4X62O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x62O00
4LF4O 4DR5O 1DK1A 1IBLO 1FYJA 4LFAO 1KUQA 4B3MO 4GKKO 3R66A 2DOSA 4LFCO 5IT9N 1HR0O 2UUCO 1XEQA 1AB3A 5BY1A 2LW7A 4B3TO 4DR6O 2N74A 4JI3O 4OX9O 1XNRO 3O65A 1YZBA 4DR1O 3SDLA 4YHHO 4AQYO 4YY3O 4JI7O 1J5EO 1N34O 4X65O 1N32O 3J81N 4NXNO 4DV3O 3JAMN 4X66O 1FKAO 2E5LO 2F4VO 5BR8O 4DR2O 1N33O 4LF9O 2UXCO 2FKXA 4LF7O 3T1YO 4X62O 4LF8O 4LF6O 4DUZO 2DJVA 4JI5O 1FJGO 5IWAO 2HHHO 5H5NA 4LF5O 4DR3O 1HNXO 2ZM6O 2UUAO 4JI4O 4JYAO 2Z0AA 4X64O 1I94O 1HNWO 4DV5O 4JV5O 1N36O 2JRIA 4NXMO 3M8AA 5LMUO 4JI2O 1XMQO 4B3RO 1A32A 4DV0O 2VQEO 4K0KO 3T1HO 4DR4O 1IBMO 4DV1O 2UXBO 2AGAA 1XMOO 2UXDO 1D2DA 4DV4O 1XNQO 4DUYO 4DV6O 4B3SO 4JI8O 3J80N 1IBKO 1R6TA 5BXZA 4JI6O 3F5TA 1X59A 4JI0O 5FLXN 2UU9O 2UUBO 2VQFO 4OPHA 5LL6Y 5LMNO 4JI1O 4DR7O 3OTOO 1R1BA 4A5UB 2ZKOA 4GKJO 1NS1A 4OPAA 5A2QN 4DV2O 1AILA 1HNZO 1F7YA 3J7AU 4KHPO 1G1XB 4DV7O 3RT3C 4LFBO
chains in the Genus database with same CATH superfamily
1SERA 1COWG 1JR9A 2O57A 4RUEA 4GUNA 3VQXA 4F6RA 1H2NA 1WA8B 2V7QG 3LNMB 1IBKB 1GH6A 3KCXA 1MNGA 4BIOA 5L3FA 1H8HG 2ZIMA 1TUBB 4NB5A 4O4LB 4QE9A 4OX9O 2OT5A 2XTAA 2Q7HA 4JAUA 4YY3O 3H1HH 5FPOA 1LUVA 1WNSA 3OUFA 2EULA 5J2UB 3K79A 3CC2V 3LDDA 1BMFG 4O2AB 4TUYB 1VQMV 4UFZA 2NNUA 2E5LO 3NXSA 1VQPV 1VF6A 1K34A 4X88A 4X1IB 2BOBC 4MVMA 1OCCC 2XAFA 2ZDIA 3E2EA 2DN9A 1AVMA 3RYHB 5E1AC 1MOFA 2JDIG 4Z1MG 2XAGA 3G6BA 1RPRA 5H5NA 5DM6V 5B3SC 2X6BA 3OR7C 1J5EB 2ZM6O 2ZQMA 1OCZB 2EZPA 2JEXA 1W2BU 4DV5O 1M57C 3MHSC 3ABUA 4YJ2B 2W6JG 5CA0B 1BSMA 1WP8A 4WF9V 3CXCU 1Q81W 1ZL8B 1MZFA 1QLEC 3ZHUA 2VQEO 2UUCB 4AILC 4PV1B 2ILMA 4X62B 4BIZA 4TV8A 4BW5A 1K97A 1M1KW 2HFEC 1X59A 2DWDC 1W0KG 2F66C 3TK1A 3OMNB 3L74H 3RYIB 2ODMA 2Y4UA 1ZUQA 1GN4A 4RWUA 4CH4A 2QKSA 4JI2B 1KQSU 3CHXA 1XHXA 4XDLA 3WU2Z 1P49A 2BTQB 1R3JC 2W0XA 1B06A 3B40A 2UUBB 1PNLA 2GV9A 2M6YA 4PD4F 3K5LA 1KP3A 1KECA 4JI1B 3H1JH 1QVGU 5EBMC 5L3CA 2AHZA 2FL4A 3ETQA 2ZD9A 5EBLC 3T1HB 1FKAO 2WLLB 4WBNA 4DV7B 2HP8A 2WAMA 1VMGA 1AR1B 4G2KA 2WLIB 4IT5A 3IAYA 5LYJB 1OCZC 4J41A 3AK2A 1R3LC 1FJGO 3UO3A 3A0BZ 1GN2A 4UUJC 1NZ6A 3L72H 2ADPA 4OGQB 2EIKB 3BA9A 3UCSC 3AG7A 3F5WC 3K0DA 4XDKA 4ZOLA 4WFHA 1BZKA 5JVDA 1A32A 1URFA 3ABMC 2DYRB 3HPLC 2DQ3A 3TGUH 4DK0A 3K06A 5C93A 1GKFA 3CWBH 2Q67A 3N2GA 2V1DA 1AR4A 2MK3A 5LGNA 4I4TA 4I55A 3K5NA 1IXMA 2OIGA 1NH2D 3CRAA 1PL0A 3THOA 1R1BA 1PV0A 3SJBC 4JYAB 3RW0A 1I94B 5FL7G 3PJSK 4R8CA 1K8AW 2A7WA 4WFAV 3ZMVA 4HNAA 2WLJA 4NKGB 2XUMA 3S3XA 4D7SA 3KG2A 1Y6XA 2ARHA 1Q6UA 5KMGB 2HHHB 4IIJB 4JI6B 1XEQA 1IZ3A 2NN4A 2QGNA 4FLVA 1YF2A 4DR7B 1MSWD 3SDLA 3KZIZ 2K1EA 4ZHQB 4LH6A 1SS3A 1K7DA 3ZMUA 4CBCA 4DV3O 4ICGA 3SYOA 2KSDA 4TV9A 3K5MA 5J2TA 4BW9A 2Q69A 4TOIA 4GKKB 3CCEV 3RYFB 2EIKC 3APOA 2RN9A 3SYCA 2CAZC 4J10A 4KUMA 5K1XA 3ZRWA 4X20B 3JAKA 2XASA 1E1QG 4UCVA 4IHJB 2K9PA 4ZIBA 4DR3O 3G6EV 4X65B 4NXNB 2FYUH 4FZ0A 2JGUA 4DRXA 1EFRG 4GT1A 3E22A 4YJ3A 4LNUB 1GAXA 3JCZA 2QDOA 1QR8A 4FLUA 4DV1O 2UXCB 2UXBO 4LF7B 2YXYA 3JASA 2EILB 3ZRSA 4O4IB 2YXLA 2P7TC 4CS3A 1AJQA 1HW7A 1KB9F 4DUZB 2Y0PA 1TAEA 2UU9O 4H33A 5EIBC 4JGSA 2ZKOA 3H1LH 4AI8A 1RSOB 1K4CC 1HNZO 2P4KA 1NTKH 2Q0OC 2W6IG 3BAAA 2UXXA 5B66Z 1HDJA 4K0KB 3GB7C 3P3NA 5LA6A 1MZEA 4UB6Z 2EZOA 1FXVA 4HBNA 1AP6A 4B3SB 5CN0A 1Q43A 3UKMA 5K1PA 1FPOA 5IDJA 1VF5B 2DW4A 1MG1A 4QE7A 2LQTA 3DXRA 3ZHTA 5GTIZ 3CB2A 3FYIB 4LP8A 4O2BB 1Q6HA 4W4LA 4JASA 4DR2O 4KFMA 3AK1A 3SJQC 3LDEA 4BR6A 2MW2B 1BQ0A 4OXSA 3SR2C 3DTUB 1KD1W 3QG5A 3G4SV 1NU1H 3OE7G 1W0JG 1Y66A 4JI5O 3K9SA 4RO2A 3RYCB 1SRYA 3EXAA 3U10A 4NTYA 1Z5VA 4JI7B 4X1YA 1FAFA 4FPPA 3AK3A 5KA6A 2EILC 3B8NA 4NTWA 4CS4A 1Y67A 4I0XA 2F4VB 4O4HA 5IJ9A 1K3EA 1WAZA 4Q20A 1Q6IA 3OEHG 4MVOA 4DV4O 5EYPA 5IJ0A 2IW5A 3HB3B 1M9NA 3CSXA 1VQLV 5BXZA 1VQ6V 2AZ0A 1OHHG 5B1AB 3OMIB 2YIBD 1XL6A 5KA5A 5LP6A 3HKEA 1U96A 4X66B 1BS3A 4JI4B 3BY6A 4GCZA 3OGIB 1WN7A 1AILA 1YVWA 3RGBA 1H2LA 5LOVA 3CJHB 3OM3B 1JOYA 2ITCC 4LFBO 5JQGB 2YEVB 3BFRA 4J9YB 4JAAA 4DR5O 1IBLO 2FMLA 4ZI7A 4CS2A 4LWSA 1QNMA 2XT9A 1F51A 1JFFA 3AG3B 1EN6A 4JI0B 3B8MA 1OJHA 2GTAA 4JI3O 3UT5B 3GVMA 5CB4A 1YTFB 4IL6Z 1ORQC 4I5SA 2M7WA 2DQ0A 3ABLB 1N32O 2ADQB 4IYIA 1BL8A 1NJIW 1UJWB 4WFEA 2IJHA 4LF9O 3JCUZ 1H2MA 1WB8A 1HR0B 1SZXA 2JEUA 2Q7GA 4J7KA 1UPGA 2OTLV 4J11A 1EM1A 2Y0IA 3HR0A 3JARA 3TXSA 2HR3A 4KP4A 2AW9A 1KP2A 1NBMG 1P7GA 3I55V 5KX5B 3JD2A 4I50B 5KHHA 4LH7A 2RMKB 4FVMA 2P6JA 3PN1A 1VQ5V 2KG7A 1MABG 2JGDB 5B1AC 2IU3A 1WPXA 2D2CB 3FB7C 2XAJA 1JMKC 4DR4O 1AI4A 3HKDA 4Z1VA 2IM9A 4ZBMA 4DV6O 1OCCB 4EKWA 1AI5A 1BQZA 5LBQA 2V4DA 4CC6A 2CTWA 2AXTZ 1DTOA 4JTCB 2QE7G 4X9QA 1JCHA 2C2AA 4UB8Z 5DECA 4LF5B 5B1NA 3P30A 4UVAA 5B3SB 4H13B 1YJNV 1F7YA 1XBLA 5IYZA 5JWPA 3CP1A 4E4EA 1VQ9V 3LNNA 3AG3C 4B3RB 3M7MX 1E1RG 2HJFC 2RJZA 3JALB 3CS5A 2DOSA 4U7NA 2UUCO 5EK0A 3ABLC 2LW7A 3ZRXA 4WFFA 1PP9H 2WWWA 5GTHZ 3K03A 1S5JA 1Q90D 4CH6A 1VQ8V 3OUSA 1NI8A 2YIAA 5IYBO 4DV2B 3S3WA 1ROPA 1Y76B 1TVKA 1L8DA 1YITV 1S0VA 1IX9A 4LFAB 3E8HA 3E89A 2OIEA 3LSUA 3RBZA 3U0ZA 4MVZA 4LR3A 2VS0A 3KKYA 5IYCO 1VQ4V 4B3TB 1SA0B 5LXTA 2YIBA 2CTQA 4TV8B 3U11A 4YHHB 1IXBA 1T5EA 3ASOC 4MT8A 2Z0AA 3RVYA 1HNWO 3ABKB 1N36O 5L3GA 4DV0O 3FB8C 3T1HO 2JK5C 2QKAA 1XUQA 1XI1A 2AGAA 1QBZA 3JSNA 3LSSA 1Y74A 1XL4A 2QWOB 3RFRA 3F5TA 1CXZB 5H6QA 4JYYA 3ZCCA 5FNVA 3VQVA 2Y69B 4JTDB 3JD1A 5BMVA 5JJEB 3UQ8A 2X6CA 4YXWG 4PDLA 2IJIA 1VQOV 3A8TA 2IH1C 2Q68A 4OPAA 3SPHA 2YIDA 4H37A 4O4JA 4FLXA 4KHPO 2G38A 4DW0A 1XMQB 1VF6C 1Q86W 5LHGA 1TA8A 2ZDIC 1XMOB 1H8EG 1BCCH 3ABMB 3CCMV 4WBNB 5GONA 4QIWF 4JI8B 3TCUA 2OCCB 4QGPA 1DF5A 3EFFK 4J80A 4UV9A 4PA6A 2PUSA 5J2UA 4AQYO 3CCQV 1YEWA 3JD4A 1AJPA 1EZJA 1UFIA 3CMAV 1PNKA 2B5UA 2ZNJA 3C3SA 3APQA 4GYCB 1WP7A 5B1BB 1JJOA 4X1IA 4BIUA 3SPJA 5KUKA 3K5OA 4ZOLB 4N21A 4U3JA 5CMUA 4JAVA 5JVDB 4K8ZA 3CRRA 4TSFG 5C8YA 1K73W 3ABKC 3T1CA 1N8RW 3A0HZ 3MD0A 2WLHA 2EX3A 4OX9B 1VQNV 5IWAO 2HHHO 4YY3B 3N2GB 2JJ2G 3CRMA 2UUAO 2FB5A 3BVOA 4I4TB 4I55B 4JV5O 3ETGA 1ZL8A 4NTXA 1SQBH 3F7VC 2E5LB 4K35A 4FMTA 3ICXA 4GX5A 4QPKA 2CGOA 2QTSA 2P22C 2A3QA 2Y69C 1V54C 1D2DA 3Q4HB 4PELA 4MTOA 3OAAG 1CPYA 3JAWA 1QHTA 1VIBA 2EBOA 1DGSA 1VQ7V 2ZM6B 2LFRA 4QJFB 2BSKA 4R6ZA 4DV5B 2WLMA 5CA3A 1Z5WA 1EN5A 4RQEA 2Q4PA 2OCCC 3G71V 2N04A 5EC2C 2VQEB 1NVPB 2JS5A 4LFCO 4B08A 5HFMA 4TV9B 5J2TB 3AG4C 2Q7EA 4DR6O 5B1BC 2BE3A 1RM1C 2R72A 1SQFA 3J81N 3ZRWB 3WB2A 3JAKB 1LNQA 2ZCEA 1VP7A 5BR8O 3OFNG 1MA1A 5L3EA 2XNDG 4DRXB 3E22B 4YJ3B 1SQVH 1KU9A 2CDYA 3CCRV 2B1IA 1VEWA 4XBFA 1K92A 3JASB 3BPZA 5KHIA 1YIJV 3SPCA 4X64O 2AZ2A 4NVPA 1MMMA 4FLTA 3CMEV 4NXMO 5LMUO 2A0LA 1IBMO 5H6RA 1K33A 3D36A 1R6TA 4TWKA 2A9HA 3H1KH 3JATA 1FJGB 1QLNA 1ZWIC 2VQFO 4OPHA 2BTOA 5LA6B 5LMNO 5KHKA 3OTOO 4GKJO 4PDRA 3DGEA 3CC4V 3P32A 3T2MA 5ITZB 1FXKA 4FLZA 1YXBA 3DXRB 1TUEB 2F95B 2EIJB 2X7RB 3IC9A 1JJ2U 2E74B 1Y4MA 3STZC 5LHHA 2HG5C 4KL1A 2QEXV 3D36C 2QTOA 3OGCC 3W7UA 1YI2V 1XNRO 1GM7A 2IU0A 5DEDA 1GTOA 3L75H 1K9MW 4BWAA 3T4ZA 4X66O 1NH2B 1P84F 4X1YB 3RYFA 3FAVB 4UCTA 4HZ3A 2W0FC 3QO7A 2E76B 3FB6C 4I0XB 3RVZA 4LF8O 2Z3YA 5CA1B 1FFXB 5IJ9B 2Q73A 4X20A 1YDXA 4E2LA 2P5OA 4IHJA 4ZKIA 1FD9A 5EYPB 5IJ0B 5JH7A 4QPJA 1HNXO 3G67A 3CCLV 3L9DA 4DV3B 2PY5A 2EJRA 2R70A 5LP6B 2XAHA 1X4TA 5JCOA 1Q5OA 4J7ZA 1R6KA 2QR4A 4FM1A 2UXDO 1M93A 1XNQO 5LOVB 4HYOA 5IY5B 2RDCA 3OMAB 2CE4A 3N27A 5FLXN 4X1KA 2WA3A 4PJ0Z 5JJNB 2R9RB 4LWSB 2L35A 1K5SA 5CBGA 2QA4V 4DR3B 1JFFB 2EIJC 4ASUG 1S72V 2DWEC 4K3AA 4LF4O 5JJJB 4DV1B 2UXBB 4B3MO 2CGNA 1HP8A 2LGWA 3TETA 2Q0AA 2ZXWB 2IBZH 4RAIA 4TQFA 1SQPH 2UU9B 2N74A 1SKVA 1S76D 1NT2B 1K5QA 4DR1O 1I0HA 4QNHB 1VARA 5EZYA 4B7EA 4DW1A 4BAYA 1N34O 4MVSA 1HNZB 1I5XA 3JARB 4FJCC 2ZINA 3IC7A 1WJZA 1E79G 1ZX3A 1SETA 3E8BA 1N33O 3W7SA 1JX9A 3K57A 3T1YO 4DYLA 5HFLA 2LP7A 3ZIAG 4LF6O 3WG7B 3K9AA 4P30A 5LP6C 4WCEV 1G8MA 4GX1A 3AEIA 2ZT9B 4J42A 4PDMA 3AG1B 4W4KA 1DF4A 2YUAA 3FYEB 4RUFA 1OZ0A 5IY5C 3ZN0A 2QM8A 4DR2B 3OR6C 1AI6A 4I9WA 3DSQA 1B04A 1I5YA 4FZ1A 5IYZB 3IJ4A 3OW2U 1XREA 3J80N 4J9ZB 1IBKO 1M4UA 3RN4A 4I7ZB 5B1OA 4JI5B 2QWNB 2F93B 4LCUC 3SJCC 2PTMA 3ASOB 4IGGA 3CCUV 4EB6A 2ZXWC 3DC5A 5KAIZ 3ZHVA 1JVMA 1FYJA 5EC1C 4DV4B 1TVKB 2YICA 5IT9N 2NR5A 4B7KA 4F6RB 2Q8VA 1PL4A 1AB3A 1D5NA 3TJTA 4JZ2A 3VOUA 2ZR3A 1GN6A 3LUTB 3EHBB 3O65A 3HKCA 5GW7A 2H94A 1I7FA 3GWKC 1J5EO 1JPXA 3ZN1A 1US6A 4PDVA 1PD3A 4F6EA 4LFBB 2RNBA 3E8GA 1O9GA 3QF7A 4DUYB 3C3TA 4DR5B 3WG7C 1IBLB 4KXRA 2HEPA 2FKXA 1M56C 1VF7A 4X62O 2CUGA 1NTMH 2YC0A 1SQXH 1H38A 2DYSB 3AG1C 4U7OA 4JF3A 2Q6AA 2X0LA 1PM9A 4JI3B 1HWYA 1SZTA 4MVUA 1NKDA 3X2QB 4PI2A 4EFEA 5IE9A 5KX5A 3B77A 5FNVB 1N32B 4JYBA 3MHHC 1KKDA 4JI2O 1TGOA 4WFBV 3LDCA 4PA4A 4LF9B 3E86A 2RQ6A 2JIZG 3N2KA 4O4JB 2JVDA 2EJ7A 2LO1A 4UCUA 4FFBA 4FK5C 2UUBO 2Y4TA 2CH7A 2WLKA 4JI1O 5LGTA 2WSSG 5GONB 3HKBA 1BGYH 2YI9A 1FS0G 4NR1A 3WFVA 2BOCC 4P9OA 4DV7O 4MW8A 3RT3C 1V9PA 3JALA 4DR4B 1XILA 1KBHA 5FPRA 1AROP 5AG2A 5A9GA 3FKSG 2GUZA 3R66A 4MVRA 3D3QA 2GSMB 3LSQA 4DV6B 2VWJA 4CZZA 2PYJA 1V54B 1U97A 5BZBA 1K4DC 1GO3F 1YHQV 4U3JB 4MVQA 1W59A 2CK3G 3IFXA 5KHJA 2GBOA 2CTPA 5TISZ 3ZHRA 5H9CA 2XAQA 1Y76A 5C8YB 3FFQA 3KCYA 3SYPA 4C7UA 1LUWA 2OCHA 1EBOA 1WA8A 2N05A 2VRZA 1NVPD 3OD4A 1XQ8A 4UXNA 2DYSC 1QVFU 5LGUA 3IGAC 3BA8A 4Q6GA 2IJJA 5EBWC 4CH3A 1TUBA 4O4LA 1OCOB 4LBEC 4NYKA 3X2QC 4FLYA 4TT3G 1SA0A 3ZX6A 3BHPA 3SYQA 2P4VA 2ZIOA 4O2AA 4TUYA 3ETDA 3SPIA 2PI5A 3AG4B 4X8AA 2EIMB 5EIBD 2L6LA 3VBBA 4JYAO 1RM1B 1I94O 3JAWB 2ZE6A 1JQ0A 1S77D 2GHYA 4GLXA 3RYHA 3BABA 2YDEA 1GRJA 3JYCA 3VQWA 5B5EZ 4RQFA 2OTJV 3H01A 2BSKB 3CCJV 3H1IH 1O9HA 5F2VO 2LFSA 3T4DA 4JI6O 1GM8A 1L1FA 3RWRD 3VQYA 3JD0A 1KYOF 4YJ2A 5CA0A 4CH5A 4DR7O 1GK9A 4MTFA 3ABTA 2F43G 2X6AA 2ZE5A 1HNWB 1SF9A 5J9PC 3CEIA 1N36B 3ZRVA 1ZSPA 2Q9LA 2YXHA 3C90A 5E79Z 4DV0B 2PYLA 1OV9A 3GWOA 5L3DA 4UCSA 4HNAB 2F23A 4GKKO 3RYIA 2KQXA 1FXHA 1YJWV 3CX5F 2QKCA 3ZMTA 4UCOA 3ZMSA 3K3WA 3OTFA 2WA4A 1RP3B 4MTGA 3D3IA 1SC5B 1AJNA 2HVJC 1OCOC 4X65O 2BTQA 3SYAA 4NXNO 4KHPB 2ZE8A 3JD3A 2R9IA 3ML0A 5D5PA 1L0NH 1S5HC 1EN4A 1KKCA 2UXCO 2QWPB 4LF7O 2EIMC 3CYOA 2LJ2A 4JTAB 1PNMA 4DUZO 1R6NA 2WLLA 1GN3A 2YI8A 2ZE7A 2ZR2A 4TQDA 4AQYB 2CTRA 3B4SA 2WPDG 2PGGA 4UCRA 1BHBA 3JATB 1SQGA 3K08A 2WLIA 5LYJA 1S5LZ 4YIPA 2B1GA 3Q4HA 4K0KO 4PA9A 3CCSV 3ASNB 3SPGA 4DK1A 3QO5A 4B3SO 1FXKB 2QM7A 1N0JA 2A06H 5IWAB 5LL6Y 2AHYA 3QTCA 4UVBA 3ZHQA 2IH3C 2IJKA 4MTXA 1XHZA 2UUAB 1H2KA 2BCCH 3R65A 5A2QN 4GZRB 4JV5B 4JPRA 3J7AU 2FTKA 4K8XA 3W7XA 3STLC 2ZNIA 3CC7V 2HJDA 1SQQH 1YSCA 2EINB 2LGQA 1VQKV 5D5QA 2PZSA 4H0LB 1G4YB 1MSDA 3ZMZA 2RCVA 2ATKC 3D8CA 3P3PA 2VWKA 4JI7O 3FX7A 4FM0A 1OCRB 1Q8IA 2DYRC 4EEQA 5KMGA 5JH7B 2F4VO 4IIJA 1Q82W 3O9OA 1S3JA 1AR5A 1PKXA 5IYDO 4G28B 1GMGA 4LFCB 1THZA 4ZHQA 1H2GA 3CXHF 2PF4E 2YS8A 2DJVA 4DR6B 4LC1A 1N4CA 2B9ZA 3OT7A 1F4MA 2HKOA 3BCCH 1IURA 1FFTB 4JI4O 4Z2WA 4X1KB 2D3OW 3ASNC 2JRIA 3M8AA 4G27B 1FXKC 1JA8A 5BR8B 4WFGA 3MDSA 1IVSA 1D5AA 1RFYA 4O4HB 3DC6A 2KKWA 1YTFD 4L8JA 4P2ZA 3W7TA 5H2FZ 1DLBA 1XDCA 4JI0O 2KB1A 4HAMA 5DN6G 1L0LH 4LNUA 3ZJZA 4U3FH 2GDSA 4N23A 4A5UB 4X64B 3HKEB 1F23A 5ITZA 1QU7A 2EINC 4NXMB 1R73A 5LMUB 3BEHA 3FB5C 4MSWC 3WB0A 4O4IA 2OWOA 5EZYB 1IBMB 2ETNA 4UV8A 2E75B 2WLNA 1CEZA 4IYHA 3K58A 4FM2A 3SGIA 5KAFZ 4ZI7B 1YJ9V 1HR0O 3UO2A 1B6QA 1ZTEA 1OCRC 2XHBA 1RSOA 3L73H 3CD6V 4DO2A 2VQFB 4MS2A 1WLEA 5LMNB 3OTOB 5LHIA 2Q5ZA 4GKJB 2LW1A 3W7WA 4R50A 5CB4B 4FLWA 3L71H 3CE2A 3NR7A 4PI0A 3FAVA 1QQCA 5JCOC 1ZLZA 3A0RA 4ABMA 5CBHA 1AP5A 4JYCA 3ETEA 4I9QA 3M99B 2NLJC 3K0GA 2A79B 1SESA 2JJ1G 5CA1A 1FFXA 3JSLA 2JS3A 1G6UA 1EZVH 5KUMA 3E83A 4O2BA 3CPWU 1XNRB 1P4RA 3WB1A 5L3BA 4LF5O 1F4NA 1R3KC 3OEEG 4UVCA 3I5DA 3B2EE 3H9VA 1I08A 3ZBHA 1Q7YW 1PPJH 2YSUB 4B3RO 3CCVV 2KG7B 1NR7A 3ZEDA 1NQTA 3RYCA 5KLVH 4FIPC 4GX2A 3UM7A 4DUYO 4F4LA 3E8FA 4LF8B 4EB6B 3HKDB 1B3QA 1M56B 2R9AA 2DE0X 3TXQA 1CP9A 3A2FA 4PA7A 5CBFA 1WB7A 1XOUA 1HNXB 3BRCA 2QJ1A 4EFBA 4PA3A 1NS1A 2OYQA 2QWRB 4MW3A 4DV2O 3QNEA 2P06A 2F1MA 4YIOA 3F7YC 4GX0A 4CC5A 3HKCB 3AG2B 4XDJA 1Q3EA 1QCEA 1DK1A 1M5IA 2P90A 4LFAO 1KUQA 2UXDB 1LR1A 3CRQA 1XNQB 1ZAUA 1V55B 1J95A 2UXNA 5BY1A 4B3TO 4PHZA 4P9PA 2HLDG 1KC8W 1BHAA 3CJHA 1YZBA 3MAQA 1N0NA 3L70H 5JQGA 2YEVA 4YHHO 5KHGA 1RPOA 1IDSA 3JAMN 2QM4A 4LF4B 3K59A 2Z5UA 3I56V 1QR9A 4B3MB 3UT5A 3E35A 3B09A 2P67A 2HVKC 1ENVA 4H44B 3EVKA 1WPBA 1P7BA 3G80A 3SJAC 2ITDC 1KMIZ 2QSAA 4L87A 1BE3H 3N2KB 3ZS8C 1H2SB 2XOKG 4DR1B 1AI7A 2QWQB 5LXTB 4D7TA 1N34B 4FFBB 2CH7B 1YCIA 1Z2GA 3K04A 1XMQO 3QVNA 3HKBB 1R3IC 1M90W 1N33B 2DMXA 4X89A 2H8PC 3QO8A 3T1YB 1XMOO 1M57B 4J7JA 4AHCA 4JI8O 1NR1A 4R7CA 4LF6B 4I50A 1Y74B 1QLEB 2GTSA 1GM9A 2GUZB 2H3OA 4FFKA 2PI4A 3CRCA 3AG2C 2JGDA 3FD9A 4D6TH 2Y48A 5BMVB 2E3CA 3ZHSA 4DXWA 4JZGA 1BT8A 1V55C 1G1XB 1NTZH
chains in the Genus database with same CATH topology
4LF4O 4DR5O 1DK1A 1IBLO 1FYJA 4LFAO 1KUQA 4B3MO 4GKKO 3R66A 2DOSA 4LFCO 5IT9N 1HR0O 2UUCO 1XEQA 1AB3A 5BY1A 2LW7A 4B3TO 4DR6O 2N74A 4JI3O 4OX9O 1XNRO 3O65A 1YZBA 4DR1O 3SDLA 4YHHO 4AQYO 4YY3O 4JI7O 1J5EO 1N34O 4X65O 1N32O 3J81N 4NXNO 4DV3O 3JAMN 4X66O 1FKAO 2E5LO 2F4VO 5BR8O 4DR2O 1N33O 4LF9O 2UXCO 2FKXA 4LF7O 3T1YO 4X62O 4LF8O 4LF6O 4DUZO 2DJVA 4JI5O 1FJGO 5IWAO 2HHHO 5H5NA 4LF5O 4DR3O 1HNXO 2ZM6O 2UUAO 4JI4O 4JYAO 2Z0AA 4X64O 1I94O 1HNWO 4DV5O 4JV5O 1N36O 2JRIA 4NXMO 3M8AA 5LMUO 4JI2O 1XMQO 4B3RO 1A32A 4DV0O 2VQEO 4K0KO 3T1HO 4DR4O 1IBMO 4DV1O 2UXBO 2AGAA 1XMOO 2UXDO 1D2DA 4DV4O 1XNQO 4DUYO 4DV6O 4B3SO 4JI8O 3J80N 1IBKO 1R6TA 5BXZA 4JI6O 3F5TA 1X59A 4JI0O 5FLXN 2UU9O 2UUBO 2VQFO 4OPHA 5LL6Y 5LMNO 4JI1O 4DR7O 3OTOO 1R1BA 4A5UB 2ZKOA 4GKJO 1NS1A 4OPAA 5A2QN 4DV2O 1AILA 1HNZO 1F7YA 3J7AU 4KHPO 1G1XB 4DV7O 3RT3C 4LFBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 O;  4DR5 O;  1DK1 A;  1IBL O;  1FYJ A;  4LFA O;  1KUQ A;  4B3M O;  4GKK O;  3R66 A;  2DOS A;  4LFC O;  5IT9 N;  1HR0 O;  2UUC O;  1XEQ A;  1AB3 A;  5BY1 A;  2LW7 A;  4B3T O;  4DR6 O;  2N74 A;  4JI3 O;  4OX9 O;  1XNR O;  3O65 A;  1YZB A;  4DR1 O;  3SDL A;  4YHH O;  4AQY O;  4YY3 O;  4JI7 O;  1J5E O;  1N34 O;  4X65 O;  1N32 O;  3J81 N;  4NXN O;  4DV3 O;  3JAM N;  4X66 O;  1FKA O;  2E5L O;  2F4V O;  5BR8 O;  4DR2 O;  1N33 O;  4LF9 O;  2UXC O;  2FKX A;  4LF7 O;  3T1Y O;  4X62 O;  4LF8 O;  4LF6 O;  4DUZ O;  2DJV A;  4JI5 O;  1FJG O;  5IWA O;  2HHH O;  5H5N A;  4LF5 O;  4DR3 O;  1HNX O;  2ZM6 O;  2UUA O;  4JI4 O;  4JYA O;  2Z0A A;  4X64 O;  1I94 O;  1HNW O;  4DV5 O;  4JV5 O;  1N36 O;  2JRI A;  4NXM O;  3M8A A;  5LMU O;  4JI2 O;  1XMQ O;  4B3R O;  1A32 A;  4DV0 O;  2VQE O;  4K0K O;  3T1H O;  4DR4 O;  1IBM O;  4DV1 O;  2UXB O;  2AGA A;  1XMO O;  2UXD O;  1D2D A;  4DV4 O;  1XNQ O;  4DUY O;  4DV6 O;  4B3S O;  4JI8 O;  3J80 N;  1IBK O;  1R6T A;  5BXZ A;  4JI6 O;  3F5T A;  1X59 A;  4JI0 O;  5FLX N;  2UU9 O;  2UUB O;  2VQF O;  4OPH A;  5LL6 Y;  5LMN O;  4JI1 O;  4DR7 O;  3OTO O;  1R1B A;  4A5U B;  2ZKO A;  4GKJ O;  1NS1 A;  4OPA A;  5A2Q N;  4DV2 O;  1AIL A;  1HNZ O;  1F7Y A;  3J7A U;  4KHP O;  1G1X B;  4DV7 O;  3RT3 C;  4LFB O; 
#chains in the Genus database with same CATH topology
 1SER A;  1COW G;  1JR9 A;  2O57 A;  4RUE A;  4GUN A;  3VQX A;  4F6R A;  1H2N A;  1WA8 B;  2V7Q G;  3LNM B;  1IBK B;  1GH6 A;  3KCX A;  1MNG A;  4BIO A;  5L3F A;  1H8H G;  2ZIM A;  1TUB B;  4NB5 A;  4O4L B;  4QE9 A;  4OX9 O;  2OT5 A;  2XTA A;  2Q7H A;  4JAU A;  4YY3 O;  3H1H H;  5FPO A;  1LUV A;  1WNS A;  3OUF A;  2EUL A;  5J2U B;  3K79 A;  3CC2 V;  3LDD A;  1BMF G;  4O2A B;  4TUY B;  1VQM V;  4UFZ A;  2NNU A;  2E5L O;  3NXS A;  1VQP V;  1VF6 A;  1K34 A;  4X88 A;  4X1I B;  2BOB C;  4MVM A;  1OCC C;  2XAF A;  2ZDI A;  3E2E A;  2DN9 A;  1AVM A;  3RYH B;  5E1A C;  1MOF A;  2JDI G;  4Z1M G;  2XAG A;  3G6B A;  1RPR A;  5H5N A;  5DM6 V;  5B3S C;  2X6B A;  3OR7 C;  1J5E B;  2ZM6 O;  2ZQM A;  1OCZ B;  2EZP A;  2JEX A;  1W2B U;  4DV5 O;  1M57 C;  3MHS C;  3ABU A;  4YJ2 B;  2W6J G;  5CA0 B;  1BSM A;  1WP8 A;  4WF9 V;  3CXC U;  1Q81 W;  1ZL8 B;  1MZF A;  1QLE C;  3ZHU A;  2VQE O;  2UUC B;  4AIL C;  4PV1 B;  2ILM A;  4X62 B;  4BIZ A;  4TV8 A;  4BW5 A;  1K97 A;  1M1K W;  2HFE C;  1X59 A;  2DWD C;  1W0K G;  2F66 C;  3TK1 A;  3OMN B;  3L74 H;  3RYI B;  2ODM A;  2Y4U A;  1ZUQ A;  1GN4 A;  4RWU A;  4CH4 A;  2QKS A;  4JI2 B;  1KQS U;  3CHX A;  1XHX A;  4XDL A;  3WU2 Z;  1P49 A;  2BTQ B;  1R3J C;  2W0X A;  1B06 A;  3B40 A;  2UUB B;  1PNL A;  2GV9 A;  2M6Y A;  4PD4 F;  3K5L A;  1KP3 A;  1KEC A;  4JI1 B;  3H1J H;  1QVG U;  5EBM C;  5L3C A;  2AHZ A;  2FL4 A;  3ETQ A;  2ZD9 A;  5EBL C;  3T1H B;  1FKA O;  2WLL B;  4WBN A;  4DV7 B;  2HP8 A;  2WAM A;  1VMG A;  1AR1 B;  4G2K A;  2WLI B;  4IT5 A;  3IAY A;  5LYJ B;  1OCZ C;  4J41 A;  3AK2 A;  1R3L C;  1FJG O;  3UO3 A;  3A0B Z;  1GN2 A;  4UUJ C;  1NZ6 A;  3L72 H;  2ADP A;  4OGQ B;  2EIK B;  3BA9 A;  3UCS C;  3AG7 A;  3F5W C;  3K0D A;  4XDK A;  4ZOL A;  4WFH A;  1BZK A;  5JVD A;  1A32 A;  1URF A;  3ABM C;  2DYR B;  3HPL C;  2DQ3 A;  3TGU H;  4DK0 A;  3K06 A;  5C93 A;  1GKF A;  3CWB H;  2Q67 A;  3N2G A;  2V1D A;  1AR4 A;  2MK3 A;  5LGN A;  4I4T A;  4I55 A;  3K5N A;  1IXM A;  2OIG A;  1NH2 D;  3CRA A;  1PL0 A;  3THO A;  1R1B A;  1PV0 A;  3SJB C;  4JYA B;  3RW0 A;  1I94 B;  5FL7 G;  3PJS K;  4R8C A;  1K8A W;  2A7W A;  4WFA V;  3ZMV A;  4HNA A;  2WLJ A;  4NKG B;  2XUM A;  3S3X A;  4D7S A;  3KG2 A;  1Y6X A;  2ARH A;  1Q6U A;  5KMG B;  2HHH B;  4IIJ B;  4JI6 B;  1XEQ A;  1IZ3 A;  2NN4 A;  2QGN A;  4FLV A;  1YF2 A;  4DR7 B;  1MSW D;  3SDL A;  3KZI Z;  2K1E A;  4ZHQ B;  4LH6 A;  1SS3 A;  1K7D A;  3ZMU A;  4CBC A;  4DV3 O;  4ICG A;  3SYO A;  2KSD A;  4TV9 A;  3K5M A;  5J2T A;  4BW9 A;  2Q69 A;  4TOI A;  4GKK B;  3CCE V;  3RYF B;  2EIK C;  3APO A;  2RN9 A;  3SYC A;  2CAZ C;  4J10 A;  4KUM A;  5K1X A;  3ZRW A;  4X20 B;  3JAK A;  2XAS A;  1E1Q G;  4UCV A;  4IHJ B;  2K9P A;  4ZIB A;  4DR3 O;  3G6E V;  4X65 B;  4NXN B;  2FYU H;  4FZ0 A;  2JGU A;  4DRX A;  1EFR G;  4GT1 A;  3E22 A;  4YJ3 A;  4LNU B;  1GAX A;  3JCZ A;  2QDO A;  1QR8 A;  4FLU A;  4DV1 O;  2UXC B;  2UXB O;  4LF7 B;  2YXY A;  3JAS A;  2EIL B;  3ZRS A;  4O4I B;  2YXL A;  2P7T C;  4CS3 A;  1AJQ A;  1HW7 A;  1KB9 F;  4DUZ B;  2Y0P A;  1TAE A;  2UU9 O;  4H33 A;  5EIB C;  4JGS A;  2ZKO A;  3H1L H;  4AI8 A;  1RSO B;  1K4C C;  1HNZ O;  2P4K A;  1NTK H;  2Q0O C;  2W6I G;  3BAA A;  2UXX A;  5B66 Z;  1HDJ A;  4K0K B;  3GB7 C;  3P3N A;  5LA6 A;  1MZE A;  4UB6 Z;  2EZO A;  1FXV A;  4HBN A;  1AP6 A;  4B3S B;  5CN0 A;  1Q43 A;  3UKM A;  5K1P A;  1FPO A;  5IDJ A;  1VF5 B;  2DW4 A;  1MG1 A;  4QE7 A;  2LQT A;  3DXR A;  3ZHT A;  5GTI Z;  3CB2 A;  3FYI B;  4LP8 A;  4O2B B;  1Q6H A;  4W4L A;  4JAS A;  4DR2 O;  4KFM A;  3AK1 A;  3SJQ C;  3LDE A;  4BR6 A;  2MW2 B;  1BQ0 A;  4OXS A;  3SR2 C;  3DTU B;  1KD1 W;  3QG5 A;  3G4S V;  1NU1 H;  3OE7 G;  1W0J G;  1Y66 A;  4JI5 O;  3K9S A;  4RO2 A;  3RYC B;  1SRY A;  3EXA A;  3U10 A;  4NTY A;  1Z5V A;  4JI7 B;  4X1Y A;  1FAF A;  4FPP A;  3AK3 A;  5KA6 A;  2EIL C;  3B8N A;  4NTW A;  4CS4 A;  1Y67 A;  4I0X A;  2F4V B;  4O4H A;  5IJ9 A;  1K3E A;  1WAZ A;  4Q20 A;  1Q6I A;  3OEH G;  4MVO A;  4DV4 O;  5EYP A;  5IJ0 A;  2IW5 A;  3HB3 B;  1M9N A;  3CSX A;  1VQL V;  5BXZ A;  1VQ6 V;  2AZ0 A;  1OHH G;  5B1A B;  3OMI B;  2YIB D;  1XL6 A;  5KA5 A;  5LP6 A;  3HKE A;  1U96 A;  4X66 B;  1BS3 A;  4JI4 B;  3BY6 A;  4GCZ A;  3OGI B;  1WN7 A;  1AIL A;  1YVW A;  3RGB A;  1H2L A;  5LOV A;  3CJH B;  3OM3 B;  1JOY A;  2ITC C;  4LFB O;  5JQG B;  2YEV B;  3BFR A;  4J9Y B;  4JAA A;  4DR5 O;  1IBL O;  2FML A;  4ZI7 A;  4CS2 A;  4LWS A;  1QNM A;  2XT9 A;  1F51 A;  1JFF A;  3AG3 B;  1EN6 A;  4JI0 B;  3B8M A;  1OJH A;  2GTA A;  4JI3 O;  3UT5 B;  3GVM A;  5CB4 A;  1YTF B;  4IL6 Z;  1ORQ C;  4I5S A;  2M7W A;  2DQ0 A;  3ABL B;  1N32 O;  2ADQ B;  4IYI A;  1BL8 A;  1NJI W;  1UJW B;  4WFE A;  2IJH A;  4LF9 O;  3JCU Z;  1H2M A;  1WB8 A;  1HR0 B;  1SZX A;  2JEU A;  2Q7G A;  4J7K A;  1UPG A;  2OTL V;  4J11 A;  1EM1 A;  2Y0I A;  3HR0 A;  3JAR A;  3TXS A;  2HR3 A;  4KP4 A;  2AW9 A;  1KP2 A;  1NBM G;  1P7G A;  3I55 V;  5KX5 B;  3JD2 A;  4I50 B;  5KHH A;  4LH7 A;  2RMK B;  4FVM A;  2P6J A;  3PN1 A;  1VQ5 V;  2KG7 A;  1MAB G;  2JGD B;  5B1A C;  2IU3 A;  1WPX A;  2D2C B;  3FB7 C;  2XAJ A;  1JMK C;  4DR4 O;  1AI4 A;  3HKD A;  4Z1V A;  2IM9 A;  4ZBM A;  4DV6 O;  1OCC B;  4EKW A;  1AI5 A;  1BQZ A;  5LBQ A;  2V4D A;  4CC6 A;  2CTW A;  2AXT Z;  1DTO A;  4JTC B;  2QE7 G;  4X9Q A;  1JCH A;  2C2A A;  4UB8 Z;  5DEC A;  4LF5 B;  5B1N A;  3P30 A;  4UVA A;  5B3S B;  4H13 B;  1YJN V;  1F7Y A;  1XBL A;  5IYZ A;  5JWP A;  3CP1 A;  4E4E A;  1VQ9 V;  3LNN A;  3AG3 C;  4B3R B;  3M7M X;  1E1R G;  2HJF C;  2RJZ A;  3JAL B;  3CS5 A;  2DOS A;  4U7N A;  2UUC O;  5EK0 A;  3ABL C;  2LW7 A;  3ZRX A;  4WFF A;  1PP9 H;  2WWW A;  5GTH Z;  3K03 A;  1S5J A;  1Q90 D;  4CH6 A;  1VQ8 V;  3OUS A;  1NI8 A;  2YIA A;  5IYB O;  4DV2 B;  3S3W A;  1ROP A;  1Y76 B;  1TVK A;  1L8D A;  1YIT V;  1S0V A;  1IX9 A;  4LFA B;  3E8H A;  3E89 A;  2OIE A;  3LSU A;  3RBZ A;  3U0Z A;  4MVZ A;  4LR3 A;  2VS0 A;  3KKY A;  5IYC O;  1VQ4 V;  4B3T B;  1SA0 B;  5LXT A;  2YIB A;  2CTQ A;  4TV8 B;  3U11 A;  4YHH B;  1IXB A;  1T5E A;  3ASO C;  4MT8 A;  2Z0A A;  3RVY A;  1HNW O;  3ABK B;  1N36 O;  5L3G A;  4DV0 O;  3FB8 C;  3T1H O;  2JK5 C;  2QKA A;  1XUQ A;  1XI1 A;  2AGA A;  1QBZ A;  3JSN A;  3LSS A;  1Y74 A;  1XL4 A;  2QWO B;  3RFR A;  3F5T A;  1CXZ B;  5H6Q A;  4JYY A;  3ZCC A;  5FNV A;  3VQV A;  2Y69 B;  4JTD B;  3JD1 A;  5BMV A;  5JJE B;  3UQ8 A;  2X6C A;  4YXW G;  4PDL A;  2IJI A;  1VQO V;  3A8T A;  2IH1 C;  2Q68 A;  4OPA A;  3SPH A;  2YID A;  4H37 A;  4O4J A;  4FLX A;  4KHP O;  2G38 A;  4DW0 A;  1XMQ B;  1VF6 C;  1Q86 W;  5LHG A;  1TA8 A;  2ZDI C;  1XMO B;  1H8E G;  1BCC H;  3ABM B;  3CCM V;  4WBN B;  5GON A;  4QIW F;  4JI8 B;  3TCU A;  2OCC B;  4QGP A;  1DF5 A;  3EFF K;  4J80 A;  4UV9 A;  4PA6 A;  2PUS A;  5J2U A;  4AQY O;  3CCQ V;  1YEW A;  3JD4 A;  1AJP A;  1EZJ A;  1UFI A;  3CMA V;  1PNK A;  2B5U A;  2ZNJ A;  3C3S A;  3APQ A;  4GYC B;  1WP7 A;  5B1B B;  1JJO A;  4X1I A;  4BIU A;  3SPJ A;  5KUK A;  3K5O A;  4ZOL B;  4N21 A;  4U3J A;  5CMU A;  4JAV A;  5JVD B;  4K8Z A;  3CRR A;  4TSF G;  5C8Y A;  1K73 W;  3ABK C;  3T1C A;  1N8R W;  3A0H Z;  3MD0 A;  2WLH A;  2EX3 A;  4OX9 B;  1VQN V;  5IWA O;  2HHH O;  4YY3 B;  3N2G B;  2JJ2 G;  3CRM A;  2UUA O;  2FB5 A;  3BVO A;  4I4T B;  4I55 B;  4JV5 O;  3ETG A;  1ZL8 A;  4NTX A;  1SQB H;  3F7V C;  2E5L B;  4K35 A;  4FMT A;  3ICX A;  4GX5 A;  4QPK A;  2CGO A;  2QTS A;  2P22 C;  2A3Q A;  2Y69 C;  1V54 C;  1D2D A;  3Q4H B;  4PEL A;  4MTO A;  3OAA G;  1CPY A;  3JAW A;  1QHT A;  1VIB A;  2EBO A;  1DGS A;  1VQ7 V;  2ZM6 B;  2LFR A;  4QJF B;  2BSK A;  4R6Z A;  4DV5 B;  2WLM A;  5CA3 A;  1Z5W A;  1EN5 A;  4RQE A;  2Q4P A;  2OCC C;  3G71 V;  2N04 A;  5EC2 C;  2VQE B;  1NVP B;  2JS5 A;  4LFC O;  4B08 A;  5HFM A;  4TV9 B;  5J2T B;  3AG4 C;  2Q7E A;  4DR6 O;  5B1B C;  2BE3 A;  1RM1 C;  2R72 A;  1SQF A;  3J81 N;  3ZRW B;  3WB2 A;  3JAK B;  1LNQ A;  2ZCE A;  1VP7 A;  5BR8 O;  3OFN G;  1MA1 A;  5L3E A;  2XND G;  4DRX B;  3E22 B;  4YJ3 B;  1SQV H;  1KU9 A;  2CDY A;  3CCR V;  2B1I A;  1VEW A;  4XBF A;  1K92 A;  3JAS B;  3BPZ A;  5KHI A;  1YIJ V;  3SPC A;  4X64 O;  2AZ2 A;  4NVP A;  1MMM A;  4FLT A;  3CME V;  4NXM O;  5LMU O;  2A0L A;  1IBM O;  5H6R A;  1K33 A;  3D36 A;  1R6T A;  4TWK A;  2A9H A;  3H1K H;  3JAT A;  1FJG B;  1QLN A;  1ZWI C;  2VQF O;  4OPH A;  2BTO A;  5LA6 B;  5LMN O;  5KHK A;  3OTO O;  4GKJ O;  4PDR A;  3DGE A;  3CC4 V;  3P32 A;  3T2M A;  5ITZ B;  1FXK A;  4FLZ A;  1YXB A;  3DXR B;  1TUE B;  2F95 B;  2EIJ B;  2X7R B;  3IC9 A;  1JJ2 U;  2E74 B;  1Y4M A;  3STZ C;  5LHH A;  2HG5 C;  4KL1 A;  2QEX V;  3D36 C;  2QTO A;  3OGC C;  3W7U A;  1YI2 V;  1XNR O;  1GM7 A;  2IU0 A;  5DED A;  1GTO A;  3L75 H;  1K9M W;  4BWA A;  3T4Z A;  4X66 O;  1NH2 B;  1P84 F;  4X1Y B;  3RYF A;  3FAV B;  4UCT A;  4HZ3 A;  2W0F C;  3QO7 A;  2E76 B;  3FB6 C;  4I0X B;  3RVZ A;  4LF8 O;  2Z3Y A;  5CA1 B;  1FFX B;  5IJ9 B;  2Q73 A;  4X20 A;  1YDX A;  4E2L A;  2P5O A;  4IHJ A;  4ZKI A;  1FD9 A;  5EYP B;  5IJ0 B;  5JH7 A;  4QPJ A;  1HNX O;  3G67 A;  3CCL V;  3L9D A;  4DV3 B;  2PY5 A;  2EJR A;  2R70 A;  5LP6 B;  2XAH A;  1X4T A;  5JCO A;  1Q5O A;  4J7Z A;  1R6K A;  2QR4 A;  4FM1 A;  2UXD O;  1M93 A;  1XNQ O;  5LOV B;  4HYO A;  5IY5 B;  2RDC A;  3OMA B;  2CE4 A;  3N27 A;  5FLX N;  4X1K A;  2WA3 A;  4PJ0 Z;  5JJN B;  2R9R B;  4LWS B;  2L35 A;  1K5S A;  5CBG A;  2QA4 V;  4DR3 B;  1JFF B;  2EIJ C;  4ASU G;  1S72 V;  2DWE C;  4K3A A;  4LF4 O;  5JJJ B;  4DV1 B;  2UXB B;  4B3M O;  2CGN A;  1HP8 A;  2LGW A;  3TET A;  2Q0A A;  2ZXW B;  2IBZ H;  4RAI A;  4TQF A;  1SQP H;  2UU9 B;  2N74 A;  1SKV A;  1S76 D;  1NT2 B;  1K5Q A;  4DR1 O;  1I0H A;  4QNH B;  1VAR A;  5EZY A;  4B7E A;  4DW1 A;  4BAY A;  1N34 O;  4MVS A;  1HNZ B;  1I5X A;  3JAR B;  4FJC C;  2ZIN A;  3IC7 A;  1WJZ A;  1E79 G;  1ZX3 A;  1SET A;  3E8B A;  1N33 O;  3W7S A;  1JX9 A;  3K57 A;  3T1Y O;  4DYL A;  5HFL A;  2LP7 A;  3ZIA G;  4LF6 O;  3WG7 B;  3K9A A;  4P30 A;  5LP6 C;  4WCE V;  1G8M A;  4GX1 A;  3AEI A;  2ZT9 B;  4J42 A;  4PDM A;  3AG1 B;  4W4K A;  1DF4 A;  2YUA A;  3FYE B;  4RUF A;  1OZ0 A;  5IY5 C;  3ZN0 A;  2QM8 A;  4DR2 B;  3OR6 C;  1AI6 A;  4I9W A;  3DSQ A;  1B04 A;  1I5Y A;  4FZ1 A;  5IYZ B;  3IJ4 A;  3OW2 U;  1XRE A;  3J80 N;  4J9Z B;  1IBK O;  1M4U A;  3RN4 A;  4I7Z B;  5B1O A;  4JI5 B;  2QWN B;  2F93 B;  4LCU C;  3SJC C;  2PTM A;  3ASO B;  4IGG A;  3CCU V;  4EB6 A;  2ZXW C;  3DC5 A;  5KAI Z;  3ZHV A;  1JVM A;  1FYJ A;  5EC1 C;  4DV4 B;  1TVK B;  2YIC A;  5IT9 N;  2NR5 A;  4B7K A;  4F6R B;  2Q8V A;  1PL4 A;  1AB3 A;  1D5N A;  3TJT A;  4JZ2 A;  3VOU A;  2ZR3 A;  1GN6 A;  3LUT B;  3EHB B;  3O65 A;  3HKC A;  5GW7 A;  2H94 A;  1I7F A;  3GWK C;  1J5E O;  1JPX A;  3ZN1 A;  1US6 A;  4PDV A;  1PD3 A;  4F6E A;  4LFB B;  2RNB A;  3E8G A;  1O9G A;  3QF7 A;  4DUY B;  3C3T A;  4DR5 B;  3WG7 C;  1IBL B;  4KXR A;  2HEP A;  2FKX A;  1M56 C;  1VF7 A;  4X62 O;  2CUG A;  1NTM H;  2YC0 A;  1SQX H;  1H38 A;  2DYS B;  3AG1 C;  4U7O A;  4JF3 A;  2Q6A A;  2X0L A;  1PM9 A;  4JI3 B;  1HWY A;  1SZT A;  4MVU A;  1NKD A;  3X2Q B;  4PI2 A;  4EFE A;  5IE9 A;  5KX5 A;  3B77 A;  5FNV B;  1N32 B;  4JYB A;  3MHH C;  1KKD A;  4JI2 O;  1TGO A;  4WFB V;  3LDC A;  4PA4 A;  4LF9 B;  3E86 A;  2RQ6 A;  2JIZ G;  3N2K A;  4O4J B;  2JVD A;  2EJ7 A;  2LO1 A;  4UCU A;  4FFB A;  4FK5 C;  2UUB O;  2Y4T A;  2CH7 A;  2WLK A;  4JI1 O;  5LGT A;  2WSS G;  5GON B;  3HKB A;  1BGY H;  2YI9 A;  1FS0 G;  4NR1 A;  3WFV A;  2BOC C;  4P9O A;  4DV7 O;  4MW8 A;  3RT3 C;  1V9P A;  3JAL A;  4DR4 B;  1XIL A;  1KBH A;  5FPR A;  1ARO P;  5AG2 A;  5A9G A;  3FKS G;  2GUZ A;  3R66 A;  4MVR A;  3D3Q A;  2GSM B;  3LSQ A;  4DV6 B;  2VWJ A;  4CZZ A;  2PYJ A;  1V54 B;  1U97 A;  5BZB A;  1K4D C;  1GO3 F;  1YHQ V;  4U3J B;  4MVQ A;  1W59 A;  2CK3 G;  3IFX A;  5KHJ A;  2GBO A;  2CTP A;  5TIS Z;  3ZHR A;  5H9C A;  2XAQ A;  1Y76 A;  5C8Y B;  3FFQ A;  3KCY A;  3SYP A;  4C7U A;  1LUW A;  2OCH A;  1EBO A;  1WA8 A;  2N05 A;  2VRZ A;  1NVP D;  3OD4 A;  1XQ8 A;  4UXN A;  2DYS C;  1QVF U;  5LGU A;  3IGA C;  3BA8 A;  4Q6G A;  2IJJ A;  5EBW C;  4CH3 A;  1TUB A;  4O4L A;  1OCO B;  4LBE C;  4NYK A;  3X2Q C;  4FLY A;  4TT3 G;  1SA0 A;  3ZX6 A;  3BHP A;  3SYQ A;  2P4V A;  2ZIO A;  4O2A A;  4TUY A;  3ETD A;  3SPI A;  2PI5 A;  3AG4 B;  4X8A A;  2EIM B;  5EIB D;  2L6L A;  3VBB A;  4JYA O;  1RM1 B;  1I94 O;  3JAW B;  2ZE6 A;  1JQ0 A;  1S77 D;  2GHY A;  4GLX A;  3RYH A;  3BAB A;  2YDE A;  1GRJ A;  3JYC A;  3VQW A;  5B5E Z;  4RQF A;  2OTJ V;  3H01 A;  2BSK B;  3CCJ V;  3H1I H;  1O9H A;  5F2V O;  2LFS A;  3T4D A;  4JI6 O;  1GM8 A;  1L1F A;  3RWR D;  3VQY A;  3JD0 A;  1KYO F;  4YJ2 A;  5CA0 A;  4CH5 A;  4DR7 O;  1GK9 A;  4MTF A;  3ABT A;  2F43 G;  2X6A A;  2ZE5 A;  1HNW B;  1SF9 A;  5J9P C;  3CEI A;  1N36 B;  3ZRV A;  1ZSP A;  2Q9L A;  2YXH A;  3C90 A;  5E79 Z;  4DV0 B;  2PYL A;  1OV9 A;  3GWO A;  5L3D A;  4UCS A;  4HNA B;  2F23 A;  4GKK O;  3RYI A;  2KQX A;  1FXH A;  1YJW V;  3CX5 F;  2QKC A;  3ZMT A;  4UCO A;  3ZMS A;  3K3W A;  3OTF A;  2WA4 A;  1RP3 B;  4MTG A;  3D3I A;  1SC5 B;  1AJN A;  2HVJ C;  1OCO C;  4X65 O;  2BTQ A;  3SYA A;  4NXN O;  4KHP B;  2ZE8 A;  3JD3 A;  2R9I A;  3ML0 A;  5D5P A;  1L0N H;  1S5H C;  1EN4 A;  1KKC A;  2UXC O;  2QWP B;  4LF7 O;  2EIM C;  3CYO A;  2LJ2 A;  4JTA B;  1PNM A;  4DUZ O;  1R6N A;  2WLL A;  1GN3 A;  2YI8 A;  2ZE7 A;  2ZR2 A;  4TQD A;  4AQY B;  2CTR A;  3B4S A;  2WPD G;  2PGG A;  4UCR A;  1BHB A;  3JAT B;  1SQG A;  3K08 A;  2WLI A;  5LYJ A;  1S5L Z;  4YIP A;  2B1G A;  3Q4H A;  4K0K O;  4PA9 A;  3CCS V;  3ASN B;  3SPG A;  4DK1 A;  3QO5 A;  4B3S O;  1FXK B;  2QM7 A;  1N0J A;  2A06 H;  5IWA B;  5LL6 Y;  2AHY A;  3QTC A;  4UVB A;  3ZHQ A;  2IH3 C;  2IJK A;  4MTX A;  1XHZ A;  2UUA B;  1H2K A;  2BCC H;  3R65 A;  5A2Q N;  4GZR B;  4JV5 B;  4JPR A;  3J7A U;  2FTK A;  4K8X A;  3W7X A;  3STL C;  2ZNI A;  3CC7 V;  2HJD A;  1SQQ H;  1YSC A;  2EIN B;  2LGQ A;  1VQK V;  5D5Q A;  2PZS A;  4H0L B;  1G4Y B;  1MSD A;  3ZMZ A;  2RCV A;  2ATK C;  3D8C A;  3P3P A;  2VWK A;  4JI7 O;  3FX7 A;  4FM0 A;  1OCR B;  1Q8I A;  2DYR C;  4EEQ A;  5KMG A;  5JH7 B;  2F4V O;  4IIJ A;  1Q82 W;  3O9O A;  1S3J A;  1AR5 A;  1PKX A;  5IYD O;  4G28 B;  1GMG A;  4LFC B;  1THZ A;  4ZHQ A;  1H2G A;  3CXH F;  2PF4 E;  2YS8 A;  2DJV A;  4DR6 B;  4LC1 A;  1N4C A;  2B9Z A;  3OT7 A;  1F4M A;  2HKO A;  3BCC H;  1IUR A;  1FFT B;  4JI4 O;  4Z2W A;  4X1K B;  2D3O W;  3ASN C;  2JRI A;  3M8A A;  4G27 B;  1FXK C;  1JA8 A;  5BR8 B;  4WFG A;  3MDS A;  1IVS A;  1D5A A;  1RFY A;  4O4H B;  3DC6 A;  2KKW A;  1YTF D;  4L8J A;  4P2Z A;  3W7T A;  5H2F Z;  1DLB A;  1XDC A;  4JI0 O;  2KB1 A;  4HAM A;  5DN6 G;  1L0L H;  4LNU A;  3ZJZ A;  4U3F H;  2GDS A;  4N23 A;  4A5U B;  4X64 B;  3HKE B;  1F23 A;  5ITZ A;  1QU7 A;  2EIN C;  4NXM B;  1R73 A;  5LMU B;  3BEH A;  3FB5 C;  4MSW C;  3WB0 A;  4O4I A;  2OWO A;  5EZY B;  1IBM B;  2ETN A;  4UV8 A;  2E75 B;  2WLN A;  1CEZ A;  4IYH A;  3K58 A;  4FM2 A;  3SGI A;  5KAF Z;  4ZI7 B;  1YJ9 V;  1HR0 O;  3UO2 A;  1B6Q A;  1ZTE A;  1OCR C;  2XHB A;  1RSO A;  3L73 H;  3CD6 V;  4DO2 A;  2VQF B;  4MS2 A;  1WLE A;  5LMN B;  3OTO B;  5LHI A;  2Q5Z A;  4GKJ B;  2LW1 A;  3W7W A;  4R50 A;  5CB4 B;  4FLW A;  3L71 H;  3CE2 A;  3NR7 A;  4PI0 A;  3FAV A;  1QQC A;  5JCO C;  1ZLZ A;  3A0R A;  4ABM A;  5CBH A;  1AP5 A;  4JYC A;  3ETE A;  4I9Q A;  3M99 B;  2NLJ C;  3K0G A;  2A79 B;  1SES A;  2JJ1 G;  5CA1 A;  1FFX A;  3JSL A;  2JS3 A;  1G6U A;  1EZV H;  5KUM A;  3E83 A;  4O2B A;  3CPW U;  1XNR B;  1P4R A;  3WB1 A;  5L3B A;  4LF5 O;  1F4N A;  1R3K C;  3OEE G;  4UVC A;  3I5D A;  3B2E E;  3H9V A;  1I08 A;  3ZBH A;  1Q7Y W;  1PPJ H;  2YSU B;  4B3R O;  3CCV V;  2KG7 B;  1NR7 A;  3ZED A;  1NQT A;  3RYC A;  5KLV H;  4FIP C;  4GX2 A;  3UM7 A;  4DUY O;  4F4L A;  3E8F A;  4LF8 B;  4EB6 B;  3HKD B;  1B3Q A;  1M56 B;  2R9A A;  2DE0 X;  3TXQ A;  1CP9 A;  3A2F A;  4PA7 A;  5CBF A;  1WB7 A;  1XOU A;  1HNX B;  3BRC A;  2QJ1 A;  4EFB A;  4PA3 A;  1NS1 A;  2OYQ A;  2QWR B;  4MW3 A;  4DV2 O;  3QNE A;  2P06 A;  2F1M A;  4YIO A;  3F7Y C;  4GX0 A;  4CC5 A;  3HKC B;  3AG2 B;  4XDJ A;  1Q3E A;  1QCE A;  1DK1 A;  1M5I A;  2P90 A;  4LFA O;  1KUQ A;  2UXD B;  1LR1 A;  3CRQ A;  1XNQ B;  1ZAU A;  1V55 B;  1J95 A;  2UXN A;  5BY1 A;  4B3T O;  4PHZ A;  4P9P A;  2HLD G;  1KC8 W;  1BHA A;  3CJH A;  1YZB A;  3MAQ A;  1N0N A;  3L70 H;  5JQG A;  2YEV A;  4YHH O;  5KHG A;  1RPO A;  1IDS A;  3JAM N;  2QM4 A;  4LF4 B;  3K59 A;  2Z5U A;  3I56 V;  1QR9 A;  4B3M B;  3UT5 A;  3E35 A;  3B09 A;  2P67 A;  2HVK C;  1ENV A;  4H44 B;  3EVK A;  1WPB A;  1P7B A;  3G80 A;  3SJA C;  2ITD C;  1KMI Z;  2QSA A;  4L87 A;  1BE3 H;  3N2K B;  3ZS8 C;  1H2S B;  2XOK G;  4DR1 B;  1AI7 A;  2QWQ B;  5LXT B;  4D7T A;  1N34 B;  4FFB B;  2CH7 B;  1YCI A;  1Z2G A;  3K04 A;  1XMQ O;  3QVN A;  3HKB B;  1R3I C;  1M90 W;  1N33 B;  2DMX A;  4X89 A;  2H8P C;  3QO8 A;  3T1Y B;  1XMO O;  1M57 B;  4J7J A;  4AHC A;  4JI8 O;  1NR1 A;  4R7C A;  4LF6 B;  4I50 A;  1Y74 B;  1QLE B;  2GTS A;  1GM9 A;  2GUZ B;  2H3O A;  4FFK A;  2PI4 A;  3CRC A;  3AG2 C;  2JGD A;  3FD9 A;  4D6T H;  2Y48 A;  5BMV B;  2E3C A;  3ZHS A;  4DXW A;  4JZG A;  1BT8 A;  1V55 C;  1G1X B;  1NTZ H; 
#chains in the Genus database with same CATH homology
 4LF4 O;  4DR5 O;  1DK1 A;  1IBL O;  1FYJ A;  4LFA O;  1KUQ A;  4B3M O;  4GKK O;  3R66 A;  2DOS A;  4LFC O;  5IT9 N;  1HR0 O;  2UUC O;  1XEQ A;  1AB3 A;  5BY1 A;  2LW7 A;  4B3T O;  4DR6 O;  2N74 A;  4JI3 O;  4OX9 O;  1XNR O;  3O65 A;  1YZB A;  4DR1 O;  3SDL A;  4YHH O;  4AQY O;  4YY3 O;  4JI7 O;  1J5E O;  1N34 O;  4X65 O;  1N32 O;  3J81 N;  4NXN O;  4DV3 O;  3JAM N;  4X66 O;  1FKA O;  2E5L O;  2F4V O;  5BR8 O;  4DR2 O;  1N33 O;  4LF9 O;  2UXC O;  2FKX A;  4LF7 O;  3T1Y O;  4X62 O;  4LF8 O;  4LF6 O;  4DUZ O;  2DJV A;  4JI5 O;  1FJG O;  5IWA O;  2HHH O;  5H5N A;  4LF5 O;  4DR3 O;  1HNX O;  2ZM6 O;  2UUA O;  4JI4 O;  4JYA O;  2Z0A A;  4X64 O;  1I94 O;  1HNW O;  4DV5 O;  4JV5 O;  1N36 O;  2JRI A;  4NXM O;  3M8A A;  5LMU O;  4JI2 O;  1XMQ O;  4B3R O;  1A32 A;  4DV0 O;  2VQE O;  4K0K O;  3T1H O;  4DR4 O;  1IBM O;  4DV1 O;  2UXB O;  2AGA A;  1XMO O;  2UXD O;  1D2D A;  4DV4 O;  1XNQ O;  4DUY O;  4DV6 O;  4B3S O;  4JI8 O;  3J80 N;  1IBK O;  1R6T A;  5BXZ A;  4JI6 O;  3F5T A;  1X59 A;  4JI0 O;  5FLX N;  2UU9 O;  2UUB O;  2VQF O;  4OPH A;  5LL6 Y;  5LMN O;  4JI1 O;  4DR7 O;  3OTO O;  1R1B A;  4A5U B;  2ZKO A;  4GKJ O;  1NS1 A;  4OPA A;  5A2Q N;  4DV2 O;  1AIL A;  1HNZ O;  1F7Y A;  3J7A U;  4KHP O;  1G1X B;  4DV7 O;  3RT3 C;  4LFB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...