4LF8O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf8O00
5FLXN 2F4VO 4LF5O 3OTOO 1YZBA 4B3RO 2UUCO 4LF4O 4DV6O 5IT9N 4DR6O 4AQYO 4DR4O 5BR8O 4KHPO 2DJVA 3J7AU 4JI0O 2ZKOA 4LF6O 4DR5O 2UU9O 4YHHO 1HR0O 2UUBO 1XNQO 4DV4O 2JRIA 2VQEO 1NS1A 1D2DA 1R1BA 5LMUO 3O65A 4JI5O 1XNRO 1KUQA 3T1YO 4OPHA 3J80N 3JAMN 4YY3O 1N34O 1N32O 2UUAO 1G1XB 1FJGO 4LF9O 4DV3O 1J5EO 4LFCO 4X65O 1FYJA 4B3TO 3J81N 2UXBO 3F5TA 5BY1A 4DR1O 4JI8O 3R66A 4GKKO 4X64O 2E5LO 4OPAA 4A5UB 4B3MO 1N36O 5IWAO 4JV5O 4DV1O 1IBLO 1F7YA 1X59A 1AB3A 5LMNO 4JI7O 2N74A 2ZM6O 4B3SO 4X66O 4LFBO 1XMQO 4JI1O 5LL6Y 1N33O 1FKAO 3RT3C 4K0KO 4DUZO 4NXMO 5BXZA 4OX9O 4X62O 4DV2O 1R6TA 4DV0O 1IBMO 4LF8O 2UXCO 4DV7O 4JI4O 4JI3O 1HNWO 1HNXO 1HNZO 4DUYO 3SDLA 4JYAO 3T1HO 4DR7O 4NXNO 2UXDO 5A2QN 1AILA 4LF7O 2DOSA 5H5NA 4JI6O 2VQFO 1XEQA 4JI2O 4LFAO 1A32A 2Z0AA 4DR3O 2FKXA 2HHHO 4DR2O 1DK1A 2LW7A 2AGAA 1IBKO 4GKJO 4DV5O 1XMOO 3M8AA 1I94O
chains in the Genus database with same CATH superfamily
2WWWA 1VQLV 4QE9A 1N32B 2F4VO 4NR1A 5JJJB 4IYHA 1FPOA 1PM9A 3CC4V 4P9OA 4DR4O 1Q43A 5B5EZ 4ASUG 5FL7G 5IJ0A 4Z2WA 4K3AA 4DR5O 1Y74B 3W7XA 1KBHA 4D7TA 4JGSA 2VS0A 1BSMA 2WLLB 4ZHQB 5LMNB 1L0NH 3DGEA 1XL4A 1OCZB 4FLWA 4UCOA 4DV3O 1J5EO 4PDVA 2ZR2A 3E8GA 3EXAA 4XDLA 1H38A 4OX9B 4CH6A 1QVGU 5E79Z 1E1RG 3OMIB 4BIZA 4DR1O 1COWG 4LNUB 4B3MB 2HJFC 4GKKO 1N0JA 2YC0A 2QE7G 2Q68A 2Q5ZA 2DN9A 3ZHUA 1LNQA 4PA6A 4C7UA 1NBMG 4R50A 1NTMH 2KKWA 4B3SO 1OCRC 1GK9A 3DXRB 4WFHA 1D5NA 1VARA 4DRXB 4AI8A 2BTQA 2JDIG 3B40A 3ZHVA 5BXZA 2XAFA 4NTWA 4JI3O 4FLUA 3HKBB 4BWAA 1H2NA 2YIBD 1ZUQA 5JCOC 4YHHB 1RM1B 4RUFA 4K8ZA 2EIJC 5EIBC 3JCUZ 1WN7A 1FXKB 5EBLC 4DR2O 3MHSC 3ZRVA 1Y74A 3T1YB 3BCCH 1ZWIC 1Y76B 5KAIZ 2WLLA 4G27B 3S3WA 3JYCA 2ZD9A 2V4DA 3BFRA 1US6A 2PGGA 4JI0B 1KYOF 2QM8A 3ZS8C 3KG2A 2GTAA 2EIMB 4CC5A 4PA9A 4U3FH 4FJCC 3ZMZA 3BABA 5JJEB 3FX7A 4FFKA 1PKXA 1R1BA 4HAMA 4IIJB 4LNUA 4QPJA 4HNAB 4JYCA 4H33A 1AR1B 2ZM6B 3GWKC 4X66B 3LSQA 3UM7A 1OCCB 3JAKB 2HEPA 1NQTA 3AG2C 4UCVA 4DUZB 3DXRA 4B3TO 2GUZB 5CMUA 3R66A 5JVDB 4LH7A 3ABMB 4DYLA 2IBZH 3HKBA 2Q0OC 2QKAA 3SJCC 1BZKA 4DR3B 1NI8A 1VIBA 1V55B 3F5WC 4LR3A 4LFBO 5LGUA 5LP6B 1JQ0A 4DK0A 1CP9A 1FXKA 5LHGA 2XT9A 4LWSB 5CB4B 4DV2O 1JA8A 1MSWD 1R6TA 3ZBHA 2JS5A 1B6QA 1GRJA 3IJ4A 1Y76A 1AI7A 5C8YB 3SYPA 5B3SC 3D3QA 4JYBA 4JI6O 4LH6A 3L71H 3TXQA 2XAGA 4UCSA 1I94B 3SPCA 1M1KW 2HLDG 2WLJA 1GN6A 2HJDA 2ZNJA 5TISZ 5KHKA 4GZRB 4IIJA 3H1IH 1M93A 4HNAA 2P22C 4B3RO 2E74B 3K0DA 1W0JG 4TWKA 4XDJA 1VQMV 3JAKA 2Y0IA 3VQWA 4I4TB 3C3SA 5EIBD 3B77A 1K3EA 1NR7A 2GUZA 2AZ2A 1NVPD 2DYRC 2F66C 5JVDA 1VF6A 1WP8A 2WLIB 1G1XB 5JQGB 2AHYA 2P4VA 3G4SV 1W59A 1YCIA 2DYSC 2NN4A 3CCUV 1G4YB 2PZSA 1IDSA 3SPGA 5ITZB 5LP6A 4DV0B 1KQSU 3K04A 2OCCB 2UXBO 2ZDIA 4RQFA 3QO7A 1UJWB 1YJWV 2P4KA 3ZEDA 2OYQA 3BA9A 1QNMA 1FXVA 5CB4A 1VQOV 1UPGA 5KHIA 1AROP 1K4DC 4FK5C 4FPPA 1N36O 2Y69C 1K97A 5C8YA 2P90A 3RYIB 1GO3F 4MVOA 1MG1A 1W0KG 5EK0A 4CS3A 1BS3A 1Q81W 1DF4A 4K0KO 2ZR3A 4DV6B 4I5SA 1WJZA 4PDLA 1HNZO 2GSMB 2QM4A 1L0LH 2RQ6A 1SF9A 5H5NA 5L3EA 2VQFO 2IH1C 1XNQB 3OAAG 3CE2A 1JX9A 2XTAA 2VQEB 5EZYB 2VWJA 2EZPA 4JTAB 4TOIA 4JTCB 1PPJH 3M8AA 4I7ZB 3APOA 4YY3B 4LF5O 1EN4A 4B08A 4WBNB 2UUCO 2O57A 4MS2A 2WLIA 1YJ9V 3MD0A 5JQGA 4KHPO 1URFA 3QNEA 3QVNA 2JRIA 5ITZA 3OE7G 1H8EG 1NS1A 3JASB 2LW1A 1WLEA 3JD1A 1YJNV 1N4CA 3ZIAG 1YF2A 1ORQC 3AG3C 1OCRB 5L3BA 1FS0G 2OWOA 4G28B 3RYIA 1AR5A 3UCSC 3TK1A 4P2ZA 4NXMB 4FM0A 3WFVA 2E76B 4JI8O 4MVUA 1NJIW 1HWYA 1Z2GA 3OM3B 2Z3YA 3CCRV 1XBLA 4O2AB 1YSCA 1N0NA 3OGIB 3CSXA 2ZINA 5KMGB 4JI1B 2N74A 3CRAA 1NVPB 4RAIA 5EZYA 1OCOB 3K5NA 2YIAA 3JALB 3E8BA 1KP3A 4IT5A 2Y4UA 1NTKH 4DV7O 1D5AA 4EFBA 1PNMA 3U10A 2CGNA 4NXNO 2YDEA 4WBNA 3ZCCA 5KX5B 4LF7O 4JI2O 4LFAO 3JARB 2Z0AA 3H1HH 4DV5B 1F4NA 3OMNB 4GYCB 5EBWC 2LW7A 2AXTZ 5CA1B 2EINC 3SYOA 4BAYA 2L6LA 1CEZA 4FZ0A 3ZMUA 3W7SA 3JASA 3WG7C 2M7WA 4LF4O 4MVQA 4FM2A 4YXWG 1ZLZA 2QA4V 4RUEA 4LF6B 4U7OA 2PF4E 4O4LB 2QTOA 5EYPB 4BW9A 3G67A 4HBNA 3ABUA 4X64B 3KKYA 5GW7A 2E5LB 4NTXA 4MVMA 1ROPA 2LGQA 3A2FA 3BRCA 1JMKC 4FIPC 4P30A 5H2FZ 4MW8A 3SPIA 3GWOA 3H1KH 4JI7B 2IU0A 4O2AA 4YJ2B 3E35A 1JR9A 4DW0A 2F43G 5KMGA 3P30A 4R6ZA 4J7KA 2HP8A 3EHBB 3F5TA 1QU7A 1NT2B 1TUEB 3RWRD 3JALA 1MSDA 2NLJC 4K35A 1GH6A 3FYEB 3CC2V 5B3SB 2JS3A 2ITDC 3RYFB 2HVKC 5KX5A 3CMAV 1W2BU 2QWNB 3ZHTA 1NR1A 4PDRA 3JARA 1T5EA 4H44B 5CA1A 1IURA 4UCUA 4X62O 1SZTA 4E4EA 1IBMO 3TJTA 2Q7GA 4IYIA 4FFBB 2OIGA 3ZRWB 3HKCB 1I5XA 5B1BB 4BW5A 1Y4MA 5KAFZ 3H9VA 2DOSA 2ZIMA 4KFMA 2B1GA 3QF7A 5B66Z 1JCHA 2YICA 1A32A 5J2TB 4GX2A 4PV1B 2Q73A 4O4LA 5EYPA 4Z1MG 5IYCO 4JI5B 2B5UA 2RCVA 5B1AB 3L9DA 2LFRA 1FJGB 2FYUH 4JF3A 3A0HZ 4AQYO 4FM1A 2DYSB 4YJ2A 2PUSA 3OW2U 4QGPA 1I0HA 1XILA 1RPRA 1X4TA 3W7UA 3H01A 2Q67A 4PDMA 3ETEA 2XAHA 4ZI7B 5LGTA 4J7JA 1S72V 2ADQB 4OPHA 2B9ZA 1GM8A 5IJ9B 3ZRSA 4LF9O 3RYFA 5KHHA 4GX0A 1JPXA 4DK1A 4LF8B 1HNWB 2WPDG 4DR7B 4B3MO 3K9AA 1BE3H 4UVCA 4NKGB 2GTSA 4FFBA 4UB6Z 3ZRWA 1XHZA 2RN9A 2WA4A 3HKCA 2WLNA 2HHHB 4W4KA 1TAEA 1XMQO 4W4LA 2LGWA 3ZHQA 5J2TA 4J11A 5H9CA 5JH7B 2F4VB 3CWBH 1HNXB 2ITCC 1XQ8A 4Q20A 3ASNB 1IX9A 3ZRXA 4DR4B 3RVYA 3Q4HB 2QJ1A 1OJHA 2UXDO 4CH5A 2LO1A 3JAWB 4R8CA 4DXWA 5B1OA 3SPJA 4DR5B 4NYKA 5J2UB 2E75B 4ZKIA 5E1AC 3CCLV 1GM7A 1WB7A 1GTOA 1AR4A 2CUGA 3K79A 1M56C 1SQXH 3M7MX 3CX5F 4ZI7A 1NKDA 1XREA 1YVWA 4KL1A 4KP4A 2IU3A 4DV3B 1M57C 4DR6O 3ZMSA 1BCCH 1P49A 5IJ9A 1NH2B 2ZE8A 4JI0O 4DV4B 4DR1B 3D3IA 2P67A 2UUBO 4GKKB 3A0RA 4YJ3B 2F23A 1QLEC 2CGOA 3F7VC 3LSUA 5B1NA 3ABKB 1KP2A 2DW4A 3BEHA 3EVKA 5LXTB 3T4ZA 2QDOA 4FLYA 3J80N 2UUAO 4B3SB 2LJ2A 1SRYA 3CYOA 4GT1A 2DQ3A 4MTOA 2QWRB 1PNLA 4WFFA 5CA3A 3NXSA 1RFYA 5IY5B 5JH7A 1CPYA 2FL4A 1RP3B 4JI3B 1GN4A 1R3IC 4WF9V 3RYCB 1AVMA 3TGUH 3RFRA 5FNVB 3Q4HA 4DR2B 3JAWA 1NZ6A 4JAUA 3QO5A 2BSKB 1R3JC 5J2UA 2EIKB 2PYJA 1SESA 1B3QA 2ZXWC 3K5LA 3AG4B 4J42A 1V9PA 1JFFB 2UXCB 4TQDA 3HKEB 5KA6A 2QR4A 2A0LA 2ZT9B 1JJOA 1PL0A 1ZL8B 3WG7B 4DUYO 3CXHF 1DTOA 4JYAO 5AG2A 2XNDG 1BHBA 4RWUA 4BIOA 1M9NA 1L1FA 1JOYA 3BPZA 4N23A 3QG5A 3TXSA 3RYHB 1ZX3A 3SR2C 1GN2A 4O4JB 1K5QA 3FKSG 2ZCEA 1I94O 3T2MA 3P32A 2ODMA 1SS3A 4YJ3A 3SJBC 2YUAA 4TSFG 1I08A 3JD4A 5FPOA 5LXTA 2YXYA 2ILMA 2H94A 1R6NA 2BE3A 5BR8O 2LQTA 2ZKOA 4DO2A 2K9PA 2CTQA 1S76D 2C2AA 1VQKV 4IGGA 1YDXA 3ABLB 2IM9A 3RYCA 1SQVH 4QJFB 3TETA 3K08A 4NVPA 3OTFA 4X89A 1K33A 5FNVA 4F4LA 3WB2A 5CA0B 5KUKA 3UKMA 2Y48A 2V1DA 4PD4F 4LFCO 1Z5WA 4X8AA 2JGDB 1OV9A 2BSKA 4DV2B 4G2KA 3ETDA 4ZBMA 4FLXA 4TUYB 2X6AA 1JFFA 1VEWA 3HKEA 2JVDA 1ZL8A 3IFXA 4JI6B 5BZBA 3M99B 3CP1A 2EILC 4JAAA 1N8RW 3RVZA 1IBLO 1IXBA 2QWQB 1Q86W 2HFEC 1PP9H 4JASA 4PJ0Z 1AP5A 3ZMTA 4ZIBA 3RYHA 4AHCA 4O4JA 4MVZA 4B3RB 3CPWU 4EEQA 1RPOA 3FFQA 3U11A 2LP7A 1XUQA 2AW9A 3H1LH 2FKXA 4U3JB 5BMVB 4KXRA 1NTZH 2XAJA 1V54C 3OUFA 3HR0A 3OTOB 2D3OW 2GDSA 3ICXA 2RNBA 4WFEA 3MHHC 3GB7C 4RQEA 4X1YB 2CH7B 4MTXA 4Q6GA 5CA0A 2UXBB 3JD3A 3I56V 5C93A 5K1XA 1LUVA 4FLTA 4GLXA 2JGDA 1R6KA 2YS8A 3WB1A 1MABG 3CD6V 2A06H 4TUYA 3F7YC 2WLMA 3K9SA 1KUQA 1N36B 1Q8IA 2CTPA 3H1JH 2YIBA 1N34O 4J10A 1VQ8V 3BY6A 4UVBA 1GN3A 4N21A 1OCZC 2JEUA 4CH3A 4K0KB 2FB5A 3W7TA 1DF5A 4F6RB 1HNZB 1H2SB 4TV9B 3ETGA 2Q4PA 1HW7A 1WB8A 5HFMA 2EZOA 4PA3A 3GVMA 3FAVB 1AI5A 1QHTA 2GV9A 4PI0A 1HP8A 2YI9A 2F1MA 4ABMA 5JJNB 4JV5O 4IHJB 3FB5C 3CMEV 4L87A 4P9PA 2CTRA 1Y67A 3MDSA 4JI1O 5LL6Y 1BT8A 4U3JA 1ZTEA 4U7NA 5BMVA 1FKAO 3ABTA 3RT3C 4LF5B 1BQ0A 4CZZA 2UUCB 3VOUA 1ZAUA 1Q5OA 3T1HO 5IYZB 4KHPB 3ZHRA 4X1YA 1Q6UA 3OR7C 3B4SA 1KC8W 2CH7A 2EIJB 4YIOA 4UXNA 1XMOB 3IAYA 1FXKC 1QLEB 3RGBA 2WA3A 4GKJO 4DV5O 2QGNA 4JZGA 3U0ZA 1EFRG 2YIDA 2P5OA 2CE4A 3FB8C 4D7SA 1TA8A 5L3DA 3VQYA 4WCEV 3CRQA 3ASOC 1TUBB 2PI4A 5A9GA 1LR1A 1YXBA 5LHIA 3A0BZ 4UVAA 3CEIA 2EIMC 4LF6O 2UXXA 1UFIA 5IYDO 4B7KA 2EJRA 2XUMA 1HR0O 4JTDB 1M4UA 2WLKA 2KB1A 4F6RA 3E8HA 2HG5C 1P4RA 3JCZA 1VMGA 1XNRO 4TV9A 2K1EA 5LOVB 4TQFA 3CXCU 4CBCA 3FAVA 2YXHA 3E8FA 5LGNA 2Z5UA 1OCCC 1QR8A 3AG2B 4IHJA 1NU1H 2N05A 4X65O 2D2CB 5LA6B 3P3NA 1SERA 4JPRA 4DV7B 4UFZA 4K8XA 1H8HG 2NR5A 4NXNB 4OPAA 1VF6C 1S5LZ 3ABMC 2A9HA 4JZ2A 4JI2B 4LFAB 1S0VA 5IYZA 1P84F 5IWAO 4DV1O 2KG7B 2F93B 5JCOA 1N33B 3SJQC 1O9HA 5IDJA 5LP6C 3FYIB 2ZDIC 3C90A 4PI2A 2HKOA 5D5PA 3SJAC 4LF4B 2BTOA 2W6IG 4JI4O 3A8TA 1XI1A 3WB0A 1WP7A 2G38A 1YHQV 3AG1C 1KECA 3RN4A 3T1CA 3THOA 1FFXB 3L72H 5L3CA 1TUBA 4EKWA 1FAFA 1FD9A 2JK5C 1JJ2U 1DK1A 4TV8B 1IBKO 3B09A 1F51A 3IC9A 1VQPV 4MVSA 1EZJA 1R3KC 2R9IA 1SKVA 5LOVA 5CBFA 3OEHG 3D36C 4UCTA 3SYQA 3JD0A 5EC1C 1TGOA 4QNHB 1SQFA 1M5IA 5IYBO 3E83A 2UU9O 5LA6A 4UCRA 4L8JA 2DYRB 1XOUA 5LMUO 3CCMV 2KQXA 1VQ6V 5L3GA 2FTKA 3X2QC 5DECA 4TT3G 1N32O 2Q8VA 2CAZC 2QEXV 2KG7A 2CK3G 3SYCA 2PTMA 1H2MA 3G6BA 4IL6Z 4X62B 1IBMB 4BR6A 4FLZA 2OCCC 3K57A 3OMAB 1QCEA 2OCHA 1VF5B 5HFLA 1PD3A 3STZC 3ZX6A 2R9RB 5EBMC 4H0LB 2IJJA 2R70A 5GTIZ 2WSSG 2Y69B 4EB6B 1FFXA 1X59A 5LMNO 1SQQH 3CHXA 1YIJV 2AHZA 4I55B 1V54B 1Z5VA 2PY5A 2EBOA 4GUNA 4TV8A 4D6TH 1VP7A 4OX9O 3JD2A 1L8DA 3B2EE 3T4DA 1BQZA 1HNXO 4AQYB 3RBZA 3SDLA 3AG7A 2Q69A 4O4IB 1KU9A 2Q9LA 4OGQB 1QLNA 3G71V 4FVMA 4HYOA 3DC6A 3K0GA 2P7TC 2Q6AA 4KUMA 1SQGA 1SA0B 3FB6C 2A7WA 2IW5A 3TCUA 4QIWF 1H2GA 3LDDA 1EBOA 3C3TA 1GAXA 1O9GA 5GONB 4LF9B 4X9QA 5IE9A 4LCUC 2UXNA 4MSWC 3OT7A 5KHGA 1WAZA 3AK2A 2QKCA 2PYLA 3SPHA 4J9YB 4YHHO 1QQCA 4DV4O 4FLVA 4F6EA 3O65A 1HDJA 5J9PC 3KCXA 5DN6G 5LBQA 1Q7YW 3UQ8A 3T1YO 2RDCA 4Z1VA 2PI5A 4CC6A 3AEIA 3DTUB 3ZHSA 4BIUA 3AG3B 1J5EB 1XMQB 1Y6XA 3SGIA 2IJIA 4EB6A 1LUWA 2N04A 1P7GA 1KKDA 3IGAC 4I55A 5BY1A 2ZE6A 2EJ7A 1E79G 2UXDB 3ML0A 2E3CA 4MW3A 4O4IA 1Q82W 2WLHA 1ZSPA 1B04A 4EFEA 1AB3A 3BVOA 2ZM6O 4X66O 2H8PC 1XHXA 3CB2A 4QPKA 5L3FA 2XAQA 2W0XA 2X0LA 1YTFD 4FMTA 2QWPB 4PA4A 4DUZO 1OCOC 2X7RB 3LDEA 1SA0A 1MA1A 3AK3A 2UXCO 1AJPA 4DR6B 2R9AA 3VQVA 3ASOB 4ZHQA 3FD9A 5GONA 1AILA 2F95B 1AI4A 3S3XA 1G8MA 2Q7HA 4MTGA 4ZOLB 2UUBB 4DR3O 1GM9A 3BA8A 1FXHA 1XL6A 2EINB 1SETA 3G6EV 4X1KB 4PA7A 3EFFK 3FB7C 2DE0X 3KZIZ 4ICGA 2UUAB 1BL8A 3P3PA 3ZJZA 1AJNA 1K5SA 1DLBA 2P06A 5K1PA 3K5OA 2Y4TA 4X20B 4XBFA 4DRXA 1E1QG 2KSDA 3APQA 1YEWA 3I5DA 2JGUA 1YITV 1EZVH 2A3QA 3E2EA 3ZN0A 1D2DA 1I5YA 1K4CC 1H2LA 3JAMN 1K34A 4CS4A 1K73W 1GMGA 4B3TB 3UO2A 5FPRA 4O4HB 1VF7A 5KUMA 4PHZA 5LHHA 1EN6A 1GKFA 1EN5A 1THZA 3CCQV 4DUYB 2JJ2G 4JYAB 3RW0A 3AG1B 3CCJV 1Q90D 1U97A 2ZE5A 3LDCA 1ENVA 4LFBB 1F7YA 4ZOLA 3O9OA 3N2KB 2Q7EA 4MT8A 1F23A 1K7DA 4J41A 4X1KA 1VQNV 4DV0O 3WU2Z 3DSQA 2B1IA 3HKDB 2GBOA 3HPLC 1WPBA 2BOCC 5BR8B 4GX1A 5B1BC 4HZ3A 2DWEC 3CC7V 1JVMA 4X20A 3CCVV 2R72A 2ZE7A 1TVKB 3W7WA 1R73A 3CJHB 4YIPA 2OTLV 5B1AC 2ZNIA 3OTOO 3X2QB 1YZBA 4DV6O 3L74H 4LFCB 2IJKA 2YXLA 3DC5A 1RSOB 1MNGA 1YTFB 2DWDC 2V7QG 2X6CA 4O4HA 1XNQO 4AILC 2VQEO 1KB9F 4J7ZA 2YEVB 1S5HC 4LWSA 3N2GB 4J9ZB 2CTWA 1EM1A 2CDYA 1CXZB 3PN1A 1IBLB 1PL4A 4YY3O 2A79B 3OFNG 3UO3A 3R65A 1IVSA 3CCSV 1P7BA 4H37A 2QKSA 2LFSA 4MVRA 3STLC 5CBGA 3N2KA 1Q6IA 3J81N 2L35A 4A5UB 3ETQA 4X1IB 3D36A 4I0XB 1VQ7V 3HKDA 2WAMA 3OEEG 3SYAA 3UT5B 2AZ0A 1BHAA 2YSUB 2QM7A 2HR3A 3KCYA 4I4TA 3IC7A 3VQXA 1OHHG 4I9WA 2ZIOA 4NXMO 2IH3C 3L70H 1MMMA 1TVKA 3E89A 4UV8A 3ASNC 3CJHA 5CN0A 1F4MA 1U96A 1Q6HA 5GTHZ 1KD1W 5A2QN 2VQFB 5KLVH 5H6RA 3K03A 2H3OA 5EC2C 2M6YA 4WFAV 1RSOA 4CS2A 3MAQA 3L75H 3LNNA 2AGAA 3LSSA 1Q3EA 1M56B 1SQBH 2P6JA 1XMOO 1XDCA 1MZEA 4XDKA 1SZXA 5DEDA 2GHYA 2BCCH 2XOKG 2YEVA 4R7CA 3N2GA 4MTFA 1N34B 1PNKA 1M57B 5IT9N 1WA8B 2OTJV 1AP6A 1QBZA 3CS5A 3K06A 2HVJC 1M90W 1RM1C 5H6QA 5KA5A 1WPXA 2JIZG 4LP8A 1SC5B 3ABKC 4JV5B 4NB5A 4UB8Z 4X1IA 4I0XA 3JATB 4FZ1A 2DMXA 1H2KA 4JYYA 1G6UA 4O2BB 4RO2A 3UT5A 4OXSA 1FYJA 1IZ3A 2MW2B 4JI8B 3K5MA 4H13B 3E22B 3VBBA 3B8NA 5IY5C 2ATKC 2ADPA 2OT5A 1AI6A 4X64O 3T1HB 2E5LO 3K59A 2OIEA 3LNMB 3CCEV 1DGSA 2Q0AA 3PJSK 4JI7O 4GKJB 5D5QA 2VRZA 1S77D 2EX3A 2ZXWB 1N33O 1B06A 2ETNA 4LBEC 2EIKC 4X88A 3AG4C 1PV0A 3E86A 1VQ4V 2JJ1G 4DW1A 2MK3A 1Y66A 4E2LA 3K58A 4LF7B 5KHJA 2ZQMA 4PELA 1IXMA 3JSLA 1WA8A 4LC1A 4UUJC 3OR6C 1HR0B 1BMFG 3OGCC 2XHBA 1V55C 5LYJB 2QTSA 5JWPA 1XNRB 1KMIZ 4I50B 5F2VO 2JEXA 1OZ0A 3ZN1A 5FLXN 3D8CA 2X6BA 1SQPH 1VQ5V 1VQ9V 4GCZA 1AJQA 3OD4A 4X65B 1R3LC 1J95A 3JATA 1I7FA 2YI8A 4CH4A 2FMLA 2DJVA 3J7AU 2DQ0A 2QSAA 3B8MA 4O2BA 4B7EA 1YI2V 2IJHA 3E22A 1S3JA 4JI5O 1WNSA 3ABLC 5IWAB 4DV1B 1MOFA 4NTYA 1KKCA 1FJGO 3CRRA 5IJ0B 2RMKB 2W0FC 1NH2D 1K92A 3K3WA 1QR9A 3G80A 1K8AW 3AK1A 3QO8A 3BHPA 4JI4B 3OUSA 2XASA 2W6JG 2QWOB 2EILB 1K9MW 3HB3B 1BGYH 5DM6V 1IBKB 3L73H 4I9QA 3I55V 3CRCA 1QVFU 5LYJA 1S5JA 2VWKA 2ARHA 4LF8O 1FFTB 1HNWO 2RJZA 4I50A 4JAVA 4WFBV 4UV9A 4WFGA 4DR7O 1MZFA 4QE7A 3N27A 5CBHA 4J80A 3QTCA 2UU9B 1XEQA 3CRMA 2BTQB 3JSNA 2HHHO 3ZMVA 3BAAA 2BOBC 5LMUB 2Y0PA 4GX5A 3NR7A 2EULA 2NNUA 3LUTB
chains in the Genus database with same CATH topology
5FLXN 2F4VO 4LF5O 3OTOO 1YZBA 4B3RO 2UUCO 4LF4O 4DV6O 5IT9N 4DR6O 4AQYO 4DR4O 5BR8O 4KHPO 2DJVA 3J7AU 4JI0O 2ZKOA 4LF6O 4DR5O 2UU9O 4YHHO 1HR0O 2UUBO 1XNQO 4DV4O 2JRIA 2VQEO 1NS1A 1D2DA 1R1BA 5LMUO 3O65A 4JI5O 1XNRO 1KUQA 3T1YO 4OPHA 3J80N 3JAMN 4YY3O 1N34O 1N32O 2UUAO 1G1XB 1FJGO 4LF9O 4DV3O 1J5EO 4LFCO 4X65O 1FYJA 4B3TO 3J81N 2UXBO 3F5TA 5BY1A 4DR1O 4JI8O 3R66A 4GKKO 4X64O 2E5LO 4OPAA 4A5UB 4B3MO 1N36O 5IWAO 4JV5O 4DV1O 1IBLO 1F7YA 1X59A 1AB3A 5LMNO 4JI7O 2N74A 2ZM6O 4B3SO 4X66O 4LFBO 1XMQO 4JI1O 5LL6Y 1N33O 1FKAO 3RT3C 4K0KO 4DUZO 4NXMO 5BXZA 4OX9O 4X62O 4DV2O 1R6TA 4DV0O 1IBMO 4LF8O 2UXCO 4DV7O 4JI4O 4JI3O 1HNWO 1HNXO 1HNZO 4DUYO 3SDLA 4JYAO 3T1HO 4DR7O 4NXNO 2UXDO 5A2QN 1AILA 4LF7O 2DOSA 5H5NA 4JI6O 2VQFO 1XEQA 4JI2O 4LFAO 1A32A 2Z0AA 4DR3O 2FKXA 2HHHO 4DR2O 1DK1A 2LW7A 2AGAA 1IBKO 4GKJO 4DV5O 1XMOO 3M8AA 1I94O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX N;  2F4V O;  4LF5 O;  3OTO O;  1YZB A;  4B3R O;  2UUC O;  4LF4 O;  4DV6 O;  5IT9 N;  4DR6 O;  4AQY O;  4DR4 O;  5BR8 O;  4KHP O;  2DJV A;  3J7A U;  4JI0 O;  2ZKO A;  4LF6 O;  4DR5 O;  2UU9 O;  4YHH O;  1HR0 O;  2UUB O;  1XNQ O;  4DV4 O;  2JRI A;  2VQE O;  1NS1 A;  1D2D A;  1R1B A;  5LMU O;  3O65 A;  4JI5 O;  1XNR O;  1KUQ A;  3T1Y O;  4OPH A;  3J80 N;  3JAM N;  4YY3 O;  1N34 O;  1N32 O;  2UUA O;  1G1X B;  1FJG O;  4LF9 O;  4DV3 O;  1J5E O;  4LFC O;  4X65 O;  1FYJ A;  4B3T O;  3J81 N;  2UXB O;  3F5T A;  5BY1 A;  4DR1 O;  4JI8 O;  3R66 A;  4GKK O;  4X64 O;  2E5L O;  4OPA A;  4A5U B;  4B3M O;  1N36 O;  5IWA O;  4JV5 O;  4DV1 O;  1IBL O;  1F7Y A;  1X59 A;  1AB3 A;  5LMN O;  4JI7 O;  2N74 A;  2ZM6 O;  4B3S O;  4X66 O;  4LFB O;  1XMQ O;  4JI1 O;  5LL6 Y;  1N33 O;  1FKA O;  3RT3 C;  4K0K O;  4DUZ O;  4NXM O;  5BXZ A;  4OX9 O;  4X62 O;  4DV2 O;  1R6T A;  4DV0 O;  1IBM O;  4LF8 O;  2UXC O;  4DV7 O;  4JI4 O;  4JI3 O;  1HNW O;  1HNX O;  1HNZ O;  4DUY O;  3SDL A;  4JYA O;  3T1H O;  4DR7 O;  4NXN O;  2UXD O;  5A2Q N;  1AIL A;  4LF7 O;  2DOS A;  5H5N A;  4JI6 O;  2VQF O;  1XEQ A;  4JI2 O;  4LFA O;  1A32 A;  2Z0A A;  4DR3 O;  2FKX A;  2HHH O;  4DR2 O;  1DK1 A;  2LW7 A;  2AGA A;  1IBK O;  4GKJ O;  4DV5 O;  1XMO O;  3M8A A;  1I94 O; 
#chains in the Genus database with same CATH topology
 2WWW A;  1VQL V;  4QE9 A;  1N32 B;  2F4V O;  4NR1 A;  5JJJ B;  4IYH A;  1FPO A;  1PM9 A;  3CC4 V;  4P9O A;  4DR4 O;  1Q43 A;  5B5E Z;  4ASU G;  5FL7 G;  5IJ0 A;  4Z2W A;  4K3A A;  4DR5 O;  1Y74 B;  3W7X A;  1KBH A;  4D7T A;  4JGS A;  2VS0 A;  1BSM A;  2WLL B;  4ZHQ B;  5LMN B;  1L0N H;  3DGE A;  1XL4 A;  1OCZ B;  4FLW A;  4UCO A;  4DV3 O;  1J5E O;  4PDV A;  2ZR2 A;  3E8G A;  3EXA A;  4XDL A;  1H38 A;  4OX9 B;  4CH6 A;  1QVG U;  5E79 Z;  1E1R G;  3OMI B;  4BIZ A;  4DR1 O;  1COW G;  4LNU B;  4B3M B;  2HJF C;  4GKK O;  1N0J A;  2YC0 A;  2QE7 G;  2Q68 A;  2Q5Z A;  2DN9 A;  3ZHU A;  1LNQ A;  4PA6 A;  4C7U A;  1NBM G;  4R50 A;  1NTM H;  2KKW A;  4B3S O;  1OCR C;  1GK9 A;  3DXR B;  4WFH A;  1D5N A;  1VAR A;  4DRX B;  4AI8 A;  2BTQ A;  2JDI G;  3B40 A;  3ZHV A;  5BXZ A;  2XAF A;  4NTW A;  4JI3 O;  4FLU A;  3HKB B;  4BWA A;  1H2N A;  2YIB D;  1ZUQ A;  5JCO C;  4YHH B;  1RM1 B;  4RUF A;  4K8Z A;  2EIJ C;  5EIB C;  3JCU Z;  1WN7 A;  1FXK B;  5EBL C;  4DR2 O;  3MHS C;  3ZRV A;  1Y74 A;  3T1Y B;  3BCC H;  1ZWI C;  1Y76 B;  5KAI Z;  2WLL A;  4G27 B;  3S3W A;  3JYC A;  2ZD9 A;  2V4D A;  3BFR A;  1US6 A;  2PGG A;  4JI0 B;  1KYO F;  2QM8 A;  3ZS8 C;  3KG2 A;  2GTA A;  2EIM B;  4CC5 A;  4PA9 A;  4U3F H;  4FJC C;  3ZMZ A;  3BAB A;  5JJE B;  3FX7 A;  4FFK A;  1PKX A;  1R1B A;  4HAM A;  4IIJ B;  4LNU A;  4QPJ A;  4HNA B;  4JYC A;  4H33 A;  1AR1 B;  2ZM6 B;  3GWK C;  4X66 B;  3LSQ A;  3UM7 A;  1OCC B;  3JAK B;  2HEP A;  1NQT A;  3AG2 C;  4UCV A;  4DUZ B;  3DXR A;  4B3T O;  2GUZ B;  5CMU A;  3R66 A;  5JVD B;  4LH7 A;  3ABM B;  4DYL A;  2IBZ H;  3HKB A;  2Q0O C;  2QKA A;  3SJC C;  1BZK A;  4DR3 B;  1NI8 A;  1VIB A;  1V55 B;  3F5W C;  4LR3 A;  4LFB O;  5LGU A;  5LP6 B;  1JQ0 A;  4DK0 A;  1CP9 A;  1FXK A;  5LHG A;  2XT9 A;  4LWS B;  5CB4 B;  4DV2 O;  1JA8 A;  1MSW D;  1R6T A;  3ZBH A;  2JS5 A;  1B6Q A;  1GRJ A;  3IJ4 A;  1Y76 A;  1AI7 A;  5C8Y B;  3SYP A;  5B3S C;  3D3Q A;  4JYB A;  4JI6 O;  4LH6 A;  3L71 H;  3TXQ A;  2XAG A;  4UCS A;  1I94 B;  3SPC A;  1M1K W;  2HLD G;  2WLJ A;  1GN6 A;  2HJD A;  2ZNJ A;  5TIS Z;  5KHK A;  4GZR B;  4IIJ A;  3H1I H;  1M93 A;  4HNA A;  2P22 C;  4B3R O;  2E74 B;  3K0D A;  1W0J G;  4TWK A;  4XDJ A;  1VQM V;  3JAK A;  2Y0I A;  3VQW A;  4I4T B;  3C3S A;  5EIB D;  3B77 A;  1K3E A;  1NR7 A;  2GUZ A;  2AZ2 A;  1NVP D;  2DYR C;  2F66 C;  5JVD A;  1VF6 A;  1WP8 A;  2WLI B;  1G1X B;  5JQG B;  2AHY A;  2P4V A;  3G4S V;  1W59 A;  1YCI A;  2DYS C;  2NN4 A;  3CCU V;  1G4Y B;  2PZS A;  1IDS A;  3SPG A;  5ITZ B;  5LP6 A;  4DV0 B;  1KQS U;  3K04 A;  2OCC B;  2UXB O;  2ZDI A;  4RQF A;  3QO7 A;  1UJW B;  1YJW V;  2P4K A;  3ZED A;  2OYQ A;  3BA9 A;  1QNM A;  1FXV A;  5CB4 A;  1VQO V;  1UPG A;  5KHI A;  1ARO P;  1K4D C;  4FK5 C;  4FPP A;  1N36 O;  2Y69 C;  1K97 A;  5C8Y A;  2P90 A;  3RYI B;  1GO3 F;  4MVO A;  1MG1 A;  1W0K G;  5EK0 A;  4CS3 A;  1BS3 A;  1Q81 W;  1DF4 A;  4K0K O;  2ZR3 A;  4DV6 B;  4I5S A;  1WJZ A;  4PDL A;  1HNZ O;  2GSM B;  2QM4 A;  1L0L H;  2RQ6 A;  1SF9 A;  5H5N A;  5L3E A;  2VQF O;  2IH1 C;  1XNQ B;  3OAA G;  3CE2 A;  1JX9 A;  2XTA A;  2VQE B;  5EZY B;  2VWJ A;  2EZP A;  4JTA B;  4TOI A;  4JTC B;  1PPJ H;  3M8A A;  4I7Z B;  3APO A;  4YY3 B;  4LF5 O;  1EN4 A;  4B08 A;  4WBN B;  2UUC O;  2O57 A;  4MS2 A;  2WLI A;  1YJ9 V;  3MD0 A;  5JQG A;  4KHP O;  1URF A;  3QNE A;  3QVN A;  2JRI A;  5ITZ A;  3OE7 G;  1H8E G;  1NS1 A;  3JAS B;  2LW1 A;  1WLE A;  3JD1 A;  1YJN V;  1N4C A;  3ZIA G;  1YF2 A;  1ORQ C;  3AG3 C;  1OCR B;  5L3B A;  1FS0 G;  2OWO A;  4G28 B;  3RYI A;  1AR5 A;  3UCS C;  3TK1 A;  4P2Z A;  4NXM B;  4FM0 A;  3WFV A;  2E76 B;  4JI8 O;  4MVU A;  1NJI W;  1HWY A;  1Z2G A;  3OM3 B;  2Z3Y A;  3CCR V;  1XBL A;  4O2A B;  1YSC A;  1N0N A;  3OGI B;  3CSX A;  2ZIN A;  5KMG B;  4JI1 B;  2N74 A;  3CRA A;  1NVP B;  4RAI A;  5EZY A;  1OCO B;  3K5N A;  2YIA A;  3JAL B;  3E8B A;  1KP3 A;  4IT5 A;  2Y4U A;  1NTK H;  4DV7 O;  1D5A A;  4EFB A;  1PNM A;  3U10 A;  2CGN A;  4NXN O;  2YDE A;  4WBN A;  3ZCC A;  5KX5 B;  4LF7 O;  4JI2 O;  4LFA O;  3JAR B;  2Z0A A;  3H1H H;  4DV5 B;  1F4N A;  3OMN B;  4GYC B;  5EBW C;  2LW7 A;  2AXT Z;  5CA1 B;  2EIN C;  3SYO A;  4BAY A;  2L6L A;  1CEZ A;  4FZ0 A;  3ZMU A;  3W7S A;  3JAS A;  3WG7 C;  2M7W A;  4LF4 O;  4MVQ A;  4FM2 A;  4YXW G;  1ZLZ A;  2QA4 V;  4RUE A;  4LF6 B;  4U7O A;  2PF4 E;  4O4L B;  2QTO A;  5EYP B;  4BW9 A;  3G67 A;  4HBN A;  3ABU A;  4X64 B;  3KKY A;  5GW7 A;  2E5L B;  4NTX A;  4MVM A;  1ROP A;  2LGQ A;  3A2F A;  3BRC A;  1JMK C;  4FIP C;  4P30 A;  5H2F Z;  4MW8 A;  3SPI A;  3GWO A;  3H1K H;  4JI7 B;  2IU0 A;  4O2A A;  4YJ2 B;  3E35 A;  1JR9 A;  4DW0 A;  2F43 G;  5KMG A;  3P30 A;  4R6Z A;  4J7K A;  2HP8 A;  3EHB B;  3F5T A;  1QU7 A;  1NT2 B;  1TUE B;  3RWR D;  3JAL A;  1MSD A;  2NLJ C;  4K35 A;  1GH6 A;  3FYE B;  3CC2 V;  5B3S B;  2JS3 A;  2ITD C;  3RYF B;  2HVK C;  5KX5 A;  3CMA V;  1W2B U;  2QWN B;  3ZHT A;  1NR1 A;  4PDR A;  3JAR A;  1T5E A;  4H44 B;  5CA1 A;  1IUR A;  4UCU A;  4X62 O;  1SZT A;  4E4E A;  1IBM O;  3TJT A;  2Q7G A;  4IYI A;  4FFB B;  2OIG A;  3ZRW B;  3HKC B;  1I5X A;  5B1B B;  4BW5 A;  1Y4M A;  5KAF Z;  3H9V A;  2DOS A;  2ZIM A;  4KFM A;  2B1G A;  3QF7 A;  5B66 Z;  1JCH A;  2YIC A;  1A32 A;  5J2T B;  4GX2 A;  4PV1 B;  2Q73 A;  4O4L A;  5EYP A;  4Z1M G;  5IYC O;  4JI5 B;  2B5U A;  2RCV A;  5B1A B;  3L9D A;  2LFR A;  1FJG B;  2FYU H;  4JF3 A;  3A0H Z;  4AQY O;  4FM1 A;  2DYS B;  4YJ2 A;  2PUS A;  3OW2 U;  4QGP A;  1I0H A;  1XIL A;  1RPR A;  1X4T A;  3W7U A;  3H01 A;  2Q67 A;  4PDM A;  3ETE A;  2XAH A;  4ZI7 B;  5LGT A;  4J7J A;  1S72 V;  2ADQ B;  4OPH A;  2B9Z A;  1GM8 A;  5IJ9 B;  3ZRS A;  4LF9 O;  3RYF A;  5KHH A;  4GX0 A;  1JPX A;  4DK1 A;  4LF8 B;  1HNW B;  2WPD G;  4DR7 B;  4B3M O;  3K9A A;  1BE3 H;  4UVC A;  4NKG B;  2GTS A;  4FFB A;  4UB6 Z;  3ZRW A;  1XHZ A;  2RN9 A;  2WA4 A;  3HKC A;  2WLN A;  2HHH B;  4W4K A;  1TAE A;  1XMQ O;  4W4L A;  2LGW A;  3ZHQ A;  5J2T A;  4J11 A;  5H9C A;  5JH7 B;  2F4V B;  3CWB H;  1HNX B;  2ITC C;  1XQ8 A;  4Q20 A;  3ASN B;  1IX9 A;  3ZRX A;  4DR4 B;  3RVY A;  3Q4H B;  2QJ1 A;  1OJH A;  2UXD O;  4CH5 A;  2LO1 A;  3JAW B;  4R8C A;  4DXW A;  5B1O A;  3SPJ A;  4DR5 B;  4NYK A;  5J2U B;  2E75 B;  4ZKI A;  5E1A C;  3CCL V;  1GM7 A;  1WB7 A;  1GTO A;  1AR4 A;  2CUG A;  3K79 A;  1M56 C;  1SQX H;  3M7M X;  3CX5 F;  4ZI7 A;  1NKD A;  1XRE A;  1YVW A;  4KL1 A;  4KP4 A;  2IU3 A;  4DV3 B;  1M57 C;  4DR6 O;  3ZMS A;  1BCC H;  1P49 A;  5IJ9 A;  1NH2 B;  2ZE8 A;  4JI0 O;  4DV4 B;  4DR1 B;  3D3I A;  2P67 A;  2UUB O;  4GKK B;  3A0R A;  4YJ3 B;  2F23 A;  1QLE C;  2CGO A;  3F7V C;  3LSU A;  5B1N A;  3ABK B;  1KP2 A;  2DW4 A;  3BEH A;  3EVK A;  5LXT B;  3T4Z A;  2QDO A;  4FLY A;  3J80 N;  2UUA O;  4B3S B;  2LJ2 A;  1SRY A;  3CYO A;  4GT1 A;  2DQ3 A;  4MTO A;  2QWR B;  1PNL A;  4WFF A;  5CA3 A;  3NXS A;  1RFY A;  5IY5 B;  5JH7 A;  1CPY A;  2FL4 A;  1RP3 B;  4JI3 B;  1GN4 A;  1R3I C;  4WF9 V;  3RYC B;  1AVM A;  3TGU H;  3RFR A;  5FNV B;  3Q4H A;  4DR2 B;  3JAW A;  1NZ6 A;  4JAU A;  3QO5 A;  2BSK B;  1R3J C;  5J2U A;  2EIK B;  2PYJ A;  1SES A;  1B3Q A;  2ZXW C;  3K5L A;  3AG4 B;  4J42 A;  1V9P A;  1JFF B;  2UXC B;  4TQD A;  3HKE B;  5KA6 A;  2QR4 A;  2A0L A;  2ZT9 B;  1JJO A;  1PL0 A;  1ZL8 B;  3WG7 B;  4DUY O;  3CXH F;  1DTO A;  4JYA O;  5AG2 A;  2XND G;  1BHB A;  4RWU A;  4BIO A;  1M9N A;  1L1F A;  1JOY A;  3BPZ A;  4N23 A;  3QG5 A;  3TXS A;  3RYH B;  1ZX3 A;  3SR2 C;  1GN2 A;  4O4J B;  1K5Q A;  3FKS G;  2ZCE A;  1I94 O;  3T2M A;  3P32 A;  2ODM A;  1SS3 A;  4YJ3 A;  3SJB C;  2YUA A;  4TSF G;  1I08 A;  3JD4 A;  5FPO A;  5LXT A;  2YXY A;  2ILM A;  2H94 A;  1R6N A;  2BE3 A;  5BR8 O;  2LQT A;  2ZKO A;  4DO2 A;  2K9P A;  2CTQ A;  1S76 D;  2C2A A;  1VQK V;  4IGG A;  1YDX A;  3ABL B;  2IM9 A;  3RYC A;  1SQV H;  4QJF B;  3TET A;  3K08 A;  4NVP A;  3OTF A;  4X89 A;  1K33 A;  5FNV A;  4F4L A;  3WB2 A;  5CA0 B;  5KUK A;  3UKM A;  2Y48 A;  2V1D A;  4PD4 F;  4LFC O;  1Z5W A;  4X8A A;  2JGD B;  1OV9 A;  2BSK A;  4DV2 B;  4G2K A;  3ETD A;  4ZBM A;  4FLX A;  4TUY B;  2X6A A;  1JFF A;  1VEW A;  3HKE A;  2JVD A;  1ZL8 A;  3IFX A;  4JI6 B;  5BZB A;  3M99 B;  3CP1 A;  2EIL C;  4JAA A;  1N8R W;  3RVZ A;  1IBL O;  1IXB A;  2QWQ B;  1Q86 W;  2HFE C;  1PP9 H;  4JAS A;  4PJ0 Z;  1AP5 A;  3ZMT A;  4ZIB A;  3RYH A;  4AHC A;  4O4J A;  4MVZ A;  4B3R B;  3CPW U;  4EEQ A;  1RPO A;  3FFQ A;  3U11 A;  2LP7 A;  1XUQ A;  2AW9 A;  3H1L H;  2FKX A;  4U3J B;  5BMV B;  4KXR A;  1NTZ H;  2XAJ A;  1V54 C;  3OUF A;  3HR0 A;  3OTO B;  2D3O W;  2GDS A;  3ICX A;  2RNB A;  4WFE A;  3MHH C;  3GB7 C;  4RQE A;  4X1Y B;  2CH7 B;  4MTX A;  4Q6G A;  5CA0 A;  2UXB B;  3JD3 A;  3I56 V;  5C93 A;  5K1X A;  1LUV A;  4FLT A;  4GLX A;  2JGD A;  1R6K A;  2YS8 A;  3WB1 A;  1MAB G;  3CD6 V;  2A06 H;  4TUY A;  3F7Y C;  2WLM A;  3K9S A;  1KUQ A;  1N36 B;  1Q8I A;  2CTP A;  3H1J H;  2YIB A;  1N34 O;  4J10 A;  1VQ8 V;  3BY6 A;  4UVB A;  1GN3 A;  4N21 A;  1OCZ C;  2JEU A;  4CH3 A;  4K0K B;  2FB5 A;  3W7T A;  1DF5 A;  4F6R B;  1HNZ B;  1H2S B;  4TV9 B;  3ETG A;  2Q4P A;  1HW7 A;  1WB8 A;  5HFM A;  2EZO A;  4PA3 A;  3GVM A;  3FAV B;  1AI5 A;  1QHT A;  2GV9 A;  4PI0 A;  1HP8 A;  2YI9 A;  2F1M A;  4ABM A;  5JJN B;  4JV5 O;  4IHJ B;  3FB5 C;  3CME V;  4L87 A;  4P9P A;  2CTR A;  1Y67 A;  3MDS A;  4JI1 O;  5LL6 Y;  1BT8 A;  4U3J A;  1ZTE A;  4U7N A;  5BMV A;  1FKA O;  3ABT A;  3RT3 C;  4LF5 B;  1BQ0 A;  4CZZ A;  2UUC B;  3VOU A;  1ZAU A;  1Q5O A;  3T1H O;  5IYZ B;  4KHP B;  3ZHR A;  4X1Y A;  1Q6U A;  3OR7 C;  3B4S A;  1KC8 W;  2CH7 A;  2EIJ B;  4YIO A;  4UXN A;  1XMO B;  3IAY A;  1FXK C;  1QLE B;  3RGB A;  2WA3 A;  4GKJ O;  4DV5 O;  2QGN A;  4JZG A;  3U0Z A;  1EFR G;  2YID A;  2P5O A;  2CE4 A;  3FB8 C;  4D7S A;  1TA8 A;  5L3D A;  3VQY A;  4WCE V;  3CRQ A;  3ASO C;  1TUB B;  2PI4 A;  5A9G A;  1LR1 A;  1YXB A;  5LHI A;  3A0B Z;  4UVA A;  3CEI A;  2EIM C;  4LF6 O;  2UXX A;  1UFI A;  5IYD O;  4B7K A;  2EJR A;  2XUM A;  1HR0 O;  4JTD B;  1M4U A;  2WLK A;  2KB1 A;  4F6R A;  3E8H A;  2HG5 C;  1P4R A;  3JCZ A;  1VMG A;  1XNR O;  4TV9 A;  2K1E A;  5LOV B;  4TQF A;  3CXC U;  4CBC A;  3FAV A;  2YXH A;  3E8F A;  5LGN A;  2Z5U A;  1OCC C;  1QR8 A;  3AG2 B;  4IHJ A;  1NU1 H;  2N05 A;  4X65 O;  2D2C B;  5LA6 B;  3P3N A;  1SER A;  4JPR A;  4DV7 B;  4UFZ A;  4K8X A;  1H8H G;  2NR5 A;  4NXN B;  4OPA A;  1VF6 C;  1S5L Z;  3ABM C;  2A9H A;  4JZ2 A;  4JI2 B;  4LFA B;  1S0V A;  5IYZ A;  1P84 F;  5IWA O;  4DV1 O;  2KG7 B;  2F93 B;  5JCO A;  1N33 B;  3SJQ C;  1O9H A;  5IDJ A;  5LP6 C;  3FYI B;  2ZDI C;  3C90 A;  4PI2 A;  2HKO A;  5D5P A;  3SJA C;  4LF4 B;  2BTO A;  2W6I G;  4JI4 O;  3A8T A;  1XI1 A;  3WB0 A;  1WP7 A;  2G38 A;  1YHQ V;  3AG1 C;  1KEC A;  3RN4 A;  3T1C A;  3THO A;  1FFX B;  3L72 H;  5L3C A;  1TUB A;  4EKW A;  1FAF A;  1FD9 A;  2JK5 C;  1JJ2 U;  1DK1 A;  4TV8 B;  1IBK O;  3B09 A;  1F51 A;  3IC9 A;  1VQP V;  4MVS A;  1EZJ A;  1R3K C;  2R9I A;  1SKV A;  5LOV A;  5CBF A;  3OEH G;  3D36 C;  4UCT A;  3SYQ A;  3JD0 A;  5EC1 C;  1TGO A;  4QNH B;  1SQF A;  1M5I A;  5IYB O;  3E83 A;  2UU9 O;  5LA6 A;  4UCR A;  4L8J A;  2DYR B;  1XOU A;  5LMU O;  3CCM V;  2KQX A;  1VQ6 V;  5L3G A;  2FTK A;  3X2Q C;  5DEC A;  4TT3 G;  1N32 O;  2Q8V A;  2CAZ C;  2QEX V;  2KG7 A;  2CK3 G;  3SYC A;  2PTM A;  1H2M A;  3G6B A;  4IL6 Z;  4X62 B;  1IBM B;  4BR6 A;  4FLZ A;  2OCC C;  3K57 A;  3OMA B;  1QCE A;  2OCH A;  1VF5 B;  5HFL A;  1PD3 A;  3STZ C;  3ZX6 A;  2R9R B;  5EBM C;  4H0L B;  2IJJ A;  2R70 A;  5GTI Z;  2WSS G;  2Y69 B;  4EB6 B;  1FFX A;  1X59 A;  5LMN O;  1SQQ H;  3CHX A;  1YIJ V;  2AHZ A;  4I55 B;  1V54 B;  1Z5V A;  2PY5 A;  2EBO A;  4GUN A;  4TV8 A;  4D6T H;  1VP7 A;  4OX9 O;  3JD2 A;  1L8D A;  3B2E E;  3T4D A;  1BQZ A;  1HNX O;  4AQY B;  3RBZ A;  3SDL A;  3AG7 A;  2Q69 A;  4O4I B;  1KU9 A;  2Q9L A;  4OGQ B;  1QLN A;  3G71 V;  4FVM A;  4HYO A;  3DC6 A;  3K0G A;  2P7T C;  2Q6A A;  4KUM A;  1SQG A;  1SA0 B;  3FB6 C;  2A7W A;  2IW5 A;  3TCU A;  4QIW F;  1H2G A;  3LDD A;  1EBO A;  3C3T A;  1GAX A;  1O9G A;  5GON B;  4LF9 B;  4X9Q A;  5IE9 A;  4LCU C;  2UXN A;  4MSW C;  3OT7 A;  5KHG A;  1WAZ A;  3AK2 A;  2QKC A;  2PYL A;  3SPH A;  4J9Y B;  4YHH O;  1QQC A;  4DV4 O;  4FLV A;  4F6E A;  3O65 A;  1HDJ A;  5J9P C;  3KCX A;  5DN6 G;  5LBQ A;  1Q7Y W;  3UQ8 A;  3T1Y O;  2RDC A;  4Z1V A;  2PI5 A;  4CC6 A;  3AEI A;  3DTU B;  3ZHS A;  4BIU A;  3AG3 B;  1J5E B;  1XMQ B;  1Y6X A;  3SGI A;  2IJI A;  4EB6 A;  1LUW A;  2N04 A;  1P7G A;  1KKD A;  3IGA C;  4I55 A;  5BY1 A;  2ZE6 A;  2EJ7 A;  1E79 G;  2UXD B;  3ML0 A;  2E3C A;  4MW3 A;  4O4I A;  1Q82 W;  2WLH A;  1ZSP A;  1B04 A;  4EFE A;  1AB3 A;  3BVO A;  2ZM6 O;  4X66 O;  2H8P C;  1XHX A;  3CB2 A;  4QPK A;  5L3F A;  2XAQ A;  2W0X A;  2X0L A;  1YTF D;  4FMT A;  2QWP B;  4PA4 A;  4DUZ O;  1OCO C;  2X7R B;  3LDE A;  1SA0 A;  1MA1 A;  3AK3 A;  2UXC O;  1AJP A;  4DR6 B;  2R9A A;  3VQV A;  3ASO B;  4ZHQ A;  3FD9 A;  5GON A;  1AIL A;  2F95 B;  1AI4 A;  3S3X A;  1G8M A;  2Q7H A;  4MTG A;  4ZOL B;  2UUB B;  4DR3 O;  1GM9 A;  3BA8 A;  1FXH A;  1XL6 A;  2EIN B;  1SET A;  3G6E V;  4X1K B;  4PA7 A;  3EFF K;  3FB7 C;  2DE0 X;  3KZI Z;  4ICG A;  2UUA B;  1BL8 A;  3P3P A;  3ZJZ A;  1AJN A;  1K5S A;  1DLB A;  2P06 A;  5K1P A;  3K5O A;  2Y4T A;  4X20 B;  4XBF A;  4DRX A;  1E1Q G;  2KSD A;  3APQ A;  1YEW A;  3I5D A;  2JGU A;  1YIT V;  1EZV H;  2A3Q A;  3E2E A;  3ZN0 A;  1D2D A;  1I5Y A;  1K4C C;  1H2L A;  3JAM N;  1K34 A;  4CS4 A;  1K73 W;  1GMG A;  4B3T B;  3UO2 A;  5FPR A;  4O4H B;  1VF7 A;  5KUM A;  4PHZ A;  5LHH A;  1EN6 A;  1GKF A;  1EN5 A;  1THZ A;  3CCQ V;  4DUY B;  2JJ2 G;  4JYA B;  3RW0 A;  3AG1 B;  3CCJ V;  1Q90 D;  1U97 A;  2ZE5 A;  3LDC A;  1ENV A;  4LFB B;  1F7Y A;  4ZOL A;  3O9O A;  3N2K B;  2Q7E A;  4MT8 A;  1F23 A;  1K7D A;  4J41 A;  4X1K A;  1VQN V;  4DV0 O;  3WU2 Z;  3DSQ A;  2B1I A;  3HKD B;  2GBO A;  3HPL C;  1WPB A;  2BOC C;  5BR8 B;  4GX1 A;  5B1B C;  4HZ3 A;  2DWE C;  3CC7 V;  1JVM A;  4X20 A;  3CCV V;  2R72 A;  2ZE7 A;  1TVK B;  3W7W A;  1R73 A;  3CJH B;  4YIP A;  2OTL V;  5B1A C;  2ZNI A;  3OTO O;  3X2Q B;  1YZB A;  4DV6 O;  3L74 H;  4LFC B;  2IJK A;  2YXL A;  3DC5 A;  1RSO B;  1MNG A;  1YTF B;  2DWD C;  2V7Q G;  2X6C A;  4O4H A;  1XNQ O;  4AIL C;  2VQE O;  1KB9 F;  4J7Z A;  2YEV B;  1S5H C;  4LWS A;  3N2G B;  4J9Z B;  2CTW A;  1EM1 A;  2CDY A;  1CXZ B;  3PN1 A;  1IBL B;  1PL4 A;  4YY3 O;  2A79 B;  3OFN G;  3UO3 A;  3R65 A;  1IVS A;  3CCS V;  1P7B A;  4H37 A;  2QKS A;  2LFS A;  4MVR A;  3STL C;  5CBG A;  3N2K A;  1Q6I A;  3J81 N;  2L35 A;  4A5U B;  3ETQ A;  4X1I B;  3D36 A;  4I0X B;  1VQ7 V;  3HKD A;  2WAM A;  3OEE G;  3SYA A;  3UT5 B;  2AZ0 A;  1BHA A;  2YSU B;  2QM7 A;  2HR3 A;  3KCY A;  4I4T A;  3IC7 A;  3VQX A;  1OHH G;  4I9W A;  2ZIO A;  4NXM O;  2IH3 C;  3L70 H;  1MMM A;  1TVK A;  3E89 A;  4UV8 A;  3ASN C;  3CJH A;  5CN0 A;  1F4M A;  1U96 A;  1Q6H A;  5GTH Z;  1KD1 W;  5A2Q N;  2VQF B;  5KLV H;  5H6R A;  3K03 A;  2H3O A;  5EC2 C;  2M6Y A;  4WFA V;  1RSO A;  4CS2 A;  3MAQ A;  3L75 H;  3LNN A;  2AGA A;  3LSS A;  1Q3E A;  1M56 B;  1SQB H;  2P6J A;  1XMO O;  1XDC A;  1MZE A;  4XDK A;  1SZX A;  5DED A;  2GHY A;  2BCC H;  2XOK G;  2YEV A;  4R7C A;  3N2G A;  4MTF A;  1N34 B;  1PNK A;  1M57 B;  5IT9 N;  1WA8 B;  2OTJ V;  1AP6 A;  1QBZ A;  3CS5 A;  3K06 A;  2HVJ C;  1M90 W;  1RM1 C;  5H6Q A;  5KA5 A;  1WPX A;  2JIZ G;  4LP8 A;  1SC5 B;  3ABK C;  4JV5 B;  4NB5 A;  4UB8 Z;  4X1I A;  4I0X A;  3JAT B;  4FZ1 A;  2DMX A;  1H2K A;  4JYY A;  1G6U A;  4O2B B;  4RO2 A;  3UT5 A;  4OXS A;  1FYJ A;  1IZ3 A;  2MW2 B;  4JI8 B;  3K5M A;  4H13 B;  3E22 B;  3VBB A;  3B8N A;  5IY5 C;  2ATK C;  2ADP A;  2OT5 A;  1AI6 A;  4X64 O;  3T1H B;  2E5L O;  3K59 A;  2OIE A;  3LNM B;  3CCE V;  1DGS A;  2Q0A A;  3PJS K;  4JI7 O;  4GKJ B;  5D5Q A;  2VRZ A;  1S77 D;  2EX3 A;  2ZXW B;  1N33 O;  1B06 A;  2ETN A;  4LBE C;  2EIK C;  4X88 A;  3AG4 C;  1PV0 A;  3E86 A;  1VQ4 V;  2JJ1 G;  4DW1 A;  2MK3 A;  1Y66 A;  4E2L A;  3K58 A;  4LF7 B;  5KHJ A;  2ZQM A;  4PEL A;  1IXM A;  3JSL A;  1WA8 A;  4LC1 A;  4UUJ C;  3OR6 C;  1HR0 B;  1BMF G;  3OGC C;  2XHB A;  1V55 C;  5LYJ B;  2QTS A;  5JWP A;  1XNR B;  1KMI Z;  4I50 B;  5F2V O;  2JEX A;  1OZ0 A;  3ZN1 A;  5FLX N;  3D8C A;  2X6B A;  1SQP H;  1VQ5 V;  1VQ9 V;  4GCZ A;  1AJQ A;  3OD4 A;  4X65 B;  1R3L C;  1J95 A;  3JAT A;  1I7F A;  2YI8 A;  4CH4 A;  2FML A;  2DJV A;  3J7A U;  2DQ0 A;  2QSA A;  3B8M A;  4O2B A;  4B7E A;  1YI2 V;  2IJH A;  3E22 A;  1S3J A;  4JI5 O;  1WNS A;  3ABL C;  5IWA B;  4DV1 B;  1MOF A;  4NTY A;  1KKC A;  1FJG O;  3CRR A;  5IJ0 B;  2RMK B;  2W0F C;  1NH2 D;  1K92 A;  3K3W A;  1QR9 A;  3G80 A;  1K8A W;  3AK1 A;  3QO8 A;  3BHP A;  4JI4 B;  3OUS A;  2XAS A;  2W6J G;  2QWO B;  2EIL B;  1K9M W;  3HB3 B;  1BGY H;  5DM6 V;  1IBK B;  3L73 H;  4I9Q A;  3I55 V;  3CRC A;  1QVF U;  5LYJ A;  1S5J A;  2VWK A;  2ARH A;  4LF8 O;  1FFT B;  1HNW O;  2RJZ A;  4I50 A;  4JAV A;  4WFB V;  4UV9 A;  4WFG A;  4DR7 O;  1MZF A;  4QE7 A;  3N27 A;  5CBH A;  4J80 A;  3QTC A;  2UU9 B;  1XEQ A;  3CRM A;  2BTQ B;  3JSN A;  2HHH O;  3ZMV A;  3BAA A;  2BOB C;  5LMU B;  2Y0P A;  4GX5 A;  3NR7 A;  2EUL A;  2NNU A;  3LUT B; 
#chains in the Genus database with same CATH homology
 5FLX N;  2F4V O;  4LF5 O;  3OTO O;  1YZB A;  4B3R O;  2UUC O;  4LF4 O;  4DV6 O;  5IT9 N;  4DR6 O;  4AQY O;  4DR4 O;  5BR8 O;  4KHP O;  2DJV A;  3J7A U;  4JI0 O;  2ZKO A;  4LF6 O;  4DR5 O;  2UU9 O;  4YHH O;  1HR0 O;  2UUB O;  1XNQ O;  4DV4 O;  2JRI A;  2VQE O;  1NS1 A;  1D2D A;  1R1B A;  5LMU O;  3O65 A;  4JI5 O;  1XNR O;  1KUQ A;  3T1Y O;  4OPH A;  3J80 N;  3JAM N;  4YY3 O;  1N34 O;  1N32 O;  2UUA O;  1G1X B;  1FJG O;  4LF9 O;  4DV3 O;  1J5E O;  4LFC O;  4X65 O;  1FYJ A;  4B3T O;  3J81 N;  2UXB O;  3F5T A;  5BY1 A;  4DR1 O;  4JI8 O;  3R66 A;  4GKK O;  4X64 O;  2E5L O;  4OPA A;  4A5U B;  4B3M O;  1N36 O;  5IWA O;  4JV5 O;  4DV1 O;  1IBL O;  1F7Y A;  1X59 A;  1AB3 A;  5LMN O;  4JI7 O;  2N74 A;  2ZM6 O;  4B3S O;  4X66 O;  4LFB O;  1XMQ O;  4JI1 O;  5LL6 Y;  1N33 O;  1FKA O;  3RT3 C;  4K0K O;  4DUZ O;  4NXM O;  5BXZ A;  4OX9 O;  4X62 O;  4DV2 O;  1R6T A;  4DV0 O;  1IBM O;  4LF8 O;  2UXC O;  4DV7 O;  4JI4 O;  4JI3 O;  1HNW O;  1HNX O;  1HNZ O;  4DUY O;  3SDL A;  4JYA O;  3T1H O;  4DR7 O;  4NXN O;  2UXD O;  5A2Q N;  1AIL A;  4LF7 O;  2DOS A;  5H5N A;  4JI6 O;  2VQF O;  1XEQ A;  4JI2 O;  4LFA O;  1A32 A;  2Z0A A;  4DR3 O;  2FKX A;  2HHH O;  4DR2 O;  1DK1 A;  2LW7 A;  2AGA A;  1IBK O;  4GKJ O;  4DV5 O;  1XMO O;  3M8A A;  1I94 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...