2LFRA

Solution structure of the chimeric af1503 hamp- envz dhp homodimer
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
111
structure length
111
Chain Sequence
b'STITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein, Osmolarity sensor protein envZ chim
publication title Mechanism of regulation of receptor histidine kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus, shigella flexneri
molecule tags Transferase
total genus 43
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00672 HAMP HAMP domain
A PF00672 HAMP HAMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lfrA00
4JYCA 2LFSA 4BIUA 3MD0A 3ZRWB 3D36A 4KP4A 3ZRVA 3A0RA 5C93A 4FPPA 4ZKIA 4QPJA 4MTXA 3DGEA 4FMTA 5IDJA 2P67A 4JASA 3P32A 5B1OA 2QM8A 2C2AA 2QM7A 3NXSA 4GT1A 2FTKA 4JAVA 1F51A 3ZRWA 3TK1A 4Q20A 4QPKA 2WWWA 4U7NA 4JAUA 4GCZA 5B1NA 4MT8A 2LFRA 3ZRXA 1IXMA 4BIZA 1JOYA 4JYBA 4U7OA 3ZCCA 4I5SA 4LC1A
chains in the Genus database with same CATH superfamily
3K59A 2PTMA 3RYFA 1AJQA 1Q6IA 1FXKB 1TUBB 3CRAA 4D7SA 4JI2B 2EINC 1N32B 2K1EA 4GKKO 1B06A 4I0XA 2UXBB 1XMOB 4FM1A 4TV9A 3R66A 1Q82W 1YZBA 1WLEA 2KG7B 5IY5C 3AK1A 4DV1O 3C90A 2ZM6O 3N2KB 2QSAA 1S5LZ 4B3RB 1VQ7V 4YJ3A 2ZE6A 4DR5B 1FKAO 1R3JC 4B3SB 3ICXA 4CZZA 4EFBA 1M5IA 1XL4A 1AROP 1SRYA 4CH6A 2Z3YA 4BIZA 4LFAO 1FJGO 2W0FC 4CH4A 5J2TB 3BCCH 1NR7A 2H3OA 4PA4A 3SDLA 4ASUG 4O4JA 5KX5A 4UUJC 1RP3B 5EK0A 2D3OW 4TOIA 3GVMA 3BA8A 4DXWA 2WA4A 2EIKB 2WPDG 4JYAO 3ETQA 1KYOF 1ZAUA 4DV4B 4CH5A 1L0LH 3E8HA 4YHHO 1QVGU 1QR9A 1N33O 1TUEB 2EINB 2LJ2A 4FLUA 4O4IA 3G71V 4NTXA 2EILC 1WP7A 1L1FA 2BTQA 4I5SA 4JI2O 2XOKG 1YI2V 4N21A 1KQSU 3JD1A 1N32O 2WLLA 1VQMV 5IY5B 2DQ3A 2UXBO 1XMOO 2ZDIA 5CMUA 3EXAA 3D36C 3K03A 3K9AA 1AI6A 2V7QG 4WFEA 4YJ2B 1NKDA 3K3WA 3PJSK 5EYPA 3O65A 1VF5B 3CCQV 3K08A 1QLNA 1V9PA 2GTSA 4PI0A 2DWDC 4B3RO 4GYCB 2IU0A 1M90W 1M57C 2XTAA 4DR5O 2JGUA 5C93A 4B3SO 4DK1A 4A5UB 4LH7A 4ICGA 3WFVA 3Q4HB 4D6TH 3NXSA 1XOUA 2RJZA 1K3EA 1VP7A 4U3JA 2VQFB 2QKSA 4DR1B 3FB8C 3UQ8A 3ZHRA 3BA9A 2JGDA 3UCSC 1JR9A 2VRZA 2YIBD 1FFXA 5KMGB 1DGSA 2ZE8A 3H01A 5GW7A 4AILC 3EHBB 1H8HG 3CRQA 4L8JA 2Y4TA 5HFLA 1Q43A 3OEEG 1WB8A 4DV4O 3MDSA 3OTOB 1VF6C 1HNZB 1XMQB 2HLDG 3TXQA 2EILB 3KZIZ 2E5LB 4L87A 1SC5B 3CCMV 4NXNB 4J7KA 5LMUB 2Q69A 2HVJC 3ZRSA 2WLNA 2H94A 1AI7A 4TUYB 2E76B 5B1AC 3RYCA 4DUZO 3WG7C 4MVSA 1Q81W 2WLIA 1V54C 1Y4MA 4TV8B 4FLZA 1GM8A 3FYEB 1NVPD 2IJIA 3LDDA 1Q8IA 3IC9A 1M57B 4AQYB 4UCVA 3K5OA 4JAVA 4WBNB 2NR5A 4PD4F 5DECA 4DR2B 2K9PA 1ENVA 2PF4E 4GCZA 4O4HB 1B04A 3FB5C 1IXMA 2RCVA 4JI4B 1YJ9V 1Y6XA 3ZHUA 1FXHA 2IH3C 1KMIZ 5IYZB 2Y0PA 4G2KA 4MSWC 4X88A 1K4DC 1KD1W 5IJ9B 3HKDA 1IBLB 5A9GA 1NR1A 1VQNV 3JSLA 1OCCC 5EBLC 2QR4A 2VQFO 5DN6G 3CRRA 4DR1O 4LFCB 4LH6A 5IWAB 4ZOLA 1NH2D 2OYQA 1Q3EA 1SQGA 1MNGA 1MZEA 2CE4A 5LGUA 3N2GA 4XDLA 4I9QA 1H2GA 2YI8A 3CCUV 3ML0A 4PJ0Z 2M7WA 4J9ZB 1TVKB 1IBKB 2BSKA 4UFZA 1YCIA 3CC7V 3K0GA 5K1XA 3RYHA 1AR1B 1HNZO 1XMQO 3K57A 2KKWA 5B1AB 3OUSA 4NTWA 2E5LO 1OZ0A 2Q6AA 3CCVV 3BEHA 3WG7B 4NXNO 1V54B 5LMUO 2R9IA 2HEPA 2FB5A 3JAWB 4MW3A 2YIBA 3THOA 4JTAB 2AZ0A 4I50B 2A9HA 1BHBA 4U3FH 1GKFA 1KUQA 4UCTA 4K0KB 3P30A 1L8DA 5LYJB 4JAUA 3D8CA 4BW9A 3F7YC 2Q0OC 3SJQC 2ARHA 3SPHA 1X4TA 3CX5F 4KHPB 2E3CA 3E2EA 2GHYA 5LP6A 3HB3B 1SZTA 4QNHB 4AQYO 4JI6O 3GWOA 2Q68A 3A0RA 4DR2O 5LXTA 4JI4O 4IIJB 1OCCB 5ITZB 4ABMA 3W7SA 2F43G 1IBLO 5L3CA 3ZMTA 3ZHVA 1BMFG 1I5YA 3AEIA 4AHCA 2QM4A 4FLXA 4LFCO 2JEUA 4QPJA 5IWAO 4ZI7B 4OPHA 5FLXN 1NQTA 3SYOA 3OEHG 2F93B 1TUBA 1FXKA 4X1YA 1GK9A 2CTWA 5GONB 3VBBA 5FL7G 2P5OA 3ASOC 5H2FZ 3T4ZA 3FKSG 5HFMA 1P49A 1AP6A 2Q9LA 2Q0AA 1VQLV 4N23A 3SJBC 4JI0B 5KAFZ 4IGGA 3M99B 4PA6A 2C2AA 2YC0A 3N2KA 1WA8A 3CS5A 1BSMA 1PL4A 4DR4B 4LNUB 2W6JG 2QE7G 4FK5C 1KP3A 4O2AA 5KA6A 2OCCC 2BOBC 4J42A 3QG5A 2B5UA 1EZJA 4K0KO 1S5JA 1K97A 5KLVH 4KHPO 2QGNA 2CTQA 3KG2A 5J2TA 1SERA 3PN1A 5L3GA 2JJ1G 2R9RB 2Q7EA 3O9OA 1HNWB 1AP5A 1QHTA 3ZHSA 3KCYA 1J5EB 4H0LB 3JASB 1ZL8B 4NYKA 4B3MO 5K1PA 2EIJB 4X8AA 3HKCB 4YIOA 1K73W 2YIAA 3CEIA 2R70A 2OT5A 3SR2C 2DYSB 3HKEB 4KUMA 4X1IB 1Y76A 4DR6B 2UXNA 1ZSPA 4I4TB 4DRXB 2LFSA 3ASOB 1SS3A 3WB1A 1GRJA 4FPPA 3STLC 3ZN0A 3DGEA 2IH1C 3T1HB 1ZUQA 2KQXA 2BOCC 1MABG 4MT8A 4JI0O 3H1LH 1NS1A 4UCUA 3JD0A 4QE9A 4X20A 2P7TC 4YJ2A 3E86A 4H37A 2OCCB 1JCHA 3FFQA 5B5EZ 2XAHA 2EJ7A 4RAIA 4DR4O 1UJWB 3QO7A 1HP8A 5BMVB 3UKMA 2OTJV 3ETGA 4Z1MG 1XNQB 2YSUB 1YDXA 3VQVA 5B1BC 3Q4HA 3GWKC 2UU9B 3DXRA 3QVNA 1S0VA 1AI4A 2ZQMA 1K92A 1HNWO 1H38A 3E8BA 1KB9F 4O4LB 5KMGA 1J5EO 1G6UA 3AG7A 4QJFB 2P6JA 4CC5A 1JX9A 4H33A 1N36B 2LW1A 3CPWU 1JJOA 4DR3B 3E8FA 5CB4B 4FLYA 1RM1C 3JAKB 3SYAA 4DR6O 3KKYA 4JI7O 4GX0A 1VQ9V 3K0DA 4JF3A 1HDJA 4J80A 2A79B 1SQXH 3HPLC 4LC1A 4WCEV 3T1HO 3D36A 4OXSA 1HR0B 5IYBO 1V55C 3E89A 5IJ0A 4TV8A 2ZNIA 3U10A 1TAEA 1AI5A 4P2ZA 2VS0A 2N74A 4DW1A 3LDCA 1YTFB 1Z5VA 3QF7A 1LR1A 3CWBH 2HJFC 2ZNJA 4F6RB 2XAFA 5LA6A 4LF6B 1YJNV 2CDYA 3STZC 1AILA 3E83A 4NKGB 1BT8A 4O4HA 4PDLA 3ABMC 5B1BB 3ZMZA 3W7XA 4FZ0A 1UPGA 1OJHA 4ZIBA 1XNQO 2UXCB 5JWPA 3NR7A 3QNEA 2PYJA 4HYOA 1I7FA 2ADQB 3UT5A 5LOVB 2UU9O 5JH7B 3ZCCA 1IXBA 5FNVB 3SPJA 4Z1VA 1MG1A 3AK3A 4MVUA 2JS5A 3FX7A 1YIJV 1Q6UA 1K9MW 3OGCC 3OAAG 3ABUA 4MTFA 1RM1B 2QWOB 4UV9A 3DC6A 4QPKA 1KKDA 3OMIB 1N36O 3H9VA 1VF6A 2GUZB 5CA0B 1TVKA 2VQEB 4DR3O 1YEWA 5DEDA 2EBOA 3K5MA 5H6RA 3CJHB 3RGBA 1JFFB 3B8NA 2PI5A 3FB7C 3S3XA 2X6CA 4I55B 5J2UB 3X2QC 2ZIMA 1V55B 2QWRB 1VQ6V 1NTKH 2QJ1A 3IAYA 4NR1A 3UO2A 1S3JA 4W4LA 1XBLA 3B8MA 4KL1A 3BAAA 5C8YB 3CCRV 4I50A 1HR0O 4P9OA 1EZVH 2IU3A 3JYCA 3G80A 1P4RA 1P7GA 3F5TA 5LYJA 4CS4A 2CTRA 2FYUH 4BIOA 1GAXA 4LWSB 3EVKA 2QM8A 3ABMB 1QVFU 1BE3H 3RWRD 1GH6A 4X62B 4LF6O 1Q6HA 5KHGA 1WPXA 5CA1B 2ZR3A 3FAVB 3B40A 5ITZA 2UXCO 4YY3B 1QLEC 3ZRVA 2VWJA 2B9ZA 1VMGA 4CS2A 2JS3A 5JQGA 5IYDO 1VIBA 2DW4A 4CH3A 3ZMUA 2YEVB 4PDVA 5B1NA 1I08A 1BGYH 4GX2A 4ZI7A 1KU9A 1MMMA 4DV2B 5JVDB 1R6KA 3AG2C 3D3IA 4EB6A 3HKBA 3AK2A 1M1KW 5GONA 2WA3A 4GLXA 2ZXWC 1BL8A 1SQQH 2VQEO 3JSNA 3JARA 1SA0B 2XAGA 2EIMC 4Q20A 4OGQB 1XHZA 3T1YB 3X2QB 2AHZA 4I9WA 3ZIAG 2Q73A 1WP8A 3TETA 4WFBV 1GN6A 3OMAB 2Y0IA 1FPOA 1IDSA 1JJ2U 1SF9A 1QR8A 5EBWC 1FS0G 1Z2GA 2JVDA 4DYLA 4H44B 2Q7GA 2P4KA 2LW7A 1PPJH 4WFFA 1H2LA 2W6IG 1G4YB 1US6A 4DV0B 4K35A 3OW2U 2GSMB 1MSDA 1F4NA 2B1IA 2ODMA 3AG1C 1L0NH 1DF4A 4BIUA 4DV3B 1K4CC 4X62O 4E4EA 2QDOA 4E2LA 5JJNB 1QLEB 4X65B 4DR7B 4BAYA 3BFRA 3IC7A 3G6EV 4LF9B 3DC5A 1N0NA 1BQZA 4NVPA 5EIBD 4JTCB 4YY3O 1AR5A 5LHGA 4TV9B 3HKEA 3BVOA 3AG2B 4X1IA 3LUTB 4RWUA 4FFBA 5IYCO 3U0ZA 2NN4A 1VQPV 1MSWD 4DRXA 1F23A 4LR3A 5D5QA 1YITV 3T2MA 2HP8A 4DV2O 2ZXWB 3JATB 1E1QG 2PUSA 2EIMB 2BTOA 4YJ3B 1GN3A 1GN2A 1XEQA 4MVZA 1EBOA 3UO3A 1BCCH 4YXWG 5H6QA 1UFIA 4KFMA 3ZRWB 1A32A 4YIPA 1R6TA 4UVCA 5BY1A 3T1YO 1VQOV 3F7VC 2A7WA 3SYCA 5BXZA 1VEWA 2QM7A 3JAMN 1F51A 1ZLZA 2CUGA 2XNDG 3OT7A 2H8PC 1CP9A 5KHKA 4JYYA 3OTOO 2AGAA 3I55V 2CGNA 2YXHA 4DV5B 4X9QA 1Q86W 1FD9A 2GBOA 4FM2A 1COWG 4WFGA 2ADPA 2N05A 1AJNA 2RN9A 3AG1B 2X0LA 4MTXA 2MK3A 1PNKA 4MVRA 4FLWA 3AG3B 2JRIA 3OD4A 1R73A 4XBFA 3TK1A 4DV0O 1SQFA 4K3AA 3SPGA 4C7UA 3WB0A 1TGOA 2DYRC 2PI4A 1DLBA 1GTOA 5LHHA 2Q4PA 1ROPA 1OHHG 3MAQA 4X65O 4DR7O 4O4IB 4UXNA 4JI1B 3B4SA 4ZKIA 4LF9O 4P30A 1EM1A 2Z5UA 1U97A 3TGUH 4X1KA 2BTQB 1VQKV 4FZ1A 4B3TB 2ZT9B 3JALB 3BY6A 3FD9A 3ABKC 4KXRA 2DOSA 4IYHA 3ZRXA 2Q5ZA 1AB3A 4D7TA 1EFRG 4LF8B 2EIJC 2CGOA 5EYPB 4LF5B 1GMGA 1OCOC 1Q5OA 4FMTA 5BR8B 5EBMC 2JIZG 3W7UA 4RQFA 2DYSC 2KSDA 4JI5B 2LGQA 3IJ4A 4XDKA 4HZ3A 1CPYA 3IGAC 3QO5A 4K8XA 2E75B 2Z0AA 3JCUZ 1HNXB 1IBKO 2ZKOA 3MD0A 2IJKA 3G67A 2ITCC 3R65A 4U3JB 4CBCA 3TCUA 4F6RA 4PDMA 2UUCB 5EC2C 2KG7A 3SJAC 2FTKA 4DV5O 3CRCA 1R3KC 4JV5B 1CEZA 3DTUB 3T1CA 2DYRB 2IJJA 1M9NA 4NTYA 2DN9A 3OR6C 5JH7A 4O2BB 5CBHA 1R6NA 3T4DA 3H1KH 4RUFA 3J80N 5AG2A 1EN5A 4GZRB 1OCZC 2HFEC 2LQTA 5A2QN 4X66B 3CC2V 4OX9B 3ABLC 2WLHA 4JI1O 3ABKB 2JJ2G 1NZ6A 4PHZA 2DJVA 4B3TO 2GUZA 5CA0A 1FXVA 4BWAA 3F5WC 3ZJZA 2XAJA 2IM9A 3SGIA 1OCOB 4IHJB 2Q7HA 4WFAV 1M56C 4Z2WA 2WWWA 2XT9A 1JFFA 3C3TA 1SETA 4LF8O 4UV8A 1YVWA 4I55A 5J2UA 3L70H 4LF5O 1NU1H 2RDCA 1RPOA 2LO1A 4EEQA 5LP6C 4JI5O 1WNSA 5C8YA 3JD4A 1K34A 2NNUA 4LBEC 5BZBA 4U7NA 2EJRA 2LGWA 3A0BZ 1HNXO 2OWOA 1Y74B 2AXTZ 2B1GA 1G8MA 3OUFA 3VQYA 1BQ0A 2V4DA 3ETEA 1Z5WA 3CMEV 1I0HA 4LF7B 2ITDC 2UUCO 1AR4A 2L35A 2QA4V 3E22B 4H13B 3K5LA 4UCOA 3CCLV 2KB1A 3QTCA 3SJCC 2XUMA 4JV5O 1YF2A 3N2GB 4GT1A 2UXDB 3CXHF 4J9YB 1MOFA 2EZPA 1W2BU 3W7WA 3CHXA 3CCEV 5LGNA 4TT3G 1JOYA 3EFFK 1OCZB 1QCEA 1N8RW 5EZYB 5IT9N 3ABLB 2WSSG 3UM7A 1XILA 4F4LA 1TA8A 4X66O 4OX9O 2F23A 3RYIB 3CXCU 1S76D 3CE2A 2X6AA 2E74B 5JCOC 3N27A 1DF5A 2QKAA 1M56B 4NXMB 1F4MA 3TJTA 3M7MX 1SA0A 1M93A 2R72A 5DM6V 3LSSA 3MHHC 1NBMG 4TWKA 5LP6B 4JASA 3RVZA 4J7JA 1LNQA 5E1AC 3SYQA 3L73H 3CRMA 4FVMA 5LXTB 1SZXA 1W0KG 1GN4A 3FB6C 5EC1C 2P90A 4TUYA 5CBGA 1N0JA 1OCRC 4IL6Z 1PD3A 5IDJA 2RQ6A 2CH7B 3K04A 3B2EE 2DQ0A 5B1OA 4LF4B 1B6QA 4LF7O 2R9AA 4J11A 4BW5A 1NVPB 1K5SA 1NJIW 4WBNA 5JJEB 4X1YB 2UXDO 1P7BA 3ZMSA 1O9HA 1WN7A 4DO2A 5KA5A 5IYZA 2ILMA 3CMAV 2GDSA 3VOUA 5IJ9A 2OCHA 3LSQA 1JPXA 1N34B 2DMXA 1D2DA 2Q8VA 4BR6A 2PGGA 1WA8B 4KP4A 4JPRA 3L74H 3JATA 4ZHQB 4O2AB 4R6ZA 1NH2B 2ZR2A 2EZOA 1GM7A 4FLVA 3ZRWA 4NXMO 5H5NA 3ASNC 1PM9A 3LNNA 5KUMA 2A0LA 3J7AU 2YICA 4HNAB 5H9CA 1I94B 3ZX6A 4EFEA 1HW7A 2CAZC 1VQ4V 1EN4A 1GO3F 2ZCEA 3GB7C 4JZ2A 1XDCA 3A8TA 2CK3G 4X64B 1OCRB 4HAMA 4RUEA 3S3WA 2YDEA 3JAWA 1XNRB 4LCUC 2IW5A 3LSUA 3QO8A 3RFRA 4JI8B 4J41A 4LF4O 3K79A 4B08A 1DK1A 5GTIZ 2HG5C 5KAIZ 1Y76B 2AHYA 1IURA 4TQDA 2A06H 1IZ3A 4PI2A 2IJHA 2N04A 1JQ0A 1RSOB 2DWEC 2EX3A 1PV0A 4PA9A 3HR0A 4DUZB 4IIJA 3CCJV 3JALA 4QIWF 1PP9H 4JTDB 1HWYA 3P3PA 1N34O 4MVQA 1VF7A 4NB5A 4X20B 3H1HH 3OR7C 1XHXA 4JAAA 3ASNB 3L75H 1K7DA 4FJCC 1MZFA 4PELA 5B3SC 3CD6V 2HR3A 1I94O 4JGSA 4RQEA 3APOA 4LP8A 2D2CB 3RVYA 3DXRB 3SPIA 1WPBA 4MVMA 4HBNA 1X59A 2LFRA 1SESA 1YJWV 1K33A 1Q7YW 3JCZA 2XASA 4X64O 1XQ8A 2WAMA 3D3QA 1S77D 1SQPH 1BS3A 3E8GA 2A3QA 5TISZ 3L72H 4LNUA 5J9PC 1XNRO 2FKXA 5FPRA 2Y69C 2YXYA 3E35A 2QWQB 1Y67A 4JI8O 4O2BA 3VQXA 1H8EG 2F66C 2JDIG 1URFA 1NI8A 3ZEDA 5IE9A 2XHBA 2YS8A 3AG3C 5LL6Y 2F4VB 1WJZA 1WAZA 1SQVH 3I56V 1KECA 3JASA 3VQWA 1ZL8A 3RYFB 2QWNB 3KCXA 5IJ0B 1QBZA 3HKCA 1YTFD 1W59A 4IHJA 5D5PA 4I0XB 5KHHA 4G27B 4G28B 1RPRA 4JI6B 4JI3B 4MW8A 5B3SB 2QKCA 2UUBB 5LA6B 4I4TA 2ZDIC 5FPOA 3BABA 4ZBMA 1Q90D 1CXZB 3H1JH 3SPCA 4QGPA 2V1DA 4J10A 3JD3A 4JZGA 4UCSA 2FL4A 1S72V 5B66Z 3UT5B 1Y74A 2OIEA 3H1IH 4IYIA 4LFBB 1E79G 3SYPA 5L3DA 3RW0A 3E22A 4GX5A 5F2VO 2Y69B 1I5XA 2CTPA 4JYBA 4X89A 4WF9V 2F1MA 3OMNB 3BPZA 4O4JB 2PZSA 1NTMH 4PV1B 3AG4C 5KX5B 1VQ8V 5BMVA 1J95A 4W4KA 4GX1A 2HKOA 2IBZH 3RN4A 1G1XB 1R1BA 5EZYA 2ETNA 2UUAB 2F95B 5CA3A 4K8ZA 2OIGA 5GTHZ 4B7KA 2P4VA 3L71H 4DV3O 2QEXV 4WFHA 2AZ2A 2HHHB 1PL0A 4O4LA 3RYIA 3K5NA 3U11A 2F4VO 1KKCA 1XI1A 5KHIA 3TXSA 1NT2B 4IT5A 3LNMB 1ORQC 3OTFA 3K58A 1KC8W 1K5QA 3W7TA 1YHQV 1IVSA 5CB4A 2WLLB 1QNMA 5CN0A 3A2FA 3JAKA 4JI3O 2QWPB 1IBMB 1RFYA 2WLMA 2UUBO 5L3FA 3LDEA 4CS3A 4DV7B 4I7ZB 1D5NA 1YXBA 3ABTA 4B3MB 3J81N 5E79Z 3JD2A 1S5HC 2Q67A 4R7CA 1SQBH 3CYOA 3ZN1A 1H2SB 2CH7A 2BCCH 5JQGB 4DUYB 2EULA 4Q6GA 4DW0A 4LFBO 3DSQA 3P3NA 1VQ5V 2WLKA 3ZBHA 2G38A 4MTOA 3AG4B 1AJPA 4R8CA 5LMNB 1K8AW 5KUKA 2QTOA 1H2NA 2JGDB 1FFXB 2RMKB 1VARA 3OGIB 4EB6B 3HKBB 1H2KA 3I5DA 4UCRA 5CBFA 5L3BA 5LHIA 1O9GA 4PA3A 3JARB 2YIDA 3G6BA 4EKWA 2HJDA 1WB7A 2PYLA 1KBHA 2UUAO 1T5EA 5LOVA 1GM9A 3K06A 4PA7A 1R3LC 1OV9A 5FNVA 5JCOA 2ZE5A 4P9PA 2LP7A 2HHHO 2ZD9A 3ZMVA 3G4SV 1NTZH 1FAFA 1E1RG 4FM0A 4ZHQA 3IFXA 1JA8A 1BZKA 4JYCA 3ZHTA 4QE7A 4AI8A 3CC4V 4HNAA 3RYCB 1PKXA 2FMLA 2WLIB 3RBZA 3ETDA 3CJHA 4TQFA 1FFTB 2HVKC 1N4CA 3CCSV 1EN6A 1IBMO 4OPAA 4FLTA 4DV7O 2RNBA 2Y4UA 1BHAA 3WB2A 2O57A 5BR8O 2W0XA 5LGTA 3M8AA 1MA1A 1QU7A 3K9SA 4DV6B 2BE3A 3P32A 4TSFG 4F6EA 4B7EA 5KHJA 2ZINA 1JMKC 4DUYO 4GKJB 3CB2A 3HKDB 3MHSC 4MVOA 3BRCA 2GTAA 4FFBB 4XDJA 4PDRA 4U7OA 2PY5A 4JI7B 1H2MA 4LWSA 1R3IC 2ATKC 2DE0X 2ZIOA 5LMNO 3ZS8C 1Y66A 1JVMA 1RSOA 3B09A 4ZOLB 1PNLA 1LUVA 1XREA 3OFNG 5CA1A 4MTGA 4MS2A 1B3QA 3FAVA 2YXLA 3FYIB 1U96A 4DK0A 2JK5C 1DTOA 4RO2A 4GKKB 2P22C 1FXKC 2BSKB 1PNMA 4UB8Z 3C3SA 1IX9A 4FFKA 1YSCA 1FYJA 4J7ZA 2X6BA 2XAQA 1THZA 2WLJA 2YEVA 5EIBC 3RYHB 4DV1B 2P67A 2ZM6B 2VWKA 5JVDA 2P06A 1KP2A 1F7YA 1W0JG 4UB6Z 2UXXA 3B77A 1ZTEA 2OTLV 3WU2Z 2QTSA 4GUNA 2YUAA 3APQA 3A0HZ 5L3EA 2L6LA 1QQCA 4LFAB 2YI9A 1P84F 1FJGB 1XL6A 1XUQA 3ZHQA 2JEXA 1D5AA 2ZE7A 2NLJC 3OE7G 3OM3B 2AW9A 1LUWA 3RT3C 4UVAA 4FIPC 3CSXA 4CC6A 4X1KB 5LBQA 3BHPA 2GV9A 1SKVA 4DV6O 1ZX3A 1M4UA 2M6YA 1AVMA 2MW2B 4GKJO 5JJJB 4JYAB 4UVBA 4R50A 2Y48A 2EIKC 2X7RB 4YHHB 3L9DA 3CP1A 1ZWIC 1N33B
chains in the Genus database with same CATH topology
1COWG 4WFGA 4FJCC 1AJQA 4PELA 1AJNA 1FXKB 5B3SC 3CD6V 2EIJB 4X8AA 3AG1B 2X0LA 4MTXA 2EINC 2HR3A 2MK3A 1PNKA 4JGSA 4MVRA 1K73W 2K1EA 4RQEA 3AG3B 4LP8A 1R73A 4XBFA 3TK1A 2OT5A 3SPGA 3RVYA 3SPIA 2DYSB 4MVMA 4KUMA 1Q82W 2LFRA 1SESA 2DYRC 1YJWV 2UXNA 2PI4A 1DLBA 1GTOA 1WLEA 5IY5C 1K33A 1Q7YW 3JCZA 2XASA 5LHHA 1ROPA 2LFSA 3ASOB 1OHHG 2WAMA 1S77D 3E8GA 4UXNA 4FPPA 3STLC 4ZKIA 1VQ7V 4P30A 2Z5UA 3ZN0A 3DGEA 2IH1C 1VQKV 5J9PC 2BOCC 1R3JC 2Y69C 1MABG 4CZZA 3BY6A 1XL4A 3E35A 1AROP 1SRYA 3ABKC 2Z3YA 4MT8A 3ZRXA 4BIZA 1H8EG 2W0FC 2JDIG 3JD0A 1EFRG 4QE9A 2P7TC 2EIJC 1NR7A 3E86A 4PA4A 4H37A 4ASUG 1GMGA 1OCOC 2OCCB 3AG3C 1JCHA 4FMTA 2XAHA 5EBMC 2JIZG 3W7UA 4RAIA 4RQFA 3I56V 1KECA 2DYSC 1UJWB 3QO7A 4UUJC 5EK0A 3UKMA 2OTJV 3ETGA 4XDKA 4Z1MG 2D3OW 4HZ3A 1CPYA 2YSUB 3IGAC 3QO5A 4DXWA 1QBZA 5B1BC 1YTFD 2EIKB 2WPDG 3MD0A 2IJKA 4G27B 4G28B 2ITCC 1RPRA 3R65A 4CBCA 1S0VA 1AI4A 2ZQMA 3TCUA 1K92A 4MW8A 5B3SB 4PDMA 3E8HA 5EC2C 1H38A 3E8BA 1QVGU 2FTKA 1QR9A 1TUEB 2ZDIC 2EINB 4QJFB 2P6JA 4ZBMA 1R3KC 3G71V 3SPCA 1CEZA 2V1DA 3JD3A 1JX9A 2EILC 3DTUB 1L1FA 3T1CA 4I5SA 4H33A 2XOKG 1YI2V 4N21A 2DYRB 2IJJA 1M9NA 3JD1A 3CPWU 1S72V 1KQSU 3E8FA 2WLLA 1VQMV 5IY5B 2DQ3A 1RM1C 3OR6C 2ZDIA 5CMUA 1E79G 3SYPA 1R6NA 3T4DA 5CBHA 5L3DA 3SYAA 3K03A 3RW0A 4RUFA 3K9AA 1AI6A 2V7QG 4WFEA 4GX0A 1OCZC 1NKDA 3K3WA 3PJSK 2HFEC 4GX5A 1VQ9V 3CCQV 3CC2V 2Y69B 3K0DA 1I5XA 3ABLC 3K08A 4JYBA 1QLNA 4JF3A 2WLHA 2DWDC 4X89A 2A79B 2IU0A 4WF9V 3OMNB 3ABKB 3HPLC 4LC1A 1M90W 1M57C 2JJ2G 3AG4C 4WCEV 1VQ8V 3D36A 1J95A 4OXSA 5IYBO 5C93A 1V55C 1FXVA 3E89A 4GX1A 2HKOA 3F5WC 3ZJZA 3WFVA 2XAJA 1AI5A 1OCOB 3NXSA 4P2ZA 1K3EA 4WFAV 1M56C 2WWWA 1YTFB 3LDCA 5CA3A 1SETA 2QKSA 4UV8A 2HJFC 3FB8C 2QEXV 4WFHA 2XAFA 1PL0A 1RPOA 1YJNV 3STZC 3E83A 4PDLA 3ABMC 5B1BB 3ZMZA 3H01A 5GW7A 3W7XA 3EHBB 3JD4A 3LNMB 1ORQC 1K34A 1H8HG 2NNUA 4LBEC 5BZBA 1KC8W 1K5QA 3W7TA 3QNEA 1YHQV 4U7NA 2WLLB 2EJRA 4HYOA 5CN0A 2B1GA 1G8MA 3ZCCA 3OUFA 5HFLA 3SPJA 3ETEA 3OEEG 3CMEV 1MG1A 4MVUA 2WLMA 2ITDC 2HLDG 2QA4V 1YIJV 2EILB 5L3FA 3LDEA 4L87A 1K9MW 3OGCC 3CCLV 3CCMV 3OAAG 3ABUA 2KB1A 2Q69A 2HVJC 4MTFA 3ZRSA 3ABTA 1RM1B 2WLNA 4GT1A 2H94A 1AI7A 4UV9A 5B1AC 4QPKA 1KKDA 3OMIB 4J9YB 1MOFA 3JD2A 1S5HC 2EZPA 2Q67A 1W2BU 3W7WA 4R7CA 3CCEV 3WG7C 4MVSA 5LGNA 4TT3G 2WLIA 3CYOA 1V54C 3EFFK 3ZN1A 1Q81W 1Y4MA 1JOYA 1OCZB 2EBOA 1QCEA 1GM8A 3FYEB 5H6RA 1N8RW 1NVPD 3ABLB 2WSSG 1VQ5V 2IJIA 3LDDA 3B8NA 2WLKA 3UM7A 1M57B 4MTOA 2PI5A 3FB7C 3AG4B 1AJPA 4F4LA 2X6CA 4R8CA 1K8AW 3X2QC 5KUKA 2QTOA 1V55B 4JAVA 1VQ6V 3CXCU 1S76D 1S3JA 1ENVA 2X6AA 4GCZA 3B8MA 5CBFA 3FB5C 1DF5A 5L3BA 1IXMA 3CCRV 1YJ9V 1M56B 4P9OA 5LHIA 2IU3A 3JYCA 1FXHA 1F4MA 2IH3C 4PA3A 1P4RA 4G2KA 5DM6V 4EKWA 4MSWC 4X88A 1K4DC 1KD1W 3LSSA 3MHHC 1NBMG 1NR1A 1VQNV 4TWKA 5EBLC 1OCCC 1GM9A 3K06A 4PA7A 4JASA 1R3LC 3RVZA 5DN6G 2QM8A 3ABMB 1QVFU 1LNQA 5E1AC 3SYQA 4P9PA 2LP7A 2ZD9A 3ZMVA 3G4SV 1NH2D 1E1RG 1WPXA 2ZR3A 3IFXA 1W0KG 5LGUA 3FB6C 4JYCA 4XDLA 5EC1C 2P90A 5CBGA 4QE7A 3CC4V 1H2GA 1OCRC 3CCUV 1QLEC 3ML0A 3ZRVA 2M7WA 4J9ZB 1PKXA 1PD3A 2WLIB 5IDJA 3RBZA 5IYDO 3ETDA 3K04A 5B1OA 2DQ0A 2DW4A 3ZMUA 1FFTB 2HVKC 3CC7V 3K0GA 1B6QA 3CCSV 2YEVB 1AR1B 4PDVA 5B1NA 4BW5A 1NVPB 4GX2A 5B1AB 1K5SA 3OUSA 1NJIW 1OZ0A 2Q6AA 1R6KA 3CCVV 3AG2C 1BHAA 3BEHA 3D3IA 3WG7B 1V54B 2R9IA 5LGTA 1M1KW 4MW3A 1P7BA 3ZMSA 4JTAB 2ZXWC 1BL8A 2A9HA 1BHBA 3P32A 4TSFG 4DO2A 5KA5A 1GKFA 3CMAV 2XAGA 2EIMC 3P30A 4Q20A 4JAUA 3VOUA 3X2QB 2AHZA 3F7YC 3LSQA 3MHSC 4I9WA 4MVOA 3SJQC 3SPHA 1JPXA 3ZIAG 4XDJA 4PDRA 4U7OA 3E2EA 2GHYA 3TETA 4WFBV 3OMAB 3HB3B 1R3IC 2ATKC 1SZTA 4QNHB 3GWOA 1JJ2U 1QR8A 5EBWC 4KP4A 1FS0G 4JPRA 2Q68A 1Y66A 3A0RA 1JVMA 1PNLA 3OFNG 4MTGA 4MS2A 4R6ZA 1NH2B 2ZR2A 2EZOA 1GM7A 3FYIB 3ZRWA 1OCCB 2JK5C 3ASNC 1DTOA 5KUMA 2A0LA 4RO2A 3W7SA 2F43G 5H9CA 4WFFA 2W6IG 1G4YB 1FXKC 3OW2U 1PNMA 5L3CA 2GSMB 3ZMTA 1VQ4V 1F4NA 1GO3F 2B1IA 3AG1C 1BMFG 1DF4A 1YSCA 3GB7C 1I5YA 3AEIA 4BIUA 2X6BA 2XAQA 1THZA 2WLJA 2YEVA 1K4CC 2JEUA 4QPJA 2CK3G 4E2LA 2P67A 1OCRB 4HAMA 1QLEB 1KP2A 1NQTA 3SYOA 3OEHG 1W0JG 4BAYA 2UXXA 3IC7A 1FXKA 4RUEA 3B77A 3G6EV 2OTLV 1GK9A 3VBBA 4JTCB 5FL7G 3ASOC 4LCUC 2IW5A 3QO8A 3T4ZA 3FKSG 5HFMA 5L3EA 5LHGA 3K79A 1VQLV 4N23A 1XL6A 2HG5C 3AG2B 2JEXA 3LUTB 2AHYA 3M99B 5IYCO 4PA6A 1VQPV 1MSWD 2NLJC 2C2AA 1F23A 3OE7G 3OM3B 1YITV 3T2MA 2ZXWB 4UVAA 4FIPC 2IJHA 1E1QG 1JQ0A 2EIMB 2DWEC 5LBQA 2W6JG 2QE7G 4MVZA 4FK5C 1KP3A 1EBOA 4PA9A 5KA6A 4YXWG 2OCCC 2BOBC 5H6QA 3CCJV 4KFMA 4QIWF 3ZRWB 2B5UA 4JTDB 1EZJA 1HWYA 4UVCA 1K97A 1VQOV 3F7VC 4UVBA 3SYCA 4R50A 3KG2A 4MVQA 2QM7A 1SERA 1F51A 2XNDG 3OR7C 5L3GA 2JJ1G 2H8PC 2Y48A 1CP9A 2R9RB 2EIKC 2X7RB 3I55V 3ASNB 3CP1A 1ZWIC 1Q86W 1K7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYC A;  2LFS A;  4BIU A;  3MD0 A;  3ZRW B;  3D36 A;  4KP4 A;  3ZRV A;  3A0R A;  5C93 A;  4FPP A;  4ZKI A;  4QPJ A;  4MTX A;  3DGE A;  4FMT A;  5IDJ A;  2P67 A;  4JAS A;  3P32 A;  5B1O A;  2QM8 A;  2C2A A;  2QM7 A;  3NXS A;  4GT1 A;  2FTK A;  4JAV A;  1F51 A;  3ZRW A;  3TK1 A;  4Q20 A;  4QPK A;  2WWW A;  4U7N A;  4JAU A;  4GCZ A;  5B1N A;  4MT8 A;  2LFR A;  3ZRX A;  1IXM A;  4BIZ A;  1JOY A;  4JYB A;  4U7O A;  3ZCC A;  4I5S A;  4LC1 A; 
#chains in the Genus database with same CATH topology
 3K59 A;  2PTM A;  3RYF A;  1AJQ A;  1Q6I A;  1FXK B;  1TUB B;  3CRA A;  4D7S A;  4JI2 B;  2EIN C;  1N32 B;  2K1E A;  4GKK O;  1B06 A;  4I0X A;  2UXB B;  1XMO B;  4FM1 A;  4TV9 A;  3R66 A;  1Q82 W;  1YZB A;  1WLE A;  2KG7 B;  5IY5 C;  3AK1 A;  4DV1 O;  3C90 A;  2ZM6 O;  3N2K B;  2QSA A;  1S5L Z;  4B3R B;  1VQ7 V;  4YJ3 A;  2ZE6 A;  4DR5 B;  1FKA O;  1R3J C;  4B3S B;  3ICX A;  4CZZ A;  4EFB A;  1M5I A;  1XL4 A;  1ARO P;  1SRY A;  4CH6 A;  2Z3Y A;  4BIZ A;  4LFA O;  1FJG O;  2W0F C;  4CH4 A;  5J2T B;  3BCC H;  1NR7 A;  2H3O A;  4PA4 A;  3SDL A;  4ASU G;  4O4J A;  5KX5 A;  4UUJ C;  1RP3 B;  5EK0 A;  2D3O W;  4TOI A;  3GVM A;  3BA8 A;  4DXW A;  2WA4 A;  2EIK B;  2WPD G;  4JYA O;  3ETQ A;  1KYO F;  1ZAU A;  4DV4 B;  4CH5 A;  1L0L H;  3E8H A;  4YHH O;  1QVG U;  1QR9 A;  1N33 O;  1TUE B;  2EIN B;  2LJ2 A;  4FLU A;  4O4I A;  3G71 V;  4NTX A;  2EIL C;  1WP7 A;  1L1F A;  2BTQ A;  4I5S A;  4JI2 O;  2XOK G;  1YI2 V;  4N21 A;  1KQS U;  3JD1 A;  1N32 O;  2WLL A;  1VQM V;  5IY5 B;  2DQ3 A;  2UXB O;  1XMO O;  2ZDI A;  5CMU A;  3EXA A;  3D36 C;  3K03 A;  3K9A A;  1AI6 A;  2V7Q G;  4WFE A;  4YJ2 B;  1NKD A;  3K3W A;  3PJS K;  5EYP A;  3O65 A;  1VF5 B;  3CCQ V;  3K08 A;  1QLN A;  1V9P A;  2GTS A;  4PI0 A;  2DWD C;  4B3R O;  4GYC B;  2IU0 A;  1M90 W;  1M57 C;  2XTA A;  4DR5 O;  2JGU A;  5C93 A;  4B3S O;  4DK1 A;  4A5U B;  4LH7 A;  4ICG A;  3WFV A;  3Q4H B;  4D6T H;  3NXS A;  1XOU A;  2RJZ A;  1K3E A;  1VP7 A;  4U3J A;  2VQF B;  2QKS A;  4DR1 B;  3FB8 C;  3UQ8 A;  3ZHR A;  3BA9 A;  2JGD A;  3UCS C;  1JR9 A;  2VRZ A;  2YIB D;  1FFX A;  5KMG B;  1DGS A;  2ZE8 A;  3H01 A;  5GW7 A;  4AIL C;  3EHB B;  1H8H G;  3CRQ A;  4L8J A;  2Y4T A;  5HFL A;  1Q43 A;  3OEE G;  1WB8 A;  4DV4 O;  3MDS A;  3OTO B;  1VF6 C;  1HNZ B;  1XMQ B;  2HLD G;  3TXQ A;  2EIL B;  3KZI Z;  2E5L B;  4L87 A;  1SC5 B;  3CCM V;  4NXN B;  4J7K A;  5LMU B;  2Q69 A;  2HVJ C;  3ZRS A;  2WLN A;  2H94 A;  1AI7 A;  4TUY B;  2E76 B;  5B1A C;  3RYC A;  4DUZ O;  3WG7 C;  4MVS A;  1Q81 W;  2WLI A;  1V54 C;  1Y4M A;  4TV8 B;  4FLZ A;  1GM8 A;  3FYE B;  1NVP D;  2IJI A;  3LDD A;  1Q8I A;  3IC9 A;  1M57 B;  4AQY B;  4UCV A;  3K5O A;  4JAV A;  4WBN B;  2NR5 A;  4PD4 F;  5DEC A;  4DR2 B;  2K9P A;  1ENV A;  2PF4 E;  4GCZ A;  4O4H B;  1B04 A;  3FB5 C;  1IXM A;  2RCV A;  4JI4 B;  1YJ9 V;  1Y6X A;  3ZHU A;  1FXH A;  2IH3 C;  1KMI Z;  5IYZ B;  2Y0P A;  4G2K A;  4MSW C;  4X88 A;  1K4D C;  1KD1 W;  5IJ9 B;  3HKD A;  1IBL B;  5A9G A;  1NR1 A;  1VQN V;  3JSL A;  1OCC C;  5EBL C;  2QR4 A;  2VQF O;  5DN6 G;  3CRR A;  4DR1 O;  4LFC B;  4LH6 A;  5IWA B;  4ZOL A;  1NH2 D;  2OYQ A;  1Q3E A;  1SQG A;  1MNG A;  1MZE A;  2CE4 A;  5LGU A;  3N2G A;  4XDL A;  4I9Q A;  1H2G A;  2YI8 A;  3CCU V;  3ML0 A;  4PJ0 Z;  2M7W A;  4J9Z B;  1TVK B;  1IBK B;  2BSK A;  4UFZ A;  1YCI A;  3CC7 V;  3K0G A;  5K1X A;  3RYH A;  1AR1 B;  1HNZ O;  1XMQ O;  3K57 A;  2KKW A;  5B1A B;  3OUS A;  4NTW A;  2E5L O;  1OZ0 A;  2Q6A A;  3CCV V;  3BEH A;  3WG7 B;  4NXN O;  1V54 B;  5LMU O;  2R9I A;  2HEP A;  2FB5 A;  3JAW B;  4MW3 A;  2YIB A;  3THO A;  4JTA B;  2AZ0 A;  4I50 B;  2A9H A;  1BHB A;  4U3F H;  1GKF A;  1KUQ A;  4UCT A;  4K0K B;  3P30 A;  1L8D A;  5LYJ B;  4JAU A;  3D8C A;  4BW9 A;  3F7Y C;  2Q0O C;  3SJQ C;  2ARH A;  3SPH A;  1X4T A;  3CX5 F;  4KHP B;  2E3C A;  3E2E A;  2GHY A;  5LP6 A;  3HB3 B;  1SZT A;  4QNH B;  4AQY O;  4JI6 O;  3GWO A;  2Q68 A;  3A0R A;  4DR2 O;  5LXT A;  4JI4 O;  4IIJ B;  1OCC B;  5ITZ B;  4ABM A;  3W7S A;  2F43 G;  1IBL O;  5L3C A;  3ZMT A;  3ZHV A;  1BMF G;  1I5Y A;  3AEI A;  4AHC A;  2QM4 A;  4FLX A;  4LFC O;  2JEU A;  4QPJ A;  5IWA O;  4ZI7 B;  4OPH A;  5FLX N;  1NQT A;  3SYO A;  3OEH G;  2F93 B;  1TUB A;  1FXK A;  4X1Y A;  1GK9 A;  2CTW A;  5GON B;  3VBB A;  5FL7 G;  2P5O A;  3ASO C;  5H2F Z;  3T4Z A;  3FKS G;  5HFM A;  1P49 A;  1AP6 A;  2Q9L A;  2Q0A A;  1VQL V;  4N23 A;  3SJB C;  4JI0 B;  5KAF Z;  4IGG A;  3M99 B;  4PA6 A;  2C2A A;  2YC0 A;  3N2K A;  1WA8 A;  3CS5 A;  1BSM A;  1PL4 A;  4DR4 B;  4LNU B;  2W6J G;  2QE7 G;  4FK5 C;  1KP3 A;  4O2A A;  5KA6 A;  2OCC C;  2BOB C;  4J42 A;  3QG5 A;  2B5U A;  1EZJ A;  4K0K O;  1S5J A;  1K97 A;  5KLV H;  4KHP O;  2QGN A;  2CTQ A;  3KG2 A;  5J2T A;  1SER A;  3PN1 A;  5L3G A;  2JJ1 G;  2R9R B;  2Q7E A;  3O9O A;  1HNW B;  1AP5 A;  1QHT A;  3ZHS A;  3KCY A;  1J5E B;  4H0L B;  3JAS B;  1ZL8 B;  4NYK A;  4B3M O;  5K1P A;  2EIJ B;  4X8A A;  3HKC B;  4YIO A;  1K73 W;  2YIA A;  3CEI A;  2R70 A;  2OT5 A;  3SR2 C;  2DYS B;  3HKE B;  4KUM A;  4X1I B;  1Y76 A;  4DR6 B;  2UXN A;  1ZSP A;  4I4T B;  4DRX B;  2LFS A;  3ASO B;  1SS3 A;  3WB1 A;  1GRJ A;  4FPP A;  3STL C;  3ZN0 A;  3DGE A;  2IH1 C;  3T1H B;  1ZUQ A;  2KQX A;  2BOC C;  1MAB G;  4MT8 A;  4JI0 O;  3H1L H;  1NS1 A;  4UCU A;  3JD0 A;  4QE9 A;  4X20 A;  2P7T C;  4YJ2 A;  3E86 A;  4H37 A;  2OCC B;  1JCH A;  3FFQ A;  5B5E Z;  2XAH A;  2EJ7 A;  4RAI A;  4DR4 O;  1UJW B;  3QO7 A;  1HP8 A;  5BMV B;  3UKM A;  2OTJ V;  3ETG A;  4Z1M G;  1XNQ B;  2YSU B;  1YDX A;  3VQV A;  5B1B C;  3Q4H A;  3GWK C;  2UU9 B;  3DXR A;  3QVN A;  1S0V A;  1AI4 A;  2ZQM A;  1K92 A;  1HNW O;  1H38 A;  3E8B A;  1KB9 F;  4O4L B;  5KMG A;  1J5E O;  1G6U A;  3AG7 A;  4QJF B;  2P6J A;  4CC5 A;  1JX9 A;  4H33 A;  1N36 B;  2LW1 A;  3CPW U;  1JJO A;  4DR3 B;  3E8F A;  5CB4 B;  4FLY A;  1RM1 C;  3JAK B;  3SYA A;  4DR6 O;  3KKY A;  4JI7 O;  4GX0 A;  1VQ9 V;  3K0D A;  4JF3 A;  1HDJ A;  4J80 A;  2A79 B;  1SQX H;  3HPL C;  4LC1 A;  4WCE V;  3T1H O;  3D36 A;  4OXS A;  1HR0 B;  5IYB O;  1V55 C;  3E89 A;  5IJ0 A;  4TV8 A;  2ZNI A;  3U10 A;  1TAE A;  1AI5 A;  4P2Z A;  2VS0 A;  2N74 A;  4DW1 A;  3LDC A;  1YTF B;  1Z5V A;  3QF7 A;  1LR1 A;  3CWB H;  2HJF C;  2ZNJ A;  4F6R B;  2XAF A;  5LA6 A;  4LF6 B;  1YJN V;  2CDY A;  3STZ C;  1AIL A;  3E83 A;  4NKG B;  1BT8 A;  4O4H A;  4PDL A;  3ABM C;  5B1B B;  3ZMZ A;  3W7X A;  4FZ0 A;  1UPG A;  1OJH A;  4ZIB A;  1XNQ O;  2UXC B;  5JWP A;  3NR7 A;  3QNE A;  2PYJ A;  4HYO A;  1I7F A;  2ADQ B;  3UT5 A;  5LOV B;  2UU9 O;  5JH7 B;  3ZCC A;  1IXB A;  5FNV B;  3SPJ A;  4Z1V A;  1MG1 A;  3AK3 A;  4MVU A;  2JS5 A;  3FX7 A;  1YIJ V;  1Q6U A;  1K9M W;  3OGC C;  3OAA G;  3ABU A;  4MTF A;  1RM1 B;  2QWO B;  4UV9 A;  3DC6 A;  4QPK A;  1KKD A;  3OMI B;  1N36 O;  3H9V A;  1VF6 A;  2GUZ B;  5CA0 B;  1TVK A;  2VQE B;  4DR3 O;  1YEW A;  5DED A;  2EBO A;  3K5M A;  5H6R A;  3CJH B;  3RGB A;  1JFF B;  3B8N A;  2PI5 A;  3FB7 C;  3S3X A;  2X6C A;  4I55 B;  5J2U B;  3X2Q C;  2ZIM A;  1V55 B;  2QWR B;  1VQ6 V;  1NTK H;  2QJ1 A;  3IAY A;  4NR1 A;  3UO2 A;  1S3J A;  4W4L A;  1XBL A;  3B8M A;  4KL1 A;  3BAA A;  5C8Y B;  3CCR V;  4I50 A;  1HR0 O;  4P9O A;  1EZV H;  2IU3 A;  3JYC A;  3G80 A;  1P4R A;  1P7G A;  3F5T A;  5LYJ A;  4CS4 A;  2CTR A;  2FYU H;  4BIO A;  1GAX A;  4LWS B;  3EVK A;  2QM8 A;  3ABM B;  1QVF U;  1BE3 H;  3RWR D;  1GH6 A;  4X62 B;  4LF6 O;  1Q6H A;  5KHG A;  1WPX A;  5CA1 B;  2ZR3 A;  3FAV B;  3B40 A;  5ITZ A;  2UXC O;  4YY3 B;  1QLE C;  3ZRV A;  2VWJ A;  2B9Z A;  1VMG A;  4CS2 A;  2JS3 A;  5JQG A;  5IYD O;  1VIB A;  2DW4 A;  4CH3 A;  3ZMU A;  2YEV B;  4PDV A;  5B1N A;  1I08 A;  1BGY H;  4GX2 A;  4ZI7 A;  1KU9 A;  1MMM A;  4DV2 B;  5JVD B;  1R6K A;  3AG2 C;  3D3I A;  4EB6 A;  3HKB A;  3AK2 A;  1M1K W;  5GON A;  2WA3 A;  4GLX A;  2ZXW C;  1BL8 A;  1SQQ H;  2VQE O;  3JSN A;  3JAR A;  1SA0 B;  2XAG A;  2EIM C;  4Q20 A;  4OGQ B;  1XHZ A;  3T1Y B;  3X2Q B;  2AHZ A;  4I9W A;  3ZIA G;  2Q73 A;  1WP8 A;  3TET A;  4WFB V;  1GN6 A;  3OMA B;  2Y0I A;  1FPO A;  1IDS A;  1JJ2 U;  1SF9 A;  1QR8 A;  5EBW C;  1FS0 G;  1Z2G A;  2JVD A;  4DYL A;  4H44 B;  2Q7G A;  2P4K A;  2LW7 A;  1PPJ H;  4WFF A;  1H2L A;  2W6I G;  1G4Y B;  1US6 A;  4DV0 B;  4K35 A;  3OW2 U;  2GSM B;  1MSD A;  1F4N A;  2B1I A;  2ODM A;  3AG1 C;  1L0N H;  1DF4 A;  4BIU A;  4DV3 B;  1K4C C;  4X62 O;  4E4E A;  2QDO A;  4E2L A;  5JJN B;  1QLE B;  4X65 B;  4DR7 B;  4BAY A;  3BFR A;  3IC7 A;  3G6E V;  4LF9 B;  3DC5 A;  1N0N A;  1BQZ A;  4NVP A;  5EIB D;  4JTC B;  4YY3 O;  1AR5 A;  5LHG A;  4TV9 B;  3HKE A;  3BVO A;  3AG2 B;  4X1I A;  3LUT B;  4RWU A;  4FFB A;  5IYC O;  3U0Z A;  2NN4 A;  1VQP V;  1MSW D;  4DRX A;  1F23 A;  4LR3 A;  5D5Q A;  1YIT V;  3T2M A;  2HP8 A;  4DV2 O;  2ZXW B;  3JAT B;  1E1Q G;  2PUS A;  2EIM B;  2BTO A;  4YJ3 B;  1GN3 A;  1GN2 A;  1XEQ A;  4MVZ A;  1EBO A;  3UO3 A;  1BCC H;  4YXW G;  5H6Q A;  1UFI A;  4KFM A;  3ZRW B;  1A32 A;  4YIP A;  1R6T A;  4UVC A;  5BY1 A;  3T1Y O;  1VQO V;  3F7V C;  2A7W A;  3SYC A;  5BXZ A;  1VEW A;  2QM7 A;  3JAM N;  1F51 A;  1ZLZ A;  2CUG A;  2XND G;  3OT7 A;  2H8P C;  1CP9 A;  5KHK A;  4JYY A;  3OTO O;  2AGA A;  3I55 V;  2CGN A;  2YXH A;  4DV5 B;  4X9Q A;  1Q86 W;  1FD9 A;  2GBO A;  4FM2 A;  1COW G;  4WFG A;  2ADP A;  2N05 A;  1AJN A;  2RN9 A;  3AG1 B;  2X0L A;  4MTX A;  2MK3 A;  1PNK A;  4MVR A;  4FLW A;  3AG3 B;  2JRI A;  3OD4 A;  1R73 A;  4XBF A;  3TK1 A;  4DV0 O;  1SQF A;  4K3A A;  3SPG A;  4C7U A;  3WB0 A;  1TGO A;  2DYR C;  2PI4 A;  1DLB A;  1GTO A;  5LHH A;  2Q4P A;  1ROP A;  1OHH G;  3MAQ A;  4X65 O;  4DR7 O;  4O4I B;  4UXN A;  4JI1 B;  3B4S A;  4ZKI A;  4LF9 O;  4P30 A;  1EM1 A;  2Z5U A;  1U97 A;  3TGU H;  4X1K A;  2BTQ B;  1VQK V;  4FZ1 A;  4B3T B;  2ZT9 B;  3JAL B;  3BY6 A;  3FD9 A;  3ABK C;  4KXR A;  2DOS A;  4IYH A;  3ZRX A;  2Q5Z A;  1AB3 A;  4D7T A;  1EFR G;  4LF8 B;  2EIJ C;  2CGO A;  5EYP B;  4LF5 B;  1GMG A;  1OCO C;  1Q5O A;  4FMT A;  5BR8 B;  5EBM C;  2JIZ G;  3W7U A;  4RQF A;  2DYS C;  2KSD A;  4JI5 B;  2LGQ A;  3IJ4 A;  4XDK A;  4HZ3 A;  1CPY A;  3IGA C;  3QO5 A;  4K8X A;  2E75 B;  2Z0A A;  3JCU Z;  1HNX B;  1IBK O;  2ZKO A;  3MD0 A;  2IJK A;  3G67 A;  2ITC C;  3R65 A;  4U3J B;  4CBC A;  3TCU A;  4F6R A;  4PDM A;  2UUC B;  5EC2 C;  2KG7 A;  3SJA C;  2FTK A;  4DV5 O;  3CRC A;  1R3K C;  4JV5 B;  1CEZ A;  3DTU B;  3T1C A;  2DYR B;  2IJJ A;  1M9N A;  4NTY A;  2DN9 A;  3OR6 C;  5JH7 A;  4O2B B;  5CBH A;  1R6N A;  3T4D A;  3H1K H;  4RUF A;  3J80 N;  5AG2 A;  1EN5 A;  4GZR B;  1OCZ C;  2HFE C;  2LQT A;  5A2Q N;  4X66 B;  3CC2 V;  4OX9 B;  3ABL C;  2WLH A;  4JI1 O;  3ABK B;  2JJ2 G;  1NZ6 A;  4PHZ A;  2DJV A;  4B3T O;  2GUZ A;  5CA0 A;  1FXV A;  4BWA A;  3F5W C;  3ZJZ A;  2XAJ A;  2IM9 A;  3SGI A;  1OCO B;  4IHJ B;  2Q7H A;  4WFA V;  1M56 C;  4Z2W A;  2WWW A;  2XT9 A;  1JFF A;  3C3T A;  1SET A;  4LF8 O;  4UV8 A;  1YVW A;  4I55 A;  5J2U A;  3L70 H;  4LF5 O;  1NU1 H;  2RDC A;  1RPO A;  2LO1 A;  4EEQ A;  5LP6 C;  4JI5 O;  1WNS A;  5C8Y A;  3JD4 A;  1K34 A;  2NNU A;  4LBE C;  5BZB A;  4U7N A;  2EJR A;  2LGW A;  3A0B Z;  1HNX O;  2OWO A;  1Y74 B;  2AXT Z;  2B1G A;  1G8M A;  3OUF A;  3VQY A;  1BQ0 A;  2V4D A;  3ETE A;  1Z5W A;  3CME V;  1I0H A;  4LF7 B;  2ITD C;  2UUC O;  1AR4 A;  2L35 A;  2QA4 V;  3E22 B;  4H13 B;  3K5L A;  4UCO A;  3CCL V;  2KB1 A;  3QTC A;  3SJC C;  2XUM A;  4JV5 O;  1YF2 A;  3N2G B;  4GT1 A;  2UXD B;  3CXH F;  4J9Y B;  1MOF A;  2EZP A;  1W2B U;  3W7W A;  3CHX A;  3CCE V;  5LGN A;  4TT3 G;  1JOY A;  3EFF K;  1OCZ B;  1QCE A;  1N8R W;  5EZY B;  5IT9 N;  3ABL B;  2WSS G;  3UM7 A;  1XIL A;  4F4L A;  1TA8 A;  4X66 O;  4OX9 O;  2F23 A;  3RYI B;  3CXC U;  1S76 D;  3CE2 A;  2X6A A;  2E74 B;  5JCO C;  3N27 A;  1DF5 A;  2QKA A;  1M56 B;  4NXM B;  1F4M A;  3TJT A;  3M7M X;  1SA0 A;  1M93 A;  2R72 A;  5DM6 V;  3LSS A;  3MHH C;  1NBM G;  4TWK A;  5LP6 B;  4JAS A;  3RVZ A;  4J7J A;  1LNQ A;  5E1A C;  3SYQ A;  3L73 H;  3CRM A;  4FVM A;  5LXT B;  1SZX A;  1W0K G;  1GN4 A;  3FB6 C;  5EC1 C;  2P90 A;  4TUY A;  5CBG A;  1N0J A;  1OCR C;  4IL6 Z;  1PD3 A;  5IDJ A;  2RQ6 A;  2CH7 B;  3K04 A;  3B2E E;  2DQ0 A;  5B1O A;  4LF4 B;  1B6Q A;  4LF7 O;  2R9A A;  4J11 A;  4BW5 A;  1NVP B;  1K5S A;  1NJI W;  4WBN A;  5JJE B;  4X1Y B;  2UXD O;  1P7B A;  3ZMS A;  1O9H A;  1WN7 A;  4DO2 A;  5KA5 A;  5IYZ A;  2ILM A;  3CMA V;  2GDS A;  3VOU A;  5IJ9 A;  2OCH A;  3LSQ A;  1JPX A;  1N34 B;  2DMX A;  1D2D A;  2Q8V A;  4BR6 A;  2PGG A;  1WA8 B;  4KP4 A;  4JPR A;  3L74 H;  3JAT A;  4ZHQ B;  4O2A B;  4R6Z A;  1NH2 B;  2ZR2 A;  2EZO A;  1GM7 A;  4FLV A;  3ZRW A;  4NXM O;  5H5N A;  3ASN C;  1PM9 A;  3LNN A;  5KUM A;  2A0L A;  3J7A U;  2YIC A;  4HNA B;  5H9C A;  1I94 B;  3ZX6 A;  4EFE A;  1HW7 A;  2CAZ C;  1VQ4 V;  1EN4 A;  1GO3 F;  2ZCE A;  3GB7 C;  4JZ2 A;  1XDC A;  3A8T A;  2CK3 G;  4X64 B;  1OCR B;  4HAM A;  4RUE A;  3S3W A;  2YDE A;  3JAW A;  1XNR B;  4LCU C;  2IW5 A;  3LSU A;  3QO8 A;  3RFR A;  4JI8 B;  4J41 A;  4LF4 O;  3K79 A;  4B08 A;  1DK1 A;  5GTI Z;  2HG5 C;  5KAI Z;  1Y76 B;  2AHY A;  1IUR A;  4TQD A;  2A06 H;  1IZ3 A;  4PI2 A;  2IJH A;  2N04 A;  1JQ0 A;  1RSO B;  2DWE C;  2EX3 A;  1PV0 A;  4PA9 A;  3HR0 A;  4DUZ B;  4IIJ A;  3CCJ V;  3JAL A;  4QIW F;  1PP9 H;  4JTD B;  1HWY A;  3P3P A;  1N34 O;  4MVQ A;  1VF7 A;  4NB5 A;  4X20 B;  3H1H H;  3OR7 C;  1XHX A;  4JAA A;  3ASN B;  3L75 H;  1K7D A;  4FJC C;  1MZF A;  4PEL A;  5B3S C;  3CD6 V;  2HR3 A;  1I94 O;  4JGS A;  4RQE A;  3APO A;  4LP8 A;  2D2C B;  3RVY A;  3DXR B;  3SPI A;  1WPB A;  4MVM A;  4HBN A;  1X59 A;  2LFR A;  1SES A;  1YJW V;  1K33 A;  1Q7Y W;  3JCZ A;  2XAS A;  4X64 O;  1XQ8 A;  2WAM A;  3D3Q A;  1S77 D;  1SQP H;  1BS3 A;  3E8G A;  2A3Q A;  5TIS Z;  3L72 H;  4LNU A;  5J9P C;  1XNR O;  2FKX A;  5FPR A;  2Y69 C;  2YXY A;  3E35 A;  2QWQ B;  1Y67 A;  4JI8 O;  4O2B A;  3VQX A;  1H8E G;  2F66 C;  2JDI G;  1URF A;  1NI8 A;  3ZED A;  5IE9 A;  2XHB A;  2YS8 A;  3AG3 C;  5LL6 Y;  2F4V B;  1WJZ A;  1WAZ A;  1SQV H;  3I56 V;  1KEC A;  3JAS A;  3VQW A;  1ZL8 A;  3RYF B;  2QWN B;  3KCX A;  5IJ0 B;  1QBZ A;  3HKC A;  1YTF D;  1W59 A;  4IHJ A;  5D5P A;  4I0X B;  5KHH A;  4G27 B;  4G28 B;  1RPR A;  4JI6 B;  4JI3 B;  4MW8 A;  5B3S B;  2QKC A;  2UUB B;  5LA6 B;  4I4T A;  2ZDI C;  5FPO A;  3BAB A;  4ZBM A;  1Q90 D;  1CXZ B;  3H1J H;  3SPC A;  4QGP A;  2V1D A;  4J10 A;  3JD3 A;  4JZG A;  4UCS A;  2FL4 A;  1S72 V;  5B66 Z;  3UT5 B;  1Y74 A;  2OIE A;  3H1I H;  4IYI A;  4LFB B;  1E79 G;  3SYP A;  5L3D A;  3RW0 A;  3E22 A;  4GX5 A;  5F2V O;  2Y69 B;  1I5X A;  2CTP A;  4JYB A;  4X89 A;  4WF9 V;  2F1M A;  3OMN B;  3BPZ A;  4O4J B;  2PZS A;  1NTM H;  4PV1 B;  3AG4 C;  5KX5 B;  1VQ8 V;  5BMV A;  1J95 A;  4W4K A;  4GX1 A;  2HKO A;  2IBZ H;  3RN4 A;  1G1X B;  1R1B A;  5EZY A;  2ETN A;  2UUA B;  2F95 B;  5CA3 A;  4K8Z A;  2OIG A;  5GTH Z;  4B7K A;  2P4V A;  3L71 H;  4DV3 O;  2QEX V;  4WFH A;  2AZ2 A;  2HHH B;  1PL0 A;  4O4L A;  3RYI A;  3K5N A;  3U11 A;  2F4V O;  1KKC A;  1XI1 A;  5KHI A;  3TXS A;  1NT2 B;  4IT5 A;  3LNM B;  1ORQ C;  3OTF A;  3K58 A;  1KC8 W;  1K5Q A;  3W7T A;  1YHQ V;  1IVS A;  5CB4 A;  2WLL B;  1QNM A;  5CN0 A;  3A2F A;  3JAK A;  4JI3 O;  2QWP B;  1IBM B;  1RFY A;  2WLM A;  2UUB O;  5L3F A;  3LDE A;  4CS3 A;  4DV7 B;  4I7Z B;  1D5N A;  1YXB A;  3ABT A;  4B3M B;  3J81 N;  5E79 Z;  3JD2 A;  1S5H C;  2Q67 A;  4R7C A;  1SQB H;  3CYO A;  3ZN1 A;  1H2S B;  2CH7 A;  2BCC H;  5JQG B;  4DUY B;  2EUL A;  4Q6G A;  4DW0 A;  4LFB O;  3DSQ A;  3P3N A;  1VQ5 V;  2WLK A;  3ZBH A;  2G38 A;  4MTO A;  3AG4 B;  1AJP A;  4R8C A;  5LMN B;  1K8A W;  5KUK A;  2QTO A;  1H2N A;  2JGD B;  1FFX B;  2RMK B;  1VAR A;  3OGI B;  4EB6 B;  3HKB B;  1H2K A;  3I5D A;  4UCR A;  5CBF A;  5L3B A;  5LHI A;  1O9G A;  4PA3 A;  3JAR B;  2YID A;  3G6B A;  4EKW A;  2HJD A;  1WB7 A;  2PYL A;  1KBH A;  2UUA O;  1T5E A;  5LOV A;  1GM9 A;  3K06 A;  4PA7 A;  1R3L C;  1OV9 A;  5FNV A;  5JCO A;  2ZE5 A;  4P9P A;  2LP7 A;  2HHH O;  2ZD9 A;  3ZMV A;  3G4S V;  1NTZ H;  1FAF A;  1E1R G;  4FM0 A;  4ZHQ A;  3IFX A;  1JA8 A;  1BZK A;  4JYC A;  3ZHT A;  4QE7 A;  4AI8 A;  3CC4 V;  4HNA A;  3RYC B;  1PKX A;  2FML A;  2WLI B;  3RBZ A;  3ETD A;  3CJH A;  4TQF A;  1FFT B;  2HVK C;  1N4C A;  3CCS V;  1EN6 A;  1IBM O;  4OPA A;  4FLT A;  4DV7 O;  2RNB A;  2Y4U A;  1BHA A;  3WB2 A;  2O57 A;  5BR8 O;  2W0X A;  5LGT A;  3M8A A;  1MA1 A;  1QU7 A;  3K9S A;  4DV6 B;  2BE3 A;  3P32 A;  4TSF G;  4F6E A;  4B7E A;  5KHJ A;  2ZIN A;  1JMK C;  4DUY O;  4GKJ B;  3CB2 A;  3HKD B;  3MHS C;  4MVO A;  3BRC A;  2GTA A;  4FFB B;  4XDJ A;  4PDR A;  4U7O A;  2PY5 A;  4JI7 B;  1H2M A;  4LWS A;  1R3I C;  2ATK C;  2DE0 X;  2ZIO A;  5LMN O;  3ZS8 C;  1Y66 A;  1JVM A;  1RSO A;  3B09 A;  4ZOL B;  1PNL A;  1LUV A;  1XRE A;  3OFN G;  5CA1 A;  4MTG A;  4MS2 A;  1B3Q A;  3FAV A;  2YXL A;  3FYI B;  1U96 A;  4DK0 A;  2JK5 C;  1DTO A;  4RO2 A;  4GKK B;  2P22 C;  1FXK C;  2BSK B;  1PNM A;  4UB8 Z;  3C3S A;  1IX9 A;  4FFK A;  1YSC A;  1FYJ A;  4J7Z A;  2X6B A;  2XAQ A;  1THZ A;  2WLJ A;  2YEV A;  5EIB C;  3RYH B;  4DV1 B;  2P67 A;  2ZM6 B;  2VWK A;  5JVD A;  2P06 A;  1KP2 A;  1F7Y A;  1W0J G;  4UB6 Z;  2UXX A;  3B77 A;  1ZTE A;  2OTL V;  3WU2 Z;  2QTS A;  4GUN A;  2YUA A;  3APQ A;  3A0H Z;  5L3E A;  2L6L A;  1QQC A;  4LFA B;  2YI9 A;  1P84 F;  1FJG B;  1XL6 A;  1XUQ A;  3ZHQ A;  2JEX A;  1D5A A;  2ZE7 A;  2NLJ C;  3OE7 G;  3OM3 B;  2AW9 A;  1LUW A;  3RT3 C;  4UVA A;  4FIP C;  3CSX A;  4CC6 A;  4X1K B;  5LBQ A;  3BHP A;  2GV9 A;  1SKV A;  4DV6 O;  1ZX3 A;  1M4U A;  2M6Y A;  1AVM A;  2MW2 B;  4GKJ O;  5JJJ B;  4JYA B;  4UVB A;  4R50 A;  2Y48 A;  2EIK C;  2X7R B;  4YHH B;  3L9D A;  3CP1 A;  1ZWI C;  1N33 B; 
#chains in the Genus database with same CATH homology
 1COW G;  4WFG A;  4FJC C;  1AJQ A;  4PEL A;  1AJN A;  1FXK B;  5B3S C;  3CD6 V;  2EIJ B;  4X8A A;  3AG1 B;  2X0L A;  4MTX A;  2EIN C;  2HR3 A;  2MK3 A;  1PNK A;  4JGS A;  4MVR A;  1K73 W;  2K1E A;  4RQE A;  3AG3 B;  4LP8 A;  1R73 A;  4XBF A;  3TK1 A;  2OT5 A;  3SPG A;  3RVY A;  3SPI A;  2DYS B;  4MVM A;  4KUM A;  1Q82 W;  2LFR A;  1SES A;  2DYR C;  1YJW V;  2UXN A;  2PI4 A;  1DLB A;  1GTO A;  1WLE A;  5IY5 C;  1K33 A;  1Q7Y W;  3JCZ A;  2XAS A;  5LHH A;  1ROP A;  2LFS A;  3ASO B;  1OHH G;  2WAM A;  1S77 D;  3E8G A;  4UXN A;  4FPP A;  3STL C;  4ZKI A;  1VQ7 V;  4P30 A;  2Z5U A;  3ZN0 A;  3DGE A;  2IH1 C;  1VQK V;  5J9P C;  2BOC C;  1R3J C;  2Y69 C;  1MAB G;  4CZZ A;  3BY6 A;  1XL4 A;  3E35 A;  1ARO P;  1SRY A;  3ABK C;  2Z3Y A;  4MT8 A;  3ZRX A;  4BIZ A;  1H8E G;  2W0F C;  2JDI G;  3JD0 A;  1EFR G;  4QE9 A;  2P7T C;  2EIJ C;  1NR7 A;  3E86 A;  4PA4 A;  4H37 A;  4ASU G;  1GMG A;  1OCO C;  2OCC B;  3AG3 C;  1JCH A;  4FMT A;  2XAH A;  5EBM C;  2JIZ G;  3W7U A;  4RAI A;  4RQF A;  3I56 V;  1KEC A;  2DYS C;  1UJW B;  3QO7 A;  4UUJ C;  5EK0 A;  3UKM A;  2OTJ V;  3ETG A;  4XDK A;  4Z1M G;  2D3O W;  4HZ3 A;  1CPY A;  2YSU B;  3IGA C;  3QO5 A;  4DXW A;  1QBZ A;  5B1B C;  1YTF D;  2EIK B;  2WPD G;  3MD0 A;  2IJK A;  4G27 B;  4G28 B;  2ITC C;  1RPR A;  3R65 A;  4CBC A;  1S0V A;  1AI4 A;  2ZQM A;  3TCU A;  1K92 A;  4MW8 A;  5B3S B;  4PDM A;  3E8H A;  5EC2 C;  1H38 A;  3E8B A;  1QVG U;  2FTK A;  1QR9 A;  1TUE B;  2ZDI C;  2EIN B;  4QJF B;  2P6J A;  4ZBM A;  1R3K C;  3G71 V;  3SPC A;  1CEZ A;  2V1D A;  3JD3 A;  1JX9 A;  2EIL C;  3DTU B;  1L1F A;  3T1C A;  4I5S A;  4H33 A;  2XOK G;  1YI2 V;  4N21 A;  2DYR B;  2IJJ A;  1M9N A;  3JD1 A;  3CPW U;  1S72 V;  1KQS U;  3E8F A;  2WLL A;  1VQM V;  5IY5 B;  2DQ3 A;  1RM1 C;  3OR6 C;  2ZDI A;  5CMU A;  1E79 G;  3SYP A;  1R6N A;  3T4D A;  5CBH A;  5L3D A;  3SYA A;  3K03 A;  3RW0 A;  4RUF A;  3K9A A;  1AI6 A;  2V7Q G;  4WFE A;  4GX0 A;  1OCZ C;  1NKD A;  3K3W A;  3PJS K;  2HFE C;  4GX5 A;  1VQ9 V;  3CCQ V;  3CC2 V;  2Y69 B;  3K0D A;  1I5X A;  3ABL C;  3K08 A;  4JYB A;  1QLN A;  4JF3 A;  2WLH A;  2DWD C;  4X89 A;  2A79 B;  2IU0 A;  4WF9 V;  3OMN B;  3ABK B;  3HPL C;  4LC1 A;  1M90 W;  1M57 C;  2JJ2 G;  3AG4 C;  4WCE V;  1VQ8 V;  3D36 A;  1J95 A;  4OXS A;  5IYB O;  5C93 A;  1V55 C;  1FXV A;  3E89 A;  4GX1 A;  2HKO A;  3F5W C;  3ZJZ A;  3WFV A;  2XAJ A;  1AI5 A;  1OCO B;  3NXS A;  4P2Z A;  1K3E A;  4WFA V;  1M56 C;  2WWW A;  1YTF B;  3LDC A;  5CA3 A;  1SET A;  2QKS A;  4UV8 A;  2HJF C;  3FB8 C;  2QEX V;  4WFH A;  2XAF A;  1PL0 A;  1RPO A;  1YJN V;  3STZ C;  3E83 A;  4PDL A;  3ABM C;  5B1B B;  3ZMZ A;  3H01 A;  5GW7 A;  3W7X A;  3EHB B;  3JD4 A;  3LNM B;  1ORQ C;  1K34 A;  1H8H G;  2NNU A;  4LBE C;  5BZB A;  1KC8 W;  1K5Q A;  3W7T A;  3QNE A;  1YHQ V;  4U7N A;  2WLL B;  2EJR A;  4HYO A;  5CN0 A;  2B1G A;  1G8M A;  3ZCC A;  3OUF A;  5HFL A;  3SPJ A;  3ETE A;  3OEE G;  3CME V;  1MG1 A;  4MVU A;  2WLM A;  2ITD C;  2HLD G;  2QA4 V;  1YIJ V;  2EIL B;  5L3F A;  3LDE A;  4L87 A;  1K9M W;  3OGC C;  3CCL V;  3CCM V;  3OAA G;  3ABU A;  2KB1 A;  2Q69 A;  2HVJ C;  4MTF A;  3ZRS A;  3ABT A;  1RM1 B;  2WLN A;  4GT1 A;  2H94 A;  1AI7 A;  4UV9 A;  5B1A C;  4QPK A;  1KKD A;  3OMI B;  4J9Y B;  1MOF A;  3JD2 A;  1S5H C;  2EZP A;  2Q67 A;  1W2B U;  3W7W A;  4R7C A;  3CCE V;  3WG7 C;  4MVS A;  5LGN A;  4TT3 G;  2WLI A;  3CYO A;  1V54 C;  3EFF K;  3ZN1 A;  1Q81 W;  1Y4M A;  1JOY A;  1OCZ B;  2EBO A;  1QCE A;  1GM8 A;  3FYE B;  5H6R A;  1N8R W;  1NVP D;  3ABL B;  2WSS G;  1VQ5 V;  2IJI A;  3LDD A;  3B8N A;  2WLK A;  3UM7 A;  1M57 B;  4MTO A;  2PI5 A;  3FB7 C;  3AG4 B;  1AJP A;  4F4L A;  2X6C A;  4R8C A;  1K8A W;  3X2Q C;  5KUK A;  2QTO A;  1V55 B;  4JAV A;  1VQ6 V;  3CXC U;  1S76 D;  1S3J A;  1ENV A;  2X6A A;  4GCZ A;  3B8M A;  5CBF A;  3FB5 C;  1DF5 A;  5L3B A;  1IXM A;  3CCR V;  1YJ9 V;  1M56 B;  4P9O A;  5LHI A;  2IU3 A;  3JYC A;  1FXH A;  1F4M A;  2IH3 C;  4PA3 A;  1P4R A;  4G2K A;  5DM6 V;  4EKW A;  4MSW C;  4X88 A;  1K4D C;  1KD1 W;  3LSS A;  3MHH C;  1NBM G;  1NR1 A;  1VQN V;  4TWK A;  5EBL C;  1OCC C;  1GM9 A;  3K06 A;  4PA7 A;  4JAS A;  1R3L C;  3RVZ A;  5DN6 G;  2QM8 A;  3ABM B;  1QVF U;  1LNQ A;  5E1A C;  3SYQ A;  4P9P A;  2LP7 A;  2ZD9 A;  3ZMV A;  3G4S V;  1NH2 D;  1E1R G;  1WPX A;  2ZR3 A;  3IFX A;  1W0K G;  5LGU A;  3FB6 C;  4JYC A;  4XDL A;  5EC1 C;  2P90 A;  5CBG A;  4QE7 A;  3CC4 V;  1H2G A;  1OCR C;  3CCU V;  1QLE C;  3ML0 A;  3ZRV A;  2M7W A;  4J9Z B;  1PKX A;  1PD3 A;  2WLI B;  5IDJ A;  3RBZ A;  5IYD O;  3ETD A;  3K04 A;  5B1O A;  2DQ0 A;  2DW4 A;  3ZMU A;  1FFT B;  2HVK C;  3CC7 V;  3K0G A;  1B6Q A;  3CCS V;  2YEV B;  1AR1 B;  4PDV A;  5B1N A;  4BW5 A;  1NVP B;  4GX2 A;  5B1A B;  1K5S A;  3OUS A;  1NJI W;  1OZ0 A;  2Q6A A;  1R6K A;  3CCV V;  3AG2 C;  1BHA A;  3BEH A;  3D3I A;  3WG7 B;  1V54 B;  2R9I A;  5LGT A;  1M1K W;  4MW3 A;  1P7B A;  3ZMS A;  4JTA B;  2ZXW C;  1BL8 A;  2A9H A;  1BHB A;  3P32 A;  4TSF G;  4DO2 A;  5KA5 A;  1GKF A;  3CMA V;  2XAG A;  2EIM C;  3P30 A;  4Q20 A;  4JAU A;  3VOU A;  3X2Q B;  2AHZ A;  3F7Y C;  3LSQ A;  3MHS C;  4I9W A;  4MVO A;  3SJQ C;  3SPH A;  1JPX A;  3ZIA G;  4XDJ A;  4PDR A;  4U7O A;  3E2E A;  2GHY A;  3TET A;  4WFB V;  3OMA B;  3HB3 B;  1R3I C;  2ATK C;  1SZT A;  4QNH B;  3GWO A;  1JJ2 U;  1QR8 A;  5EBW C;  4KP4 A;  1FS0 G;  4JPR A;  2Q68 A;  1Y66 A;  3A0R A;  1JVM A;  1PNL A;  3OFN G;  4MTG A;  4MS2 A;  4R6Z A;  1NH2 B;  2ZR2 A;  2EZO A;  1GM7 A;  3FYI B;  3ZRW A;  1OCC B;  2JK5 C;  3ASN C;  1DTO A;  5KUM A;  2A0L A;  4RO2 A;  3W7S A;  2F43 G;  5H9C A;  4WFF A;  2W6I G;  1G4Y B;  1FXK C;  3OW2 U;  1PNM A;  5L3C A;  2GSM B;  3ZMT A;  1VQ4 V;  1F4N A;  1GO3 F;  2B1I A;  3AG1 C;  1BMF G;  1DF4 A;  1YSC A;  3GB7 C;  1I5Y A;  3AEI A;  4BIU A;  2X6B A;  2XAQ A;  1THZ A;  2WLJ A;  2YEV A;  1K4C C;  2JEU A;  4QPJ A;  2CK3 G;  4E2L A;  2P67 A;  1OCR B;  4HAM A;  1QLE B;  1KP2 A;  1NQT A;  3SYO A;  3OEH G;  1W0J G;  4BAY A;  2UXX A;  3IC7 A;  1FXK A;  4RUE A;  3B77 A;  3G6E V;  2OTL V;  1GK9 A;  3VBB A;  4JTC B;  5FL7 G;  3ASO C;  4LCU C;  2IW5 A;  3QO8 A;  3T4Z A;  3FKS G;  5HFM A;  5L3E A;  5LHG A;  3K79 A;  1VQL V;  4N23 A;  1XL6 A;  2HG5 C;  3AG2 B;  2JEX A;  3LUT B;  2AHY A;  3M99 B;  5IYC O;  4PA6 A;  1VQP V;  1MSW D;  2NLJ C;  2C2A A;  1F23 A;  3OE7 G;  3OM3 B;  1YIT V;  3T2M A;  2ZXW B;  4UVA A;  4FIP C;  2IJH A;  1E1Q G;  1JQ0 A;  2EIM B;  2DWE C;  5LBQ A;  2W6J G;  2QE7 G;  4MVZ A;  4FK5 C;  1KP3 A;  1EBO A;  4PA9 A;  5KA6 A;  4YXW G;  2OCC C;  2BOB C;  5H6Q A;  3CCJ V;  4KFM A;  4QIW F;  3ZRW B;  2B5U A;  4JTD B;  1EZJ A;  1HWY A;  4UVC A;  1K97 A;  1VQO V;  3F7V C;  4UVB A;  3SYC A;  4R50 A;  3KG2 A;  4MVQ A;  2QM7 A;  1SER A;  1F51 A;  2XND G;  3OR7 C;  5L3G A;  2JJ1 G;  2H8P C;  2Y48 A;  1CP9 A;  2R9R B;  2EIK C;  2X7R B;  3I55 V;  3ASN B;  3CP1 A;  1ZWI C;  1Q86 W;  1K7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...