4LF8O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf8O00
2DOSA 3R66A 5A2QN 3T1HO 1XMOO 4AQYO 1HNWO 4KHPO 1J5EO 1R6TA 4JV5O 3RT3C 4DV1O 3JAMN 1R1BA 1I94O 4OPHA 4DUZO 1FJGO 4JI5O 4NXNO 1YZBA 4JYAO 4DV7O 1NS1A 4X65O 4LF8O 4K0KO 4JI8O 1XMQO 1HNZO 3F5TA 4LFCO 3M8AA 4LF5O 2VQEO 4X64O 1IBMO 4B3SO 4DR2O 1D2DA 4OPAA 4DV4O 2AGAA 4JI7O 2UUAO 4GKJO 5H5NA 5IT9N 5FLXN 5BR8O 4X66O 4LF4O 4DV0O 3J81N 1N34O 4OX9O 1IBLO 1FYJA 5BY1A 1XNRO 1AILA 4DR7O 1N32O 4JI3O 5BXZA 4JI6O 2VQFO 4YY3O 4JI4O 2ZKOA 2N74A 4DUYO 2E5LO 2UUBO 4DV5O 4DV2O 4LF7O 1DK1A 4DV6O 4JI2O 4DR3O 2UUCO 1XEQA 3J7AU 4JI0O 3OTOO 3T1YO 1KUQA 1N36O 1IBKO 1F7YA 2ZM6O 3O65A 4A5UB 4DV3O 2HHHO 1FKAO 4DR4O 4DR5O 1XNQO 4GKKO 4JI1O 4LFAO 2F4VO 2LW7A 2JRIA 4DR6O 4LF6O 2FKXA 5IWAO 3J80N 2UU9O 5LMNO 2UXDO 2Z0AA 4YHHO 4B3TO 5LL6Y 1HNXO 1AB3A 1A32A 1N33O 4B3RO 4LF9O 5LMUO 4B3MO 2DJVA 4NXMO 4DR1O 3SDLA 1HR0O 4X62O 4LFBO 2UXCO 2UXBO 1X59A 1G1XB
chains in the Genus database with same CATH superfamily
4WFAV 3LDDA 3E83A 1R6TA 1NTMH 5KX5A 4RQEA 3L71H 1I94O 2N04A 4Q20A 4PELA 4DR2B 1VQKV 4LF7B 1DGSA 1R6KA 2B9ZA 4ZIBA 5KHHA 4XDKA 1HNXB 3ASNC 1H38A 3M8AA 2NN4A 2FTKA 3SPHA 3JSLA 2AGAA 4DV4O 2PYLA 5CBGA 3G71V 5L3GA 3WG7B 2QKAA 5DECA 3SYPA 1GMGA 4J9ZB 2OCCB 3AG4B 2UUAB 1AILA 2LFSA 4R7CA 2UXDB 2D3OW 3BY6A 3UT5A 3MHHC 4JI6O 2FMLA 3OW2U 2X6AA 3ZHQA 1BHAA 5IJ9B 1XI1A 4JZGA 5LOVA 2QA4V 2WLLB 4CBCA 5KHGA 1NH2B 3WB1A 5JWPA 4JI0O 3ZMUA 5EIBC 4NTWA 3CCQV 3SYQA 1O9HA 3CXHF 2KKWA 1KU9A 3SR2C 3SPGA 1QHTA 4K3AA 4U7NA 3HB3B 3JD3A 1KC8W 5GTHZ 3MDSA 4GCZA 2WA4A 5KAIZ 1GO3F 1OCOC 1SA0B 1Y66A 2EZOA 1T5EA 5KA5A 1K5SA 3E86A 2P4VA 4B3RO 4HYOA 1F4NA 4DR1O 3SDLA 4X9QA 1E1QG 5EZYA 2Q7HA 3WU2Z 1J5EB 2UXCO 1ROPA 2CTWA 1X59A 3CRRA 1RM1C 1TA8A 1QLEB 2ZD9A 1R1BA 4YIOA 1XNRB 3SGIA 4H37A 3E8GA 1G8MA 4DUZO 1ZAUA 1XHXA 1YZBA 3EXAA 2QSAA 1Y76B 3OUFA 1R73A 3JAWA 2DYSC 3N2KB 3ZRWA 3F5TA 5LGNA 4X89A 1OCCB 1M90W 1VEWA 4I50B 2JGDA 3CB2A 4DUYB 4IIJA 1EM1A 4O4LB 4OPAA 2LW1A 2HVKC 1K7DA 2IJJA 4LH6A 1AJQA 5BR8O 1M5IA 4LP8A 1XMOB 2P06A 4PA3A 1KECA 1JPXA 1AROP 1SQPH 2H8PC 3CCSV 3GWOA 1ZL8B 5D5QA 5B1AB 4JI3O 4UVBA 4JI7B 3TXSA 2N74A 1RFYA 4MW8A 5EK0A 2BOCC 3BVOA 4QIWF 1NBMG 1YXBA 2Q4PA 5JCOA 4EEQA 3U0ZA 3AK1A 2RNBA 2ZM6B 1MZEA 4IT5A 2CTQA 3BCCH 4DR6B 1SS3A 4DR4B 4WBNB 2F4VO 1Q90D 1R3IC 1NJIW 3U10A 1S5LZ 4NVPA 1G6UA 1QQCA 4FIPC 4X20A 1YHQV 3EHBB 1M56B 2LFRA 4DV2B 2F1MA 5L3DA 1HW7A 5IE9A 1I94B 4P2ZA 5CA1A 1LUVA 1MZFA 1Z5VA 3K5OA 3KG2A 1FXKB 3TK1A 1M1KW 4NXNO 5LXTB 1YSCA 3RBZA 3RYFA 2E75B 2A7WA 1SQVH 3K08A 5B1NA 4TSFG 5KLVH 5J2UA 4DR2O 1D2DA 2YIDA 1BHBA 3HKBB 2MK3A 1AJPA 2UUAO 4JAUA 1I7FA 1SQXH 1I0HA 5FLXN 1VIBA 1SF9A 2EZPA 4WCEV 1JMKC 5LHIA 3OGIB 2NR5A 1N34O 2XAQA 1L8DA 4U3JB 1IBLO 4B3MB 1KBHA 2QTOA 4F6RB 3JD4A 3LUTB 2QGNA 3G4SV 1H2GA 3E8FA 2E3CA 3N27A 2PI4A 1ZSPA 1Q3EA 1Q82W 1F23A 1M56C 1P4RA 2ITDC 4DV6O 4TV8A 3NR7A 1WPBA 5CBHA 3L9DA 4UVCA 3T1YO 2C2AA 1MNGA 3O65A 4JF3A 1KKCA 4DR3B 1N0JA 4X1KB 2L6LA 4O4HB 1NVPB 3T1HB 4K8XA 2PI5A 4PD4F 1OCCC 2YEVB 3QO7A 1LR1A 1WPXA 4LFAO 1JOYA 4PJ0Z 1QNMA 3E8BA 4GZRB 5IWAO 1US6A 2IH1C 3MAQA 2XHBA 3ABKC 3ZRXA 5KHIA 2Z0AA 3DTUB 4LC1A 2Y4TA 3BRCA 2ZT9B 4L8JA 1QVGU 3H1LH 4X62B 2UXBO 3WB2A 1W0KG 4Z1VA 1UFIA 1XQ8A 2YDEA 2OWOA 2N05A 4K0KB 3JAMN 5FPOA 2JS5A 4ZHQA 5LA6B 3QG5A 2IU3A 1Y67A 4CH3A 5F2VO 4X64O 4PDLA 2AZ2A 2ZINA 3L74H 4DV4B 3ZHUA 4MVMA 4O4JB 4B7EA 4UV8A 2YI9A 1FXKC 3ML0A 1MABG 3K06A 1QCEA 1CEZA 1KMIZ 1PV0A 1WAZA 1NKDA 5ITZA 3ZHSA 4KFMA 4D7TA 2ZCEA 1H8EG 2BTQA 3L72H 3E8HA 1NR7A 5IYBO 4YY3O 2UUBO 1Y4MA 3OEEG 1R3KC 2KSDA 3KZIZ 2QM7A 1RPRA 2A3QA 3B2EE 4J7ZA 2WLHA 4TV9B 5B3SC 2QR4A 1XOUA 3G67A 1N36B 4RQFA 5JH7B 2A06H 3A0BZ 4JI1O 5CMUA 1ZLZA 4HBNA 1MOFA 2BSKA 4LCUC 1GN6A 4GKJB 1IXMA 5JJEB 5JQGA 2YC0A 4J42A 1CPYA 2PF4E 3H9VA 3X2QC 2F4VB 1RP3B 2DJVA 2HFEC 1GTOA 3VQXA 2Q69A 3JCUZ 1GN4A 1HR0O 3T4ZA 4X1IB 1M9NA 4FFBB 5H2FZ 1Q81W 1CP9A 2WA3A 4FZ1A 4WFBV 2W6IG 4MVQA 2GTSA 3FYIB 2DOSA 5EIBD 5A2QN 3G6EV 4X8AA 1Y74B 1KB9F 1FFXA 5B1AC 4I5SA 5E79Z 3Q4HA 2UU9B 3RFRA 1Q6UA 3PJSK 3K0GA 1OV9A 1WA8B 2R9IA 1YCIA 1MA1A 1XMQO 1JX9A 5GW7A 4JASA 3JATA 4JI3B 5C8YA 2RDCA 3KCYA 1KD1W 1BCCH 3OR6C 4J11A 4F6RA 3TGUH 3CJHB 1K8AW 1SQGA 2Z5UA 5BR8B 2EULA 1VQOV 2R70A 4EFBA 4OX9O 3P3PA 4RUFA 5JJNB 1QLEC 4B08A 4J80A 5FPRA 3M7MX 3QNEA 5K1PA 2DW4A 2P7TC 1P7BA 1HR0B 3N2KA 3ZRWB 4B3TB 2X7RB 4X1KA 1NI8A 5KHJA 4BWAA 1SA0A 1SQBH 4GKKB 4HNAB 4RUEA 5IJ0A 1YEWA 3K9SA 1ORQC 1VQ6V 1NH2D 4BR6A 3CP1A 1M57B 3L73H 1GN3A 1B06A 1G4YB 5LL6Y 5J2TB 1A32A 4UCVA 4NTYA 3NXSA 3G6BA 3CEIA 2GSMB 4CH6A 3CRAA 4QGPA 4IGGA 4LFBO 1VP7A 4PV1B 4NXMB 4DO2A 2EX3A 4UCSA 3E89A 3ICXA 4GX5A 1J5EO 1V55B 3PN1A 1YTFB 3UT5B 4J41A 2HG5C 5EC1C 4O4JA 3T1CA 4DRXA 2EILC 3APQA 4AQYB 2F95B 3F7YC 3VQYA 1WP8A 2UXXA 4GKJO 5D5PA 2K9PA 1QU7A 3SYOA 1Y6XA 2JS3A 2BE3A 2P6JA 1N34B 4QPJA 1XNRO 1WB7A 4DUZB 3CMEV 3TJTA 1IBMB 4FMTA 3E2EA 5BZBA 2LO1A 5L3EA 2VRZA 3ZHRA 2GHYA 4Q6GA 4JI4O 4JI2B 1K34A 1I5XA 3LDEA 1YI2V 2H3OA 4LF4B 5IYZA 1D5AA 1XREA 4E2LA 1SERA 2P90A 4IYHA 4KP4A 4I55A 1IBKO 1WJZA 1F4MA 4KHPB 3JASA 5JQGB 2OCHA 3B77A 4DR5O 1XMQB 2L35A 5L3CA 1H2SB 1IBLB 2FL4A 3FB7C 4ZOLA 2PY5A 4PA6A 3DGEA 4D6TH 5EBLC 5LMNO 2JGDB 3DSQA 3K5LA 3SJBC 4C7UA 4I7ZB 2EIMB 3CCRV 3CCVV 3CRMA 2HP8A 5DEDA 3A2FA 1H2KA 2HKOA 1BSMA 3F5WC 2M6YA 3VBBA 3CE2A 4CS2A 4O2BB 2B1GA 4CZZA 1VQNV 1Q6HA 5LXTA 3B09A 4IHJA 3CCUV 1OCZC 4DV1O 3RYIA 3HPLC 1BE3H 4UV9A 3RYCB 3OMAB 3BA8A 1Q86W 3ZS8C 5GONB 1XDCA 4BIZA 2ODMA 1L0NH 2OYQA 3A8TA 4EFEA 5JH7A 3J81N 4XDLA 1BQ0A 1JJ2U 2M7WA 2P5OA 1FYJA 1VQ5V 3CMAV 2Y48A 2VQFB 1N32O 5IY5C 4B3SB 3H01A 2EIKB 4DR1B 2LGWA 1HWYA 4B3RB 3CRCA 5BXZA 2B5UA 1P84F 5IYDO 2DMXA 2EINC 3ABMC 2CDYA 5KHKA 4LF7O 2IU0A 2BCCH 3K5MA 4NKGB 3ETEA 1AI4A 2DN9A 2F43G 5B5EZ 1HNWB 1SETA 3CXCU 2ZNIA 1FFXB 2NLJC 3SYAA 2CAZC 1GAXA 4TUYB 4I9QA 1VF6C 2A9HA 2ZXWB 5J2TA 5CBFA 1FAFA 5LHHA 3WFVA 1VQLV 1N0NA 1BQZA 5IDJA 1TUBB 2UXDO 3RGBA 4QPKA 2JEXA 1SC5B 3ABUA 1R3LC 2V1DA 2E74B 3JD2A 1COWG 2KG7B 2PTMA 3JAKA 3LSQA 2CTPA 2GBOA 4R50A 4JYCA 1PPJH 4MVSA 3F7VC 3ZN0A 1S3JA 1K73W 3TXQA 4FK5C 3BA9A 2P67A 3BHPA 5IY5B 3ETQA 1VQ8V 2WSSG 5CA3A 1HNZB 3JCZA 2Q7GA 4MT8A 3OM3B 1V9PA 2HEPA 4WBNA 4DV7O 1K5QA 4MW3A 3OUSA 4K0KO 4JI8O 1EZJA 3K9AA 4PI0A 4WFGA 4NB5A 1KQSU 3N2GA 1OJHA 3ABLC 3VQVA 1VQMV 3JAWB 4R6ZA 2UXBB 4FM1A 4XBFA 3ABMB 4O4HA 2CTRA 4O4LA 2RCVA 1BZKA 1PNMA 4I0XB 2Y0PA 3Q4HB 4AI8A 5KAFZ 1RM1B 2RQ6A 1WA8A 5JJJB 4JYYA 2QM4A 1I08A 3B8NA 3JASB 1EN5A 4DV2O 3D36A 3H1KH 2QWNB 4O2AB 2YUAA 2IM9A 2EIJC 4H33A 2W0FC 2YIBD 2X0LA 2JDIG 2HJDA 4H13B 3CJHA 4QNHB 4U7OA 2ITCC 1TGOA 1XNQO 2AHZA 4RAIA 4GKKO 2ZE6A 5B1BB 5KMGB 1ENVA 1AI7A 1AJNA 1K92A 2FKXA 4YY3B 3FX7A 1L0LH 1GH6A 3ZIAG 2O57A 1V55C 5KUKA 1XUQA 2YS8A 4YHHO 1Q5OA 4JZ2A 2EINB 1N33O 3OGCC 3ZEDA 5A9GA 4B3MO 5DN6G 3RVYA 2UXNA 4Z1MG 4CS3A 4GYCB 3RYIB 3ZRVA 3ZMTA 2XT9A 4AQYO 5J9PC 4DXWA 2UUCB 3OTOB 3CC4V 3ETDA 4X65B 2E76B 1Y74A 4CS4A 4LF8O 4MTOA 3K0DA 1SESA 4PA7A 4JI6B 4LF6B 4LFCO 1RPOA 3CCJV 3I55V 1IBMO 5L3BA 2OTJV 3JD0A 4TV9A 4JI7O 5CB4B 1QLNA 1FFTB 4GUNA 1HP8A 3UKMA 4LFAB 4CH5A 4DV0O 4KUMA 1H2NA 1PL4A 3DXRA 5LBQA 5K1XA 1DF5A 2IW5A 4D7SA 3S3WA 2RJZA 2ZDIA 2BOBC 4I9WA 3AG2C 5C93A 4FM2A 1B6QA 3R65A 2LP7A 4UCRA 4ZHQB 3B4SA 2DYRB 2YSUB 3WB0A 2X6CA 5IYCO 2AHYA 3HKEA 3JSNA 2DYRC 2HJFC 4FFBA 2JEUA 1XEQA 4J7JA 4TUYA 4QJFB 2ZM6O 4MTXA 1FKAO 4UUJC 2FYUH 2ZR2A 3MHSC 4LR3A 4Z2WA 1K3EA 1WN7A 1RSOB 1VMGA 3CWBH 4YJ2B 3ASNB 4LF6O 2YIBA 3AK3A 3ZBHA 1U97A 4PA9A 1F51A 1KYOF 2OT5A 3LNNA 3TETA 3JATB 1EN6A 1XL6A 4LF9O 2WLIA 4F6EA 4EKWA 1JFFA 1SRYA 2H94A 4FLXA 3K04A 1TVKB 4OGQB 3ZMZA 3CD6V 1G1XB 3K58A 1XMOO 2VWKA 2ZE7A 2Q5ZA 4KHPO 3ZCCA 2Q7EA 2PZSA 1MMMA 4GT1A 1FJGO 2YI8A 4L87A 3JYCA 3K79A 4P30A 4NR1A 1PM9A 4UB8Z 4B3SO 3BEHA 3JARB 2FB5A 1S5HC 1AP6A 4U3FH 3ABLB 1YTFD 1EN4A 3HKDA 1VQPV 3AK2A 3QO5A 1YJNV 3FAVB 2VS0A 4X66B 4G27B 1VARA 5IJ0B 5EC2C 4TQDA 1GN2A 4DV6B 5BY1A 3AG3C 2R9AA 3UCSC 4ZI7B 5IYZB 3D3IA 1L1FA 4FJCC 1OCRB 1SZXA 2WLNA 3CCLV 3CC7V 4MVOA 1YJ9V 4DUYO 3RYCA 1BS3A 3JAKB 3JD1A 3ABTA 4FVMA 1ZUQA 4EB6B 1IDSA 2Z3YA 3SJCC 5BMVB 5TISZ 3AG7A 4A5UB 3ETGA 2Q73A 1PNKA 4LFCB 1IBKB 1NR1A 1LUWA 5HFLA 2QTSA 4I55B 1Q7YW 2JK5C 2CK3G 1K4DC 4DR6O 4UCOA 4FLZA 4OXSA 2R72A 3CS5A 1ZX3A 4KXRA 4QE9A 3ZX6A 1AB3A 3APOA 5LMNB 1NT2B 3A0HZ 2VQEB 1NVPD 2NNUA 4BIOA 1GM8A 4W4LA 4LNUA 2XASA 1K97A 4UXNA 2P22C 2ETNA 4AILC 5KUMA 3C90A 5L3FA 4DYLA 3FB5C 1FS0G 4BIUA 2ZXWC 4PDRA 2E5LB 5CB4A 1NS1A 2Y0IA 3AG3B 1K4CC 1M57C 2QM8A 3D3QA 4O4IB 1OCZB 4ICGA 1XL4A 2OTLV 1JCHA 4FM0A 1XBLA 5FL7G 2OIGA 5IT9N 4JAVA 1AR4A 2G38A 2DWEC 5B1BC 5GONA 2AXTZ 1V54C 2GTAA 1LNQA 3FB8C 1R3JC 1JJOA 2EJRA 4ZOLB 4UVAA 1NQTA 3L75H 1MSWD 2AZ0A 5CA0B 4JYBA 3CCEV 5IWAB 4YJ3A 1GM9A 3CHXA 4DV5O 5LP6B 3K57A 3E22A 3ZHVA 1RSOA 4DR3O 4K8ZA 4UCTA 3SYCA 4TT3G 1KUQA 4HZ3A 4DK0A 4G28B 4PDMA 3U11A 1WB8A 5FNVA 2ZE8A 2XUMA 1P7GA 3W7XA 1IZ3A 3K03A 4N21A 5JVDA 4DV3B 2HHHB 2ZE5A 2QKCA 2ARHA 4LF9B 3J80N 5EYPA 4XDJA 2WPDG 4BW5A 3ZMSA 1VQ9V 4HNAA 1P49A 1GKFA 5JCOC 3SPCA 1PNLA 2LQTA 2EJ7A 2Q9LA 4MVUA 3B8MA 1X4TA 1WNSA 2IBZH 2VWJA 4FFKA 1E1RG 1OCRC 1VF5B 3T1HO 4BAYA 2KB1A 1QVFU 2WLMA 1JVMA 3AG2B 1AI5A 2QE7G 4YIPA 1H2LA 2GDSA 4X65O 4X88A 2JJ2G 1HNZO 5AG2A 1Q43A 1AP5A 3AG1B 4BW9A 2QDOA 2F23A 2XOKG 4X1YB 1URFA 4J10A 4YHHB 1AR1B 4IL6Z 3QVNA 3OMIB 4I4TB 3A0RA 2HR3A 4DRXB 5H9CA 2JVDA 2YIAA 4LWSA 4OX9B 5H6RA 4GLXA 3LSSA 4JAAA 3JALA 5DM6V 4CC5A 2D2CB 1SKVA 3FB6C 4IHJB 5KX5B 2UUBB 4PDVA 2WLIB 1S5JA 2RMKB 3P32A 3IJ4A 1FXVA 4AHCA 4LBEC 3RYHB 5LYJB 1W2BU 1E79G 1Q8IA 1WLEA 1W59A 1N36O 4JV5B 3EVKA 4O2AA 3CYOA 1S77D 1KKDA 3W7UA 2A79B 3HR0A 3P30A 2EIJB 3BFRA 2LW7A 2DYSB 4J7KA 2CE4A 2W6JG 4IIJB 2Q68A 4FPPA 4LNUB 1HNXO 3DC5A 1TUEB 2CH7B 3C3SA 4JI4B 1N32B 4X62O 1S72V 1FPOA 2HVJC 4WFEA 1AI6A 5GTIZ 3DC6A 3R66A 1B04A 2QKSA 4CH4A 4K35A 1SZTA 1YIJV 4ZI7A 1M93A 3SPIA 2V7QG 4CC6A 1W0JG 3ZJZA 3I56V 4LF5B 3CX5F 1GRJA 3AEIA 4ASUG 4OPHA 3IC9A 4O2BA 3S3XA 1S0VA 1THZA 3D36C 2Q0AA 1OCOB 5H6QA 1TUBA 1M4UA 1R6NA 1CXZB 4X64B 2F66C 1BT8A 3SPJA 5HFMA 3K3WA 1Q6IA 2ZIOA 1NTZH 2JGUA 4X66O 4JYAB 4LF4O 5LMUB 5LP6C 2LJ2A 3KCXA 3GVMA 3QO8A 3H1JH 1FD9A 4E4EA 3E22B 2GUZA 3HKCA 2P4KA 3CCMV 4TV8B 1Y76A 4G2KA 2OCCC 2Y4UA 1NU1H 1ZWIC 1U96A 4NXNB 4X20B 3RW0A 4PI2A 1XILA 2EIKC 2WLKA 3J7AU 3JARA 4DR7B 4W4KA 5IJ9A 4YJ2A 4DV3O 2HHHO 4UCUA 5LOVB 3D8CA 1DTOA 2IJKA 2QJ1A 4DV7B 4YXWG 2PYJA 2ADPA 3OR7C 3AG1C 4ABMA 2XTAA 3RYFB 1H8HG 5EZYB 4J9YB 2XAJA 2X6BA 1VQ7V 4P9PA 4B3TO 1H2MA 2V4DA 5EBWC 4NXMO 4WFFA 1EBOA 4MSWC 1IVSA 1K9MW 3H1IH 4JTCB 1GK9A 3CRQA 4P9OA 3OT7A 1HNWO 2KG7A 2ZDIC 1NTKH 1JFFB 2Q0OC 4R8CA 2EIMC 3C3TA 1NZ6A 5KMGA 1UJWB 2IJIA 3CSXA 1PD3A 1V54B 4JPRA 5LGTA 3HKDB 2ILMA 2WLLA 1K33A 4RO2A 3FKSG 4PHZA 4FZ0A 3X2QB 4FLTA 2Y69B 4LWSB 3L70H 1AR5A 1YF2A 1BL8A 1SQQH 2BTQB 3FYEB 3N2GB 1QBZA 3CC2V 2CUGA 5CA1B 2XAHA 5JVDB 2ZR3A 1N33B 1FJGB 3O9OA 4TOIA 3RVZA 3E35A 2Q6AA 4MTGA 1VF6A 1O9GA 1BMFG 4I0XA 3ZN1A 1EZVH 2E5LO 3IC7A 1VQ4V 1ZL8A 4DV5B 3UO3A 2CGOA 4NYKA 4JI2O 2R9RB 2UUCO 3KKYA 5J2UB 1YJWV 3T2MA 4FLWA 2AW9A 3OTOO 1TAEA 2A0LA 1MSDA 4MVRA 2ZNJA 1Z5WA 2BTOA 2Y69C 1XHZA 4EB6A 1HDJA 1GM7A 1ZTEA 1SQFA 2YXHA 1MG1A 3K5NA 3RN4A 1N8RW 4JI0B 1IXBA 2EILB 2HLDG 4UFZA 1YDXA 2ZIMA 2ZQMA 5CA0A 3T4DA 2QWOB 4QE7A 5B66Z 4IYIA 2PGGA 5LMUO 3HKEB 5LP6A 1J95A 2ADQB 3FAVA 3LDCA 4GX2A 1BGYH 2UXCB 4DW0A 1UPGA 2DE0X 4FLVA 3JALB 3RT3C 5B1OA 4JI5O 4KL1A 1PKXA 4WFHA 4JI1B 3ZMVA 4LF5O 2VQEO 4H0LB 2WAMA 2GV9A 5BMVA 3P3NA 4MTFA 5H5NA 3UQ8A 3CPWU 2CGNA 2GUZB 1QR8A 3BAAA 3HKCB 3IFXA 3T1YB 3THOA 1PL0A 1TVKA 4O4IA 4JTAB 3OTFA 3VQWA 4UB6Z 4TQFA 5B3SB 3SJAC 1DLBA 3OE7G 3OAAG 1N4CA 2VQFO 4U3JA 3DXRB 5LA6A 3EFFK 4TWKA 1DF4A 3STLC 3IGAC 4YJ3B 2MW2B 3STZC 3ABKB 5EYPB 4DR5B 4WF9V 4H44B 4I4TA 3W7SA 2ATKC 4RWUA 3VOUA 2OIEA 1FXKA 1FXHA 1QR9A 2K1EA 3RWRD 5LHGA 5FNVB 3OD4A 3G80A 4JGSA 4GX1A 3TCUA 4DW1A 5LGUA 1YVWA 2YXYA 2YICA 2YXLA 3HKBA 2WWWA 1KP3A 3H1HH 3LNMB 5KA6A 1EFRG 3OFNG 4ZBMA 2EBOA 2XAFA 3IAYA 4LH7A 3OEHG 2PUSA 4F4LA 2IH3C 4JV5O 1AVMA 5EBMC 3SJQC 1YITV 3WG7C 1OZ0A 4X1YA 3M99B 4JYAO 1JR9A 2F93B 3BABA 4FLYA 4LF8B 1B3QA 3LSUA 1VF7A 2KQXA 1Z2GA 4JI8B 1JA8A 4DK1A 5ITZB 4PA4A 4FLUA 3QTCA 2DQ0A 2CH7A 2WLJA 4B7KA 2LGQA 4X1IA 4I50A 3MD0A 4DV0B 2YEVA 2JIZG 1S76D 1PP9H 4NTXA 4HAMA 4DR7O 3OMNB 4LFBB 3I5DA 3BPZA 2ZKOA 4ZKIA 3UO2A 1DK1A 2W0XA 3AG4C 3FFQA 3FD9A 5E1AC 2DWDC 5C8YB 3ZHTA 1JQ0A 2BSKB 3GB7C 1F7YA 3QF7A 4DR4O 4GX0A 4DV1B 2DQ3A 2QWPB 1OHHG 2QEXV 2QWQB 3W7TA 1IURA 3ZRSA 3RYHA 5LYJA 3W7WA 2QWRB 2XNDG 1IX9A 1KP2A 2RN9A 2JRIA 2UU9O 3GWKC 2Q8VA 2IJHA 4MS2A 5CN0A 2XAGA 1WP7A 4MVZA 2B1IA 3UM7A 1D5NA 4N23A 1I5YA 3ASOC 3B40A 3K59A 3ASOB 4JTDB 2JJ1G 2Q67A 1XNQB 4JI5B
chains in the Genus database with same CATH topology
2DOSA 3R66A 5A2QN 3T1HO 1XMOO 4AQYO 1HNWO 4KHPO 1J5EO 1R6TA 4JV5O 3RT3C 4DV1O 3JAMN 1R1BA 1I94O 4OPHA 4DUZO 1FJGO 4JI5O 4NXNO 1YZBA 4JYAO 4DV7O 1NS1A 4X65O 4LF8O 4K0KO 4JI8O 1XMQO 1HNZO 3F5TA 4LFCO 3M8AA 4LF5O 2VQEO 4X64O 1IBMO 4B3SO 4DR2O 1D2DA 4OPAA 4DV4O 2AGAA 4JI7O 2UUAO 4GKJO 5H5NA 5IT9N 5FLXN 5BR8O 4X66O 4LF4O 4DV0O 3J81N 1N34O 4OX9O 1IBLO 1FYJA 5BY1A 1XNRO 1AILA 4DR7O 1N32O 4JI3O 5BXZA 4JI6O 2VQFO 4YY3O 4JI4O 2ZKOA 2N74A 4DUYO 2E5LO 2UUBO 4DV5O 4DV2O 4LF7O 1DK1A 4DV6O 4JI2O 4DR3O 2UUCO 1XEQA 3J7AU 4JI0O 3OTOO 3T1YO 1KUQA 1N36O 1IBKO 1F7YA 2ZM6O 3O65A 4A5UB 4DV3O 2HHHO 1FKAO 4DR4O 4DR5O 1XNQO 4GKKO 4JI1O 4LFAO 2F4VO 2LW7A 2JRIA 4DR6O 4LF6O 2FKXA 5IWAO 3J80N 2UU9O 5LMNO 2UXDO 2Z0AA 4YHHO 4B3TO 5LL6Y 1HNXO 1AB3A 1A32A 1N33O 4B3RO 4LF9O 5LMUO 4B3MO 2DJVA 4NXMO 4DR1O 3SDLA 1HR0O 4X62O 4LFBO 2UXCO 2UXBO 1X59A 1G1XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOS A;  3R66 A;  5A2Q N;  3T1H O;  1XMO O;  4AQY O;  1HNW O;  4KHP O;  1J5E O;  1R6T A;  4JV5 O;  3RT3 C;  4DV1 O;  3JAM N;  1R1B A;  1I94 O;  4OPH A;  4DUZ O;  1FJG O;  4JI5 O;  4NXN O;  1YZB A;  4JYA O;  4DV7 O;  1NS1 A;  4X65 O;  4LF8 O;  4K0K O;  4JI8 O;  1XMQ O;  1HNZ O;  3F5T A;  4LFC O;  3M8A A;  4LF5 O;  2VQE O;  4X64 O;  1IBM O;  4B3S O;  4DR2 O;  1D2D A;  4OPA A;  4DV4 O;  2AGA A;  4JI7 O;  2UUA O;  4GKJ O;  5H5N A;  5IT9 N;  5FLX N;  5BR8 O;  4X66 O;  4LF4 O;  4DV0 O;  3J81 N;  1N34 O;  4OX9 O;  1IBL O;  1FYJ A;  5BY1 A;  1XNR O;  1AIL A;  4DR7 O;  1N32 O;  4JI3 O;  5BXZ A;  4JI6 O;  2VQF O;  4YY3 O;  4JI4 O;  2ZKO A;  2N74 A;  4DUY O;  2E5L O;  2UUB O;  4DV5 O;  4DV2 O;  4LF7 O;  1DK1 A;  4DV6 O;  4JI2 O;  4DR3 O;  2UUC O;  1XEQ A;  3J7A U;  4JI0 O;  3OTO O;  3T1Y O;  1KUQ A;  1N36 O;  1IBK O;  1F7Y A;  2ZM6 O;  3O65 A;  4A5U B;  4DV3 O;  2HHH O;  1FKA O;  4DR4 O;  4DR5 O;  1XNQ O;  4GKK O;  4JI1 O;  4LFA O;  2F4V O;  2LW7 A;  2JRI A;  4DR6 O;  4LF6 O;  2FKX A;  5IWA O;  3J80 N;  2UU9 O;  5LMN O;  2UXD O;  2Z0A A;  4YHH O;  4B3T O;  5LL6 Y;  1HNX O;  1AB3 A;  1A32 A;  1N33 O;  4B3R O;  4LF9 O;  5LMU O;  4B3M O;  2DJV A;  4NXM O;  4DR1 O;  3SDL A;  1HR0 O;  4X62 O;  4LFB O;  2UXC O;  2UXB O;  1X59 A;  1G1X B; 
#chains in the Genus database with same CATH topology
 4WFA V;  3LDD A;  3E83 A;  1R6T A;  1NTM H;  5KX5 A;  4RQE A;  3L71 H;  1I94 O;  2N04 A;  4Q20 A;  4PEL A;  4DR2 B;  1VQK V;  4LF7 B;  1DGS A;  1R6K A;  2B9Z A;  4ZIB A;  5KHH A;  4XDK A;  1HNX B;  3ASN C;  1H38 A;  3M8A A;  2NN4 A;  2FTK A;  3SPH A;  3JSL A;  2AGA A;  4DV4 O;  2PYL A;  5CBG A;  3G71 V;  5L3G A;  3WG7 B;  2QKA A;  5DEC A;  3SYP A;  1GMG A;  4J9Z B;  2OCC B;  3AG4 B;  2UUA B;  1AIL A;  2LFS A;  4R7C A;  2UXD B;  2D3O W;  3BY6 A;  3UT5 A;  3MHH C;  4JI6 O;  2FML A;  3OW2 U;  2X6A A;  3ZHQ A;  1BHA A;  5IJ9 B;  1XI1 A;  4JZG A;  5LOV A;  2QA4 V;  2WLL B;  4CBC A;  5KHG A;  1NH2 B;  3WB1 A;  5JWP A;  4JI0 O;  3ZMU A;  5EIB C;  4NTW A;  3CCQ V;  3SYQ A;  1O9H A;  3CXH F;  2KKW A;  1KU9 A;  3SR2 C;  3SPG A;  1QHT A;  4K3A A;  4U7N A;  3HB3 B;  3JD3 A;  1KC8 W;  5GTH Z;  3MDS A;  4GCZ A;  2WA4 A;  5KAI Z;  1GO3 F;  1OCO C;  1SA0 B;  1Y66 A;  2EZO A;  1T5E A;  5KA5 A;  1K5S A;  3E86 A;  2P4V A;  4B3R O;  4HYO A;  1F4N A;  4DR1 O;  3SDL A;  4X9Q A;  1E1Q G;  5EZY A;  2Q7H A;  3WU2 Z;  1J5E B;  2UXC O;  1ROP A;  2CTW A;  1X59 A;  3CRR A;  1RM1 C;  1TA8 A;  1QLE B;  2ZD9 A;  1R1B A;  4YIO A;  1XNR B;  3SGI A;  4H37 A;  3E8G A;  1G8M A;  4DUZ O;  1ZAU A;  1XHX A;  1YZB A;  3EXA A;  2QSA A;  1Y76 B;  3OUF A;  1R73 A;  3JAW A;  2DYS C;  3N2K B;  3ZRW A;  3F5T A;  5LGN A;  4X89 A;  1OCC B;  1M90 W;  1VEW A;  4I50 B;  2JGD A;  3CB2 A;  4DUY B;  4IIJ A;  1EM1 A;  4O4L B;  4OPA A;  2LW1 A;  2HVK C;  1K7D A;  2IJJ A;  4LH6 A;  1AJQ A;  5BR8 O;  1M5I A;  4LP8 A;  1XMO B;  2P06 A;  4PA3 A;  1KEC A;  1JPX A;  1ARO P;  1SQP H;  2H8P C;  3CCS V;  3GWO A;  1ZL8 B;  5D5Q A;  5B1A B;  4JI3 O;  4UVB A;  4JI7 B;  3TXS A;  2N74 A;  1RFY A;  4MW8 A;  5EK0 A;  2BOC C;  3BVO A;  4QIW F;  1NBM G;  1YXB A;  2Q4P A;  5JCO A;  4EEQ A;  3U0Z A;  3AK1 A;  2RNB A;  2ZM6 B;  1MZE A;  4IT5 A;  2CTQ A;  3BCC H;  4DR6 B;  1SS3 A;  4DR4 B;  4WBN B;  2F4V O;  1Q90 D;  1R3I C;  1NJI W;  3U10 A;  1S5L Z;  4NVP A;  1G6U A;  1QQC A;  4FIP C;  4X20 A;  1YHQ V;  3EHB B;  1M56 B;  2LFR A;  4DV2 B;  2F1M A;  5L3D A;  1HW7 A;  5IE9 A;  1I94 B;  4P2Z A;  5CA1 A;  1LUV A;  1MZF A;  1Z5V A;  3K5O A;  3KG2 A;  1FXK B;  3TK1 A;  1M1K W;  4NXN O;  5LXT B;  1YSC A;  3RBZ A;  3RYF A;  2E75 B;  2A7W A;  1SQV H;  3K08 A;  5B1N A;  4TSF G;  5KLV H;  5J2U A;  4DR2 O;  1D2D A;  2YID A;  1BHB A;  3HKB B;  2MK3 A;  1AJP A;  2UUA O;  4JAU A;  1I7F A;  1SQX H;  1I0H A;  5FLX N;  1VIB A;  1SF9 A;  2EZP A;  4WCE V;  1JMK C;  5LHI A;  3OGI B;  2NR5 A;  1N34 O;  2XAQ A;  1L8D A;  4U3J B;  1IBL O;  4B3M B;  1KBH A;  2QTO A;  4F6R B;  3JD4 A;  3LUT B;  2QGN A;  3G4S V;  1H2G A;  3E8F A;  2E3C A;  3N27 A;  2PI4 A;  1ZSP A;  1Q3E A;  1Q82 W;  1F23 A;  1M56 C;  1P4R A;  2ITD C;  4DV6 O;  4TV8 A;  3NR7 A;  1WPB A;  5CBH A;  3L9D A;  4UVC A;  3T1Y O;  2C2A A;  1MNG A;  3O65 A;  4JF3 A;  1KKC A;  4DR3 B;  1N0J A;  4X1K B;  2L6L A;  4O4H B;  1NVP B;  3T1H B;  4K8X A;  2PI5 A;  4PD4 F;  1OCC C;  2YEV B;  3QO7 A;  1LR1 A;  1WPX A;  4LFA O;  1JOY A;  4PJ0 Z;  1QNM A;  3E8B A;  4GZR B;  5IWA O;  1US6 A;  2IH1 C;  3MAQ A;  2XHB A;  3ABK C;  3ZRX A;  5KHI A;  2Z0A A;  3DTU B;  4LC1 A;  2Y4T A;  3BRC A;  2ZT9 B;  4L8J A;  1QVG U;  3H1L H;  4X62 B;  2UXB O;  3WB2 A;  1W0K G;  4Z1V A;  1UFI A;  1XQ8 A;  2YDE A;  2OWO A;  2N05 A;  4K0K B;  3JAM N;  5FPO A;  2JS5 A;  4ZHQ A;  5LA6 B;  3QG5 A;  2IU3 A;  1Y67 A;  4CH3 A;  5F2V O;  4X64 O;  4PDL A;  2AZ2 A;  2ZIN A;  3L74 H;  4DV4 B;  3ZHU A;  4MVM A;  4O4J B;  4B7E A;  4UV8 A;  2YI9 A;  1FXK C;  3ML0 A;  1MAB G;  3K06 A;  1QCE A;  1CEZ A;  1KMI Z;  1PV0 A;  1WAZ A;  1NKD A;  5ITZ A;  3ZHS A;  4KFM A;  4D7T A;  2ZCE A;  1H8E G;  2BTQ A;  3L72 H;  3E8H A;  1NR7 A;  5IYB O;  4YY3 O;  2UUB O;  1Y4M A;  3OEE G;  1R3K C;  2KSD A;  3KZI Z;  2QM7 A;  1RPR A;  2A3Q A;  3B2E E;  4J7Z A;  2WLH A;  4TV9 B;  5B3S C;  2QR4 A;  1XOU A;  3G67 A;  1N36 B;  4RQF A;  5JH7 B;  2A06 H;  3A0B Z;  4JI1 O;  5CMU A;  1ZLZ A;  4HBN A;  1MOF A;  2BSK A;  4LCU C;  1GN6 A;  4GKJ B;  1IXM A;  5JJE B;  5JQG A;  2YC0 A;  4J42 A;  1CPY A;  2PF4 E;  3H9V A;  3X2Q C;  2F4V B;  1RP3 B;  2DJV A;  2HFE C;  1GTO A;  3VQX A;  2Q69 A;  3JCU Z;  1GN4 A;  1HR0 O;  3T4Z A;  4X1I B;  1M9N A;  4FFB B;  5H2F Z;  1Q81 W;  1CP9 A;  2WA3 A;  4FZ1 A;  4WFB V;  2W6I G;  4MVQ A;  2GTS A;  3FYI B;  2DOS A;  5EIB D;  5A2Q N;  3G6E V;  4X8A A;  1Y74 B;  1KB9 F;  1FFX A;  5B1A C;  4I5S A;  5E79 Z;  3Q4H A;  2UU9 B;  3RFR A;  1Q6U A;  3PJS K;  3K0G A;  1OV9 A;  1WA8 B;  2R9I A;  1YCI A;  1MA1 A;  1XMQ O;  1JX9 A;  5GW7 A;  4JAS A;  3JAT A;  4JI3 B;  5C8Y A;  2RDC A;  3KCY A;  1KD1 W;  1BCC H;  3OR6 C;  4J11 A;  4F6R A;  3TGU H;  3CJH B;  1K8A W;  1SQG A;  2Z5U A;  5BR8 B;  2EUL A;  1VQO V;  2R70 A;  4EFB A;  4OX9 O;  3P3P A;  4RUF A;  5JJN B;  1QLE C;  4B08 A;  4J80 A;  5FPR A;  3M7M X;  3QNE A;  5K1P A;  2DW4 A;  2P7T C;  1P7B A;  1HR0 B;  3N2K A;  3ZRW B;  4B3T B;  2X7R B;  4X1K A;  1NI8 A;  5KHJ A;  4BWA A;  1SA0 A;  1SQB H;  4GKK B;  4HNA B;  4RUE A;  5IJ0 A;  1YEW A;  3K9S A;  1ORQ C;  1VQ6 V;  1NH2 D;  4BR6 A;  3CP1 A;  1M57 B;  3L73 H;  1GN3 A;  1B06 A;  1G4Y B;  5LL6 Y;  5J2T B;  1A32 A;  4UCV A;  4NTY A;  3NXS A;  3G6B A;  3CEI A;  2GSM B;  4CH6 A;  3CRA A;  4QGP A;  4IGG A;  4LFB O;  1VP7 A;  4PV1 B;  4NXM B;  4DO2 A;  2EX3 A;  4UCS A;  3E89 A;  3ICX A;  4GX5 A;  1J5E O;  1V55 B;  3PN1 A;  1YTF B;  3UT5 B;  4J41 A;  2HG5 C;  5EC1 C;  4O4J A;  3T1C A;  4DRX A;  2EIL C;  3APQ A;  4AQY B;  2F95 B;  3F7Y C;  3VQY A;  1WP8 A;  2UXX A;  4GKJ O;  5D5P A;  2K9P A;  1QU7 A;  3SYO A;  1Y6X A;  2JS3 A;  2BE3 A;  2P6J A;  1N34 B;  4QPJ A;  1XNR O;  1WB7 A;  4DUZ B;  3CME V;  3TJT A;  1IBM B;  4FMT A;  3E2E A;  5BZB A;  2LO1 A;  5L3E A;  2VRZ A;  3ZHR A;  2GHY A;  4Q6G A;  4JI4 O;  4JI2 B;  1K34 A;  1I5X A;  3LDE A;  1YI2 V;  2H3O A;  4LF4 B;  5IYZ A;  1D5A A;  1XRE A;  4E2L A;  1SER A;  2P90 A;  4IYH A;  4KP4 A;  4I55 A;  1IBK O;  1WJZ A;  1F4M A;  4KHP B;  3JAS A;  5JQG B;  2OCH A;  3B77 A;  4DR5 O;  1XMQ B;  2L35 A;  5L3C A;  1H2S B;  1IBL B;  2FL4 A;  3FB7 C;  4ZOL A;  2PY5 A;  4PA6 A;  3DGE A;  4D6T H;  5EBL C;  5LMN O;  2JGD B;  3DSQ A;  3K5L A;  3SJB C;  4C7U A;  4I7Z B;  2EIM B;  3CCR V;  3CCV V;  3CRM A;  2HP8 A;  5DED A;  3A2F A;  1H2K A;  2HKO A;  1BSM A;  3F5W C;  2M6Y A;  3VBB A;  3CE2 A;  4CS2 A;  4O2B B;  2B1G A;  4CZZ A;  1VQN V;  1Q6H A;  5LXT A;  3B09 A;  4IHJ A;  3CCU V;  1OCZ C;  4DV1 O;  3RYI A;  3HPL C;  1BE3 H;  4UV9 A;  3RYC B;  3OMA B;  3BA8 A;  1Q86 W;  3ZS8 C;  5GON B;  1XDC A;  4BIZ A;  2ODM A;  1L0N H;  2OYQ A;  3A8T A;  4EFE A;  5JH7 A;  3J81 N;  4XDL A;  1BQ0 A;  1JJ2 U;  2M7W A;  2P5O A;  1FYJ A;  1VQ5 V;  3CMA V;  2Y48 A;  2VQF B;  1N32 O;  5IY5 C;  4B3S B;  3H01 A;  2EIK B;  4DR1 B;  2LGW A;  1HWY A;  4B3R B;  3CRC A;  5BXZ A;  2B5U A;  1P84 F;  5IYD O;  2DMX A;  2EIN C;  3ABM C;  2CDY A;  5KHK A;  4LF7 O;  2IU0 A;  2BCC H;  3K5M A;  4NKG B;  3ETE A;  1AI4 A;  2DN9 A;  2F43 G;  5B5E Z;  1HNW B;  1SET A;  3CXC U;  2ZNI A;  1FFX B;  2NLJ C;  3SYA A;  2CAZ C;  1GAX A;  4TUY B;  4I9Q A;  1VF6 C;  2A9H A;  2ZXW B;  5J2T A;  5CBF A;  1FAF A;  5LHH A;  3WFV A;  1VQL V;  1N0N A;  1BQZ A;  5IDJ A;  1TUB B;  2UXD O;  3RGB A;  4QPK A;  2JEX A;  1SC5 B;  3ABU A;  1R3L C;  2V1D A;  2E74 B;  3JD2 A;  1COW G;  2KG7 B;  2PTM A;  3JAK A;  3LSQ A;  2CTP A;  2GBO A;  4R50 A;  4JYC A;  1PPJ H;  4MVS A;  3F7V C;  3ZN0 A;  1S3J A;  1K73 W;  3TXQ A;  4FK5 C;  3BA9 A;  2P67 A;  3BHP A;  5IY5 B;  3ETQ A;  1VQ8 V;  2WSS G;  5CA3 A;  1HNZ B;  3JCZ A;  2Q7G A;  4MT8 A;  3OM3 B;  1V9P A;  2HEP A;  4WBN A;  4DV7 O;  1K5Q A;  4MW3 A;  3OUS A;  4K0K O;  4JI8 O;  1EZJ A;  3K9A A;  4PI0 A;  4WFG A;  4NB5 A;  1KQS U;  3N2G A;  1OJH A;  3ABL C;  3VQV A;  1VQM V;  3JAW B;  4R6Z A;  2UXB B;  4FM1 A;  4XBF A;  3ABM B;  4O4H A;  2CTR A;  4O4L A;  2RCV A;  1BZK A;  1PNM A;  4I0X B;  2Y0P A;  3Q4H B;  4AI8 A;  5KAF Z;  1RM1 B;  2RQ6 A;  1WA8 A;  5JJJ B;  4JYY A;  2QM4 A;  1I08 A;  3B8N A;  3JAS B;  1EN5 A;  4DV2 O;  3D36 A;  3H1K H;  2QWN B;  4O2A B;  2YUA A;  2IM9 A;  2EIJ C;  4H33 A;  2W0F C;  2YIB D;  2X0L A;  2JDI G;  2HJD A;  4H13 B;  3CJH A;  4QNH B;  4U7O A;  2ITC C;  1TGO A;  1XNQ O;  2AHZ A;  4RAI A;  4GKK O;  2ZE6 A;  5B1B B;  5KMG B;  1ENV A;  1AI7 A;  1AJN A;  1K92 A;  2FKX A;  4YY3 B;  3FX7 A;  1L0L H;  1GH6 A;  3ZIA G;  2O57 A;  1V55 C;  5KUK A;  1XUQ A;  2YS8 A;  4YHH O;  1Q5O A;  4JZ2 A;  2EIN B;  1N33 O;  3OGC C;  3ZED A;  5A9G A;  4B3M O;  5DN6 G;  3RVY A;  2UXN A;  4Z1M G;  4CS3 A;  4GYC B;  3RYI B;  3ZRV A;  3ZMT A;  2XT9 A;  4AQY O;  5J9P C;  4DXW A;  2UUC B;  3OTO B;  3CC4 V;  3ETD A;  4X65 B;  2E76 B;  1Y74 A;  4CS4 A;  4LF8 O;  4MTO A;  3K0D A;  1SES A;  4PA7 A;  4JI6 B;  4LF6 B;  4LFC O;  1RPO A;  3CCJ V;  3I55 V;  1IBM O;  5L3B A;  2OTJ V;  3JD0 A;  4TV9 A;  4JI7 O;  5CB4 B;  1QLN A;  1FFT B;  4GUN A;  1HP8 A;  3UKM A;  4LFA B;  4CH5 A;  4DV0 O;  4KUM A;  1H2N A;  1PL4 A;  3DXR A;  5LBQ A;  5K1X A;  1DF5 A;  2IW5 A;  4D7S A;  3S3W A;  2RJZ A;  2ZDI A;  2BOB C;  4I9W A;  3AG2 C;  5C93 A;  4FM2 A;  1B6Q A;  3R65 A;  2LP7 A;  4UCR A;  4ZHQ B;  3B4S A;  2DYR B;  2YSU B;  3WB0 A;  2X6C A;  5IYC O;  2AHY A;  3HKE A;  3JSN A;  2DYR C;  2HJF C;  4FFB A;  2JEU A;  1XEQ A;  4J7J A;  4TUY A;  4QJF B;  2ZM6 O;  4MTX A;  1FKA O;  4UUJ C;  2FYU H;  2ZR2 A;  3MHS C;  4LR3 A;  4Z2W A;  1K3E A;  1WN7 A;  1RSO B;  1VMG A;  3CWB H;  4YJ2 B;  3ASN B;  4LF6 O;  2YIB A;  3AK3 A;  3ZBH A;  1U97 A;  4PA9 A;  1F51 A;  1KYO F;  2OT5 A;  3LNN A;  3TET A;  3JAT B;  1EN6 A;  1XL6 A;  4LF9 O;  2WLI A;  4F6E A;  4EKW A;  1JFF A;  1SRY A;  2H94 A;  4FLX A;  3K04 A;  1TVK B;  4OGQ B;  3ZMZ A;  3CD6 V;  1G1X B;  3K58 A;  1XMO O;  2VWK A;  2ZE7 A;  2Q5Z A;  4KHP O;  3ZCC A;  2Q7E A;  2PZS A;  1MMM A;  4GT1 A;  1FJG O;  2YI8 A;  4L87 A;  3JYC A;  3K79 A;  4P30 A;  4NR1 A;  1PM9 A;  4UB8 Z;  4B3S O;  3BEH A;  3JAR B;  2FB5 A;  1S5H C;  1AP6 A;  4U3F H;  3ABL B;  1YTF D;  1EN4 A;  3HKD A;  1VQP V;  3AK2 A;  3QO5 A;  1YJN V;  3FAV B;  2VS0 A;  4X66 B;  4G27 B;  1VAR A;  5IJ0 B;  5EC2 C;  4TQD A;  1GN2 A;  4DV6 B;  5BY1 A;  3AG3 C;  2R9A A;  3UCS C;  4ZI7 B;  5IYZ B;  3D3I A;  1L1F A;  4FJC C;  1OCR B;  1SZX A;  2WLN A;  3CCL V;  3CC7 V;  4MVO A;  1YJ9 V;  4DUY O;  3RYC A;  1BS3 A;  3JAK B;  3JD1 A;  3ABT A;  4FVM A;  1ZUQ A;  4EB6 B;  1IDS A;  2Z3Y A;  3SJC C;  5BMV B;  5TIS Z;  3AG7 A;  4A5U B;  3ETG A;  2Q73 A;  1PNK A;  4LFC B;  1IBK B;  1NR1 A;  1LUW A;  5HFL A;  2QTS A;  4I55 B;  1Q7Y W;  2JK5 C;  2CK3 G;  1K4D C;  4DR6 O;  4UCO A;  4FLZ A;  4OXS A;  2R72 A;  3CS5 A;  1ZX3 A;  4KXR A;  4QE9 A;  3ZX6 A;  1AB3 A;  3APO A;  5LMN B;  1NT2 B;  3A0H Z;  2VQE B;  1NVP D;  2NNU A;  4BIO A;  1GM8 A;  4W4L A;  4LNU A;  2XAS A;  1K97 A;  4UXN A;  2P22 C;  2ETN A;  4AIL C;  5KUM A;  3C90 A;  5L3F A;  4DYL A;  3FB5 C;  1FS0 G;  4BIU A;  2ZXW C;  4PDR A;  2E5L B;  5CB4 A;  1NS1 A;  2Y0I A;  3AG3 B;  1K4C C;  1M57 C;  2QM8 A;  3D3Q A;  4O4I B;  1OCZ B;  4ICG A;  1XL4 A;  2OTL V;  1JCH A;  4FM0 A;  1XBL A;  5FL7 G;  2OIG A;  5IT9 N;  4JAV A;  1AR4 A;  2G38 A;  2DWE C;  5B1B C;  5GON A;  2AXT Z;  1V54 C;  2GTA A;  1LNQ A;  3FB8 C;  1R3J C;  1JJO A;  2EJR A;  4ZOL B;  4UVA A;  1NQT A;  3L75 H;  1MSW D;  2AZ0 A;  5CA0 B;  4JYB A;  3CCE V;  5IWA B;  4YJ3 A;  1GM9 A;  3CHX A;  4DV5 O;  5LP6 B;  3K57 A;  3E22 A;  3ZHV A;  1RSO A;  4DR3 O;  4K8Z A;  4UCT A;  3SYC A;  4TT3 G;  1KUQ A;  4HZ3 A;  4DK0 A;  4G28 B;  4PDM A;  3U11 A;  1WB8 A;  5FNV A;  2ZE8 A;  2XUM A;  1P7G A;  3W7X A;  1IZ3 A;  3K03 A;  4N21 A;  5JVD A;  4DV3 B;  2HHH B;  2ZE5 A;  2QKC A;  2ARH A;  4LF9 B;  3J80 N;  5EYP A;  4XDJ A;  2WPD G;  4BW5 A;  3ZMS A;  1VQ9 V;  4HNA A;  1P49 A;  1GKF A;  5JCO C;  3SPC A;  1PNL A;  2LQT A;  2EJ7 A;  2Q9L A;  4MVU A;  3B8M A;  1X4T A;  1WNS A;  2IBZ H;  2VWJ A;  4FFK A;  1E1R G;  1OCR C;  1VF5 B;  3T1H O;  4BAY A;  2KB1 A;  1QVF U;  2WLM A;  1JVM A;  3AG2 B;  1AI5 A;  2QE7 G;  4YIP A;  1H2L A;  2GDS A;  4X65 O;  4X88 A;  2JJ2 G;  1HNZ O;  5AG2 A;  1Q43 A;  1AP5 A;  3AG1 B;  4BW9 A;  2QDO A;  2F23 A;  2XOK G;  4X1Y B;  1URF A;  4J10 A;  4YHH B;  1AR1 B;  4IL6 Z;  3QVN A;  3OMI B;  4I4T B;  3A0R A;  2HR3 A;  4DRX B;  5H9C A;  2JVD A;  2YIA A;  4LWS A;  4OX9 B;  5H6R A;  4GLX A;  3LSS A;  4JAA A;  3JAL A;  5DM6 V;  4CC5 A;  2D2C B;  1SKV A;  3FB6 C;  4IHJ B;  5KX5 B;  2UUB B;  4PDV A;  2WLI B;  1S5J A;  2RMK B;  3P32 A;  3IJ4 A;  1FXV A;  4AHC A;  4LBE C;  3RYH B;  5LYJ B;  1W2B U;  1E79 G;  1Q8I A;  1WLE A;  1W59 A;  1N36 O;  4JV5 B;  3EVK A;  4O2A A;  3CYO A;  1S77 D;  1KKD A;  3W7U A;  2A79 B;  3HR0 A;  3P30 A;  2EIJ B;  3BFR A;  2LW7 A;  2DYS B;  4J7K A;  2CE4 A;  2W6J G;  4IIJ B;  2Q68 A;  4FPP A;  4LNU B;  1HNX O;  3DC5 A;  1TUE B;  2CH7 B;  3C3S A;  4JI4 B;  1N32 B;  4X62 O;  1S72 V;  1FPO A;  2HVJ C;  4WFE A;  1AI6 A;  5GTI Z;  3DC6 A;  3R66 A;  1B04 A;  2QKS A;  4CH4 A;  4K35 A;  1SZT A;  1YIJ V;  4ZI7 A;  1M93 A;  3SPI A;  2V7Q G;  4CC6 A;  1W0J G;  3ZJZ A;  3I56 V;  4LF5 B;  3CX5 F;  1GRJ A;  3AEI A;  4ASU G;  4OPH A;  3IC9 A;  4O2B A;  3S3X A;  1S0V A;  1THZ A;  3D36 C;  2Q0A A;  1OCO B;  5H6Q A;  1TUB A;  1M4U A;  1R6N A;  1CXZ B;  4X64 B;  2F66 C;  1BT8 A;  3SPJ A;  5HFM A;  3K3W A;  1Q6I A;  2ZIO A;  1NTZ H;  2JGU A;  4X66 O;  4JYA B;  4LF4 O;  5LMU B;  5LP6 C;  2LJ2 A;  3KCX A;  3GVM A;  3QO8 A;  3H1J H;  1FD9 A;  4E4E A;  3E22 B;  2GUZ A;  3HKC A;  2P4K A;  3CCM V;  4TV8 B;  1Y76 A;  4G2K A;  2OCC C;  2Y4U A;  1NU1 H;  1ZWI C;  1U96 A;  4NXN B;  4X20 B;  3RW0 A;  4PI2 A;  1XIL A;  2EIK C;  2WLK A;  3J7A U;  3JAR A;  4DR7 B;  4W4K A;  5IJ9 A;  4YJ2 A;  4DV3 O;  2HHH O;  4UCU A;  5LOV B;  3D8C A;  1DTO A;  2IJK A;  2QJ1 A;  4DV7 B;  4YXW G;  2PYJ A;  2ADP A;  3OR7 C;  3AG1 C;  4ABM A;  2XTA A;  3RYF B;  1H8H G;  5EZY B;  4J9Y B;  2XAJ A;  2X6B A;  1VQ7 V;  4P9P A;  4B3T O;  1H2M A;  2V4D A;  5EBW C;  4NXM O;  4WFF A;  1EBO A;  4MSW C;  1IVS A;  1K9M W;  3H1I H;  4JTC B;  1GK9 A;  3CRQ A;  4P9O A;  3OT7 A;  1HNW O;  2KG7 A;  2ZDI C;  1NTK H;  1JFF B;  2Q0O C;  4R8C A;  2EIM C;  3C3T A;  1NZ6 A;  5KMG A;  1UJW B;  2IJI A;  3CSX A;  1PD3 A;  1V54 B;  4JPR A;  5LGT A;  3HKD B;  2ILM A;  2WLL A;  1K33 A;  4RO2 A;  3FKS G;  4PHZ A;  4FZ0 A;  3X2Q B;  4FLT A;  2Y69 B;  4LWS B;  3L70 H;  1AR5 A;  1YF2 A;  1BL8 A;  1SQQ H;  2BTQ B;  3FYE B;  3N2G B;  1QBZ A;  3CC2 V;  2CUG A;  5CA1 B;  2XAH A;  5JVD B;  2ZR3 A;  1N33 B;  1FJG B;  3O9O A;  4TOI A;  3RVZ A;  3E35 A;  2Q6A A;  4MTG A;  1VF6 A;  1O9G A;  1BMF G;  4I0X A;  3ZN1 A;  1EZV H;  2E5L O;  3IC7 A;  1VQ4 V;  1ZL8 A;  4DV5 B;  3UO3 A;  2CGO A;  4NYK A;  4JI2 O;  2R9R B;  2UUC O;  3KKY A;  5J2U B;  1YJW V;  3T2M A;  4FLW A;  2AW9 A;  3OTO O;  1TAE A;  2A0L A;  1MSD A;  4MVR A;  2ZNJ A;  1Z5W A;  2BTO A;  2Y69 C;  1XHZ A;  4EB6 A;  1HDJ A;  1GM7 A;  1ZTE A;  1SQF A;  2YXH A;  1MG1 A;  3K5N A;  3RN4 A;  1N8R W;  4JI0 B;  1IXB A;  2EIL B;  2HLD G;  4UFZ A;  1YDX A;  2ZIM A;  2ZQM A;  5CA0 A;  3T4D A;  2QWO B;  4QE7 A;  5B66 Z;  4IYI A;  2PGG A;  5LMU O;  3HKE B;  5LP6 A;  1J95 A;  2ADQ B;  3FAV A;  3LDC A;  4GX2 A;  1BGY H;  2UXC B;  4DW0 A;  1UPG A;  2DE0 X;  4FLV A;  3JAL B;  3RT3 C;  5B1O A;  4JI5 O;  4KL1 A;  1PKX A;  4WFH A;  4JI1 B;  3ZMV A;  4LF5 O;  2VQE O;  4H0L B;  2WAM A;  2GV9 A;  5BMV A;  3P3N A;  4MTF A;  5H5N A;  3UQ8 A;  3CPW U;  2CGN A;  2GUZ B;  1QR8 A;  3BAA A;  3HKC B;  3IFX A;  3T1Y B;  3THO A;  1PL0 A;  1TVK A;  4O4I A;  4JTA B;  3OTF A;  3VQW A;  4UB6 Z;  4TQF A;  5B3S B;  3SJA C;  1DLB A;  3OE7 G;  3OAA G;  1N4C A;  2VQF O;  4U3J A;  3DXR B;  5LA6 A;  3EFF K;  4TWK A;  1DF4 A;  3STL C;  3IGA C;  4YJ3 B;  2MW2 B;  3STZ C;  3ABK B;  5EYP B;  4DR5 B;  4WF9 V;  4H44 B;  4I4T A;  3W7S A;  2ATK C;  4RWU A;  3VOU A;  2OIE A;  1FXK A;  1FXH A;  1QR9 A;  2K1E A;  3RWR D;  5LHG A;  5FNV B;  3OD4 A;  3G80 A;  4JGS A;  4GX1 A;  3TCU A;  4DW1 A;  5LGU A;  1YVW A;  2YXY A;  2YIC A;  2YXL A;  3HKB A;  2WWW A;  1KP3 A;  3H1H H;  3LNM B;  5KA6 A;  1EFR G;  3OFN G;  4ZBM A;  2EBO A;  2XAF A;  3IAY A;  4LH7 A;  3OEH G;  2PUS A;  4F4L A;  2IH3 C;  4JV5 O;  1AVM A;  5EBM C;  3SJQ C;  1YIT V;  3WG7 C;  1OZ0 A;  4X1Y A;  3M99 B;  4JYA O;  1JR9 A;  2F93 B;  3BAB A;  4FLY A;  4LF8 B;  1B3Q A;  3LSU A;  1VF7 A;  2KQX A;  1Z2G A;  4JI8 B;  1JA8 A;  4DK1 A;  5ITZ B;  4PA4 A;  4FLU A;  3QTC A;  2DQ0 A;  2CH7 A;  2WLJ A;  4B7K A;  2LGQ A;  4X1I A;  4I50 A;  3MD0 A;  4DV0 B;  2YEV A;  2JIZ G;  1S76 D;  1PP9 H;  4NTX A;  4HAM A;  4DR7 O;  3OMN B;  4LFB B;  3I5D A;  3BPZ A;  2ZKO A;  4ZKI A;  3UO2 A;  1DK1 A;  2W0X A;  3AG4 C;  3FFQ A;  3FD9 A;  5E1A C;  2DWD C;  5C8Y B;  3ZHT A;  1JQ0 A;  2BSK B;  3GB7 C;  1F7Y A;  3QF7 A;  4DR4 O;  4GX0 A;  4DV1 B;  2DQ3 A;  2QWP B;  1OHH G;  2QEX V;  2QWQ B;  3W7T A;  1IUR A;  3ZRS A;  3RYH A;  5LYJ A;  3W7W A;  2QWR B;  2XND G;  1IX9 A;  1KP2 A;  2RN9 A;  2JRI A;  2UU9 O;  3GWK C;  2Q8V A;  2IJH A;  4MS2 A;  5CN0 A;  2XAG A;  1WP7 A;  4MVZ A;  2B1I A;  3UM7 A;  1D5N A;  4N23 A;  1I5Y A;  3ASO C;  3B40 A;  3K59 A;  3ASO B;  4JTD B;  2JJ1 G;  2Q67 A;  1XNQ B;  4JI5 B; 
#chains in the Genus database with same CATH homology
 2DOS A;  3R66 A;  5A2Q N;  3T1H O;  1XMO O;  4AQY O;  1HNW O;  4KHP O;  1J5E O;  1R6T A;  4JV5 O;  3RT3 C;  4DV1 O;  3JAM N;  1R1B A;  1I94 O;  4OPH A;  4DUZ O;  1FJG O;  4JI5 O;  4NXN O;  1YZB A;  4JYA O;  4DV7 O;  1NS1 A;  4X65 O;  4LF8 O;  4K0K O;  4JI8 O;  1XMQ O;  1HNZ O;  3F5T A;  4LFC O;  3M8A A;  4LF5 O;  2VQE O;  4X64 O;  1IBM O;  4B3S O;  4DR2 O;  1D2D A;  4OPA A;  4DV4 O;  2AGA A;  4JI7 O;  2UUA O;  4GKJ O;  5H5N A;  5IT9 N;  5FLX N;  5BR8 O;  4X66 O;  4LF4 O;  4DV0 O;  3J81 N;  1N34 O;  4OX9 O;  1IBL O;  1FYJ A;  5BY1 A;  1XNR O;  1AIL A;  4DR7 O;  1N32 O;  4JI3 O;  5BXZ A;  4JI6 O;  2VQF O;  4YY3 O;  4JI4 O;  2ZKO A;  2N74 A;  4DUY O;  2E5L O;  2UUB O;  4DV5 O;  4DV2 O;  4LF7 O;  1DK1 A;  4DV6 O;  4JI2 O;  4DR3 O;  2UUC O;  1XEQ A;  3J7A U;  4JI0 O;  3OTO O;  3T1Y O;  1KUQ A;  1N36 O;  1IBK O;  1F7Y A;  2ZM6 O;  3O65 A;  4A5U B;  4DV3 O;  2HHH O;  1FKA O;  4DR4 O;  4DR5 O;  1XNQ O;  4GKK O;  4JI1 O;  4LFA O;  2F4V O;  2LW7 A;  2JRI A;  4DR6 O;  4LF6 O;  2FKX A;  5IWA O;  3J80 N;  2UU9 O;  5LMN O;  2UXD O;  2Z0A A;  4YHH O;  4B3T O;  5LL6 Y;  1HNX O;  1AB3 A;  1A32 A;  1N33 O;  4B3R O;  4LF9 O;  5LMU O;  4B3M O;  2DJV A;  4NXM O;  4DR1 O;  3SDL A;  1HR0 O;  4X62 O;  4LFB O;  2UXC O;  2UXB O;  1X59 A;  1G1X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...