4X62O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 27
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x62O00
3O65A 5FLXN 5BY1A 4OPAA 4B3RO 2VQFO 4NXNO 4LFCO 1HNXO 4DUYO 3T1HO 4DV1O 2DJVA 4X65O 4DR5O 4LF6O 1HNWO 4JI3O 2UUAO 4DV5O 4DV6O 4DV4O 4DV7O 4NXMO 1F7YA 4B3SO 4B3TO 4X62O 4JYAO 1N36O 3R66A 5LMUO 3J80N 4DR1O 1XEQA 2UUCO 4LF9O 1R1BA 1R6TA 4DV2O 2Z0AA 1AILA 1HNZO 4JI6O 4JV5O 4LF4O 3F5TA 4X64O 4LFAO 3OTOO 1N33O 1KUQA 4DV0O 3M8AA 1AB3A 4K0KO 3JAMN 1DK1A 3J81N 1IBKO 4JI0O 4JI4O 3SDLA 1XNRO 1J5EO 1IBMO 2JRIA 2UXDO 4DUZO 2UU9O 4KHPO 1FKAO 2HHHO 4JI1O 2UXCO 1D2DA 4GKKO 1XMOO 2VQEO 1YZBA 5BR8O 1N34O 2ZKOA 3J7AU 3RT3C 4DR7O 4LFBO 4AQYO 2LW7A 4X66O 4YHHO 1XMQO 4GKJO 1FJGO 1I94O 2N74A 2E5LO 4DR2O 2UUBO 4OX9O 4DR4O 5H5NA 1NS1A 4YY3O 4OPHA 2ZM6O 4JI2O 2F4VO 1XNQO 4LF5O 4JI8O 4JI7O 4LF7O 4DV3O 2AGAA 4JI5O 4A5UB 2UXBO 4LF8O 4B3MO 1A32A 5A2QN 1G1XB 4DR6O 1X59A 5IT9N 1HR0O 1FYJA 3T1YO 1IBLO 2DOSA 2FKXA 5IWAO 5LL6Y 5BXZA 4DR3O 5LMNO 1N32O
chains in the Genus database with same CATH superfamily
1T5EA 4PA9A 4PI0A 5DN6G 4JPRA 2ZE5A 1NT2B 1HNXO 4D6TH 1RM1B 3ZMUA 4JI7B 3CJHB 5CA0B 1XQ8A 1ZWIC 4X62B 1OZ0A 4J80A 1NH2B 3MHSC 1KP3A 4X62O 5J2UB 4K3AA 4YJ2A 4FLVA 1H2MA 1FXKC 5FPOA 2YEVA 4NB5A 2N05A 3ZMTA 4PDVA 4TUYA 2VRZA 4I50B 4JV5O 2CAZC 1JVMA 3EFFK 5F2VO 1GAXA 2UU9B 3ZBHA 1I7FA 2YXHA 4QNHB 2B5UA 2HKOA 5CBFA 2HP8A 1BE3H 4K0KB 4NXNB 2ZIMA 2EULA 4TV9A 4PA7A 2JJ2G 4I7ZB 2ODMA 3KCYA 5L3CA 3S3XA 1XDCA 4DR5B 4TUYB 3RYHA 1PV0A 4GLXA 2QJ1A 4WFEA 2R72A 1AJNA 1WPBA 3K57A 3A8TA 2JJ1G 3TK1A 1BSMA 4WFAV 4YY3O 4OPHA 3K79A 4CS4A 5IJ0B 2YIBA 1I5XA 1E79G 4QPJA 4UB6Z 4B3MO 1WJZA 5KMGB 5A2QN 1XMQB 5CB4A 2CTWA 2LFRA 2K1EA 3BEHA 3QVNA 1R3IC 2ZR3A 2JGDB 2XAFA 2ZCEA 3JAWB 4WFGA 2VQEB 4GX2A 1BT8A 4JI2B 3E86A 5IYDO 1YTFB 5KAFZ 1MSWD 2F95B 1WPXA 2G38A 1GM7A 4DW1A 1KC8W 4I55B 1R3LC 4LC1A 3CC7V 3W7WA 4ZHQA 1Q6HA 1FXHA 1K3EA 2A7WA 4B3SO 1MSDA 2Y0PA 2ITDC 3B77A 3DXRB 5C8YA 4UFZA 4NTWA 1MOFA 3FYIB 5H6QA 1FFXA 2EBOA 2KG7B 2QKAA 3LDCA 2LFSA 1OCRB 3RVZA 2YDEA 3B8NA 2EILB 2WLMA 5B1AC 1P7GA 1BHBA 2UXXA 1VIBA 2HFEC 5KLVH 3APOA 1IVSA 2QWRB 4X1KA 1RPRA 2VS0A 4ZHQB 3OUFA 1SA0A 2JRIA 1XHZA 3JALB 3UKMA 3CC4V 4JI8B 2Y4TA 3ABTA 4PELA 4GT1A 2MK3A 4W4LA 5KHGA 2P6JA 4UCOA 4D7TA 5IJ9B 2GV9A 3HKEB 4NVPA 1NU1H 3ABUA 1XBLA 1I94O 2QE7G 2XOKG 2JDIG 1XL6A 5LXTB 5LBQA 4EB6B 3OMAB 3JALA 2QTOA 1ZTEA 1P49A 4WCEV 3AK1A 5JH7A 5KX5A 3L73H 2B1GA 5B1BC 4C7UA 2PI5A 3BPZA 1ZAUA 1N34B 2HLDG 4JYBA 2JGUA 1VQ9V 2EIMB 1FXVA 3MDSA 1AR1B 4E2LA 1NQTA 3STZC 2P7TC 4QE9A 4O4HB 2XUMA 3CCEV 3E83A 2WLKA 5L3DA 4JYAB 5LHGA 2Q6AA 3JSNA 2LP7A 1KB9F 3OW2U 1OHHG 3K04A 3OGCC 3AG2B 1JR9A 1N8RW 1W0KG 2EINB 1R1BA 1X4TA 3RYIA 4H13B 1M56C 5J2UA 2V7QG 1AILA 3VQWA 1YXBA 1J95A 2QWPB 2QDOA 2YEVB 1SQVH 1S0VA 4K0KO 2UXNA 4WFHA 3D36C 4WFFA 1K7DA 1XOUA 4P30A 3BY6A 2IJIA 4G2KA 2JK5C 3W7SA 1H38A 3ZMSA 4TV8B 2UU9O 4MW8A 3ZEDA 4JV5B 1JMKC 3JSLA 3CCVV 3CCRV 2PI4A 1PL4A 3N2KA 4IT5A 2E5LB 3IAYA 4LFBO 4AHCA 1NKDA 1NR1A 3K5MA 1SESA 2DE0X 1SQXH 2EZOA 3EVKA 4LF5B 3O9OA 4X88A 3UT5B 2UXCB 3VQYA 2HHHB 2K9PA 1E1RG 3ABKB 4I4TA 2Q67A 4G28B 1ORQC 5CB4B 4YIPA 4DR3O 3JARA 1R3KC 5LHHA 1GN2A 2UUBB 4JYCA 3LNMB 1UFIA 3L72H 3ZRXA 4XDJA 3SYAA 5JCOC 2XTAA 2JS3A 1SQPH 1V55B 2YS8A 4UCVA 4MTXA 5JJNB 4JI3O 4FK5C 3JD0A 4DV5O 4ZIBA 3EHBB 3SYOA 3FB7C 3K5OA 4DV5B 1N36O 1TVKB 4I55A 1TAEA 2E76B 3JAWA 2BOBC 1EM1A 3ASOC 1KD1W 3H1KH 3QO7A 1DLBA 2QWOB 4UCRA 3DXRA 1FFTB 2B9ZA 2QA4V 1IURA 3D8CA 3OTOO 2GDSA 4CBCA 1NR7A 4JI0B 2C2AA 5EZYB 1VMGA 2QKSA 1L0LH 1D5NA 2X6AA 4ZI7B 5LGUA 1YJ9V 4LR3A 3E8HA 4P2ZA 3PN1A 2LW7A 1Y76A 2GUZB 1PKXA 1Z5WA 1YEWA 2X6CA 2IU3A 3RYCA 5BMVB 4FIPC 3K58A 3H9VA 4DRXA 1MG1A 4RQFA 2EIKB 1FYJA 4MVZA 1YTFD 4X20A 4YXWG 1YDXA 5HFMA 3BCCH 1QR8A 1EFRG 1IZ3A 1PPJH 2EJ7A 4MSWC 2ZM6B 2P4KA 4Z2WA 1PNMA 4HYOA 1PP9H 4DR2B 3H1HH 4QJFB 1QR9A 2ZE8A 1AJQA 4DV1O 2Y0IA 1KU9A 3CC2V 1NTKH 1K92A 3CP1A 4F6RA 5B3SC 4GKKB 5CA3A 4N23A 4GUNA 5EIBD 2HJDA 3K0DA 5B1AB 3G6EV 3ZHSA 2H3OA 4IGGA 4I50A 2IW5A 1U96A 5B1OA 1H8HG 2HVJC 5KA6A 2OIEA 2EINC 4JI6O 3BA9A 4U3FH 4CC5A 3HKBB 1QLEC 5GONB 4DYLA 3CCUV 2ZIOA 4F6RB 3JAMN 1AP5A 2DYRB 2RNBA 1H8EG 1IBKO 2D3OW 4J7ZA 3SDLA 2F66C 5L3GA 4B08A 3IC7A 4MVMA 4FM1A 1BMFG 4KXRA 2LGQA 3IJ4A 2P4VA 2WLNA 4P9OA 1H2NA 2WLHA 2AXTZ 3W7TA 3ETGA 4GKKO 5BR8O 3G80A 1B3QA 1COWG 1Q86W 3ZN1A 2JIZG 4B7KA 2KB1A 1UJWB 1PD3A 2LW1A 1L1FA 4DR2O 1IDSA 1B04A 1PNLA 1E1QG 4F6EA 2D2CB 4TQFA 1K4CC 1Q6IA 2ZR2A 2F23A 1JJOA 1N32O 1IX9A 3O65A 2PF4E 2O57A 3JATA 3FFQA 4U7OA 3OTFA 3T1HO 1AJPA 2BTOA 3K3WA 2EX3A 1FD9A 3SPIA 4LF7B 3AG4C 4GX1A 3VQXA 2YXYA 2XAGA 1RFYA 2F93B 2WA3A 4O2AB 4TWKA 4J11A 5IYBO 5J2TB 2QWQB 3J80N 4AQYB 1BHAA 2FTKA 2ZQMA 3CE2A 4DK1A 3RFRA 4LF9O 2EZPA 1S3JA 4D7SA 3RBZA 4TT3G 3L74H 1N36B 1FAFA 2OCHA 2XAHA 3DC5A 3GWKC 4H33A 1NZ6A 2QM7A 3DC6A 4X1IA 4UCUA 4LH6A 1XNRO 1NBMG 4LFCB 4JYYA 4JTAB 4GZRB 2ZXWC 4XBFA 4NXMB 3AG3B 1XMOO 2VQEO 3ASNC 4LWSA 3RYFA 2P06A 3ETEA 3ZRWA 5B1NA 3E22A 4MW3A 1R6KA 4N21A 5EBLC 1NTZH 2NNUA 1SF9A 1YITV 4X66O 1XMQO 4OX9O 5JJEB 2OIGA 1M4UA 2Q7EA 4X1IB 3WG7C 1BL8A 1EZJA 3JASB 4CS2A 3WB2A 4MS2A 4A5UB 3LDEA 1A32A 1VF6C 3FX7A 2OCCB 5AG2A 1F23A 3X2QC 4RWUA 5EC2C 4J9YB 3HKCB 1H2LA 1Y76B 1Y66A 1KKCA 2W0FC 4RUEA 5IYCO 4UV9A 2WA4A 3OM3B 1CP9A 1WP8A 3ZHQA 4JI4B 4CZZA 2ZDIA 4PDMA 1GO3F 1QNMA 2IH1C 2ZNJA 4AI8A 3ZS8C 4X1YB 1F7YA 4CH4A 1S5LZ 3N2GA 4KP4A 4O4IA 3HKCA 4DR7B 4TV9B 1R6TA 1V54C 2WLIA 3OGIB 1NVPB 2W6IG 5B5EZ 3FAVA 4RO2A 2Q0OC 1K9MW 5LYJB 4JTDB 1GTOA 3EXAA 4TV8A 4DV2B 1G8MA 3BFRA 3IFXA 4IYHA 4FM0A 4JI4O 3N2GB 2Q0AA 4J7JA 1H2SB 3SJCC 2HR3A 5FNVA 3SR2C 4IYIA 3SPJA 3QF7A 4LNUB 1JPXA 1N34O 1SQQH 1XL4A 1K33A 1WN7A 2QKCA 3RT3C 4X9QA 3SPGA 1ZSPA 1L8DA 1K4DC 4UCSA 3AEIA 3E8BA 3JD1A 1QQCA 1QVGU 1S72V 1Q5OA 4P9PA 2OTJV 4LCUC 2ATKC 2ZDIC 4NKGB 2AGAA 4JI5O 1QU7A 1XREA 4WBNA 4R8CA 1XNRB 1X59A 2OCCC 1YIJV 3JARB 5K1PA 2KSDA 2DOSA 5KHJA 1VARA 5H9CA 5LL6Y 4FPPA 5BXZA 3SJQC 4DV0B 4RUFA 4UUJC 4PDLA 1YJNV 1XMOB 4MTOA 1SKVA 1XHXA 1DF5A 4DR4B 5FPRA 3DSQA 3Q4HA 1K97A 4LFCO 1CXZB 4I0XB 4X65O 4FFBB 4R6ZA 2UXBB 4MVQA 1YCIA 1SC5B 2IH3C 2WLLB 5IY5C 3W7UA 4DV7O 4B3TO 4MTFA 1XILA 5EBWC 1SA0B 4J10A 5EYPB 3CRCA 3A0HZ 1OV9A 3CCSV 1LUVA 1SZXA 3R65A 5LA6A 4B3SB 3AK3A 2R9AA 3LDDA 4UCTA 1BQZA 2QM8A 2CTPA 4QE7A 4PA4A 1F4MA 1Y74A 4EB6A 3AG7A 4K8XA 5J2TA 3CXCU 5JVDB 2PYJA 1AR5A 3JD3A 4DV6B 1XNQB 5JQGB 4PA3A 4PJ0Z 1H2KA 3OT7A 3FD9A 2ARHA 3T1HB 1W59A 4HZ3A 4TQDA 4DR6B 5IYZB 1VQNV 4DR4O 5DM6V 1YF2A 3E22B 5K1XA 1VF7A 2YSUB 2H8PC 4RAIA 4BW5A 3GVMA 4MT8A 2UXBO 1BS3A 1K5QA 3ML0A 4JAUA 4LWSB 5DECA 2ZNIA 4BIZA 5IWAO 4O4JA 3AG4B 5BR8B 3JAKB 3VQVA 2IU0A 5FLXN 5EC1C 3K03A 3M99B 3JASA 2ETNA 1S77D 3W7XA 2CGOA 1JOYA 3HR0A 5KA5A 4JZGA 2VWJA 4DV4O 1VQOV 3K9AA 1ZL8B 2B1IA 4FVMA 5D5QA 3JAKA 2AHYA 2LGWA 2HG5C 3A0BZ 3ABLB 4NTYA 1N4CA 3TETA 1KECA 1I08A 2WWWA 4IIJA 1HNZO 4X64B 5CA1A 4LF4O 4CH5A 2P22C 3FAVB 3ASNB 4J7KA 3F5WC 3QTCA 2DN9A 4X1YA 1R6NA 1ZL8A 2PYLA 1ROPA 1WP7A 1HNXB 1J5EO 3G67A 4JZ2A 5KMGA 1AROP 3ZX6A 3PJSK 2W6JG 2EIJC 2ZKOA 1OCCC 1RPOA 3FB8C 2YXLA 1N0JA 4PI2A 4E4EA 4O2BA 4DR7O 3L70H 3RGBA 2X7RB 2PY5A 4W4KA 1FJGO 1F51A 1ZX3A 4LF8B 3K5LA 3OR6C 3U11A 3B4SA 1K5SA 3L75H 3ABKC 4JI1B 4ASUG 5C93A 4JI7O 1OCOB 3SPHA 2Q4PA 3U0ZA 4UB8Z 5IT9N 2BTQA 5B1BB 1AI5A 3RYHB 4CS3A 5H2FZ 1TGOA 2R9RB 3RN4A 4HNAB 4WBNB 2OT5A 3JATB 3ZN0A 5JWPA 3FYEB 5BY1A 1FFXB 2KG7A 3TJTA 4OPAA 1SQGA 2VQFO 4DO2A 2A9HA 2VWKA 1V55C 4FJCC 5CBHA 2XNDG 3CMEV 2M7WA 5KAIZ 2JVDA 2GBOA 3P3PA 4FLWA 1V54B 4LF6O 2DYSC 2RN9A 2F4VB 3UCSC 3ASOB 3CHXA 1GMGA 4FFBA 4NXMO 3D36A 2AW9A 4KL1A 4YHHB 4X66B 5E1AC 1IBMB 2YIAA 1P84F 3L9DA 2WAMA 3RVYA 4UVCA 1M1KW 2NLJC 4EFBA 4X89A 2WPDG 2YICA 3ZHUA 5IJ9A 4QGPA 5DEDA 1NH2D 3CRRA 3MAQA 1N33O 1SETA 4DV0O 2GSMB 2IBZH 2A06H 5EBMC 5TISZ 1CPYA 2NR5A 2GUZA 1VQ8V 3VOUA 4WF9V 2A3QA 3N27A 2PTMA 1KQSU 5LP6B 2UXDO 3SYPA 1QLEB 2HHHO 3ZHVA 5FL7G 2A0LA 1YZBA 5GTHZ 4JI3B 4K8ZA 2IJHA 2QSAA 4BR6A 4LF9B 2E74B 2HJFC 1HWYA 1HP8A 3TCUA 1GH6A 5JQGA 3L71H 3I56V 4ZKIA 1WB8A 2E5LO 3C3TA 3CPWU 1Y6XA 4X1KB 1NS1A 2YI9A 4DR3B 4LP8A 1KBHA 4JAVA 3H1JH 1G1XB 2XAJA 4X8AA 1N0NA 1VQKV 2YIBD 3IGAC 1HR0O 2FKXA 1Q90D 3ZIAG 1R3JC 3AK2A 4GYCB 2N74A 4PV1B 2BOCC 3OAAG 5IY5B 1Q82W 3K9SA 4YIOA 2CTQA 1WNSA 3K06A 3ZJZA 3U10A 1J5EB 4LFBB 5B66Z 4DUYO 2RDCA 1BGYH 5B3SB 2DWDC 4ZOLB 5GONA 1OJHA 2AHZA 3C3SA 2OTLV 4O4IB 1LR1A 3CEIA 5CMUA 3GWOA 1DTOA 1ENVA 4JYAO 2ZD9A 1OCZB 1AR4A 1ZLZA 3P30A 1IBKB 1Y67A 3K08A 1BCCH 3CCQV 4KUMA 5LMUB 4XDLA 1OCRC 2ZE6A 3MHHC 4ZOLA 5A9GA 4X64O 1XI1A 1HNWB 3ETDA 2JS5A 5FNVB 2IM9A 3P32A 3GB7C 3RW0A 3J81N 4ZBMA 3JCUZ 1LUWA 3K5NA 1RSOB 1SS3A 4JTCB 5IE9A 3T4DA 3HB3B 3FB6C 2M6YA 4YJ3B 1HNZB 3SJAC 5ITZB 3LSUA 4CC6A 3KG2A 1PM9A 1AI4A 3BVOA 5LGNA 3J7AU 2V1DA 1VQPV 1MNGA 4IHJA 4LBEC 3UQ8A 2Q68A 1BQ0A 4GKJO 1SZTA 4L8JA 2ZXWB 3LUTB 3LNNA 5E79Z 4JI8O 1WB7A 4UXNA 4DR6O 2ZT9B 4DUYB 2EIKC 1ZUQA 3HKDA 3IC9A 5LMNO 2XASA 3CB2A 2JGDA 2ILMA 4DUZB 1K73W 4NR1A 1D5AA 4DK0A 2WLLA 4R7CA 1Y4MA 4Q6GA 3UT5A 2BSKA 4B7EA 1R73A 4O2AA 2GTSA 3ABLC 5JCOA 3Q4HB 2YC0A 4UVAA 4DV6O 4DV7B 3JCZA 1P7BA 5CN0A 2DYSB 1M93A 4HNAA 1XEQA 3AG2C 4GX0A 3UM7A 3CRAA 1SERA 3G4SV 4FLTA 2L35A 4OXSA 3OTOB 3F7VC 3ZCCA 1GN6A 3QO8A 1BZKA 2P90A 2A79B 3B40A 2EIJB 2FL4A 3CSXA 4JI0O 2QR4A 1TVKA 2QGNA 3WB0A 3TXQA 4DUZO 4KHPO 1Y74B 4LFAB 1THZA 3H1IH 3QG5A 2DMXA 3KZIZ 1D2DA 5LMNB 1O9HA 5KUKA 3OEEG 5KHHA 5LP6A 1Q81W 2JEXA 3T1YB 5H6RA 4EFEA 4PDRA 3SJBC 4YHHO 2BCCH 2UUBO 3HKEA 2QWNB 4JI2O 5L3BA 2H94A 4R50A 3T1CA 2DWEC 4DV3O 2CE4A 1CEZA 3UO2A 3X2QB 4X65B 4U3JB 4BWAA 1JX9A 2Y4UA 1KP2A 4B3MB 2VQFB 2FB5A 1SQBH 2ADPA 1JA8A 1JFFB 4QIWF 4JF3A 1GM9A 2CTRA 4YY3B 4O4JB 1GM8A 4NXNO 1Q7YW 1VQ5V 1TUBB 3ZMVA 3K59A 2Z5UA 3ABMC 5LYJA 4TSFG 3CWBH 1P4RA 1HNWO 2UUAO 3E2EA 1VQ7V 1Z5VA 3C90A 4X20B 3JYCA 1FJGB 5LMUO 4DR1O 3TXSA 4U7NA 3M7MX 3WFVA 5L3EA 1VQ4V 3OE7G 2V4DA 4J41A 2PUSA 2Q9LA 3S3WA 4DV2O 2YIDA 2RCVA 3D3QA 3D3IA 1EN5A 2Z0AA 1URFA 1W0JG 1PNKA 2BE3A 5LP6C 2L6LA 1YSCA 2QEXV 3F5TA 5HFLA 2CGNA 2UUAB 4J42A 1US6A 4IIJB 1GRJA 2R70A 3VBBA 5CA1B 1HR0B 4O4LA 2IJKA 2P67A 2RMKB 2AZ0A 3BHPA 4FLUA 1FKAO 4LF4B 3G71V 2XAQA 2CH7B 1EN4A 1RSOA 1K8AW 1VF5B 3AG1C 3OR7C 3ZHRA 4YJ3A 4DR1B 2Q7HA 2YUAA 1KYOF 3N2KB 4DV3B 1EZVH 1G6UA 3LSQA 4UVBA 4DV4B 2E75B 2EJRA 1NJIW 4O4LB 1DGSA 2BTQB 1QVFU 1IBLB 1PL0A 4HAMA 4TOIA 2CH7A 1WA8B 3MD0A 5IJ0A 5ITZA 2LO1A 3DTUB 3T1YO 2R9IA 1VEWA 1KMIZ 3E35A 3A0RA 3CXHF 4I9WA 1QLNA 1JQ0A 2E3CA 4DXWA 4KHPB 3OFNG 2UXDB 1Z2GA 3OMIB 1OCZC 2KQXA 4WFBV 5EK0A 2DJVA 3ABMB 2Q73A 1M56B 1N33B 4PHZA 2FYUH 4I4TB 5EYPA 3CRQA 2X0LA 2BSKB 1S5JA 3CD6V 2PGGA 3HKDB 2Y48A 4LF6B 3R66A 5LA6B 2UUCO 4MVSA 2XHBA 1HW7A 2OWOA 1WAZA 2QM4A 4G27B 3BA8A 1IXBA 1G4YB 4LFAO 3H01A 5LGTA 2ZINA 1AB3A 5EIBC 3QO5A 3KKYA 2DYRC 2Q8VA 3BABA 4LH7A 3WG7B 3CMAV 1YI2V 1AI6A 2XT9A 5EZYA 4PA6A 4JI1O 1AP6A 2UXCO 4NYKA 2OYQA 4I9QA 2HVKC 3SYCA 1NI8A 5IYZA 2Q5ZA 3AG1B 3ZHTA 3LSSA 4AQYO 1JJ2U 2Q69A 1WLEA 3E8FA 4F4LA 1FPOA 5H5NA 4H0LB 3JD2A 3H1LH 1TUEB 5KX5B 4LF7O 3K0GA 3SGIA 1QBZA 2DQ0A 3A2FA 4LF8O 4JASA 2ZE7A 5LXTA 5CA0A 4UV8A 1VP7A 3RYFB 4FFKA 3QNEA 4FLYA 2W0XA 3ZMZA 3ETQA 4DRXB 4H37A 1VQ6V 1N32B 1RM1C 2KKWA 2CK3G 1EBOA 2CUGA 4JI6B 2YI8A 2WLJA 3RYCB 3P3NA 5GW7A 4Z1MG 3SPCA 3WU2Z 1MABG 4JI5B 1IXMA 4EKWA 1Q8IA 1VQMV 4DR5O 4MVRA 1AVMA 4XDKA 4YJ2B 1GK9A 4BIOA 1JFFA 4GKJB 5LOVA 1KKDA 3CCMV 1H2GA 2RQ6A 2MW2B 1I5YA 3I5DA 3APQA 2Z3YA 3TGUH 3RYIB 3THOA 1GN3A 1AI7A 5J9PC 5L3FA 4CH3A 1S5HC 4EEQA 1KUQA 5GTIZ 3M8AA 1Q43A 1F4NA 5IWAB 3I55V 1MA1A 3RWRD 1Q3EA 1M57B 5LOVB 2ITCC 4JAAA 1QHTA 1GKFA 3HPLC 3CYOA 1GN4A 4O2BB 4IHJB 2WLIB 3AG3C 3ZRVA 3DGEA 3UO3A 1NVPD 1M90W 3T2MA 3ICXA 3B8MA 5KUMA 1I94B 3CS5A 3HKBA 4KFMA 2Q7GA 2DQ3A 3OD4A 4DW0A 5CBGA 1DF4A 2ZM6O 4FZ1A 2LQTA 1MZFA 1XNQO 4Z1VA 3CCLV 4FLXA 4FMTA 1M9NA 4I5SA 3JD4A 1HDJA 4DV1B 1TA8A 2P5OA 3STLC 2CDYA 4LNUA 1M5IA 4GCZA 3T4ZA 2X6BA 3BRCA 2N04A 3OMNB 4B3RO 2LJ2A 1U97A 3B09A 4H44B 3E8GA 1QCEA 4ICGA 1YHQV 5IDJA 1VF6A 4MVUA 5KHKA 5C8YB 1O9GA 2NN4A 1WA8A 4B3TB 1B06A 5BZBA 4OX9B 2QTSA 2Y69C 4JGSA 3NR7A 3WB1A 1W2BU 3ZRSA 1RP3B 5JVDA 1FXKB 4NTXA 1S76D 2F43G 2EILC 1MMMA 2GTAA 4OGQB 3BAAA 1VQLV 2WSSG 4GX5A 4RQEA 2RJZA 4IL6Z 4BAYA 4Q20A 1NTMH 2PZSA 4FZ0A 4I0XA 3NXSA 4MTGA 2DW4A 3FKSG 4QPKA 1LNQA 1FS0G 3CX5F 2Y69B 1DK1A 1I0HA 1SQFA 1V9PA 2UUCB 1JCHA 4K35A 1IBMO 1Q6UA 1M57C 2AZ2A 1FXKA 5JJJB 4AILC 4ABMA 1SRYA 4CH6A 1K34A 1OCCB 5KHIA 4FLZA 1L0NH 4ZI7A 1UPGA 4MVOA 4HBNA 3OUSA 5BMVA 2ADQB 3OEHG 4PD4F 1XUQA 4B3RB 2F1MA 3ZRWB 1EN6A 3E89A 2JEUA 3CCJV 3B2EE 4L87A 4FM2A 5JH7B 2F4VO 3KCXA 4LF5O 1OCOC 1B6QA 4O4HA 4BW9A 3G6BA 1YJWV 3SYQA 1YVWA 2HEPA 3CJHA 3FB5C 5LHIA 1MZEA 4J9ZB 2FMLA 2IJJA 1IBLO 4BIUA 3F7YC 2EIMC 2GHYA 4U3JA 3CRMA 5D5PA 1TUBA
chains in the Genus database with same CATH topology
3O65A 5FLXN 5BY1A 4OPAA 4B3RO 2VQFO 4NXNO 4LFCO 1HNXO 4DUYO 3T1HO 4DV1O 2DJVA 4X65O 4DR5O 4LF6O 1HNWO 4JI3O 2UUAO 4DV5O 4DV6O 4DV4O 4DV7O 4NXMO 1F7YA 4B3SO 4B3TO 4X62O 4JYAO 1N36O 3R66A 5LMUO 3J80N 4DR1O 1XEQA 2UUCO 4LF9O 1R1BA 1R6TA 4DV2O 2Z0AA 1AILA 1HNZO 4JI6O 4JV5O 4LF4O 3F5TA 4X64O 4LFAO 3OTOO 1N33O 1KUQA 4DV0O 3M8AA 1AB3A 4K0KO 3JAMN 1DK1A 3J81N 1IBKO 4JI0O 4JI4O 3SDLA 1XNRO 1J5EO 1IBMO 2JRIA 2UXDO 4DUZO 2UU9O 4KHPO 1FKAO 2HHHO 4JI1O 2UXCO 1D2DA 4GKKO 1XMOO 2VQEO 1YZBA 5BR8O 1N34O 2ZKOA 3J7AU 3RT3C 4DR7O 4LFBO 4AQYO 2LW7A 4X66O 4YHHO 1XMQO 4GKJO 1FJGO 1I94O 2N74A 2E5LO 4DR2O 2UUBO 4OX9O 4DR4O 5H5NA 1NS1A 4YY3O 4OPHA 2ZM6O 4JI2O 2F4VO 1XNQO 4LF5O 4JI8O 4JI7O 4LF7O 4DV3O 2AGAA 4JI5O 4A5UB 2UXBO 4LF8O 4B3MO 1A32A 5A2QN 1G1XB 4DR6O 1X59A 5IT9N 1HR0O 1FYJA 3T1YO 1IBLO 2DOSA 2FKXA 5IWAO 5LL6Y 5BXZA 4DR3O 5LMNO 1N32O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O65 A;  5FLX N;  5BY1 A;  4OPA A;  4B3R O;  2VQF O;  4NXN O;  4LFC O;  1HNX O;  4DUY O;  3T1H O;  4DV1 O;  2DJV A;  4X65 O;  4DR5 O;  4LF6 O;  1HNW O;  4JI3 O;  2UUA O;  4DV5 O;  4DV6 O;  4DV4 O;  4DV7 O;  4NXM O;  1F7Y A;  4B3S O;  4B3T O;  4X62 O;  4JYA O;  1N36 O;  3R66 A;  5LMU O;  3J80 N;  4DR1 O;  1XEQ A;  2UUC O;  4LF9 O;  1R1B A;  1R6T A;  4DV2 O;  2Z0A A;  1AIL A;  1HNZ O;  4JI6 O;  4JV5 O;  4LF4 O;  3F5T A;  4X64 O;  4LFA O;  3OTO O;  1N33 O;  1KUQ A;  4DV0 O;  3M8A A;  1AB3 A;  4K0K O;  3JAM N;  1DK1 A;  3J81 N;  1IBK O;  4JI0 O;  4JI4 O;  3SDL A;  1XNR O;  1J5E O;  1IBM O;  2JRI A;  2UXD O;  4DUZ O;  2UU9 O;  4KHP O;  1FKA O;  2HHH O;  4JI1 O;  2UXC O;  1D2D A;  4GKK O;  1XMO O;  2VQE O;  1YZB A;  5BR8 O;  1N34 O;  2ZKO A;  3J7A U;  3RT3 C;  4DR7 O;  4LFB O;  4AQY O;  2LW7 A;  4X66 O;  4YHH O;  1XMQ O;  4GKJ O;  1FJG O;  1I94 O;  2N74 A;  2E5L O;  4DR2 O;  2UUB O;  4OX9 O;  4DR4 O;  5H5N A;  1NS1 A;  4YY3 O;  4OPH A;  2ZM6 O;  4JI2 O;  2F4V O;  1XNQ O;  4LF5 O;  4JI8 O;  4JI7 O;  4LF7 O;  4DV3 O;  2AGA A;  4JI5 O;  4A5U B;  2UXB O;  4LF8 O;  4B3M O;  1A32 A;  5A2Q N;  1G1X B;  4DR6 O;  1X59 A;  5IT9 N;  1HR0 O;  1FYJ A;  3T1Y O;  1IBL O;  2DOS A;  2FKX A;  5IWA O;  5LL6 Y;  5BXZ A;  4DR3 O;  5LMN O;  1N32 O; 
#chains in the Genus database with same CATH topology
 1T5E A;  4PA9 A;  4PI0 A;  5DN6 G;  4JPR A;  2ZE5 A;  1NT2 B;  1HNX O;  4D6T H;  1RM1 B;  3ZMU A;  4JI7 B;  3CJH B;  5CA0 B;  1XQ8 A;  1ZWI C;  4X62 B;  1OZ0 A;  4J80 A;  1NH2 B;  3MHS C;  1KP3 A;  4X62 O;  5J2U B;  4K3A A;  4YJ2 A;  4FLV A;  1H2M A;  1FXK C;  5FPO A;  2YEV A;  4NB5 A;  2N05 A;  3ZMT A;  4PDV A;  4TUY A;  2VRZ A;  4I50 B;  4JV5 O;  2CAZ C;  1JVM A;  3EFF K;  5F2V O;  1GAX A;  2UU9 B;  3ZBH A;  1I7F A;  2YXH A;  4QNH B;  2B5U A;  2HKO A;  5CBF A;  2HP8 A;  1BE3 H;  4K0K B;  4NXN B;  2ZIM A;  2EUL A;  4TV9 A;  4PA7 A;  2JJ2 G;  4I7Z B;  2ODM A;  3KCY A;  5L3C A;  3S3X A;  1XDC A;  4DR5 B;  4TUY B;  3RYH A;  1PV0 A;  4GLX A;  2QJ1 A;  4WFE A;  2R72 A;  1AJN A;  1WPB A;  3K57 A;  3A8T A;  2JJ1 G;  3TK1 A;  1BSM A;  4WFA V;  4YY3 O;  4OPH A;  3K79 A;  4CS4 A;  5IJ0 B;  2YIB A;  1I5X A;  1E79 G;  4QPJ A;  4UB6 Z;  4B3M O;  1WJZ A;  5KMG B;  5A2Q N;  1XMQ B;  5CB4 A;  2CTW A;  2LFR A;  2K1E A;  3BEH A;  3QVN A;  1R3I C;  2ZR3 A;  2JGD B;  2XAF A;  2ZCE A;  3JAW B;  4WFG A;  2VQE B;  4GX2 A;  1BT8 A;  4JI2 B;  3E86 A;  5IYD O;  1YTF B;  5KAF Z;  1MSW D;  2F95 B;  1WPX A;  2G38 A;  1GM7 A;  4DW1 A;  1KC8 W;  4I55 B;  1R3L C;  4LC1 A;  3CC7 V;  3W7W A;  4ZHQ A;  1Q6H A;  1FXH A;  1K3E A;  2A7W A;  4B3S O;  1MSD A;  2Y0P A;  2ITD C;  3B77 A;  3DXR B;  5C8Y A;  4UFZ A;  4NTW A;  1MOF A;  3FYI B;  5H6Q A;  1FFX A;  2EBO A;  2KG7 B;  2QKA A;  3LDC A;  2LFS A;  1OCR B;  3RVZ A;  2YDE A;  3B8N A;  2EIL B;  2WLM A;  5B1A C;  1P7G A;  1BHB A;  2UXX A;  1VIB A;  2HFE C;  5KLV H;  3APO A;  1IVS A;  2QWR B;  4X1K A;  1RPR A;  2VS0 A;  4ZHQ B;  3OUF A;  1SA0 A;  2JRI A;  1XHZ A;  3JAL B;  3UKM A;  3CC4 V;  4JI8 B;  2Y4T A;  3ABT A;  4PEL A;  4GT1 A;  2MK3 A;  4W4L A;  5KHG A;  2P6J A;  4UCO A;  4D7T A;  5IJ9 B;  2GV9 A;  3HKE B;  4NVP A;  1NU1 H;  3ABU A;  1XBL A;  1I94 O;  2QE7 G;  2XOK G;  2JDI G;  1XL6 A;  5LXT B;  5LBQ A;  4EB6 B;  3OMA B;  3JAL A;  2QTO A;  1ZTE A;  1P49 A;  4WCE V;  3AK1 A;  5JH7 A;  5KX5 A;  3L73 H;  2B1G A;  5B1B C;  4C7U A;  2PI5 A;  3BPZ A;  1ZAU A;  1N34 B;  2HLD G;  4JYB A;  2JGU A;  1VQ9 V;  2EIM B;  1FXV A;  3MDS A;  1AR1 B;  4E2L A;  1NQT A;  3STZ C;  2P7T C;  4QE9 A;  4O4H B;  2XUM A;  3CCE V;  3E83 A;  2WLK A;  5L3D A;  4JYA B;  5LHG A;  2Q6A A;  3JSN A;  2LP7 A;  1KB9 F;  3OW2 U;  1OHH G;  3K04 A;  3OGC C;  3AG2 B;  1JR9 A;  1N8R W;  1W0K G;  2EIN B;  1R1B A;  1X4T A;  3RYI A;  4H13 B;  1M56 C;  5J2U A;  2V7Q G;  1AIL A;  3VQW A;  1YXB A;  1J95 A;  2QWP B;  2QDO A;  2YEV B;  1SQV H;  1S0V A;  4K0K O;  2UXN A;  4WFH A;  3D36 C;  4WFF A;  1K7D A;  1XOU A;  4P30 A;  3BY6 A;  2IJI A;  4G2K A;  2JK5 C;  3W7S A;  1H38 A;  3ZMS A;  4TV8 B;  2UU9 O;  4MW8 A;  3ZED A;  4JV5 B;  1JMK C;  3JSL A;  3CCV V;  3CCR V;  2PI4 A;  1PL4 A;  3N2K A;  4IT5 A;  2E5L B;  3IAY A;  4LFB O;  4AHC A;  1NKD A;  1NR1 A;  3K5M A;  1SES A;  2DE0 X;  1SQX H;  2EZO A;  3EVK A;  4LF5 B;  3O9O A;  4X88 A;  3UT5 B;  2UXC B;  3VQY A;  2HHH B;  2K9P A;  1E1R G;  3ABK B;  4I4T A;  2Q67 A;  4G28 B;  1ORQ C;  5CB4 B;  4YIP A;  4DR3 O;  3JAR A;  1R3K C;  5LHH A;  1GN2 A;  2UUB B;  4JYC A;  3LNM B;  1UFI A;  3L72 H;  3ZRX A;  4XDJ A;  3SYA A;  5JCO C;  2XTA A;  2JS3 A;  1SQP H;  1V55 B;  2YS8 A;  4UCV A;  4MTX A;  5JJN B;  4JI3 O;  4FK5 C;  3JD0 A;  4DV5 O;  4ZIB A;  3EHB B;  3SYO A;  3FB7 C;  3K5O A;  4DV5 B;  1N36 O;  1TVK B;  4I55 A;  1TAE A;  2E76 B;  3JAW A;  2BOB C;  1EM1 A;  3ASO C;  1KD1 W;  3H1K H;  3QO7 A;  1DLB A;  2QWO B;  4UCR A;  3DXR A;  1FFT B;  2B9Z A;  2QA4 V;  1IUR A;  3D8C A;  3OTO O;  2GDS A;  4CBC A;  1NR7 A;  4JI0 B;  2C2A A;  5EZY B;  1VMG A;  2QKS A;  1L0L H;  1D5N A;  2X6A A;  4ZI7 B;  5LGU A;  1YJ9 V;  4LR3 A;  3E8H A;  4P2Z A;  3PN1 A;  2LW7 A;  1Y76 A;  2GUZ B;  1PKX A;  1Z5W A;  1YEW A;  2X6C A;  2IU3 A;  3RYC A;  5BMV B;  4FIP C;  3K58 A;  3H9V A;  4DRX A;  1MG1 A;  4RQF A;  2EIK B;  1FYJ A;  4MVZ A;  1YTF D;  4X20 A;  4YXW G;  1YDX A;  5HFM A;  3BCC H;  1QR8 A;  1EFR G;  1IZ3 A;  1PPJ H;  2EJ7 A;  4MSW C;  2ZM6 B;  2P4K A;  4Z2W A;  1PNM A;  4HYO A;  1PP9 H;  4DR2 B;  3H1H H;  4QJF B;  1QR9 A;  2ZE8 A;  1AJQ A;  4DV1 O;  2Y0I A;  1KU9 A;  3CC2 V;  1NTK H;  1K92 A;  3CP1 A;  4F6R A;  5B3S C;  4GKK B;  5CA3 A;  4N23 A;  4GUN A;  5EIB D;  2HJD A;  3K0D A;  5B1A B;  3G6E V;  3ZHS A;  2H3O A;  4IGG A;  4I50 A;  2IW5 A;  1U96 A;  5B1O A;  1H8H G;  2HVJ C;  5KA6 A;  2OIE A;  2EIN C;  4JI6 O;  3BA9 A;  4U3F H;  4CC5 A;  3HKB B;  1QLE C;  5GON B;  4DYL A;  3CCU V;  2ZIO A;  4F6R B;  3JAM N;  1AP5 A;  2DYR B;  2RNB A;  1H8E G;  1IBK O;  2D3O W;  4J7Z A;  3SDL A;  2F66 C;  5L3G A;  4B08 A;  3IC7 A;  4MVM A;  4FM1 A;  1BMF G;  4KXR A;  2LGQ A;  3IJ4 A;  2P4V A;  2WLN A;  4P9O A;  1H2N A;  2WLH A;  2AXT Z;  3W7T A;  3ETG A;  4GKK O;  5BR8 O;  3G80 A;  1B3Q A;  1COW G;  1Q86 W;  3ZN1 A;  2JIZ G;  4B7K A;  2KB1 A;  1UJW B;  1PD3 A;  2LW1 A;  1L1F A;  4DR2 O;  1IDS A;  1B04 A;  1PNL A;  1E1Q G;  4F6E A;  2D2C B;  4TQF A;  1K4C C;  1Q6I A;  2ZR2 A;  2F23 A;  1JJO A;  1N32 O;  1IX9 A;  3O65 A;  2PF4 E;  2O57 A;  3JAT A;  3FFQ A;  4U7O A;  3OTF A;  3T1H O;  1AJP A;  2BTO A;  3K3W A;  2EX3 A;  1FD9 A;  3SPI A;  4LF7 B;  3AG4 C;  4GX1 A;  3VQX A;  2YXY A;  2XAG A;  1RFY A;  2F93 B;  2WA3 A;  4O2A B;  4TWK A;  4J11 A;  5IYB O;  5J2T B;  2QWQ B;  3J80 N;  4AQY B;  1BHA A;  2FTK A;  2ZQM A;  3CE2 A;  4DK1 A;  3RFR A;  4LF9 O;  2EZP A;  1S3J A;  4D7S A;  3RBZ A;  4TT3 G;  3L74 H;  1N36 B;  1FAF A;  2OCH A;  2XAH A;  3DC5 A;  3GWK C;  4H33 A;  1NZ6 A;  2QM7 A;  3DC6 A;  4X1I A;  4UCU A;  4LH6 A;  1XNR O;  1NBM G;  4LFC B;  4JYY A;  4JTA B;  4GZR B;  2ZXW C;  4XBF A;  4NXM B;  3AG3 B;  1XMO O;  2VQE O;  3ASN C;  4LWS A;  3RYF A;  2P06 A;  3ETE A;  3ZRW A;  5B1N A;  3E22 A;  4MW3 A;  1R6K A;  4N21 A;  5EBL C;  1NTZ H;  2NNU A;  1SF9 A;  1YIT V;  4X66 O;  1XMQ O;  4OX9 O;  5JJE B;  2OIG A;  1M4U A;  2Q7E A;  4X1I B;  3WG7 C;  1BL8 A;  1EZJ A;  3JAS B;  4CS2 A;  3WB2 A;  4MS2 A;  4A5U B;  3LDE A;  1A32 A;  1VF6 C;  3FX7 A;  2OCC B;  5AG2 A;  1F23 A;  3X2Q C;  4RWU A;  5EC2 C;  4J9Y B;  3HKC B;  1H2L A;  1Y76 B;  1Y66 A;  1KKC A;  2W0F C;  4RUE A;  5IYC O;  4UV9 A;  2WA4 A;  3OM3 B;  1CP9 A;  1WP8 A;  3ZHQ A;  4JI4 B;  4CZZ A;  2ZDI A;  4PDM A;  1GO3 F;  1QNM A;  2IH1 C;  2ZNJ A;  4AI8 A;  3ZS8 C;  4X1Y B;  1F7Y A;  4CH4 A;  1S5L Z;  3N2G A;  4KP4 A;  4O4I A;  3HKC A;  4DR7 B;  4TV9 B;  1R6T A;  1V54 C;  2WLI A;  3OGI B;  1NVP B;  2W6I G;  5B5E Z;  3FAV A;  4RO2 A;  2Q0O C;  1K9M W;  5LYJ B;  4JTD B;  1GTO A;  3EXA A;  4TV8 A;  4DV2 B;  1G8M A;  3BFR A;  3IFX A;  4IYH A;  4FM0 A;  4JI4 O;  3N2G B;  2Q0A A;  4J7J A;  1H2S B;  3SJC C;  2HR3 A;  5FNV A;  3SR2 C;  4IYI A;  3SPJ A;  3QF7 A;  4LNU B;  1JPX A;  1N34 O;  1SQQ H;  1XL4 A;  1K33 A;  1WN7 A;  2QKC A;  3RT3 C;  4X9Q A;  3SPG A;  1ZSP A;  1L8D A;  1K4D C;  4UCS A;  3AEI A;  3E8B A;  3JD1 A;  1QQC A;  1QVG U;  1S72 V;  1Q5O A;  4P9P A;  2OTJ V;  4LCU C;  2ATK C;  2ZDI C;  4NKG B;  2AGA A;  4JI5 O;  1QU7 A;  1XRE A;  4WBN A;  4R8C A;  1XNR B;  1X59 A;  2OCC C;  1YIJ V;  3JAR B;  5K1P A;  2KSD A;  2DOS A;  5KHJ A;  1VAR A;  5H9C A;  5LL6 Y;  4FPP A;  5BXZ A;  3SJQ C;  4DV0 B;  4RUF A;  4UUJ C;  4PDL A;  1YJN V;  1XMO B;  4MTO A;  1SKV A;  1XHX A;  1DF5 A;  4DR4 B;  5FPR A;  3DSQ A;  3Q4H A;  1K97 A;  4LFC O;  1CXZ B;  4I0X B;  4X65 O;  4FFB B;  4R6Z A;  2UXB B;  4MVQ A;  1YCI A;  1SC5 B;  2IH3 C;  2WLL B;  5IY5 C;  3W7U A;  4DV7 O;  4B3T O;  4MTF A;  1XIL A;  5EBW C;  1SA0 B;  4J10 A;  5EYP B;  3CRC A;  3A0H Z;  1OV9 A;  3CCS V;  1LUV A;  1SZX A;  3R65 A;  5LA6 A;  4B3S B;  3AK3 A;  2R9A A;  3LDD A;  4UCT A;  1BQZ A;  2QM8 A;  2CTP A;  4QE7 A;  4PA4 A;  1F4M A;  1Y74 A;  4EB6 A;  3AG7 A;  4K8X A;  5J2T A;  3CXC U;  5JVD B;  2PYJ A;  1AR5 A;  3JD3 A;  4DV6 B;  1XNQ B;  5JQG B;  4PA3 A;  4PJ0 Z;  1H2K A;  3OT7 A;  3FD9 A;  2ARH A;  3T1H B;  1W59 A;  4HZ3 A;  4TQD A;  4DR6 B;  5IYZ B;  1VQN V;  4DR4 O;  5DM6 V;  1YF2 A;  3E22 B;  5K1X A;  1VF7 A;  2YSU B;  2H8P C;  4RAI A;  4BW5 A;  3GVM A;  4MT8 A;  2UXB O;  1BS3 A;  1K5Q A;  3ML0 A;  4JAU A;  4LWS B;  5DEC A;  2ZNI A;  4BIZ A;  5IWA O;  4O4J A;  3AG4 B;  5BR8 B;  3JAK B;  3VQV A;  2IU0 A;  5FLX N;  5EC1 C;  3K03 A;  3M99 B;  3JAS A;  2ETN A;  1S77 D;  3W7X A;  2CGO A;  1JOY A;  3HR0 A;  5KA5 A;  4JZG A;  2VWJ A;  4DV4 O;  1VQO V;  3K9A A;  1ZL8 B;  2B1I A;  4FVM A;  5D5Q A;  3JAK A;  2AHY A;  2LGW A;  2HG5 C;  3A0B Z;  3ABL B;  4NTY A;  1N4C A;  3TET A;  1KEC A;  1I08 A;  2WWW A;  4IIJ A;  1HNZ O;  4X64 B;  5CA1 A;  4LF4 O;  4CH5 A;  2P22 C;  3FAV B;  3ASN B;  4J7K A;  3F5W C;  3QTC A;  2DN9 A;  4X1Y A;  1R6N A;  1ZL8 A;  2PYL A;  1ROP A;  1WP7 A;  1HNX B;  1J5E O;  3G67 A;  4JZ2 A;  5KMG A;  1ARO P;  3ZX6 A;  3PJS K;  2W6J G;  2EIJ C;  2ZKO A;  1OCC C;  1RPO A;  3FB8 C;  2YXL A;  1N0J A;  4PI2 A;  4E4E A;  4O2B A;  4DR7 O;  3L70 H;  3RGB A;  2X7R B;  2PY5 A;  4W4K A;  1FJG O;  1F51 A;  1ZX3 A;  4LF8 B;  3K5L A;  3OR6 C;  3U11 A;  3B4S A;  1K5S A;  3L75 H;  3ABK C;  4JI1 B;  4ASU G;  5C93 A;  4JI7 O;  1OCO B;  3SPH A;  2Q4P A;  3U0Z A;  4UB8 Z;  5IT9 N;  2BTQ A;  5B1B B;  1AI5 A;  3RYH B;  4CS3 A;  5H2F Z;  1TGO A;  2R9R B;  3RN4 A;  4HNA B;  4WBN B;  2OT5 A;  3JAT B;  3ZN0 A;  5JWP A;  3FYE B;  5BY1 A;  1FFX B;  2KG7 A;  3TJT A;  4OPA A;  1SQG A;  2VQF O;  4DO2 A;  2A9H A;  2VWK A;  1V55 C;  4FJC C;  5CBH A;  2XND G;  3CME V;  2M7W A;  5KAI Z;  2JVD A;  2GBO A;  3P3P A;  4FLW A;  1V54 B;  4LF6 O;  2DYS C;  2RN9 A;  2F4V B;  3UCS C;  3ASO B;  3CHX A;  1GMG A;  4FFB A;  4NXM O;  3D36 A;  2AW9 A;  4KL1 A;  4YHH B;  4X66 B;  5E1A C;  1IBM B;  2YIA A;  1P84 F;  3L9D A;  2WAM A;  3RVY A;  4UVC A;  1M1K W;  2NLJ C;  4EFB A;  4X89 A;  2WPD G;  2YIC A;  3ZHU A;  5IJ9 A;  4QGP A;  5DED A;  1NH2 D;  3CRR A;  3MAQ A;  1N33 O;  1SET A;  4DV0 O;  2GSM B;  2IBZ H;  2A06 H;  5EBM C;  5TIS Z;  1CPY A;  2NR5 A;  2GUZ A;  1VQ8 V;  3VOU A;  4WF9 V;  2A3Q A;  3N27 A;  2PTM A;  1KQS U;  5LP6 B;  2UXD O;  3SYP A;  1QLE B;  2HHH O;  3ZHV A;  5FL7 G;  2A0L A;  1YZB A;  5GTH Z;  4JI3 B;  4K8Z A;  2IJH A;  2QSA A;  4BR6 A;  4LF9 B;  2E74 B;  2HJF C;  1HWY A;  1HP8 A;  3TCU A;  1GH6 A;  5JQG A;  3L71 H;  3I56 V;  4ZKI A;  1WB8 A;  2E5L O;  3C3T A;  3CPW U;  1Y6X A;  4X1K B;  1NS1 A;  2YI9 A;  4DR3 B;  4LP8 A;  1KBH A;  4JAV A;  3H1J H;  1G1X B;  2XAJ A;  4X8A A;  1N0N A;  1VQK V;  2YIB D;  3IGA C;  1HR0 O;  2FKX A;  1Q90 D;  3ZIA G;  1R3J C;  3AK2 A;  4GYC B;  2N74 A;  4PV1 B;  2BOC C;  3OAA G;  5IY5 B;  1Q82 W;  3K9S A;  4YIO A;  2CTQ A;  1WNS A;  3K06 A;  3ZJZ A;  3U10 A;  1J5E B;  4LFB B;  5B66 Z;  4DUY O;  2RDC A;  1BGY H;  5B3S B;  2DWD C;  4ZOL B;  5GON A;  1OJH A;  2AHZ A;  3C3S A;  2OTL V;  4O4I B;  1LR1 A;  3CEI A;  5CMU A;  3GWO A;  1DTO A;  1ENV A;  4JYA O;  2ZD9 A;  1OCZ B;  1AR4 A;  1ZLZ A;  3P30 A;  1IBK B;  1Y67 A;  3K08 A;  1BCC H;  3CCQ V;  4KUM A;  5LMU B;  4XDL A;  1OCR C;  2ZE6 A;  3MHH C;  4ZOL A;  5A9G A;  4X64 O;  1XI1 A;  1HNW B;  3ETD A;  2JS5 A;  5FNV B;  2IM9 A;  3P32 A;  3GB7 C;  3RW0 A;  3J81 N;  4ZBM A;  3JCU Z;  1LUW A;  3K5N A;  1RSO B;  1SS3 A;  4JTC B;  5IE9 A;  3T4D A;  3HB3 B;  3FB6 C;  2M6Y A;  4YJ3 B;  1HNZ B;  3SJA C;  5ITZ B;  3LSU A;  4CC6 A;  3KG2 A;  1PM9 A;  1AI4 A;  3BVO A;  5LGN A;  3J7A U;  2V1D A;  1VQP V;  1MNG A;  4IHJ A;  4LBE C;  3UQ8 A;  2Q68 A;  1BQ0 A;  4GKJ O;  1SZT A;  4L8J A;  2ZXW B;  3LUT B;  3LNN A;  5E79 Z;  4JI8 O;  1WB7 A;  4UXN A;  4DR6 O;  2ZT9 B;  4DUY B;  2EIK C;  1ZUQ A;  3HKD A;  3IC9 A;  5LMN O;  2XAS A;  3CB2 A;  2JGD A;  2ILM A;  4DUZ B;  1K73 W;  4NR1 A;  1D5A A;  4DK0 A;  2WLL A;  4R7C A;  1Y4M A;  4Q6G A;  3UT5 A;  2BSK A;  4B7E A;  1R73 A;  4O2A A;  2GTS A;  3ABL C;  5JCO A;  3Q4H B;  2YC0 A;  4UVA A;  4DV6 O;  4DV7 B;  3JCZ A;  1P7B A;  5CN0 A;  2DYS B;  1M93 A;  4HNA A;  1XEQ A;  3AG2 C;  4GX0 A;  3UM7 A;  3CRA A;  1SER A;  3G4S V;  4FLT A;  2L35 A;  4OXS A;  3OTO B;  3F7V C;  3ZCC A;  1GN6 A;  3QO8 A;  1BZK A;  2P90 A;  2A79 B;  3B40 A;  2EIJ B;  2FL4 A;  3CSX A;  4JI0 O;  2QR4 A;  1TVK A;  2QGN A;  3WB0 A;  3TXQ A;  4DUZ O;  4KHP O;  1Y74 B;  4LFA B;  1THZ A;  3H1I H;  3QG5 A;  2DMX A;  3KZI Z;  1D2D A;  5LMN B;  1O9H A;  5KUK A;  3OEE G;  5KHH A;  5LP6 A;  1Q81 W;  2JEX A;  3T1Y B;  5H6R A;  4EFE A;  4PDR A;  3SJB C;  4YHH O;  2BCC H;  2UUB O;  3HKE A;  2QWN B;  4JI2 O;  5L3B A;  2H94 A;  4R50 A;  3T1C A;  2DWE C;  4DV3 O;  2CE4 A;  1CEZ A;  3UO2 A;  3X2Q B;  4X65 B;  4U3J B;  4BWA A;  1JX9 A;  2Y4U A;  1KP2 A;  4B3M B;  2VQF B;  2FB5 A;  1SQB H;  2ADP A;  1JA8 A;  1JFF B;  4QIW F;  4JF3 A;  1GM9 A;  2CTR A;  4YY3 B;  4O4J B;  1GM8 A;  4NXN O;  1Q7Y W;  1VQ5 V;  1TUB B;  3ZMV A;  3K59 A;  2Z5U A;  3ABM C;  5LYJ A;  4TSF G;  3CWB H;  1P4R A;  1HNW O;  2UUA O;  3E2E A;  1VQ7 V;  1Z5V A;  3C90 A;  4X20 B;  3JYC A;  1FJG B;  5LMU O;  4DR1 O;  3TXS A;  4U7N A;  3M7M X;  3WFV A;  5L3E A;  1VQ4 V;  3OE7 G;  2V4D A;  4J41 A;  2PUS A;  2Q9L A;  3S3W A;  4DV2 O;  2YID A;  2RCV A;  3D3Q A;  3D3I A;  1EN5 A;  2Z0A A;  1URF A;  1W0J G;  1PNK A;  2BE3 A;  5LP6 C;  2L6L A;  1YSC A;  2QEX V;  3F5T A;  5HFL A;  2CGN A;  2UUA B;  4J42 A;  1US6 A;  4IIJ B;  1GRJ A;  2R70 A;  3VBB A;  5CA1 B;  1HR0 B;  4O4L A;  2IJK A;  2P67 A;  2RMK B;  2AZ0 A;  3BHP A;  4FLU A;  1FKA O;  4LF4 B;  3G71 V;  2XAQ A;  2CH7 B;  1EN4 A;  1RSO A;  1K8A W;  1VF5 B;  3AG1 C;  3OR7 C;  3ZHR A;  4YJ3 A;  4DR1 B;  2Q7H A;  2YUA A;  1KYO F;  3N2K B;  4DV3 B;  1EZV H;  1G6U A;  3LSQ A;  4UVB A;  4DV4 B;  2E75 B;  2EJR A;  1NJI W;  4O4L B;  1DGS A;  2BTQ B;  1QVF U;  1IBL B;  1PL0 A;  4HAM A;  4TOI A;  2CH7 A;  1WA8 B;  3MD0 A;  5IJ0 A;  5ITZ A;  2LO1 A;  3DTU B;  3T1Y O;  2R9I A;  1VEW A;  1KMI Z;  3E35 A;  3A0R A;  3CXH F;  4I9W A;  1QLN A;  1JQ0 A;  2E3C A;  4DXW A;  4KHP B;  3OFN G;  2UXD B;  1Z2G A;  3OMI B;  1OCZ C;  2KQX A;  4WFB V;  5EK0 A;  2DJV A;  3ABM B;  2Q73 A;  1M56 B;  1N33 B;  4PHZ A;  2FYU H;  4I4T B;  5EYP A;  3CRQ A;  2X0L A;  2BSK B;  1S5J A;  3CD6 V;  2PGG A;  3HKD B;  2Y48 A;  4LF6 B;  3R66 A;  5LA6 B;  2UUC O;  4MVS A;  2XHB A;  1HW7 A;  2OWO A;  1WAZ A;  2QM4 A;  4G27 B;  3BA8 A;  1IXB A;  1G4Y B;  4LFA O;  3H01 A;  5LGT A;  2ZIN A;  1AB3 A;  5EIB C;  3QO5 A;  3KKY A;  2DYR C;  2Q8V A;  3BAB A;  4LH7 A;  3WG7 B;  3CMA V;  1YI2 V;  1AI6 A;  2XT9 A;  5EZY A;  4PA6 A;  4JI1 O;  1AP6 A;  2UXC O;  4NYK A;  2OYQ A;  4I9Q A;  2HVK C;  3SYC A;  1NI8 A;  5IYZ A;  2Q5Z A;  3AG1 B;  3ZHT A;  3LSS A;  4AQY O;  1JJ2 U;  2Q69 A;  1WLE A;  3E8F A;  4F4L A;  1FPO A;  5H5N A;  4H0L B;  3JD2 A;  3H1L H;  1TUE B;  5KX5 B;  4LF7 O;  3K0G A;  3SGI A;  1QBZ A;  2DQ0 A;  3A2F A;  4LF8 O;  4JAS A;  2ZE7 A;  5LXT A;  5CA0 A;  4UV8 A;  1VP7 A;  3RYF B;  4FFK A;  3QNE A;  4FLY A;  2W0X A;  3ZMZ A;  3ETQ A;  4DRX B;  4H37 A;  1VQ6 V;  1N32 B;  1RM1 C;  2KKW A;  2CK3 G;  1EBO A;  2CUG A;  4JI6 B;  2YI8 A;  2WLJ A;  3RYC B;  3P3N A;  5GW7 A;  4Z1M G;  3SPC A;  3WU2 Z;  1MAB G;  4JI5 B;  1IXM A;  4EKW A;  1Q8I A;  1VQM V;  4DR5 O;  4MVR A;  1AVM A;  4XDK A;  4YJ2 B;  1GK9 A;  4BIO A;  1JFF A;  4GKJ B;  5LOV A;  1KKD A;  3CCM V;  1H2G A;  2RQ6 A;  2MW2 B;  1I5Y A;  3I5D A;  3APQ A;  2Z3Y A;  3TGU H;  3RYI B;  3THO A;  1GN3 A;  1AI7 A;  5J9P C;  5L3F A;  4CH3 A;  1S5H C;  4EEQ A;  1KUQ A;  5GTI Z;  3M8A A;  1Q43 A;  1F4N A;  5IWA B;  3I55 V;  1MA1 A;  3RWR D;  1Q3E A;  1M57 B;  5LOV B;  2ITC C;  4JAA A;  1QHT A;  1GKF A;  3HPL C;  3CYO A;  1GN4 A;  4O2B B;  4IHJ B;  2WLI B;  3AG3 C;  3ZRV A;  3DGE A;  3UO3 A;  1NVP D;  1M90 W;  3T2M A;  3ICX A;  3B8M A;  5KUM A;  1I94 B;  3CS5 A;  3HKB A;  4KFM A;  2Q7G A;  2DQ3 A;  3OD4 A;  4DW0 A;  5CBG A;  1DF4 A;  2ZM6 O;  4FZ1 A;  2LQT A;  1MZF A;  1XNQ O;  4Z1V A;  3CCL V;  4FLX A;  4FMT A;  1M9N A;  4I5S A;  3JD4 A;  1HDJ A;  4DV1 B;  1TA8 A;  2P5O A;  3STL C;  2CDY A;  4LNU A;  1M5I A;  4GCZ A;  3T4Z A;  2X6B A;  3BRC A;  2N04 A;  3OMN B;  4B3R O;  2LJ2 A;  1U97 A;  3B09 A;  4H44 B;  3E8G A;  1QCE A;  4ICG A;  1YHQ V;  5IDJ A;  1VF6 A;  4MVU A;  5KHK A;  5C8Y B;  1O9G A;  2NN4 A;  1WA8 A;  4B3T B;  1B06 A;  5BZB A;  4OX9 B;  2QTS A;  2Y69 C;  4JGS A;  3NR7 A;  3WB1 A;  1W2B U;  3ZRS A;  1RP3 B;  5JVD A;  1FXK B;  4NTX A;  1S76 D;  2F43 G;  2EIL C;  1MMM A;  2GTA A;  4OGQ B;  3BAA A;  1VQL V;  2WSS G;  4GX5 A;  4RQE A;  2RJZ A;  4IL6 Z;  4BAY A;  4Q20 A;  1NTM H;  2PZS A;  4FZ0 A;  4I0X A;  3NXS A;  4MTG A;  2DW4 A;  3FKS G;  4QPK A;  1LNQ A;  1FS0 G;  3CX5 F;  2Y69 B;  1DK1 A;  1I0H A;  1SQF A;  1V9P A;  2UUC B;  1JCH A;  4K35 A;  1IBM O;  1Q6U A;  1M57 C;  2AZ2 A;  1FXK A;  5JJJ B;  4AIL C;  4ABM A;  1SRY A;  4CH6 A;  1K34 A;  1OCC B;  5KHI A;  4FLZ A;  1L0N H;  4ZI7 A;  1UPG A;  4MVO A;  4HBN A;  3OUS A;  5BMV A;  2ADQ B;  3OEH G;  4PD4 F;  1XUQ A;  4B3R B;  2F1M A;  3ZRW B;  1EN6 A;  3E89 A;  2JEU A;  3CCJ V;  3B2E E;  4L87 A;  4FM2 A;  5JH7 B;  2F4V O;  3KCX A;  4LF5 O;  1OCO C;  1B6Q A;  4O4H A;  4BW9 A;  3G6B A;  1YJW V;  3SYQ A;  1YVW A;  2HEP A;  3CJH A;  3FB5 C;  5LHI A;  1MZE A;  4J9Z B;  2FML A;  2IJJ A;  1IBL O;  4BIU A;  3F7Y C;  2EIM C;  2GHY A;  4U3J A;  3CRM A;  5D5P A;  1TUB A; 
#chains in the Genus database with same CATH homology
 3O65 A;  5FLX N;  5BY1 A;  4OPA A;  4B3R O;  2VQF O;  4NXN O;  4LFC O;  1HNX O;  4DUY O;  3T1H O;  4DV1 O;  2DJV A;  4X65 O;  4DR5 O;  4LF6 O;  1HNW O;  4JI3 O;  2UUA O;  4DV5 O;  4DV6 O;  4DV4 O;  4DV7 O;  4NXM O;  1F7Y A;  4B3S O;  4B3T O;  4X62 O;  4JYA O;  1N36 O;  3R66 A;  5LMU O;  3J80 N;  4DR1 O;  1XEQ A;  2UUC O;  4LF9 O;  1R1B A;  1R6T A;  4DV2 O;  2Z0A A;  1AIL A;  1HNZ O;  4JI6 O;  4JV5 O;  4LF4 O;  3F5T A;  4X64 O;  4LFA O;  3OTO O;  1N33 O;  1KUQ A;  4DV0 O;  3M8A A;  1AB3 A;  4K0K O;  3JAM N;  1DK1 A;  3J81 N;  1IBK O;  4JI0 O;  4JI4 O;  3SDL A;  1XNR O;  1J5E O;  1IBM O;  2JRI A;  2UXD O;  4DUZ O;  2UU9 O;  4KHP O;  1FKA O;  2HHH O;  4JI1 O;  2UXC O;  1D2D A;  4GKK O;  1XMO O;  2VQE O;  1YZB A;  5BR8 O;  1N34 O;  2ZKO A;  3J7A U;  3RT3 C;  4DR7 O;  4LFB O;  4AQY O;  2LW7 A;  4X66 O;  4YHH O;  1XMQ O;  4GKJ O;  1FJG O;  1I94 O;  2N74 A;  2E5L O;  4DR2 O;  2UUB O;  4OX9 O;  4DR4 O;  5H5N A;  1NS1 A;  4YY3 O;  4OPH A;  2ZM6 O;  4JI2 O;  2F4V O;  1XNQ O;  4LF5 O;  4JI8 O;  4JI7 O;  4LF7 O;  4DV3 O;  2AGA A;  4JI5 O;  4A5U B;  2UXB O;  4LF8 O;  4B3M O;  1A32 A;  5A2Q N;  1G1X B;  4DR6 O;  1X59 A;  5IT9 N;  1HR0 O;  1FYJ A;  3T1Y O;  1IBL O;  2DOS A;  2FKX A;  5IWA O;  5LL6 Y;  5BXZ A;  4DR3 O;  5LMN O;  1N32 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...