2LFRA

Solution structure of the chimeric af1503 hamp- envz dhp homodimer
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Uncharacterized protein, Osmolarity sensor protein envZ chim
publication title Mechanism of regulation of receptor histidine kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus, shigella flexneri
total genus 43
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00672 HAMP HAMP domain
A PF00672 HAMP HAMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lfrA00
2QM7A 4GT1A 4U7NA 1F51A 4QPKA 3ZRWA 4BIZA 3MD0A 3A0RA 5B1OA 4MT8A 3D36A 4JYCA 4FMTA 2LFRA 3ZRXA 2C2AA 1JOYA 2QM8A 3ZCCA 4Q20A 2LFSA 4BIUA 2P67A 4ZKIA 4GCZA 4LC1A 4U7OA 5B1NA 4FPPA 2FTKA 4JYBA 4JAUA 3ZRVA 4KP4A 3ZRWB 5IDJA 4QPJA 2WWWA 3TK1A 3P32A 4I5SA 4JASA 3NXSA 3DGEA 4JAVA 5C93A 4MTXA 1IXMA
chains in the Genus database with same CATH superfamily
2LGWA 4JI1B 4JI8O 2M6YA 1X59A 2VRZA 2LQTA 3RFRA 1QR9A 1NT2B 5IJ9B 1PPJH 3FB8C 4R6ZA 3HKCA 1UPGA 2CK3G 5GW7A 4PD4F 2KG7A 3QO5A 4LF9B 1TUEB 3CRAA 4MVQA 1H2SB 1OV9A 4EFBA 4H33A 2ITCC 2WLJA 4YIOA 1AP5A 4TOIA 2QSAA 1E1QG 2F93B 4J80A 4QNHB 2OCCB 3DTUB 4GX5A 4DV7O 3T1HO 3KG2A 5JH7A 3BA9A 2UXDB 1MABG 4KL1A 3E8GA 4JV5O 3IGAC 2YIBA 4X1IA 2CTWA 1Q81W 1NR7A 2DYSB 4JGSA 3SJQC 3F5TA 1N34B 2DWDC 1BMFG 4DUYB 1M9NA 2V4DA 4DV2O 3DXRA 3L74H 4K0KO 4NXNB 4WBNA 4GKJO 1M4UA 3T1CA 3OEEG 5CN0A 4DV6B 4JTCB 4FLTA 1WP7A 3ZMUA 3TK1A 2JEXA 3P32A 1UJWB 2Q0OC 1WAZA 4IYHA 1QR8A 4EEQA 2CH7A 4DV5B 1VQ4V 2H94A 1WA8B 3JALA 3ZRSA 4QIWF 3SYQA 1FAFA 4DR2B 3RVYA 4AQYO 3Q4HA 2RMKB 2HFEC 1QBZA 3LDCA 1LUVA 1OCZC 3VQWA 1KB9F 3TJTA 1MSDA 4K8XA 3ZHVA 4CH6A 2ZXWB 2ZE6A 1EN6A 4PA6A 5EC1C 1W2BU 1OCRC 4QE7A 4LFBO 1KMIZ 2F23A 4OX9O 1BZKA 4ZBMA 1Q43A 4Q20A 4U7OA 1P7GA 3G6EV 2IJIA 2B9ZA 3AK3A 3GVMA 3ZEDA 4J9ZB 3BAAA 1QU7A 2W6JG 3JCUZ 2VQEO 2OTJV 1BHBA 2QJ1A 4UV8A 1HNWB 1EBOA 3F5WC 3LSUA 4FLXA 1W59A 2Q6AA 1IBMB 2F43G 2ZINA 4NKGB 3ZHUA 4CZZA 1QCEA 3E8HA 1YIJV 5BR8O 1IXBA 2JJ2G 3OM3B 3N2KB 1CPYA 3PN1A 3CS5A 4I0XB 1ZWIC 2IU0A 4DW1A 4DV0O 3JCZA 5KHIA 1M56B 1Y76A 1PD3A 3AG4B 1RSOA 5LHGA 1D5AA 4MVUA 2MK3A 3CEIA 3RYFA 3CRRA 4KHPB 1ORQC 4B3TO 2IJJA 1R3IC 1Q82W 1JJ2U 3K03A 1VQMV 3JAKA 4R50A 2V1DA 5FPOA 2B1GA 4X1YA 3DSQA 2WPDG 3HKBA 3OEHG 5BY1A 3OMAB 3K5NA 4FMTA 3CCQV 3QF7A 2X6CA 2BSKB 1J95A 1M57B 2Z5UA 4WFEA 5IDJA 4B3RB 4JI2B 1ROPA 1XEQA 4O2BB 5B66Z 3HPLC 2E3CA 2IH3C 4J42A 2AHYA 2Q0AA 4J7ZA 4GKKB 2E5LB 1XUQA 4H0LB 4DR1O 2QWPB 3L73H 1ENVA 4GZRB 2PI4A 4DUZO 1OCOB 3RVZA 5JJNB 4I4TA 3CB2A 3LNNA 4E4EA 3HKDB 4MSWC 4LH6A 5LYJB 2JK5C 1HNXO 1BE3H 4X66O 4PJ0Z 2NR5A 1H2KA 2Z0AA 3ZIAG 4O4HB 1N33B 3VBBA 2AHZA 4I9WA 2FKXA 3TXSA 3GB7C 2P06A 4JI3B 3TCUA 1Z2GA 3H1IH 1FXKC 2LGQA 5KMGB 2Y69B 1GRJA 1YJ9V 3WU2Z 3HKCB 4LF5O 4O4LB 1KYOF 1A32A 1OCCB 3MHHC 5BZBA 1DLBA 2HVKC 2YSUB 3ML0A 4I9QA 1CXZB 5CA3A 4L87A 4CH3A 2UXCO 5IYZB 2DQ3A 3EXAA 5KA5A 1N8RW 3LDEA 4NTYA 4JYAO 3E22A 4JI4B 3G67A 4EKWA 3LDDA 3ETGA 2ARHA 3RYCA 1VQNV 2OIEA 1XMOO 4WFHA 4GT1A 4JAAA 4WCEV 3JYCA 1FJGB 2EILC 2EJ7A 4LF8O 3CCRV 4I7ZB 3JD0A 5AG2A 5KX5B 5J2UA 3WG7C 2R72A 5JJJB 1SZXA 3JAWA 2WLLB 1SQGA 4QPJA 4D7SA 3A2FA 4TV9A 3A0BZ 4WBNB 4XDJA 5LP6B 4JI5O 4LR3A 3M99B 3OT7A 3A0RA 1Z5VA 2WLNA 2OT5A 5JVDA 3RBZA 2CGOA 2X0LA 2H8PC 4DV3B 4DV4O 4RUEA 4UCOA 1V55B 1AI7A 3I56V 1K92A 1B06A 3MHSC 5HFLA 5E1AC 3WB2A 1FS0G 3STLC 3CJHA 3EVKA 3E8BA 4I5SA 3OTOB 3JALB 1HR0O 1F51A 3ZRWA 1G4YB 1SF9A 3LSQA 4PA9A 2X6AA 3JSLA 1RPRA 4LF4B 1RM1B 2DMXA 5LXTB 4W4KA 1LNQA 3RW0A 2EINC 5LA6A 4WFBV 3ZN1A 2QWRB 1FXVA 4OPAA 3EFFK 2QTOA 4YY3O 1TVKA 3ABTA 1WN7A 3CMAV 2QTSA 3J81N 2WA3A 2UUBO 4QJFB 1J5EO 3OR7C 3B77A 2QWNB 3D3IA 4K8ZA 2HJFC 4PA3A 2QE7G 1R3LC 4LWSB 5LBQA 5A9GA 2UXBO 2JGDB 2DN9A 2UUAO 3UCSC 2CDYA 4X64B 4LF6O 4EFEA 3JATA 3JAMN 1VEWA 4DR4O 2XUMA 4FLWA 1VQ9V 3U10A 2QWQB 5BMVA 5EC2C 4JZGA 2R9AA 3K06A 4X9QA 4LFAO 1QNMA 4C7UA 2GV9A 1IURA 4TQFA 2N74A 4P9PA 2GBOA 1JVMA 3OMNB 4PI2A 2DQ0A 1ZL8B 2GUZB 1XDCA 1GK9A 2NNUA 4UCTA 3K5OA 3JAKB 3HR0A 4UCRA 2XAJA 1XMQO 1BL8A 2EIJB 3IAYA 5H6QA 4B3SB 1WPBA 3W7TA 1L0NH 1PL4A 4JPRA 2UXXA 1IBKB 2XAGA 1NS1A 2QKSA 4PA4A 3N2GA 3OUFA 2EX3A 2BCCH 2VWJA 1CEZA 1TUBB 5CA1A 2UUCO 3ZHQA 3AG2B 1HWYA 3C3SA 3L72H 4UCUA 2ZM6B 1O9HA 4JAVA 1EN5A 1GAXA 3R65A 2GSMB 3FYIB 4GX1A 2PTMA 2XHBA 5LGNA 1VF7A 2G38A 4I4TB 3THOA 4OGQB 2EJRA 5JQGB 3E35A 1VQPV 1U96A 1D5NA 1YJNV 1N32O 3TGUH 2DWEC 4LCUC 3S3XA 4L8JA 2CTRA 4W4LA 1PL0A 1R1BA 1JR9A 3ZRXA 3N27A 1KU9A 4BW5A 4DR3O 1Y66A 3X2QB 1H8EG 2WA4A 3C3TA 3WFVA 4GLXA 5GTIZ 3SJCC 4DR7B 1XL4A 1SERA 1Q7YW 1WB7A 2X6BA 3ABMB 4NXMB 2JS5A 2RN9A 3S3WA 4IL6Z 3FB6C 1XL6A 2BOBC 3B8NA 3E22B 2WLIA 3CC4V 2QM8A 2P67A 2IBZH 3K57A 4IHJB 3KCXA 2B5UA 3FYEB 1Q90D 4DK0A 5L3EA 4FM2A 2XT9A 5GONA 3RGBA 3JASA 1SA0A 3H01A 3RYHA 3VQYA 4FLYA 1KD1W 1K73W 1Y67A 5J2UB 4DR5O 1AI5A 1JX9A 5H5NA 3JAWB 4PDRA 1PNLA 4IYIA 1FYJA 2EIKC 4TV9B 1AJNA 1AJPA 1I0HA 1Y74A 3OGCC 3KCYA 5FNVB 1QLEC 3CC2V 1P84F 3W7WA 2F4VO 5B1AB 4DK1A 1SESA 1N0JA 3SYPA 2M7WA 2YXHA 2Q8VA 1VMGA 3G80A 4UUJC 1WJZA 2P7TC 3RT3C 5IY5B 2W0FC 4Q6GA 4X88A 3ETEA 1P49A 5KHKA 4KP4A 5L3BA 2UU9O 4PHZA 4JI0B 1M90W 3BRCA 4WFAV 2DJVA 3L71H 2L6LA 1GN2A 2YUAA 5LGUA 3RYIA 4I55A 1V54C 2OYQA 3A0HZ 1YTFD 3ZCCA 5L3CA 4NB5A 5LMUB 1VQ8V 3K3WA 1L1FA 3K0DA 2YI8A 1GN6A 4ZOLB 4J7KA 1RFYA 3FAVB 3OFNG 1XILA 1XNQO 1XNRB 5IJ0A 4X20A 2YI9A 3CRQA 4JI7O 4U3JA 5IWAO 3DC5A 3GWOA 3ZS8C 4WFGA 4DRXA 2PYLA 2KSDA 4I50B 3QTCA 1N36O 4UFZA 5DEDA 5EBWC 5JJEB 1VARA 3HKEA 3R66A 2PZSA 4JI6O 3AG1B 3ABKB 2YIBD 4CC5A 3OE7G 3DC6A 1ZLZA 1OHHG 4HAMA 5EZYA 5LOVA 3STZC 2HVJC 4B7EA 1URFA 3I55V 1P7BA 4F6RA 2A06H 2Y0PA 1L0LH 3UT5B 2UXNA 5BMVB 1OJHA 5EYPA 4LF7B 2Y0IA 4EB6B 1YEWA 4RAIA 5EIBC 3WB1A 1WP8A 4BIUA 4R8CA 3U11A 3T4ZA 4QE9A 1PV0A 5L3DA 3F7YC 4ZHQB 1B3QA 4JF3A 4MVRA 4DV1O 1KKCA 2WAMA 1S5HC 5KHGA 2LW7A 1XHZA 4CC6A 4FK5C 2ZT9B 1R6NA 2YEVB 1AR1B 3M8AA 4K3AA 5IYBO 1AI6A 4LFCB 3MAQA 5DECA 3JARB 3ZHSA 2R9RB 3TXQA 2PI5A 2K9PA 3AG7A 1HDJA 3N2GB 1NU1H 4LNUB 4JI1O 3OD4A 3CXCU 3AK1A 4O2AA 4YHHB 4MTGA 5B1OA 4KFMA 4YJ2B 1KECA 1I5XA 4FLUA 4LF9O 2IW5A 5CA0B 5B1NA 2GTAA 2Y4UA 3J7AU 1V9PA 1S5JA 4TV8B 3OW2U 4J11A 1I7FA 4ABMA 5LGTA 2ZDIC 4JI5B 1H2GA 3AG3C 5ITZA 5C8YA 3CE2A 1SKVA 2UXDO 3G71V 2OIGA 3ICXA 4DYLA 4X62B 3ZX6A 1HNZB 3CCSV 4RQEA 2ZDIA 2OWOA 3IJ4A 2WLMA 4P9OA 1EZVH 3H1JH 1N34O 2P5OA 2AZ0A 3ASOB 4UV9A 4DUYO 1F7YA 4YJ3A 4UVCA 1HR0B 3UQ8A 1VIBA 1VF5B 4NXNO 4TUYB 1JOYA 1F23A 4X65B 2XASA 4DV6O 2IU3A 1K3EA 5KA6A 2AZ2A 1EM1A 2RQ6A 1JPXA 4PELA 4DV5O 3O65A 2PYJA 2N04A 4X1KA 4DR2O 5FLXN 4NTXA 4CH5A 4ZI7B 4ZKIA 1Q3EA 4GUNA 5HFMA 3BEHA 2QEXV 4JYYA 5TISZ 1R6KA 2HKOA 1VQLV 1YTFB 3W7XA 3K5MA 5LMNB 1K5SA 1IZ3A 2KG7B 2VQFB 5IT9N 1AP6A 1QHTA 1FXHA 3SPCA 5E79Z 1FXKA 4CBCA 4CS3A 1UFIA 2EIKB 4AILC 2F1MA 1Y6XA 2B1IA 4LFAB 2Q67A 1JJOA 2IH1C 5JH7B 3M7MX 2Q4PA 4O4IA 2EZOA 3ZJZA 4O4JA 2Y4TA 5B3SC 1HNWO 1SC5B 2JJ1G 1IBMO 5B1BC 2Q68A 4X1IB 1I94B 4ASUG 1WB8A 3T2MA 4MW8A 3IC9A 4U3FH 4J7JA 3DXRB 1CP9A 2W6IG 1ZUQA 2QM7A 5J2TA 1SQBH 2MW2B 3E86A 1DK1A 4G27B 2CTPA 1K9MW 3ZHRA 4A5UB 1M5IA 2YIDA 4KHPO 2P90A 1Q5OA 1Q6UA 5IJ9A 2FTKA 1S5LZ 2CH7B 1ZTEA 2PF4E 3SPHA 4UVAA 3HKEB 3A8TA 1COWG 4N23A 3SGIA 5CB4A 3RWRD 3Q4HB 1EN4A 2YS8A 1Q6IA 5EZYB 2GDSA 4WF9V 4X89A 3FB5C 2DYSC 4B3RO 1SQQH 3K04A 4JI2O 2CGNA 2XTAA 3QO7A 4IGGA 3CWBH 1OCZB 1N0NA 2XNDG 3AK2A 1NTKH 4F6EA 4GKKO 2E5LO 2V7QG 3JD3A 2JS3A 3QVNA 1OCRB 4RUFA 2FL4A 4FIPC 4FPPA 4DR6O 1SETA 1L8DA 2FMLA 3L9DA 3JD2A 1YJWV 2AGAA 4D7TA 1QVFU 4K35A 1SQFA 1VQ6V 4B3MB 4JYCA 5KUKA 1R3JC 1JQ0A 2PUSA 5KAFZ 5GTHZ 1N33O 3LSSA 1IX9A 4PDVA 3G6BA 4JI3O 4O2AB 3E2EA 1S77D 2YXYA 1WA8A 3OR6C 4HZ3A 1ZX3A 2FB5A 2HHHO 3B09A 1R73A 3K0GA 3C90A 3T4DA 1Y76B 1RSOB 4XDLA 1HW7A 4JI8B 2ZNJA 3BFRA 4FM0A 2RNBA 3RYFB 2JDIG 5FPRA 2E75B 5EBLC 1PM9A 5D5QA 4FZ0A 1JFFA 1S3JA 3BABA 5ITZB 4JI4O 1KUQA 4X1YB 3B4SA 3HKBB 3PJSK 1D2DA 2RDCA 1FJGO 1TGOA 1I5YA 4BIOA 1KC8W 1GO3F 3CD6V 4DV7B 3T1HB 1AROP 4JV5B 4G2KA 1KP3A 1G8MA 2UU9B 4LP8A 2ZKOA 5LHIA 3B40A 4BIZA 1WPXA 1M56C 1M1KW 3AG4C 4DV3O 4DV2B 2A3QA 5B5EZ 3N2KA 4K0KB 2YICA 3ZN0A 4BAYA 4I0XA 4GCZA 1SRYA 4GKJB 4PV1B 2ZE7A 1Q86W 3CCLV 3CPWU 2DE0X 3OTOO 4MS2A 1NQTA 4D6TH 4J41A 1K8AW 2CE4A 4LF4O 1BT8A 1M57C 2RJZA 3LUTB 4FFBA 1FPOA 4AQYB 1WLEA 4JI6B 5JCOC 1YCIA 3T1YO 1BCCH 2CTQA 3ZRVA 3UO3A 3CX5F 2BSKA 4MTOA 1K4CC 3MDSA 4Z1VA 2ZIMA 4PDLA 4QGPA 2ZQMA 1FXKB 3FX7A 5CBHA 1FFTB 5JCOA 1JMKC 2EIMC 1NI8A 4O2BA 5H2FZ 4LFBB 1OCOC 4OX9B 1MZEA 3RYCB 1S0VA 1S76D 5LHHA 4MVSA 3VQVA 4O4JB 2PY5A 2A9HA 3CCMV 1OZ0A 1K7DA 3BA8A 4TQDA 4UB6Z 2YC0A 5J9PC 2A7WA 3FD9A 1KKDA 1GMGA 3ABLC 3E89A 4DXWA 2VQEB 3WB0A 2ZD9A 4MT8A 4X64O 1MA1A 3HKDA 5DN6G 3VQXA 3IFXA 4FLZA 2F66C 2EILB 5J2TB 2Q7HA 2Y69C 1AI4A 3WG7B 5JVDB 5IE9A 1OCCC 1VQ5V 5BR8B 2N05A 1AJQA 3D8CA 3OMIB 1AVMA 5KMGA 1F4MA 1IBLO 2LFRA 3APOA 4O4LA 5KHHA 4DV0B 4Z2WA 3K9SA 3CJHB 5H6RA 3QG5A 4UCSA 1NZ6A 4B3SO 3ZRWB 2XAFA 5CB4B 1K97A 4B3TB 5IYZA 4MVOA 1NVPD 3NXSA 3JSNA 1BS3A 1QVGU 1IBKO 1G1XB 1BQZA 1YDXA 1MG1A 5LA6B 4IIJA 4JZ2A 1KP2A 2EBOA 1H8HG 1MNGA 1E1RG 3UO2A 1FD9A 1H2NA 2ZM6O 1TVKB 3D3QA 5LP6C 2EINB 1THZA 3BCCH 3OAAG 3K58A 5KX5A 4J10A 3P3NA 1H2LA 3CP1A 2WLLA 1V55C 5LP6A 3SYOA 3SPGA 4YIPA 5DM6V 1P4RA 1HP8A 3ZMSA 4DR1B 3BVOA 4N21A 4DUZB 2IJHA 1H38A 2ZNIA 1Q8IA 1BHAA 4QPKA 3JATB 2ZCEA 1RM1C 1T5EA 1N4CA 1HNXB 3G4SV 4X66B 3CYOA 2CUGA 3SYAA 3KZIZ 4PI0A 4LBEC 4DR7O 5LXTA 1XOUA 1B6QA 4NXMO 4LF5B 3SPJA 1JFFB 4AHCA 5KAIZ 1ZAUA 2C2AA 4J9YB 5KUMA 2ZR3A 3SR2C 2UXCB 1K33A 2QKAA 2XOKG 4CS2A 5KLVH 1LR1A 1U97A 4JYAB 2CAZC 1AILA 1XMOB 1MZFA 1YVWA 4RO2A 3ZMZA 4DW0A 2Y48A 5CA1B 2ZIOA 2HR3A 4F4LA 2ZR2A 3CCVV 3LNMB 4H37A 4LF8B 4LWSA 1BGYH 1GM9A 2JGDA 4GX2A 4TSFG 2NLJC 4JYBA 3B8MA 1G6UA 2EULA 4NYKA 3CC7V 2BTQA 2H3OA 2L35A 1PNKA 1RPOA 1M93A 2ITDC 4NR1A 1AR5A 4HBNA 1YZBA 2DYRC 1Z5WA 2K1EA 5EIBD 1YI2V 1YITV 1B04A 3ABUA 1DTOA 4DV4B 2Q5ZA 2P4KA 2EIJC 4P30A 4CS4A 1ZL8A 4PA7A 2GUZA 2AXTZ 4FLVA 1PNMA 4FJCC 4JI0O 2Q7GA 3P3PA 1VP7A 5L3FA 2KQXA 2ZE5A 2OTLV 4FFBB 4U7NA 1AB3A 4OPHA 2WSSG 5LMUO 3AG2C 5JWPA 1X4TA 5H9CA 1EFRG 3D36C 2QR4A 2HJDA 1GM7A 2BE3A 3TETA 5IYDO 1XNRO 2ATKC 1NTMH 1TUBA 2WLIB 1S72V 2JGUA 5CBGA 1Y4MA 3CCJV 4YY3B 3H9VA 3HB3B 3D36A 1GM8A 1PP9H 1NTZH 3W7SA 5GONB 2Z3YA 3JASB 1SA0B 2EIMB 3RYHB 1NVPB 3E8FA 2LFSA 3SDLA 1NH2D 4HNAA 2UUBB 3OUSA 4DR6B 3CSXA 4B08A 2P6JA 5JQGA 4NVPA 1J5EB 3H1LH 4IT5A 1AR4A 2W0XA 5C93A 3ETQA 1F4NA 1Y74B 2YXLA 3ABLB 2QGNA 4PDMA 4LF7O 2QA4V 3L75H 3CCUV 1BSMA 2UXBB 2UUAB 2QKCA 3X2QC 4LF6B 1JA8A 3ZBHA 5K1PA 4DR4B 3ETDA 3ZHTA 1IDSA 2KB1A 3ABMC 3NR7A 2IM9A 4P2ZA 2HHHB 1GKFA 3ASNC 1QLEB 1NR1A 1FFXA 1K34A 4LFCO 2JVDA 2YIAA 2HEPA 3SYCA 1XMQB 1R3KC 4JAUA 3RYIB 4I55B 4IIJB 1US6A 4YHHO 5EK0A 4IHJA 2ETNA 4FVMA 4X8AA 4OXSA 2HP8A 4KUMA 4TWKA 2ADQB 4Z1MG 2LJ2A 1W0KG 2RCVA 5IJ0B 1V54B 4X20B 1VQ7V 5KHJA 1W0JG 5CMUA 4U3JB 1GTOA 4MVMA 2Q7EA 4DRXB 2UUCB 5B1AC 1XREA 1Q6HA 2BTOA 3BY6A 3UKMA 3K5LA 4BWAA 4YXWG 4HYOA 3CHXA 2OCCC 3K79A 2XAQA 5FNVA 1XHXA 4FFKA 3K9AA 4X62O 2ODMA 5IY5C 1SZTA 5LOVB 1HNZO 1TA8A 4AI8A 3APQA 5CBFA 3L70H 4MTFA 5L3GA 3I5DA 3GWKC 4F6RB 3AEIA 4H44B 2WWWA 2YDEA 1N32B 3BHPA 1K4DC 4UXNA 1DF4A 5EYPB 1EZJA 1NJIW 1H2MA 1WNSA 3UM7A 3FKSG 4MW3A 3VOUA 4X65O 3CXHF 1I08A 1QQCA 1BQ0A 4GYCB 3FFQA 4ZIBA 4H13B 4DR3B 3U0ZA 3T1YB 1KBHA 1YHQV 3SJAC 1GN4A 3DGEA 4ZOLA 5F2VO 1LUWA 2JRIA 3FAVA 3J80N 3KKYA 1JCHA 4RQFA 4LH7A 3K59A 3ZMVA 4GX0A 1MSWD 2FYUH 3AG1C 2JIZG 3ABKC 1YF2A 4I50A 2HG5C 4KXRA 4FM1A 2Q69A 2IJKA 2PGGA 1VQOV 1PKXA 3P30A 4MVZA 5LMNO 4JASA 1GN3A 2E76B 3IC7A 1O9GA 2ZXWC 3SPIA 4R7CA 2VQFO 1KQSU 2LO1A 4DR5B 2O57A 5A2QN 4UVBA 2BTQB 4FZ1A 2R70A 4BW9A 5LL6Y 3UT5A 1MOFA 4NTWA 1DGSA 5C8YB 2F95B 4EB6A 2X7RB 5D5PA 2F4VB 2ZE8A 3OGIB 4ICGA 4ZHQA 3MD0A 1NH2B 2NN4A 2DW4A 2DYRB 1I94O 3AG3B 3CMEV 1IBLB 3JD1A 1GH6A 1R6TA 3SJBC 1SQXH 4YJ3B 2YEVA 3H1KH 2ADPA 1XI1A 1YSCA 1FKAO 4UB8Z 4RWUA 2JEUA 4BR6A 3JARA 2EZPA 3ZMTA 2P22C 5FL7G 3O9OA 5IYCO 4LNUA 3QO8A 4JTDB 3B2EE 1IVSA 3H1HH 1SS3A 4DO2A 4WFFA 1QLNA 4YJ2A 2A0LA 2VWKA 1XNQB 3CRCA 5CA0A 4X1KB 4MTXA 1IXMA 4E2LA 4G28B 1ZSPA 4JI7B 5IWAB 5EBMC 4HNAB 1SQVH 5BXZA 2ILMA 4TV8A 1N36B 2WLKA 1DF5A 2BOCC 1VF6C 1NKDA 2A79B 3RN4A 3W7UA 2E74B 1XBLA 3ASOC 2QDOA 1YXBA 3CRMA 2Q9LA 3JD4A 4B7KA 1XQ8A 2D3OW 4UCVA 1VF6A 2GHYA 1MMMA 2DOSA 3OTFA 3QNEA 4CH4A 4XDKA 2LW1A 2XAHA 2D2CB 2OCHA 1RP3B 4TUYA 3CCEV 2P4VA 2WLHA 4O4IB 1K5QA 2QM4A 1NBMG 2VS0A 1FFXB 2HLDG 2LP7A 1SQPH 1TAEA 3FB7C 4DV1B 2GTSA 3ASNB 4B3MO 4JTAB 2QWOB 5B3SB 5K1XA 2Q73A 3K08A 5B1BB 4LC1A 5LYJA 2KKWA 3BPZA 4TT3G 3EHBB 3F7VC 2AW9A 2R9IA 3E83A 4O4HA 4XBFA 4ZI7A 1E79G 1VQKV
chains in the Genus database with same CATH topology
1JVMA 2EZOA 3ZJZA 3OMNB 4RO2A 3ZMZA 5B3SC 2Y48A 2DQ0A 1QR9A 2JJ1G 2HR3A 1GK9A 2NNUA 5B1BC 2ZR2A 2Q68A 3FB8C 4R6ZA 4F4LA 3CCVV 2CK3G 3LNMB 4H37A 5GW7A 3QO5A 2XAJA 1GM9A 1TUEB 4ASUG 3T2MA 4GX2A 1BL8A 4MW8A 4TSFG 4MVQA 2NLJC 2EIJB 4JYBA 3B8MA 5H6QA 3CC7V 4H33A 2ITCC 2WLJA 1PNKA 1RPOA 3W7TA 2ITDC 1CP9A 2QM7A 2W6IG 2DYRC 4JPRA 2UXXA 2K1EA 1YI2V 2XAGA 1YITV 1E1QG 2QKSA 4QNHB 2OCCB 3E86A 3DTUB 4GX5A 4PA4A 3ABUA 3OUFA 3KG2A 4G27B 1DTOA 1K9MW 1MABG 3E8GA 2EIJC 4P30A 1CEZA 3IGAC 2P90A 3AG2B 4PA7A 2FTKA 1PNMA 1HWYA 4FJCC 1Q81W 1NR7A 2DYSB 4JGSA 3SJQC 4JAVA 5L3FA 2DWDC 4UVAA 3SPHA 2OTLV 3R65A 2GSMB 1BMFG 3FYIB 1COWG 4GX1A 4U7NA 1M9NA 4N23A 5LGNA 2WSSG 2EJRA 3AG2C 3E35A 4WF9V 1VQPV 4X89A 3FB5C 3T1CA 2DYSC 3OEEG 5H9CA 5CN0A 1EFRG 1YJNV 3K04A 1GM7A 4JTCB 3TETA 5IYDO 3ZMUA 3TK1A 2DWEC 2JEXA 3P32A 3QO7A 1UJWB 2ATKC 4LCUC 2WLIB 1OCZB 1S72V 5CBGA 1Y4MA 2XNDG 1QR8A 3CCJV 3HB3B 3D36A 1GM8A 1PL0A 3W7SA 1VQ4V 2H94A 3ZRXA 2V7QG 3JD3A 2Z3YA 3ZRSA 4QIWF 2EIMB 3SYQA 1OCRB 1NVPB 3E8FA 2LFSA 4RUFA 3RVYA 4BW5A 4FIPC 1Y66A 1NH2D 3OUSA 4FPPA 1SETA 3X2QB 2HFEC 1H8EG 1QBZA 2P6JA 3LDCA 1OCZC 3WFVA 3JD2A 1YJWV 1QVFU 1XL4A 5C93A 1SERA 1Q7YW 3ABMB 2X6BA 1VQ6V 2ZXWB 3FB6C 4PA6A 1F4NA 5EC1C 1W2BU 3ABLB 1OCRC 1XL6A 2BOBC 4PDMA 3B8NA 4JYCA 4QE7A 5KUKA 2QA4V 1R3JC 3CCUV 1JQ0A 2WLIA 3CC4V 2QM8A 4ZBMA 3LSSA 3X2QC 4Q20A 2P67A 4PDVA 4U7OA 3G6EV 2IJIA 3E2EA 2B5UA 3ETDA 3FYEB 5L3EA 1S77D 4J9ZB 2KB1A 3OR6C 3ABMC 3H01A 4HZ3A 2W6JG 4P2ZA 3K0GA 1R73A 1GKFA 3ASNC 3T4DA 1KD1W 1K73W 1QLEB 2OTJV 1BHBA 4UV8A 4XDLA 1AI5A 1JX9A 1NR1A 1EBOA 3F5WC 4PDRA 1PNLA 2JDIG 1K34A 2Q6AA 2F43G 5EBLC 2EIKC 1AJNA 1AJPA 1S3JA 4CZZA 3SYCA 3OGCC 1R3KC 4JAUA 1QCEA 1QLEC 3E8HA 3W7WA 1YIJV 3CC2V 5B1AB 2JJ2G 3PJSK 3OM3B 1SESA 5EK0A 1CPYA 3SYPA 4X8AA 1I5YA 2M7WA 1ZWIC 4OXSA 4KUMA 4TWKA 2IU0A 4Z1MG 1KC8W 1GO3F 3JCZA 3CD6V 4UUJC 1M56B 1W0KG 1PD3A 1AROP 2P7TC 3AG4B 5LHGA 1V54B 1VQ7V 1W0JG 5CMUA 4MVUA 2MK3A 5IY5B 1GTOA 2W0FC 4G2KA 4X88A 1ORQC 4MVMA 3ETEA 1KP3A 5B1AC 4KP4A 2IJJA 5L3BA 1G8MA 3BY6A 1R3IC 1Q82W 3UKMA 1JJ2U 1M90W 3K03A 4WFAV 4LP8A 1VQMV 4YXWG 5LHIA 4HYOA 4R50A 5LGUA 2V1DA 2OCCC 3K79A 2B1GA 4BIZA 2XAQA 1WPXA 2WPDG 1M56C 1M1KW 3AG4C 3OEHG 3K9AA 1V54C 3OMAB 4FMTA 1YTFD 5IY5C 3CCQV 1SZTA 3ZCCA 5L3CA 2X6CA 1VQ8V 5CBFA 3ZN0A 3K3WA 1J95A 1M57B 1L1FA 4BAYA 4GCZA 3K0DA 1SRYA 4MTFA 5L3GA 1Q86W 2Z5UA 3OFNG 4WFEA 3AEIA 5IDJA 3CPWU 3CCLV 2WWWA 1K4DC 4UXNA 1DF4A 1ROPA 1EZJA 3HPLC 3GWOA 4WFGA 4MS2A 1NQTA 1NJIW 3UM7A 1K8AW 3FKSG 2IH3C 4MW3A 3VOUA 1M57C 2AHYA 5EBWC 3LUTB 3AG1B 1ENVA 1WLEA 3ABKB 2PI4A 1OCOB 3RVZA 3OE7G 3ZRVA 4HAMA 1OHHG 1YHQV 3STZC 4MTOA 1K4CC 3DGEA 2HVJC 4PDLA 2ZQMA 3I55V 1FXKB 4MSWC 1P7BA 5CBHA 1JCHA 4RQFA 2JK5C 1FFTB 3ZMVA 4GX0A 1MSWD 2EIMC 2UXNA 3ZIAG 3AG1C 2JIZG 3ABKC 1OCOC 4RAIA 4BIUA 1S0VA 3VBBA 1S76D 2HG5C 2AHZA 2Q69A 4R8CA 5LHHA 4I9WA 3T4ZA 2IJKA 4MVSA 4QE9A 3GB7C 5L3DA 3F7YC 2A9HA 3CCMV 1OZ0A 1VQOV 3TCUA 1K7DA 1PKXA 3P30A 4MVZA 4JF3A 1FXKC 4MVRA 4JASA 2Y69B 1YJ9V 3IC7A 5J9PC 2ZXWC 2WAMA 1KKDA 3SPIA 1GMGA 1S5HC 3ABLC 3E89A 4DXWA 4R7CA 1OCCB 3MHHC 5BZBA 1DLBA 2HVKC 1KQSU 2YSUB 3ML0A 4FK5C 2ZD9A 4MT8A 1R6NA 2YEVB 1AR1B 5DN6G 5CA3A 4L87A 5IYBO 1AI6A 3IFXA 2DQ3A 4UVBA 5KA5A 1N8RW 2EILB 3LDEA 1MOFA 2Y69C 1AI4A 3WG7B 4EKWA 2R9RB 3LDDA 3ETGA 2PI5A 2X7RB 1OCCC 1VQNV 1VQ5V 3CXCU 4WFHA 4GT1A 1AJQA 3MD0A 4MTGA 5B1OA 4WCEV 1NH2B 3JYCA 3OMIB 2DW4A 2DYRB 1F4MA 4KFMA 3AG3B 3CMEV 2LFRA 1KECA 1I5XA 2EILC 3JD1A 3CCRV 3JD0A 5H6RA 2IW5A 3WG7C 5B1NA 2YEVA 3ZRWB 2XAFA 2WLLB 1K97A 1YSCA 4QPJA 4MVOA 3OW2U 1NVPD 3NXSA 2JEUA 5LGTA 4XDJA 2ZDIC 1QVGU 2EZPA 1H2GA 3AG3C 3M99B 3ZMTA 1MG1A 3A0RA 2WLNA 2OT5A 5FL7G 3RBZA 5IYCO 2X0LA 3QO8A 2H8PC 3G71V 4RUEA 1V55B 1KP2A 1AI7A 2EBOA 1H8HG 3CCSV 3I56V 4JTDB 1K92A 1E1RG 3MHSC 5HFLA 4RQEA 2ZDIA 5E1AC 4DO2A 4WFFA 2WLMA 4P9OA 1QLNA 2EINB 1FS0G 1THZA 3OAAG 3STLC 3E8BA 2A0LA 4I5SA 3ASOB 4UV9A 4MTXA 1IXMA 4E2LA 4G28B 4UVCA 1F51A 3ZRWA 1G4YB 2WLLA 3CP1A 5EBMC 1V55C 3LSQA 4PA9A 2WLKA 2X6AA 1RPRA 1DF5A 1JOYA 2BOCC 1F23A 1RM1B 3SYOA 3SPGA 5DM6V 1NKDA 1LNQA 1P4RA 2A79B 2XASA 3RW0A 3W7UA 2EINC 2IU3A 3ZMSA 4WFBV 1K3EA 4N21A 5KA6A 3ASOC 3ZN1A 1FXVA 2IJHA 1H38A 3JD4A 3EFFK 2QTOA 1BHAA 2D3OW 1JPXA 4PELA 4QPKA 3ABTA 1RM1C 2GHYA 3G4SV 3CMAV 3QNEA 3CYOA 4XDKA 2XAHA 4ZKIA 3SYAA 5HFMA 3BEHA 2QEXV 4QJFB 3CCEV 1R6KA 2WLHA 1K5QA 4LBEC 3OR7C 2HKOA 3B77A 1NBMG 1VQLV 2HLDG 3W7XA 1YTFB 2LP7A 1B6QA 3D3IA 1K5SA 2HJFC 3SPJA 3FB7C 4PA3A 2QE7G 3ASNB 1R3LC 5LBQA 4JTAB 2C2AA 1FXHA 5B3SB 4J9YB 5KUMA 2ZR3A 1FXKA 3K08A 1K33A 3SPCA 5B1BB 4CBCA 4LC1A 2XOKG 2EIKB 4TT3G 3EHBB 3F7VC 1VQ9V 2R9IA 3E83A 5EC2C 3K06A 4XBFA 2B1IA 1E79G 2Q67A 1VQKV 2IH1C 4P9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QM7 A;  4GT1 A;  4U7N A;  1F51 A;  4QPK A;  3ZRW A;  4BIZ A;  3MD0 A;  3A0R A;  5B1O A;  4MT8 A;  3D36 A;  4JYC A;  4FMT A;  2LFR A;  3ZRX A;  2C2A A;  1JOY A;  2QM8 A;  3ZCC A;  4Q20 A;  2LFS A;  4BIU A;  2P67 A;  4ZKI A;  4GCZ A;  4LC1 A;  4U7O A;  5B1N A;  4FPP A;  2FTK A;  4JYB A;  4JAU A;  3ZRV A;  4KP4 A;  3ZRW B;  5IDJ A;  4QPJ A;  2WWW A;  3TK1 A;  3P32 A;  4I5S A;  4JAS A;  3NXS A;  3DGE A;  4JAV A;  5C93 A;  4MTX A;  1IXM A; 
#chains in the Genus database with same CATH topology
 2LGW A;  4JI1 B;  4JI8 O;  2M6Y A;  1X59 A;  2VRZ A;  2LQT A;  3RFR A;  1QR9 A;  1NT2 B;  5IJ9 B;  1PPJ H;  3FB8 C;  4R6Z A;  3HKC A;  1UPG A;  2CK3 G;  5GW7 A;  4PD4 F;  2KG7 A;  3QO5 A;  4LF9 B;  1TUE B;  3CRA A;  4MVQ A;  1H2S B;  1OV9 A;  4EFB A;  4H33 A;  2ITC C;  2WLJ A;  4YIO A;  1AP5 A;  4TOI A;  2QSA A;  1E1Q G;  2F93 B;  4J80 A;  4QNH B;  2OCC B;  3DTU B;  4GX5 A;  4DV7 O;  3T1H O;  3KG2 A;  5JH7 A;  3BA9 A;  2UXD B;  1MAB G;  4KL1 A;  3E8G A;  4JV5 O;  3IGA C;  2YIB A;  4X1I A;  2CTW A;  1Q81 W;  1NR7 A;  2DYS B;  4JGS A;  3SJQ C;  3F5T A;  1N34 B;  2DWD C;  1BMF G;  4DUY B;  1M9N A;  2V4D A;  4DV2 O;  3DXR A;  3L74 H;  4K0K O;  4NXN B;  4WBN A;  4GKJ O;  1M4U A;  3T1C A;  3OEE G;  5CN0 A;  4DV6 B;  4JTC B;  4FLT A;  1WP7 A;  3ZMU A;  3TK1 A;  2JEX A;  3P32 A;  1UJW B;  2Q0O C;  1WAZ A;  4IYH A;  1QR8 A;  4EEQ A;  2CH7 A;  4DV5 B;  1VQ4 V;  2H94 A;  1WA8 B;  3JAL A;  3ZRS A;  4QIW F;  3SYQ A;  1FAF A;  4DR2 B;  3RVY A;  4AQY O;  3Q4H A;  2RMK B;  2HFE C;  1QBZ A;  3LDC A;  1LUV A;  1OCZ C;  3VQW A;  1KB9 F;  3TJT A;  1MSD A;  4K8X A;  3ZHV A;  4CH6 A;  2ZXW B;  2ZE6 A;  1EN6 A;  4PA6 A;  5EC1 C;  1W2B U;  1OCR C;  4QE7 A;  4LFB O;  1KMI Z;  2F23 A;  4OX9 O;  1BZK A;  4ZBM A;  1Q43 A;  4Q20 A;  4U7O A;  1P7G A;  3G6E V;  2IJI A;  2B9Z A;  3AK3 A;  3GVM A;  3ZED A;  4J9Z B;  3BAA A;  1QU7 A;  2W6J G;  3JCU Z;  2VQE O;  2OTJ V;  1BHB A;  2QJ1 A;  4UV8 A;  1HNW B;  1EBO A;  3F5W C;  3LSU A;  4FLX A;  1W59 A;  2Q6A A;  1IBM B;  2F43 G;  2ZIN A;  4NKG B;  3ZHU A;  4CZZ A;  1QCE A;  3E8H A;  1YIJ V;  5BR8 O;  1IXB A;  2JJ2 G;  3OM3 B;  3N2K B;  1CPY A;  3PN1 A;  3CS5 A;  4I0X B;  1ZWI C;  2IU0 A;  4DW1 A;  4DV0 O;  3JCZ A;  5KHI A;  1M56 B;  1Y76 A;  1PD3 A;  3AG4 B;  1RSO A;  5LHG A;  1D5A A;  4MVU A;  2MK3 A;  3CEI A;  3RYF A;  3CRR A;  4KHP B;  1ORQ C;  4B3T O;  2IJJ A;  1R3I C;  1Q82 W;  1JJ2 U;  3K03 A;  1VQM V;  3JAK A;  4R50 A;  2V1D A;  5FPO A;  2B1G A;  4X1Y A;  3DSQ A;  2WPD G;  3HKB A;  3OEH G;  5BY1 A;  3OMA B;  3K5N A;  4FMT A;  3CCQ V;  3QF7 A;  2X6C A;  2BSK B;  1J95 A;  1M57 B;  2Z5U A;  4WFE A;  5IDJ A;  4B3R B;  4JI2 B;  1ROP A;  1XEQ A;  4O2B B;  5B66 Z;  3HPL C;  2E3C A;  2IH3 C;  4J42 A;  2AHY A;  2Q0A A;  4J7Z A;  4GKK B;  2E5L B;  1XUQ A;  4H0L B;  4DR1 O;  2QWP B;  3L73 H;  1ENV A;  4GZR B;  2PI4 A;  4DUZ O;  1OCO B;  3RVZ A;  5JJN B;  4I4T A;  3CB2 A;  3LNN A;  4E4E A;  3HKD B;  4MSW C;  4LH6 A;  5LYJ B;  2JK5 C;  1HNX O;  1BE3 H;  4X66 O;  4PJ0 Z;  2NR5 A;  1H2K A;  2Z0A A;  3ZIA G;  4O4H B;  1N33 B;  3VBB A;  2AHZ A;  4I9W A;  2FKX A;  3TXS A;  3GB7 C;  2P06 A;  4JI3 B;  3TCU A;  1Z2G A;  3H1I H;  1FXK C;  2LGQ A;  5KMG B;  2Y69 B;  1GRJ A;  1YJ9 V;  3WU2 Z;  3HKC B;  4LF5 O;  4O4L B;  1KYO F;  1A32 A;  1OCC B;  3MHH C;  5BZB A;  1DLB A;  2HVK C;  2YSU B;  3ML0 A;  4I9Q A;  1CXZ B;  5CA3 A;  4L87 A;  4CH3 A;  2UXC O;  5IYZ B;  2DQ3 A;  3EXA A;  5KA5 A;  1N8R W;  3LDE A;  4NTY A;  4JYA O;  3E22 A;  4JI4 B;  3G67 A;  4EKW A;  3LDD A;  3ETG A;  2ARH A;  3RYC A;  1VQN V;  2OIE A;  1XMO O;  4WFH A;  4GT1 A;  4JAA A;  4WCE V;  3JYC A;  1FJG B;  2EIL C;  2EJ7 A;  4LF8 O;  3CCR V;  4I7Z B;  3JD0 A;  5AG2 A;  5KX5 B;  5J2U A;  3WG7 C;  2R72 A;  5JJJ B;  1SZX A;  3JAW A;  2WLL B;  1SQG A;  4QPJ A;  4D7S A;  3A2F A;  4TV9 A;  3A0B Z;  4WBN B;  4XDJ A;  5LP6 B;  4JI5 O;  4LR3 A;  3M99 B;  3OT7 A;  3A0R A;  1Z5V A;  2WLN A;  2OT5 A;  5JVD A;  3RBZ A;  2CGO A;  2X0L A;  2H8P C;  4DV3 B;  4DV4 O;  4RUE A;  4UCO A;  1V55 B;  1AI7 A;  3I56 V;  1K92 A;  1B06 A;  3MHS C;  5HFL A;  5E1A C;  3WB2 A;  1FS0 G;  3STL C;  3CJH A;  3EVK A;  3E8B A;  4I5S A;  3OTO B;  3JAL B;  1HR0 O;  1F51 A;  3ZRW A;  1G4Y B;  1SF9 A;  3LSQ A;  4PA9 A;  2X6A A;  3JSL A;  1RPR A;  4LF4 B;  1RM1 B;  2DMX A;  5LXT B;  4W4K A;  1LNQ A;  3RW0 A;  2EIN C;  5LA6 A;  4WFB V;  3ZN1 A;  2QWR B;  1FXV A;  4OPA A;  3EFF K;  2QTO A;  4YY3 O;  1TVK A;  3ABT A;  1WN7 A;  3CMA V;  2QTS A;  3J81 N;  2WA3 A;  2UUB O;  4QJF B;  1J5E O;  3OR7 C;  3B77 A;  2QWN B;  3D3I A;  4K8Z A;  2HJF C;  4PA3 A;  2QE7 G;  1R3L C;  4LWS B;  5LBQ A;  5A9G A;  2UXB O;  2JGD B;  2DN9 A;  2UUA O;  3UCS C;  2CDY A;  4X64 B;  4LF6 O;  4EFE A;  3JAT A;  3JAM N;  1VEW A;  4DR4 O;  2XUM A;  4FLW A;  1VQ9 V;  3U10 A;  2QWQ B;  5BMV A;  5EC2 C;  4JZG A;  2R9A A;  3K06 A;  4X9Q A;  4LFA O;  1QNM A;  4C7U A;  2GV9 A;  1IUR A;  4TQF A;  2N74 A;  4P9P A;  2GBO A;  1JVM A;  3OMN B;  4PI2 A;  2DQ0 A;  1ZL8 B;  2GUZ B;  1XDC A;  1GK9 A;  2NNU A;  4UCT A;  3K5O A;  3JAK B;  3HR0 A;  4UCR A;  2XAJ A;  1XMQ O;  1BL8 A;  2EIJ B;  3IAY A;  5H6Q A;  4B3S B;  1WPB A;  3W7T A;  1L0N H;  1PL4 A;  4JPR A;  2UXX A;  1IBK B;  2XAG A;  1NS1 A;  2QKS A;  4PA4 A;  3N2G A;  3OUF A;  2EX3 A;  2BCC H;  2VWJ A;  1CEZ A;  1TUB B;  5CA1 A;  2UUC O;  3ZHQ A;  3AG2 B;  1HWY A;  3C3S A;  3L72 H;  4UCU A;  2ZM6 B;  1O9H A;  4JAV A;  1EN5 A;  1GAX A;  3R65 A;  2GSM B;  3FYI B;  4GX1 A;  2PTM A;  2XHB A;  5LGN A;  1VF7 A;  2G38 A;  4I4T B;  3THO A;  4OGQ B;  2EJR A;  5JQG B;  3E35 A;  1VQP V;  1U96 A;  1D5N A;  1YJN V;  1N32 O;  3TGU H;  2DWE C;  4LCU C;  3S3X A;  4L8J A;  2CTR A;  4W4L A;  1PL0 A;  1R1B A;  1JR9 A;  3ZRX A;  3N27 A;  1KU9 A;  4BW5 A;  4DR3 O;  1Y66 A;  3X2Q B;  1H8E G;  2WA4 A;  3C3T A;  3WFV A;  4GLX A;  5GTI Z;  3SJC C;  4DR7 B;  1XL4 A;  1SER A;  1Q7Y W;  1WB7 A;  2X6B A;  3ABM B;  4NXM B;  2JS5 A;  2RN9 A;  3S3W A;  4IL6 Z;  3FB6 C;  1XL6 A;  2BOB C;  3B8N A;  3E22 B;  2WLI A;  3CC4 V;  2QM8 A;  2P67 A;  2IBZ H;  3K57 A;  4IHJ B;  3KCX A;  2B5U A;  3FYE B;  1Q90 D;  4DK0 A;  5L3E A;  4FM2 A;  2XT9 A;  5GON A;  3RGB A;  3JAS A;  1SA0 A;  3H01 A;  3RYH A;  3VQY A;  4FLY A;  1KD1 W;  1K73 W;  1Y67 A;  5J2U B;  4DR5 O;  1AI5 A;  1JX9 A;  5H5N A;  3JAW B;  4PDR A;  1PNL A;  4IYI A;  1FYJ A;  2EIK C;  4TV9 B;  1AJN A;  1AJP A;  1I0H A;  1Y74 A;  3OGC C;  3KCY A;  5FNV B;  1QLE C;  3CC2 V;  1P84 F;  3W7W A;  2F4V O;  5B1A B;  4DK1 A;  1SES A;  1N0J A;  3SYP A;  2M7W A;  2YXH A;  2Q8V A;  1VMG A;  3G80 A;  4UUJ C;  1WJZ A;  2P7T C;  3RT3 C;  5IY5 B;  2W0F C;  4Q6G A;  4X88 A;  3ETE A;  1P49 A;  5KHK A;  4KP4 A;  5L3B A;  2UU9 O;  4PHZ A;  4JI0 B;  1M90 W;  3BRC A;  4WFA V;  2DJV A;  3L71 H;  2L6L A;  1GN2 A;  2YUA A;  5LGU A;  3RYI A;  4I55 A;  1V54 C;  2OYQ A;  3A0H Z;  1YTF D;  3ZCC A;  5L3C A;  4NB5 A;  5LMU B;  1VQ8 V;  3K3W A;  1L1F A;  3K0D A;  2YI8 A;  1GN6 A;  4ZOL B;  4J7K A;  1RFY A;  3FAV B;  3OFN G;  1XIL A;  1XNQ O;  1XNR B;  5IJ0 A;  4X20 A;  2YI9 A;  3CRQ A;  4JI7 O;  4U3J A;  5IWA O;  3DC5 A;  3GWO A;  3ZS8 C;  4WFG A;  4DRX A;  2PYL A;  2KSD A;  4I50 B;  3QTC A;  1N36 O;  4UFZ A;  5DED A;  5EBW C;  5JJE B;  1VAR A;  3HKE A;  3R66 A;  2PZS A;  4JI6 O;  3AG1 B;  3ABK B;  2YIB D;  4CC5 A;  3OE7 G;  3DC6 A;  1ZLZ A;  1OHH G;  4HAM A;  5EZY A;  5LOV A;  3STZ C;  2HVJ C;  4B7E A;  1URF A;  3I55 V;  1P7B A;  4F6R A;  2A06 H;  2Y0P A;  1L0L H;  3UT5 B;  2UXN A;  5BMV B;  1OJH A;  5EYP A;  4LF7 B;  2Y0I A;  4EB6 B;  1YEW A;  4RAI A;  5EIB C;  3WB1 A;  1WP8 A;  4BIU A;  4R8C A;  3U11 A;  3T4Z A;  4QE9 A;  1PV0 A;  5L3D A;  3F7Y C;  4ZHQ B;  1B3Q A;  4JF3 A;  4MVR A;  4DV1 O;  1KKC A;  2WAM A;  1S5H C;  5KHG A;  2LW7 A;  1XHZ A;  4CC6 A;  4FK5 C;  2ZT9 B;  1R6N A;  2YEV B;  1AR1 B;  3M8A A;  4K3A A;  5IYB O;  1AI6 A;  4LFC B;  3MAQ A;  5DEC A;  3JAR B;  3ZHS A;  2R9R B;  3TXQ A;  2PI5 A;  2K9P A;  3AG7 A;  1HDJ A;  3N2G B;  1NU1 H;  4LNU B;  4JI1 O;  3OD4 A;  3CXC U;  3AK1 A;  4O2A A;  4YHH B;  4MTG A;  5B1O A;  4KFM A;  4YJ2 B;  1KEC A;  1I5X A;  4FLU A;  4LF9 O;  2IW5 A;  5CA0 B;  5B1N A;  2GTA A;  2Y4U A;  3J7A U;  1V9P A;  1S5J A;  4TV8 B;  3OW2 U;  4J11 A;  1I7F A;  4ABM A;  5LGT A;  2ZDI C;  4JI5 B;  1H2G A;  3AG3 C;  5ITZ A;  5C8Y A;  3CE2 A;  1SKV A;  2UXD O;  3G71 V;  2OIG A;  3ICX A;  4DYL A;  4X62 B;  3ZX6 A;  1HNZ B;  3CCS V;  4RQE A;  2ZDI A;  2OWO A;  3IJ4 A;  2WLM A;  4P9O A;  1EZV H;  3H1J H;  1N34 O;  2P5O A;  2AZ0 A;  3ASO B;  4UV9 A;  4DUY O;  1F7Y A;  4YJ3 A;  4UVC A;  1HR0 B;  3UQ8 A;  1VIB A;  1VF5 B;  4NXN O;  4TUY B;  1JOY A;  1F23 A;  4X65 B;  2XAS A;  4DV6 O;  2IU3 A;  1K3E A;  5KA6 A;  2AZ2 A;  1EM1 A;  2RQ6 A;  1JPX A;  4PEL A;  4DV5 O;  3O65 A;  2PYJ A;  2N04 A;  4X1K A;  4DR2 O;  5FLX N;  4NTX A;  4CH5 A;  4ZI7 B;  4ZKI A;  1Q3E A;  4GUN A;  5HFM A;  3BEH A;  2QEX V;  4JYY A;  5TIS Z;  1R6K A;  2HKO A;  1VQL V;  1YTF B;  3W7X A;  3K5M A;  5LMN B;  1K5S A;  1IZ3 A;  2KG7 B;  2VQF B;  5IT9 N;  1AP6 A;  1QHT A;  1FXH A;  3SPC A;  5E79 Z;  1FXK A;  4CBC A;  4CS3 A;  1UFI A;  2EIK B;  4AIL C;  2F1M A;  1Y6X A;  2B1I A;  4LFA B;  2Q67 A;  1JJO A;  2IH1 C;  5JH7 B;  3M7M X;  2Q4P A;  4O4I A;  2EZO A;  3ZJZ A;  4O4J A;  2Y4T A;  5B3S C;  1HNW O;  1SC5 B;  2JJ1 G;  1IBM O;  5B1B C;  2Q68 A;  4X1I B;  1I94 B;  4ASU G;  1WB8 A;  3T2M A;  4MW8 A;  3IC9 A;  4U3F H;  4J7J A;  3DXR B;  1CP9 A;  2W6I G;  1ZUQ A;  2QM7 A;  5J2T A;  1SQB H;  2MW2 B;  3E86 A;  1DK1 A;  4G27 B;  2CTP A;  1K9M W;  3ZHR A;  4A5U B;  1M5I A;  2YID A;  4KHP O;  2P90 A;  1Q5O A;  1Q6U A;  5IJ9 A;  2FTK A;  1S5L Z;  2CH7 B;  1ZTE A;  2PF4 E;  3SPH A;  4UVA A;  3HKE B;  3A8T A;  1COW G;  4N23 A;  3SGI A;  5CB4 A;  3RWR D;  3Q4H B;  1EN4 A;  2YS8 A;  1Q6I A;  5EZY B;  2GDS A;  4WF9 V;  4X89 A;  3FB5 C;  2DYS C;  4B3R O;  1SQQ H;  3K04 A;  4JI2 O;  2CGN A;  2XTA A;  3QO7 A;  4IGG A;  3CWB H;  1OCZ B;  1N0N A;  2XND G;  3AK2 A;  1NTK H;  4F6E A;  4GKK O;  2E5L O;  2V7Q G;  3JD3 A;  2JS3 A;  3QVN A;  1OCR B;  4RUF A;  2FL4 A;  4FIP C;  4FPP A;  4DR6 O;  1SET A;  1L8D A;  2FML A;  3L9D A;  3JD2 A;  1YJW V;  2AGA A;  4D7T A;  1QVF U;  4K35 A;  1SQF A;  1VQ6 V;  4B3M B;  4JYC A;  5KUK A;  1R3J C;  1JQ0 A;  2PUS A;  5KAF Z;  5GTH Z;  1N33 O;  3LSS A;  1IX9 A;  4PDV A;  3G6B A;  4JI3 O;  4O2A B;  3E2E A;  1S77 D;  2YXY A;  1WA8 A;  3OR6 C;  4HZ3 A;  1ZX3 A;  2FB5 A;  2HHH O;  3B09 A;  1R73 A;  3K0G A;  3C90 A;  3T4D A;  1Y76 B;  1RSO B;  4XDL A;  1HW7 A;  4JI8 B;  2ZNJ A;  3BFR A;  4FM0 A;  2RNB A;  3RYF B;  2JDI G;  5FPR A;  2E75 B;  5EBL C;  1PM9 A;  5D5Q A;  4FZ0 A;  1JFF A;  1S3J A;  3BAB A;  5ITZ B;  4JI4 O;  1KUQ A;  4X1Y B;  3B4S A;  3HKB B;  3PJS K;  1D2D A;  2RDC A;  1FJG O;  1TGO A;  1I5Y A;  4BIO A;  1KC8 W;  1GO3 F;  3CD6 V;  4DV7 B;  3T1H B;  1ARO P;  4JV5 B;  4G2K A;  1KP3 A;  1G8M A;  2UU9 B;  4LP8 A;  2ZKO A;  5LHI A;  3B40 A;  4BIZ A;  1WPX A;  1M56 C;  1M1K W;  3AG4 C;  4DV3 O;  4DV2 B;  2A3Q A;  5B5E Z;  3N2K A;  4K0K B;  2YIC A;  3ZN0 A;  4BAY A;  4I0X A;  4GCZ A;  1SRY A;  4GKJ B;  4PV1 B;  2ZE7 A;  1Q86 W;  3CCL V;  3CPW U;  2DE0 X;  3OTO O;  4MS2 A;  1NQT A;  4D6T H;  4J41 A;  1K8A W;  2CE4 A;  4LF4 O;  1BT8 A;  1M57 C;  2RJZ A;  3LUT B;  4FFB A;  1FPO A;  4AQY B;  1WLE A;  4JI6 B;  5JCO C;  1YCI A;  3T1Y O;  1BCC H;  2CTQ A;  3ZRV A;  3UO3 A;  3CX5 F;  2BSK A;  4MTO A;  1K4C C;  3MDS A;  4Z1V A;  2ZIM A;  4PDL A;  4QGP A;  2ZQM A;  1FXK B;  3FX7 A;  5CBH A;  1FFT B;  5JCO A;  1JMK C;  2EIM C;  1NI8 A;  4O2B A;  5H2F Z;  4LFB B;  1OCO C;  4OX9 B;  1MZE A;  3RYC B;  1S0V A;  1S76 D;  5LHH A;  4MVS A;  3VQV A;  4O4J B;  2PY5 A;  2A9H A;  3CCM V;  1OZ0 A;  1K7D A;  3BA8 A;  4TQD A;  4UB6 Z;  2YC0 A;  5J9P C;  2A7W A;  3FD9 A;  1KKD A;  1GMG A;  3ABL C;  3E89 A;  4DXW A;  2VQE B;  3WB0 A;  2ZD9 A;  4MT8 A;  4X64 O;  1MA1 A;  3HKD A;  5DN6 G;  3VQX A;  3IFX A;  4FLZ A;  2F66 C;  2EIL B;  5J2T B;  2Q7H A;  2Y69 C;  1AI4 A;  3WG7 B;  5JVD B;  5IE9 A;  1OCC C;  1VQ5 V;  5BR8 B;  2N05 A;  1AJQ A;  3D8C A;  3OMI B;  1AVM A;  5KMG A;  1F4M A;  1IBL O;  2LFR A;  3APO A;  4O4L A;  5KHH A;  4DV0 B;  4Z2W A;  3K9S A;  3CJH B;  5H6R A;  3QG5 A;  4UCS A;  1NZ6 A;  4B3S O;  3ZRW B;  2XAF A;  5CB4 B;  1K97 A;  4B3T B;  5IYZ A;  4MVO A;  1NVP D;  3NXS A;  3JSN A;  1BS3 A;  1QVG U;  1IBK O;  1G1X B;  1BQZ A;  1YDX A;  1MG1 A;  5LA6 B;  4IIJ A;  4JZ2 A;  1KP2 A;  2EBO A;  1H8H G;  1MNG A;  1E1R G;  3UO2 A;  1FD9 A;  1H2N A;  2ZM6 O;  1TVK B;  3D3Q A;  5LP6 C;  2EIN B;  1THZ A;  3BCC H;  3OAA G;  3K58 A;  5KX5 A;  4J10 A;  3P3N A;  1H2L A;  3CP1 A;  2WLL A;  1V55 C;  5LP6 A;  3SYO A;  3SPG A;  4YIP A;  5DM6 V;  1P4R A;  1HP8 A;  3ZMS A;  4DR1 B;  3BVO A;  4N21 A;  4DUZ B;  2IJH A;  1H38 A;  2ZNI A;  1Q8I A;  1BHA A;  4QPK A;  3JAT B;  2ZCE A;  1RM1 C;  1T5E A;  1N4C A;  1HNX B;  3G4S V;  4X66 B;  3CYO A;  2CUG A;  3SYA A;  3KZI Z;  4PI0 A;  4LBE C;  4DR7 O;  5LXT A;  1XOU A;  1B6Q A;  4NXM O;  4LF5 B;  3SPJ A;  1JFF B;  4AHC A;  5KAI Z;  1ZAU A;  2C2A A;  4J9Y B;  5KUM A;  2ZR3 A;  3SR2 C;  2UXC B;  1K33 A;  2QKA A;  2XOK G;  4CS2 A;  5KLV H;  1LR1 A;  1U97 A;  4JYA B;  2CAZ C;  1AIL A;  1XMO B;  1MZF A;  1YVW A;  4RO2 A;  3ZMZ A;  4DW0 A;  2Y48 A;  5CA1 B;  2ZIO A;  2HR3 A;  4F4L A;  2ZR2 A;  3CCV V;  3LNM B;  4H37 A;  4LF8 B;  4LWS A;  1BGY H;  1GM9 A;  2JGD A;  4GX2 A;  4TSF G;  2NLJ C;  4JYB A;  3B8M A;  1G6U A;  2EUL A;  4NYK A;  3CC7 V;  2BTQ A;  2H3O A;  2L35 A;  1PNK A;  1RPO A;  1M93 A;  2ITD C;  4NR1 A;  1AR5 A;  4HBN A;  1YZB A;  2DYR C;  1Z5W A;  2K1E A;  5EIB D;  1YI2 V;  1YIT V;  1B04 A;  3ABU A;  1DTO A;  4DV4 B;  2Q5Z A;  2P4K A;  2EIJ C;  4P30 A;  4CS4 A;  1ZL8 A;  4PA7 A;  2GUZ A;  2AXT Z;  4FLV A;  1PNM A;  4FJC C;  4JI0 O;  2Q7G A;  3P3P A;  1VP7 A;  5L3F A;  2KQX A;  2ZE5 A;  2OTL V;  4FFB B;  4U7N A;  1AB3 A;  4OPH A;  2WSS G;  5LMU O;  3AG2 C;  5JWP A;  1X4T A;  5H9C A;  1EFR G;  3D36 C;  2QR4 A;  2HJD A;  1GM7 A;  2BE3 A;  3TET A;  5IYD O;  1XNR O;  2ATK C;  1NTM H;  1TUB A;  2WLI B;  1S72 V;  2JGU A;  5CBG A;  1Y4M A;  3CCJ V;  4YY3 B;  3H9V A;  3HB3 B;  3D36 A;  1GM8 A;  1PP9 H;  1NTZ H;  3W7S A;  5GON B;  2Z3Y A;  3JAS B;  1SA0 B;  2EIM B;  3RYH B;  1NVP B;  3E8F A;  2LFS A;  3SDL A;  1NH2 D;  4HNA A;  2UUB B;  3OUS A;  4DR6 B;  3CSX A;  4B08 A;  2P6J A;  5JQG A;  4NVP A;  1J5E B;  3H1L H;  4IT5 A;  1AR4 A;  2W0X A;  5C93 A;  3ETQ A;  1F4N A;  1Y74 B;  2YXL A;  3ABL B;  2QGN A;  4PDM A;  4LF7 O;  2QA4 V;  3L75 H;  3CCU V;  1BSM A;  2UXB B;  2UUA B;  2QKC A;  3X2Q C;  4LF6 B;  1JA8 A;  3ZBH A;  5K1P A;  4DR4 B;  3ETD A;  3ZHT A;  1IDS A;  2KB1 A;  3ABM C;  3NR7 A;  2IM9 A;  4P2Z A;  2HHH B;  1GKF A;  3ASN C;  1QLE B;  1NR1 A;  1FFX A;  1K34 A;  4LFC O;  2JVD A;  2YIA A;  2HEP A;  3SYC A;  1XMQ B;  1R3K C;  4JAU A;  3RYI B;  4I55 B;  4IIJ B;  1US6 A;  4YHH O;  5EK0 A;  4IHJ A;  2ETN A;  4FVM A;  4X8A A;  4OXS A;  2HP8 A;  4KUM A;  4TWK A;  2ADQ B;  4Z1M G;  2LJ2 A;  1W0K G;  2RCV A;  5IJ0 B;  1V54 B;  4X20 B;  1VQ7 V;  5KHJ A;  1W0J G;  5CMU A;  4U3J B;  1GTO A;  4MVM A;  2Q7E A;  4DRX B;  2UUC B;  5B1A C;  1XRE A;  1Q6H A;  2BTO A;  3BY6 A;  3UKM A;  3K5L A;  4BWA A;  4YXW G;  4HYO A;  3CHX A;  2OCC C;  3K79 A;  2XAQ A;  5FNV A;  1XHX A;  4FFK A;  3K9A A;  4X62 O;  2ODM A;  5IY5 C;  1SZT A;  5LOV B;  1HNZ O;  1TA8 A;  4AI8 A;  3APQ A;  5CBF A;  3L70 H;  4MTF A;  5L3G A;  3I5D A;  3GWK C;  4F6R B;  3AEI A;  4H44 B;  2WWW A;  2YDE A;  1N32 B;  3BHP A;  1K4D C;  4UXN A;  1DF4 A;  5EYP B;  1EZJ A;  1NJI W;  1H2M A;  1WNS A;  3UM7 A;  3FKS G;  4MW3 A;  3VOU A;  4X65 O;  3CXH F;  1I08 A;  1QQC A;  1BQ0 A;  4GYC B;  3FFQ A;  4ZIB A;  4H13 B;  4DR3 B;  3U0Z A;  3T1Y B;  1KBH A;  1YHQ V;  3SJA C;  1GN4 A;  3DGE A;  4ZOL A;  5F2V O;  1LUW A;  2JRI A;  3FAV A;  3J80 N;  3KKY A;  1JCH A;  4RQF A;  4LH7 A;  3K59 A;  3ZMV A;  4GX0 A;  1MSW D;  2FYU H;  3AG1 C;  2JIZ G;  3ABK C;  1YF2 A;  4I50 A;  2HG5 C;  4KXR A;  4FM1 A;  2Q69 A;  2IJK A;  2PGG A;  1VQO V;  1PKX A;  3P30 A;  4MVZ A;  5LMN O;  4JAS A;  1GN3 A;  2E76 B;  3IC7 A;  1O9G A;  2ZXW C;  3SPI A;  4R7C A;  2VQF O;  1KQS U;  2LO1 A;  4DR5 B;  2O57 A;  5A2Q N;  4UVB A;  2BTQ B;  4FZ1 A;  2R70 A;  4BW9 A;  5LL6 Y;  3UT5 A;  1MOF A;  4NTW A;  1DGS A;  5C8Y B;  2F95 B;  4EB6 A;  2X7R B;  5D5P A;  2F4V B;  2ZE8 A;  3OGI B;  4ICG A;  4ZHQ A;  3MD0 A;  1NH2 B;  2NN4 A;  2DW4 A;  2DYR B;  1I94 O;  3AG3 B;  3CME V;  1IBL B;  3JD1 A;  1GH6 A;  1R6T A;  3SJB C;  1SQX H;  4YJ3 B;  2YEV A;  3H1K H;  2ADP A;  1XI1 A;  1YSC A;  1FKA O;  4UB8 Z;  4RWU A;  2JEU A;  4BR6 A;  3JAR A;  2EZP A;  3ZMT A;  2P22 C;  5FL7 G;  3O9O A;  5IYC O;  4LNU A;  3QO8 A;  4JTD B;  3B2E E;  1IVS A;  3H1H H;  1SS3 A;  4DO2 A;  4WFF A;  1QLN A;  4YJ2 A;  2A0L A;  2VWK A;  1XNQ B;  3CRC A;  5CA0 A;  4X1K B;  4MTX A;  1IXM A;  4E2L A;  4G28 B;  1ZSP A;  4JI7 B;  5IWA B;  5EBM C;  4HNA B;  1SQV H;  5BXZ A;  2ILM A;  4TV8 A;  1N36 B;  2WLK A;  1DF5 A;  2BOC C;  1VF6 C;  1NKD A;  2A79 B;  3RN4 A;  3W7U A;  2E74 B;  1XBL A;  3ASO C;  2QDO A;  1YXB A;  3CRM A;  2Q9L A;  3JD4 A;  4B7K A;  1XQ8 A;  2D3O W;  4UCV A;  1VF6 A;  2GHY A;  1MMM A;  2DOS A;  3OTF A;  3QNE A;  4CH4 A;  4XDK A;  2LW1 A;  2XAH A;  2D2C B;  2OCH A;  1RP3 B;  4TUY A;  3CCE V;  2P4V A;  2WLH A;  4O4I B;  1K5Q A;  2QM4 A;  1NBM G;  2VS0 A;  1FFX B;  2HLD G;  2LP7 A;  1SQP H;  1TAE A;  3FB7 C;  4DV1 B;  2GTS A;  3ASN B;  4B3M O;  4JTA B;  2QWO B;  5B3S B;  5K1X A;  2Q73 A;  3K08 A;  5B1B B;  4LC1 A;  5LYJ A;  2KKW A;  3BPZ A;  4TT3 G;  3EHB B;  3F7V C;  2AW9 A;  2R9I A;  3E83 A;  4O4H A;  4XBF A;  4ZI7 A;  1E79 G;  1VQK V; 
#chains in the Genus database with same CATH homology
 1JVM A;  2EZO A;  3ZJZ A;  3OMN B;  4RO2 A;  3ZMZ A;  5B3S C;  2Y48 A;  2DQ0 A;  1QR9 A;  2JJ1 G;  2HR3 A;  1GK9 A;  2NNU A;  5B1B C;  2ZR2 A;  2Q68 A;  3FB8 C;  4R6Z A;  4F4L A;  3CCV V;  2CK3 G;  3LNM B;  4H37 A;  5GW7 A;  3QO5 A;  2XAJ A;  1GM9 A;  1TUE B;  4ASU G;  3T2M A;  4GX2 A;  1BL8 A;  4MW8 A;  4TSF G;  4MVQ A;  2NLJ C;  2EIJ B;  4JYB A;  3B8M A;  5H6Q A;  3CC7 V;  4H33 A;  2ITC C;  2WLJ A;  1PNK A;  1RPO A;  3W7T A;  2ITD C;  1CP9 A;  2QM7 A;  2W6I G;  2DYR C;  4JPR A;  2UXX A;  2K1E A;  1YI2 V;  2XAG A;  1YIT V;  1E1Q G;  2QKS A;  4QNH B;  2OCC B;  3E86 A;  3DTU B;  4GX5 A;  4PA4 A;  3ABU A;  3OUF A;  3KG2 A;  4G27 B;  1DTO A;  1K9M W;  1MAB G;  3E8G A;  2EIJ C;  4P30 A;  1CEZ A;  3IGA C;  2P90 A;  3AG2 B;  4PA7 A;  2FTK A;  1PNM A;  1HWY A;  4FJC C;  1Q81 W;  1NR7 A;  2DYS B;  4JGS A;  3SJQ C;  4JAV A;  5L3F A;  2DWD C;  4UVA A;  3SPH A;  2OTL V;  3R65 A;  2GSM B;  1BMF G;  3FYI B;  1COW G;  4GX1 A;  4U7N A;  1M9N A;  4N23 A;  5LGN A;  2WSS G;  2EJR A;  3AG2 C;  3E35 A;  4WF9 V;  1VQP V;  4X89 A;  3FB5 C;  3T1C A;  2DYS C;  3OEE G;  5H9C A;  5CN0 A;  1EFR G;  1YJN V;  3K04 A;  1GM7 A;  4JTC B;  3TET A;  5IYD O;  3ZMU A;  3TK1 A;  2DWE C;  2JEX A;  3P32 A;  3QO7 A;  1UJW B;  2ATK C;  4LCU C;  2WLI B;  1OCZ B;  1S72 V;  5CBG A;  1Y4M A;  2XND G;  1QR8 A;  3CCJ V;  3HB3 B;  3D36 A;  1GM8 A;  1PL0 A;  3W7S A;  1VQ4 V;  2H94 A;  3ZRX A;  2V7Q G;  3JD3 A;  2Z3Y A;  3ZRS A;  4QIW F;  2EIM B;  3SYQ A;  1OCR B;  1NVP B;  3E8F A;  2LFS A;  4RUF A;  3RVY A;  4BW5 A;  4FIP C;  1Y66 A;  1NH2 D;  3OUS A;  4FPP A;  1SET A;  3X2Q B;  2HFE C;  1H8E G;  1QBZ A;  2P6J A;  3LDC A;  1OCZ C;  3WFV A;  3JD2 A;  1YJW V;  1QVF U;  1XL4 A;  5C93 A;  1SER A;  1Q7Y W;  3ABM B;  2X6B A;  1VQ6 V;  2ZXW B;  3FB6 C;  4PA6 A;  1F4N A;  5EC1 C;  1W2B U;  3ABL B;  1OCR C;  1XL6 A;  2BOB C;  4PDM A;  3B8N A;  4JYC A;  4QE7 A;  5KUK A;  2QA4 V;  1R3J C;  3CCU V;  1JQ0 A;  2WLI A;  3CC4 V;  2QM8 A;  4ZBM A;  3LSS A;  3X2Q C;  4Q20 A;  2P67 A;  4PDV A;  4U7O A;  3G6E V;  2IJI A;  3E2E A;  2B5U A;  3ETD A;  3FYE B;  5L3E A;  1S77 D;  4J9Z B;  2KB1 A;  3OR6 C;  3ABM C;  3H01 A;  4HZ3 A;  2W6J G;  4P2Z A;  3K0G A;  1R73 A;  1GKF A;  3ASN C;  3T4D A;  1KD1 W;  1K73 W;  1QLE B;  2OTJ V;  1BHB A;  4UV8 A;  4XDL A;  1AI5 A;  1JX9 A;  1NR1 A;  1EBO A;  3F5W C;  4PDR A;  1PNL A;  2JDI G;  1K34 A;  2Q6A A;  2F43 G;  5EBL C;  2EIK C;  1AJN A;  1AJP A;  1S3J A;  4CZZ A;  3SYC A;  3OGC C;  1R3K C;  4JAU A;  1QCE A;  1QLE C;  3E8H A;  3W7W A;  1YIJ V;  3CC2 V;  5B1A B;  2JJ2 G;  3PJS K;  3OM3 B;  1SES A;  5EK0 A;  1CPY A;  3SYP A;  4X8A A;  1I5Y A;  2M7W A;  1ZWI C;  4OXS A;  4KUM A;  4TWK A;  2IU0 A;  4Z1M G;  1KC8 W;  1GO3 F;  3JCZ A;  3CD6 V;  4UUJ C;  1M56 B;  1W0K G;  1PD3 A;  1ARO P;  2P7T C;  3AG4 B;  5LHG A;  1V54 B;  1VQ7 V;  1W0J G;  5CMU A;  4MVU A;  2MK3 A;  5IY5 B;  1GTO A;  2W0F C;  4G2K A;  4X88 A;  1ORQ C;  4MVM A;  3ETE A;  1KP3 A;  5B1A C;  4KP4 A;  2IJJ A;  5L3B A;  1G8M A;  3BY6 A;  1R3I C;  1Q82 W;  3UKM A;  1JJ2 U;  1M90 W;  3K03 A;  4WFA V;  4LP8 A;  1VQM V;  4YXW G;  5LHI A;  4HYO A;  4R50 A;  5LGU A;  2V1D A;  2OCC C;  3K79 A;  2B1G A;  4BIZ A;  2XAQ A;  1WPX A;  2WPD G;  1M56 C;  1M1K W;  3AG4 C;  3OEH G;  3K9A A;  1V54 C;  3OMA B;  4FMT A;  1YTF D;  5IY5 C;  3CCQ V;  1SZT A;  3ZCC A;  5L3C A;  2X6C A;  1VQ8 V;  5CBF A;  3ZN0 A;  3K3W A;  1J95 A;  1M57 B;  1L1F A;  4BAY A;  4GCZ A;  3K0D A;  1SRY A;  4MTF A;  5L3G A;  1Q86 W;  2Z5U A;  3OFN G;  4WFE A;  3AEI A;  5IDJ A;  3CPW U;  3CCL V;  2WWW A;  1K4D C;  4UXN A;  1DF4 A;  1ROP A;  1EZJ A;  3HPL C;  3GWO A;  4WFG A;  4MS2 A;  1NQT A;  1NJI W;  3UM7 A;  1K8A W;  3FKS G;  2IH3 C;  4MW3 A;  3VOU A;  1M57 C;  2AHY A;  5EBW C;  3LUT B;  3AG1 B;  1ENV A;  1WLE A;  3ABK B;  2PI4 A;  1OCO B;  3RVZ A;  3OE7 G;  3ZRV A;  4HAM A;  1OHH G;  1YHQ V;  3STZ C;  4MTO A;  1K4C C;  3DGE A;  2HVJ C;  4PDL A;  2ZQM A;  3I55 V;  1FXK B;  4MSW C;  1P7B A;  5CBH A;  1JCH A;  4RQF A;  2JK5 C;  1FFT B;  3ZMV A;  4GX0 A;  1MSW D;  2EIM C;  2UXN A;  3ZIA G;  3AG1 C;  2JIZ G;  3ABK C;  1OCO C;  4RAI A;  4BIU A;  1S0V A;  3VBB A;  1S76 D;  2HG5 C;  2AHZ A;  2Q69 A;  4R8C A;  5LHH A;  4I9W A;  3T4Z A;  2IJK A;  4MVS A;  4QE9 A;  3GB7 C;  5L3D A;  3F7Y C;  2A9H A;  3CCM V;  1OZ0 A;  1VQO V;  3TCU A;  1K7D A;  1PKX A;  3P30 A;  4MVZ A;  4JF3 A;  1FXK C;  4MVR A;  4JAS A;  2Y69 B;  1YJ9 V;  3IC7 A;  5J9P C;  2ZXW C;  2WAM A;  1KKD A;  3SPI A;  1GMG A;  1S5H C;  3ABL C;  3E89 A;  4DXW A;  4R7C A;  1OCC B;  3MHH C;  5BZB A;  1DLB A;  2HVK C;  1KQS U;  2YSU B;  3ML0 A;  4FK5 C;  2ZD9 A;  4MT8 A;  1R6N A;  2YEV B;  1AR1 B;  5DN6 G;  5CA3 A;  4L87 A;  5IYB O;  1AI6 A;  3IFX A;  2DQ3 A;  4UVB A;  5KA5 A;  1N8R W;  2EIL B;  3LDE A;  1MOF A;  2Y69 C;  1AI4 A;  3WG7 B;  4EKW A;  2R9R B;  3LDD A;  3ETG A;  2PI5 A;  2X7R B;  1OCC C;  1VQN V;  1VQ5 V;  3CXC U;  4WFH A;  4GT1 A;  1AJQ A;  3MD0 A;  4MTG A;  5B1O A;  4WCE V;  1NH2 B;  3JYC A;  3OMI B;  2DW4 A;  2DYR B;  1F4M A;  4KFM A;  3AG3 B;  3CME V;  2LFR A;  1KEC A;  1I5X A;  2EIL C;  3JD1 A;  3CCR V;  3JD0 A;  5H6R A;  2IW5 A;  3WG7 C;  5B1N A;  2YEV A;  3ZRW B;  2XAF A;  2WLL B;  1K97 A;  1YSC A;  4QPJ A;  4MVO A;  3OW2 U;  1NVP D;  3NXS A;  2JEU A;  5LGT A;  4XDJ A;  2ZDI C;  1QVG U;  2EZP A;  1H2G A;  3AG3 C;  3M99 B;  3ZMT A;  1MG1 A;  3A0R A;  2WLN A;  2OT5 A;  5FL7 G;  3RBZ A;  5IYC O;  2X0L A;  3QO8 A;  2H8P C;  3G71 V;  4RUE A;  1V55 B;  1KP2 A;  1AI7 A;  2EBO A;  1H8H G;  3CCS V;  3I56 V;  4JTD B;  1K92 A;  1E1R G;  3MHS C;  5HFL A;  4RQE A;  2ZDI A;  5E1A C;  4DO2 A;  4WFF A;  2WLM A;  4P9O A;  1QLN A;  2EIN B;  1FS0 G;  1THZ A;  3OAA G;  3STL C;  3E8B A;  2A0L A;  4I5S A;  3ASO B;  4UV9 A;  4MTX A;  1IXM A;  4E2L A;  4G28 B;  4UVC A;  1F51 A;  3ZRW A;  1G4Y B;  2WLL A;  3CP1 A;  5EBM C;  1V55 C;  3LSQ A;  4PA9 A;  2WLK A;  2X6A A;  1RPR A;  1DF5 A;  1JOY A;  2BOC C;  1F23 A;  1RM1 B;  3SYO A;  3SPG A;  5DM6 V;  1NKD A;  1LNQ A;  1P4R A;  2A79 B;  2XAS A;  3RW0 A;  3W7U A;  2EIN C;  2IU3 A;  3ZMS A;  4WFB V;  1K3E A;  4N21 A;  5KA6 A;  3ASO C;  3ZN1 A;  1FXV A;  2IJH A;  1H38 A;  3JD4 A;  3EFF K;  2QTO A;  1BHA A;  2D3O W;  1JPX A;  4PEL A;  4QPK A;  3ABT A;  1RM1 C;  2GHY A;  3G4S V;  3CMA V;  3QNE A;  3CYO A;  4XDK A;  2XAH A;  4ZKI A;  3SYA A;  5HFM A;  3BEH A;  2QEX V;  4QJF B;  3CCE V;  1R6K A;  2WLH A;  1K5Q A;  4LBE C;  3OR7 C;  2HKO A;  3B77 A;  1NBM G;  1VQL V;  2HLD G;  3W7X A;  1YTF B;  2LP7 A;  1B6Q A;  3D3I A;  1K5S A;  2HJF C;  3SPJ A;  3FB7 C;  4PA3 A;  2QE7 G;  3ASN B;  1R3L C;  5LBQ A;  4JTA B;  2C2A A;  1FXH A;  5B3S B;  4J9Y B;  5KUM A;  2ZR3 A;  1FXK A;  3K08 A;  1K33 A;  3SPC A;  5B1B B;  4CBC A;  4LC1 A;  2XOK G;  2EIK B;  4TT3 G;  3EHB B;  3F7V C;  1VQ9 V;  2R9I A;  3E83 A;  5EC2 C;  3K06 A;  4XBF A;  2B1I A;  1E79 G;  2Q67 A;  1VQK V;  2IH1 C;  4P9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...