  4FJC C;  2Q7H A;  4UV9 A;  3MDS A;  4WF9 V;  4X1K B;  4OX9 B;  3CCR V;  2PY5 A;  4R50 A;  4FLY A;  3OFN G;  2KSD A;  1K34 A;  2OCC C;  4X88 A;  4LH7 A;  4FLU A;  1XNQ O;  2IBZ H;  2PTM A;  1ZTE A;  2F66 C;  2XT9 A;  4TV8 B;  3IC9 A;  1J95 A;  4DV5 B;  4D6T H;  2P6J A;  3K59 A;  3DC5 A;  2QJ1 A;  5J2U B;  4DUY B;  3ZN0 A;  4DV4 B;  2LW7 A;  1F4N A;  2AZ2 A;  2QM4 A;  2CDY A;  2D3O W;  1F7Y A;  2NR5 A;  3CWB H;  2PGG A;  3I5D A;  2RQ6 A;  2W0X A;  1OHH G;  3L70 H;  3F5T A;  4CC5 A;  4JAV A;  3DSQ A;  2F23 A;  4BWA A;  1AI6 A;  4I50 A;  2YC0 A;  4MVS A;  4QGP A; 
#chains in the Genus database with same CATH homology
 4JAS A;  2Y69 C;  1YJ9 V;  1SER A;  3OUF A;  3SPH A;  3ASN C;  4MVQ A;  3OR7 C;  3D3I A;  3X2Q C;  5IY5 B;  5J9P C;  1SES A;  3SYA A;  2NNU A;  2BOC C;  5L3G A;  1R3K C;  4WFF A;  3AG2 C;  4JTC B;  4BW5 A;  4WFG A;  1UJW B;  1AI7 A;  1ROP A;  2EBO A;  3RVZ A;  3OEH G;  2V7Q G;  2DWD C;  1YSC A;  4PDM A;  4WFE A;  2IH1 C;  1DLB A;  2WLL A;  5IDJ A;  3SPG A;  1AJP A;  2NLJ C;  3JD3 A;  2HFE C;  2QA4 V;  1Q86 W;  3K3W A;  2OT5 A;  3RVY A;  1K4D C;  5L3D A;  1QLN A;  1BL8 A;  1PNL A;  2JJ1 G;  2X0L A;  5B1B C;  4I9W A;  4GT1 A;  3ASO B;  3JYC A;  2R9I A;  1KKD A;  2B1I A;  4LBE C;  4HZ3 A;  2EZP A;  4PA7 A;  2W6J G;  4QJF B;  2DYS B;  1VQ5 V;  3STZ C;  4RO2 A;  2QKS A;  1S77 D;  1H2G A;  1JCH A;  1Y66 A;  3E35 A;  1NR1 A;  4FK5 C;  3G71 V;  4JPR A;  2DWE C;  2YSU B;  2WAM A;  4J9Y B;  4DO2 A;  3CME V;  2HKO A;  5HFM A;  4XDK A;  1R3I C;  1R3L C;  1H8E G;  5KUK A;  3W7S A;  1E1Q G;  2WLL B;  2HVJ C;  3OMA B;  5EBW C;  2Y69 B;  3K0D A;  3W7T A;  5LHG A;  2WLI A;  4X8A A;  1P4R A;  3EHB B;  2JK5 C;  5IYB O;  1QVF U;  1NJI W;  4MTG A;  1VQN V;  1LNQ A;  4PDL A;  5L3C A;  4MVZ A;  1G4Y B;  3MHS C;  3WG7 C;  5H6Q A;  1JOY A;  2HG5 C;  1S0V A;  2QTO A;  3DGE A;  3KG2 A;  4XDJ A;  2EIJ B;  3CCJ V;  2W0F C;  3AG4 C;  3OGC C;  4QIW F;  4QPJ A;  1EBO A;  1VQP V;  1G8M A;  5B1A C;  1FXK C;  5IY5 C;  2CK3 G;  1OCZ B;  2QEX V;  3ETD A;  3SYC A;  2ZQM A;  3FB6 C;  3AG1 B;  5GW7 A;  1MOF A;  2XAS A;  1V55 B;  4J9Z B;  1NH2 B;  3LDC A;  2OTL V;  3BY6 A;  2AHZ A;  4JTD B;  4JYB A;  3AEI A;  2AHY A;  5IYD O;  1RPR A;  1W0K G;  2R9R B;  1AI5 A;  4JF3 A;  5HFL A;  4RQE A;  4UUJ C;  3ASN B;  4MVM A;  2M7W A;  3FB5 C;  2XAH A;  3D36 A;  3DTU B;  4WFH A;  3CC7 V;  1KP3 A;  3ZCC A;  2ZDI A;  3HPL C;  1GM8 A;  1YJW V;  1KEC A;  1K7D A;  2X7R B;  1F23 A;  3E8H A;  2IH3 C;  1MAB G;  3ZMZ A;  2ZD9 A;  3STL C;  4ZBM A;  1YJN V;  1AR1 B;  4H33 A;  2XOK G;  1XL6 A;  1M56 B;  1FXK B;  1FFT B;  5BZB A;  3LUT B;  2WSS G;  2XAG A;  4FIP C;  2QM7 A;  1OCR C;  4HYO A;  1EZJ A;  2A9H A;  4YXW G;  1FXV A;  1PNK A;  4P2Z A;  3RBZ A;  3SYP A;  1ZWI C;  1K5Q A;  1JVM A;  3WG7 B;  3ZRV A;  3OM3 B;  4MTO A;  4QE7 A;  5B1B B;  2WLN A;  4XBF A;  1EFR G;  3CCV V;  1QVG U;  4MT8 A;  3AG3 C;  3E86 A;  1XL4 A;  3E2E A;  5B1N A;  1QLE B;  4MVO A;  4GX2 A;  3K04 A;  3PJS K;  4TSF G;  3IC7 A;  4ASU G;  4MS2 A;  1NQT A;  1P7B A;  3E8B A;  5DM6 V;  5LGT A;  2WLH A;  1M57 C;  1F51 A;  1NR7 A;  4GX5 A;  3M99 B;  4PA3 A;  3TK1 A;  2DYS C;  3CCE V;  4MVU A;  4BIU A;  3UKM A;  4BIZ A;  5L3B A;  1M90 W;  3F7Y C;  4PDV A;  4P30 A;  1QCE A;  5LHH A;  4TT3 G;  4EKW A;  1NH2 D;  3FB8 C;  3I56 V;  4JYC A;  3LSS A;  3X2Q B;  3IFX A;  2DYR C;  3OMN B;  2PI4 A;  4G27 B;  2W6I G;  5LHI A;  1PD3 A;  1R6K A;  1S5H C;  1GM9 A;  1L1F A;  2ITD C;  1AJQ A;  4X89 A;  5EBL C;  3MHH C;  4GX0 A;  1PL0 A;  3OUS A;  1DTO A;  2EIL C;  4MTF A;  4HAM A;  3P30 A;  3K79 A;  4QPK A;  3T1C A;  4XDL A;  3ZIA G;  2B1G A;  1VQ4 V;  4KP4 A;  2DQ0 A;  1JQ0 A;  3B77 A;  3AG2 B;  2EIM C;  1W2B U;  3CC4 V;  4DXW A;  2HVK C;  2IU3 A;  2V1D A;  1QR8 A;  1CP9 A;  4WFA V;  1OCO B;  5L3E A;  4UV8 A;  4BAY A;  1VQ8 V;  2P7T C;  3ABT A;  1PNM A;  3EFF K;  2ZXW B;  2WLI B;  1GTO A;  1GKF A;  5EK0 A;  1PKX A;  3F7V C;  2LFR A;  3FYE B;  2Z5U A;  1NVP D;  3E89 A;  2LP7 A;  4E2L A;  3B8N A;  2H8P C;  2KB1 A;  3OEE G;  4FPP A;  5LGN A;  4MVR A;  3F5W C;  1M9N A;  1W0J G;  2EZO A;  4GCZ A;  5EBM C;  1YHQ V;  1JJ2 U;  2B5U A;  3NXS A;  1QR9 A;  3CXC U;  2BOB C;  3GWO A;  4JTA B;  5B3S C;  3JD4 A;  1OZ0 A;  1MSW D;  2EIL B;  3TCU A;  3E8F A;  4CZZ A;  3ABU A;  1S3J A;  2OCC B;  2QE7 G;  3W7W A;  3K08 A;  3G4S V;  1KQS U;  1RM1 B;  5KA6 A;  2DQ3 A;  4JAU A;  1BHA A;  1SZT A;  2XAF A;  2EIK B;  2XAQ A;  3SJQ C;  2GHY A;  3MD0 A;  4P9P A;  1FXH A;  2ZDI C;  3ABM C;  1K9M W;  4R8C A;  1RPO A;  2XAJ A;  3QNE A;  4PA6 A;  1JPX A;  4PDR A;  2WPD G;  3W7U A;  3ZRW A;  1YI2 V;  4JGS A;  1R6N A;  3ZMT A;  2JEU A;  3QO5 A;  1Y4M A;  4UXN A;  3SPI A;  3FB7 C;  2Q68 A;  2WWW A;  5CBH A;  2XND G;  5DN6 G;  5B3S B;  1COW G;  1H8H G;  2HR3 A;  3ABM B;  4MSW C;  1KC8 W;  3P32 A;  1K3E A;  2WLJ A;  3OW2 U;  3SYQ A;  1HWY A;  5H9C A;  1QLE C;  4ZKI A;  4CBC A;  1OCC B;  3ABL C;  3T4D A;  3H01 A;  2Y48 A;  1YIT V;  1ENV A;  3LDE A;  1MG1 A;  3HB3 B;  3ZMS A;  3CP1 A;  5CBG A;  1THZ A;  1V55 C;  2X6B A;  1VQ6 V;  3WFV A;  3ML0 A;  3ZMV A;  1FS0 G;  2EIN B;  4G2K A;  1OCC C;  2HLD G;  3ABL B;  2UXN A;  3K9A A;  5CBF A;  1CEZ A;  2EIK C;  1GO3 F;  1WPX A;  4I5S A;  2A0L A;  1M57 B;  1K4C C;  1I5Y A;  5CA3 A;  2P90 A;  1V54 C;  3LNM B;  3ZRX A;  3G6E V;  1DF5 A;  5KUM A;  1DF4 A;  5CMU A;  3T4Z A;  3LSQ A;  4GX1 A;  3ZMU A;  4KUM A;  3CCS V;  3AG3 B;  1B6Q A;  1VQ7 V;  1N8R W;  2EIN C;  3ABK C;  2QM8 A;  1VQ9 V;  2ZXW C;  2ATK C;  3SPJ A;  5LBQ A;  2DW4 A;  1V54 B;  4LC1 A;  2DYR B;  4FMT A;  4QE9 A;  3ETG A;  3UM7 A;  3ZRS A;  3R65 A;  1OCO C;  1SRY A;  1K97 A;  4RQF A;  3LDD A;  5EC2 C;  5B1O A;  1AI4 A;  4MW8 A;  5EC1 C;  4WFB V;  3VBB A;  4N21 A;  2FTK A;  3JD1 A;  1AJN A;  1K8A W;  2H94 A;  3QO7 A;  4LCU C;  3OE7 G;  3OMI B;  3VOU A;  3ZRW B;  1CPY A;  2IW5 A;  3FKS G;  2IJH A;  3JD2 A;  4UVA A;  3CC2 V;  1QBZ A;  1VQK V;  4OXS A;  1S72 V;  3B8M A;  3CPW U;  1VQO V;  1GM7 A;  5C93 A;  4MTX A;  1S76 D;  4UVC A;  1FXK A;  3W7X A;  3ABK B;  4L87 A;  3CCQ V;  1NBM G;  4RUF A;  3I55 V;  1H38 A;  2ITC C;  2A79 B;  3RW0 A;  2IJK A;  3K06 A;  2F43 G;  1KP2 A;  4U7O A;  4P9O A;  1I5X A;  4KFM A;  3CCM V;  4Q20 A;  1OCZ C;  4PA4 A;  3JCZ A;  3CYO A;  5FL7 G;  5CN0 A;  3ZJZ A;  1VQL V;  3AG4 B;  4Z1M G;  1M56 C;  3E8G A;  2EIJ C;  4F4L A;  3SYO A;  4PEL A;  4RUE A;  1BMF G;  2WLK A;  4LP8 A;  4MW3 A;  1Q81 W;  2Q6A A;  3AG1 C;  3CD6 V;  1Q7Y W;  4U7N A;  3ETE A;  1GMG A;  1SET A;  1WLE A;  2OTJ V;  3ASO C;  1NVP B;  1M1K W;  1NKD A;  2EIM B;  1E1R G;  4UVB A;  2ZR3 A;  5H6R A;  1KD1 W;  1GK9 A;  2PI5 A;  1YIJ V;  2YEV A;  1K92 A;  2Q69 A;  3OAA G;  2IJI A;  2P67 A;  2JIZ G;  1ORQ C;  4FJC C;  2C2A A;  4UV9 A;  3JD0 A;  4WF9 V;  3T2M A;  2JEX A;  2JJ2 G;  1OCR B;  1K73 W;  1JX9 A;  2WLM A;  3CCR V;  1RM1 C;  3CCU V;  4R50 A;  3OFN G;  1K34 A;  2Q67 A;  2OCC C;  2X6C A;  4N23 A;  4X88 A;  2GSM B;  1VQM V;  2ZR2 A;  2K1E A;  2IU0 A;  1K5S A;  3IGA C;  5KA5 A;  1J95 A;  3A0R A;  2YEV B;  1K33 A;  2P6J A;  2Z3Y A;  5L3F A;  3E83 A;  5B1A B;  3FYI B;  4H37 A;  1R73 A;  4WCE V;  3CMA V;  2EJR A;  3ZN0 A;  4R7C A;  1F4N A;  3TET A;  4R6Z A;  3K03 A;  5IYC O;  2JDI G;  2D3O W;  3GB7 C;  3QO8 A;  1E79 G;  1IXM A;  1YTF B;  2IJJ A;  2UXX A;  4G28 B;  2LFS A;  1R3J C;  2MK3 A;  1TUE B;  3ZN1 A;  2X6A A;  1F4M A;  1Q82 W;  1OHH G;  4TWK A;  4RAI A;  3SPC A;  1ARO P;  3OR6 C;  1YTF D;  4JAV A;  4PA9 A;  3BEH A;  5LGU A;  1AI6 A;  2HJF C;  4QNH B;  3CCL V;  5E1A C;  3K0G A;  4MVS A;  1BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...