2LFRA

Solution structure of the chimeric af1503 hamp- envz dhp homodimer
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of regulation of receptor histidine kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus, shigella flexneri
molecule tags Transferase
molecule keywords Uncharacterized protein, Osmolarity sensor protein envZ chim
total genus 43
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00672 HAMP HAMP domain
A PF00672 HAMP HAMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lfrA00
4ZKIA 4LC1A 4MTXA 4FMTA 5B1NA 3P32A 4QPJA 4JASA 4GCZA 2C2AA 2WWWA 4Q20A 4MT8A 5B1OA 4JYBA 3ZCCA 2QM8A 3D36A 3ZRWA 1IXMA 3ZRWB 4BIUA 4KP4A 2LFSA 2QM7A 1F51A 5C93A 3MD0A 4JYCA 4U7NA 4JAUA 3ZRVA 2FTKA 4JAVA 5IDJA 3NXSA 3A0RA 3DGEA 4I5SA 4U7OA 1JOYA 4QPKA 2LFRA 4FPPA 4GT1A 2P67A 3TK1A 3ZRXA 4BIZA
chains in the Genus database with same CATH superfamily
3BA8A 2ETNA 1H2GA 2H94A 5CA1B 4J7KA 1BL8A 5FL7G 3OW2U 4IGGA 2QM8A 3D36A 1K92A 1BT8A 3ZEDA 5H6QA 1RSOA 3HB3B 1GO3F 4K0KB 2XUMA 5EIBC 5LMNB 3IC7A 3JD1A 4TOIA 4FLYA 1S77D 4F6EA 3D8CA 3PJSK 3JD0A 4LWSB 1TA8A 1B04A 1PL4A 2QKAA 4DV2O 4JI6O 4R8CA 2R9AA 3LDDA 4JTAB 1Q86W 2Q5ZA 4F6RB 5L3BA 3L75H 3RFRA 3ETGA 4LF6B 3HKDA 1BQ0A 4X89A 4ZIBA 1R3JC 3D36C 2A3QA 4DR5B 4X62B 4WFHA 4JYCA 5KUKA 1M56C 4O4JA 4Z1MG 5LGTA 1S5LZ 4OPAA 5AG2A 5FPOA 1FXKA 1HR0B 4YJ2A 4PA7A 1OJHA 3KG2A 2HJFC 2RN9A 4ZHQA 2IJHA 3J80N 2IM9A 4DR3O 4FZ1A 1M9NA 4J42A 5GTHZ 1NKDA 1NTMH 4FLZA 5EC1C 3ZRVA 5LHHA 2H3OA 4CH5A 3FB7C 2DE0X 4YIPA 3CRCA 1PKXA 2FMLA 4X1IA 2EIJC 3CCMV 1K73W 1EN4A 2XAGA 4NXNO 3U11A 2IJJA 2IU0A 1IXMA 3F5TA 4LFBB 4TV9B 4NVPA 3TCUA 5LP6A 3K58A 2ZINA 5LMNO 1EN6A 4UV8A 3BHPA 2BTQB 4JI8O 3E83A 3L70H 2AZ0A 2AXTZ 3RYIB 1ORQC 1LR1A 4B3RB 1EZVH 2DW4A 3AEIA 2WSSG 4NTWA 4UCVA 4AILC 3GWKC 4ABMA 4B3MB 4GX5A 3F5WC 5GONB 2JIZG 3BA9A 4MW3A 2FL4A 2HP8A 3MAQA 4B7EA 4JYAO 3ABTA 2W0XA 4DV2B 1XOUA 3HKEB 2M6YA 4DR7O 2P4KA 4GX0A 1XI1A 4E2LA 3BCCH 4KP4A 1HDJA 3FFQA 1O9HA 3OE7G 2FKXA 2YI8A 3ABKC 4ZHQB 3ASNB 4DK0A 4WBNB 5B1BC 4LFBO 1AI7A 4FLUA 3LDCA 2ZD9A 1NR7A 2YS8A 5EBLC 1PV0A 1KECA 3UKMA 2BCCH 4D6TH 3ZMSA 1VARA 4K8ZA 2WLLA 1V55C 2E74B 2XHBA 4FM0A 1TVKB 3CCLV 3WG7C 4QPJA 3N2KB 5J2TB 2UUCB 5KHGA 1RFYA 5LL6Y 3UT5B 1QLNA 1COWG 3P3PA 2WPDG 2EX3A 1H2MA 4FJCC 4MVQA 2YICA 2ZNIA 1SKVA 2KB1A 4MTGA 5K1PA 2CE4A 1VQ4V 4LC1A 2UXXA 3ABLB 1YEWA 4EEQA 3K5LA 1R3LC 5CB4A 2ZIOA 3MDSA 1SZTA 3ASOC 2PI5A 2ADPA 3GWOA 4J7ZA 1P7BA 4DUZO 2A7WA 4UXNA 1DF5A 3EFFK 2ARHA 2XASA 3D3IA 2R72A 2YIBA 4NXNB 3RGBA 1QLEC 3I5DA 1AROP 5BXZA 2DYRB 1QHTA 2VQEB 4B3TB 4E4EA 3AG2C 3ASOB 1Q8IA 2IH3C 2ITDC 1ZL8A 3FB8C 3WG7B 2VWKA 4WFGA 4WBNA 5HFLA 3T1HB 1BS3A 3LSSA 3LUTB 2EINB 4IIJB 3X2QB 4CC6A 3K5NA 1R6TA 4YHHB 5KA6A 1VF7A 2ZQMA 2QE7G 4BW5A 1G4YB 3L74H 3SR2C 2AZ2A 3FB5C 5BR8B 2KKWA 4NB5A 1HNZB 3K0GA 4WFAV 3QVNA 4LH7A 1YIJV 5FNVB 2F23A 3Q4HA 4G2KA 4FM2A 4DR6B 3TK1A 1VQLV 2K1EA 3SGIA 3OEHG 3ZN1A 4IL6Z 1FJGO 4PA3A 4CH4A 1BZKA 4NTYA 5L3DA 1KKCA 1NJIW 1J5EO 2BOBC 3CRAA 1IURA 2QM7A 1Z2GA 2NNUA 3CCJV 4O4HA 4JI7B 3RVYA 4EB6A 3DGEA 4PA6A 1WNSA 4HYOA 4X1KA 2DQ3A 4LF8O 1WLEA 3TXQA 1H2NA 2Q4PA 4GX1A 2PI4A 4QIWF 2HFEC 2RCVA 1F23A 3H1HH 3K08A 2Q68A 3CXHF 2WLIB 5BY1A 4P9PA 2NLJC 2Q69A 1WPBA 4DR2O 4GUNA 4GKJB 5IJ0A 5IJ9A 2BOCC 4W4KA 4MTOA 4LF5B 3VBBA 1CPYA 2XAQA 1SF9A 2JJ2G 3ZMVA 5BMVB 4YJ2B 4MVOA 2PYJA 1SQPH 3ZX6A 2QWOB 3AK3A 4I5SA 3QTCA 1U96A 4U7OA 1K97A 1JMKC 3OGCC 4D7SA 2PY5A 1Y76A 1JA8A 2YI9A 4I7ZB 4ICGA 4P2ZA 3S3XA 2KG7B 1EM1A 2RNBA 1M1KW 2ZE5A 3CS5A 4EKWA 5ITZB 1F4NA 2EZPA 3H1LH 4WFEA 2LFSA 3JCUZ 5KX5B 1UJWB 4NR1A 3Q4HB 1YVWA 2YIAA 3N27A 4J41A 2EIJB 1KC8W 4GYCB 1G6UA 2HHHO 1AR5A 1N32O 3CCEV 4WF9V 3FYEB 4CBCA 2BTQA 1MMMA 1VQOV 2ZCEA 4UV9A 3SYQA 4H33A 5LGNA 3SPGA 3JSLA 2HG5C 4LFAO 2WAMA 2Y4TA 5LXTB 1BHBA 3R66A 4IYIA 4QE9A 2OCHA 3SDLA 5J9PC 4X8AA 4FFBB 1ZSPA 4K35A 2HJDA 4PI0A 1H8HG 1MZFA 5CA0B 2YIDA 3S3WA 4DR3B 2RDCA 4JTDB 1XDCA 3STLC 5KLVH 5C8YA 2CTRA 4X65B 1GK9A 2Q0OC 1XBLA 3CEIA 4BIUA 3EXAA 1XL6A 1M93A 2Y0PA 3A0RA 2QA4V 2E5LB 3E22A 1XNRB 1BHAA 1Y67A 5B3SB 1MSWD 2ZDIA 2BTOA 4CZZA 3JARA 4WFBV 4OX9O 3ZHQA 3E86A 2A0LA 2UU9B 5CMUA 1FXHA 4JTCB 1K5QA 1OCCB 3ZJZA 1J5EB 1NR1A 1K33A 4DUYB 3L72H 3MHHC 2WA4A 1SA0B 2UXNA 2LO1A 4RQEA 1I0HA 2F95B 4Z2WA 1IBMO 1VIBA 2CK3G 1SERA 3L71H 4HNAA 4ZOLB 5KMGB 1TUBA 2V1DA 3RYFB 1I94O 3WFVA 2ZKOA 1HNZO 2JS3A 2Z0AA 1N34O 5KHIA 1W2BU 3F7VC 5JJEB 5KA5A 3LNNA 2QM4A 1W0KG 1YJWV 1PP9H 3RBZA 2EZOA 2VQEO 4B3TO 2WLNA 4BAYA 2GTSA 4NTXA 2LFRA 4HBNA 3RVZA 4I0XA 4RUEA 3CC4V 3SPIA 5IJ9B 4FLVA 3EVKA 4FMTA 1KD1W 4EFEA 1Q43A 4DV7B 1FFTB 3K59A 3OGIB 3P30A 3CMEV 3HKCA 4UFZA 4DV7O 4LNUB 3K9SA 4TQDA 1US6A 2DN9A 3CCUV 2LP7A 3CRQA 3O65A 3JD4A 4DUYO 4JI3O 4JAUA 1YI2V 3NR7A 1N32B 4N23A 1SQVH 2P6JA 2QWRB 2VQFB 2DQ0A 3BY6A 1A32A 4OX9B 3K5MA 1BCCH 3QNEA 1E79G 2AGAA 1JX9A 2N05A 4R50A 4B08A 4O2AB 1R1BA 5C8YB 2LGQA 3K3WA 5IE9A 3UM7A 1XNQB 2WLLB 2JK5C 2CGOA 4DV6O 4NXMO 1YTFB 4I50A 2EIMB 3JSNA 4LFCO 5EIBD 1E1RG 1FXKC 1VP7A 2X7RB 2XT9A 1NS1A 1V9PA 2ZXWC 3K9AA 2GBOA 2WWWA 3SJCC 4JZ2A 5LBQA 4FZ0A 5CA3A 4AI8A 3A2FA 3G71V 3E2EA 1JCHA 3FX7A 2EIMC 3RYFA 5IYZA 4Z1VA 1JFFA 1FD9A 2AHZA 2UXDO 4I9WA 5CN0A 1Q7YW 1SZXA 2WLJA 5H5NA 3SYCA 3H9VA 2F66C 4PI2A 3ZIAG 3P3NA 4LF9O 2DYRC 4JI4O 1KKDA 2QWQB 3A0HZ 4H0LB 3A8TA 5B1AB 4Q6GA 1ZLZA 5JWPA 4H13B 3OT7A 2UXBO 1T5EA 2ITCC 1JJOA 3HKCB 4O4LB 3DXRB 2UUAB 4JF3A 2IJKA 5J2TA 2EILC 1Y74B 5B1NA 4GKKB 1ZL8B 3FKSG 2WLHA 4X20B 1UFIA 1KB9F 1K4DC 1QR9A 1VMGA 3HPLC 4KHPB 2DYSC 4EFBA 3K57A 2CTWA 5EZYA 4LWSA 1GN4A 2CH7A 1RPOA 4JYAB 4KHPO 5BZBA 4JI0B 4X88A 1GM8A 5EBMC 4PDLA 3JALA 3AG1C 1EZJA 3B77A 4DV6B 2KQXA 3CWBH 2D3OW 1UPGA 4MT8A 3OR6C 4CS4A 4JI8B 1N0NA 4UB8Z 5JH7B 4JPRA 4ZI7A 1S0VA 4B3RO 3OUFA 1WAZA 4TV8B 4TUYA 3CCSV 4WCEV 1VQ6V 1BGYH 4MTFA 3O9OA 4O4JB 1S5HC 4UVCA 4RUFA 1N33O 1MZEA 2QWNB 1IBKO 1E1QG 3JAWA 1NQTA 1VEWA 3U0ZA 1B06A 2Q8VA 4RWUA 5IYBO 4NYKA 1BSMA 2NR5A 1FJGB 2L35A 2ZIMA 4LF7B 3ZMTA 4UB6Z 4LR3A 4X66O 4UCRA 3M7MX 2ZE8A 1Y4MA 1HNXB 4KXRA 2E76B 2JVDA 4JASA 3TXSA 2UUBO 1MOFA 2E3CA 5EYPA 2P90A 3ZCCA 4X1IB 4DR4O 5TISZ 1H2KA 1AI4A 1TGOA 3CC2V 2OCCB 1H8EG 1ZUQA 2LGWA 3DXRA 1FYJA 1BE3H 2F43G 1NZ6A 4PDVA 2YXHA 4JI1O 3DSQA 5E1AC 4DRXA 4X20A 4X64B 3EHBB 1Q6IA 5J2UA 2PZSA 4PDRA 2W6JG 1XMQO 1AR1B 1TUEB 2P4VA 3E35A 3JCZA 4QNHB 2VQFO 1NH2D 3CCVV 3CB2A 2XTAA 3JALB 1JPXA 3KKYA 5GONA 2LQTA 3ZS8C 1AP6A 2YXYA 3E22B 5IYCO 5KAFZ 1Z5WA 1WPXA 3N2KA 5EBWC 1F7YA 3JARB 4PDMA 1S3JA 5F2VO 4DO2A 5LGUA 4LP8A 2F4VO 2ZR3A 1XNQO 5D5PA 4PJ0Z 3RYCA 1L1FA 3OM3B 1AI5A 3APQA 1AILA 3JAMN 5L3EA 3KCXA 3ZHUA 1GN6A 1R6KA 1QNMA 3P32A 4FFKA 1Y74A 2ODMA 2ZE6A 3ZBHA 5CB4B 3DC6A 2MK3A 1Z5VA 2CTPA 2JS5A 4JI0O 2RQ6A 3SJAC 2EULA 4GKKO 4UCTA 3HKBB 4DV3O 4QGPA 3VQYA 3C90A 3W7WA 5KHHA 5CA1A 3CE2A 2XOKG 1VF6A 1GN3A 3ZMUA 2DWEC 3ETQA 2E5LO 3ICXA 2AW9A 1P84F 2Q7GA 4I4TB 4K0KO 1ZAUA 4QE7A 1EN5A 4KL1A 2UXBB 5FLXN 1PNMA 4BW9A 3OMIB 4ZI7B 5DN6G 2HLDG 4U3JA 2RJZA 1K3EA 1VQ9V 4TUYB 2QGNA 4PV1B 2B1GA 3ABLC 2X6CA 1XHXA 3ABKB 4O4IA 1OCRB 1IBMB 1QU7A 1YJNV 4CC5A 1KP3A 2JEUA 1FFXA 1QQCA 2GUZA 2H8PC 1IXBA 1NH2B 5GTIZ 5B1BB 1YTFD 4LF5O 3VQWA 2A79B 4JGSA 3K0DA 1DTOA 1YHQV 1HWYA 2ADQB 2Q67A 5CA0A 3RW0A 5B5EZ 4YXWG 1N8RW 2YSUB 1NTZH 4BIOA 4R7CA 1K5SA 5B1OA 3ZRSA 2YDEA 3JATA 4I0XB 4RAIA 1GMGA 5IYDO 1OCRC 4JI6B 3U10A 1M5IA 2QKCA 1VQ5V 3GB7C 3CCQV 1CP9A 1AJQA 1GRJA 3ZMZA 4DR1B 3E8HA 1IBLO 1OCZC 5IYZB 3G6EV 1OCOC 4X9QA 3UQ8A 3SPCA 3CC7V 3IC9A 4O2BA 3J7AU 1NT2B 5K1XA 1JR9A 3T1CA 2M7WA 1PL0A 3THOA 1H38A 2V4DA 3RWRD 4YY3O 2ILMA 1WJZA 1Y6XA 5KUMA 2ATKC 5KMGA 1TUBB 1IBKB 2EJRA 1GTOA 2CGNA 2VRZA 1AP5A 2P7TC 4TSFG 4I50B 4J11A 2IJIA 3WU2Z 4JV5O 3CYOA 2O57A 3AG3B 3N2GB 5B1AC 3OTOO 5EK0A 3KZIZ 4U3JB 3KCYA 1QLEB 4X64O 4MVUA 5JVDA 4OXSA 2A06H 2N04A 3C3TA 1WP8A 3JYCA 3T2MA 1IDSA 1CEZA 3FYIB 2KG7A 4CS2A 4DV5B 4YJ3B 4LF8B 1V54C 2EINC 5DEDA 2F93B 5LA6A 3M8AA 4DR5O 3UO2A 4KUMA 1NTKH 4X66B 2UXDB 1OHHG 4BR6A 5D5QA 1Q82W 4J9ZB 4YY3B 3RYHB 1XMOB 1NVPB 1MNGA 3ABUA 4DUZB 4FLWA 3OUSA 1XMOO 2EIKC 2UXCB 5IJ0B 3K03A 1R3IC 1PPJH 3G4SV 1K34A 1XL4A 4XBFA 1YITV 1P49A 3CJHA 1Q5OA 3MD0A 3LNMB 1OCZB 3OAAG 2Z3YA 3IGAC 4JI4B 1K8AW 3M99B 4CS3A 4I55B 4IHJA 2QWPB 3BEHA 2P67A 5LOVA 4BIZA 4JI7O 1VQNV 2CH7B 2OT5A 4JYBA 4DK1A 4LF6O 4UCSA 5H9CA 1FFXB 2FTKA 4JV5B 2P22C 5CBFA 3OEEG 2G38A 5KHJA 4J10A 5FPRA 5JCOA 3ASNC 2B9ZA 4FK5C 4DV3B 3ZN0A 2PUSA 1J95A 1S5JA 1F4MA 3C3SA 3CCRV 2UUAO 3K04A 1VQKV 3PN1A 1I08A 1SRYA 4CH6A 1K7DA 5LXTA 2F4VB 3H01A 3JAWB 4HNAB 2EILB 3AG4B 4ZKIA 4HAMA 2Q6AA 1VF5B 4JI2B 2PTMA 3G6BA 5LHGA 3ZRWA 1TAEA 1PNLA 2WA3A 4UUJC 3B8MA 4A5UB 3AG1B 5DECA 3TETA 2DWDC 4MS2A 1AJNA 1I7FA 5CBGA 3QO5A 1S72V 2HVKC 3QF7A 3DTUB 1LUWA 1XHZA 5JJJB 1MA1A 2YXLA 1TVKA 4Q20A 3WB0A 2R70A 5JQGB 3T1YB 2ZT9B 2CAZC 1WA8B 4JI1B 4YIOA 1B3QA 5H6RA 2XAJA 4I55A 4IHJB 3HR0A 1YXBA 1H2SB 5J2UB 3IAYA 2HEPA 2GTAA 1N34B 2QDOA 3FD9A 1L8DA 3JASA 1SS3A 2Y69C 5BR8O 1I5XA 4NXMB 3ZHTA 3AG3C 1KU9A 2DOSA 2QR4A 2UUCO 4QJFB 3L73H 3ETEA 3T4ZA 1AI6A 2ZDIC 1SESA 2UUBB 4PD4F 2Z5UA 4J9YB 4FLTA 4DR7B 4JAAA 4UCUA 1FS0G 2X0LA 2OCCC 1KYOF 3CP1A 4LFCB 4JI5B 2Y69B 5IY5C 3MHSC 2ZXWB 1YJ9V 3NXSA 1RSOB 3AG4C 4P9OA 4LBEC 1FXVA 1M57C 1JFFB 3ZHSA 4DR4B 1HW7A 4G27B 1DLBA 2X6BA 4B3SO 2QTOA 2BSKA 3T1YO 2LJ2A 1WB7A 2MW2B 4TQFA 3SYAA 1RPRA 1WB8A 2GHYA 2ZM6O 2ZE7A 1MG1A 5BMVA 2OIEA 5IWAO 1P4RA 2VWJA 1YCIA 3R65A 4DV0B 3J81N 2CTQA 5L3CA 4HZ3A 3RN4A 4DR1O 2B5UA 3JASB 1YDXA 1THZA 2HKOA 4MVZA 5IT9N 3BFRA 2DYSB 5LYJB 3IFXA 3ZHVA 1ZWIC 4H37A 2C2AA 2XAFA 5KX5A 1XEQA 1OZ0A 2JGDB 1D5NA 3W7TA 2IW5A 4U7NA 2NN4A 1URFA 1DGSA 2YUAA 4IYHA 2P5OA 2VS0A 4U3FH 1K9MW 1IX9A 3LSQA 4FM1A 3K06A 2P06A 2KSDA 2YEVA 2K9PA 4LH6A 1Q6HA 2XNDG 3BRCA 3VQXA 4I9QA 2F1MA 4I4TA 1QBZA 4PELA 1WN7A 4FFBA 1SQXH 5IDJA 1ENVA 4O2BB 3OR7C 1X4TA 4DV1B 1N33B 1YZBA 2HR3A 1V54B 3RYIA 2HHHB 3OTFA 5B3SC 3STZC 1PM9A 3CD6V 1GM7A 3WB2A 2IH1C 1ZX3A 2Y0IA 1S76D 1XQ8A 3QG5A 2GUZB 2BE3A 4NKGB 1JQ0A 3LDEA 5ITZA 2LW1A 2JGUA 3FAVA 4ZBMA 4PA4A 1DF4A 2UXCO 3N2GA 1V55B 3ETDA 2IU3A 1R73A 3CHXA 3T4DA 4TV8A 1L0NH 3HKEA 3W7UA 1QR8A 1SA0A 2W6IG 4DR6O 3OMNB 5B66Z 4PHZA 5LMUO 1B6QA 2W0FC 2OWOA 3TGUH 5JJNB 1YSCA 4DW0A 1QVGU 3FB6C 2ZM6B 1IZ3A 1SQBH 4DV5O 4J80A 4QPKA 2GSMB 2YIBD 1OCOB 3APOA 1VQ7V 2R9RB 4B7KA 5GW7A 4X1YB 2LW7A 1R6NA 5LP6C 1Q6UA 3RYHA 5CBHA 2R9IA 1SETA 5EYPB 3JD2A 1KMIZ 1W59A 1VQ8V 2BSKB 3BAAA 1AJPA 2PYLA 1M56B 4DV0O 4JI3B 1SQQH 5LMUB 1VQPV 2QEXV 2YC0A 1M90W 3SJBC 4C7UA 1RM1B 5A2QN 3ML0A 1OV9A 2QJ1A 3CPWU 2EJ7A 3E89A 4JAVA 3AK1A 3BPZA 4O2AA 2PGGA 3CSXA 1XMQB 3IJ4A 1MSDA 2ZNJA 4MTXA 4YJ3A 2WLKA 3CRMA 4R6ZA 1OCCC 4DXWA 4LF9B 1M57B 3QO7A 3JAKB 5LA6B 1I94B 5JQGA 5C93A 3E8BA 1HNXO 4X65O 1HP8A 3H1IH 3AK2A 4XDKA 5LP6B 3B4SA 3E8GA 4TWKA 3RYCB 1VQMV 4O4IB 2YEVB 3CMAV 4O4HB 2B1IA 4RO2A 1AR4A 3L9DA 3A0BZ 1Q3EA 4LF7O 2Y48A 4X1KB 4GLXA 1F51A 4LNUA 3X2QC 1GM9A 1ROPA 3B8NA 4X1YA 4WFFA 4JI2O 4IIJA 5LHIA 2Q0AA 3RT3C 3OD4A 4FLXA 2EIKB 1EBOA 2HVJC 4DW1A 2WLIA 1IVSA 3JATB 4RQFA 4BWAA 1IBLB 2GDSA 1U97A 4DV4B 4OGQB 1CXZB 4O4LA 1R3KC 3UO3A 1NI8A 2Q73A 2Q7HA 2Q7EA 3I56V 5E79Z 5EC2C 2DJVA 4L8JA 4LCUC 2V7QG 3K79A 3BVOA 1AVMA 4EB6B 2EBOA 1RP3B 2L6LA 4FVMA 4ASUG 1FXKB 4JZGA 2JJ1G 4B3SB 1WP7A 1NBMG 3OFNG 2CUGA 1D2DA 3W7SA 5H2FZ 1N36O 1G1XB 1GKFA 4PA9A 4K3AA 4AQYO 5JH7A 4JYYA 1XUQA 5L3GA 3UT5A 1YF2A 1HR0O 4L87A 3B40A 2AHYA 2QSAA 2OTJV 3VOUA 1HNWB 4AQYB 1KBHA 5L3FA 3E8FA 3VQVA 3H1KH 3CRRA 4FIPC 4JI5O 4W4LA 4XDLA 2RMKB 1QVFU 3ABMB 4TV9A 4N21A 1DK1A 1KUQA 3H1JH 1FKAO 4LFAB 4H44B 1GH6A 5EZYB 1L0LH 1W0JG 3DC5A 1MABG 1VF6C 1JOYA 2OIGA 4LF4B 1QCEA 2JRIA 4MVMA 3W7XA 2XAHA 1JJ2U 4YHHO 3ABMC 5DM6V 2Y4UA 3JD3A 3TJTA 5KAIZ 4XDJA 4X62O 4DRXB 4DYLA 2WLMA 5A9GA 1LUVA 5JVDB 3D3QA 3SJQC 4F4LA 1BMFG 4J7JA 1PD3A 5IWAB 1SQFA 4P30A 5IY5B 1FPOA 4D7TA 5HFMA 3SYOA 1O9GA 4MVRA 3LSUA 4TT3G 3ZHRA 1KQSU 4B3MO 3OMAB 1RM1C 4GT1A 1SQGA 5JCOC 2OTLV 4AHCA 4UVAA 3CX5F 5KHKA 4DV4O 1XILA 1EFRG 1XREA 1FAFA 1NVPD 3B2EE 1AB3A 3T1HO 3QO8A 2FB5A 3BABA 3CJHB 3SPHA 4CH3A 3ZRXA 1H2LA 3AG2B 1LNQA 5LOVB 3ZRWB 2N74A 1K4CC 1G8MA 4LF4O 1ZTEA 2FYUH 1Y66A 5LYJA 4ZOLA 1X59A 1JVMA 2UU9O 4DR2B 4GKJO 4F6RA 1PNKA 1KP2A 5FNVA 2Q9LA 3FAVB 4GCZA 1D5AA 1M4UA 2X6AA 4MSWC 3WB1A 3HKDB 4KFMA 4MW8A 1P7GA 2JGDA 1XNRO 1BQZA 1WA8A 4K8XA 3SYPA 2JEXA 1N4CA 1Q90D 1NU1H 3SPJA 1GN2A 1HNWO 2DMXA 3K5OA 1N36B 3F7YC 2ZR2A 2GV9A 2IBZH 2CDYA 1Y76B 4DV1O 3G67A 2QTSA 3I55V 3GVMA 2A9HA 4MVSA 3G80A 2OYQA 2E75B 1SC5B 1Q81W 2JDIG 1GAXA 3JAKA 4GX2A 3OTOB 4GZRB 3CXCU 2QKSA 4G28B 1I5YA 4OPHA 2PF4E 3AG7A 4UVBA 2D2CB 4FPPA 3UCSC 3B09A 1N0JA 4UCOA 4IT5A 3HKBA
chains in the Genus database with same CATH topology
4UV9A 3STZC 3SYQA 3ABKB 1OCRB 1GM7A 3CD6V 4H33A 1H2GA 2H94A 2IH1C 5LGNA 1YJNV 1S76D 1KP3A 1BL8A 2JEUA 5FL7G 3SPGA 3OW2U 2HG5C 2WAMA 2QM8A 3D36A 1K92A 2H8PC 1NH2B 1BHBA 1JQ0A 3LDEA 5B1BB 1YTFD 4QE9A 5H6QA 2A79B 4JGSA 3K0DA 3HB3B 1GO3F 1DTOA 4X8AA 4ZBMA 5J9PC 1HWYA 1YHQV 3IC7A 2Q67A 3JD1A 4PA4A 1S77D 1DF4A 3RW0A 1H8HG 1V55B 3ETDA 2IU3A 4YXWG 1R73A 1N8RW 3T4DA 3PJSK 3JD0A 4JTDB 2YSUB 3W7UA 4R7CA 3STLC 1QR8A 1K5SA 5B1OA 2W6IG 3ZRSA 3OMNB 1GK9A 1B6QA 4RAIA 1GMGA 4BIUA 4R8CA 5IYDO 2W0FC 1OCRC 1XL6A 1YSCA 3LDDA 3A0RA 1QVGU 3FB6C 4JTAB 1Q86W 1VQ5V 3GB7C 2QA4V 4QPKA 3CCQV 1CP9A 1AJQA 2GSMB 5L3BA 3ZMZA 1BHAA 1OCOB 5B3SB 3E8HA 1VQ7V 1MSWD 1OCZC 2R9RB 2ZDIA 4CZZA 3ETGA 3G6EV 1OCOC 5GW7A 3SPCA 3CC7V 1R6NA 4WFBV 4X89A 3E86A 2A0LA 5CMUA 1FXHA 1R3JC 1K5QA 1OCCB 4JTCB 3ZJZA 1NR1A 1K33A 4WFHA 3T1CA 3MHHC 2M7WA 1PL0A 2UXNA 4JYCA 5CBHA 5KUKA 1H38A 2R9IA 1SETA 4RQEA 3JD2A 1VQ8V 1AJPA 1M56C 4Z1MG 5LGTA 5KUMA 2ATKC 1M56B 2CK3G 1SERA 2EJRA 1GTOA 1FXKA 2V1DA 4PA7A 1VQPV 3KG2A 2HJFC 2QEXV 3WFVA 2P7TC 4TSFG 1M90W 2IJIA 1W2BU 3F7VC 5KA5A 2IJHA 3CYOA 1RM1B 3AG3B 5B1AC 5EK0A 1M9NA 1W0KG 1YJWV 1NKDA 3ML0A 3RBZA 3CPWU 5EC1C 3ZRVA 3E89A 2EZOA 4JAVA 1QLEB 4MVUA 5LHHA 2WLNA 4OXSA 3FB7C 4BAYA 2LFRA 3RVZA 1PKXA 4RUEA 3CC4V 3SPIA 3JYCA 2EIJC 3T2MA 1CEZA 3FYIB 4MTXA 4FMTA 2WLKA 2XAGA 3CCMV 1K73W 1KD1W 1FFTB 4R6ZA 1OCCC 4DXWA 1V54C 3P30A 1M57B 3CMEV 2EINC 2IJJA 3QO7A 2IU0A 1IXMA 3CCUV 2LP7A 5C93A 3E8BA 3JD4A 4JAUA 3TCUA 1YI2V 4KUMA 4N23A 2P6JA 4UV8A 4XDKA 1OHHG 3E8GA 1Q82W 2DQ0A 4J9ZB 3BY6A 3E83A 4TWKA 1NVPB 3QNEA 1ORQC 1E79G 1JX9A 4R50A 3ABUA 3OUSA 2EIKC 3K03A 1R3IC 2DW4A 2WSSG 3AEIA 1VQMV 2YEVB 3G4SV 3CMAV 1K34A 2B1IA 4RO2A 1XL4A 3K3WA 4XBFA 3UM7A 2WLLB 2Y48A 4GX5A 1YITV 3F5WC 2JK5C 1F51A 3X2QC 3MD0A 3LNMB 1OCZB 1YTFB 3OAAG 2Z3YA 3IGAC 1GM9A 2EIMB 2JIZG 1K8AW 1ROPA 3M99B 4MW3A 3B8NA 4WFFA 3BEHA 1E1RG 1FXKC 2P67A 5LHIA 4BIZA 2X7RB 3ABTA 1VQNV 2EIKB 1EBOA 2HVJC 2ZXWC 3K9AA 2WLIA 2WWWA 2OT5A 5LBQA 4GX0A 4JYBA 5CA3A 5H9CA 4E2LA 4RQFA 4KP4A 3G71V 3OE7G 3E2EA 1JCHA 2FTKA 5CBFA 3OEEG 3ABKC 2EIMC 1R3KC 3ASNC 2AHZA 3I56V 4FK5C 3ASNB 4I9WA 5EC2C 3ZN0A 5CN0A 5B1BC 1Q7YW 1AI7A 4LCUC 2WLJA 1J95A 3SYCA 3LDCA 2ZD9A 1NR7A 2V7QG 3ZIAG 3K79A 2DYRC 1F4MA 1KKDA 5EBLC 3UKMA 1KECA 3CCRV 2EBOA 3K04A 1VQKV 3ZMSA 1SRYA 5B1AB 4ASUG 1K7DA 1FXKB 2WLLA 1V55C 2JJ1G 3H01A 2ITCC 2EILB 1NBMG 3OFNG 3AG4B 4JF3A 3CCLV 4ZKIA 2IJKA 3W7SA 2EILC 5B1NA 3WG7C 4HAMA 2Q6AA 4QPJA 1GKFA 3FKSG 4PA9A 2WLHA 1K4DC 5L3GA 3ZRWA 1QR9A 5LHGA 1COWG 1QLNA 1PNLA 3HPLC 2DYSC 2WPDG 4UUJC 3B8MA 1RPOA 3AG1B 4FJCC 3TETA 4L87A 4MVQA 2AHYA 5BZBA 2DWDC 2OTJV 4MS2A 3VOUA 4X88A 1AJNA 5CBGA 5L3FA 2KB1A 3QO5A 3E8FA 1S72V 2HVKC 4MTGA 1GM8A 5EBMC 2X6CA 3DTUB 4PDLA 4FIPC 3AG1C 1VQ4V 4LC1A 2UXXA 1EZJA 3B77A 3ABLB 4XDLA 2D3OW 4Q20A 4MT8A 1QVFU 3ABMB 4N21A 3OR6C 1R3LC 1SZTA 3ASOC 2PI5A 5H6RA 2XAJA 3GWOA 4JPRA 1P7BA 1S0VA 3OUFA 4UXNA 1W0JG 1DF5A 1MABG 1JOYA 3EFFK 2XASA 3D3IA 3CCSV 4WCEV 1VQ6V 4MTFA 1QCEA 1S5HC 2Y69C 1I5XA 4RUFA 4UVCA 4MVMA 3W7XA 2XAHA 1QLEC 1AROP 3AG3C 1JJ2U 1E1QG 3ABMC 2DYRB 1VQOV 5DM6V 1NQTA 4QJFB 3ETEA 3JD3A 3AG2C 3ASOB 3T4ZA 2IH3C 5IYBO 2ITDC 4XDJA 3FB8C 3WG7B 1AI6A 2ZDIC 4WFGA 1SESA 5HFLA 3LSSA 2Z5UA 3LUTB 4J9YB 2WLMA 2EINB 3ZMTA 3X2QB 1FS0G 5KA6A 1Y4MA 3SJQC 4F4LA 2ZQMA 2X0LA 2QE7G 4JASA 2OCCC 1BMFG 1MOFA 1PD3A 1G4YB 4BW5A 2P90A 3CP1A 3FB5C 3ZCCA 4P30A 5IY5B 2Y69B 5IY5C 3MHSC 5HFMA 1AI4A 2ZXWB 3SYOA 3K0GA 3CC2V 4WFAV 4MVRA 1YJ9V 2OCCB 4TT3G 3NXSA 3AG4C 1YIJV 4P9OA 4LBEC 1H8EG 1KQSU 3OMAB 1RM1C 1FXVA 2F43G 1M57C 4G2KA 4GT1A 4PDVA 3TK1A 1VQLV 2K1EA 3OEHG 5E1AC 2OTLV 3ZN1A 3EHBB 4PDRA 2W6JG 1AR1B 4UVAA 1TUEB 3E35A 4G27B 4PA3A 3JCZA 4QNHB 1DLBA 5L3DA 2X6BA 1EFRG 1NJIW 2BOBC 1NH2D 2QM7A 2NNUA 3CCJV 1NVPD 2QTOA 3CCVV 3RVYA 3DGEA 4PA6A 3QO8A 4HYOA 3SYAA 1RPRA 1JPXA 3SPHA 2DQ3A 3ZRXA 2GHYA 1WLEA 1MG1A 5IYCO 3AG2B 4GX1A 1WPXA 5EBWC 1LNQA 1P4RA 2PI4A 4PDMA 1S3JA 4QIWF 2HFEC 3R65A 1F23A 3ZRWB 4DO2A 3K08A 2Q68A 5LGUA 4LP8A 1K4CC 1G8MA 2ZR3A 5L3CA 2WLIB 4HZ3A 4P9PA 2NLJC 2Q69A 2B5UA 1L1FA 3OM3B 1Y66A 2HKOA 1THZA 4MVZA 1AI5A 2DYSB 1JVMA 2BOCC 3IFXA 5L3EA 1PNKA 1ZWIC 4H37A 4MTOA 3VBBA 1R6KA 1KP2A 3P32A 1CPYA 2XAQA 2JJ2G 2C2AA 2XAFA 4GCZA 2X6AA 3ZMVA 4MSWC 4KFMA 4MW8A 1OZ0A 4MVOA 2MK3A 3W7TA 2IW5A 4U7NA 3SYPA 2JEXA 3SPJA 4I5SA 3F7YC 4U7OA 2ZR2A 1K97A 3OGCC 1K9MW 3LSQA 3W7WA 3K06A 4P2ZA 3I55V 2A9HA 2XOKG 2YEVA 4MVSA 1M1KW 3ZMUA 2XNDG 1Q81W 2JDIG 4EKWA 2DWEC 1F4NA 2EZPA 4WFEA 2LFSA 1UJWB 4QE7A 1QBZA 4GX2A 4PELA 3CXCU 2QKSA 1ENVA 4G28B 1I5YA 1PNMA 2EIJB 5IDJA 3OMIB 3OR7C 5DN6G 1KC8W 2HLDG 4UVBA 2HR3A 1V54B 1K3EA 4FPPA 3CCEV 1VQ9V 4WF9V 3FYEB 4CBCA 5B3SC 2B1GA 3ABLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKI A;  4LC1 A;  4MTX A;  4FMT A;  5B1N A;  3P32 A;  4QPJ A;  4JAS A;  4GCZ A;  2C2A A;  2WWW A;  4Q20 A;  4MT8 A;  5B1O A;  4JYB A;  3ZCC A;  2QM8 A;  3D36 A;  3ZRW A;  1IXM A;  3ZRW B;  4BIU A;  4KP4 A;  2LFS A;  2QM7 A;  1F51 A;  5C93 A;  3MD0 A;  4JYC A;  4U7N A;  4JAU A;  3ZRV A;  2FTK A;  4JAV A;  5IDJ A;  3NXS A;  3A0R A;  3DGE A;  4I5S A;  4U7O A;  1JOY A;  4QPK A;  2LFR A;  4FPP A;  4GT1 A;  2P67 A;  3TK1 A;  3ZRX A;  4BIZ A; 
#chains in the Genus database with same CATH topology
 3BA8 A;  2ETN A;  1H2G A;  2H94 A;  5CA1 B;  4J7K A;  1BL8 A;  5FL7 G;  3OW2 U;  4IGG A;  2QM8 A;  3D36 A;  1K92 A;  1BT8 A;  3ZED A;  5H6Q A;  1RSO A;  3HB3 B;  1GO3 F;  4K0K B;  2XUM A;  5EIB C;  5LMN B;  3IC7 A;  3JD1 A;  4TOI A;  4FLY A;  1S77 D;  4F6E A;  3D8C A;  3PJS K;  3JD0 A;  4LWS B;  1TA8 A;  1B04 A;  1PL4 A;  2QKA A;  4DV2 O;  4JI6 O;  4R8C A;  2R9A A;  3LDD A;  4JTA B;  1Q86 W;  2Q5Z A;  4F6R B;  5L3B A;  3L75 H;  3RFR A;  3ETG A;  4LF6 B;  3HKD A;  1BQ0 A;  4X89 A;  4ZIB A;  1R3J C;  3D36 C;  2A3Q A;  4DR5 B;  4X62 B;  4WFH A;  4JYC A;  5KUK A;  1M56 C;  4O4J A;  4Z1M G;  5LGT A;  1S5L Z;  4OPA A;  5AG2 A;  5FPO A;  1FXK A;  1HR0 B;  4YJ2 A;  4PA7 A;  1OJH A;  3KG2 A;  2HJF C;  2RN9 A;  4ZHQ A;  2IJH A;  3J80 N;  2IM9 A;  4DR3 O;  4FZ1 A;  1M9N A;  4J42 A;  5GTH Z;  1NKD A;  1NTM H;  4FLZ A;  5EC1 C;  3ZRV A;  5LHH A;  2H3O A;  4CH5 A;  3FB7 C;  2DE0 X;  4YIP A;  3CRC A;  1PKX A;  2FML A;  4X1I A;  2EIJ C;  3CCM V;  1K73 W;  1EN4 A;  2XAG A;  4NXN O;  3U11 A;  2IJJ A;  2IU0 A;  1IXM A;  3F5T A;  4LFB B;  4TV9 B;  4NVP A;  3TCU A;  5LP6 A;  3K58 A;  2ZIN A;  5LMN O;  1EN6 A;  4UV8 A;  3BHP A;  2BTQ B;  4JI8 O;  3E83 A;  3L70 H;  2AZ0 A;  2AXT Z;  3RYI B;  1ORQ C;  1LR1 A;  4B3R B;  1EZV H;  2DW4 A;  3AEI A;  2WSS G;  4NTW A;  4UCV A;  4AIL C;  3GWK C;  4ABM A;  4B3M B;  4GX5 A;  3F5W C;  5GON B;  2JIZ G;  3BA9 A;  4MW3 A;  2FL4 A;  2HP8 A;  3MAQ A;  4B7E A;  4JYA O;  3ABT A;  2W0X A;  4DV2 B;  1XOU A;  3HKE B;  2M6Y A;  4DR7 O;  2P4K A;  4GX0 A;  1XI1 A;  4E2L A;  3BCC H;  4KP4 A;  1HDJ A;  3FFQ A;  1O9H A;  3OE7 G;  2FKX A;  2YI8 A;  3ABK C;  4ZHQ B;  3ASN B;  4DK0 A;  4WBN B;  5B1B C;  4LFB O;  1AI7 A;  4FLU A;  3LDC A;  2ZD9 A;  1NR7 A;  2YS8 A;  5EBL C;  1PV0 A;  1KEC A;  3UKM A;  2BCC H;  4D6T H;  3ZMS A;  1VAR A;  4K8Z A;  2WLL A;  1V55 C;  2E74 B;  2XHB A;  4FM0 A;  1TVK B;  3CCL V;  3WG7 C;  4QPJ A;  3N2K B;  5J2T B;  2UUC B;  5KHG A;  1RFY A;  5LL6 Y;  3UT5 B;  1QLN A;  1COW G;  3P3P A;  2WPD G;  2EX3 A;  1H2M A;  4FJC C;  4MVQ A;  2YIC A;  2ZNI A;  1SKV A;  2KB1 A;  4MTG A;  5K1P A;  2CE4 A;  1VQ4 V;  4LC1 A;  2UXX A;  3ABL B;  1YEW A;  4EEQ A;  3K5L A;  1R3L C;  5CB4 A;  2ZIO A;  3MDS A;  1SZT A;  3ASO C;  2PI5 A;  2ADP A;  3GWO A;  4J7Z A;  1P7B A;  4DUZ O;  2A7W A;  4UXN A;  1DF5 A;  3EFF K;  2ARH A;  2XAS A;  3D3I A;  2R72 A;  2YIB A;  4NXN B;  3RGB A;  1QLE C;  3I5D A;  1ARO P;  5BXZ A;  2DYR B;  1QHT A;  2VQE B;  4B3T B;  4E4E A;  3AG2 C;  3ASO B;  1Q8I A;  2IH3 C;  2ITD C;  1ZL8 A;  3FB8 C;  3WG7 B;  2VWK A;  4WFG A;  4WBN A;  5HFL A;  3T1H B;  1BS3 A;  3LSS A;  3LUT B;  2EIN B;  4IIJ B;  3X2Q B;  4CC6 A;  3K5N A;  1R6T A;  4YHH B;  5KA6 A;  1VF7 A;  2ZQM A;  2QE7 G;  4BW5 A;  1G4Y B;  3L74 H;  3SR2 C;  2AZ2 A;  3FB5 C;  5BR8 B;  2KKW A;  4NB5 A;  1HNZ B;  3K0G A;  4WFA V;  3QVN A;  4LH7 A;  1YIJ V;  5FNV B;  2F23 A;  3Q4H A;  4G2K A;  4FM2 A;  4DR6 B;  3TK1 A;  1VQL V;  2K1E A;  3SGI A;  3OEH G;  3ZN1 A;  4IL6 Z;  1FJG O;  4PA3 A;  4CH4 A;  1BZK A;  4NTY A;  5L3D A;  1KKC A;  1NJI W;  1J5E O;  2BOB C;  3CRA A;  1IUR A;  2QM7 A;  1Z2G A;  2NNU A;  3CCJ V;  4O4H A;  4JI7 B;  3RVY A;  4EB6 A;  3DGE A;  4PA6 A;  1WNS A;  4HYO A;  4X1K A;  2DQ3 A;  4LF8 O;  1WLE A;  3TXQ A;  1H2N A;  2Q4P A;  4GX1 A;  2PI4 A;  4QIW F;  2HFE C;  2RCV A;  1F23 A;  3H1H H;  3K08 A;  2Q68 A;  3CXH F;  2WLI B;  5BY1 A;  4P9P A;  2NLJ C;  2Q69 A;  1WPB A;  4DR2 O;  4GUN A;  4GKJ B;  5IJ0 A;  5IJ9 A;  2BOC C;  4W4K A;  4MTO A;  4LF5 B;  3VBB A;  1CPY A;  2XAQ A;  1SF9 A;  2JJ2 G;  3ZMV A;  5BMV B;  4YJ2 B;  4MVO A;  2PYJ A;  1SQP H;  3ZX6 A;  2QWO B;  3AK3 A;  4I5S A;  3QTC A;  1U96 A;  4U7O A;  1K97 A;  1JMK C;  3OGC C;  4D7S A;  2PY5 A;  1Y76 A;  1JA8 A;  2YI9 A;  4I7Z B;  4ICG A;  4P2Z A;  3S3X A;  2KG7 B;  1EM1 A;  2RNB A;  1M1K W;  2ZE5 A;  3CS5 A;  4EKW A;  5ITZ B;  1F4N A;  2EZP A;  3H1L H;  4WFE A;  2LFS A;  3JCU Z;  5KX5 B;  1UJW B;  4NR1 A;  3Q4H B;  1YVW A;  2YIA A;  3N27 A;  4J41 A;  2EIJ B;  1KC8 W;  4GYC B;  1G6U A;  2HHH O;  1AR5 A;  1N32 O;  3CCE V;  4WF9 V;  3FYE B;  4CBC A;  2BTQ A;  1MMM A;  1VQO V;  2ZCE A;  4UV9 A;  3SYQ A;  4H33 A;  5LGN A;  3SPG A;  3JSL A;  2HG5 C;  4LFA O;  2WAM A;  2Y4T A;  5LXT B;  1BHB A;  3R66 A;  4IYI A;  4QE9 A;  2OCH A;  3SDL A;  5J9P C;  4X8A A;  4FFB B;  1ZSP A;  4K35 A;  2HJD A;  4PI0 A;  1H8H G;  1MZF A;  5CA0 B;  2YID A;  3S3W A;  4DR3 B;  2RDC A;  4JTD B;  1XDC A;  3STL C;  5KLV H;  5C8Y A;  2CTR A;  4X65 B;  1GK9 A;  2Q0O C;  1XBL A;  3CEI A;  4BIU A;  3EXA A;  1XL6 A;  1M93 A;  2Y0P A;  3A0R A;  2QA4 V;  2E5L B;  3E22 A;  1XNR B;  1BHA A;  1Y67 A;  5B3S B;  1MSW D;  2ZDI A;  2BTO A;  4CZZ A;  3JAR A;  4WFB V;  4OX9 O;  3ZHQ A;  3E86 A;  2A0L A;  2UU9 B;  5CMU A;  1FXH A;  4JTC B;  1K5Q A;  1OCC B;  3ZJZ A;  1J5E B;  1NR1 A;  1K33 A;  4DUY B;  3L72 H;  3MHH C;  2WA4 A;  1SA0 B;  2UXN A;  2LO1 A;  4RQE A;  1I0H A;  2F95 B;  4Z2W A;  1IBM O;  1VIB A;  2CK3 G;  1SER A;  3L71 H;  4HNA A;  4ZOL B;  5KMG B;  1TUB A;  2V1D A;  3RYF B;  1I94 O;  3WFV A;  2ZKO A;  1HNZ O;  2JS3 A;  2Z0A A;  1N34 O;  5KHI A;  1W2B U;  3F7V C;  5JJE B;  5KA5 A;  3LNN A;  2QM4 A;  1W0K G;  1YJW V;  1PP9 H;  3RBZ A;  2EZO A;  2VQE O;  4B3T O;  2WLN A;  4BAY A;  2GTS A;  4NTX A;  2LFR A;  4HBN A;  3RVZ A;  4I0X A;  4RUE A;  3CC4 V;  3SPI A;  5IJ9 B;  4FLV A;  3EVK A;  4FMT A;  1KD1 W;  4EFE A;  1Q43 A;  4DV7 B;  1FFT B;  3K59 A;  3OGI B;  3P30 A;  3CME V;  3HKC A;  4UFZ A;  4DV7 O;  4LNU B;  3K9S A;  4TQD A;  1US6 A;  2DN9 A;  3CCU V;  2LP7 A;  3CRQ A;  3O65 A;  3JD4 A;  4DUY O;  4JI3 O;  4JAU A;  1YI2 V;  3NR7 A;  1N32 B;  4N23 A;  1SQV H;  2P6J A;  2QWR B;  2VQF B;  2DQ0 A;  3BY6 A;  1A32 A;  4OX9 B;  3K5M A;  1BCC H;  3QNE A;  1E79 G;  2AGA A;  1JX9 A;  2N05 A;  4R50 A;  4B08 A;  4O2A B;  1R1B A;  5C8Y B;  2LGQ A;  3K3W A;  5IE9 A;  3UM7 A;  1XNQ B;  2WLL B;  2JK5 C;  2CGO A;  4DV6 O;  4NXM O;  1YTF B;  4I50 A;  2EIM B;  3JSN A;  4LFC O;  5EIB D;  1E1R G;  1FXK C;  1VP7 A;  2X7R B;  2XT9 A;  1NS1 A;  1V9P A;  2ZXW C;  3K9A A;  2GBO A;  2WWW A;  3SJC C;  4JZ2 A;  5LBQ A;  4FZ0 A;  5CA3 A;  4AI8 A;  3A2F A;  3G71 V;  3E2E A;  1JCH A;  3FX7 A;  2EIM C;  3RYF A;  5IYZ A;  4Z1V A;  1JFF A;  1FD9 A;  2AHZ A;  2UXD O;  4I9W A;  5CN0 A;  1Q7Y W;  1SZX A;  2WLJ A;  5H5N A;  3SYC A;  3H9V A;  2F66 C;  4PI2 A;  3ZIA G;  3P3N A;  4LF9 O;  2DYR C;  4JI4 O;  1KKD A;  2QWQ B;  3A0H Z;  4H0L B;  3A8T A;  5B1A B;  4Q6G A;  1ZLZ A;  5JWP A;  4H13 B;  3OT7 A;  2UXB O;  1T5E A;  2ITC C;  1JJO A;  3HKC B;  4O4L B;  3DXR B;  2UUA B;  4JF3 A;  2IJK A;  5J2T A;  2EIL C;  1Y74 B;  5B1N A;  4GKK B;  1ZL8 B;  3FKS G;  2WLH A;  4X20 B;  1UFI A;  1KB9 F;  1K4D C;  1QR9 A;  1VMG A;  3HPL C;  4KHP B;  2DYS C;  4EFB A;  3K57 A;  2CTW A;  5EZY A;  4LWS A;  1GN4 A;  2CH7 A;  1RPO A;  4JYA B;  4KHP O;  5BZB A;  4JI0 B;  4X88 A;  1GM8 A;  5EBM C;  4PDL A;  3JAL A;  3AG1 C;  1EZJ A;  3B77 A;  4DV6 B;  2KQX A;  3CWB H;  2D3O W;  1UPG A;  4MT8 A;  3OR6 C;  4CS4 A;  4JI8 B;  1N0N A;  4UB8 Z;  5JH7 B;  4JPR A;  4ZI7 A;  1S0V A;  4B3R O;  3OUF A;  1WAZ A;  4TV8 B;  4TUY A;  3CCS V;  4WCE V;  1VQ6 V;  1BGY H;  4MTF A;  3O9O A;  4O4J B;  1S5H C;  4UVC A;  4RUF A;  1N33 O;  1MZE A;  2QWN B;  1IBK O;  1E1Q G;  3JAW A;  1NQT A;  1VEW A;  3U0Z A;  1B06 A;  2Q8V A;  4RWU A;  5IYB O;  4NYK A;  1BSM A;  2NR5 A;  1FJG B;  2L35 A;  2ZIM A;  4LF7 B;  3ZMT A;  4UB6 Z;  4LR3 A;  4X66 O;  4UCR A;  3M7M X;  2ZE8 A;  1Y4M A;  1HNX B;  4KXR A;  2E76 B;  2JVD A;  4JAS A;  3TXS A;  2UUB O;  1MOF A;  2E3C A;  5EYP A;  2P90 A;  3ZCC A;  4X1I B;  4DR4 O;  5TIS Z;  1H2K A;  1AI4 A;  1TGO A;  3CC2 V;  2OCC B;  1H8E G;  1ZUQ A;  2LGW A;  3DXR A;  1FYJ A;  1BE3 H;  2F43 G;  1NZ6 A;  4PDV A;  2YXH A;  4JI1 O;  3DSQ A;  5E1A C;  4DRX A;  4X20 A;  4X64 B;  3EHB B;  1Q6I A;  5J2U A;  2PZS A;  4PDR A;  2W6J G;  1XMQ O;  1AR1 B;  1TUE B;  2P4V A;  3E35 A;  3JCZ A;  4QNH B;  2VQF O;  1NH2 D;  3CCV V;  3CB2 A;  2XTA A;  3JAL B;  1JPX A;  3KKY A;  5GON A;  2LQT A;  3ZS8 C;  1AP6 A;  2YXY A;  3E22 B;  5IYC O;  5KAF Z;  1Z5W A;  1WPX A;  3N2K A;  5EBW C;  1F7Y A;  3JAR B;  4PDM A;  1S3J A;  5F2V O;  4DO2 A;  5LGU A;  4LP8 A;  2F4V O;  2ZR3 A;  1XNQ O;  5D5P A;  4PJ0 Z;  3RYC A;  1L1F A;  3OM3 B;  1AI5 A;  3APQ A;  1AIL A;  3JAM N;  5L3E A;  3KCX A;  3ZHU A;  1GN6 A;  1R6K A;  1QNM A;  3P32 A;  4FFK A;  1Y74 A;  2ODM A;  2ZE6 A;  3ZBH A;  5CB4 B;  3DC6 A;  2MK3 A;  1Z5V A;  2CTP A;  2JS5 A;  4JI0 O;  2RQ6 A;  3SJA C;  2EUL A;  4GKK O;  4UCT A;  3HKB B;  4DV3 O;  4QGP A;  3VQY A;  3C90 A;  3W7W A;  5KHH A;  5CA1 A;  3CE2 A;  2XOK G;  1VF6 A;  1GN3 A;  3ZMU A;  2DWE C;  3ETQ A;  2E5L O;  3ICX A;  2AW9 A;  1P84 F;  2Q7G A;  4I4T B;  4K0K O;  1ZAU A;  4QE7 A;  1EN5 A;  4KL1 A;  2UXB B;  5FLX N;  1PNM A;  4BW9 A;  3OMI B;  4ZI7 B;  5DN6 G;  2HLD G;  4U3J A;  2RJZ A;  1K3E A;  1VQ9 V;  4TUY B;  2QGN A;  4PV1 B;  2B1G A;  3ABL C;  2X6C A;  1XHX A;  3ABK B;  4O4I A;  1OCR B;  1IBM B;  1QU7 A;  1YJN V;  4CC5 A;  1KP3 A;  2JEU A;  1FFX A;  1QQC A;  2GUZ A;  2H8P C;  1IXB A;  1NH2 B;  5GTI Z;  5B1B B;  1YTF D;  4LF5 O;  3VQW A;  2A79 B;  4JGS A;  3K0D A;  1DTO A;  1YHQ V;  1HWY A;  2ADQ B;  2Q67 A;  5CA0 A;  3RW0 A;  5B5E Z;  4YXW G;  1N8R W;  2YSU B;  1NTZ H;  4BIO A;  4R7C A;  1K5S A;  5B1O A;  3ZRS A;  2YDE A;  3JAT A;  4I0X B;  4RAI A;  1GMG A;  5IYD O;  1OCR C;  4JI6 B;  3U10 A;  1M5I A;  2QKC A;  1VQ5 V;  3GB7 C;  3CCQ V;  1CP9 A;  1AJQ A;  1GRJ A;  3ZMZ A;  4DR1 B;  3E8H A;  1IBL O;  1OCZ C;  5IYZ B;  3G6E V;  1OCO C;  4X9Q A;  3UQ8 A;  3SPC A;  3CC7 V;  3IC9 A;  4O2B A;  3J7A U;  1NT2 B;  5K1X A;  1JR9 A;  3T1C A;  2M7W A;  1PL0 A;  3THO A;  1H38 A;  2V4D A;  3RWR D;  4YY3 O;  2ILM A;  1WJZ A;  1Y6X A;  5KUM A;  2ATK C;  5KMG A;  1TUB B;  1IBK B;  2EJR A;  1GTO A;  2CGN A;  2VRZ A;  1AP5 A;  2P7T C;  4TSF G;  4I50 B;  4J11 A;  2IJI A;  3WU2 Z;  4JV5 O;  3CYO A;  2O57 A;  3AG3 B;  3N2G B;  5B1A C;  3OTO O;  5EK0 A;  3KZI Z;  4U3J B;  3KCY A;  1QLE B;  4X64 O;  4MVU A;  5JVD A;  4OXS A;  2A06 H;  2N04 A;  3C3T A;  1WP8 A;  3JYC A;  3T2M A;  1IDS A;  1CEZ A;  3FYI B;  2KG7 A;  4CS2 A;  4DV5 B;  4YJ3 B;  4LF8 B;  1V54 C;  2EIN C;  5DED A;  2F93 B;  5LA6 A;  3M8A A;  4DR5 O;  3UO2 A;  4KUM A;  1NTK H;  4X66 B;  2UXD B;  1OHH G;  4BR6 A;  5D5Q A;  1Q82 W;  4J9Z B;  4YY3 B;  3RYH B;  1XMO B;  1NVP B;  1MNG A;  3ABU A;  4DUZ B;  4FLW A;  3OUS A;  1XMO O;  2EIK C;  2UXC B;  5IJ0 B;  3K03 A;  1R3I C;  1PPJ H;  3G4S V;  1K34 A;  1XL4 A;  4XBF A;  1YIT V;  1P49 A;  3CJH A;  1Q5O A;  3MD0 A;  3LNM B;  1OCZ B;  3OAA G;  2Z3Y A;  3IGA C;  4JI4 B;  1K8A W;  3M99 B;  4CS3 A;  4I55 B;  4IHJ A;  2QWP B;  3BEH A;  2P67 A;  5LOV A;  4BIZ A;  4JI7 O;  1VQN V;  2CH7 B;  2OT5 A;  4JYB A;  4DK1 A;  4LF6 O;  4UCS A;  5H9C A;  1FFX B;  2FTK A;  4JV5 B;  2P22 C;  5CBF A;  3OEE G;  2G38 A;  5KHJ A;  4J10 A;  5FPR A;  5JCO A;  3ASN C;  2B9Z A;  4FK5 C;  4DV3 B;  3ZN0 A;  2PUS A;  1J95 A;  1S5J A;  1F4M A;  3C3S A;  3CCR V;  2UUA O;  3K04 A;  1VQK V;  3PN1 A;  1I08 A;  1SRY A;  4CH6 A;  1K7D A;  5LXT A;  2F4V B;  3H01 A;  3JAW B;  4HNA B;  2EIL B;  3AG4 B;  4ZKI A;  4HAM A;  2Q6A A;  1VF5 B;  4JI2 B;  2PTM A;  3G6B A;  5LHG A;  3ZRW A;  1TAE A;  1PNL A;  2WA3 A;  4UUJ C;  3B8M A;  4A5U B;  3AG1 B;  5DEC A;  3TET A;  2DWD C;  4MS2 A;  1AJN A;  1I7F A;  5CBG A;  3QO5 A;  1S72 V;  2HVK C;  3QF7 A;  3DTU B;  1LUW A;  1XHZ A;  5JJJ B;  1MA1 A;  2YXL A;  1TVK A;  4Q20 A;  3WB0 A;  2R70 A;  5JQG B;  3T1Y B;  2ZT9 B;  2CAZ C;  1WA8 B;  4JI1 B;  4YIO A;  1B3Q A;  5H6R A;  2XAJ A;  4I55 A;  4IHJ B;  3HR0 A;  1YXB A;  1H2S B;  5J2U B;  3IAY A;  2HEP A;  2GTA A;  1N34 B;  2QDO A;  3FD9 A;  1L8D A;  3JAS A;  1SS3 A;  2Y69 C;  5BR8 O;  1I5X A;  4NXM B;  3ZHT A;  3AG3 C;  1KU9 A;  2DOS A;  2QR4 A;  2UUC O;  4QJF B;  3L73 H;  3ETE A;  3T4Z A;  1AI6 A;  2ZDI C;  1SES A;  2UUB B;  4PD4 F;  2Z5U A;  4J9Y B;  4FLT A;  4DR7 B;  4JAA A;  4UCU A;  1FS0 G;  2X0L A;  2OCC C;  1KYO F;  3CP1 A;  4LFC B;  4JI5 B;  2Y69 B;  5IY5 C;  3MHS C;  2ZXW B;  1YJ9 V;  3NXS A;  1RSO B;  3AG4 C;  4P9O A;  4LBE C;  1FXV A;  1M57 C;  1JFF B;  3ZHS A;  4DR4 B;  1HW7 A;  4G27 B;  1DLB A;  2X6B A;  4B3S O;  2QTO A;  2BSK A;  3T1Y O;  2LJ2 A;  1WB7 A;  2MW2 B;  4TQF A;  3SYA A;  1RPR A;  1WB8 A;  2GHY A;  2ZM6 O;  2ZE7 A;  1MG1 A;  5BMV A;  2OIE A;  5IWA O;  1P4R A;  2VWJ A;  1YCI A;  3R65 A;  4DV0 B;  3J81 N;  2CTQ A;  5L3C A;  4HZ3 A;  3RN4 A;  4DR1 O;  2B5U A;  3JAS B;  1YDX A;  1THZ A;  2HKO A;  4MVZ A;  5IT9 N;  3BFR A;  2DYS B;  5LYJ B;  3IFX A;  3ZHV A;  1ZWI C;  4H37 A;  2C2A A;  2XAF A;  5KX5 A;  1XEQ A;  1OZ0 A;  2JGD B;  1D5N A;  3W7T A;  2IW5 A;  4U7N A;  2NN4 A;  1URF A;  1DGS A;  2YUA A;  4IYH A;  2P5O A;  2VS0 A;  4U3F H;  1K9M W;  1IX9 A;  3LSQ A;  4FM1 A;  3K06 A;  2P06 A;  2KSD A;  2YEV A;  2K9P A;  4LH6 A;  1Q6H A;  2XND G;  3BRC A;  3VQX A;  4I9Q A;  2F1M A;  4I4T A;  1QBZ A;  4PEL A;  1WN7 A;  4FFB A;  1SQX H;  5IDJ A;  1ENV A;  4O2B B;  3OR7 C;  1X4T A;  4DV1 B;  1N33 B;  1YZB A;  2HR3 A;  1V54 B;  3RYI A;  2HHH B;  3OTF A;  5B3S C;  3STZ C;  1PM9 A;  3CD6 V;  1GM7 A;  3WB2 A;  2IH1 C;  1ZX3 A;  2Y0I A;  1S76 D;  1XQ8 A;  3QG5 A;  2GUZ B;  2BE3 A;  4NKG B;  1JQ0 A;  3LDE A;  5ITZ A;  2LW1 A;  2JGU A;  3FAV A;  4ZBM A;  4PA4 A;  1DF4 A;  2UXC O;  3N2G A;  1V55 B;  3ETD A;  2IU3 A;  1R73 A;  3CHX A;  3T4D A;  4TV8 A;  1L0N H;  3HKE A;  3W7U A;  1QR8 A;  1SA0 A;  2W6I G;  4DR6 O;  3OMN B;  5B66 Z;  4PHZ A;  5LMU O;  1B6Q A;  2W0F C;  2OWO A;  3TGU H;  5JJN B;  1YSC A;  4DW0 A;  1QVG U;  3FB6 C;  2ZM6 B;  1IZ3 A;  1SQB H;  4DV5 O;  4J80 A;  4QPK A;  2GSM B;  2YIB D;  1OCO B;  3APO A;  1VQ7 V;  2R9R B;  4B7K A;  5GW7 A;  4X1Y B;  2LW7 A;  1R6N A;  5LP6 C;  1Q6U A;  3RYH A;  5CBH A;  2R9I A;  1SET A;  5EYP B;  3JD2 A;  1KMI Z;  1W59 A;  1VQ8 V;  2BSK B;  3BAA A;  1AJP A;  2PYL A;  1M56 B;  4DV0 O;  4JI3 B;  1SQQ H;  5LMU B;  1VQP V;  2QEX V;  2YC0 A;  1M90 W;  3SJB C;  4C7U A;  1RM1 B;  5A2Q N;  3ML0 A;  1OV9 A;  2QJ1 A;  3CPW U;  2EJ7 A;  3E89 A;  4JAV A;  3AK1 A;  3BPZ A;  4O2A A;  2PGG A;  3CSX A;  1XMQ B;  3IJ4 A;  1MSD A;  2ZNJ A;  4MTX A;  4YJ3 A;  2WLK A;  3CRM A;  4R6Z A;  1OCC C;  4DXW A;  4LF9 B;  1M57 B;  3QO7 A;  3JAK B;  5LA6 B;  1I94 B;  5JQG A;  5C93 A;  3E8B A;  1HNX O;  4X65 O;  1HP8 A;  3H1I H;  3AK2 A;  4XDK A;  5LP6 B;  3B4S A;  3E8G A;  4TWK A;  3RYC B;  1VQM V;  4O4I B;  2YEV B;  3CMA V;  4O4H B;  2B1I A;  4RO2 A;  1AR4 A;  3L9D A;  3A0B Z;  1Q3E A;  4LF7 O;  2Y48 A;  4X1K B;  4GLX A;  1F51 A;  4LNU A;  3X2Q C;  1GM9 A;  1ROP A;  3B8N A;  4X1Y A;  4WFF A;  4JI2 O;  4IIJ A;  5LHI A;  2Q0A A;  3RT3 C;  3OD4 A;  4FLX A;  2EIK B;  1EBO A;  2HVJ C;  4DW1 A;  2WLI A;  1IVS A;  3JAT B;  4RQF A;  4BWA A;  1IBL B;  2GDS A;  1U97 A;  4DV4 B;  4OGQ B;  1CXZ B;  4O4L A;  1R3K C;  3UO3 A;  1NI8 A;  2Q73 A;  2Q7H A;  2Q7E A;  3I56 V;  5E79 Z;  5EC2 C;  2DJV A;  4L8J A;  4LCU C;  2V7Q G;  3K79 A;  3BVO A;  1AVM A;  4EB6 B;  2EBO A;  1RP3 B;  2L6L A;  4FVM A;  4ASU G;  1FXK B;  4JZG A;  2JJ1 G;  4B3S B;  1WP7 A;  1NBM G;  3OFN G;  2CUG A;  1D2D A;  3W7S A;  5H2F Z;  1N36 O;  1G1X B;  1GKF A;  4PA9 A;  4K3A A;  4AQY O;  5JH7 A;  4JYY A;  1XUQ A;  5L3G A;  3UT5 A;  1YF2 A;  1HR0 O;  4L87 A;  3B40 A;  2AHY A;  2QSA A;  2OTJ V;  3VOU A;  1HNW B;  4AQY B;  1KBH A;  5L3F A;  3E8F A;  3VQV A;  3H1K H;  3CRR A;  4FIP C;  4JI5 O;  4W4L A;  4XDL A;  2RMK B;  1QVF U;  3ABM B;  4TV9 A;  4N21 A;  1DK1 A;  1KUQ A;  3H1J H;  1FKA O;  4LFA B;  4H44 B;  1GH6 A;  5EZY B;  1L0L H;  1W0J G;  3DC5 A;  1MAB G;  1VF6 C;  1JOY A;  2OIG A;  4LF4 B;  1QCE A;  2JRI A;  4MVM A;  3W7X A;  2XAH A;  1JJ2 U;  4YHH O;  3ABM C;  5DM6 V;  2Y4U A;  3JD3 A;  3TJT A;  5KAI Z;  4XDJ A;  4X62 O;  4DRX B;  4DYL A;  2WLM A;  5A9G A;  1LUV A;  5JVD B;  3D3Q A;  3SJQ C;  4F4L A;  1BMF G;  4J7J A;  1PD3 A;  5IWA B;  1SQF A;  4P30 A;  5IY5 B;  1FPO A;  4D7T A;  5HFM A;  3SYO A;  1O9G A;  4MVR A;  3LSU A;  4TT3 G;  3ZHR A;  1KQS U;  4B3M O;  3OMA B;  1RM1 C;  4GT1 A;  1SQG A;  5JCO C;  2OTL V;  4AHC A;  4UVA A;  3CX5 F;  5KHK A;  4DV4 O;  1XIL A;  1EFR G;  1XRE A;  1FAF A;  1NVP D;  3B2E E;  1AB3 A;  3T1H O;  3QO8 A;  2FB5 A;  3BAB A;  3CJH B;  3SPH A;  4CH3 A;  3ZRX A;  1H2L A;  3AG2 B;  1LNQ A;  5LOV B;  3ZRW B;  2N74 A;  1K4C C;  1G8M A;  4LF4 O;  1ZTE A;  2FYU H;  1Y66 A;  5LYJ A;  4ZOL A;  1X59 A;  1JVM A;  2UU9 O;  4DR2 B;  4GKJ O;  4F6R A;  1PNK A;  1KP2 A;  5FNV A;  2Q9L A;  3FAV B;  4GCZ A;  1D5A A;  1M4U A;  2X6A A;  4MSW C;  3WB1 A;  3HKD B;  4KFM A;  4MW8 A;  1P7G A;  2JGD A;  1XNR O;  1BQZ A;  1WA8 A;  4K8X A;  3SYP A;  2JEX A;  1N4C A;  1Q90 D;  1NU1 H;  3SPJ A;  1GN2 A;  1HNW O;  2DMX A;  3K5O A;  1N36 B;  3F7Y C;  2ZR2 A;  2GV9 A;  2IBZ H;  2CDY A;  1Y76 B;  4DV1 O;  3G67 A;  2QTS A;  3I55 V;  3GVM A;  2A9H A;  4MVS A;  3G80 A;  2OYQ A;  2E75 B;  1SC5 B;  1Q81 W;  2JDI G;  1GAX A;  3JAK A;  4GX2 A;  3OTO B;  4GZR B;  3CXC U;  2QKS A;  4G28 B;  1I5Y A;  4OPH A;  2PF4 E;  3AG7 A;  4UVB A;  2D2C B;  4FPP A;  3UCS C;  3B09 A;  1N0J A;  4UCO A;  4IT5 A;  3HKB A; 
#chains in the Genus database with same CATH homology
 4UV9 A;  3STZ C;  3SYQ A;  3ABK B;  1OCR B;  1GM7 A;  3CD6 V;  4H33 A;  1H2G A;  2H94 A;  2IH1 C;  5LGN A;  1YJN V;  1S76 D;  1KP3 A;  1BL8 A;  2JEU A;  5FL7 G;  3SPG A;  3OW2 U;  2HG5 C;  2WAM A;  2QM8 A;  3D36 A;  1K92 A;  2H8P C;  1NH2 B;  1BHB A;  1JQ0 A;  3LDE A;  5B1B B;  1YTF D;  4QE9 A;  5H6Q A;  2A79 B;  4JGS A;  3K0D A;  3HB3 B;  1GO3 F;  1DTO A;  4X8A A;  4ZBM A;  5J9P C;  1HWY A;  1YHQ V;  3IC7 A;  2Q67 A;  3JD1 A;  4PA4 A;  1S77 D;  1DF4 A;  3RW0 A;  1H8H G;  1V55 B;  3ETD A;  2IU3 A;  4YXW G;  1R73 A;  1N8R W;  3T4D A;  3PJS K;  3JD0 A;  4JTD B;  2YSU B;  3W7U A;  4R7C A;  3STL C;  1QR8 A;  1K5S A;  5B1O A;  2W6I G;  3ZRS A;  3OMN B;  1GK9 A;  1B6Q A;  4RAI A;  1GMG A;  4BIU A;  4R8C A;  5IYD O;  2W0F C;  1OCR C;  1XL6 A;  1YSC A;  3LDD A;  3A0R A;  1QVG U;  3FB6 C;  4JTA B;  1Q86 W;  1VQ5 V;  3GB7 C;  2QA4 V;  4QPK A;  3CCQ V;  1CP9 A;  1AJQ A;  2GSM B;  5L3B A;  3ZMZ A;  1BHA A;  1OCO B;  5B3S B;  3E8H A;  1VQ7 V;  1MSW D;  1OCZ C;  2R9R B;  2ZDI A;  4CZZ A;  3ETG A;  3G6E V;  1OCO C;  5GW7 A;  3SPC A;  3CC7 V;  1R6N A;  4WFB V;  4X89 A;  3E86 A;  2A0L A;  5CMU A;  1FXH A;  1R3J C;  1K5Q A;  1OCC B;  4JTC B;  3ZJZ A;  1NR1 A;  1K33 A;  4WFH A;  3T1C A;  3MHH C;  2M7W A;  1PL0 A;  2UXN A;  4JYC A;  5CBH A;  5KUK A;  1H38 A;  2R9I A;  1SET A;  4RQE A;  3JD2 A;  1VQ8 V;  1AJP A;  1M56 C;  4Z1M G;  5LGT A;  5KUM A;  2ATK C;  1M56 B;  2CK3 G;  1SER A;  2EJR A;  1GTO A;  1FXK A;  2V1D A;  4PA7 A;  1VQP V;  3KG2 A;  2HJF C;  2QEX V;  3WFV A;  2P7T C;  4TSF G;  1M90 W;  2IJI A;  1W2B U;  3F7V C;  5KA5 A;  2IJH A;  3CYO A;  1RM1 B;  3AG3 B;  5B1A C;  5EK0 A;  1M9N A;  1W0K G;  1YJW V;  1NKD A;  3ML0 A;  3RBZ A;  3CPW U;  5EC1 C;  3ZRV A;  3E89 A;  2EZO A;  4JAV A;  1QLE B;  4MVU A;  5LHH A;  2WLN A;  4OXS A;  3FB7 C;  4BAY A;  2LFR A;  3RVZ A;  1PKX A;  4RUE A;  3CC4 V;  3SPI A;  3JYC A;  2EIJ C;  3T2M A;  1CEZ A;  3FYI B;  4MTX A;  4FMT A;  2WLK A;  2XAG A;  3CCM V;  1K73 W;  1KD1 W;  1FFT B;  4R6Z A;  1OCC C;  4DXW A;  1V54 C;  3P30 A;  1M57 B;  3CME V;  2EIN C;  2IJJ A;  3QO7 A;  2IU0 A;  1IXM A;  3CCU V;  2LP7 A;  5C93 A;  3E8B A;  3JD4 A;  4JAU A;  3TCU A;  1YI2 V;  4KUM A;  4N23 A;  2P6J A;  4UV8 A;  4XDK A;  1OHH G;  3E8G A;  1Q82 W;  2DQ0 A;  4J9Z B;  3BY6 A;  3E83 A;  4TWK A;  1NVP B;  3QNE A;  1ORQ C;  1E79 G;  1JX9 A;  4R50 A;  3ABU A;  3OUS A;  2EIK C;  3K03 A;  1R3I C;  2DW4 A;  2WSS G;  3AEI A;  1VQM V;  2YEV B;  3G4S V;  3CMA V;  1K34 A;  2B1I A;  4RO2 A;  1XL4 A;  3K3W A;  4XBF A;  3UM7 A;  2WLL B;  2Y48 A;  4GX5 A;  1YIT V;  3F5W C;  2JK5 C;  1F51 A;  3X2Q C;  3MD0 A;  3LNM B;  1OCZ B;  1YTF B;  3OAA G;  2Z3Y A;  3IGA C;  1GM9 A;  2EIM B;  2JIZ G;  1K8A W;  1ROP A;  3M99 B;  4MW3 A;  3B8N A;  4WFF A;  3BEH A;  1E1R G;  1FXK C;  2P67 A;  5LHI A;  4BIZ A;  2X7R B;  3ABT A;  1VQN V;  2EIK B;  1EBO A;  2HVJ C;  2ZXW C;  3K9A A;  2WLI A;  2WWW A;  2OT5 A;  5LBQ A;  4GX0 A;  4JYB A;  5CA3 A;  5H9C A;  4E2L A;  4RQF A;  4KP4 A;  3G71 V;  3OE7 G;  3E2E A;  1JCH A;  2FTK A;  5CBF A;  3OEE G;  3ABK C;  2EIM C;  1R3K C;  3ASN C;  2AHZ A;  3I56 V;  4FK5 C;  3ASN B;  4I9W A;  5EC2 C;  3ZN0 A;  5CN0 A;  5B1B C;  1Q7Y W;  1AI7 A;  4LCU C;  2WLJ A;  1J95 A;  3SYC A;  3LDC A;  2ZD9 A;  1NR7 A;  2V7Q G;  3ZIA G;  3K79 A;  2DYR C;  1F4M A;  1KKD A;  5EBL C;  3UKM A;  1KEC A;  3CCR V;  2EBO A;  3K04 A;  1VQK V;  3ZMS A;  1SRY A;  5B1A B;  4ASU G;  1K7D A;  1FXK B;  2WLL A;  1V55 C;  2JJ1 G;  3H01 A;  2ITC C;  2EIL B;  1NBM G;  3OFN G;  3AG4 B;  4JF3 A;  3CCL V;  4ZKI A;  2IJK A;  3W7S A;  2EIL C;  5B1N A;  3WG7 C;  4HAM A;  2Q6A A;  4QPJ A;  1GKF A;  3FKS G;  4PA9 A;  2WLH A;  1K4D C;  5L3G A;  3ZRW A;  1QR9 A;  5LHG A;  1COW G;  1QLN A;  1PNL A;  3HPL C;  2DYS C;  2WPD G;  4UUJ C;  3B8M A;  1RPO A;  3AG1 B;  4FJC C;  3TET A;  4L87 A;  4MVQ A;  2AHY A;  5BZB A;  2DWD C;  2OTJ V;  4MS2 A;  3VOU A;  4X88 A;  1AJN A;  5CBG A;  5L3F A;  2KB1 A;  3QO5 A;  3E8F A;  1S72 V;  2HVK C;  4MTG A;  1GM8 A;  5EBM C;  2X6C A;  3DTU B;  4PDL A;  4FIP C;  3AG1 C;  1VQ4 V;  4LC1 A;  2UXX A;  1EZJ A;  3B77 A;  3ABL B;  4XDL A;  2D3O W;  4Q20 A;  4MT8 A;  1QVF U;  3ABM B;  4N21 A;  3OR6 C;  1R3L C;  1SZT A;  3ASO C;  2PI5 A;  5H6R A;  2XAJ A;  3GWO A;  4JPR A;  1P7B A;  1S0V A;  3OUF A;  4UXN A;  1W0J G;  1DF5 A;  1MAB G;  1JOY A;  3EFF K;  2XAS A;  3D3I A;  3CCS V;  4WCE V;  1VQ6 V;  4MTF A;  1QCE A;  1S5H C;  2Y69 C;  1I5X A;  4RUF A;  4UVC A;  4MVM A;  3W7X A;  2XAH A;  1QLE C;  1ARO P;  3AG3 C;  1JJ2 U;  1E1Q G;  3ABM C;  2DYR B;  1VQO V;  5DM6 V;  1NQT A;  4QJF B;  3ETE A;  3JD3 A;  3AG2 C;  3ASO B;  3T4Z A;  2IH3 C;  5IYB O;  2ITD C;  4XDJ A;  3FB8 C;  3WG7 B;  1AI6 A;  2ZDI C;  4WFG A;  1SES A;  5HFL A;  3LSS A;  2Z5U A;  3LUT B;  4J9Y B;  2WLM A;  2EIN B;  3ZMT A;  3X2Q B;  1FS0 G;  5KA6 A;  1Y4M A;  3SJQ C;  4F4L A;  2ZQM A;  2X0L A;  2QE7 G;  4JAS A;  2OCC C;  1BMF G;  1MOF A;  1PD3 A;  1G4Y B;  4BW5 A;  2P90 A;  3CP1 A;  3FB5 C;  3ZCC A;  4P30 A;  5IY5 B;  2Y69 B;  5IY5 C;  3MHS C;  5HFM A;  1AI4 A;  2ZXW B;  3SYO A;  3K0G A;  3CC2 V;  4WFA V;  4MVR A;  1YJ9 V;  2OCC B;  4TT3 G;  3NXS A;  3AG4 C;  1YIJ V;  4P9O A;  4LBE C;  1H8E G;  1KQS U;  3OMA B;  1RM1 C;  1FXV A;  2F43 G;  1M57 C;  4G2K A;  4GT1 A;  4PDV A;  3TK1 A;  1VQL V;  2K1E A;  3OEH G;  5E1A C;  2OTL V;  3ZN1 A;  3EHB B;  4PDR A;  2W6J G;  1AR1 B;  4UVA A;  1TUE B;  3E35 A;  4G27 B;  4PA3 A;  3JCZ A;  4QNH B;  1DLB A;  5L3D A;  2X6B A;  1EFR G;  1NJI W;  2BOB C;  1NH2 D;  2QM7 A;  2NNU A;  3CCJ V;  1NVP D;  2QTO A;  3CCV V;  3RVY A;  3DGE A;  4PA6 A;  3QO8 A;  4HYO A;  3SYA A;  1RPR A;  1JPX A;  3SPH A;  2DQ3 A;  3ZRX A;  2GHY A;  1WLE A;  1MG1 A;  5IYC O;  3AG2 B;  4GX1 A;  1WPX A;  5EBW C;  1LNQ A;  1P4R A;  2PI4 A;  4PDM A;  1S3J A;  4QIW F;  2HFE C;  3R65 A;  1F23 A;  3ZRW B;  4DO2 A;  3K08 A;  2Q68 A;  5LGU A;  4LP8 A;  1K4C C;  1G8M A;  2ZR3 A;  5L3C A;  2WLI B;  4HZ3 A;  4P9P A;  2NLJ C;  2Q69 A;  2B5U A;  1L1F A;  3OM3 B;  1Y66 A;  2HKO A;  1THZ A;  4MVZ A;  1AI5 A;  2DYS B;  1JVM A;  2BOC C;  3IFX A;  5L3E A;  1PNK A;  1ZWI C;  4H37 A;  4MTO A;  3VBB A;  1R6K A;  1KP2 A;  3P32 A;  1CPY A;  2XAQ A;  2JJ2 G;  2C2A A;  2XAF A;  4GCZ A;  2X6A A;  3ZMV A;  4MSW C;  4KFM A;  4MW8 A;  1OZ0 A;  4MVO A;  2MK3 A;  3W7T A;  2IW5 A;  4U7N A;  3SYP A;  2JEX A;  3SPJ A;  4I5S A;  3F7Y C;  4U7O A;  2ZR2 A;  1K97 A;  3OGC C;  1K9M W;  3LSQ A;  3W7W A;  3K06 A;  4P2Z A;  3I55 V;  2A9H A;  2XOK G;  2YEV A;  4MVS A;  1M1K W;  3ZMU A;  2XND G;  1Q81 W;  2JDI G;  4EKW A;  2DWE C;  1F4N A;  2EZP A;  4WFE A;  2LFS A;  1UJW B;  4QE7 A;  1QBZ A;  4GX2 A;  4PEL A;  3CXC U;  2QKS A;  1ENV A;  4G28 B;  1I5Y A;  1PNM A;  2EIJ B;  5IDJ A;  3OMI B;  3OR7 C;  5DN6 G;  1KC8 W;  2HLD G;  4UVB A;  2HR3 A;  1V54 B;  1K3E A;  4FPP A;  3CCE V;  1VQ9 V;  4WF9 V;  3FYE B;  4CBC A;  5B3S C;  2B1G A;  3ABL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...