4MSWC

Y78 ester mutant of kcsa in high k+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 43
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mswC00
2EINC 2A9HA 4JTAB 4QE9A 4X8AA 5CBGA 2IH1C 4PDRA 1BL8A 2HFEC 3TETA 3F5WC 2JK5C 4QE7A 1M56C 4X88A 2H8PC 3ABMC 3ASNC 4ZBMA 2ATKC 2EIMC 3AG2C 3E89A 5B1BC 3OUSA 4PA9A 1OCCC 1OCOC 4BW5A 1OCZC 2OCCC 4R8CA 3WG7C 1R3IC 2EIJC 3SYCA 2WLNA 4MTOA 4PDMA 4RUFA 4PDLA 4MTGA 2A79B 4P9PA 4R7CA 4I9WA 2AHZA 2Q69A 2P7TC 3T4DA 2WLIB 4OXSA 4HYOA 4JTCB 4MVOA 4MSWC 4XDJA 5EC1C 5EK0A 5CBFA 3SYOA 2Q6AA 1R3JC 2HG5C 1QLEC 4WFEA 2DYRC 3FB7C 3FB8C 3EFFK 1P7BA 3F7VC 2X6CA 4RAIA 3E83A 3FB5C 3VOUA 2X6BA 4MVZA 2HJFC 2WLHA 2ZD9A 3LDDA 3RBZA 3IGAC 3IFXA 4PA3A 3ABKC 2WLLB 3AG1C 2K1EA 3K0DA 3KG2A 3STLC 5B1AC 2BOCC 3K06A 5EBMC 3K04A 4WFFA 3AG3C 5BZBA 2ITDC 2QTOA 1J95A 1S5HC 3JYCA 1M57C 4JTDB 4J9ZB 4PDVA 3K08A 3RW0A 4J9YB 4XDLA 2BOBC 5EC2C 4XDKA 2W0FC 4MVUA 2EIKC 2Q68A 3T4ZA 4RO2A 1G4YB 3E86A 4MVMA 5EBWC 2DWDC 3K03A 4MVQA 4TWKA 1ZWIC 3K0GA 2HVKC 4PA6A 4P9OA 3SPGA 2KB1A 4GX2A 3SYPA 3LDEA 2X6AA 5J9PC 5KUKA 2R9RB 2A0LA 2DWEC 3OR7C 4PA4A 5IY5C 3UM7A 1R3KC 3AG4C 4MVRA 4P2ZA 1K4DC 1ORQC 3LNMB 2AHYA 2YEVA 4G27B 3OUFA 4H37A 4R6ZA 1K4CC 3RVZA 4HZ3A 1OCRC 3SPIA 3T1CA 4GX5A 3PJSK 4GX1A 2Q67A 4UUJC 3T2MA 1V54C 1JVMA 4LBEC 3SJQC 4DXWA 4PA7A 3LUTB 5EBLC 4CBCA 3F7YC 4WFHA 5KUMA 5B3SC 2WLJA 4R50A 4P30A 4GX0A 3SYAA 1XL4A 4QNHB 2WLIA 4MTFA 3BEHA 4LP8A 3ZRSA 4MS2A 2WLKA 4X89A 3RVYA 3ABLC 4EKWA 4F4LA 3E8GA 2HVJC 3TCUA 3UKMA 3SPJA 4LCUC 2ITCC 3FB6C 1XL6A 4WFGA 4MW3A 1V55C 1LNQA 2NLJC 3E8BA 1KKDA 5E1AC 4H33A 3E8FA 2Y69C 2WLLA 2EILC 3OGCC 2IH3C 2DYSC 2ZXWC 3GB7C 4MVSA 3ZJZA 2QKSA 3SPHA 2WLMA 3SPCA 3ASOC 3X2QC 4MW8A 3E8HA 3OR6C 4G28B 3SYQA 4KFMA 3STZC 3LDCA 4RUEA 5CBHA 3HPLC 1R3LC 3R65A
chains in the Genus database with same CATH superfamily
2CTPA 2FB5A 5C8YB 2IH1C 3LSQA 3K58A 1KECA 4KUMA 2N05A 3ZHVA 1OCCC 1RPRA 2YI8A 5KHKA 4TOIA 4DV1B 1N33O 2BCCH 3OEEG 4R7CA 2N74A 1GM9A 3GVMA 3OMAB 2WLIB 1YITV 3WB2A 4AQYB 5JJNB 3J80N 5EK0A 2UUCB 3MAQA 2Q6AA 3ZHRA 4PV1B 4RAIA 1BS3A 2UXDO 3E83A 3Q4HB 4U3FH 1RM1B 3ZRWA 1K5QA 5EIBC 2ZT9B 4ZOLB 4JZ2A 1FXKC 2BOBC 5D5QA 5CN0A 1VQ5V 3SPGA 1E1QG 5B1NA 2X6AA 4WBNB 2YXHA 4EB6A 2XAQA 5LMNO 1GO3F 5C8YA 1K34A 3TXQA 1AP6A 1ZUQA 2ZDIC 1BT8A 5LP6B 1HW7A 1WP8A 1TUEB 1OCRC 4ABMA 3C3SA 3OTOB 1NKDA 4UCRA 3MDSA 3G71V 4TSFG 1BCCH 4LFCB 2WLIA 1GK9A 5CA0B 4N21A 1Y76B 5B5EZ 1HP8A 2UXXA 2GHYA 2YDEA 1PPJH 3G6BA 1Z2GA 4F4LA 3KCYA 3Q4HA 3ZMVA 1HNZB 5KHHA 1VARA 3E8FA 4YXWG 1M4UA 4F6RB 4LWSB 1WJZA 4ZOLA 4CS2A 3E8HA 4JI7B 4G28B 2YIBA 1R6KA 2W6IG 4PI2A 2RJZA 1PKXA 1YCIA 4IL6Z 5GTIZ 4ZIBA 2Y4UA 4J80A 1NI8A 4WBNA 2NR5A 5B1BC 5LHGA 4B3MO 1HNWB 2YICA 4FVMA 1NU1H 4MTOA 5K1XA 5LP6A 1P4RA 1KB9F 3A2FA 1V54B 3SDLA 1Q82W 2IJHA 5BMVB 2EIKB 3TJTA 1QLEC 2HG5C 3QF7A 3FB7C 5CA0A 1YJNV 1Y76A 2WA3A 3LDDA 5L3BA 3ABKC 1K33A 2AGAA 1YTFD 3KZIZ 3RFRA 3CS5A 4KP4A 1H38A 3ZHSA 3DC6A 4F6RA 4LWSA 4TWKA 1L1FA 1N34B 2BSKB 2JDIG 1AVMA 1NZ6A 4MTXA 3QVNA 2ODMA 2GUZB 1IXMA 1HNXB 2XAFA 3IC9A 4FLVA 4JYAB 2OIGA 4H37A 3T1YO 3CCVV 1YJWV 1Z5WA 1ZTEA 5BXZA 2HP8A 4P30A 3OW2U 4QNHB 4DW1A 5BMVA 4X64B 3QTCA 2YSUB 4AI8A 3E8GA 3QO5A 4BR6A 2F1MA 3CCMV 4FLWA 1XL6A 4DR3B 4DUZB 1FPOA 1XUQA 2FTKA 1YZBA 4TT3G 1F23A 3AG3B 4C7UA 1TVKB 3L72H 1ZL8B 4JI8B 3BHPA 4MW8A 2KG7B 2CTQA 3LDCA 5J9PC 1H2NA 5FPOA 4DR2B 1LUVA 4UCTA 1IBLB 3TETA 2YEVB 4Z2WA 3E35A 3K9SA 2BSKA 4LR3A 3RYIB 2GUZA 5B1AB 4JYCA 2ZIMA 2YI9A 4PJ0Z 1TGOA 2EJRA 3CPWU 3K57A 1K5SA 2Q8VA 3H01A 3QO7A 3A0RA 4J41A 2WLHA 4LH7A 3T1HB 1H2KA 1BGYH 5FNVB 5IDJA 2CTRA 1HR0B 2L35A 3K04A 3FAVB 4HAMA 5DN6G 1I5XA 2JIZG 4FPPA 2MK3A 4JTDB 1QVGU 3E86A 3K03A 1TVKA 1ZL8A 3R66A 3BA8A 1SQVH 2KG7A 5BR8B 3IJ4A 1XNRO 2YEVA 3OUFA 3P32A 3OTFA 3KCXA 3RYIA 4DR3O 4DUZO 1KBHA 5LMUB 3P30A 1NTMH 4PELA 3F7YC 3UCSC 2V1DA 3CCRV 4TQFA 1S77D 2XNDG 2HKOA 2AXTZ 4DR4B 3FFQA 1RM1C 4DR2O 1FXHA 1W59A 3SPJA 2LGQA 1M90W 1GTOA 2D2CB 5FNVA 1Y67A 3J81N 3M8AA 2PY5A 1ROPA 1Q6HA 4LF6O 3FAVA 2WLMA 1L0LH 2XAGA 3SYQA 1EZJA 2UUAO 2GBOA 1VQOV 4PDRA 1JX9A 2HEPA 3KKYA 1EN4A 3CCLV 1E79G 4LFBB 2F23A 5LP6C 3OUSA 4D7SA 4DV7B 4FIPC 2OCCC 1TA8A 4NXNB 4KL1A 4X65B 4YHHO 2CE4A 1DK1A 2P6JA 3MD0A 2JEUA 1XNQB 4DK1A 2WLLB 3VQWA 1IBKB 2ITDC 3RW0A 4JI0O 1OCRB 2K9PA 2B1GA 3CCUV 4RQFA 4UCSA 1GAXA 1IURA 3K0GA 1PL4A 4UCVA 3LDEA 1THZA 3CD6V 3OM3B 1I0HA 3BVOA 5IJ9B 1AB3A 1XOUA 5HFLA 4DR1O 5LHIA 2OYQA 1Y66A 4GCZA 2CAZC 1V54C 1FAFA 4PI0A 4F6EA 4HBNA 3G80A 3P3NA 4Q6GA 2VS0A 1FFTB 1J5EB 2E75B 4MS2A 3K5OA 5GW7A 4BIZA 3TK1A 2Y4TA 2RCVA 4UFZA 5EZYB 3UKMA 4LCUC 4WFGA 4WCEV 4H33A 5B1BB 2WLLA 2AZ2A 5JCOA 1VMGA 1EN6A 2QKAA 1M57B 1WN7A 4BAYA 2ADQB 3ABTA 4DV5B 1VP7A 4LF8B 4K0KO 3JD3A 1H8EG 1B04A 4PD4F 1RP3B 1QLEB 1IBMB 1YI2V 2M7WA 4YIOA 4JV5B 4X88A 1A32A 1G1XB 3ML0A 5IJ9A 5JJJB 1IBKO 4JYYA 2CH7B 4GKJO 3B8NA 3DC5A 2QA4V 2C2AA 1O9HA 5E79Z 2ETNA 3N2KB 2IM9A 2ZD9A 3ABLB 1W2BU 3IFXA 5BZBA 5EZYA 4WFFA 3AG3C 2OCHA 1J95A 2QR4A 2LP7A 4GYCB 1KP3A 4I0XB 1GMGA 4W4KA 4GX2A 1N32B 3CSXA 3GWOA 4P2ZA 3HR0A 1L8DA 5LYJB 2LO1A 2EIMB 2EJ7A 1JVMA 1DGSA 4H44B 2CH7A 1YIJV 2LJ2A 4FFKA 3AK2A 1XQ8A 4DV5O 1G6UA 3JALB 3RVYA 1D5NA 3DXRB 3CP1A 3N2KA 3TCUA 4NXMO 3TXSA 3OEHG 3E8BA 1UPGA 4UB8Z 3GWKC 2AZ0A 3DTUB 2ZE6A 2UUBB 1VQ4V 4I0XA 4BIOA 4DV0B 1PD3A 4JI2O 3R65A 1I5YA 1XMQB 2L6LA 1WPBA 1N4CA 2R9AA 3VQXA 3ZX6A 4DV3B 3AG4B 1EFRG 3AG2C 1MABG 3CRQA 1PL0A 1R3IC 1MMMA 3SYCA 5LYJA 2WWWA 3VQYA 1NS1A 2UU9O 2YC0A 4BWAA 4JGSA 1GN6A 2QTSA 4JI1B 3MHHC 4AILC 2QKCA 3JAKB 5HFMA 2ZE5A 5H6RA 3EFFK 1YF2A 4BIUA 2PGGA 4LNUB 1O9GA 1JMKC 1Q6IA 3RBZA 2B1IA 4NTWA 3JALA 2GV9A 3DXRA 2H94A 4CH3A 1SZTA 4O4JB 5EBMC 5K1PA 4WFAV 2LQTA 2KSDA 2ZE8A 2Q68A 3T4ZA 4MVMA 4L87A 4J7KA 3D3QA 1FXVA 4FLUA 2X7RB 2R9RB 1I08A 4IYIA 4PA4A 2F43G 1R3KC 1PP9H 1QHTA 4X9QA 3OGIB 2NNUA 1WA8B 1US6A 3BAAA 4QGPA 1AJPA 3ZRXA 5J2TB 2PI4A 2FYUH 4GKKO 4R50A 3CB2A 4OPAA 1R6TA 4DV0O 4X89A 1N8RW 1VEWA 3JAKA 2PYJA 1D2DA 3B40A 1TUBB 5JCOC 4DV2B 3THOA 3L73H 4LNUA 3JSLA 1XHZA 4JPRA 2OCCB 4O4JA 2E5LO 1Q90D 3W7SA 2PUSA 4TV8B 1KKCA 3OD4A 5FL7G 4D6TH 3CC7V 4FLTA 1AI7A 4LFAO 4JAUA 2P22C 4X20B 4X62B 1VQ7V 1DF5A 1MZEA 1QR8A 4XBFA 4X66B 3JD4A 2N04A 4BW5A 1RSOB 1VQ9V 4LF5B 1EBOA 2XAHA 4DV1O 1WA8A 4JTCB 4MVOA 2QM4A 1XHXA 1NR1A 5J2TA 4AQYO 1Q6UA 4WFEA 4OX9B 2UUCO 2X6CA 3FB5C 4YJ3B 4KHPB 2F93B 3CCEV 3FD9A 1KMIZ 3STLC 1ZSPA 1TUBA 1V55B 1M57C 1SQPH 1AI4A 4XDLA 5EC2C 2CDYA 1VF5B 4FFBB 4NTYA 1NT2B 1ZWIC 2KB1A 3WB0A 1AILA 4TV8A 4B3SB 3RGBA 3K9AA 3L70H 3APOA 2VWKA 4ZHQA 1R73A 4B3TB 3SJCC 4X20A 1F7YA 1GM7A 1M56B 1G8MA 3JD2A 3CCQV 2PI5A 4TV9B 3CC4V 4GX5A 1RSOA 4G2KA 4E4EA 1M9NA 3OTOO 4DO2A 2HLDG 1P49A 2GDSA 2IW5A 3P3PA 4MTFA 4FLZA 4H0LB 2WLKA 4LFCO 4GZRB 3ABLC 1BHAA 2OT5A 4X62O 4YJ3A 3L74H 3BA9A 1LNQA 2F95B 3NXSA 1AI5A 3AG1B 1HNZO 1KYOF 1QLNA 2CTWA 3B77A 4J10A 2UXCB 2UXBB 1ZLZA 3ZHUA 3STZC 4FJCC 1F4MA 5H5NA 4JI7O 5CBGA 4FFBA 1VF6A 1KP2A 5L3EA 4OX9O 2JK5C 5LBQA 4JASA 4KHPO 2EIMC 2ILMA 4B7EA 1SQXH 5CB4B 2Z0AA 1HNWO 5KMGB 4UCUA 4CH5A 4TV9A 2AHZA 1NTKH 1NJIW 3FYEB 4O4IB 4XDJA 1YEWA 5JQGB 5CBFA 1JR9A 1R3JC 1R6NA 2OTLV 2BE3A 3G6EV 3JD0A 1BSMA 3I5DA 3M99B 1B3QA 4K35A 3WU2Z 2HHHB 4JI3B 4JAVA 3WB1A 4PDVA 2EILB 1X4TA 1YJ9V 4GLXA 4MVQA 4J11A 3H1LH 1SF9A 2HVKC 3UO3A 3ZHQA 3JASB 4EFBA 2DWEC 3OR7C 4H13B 2RMKB 3AG4C 4OGQB 5IWAB 1N34O 2GTAA 2ZM6B 3SR2C 3LNMB 2EBOA 1P7GA 4EFEA 5JVDB 4OPHA 1HNXO 4JYAO 5LHHA 1NR7A 3H1JH 5CB4A 1WLEA 2GTSA 3E22B 4CBCA 1W0KG 5KMGA 4DR6B 3ZS8C 2XT9A 5J2UB 5D5PA 4O4IA 3D36A 1MNGA 5F2VO 5JQGA 3L75H 4X64O 3ZEDA 4YJ2B 3CEIA 3AG2B 1QR9A 3I56V 3GB7C 2JS5A 3OT7A 3NR7A 4WFBV 3CX5F 3OR6C 2PF4E 2F4VB 1NH2B 4JI8O 3SGIA 2JS3A 4FLXA 4X8AA 3CMEV 5KHJA 5IY5B 1B6QA 3JASA 1IBLO 2H8PC 4ZBMA 1QCEA 2LGWA 5KHGA 2DOSA 4NYKA 4B3RB 2Q7GA 4PDMA 4PDLA 5TISZ 4LF4B 5JVDA 2JJ1G 4I9WA 2Q69A 2P7TC 1AI6A 1M93A 1SA0B 5H6QA 2ZINA 1AR1B 3E22A 3CRCA 3SYOA 2VQEB 2G38A 5B3SB 5J2UA 1LUWA 3AK3A 3VQVA 5GONB 1H8HG 4GT1A 2JGDB 5KAIZ 4HNAB 3HKEB 2VQFB 3T1HO 1R1BA 2EZPA 3K5NA 4I55B 2E74B 2DQ3A 2FL4A 4YJ2A 1HR0O 2QE7G 1FJGB 3LNNA 5L3GA 2ZXWB 1G4YB 3W7UA 1WPXA 2VRZA 1H2MA 4DR6O 3ZCCA 1JJOA 1K8AW 1RFYA 1NVPD 3N2GB 5IJ0B 3UM7A 1H2LA 2KKWA 1H2SB 1ORQC 2PZSA 4FM0A 4G27B 5BR8O 5LGTA 5B66Z 2QM8A 4O2AB 1OCZB 2Z3YA 5LA6A 3WG7B 2RN9A 3T2MA 2EIJB 3WFVA 5IT9N 3J7AU 1Q43A 5LMUO 3SYAA 4ZI7B 4DW0A 3BEHA 1SA0A 2F4VO 3B4SA 5L3DA 4DR4O 2DJVA 1SQQH 2ITCC 1V55C 3ETDA 4DUYB 2NLJC 1IZ3A 3G67A 5GONA 2JGDA 1Q86W 2CGNA 4HNAA 3HKEA 1S3JA 4I55A 4DR5B 2R72A 3ETEA 4LF4O 4I7ZB 3SPHA 1VF6C 5FPRA 3W7TA 3H1KH 1R3LC 2VQEO 2XAJA 4UV8A 1GN4A 2QDOA 1M56C 3N2GA 5IJ0A 3E89A 4PA9A 4LFBO 2QWRB 1GKFA 2OIEA 1AP5A 4I9QA 2YUAA 3BY6A 4DV7O 3B2EE 1MOFA 2A79B 1DLBA 4NXNO 4X65O 4O2AA 1YSCA 4LF9B 3T4DA 1FJGO 1RPOA 3CCJV 4MSWC 1N36B 2Y0IA 2EX3A 1QBZA 3OE7G 4EEQA 5DEDA 4ZI7A 4MVZA 3JARB 2M6YA 3IGAC 4B7KA 5IYBO 3AG1C 1XNQO 4CH4A 4JI5B 1QQCA 1S76D 3CJHB 1S5HC 3JYCA 1I94B 2IJKA 2W0FC 3EHBB 1YTFB 1VQMV 5EBWC 2B5UA 3ZRVA 5LOVB 1MSWD 3U10A 4MVRA 3RWRD 4UXNA 4X1IB 1BZKA 3O9OA 1SETA 4L8JA 3OMNB 3SPIA 1WB7A 2WSSG 1KUQA 4LBEC 4IYHA 4U3JB 3SJQC 3D36C 1XBLA 3S3WA 4LP8A 1J5EO 5CMUA 1F51A 1JJ2U 4EKWA 2UXNA 4JYBA 3JARA 1EN5A 1FS0G 1I7FA 1PM9A 2EILC 4FZ0A 2YIAA 2LFSA 4CC6A 3CJHA 4CS3A 1GH6A 2P4VA 4QJFB 3SJAC 4JTAB 4LF8O 5L3CA 1NTZH 5LOVA 3BFRA 4RWUA 3HKCB 1U97A 1VQKV 2QWOB 1IBMO 4JI4B 1N33B 4JV5O 2ZE7A 4I50B 3K5MA 5JWPA 3B8MA 4JI5O 4X1IA 2YIDA 1YHQV 3M7MX 3PN1A 1I94O 1L0NH 2QGNA 2HR3A 5KHIA 4U3JA 4FM2A 1Y74B 4I5SA 3VOUA 4NTXA 1SS3A 3JAWB 4ZKIA 2R70A 2BOCC 1T5EA 1SQGA 2JJ2G 1MG1A 3DGEA 4LF7B 2DYSB 2XASA 3UT5B 5A9GA 4B08A 4DV6B 1CEZA 4JZGA 5LMNB 5IY5C 3RYFB 1N32O 3JCUZ 2EINB 1N0JA 2FKXA 3FYIB 5DM6V 2P90A 2AHYA 3HKCA 5ITZB 3RVZA 2OTJV 4I50A 2Q67A 5KX5B 5GTHZ 2P5OA 4J7ZA 3ZMZA 5B3SC 2A7WA 1VQNV 1PNLA 1Y74A 3O65A 4QPJA 2WAMA 3W7XA 5JJEB 4JI4O 1XREA 3HKDB 3JAWA 4X1KB 2ZXWC 1SQBH 3FX7A 1JPXA 1Q8IA 1EM1A 3C3TA 1WNSA 3CE2A 3UT5A 3CWBH 4AHCA 2UUBO 4FK5C 4O2BB 1WP7A 1VIBA 3ZHTA 5KAFZ 1XMQO 4B3MB 2JVDA 3RYFA 5EIBD 2OWOA 1OCZC 2JRIA 3APQA 4DV3O 1ENVA 3WG7C 2EIJC 4MTGA 1F4NA 5ITZA 2V4DA 4DV4B 4LF7O 2YS8A 5KX5A 1XEQA 4DV6O 4DK0A 4ZHQB 4JI1O 2DYRC 2X6BA 1NVPB 1AR4A 4PA3A 1W0JG 3D3IA 2Q0OC 1SC5B 1Q5OA 4Z1VA 3HKDA 3IC7A 4X1KA 1CPYA 3LSSA 3H1HH 2DWDC 2Q73A 4PA6A 3ASOB 1K73W 3X2QB 1H2GA 2A0LA 2XUMA 1JOYA 2PYLA 3ICXA 2RDCA 3T1YB 4O2BA 3ABMB 3ASNB 3CRRA 1FD9A 1XMOB 4TUYB 3SJBC 2QWPB 4JF3A 4GX1A 3IAYA 3ZN1A 2HJDA 2WA4A 4U7OA 5EBLC 1JA8A 1K3EA 5KUMA 2WLJA 4GX0A 3A0HZ 3ZRSA 5LGNA 1HWYA 1DTOA 1Q7YW 2ADPA 3FB6C 4TQDA 1Q3EA 5IYZB 3RN4A 4DV2O 4YIPA 5B1OA 5JH7B 1S72V 2MW2B 1ZX3A 2ZNIA 1OZ0A 4MVSA 2FMLA 3SPCA 4DV4O 1D5AA 4QPKA 3EXAA 2Z5UA 1IXBA 2Q9LA 5CBHA 4GUNA 2EULA 2HFEC 3F5WC 2E3CA 2ATKC 3ZMSA 3LSUA 2XTAA 4X66O 2VWJA 3QNEA 1XILA 1CXZB 4P9PA 4LF5O 4TUYA 4E2LA 1OV9A 1B06A 4CZZA 3EVKA 4HYOA 1N0NA 3ZMTA 3JATB 2W0XA 4ICGA 2YXYA 4MT8A 4ASUG 3U0ZA 1SZXA 5AG2A 2QEXV 5DECA 3JD1A 3K0DA 4NKGB 5LXTB 2V7QG 2DW4A 1XMOO 1YDXA 5IYZA 1XDCA 4J9YB 3FKSG 2P06A 3AK1A 5JH7A 4O4HB 2XHBA 4P9OA 4FLYA 2P67A 2RNBA 4B3SO 1BMFG 1XNRB 3L71H 3AEIA 1K4DC 1OJHA 3E2EA 4B3TO 4IGGA 3H9VA 1DF4A 3L9DA 2ZR2A 1OCOB 2QWNB 1NQTA 1GRJA 2E76B 3LUTB 4PA7A 4BW9A 2EZOA 4I4TB 4WFHA 1BHBA 1SESA 4UVBA 3K79A 3JATA 3OAAG 3RYHB 2HVJC 1M1KW 3BRCA 1V9PA 3CYOA 4CH6A 1IX9A 4LF6B 1VQ8V 1P84F 5LXTA 2P4KA 2DYSC 2Y48A 2UUAB 2XOKG 2UXCO 3N27A 2UXBO 2IJIA 2W6JG 2ZIOA 2EINC 4O4HA 1BL8A 4CC5A 2QJ1A 4J42A 3ZBHA 4YHHB 3QO8A 5IE9A 5KLVH 4K8ZA 1K92A 1MZFA 4OXSA 1VF7A 5EC1C 3I55V 1YVWA 4I4TA 1KQSU 2ZKOA 1K9MW 3HKBB 3F7VC 4UVAA 2Q4PA 5H2FZ 3JAMN 5BY1A 2ZNJA 3UQ8A 3KG2A 5LA6B 3K3WA 3RYHA 3CXCU 2QTOA 3B09A 4JI0B 2Q5ZA 2JEXA 3K08A 2HHHO 2Y69B 4JI3O 4RO2A 3QG5A 2QWQB 4IIJB 4J7JA 4JI6B 1NBMG 2IU3A 4JAAA 1BQ0A 1LR1A 1UJWB 5IWAO 4DR1B 1IDSA 4DR7B 2GSMB 2ZM6O 5LL6Y 3T1CA 1OCCB 2YIBD 1IVSA 3PJSK 4QIWF 1Y4MA 2LFRA 2Y0PA 4W4LA 2QM7A 1PNKA 4IHJB 1QNMA 3ABUA 4FM1A 5L3FA 4O4LB 2DE0X 2BTQB 3ZIAG 3D8CA 2Q7HA 4CS4A 3HKBA 4U7NA 4MW3A 5KA5A 1KKDA 5E1AC 1AJQA 2DQ0A 3CC2V 1VQ6V 4YY3B 3OGCC 4N23A 2IH3C 4X1YB 1COWG 1CP9A 1SKVA 1FXKB 2QKSA 4K0KB 1QU7A 3ASOC 3X2QC 1S5LZ 1ZAUA 4DRXB 3RT3C 1FKAO 1JCHA 1PNMA 3K5LA 4IIJA 2BTOA 4QE7A 2DYRB 3ABMC 3ASNC 2AW9A 4GKJB 2WLNA 3CRAA 1M5IA 4RUFA 4B3RO 1GM8A 3RYCB 1Y6XA 3F5TA 1BQZA 1VQPV 2A06H 3G4SV 1SRYA 4IHJA 5CA3A 3FB8C 3CCSV 4JI6O 3DSQA 1AJNA 2RQ6A 2A3QA 4O4LA 2BTQA 1FYJA 3OFNG 2JGUA 5C93A 3HB3B 3BPZA 5H9CA 4DR7O 3VBBA 2DN9A 2VQFO 2EIKC 4FZ1A 1WAZA 5A2QN 4X1YA 2R9IA 4KXRA 1FXKA 2B9ZA 3SYPA 1KC8W 5KUKA 5KA6A 1U96A 4DRXA 2ZCEA 3BABA 3CMAV 2ZR3A 4Z1MG 1VQLV 1K4CC 4HZ3A 4UUJC 4UV9A 4YY3O 4DXWA 1GN2A 3A8TA 2ZDIA 3RYCA 2NN4A 4FMTA 1XL4A 4K3AA 5EYPB 3JCZA 4NXMB 3K59A 3U11A 2F66C 1KU9A 1Z5VA 3A0BZ 1GN3A 3ABKB 4D7TA 2LW7A 4DUYO 2KQXA 4NB5A 2IJJA 2Q0AA 4DR5O 4JI2B 3CRMA 4KFMA 4Q20A 1FFXB 3HPLC 3ZJZA 2A9HA 3H1IH 4QE9A 2CGOA 5IYCO 3ETGA 3C90A 3CXHF 2WPDG 1OCOC 1YXBA 4LC1A 4R8CA 3W7WA 2UU9B 1MSDA 5IYDO 4NVPA 1JFFB 3OMIB 4LH6A 4LF9O 4NR1A 1K97A 2D3OW 2ZQMA 5CA1B 2CUGA 1JQ0A 1N36O 2Q7EA 1SERA 2H3OA 1P7BA 1EZVH 2LW1A 1Q81W 3ZN0A 3ETQA 2HJFC 1BE3H 5EYPA 5LGUA 1XI1A 2K1EA 4RQEA 1PV0A 5B1AC 3K06A 1SQFA 1MA1A 1TAEA 2YXLA 4J9ZB 4XDKA 1S5JA 4MVUA 3AG7A 4IT5A 3CHXA 2ARHA 3UO2A 1WB8A 2UXDB 1K7DA 1FFXA 5FLXN 1URFA 3BCCH 3JSNA 1UFIA 1AROP 4A5UB 4UB6Z 4R6ZA 2IU0A 3MHSC 4GKKB 4K8XA 1E1RG 3TGUH 2CK3G 2IBZH 1JFFA 1X59A 3ZRWB 2PTMA 4UVCA 1HDJA 1AR5A 5CA1A 4DYLA 1OHHG 4PHZA 2X0LA 1QVFU 4UCOA 2E5LB 2DMXA 2O57A 2Y69C 2QSAA 1KD1W 1S0VA 1NH2D 3S3XA 4WF9V 4LFAB 4EB6B 3ZMUA 4RUEA
chains in the Genus database with same CATH topology
4X8AA 2IH1C 3CMEV 3LSQA 1QLEB 2HFEC 1YI2V 3F5WC 5IY5B 1B6QA 2M7WA 4X88A 2H8PC 1KECA 1QCEA 4ZBMA 2ATKC 4KUMA 3ZMSA 1OCCC 3ML0A 1RPRA 4PDMA 3OEEG 4PDLA 3QNEA 4P9PA 4R7CA 4E2LA 3B8NA 1GM9A 2JJ1G 4I9WA 3OMAB 2Q69A 2P7TC 4CZZA 2WLIB 1AI6A 4HYOA 2QA4V 1YITV 5H6QA 2C2AA 5EK0A 1AR1B 3ZMTA 3SYOA 2Q6AA 5B3SB 4MT8A 4RAIA 3E83A 4ASUG 1RM1B 2ZD9A 1H8HG 1K5QA 4GT1A 3ABLB 3ZRWA 3IFXA 1W2BU 2QEXV 3JD1A 3K0DA 5BZBA 2EZPA 4WFFA 3AG3C 2V7QG 2DW4A 2DQ3A 1J95A 1FXKC 2QE7G 2LP7A 4J9YB 2BOBC 3FKSG 5CN0A 5L3GA 1KP3A 2ZXWB 1G4YB 3W7UA 1WPXA 1VQ5V 1GMGA 1E1QG 5B1NA 4P9OA 3SPGA 4GX2A 3ZCCA 2X6AA 1K8AW 2P67A 1NVPD 3GWOA 2XAQA 3UM7A 1BMFG 1GO3F 4P2ZA 3AEIA 1K34A 1K4DC 3E2EA 1ORQC 4G27B 1DF4A 2EIMB 2ZDIC 5LGTA 2ZR2A 1TUEB 2QM8A 1OCRC 1OCOB 1OCZB 2Z3YA 1NQTA 3WG7B 3T2MA 1NKDA 2EIJB 1NH2B 1JVMA 4PA7A 3LUTB 2EZOA 3WFVA 1YIJV 3G71V 4WFHA 1BHBA 4TSFG 1SESA 3SYAA 2WLIA 1GK9A 3BEHA 4N21A 4UVBA 2UXXA 3K79A 2GHYA 5L3DA 3RVYA 3OAAG 3CP1A 4F4LA 3TCUA 2HVJC 1M1KW 2ITCC 3CYOA 3ZMVA 1V55C 3ETDA 2NLJC 3E8BA 3OEHG 1Q86W 3E8FA 1VQ8V 4YXWG 2DYSC 1S3JA 2Y48A 3ETEA 3DTUB 3SPHA 2XOKG 3E8HA 4G28B 1VQ4V 1R6KA 2W6IG 2IJIA 2W6JG 3W7TA 1PD3A 1R3LC 3R65A 2EINC 1I5YA 1PKXA 2XAJA 4UV8A 1BL8A 1M56C 3AG4B 1EFRG 3AG2C 3E89A 5B1BC 1MABG 4PA9A 5LHGA 1PL0A 1GKFA 1R3IC 3SYCA 3QO8A 2WWWA 3BY6A 4MTOA 1MOFA 1K92A 2A79B 1DLBA 1P4RA 1YSCA 3T4DA 1RPOA 1V54B 4OXSA 4JGSA 1Q82W 3CCJV 2IJHA 4MSWC 5EC1C 3MHHC 2EIKB 1QBZA 3I55V 1QLEC 2HG5C 1KQSU 5HFMA 1K9MW 3OE7G 3FB7C 5H6RA 3EFFK 3F7VC 4UVAA 4BIUA 1YJNV 4MVZA 5L3BA 3LDDA 3RBZA 3IGAC 2B1IA 5CBHA 5IYBO 3ABKC 3AG1C 1K33A 3KG2A 2H94A 3K3WA 1SZTA 5EBMC 4WFAV 3CXCU 2QTOA 1YTFD 1S76D 1S5HC 3JYCA 2JEXA 3K08A 2Y69B 2IJKA 2W0FC 4KP4A 3EHBB 1H38A 2Q68A 3T4ZA 4RO2A 1VQMV 1YTFB 4MVMA 5EBWC 4L87A 4TWKA 1L1FA 1FXVA 2X7RB 2B5UA 3ZRVA 2R9RB 4PA4A 1MSWD 2JDIG 2F43G 1R3KC 4MVRA 1NBMG 4MTXA 2IU3A 4UXNA 1IXMA 1UJWB 2XAFA 2GSMB 4H37A 1SETA 3OMNB 3SPIA 3CCVV 3T1CA 1OCCB 2NNUA 3PJSK 1YJWV 2WSSG 3ZRXA 1AJPA 4QIWF 1Y4MA 4LBEC 3SJQC 2LFRA 2QM7A 1PNKA 2PI4A 3ABUA 4R50A 4P30A 3OW2U 4QNHB 4LP8A 5L3FA 3ZIAG 4X89A 5CMUA 1N8RW 1F51A 2YSUB 1JJ2U 4U7NA 4EKWA 2UXNA 3E8GA 3QO5A 4JYBA 3CCMV 1XL6A 4MW3A 5KA5A 1KKDA 1FS0G 5E1AC 1AJQA 2DQ0A 3CC2V 1VQ6V 2FTKA 4TT3G 1F23A 2EILC 3OGCC 4JPRA 3AG3B 2LFSA 2IH3C 2OCCB 4N23A 1COWG 1CP9A 1FXKB 2QKSA 3W7SA 3ASOC 3X2QC 4MW8A 3CC7V 5FL7G 3LDCA 5J9PC 1AI7A 1JCHA 4QJFB 1PNMA 4JTAB 4JAUA 5L3CA 3TETA 2YEVB 1VQ7V 4QE7A 1DF5A 2DYRB 1QR8A 3ABMC 3ASNC 4XBFA 1VQKV 3E35A 3JD4A 4BW5A 1VQ9V 3B8MA 2WLNA 4RUFA 1EBOA 1GM8A 2XAHA 1YHQV 5B1AB 4JYCA 2HR3A 4JTCB 4MVOA 1VQPV 3G4SV 1NR1A 2EJRA 1SRYA 4I5SA 3CPWU 4WFEA 5CA3A 3FB8C 3CCSV 1K5SA 2X6CA 3H01A 3QO7A 3FB5C 3A0RA 3CCEV 1AJNA 3VOUA 2WLHA 3OFNG 5IDJA 5C93A 3HB3B 4ZKIA 5H9CA 3STLC 2BOCC 3K04A 4HAMA 3VBBA 1V55B 5DN6G 1I5XA 2JIZG 1M57C 2JJ2G 2MK3A 4FPPA 4JTDB 1QVGU 1MG1A 1AI4A 4XDLA 3DGEA 5EC2C 2EIKC 2DYSB 2XASA 3E86A 1CEZA 3K03A 2R9IA 1FXKA 1ZWIC 3SYPA 1KC8W 2KB1A 5KUKA 3K9AA 5IY5C 5KA6A 2EINB 1R73A 3FYIB 3CMAV 5DM6V 2P90A 2AHYA 1GM7A 1M56B 2YEVA 1G8MA 2ZR3A 3OUFA 3P32A 4Z1MG 3JD2A 3CCQV 1VQLV 3RVZA 1K4CC 2PI5A 4HZ3A 3CC4V 2OTJV 4GX5A 2Q67A 4UUJC 4G2KA 4UV9A 4DXWA 1M9NA 3ZMZA 2ZDIA 3P30A 4DO2A 4PELA 2HLDG 3F7YC 4FMTA 2V1DA 5B3SC 3CCRV 1VQNV 1S77D 2XNDG 2HKOA 2IW5A 1XL4A 4MTFA 1PNLA 2WLKA 1RM1C 3JCZA 3ABLC 1FXHA 1BHAA 4QPJA 2WAMA 2OT5A 3W7XA 3SPJA 1M90W 1LNQA 1GTOA 3NXSA 1AI5A 3ABKB 3AG1B 1QLNA 1ROPA 2ZXWC 3B77A 1JPXA 2IJJA 2WLMA 2XAGA 3SYQA 4KFMA 1EZJA 4FJCC 4Q20A 3STZC 3HPLC 3ZJZA 1F4MA 2A9HA 4QE9A 4FK5C 5CBGA 1VQOV 4PDRA 1KP2A 5L3EA 5IYCO 1JX9A 2JK5C 3ETGA 3CCLV 1E79G 5LBQA 4JASA 2EIMC 3OUSA 2WPDG 4FIPC 1OCOC 4LC1A 1OCZC 2OCCC 4R8CA 3W7WA 1ENVA 3WG7C 2EIJC 4MTGA 1F4NA 5IYDO 2AHZA 3OMIB 1NJIW 3FYEB 2P6JA 4XDJA 1K97A 3MD0A 2ZQMA 5CBFA 1R3JC 2D3OW 1JQ0A 1SERA 2DYRC 1R6NA 1P7BA 2JEUA 1Q81W 2OTLV 3ZN0A 3G6EV 2X6BA 3JD0A 2HJFC 1NVPB 3M99B 4PA3A 5LGUA 2WLLB 2K1EA 4RQEA 5B1AC 1W0JG 3K06A 3D3IA 2ITDC 4JAVA 4J9ZB 4PDVA 3RW0A 3IC7A 4XDKA 4MVUA 1CPYA 1OCRB 2EILB 2B1GA 3CCUV 3LSSA 1YJ9V 4RQFA 2DWDC 4MVQA 3K0GA 2HVKC 4PA6A 3ASOB 1K73W 3X2QB 3LDEA 1THZA 1H2GA 2A0LA 2DWEC 3OR7C 3CD6V 3OM3B 1JOYA 1K7DA 3AG4C 3LNMB 1AROP 2EBOA 3ABMB 3ASNB 5HFLA 4R6ZA 5LHIA 1Y66A 4GCZA 4JF3A 4GX1A 2IU0A 3ZN1A 1V54C 3MHSC 5LHHA 1NR7A 4U7OA 1WLEA 1E1RG 5EBLC 4CBCA 1K3EA 1W0KG 5KUMA 2WLJA 2CK3G 4GX0A 1FFTB 3D36A 3ZRSA 4MS2A 3ZRWB 4BIZA 5GW7A 4UVCA 3TK1A 5LGNA 1HWYA 1OHHG 1DTOA 1Q7YW 3UKMA 2X0LA 4LCUC 4WFGA 3FB6C 1QVFU 4WCEV 5B1OA 3AG2B 4H33A 5B1BB 2Y69C 1QR9A 2WLLA 1S72V 1KD1W 3I56V 3GB7C 1S0VA 1OZ0A 1NH2D 4MVSA 1M57B 4WFBV 3SPCA 4BAYA 4WF9V 3ABTA 4QPKA 3OR6C 2Z5UA 3ZMUA 4RUEA 3JD3A 1H8EG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN C;  2A9H A;  4JTA B;  4QE9 A;  4X8A A;  5CBG A;  2IH1 C;  4PDR A;  1BL8 A;  2HFE C;  3TET A;  3F5W C;  2JK5 C;  4QE7 A;  1M56 C;  4X88 A;  2H8P C;  3ABM C;  3ASN C;  4ZBM A;  2ATK C;  2EIM C;  3AG2 C;  3E89 A;  5B1B C;  3OUS A;  4PA9 A;  1OCC C;  1OCO C;  4BW5 A;  1OCZ C;  2OCC C;  4R8C A;  3WG7 C;  1R3I C;  2EIJ C;  3SYC A;  2WLN A;  4MTO A;  4PDM A;  4RUF A;  4PDL A;  4MTG A;  2A79 B;  4P9P A;  4R7C A;  4I9W A;  2AHZ A;  2Q69 A;  2P7T C;  3T4D A;  2WLI B;  4OXS A;  4HYO A;  4JTC B;  4MVO A;  4MSW C;  4XDJ A;  5EC1 C;  5EK0 A;  5CBF A;  3SYO A;  2Q6A A;  1R3J C;  2HG5 C;  1QLE C;  4WFE A;  2DYR C;  3FB7 C;  3FB8 C;  3EFF K;  1P7B A;  3F7V C;  2X6C A;  4RAI A;  3E83 A;  3FB5 C;  3VOU A;  2X6B A;  4MVZ A;  2HJF C;  2WLH A;  2ZD9 A;  3LDD A;  3RBZ A;  3IGA C;  3IFX A;  4PA3 A;  3ABK C;  2WLL B;  3AG1 C;  2K1E A;  3K0D A;  3KG2 A;  3STL C;  5B1A C;  2BOC C;  3K06 A;  5EBM C;  3K04 A;  4WFF A;  3AG3 C;  5BZB A;  2ITD C;  2QTO A;  1J95 A;  1S5H C;  3JYC A;  1M57 C;  4JTD B;  4J9Z B;  4PDV A;  3K08 A;  3RW0 A;  4J9Y B;  4XDL A;  2BOB C;  5EC2 C;  4XDK A;  2W0F C;  4MVU A;  2EIK C;  2Q68 A;  3T4Z A;  4RO2 A;  1G4Y B;  3E86 A;  4MVM A;  5EBW C;  2DWD C;  3K03 A;  4MVQ A;  4TWK A;  1ZWI C;  3K0G A;  2HVK C;  4PA6 A;  4P9O A;  3SPG A;  2KB1 A;  4GX2 A;  3SYP A;  3LDE A;  2X6A A;  5J9P C;  5KUK A;  2R9R B;  2A0L A;  2DWE C;  3OR7 C;  4PA4 A;  5IY5 C;  3UM7 A;  1R3K C;  3AG4 C;  4MVR A;  4P2Z A;  1K4D C;  1ORQ C;  3LNM B;  2AHY A;  2YEV A;  4G27 B;  3OUF A;  4H37 A;  4R6Z A;  1K4C C;  3RVZ A;  4HZ3 A;  1OCR C;  3SPI A;  3T1C A;  4GX5 A;  3PJS K;  4GX1 A;  2Q67 A;  4UUJ C;  3T2M A;  1V54 C;  1JVM A;  4LBE C;  3SJQ C;  4DXW A;  4PA7 A;  3LUT B;  5EBL C;  4CBC A;  3F7Y C;  4WFH A;  5KUM A;  5B3S C;  2WLJ A;  4R50 A;  4P30 A;  4GX0 A;  3SYA A;  1XL4 A;  4QNH B;  2WLI A;  4MTF A;  3BEH A;  4LP8 A;  3ZRS A;  4MS2 A;  2WLK A;  4X89 A;  3RVY A;  3ABL C;  4EKW A;  4F4L A;  3E8G A;  2HVJ C;  3TCU A;  3UKM A;  3SPJ A;  4LCU C;  2ITC C;  3FB6 C;  1XL6 A;  4WFG A;  4MW3 A;  1V55 C;  1LNQ A;  2NLJ C;  3E8B A;  1KKD A;  5E1A C;  4H33 A;  3E8F A;  2Y69 C;  2WLL A;  2EIL C;  3OGC C;  2IH3 C;  2DYS C;  2ZXW C;  3GB7 C;  4MVS A;  3ZJZ A;  2QKS A;  3SPH A;  2WLM A;  3SPC A;  3ASO C;  3X2Q C;  4MW8 A;  3E8H A;  3OR6 C;  4G28 B;  3SYQ A;  4KFM A;  3STZ C;  3LDC A;  4RUE A;  5CBH A;  3HPL C;  1R3L C;  3R65 A; 
#chains in the Genus database with same CATH topology
 2CTP A;  2FB5 A;  5C8Y B;  2IH1 C;  3LSQ A;  3K58 A;  1KEC A;  4KUM A;  2N05 A;  3ZHV A;  1OCC C;  1RPR A;  2YI8 A;  5KHK A;  4TOI A;  4DV1 B;  1N33 O;  2BCC H;  3OEE G;  4R7C A;  2N74 A;  1GM9 A;  3GVM A;  3OMA B;  2WLI B;  1YIT V;  3WB2 A;  4AQY B;  5JJN B;  3J80 N;  5EK0 A;  2UUC B;  3MAQ A;  2Q6A A;  3ZHR A;  4PV1 B;  4RAI A;  1BS3 A;  2UXD O;  3E83 A;  3Q4H B;  4U3F H;  1RM1 B;  3ZRW A;  1K5Q A;  5EIB C;  2ZT9 B;  4ZOL B;  4JZ2 A;  1FXK C;  2BOB C;  5D5Q A;  5CN0 A;  1VQ5 V;  3SPG A;  1E1Q G;  5B1N A;  2X6A A;  4WBN B;  2YXH A;  4EB6 A;  2XAQ A;  5LMN O;  1GO3 F;  5C8Y A;  1K34 A;  3TXQ A;  1AP6 A;  1ZUQ A;  2ZDI C;  1BT8 A;  5LP6 B;  1HW7 A;  1WP8 A;  1TUE B;  1OCR C;  4ABM A;  3C3S A;  3OTO B;  1NKD A;  4UCR A;  3MDS A;  3G71 V;  4TSF G;  1BCC H;  4LFC B;  2WLI A;  1GK9 A;  5CA0 B;  4N21 A;  1Y76 B;  5B5E Z;  1HP8 A;  2UXX A;  2GHY A;  2YDE A;  1PPJ H;  3G6B A;  1Z2G A;  4F4L A;  3KCY A;  3Q4H A;  3ZMV A;  1HNZ B;  5KHH A;  1VAR A;  3E8F A;  4YXW G;  1M4U A;  4F6R B;  4LWS B;  1WJZ A;  4ZOL A;  4CS2 A;  3E8H A;  4JI7 B;  4G28 B;  2YIB A;  1R6K A;  2W6I G;  4PI2 A;  2RJZ A;  1PKX A;  1YCI A;  4IL6 Z;  5GTI Z;  4ZIB A;  2Y4U A;  4J80 A;  1NI8 A;  4WBN A;  2NR5 A;  5B1B C;  5LHG A;  4B3M O;  1HNW B;  2YIC A;  4FVM A;  1NU1 H;  4MTO A;  5K1X A;  5LP6 A;  1P4R A;  1KB9 F;  3A2F A;  1V54 B;  3SDL A;  1Q82 W;  2IJH A;  5BMV B;  2EIK B;  3TJT A;  1QLE C;  2HG5 C;  3QF7 A;  3FB7 C;  5CA0 A;  1YJN V;  1Y76 A;  2WA3 A;  3LDD A;  5L3B A;  3ABK C;  1K33 A;  2AGA A;  1YTF D;  3KZI Z;  3RFR A;  3CS5 A;  4KP4 A;  1H38 A;  3ZHS A;  3DC6 A;  4F6R A;  4LWS A;  4TWK A;  1L1F A;  1N34 B;  2BSK B;  2JDI G;  1AVM A;  1NZ6 A;  4MTX A;  3QVN A;  2ODM A;  2GUZ B;  1IXM A;  1HNX B;  2XAF A;  3IC9 A;  4FLV A;  4JYA B;  2OIG A;  4H37 A;  3T1Y O;  3CCV V;  1YJW V;  1Z5W A;  1ZTE A;  5BXZ A;  2HP8 A;  4P30 A;  3OW2 U;  4QNH B;  4DW1 A;  5BMV A;  4X64 B;  3QTC A;  2YSU B;  4AI8 A;  3E8G A;  3QO5 A;  4BR6 A;  2F1M A;  3CCM V;  4FLW A;  1XL6 A;  4DR3 B;  4DUZ B;  1FPO A;  1XUQ A;  2FTK A;  1YZB A;  4TT3 G;  1F23 A;  3AG3 B;  4C7U A;  1TVK B;  3L72 H;  1ZL8 B;  4JI8 B;  3BHP A;  4MW8 A;  2KG7 B;  2CTQ A;  3LDC A;  5J9P C;  1H2N A;  5FPO A;  4DR2 B;  1LUV A;  4UCT A;  1IBL B;  3TET A;  2YEV B;  4Z2W A;  3E35 A;  3K9S A;  2BSK A;  4LR3 A;  3RYI B;  2GUZ A;  5B1A B;  4JYC A;  2ZIM A;  2YI9 A;  4PJ0 Z;  1TGO A;  2EJR A;  3CPW U;  3K57 A;  1K5S A;  2Q8V A;  3H01 A;  3QO7 A;  3A0R A;  4J41 A;  2WLH A;  4LH7 A;  3T1H B;  1H2K A;  1BGY H;  5FNV B;  5IDJ A;  2CTR A;  1HR0 B;  2L35 A;  3K04 A;  3FAV B;  4HAM A;  5DN6 G;  1I5X A;  2JIZ G;  4FPP A;  2MK3 A;  4JTD B;  1QVG U;  3E86 A;  3K03 A;  1TVK A;  1ZL8 A;  3R66 A;  3BA8 A;  1SQV H;  2KG7 A;  5BR8 B;  3IJ4 A;  1XNR O;  2YEV A;  3OUF A;  3P32 A;  3OTF A;  3KCX A;  3RYI A;  4DR3 O;  4DUZ O;  1KBH A;  5LMU B;  3P30 A;  1NTM H;  4PEL A;  3F7Y C;  3UCS C;  2V1D A;  3CCR V;  4TQF A;  1S77 D;  2XND G;  2HKO A;  2AXT Z;  4DR4 B;  3FFQ A;  1RM1 C;  4DR2 O;  1FXH A;  1W59 A;  3SPJ A;  2LGQ A;  1M90 W;  1GTO A;  2D2C B;  5FNV A;  1Y67 A;  3J81 N;  3M8A A;  2PY5 A;  1ROP A;  1Q6H A;  4LF6 O;  3FAV A;  2WLM A;  1L0L H;  2XAG A;  3SYQ A;  1EZJ A;  2UUA O;  2GBO A;  1VQO V;  4PDR A;  1JX9 A;  2HEP A;  3KKY A;  1EN4 A;  3CCL V;  1E79 G;  4LFB B;  2F23 A;  5LP6 C;  3OUS A;  4D7S A;  4DV7 B;  4FIP C;  2OCC C;  1TA8 A;  4NXN B;  4KL1 A;  4X65 B;  4YHH O;  2CE4 A;  1DK1 A;  2P6J A;  3MD0 A;  2JEU A;  1XNQ B;  4DK1 A;  2WLL B;  3VQW A;  1IBK B;  2ITD C;  3RW0 A;  4JI0 O;  1OCR B;  2K9P A;  2B1G A;  3CCU V;  4RQF A;  4UCS A;  1GAX A;  1IUR A;  3K0G A;  1PL4 A;  4UCV A;  3LDE A;  1THZ A;  3CD6 V;  3OM3 B;  1I0H A;  3BVO A;  5IJ9 B;  1AB3 A;  1XOU A;  5HFL A;  4DR1 O;  5LHI A;  2OYQ A;  1Y66 A;  4GCZ A;  2CAZ C;  1V54 C;  1FAF A;  4PI0 A;  4F6E A;  4HBN A;  3G80 A;  3P3N A;  4Q6G A;  2VS0 A;  1FFT B;  1J5E B;  2E75 B;  4MS2 A;  3K5O A;  5GW7 A;  4BIZ A;  3TK1 A;  2Y4T A;  2RCV A;  4UFZ A;  5EZY B;  3UKM A;  4LCU C;  4WFG A;  4WCE V;  4H33 A;  5B1B B;  2WLL A;  2AZ2 A;  5JCO A;  1VMG A;  1EN6 A;  2QKA A;  1M57 B;  1WN7 A;  4BAY A;  2ADQ B;  3ABT A;  4DV5 B;  1VP7 A;  4LF8 B;  4K0K O;  3JD3 A;  1H8E G;  1B04 A;  4PD4 F;  1RP3 B;  1QLE B;  1IBM B;  1YI2 V;  2M7W A;  4YIO A;  4JV5 B;  4X88 A;  1A32 A;  1G1X B;  3ML0 A;  5IJ9 A;  5JJJ B;  1IBK O;  4JYY A;  2CH7 B;  4GKJ O;  3B8N A;  3DC5 A;  2QA4 V;  2C2A A;  1O9H A;  5E79 Z;  2ETN A;  3N2K B;  2IM9 A;  2ZD9 A;  3ABL B;  1W2B U;  3IFX A;  5BZB A;  5EZY A;  4WFF A;  3AG3 C;  2OCH A;  1J95 A;  2QR4 A;  2LP7 A;  4GYC B;  1KP3 A;  4I0X B;  1GMG A;  4W4K A;  4GX2 A;  1N32 B;  3CSX A;  3GWO A;  4P2Z A;  3HR0 A;  1L8D A;  5LYJ B;  2LO1 A;  2EIM B;  2EJ7 A;  1JVM A;  1DGS A;  4H44 B;  2CH7 A;  1YIJ V;  2LJ2 A;  4FFK A;  3AK2 A;  1XQ8 A;  4DV5 O;  1G6U A;  3JAL B;  3RVY A;  1D5N A;  3DXR B;  3CP1 A;  3N2K A;  3TCU A;  4NXM O;  3TXS A;  3OEH G;  3E8B A;  1UPG A;  4UB8 Z;  3GWK C;  2AZ0 A;  3DTU B;  2ZE6 A;  2UUB B;  1VQ4 V;  4I0X A;  4BIO A;  4DV0 B;  1PD3 A;  4JI2 O;  3R65 A;  1I5Y A;  1XMQ B;  2L6L A;  1WPB A;  1N4C A;  2R9A A;  3VQX A;  3ZX6 A;  4DV3 B;  3AG4 B;  1EFR G;  3AG2 C;  1MAB G;  3CRQ A;  1PL0 A;  1R3I C;  1MMM A;  3SYC A;  5LYJ A;  2WWW A;  3VQY A;  1NS1 A;  2UU9 O;  2YC0 A;  4BWA A;  4JGS A;  1GN6 A;  2QTS A;  4JI1 B;  3MHH C;  4AIL C;  2QKC A;  3JAK B;  5HFM A;  2ZE5 A;  5H6R A;  3EFF K;  1YF2 A;  4BIU A;  2PGG A;  4LNU B;  1O9G A;  1JMK C;  1Q6I A;  3RBZ A;  2B1I A;  4NTW A;  3JAL A;  2GV9 A;  3DXR A;  2H94 A;  4CH3 A;  1SZT A;  4O4J B;  5EBM C;  5K1P A;  4WFA V;  2LQT A;  2KSD A;  2ZE8 A;  2Q68 A;  3T4Z A;  4MVM A;  4L87 A;  4J7K A;  3D3Q A;  1FXV A;  4FLU A;  2X7R B;  2R9R B;  1I08 A;  4IYI A;  4PA4 A;  2F43 G;  1R3K C;  1PP9 H;  1QHT A;  4X9Q A;  3OGI B;  2NNU A;  1WA8 B;  1US6 A;  3BAA A;  4QGP A;  1AJP A;  3ZRX A;  5J2T B;  2PI4 A;  2FYU H;  4GKK O;  4R50 A;  3CB2 A;  4OPA A;  1R6T A;  4DV0 O;  4X89 A;  1N8R W;  1VEW A;  3JAK A;  2PYJ A;  1D2D A;  3B40 A;  1TUB B;  5JCO C;  4DV2 B;  3THO A;  3L73 H;  4LNU A;  3JSL A;  1XHZ A;  4JPR A;  2OCC B;  4O4J A;  2E5L O;  1Q90 D;  3W7S A;  2PUS A;  4TV8 B;  1KKC A;  3OD4 A;  5FL7 G;  4D6T H;  3CC7 V;  4FLT A;  1AI7 A;  4LFA O;  4JAU A;  2P22 C;  4X20 B;  4X62 B;  1VQ7 V;  1DF5 A;  1MZE A;  1QR8 A;  4XBF A;  4X66 B;  3JD4 A;  2N04 A;  4BW5 A;  1RSO B;  1VQ9 V;  4LF5 B;  1EBO A;  2XAH A;  4DV1 O;  1WA8 A;  4JTC B;  4MVO A;  2QM4 A;  1XHX A;  1NR1 A;  5J2T A;  4AQY O;  1Q6U A;  4WFE A;  4OX9 B;  2UUC O;  2X6C A;  3FB5 C;  4YJ3 B;  4KHP B;  2F93 B;  3CCE V;  3FD9 A;  1KMI Z;  3STL C;  1ZSP A;  1TUB A;  1V55 B;  1M57 C;  1SQP H;  1AI4 A;  4XDL A;  5EC2 C;  2CDY A;  1VF5 B;  4FFB B;  4NTY A;  1NT2 B;  1ZWI C;  2KB1 A;  3WB0 A;  1AIL A;  4TV8 A;  4B3S B;  3RGB A;  3K9A A;  3L70 H;  3APO A;  2VWK A;  4ZHQ A;  1R73 A;  4B3T B;  3SJC C;  4X20 A;  1F7Y A;  1GM7 A;  1M56 B;  1G8M A;  3JD2 A;  3CCQ V;  2PI5 A;  4TV9 B;  3CC4 V;  4GX5 A;  1RSO A;  4G2K A;  4E4E A;  1M9N A;  3OTO O;  4DO2 A;  2HLD G;  1P49 A;  2GDS A;  2IW5 A;  3P3P A;  4MTF A;  4FLZ A;  4H0L B;  2WLK A;  4LFC O;  4GZR B;  3ABL C;  1BHA A;  2OT5 A;  4X62 O;  4YJ3 A;  3L74 H;  3BA9 A;  1LNQ A;  2F95 B;  3NXS A;  1AI5 A;  3AG1 B;  1HNZ O;  1KYO F;  1QLN A;  2CTW A;  3B77 A;  4J10 A;  2UXC B;  2UXB B;  1ZLZ A;  3ZHU A;  3STZ C;  4FJC C;  1F4M A;  5H5N A;  4JI7 O;  5CBG A;  4FFB A;  1VF6 A;  1KP2 A;  5L3E A;  4OX9 O;  2JK5 C;  5LBQ A;  4JAS A;  4KHP O;  2EIM C;  2ILM A;  4B7E A;  1SQX H;  5CB4 B;  2Z0A A;  1HNW O;  5KMG B;  4UCU A;  4CH5 A;  4TV9 A;  2AHZ A;  1NTK H;  1NJI W;  3FYE B;  4O4I B;  4XDJ A;  1YEW A;  5JQG B;  5CBF A;  1JR9 A;  1R3J C;  1R6N A;  2OTL V;  2BE3 A;  3G6E V;  3JD0 A;  1BSM A;  3I5D A;  3M99 B;  1B3Q A;  4K35 A;  3WU2 Z;  2HHH B;  4JI3 B;  4JAV A;  3WB1 A;  4PDV A;  2EIL B;  1X4T A;  1YJ9 V;  4GLX A;  4MVQ A;  4J11 A;  3H1L H;  1SF9 A;  2HVK C;  3UO3 A;  3ZHQ A;  3JAS B;  4EFB A;  2DWE C;  3OR7 C;  4H13 B;  2RMK B;  3AG4 C;  4OGQ B;  5IWA B;  1N34 O;  2GTA A;  2ZM6 B;  3SR2 C;  3LNM B;  2EBO A;  1P7G A;  4EFE A;  5JVD B;  4OPH A;  1HNX O;  4JYA O;  5LHH A;  1NR7 A;  3H1J H;  5CB4 A;  1WLE A;  2GTS A;  3E22 B;  4CBC A;  1W0K G;  5KMG A;  4DR6 B;  3ZS8 C;  2XT9 A;  5J2U B;  5D5P A;  4O4I A;  3D36 A;  1MNG A;  5F2V O;  5JQG A;  3L75 H;  4X64 O;  3ZED A;  4YJ2 B;  3CEI A;  3AG2 B;  1QR9 A;  3I56 V;  3GB7 C;  2JS5 A;  3OT7 A;  3NR7 A;  4WFB V;  3CX5 F;  3OR6 C;  2PF4 E;  2F4V B;  1NH2 B;  4JI8 O;  3SGI A;  2JS3 A;  4FLX A;  4X8A A;  3CME V;  5KHJ A;  5IY5 B;  1B6Q A;  3JAS A;  1IBL O;  2H8P C;  4ZBM A;  1QCE A;  2LGW A;  5KHG A;  2DOS A;  4NYK A;  4B3R B;  2Q7G A;  4PDM A;  4PDL A;  5TIS Z;  4LF4 B;  5JVD A;  2JJ1 G;  4I9W A;  2Q69 A;  2P7T C;  1AI6 A;  1M93 A;  1SA0 B;  5H6Q A;  2ZIN A;  1AR1 B;  3E22 A;  3CRC A;  3SYO A;  2VQE B;  2G38 A;  5B3S B;  5J2U A;  1LUW A;  3AK3 A;  3VQV A;  5GON B;  1H8H G;  4GT1 A;  2JGD B;  5KAI Z;  4HNA B;  3HKE B;  2VQF B;  3T1H O;  1R1B A;  2EZP A;  3K5N A;  4I55 B;  2E74 B;  2DQ3 A;  2FL4 A;  4YJ2 A;  1HR0 O;  2QE7 G;  1FJG B;  3LNN A;  5L3G A;  2ZXW B;  1G4Y B;  3W7U A;  1WPX A;  2VRZ A;  1H2M A;  4DR6 O;  3ZCC A;  1JJO A;  1K8A W;  1RFY A;  1NVP D;  3N2G B;  5IJ0 B;  3UM7 A;  1H2L A;  2KKW A;  1H2S B;  1ORQ C;  2PZS A;  4FM0 A;  4G27 B;  5BR8 O;  5LGT A;  5B66 Z;  2QM8 A;  4O2A B;  1OCZ B;  2Z3Y A;  5LA6 A;  3WG7 B;  2RN9 A;  3T2M A;  2EIJ B;  3WFV A;  5IT9 N;  3J7A U;  1Q43 A;  5LMU O;  3SYA A;  4ZI7 B;  4DW0 A;  3BEH A;  1SA0 A;  2F4V O;  3B4S A;  5L3D A;  4DR4 O;  2DJV A;  1SQQ H;  2ITC C;  1V55 C;  3ETD A;  4DUY B;  2NLJ C;  1IZ3 A;  3G67 A;  5GON A;  2JGD A;  1Q86 W;  2CGN A;  4HNA A;  3HKE A;  1S3J A;  4I55 A;  4DR5 B;  2R72 A;  3ETE A;  4LF4 O;  4I7Z B;  3SPH A;  1VF6 C;  5FPR A;  3W7T A;  3H1K H;  1R3L C;  2VQE O;  2XAJ A;  4UV8 A;  1GN4 A;  2QDO A;  1M56 C;  3N2G A;  5IJ0 A;  3E89 A;  4PA9 A;  4LFB O;  2QWR B;  1GKF A;  2OIE A;  1AP5 A;  4I9Q A;  2YUA A;  3BY6 A;  4DV7 O;  3B2E E;  1MOF A;  2A79 B;  1DLB A;  4NXN O;  4X65 O;  4O2A A;  1YSC A;  4LF9 B;  3T4D A;  1FJG O;  1RPO A;  3CCJ V;  4MSW C;  1N36 B;  2Y0I A;  2EX3 A;  1QBZ A;  3OE7 G;  4EEQ A;  5DED A;  4ZI7 A;  4MVZ A;  3JAR B;  2M6Y A;  3IGA C;  4B7K A;  5IYB O;  3AG1 C;  1XNQ O;  4CH4 A;  4JI5 B;  1QQC A;  1S76 D;  3CJH B;  1S5H C;  3JYC A;  1I94 B;  2IJK A;  2W0F C;  3EHB B;  1YTF B;  1VQM V;  5EBW C;  2B5U A;  3ZRV A;  5LOV B;  1MSW D;  3U10 A;  4MVR A;  3RWR D;  4UXN A;  4X1I B;  1BZK A;  3O9O A;  1SET A;  4L8J A;  3OMN B;  3SPI A;  1WB7 A;  2WSS G;  1KUQ A;  4LBE C;  4IYH A;  4U3J B;  3SJQ C;  3D36 C;  1XBL A;  3S3W A;  4LP8 A;  1J5E O;  5CMU A;  1F51 A;  1JJ2 U;  4EKW A;  2UXN A;  4JYB A;  3JAR A;  1EN5 A;  1FS0 G;  1I7F A;  1PM9 A;  2EIL C;  4FZ0 A;  2YIA A;  2LFS A;  4CC6 A;  3CJH A;  4CS3 A;  1GH6 A;  2P4V A;  4QJF B;  3SJA C;  4JTA B;  4LF8 O;  5L3C A;  1NTZ H;  5LOV A;  3BFR A;  4RWU A;  3HKC B;  1U97 A;  1VQK V;  2QWO B;  1IBM O;  4JI4 B;  1N33 B;  4JV5 O;  2ZE7 A;  4I50 B;  3K5M A;  5JWP A;  3B8M A;  4JI5 O;  4X1I A;  2YID A;  1YHQ V;  3M7M X;  3PN1 A;  1I94 O;  1L0N H;  2QGN A;  2HR3 A;  5KHI A;  4U3J A;  4FM2 A;  1Y74 B;  4I5S A;  3VOU A;  4NTX A;  1SS3 A;  3JAW B;  4ZKI A;  2R70 A;  2BOC C;  1T5E A;  1SQG A;  2JJ2 G;  1MG1 A;  3DGE A;  4LF7 B;  2DYS B;  2XAS A;  3UT5 B;  5A9G A;  4B08 A;  4DV6 B;  1CEZ A;  4JZG A;  5LMN B;  5IY5 C;  3RYF B;  1N32 O;  3JCU Z;  2EIN B;  1N0J A;  2FKX A;  3FYI B;  5DM6 V;  2P90 A;  2AHY A;  3HKC A;  5ITZ B;  3RVZ A;  2OTJ V;  4I50 A;  2Q67 A;  5KX5 B;  5GTH Z;  2P5O A;  4J7Z A;  3ZMZ A;  5B3S C;  2A7W A;  1VQN V;  1PNL A;  1Y74 A;  3O65 A;  4QPJ A;  2WAM A;  3W7X A;  5JJE B;  4JI4 O;  1XRE A;  3HKD B;  3JAW A;  4X1K B;  2ZXW C;  1SQB H;  3FX7 A;  1JPX A;  1Q8I A;  1EM1 A;  3C3T A;  1WNS A;  3CE2 A;  3UT5 A;  3CWB H;  4AHC A;  2UUB O;  4FK5 C;  4O2B B;  1WP7 A;  1VIB A;  3ZHT A;  5KAF Z;  1XMQ O;  4B3M B;  2JVD A;  3RYF A;  5EIB D;  2OWO A;  1OCZ C;  2JRI A;  3APQ A;  4DV3 O;  1ENV A;  3WG7 C;  2EIJ C;  4MTG A;  1F4N A;  5ITZ A;  2V4D A;  4DV4 B;  4LF7 O;  2YS8 A;  5KX5 A;  1XEQ A;  4DV6 O;  4DK0 A;  4ZHQ B;  4JI1 O;  2DYR C;  2X6B A;  1NVP B;  1AR4 A;  4PA3 A;  1W0J G;  3D3I A;  2Q0O C;  1SC5 B;  1Q5O A;  4Z1V A;  3HKD A;  3IC7 A;  4X1K A;  1CPY A;  3LSS A;  3H1H H;  2DWD C;  2Q73 A;  4PA6 A;  3ASO B;  1K73 W;  3X2Q B;  1H2G A;  2A0L A;  2XUM A;  1JOY A;  2PYL A;  3ICX A;  2RDC A;  3T1Y B;  4O2B A;  3ABM B;  3ASN B;  3CRR A;  1FD9 A;  1XMO B;  4TUY B;  3SJB C;  2QWP B;  4JF3 A;  4GX1 A;  3IAY A;  3ZN1 A;  2HJD A;  2WA4 A;  4U7O A;  5EBL C;  1JA8 A;  1K3E A;  5KUM A;  2WLJ A;  4GX0 A;  3A0H Z;  3ZRS A;  5LGN A;  1HWY A;  1DTO A;  1Q7Y W;  2ADP A;  3FB6 C;  4TQD A;  1Q3E A;  5IYZ B;  3RN4 A;  4DV2 O;  4YIP A;  5B1O A;  5JH7 B;  1S72 V;  2MW2 B;  1ZX3 A;  2ZNI A;  1OZ0 A;  4MVS A;  2FML A;  3SPC A;  4DV4 O;  1D5A A;  4QPK A;  3EXA A;  2Z5U A;  1IXB A;  2Q9L A;  5CBH A;  4GUN A;  2EUL A;  2HFE C;  3F5W C;  2E3C A;  2ATK C;  3ZMS A;  3LSU A;  2XTA A;  4X66 O;  2VWJ A;  3QNE A;  1XIL A;  1CXZ B;  4P9P A;  4LF5 O;  4TUY A;  4E2L A;  1OV9 A;  1B06 A;  4CZZ A;  3EVK A;  4HYO A;  1N0N A;  3ZMT A;  3JAT B;  2W0X A;  4ICG A;  2YXY A;  4MT8 A;  4ASU G;  3U0Z A;  1SZX A;  5AG2 A;  2QEX V;  5DEC A;  3JD1 A;  3K0D A;  4NKG B;  5LXT B;  2V7Q G;  2DW4 A;  1XMO O;  1YDX A;  5IYZ A;  1XDC A;  4J9Y B;  3FKS G;  2P06 A;  3AK1 A;  5JH7 A;  4O4H B;  2XHB A;  4P9O A;  4FLY A;  2P67 A;  2RNB A;  4B3S O;  1BMF G;  1XNR B;  3L71 H;  3AEI A;  1K4D C;  1OJH A;  3E2E A;  4B3T O;  4IGG A;  3H9V A;  1DF4 A;  3L9D A;  2ZR2 A;  1OCO B;  2QWN B;  1NQT A;  1GRJ A;  2E76 B;  3LUT B;  4PA7 A;  4BW9 A;  2EZO A;  4I4T B;  4WFH A;  1BHB A;  1SES A;  4UVB A;  3K79 A;  3JAT A;  3OAA G;  3RYH B;  2HVJ C;  1M1K W;  3BRC A;  1V9P A;  3CYO A;  4CH6 A;  1IX9 A;  4LF6 B;  1VQ8 V;  1P84 F;  5LXT A;  2P4K A;  2DYS C;  2Y48 A;  2UUA B;  2XOK G;  2UXC O;  3N27 A;  2UXB O;  2IJI A;  2W6J G;  2ZIO A;  2EIN C;  4O4H A;  1BL8 A;  4CC5 A;  2QJ1 A;  4J42 A;  3ZBH A;  4YHH B;  3QO8 A;  5IE9 A;  5KLV H;  4K8Z A;  1K92 A;  1MZF A;  4OXS A;  1VF7 A;  5EC1 C;  3I55 V;  1YVW A;  4I4T A;  1KQS U;  2ZKO A;  1K9M W;  3HKB B;  3F7V C;  4UVA A;  2Q4P A;  5H2F Z;  3JAM N;  5BY1 A;  2ZNJ A;  3UQ8 A;  3KG2 A;  5LA6 B;  3K3W A;  3RYH A;  3CXC U;  2QTO A;  3B09 A;  4JI0 B;  2Q5Z A;  2JEX A;  3K08 A;  2HHH O;  2Y69 B;  4JI3 O;  4RO2 A;  3QG5 A;  2QWQ B;  4IIJ B;  4J7J A;  4JI6 B;  1NBM G;  2IU3 A;  4JAA A;  1BQ0 A;  1LR1 A;  1UJW B;  5IWA O;  4DR1 B;  1IDS A;  4DR7 B;  2GSM B;  2ZM6 O;  5LL6 Y;  3T1C A;  1OCC B;  2YIB D;  1IVS A;  3PJS K;  4QIW F;  1Y4M A;  2LFR A;  2Y0P A;  4W4L A;  2QM7 A;  1PNK A;  4IHJ B;  1QNM A;  3ABU A;  4FM1 A;  5L3F A;  4O4L B;  2DE0 X;  2BTQ B;  3ZIA G;  3D8C A;  2Q7H A;  4CS4 A;  3HKB A;  4U7N A;  4MW3 A;  5KA5 A;  1KKD A;  5E1A C;  1AJQ A;  2DQ0 A;  3CC2 V;  1VQ6 V;  4YY3 B;  3OGC C;  4N23 A;  2IH3 C;  4X1Y B;  1COW G;  1CP9 A;  1SKV A;  1FXK B;  2QKS A;  4K0K B;  1QU7 A;  3ASO C;  3X2Q C;  1S5L Z;  1ZAU A;  4DRX B;  3RT3 C;  1FKA O;  1JCH A;  1PNM A;  3K5L A;  4IIJ A;  2BTO A;  4QE7 A;  2DYR B;  3ABM C;  3ASN C;  2AW9 A;  4GKJ B;  2WLN A;  3CRA A;  1M5I A;  4RUF A;  4B3R O;  1GM8 A;  3RYC B;  1Y6X A;  3F5T A;  1BQZ A;  1VQP V;  2A06 H;  3G4S V;  1SRY A;  4IHJ A;  5CA3 A;  3FB8 C;  3CCS V;  4JI6 O;  3DSQ A;  1AJN A;  2RQ6 A;  2A3Q A;  4O4L A;  2BTQ A;  1FYJ A;  3OFN G;  2JGU A;  5C93 A;  3HB3 B;  3BPZ A;  5H9C A;  4DR7 O;  3VBB A;  2DN9 A;  2VQF O;  2EIK C;  4FZ1 A;  1WAZ A;  5A2Q N;  4X1Y A;  2R9I A;  4KXR A;  1FXK A;  2B9Z A;  3SYP A;  1KC8 W;  5KUK A;  5KA6 A;  1U96 A;  4DRX A;  2ZCE A;  3BAB A;  3CMA V;  2ZR3 A;  4Z1M G;  1VQL V;  1K4C C;  4HZ3 A;  4UUJ C;  4UV9 A;  4YY3 O;  4DXW A;  1GN2 A;  3A8T A;  2ZDI A;  3RYC A;  2NN4 A;  4FMT A;  1XL4 A;  4K3A A;  5EYP B;  3JCZ A;  4NXM B;  3K59 A;  3U11 A;  2F66 C;  1KU9 A;  1Z5V A;  3A0B Z;  1GN3 A;  3ABK B;  4D7T A;  2LW7 A;  4DUY O;  2KQX A;  4NB5 A;  2IJJ A;  2Q0A A;  4DR5 O;  4JI2 B;  3CRM A;  4KFM A;  4Q20 A;  1FFX B;  3HPL C;  3ZJZ A;  2A9H A;  3H1I H;  4QE9 A;  2CGO A;  5IYC O;  3ETG A;  3C90 A;  3CXH F;  2WPD G;  1OCO C;  1YXB A;  4LC1 A;  4R8C A;  3W7W A;  2UU9 B;  1MSD A;  5IYD O;  4NVP A;  1JFF B;  3OMI B;  4LH6 A;  4LF9 O;  4NR1 A;  1K97 A;  2D3O W;  2ZQM A;  5CA1 B;  2CUG A;  1JQ0 A;  1N36 O;  2Q7E A;  1SER A;  2H3O A;  1P7B A;  1EZV H;  2LW1 A;  1Q81 W;  3ZN0 A;  3ETQ A;  2HJF C;  1BE3 H;  5EYP A;  5LGU A;  1XI1 A;  2K1E A;  4RQE A;  1PV0 A;  5B1A C;  3K06 A;  1SQF A;  1MA1 A;  1TAE A;  2YXL A;  4J9Z B;  4XDK A;  1S5J A;  4MVU A;  3AG7 A;  4IT5 A;  3CHX A;  2ARH A;  3UO2 A;  1WB8 A;  2UXD B;  1K7D A;  1FFX A;  5FLX N;  1URF A;  3BCC H;  3JSN A;  1UFI A;  1ARO P;  4A5U B;  4UB6 Z;  4R6Z A;  2IU0 A;  3MHS C;  4GKK B;  4K8X A;  1E1R G;  3TGU H;  2CK3 G;  2IBZ H;  1JFF A;  1X59 A;  3ZRW B;  2PTM A;  4UVC A;  1HDJ A;  1AR5 A;  5CA1 A;  4DYL A;  1OHH G;  4PHZ A;  2X0L A;  1QVF U;  4UCO A;  2E5L B;  2DMX A;  2O57 A;  2Y69 C;  2QSA A;  1KD1 W;  1S0V A;  1NH2 D;  3S3X A;  4WF9 V;  4LFA B;  4EB6 B;  3ZMU A;  4RUE A; 
#chains in the Genus database with same CATH homology
 4X8A A;  2IH1 C;  3CME V;  3LSQ A;  1QLE B;  2HFE C;  1YI2 V;  3F5W C;  5IY5 B;  1B6Q A;  2M7W A;  4X88 A;  2H8P C;  1KEC A;  1QCE A;  4ZBM A;  2ATK C;  4KUM A;  3ZMS A;  1OCC C;  3ML0 A;  1RPR A;  4PDM A;  3OEE G;  4PDL A;  3QNE A;  4P9P A;  4R7C A;  4E2L A;  3B8N A;  1GM9 A;  2JJ1 G;  4I9W A;  3OMA B;  2Q69 A;  2P7T C;  4CZZ A;  2WLI B;  1AI6 A;  4HYO A;  2QA4 V;  1YIT V;  5H6Q A;  2C2A A;  5EK0 A;  1AR1 B;  3ZMT A;  3SYO A;  2Q6A A;  5B3S B;  4MT8 A;  4RAI A;  3E83 A;  4ASU G;  1RM1 B;  2ZD9 A;  1H8H G;  1K5Q A;  4GT1 A;  3ABL B;  3ZRW A;  3IFX A;  1W2B U;  2QEX V;  3JD1 A;  3K0D A;  5BZB A;  2EZP A;  4WFF A;  3AG3 C;  2V7Q G;  2DW4 A;  2DQ3 A;  1J95 A;  1FXK C;  2QE7 G;  2LP7 A;  4J9Y B;  2BOB C;  3FKS G;  5CN0 A;  5L3G A;  1KP3 A;  2ZXW B;  1G4Y B;  3W7U A;  1WPX A;  1VQ5 V;  1GMG A;  1E1Q G;  5B1N A;  4P9O A;  3SPG A;  4GX2 A;  3ZCC A;  2X6A A;  1K8A W;  2P67 A;  1NVP D;  3GWO A;  2XAQ A;  3UM7 A;  1BMF G;  1GO3 F;  4P2Z A;  3AEI A;  1K34 A;  1K4D C;  3E2E A;  1ORQ C;  4G27 B;  1DF4 A;  2EIM B;  2ZDI C;  5LGT A;  2ZR2 A;  1TUE B;  2QM8 A;  1OCR C;  1OCO B;  1OCZ B;  2Z3Y A;  1NQT A;  3WG7 B;  3T2M A;  1NKD A;  2EIJ B;  1NH2 B;  1JVM A;  4PA7 A;  3LUT B;  2EZO A;  3WFV A;  1YIJ V;  3G71 V;  4WFH A;  1BHB A;  4TSF G;  1SES A;  3SYA A;  2WLI A;  1GK9 A;  3BEH A;  4N21 A;  4UVB A;  2UXX A;  3K79 A;  2GHY A;  5L3D A;  3RVY A;  3OAA G;  3CP1 A;  4F4L A;  3TCU A;  2HVJ C;  1M1K W;  2ITC C;  3CYO A;  3ZMV A;  1V55 C;  3ETD A;  2NLJ C;  3E8B A;  3OEH G;  1Q86 W;  3E8F A;  1VQ8 V;  4YXW G;  2DYS C;  1S3J A;  2Y48 A;  3ETE A;  3DTU B;  3SPH A;  2XOK G;  3E8H A;  4G28 B;  1VQ4 V;  1R6K A;  2W6I G;  2IJI A;  2W6J G;  3W7T A;  1PD3 A;  1R3L C;  3R65 A;  2EIN C;  1I5Y A;  1PKX A;  2XAJ A;  4UV8 A;  1BL8 A;  1M56 C;  3AG4 B;  1EFR G;  3AG2 C;  3E89 A;  5B1B C;  1MAB G;  4PA9 A;  5LHG A;  1PL0 A;  1GKF A;  1R3I C;  3SYC A;  3QO8 A;  2WWW A;  3BY6 A;  4MTO A;  1MOF A;  1K92 A;  2A79 B;  1DLB A;  1P4R A;  1YSC A;  3T4D A;  1RPO A;  1V54 B;  4OXS A;  4JGS A;  1Q82 W;  3CCJ V;  2IJH A;  4MSW C;  5EC1 C;  3MHH C;  2EIK B;  1QBZ A;  3I55 V;  1QLE C;  2HG5 C;  1KQS U;  5HFM A;  1K9M W;  3OE7 G;  3FB7 C;  5H6R A;  3EFF K;  3F7V C;  4UVA A;  4BIU A;  1YJN V;  4MVZ A;  5L3B A;  3LDD A;  3RBZ A;  3IGA C;  2B1I A;  5CBH A;  5IYB O;  3ABK C;  3AG1 C;  1K33 A;  3KG2 A;  2H94 A;  3K3W A;  1SZT A;  5EBM C;  4WFA V;  3CXC U;  2QTO A;  1YTF D;  1S76 D;  1S5H C;  3JYC A;  2JEX A;  3K08 A;  2Y69 B;  2IJK A;  2W0F C;  4KP4 A;  3EHB B;  1H38 A;  2Q68 A;  3T4Z A;  4RO2 A;  1VQM V;  1YTF B;  4MVM A;  5EBW C;  4L87 A;  4TWK A;  1L1F A;  1FXV A;  2X7R B;  2B5U A;  3ZRV A;  2R9R B;  4PA4 A;  1MSW D;  2JDI G;  2F43 G;  1R3K C;  4MVR A;  1NBM G;  4MTX A;  2IU3 A;  4UXN A;  1IXM A;  1UJW B;  2XAF A;  2GSM B;  4H37 A;  1SET A;  3OMN B;  3SPI A;  3CCV V;  3T1C A;  1OCC B;  2NNU A;  3PJS K;  1YJW V;  2WSS G;  3ZRX A;  1AJP A;  4QIW F;  1Y4M A;  4LBE C;  3SJQ C;  2LFR A;  2QM7 A;  1PNK A;  2PI4 A;  3ABU A;  4R50 A;  4P30 A;  3OW2 U;  4QNH B;  4LP8 A;  5L3F A;  3ZIA G;  4X89 A;  5CMU A;  1N8R W;  1F51 A;  2YSU B;  1JJ2 U;  4U7N A;  4EKW A;  2UXN A;  3E8G A;  3QO5 A;  4JYB A;  3CCM V;  1XL6 A;  4MW3 A;  5KA5 A;  1KKD A;  1FS0 G;  5E1A C;  1AJQ A;  2DQ0 A;  3CC2 V;  1VQ6 V;  2FTK A;  4TT3 G;  1F23 A;  2EIL C;  3OGC C;  4JPR A;  3AG3 B;  2LFS A;  2IH3 C;  2OCC B;  4N23 A;  1COW G;  1CP9 A;  1FXK B;  2QKS A;  3W7S A;  3ASO C;  3X2Q C;  4MW8 A;  3CC7 V;  5FL7 G;  3LDC A;  5J9P C;  1AI7 A;  1JCH A;  4QJF B;  1PNM A;  4JTA B;  4JAU A;  5L3C A;  3TET A;  2YEV B;  1VQ7 V;  4QE7 A;  1DF5 A;  2DYR B;  1QR8 A;  3ABM C;  3ASN C;  4XBF A;  1VQK V;  3E35 A;  3JD4 A;  4BW5 A;  1VQ9 V;  3B8M A;  2WLN A;  4RUF A;  1EBO A;  1GM8 A;  2XAH A;  1YHQ V;  5B1A B;  4JYC A;  2HR3 A;  4JTC B;  4MVO A;  1VQP V;  3G4S V;  1NR1 A;  2EJR A;  1SRY A;  4I5S A;  3CPW U;  4WFE A;  5CA3 A;  3FB8 C;  3CCS V;  1K5S A;  2X6C A;  3H01 A;  3QO7 A;  3FB5 C;  3A0R A;  3CCE V;  1AJN A;  3VOU A;  2WLH A;  3OFN G;  5IDJ A;  5C93 A;  3HB3 B;  4ZKI A;  5H9C A;  3STL C;  2BOC C;  3K04 A;  4HAM A;  3VBB A;  1V55 B;  5DN6 G;  1I5X A;  2JIZ G;  1M57 C;  2JJ2 G;  2MK3 A;  4FPP A;  4JTD B;  1QVG U;  1MG1 A;  1AI4 A;  4XDL A;  3DGE A;  5EC2 C;  2EIK C;  2DYS B;  2XAS A;  3E86 A;  1CEZ A;  3K03 A;  2R9I A;  1FXK A;  1ZWI C;  3SYP A;  1KC8 W;  2KB1 A;  5KUK A;  3K9A A;  5IY5 C;  5KA6 A;  2EIN B;  1R73 A;  3FYI B;  3CMA V;  5DM6 V;  2P90 A;  2AHY A;  1GM7 A;  1M56 B;  2YEV A;  1G8M A;  2ZR3 A;  3OUF A;  3P32 A;  4Z1M G;  3JD2 A;  3CCQ V;  1VQL V;  3RVZ A;  1K4C C;  2PI5 A;  4HZ3 A;  3CC4 V;  2OTJ V;  4GX5 A;  2Q67 A;  4UUJ C;  4G2K A;  4UV9 A;  4DXW A;  1M9N A;  3ZMZ A;  2ZDI A;  3P30 A;  4DO2 A;  4PEL A;  2HLD G;  3F7Y C;  4FMT A;  2V1D A;  5B3S C;  3CCR V;  1VQN V;  1S77 D;  2XND G;  2HKO A;  2IW5 A;  1XL4 A;  4MTF A;  1PNL A;  2WLK A;  1RM1 C;  3JCZ A;  3ABL C;  1FXH A;  1BHA A;  4QPJ A;  2WAM A;  2OT5 A;  3W7X A;  3SPJ A;  1M90 W;  1LNQ A;  1GTO A;  3NXS A;  1AI5 A;  3ABK B;  3AG1 B;  1QLN A;  1ROP A;  2ZXW C;  3B77 A;  1JPX A;  2IJJ A;  2WLM A;  2XAG A;  3SYQ A;  4KFM A;  1EZJ A;  4FJC C;  4Q20 A;  3STZ C;  3HPL C;  3ZJZ A;  1F4M A;  2A9H A;  4QE9 A;  4FK5 C;  5CBG A;  1VQO V;  4PDR A;  1KP2 A;  5L3E A;  5IYC O;  1JX9 A;  2JK5 C;  3ETG A;  3CCL V;  1E79 G;  5LBQ A;  4JAS A;  2EIM C;  3OUS A;  2WPD G;  4FIP C;  1OCO C;  4LC1 A;  1OCZ C;  2OCC C;  4R8C A;  3W7W A;  1ENV A;  3WG7 C;  2EIJ C;  4MTG A;  1F4N A;  5IYD O;  2AHZ A;  3OMI B;  1NJI W;  3FYE B;  2P6J A;  4XDJ A;  1K97 A;  3MD0 A;  2ZQM A;  5CBF A;  1R3J C;  2D3O W;  1JQ0 A;  1SER A;  2DYR C;  1R6N A;  1P7B A;  2JEU A;  1Q81 W;  2OTL V;  3ZN0 A;  3G6E V;  2X6B A;  3JD0 A;  2HJF C;  1NVP B;  3M99 B;  4PA3 A;  5LGU A;  2WLL B;  2K1E A;  4RQE A;  5B1A C;  1W0J G;  3K06 A;  3D3I A;  2ITD C;  4JAV A;  4J9Z B;  4PDV A;  3RW0 A;  3IC7 A;  4XDK A;  4MVU A;  1CPY A;  1OCR B;  2EIL B;  2B1G A;  3CCU V;  3LSS A;  1YJ9 V;  4RQF A;  2DWD C;  4MVQ A;  3K0G A;  2HVK C;  4PA6 A;  3ASO B;  1K73 W;  3X2Q B;  3LDE A;  1THZ A;  1H2G A;  2A0L A;  2DWE C;  3OR7 C;  3CD6 V;  3OM3 B;  1JOY A;  1K7D A;  3AG4 C;  3LNM B;  1ARO P;  2EBO A;  3ABM B;  3ASN B;  5HFL A;  4R6Z A;  5LHI A;  1Y66 A;  4GCZ A;  4JF3 A;  4GX1 A;  2IU0 A;  3ZN1 A;  1V54 C;  3MHS C;  5LHH A;  1NR7 A;  4U7O A;  1WLE A;  1E1R G;  5EBL C;  4CBC A;  1K3E A;  1W0K G;  5KUM A;  2WLJ A;  2CK3 G;  4GX0 A;  1FFT B;  3D36 A;  3ZRS A;  4MS2 A;  3ZRW B;  4BIZ A;  5GW7 A;  4UVC A;  3TK1 A;  5LGN A;  1HWY A;  1OHH G;  1DTO A;  1Q7Y W;  3UKM A;  2X0L A;  4LCU C;  4WFG A;  3FB6 C;  1QVF U;  4WCE V;  5B1O A;  3AG2 B;  4H33 A;  5B1B B;  2Y69 C;  1QR9 A;  2WLL A;  1S72 V;  1KD1 W;  3I56 V;  3GB7 C;  1S0V A;  1OZ0 A;  1NH2 D;  4MVS A;  1M57 B;  4WFB V;  3SPC A;  4BAY A;  4WF9 V;  3ABT A;  4QPK A;  3OR6 C;  2Z5U A;  3ZMU A;  4RUE A;  3JD3 A;  1H8E G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...