4LF8O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf8O00
2UXBO 3JAMN 4LF6O 2JRIA 4DUYO 1IBMO 2UUBO 4LF5O 4DV4O 3OTOO 1YZBA 1N32O 4AQYO 4X64O 2DOSA 1XMOO 4JV5O 5LMUO 4DV2O 4JI2O 1KUQA 4OPHA 2Z0AA 4LF4O 4JI6O 2E5LO 1N36O 4B3RO 4B3TO 3RT3C 4DV0O 3T1YO 4JI4O 1XNRO 1AB3A 1X59A 2UU9O 1IBLO 4LFBO 3O65A 2VQFO 4JI5O 4JI3O 2VQEO 2AGAA 4LFCO 4DV5O 5H5NA 4DR6O 1HNXO 1IBKO 4LF8O 2F4VO 4JYAO 3SDLA 2LW7A 5LMNO 1XEQA 4DR2O 4GKKO 3F5TA 4YY3O 1G1XB 4B3SO 5BXZA 3T1HO 4JI1O 4GKJO 4DUZO 4X62O 2N74A 4DV3O 4DV7O 1I94O 3J7AU 3R66A 2ZM6O 4DR1O 4DR5O 1FKAO 2HHHO 4JI7O 4DV1O 5LL6Y 5BR8O 4OX9O 4DV6O 5BY1A 4LF9O 1N34O 3J80N 1R6TA 4NXMO 1F7YA 2UUCO 1A32A 4JI8O 1HNZO 1AILA 5FLXN 1HR0O 4LF7O 4LFAO 1N33O 4KHPO 2UUAO 4B3MO 1J5EO 4YHHO 5IWAO 4K0KO 4JI0O 4X66O 5A2QN 1XMQO 2ZKOA 4DR4O 1NS1A 1FYJA 4A5UB 2FKXA 4NXNO 4DR7O 1XNQO 1HNWO 3J81N 2DJVA 1DK1A 2UXDO 2UXCO 1D2DA 1FJGO 5IT9N 4DR3O 1R1BA 4OPAA 3M8AA 4X65O
chains in the Genus database with same CATH superfamily
2GBOA 3ETGA 4U3FH 4UCUA 2UUBO 1VQPV 1AR5A 2Y4UA 3ZRXA 3LUTB 4X64O 3K0DA 1H8HG 3GVMA 3T1HB 4JI1B 3T1CA 3O9OA 1M4UA 4BIZA 5KHGA 2E5LO 2LW1A 1YCIA 2QWPB 2LO1A 3I55V 4XDKA 4TQDA 4I5SA 1AB3A 1SRYA 4CS2A 2UUCB 5J2TB 3KZIZ 4EB6A 1RPRA 4O4HB 4DW1A 1SQPH 1THZA 1W0JG 3CPWU 1NH2B 1JR9A 1IBKO 4LF8O 4L87A 3JALB 1FAFA 3SJCC 2XTAA 3HKEA 1FFTB 3MD0A 3F5TA 1OCCB 4MTOA 1LUWA 1VP7A 1AI4A 4X66B 3ZMZA 2Y69C 2WLKA 4WFGA 1K92A 2JK5C 4DR1O 1FJGB 5KHHA 3QVNA 2B5UA 3AG2B 4DV1O 5FPRA 3SJAC 3VBBA 4U3JB 4DO2A 1BMFG 3JSLA 4G28B 1BQZA 1L8DA 1RFYA 4AQYB 3CRMA 2QM8A 5H9CA 1XMOB 4UVCA 1KKDA 4JI8O 3JATA 3PN1A 3P32A 5FLXN 4FMTA 3OW2U 1NKDA 4KHPO 2KQXA 3E89A 2E76B 4JI4B 3HPLC 4JYCA 3LSQA 4NVPA 2HP8A 2OCHA 1DGSA 1LR1A 4A5UB 3CC7V 4L8JA 3E86A 3OFNG 1XNQO 1FXKC 2JJ2G 2VQFB 2VQEB 2LGWA 3ASOB 4WFFA 5IT9N 3K9SA 2X7RB 1XL6A 3CB2A 3AEIA 5A9GA 3DGEA 4FK5C 3ABLC 3CC4V 1H2SB 2H94A 1NT2B 5EYPB 3H1JH 1R3JC 5B1BC 4GKJB 3BY6A 4DUZB 5GW7A 1L1FA 4O4LB 3TJTA 4OX9B 1WP8A 2UU9O 3SR2C 1M57C 1P49A 3KCYA 3CRQA 4CS4A 1JA8A 2RMKB 4UFZA 1WNSA 1JQ0A 5EC1C 1GAXA 2BOCC 1OHHG 4J10A 2HR3A 2CTQA 1YTFB 4YHHB 3WG7C 2O57A 2GHYA 4GYCB 4DR7B 1WJZA 2HJDA 4O2AB 2W6JG 4EKWA 4DV7O 5B3SC 2QEXV 1K97A 3KCXA 3R66A 2PI5A 1XHXA 1BSMA 4JI7O 1KD1W 4MW8A 4DUYB 2XHBA 1BE3H 3H1KH 4B7KA 2ZINA 2X0LA 3OTOB 4CH3A 3TXSA 3CCVV 4D7TA 1Z5WA 2QGNA 2PI4A 1M9NA 2B9ZA 4FLXA 3UO2A 1CPYA 3HKEB 1VQ9V 1VMGA 4AI8A 3CP1A 3B77A 4B3TB 4DV0B 5IY5B 3EVKA 4K35A 2Q68A 1XMQO 2ZKOA 4MVQA 1NS1A 2WAMA 1E79G 1YDXA 2FB5A 1GM9A 3ZRSA 4R6ZA 2JEXA 2ZT9B 2YS8A 4MVSA 4PDMA 4IYHA 3K59A 1K34A 1IBMO 4H0LB 1JJOA 4Z1MG 3QTCA 4LWSA 5GONA 1BHBA 2Q67A 1SA0B 3UO3A 3OR6C 3BA8A 4FLYA 1CXZB 2LJ2A 2XAFA 3JATB 3GWKC 5IJ9B 1HP8A 4MVMA 3OEEG 1GMGA 5EZYB 3CCJV 4ZIBA 1V54B 1E1QG 4LBEC 5JVDA 4EFBA 3K3WA 2HJFC 2DWEC 3CE2A 1ZUQA 2YSUB 2YEVB 4ZI7A 4AILC 3CCLV 1BQ0A 2EIKB 1VF7A 1AP5A 3B09A 1Q82W 2W0XA 4DR2O 5B1AB 3FAVA 3RYCA 4YY3O 1NR7A 2K9PA 5EBMC 2XAJA 5EC2C 3WB2A 2AHZA 3IJ4A 2UXDB 3T2MA 3DXRA 5LL6Y 2FTKA 2Y4TA 5FPOA 1V55B 4MVZA 1A32A 1SS3A 1AJPA 2ZR3A 2WLLA 1ZL8B 1GK9A 3FB8C 2EIMB 3JARB 3ZX6A 1H2MA 4DV2B 3LDDA 1YXBA 1RSOA 3N2KA 2YI8A 1MSDA 4WFAV 1OV9A 3OE7G 2RN9A 5LYJA 1N0NA 1JVMA 4GX5A 5KUKA 2P4KA 3JAKB 3TK1A 2E75B 5JQGA 5H6RA 1PM9A 3DC6A 2EZPA 3WB1A 5LOVA 4P9OA 2WLIB 2XASA 1SETA 1WLEA 4DV5B 1K73W 4BW5A 4X65O 4FFBA 5CA0A 2PZSA 1BGYH 2DN9A 5IYBO 3ZHUA 2VRZA 1PNLA 1HNXB 5J2UA 3UQ8A 1VIBA 3U11A 3FYIB 4WFEA 4X20A 1HW7A 4ZKIA 4K8XA 3RGBA 2BSKA 1VQ8V 5K1PA 3TETA 4X62B 3H1HH 1SQGA 4DV3B 3CMEV 1S5HC 1S0VA 4I4TB 4PA7A 5IDJA 4IHJB 1B3QA 2JIZG 2LGQA 2QWNB 1PV0A 4H37A 1F4NA 1U97A 2A9HA 3ABUA 2ZE6A 1VF6A 2Q4PA 4JTAB 2AZ0A 2F93B 1HR0B 2F4VO 5GONB 3RYFB 1ZLZA 4GKKO 1S76D 2UUAB 1Y74A 5BXZA 4I55A 1R3KC 3ZN0A 2Q0AA 3SPIA 4X1IA 3WB0A 3M7MX 1PP9H 1I0HA 2Q9LA 1IXMA 3J7AU 1P7GA 1G8MA 3K03A 3ETDA 4X88A 1HWYA 1Q6HA 1F7YA 3C3TA 3N27A 1L0LH 3D36C 3GB7C 3BFRA 3BCCH 1D5NA 5L3DA 4O2BA 4PHZA 5D5QA 1JCHA 2KG7B 1OCRB 4LCUC 4DYLA 1OCZC 4NYKA 2AZ2A 5CA1B 3CCEV 2WWWA 2DJVA 3J81N 2BCCH 2ATKC 4LFCB 2XT9A 4JV5O 2UXBO 2Z3YA 3CCSV 5TISZ 2G38A 1VQNV 2WLLB 2GUZA 3U10A 4IGGA 3ZN1A 1KU9A 5LP6C 5LMUO 1XL4A 4JI6O 1OZ0A 2BE3A 2CH7A 4N23A 2VS0A 1L0NH 3K58A 1AI5A 1VQ7V 2F43G 5JQGB 4J7ZA 5L3BA 2CGNA 1QVFU 3OM3B 1GH6A 3B8MA 4DR6O 1HNZB 5J2UB 4PD4F 4LF7B 4JYAO 2Y0IA 4FFKA 4TSFG 1J5EB 3SPCA 5JCOC 2NR5A 2UXNA 3E2EA 2BSKB 2RCVA 1R3LC 4NXNB 1Y66A 2EILB 1HNWB 3CSXA 3CWBH 1EN6A 2DQ3A 2HHHO 5KX5B 1WB7A 1AJQA 4DV6O 3L9DA 1N34O 3SYAA 4NXMO 1BT8A 2H3OA 3EHBB 2PTMA 1K3EA 3D8CA 1N32B 1PKXA 1JPXA 4Q20A 3W7WA 3JCUZ 2ODMA 3AK1A 2GV9A 1OCOC 1QLNA 3D36A 1XREA 3JD1A 4HBNA 3ZS8C 1NTMH 5LXTA 1Y74B 5KMGB 1LUVA 1AI6A 1NR1A 1KKCA 2JVDA 4JI5B 2JDIG 2UXCO 2CTRA 1P7BA 2JJ1G 5JH7B 3LDCA 1VQ6V 2CUGA 3N2GB 2MW2B 4R7CA 4LH6A 4ZBMA 3W7TA 1PNMA 4PA3A 4G2KA 2LFSA 4OGQB 1E1RG 5LHGA 5C93A 5H2FZ 5KA5A 1F51A 4FPPA 4J7JA 5CBGA 1G4YB 3HKDB 1GN6A 4BIUA 4X8AA 1GO3F 2EIJB 5EBLC 3CXHF 5BR8B 3CJHA 4J41A 3ZJZA 1BCCH 4LFBO 2CDYA 1N0JA 3CD6V 1QR9A 4NR1A 3HKBA 4UCTA 2YIDA 1XUQA 3Q4HA 3EXAA 1ORQC 1H38A 1H2GA 3ZRWA 2Q6AA 2E3CA 1GKFA 1YSCA 3T1HO 5FNVB 4JI1O 4QIWF 1WB8A 3ASNC 1W2BU 5DM6V 1MABG 2IW5A 3FB5C 2ZE8A 4JTDB 1WP7A 3X2QC 1K7DA 4X9QA 4DR3B 2NLJC 1NTKH 2ITDC 4HYOA 4DV4B 1QLEB 3VQVA 1NVPD 2UUCO 2BTQA 1M1KW 2RQ6A 1FFXA 1V55C 3AG4B 4FVMA 3CCMV 2JGDB 1UFIA 5EIBC 3W7UA 4F6RA 2RJZA 1N4CA 2IJJA 4CS3A 1GN4A 3CCQV 4X66O 5CB4A 2DMXA 1YEWA 1NJIW 1PPJH 4WF9V 5LBQA 4O4IA 1FJGO 3M8AA 1FPOA 3OD4A 4RUFA 3RVZA 1I08A 3HB3B 2ZIMA 4DK1A 3OT7A 3K08A 4AQYO 1P4RA 1SQFA 2DOSA 4CZZA 1XMOO 3ABKB 3LSSA 1Y76A 3D3IA 4GZRB 2BTOA 4C7UA 4WBNB 4F4LA 3ZCCA 5BZBA 3RT3C 1MNGA 5IYZB 2DYRC 2ZM6B 2QKAA 3TCUA 4WFBV 1WA8A 4JI4O 4JAVA 4TV9A 4NB5A 1S3JA 4TUYA 4FLUA 4ZHQB 3RVYA 3ZHSA 2ZXWC 2VQFO 1VEWA 2VQEO 2DE0X 2R9AA 3JD0A 1P84F 5H5NA 2IJKA 2LQTA 4TV8A 1ZSPA 1EZVH 5CN0A 4FM2A 3H9VA 2OCCB 1TUBA 1PD3A 3K57A 4B3MB 1U96A 4O4JB 1RM1C 4K0KB 2PYJA 4UCSA 4H44B 4JI0B 4JYBA 4HAMA 4E2LA 4GKJO 1B04A 4DUZO 3RBZA 2N74A 2M6YA 1Q6UA 4R8CA 4KUMA 1N33B 3CJHB 4OX9O 2YI9A 1NI8A 4LF5B 1NU1H 1PL0A 5L3FA 4QJFB 3W7XA 1XDCA 4IIJA 3SYPA 3HKBB 2F1MA 3JD4A 2Q5ZA 3FKSG 5EIBD 4YJ3A 1I7FA 1MA1A 2WA3A 1Q7YW 1SZTA 4I50A 4YHHO 4PDLA 3CMAV 2YIBD 1AR1B 3VQWA 1IBLB 3JAWA 4DR7O 4EB6B 2YIBA 1DK1A 1OCRC 2EINC 2HVJC 3RFRA 4W4LA 4DUYO 3H1LH 1RPOA 5LMNB 3OTOO 2DYSB 1EBOA 1FFXB 2E74B 3FFQA 5HFLA 3P30A 5IYDO 4F6RB 2A79B 4FJCC 1YJWV 3MDSA 4YJ2A 4B3TO 4DV0O 3OMIB 2QM4A 1NZ6A 3CEIA 1FXKA 3ZMUA 3DSQA 1VQKV 3BAAA 1SQVH 5IJ0A 3E83A 4MTGA 4QPKA 3QO8A 1DLBA 1QU7A 4FLTA 2ZNIA 2PGGA 3K9AA 5F2VO 3C3SA 1EN5A 3CRRA 2XNDG 2OTLV 1SERA 1QCEA 2YUAA 1DF4A 1Q43A 1VQ5V 1SC5B 2IU0A 1WA8B 3E8GA 1WPXA 2P67A 4UCRA 4J7KA 1CEZA 3B4SA 4MVOA 2M7WA 4TQFA 4BWAA 2Q0OC 1VQOV 3RYIA 3OTFA 3MHSC 1JOYA 4RWUA 5BMVA 3ZIAG 2Q73A 5LA6A 1TUBB 4MTXA 4NTXA 1N36B 1GM7A 2WPDG 3T1YB 2QDOA 1WN7A 2R9RB 3HKCA 3AG1C 2PY5A 2UXDO 2HLDG 3IAYA 1YF2A 5H6QA 1H2LA 4BIOA 3WFVA 4LNUA 4X1YA 2ZDIC 4RQFA 5GTHZ 1K4CC 1IDSA 3RWRD 2GTAA 2A3QA 3CHXA 4MW3A 3CCUV 1Q3EA 1O9HA 4DV2O 4CH4A 3OMNB 4UXNA 3RW0A 3AK2A 3UKMA 2ZR2A 3AG3C 1FXVA 3G6BA 1Q6IA 2A7WA 4CBCA 3ZHQA 3JAWB 4LR3A 3K0GA 1S5LZ 2F23A 4GUNA 1AVMA 3TGUH 3JASA 3L71H 4X1KA 4DV5O 3CXCU 4PA4A 2F95B 3ZRVA 1HNXO 3SDLA 1YI2V 2LW7A 1XEQA 4LFAB 4PI0A 1EN4A 4ZOLA 4F6EA 4K3AA 1SZXA 5IWAB 4JAAA 1K33A 2EZOA 3JYCA 2N05A 4X62O 1FXHA 4DV3O 1BHAA 4FLZA 3SJQC 4MVRA 2Q7HA 2L6LA 4LF6B 5LHHA 3OAAG 3E8FA 2FMLA 2OWOA 4LWSB 5KUMA 1LNQA 3H01A 1CP9A 3FB6C 2WLHA 1VQLV 3ABLB 5KAFZ 4WCEV 4GX2A 3SPGA 1HR0O 2VWJA 2B1IA 2R9IA 1OCCC 4X89A 5B1BB 4B3RB 2ZE5A 3RYHA 4FIPC 2UUAO 4N21A 1XNRB 1PL4A 5JVDB 3CS5A 3I56V 5A2QN 1W0KG 4TT3G 1COWG 4ICGA 4CH6A 1Z2GA 2OIEA 2QR4A 2XOKG 1M57B 3AG2C 2X6CA 4Z2WA 2X6BA 4GLXA 1I5YA 4ZI7B 2AW9A 4JASA 1YIJV 1JJ2U 1XOUA 1S5JA 2Q7GA 4I0XA 5IYCO 3FAVB 3RYCB 2ZDIA 5LA6B 3CCRV 3WG7B 4LH7A 3G6EV 3NXSA 3ABKC 1M56B 1WAZA 2B1GA 2EJRA 3IC9A 1I94B 5DECA 4GT1A 2ITCC 4DXWA 3DXRB 1URFA 5B3SB 3AG7A 4Q6GA 4NTYA 3L75H 4RQEA 3ASOC 3O65A 2H8PC 4UV9A 4LFCO 3FX7A 2GTSA 4X1YB 1RSOB 3N2KB 1SKVA 5CMUA 1O9GA 2YXLA 5LYJB 1SQQH 3K5NA 4PELA 1F23A 2ZQMA 3PJSK 5LOVB 3BPZA 4FFBB 3ZHTA 5CA0B 1Y4MA 3MAQA 1AJNA 4MSWC 3JASB 5J2TA 1NH2D 2P7TC 1VQMV 4X20B 2RNBA 1M93A 1UJWB 1GTOA 2NNUA 1HNZO 4J11A 4JI2B 4LF4B 4PDRA 4LF7O 3JALA 3JD3A 4ZOLB 2DQ0A 4E4EA 3W7SA 1XI1A 1KP3A 1J5EO 4B7EA 1NTZH 1US6A 1BZKA 5KHJA 3OUSA 2FKXA 4NXNO 2AHYA 3T4ZA 1HNWO 4JI3B 3WU2Z 4UUJC 1GM8A 4UB6Z 3BA9A 1R1BA 1ZAUA 2WSSG 2XAGA 1YJ9V 2MK3A 4JGSA 3K04A 1N32O 2D2CB 2Q8VA 3P3NA 1Z5VA 4B3SB 4I55B 4P2ZA 4X1IB 3B8NA 5IY5C 3CC2V 4DR5B 4RO2A 1YJNV 3S3XA 2P6JA 4LF9B 2YXYA 1N8RW 4BR6A 4CC5A 3UM7A 3UT5A 1IVSA 4JI5O 2X6AA 4HZ3A 1H2NA 1SQXH 1KB9F 3BEHA 2V1DA 1S72V 4IL6Z 3JD2A 2IM9A 3OUFA 2P22C 5LP6A 4XDLA 2IH3C 1ROPA 4O2BB 1QNMA 2L35A 1XHZA 1VQ4V 2CE4A 1MSWD 3APQA 1X4TA 4DR4B 1QBZA 4FLVA 2EULA 3RN4A 1V54C 2FYUH 3QG5A 1EZJA 2A06H 4JPRA 3ZMVA 4AHCA 3ZMTA 4BW9A 4O4LA 5BR8O 1RP3B 4J80A 3A0RA 2WLJA 2UUBB 2ZE7A 3EFFK 2W6IG 1ZX3A 4UCOA 2GUZB 1IURA 2EIKC 1K5SA 4JYYA 1EFRG 4X64B 3E22A 1MOFA 1YTFD 5B1AC 1K8AW 1TUEB 1H8EG 2E5LB 5JCOA 2CH7B 4QE7A 2Z5UA 3SPHA 2OT5A 3U0ZA 4O2AA 3C90A 1MMMA 3ETQA 2LP7A 4DR3O 3CRCA 4WFHA 3L72H 1ZTEA 1IBKB 4LF8B 2EX3A 4DV4O 4UV8A 2P5OA 2OYQA 2EIMC 2R70A 2W0FC 3B40A 4MT8A 4OPHA 5LHIA 2V4DA 1WPBA 2NN4A 3GWOA 4DR1B 4DK0A 4JZ2A 4DV1B 4NTWA 4J9YB 4I9WA 2QKCA 4TOIA 3K06A 1NQTA 5LGUA 4XDJA 5CA3A 2ZIOA 2DWDC 4NKGB 5ITZA 4JI8B 4KHPB 1GRJA 5LXTB 1SA0A 1VF5B 3OGCC 5IJ9A 3K5MA 1OCZB 1MZEA 3ABMB 1XNQB 5EZYA 2ZM6O 3BRCA 5KA6A 1J95A 4Z1VA 2WLNA 3APOA 4W4KA 1S77D 1R6TA 3UT5B 3SPJA 1Q86W 4U7NA 2LFRA 2R72A 3TXQA 1T5EA 5L3CA 2YEVA 1JMKC 5KAIZ 2D3OW 5KHKA 4I7ZB 5LP6B 2Y48A 4R50A 3LDEA 4PA9A 1SESA 1SQBH 2GSMB 4J9ZB 4B3MO 2JGUA 1Q81W 4LC1A 2ZD9A 4K0KO 1KC8W 2QE7G 4JI0O 3BVOA 4GX0A 2UU9B 1Y67A 1GN3A 1R6NA 1Q5OA 1KQSU 1D2DA 1N33O 2C2AA 3Q4HB 1V9PA 2JRIA 2Y0PA 4LF5O 3F7VC 3ZRWB 4I9QA 2GDSA 1ZL8A 3E22B 4HNAA 3A0BZ 3JARA 4KFMA 1Q8IA 1VARA 2BOBC 1BL8A 1AP6A 4DV7B 4UVBA 3KG2A 4JI7B 2QJ1A 1M56C 3JAKA 4FM0A 1IBLO 5E79Z 4UB8Z 2CAZC 2BTQB 4H13B 5D5PA 2AGAA 2K1EA 3BHPA 2P06A 4GCZA 2WLIA 1NVPB 5LGTA 1K4DC 4FLWA 2VWKA 3K79A 5LMNO 4YIPA 3STZC 2CGOA 1OCOB 2F66C 2AXTZ 1TAEA 5LGNA 3CYOA 3I5DA 1XMQB 5CB4B 5KLVH 4O4IB 3FD9A 2XAHA 4I4TA 4IHJA 1IXBA 1IBMB 1KBHA 5BY1A 1GN2A 1QR8A 3SJBC 1EM1A 4J42A 2CK3G 4ASUG 1G6UA 3SYCA 5ITZB 1Y76B 3M99B 1R73A 2EBOA 3ZEDA 1R3IC 4U7OA 2ZNJA 3OEHG 5FL7G 3RYFA 4DW0A 2HG5C 3IC7A 5HFMA 3L73H 3HR0A 2ADPA 3CRAA 1D5AA 5B1NA 2QWRB 4TV9B 2EILC 4TUYB 2YDEA 1JFFA 2Q7EA 3G67A 1K9MW 3S3WA 4QE9A 3F7YC 4OPAA 3JAMN 2QWQB 4TV8B 5JJJB 1MZFA 4D6TH 4DR2B 3OMAB 1KMIZ 1VF6C 4UVAA 4YY3B 3ABTA 4DRXA 4EFEA 3BABA 1AI7A 2Q69A 5J9PC 1W59A 1ZWIC 1N36O 3ASNB 1Q90D 2ARHA 1TVKA 3T1YO 4KXRA 3VQYA 3X2QB 2KG7A 1X59A 1BS3A 1FS0G 1QQCA 4YXWG 5CA1A 4CC6A 5K1XA 4IIJB 3ZHRA 1NBMG 4P30A 3K5OA 1F4MA 1TGOA 1B06A 4YJ3B 2JS3A 3LNMB 2A0LA 4RUEA 3D3QA 1K5QA 4I50B 3THOA 1M90W 2Y69B 4HNAB 3LNNA 2JEUA 4IT5A 1G1XB 3E8BA 1IZ3A 2P90A 3K5LA 4RAIA 5CBFA 3CX5F 2EIJC 5GTIZ 2OTJV 2HEPA 1HDJA 2ILMA 4X65B 4K8ZA 3VOUA 1YHQV 4LP8A 2WA4A 2PUSA 1AILA 3SYOA 2HFEC 2UXXA 4LFAO 4YJ2B 3FYEB 5L3EA 4OXSA 1H2KA 5IWAO 4PDVA 1FXKB 3A2FA 3VQXA 2DYRB 4B08A 2PYLA 1ENVA 5IJ0B 3SGIA 5KX5A 2ZXWB 2QM7A 5KHIA 1B6QA 1QLEC 4LF6O 4PI2A 2QTSA 4QGPA 2F4VB 1I5XA 5EK0A 1TA8A 3AG4C 1YZBA 4GKKB 2HVKC 1KYOF 1SF9A 2WLMA 1QHTA 3KKYA 1KUQA 1OJHA 1XILA 2Z0AA 1RM1B 4TWKA 2N04A 2EJ7A 5DEDA 3MHHC 5DN6G 4B3RO 3LSUA 3QNEA 2KB1A 3L70H 1XNRO 3STLC 5KMGA 4JAUA 1JFFB 4KP4A 4BAYA 3ICXA 2QTOA 4XBFA 3RYIB 4EEQA 5BMVB 5JH7A 4MTFA 4D7SA 3N2GA 4UCVA 1Y6XA 5JWPA 4DRXB 2V7QG 4YIOA 4FZ0A 3H1IH 4CH5A 2IJHA 1R6KA 3E35A 3JCZA 5EBWC 3HKCB 4IYIA 3HKDA 4JF3A 1TVKB 1I94O 3G71V 3DTUB 5C8YA 4JV5B 2UXBB 2EINB 3ABMC 2JS5A 3AK3A 2DW4A 4LNUB 3J80N 3F5WC 5L3GA 1YVWA 3QF7A 2XUMA 2OCCC 5LMUB 1IX9A 3UCSC 3G80A 1PNKA 2RDCA 4JI6B 4G27B 2CTPA 3ETEA 3L74H 1KP2A 3T4DA 5CBHA 2HKOA 5FNVA 1MG1A 3ZHVA 3E8HA 1XBLA 4O4HA 2IJIA 4X1KB 5B66Z 3P3PA 4DR6B 3JSNA 1UPGA 4JYAB 1XQ8A 1FD9A 3QO5A 4KL1A 2YICA 4JTCB 3ZBHA 5AG2A 2IU3A 4JI2O 2ZCEA 4LF4O 2JGDA 4MVUA 3SYQA 3IFXA 2KKWA 2HHHB 4MS2A 2FL4A 4DV6B 1N34B 4NXMB 5JJEB 4U3JA 4H33A 4JI3O 2P4VA 4ABMA 1QVGU 1KECA 4FZ1A 3OR7C 2DYSC 4GX1A 2YIAA 2KSDA 1JX9A 3RYHB 2ADQB 1DF5A 4B3SO 2PF4E 2YXHA 4PV1B 5JJNB 1AR4A 3IGAC 4WBNA 3FB7C 5B1OA 1M5IA 1AROP 5IYZA 2UXCB 4DR5O 1FKAO 1YITV 4PJ0Z 2OIGA 4JZGA 3AG1B 3G4SV 4LF9O 4ZHQA 3R65A 4P9PA 2CTWA 4QNHB 3A8TA 4I0XB 2QA4V 3B2EE 2QSAA 3ZMSA 3ML0A 4QPJA 2XAQA 5EYPA 2QWOB 5IE9A 4FM1A 2IBZH 5E1AC 4O4JA 2ETNA 3AG3B 3A0HZ 4DR4O 1FYJA 2QKSA 3OGIB 2IH1C 4LFBB 2YC0A 3DC5A 3NR7A 4PA6A 1DTOA 5B5EZ 5C8YB 3QO7A
chains in the Genus database with same CATH topology
2UXBO 3JAMN 4LF6O 2JRIA 4DUYO 1IBMO 2UUBO 4LF5O 4DV4O 3OTOO 1YZBA 1N32O 4AQYO 4X64O 2DOSA 1XMOO 4JV5O 5LMUO 4DV2O 4JI2O 1KUQA 4OPHA 2Z0AA 4LF4O 4JI6O 2E5LO 1N36O 4B3RO 4B3TO 3RT3C 4DV0O 3T1YO 4JI4O 1XNRO 1AB3A 1X59A 2UU9O 1IBLO 4LFBO 3O65A 2VQFO 4JI5O 4JI3O 2VQEO 2AGAA 4LFCO 4DV5O 5H5NA 4DR6O 1HNXO 1IBKO 4LF8O 2F4VO 4JYAO 3SDLA 2LW7A 5LMNO 1XEQA 4DR2O 4GKKO 3F5TA 4YY3O 1G1XB 4B3SO 5BXZA 3T1HO 4JI1O 4GKJO 4DUZO 4X62O 2N74A 4DV3O 4DV7O 1I94O 3J7AU 3R66A 2ZM6O 4DR1O 4DR5O 1FKAO 2HHHO 4JI7O 4DV1O 5LL6Y 5BR8O 4OX9O 4DV6O 5BY1A 4LF9O 1N34O 3J80N 1R6TA 4NXMO 1F7YA 2UUCO 1A32A 4JI8O 1HNZO 1AILA 5FLXN 1HR0O 4LF7O 4LFAO 1N33O 4KHPO 2UUAO 4B3MO 1J5EO 4YHHO 5IWAO 4K0KO 4JI0O 4X66O 5A2QN 1XMQO 2ZKOA 4DR4O 1NS1A 1FYJA 4A5UB 2FKXA 4NXNO 4DR7O 1XNQO 1HNWO 3J81N 2DJVA 1DK1A 2UXDO 2UXCO 1D2DA 1FJGO 5IT9N 4DR3O 1R1BA 4OPAA 3M8AA 4X65O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB O;  3JAM N;  4LF6 O;  2JRI A;  4DUY O;  1IBM O;  2UUB O;  4LF5 O;  4DV4 O;  3OTO O;  1YZB A;  1N32 O;  4AQY O;  4X64 O;  2DOS A;  1XMO O;  4JV5 O;  5LMU O;  4DV2 O;  4JI2 O;  1KUQ A;  4OPH A;  2Z0A A;  4LF4 O;  4JI6 O;  2E5L O;  1N36 O;  4B3R O;  4B3T O;  3RT3 C;  4DV0 O;  3T1Y O;  4JI4 O;  1XNR O;  1AB3 A;  1X59 A;  2UU9 O;  1IBL O;  4LFB O;  3O65 A;  2VQF O;  4JI5 O;  4JI3 O;  2VQE O;  2AGA A;  4LFC O;  4DV5 O;  5H5N A;  4DR6 O;  1HNX O;  1IBK O;  4LF8 O;  2F4V O;  4JYA O;  3SDL A;  2LW7 A;  5LMN O;  1XEQ A;  4DR2 O;  4GKK O;  3F5T A;  4YY3 O;  1G1X B;  4B3S O;  5BXZ A;  3T1H O;  4JI1 O;  4GKJ O;  4DUZ O;  4X62 O;  2N74 A;  4DV3 O;  4DV7 O;  1I94 O;  3J7A U;  3R66 A;  2ZM6 O;  4DR1 O;  4DR5 O;  1FKA O;  2HHH O;  4JI7 O;  4DV1 O;  5LL6 Y;  5BR8 O;  4OX9 O;  4DV6 O;  5BY1 A;  4LF9 O;  1N34 O;  3J80 N;  1R6T A;  4NXM O;  1F7Y A;  2UUC O;  1A32 A;  4JI8 O;  1HNZ O;  1AIL A;  5FLX N;  1HR0 O;  4LF7 O;  4LFA O;  1N33 O;  4KHP O;  2UUA O;  4B3M O;  1J5E O;  4YHH O;  5IWA O;  4K0K O;  4JI0 O;  4X66 O;  5A2Q N;  1XMQ O;  2ZKO A;  4DR4 O;  1NS1 A;  1FYJ A;  4A5U B;  2FKX A;  4NXN O;  4DR7 O;  1XNQ O;  1HNW O;  3J81 N;  2DJV A;  1DK1 A;  2UXD O;  2UXC O;  1D2D A;  1FJG O;  5IT9 N;  4DR3 O;  1R1B A;  4OPA A;  3M8A A;  4X65 O; 
#chains in the Genus database with same CATH topology
 2GBO A;  3ETG A;  4U3F H;  4UCU A;  2UUB O;  1VQP V;  1AR5 A;  2Y4U A;  3ZRX A;  3LUT B;  4X64 O;  3K0D A;  1H8H G;  3GVM A;  3T1H B;  4JI1 B;  3T1C A;  3O9O A;  1M4U A;  4BIZ A;  5KHG A;  2E5L O;  2LW1 A;  1YCI A;  2QWP B;  2LO1 A;  3I55 V;  4XDK A;  4TQD A;  4I5S A;  1AB3 A;  1SRY A;  4CS2 A;  2UUC B;  5J2T B;  3KZI Z;  4EB6 A;  1RPR A;  4O4H B;  4DW1 A;  1SQP H;  1THZ A;  1W0J G;  3CPW U;  1NH2 B;  1JR9 A;  1IBK O;  4LF8 O;  4L87 A;  3JAL B;  1FAF A;  3SJC C;  2XTA A;  3HKE A;  1FFT B;  3MD0 A;  3F5T A;  1OCC B;  4MTO A;  1LUW A;  1VP7 A;  1AI4 A;  4X66 B;  3ZMZ A;  2Y69 C;  2WLK A;  4WFG A;  1K92 A;  2JK5 C;  4DR1 O;  1FJG B;  5KHH A;  3QVN A;  2B5U A;  3AG2 B;  4DV1 O;  5FPR A;  3SJA C;  3VBB A;  4U3J B;  4DO2 A;  1BMF G;  3JSL A;  4G28 B;  1BQZ A;  1L8D A;  1RFY A;  4AQY B;  3CRM A;  2QM8 A;  5H9C A;  1XMO B;  4UVC A;  1KKD A;  4JI8 O;  3JAT A;  3PN1 A;  3P32 A;  5FLX N;  4FMT A;  3OW2 U;  1NKD A;  4KHP O;  2KQX A;  3E89 A;  2E76 B;  4JI4 B;  3HPL C;  4JYC A;  3LSQ A;  4NVP A;  2HP8 A;  2OCH A;  1DGS A;  1LR1 A;  4A5U B;  3CC7 V;  4L8J A;  3E86 A;  3OFN G;  1XNQ O;  1FXK C;  2JJ2 G;  2VQF B;  2VQE B;  2LGW A;  3ASO B;  4WFF A;  5IT9 N;  3K9S A;  2X7R B;  1XL6 A;  3CB2 A;  3AEI A;  5A9G A;  3DGE A;  4FK5 C;  3ABL C;  3CC4 V;  1H2S B;  2H94 A;  1NT2 B;  5EYP B;  3H1J H;  1R3J C;  5B1B C;  4GKJ B;  3BY6 A;  4DUZ B;  5GW7 A;  1L1F A;  4O4L B;  3TJT A;  4OX9 B;  1WP8 A;  2UU9 O;  3SR2 C;  1M57 C;  1P49 A;  3KCY A;  3CRQ A;  4CS4 A;  1JA8 A;  2RMK B;  4UFZ A;  1WNS A;  1JQ0 A;  5EC1 C;  1GAX A;  2BOC C;  1OHH G;  4J10 A;  2HR3 A;  2CTQ A;  1YTF B;  4YHH B;  3WG7 C;  2O57 A;  2GHY A;  4GYC B;  4DR7 B;  1WJZ A;  2HJD A;  4O2A B;  2W6J G;  4EKW A;  4DV7 O;  5B3S C;  2QEX V;  1K97 A;  3KCX A;  3R66 A;  2PI5 A;  1XHX A;  1BSM A;  4JI7 O;  1KD1 W;  4MW8 A;  4DUY B;  2XHB A;  1BE3 H;  3H1K H;  4B7K A;  2ZIN A;  2X0L A;  3OTO B;  4CH3 A;  3TXS A;  3CCV V;  4D7T A;  1Z5W A;  2QGN A;  2PI4 A;  1M9N A;  2B9Z A;  4FLX A;  3UO2 A;  1CPY A;  3HKE B;  1VQ9 V;  1VMG A;  4AI8 A;  3CP1 A;  3B77 A;  4B3T B;  4DV0 B;  5IY5 B;  3EVK A;  4K35 A;  2Q68 A;  1XMQ O;  2ZKO A;  4MVQ A;  1NS1 A;  2WAM A;  1E79 G;  1YDX A;  2FB5 A;  1GM9 A;  3ZRS A;  4R6Z A;  2JEX A;  2ZT9 B;  2YS8 A;  4MVS A;  4PDM A;  4IYH A;  3K59 A;  1K34 A;  1IBM O;  4H0L B;  1JJO A;  4Z1M G;  3QTC A;  4LWS A;  5GON A;  1BHB A;  2Q67 A;  1SA0 B;  3UO3 A;  3OR6 C;  3BA8 A;  4FLY A;  1CXZ B;  2LJ2 A;  2XAF A;  3JAT B;  3GWK C;  5IJ9 B;  1HP8 A;  4MVM A;  3OEE G;  1GMG A;  5EZY B;  3CCJ V;  4ZIB A;  1V54 B;  1E1Q G;  4LBE C;  5JVD A;  4EFB A;  3K3W A;  2HJF C;  2DWE C;  3CE2 A;  1ZUQ A;  2YSU B;  2YEV B;  4ZI7 A;  4AIL C;  3CCL V;  1BQ0 A;  2EIK B;  1VF7 A;  1AP5 A;  3B09 A;  1Q82 W;  2W0X A;  4DR2 O;  5B1A B;  3FAV A;  3RYC A;  4YY3 O;  1NR7 A;  2K9P A;  5EBM C;  2XAJ A;  5EC2 C;  3WB2 A;  2AHZ A;  3IJ4 A;  2UXD B;  3T2M A;  3DXR A;  5LL6 Y;  2FTK A;  2Y4T A;  5FPO A;  1V55 B;  4MVZ A;  1A32 A;  1SS3 A;  1AJP A;  2ZR3 A;  2WLL A;  1ZL8 B;  1GK9 A;  3FB8 C;  2EIM B;  3JAR B;  3ZX6 A;  1H2M A;  4DV2 B;  3LDD A;  1YXB A;  1RSO A;  3N2K A;  2YI8 A;  1MSD A;  4WFA V;  1OV9 A;  3OE7 G;  2RN9 A;  5LYJ A;  1N0N A;  1JVM A;  4GX5 A;  5KUK A;  2P4K A;  3JAK B;  3TK1 A;  2E75 B;  5JQG A;  5H6R A;  1PM9 A;  3DC6 A;  2EZP A;  3WB1 A;  5LOV A;  4P9O A;  2WLI B;  2XAS A;  1SET A;  1WLE A;  4DV5 B;  1K73 W;  4BW5 A;  4X65 O;  4FFB A;  5CA0 A;  2PZS A;  1BGY H;  2DN9 A;  5IYB O;  3ZHU A;  2VRZ A;  1PNL A;  1HNX B;  5J2U A;  3UQ8 A;  1VIB A;  3U11 A;  3FYI B;  4WFE A;  4X20 A;  1HW7 A;  4ZKI A;  4K8X A;  3RGB A;  2BSK A;  1VQ8 V;  5K1P A;  3TET A;  4X62 B;  3H1H H;  1SQG A;  4DV3 B;  3CME V;  1S5H C;  1S0V A;  4I4T B;  4PA7 A;  5IDJ A;  4IHJ B;  1B3Q A;  2JIZ G;  2LGQ A;  2QWN B;  1PV0 A;  4H37 A;  1F4N A;  1U97 A;  2A9H A;  3ABU A;  2ZE6 A;  1VF6 A;  2Q4P A;  4JTA B;  2AZ0 A;  2F93 B;  1HR0 B;  2F4V O;  5GON B;  3RYF B;  1ZLZ A;  4GKK O;  1S76 D;  2UUA B;  1Y74 A;  5BXZ A;  4I55 A;  1R3K C;  3ZN0 A;  2Q0A A;  3SPI A;  4X1I A;  3WB0 A;  3M7M X;  1PP9 H;  1I0H A;  2Q9L A;  1IXM A;  3J7A U;  1P7G A;  1G8M A;  3K03 A;  3ETD A;  4X88 A;  1HWY A;  1Q6H A;  1F7Y A;  3C3T A;  3N27 A;  1L0L H;  3D36 C;  3GB7 C;  3BFR A;  3BCC H;  1D5N A;  5L3D A;  4O2B A;  4PHZ A;  5D5Q A;  1JCH A;  2KG7 B;  1OCR B;  4LCU C;  4DYL A;  1OCZ C;  4NYK A;  2AZ2 A;  5CA1 B;  3CCE V;  2WWW A;  2DJV A;  3J81 N;  2BCC H;  2ATK C;  4LFC B;  2XT9 A;  4JV5 O;  2UXB O;  2Z3Y A;  3CCS V;  5TIS Z;  2G38 A;  1VQN V;  2WLL B;  2GUZ A;  3U10 A;  4IGG A;  3ZN1 A;  1KU9 A;  5LP6 C;  5LMU O;  1XL4 A;  4JI6 O;  1OZ0 A;  2BE3 A;  2CH7 A;  4N23 A;  2VS0 A;  1L0N H;  3K58 A;  1AI5 A;  1VQ7 V;  2F43 G;  5JQG B;  4J7Z A;  5L3B A;  2CGN A;  1QVF U;  3OM3 B;  1GH6 A;  3B8M A;  4DR6 O;  1HNZ B;  5J2U B;  4PD4 F;  4LF7 B;  4JYA O;  2Y0I A;  4FFK A;  4TSF G;  1J5E B;  3SPC A;  5JCO C;  2NR5 A;  2UXN A;  3E2E A;  2BSK B;  2RCV A;  1R3L C;  4NXN B;  1Y66 A;  2EIL B;  1HNW B;  3CSX A;  3CWB H;  1EN6 A;  2DQ3 A;  2HHH O;  5KX5 B;  1WB7 A;  1AJQ A;  4DV6 O;  3L9D A;  1N34 O;  3SYA A;  4NXM O;  1BT8 A;  2H3O A;  3EHB B;  2PTM A;  1K3E A;  3D8C A;  1N32 B;  1PKX A;  1JPX A;  4Q20 A;  3W7W A;  3JCU Z;  2ODM A;  3AK1 A;  2GV9 A;  1OCO C;  1QLN A;  3D36 A;  1XRE A;  3JD1 A;  4HBN A;  3ZS8 C;  1NTM H;  5LXT A;  1Y74 B;  5KMG B;  1LUV A;  1AI6 A;  1NR1 A;  1KKC A;  2JVD A;  4JI5 B;  2JDI G;  2UXC O;  2CTR A;  1P7B A;  2JJ1 G;  5JH7 B;  3LDC A;  1VQ6 V;  2CUG A;  3N2G B;  2MW2 B;  4R7C A;  4LH6 A;  4ZBM A;  3W7T A;  1PNM A;  4PA3 A;  4G2K A;  2LFS A;  4OGQ B;  1E1R G;  5LHG A;  5C93 A;  5H2F Z;  5KA5 A;  1F51 A;  4FPP A;  4J7J A;  5CBG A;  1G4Y B;  3HKD B;  1GN6 A;  4BIU A;  4X8A A;  1GO3 F;  2EIJ B;  5EBL C;  3CXH F;  5BR8 B;  3CJH A;  4J41 A;  3ZJZ A;  1BCC H;  4LFB O;  2CDY A;  1N0J A;  3CD6 V;  1QR9 A;  4NR1 A;  3HKB A;  4UCT A;  2YID A;  1XUQ A;  3Q4H A;  3EXA A;  1ORQ C;  1H38 A;  1H2G A;  3ZRW A;  2Q6A A;  2E3C A;  1GKF A;  1YSC A;  3T1H O;  5FNV B;  4JI1 O;  4QIW F;  1WB8 A;  3ASN C;  1W2B U;  5DM6 V;  1MAB G;  2IW5 A;  3FB5 C;  2ZE8 A;  4JTD B;  1WP7 A;  3X2Q C;  1K7D A;  4X9Q A;  4DR3 B;  2NLJ C;  1NTK H;  2ITD C;  4HYO A;  4DV4 B;  1QLE B;  3VQV A;  1NVP D;  2UUC O;  2BTQ A;  1M1K W;  2RQ6 A;  1FFX A;  1V55 C;  3AG4 B;  4FVM A;  3CCM V;  2JGD B;  1UFI A;  5EIB C;  3W7U A;  4F6R A;  2RJZ A;  1N4C A;  2IJJ A;  4CS3 A;  1GN4 A;  3CCQ V;  4X66 O;  5CB4 A;  2DMX A;  1YEW A;  1NJI W;  1PPJ H;  4WF9 V;  5LBQ A;  4O4I A;  1FJG O;  3M8A A;  1FPO A;  3OD4 A;  4RUF A;  3RVZ A;  1I08 A;  3HB3 B;  2ZIM A;  4DK1 A;  3OT7 A;  3K08 A;  4AQY O;  1P4R A;  1SQF A;  2DOS A;  4CZZ A;  1XMO O;  3ABK B;  3LSS A;  1Y76 A;  3D3I A;  4GZR B;  2BTO A;  4C7U A;  4WBN B;  4F4L A;  3ZCC A;  5BZB A;  3RT3 C;  1MNG A;  5IYZ B;  2DYR C;  2ZM6 B;  2QKA A;  3TCU A;  4WFB V;  1WA8 A;  4JI4 O;  4JAV A;  4TV9 A;  4NB5 A;  1S3J A;  4TUY A;  4FLU A;  4ZHQ B;  3RVY A;  3ZHS A;  2ZXW C;  2VQF O;  1VEW A;  2VQE O;  2DE0 X;  2R9A A;  3JD0 A;  1P84 F;  5H5N A;  2IJK A;  2LQT A;  4TV8 A;  1ZSP A;  1EZV H;  5CN0 A;  4FM2 A;  3H9V A;  2OCC B;  1TUB A;  1PD3 A;  3K57 A;  4B3M B;  1U96 A;  4O4J B;  1RM1 C;  4K0K B;  2PYJ A;  4UCS A;  4H44 B;  4JI0 B;  4JYB A;  4HAM A;  4E2L A;  4GKJ O;  1B04 A;  4DUZ O;  3RBZ A;  2N74 A;  2M6Y A;  1Q6U A;  4R8C A;  4KUM A;  1N33 B;  3CJH B;  4OX9 O;  2YI9 A;  1NI8 A;  4LF5 B;  1NU1 H;  1PL0 A;  5L3F A;  4QJF B;  3W7X A;  1XDC A;  4IIJ A;  3SYP A;  3HKB B;  2F1M A;  3JD4 A;  2Q5Z A;  3FKS G;  5EIB D;  4YJ3 A;  1I7F A;  1MA1 A;  2WA3 A;  1Q7Y W;  1SZT A;  4I50 A;  4YHH O;  4PDL A;  3CMA V;  2YIB D;  1AR1 B;  3VQW A;  1IBL B;  3JAW A;  4DR7 O;  4EB6 B;  2YIB A;  1DK1 A;  1OCR C;  2EIN C;  2HVJ C;  3RFR A;  4W4L A;  4DUY O;  3H1L H;  1RPO A;  5LMN B;  3OTO O;  2DYS B;  1EBO A;  1FFX B;  2E74 B;  3FFQ A;  5HFL A;  3P30 A;  5IYD O;  4F6R B;  2A79 B;  4FJC C;  1YJW V;  3MDS A;  4YJ2 A;  4B3T O;  4DV0 O;  3OMI B;  2QM4 A;  1NZ6 A;  3CEI A;  1FXK A;  3ZMU A;  3DSQ A;  1VQK V;  3BAA A;  1SQV H;  5IJ0 A;  3E83 A;  4MTG A;  4QPK A;  3QO8 A;  1DLB A;  1QU7 A;  4FLT A;  2ZNI A;  2PGG A;  3K9A A;  5F2V O;  3C3S A;  1EN5 A;  3CRR A;  2XND G;  2OTL V;  1SER A;  1QCE A;  2YUA A;  1DF4 A;  1Q43 A;  1VQ5 V;  1SC5 B;  2IU0 A;  1WA8 B;  3E8G A;  1WPX A;  2P67 A;  4UCR A;  4J7K A;  1CEZ A;  3B4S A;  4MVO A;  2M7W A;  4TQF A;  4BWA A;  2Q0O C;  1VQO V;  3RYI A;  3OTF A;  3MHS C;  1JOY A;  4RWU A;  5BMV A;  3ZIA G;  2Q73 A;  5LA6 A;  1TUB B;  4MTX A;  4NTX A;  1N36 B;  1GM7 A;  2WPD G;  3T1Y B;  2QDO A;  1WN7 A;  2R9R B;  3HKC A;  3AG1 C;  2PY5 A;  2UXD O;  2HLD G;  3IAY A;  1YF2 A;  5H6Q A;  1H2L A;  4BIO A;  3WFV A;  4LNU A;  4X1Y A;  2ZDI C;  4RQF A;  5GTH Z;  1K4C C;  1IDS A;  3RWR D;  2GTA A;  2A3Q A;  3CHX A;  4MW3 A;  3CCU V;  1Q3E A;  1O9H A;  4DV2 O;  4CH4 A;  3OMN B;  4UXN A;  3RW0 A;  3AK2 A;  3UKM A;  2ZR2 A;  3AG3 C;  1FXV A;  3G6B A;  1Q6I A;  2A7W A;  4CBC A;  3ZHQ A;  3JAW B;  4LR3 A;  3K0G A;  1S5L Z;  2F23 A;  4GUN A;  1AVM A;  3TGU H;  3JAS A;  3L71 H;  4X1K A;  4DV5 O;  3CXC U;  4PA4 A;  2F95 B;  3ZRV A;  1HNX O;  3SDL A;  1YI2 V;  2LW7 A;  1XEQ A;  4LFA B;  4PI0 A;  1EN4 A;  4ZOL A;  4F6E A;  4K3A A;  1SZX A;  5IWA B;  4JAA A;  1K33 A;  2EZO A;  3JYC A;  2N05 A;  4X62 O;  1FXH A;  4DV3 O;  1BHA A;  4FLZ A;  3SJQ C;  4MVR A;  2Q7H A;  2L6L A;  4LF6 B;  5LHH A;  3OAA G;  3E8F A;  2FML A;  2OWO A;  4LWS B;  5KUM A;  1LNQ A;  3H01 A;  1CP9 A;  3FB6 C;  2WLH A;  1VQL V;  3ABL B;  5KAF Z;  4WCE V;  4GX2 A;  3SPG A;  1HR0 O;  2VWJ A;  2B1I A;  2R9I A;  1OCC C;  4X89 A;  5B1B B;  4B3R B;  2ZE5 A;  3RYH A;  4FIP C;  2UUA O;  4N21 A;  1XNR B;  1PL4 A;  5JVD B;  3CS5 A;  3I56 V;  5A2Q N;  1W0K G;  4TT3 G;  1COW G;  4ICG A;  4CH6 A;  1Z2G A;  2OIE A;  2QR4 A;  2XOK G;  1M57 B;  3AG2 C;  2X6C A;  4Z2W A;  2X6B A;  4GLX A;  1I5Y A;  4ZI7 B;  2AW9 A;  4JAS A;  1YIJ V;  1JJ2 U;  1XOU A;  1S5J A;  2Q7G A;  4I0X A;  5IYC O;  3FAV B;  3RYC B;  2ZDI A;  5LA6 B;  3CCR V;  3WG7 B;  4LH7 A;  3G6E V;  3NXS A;  3ABK C;  1M56 B;  1WAZ A;  2B1G A;  2EJR A;  3IC9 A;  1I94 B;  5DEC A;  4GT1 A;  2ITC C;  4DXW A;  3DXR B;  1URF A;  5B3S B;  3AG7 A;  4Q6G A;  4NTY A;  3L75 H;  4RQE A;  3ASO C;  3O65 A;  2H8P C;  4UV9 A;  4LFC O;  3FX7 A;  2GTS A;  4X1Y B;  1RSO B;  3N2K B;  1SKV A;  5CMU A;  1O9G A;  2YXL A;  5LYJ B;  1SQQ H;  3K5N A;  4PEL A;  1F23 A;  2ZQM A;  3PJS K;  5LOV B;  3BPZ A;  4FFB B;  3ZHT A;  5CA0 B;  1Y4M A;  3MAQ A;  1AJN A;  4MSW C;  3JAS B;  5J2T A;  1NH2 D;  2P7T C;  1VQM V;  4X20 B;  2RNB A;  1M93 A;  1UJW B;  1GTO A;  2NNU A;  1HNZ O;  4J11 A;  4JI2 B;  4LF4 B;  4PDR A;  4LF7 O;  3JAL A;  3JD3 A;  4ZOL B;  2DQ0 A;  4E4E A;  3W7S A;  1XI1 A;  1KP3 A;  1J5E O;  4B7E A;  1NTZ H;  1US6 A;  1BZK A;  5KHJ A;  3OUS A;  2FKX A;  4NXN O;  2AHY A;  3T4Z A;  1HNW O;  4JI3 B;  3WU2 Z;  4UUJ C;  1GM8 A;  4UB6 Z;  3BA9 A;  1R1B A;  1ZAU A;  2WSS G;  2XAG A;  1YJ9 V;  2MK3 A;  4JGS A;  3K04 A;  1N32 O;  2D2C B;  2Q8V A;  3P3N A;  1Z5V A;  4B3S B;  4I55 B;  4P2Z A;  4X1I B;  3B8N A;  5IY5 C;  3CC2 V;  4DR5 B;  4RO2 A;  1YJN V;  3S3X A;  2P6J A;  4LF9 B;  2YXY A;  1N8R W;  4BR6 A;  4CC5 A;  3UM7 A;  3UT5 A;  1IVS A;  4JI5 O;  2X6A A;  4HZ3 A;  1H2N A;  1SQX H;  1KB9 F;  3BEH A;  2V1D A;  1S72 V;  4IL6 Z;  3JD2 A;  2IM9 A;  3OUF A;  2P22 C;  5LP6 A;  4XDL A;  2IH3 C;  1ROP A;  4O2B B;  1QNM A;  2L35 A;  1XHZ A;  1VQ4 V;  2CE4 A;  1MSW D;  3APQ A;  1X4T A;  4DR4 B;  1QBZ A;  4FLV A;  2EUL A;  3RN4 A;  1V54 C;  2FYU H;  3QG5 A;  1EZJ A;  2A06 H;  4JPR A;  3ZMV A;  4AHC A;  3ZMT A;  4BW9 A;  4O4L A;  5BR8 O;  1RP3 B;  4J80 A;  3A0R A;  2WLJ A;  2UUB B;  2ZE7 A;  3EFF K;  2W6I G;  1ZX3 A;  4UCO A;  2GUZ B;  1IUR A;  2EIK C;  1K5S A;  4JYY A;  1EFR G;  4X64 B;  3E22 A;  1MOF A;  1YTF D;  5B1A C;  1K8A W;  1TUE B;  1H8E G;  2E5L B;  5JCO A;  2CH7 B;  4QE7 A;  2Z5U A;  3SPH A;  2OT5 A;  3U0Z A;  4O2A A;  3C90 A;  1MMM A;  3ETQ A;  2LP7 A;  4DR3 O;  3CRC A;  4WFH A;  3L72 H;  1ZTE A;  1IBK B;  4LF8 B;  2EX3 A;  4DV4 O;  4UV8 A;  2P5O A;  2OYQ A;  2EIM C;  2R70 A;  2W0F C;  3B40 A;  4MT8 A;  4OPH A;  5LHI A;  2V4D A;  1WPB A;  2NN4 A;  3GWO A;  4DR1 B;  4DK0 A;  4JZ2 A;  4DV1 B;  4NTW A;  4J9Y B;  4I9W A;  2QKC A;  4TOI A;  3K06 A;  1NQT A;  5LGU A;  4XDJ A;  5CA3 A;  2ZIO A;  2DWD C;  4NKG B;  5ITZ A;  4JI8 B;  4KHP B;  1GRJ A;  5LXT B;  1SA0 A;  1VF5 B;  3OGC C;  5IJ9 A;  3K5M A;  1OCZ B;  1MZE A;  3ABM B;  1XNQ B;  5EZY A;  2ZM6 O;  3BRC A;  5KA6 A;  1J95 A;  4Z1V A;  2WLN A;  3APO A;  4W4K A;  1S77 D;  1R6T A;  3UT5 B;  3SPJ A;  1Q86 W;  4U7N A;  2LFR A;  2R72 A;  3TXQ A;  1T5E A;  5L3C A;  2YEV A;  1JMK C;  5KAI Z;  2D3O W;  5KHK A;  4I7Z B;  5LP6 B;  2Y48 A;  4R50 A;  3LDE A;  4PA9 A;  1SES A;  1SQB H;  2GSM B;  4J9Z B;  4B3M O;  2JGU A;  1Q81 W;  4LC1 A;  2ZD9 A;  4K0K O;  1KC8 W;  2QE7 G;  4JI0 O;  3BVO A;  4GX0 A;  2UU9 B;  1Y67 A;  1GN3 A;  1R6N A;  1Q5O A;  1KQS U;  1D2D A;  1N33 O;  2C2A A;  3Q4H B;  1V9P A;  2JRI A;  2Y0P A;  4LF5 O;  3F7V C;  3ZRW B;  4I9Q A;  2GDS A;  1ZL8 A;  3E22 B;  4HNA A;  3A0B Z;  3JAR A;  4KFM A;  1Q8I A;  1VAR A;  2BOB C;  1BL8 A;  1AP6 A;  4DV7 B;  4UVB A;  3KG2 A;  4JI7 B;  2QJ1 A;  1M56 C;  3JAK A;  4FM0 A;  1IBL O;  5E79 Z;  4UB8 Z;  2CAZ C;  2BTQ B;  4H13 B;  5D5P A;  2AGA A;  2K1E A;  3BHP A;  2P06 A;  4GCZ A;  2WLI A;  1NVP B;  5LGT A;  1K4D C;  4FLW A;  2VWK A;  3K79 A;  5LMN O;  4YIP A;  3STZ C;  2CGO A;  1OCO B;  2F66 C;  2AXT Z;  1TAE A;  5LGN A;  3CYO A;  3I5D A;  1XMQ B;  5CB4 B;  5KLV H;  4O4I B;  3FD9 A;  2XAH A;  4I4T A;  4IHJ A;  1IXB A;  1IBM B;  1KBH A;  5BY1 A;  1GN2 A;  1QR8 A;  3SJB C;  1EM1 A;  4J42 A;  2CK3 G;  4ASU G;  1G6U A;  3SYC A;  5ITZ B;  1Y76 B;  3M99 B;  1R73 A;  2EBO A;  3ZED A;  1R3I C;  4U7O A;  2ZNJ A;  3OEH G;  5FL7 G;  3RYF A;  4DW0 A;  2HG5 C;  3IC7 A;  5HFM A;  3L73 H;  3HR0 A;  2ADP A;  3CRA A;  1D5A A;  5B1N A;  2QWR B;  4TV9 B;  2EIL C;  4TUY B;  2YDE A;  1JFF A;  2Q7E A;  3G67 A;  1K9M W;  3S3W A;  4QE9 A;  3F7Y C;  4OPA A;  3JAM N;  2QWQ B;  4TV8 B;  5JJJ B;  1MZF A;  4D6T H;  4DR2 B;  3OMA B;  1KMI Z;  1VF6 C;  4UVA A;  4YY3 B;  3ABT A;  4DRX A;  4EFE A;  3BAB A;  1AI7 A;  2Q69 A;  5J9P C;  1W59 A;  1ZWI C;  1N36 O;  3ASN B;  1Q90 D;  2ARH A;  1TVK A;  3T1Y O;  4KXR A;  3VQY A;  3X2Q B;  2KG7 A;  1X59 A;  1BS3 A;  1FS0 G;  1QQC A;  4YXW G;  5CA1 A;  4CC6 A;  5K1X A;  4IIJ B;  3ZHR A;  1NBM G;  4P30 A;  3K5O A;  1F4M A;  1TGO A;  1B06 A;  4YJ3 B;  2JS3 A;  3LNM B;  2A0L A;  4RUE A;  3D3Q A;  1K5Q A;  4I50 B;  3THO A;  1M90 W;  2Y69 B;  4HNA B;  3LNN A;  2JEU A;  4IT5 A;  1G1X B;  3E8B A;  1IZ3 A;  2P90 A;  3K5L A;  4RAI A;  5CBF A;  3CX5 F;  2EIJ C;  5GTI Z;  2OTJ V;  2HEP A;  1HDJ A;  2ILM A;  4X65 B;  4K8Z A;  3VOU A;  1YHQ V;  4LP8 A;  2WA4 A;  2PUS A;  1AIL A;  3SYO A;  2HFE C;  2UXX A;  4LFA O;  4YJ2 B;  3FYE B;  5L3E A;  4OXS A;  1H2K A;  5IWA O;  4PDV A;  1FXK B;  3A2F A;  3VQX A;  2DYR B;  4B08 A;  2PYL A;  1ENV A;  5IJ0 B;  3SGI A;  5KX5 A;  2ZXW B;  2QM7 A;  5KHI A;  1B6Q A;  1QLE C;  4LF6 O;  4PI2 A;  2QTS A;  4QGP A;  2F4V B;  1I5X A;  5EK0 A;  1TA8 A;  3AG4 C;  1YZB A;  4GKK B;  2HVK C;  1KYO F;  1SF9 A;  2WLM A;  1QHT A;  3KKY A;  1KUQ A;  1OJH A;  1XIL A;  2Z0A A;  1RM1 B;  4TWK A;  2N04 A;  2EJ7 A;  5DED A;  3MHH C;  5DN6 G;  4B3R O;  3LSU A;  3QNE A;  2KB1 A;  3L70 H;  1XNR O;  3STL C;  5KMG A;  4JAU A;  1JFF B;  4KP4 A;  4BAY A;  3ICX A;  2QTO A;  4XBF A;  3RYI B;  4EEQ A;  5BMV B;  5JH7 A;  4MTF A;  4D7S A;  3N2G A;  4UCV A;  1Y6X A;  5JWP A;  4DRX B;  2V7Q G;  4YIO A;  4FZ0 A;  3H1I H;  4CH5 A;  2IJH A;  1R6K A;  3E35 A;  3JCZ A;  5EBW C;  3HKC B;  4IYI A;  3HKD A;  4JF3 A;  1TVK B;  1I94 O;  3G71 V;  3DTU B;  5C8Y A;  4JV5 B;  2UXB B;  2EIN B;  3ABM C;  2JS5 A;  3AK3 A;  2DW4 A;  4LNU B;  3J80 N;  3F5W C;  5L3G A;  1YVW A;  3QF7 A;  2XUM A;  2OCC C;  5LMU B;  1IX9 A;  3UCS C;  3G80 A;  1PNK A;  2RDC A;  4JI6 B;  4G27 B;  2CTP A;  3ETE A;  3L74 H;  1KP2 A;  3T4D A;  5CBH A;  2HKO A;  5FNV A;  1MG1 A;  3ZHV A;  3E8H A;  1XBL A;  4O4H A;  2IJI A;  4X1K B;  5B66 Z;  3P3P A;  4DR6 B;  3JSN A;  1UPG A;  4JYA B;  1XQ8 A;  1FD9 A;  3QO5 A;  4KL1 A;  2YIC A;  4JTC B;  3ZBH A;  5AG2 A;  2IU3 A;  4JI2 O;  2ZCE A;  4LF4 O;  2JGD A;  4MVU A;  3SYQ A;  3IFX A;  2KKW A;  2HHH B;  4MS2 A;  2FL4 A;  4DV6 B;  1N34 B;  4NXM B;  5JJE B;  4U3J A;  4H33 A;  4JI3 O;  2P4V A;  4ABM A;  1QVG U;  1KEC A;  4FZ1 A;  3OR7 C;  2DYS C;  4GX1 A;  2YIA A;  2KSD A;  1JX9 A;  3RYH B;  2ADQ B;  1DF5 A;  4B3S O;  2PF4 E;  2YXH A;  4PV1 B;  5JJN B;  1AR4 A;  3IGA C;  4WBN A;  3FB7 C;  5B1O A;  1M5I A;  1ARO P;  5IYZ A;  2UXC B;  4DR5 O;  1FKA O;  1YIT V;  4PJ0 Z;  2OIG A;  4JZG A;  3AG1 B;  3G4S V;  4LF9 O;  4ZHQ A;  3R65 A;  4P9P A;  2CTW A;  4QNH B;  3A8T A;  4I0X B;  2QA4 V;  3B2E E;  2QSA A;  3ZMS A;  3ML0 A;  4QPJ A;  2XAQ A;  5EYP A;  2QWO B;  5IE9 A;  4FM1 A;  2IBZ H;  5E1A C;  4O4J A;  2ETN A;  3AG3 B;  3A0H Z;  4DR4 O;  1FYJ A;  2QKS A;  3OGI B;  2IH1 C;  4LFB B;  2YC0 A;  3DC5 A;  3NR7 A;  4PA6 A;  1DTO A;  5B5E Z;  5C8Y B;  3QO7 A; 
#chains in the Genus database with same CATH homology
 2UXB O;  3JAM N;  4LF6 O;  2JRI A;  4DUY O;  1IBM O;  2UUB O;  4LF5 O;  4DV4 O;  3OTO O;  1YZB A;  1N32 O;  4AQY O;  4X64 O;  2DOS A;  1XMO O;  4JV5 O;  5LMU O;  4DV2 O;  4JI2 O;  1KUQ A;  4OPH A;  2Z0A A;  4LF4 O;  4JI6 O;  2E5L O;  1N36 O;  4B3R O;  4B3T O;  3RT3 C;  4DV0 O;  3T1Y O;  4JI4 O;  1XNR O;  1AB3 A;  1X59 A;  2UU9 O;  1IBL O;  4LFB O;  3O65 A;  2VQF O;  4JI5 O;  4JI3 O;  2VQE O;  2AGA A;  4LFC O;  4DV5 O;  5H5N A;  4DR6 O;  1HNX O;  1IBK O;  4LF8 O;  2F4V O;  4JYA O;  3SDL A;  2LW7 A;  5LMN O;  1XEQ A;  4DR2 O;  4GKK O;  3F5T A;  4YY3 O;  1G1X B;  4B3S O;  5BXZ A;  3T1H O;  4JI1 O;  4GKJ O;  4DUZ O;  4X62 O;  2N74 A;  4DV3 O;  4DV7 O;  1I94 O;  3J7A U;  3R66 A;  2ZM6 O;  4DR1 O;  4DR5 O;  1FKA O;  2HHH O;  4JI7 O;  4DV1 O;  5LL6 Y;  5BR8 O;  4OX9 O;  4DV6 O;  5BY1 A;  4LF9 O;  1N34 O;  3J80 N;  1R6T A;  4NXM O;  1F7Y A;  2UUC O;  1A32 A;  4JI8 O;  1HNZ O;  1AIL A;  5FLX N;  1HR0 O;  4LF7 O;  4LFA O;  1N33 O;  4KHP O;  2UUA O;  4B3M O;  1J5E O;  4YHH O;  5IWA O;  4K0K O;  4JI0 O;  4X66 O;  5A2Q N;  1XMQ O;  2ZKO A;  4DR4 O;  1NS1 A;  1FYJ A;  4A5U B;  2FKX A;  4NXN O;  4DR7 O;  1XNQ O;  1HNW O;  3J81 N;  2DJV A;  1DK1 A;  2UXD O;  2UXC O;  1D2D A;  1FJG O;  5IT9 N;  4DR3 O;  1R1B A;  4OPA A;  3M8A A;  4X65 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...