2LFRA

Solution structure of the chimeric af1503 hamp- envz dhp homodimer
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of regulation of receptor histidine kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus, shigella flexneri
molecule tags Transferase
molecule keywords Uncharacterized protein, Osmolarity sensor protein envZ chim
total genus 43
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00672 HAMP HAMP domain
A PF00672 HAMP HAMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lfrA00
2LFRA 2QM7A 1IXMA 4BIUA 3TK1A 3ZCCA 2FTKA 2QM8A 3DGEA 4GT1A 4BIZA 4Q20A 3ZRWA 2WWWA 4JYCA 4MTXA 4U7OA 4QPJA 3P32A 5B1OA 3ZRVA 4FMTA 4MT8A 3ZRWB 5B1NA 3D36A 5IDJA 3MD0A 3NXSA 4JAVA 2C2AA 4U7NA 3ZRXA 5C93A 4FPPA 4ZKIA 4JASA 4JYBA 4I5SA 4JAUA 1F51A 1JOYA 2P67A 3A0RA 4QPKA 4KP4A 2LFSA 4GCZA 4LC1A
chains in the Genus database with same CATH superfamily
4NXMO 2DOSA 4TV9B 5B66Z 4LFAB 3K04A 5LMNB 3ZMZA 2W0FC 5EYPB 4Q20A 2P7TC 3JAWB 4O4IA 2UUAB 1H8EG 1YDXA 4RO2A 1XMQO 1DF5A 5E1AC 5J2UA 4TSFG 1FJGO 4JI5O 4YIOA 3OEEG 2QSAA 1X59A 4FLWA 4GKJB 5JVDA 4DR4O 2AXTZ 4X62B 3CRRA 2R9AA 4ZOLB 4UCOA 4LF9B 3ZHUA 2BOCC 1FYJA 3L9DA 4UCVA 1NBMG 4U3JB 4O4HA 3BAAA 1B06A 5JJNB 1A32A 2PI4A 1FFXB 1KUQA 1ROPA 4PA6A 3SPGA 4F4LA 1HP8A 1KU9A 3CRCA 4DR3O 4DUYB 1DLBA 4IHJB 2LGWA 4DV5O 4JI5B 4DR5B 2QKCA 3SPJA 4JI3O 1WP8A 2Z3YA 4JI7B 2EIJB 2QWPB 3OD4A 4MVOA 3VQXA 2M7WA 5JH7A 2PYLA 2AGAA 2GHYA 2WSSG 4LH7A 3L71H 1XHZA 1QBZA 3B8NA 3ZCCA 2FTKA 3DC6A 2WLHA 1R73A 4G2KA 2RMKB 3RYFA 4DV2B 5IWAB 3E89A 4B3MB 4FMTA 4X20B 3ZIAG 4ZIBA 2IU3A 2Z5UA 3WG7B 4B7KA 1MNGA 2DWEC 4JAUA 2FMLA 2NN4A 1IZ3A 3CMEV 1RFYA 3E8FA 1M4UA 4IT5A 2IW5A 4J11A 1H2MA 4FM2A 4UVBA 3MAQA 4CH5A 4JI6B 3FYEB 4FM1A 4GKJO 3DSQA 2X0LA 2QR4A 2HJDA 3HKBA 2WLJA 1YI2V 4JI1B 5L3EA 3TETA 5JVDB 1PP9H 1S5LZ 3FB6C 2X6AA 5A9GA 2XAFA 2P67A 2DJVA 2DMXA 2GTSA 4WCEV 2LW7A 1RM1B 3X2QC 2WPDG 1PD3A 4CS3A 5CA0A 1VQ5V 3P3PA 2Q7HA 2QWRB 5B1AB 2OTJV 4HNAB 1MABG 2IU0A 1HNXB 3K9SA 3ZRXA 3B40A 3AG2C 2LJ2A 3CYOA 1QVGU 1JOYA 3QNEA 4XDJA 3ZN1A 4NTYA 1YSCA 1ZAUA 3GVMA 4BIZA 3ETGA 2PY5A 1H8HG 5A2QN 3K59A 3W7TA 1VQ4V 1GN4A 4B3SB 1WA8B 1PL0A 5IJ9A 1H2NA 3C90A 4U7NA 1JR9A 4ZI7A 4EB6B 1VQMV 1N36O 2HEPA 5J2UB 1VEWA 3BA8A 4LFCO 4FZ1A 2MW2B 3ZRVA 4QPJA 1YF2A 2HG5C 4DR1B 4FLVA 3BRCA 4DUZO 3P3NA 4CZZA 1K4DC 1ORQC 4X1IA 3CJHA 5IJ0A 3HKEA 3ASNC 5EZYB 3OR6C 4TV9A 3ASOC 3KCYA 4X9QA 4LWSB 1NKDA 2O57A 1NT2B 1NR7A 2V7QG 3S3XA 4K8XA 4GKKO 2E74B 1FXKC 4I4TB 1AP5A 2ZCEA 3OGIB 2RJZA 1QVFU 4X62O 2RN9A 4EEQA 3HKBB 2RDCA 5FLXN 2R9RB 5L3GA 5FPRA 3T1HO 4X65O 1FXHA 3KZIZ 1N4CA 1EFRG 1J95A 1R6KA 4CH4A 4OX9O 4F6RA 5IYDO 5CB4A 1COWG 1N0JA 5KMGA 1WB7A 3G67A 2W0XA 4MT8A 3JCZA 3WB1A 5JQGA 3ZHTA 5L3BA 1HW7A 2IM9A 5LP6A 1M5IA 2GDSA 1KYOF 1JQ0A 3SJCC 5EBLC 3SYPA 1Y74A 4X66O 3RVZA 3K5LA 3ZMVA 1FD9A 1VIBA 5LOVB 2A0LA 1H2GA 1N34B 2P22C 2XAHA 1R1BA 2YI9A 4DO2A 4JASA 4DV6O 1K97A 2JGDB 3CPWU 3I55V 1QQCA 3ICXA 4JI2O 3ZRSA 1S77D 4H44B 3T1HB 4N23A 5GTIZ 1RSOA 5KX5A 3SYOA 2CTPA 5EC2C 1E1RG 2WLNA 3BEHA 5C8YB 2YC0A 3JYCA 3E8HA 4QPKA 1SZXA 4NVPA 4I55B 1I0HA 4YJ2B 4NTXA 4K0KB 2OTLV 2QGNA 5IY5B 1K4CC 2RNBA 5LA6A 3OW2U 3VQWA 3LDDA 2WAMA 1G6UA 4I50A 5CBFA 1AJQA 4WFGA 1IDSA 2XT9A 3ZS8C 2VS0A 2GUZB 1NJIW 1GAXA 3C3TA 5IJ9B 5IYBO 3TJTA 3AG3B 2RQ6A 1P49A 3W7XA 4LNUA 1DK1A 4UCSA 3AK1A 2YEVA 1K3EA 1JJ2U 3SPHA 4PA7A 3U11A 1SS3A 4TOIA 4ZHQA 1ENVA 1M57C 3ABMB 1N33O 2HR3A 2LFRA 5LP6C 4CH6A 3E22B 3CCVV 3M8AA 1XEQA 4QJFB 4MTXA 3T4ZA 1TVKB 4LF8B 3FAVA 4UVAA 2HKOA 1MMMA 2OIEA 1BL8A 3BHPA 1K8AW 1NTZH 2CE4A 4H37A 2B9ZA 1F4NA 1L0NH 1M1KW 1VF7A 2ZNJA 3B09A 2IJJA 2F66C 4ZBMA 2BOBC 4K8ZA 2Y69B 1N32O 1ZLZA 3H1KH 3N27A 1AI6A 4H13B 1K34A 4IIJB 2OCHA 4JF3A 3DXRA 2CTWA 3CCRV 1TUBB 3SGIA 4WFFA 5B1AC 1GRJA 4LF7O 3PN1A 4ABMA 1K92A 3I56V 4DV5B 4FLUA 3MHSC 3G6EV 5IJ0B 1OZ0A 1K7DA 2GV9A 2JGUA 3TXSA 3QF7A 2P5OA 1BMFG 1XMQB 5TISZ 4ZKIA 2CH7A 2PGGA 2JS5A 1NR1A 3H1JH 1XL6A 4O2BA 1VQPV 3JALA 1HNWB 3CB2A 4O4IB 1U97A 4HAMA 3CC7V 1ZUQA 1NU1H 4BWAA 1W59A 2BTQB 4ZI7B 5JCOC 3KG2A 2Q4PA 5H2FZ 5BR8B 3K9AA 1XOUA 4WFBV 1M90W 4CS2A 3T2MA 3CSXA 4I5SA 4BIOA 2JIZG 4KUMA 4ZHQB 4YY3B 2ZXWB 4K35A 5L3FA 2JK5C 1SF9A 2EZOA 1RPOA 3G80A 3D36A 3CXCU 5DECA 4LBEC 1F23A 3L74H 2YXLA 3RYCB 5LOVA 5IYCO 3K08A 2EULA 5BMVA 4U7OA 1YHQV 3K0GA 1N32B 4WF9V 1Y4MA 1Y66A 4O2BB 4BR6A 1BZKA 1GN6A 3UKMA 4DR2B 4EKWA 4JI0O 5HFLA 5KA5A 3K5OA 4D6TH 2E3CA 5KMGB 4X1IB 2E5LO 1F4MA 2QTSA 3SYCA 4HNAA 1IBKO 2QE7G 5H9CA 1AP6A 5LMNO 2OCCB 2HP8A 2OT5A 3K03A 1KD1W 2Y69C 4I50B 2YSUB 3JALB 3RN4A 5BMVB 1VP7A 2E75B 1LUWA 4DK1A 4TWKA 2QM7A 1IXMA 3OEHG 4RAIA 1QU7A 2HVJC 4B7EA 5ITZB 2ZE6A 1MSDA 2A3QA 4MVQA 2CAZC 2YI8A 2UXDB 1KKDA 2EINC 5LHGA 1AJPA 1SC5B 1WA8A 4IIJA 5IT9N 4DR6B 4JI8B 3CJHB 2P06A 4LR3A 3WFVA 3RGBA 2CK3G 2XAQA 4JYAO 1V9PA 5LGUA 4D7SA 5CA0B 1H2SB 1SESA 3AG4C 5K1XA 4TV8A 2WLIA 2DW4A 2EIMC 1GMGA 1I94O 2ETNA 2Y4UA 3VOUA 5FNVB 4J41A 4CH3A 1J5EO 4KHPB 4LFCB 1VQ6V 1BQ0A 1OJHA 3QTCA 4DR1O 4RQEA 3ABLC 4MVUA 5B1BB 1YJNV 1QLEB 4B3RO 3W7WA 1AVMA 2XAGA 3CEIA 1P84F 1EZJA 4I4TA 1CPYA 4Z1VA 1NVPD 3VQVA 4JAVA 1S0VA 4RUFA 4WFEA 4I9QA 1AI5A 3SDLA 4GX2A 4NYKA 1WPXA 1VQNV 1AR4A 4YJ2A 1S72V 2F95B 1D5AA 3OTOO 5CBGA 3HR0A 1K73W 1DTOA 1GM8A 4IYIA 5IY5C 2WA4A 3ZHSA 1KBHA 1K5QA 3D8CA 1K9MW 4GZRB 1AJNA 3CRMA 5JWPA 2ZDIC 3ABUA 2X6BA 5J9PC 2DQ3A 2HFEC 2Q8VA 1TVKA 4I9WA 2CTQA 4JYCA 3RYIB 4X65B 1RP3B 1PPJH 5CA1B 4LF6O 4DR7B 4GLXA 1XMOB 1MOFA 3UT5A 5IE9A 5C93A 1Q43A 1KECA 2ZIMA 5KAIZ 5LXTB 1OV9A 1R3JC 2UUCB 3GB7C 3J80N 3DXRB 3KKYA 5KAFZ 4KL1A 4JI4O 2IJIA 5JQGB 5KHIA 3H9VA 2ZKOA 5LXTA 1S5JA 3NR7A 1US6A 3B8MA 3ZMTA 1JX9A 4O2AA 4QIWF 3BA9A 4H0LB 3T1YB 1NI8A 1VMGA 4DR5O 4OPHA 2JJ2G 4UCRA 3J81N 4JI2B 3ABMC 1K5SA 2DN9A 1MZEA 5LMUO 3A0RA 4G28B 1W0KG 4DR2O 1TGOA 3AG7A 3H01A 5KLVH 1KQSU 3JATA 4R8CA 3R66A 1Z2GA 2UXNA 2CTRA 2ZQMA 1PL4A 5CA1A 2EBOA 4J42A 5LHHA 3RW0A 4LFBB 1FKAO 4DV7O 3CC4V 5KHJA 3K5MA 2CDYA 3ZHRA 4J7ZA 3H1HH 1SA0B 3FB5C 2DYSC 1LUVA 3BY6A 1EZVH 4X1KB 2K1EA 4UUJC 4PA4A 3O65A 3QVNA 1IBLO 3AEIA 1THZA 2N05A 3EHBB 4U3FH 5LA6B 4IGGA 2QWNB 2V4DA 5BY1A 1XHXA 4LF9O 2DQ0A 3JASA 2HVKC 4FLZA 2Z0AA 3UO3A 3FX7A 2ARHA 1U96A 2ZE7A 3OT7A 3N2GA 3IGAC 4X64B 1RM1C 3P30A 1R6NA 3E8BA 3BABA 4TT3G 1KMIZ 3DTUB 2AW9A 2W6IG 3E83A 4NKGB 1TA8A 4FIPC 4F6EA 4O4LB 1R6TA 2EIKC 4PDLA 2EZPA 4RUEA 1DGSA 1JFFB 2P4KA 3A8TA 3CCLV 3WB0A 2Q6AA 1B3QA 1F51A 1XI1A 2GSMB 2Q68A 4B3MO 4UV8A 1EBOA 3B2EE 3RYHA 4NXNO 1JJOA 2ZXWC 5FL7G 2R70A 1BHAA 1OCCC 4LCUC 5K1PA 5B3SC 2AHYA 4XBFA 4FM0A 2KKWA 1VQLV 1YTFB 4DRXA 2UXCB 1VQ8V 4CBCA 4WFAV 4J9ZB 4R6ZA 2MK3A 2BTOA 2Y0PA 3K0DA 3O9OA 2A9HA 5KHKA 2ZE5A 5C8YA 5FPOA 3HPLC 2X6CA 1TUEB 3CMAV 4UCTA 4BW9A 1JMKC 2ZM6B 4PELA 2KB1A 2D2CB 1VQOV 2F4VB 1R3IC 3HKDB 1F7YA 2EILC 2XAJA 1XNQB 2YIBA 3WG7C 3SJQC 1G1XB 2ZR3A 5DN6G 4FVMA 3CCMV 3RYCA 2JRIA 1IVSA 1MZFA 5CN0A 1HNXO 1V54B 4GX0A 5LBQA 1QCEA 2H3OA 2IJKA 5AG2A 4Z1MG 1Q6IA 4FJCC 3CCUV 1PM9A 4LH6A 4DV1O 1Z5VA 1FXKA 4JYYA 3K57A 1SKVA 1N34O 3JAKA 1I94B 3RVYA 3AK2A 4JTAB 1NTMH 4JYBA 4PDVA 1OHHG 1AILA 3E8GA 2CH7B 4PD4F 3K06A 4L87A 3JAKB 4DYLA 2QEXV 4AQYO 3ZRWA 4ICGA 1ZX3A 1XILA 1Q81W 4JV5O 4LFBO 2DYSB 2GTAA 2H94A 5LGTA 4FFBA 3JD4A 4UV9A 4NXNB 4B3TB 3JARB 4JI0B 5F2VO 3BPZA 2L35A 3FKSG 1Y67A 3JD1A 1KP2A 4I55A 1K33A 1YIJV 1BSMA 2FYUH 3P32A 4DR3B 5LYJB 1MG1A 3NXSA 1YXBA 2WA3A 3T1YO 1GN3A 2LP7A 3OE7G 4MSWC 1QNMA 2P90A 1RPRA 4C7UA 3UO2A 4MVMA 4DV3B 2IH1C 2A06H 1UFIA 3JD2A 3AG1B 1VQ7V 3K5NA 2Q9LA 3FAVB 1NVPB 5L3DA 2GBOA 4JZGA 1FAFA 4P2ZA 3OGCC 3CRAA 3SJAC 2D3OW 3FD9A 5D5QA 1P4RA 1N0NA 2EIJC 2LO1A 1XQ8A 3S3WA 4G27B 3APOA 3OUFA 2JEXA 5CB4B 1YITV 3RBZA 3MDSA 2Q7GA 3T1CA 1AB3A 3JD0A 2XOKG 3N2KA 1SQGA 3F7YC 2RCVA 2QKSA 2DE0X 3CCEV 5KHGA 4LF5B 1HDJA 2LFSA 4GCZA 1XNRB 3K3WA 3OMAB 3N2KB 1Q6UA 3BFRA 3CX5F 3U0ZA 1SETA 2WLIB 3ETDA 1PNLA 3VQYA 4J9YB 2OWOA 1XMOO 1VQ9V 2B5UA 2P6JA 2Q7EA 1GM7A 1Q7YW 3E2EA 3OTOB 2EJRA 2PI5A 3AK3A 1ZWIC 3UCSC 4JTDB 1HWYA 3LSQA 1SQVH 1V54C 1YZBA 1FXVA 4DRXB 3FYIB 3CCSV 3AG1C 4X89A 1WPBA 1Z5WA 3RYIA 1Y76A 3RT3C 1QLEC 2WLLB 1UPGA 2ZIOA 2Y0IA 4YXWG 4X66B 2R9IA 2EX3A 2ZE8A 1Y76B 3WU2Z 4B3SO 3SPCA 2DWDC 1JA8A 3SJBC 1YEWA 1ZTEA 1ZL8B 1QLNA 1GKFA 5FNVA 1Q82W 4LF6B 4WFHA 3AG4B 1R3KC 3G6BA 2Q0OC 5B1BC 3OUSA 4GX1A 4MTOA 2ITDC 3A0HZ 3ABKC 3JARA 3ZBHA 3G71V 2BE3A 4LC1A 5EBWC 3HKCA 3RYFB 4I7ZB 1KB9F 2UXCO 4GYCB 1RSOB 4X88A 1NH2B 2Q5ZA 1JPXA 2UUCO 4AI8A 1VF6C 5GW7A 4CC6A 4JI7O 4DW0A 5KA6A 4MVZA 2IH3C 5CMUA 1DF4A 2BTQA 3Q4HB 3D3IA 1L0LH 1Q3EA 4K3AA 4DV2O 1EN4A 4P30A 2QJ1A 4MW3A 3IFXA 4LF5O 1Q86W 5JJJB 3HKDA 5LP6B 2FL4A 2HHHB 5IWAO 3BCCH 3H1LH 1PNKA 4H33A 1M57B 4NB5A 1XNRO 4X8AA 1WNSA 1Q8IA 2QTOA 4LF7B 4LWSA 3RWRD 1GK9A 4E4EA 1AR1B 2XNDG 2M6YA 4J10A 2UUBB 2WWWA 1TUBA 2NLJC 2ODMA 3APQA 1WB8A 4CC5A 2KSDA 3IC9A 4GKKB 4KFMA 4W4LA 3LSSA 1W2BU 4X20A 5EK0A 5H6QA 2LGQA 2YUAA 3VBBA 4DV3O 1Q90D 5KUMA 1EM1A 4PI2A 3LDCA 4LF8O 3ML0A 3FFQA 1XDCA 3QO5A 4O2AB 1GH6A 2UU9B 3ASOB 2EIMB 4MW8A 4TV8B 2BCCH 3JD3A 2QDOA 2Q69A 4DK0A 1YTFD 1Q6HA 4K0KO 3CD6V 1ZSPA 2AZ0A 3HKCB 1EN5A 4E2LA 2NNUA 2N74A 1NH2D 2L6LA 5H6RA 4LFAO 2V1DA 4X64O 4OGQB 2Q67A 5BZBA 2YIBD 1PV0A 1VQKV 1HNZB 2ILMA 3Q4HA 4LF4O 5HFMA 2YEVB 2ADPA 4O4JB 4ASUG 2ZNIA 5EBMC 4WBNA 4JZ2A 4DV6B 3OMNB 2W6JG 2PYJA 2OCCC 4IYHA 4UB6Z 5LGNA 1G8MA 2XHBA 4BW5A 3BVOA 3M99B 4XDLA 4HYOA 1I08A 2Q0AA 3QO7A 2UXBO 2H8PC 1BCCH 1YJWV 1FPOA 1CXZB 3EVKA 3JAWA 2FB5A 5B1NA 5BR8O 1GO3F 3CXHF 3SYAA 4JI4B 3ZMUA 4DV0O 3M7MX 3B4SA 1KKCA 3ZEDA 3W7UA 3JASB 3X2QB 4MTFA 1I5YA 4DV1B 2YIAA 3ZHVA 1NQTA 1NZ6A 5EIBC 1LNQA 3LDEA 4JI6O 2QKAA 4MS2A 1URFA 1SZTA 5GONB 2JVDA 4PJ0Z 1XL4A 2UU9O 5LMUB 4UCUA 2G38A 4YJ3B 5GONA 3OM3B 2P4VA 3K58A 2VWKA 1JFFA 3G4SV 4FLYA 3QO8A 1BQZA 4PHZA 3CCJV 1SA0A 3THOA 1N36B 1UJWB 1W0JG 3CRQA 1NS1A 4NTWA 4DUZB 3LNMB 1OCZB 1Y6XA 2X7RB 2VWJA 2KG7B 5JCOA 3WB2A 1M56C 5D5PA 3STLC 4BIUA 2YIDA 3GWKC 1EN6A 1OCOB 3OMIB 5H5NA 5LL6Y 4EB6A 4YHHO 2ATKC 2FKXA 4JI3B 5B1OA 2PF4E 2F23A 3UT5B 1MSWD 2ITCC 4O4HB 1T5EA 4MTGA 2VQEO 2QA4V 1B04A 4FPPA 3F5WC 5B3SB 4AQYB 1XUQA 4LNUB 2HHHO 1YCIA 4FLXA 3LSUA 3E35A 1OCCB 5LHIA 2F1MA 1BHBA 4UVCA 1GTOA 3I5DA 4DW1A 1IBLB 1QHTA 1CEZA 1HR0B 3OFNG 1YVWA 2HJFC 3UM7A 1XBLA 3GWOA 3MD0A 4GX5A 1FFXA 2WLMA 4JI8O 2UXXA 5CBHA 1P7BA 4JGSA 1WLEA 3CE2A 4D7TA 3JSLA 1SQXH 2VQEB 1AR5A 3JSNA 2B1IA 4PI0A 1TAEA 4QE9A 1M93A 2EINB 4UFZA 4F6RB 3L72H 4EFEA 2B1GA 2EILB 1IX9A 4JI1O 5KX5B 1OCOC 2LW1A 1OCRC 5GTHZ 3LNNA 1J5EB 1S3JA 1IBMB 1G4YB 2Y4TA 4PA3A 3ZN0A 2XUMA 2Y48A 3OAAG 4GT1A 4UXNA 3B77A 3CHXA 4OX9B 2YDEA 4AHCA 3SYQA 5EYPA 4YIPA 3IJ4A 5B5EZ 5EIBD 3FB7C 4IHJA 1N33B 4J80A 1QR8A 3ABTA 2JDIG 2YXHA 5IYZA 5EZYA 3SR2C 2E5LB 4AILC 2DYRB 3OTFA 1HNZO 2EIKB 1KC8W 4PDRA 1LR1A 4MVRA 4BAYA 2OYQA 4N21A 1AI7A 3D3QA 4EFBA 2AHZA 3ABKB 3KCXA 5EC1C 2VQFB 1L8DA 3L70H 3R65A 4OPAA 5JH7B 2XTAA 3CCQV 4YHHB 1O9GA 1H2KA 3TCUA 1JVMA 2PUSA 4YJ3A 4FFKA 1BE3H 4TQFA 3EXAA 3F5TA 1E79G 1IBMO 1SERA 1QR9A 2CGOA 3CP1A 4DR4B 4PA9A 1BGYH 4O4LA 4CS4A 5BXZA 3UQ8A 1GM9A 3RFRA 1IBKB 1AROP 3W7SA 1I7FA 2JEUA 5JJEB 3K79A 3ZJZA 5IYZB 4RQFA 4JYAB 2A7WA 3U10A 4LF4B 4JAAA 4FFBB 1IURA 3A0BZ 4J7KA 4Q6GA 4GUNA 4OXSA 1WN7A 1BS3A 4XDKA 2IJHA 2DYRC 5L3CA 1D5NA 4KXRA 2UUAO 2KQXA 2K9PA 4JV5B 1BT8A 4TUYB 4P9OA 1SRYA 2YXYA 4PV1B 3JCUZ 2QM8A 3ASNB 2ZM6O 3QG5A 1L1FA 3IAYA 3DC5A 1YJ9V 4KHPO 4B3TO 2ZDIA 3JAMN 1JCHA 4DV0B 1N8RW 2QWOB 3HKEB 4O4JA 4RWUA 1P7GA 4DXWA 2ZINA 1Y74B 4NR1A 4FZ0A 2F93B 5IDJA 3LUTB 1WJZA 3H1IH 3C3SA 3ZX6A 1OCRB 4R50A 2PTMA 5CA3A 4I0XB 1CP9A 2CUGA 1VF6A 3AG2B 3DGEA 4X1YB 4DR6O 1I5XA 3ABLB 4JPRA 3N2GB 3F7VC 5KHHA 1GN2A 1MA1A 2JS3A 4Z2WA 1SQQH 2NR5A 2VQFO 4TUYA 1WAZA 4DV4O 1SQBH 2ZR2A 5J2TA 1Q5OA 4L8JA 2HLDG 3A2FA 2IBZH 3CS5A 2VRZA 1PNMA 5LYJA 1IXBA 1M9NA 1WP7A 4NXMB 2ADQB 3HB3B 1S76D 4I0XA 1R3LC 3L73H 1S5HC 3FB8C 2A79B 2R72A 4KP4A 1ZL8A 2F43G 4B08A 1H38A 4LP8A 2WLKA 2YICA 3STZC 4YY3O 2XASA 2UUBO 3ZMSA 3ETQA 2ZD9A 1X4TA 2Q73A 2OIGA 2BSKA 3IC7A 5ITZA 3T4DA 4A5UB 3ZRWB 4MVSA 3JATB 2C2AA 2GUZA 1AI4A 1V55C 2BSKB 2QWQB 1XNQO 1HNWO 4TQDA 2ZT9B 3TK1A 4W4KA 2WLLA 4DR7O 2LQTA 4X1KA 2PZSA 1H2LA 4WBNB 1NTKH 3MHHC 5DEDA 3CWBH 4QNHB 2F4VO 3ZHQA 4QGPA 3E22A 3OR7C 4UB8Z 3L75H 3E86A 3TXQA 1HR0O 1FS0G 3PJSK 2YS8A 2QM4A 2E76B 4FK5C 1SQFA 1FFTB 2KG7A 4X1YA 1E1QG 5E79Z 1VARA 5DM6V 1SQPH 3J7AU 3SPIA 3TGUH 2JGDA 4PDMA 1V55B 3AG3C 4IL6Z 4P9PA 3RYHB 2N04A 1D2DA 1VF5B 1XREA 4J7JA 4HZ3A 5J2TB 1B6QA 1M56B 1FJGB 3ETEA 4DV4B 1OCZC 4ZOLA 2UXDO 1KP3A 2CGNA 1O9HA 3EFFK 4QE7A 5KUKA 4R7CA 1FXKB 4HBNA 4B3RB 1PKXA 2UXBB 3CC2V 3D36C 2EJ7A 4JTCB 4DV7B 4FLTA 4U3JA 4DUYO 2AZ2A 2JJ1G
chains in the Genus database with same CATH topology
3X2QB 1K92A 4MTFA 3K04A 1I5YA 3ZMZA 2W0FC 2A9HA 3I56V 4Q20A 3MHSC 2P7TC 3G6EV 1NQTA 1OZ0A 1H8EG 3HPLC 1LNQA 1K7DA 2X6CA 3LDEA 1TUEB 4MS2A 4RO2A 3CMAV 1DF5A 1SZTA 1BMFG 5E1AC 4TSFG 4PELA 4ZKIA 3OEEG 1XL4A 1NR1A 2KB1A 1VQOV 1R3IC 1XL6A 1VQPV 2EILC 4HAMA 3CC7V 2XAJA 3OM3B 3WG7C 3SJQC 2ZR3A 5DN6G 3G4SV 3QO8A 3CCMV 3CCJV 2BOCC 3KG2A 1NBMG 3K9AA 1UJWB 4WFBV 1W0JG 1M90W 5CN0A 1V54B 3T2MA 4GX0A 5LBQA 3LNMB 1OCZB 2X7RB 1QCEA 4I5SA 2PI4A 2IJKA 2JIZG 1ROPA 4Z1MG 1M56C 4KUMA 4PA6A 3SPGA 4F4LA 3STLC 4BIUA 4FJCC 3CCUV 2ZXWB 1OCOB 1DLBA 3OMIB 5L3FA 1FXKA 2ATKC 3SPJA 2JK5C 5B1AC 5B1OA 2EZOA 1RPOA 1MSWD 2ITCC 2Z3YA 4MTGA 2EIJB 3D36A 3CXCU 4MVOA 2QA4V 3RVYA 2M7WA 4FPPA 2GHYA 2WSSG 3F5WC 4JTAB 5B3SB 4LBEC 4JYBA 4PDVA 1F23A 1OHHG 1QBZA 3E35A 5IYCO 3K08A 1OCCB 3B8NA 3E8GA 4U7OA 5LHIA 3K0GA 1YHQV 4WF9V 1BHBA 1Y4MA 3K06A 4L87A 3ZCCA 2QEXV 2FTKA 4UVCA 1GTOA 2WLHA 1Y66A 1R73A 4G2KA 3ZRWA 3UKMA 1CEZA 3OFNG 1Q81W 3E89A 2HJFC 4EKWA 4FMTA 3UM7A 5HFLA 2DYSB 3ZIAG 2H94A 5LGTA 2IU3A 2Z5UA 3JD4A 3WG7B 3GWOA 3MD0A 5KA5A 4UV9A 2DWEC 4JAUA 4GX5A 2WLMA 2UXXA 1F4MA 3SYCA 5CBHA 1P7BA 3CMEV 4JGSA 3FKSG 1WLEA 3JD1A 2QE7G 5H9CA 1KP2A 2OCCB 2B1IA 3E8FA 1K33A 4QE9A 2EINB 2IW5A 2OT5A 4UVBA 1YIJV 3P32A 3FYEB 2B1GA 2X0LA 2EILB 3K03A 1KD1W 2WLJA 2Y69C 1OCOC 1MG1A 3NXSA 1YI2V 5L3EA 2YSUB 3TETA 1OCRC 3FB6C 2X6AA 2XAFA 1S3JA 2P67A 2LP7A 4TWKA 3OE7G 1G4YB 4MSWC 2P90A 1RPRA 2QM7A 1IXMA 4PA3A 3OEHG 3ZN0A 4RAIA 3OAAG 2Y48A 4MVMA 4GT1A 4UXNA 4WCEV 3B77A 1RM1B 2IH1C 2HVJC 3X2QC 2WPDG 4MVQA 3JD2A 1PD3A 3AG1B 1KKDA 2EINC 3SYQA 5LHGA 1AJPA 1VQ7V 1VQ5V 3FB7C 5B1AB 1NVPB 2OTJV 5L3DA 1QR8A 3ABTA 1MABG 2IU0A 2JDIG 3ZRXA 3AG2C 4P2ZA 3CYOA 3OGCC 1QVGU 1JOYA 3QNEA 2DYRB 4XDJA 3WFVA 3ZN1A 2D3OW 2EIKB 1KC8W 1P4RA 4PDRA 2CK3G 2XAQA 4MVRA 4BAYA 4N21A 1YSCA 5LGUA 1AI7A 2EIJC 4BIZA 2AHZA 4G27B 3ABKB 3ETGA 5EC1C 3OUFA 1H8HG 2JEXA 1SESA 3AG4C 1YITV 3RBZA 3W7TA 1VQ4V 2WLIA 2DW4A 3T1CA 2EIMC 1GMGA 3JD0A 2XOKG 1PL0A 3R65A 3F7YC 2QKSA 3VOUA 4U7NA 3CCEV 3CCQV 3TCUA 1VQ6V 1JVMA 2LFSA 1VQMV 4GCZA 3K3WA 3OMAB 4RQEA 1SETA 3ABLC 2WLIB 3ETDA 1E79G 4MVUA 5B1BB 1YJNV 1QLEB 1SERA 1QR9A 1PNLA 3CP1A 4J9YB 4PA9A 4QPJA 3ZRVA 3W7WA 2HG5C 2XAGA 1EZJA 1GM9A 1CPYA 1VQ9V 1NVPD 4CZZA 4JAVA 1AROP 2B5UA 2P6JA 1GM7A 3W7SA 1S0VA 1Q7YW 2JEUA 4RUFA 4WFEA 3E2EA 1K4DC 1ORQC 2EJRA 2PI5A 1AI5A 1ZWIC 4JTDB 3K79A 3ASNC 4GX2A 1WPXA 3ZJZA 4RQFA 1VQNV 1HWYA 3LSQA 3OR6C 1V54C 3ASOC 1FXVA 1S72V 1NKDA 3FYIB 3CCSV 3AG1C 1NR7A 2V7QG 4X89A 5CBGA 1K73W 1DTOA 1FXKC 1GM8A 4OXSA 1QLEC 2WLLB 5IY5C 1QVFU 4XDKA 2IJHA 1K5QA 4YXWG 2DYRC 5L3CA 1K9MW 2R9IA 1AJNA 2R9RB 2ZDIC 3ABUA 5L3GA 2X6BA 5J9PC 4P9OA 1SRYA 3SPCA 1FXHA 2DWDC 2DQ3A 2QM8A 3ASNB 2HFEC 1L1FA 1YJ9V 1EFRG 1J95A 4I9WA 4JYCA 1R6KA 2ZDIA 1QLNA 1JCHA 1N8RW 5IYDO 1GKFA 1Q82W 1COWG 4DXWA 4WFHA 4MT8A 3AG4B 1R3KC 5IDJA 1MOFA 3LUTB 3JCZA 5C93A 1KECA 5B1BC 3OUSA 4GX1A 4MTOA 2ITDC 3ABKC 1R3JC 1OCRB 4R50A 5CA3A 5L3BA 3G71V 3GB7C 4LC1A 5EBWC 1CP9A 3AG2B 1JQ0A 3DGEA 2IJIA 5EBLC 3SYPA 4X88A 1NH2B 1I5XA 1JPXA 3RVZA 3ZMVA 3ABLB 5GW7A 2A0LA 1H2GA 5KA6A 4MVZA 4JPRA 3B8MA 3ZMTA 1JX9A 2XAHA 4QIWF 3F7VC 2IH3C 5CMUA 1DF4A 2JJ2G 4DO2A 3ABMC 4JASA 3D3IA 1K5SA 1K97A 3A0RA 2ZR2A 4P30A 3CPWU 4G28B 3I55V 2HLDG 4MW3A 3IFXA 1Q86W 1W0KG 3ZRSA 1S77D 4N23A 1PNKA 3H01A 4H33A 1PNMA 1M57B 1KQSU 4X8AA 4R8CA 2QTOA 2UXNA 3SYOA 1M9NA 2ZQMA 5EC2C 3HB3B 1E1RG 1S76D 2WLNA 3BEHA 1R3LC 1GK9A 3JYCA 3E8HA 1S5HC 2EBOA 3FB8C 5LHHA 3RW0A 2A79B 4QPKA 4KP4A 1H38A 2F43G 1AR1B 4LP8A 2WLKA 3STZC 3CC4V 2XNDG 2OTLV 5IY5B 2XASA 3ZMSA 1K4CC 2WWWA 2ZD9A 3OW2U 3FB5C 2DYSC 3BY6A 2NLJC 3IC7A 3LDDA 2WAMA 3T4DA 3ZRWB 2K1EA 4KFMA 4UUJC 4MVSA 4PA4A 3LSSA 1W2BU 5EK0A 5H6QA 2C2AA 5CBFA 1AJQA 1AI4A 3VBBA 4WFGA 5KUMA 1V55C 3AEIA 1THZA 3EHBB 3LDCA 1NJIW 3ML0A 3TK1A 2WLLA 3QO5A 5IYBO 3ASOB 3AG3B 3MHHC 2DQ0A 4QNHB 2EIMB 4MW8A 2HVKC 3W7XA 2YEVA 3JD3A 3OR7C 1K3EA 2Q69A 1YTFD 1JJ2U 3SPHA 4PA7A 3IGAC 3CD6V 1RM1C 3E86A 3P30A 1R6NA 3E8BA 1FS0G 3PJSK 4E2LA 1ENVA 1M57C 4TT3G 3DTUB 4FK5C 2NNUA 1FFTB 1NH2D 3ABMB 1E1QG 2W6IG 2HR3A 2LFRA 5H6RA 3E83A 5DM6V 2V1DA 4FIPC 2Q67A 5BZBA 3SPIA 3CCVV 4PDMA 4QJFB 1V55B 1VQKV 4MTXA 2EIKC 4PDLA 3T4ZA 2EZPA 3AG3C 4P9PA 4RUEA 5HFMA 2YEVB 4UVAA 4HZ3A 2HKOA 3CCLV 1B6QA 1M56B 4ASUG 2Q6AA 3ETEA 1F51A 5EBMC 3OMNB 1OCZC 2W6JG 1BL8A 2OCCC 2GSMB 2Q68A 1K8AW 1KP3A 5LGNA 1G8MA 4UV8A 3EFFK 4H37A 4QE7A 1F4NA 1EBOA 4BW5A 1M1KW 3M99B 4XDLA 4HYOA 5KUKA 3QO7A 2ZXWC 4R7CA 1FXKB 5FL7G 1PKXA 2H8PC 1YJWV 2IJJA 1BHAA 1OCCC 4ZBMA 2BOBC 2Y69B 4LCUC 3CC2V 1AI6A 4JTCB 5B1NA 5B3SC 1GO3F 2AHYA 1K34A 3SYAA 4XBFA 1VQLV 4JF3A 1YTFB 1VQ8V 3ZMUA 4CBCA 4WFAV 4J9ZB 3CCRV 4WFFA 4R6ZA 2MK3A 2JJ1G 3W7UA 3K0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFR A;  2QM7 A;  1IXM A;  4BIU A;  3TK1 A;  3ZCC A;  2FTK A;  2QM8 A;  3DGE A;  4GT1 A;  4BIZ A;  4Q20 A;  3ZRW A;  2WWW A;  4JYC A;  4MTX A;  4U7O A;  4QPJ A;  3P32 A;  5B1O A;  3ZRV A;  4FMT A;  4MT8 A;  3ZRW B;  5B1N A;  3D36 A;  5IDJ A;  3MD0 A;  3NXS A;  4JAV A;  2C2A A;  4U7N A;  3ZRX A;  5C93 A;  4FPP A;  4ZKI A;  4JAS A;  4JYB A;  4I5S A;  4JAU A;  1F51 A;  1JOY A;  2P67 A;  3A0R A;  4QPK A;  4KP4 A;  2LFS A;  4GCZ A;  4LC1 A; 
#chains in the Genus database with same CATH topology
 4NXM O;  2DOS A;  4TV9 B;  5B66 Z;  4LFA B;  3K04 A;  5LMN B;  3ZMZ A;  2W0F C;  5EYP B;  4Q20 A;  2P7T C;  3JAW B;  4O4I A;  2UUA B;  1H8E G;  1YDX A;  4RO2 A;  1XMQ O;  1DF5 A;  5E1A C;  5J2U A;  4TSF G;  1FJG O;  4JI5 O;  4YIO A;  3OEE G;  2QSA A;  1X59 A;  4FLW A;  4GKJ B;  5JVD A;  4DR4 O;  2AXT Z;  4X62 B;  3CRR A;  2R9A A;  4ZOL B;  4UCO A;  4LF9 B;  3ZHU A;  2BOC C;  1FYJ A;  3L9D A;  4UCV A;  1NBM G;  4U3J B;  4O4H A;  3BAA A;  1B06 A;  5JJN B;  1A32 A;  2PI4 A;  1FFX B;  1KUQ A;  1ROP A;  4PA6 A;  3SPG A;  4F4L A;  1HP8 A;  1KU9 A;  3CRC A;  4DR3 O;  4DUY B;  1DLB A;  4IHJ B;  2LGW A;  4DV5 O;  4JI5 B;  4DR5 B;  2QKC A;  3SPJ A;  4JI3 O;  1WP8 A;  2Z3Y A;  4JI7 B;  2EIJ B;  2QWP B;  3OD4 A;  4MVO A;  3VQX A;  2M7W A;  5JH7 A;  2PYL A;  2AGA A;  2GHY A;  2WSS G;  4LH7 A;  3L71 H;  1XHZ A;  1QBZ A;  3B8N A;  3ZCC A;  2FTK A;  3DC6 A;  2WLH A;  1R73 A;  4G2K A;  2RMK B;  3RYF A;  4DV2 B;  5IWA B;  3E89 A;  4B3M B;  4FMT A;  4X20 B;  3ZIA G;  4ZIB A;  2IU3 A;  2Z5U A;  3WG7 B;  4B7K A;  1MNG A;  2DWE C;  4JAU A;  2FML A;  2NN4 A;  1IZ3 A;  3CME V;  1RFY A;  3E8F A;  1M4U A;  4IT5 A;  2IW5 A;  4J11 A;  1H2M A;  4FM2 A;  4UVB A;  3MAQ A;  4CH5 A;  4JI6 B;  3FYE B;  4FM1 A;  4GKJ O;  3DSQ A;  2X0L A;  2QR4 A;  2HJD A;  3HKB A;  2WLJ A;  1YI2 V;  4JI1 B;  5L3E A;  3TET A;  5JVD B;  1PP9 H;  1S5L Z;  3FB6 C;  2X6A A;  5A9G A;  2XAF A;  2P67 A;  2DJV A;  2DMX A;  2GTS A;  4WCE V;  2LW7 A;  1RM1 B;  3X2Q C;  2WPD G;  1PD3 A;  4CS3 A;  5CA0 A;  1VQ5 V;  3P3P A;  2Q7H A;  2QWR B;  5B1A B;  2OTJ V;  4HNA B;  1MAB G;  2IU0 A;  1HNX B;  3K9S A;  3ZRX A;  3B40 A;  3AG2 C;  2LJ2 A;  3CYO A;  1QVG U;  1JOY A;  3QNE A;  4XDJ A;  3ZN1 A;  4NTY A;  1YSC A;  1ZAU A;  3GVM A;  4BIZ A;  3ETG A;  2PY5 A;  1H8H G;  5A2Q N;  3K59 A;  3W7T A;  1VQ4 V;  1GN4 A;  4B3S B;  1WA8 B;  1PL0 A;  5IJ9 A;  1H2N A;  3C90 A;  4U7N A;  1JR9 A;  4ZI7 A;  4EB6 B;  1VQM V;  1N36 O;  2HEP A;  5J2U B;  1VEW A;  3BA8 A;  4LFC O;  4FZ1 A;  2MW2 B;  3ZRV A;  4QPJ A;  1YF2 A;  2HG5 C;  4DR1 B;  4FLV A;  3BRC A;  4DUZ O;  3P3N A;  4CZZ A;  1K4D C;  1ORQ C;  4X1I A;  3CJH A;  5IJ0 A;  3HKE A;  3ASN C;  5EZY B;  3OR6 C;  4TV9 A;  3ASO C;  3KCY A;  4X9Q A;  4LWS B;  1NKD A;  2O57 A;  1NT2 B;  1NR7 A;  2V7Q G;  3S3X A;  4K8X A;  4GKK O;  2E74 B;  1FXK C;  4I4T B;  1AP5 A;  2ZCE A;  3OGI B;  2RJZ A;  1QVF U;  4X62 O;  2RN9 A;  4EEQ A;  3HKB B;  2RDC A;  5FLX N;  2R9R B;  5L3G A;  5FPR A;  3T1H O;  4X65 O;  1FXH A;  3KZI Z;  1N4C A;  1EFR G;  1J95 A;  1R6K A;  4CH4 A;  4OX9 O;  4F6R A;  5IYD O;  5CB4 A;  1COW G;  1N0J A;  5KMG A;  1WB7 A;  3G67 A;  2W0X A;  4MT8 A;  3JCZ A;  3WB1 A;  5JQG A;  3ZHT A;  5L3B A;  1HW7 A;  2IM9 A;  5LP6 A;  1M5I A;  2GDS A;  1KYO F;  1JQ0 A;  3SJC C;  5EBL C;  3SYP A;  1Y74 A;  4X66 O;  3RVZ A;  3K5L A;  3ZMV A;  1FD9 A;  1VIB A;  5LOV B;  2A0L A;  1H2G A;  1N34 B;  2P22 C;  2XAH A;  1R1B A;  2YI9 A;  4DO2 A;  4JAS A;  4DV6 O;  1K97 A;  2JGD B;  3CPW U;  3I55 V;  1QQC A;  3ICX A;  4JI2 O;  3ZRS A;  1S77 D;  4H44 B;  3T1H B;  4N23 A;  5GTI Z;  1RSO A;  5KX5 A;  3SYO A;  2CTP A;  5EC2 C;  1E1R G;  2WLN A;  3BEH A;  5C8Y B;  2YC0 A;  3JYC A;  3E8H A;  4QPK A;  1SZX A;  4NVP A;  4I55 B;  1I0H A;  4YJ2 B;  4NTX A;  4K0K B;  2OTL V;  2QGN A;  5IY5 B;  1K4C C;  2RNB A;  5LA6 A;  3OW2 U;  3VQW A;  3LDD A;  2WAM A;  1G6U A;  4I50 A;  5CBF A;  1AJQ A;  4WFG A;  1IDS A;  2XT9 A;  3ZS8 C;  2VS0 A;  2GUZ B;  1NJI W;  1GAX A;  3C3T A;  5IJ9 B;  5IYB O;  3TJT A;  3AG3 B;  2RQ6 A;  1P49 A;  3W7X A;  4LNU A;  1DK1 A;  4UCS A;  3AK1 A;  2YEV A;  1K3E A;  1JJ2 U;  3SPH A;  4PA7 A;  3U11 A;  1SS3 A;  4TOI A;  4ZHQ A;  1ENV A;  1M57 C;  3ABM B;  1N33 O;  2HR3 A;  2LFR A;  5LP6 C;  4CH6 A;  3E22 B;  3CCV V;  3M8A A;  1XEQ A;  4QJF B;  4MTX A;  3T4Z A;  1TVK B;  4LF8 B;  3FAV A;  4UVA A;  2HKO A;  1MMM A;  2OIE A;  1BL8 A;  3BHP A;  1K8A W;  1NTZ H;  2CE4 A;  4H37 A;  2B9Z A;  1F4N A;  1L0N H;  1M1K W;  1VF7 A;  2ZNJ A;  3B09 A;  2IJJ A;  2F66 C;  4ZBM A;  2BOB C;  4K8Z A;  2Y69 B;  1N32 O;  1ZLZ A;  3H1K H;  3N27 A;  1AI6 A;  4H13 B;  1K34 A;  4IIJ B;  2OCH A;  4JF3 A;  3DXR A;  2CTW A;  3CCR V;  1TUB B;  3SGI A;  4WFF A;  5B1A C;  1GRJ A;  4LF7 O;  3PN1 A;  4ABM A;  1K92 A;  3I56 V;  4DV5 B;  4FLU A;  3MHS C;  3G6E V;  5IJ0 B;  1OZ0 A;  1K7D A;  2GV9 A;  2JGU A;  3TXS A;  3QF7 A;  2P5O A;  1BMF G;  1XMQ B;  5TIS Z;  4ZKI A;  2CH7 A;  2PGG A;  2JS5 A;  1NR1 A;  3H1J H;  1XL6 A;  4O2B A;  1VQP V;  3JAL A;  1HNW B;  3CB2 A;  4O4I B;  1U97 A;  4HAM A;  3CC7 V;  1ZUQ A;  1NU1 H;  4BWA A;  1W59 A;  2BTQ B;  4ZI7 B;  5JCO C;  3KG2 A;  2Q4P A;  5H2F Z;  5BR8 B;  3K9A A;  1XOU A;  4WFB V;  1M90 W;  4CS2 A;  3T2M A;  3CSX A;  4I5S A;  4BIO A;  2JIZ G;  4KUM A;  4ZHQ B;  4YY3 B;  2ZXW B;  4K35 A;  5L3F A;  2JK5 C;  1SF9 A;  2EZO A;  1RPO A;  3G80 A;  3D36 A;  3CXC U;  5DEC A;  4LBE C;  1F23 A;  3L74 H;  2YXL A;  3RYC B;  5LOV A;  5IYC O;  3K08 A;  2EUL A;  5BMV A;  4U7O A;  1YHQ V;  3K0G A;  1N32 B;  4WF9 V;  1Y4M A;  1Y66 A;  4O2B B;  4BR6 A;  1BZK A;  1GN6 A;  3UKM A;  4DR2 B;  4EKW A;  4JI0 O;  5HFL A;  5KA5 A;  3K5O A;  4D6T H;  2E3C A;  5KMG B;  4X1I B;  2E5L O;  1F4M A;  2QTS A;  3SYC A;  4HNA A;  1IBK O;  2QE7 G;  5H9C A;  1AP6 A;  5LMN O;  2OCC B;  2HP8 A;  2OT5 A;  3K03 A;  1KD1 W;  2Y69 C;  4I50 B;  2YSU B;  3JAL B;  3RN4 A;  5BMV B;  1VP7 A;  2E75 B;  1LUW A;  4DK1 A;  4TWK A;  2QM7 A;  1IXM A;  3OEH G;  4RAI A;  1QU7 A;  2HVJ C;  4B7E A;  5ITZ B;  2ZE6 A;  1MSD A;  2A3Q A;  4MVQ A;  2CAZ C;  2YI8 A;  2UXD B;  1KKD A;  2EIN C;  5LHG A;  1AJP A;  1SC5 B;  1WA8 A;  4IIJ A;  5IT9 N;  4DR6 B;  4JI8 B;  3CJH B;  2P06 A;  4LR3 A;  3WFV A;  3RGB A;  2CK3 G;  2XAQ A;  4JYA O;  1V9P A;  5LGU A;  4D7S A;  5CA0 B;  1H2S B;  1SES A;  3AG4 C;  5K1X A;  4TV8 A;  2WLI A;  2DW4 A;  2EIM C;  1GMG A;  1I94 O;  2ETN A;  2Y4U A;  3VOU A;  5FNV B;  4J41 A;  4CH3 A;  1J5E O;  4KHP B;  4LFC B;  1VQ6 V;  1BQ0 A;  1OJH A;  3QTC A;  4DR1 O;  4RQE A;  3ABL C;  4MVU A;  5B1B B;  1YJN V;  1QLE B;  4B3R O;  3W7W A;  1AVM A;  2XAG A;  3CEI A;  1P84 F;  1EZJ A;  4I4T A;  1CPY A;  4Z1V A;  1NVP D;  3VQV A;  4JAV A;  1S0V A;  4RUF A;  4WFE A;  4I9Q A;  1AI5 A;  3SDL A;  4GX2 A;  4NYK A;  1WPX A;  1VQN V;  1AR4 A;  4YJ2 A;  1S72 V;  2F95 B;  1D5A A;  3OTO O;  5CBG A;  3HR0 A;  1K73 W;  1DTO A;  1GM8 A;  4IYI A;  5IY5 C;  2WA4 A;  3ZHS A;  1KBH A;  1K5Q A;  3D8C A;  1K9M W;  4GZR B;  1AJN A;  3CRM A;  5JWP A;  2ZDI C;  3ABU A;  2X6B A;  5J9P C;  2DQ3 A;  2HFE C;  2Q8V A;  1TVK A;  4I9W A;  2CTQ A;  4JYC A;  3RYI B;  4X65 B;  1RP3 B;  1PPJ H;  5CA1 B;  4LF6 O;  4DR7 B;  4GLX A;  1XMO B;  1MOF A;  3UT5 A;  5IE9 A;  5C93 A;  1Q43 A;  1KEC A;  2ZIM A;  5KAI Z;  5LXT B;  1OV9 A;  1R3J C;  2UUC B;  3GB7 C;  3J80 N;  3DXR B;  3KKY A;  5KAF Z;  4KL1 A;  4JI4 O;  2IJI A;  5JQG B;  5KHI A;  3H9V A;  2ZKO A;  5LXT A;  1S5J A;  3NR7 A;  1US6 A;  3B8M A;  3ZMT A;  1JX9 A;  4O2A A;  4QIW F;  3BA9 A;  4H0L B;  3T1Y B;  1NI8 A;  1VMG A;  4DR5 O;  4OPH A;  2JJ2 G;  4UCR A;  3J81 N;  4JI2 B;  3ABM C;  1K5S A;  2DN9 A;  1MZE A;  5LMU O;  3A0R A;  4G28 B;  1W0K G;  4DR2 O;  1TGO A;  3AG7 A;  3H01 A;  5KLV H;  1KQS U;  3JAT A;  4R8C A;  3R66 A;  1Z2G A;  2UXN A;  2CTR A;  2ZQM A;  1PL4 A;  5CA1 A;  2EBO A;  4J42 A;  5LHH A;  3RW0 A;  4LFB B;  1FKA O;  4DV7 O;  3CC4 V;  5KHJ A;  3K5M A;  2CDY A;  3ZHR A;  4J7Z A;  3H1H H;  1SA0 B;  3FB5 C;  2DYS C;  1LUV A;  3BY6 A;  1EZV H;  4X1K B;  2K1E A;  4UUJ C;  4PA4 A;  3O65 A;  3QVN A;  1IBL O;  3AEI A;  1THZ A;  2N05 A;  3EHB B;  4U3F H;  5LA6 B;  4IGG A;  2QWN B;  2V4D A;  5BY1 A;  1XHX A;  4LF9 O;  2DQ0 A;  3JAS A;  2HVK C;  4FLZ A;  2Z0A A;  3UO3 A;  3FX7 A;  2ARH A;  1U96 A;  2ZE7 A;  3OT7 A;  3N2G A;  3IGA C;  4X64 B;  1RM1 C;  3P30 A;  1R6N A;  3E8B A;  3BAB A;  4TT3 G;  1KMI Z;  3DTU B;  2AW9 A;  2W6I G;  3E83 A;  4NKG B;  1TA8 A;  4FIP C;  4F6E A;  4O4L B;  1R6T A;  2EIK C;  4PDL A;  2EZP A;  4RUE A;  1DGS A;  1JFF B;  2P4K A;  3A8T A;  3CCL V;  3WB0 A;  2Q6A A;  1B3Q A;  1F51 A;  1XI1 A;  2GSM B;  2Q68 A;  4B3M O;  4UV8 A;  1EBO A;  3B2E E;  3RYH A;  4NXN O;  1JJO A;  2ZXW C;  5FL7 G;  2R70 A;  1BHA A;  1OCC C;  4LCU C;  5K1P A;  5B3S C;  2AHY A;  4XBF A;  4FM0 A;  2KKW A;  1VQL V;  1YTF B;  4DRX A;  2UXC B;  1VQ8 V;  4CBC A;  4WFA V;  4J9Z B;  4R6Z A;  2MK3 A;  2BTO A;  2Y0P A;  3K0D A;  3O9O A;  2A9H A;  5KHK A;  2ZE5 A;  5C8Y A;  5FPO A;  3HPL C;  2X6C A;  1TUE B;  3CMA V;  4UCT A;  4BW9 A;  1JMK C;  2ZM6 B;  4PEL A;  2KB1 A;  2D2C B;  1VQO V;  2F4V B;  1R3I C;  3HKD B;  1F7Y A;  2EIL C;  2XAJ A;  1XNQ B;  2YIB A;  3WG7 C;  3SJQ C;  1G1X B;  2ZR3 A;  5DN6 G;  4FVM A;  3CCM V;  3RYC A;  2JRI A;  1IVS A;  1MZF A;  5CN0 A;  1HNX O;  1V54 B;  4GX0 A;  5LBQ A;  1QCE A;  2H3O A;  2IJK A;  5AG2 A;  4Z1M G;  1Q6I A;  4FJC C;  3CCU V;  1PM9 A;  4LH6 A;  4DV1 O;  1Z5V A;  1FXK A;  4JYY A;  3K57 A;  1SKV A;  1N34 O;  3JAK A;  1I94 B;  3RVY A;  3AK2 A;  4JTA B;  1NTM H;  4JYB A;  4PDV A;  1OHH G;  1AIL A;  3E8G A;  2CH7 B;  4PD4 F;  3K06 A;  4L87 A;  3JAK B;  4DYL A;  2QEX V;  4AQY O;  3ZRW A;  4ICG A;  1ZX3 A;  1XIL A;  1Q81 W;  4JV5 O;  4LFB O;  2DYS B;  2GTA A;  2H94 A;  5LGT A;  4FFB A;  3JD4 A;  4UV9 A;  4NXN B;  4B3T B;  3JAR B;  4JI0 B;  5F2V O;  3BPZ A;  2L35 A;  3FKS G;  1Y67 A;  3JD1 A;  1KP2 A;  4I55 A;  1K33 A;  1YIJ V;  1BSM A;  2FYU H;  3P32 A;  4DR3 B;  5LYJ B;  1MG1 A;  3NXS A;  1YXB A;  2WA3 A;  3T1Y O;  1GN3 A;  2LP7 A;  3OE7 G;  4MSW C;  1QNM A;  2P90 A;  1RPR A;  4C7U A;  3UO2 A;  4MVM A;  4DV3 B;  2IH1 C;  2A06 H;  1UFI A;  3JD2 A;  3AG1 B;  1VQ7 V;  3K5N A;  2Q9L A;  3FAV B;  1NVP B;  5L3D A;  2GBO A;  4JZG A;  1FAF A;  4P2Z A;  3OGC C;  3CRA A;  3SJA C;  2D3O W;  3FD9 A;  5D5Q A;  1P4R A;  1N0N A;  2EIJ C;  2LO1 A;  1XQ8 A;  3S3W A;  4G27 B;  3APO A;  3OUF A;  2JEX A;  5CB4 B;  1YIT V;  3RBZ A;  3MDS A;  2Q7G A;  3T1C A;  1AB3 A;  3JD0 A;  2XOK G;  3N2K A;  1SQG A;  3F7Y C;  2RCV A;  2QKS A;  2DE0 X;  3CCE V;  5KHG A;  4LF5 B;  1HDJ A;  2LFS A;  4GCZ A;  1XNR B;  3K3W A;  3OMA B;  3N2K B;  1Q6U A;  3BFR A;  3CX5 F;  3U0Z A;  1SET A;  2WLI B;  3ETD A;  1PNL A;  3VQY A;  4J9Y B;  2OWO A;  1XMO O;  1VQ9 V;  2B5U A;  2P6J A;  2Q7E A;  1GM7 A;  1Q7Y W;  3E2E A;  3OTO B;  2EJR A;  2PI5 A;  3AK3 A;  1ZWI C;  3UCS C;  4JTD B;  1HWY A;  3LSQ A;  1SQV H;  1V54 C;  1YZB A;  1FXV A;  4DRX B;  3FYI B;  3CCS V;  3AG1 C;  4X89 A;  1WPB A;  1Z5W A;  3RYI A;  1Y76 A;  3RT3 C;  1QLE C;  2WLL B;  1UPG A;  2ZIO A;  2Y0I A;  4YXW G;  4X66 B;  2R9I A;  2EX3 A;  2ZE8 A;  1Y76 B;  3WU2 Z;  4B3S O;  3SPC A;  2DWD C;  1JA8 A;  3SJB C;  1YEW A;  1ZTE A;  1ZL8 B;  1QLN A;  1GKF A;  5FNV A;  1Q82 W;  4LF6 B;  4WFH A;  3AG4 B;  1R3K C;  3G6B A;  2Q0O C;  5B1B C;  3OUS A;  4GX1 A;  4MTO A;  2ITD C;  3A0H Z;  3ABK C;  3JAR A;  3ZBH A;  3G71 V;  2BE3 A;  4LC1 A;  5EBW C;  3HKC A;  3RYF B;  4I7Z B;  1KB9 F;  2UXC O;  4GYC B;  1RSO B;  4X88 A;  1NH2 B;  2Q5Z A;  1JPX A;  2UUC O;  4AI8 A;  1VF6 C;  5GW7 A;  4CC6 A;  4JI7 O;  4DW0 A;  5KA6 A;  4MVZ A;  2IH3 C;  5CMU A;  1DF4 A;  2BTQ A;  3Q4H B;  3D3I A;  1L0L H;  1Q3E A;  4K3A A;  4DV2 O;  1EN4 A;  4P30 A;  2QJ1 A;  4MW3 A;  3IFX A;  4LF5 O;  1Q86 W;  5JJJ B;  3HKD A;  5LP6 B;  2FL4 A;  2HHH B;  5IWA O;  3BCC H;  3H1L H;  1PNK A;  4H33 A;  1M57 B;  4NB5 A;  1XNR O;  4X8A A;  1WNS A;  1Q8I A;  2QTO A;  4LF7 B;  4LWS A;  3RWR D;  1GK9 A;  4E4E A;  1AR1 B;  2XND G;  2M6Y A;  4J10 A;  2UUB B;  2WWW A;  1TUB A;  2NLJ C;  2ODM A;  3APQ A;  1WB8 A;  4CC5 A;  2KSD A;  3IC9 A;  4GKK B;  4KFM A;  4W4L A;  3LSS A;  1W2B U;  4X20 A;  5EK0 A;  5H6Q A;  2LGQ A;  2YUA A;  3VBB A;  4DV3 O;  1Q90 D;  5KUM A;  1EM1 A;  4PI2 A;  3LDC A;  4LF8 O;  3ML0 A;  3FFQ A;  1XDC A;  3QO5 A;  4O2A B;  1GH6 A;  2UU9 B;  3ASO B;  2EIM B;  4MW8 A;  4TV8 B;  2BCC H;  3JD3 A;  2QDO A;  2Q69 A;  4DK0 A;  1YTF D;  1Q6H A;  4K0K O;  3CD6 V;  1ZSP A;  2AZ0 A;  3HKC B;  1EN5 A;  4E2L A;  2NNU A;  2N74 A;  1NH2 D;  2L6L A;  5H6R A;  4LFA O;  2V1D A;  4X64 O;  4OGQ B;  2Q67 A;  5BZB A;  2YIB D;  1PV0 A;  1VQK V;  1HNZ B;  2ILM A;  3Q4H A;  4LF4 O;  5HFM A;  2YEV B;  2ADP A;  4O4J B;  4ASU G;  2ZNI A;  5EBM C;  4WBN A;  4JZ2 A;  4DV6 B;  3OMN B;  2W6J G;  2PYJ A;  2OCC C;  4IYH A;  4UB6 Z;  5LGN A;  1G8M A;  2XHB A;  4BW5 A;  3BVO A;  3M99 B;  4XDL A;  4HYO A;  1I08 A;  2Q0A A;  3QO7 A;  2UXB O;  2H8P C;  1BCC H;  1YJW V;  1FPO A;  1CXZ B;  3EVK A;  3JAW A;  2FB5 A;  5B1N A;  5BR8 O;  1GO3 F;  3CXH F;  3SYA A;  4JI4 B;  3ZMU A;  4DV0 O;  3M7M X;  3B4S A;  1KKC A;  3ZED A;  3W7U A;  3JAS B;  3X2Q B;  4MTF A;  1I5Y A;  4DV1 B;  2YIA A;  3ZHV A;  1NQT A;  1NZ6 A;  5EIB C;  1LNQ A;  3LDE A;  4JI6 O;  2QKA A;  4MS2 A;  1URF A;  1SZT A;  5GON B;  2JVD A;  4PJ0 Z;  1XL4 A;  2UU9 O;  5LMU B;  4UCU A;  2G38 A;  4YJ3 B;  5GON A;  3OM3 B;  2P4V A;  3K58 A;  2VWK A;  1JFF A;  3G4S V;  4FLY A;  3QO8 A;  1BQZ A;  4PHZ A;  3CCJ V;  1SA0 A;  3THO A;  1N36 B;  1UJW B;  1W0J G;  3CRQ A;  1NS1 A;  4NTW A;  4DUZ B;  3LNM B;  1OCZ B;  1Y6X A;  2X7R B;  2VWJ A;  2KG7 B;  5JCO A;  3WB2 A;  1M56 C;  5D5P A;  3STL C;  4BIU A;  2YID A;  3GWK C;  1EN6 A;  1OCO B;  3OMI B;  5H5N A;  5LL6 Y;  4EB6 A;  4YHH O;  2ATK C;  2FKX A;  4JI3 B;  5B1O A;  2PF4 E;  2F23 A;  3UT5 B;  1MSW D;  2ITC C;  4O4H B;  1T5E A;  4MTG A;  2VQE O;  2QA4 V;  1B04 A;  4FPP A;  3F5W C;  5B3S B;  4AQY B;  1XUQ A;  4LNU B;  2HHH O;  1YCI A;  4FLX A;  3LSU A;  3E35 A;  1OCC B;  5LHI A;  2F1M A;  1BHB A;  4UVC A;  1GTO A;  3I5D A;  4DW1 A;  1IBL B;  1QHT A;  1CEZ A;  1HR0 B;  3OFN G;  1YVW A;  2HJF C;  3UM7 A;  1XBL A;  3GWO A;  3MD0 A;  4GX5 A;  1FFX A;  2WLM A;  4JI8 O;  2UXX A;  5CBH A;  1P7B A;  4JGS A;  1WLE A;  3CE2 A;  4D7T A;  3JSL A;  1SQX H;  2VQE B;  1AR5 A;  3JSN A;  2B1I A;  4PI0 A;  1TAE A;  4QE9 A;  1M93 A;  2EIN B;  4UFZ A;  4F6R B;  3L72 H;  4EFE A;  2B1G A;  2EIL B;  1IX9 A;  4JI1 O;  5KX5 B;  1OCO C;  2LW1 A;  1OCR C;  5GTH Z;  3LNN A;  1J5E B;  1S3J A;  1IBM B;  1G4Y B;  2Y4T A;  4PA3 A;  3ZN0 A;  2XUM A;  2Y48 A;  3OAA G;  4GT1 A;  4UXN A;  3B77 A;  3CHX A;  4OX9 B;  2YDE A;  4AHC A;  3SYQ A;  5EYP A;  4YIP A;  3IJ4 A;  5B5E Z;  5EIB D;  3FB7 C;  4IHJ A;  1N33 B;  4J80 A;  1QR8 A;  3ABT A;  2JDI G;  2YXH A;  5IYZ A;  5EZY A;  3SR2 C;  2E5L B;  4AIL C;  2DYR B;  3OTF A;  1HNZ O;  2EIK B;  1KC8 W;  4PDR A;  1LR1 A;  4MVR A;  4BAY A;  2OYQ A;  4N21 A;  1AI7 A;  3D3Q A;  4EFB A;  2AHZ A;  3ABK B;  3KCX A;  5EC1 C;  2VQF B;  1L8D A;  3L70 H;  3R65 A;  4OPA A;  5JH7 B;  2XTA A;  3CCQ V;  4YHH B;  1O9G A;  1H2K A;  3TCU A;  1JVM A;  2PUS A;  4YJ3 A;  4FFK A;  1BE3 H;  4TQF A;  3EXA A;  3F5T A;  1E79 G;  1IBM O;  1SER A;  1QR9 A;  2CGO A;  3CP1 A;  4DR4 B;  4PA9 A;  1BGY H;  4O4L A;  4CS4 A;  5BXZ A;  3UQ8 A;  1GM9 A;  3RFR A;  1IBK B;  1ARO P;  3W7S A;  1I7F A;  2JEU A;  5JJE B;  3K79 A;  3ZJZ A;  5IYZ B;  4RQF A;  4JYA B;  2A7W A;  3U10 A;  4LF4 B;  4JAA A;  4FFB B;  1IUR A;  3A0B Z;  4J7K A;  4Q6G A;  4GUN A;  4OXS A;  1WN7 A;  1BS3 A;  4XDK A;  2IJH A;  2DYR C;  5L3C A;  1D5N A;  4KXR A;  2UUA O;  2KQX A;  2K9P A;  4JV5 B;  1BT8 A;  4TUY B;  4P9O A;  1SRY A;  2YXY A;  4PV1 B;  3JCU Z;  2QM8 A;  3ASN B;  2ZM6 O;  3QG5 A;  1L1F A;  3IAY A;  3DC5 A;  1YJ9 V;  4KHP O;  4B3T O;  2ZDI A;  3JAM N;  1JCH A;  4DV0 B;  1N8R W;  2QWO B;  3HKE B;  4O4J A;  4RWU A;  1P7G A;  4DXW A;  2ZIN A;  1Y74 B;  4NR1 A;  4FZ0 A;  2F93 B;  5IDJ A;  3LUT B;  1WJZ A;  3H1I H;  3C3S A;  3ZX6 A;  1OCR B;  4R50 A;  2PTM A;  5CA3 A;  4I0X B;  1CP9 A;  2CUG A;  1VF6 A;  3AG2 B;  3DGE A;  4X1Y B;  4DR6 O;  1I5X A;  3ABL B;  4JPR A;  3N2G B;  3F7V C;  5KHH A;  1GN2 A;  1MA1 A;  2JS3 A;  4Z2W A;  1SQQ H;  2NR5 A;  2VQF O;  4TUY A;  1WAZ A;  4DV4 O;  1SQB H;  2ZR2 A;  5J2T A;  1Q5O A;  4L8J A;  2HLD G;  3A2F A;  2IBZ H;  3CS5 A;  2VRZ A;  1PNM A;  5LYJ A;  1IXB A;  1M9N A;  1WP7 A;  4NXM B;  2ADQ B;  3HB3 B;  1S76 D;  4I0X A;  1R3L C;  3L73 H;  1S5H C;  3FB8 C;  2A79 B;  2R72 A;  4KP4 A;  1ZL8 A;  2F43 G;  4B08 A;  1H38 A;  4LP8 A;  2WLK A;  2YIC A;  3STZ C;  4YY3 O;  2XAS A;  2UUB O;  3ZMS A;  3ETQ A;  2ZD9 A;  1X4T A;  2Q73 A;  2OIG A;  2BSK A;  3IC7 A;  5ITZ A;  3T4D A;  4A5U B;  3ZRW B;  4MVS A;  3JAT B;  2C2A A;  2GUZ A;  1AI4 A;  1V55 C;  2BSK B;  2QWQ B;  1XNQ O;  1HNW O;  4TQD A;  2ZT9 B;  3TK1 A;  4W4K A;  2WLL A;  4DR7 O;  2LQT A;  4X1K A;  2PZS A;  1H2L A;  4WBN B;  1NTK H;  3MHH C;  5DED A;  3CWB H;  4QNH B;  2F4V O;  3ZHQ A;  4QGP A;  3E22 A;  3OR7 C;  4UB8 Z;  3L75 H;  3E86 A;  3TXQ A;  1HR0 O;  1FS0 G;  3PJS K;  2YS8 A;  2QM4 A;  2E76 B;  4FK5 C;  1SQF A;  1FFT B;  2KG7 A;  4X1Y A;  1E1Q G;  5E79 Z;  1VAR A;  5DM6 V;  1SQP H;  3J7A U;  3SPI A;  3TGU H;  2JGD A;  4PDM A;  1V55 B;  3AG3 C;  4IL6 Z;  4P9P A;  3RYH B;  2N04 A;  1D2D A;  1VF5 B;  1XRE A;  4J7J A;  4HZ3 A;  5J2T B;  1B6Q A;  1M56 B;  1FJG B;  3ETE A;  4DV4 B;  1OCZ C;  4ZOL A;  2UXD O;  1KP3 A;  2CGN A;  1O9H A;  3EFF K;  4QE7 A;  5KUK A;  4R7C A;  1FXK B;  4HBN A;  4B3R B;  1PKX A;  2UXB B;  3CC2 V;  3D36 C;  2EJ7 A;  4JTC B;  4DV7 B;  4FLT A;  4U3J A;  4DUY O;  2AZ2 A;  2JJ1 G; 
#chains in the Genus database with same CATH homology
 3X2Q B;  1K92 A;  4MTF A;  3K04 A;  1I5Y A;  3ZMZ A;  2W0F C;  2A9H A;  3I56 V;  4Q20 A;  3MHS C;  2P7T C;  3G6E V;  1NQT A;  1OZ0 A;  1H8E G;  3HPL C;  1LNQ A;  1K7D A;  2X6C A;  3LDE A;  1TUE B;  4MS2 A;  4RO2 A;  3CMA V;  1DF5 A;  1SZT A;  1BMF G;  5E1A C;  4TSF G;  4PEL A;  4ZKI A;  3OEE G;  1XL4 A;  1NR1 A;  2KB1 A;  1VQO V;  1R3I C;  1XL6 A;  1VQP V;  2EIL C;  4HAM A;  3CC7 V;  2XAJ A;  3OM3 B;  3WG7 C;  3SJQ C;  2ZR3 A;  5DN6 G;  3G4S V;  3QO8 A;  3CCM V;  3CCJ V;  2BOC C;  3KG2 A;  1NBM G;  3K9A A;  1UJW B;  4WFB V;  1W0J G;  1M90 W;  5CN0 A;  1V54 B;  3T2M A;  4GX0 A;  5LBQ A;  3LNM B;  1OCZ B;  2X7R B;  1QCE A;  4I5S A;  2PI4 A;  2IJK A;  2JIZ G;  1ROP A;  4Z1M G;  1M56 C;  4KUM A;  4PA6 A;  3SPG A;  4F4L A;  3STL C;  4BIU A;  4FJC C;  3CCU V;  2ZXW B;  1OCO B;  1DLB A;  3OMI B;  5L3F A;  1FXK A;  2ATK C;  3SPJ A;  2JK5 C;  5B1A C;  5B1O A;  2EZO A;  1RPO A;  1MSW D;  2ITC C;  2Z3Y A;  4MTG A;  2EIJ B;  3D36 A;  3CXC U;  4MVO A;  2QA4 V;  3RVY A;  2M7W A;  4FPP A;  2GHY A;  2WSS G;  3F5W C;  4JTA B;  5B3S B;  4LBE C;  4JYB A;  4PDV A;  1F23 A;  1OHH G;  1QBZ A;  3E35 A;  5IYC O;  3K08 A;  1OCC B;  3B8N A;  3E8G A;  4U7O A;  5LHI A;  3K0G A;  1YHQ V;  4WF9 V;  1BHB A;  1Y4M A;  3K06 A;  4L87 A;  3ZCC A;  2QEX V;  2FTK A;  4UVC A;  1GTO A;  2WLH A;  1Y66 A;  1R73 A;  4G2K A;  3ZRW A;  3UKM A;  1CEZ A;  3OFN G;  1Q81 W;  3E89 A;  2HJF C;  4EKW A;  4FMT A;  3UM7 A;  5HFL A;  2DYS B;  3ZIA G;  2H94 A;  5LGT A;  2IU3 A;  2Z5U A;  3JD4 A;  3WG7 B;  3GWO A;  3MD0 A;  5KA5 A;  4UV9 A;  2DWE C;  4JAU A;  4GX5 A;  2WLM A;  2UXX A;  1F4M A;  3SYC A;  5CBH A;  1P7B A;  3CME V;  4JGS A;  3FKS G;  1WLE A;  3JD1 A;  2QE7 G;  5H9C A;  1KP2 A;  2OCC B;  2B1I A;  3E8F A;  1K33 A;  4QE9 A;  2EIN B;  2IW5 A;  2OT5 A;  4UVB A;  1YIJ V;  3P32 A;  3FYE B;  2B1G A;  2X0L A;  2EIL B;  3K03 A;  1KD1 W;  2WLJ A;  2Y69 C;  1OCO C;  1MG1 A;  3NXS A;  1YI2 V;  5L3E A;  2YSU B;  3TET A;  1OCR C;  3FB6 C;  2X6A A;  2XAF A;  1S3J A;  2P67 A;  2LP7 A;  4TWK A;  3OE7 G;  1G4Y B;  4MSW C;  2P90 A;  1RPR A;  2QM7 A;  1IXM A;  4PA3 A;  3OEH G;  3ZN0 A;  4RAI A;  3OAA G;  2Y48 A;  4MVM A;  4GT1 A;  4UXN A;  4WCE V;  3B77 A;  1RM1 B;  2IH1 C;  2HVJ C;  3X2Q C;  2WPD G;  4MVQ A;  3JD2 A;  1PD3 A;  3AG1 B;  1KKD A;  2EIN C;  3SYQ A;  5LHG A;  1AJP A;  1VQ7 V;  1VQ5 V;  3FB7 C;  5B1A B;  1NVP B;  2OTJ V;  5L3D A;  1QR8 A;  3ABT A;  1MAB G;  2IU0 A;  2JDI G;  3ZRX A;  3AG2 C;  4P2Z A;  3CYO A;  3OGC C;  1QVG U;  1JOY A;  3QNE A;  2DYR B;  4XDJ A;  3WFV A;  3ZN1 A;  2D3O W;  2EIK B;  1KC8 W;  1P4R A;  4PDR A;  2CK3 G;  2XAQ A;  4MVR A;  4BAY A;  4N21 A;  1YSC A;  5LGU A;  1AI7 A;  2EIJ C;  4BIZ A;  2AHZ A;  4G27 B;  3ABK B;  3ETG A;  5EC1 C;  3OUF A;  1H8H G;  2JEX A;  1SES A;  3AG4 C;  1YIT V;  3RBZ A;  3W7T A;  1VQ4 V;  2WLI A;  2DW4 A;  3T1C A;  2EIM C;  1GMG A;  3JD0 A;  2XOK G;  1PL0 A;  3R65 A;  3F7Y C;  2QKS A;  3VOU A;  4U7N A;  3CCE V;  3CCQ V;  3TCU A;  1VQ6 V;  1JVM A;  2LFS A;  1VQM V;  4GCZ A;  3K3W A;  3OMA B;  4RQE A;  1SET A;  3ABL C;  2WLI B;  3ETD A;  1E79 G;  4MVU A;  5B1B B;  1YJN V;  1QLE B;  1SER A;  1QR9 A;  1PNL A;  3CP1 A;  4J9Y B;  4PA9 A;  4QPJ A;  3ZRV A;  3W7W A;  2HG5 C;  2XAG A;  1EZJ A;  1GM9 A;  1CPY A;  1VQ9 V;  1NVP D;  4CZZ A;  4JAV A;  1ARO P;  2B5U A;  2P6J A;  1GM7 A;  3W7S A;  1S0V A;  1Q7Y W;  2JEU A;  4RUF A;  4WFE A;  3E2E A;  1K4D C;  1ORQ C;  2EJR A;  2PI5 A;  1AI5 A;  1ZWI C;  4JTD B;  3K79 A;  3ASN C;  4GX2 A;  1WPX A;  3ZJZ A;  4RQF A;  1VQN V;  1HWY A;  3LSQ A;  3OR6 C;  1V54 C;  3ASO C;  1FXV A;  1S72 V;  1NKD A;  3FYI B;  3CCS V;  3AG1 C;  1NR7 A;  2V7Q G;  4X89 A;  5CBG A;  1K73 W;  1DTO A;  1FXK C;  1GM8 A;  4OXS A;  1QLE C;  2WLL B;  5IY5 C;  1QVF U;  4XDK A;  2IJH A;  1K5Q A;  4YXW G;  2DYR C;  5L3C A;  1K9M W;  2R9I A;  1AJN A;  2R9R B;  2ZDI C;  3ABU A;  5L3G A;  2X6B A;  5J9P C;  4P9O A;  1SRY A;  3SPC A;  1FXH A;  2DWD C;  2DQ3 A;  2QM8 A;  3ASN B;  2HFE C;  1L1F A;  1YJ9 V;  1EFR G;  1J95 A;  4I9W A;  4JYC A;  1R6K A;  2ZDI A;  1QLN A;  1JCH A;  1N8R W;  5IYD O;  1GKF A;  1Q82 W;  1COW G;  4DXW A;  4WFH A;  4MT8 A;  3AG4 B;  1R3K C;  5IDJ A;  1MOF A;  3LUT B;  3JCZ A;  5C93 A;  1KEC A;  5B1B C;  3OUS A;  4GX1 A;  4MTO A;  2ITD C;  3ABK C;  1R3J C;  1OCR B;  4R50 A;  5CA3 A;  5L3B A;  3G71 V;  3GB7 C;  4LC1 A;  5EBW C;  1CP9 A;  3AG2 B;  1JQ0 A;  3DGE A;  2IJI A;  5EBL C;  3SYP A;  4X88 A;  1NH2 B;  1I5X A;  1JPX A;  3RVZ A;  3ZMV A;  3ABL B;  5GW7 A;  2A0L A;  1H2G A;  5KA6 A;  4MVZ A;  4JPR A;  3B8M A;  3ZMT A;  1JX9 A;  2XAH A;  4QIW F;  3F7V C;  2IH3 C;  5CMU A;  1DF4 A;  2JJ2 G;  4DO2 A;  3ABM C;  4JAS A;  3D3I A;  1K5S A;  1K97 A;  3A0R A;  2ZR2 A;  4P30 A;  3CPW U;  4G28 B;  3I55 V;  2HLD G;  4MW3 A;  3IFX A;  1Q86 W;  1W0K G;  3ZRS A;  1S77 D;  4N23 A;  1PNK A;  3H01 A;  4H33 A;  1PNM A;  1M57 B;  1KQS U;  4X8A A;  4R8C A;  2QTO A;  2UXN A;  3SYO A;  1M9N A;  2ZQM A;  5EC2 C;  3HB3 B;  1E1R G;  1S76 D;  2WLN A;  3BEH A;  1R3L C;  1GK9 A;  3JYC A;  3E8H A;  1S5H C;  2EBO A;  3FB8 C;  5LHH A;  3RW0 A;  2A79 B;  4QPK A;  4KP4 A;  1H38 A;  2F43 G;  1AR1 B;  4LP8 A;  2WLK A;  3STZ C;  3CC4 V;  2XND G;  2OTL V;  5IY5 B;  2XAS A;  3ZMS A;  1K4C C;  2WWW A;  2ZD9 A;  3OW2 U;  3FB5 C;  2DYS C;  3BY6 A;  2NLJ C;  3IC7 A;  3LDD A;  2WAM A;  3T4D A;  3ZRW B;  2K1E A;  4KFM A;  4UUJ C;  4MVS A;  4PA4 A;  3LSS A;  1W2B U;  5EK0 A;  5H6Q A;  2C2A A;  5CBF A;  1AJQ A;  1AI4 A;  3VBB A;  4WFG A;  5KUM A;  1V55 C;  3AEI A;  1THZ A;  3EHB B;  3LDC A;  1NJI W;  3ML0 A;  3TK1 A;  2WLL A;  3QO5 A;  5IYB O;  3ASO B;  3AG3 B;  3MHH C;  2DQ0 A;  4QNH B;  2EIM B;  4MW8 A;  2HVK C;  3W7X A;  2YEV A;  3JD3 A;  3OR7 C;  1K3E A;  2Q69 A;  1YTF D;  1JJ2 U;  3SPH A;  4PA7 A;  3IGA C;  3CD6 V;  1RM1 C;  3E86 A;  3P30 A;  1R6N A;  3E8B A;  1FS0 G;  3PJS K;  4E2L A;  1ENV A;  1M57 C;  4TT3 G;  3DTU B;  4FK5 C;  2NNU A;  1FFT B;  1NH2 D;  3ABM B;  1E1Q G;  2W6I G;  2HR3 A;  2LFR A;  5H6R A;  3E83 A;  5DM6 V;  2V1D A;  4FIP C;  2Q67 A;  5BZB A;  3SPI A;  3CCV V;  4PDM A;  4QJF B;  1V55 B;  1VQK V;  4MTX A;  2EIK C;  4PDL A;  3T4Z A;  2EZP A;  3AG3 C;  4P9P A;  4RUE A;  5HFM A;  2YEV B;  4UVA A;  4HZ3 A;  2HKO A;  3CCL V;  1B6Q A;  1M56 B;  4ASU G;  2Q6A A;  3ETE A;  1F51 A;  5EBM C;  3OMN B;  1OCZ C;  2W6J G;  1BL8 A;  2OCC C;  2GSM B;  2Q68 A;  1K8A W;  1KP3 A;  5LGN A;  1G8M A;  4UV8 A;  3EFF K;  4H37 A;  4QE7 A;  1F4N A;  1EBO A;  4BW5 A;  1M1K W;  3M99 B;  4XDL A;  4HYO A;  5KUK A;  3QO7 A;  2ZXW C;  4R7C A;  1FXK B;  5FL7 G;  1PKX A;  2H8P C;  1YJW V;  2IJJ A;  1BHA A;  1OCC C;  4ZBM A;  2BOB C;  2Y69 B;  4LCU C;  3CC2 V;  1AI6 A;  4JTC B;  5B1N A;  5B3S C;  1GO3 F;  2AHY A;  1K34 A;  3SYA A;  4XBF A;  1VQL V;  4JF3 A;  1YTF B;  1VQ8 V;  3ZMU A;  4CBC A;  4WFA V;  4J9Z B;  3CCR V;  4WFF A;  4R6Z A;  2MK3 A;  2JJ1 G;  3W7U A;  3K0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...