4LF8O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf8O00
1N33O 1NS1A 1N32O 4X64O 4JI8O 4DV6O 4B3RO 1FYJA 1FKAO 4DV3O 3F5TA 4KHPO 1XMQO 4DR3O 5IWAO 4DR1O 2HHHO 4K0KO 4OX9O 4DR2O 5BXZA 1HR0O 1XEQA 4A5UB 2ZM6O 4B3TO 3T1YO 3J81N 4LF7O 4JI2O 1N36O 4DV4O 1N34O 1HNZO 1DK1A 4YY3O 3O65A 1R6TA 4JI1O 4LFAO 2N74A 4JI4O 4LF9O 2ZKOA 1AB3A 4LF5O 1IBKO 4DR5O 3M8AA 4LFCO 1IBMO 3J80N 2DJVA 4DR7O 4JI6O 4X62O 4LFBO 2Z0AA 4GKJO 3RT3C 4B3MO 2UUCO 2JRIA 3OTOO 5LMNO 2UXBO 1HNWO 4JV5O 1A32A 3J7AU 2F4VO 2LW7A 4JI0O 4DV1O 2UUBO 2VQFO 1XNQO 2VQEO 4DUYO 5FLXN 1XMOO 4DR4O 1G1XB 5BR8O 4GKKO 4LF6O 3JAMN 4DV7O 4YHHO 4DV5O 5IT9N 2AGAA 4JI5O 4NXMO 2UXDO 4DUZO 4DV2O 4AQYO 4JI3O 4OPAA 5LL6Y 1AILA 1HNXO 5LMUO 1FJGO 4JI7O 4LF4O 1YZBA 3R66A 1X59A 2UU9O 4OPHA 4X65O 4B3SO 2UXCO 3T1HO 5A2QN 2DOSA 2UUAO 4JYAO 1KUQA 4X66O 4NXNO 1R1BA 1F7YA 1XNRO 4DV0O 1D2DA 4DR6O 1IBLO 1J5EO 4LF8O 5H5NA 2FKXA 3SDLA 2E5LO 5BY1A 1I94O
chains in the Genus database with same CATH superfamily
1E79G 3R65A 3MDSA 5IDJA 1R3LC 3RVYA 1VIBA 2WLMA 1XILA 4R8CA 4QNHB 1FKAO 4DV3O 4R50A 3ZS8C 3CX5F 2GTAA 3G6BA 4MS2A 5IWAO 3BEHA 4JASA 2OIGA 4ZIBA 1R6KA 5KHIA 4J7KA 3ZHQA 3AG2C 4CH6A 5EZYB 1IX9A 1M57C 3AG7A 2UXCB 1QLEB 4UCSA 5J2UB 2VWKA 2OIEA 4X1IB 2XNDG 1JFFB 5CA0B 2ZKOA 2JGDA 4LFCO 2ILMA 3UKMA 1R73A 5LYJB 1IURA 1W59A 2HJFC 2DMXA 5C8YA 4E2LA 4TUYB 3HKBB 3K5OA 2YC0A 2XHBA 5JQGB 1Q3EA 4U7NA 4KHPB 2W0FC 3HKCB 2Z3YA 3B4SA 5B3SC 4LF6O 4X62B 1AI6A 5LP6C 3CJHA 1ZWIC 2F43G 1SQBH 3VQYA 1B3QA 1OCCC 5CBGA 3RYIA 4NTXA 2X6CA 3ZBHA 4JI7O 1FFTB 4MVQA 2V7QG 2QR4A 4X65O 3ZMZA 2IM9A 1WPBA 2A0LA 1NJIW 3CCLV 2DYRB 3CXHF 2O57A 4FM0A 1DGSA 3JCZA 1WLEA 1SQPH 5LA6A 1SRYA 1L0LH 4LR3A 1U96A 3CC4V 3VQWA 5LHIA 1AJNA 4MTFA 1XUQA 1NS1A 1Y66A 1DTOA 4HNAB 1ZUQA 3SPCA 4G27B 3GB7C 3GWOA 4MW3A 4NXMB 1JJ2U 4PDMA 2HHHO 4DR6B 1R3KC 4A5UB 1VQ7V 2EJ7A 1YVWA 4DV3B 4CBCA 4BIOA 1Z5WA 2HG5C 3ETEA 2BTQB 3LSQA 3RVZA 3AG1C 4Z1MG 4MT8A 1DLBA 3QNEA 2RN9A 3JYCA 3IAYA 1XI1A 2ZDIC 2RCVA 1Q43A 1QLEC 4B7KA 3OM3B 3CWBH 1PPJH 3RBZA 3L74H 4JI8B 3FB5C 5KHHA 1MMMA 2LW7A 2GV9A 1JCHA 1G8MA 1TVKB 4GT1A 4DR2B 4DR4O 2Q0OC 1YXBA 3FFQA 4BR6A 4YHHO 2AGAA 4Q20A 2KG7A 3FKSG 4DUZO 3JCUZ 5JVDB 1Z5VA 1EN6A 1N36B 1EZJA 4O2AA 1PM9A 2ZNJA 2ZR2A 5LGUA 4YY3B 3K08A 5ITZB 4JI1B 4LFAB 1M4UA 3STZC 3R66A 1CEZA 3ZRXA 4IIJB 3HKEB 4X1KA 1M93A 1XNRO 2M6YA 2ADPA 4UXNA 5LMNB 4CC6A 5H5NA 5EK0A 4JYYA 4ZKIA 3TJTA 5L3GA 1I08A 3KCXA 1QR8A 2DYRC 4DK1A 1GN3A 2QM4A 4TV8B 1YJ9V 3F5TA 2D3OW 3MD0A 3OEEG 3NR7A 4P2ZA 3JALA 5L3FA 4DV2B 1HR0O 4CC5A 2P5OA 2WAMA 4EB6A 1S5LZ 1WB7A 1H2KA 2GBOA 4JTCB 3C3SA 4LF7O 3CRRA 3OGIB 1JJOA 1VEWA 1XBLA 2W6JG 2QJ1A 1YTFD 5IE9A 2BTOA 3CD6V 1QCEA 1AROP 1US6A 5CA3A 1H2SB 4YJ2B 4DR5O 4FLXA 4GX2A 5DM6V 4B3MO 3DTUB 1SC5B 1SETA 2HJDA 2QTOA 3U10A 2K9PA 1COWG 4DRXA 2A79B 2UUBO 3BHPA 2DQ0A 3CCSV 4DR1B 1ZL8A 1ZX3A 2CDYA 5BR8O 3ZIAG 1H2GA 4B3TB 3UQ8A 3FX7A 3E8HA 3BCCH 2FL4A 3AK3A 5CA1A 3H1IH 5CB4A 4JAVA 2NN4A 4BW5A 1NI8A 2ZE8A 5CA0A 4F6RB 2CH7B 1BE3H 5H2FZ 2EIKB 3QO8A 2UU9O 4KFMA 1IBKB 4FFKA 2UUAO 4D7SA 3QTCA 4X66O 3ASNB 2AHZA 1KD1W 1D5AA 4TUYA 4WFBV 3VQXA 4ZOLB 3E8BA 1Q86W 2Q7GA 2WLLB 2JIZG 2PYLA 3F7VC 2EULA 2LGQA 1H8EG 1NVPB 4JAUA 3G71V 1PKXA 3HKCA 3L71H 3U11A 4UCOA 3L73H 2Q8VA 1R3IC 3LNNA 2YXHA 3B40A 4R6ZA 3RYCB 4K0KO 3MHSC 3RGBA 1HP8A 1F23A 3N2KA 1VQ6V 2YUAA 2V4DA 1BQ0A 2YSUB 3HKDB 2GHYA 3FB7C 4Z2WA 5KHGA 1JQ0A 5LBQA 1RPOA 1DK1A 1QQCA 4DW1A 3O9OA 1R6TA 3TETA 4PELA 4PI2A 4MTOA 1BSMA 2PI5A 2Y69B 4JTAB 2OCHA 5LOVA 5IJ0A 1J5EB 4L87A 2JEUA 1ZSPA 4LF7B 1K33A 1AI5A 3ZRWA 4ZI7B 3P30A 1PL4A 3RYHA 3D36A 4X64B 3KG2A 2X6BA 1YSCA 1NT2B 1BCCH 3W7WA 1VQMV 4FJCC 4DR5B 5FLXN 1SKVA 2QWPB 3OGCC 4DK0A 1GO3F 5LHGA 4Z1VA 5HFMA 4DXWA 4JI5O 2PTMA 3ASOB 3ZHTA 2WLNA 2YXLA 5AG2A 2P90A 1WN7A 2ODMA 5B1AB 2RDCA 4DV4B 1HNXO 5LMUO 3LDEA 1F51A 1URFA 1XL4A 4IYIA 3N2GA 4QJFB 1FJGO 4O4IB 1THZA 2C2AA 1R6NA 3UT5A 3K5LA 2EBOA 5DEDA 5A2QN 4GX5A 1N0NA 3L9DA 5KMGB 4JYAO 1R1BA 3BAAA 3PN1A 1B6QA 2E76B 4BIZA 2IJHA 1WPXA 1NTKH 2XUMA 4U3JA 4LBEC 1XMOB 4DV5B 1VQLV 4R7CA 3RYFA 4O2BB 2OCCC 4CH3A 3K79A 2Q69A 3ETQA 1XEQA 4QE9A 5ITZA 2GTSA 1G4YB 4J11A 3J81N 5DN6G 2WSSG 4FIPC 1Y76A 2LFRA 3L72H 3JAKB 4IIJA 2NNUA 3CCRV 1EN4A 4FM1A 1VQ9V 4QIWF 4JGSA 4JZ2A 4JI4O 1B06A 3OE7G 2XASA 4J80A 4PA6A 1M9NA 4LF5O 1IBMO 4MVMA 1M57B 1YIJV 1SESA 4FFBA 4EFEA 1H2MA 1BMFG 3EFFK 3WB2A 3JD0A 3RT3C 1Y67A 3JARB 3VOUA 3RFRA 4FVMA 4IGGA 2ZCEA 4X20B 4PDRA 4X89A 3QO5A 3WG7B 1FXHA 1VQNV 4DV1O 1RSOB 3SPHA 4TV9B 3I55V 4GX0A 3ABKC 1VF6A 3HB3B 1BQZA 3LDCA 2JEXA 4DV7O 1I5YA 2F23A 2IU0A 1Y4MA 2EIJC 2EZOA 5LL6Y 5B3SB 2PZSA 4YJ3B 1SQQH 3ASOC 5LP6B 2X0LA 5EYPA 4JI5B 3B8MA 4KP4A 5EBWC 1TUEB 2FMLA 5B1AC 1MABG 3VQVA 1LR1A 2BOCC 5LMUB 4FZ1A 4RUEA 3OUSA 1AVMA 1KKCA 5JH7A 3ZRVA 3OFNG 5FPOA 1MOFA 3W7UA 1NR7A 4JZGA 2YEVA 1K7DA 1RM1C 1AP5A 4YIPA 1O9HA 3WFVA 2AZ0A 3U0ZA 4H33A 2M7WA 2YICA 4PI0A 4F6RA 1Q82W 2EIMC 2EZPA 2CH7A 4MSWC 4UV9A 3ZHVA 2QM8A 2CGOA 2L35A 1YEWA 3T1HB 4NTYA 4NVPA 4G2KA 4PDVA 2DJVA 1DF4A 1CXZB 4AI8A 2F93B 5LXTB 1K4CC 5IJ9B 2Q67A 2H3OA 3AG1B 1H8HG 4LNUA 4O4LA 1NQTA 5KLVH 3THOA 1FS0G 3AK1A 4LWSB 4JI4B 2DYSC 3ABUA 4FLUA 1MSWD 1MG1A 2ITDC 4UB8Z 3HKDA 1LNQA 3TCUA 3AG3B 2EINB 1VF5B 3WG7C 1W0JG 2LO1A 3K04A 1OCRB 4JI2B 2XAGA 5GTIZ 5B1BB 2XTAA 1FPOA 2HVKC 2WLIA 5GTHZ 1YZBA 4D6TH 4WFEA 2IJJA 4LF9B 4DV7B 3EHBB 2Q73A 4GKJB 4FK5C 3T2MA 2XAHA 3OW2U 1EZVH 2XT9A 4TQFA 2JGUA 2LFSA 4P9OA 2VQFB 2AW9A 3CSXA 5HFLA 1FYJA 2DQ3A 1YHQV 1Y74A 3CC7V 1ROPA 1HDJA 5IYZB 2H94A 1E1RG 2HKOA 1AJQA 2CTWA 4O4IA 1QLNA 3ICXA 4PA4A 4FLTA 2P4VA 1N34O 2AHYA 3SPGA 4JF3A 3CMEV 4FM2A 5FNVA 3BY6A 1WA8B 2AXTZ 3IJ4A 3T4DA 2QKAA 4UB6Z 1I94B 4CH4A 4QE7A 1Z2GA 1GN4A 2R9AA 4PJ0Z 1VQ4V 2F4VO 2QWQB 1JPXA 4DV6O 2N05A 3DXRA 1FXKA 2VQEO 3LUTB 5IWAB 5EBMC 4FZ0A 2MW2B 4I4TA 4HBNA 2W0XA 5IT9N 1S3JA 3LDDA 3ZHSA 1MZEA 3WB1A 2WWWA 2EILC 5KHJA 2Q9LA 2RQ6A 4I0XA 4K3AA 3ZCCA 3SJBC 4C7UA 1XOUA 2DN9A 3AG3C 2EINC 1X4TA 2WLKA 1X59A 4J42A 4I55B 1OCRC 4LFCB 2IU3A 5EC1C 3CS5A 5B1BC 1KUQA 4NXNO 3JARA 1F7YA 3E22B 4DV0O 1D2DA 2KB1A 1SZXA 3H1LH 4TV9A 3JSNA 1FFXA 1OCZC 1EFRG 4PD4F 3A0BZ 3H1KH 1WAZA 4YIOA 4B3RO 5LGNA 4XBFA 4LF6B 2H8PC 1VQOV 4MVOA 1KYOF 2KSDA 1XMQO 4WBNA 3CCJV 3JD3A 2DW4A 3DSQA 3CB2A 4MVSA 2ZXWC 2QDOA 4ZHQA 4YJ3A 1GMGA 1JMKC 3SYQA 1Q6HA 4JI7B 1R3JC 2YXYA 3E8FA 4H0LB 3G6EV 4BAYA 4CH5A 4X65B 2QWRB 1SZTA 5JJEB 3ABTA 2RNBA 1VQ5V 2HP8A 3JATB 2P06A 1P7GA 3TXQA 1P49A 2PY5A 1SQFA 2GUZA 1N34B 4X88A 1U97A 1SA0A 5JJJB 4WFAV 5GONB 2RMKB 4CZZA 2Q68A 2UXBO 4LH7A 2HFEC 2E3CA 3DC5A 3K59A 1S0VA 3Q4HA 4H44B 2QA4V 2PI4A 1M56C 2ITCC 2IBZH 2OWOA 4JYCA 1N4CA 2HHHB 1TUBA 3P3NA 3ZMVA 4X9QA 1KB9F 2XOKG 4AQYO 4JI3O 3OMNB 2JS3A 2Y48A 1J95A 5IYCO 5IYBO 5H6QA 1MSDA 3K9AA 3D8CA 4OPHA 2DOSA 2K1EA 2GDSA 4F6EA 2X7RB 5EZYA 3B8NA 5CN0A 2ZDIA 5KX5B 3FB8C 3MHHC 5J2UA 3ETGA 2E5LO 4I5SA 1N33O 4X1IA 5IY5B 3EXAA 1JFFA 4DR4B 5LYJA 4YHHB 2R70A 4DR3O 5CBHA 4DV0B 4OX9O 4DUZB 1S5JA 3H1HH 4O4JB 2E74B 3HKBA 2NLJC 5J2TB 5JQGA 5JJNB 3OMAB 2OCCB 4G28B 2OYQA 3FD9A 1RFYA 3K5NA 3B2EE 3A8TA 1PP9H 2N74A 3OMIB 3S3WA 4MVZA 1P84F 1XNRB 1AB3A 4DR7O 4XDJA 2V1DA 3OT7A 2CK3G 1O9GA 2QKSA 3AEIA 3J7AU 1E1QG 4DYLA 4PV1B 1ZTEA 4PHZA 1WJZA 1SS3A 1NBMG 1XNQO 2F66C 3P32A 4DUYO 4B08A 1HR0B 5JCOC 4UCTA 3JAMN 1BZKA 3CCEV 1K9MW 2P4KA 2UXDO 1CPYA 3H1JH 2JGDB 3ABKB 4GX1A 5KUMA 3STLC 4HNAA 4EEQA 3K0GA 5KUKA 3TK1A 2B1IA 3D3QA 2IH1C 1VF6C 1BHBA 4X1YB 2EIJB 5C8YB 5BZBA 5L3CA 1BS3A 1VQKV 2QTSA 3CE2A 4B3MB 3E35A 1KU9A 2Q6AA 2OT5A 2QE7G 4RAIA 3SDLA 2UUBB 2BTQA 2N04A 4FLZA 4N23A 4H37A 3BABA 4K8XA 3RYIB 5BR8B 3CC2V 2JVDA 1KBHA 5TISZ 4TQDA 3SJCC 4FLVA 3SJQC 1Q5OA 5IY5C 2ZM6O 3T1YO 1UFIA 2KKWA 2YDEA 1RM1B 3QO7A 1K8AW 4N21A 3OUFA 1QNMA 2P6JA 1TVKA 3LNMB 2UU9B 2DWEC 3E22A 4U3FH 2EIMB 2UUAB 4LP8A 4X66B 3CCQV 4YXWG 5JVDA 1NKDA 3M8AA 5KAIZ 2YI9A 3J80N 1S72V 1YITV 2ZE6A 1GRJA 4QGPA 4UFZA 4J7ZA 4GLXA 2EJRA 3HKEA 1AR4A 4K0KB 2WA4A 4DR7B 3LSUA 4UCVA 2Y4UA 1Q6UA 3FYEB 3IC9A 2IJIA 2DYSB 4I50B 2Q7EA 5H6RA 3ZMSA 1XNQB 4TV8A 5LHHA 4DUYB 1S77D 3M99B 2ZD9A 2UXCO 4UCUA 2D2CB 4U7OA 2E75B 1L1FA 4GZRB 1JVMA 3B09A 2JJ1G 1YCIA 4TOIA 2IJKA 4IT5A 1W0KG 2FKXA 5GW7A 4HYOA 4NR1A 2CE4A 2KG7B 5BY1A 1ZAUA 3CRCA 3DC6A 1N32O 1MNGA 4KXRA 4O2AB 4YJ2A 4IHJB 1WP7A 4KL1A 4MVUA 2YIBA 4CS2A 3K58A 2HLDG 4RO2A 2YIBD 4O4HB 4BIUA 3OR7C 5DECA 4KHPO 1OCOB 3ABMC 2BSKB 4GUNA 4UVAA 3AG4B 3SR2C 1AI4A 1KKDA 2IH3C 1YF2A 2HR3A 2QWNB 1HNXB 4PA9A 1BGYH 3IFXA 2P7TC 1XL6A 2QGNA 5K1PA 1FJGB 1GN6A 1HNZO 1V55B 1EN5A 1I7FA 3QG5A 4JYAB 4RQFA 1F4NA 4OXSA 4FMTA 2R9RB 1I5XA 3K3WA 4EB6B 3APOA 4JV5O 1BHAA 3GVMA 3CEIA 4GYCB 2A9HA 5BMVB 5CBFA 4Q6GA 3F7YC 4ZOLA 2WLLA 5J2TA 2LW1A 1KECA 1YTFB 4NXMO 2LJ2A 1PD3A 2Q7HA 5EIBC 4CS3A 1QVGU 1M90W 2YI8A 2VRZA 3FYIB 1OV9A 1FXKC 4W4LA 2PGGA 3RYCA 4LF4O 4EKWA 4IYHA 2EILB 3JAWB 1XQ8A 3K5MA 4LF5B 1IBMB 2IW5A 4K8ZA 4DRXB 5KA6A 3K03A 2HEPA 2JK5C 2CTRA 1ZL8B 2P22C 1KMIZ 1Q7YW 3BFRA 1V9PA 1S76D 2ZNIA 2QEXV 3EVKA 4DV1B 3F5WC 2QWOB 4JI8O 3BVOA 4J10A 5CA1B 2QKCA 3A2FA 1RPRA 3TGUH 5CB4B 3W7TA 5F2VO 3ETDA 1OCZB 4E4EA 4UVBA 4ZI7A 4DR2O 1VMGA 4FPPA 1NTMH 3CCVV 1XDCA 1WNSA 3UM7A 2WA3A 1PV0A 4X1YA 2BE3A 3KCYA 1N0JA 3CRMA 1KP2A 1N32B 4RWUA 1N36O 1OCOC 4DV6B 4ASUG 3AG4C 1OZ0A 4YY3O 2Q0AA 3O65A 2ZXWB 2XAFA 1K5SA 4JI1O 4LFAO 2JJ2G 2XAQA 1V54C 1MZFA 1OHHG 3RWRD 4CS4A 3WB0A 1Q8IA 1V55C 1GM8A 1NH2D 4LFBO 3QVNA 2Z0AA 4JPRA 1HNZB 2BCCH 2PF4E 3N2KB 5LMNO 2A7WA 5L3EA 2WPDG 3X2QC 4NTWA 4JI0O 3CCUV 5KMGA 4JAAA 2ZQMA 1IXMA 1L0NH 4J7JA 3CYOA 1M56B 4DV2O 4AHCA 5E1AC 4JV5B 5LOVB 2F95B 3ZMTA 5IJ0B 1H38A 5EIBD 1GM9A 3CRQA 3WU2Z 2CUGA 1Q81W 3ZRWB 1QHTA 3CMAV 4O2BA 1ORQC 5L3BA 2Q5ZA 3RYHB 3SYAA 2DWDC 2ZT9B 3AK2A 5B1OA 3L75H 3OD4A 5KHKA 3OTFA 3A0HZ 3T4ZA 3JAKA 4RUFA 3ZX6A 1IBLO 3KZIZ 4LF8O 4UCRA 4LF4B 5EBLC 4RQEA 1Q6IA 3SGIA 4PDLA 4PA7A 3N2GB 4I9WA 4I50A 4LC1A 1IXBA 1FD9A 1K5QA 4DR1O 1AI7A 5BXZA 3FB6C 3UT5B 4B3TO 4X20A 4I7ZB 1QR9A 1RSOA 4BWAA 3CCMV 1QU7A 4AILC 2DE0X 4U3JB 4X8AA 1T5EA 1NTZH 2FYUH 2G38A 4UVCA 1BL8A 1H2NA 3K0DA 1N8RW 1IBKO 3CPWU 3ABLB 4HAMA 3SJAC 1XREA 3RYFB 3ZN0A 5FPRA 4D7TA 4MTGA 3BPZA 2UUCO 4IHJA 5IYDO 5LP6A 4J9YB 4O4HA 2YS8A 5KA5A 1HNWO 1MA1A 2BSKA 3APQA 4P30A 3E8GA 1Y76B 3A0RA 3FAVB 1G1XB 1YJNV 3OAAG 1Y6XA 2A06H 4LFBB 4EFBA 4TSFG 3G80A 2P67A 5D5QA 5E79Z 3JASB 2B9ZA 3T1CA 1YDXA 4J9ZB 4JI0B 4FFBB 4F4LA 3OEHG 1TAEA 1JX9A 1VF7A 1H2LA 4MW8A 1L8DA 4KUMA 3SPJA 4WFFA 1ENVA 4UUJC 1AP6A 5KAFZ 1J5EO 2ARHA 3UO3A 3D36C 1UPGA 4WFGA 2F4VB 1UJWB 2HVJC 5BMVA 3HR0A 1M5IA 2VQEB 4X64O 2Z5UA 3MAQA 5B5EZ 2OTJV 1GK9A 2CTPA 2JS5A 2UXNA 1FAFA 3H9VA 1TGOA 2ATKC 4P9PA 5LXTA 5IJ9A 2Q4PA 1G6UA 5EYPB 1IBLB 2QSAA 4LF8B 3E86A 1DF5A 4LWSA 3JAWA 1B04A 2UXXA 3H01A 1K4DC 4ZBMA 4DV4O 1IDSA 2X6AA 3DGEA 5JH7B 3S3XA 4W4KA 4NXNB 1K34A 1K73W 2YEVB 3E89A 4JI6O 3QF7A 2VS0A 2VWJA 1F4MA 4XDKA 4WCEV 1AR1B 2JDIG 4B3RB 3LSSA 1PNLA 1HW7A 2ZINA 2CGNA 3ABLC 1CP9A 1XMQB 1XMOO 4L8JA 3ML0A 4GKKO 1YI2V 1SERA 1GH6A 1LUVA 1GAXA 1W2BU 4LH6A 2MK3A 4DV5O 3ZJZA 3W7SA 2ZR3A 5A9GA 2UUCB 2YIDA 3M7MX 2Y4TA 4HZ3A 1XHZA 1HNWB 2L6LA 2WLHA 4K35A 1JOYA 2Y0IA 5IYZA 2PUSA 1BT8A 1EBOA 2R9IA 3OR6C 3N27A 2KQXA 4LNUB 4B7EA 4O4LB 4B3SO 2RJZA 1S5HC 5LGTA 1GTOA 1PNMA 1EM1A 2GSMB 2CTQA 2Y0PA 2LQTA 1NU1H 4ICGA 4JTDB 2UXBB 1SQGA 1P4RA 3ZMUA 2B5UA 4UV8A 1WA8A 2WLIB 4AQYB 3D3IA 4JI3B 3SYCA 4WF9V 2ZIOA 5JWPA 3VBBA 3ABMB 1JA8A 1M1KW 3CJHB 4MTXA 4BW9A 3SYPA 1XHXA 5L3DA 4DW0A 3B77A 1OJHA 1SQXH 4I9QA 1AR5A 2BOBC 5J9PC 5H9CA 3GWKC 3CHXA 1Y74B 3L70H 3E2EA 3KKYA 2E5LB 4TT3G 2W6IG 1PL0A 1FXVA 1QVFU 1N33B 3OTOO 1NH2B 2ZIMA 4I55A 1QBZA 5C93A 2B1GA 3SPIA 3K57A 5LA6B 3BRCA 1KQSU 4FLYA 4DR3B 4OX9B 3ZHUA 2ETNA 4JI6B 3BA8A 1WB8A 5D5PA 5B1NA 3JSLA 4J41A 3JD1A 2EIKC 5FNVB 4OGQB 4ABMA 1AILA 5CMUA 1LUWA 1P7BA 4MVRA 3ASNC 2QM7A 3W7XA 4H13B 4IL6Z 2CAZC 4GKKB 3ZHRA 1RP3B 3T1HO 3K06A 3ZRSA 3JD4A 3DXRB 1TA8A 1FXKB 2A3QA 3G67A 1JR9A 2FB5A 4WFHA 4I4TB 3K9SA 1GN2A 1AJPA 3FAVA 1Q90D 2ZE7A 1IVSA 4B3SB 2R72A 4I0XB 3HPLC 4LCUC 2EX3A 2OTLV 3JASA 2LP7A 3JATA 1VP7A 3AG2B 3NXSA 2UXDB 5B66Z 4FLWA 5JCOA 5GONA 4TWKA 3CRAA 1VARA 3I56V 2YIAA 3RW0A 1K92A 2LGWA 3P3PA 3JD2A 1GM7A 4JI2O 2Y69C 1KC8W 2ADQB 1FFXB 3UO2A 3G4SV 1IZ3A 3C3TA 2WLJA 4GCZA 4LF9O 3IC7A 5FL7G 3E83A 1GKFA 2F1MA 3RN4A 4X62O 4WBNB 1SF9A 4GKJO 1WP8A 1V54B 2JRIA 4X1KB 1HWYA 2NR5A 2ZE5A 1SQVH 1A32A 2PYJA 4ZHQB 3I5DA 1KP3A 1K97A 2VQFO 4QPKA 3BA9A 1OCCB 1VQ8V 4DO2A 2FTKA 5EC2C 5KX5A 1NR1A 2ZM6B 3X2QB 3T1YB 4XDLA 3ZN1A 3ZEDA 3OTOB 1PNKA 3IGAC 4OPAA 3TXSA 3JALB 1NZ6A 2GUZB 1SA0B 3UCSC 4NB5A 4QPJA 4PA3A 3SYOA 3PJSK 3CXCU 1K3EA 1I0HA 4O4JA 4JYBA 3Q4HB 1VQPV 3CP1A 4NKGB 1D5NA 2XAJA 4NYKA 3C90A 1YJWV 1TUBB 4DR6O 1NVPD 1ZLZA 2AZ2A 5K1XA 1I94O
chains in the Genus database with same CATH topology
1N33O 1NS1A 1N32O 4X64O 4JI8O 4DV6O 4B3RO 1FYJA 1FKAO 4DV3O 3F5TA 4KHPO 1XMQO 4DR3O 5IWAO 4DR1O 2HHHO 4K0KO 4OX9O 4DR2O 5BXZA 1HR0O 1XEQA 4A5UB 2ZM6O 4B3TO 3T1YO 3J81N 4LF7O 4JI2O 1N36O 4DV4O 1N34O 1HNZO 1DK1A 4YY3O 3O65A 1R6TA 4JI1O 4LFAO 2N74A 4JI4O 4LF9O 2ZKOA 1AB3A 4LF5O 1IBKO 4DR5O 3M8AA 4LFCO 1IBMO 3J80N 2DJVA 4DR7O 4JI6O 4X62O 4LFBO 2Z0AA 4GKJO 3RT3C 4B3MO 2UUCO 2JRIA 3OTOO 5LMNO 2UXBO 1HNWO 4JV5O 1A32A 3J7AU 2F4VO 2LW7A 4JI0O 4DV1O 2UUBO 2VQFO 1XNQO 2VQEO 4DUYO 5FLXN 1XMOO 4DR4O 1G1XB 5BR8O 4GKKO 4LF6O 3JAMN 4DV7O 4YHHO 4DV5O 5IT9N 2AGAA 4JI5O 4NXMO 2UXDO 4DUZO 4DV2O 4AQYO 4JI3O 4OPAA 5LL6Y 1AILA 1HNXO 5LMUO 1FJGO 4JI7O 4LF4O 1YZBA 3R66A 1X59A 2UU9O 4OPHA 4X65O 4B3SO 2UXCO 3T1HO 5A2QN 2DOSA 2UUAO 4JYAO 1KUQA 4X66O 4NXNO 1R1BA 1F7YA 1XNRO 4DV0O 1D2DA 4DR6O 1IBLO 1J5EO 4LF8O 5H5NA 2FKXA 3SDLA 2E5LO 5BY1A 1I94O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 O;  1NS1 A;  1N32 O;  4X64 O;  4JI8 O;  4DV6 O;  4B3R O;  1FYJ A;  1FKA O;  4DV3 O;  3F5T A;  4KHP O;  1XMQ O;  4DR3 O;  5IWA O;  4DR1 O;  2HHH O;  4K0K O;  4OX9 O;  4DR2 O;  5BXZ A;  1HR0 O;  1XEQ A;  4A5U B;  2ZM6 O;  4B3T O;  3T1Y O;  3J81 N;  4LF7 O;  4JI2 O;  1N36 O;  4DV4 O;  1N34 O;  1HNZ O;  1DK1 A;  4YY3 O;  3O65 A;  1R6T A;  4JI1 O;  4LFA O;  2N74 A;  4JI4 O;  4LF9 O;  2ZKO A;  1AB3 A;  4LF5 O;  1IBK O;  4DR5 O;  3M8A A;  4LFC O;  1IBM O;  3J80 N;  2DJV A;  4DR7 O;  4JI6 O;  4X62 O;  4LFB O;  2Z0A A;  4GKJ O;  3RT3 C;  4B3M O;  2UUC O;  2JRI A;  3OTO O;  5LMN O;  2UXB O;  1HNW O;  4JV5 O;  1A32 A;  3J7A U;  2F4V O;  2LW7 A;  4JI0 O;  4DV1 O;  2UUB O;  2VQF O;  1XNQ O;  2VQE O;  4DUY O;  5FLX N;  1XMO O;  4DR4 O;  1G1X B;  5BR8 O;  4GKK O;  4LF6 O;  3JAM N;  4DV7 O;  4YHH O;  4DV5 O;  5IT9 N;  2AGA A;  4JI5 O;  4NXM O;  2UXD O;  4DUZ O;  4DV2 O;  4AQY O;  4JI3 O;  4OPA A;  5LL6 Y;  1AIL A;  1HNX O;  5LMU O;  1FJG O;  4JI7 O;  4LF4 O;  1YZB A;  3R66 A;  1X59 A;  2UU9 O;  4OPH A;  4X65 O;  4B3S O;  2UXC O;  3T1H O;  5A2Q N;  2DOS A;  2UUA O;  4JYA O;  1KUQ A;  4X66 O;  4NXN O;  1R1B A;  1F7Y A;  1XNR O;  4DV0 O;  1D2D A;  4DR6 O;  1IBL O;  1J5E O;  4LF8 O;  5H5N A;  2FKX A;  3SDL A;  2E5L O;  5BY1 A;  1I94 O; 
#chains in the Genus database with same CATH topology
 1E79 G;  3R65 A;  3MDS A;  5IDJ A;  1R3L C;  3RVY A;  1VIB A;  2WLM A;  1XIL A;  4R8C A;  4QNH B;  1FKA O;  4DV3 O;  4R50 A;  3ZS8 C;  3CX5 F;  2GTA A;  3G6B A;  4MS2 A;  5IWA O;  3BEH A;  4JAS A;  2OIG A;  4ZIB A;  1R6K A;  5KHI A;  4J7K A;  3ZHQ A;  3AG2 C;  4CH6 A;  5EZY B;  1IX9 A;  1M57 C;  3AG7 A;  2UXC B;  1QLE B;  4UCS A;  5J2U B;  2VWK A;  2OIE A;  4X1I B;  2XND G;  1JFF B;  5CA0 B;  2ZKO A;  2JGD A;  4LFC O;  2ILM A;  3UKM A;  1R73 A;  5LYJ B;  1IUR A;  1W59 A;  2HJF C;  2DMX A;  5C8Y A;  4E2L A;  4TUY B;  3HKB B;  3K5O A;  2YC0 A;  2XHB A;  5JQG B;  1Q3E A;  4U7N A;  4KHP B;  2W0F C;  3HKC B;  2Z3Y A;  3B4S A;  5B3S C;  4LF6 O;  4X62 B;  1AI6 A;  5LP6 C;  3CJH A;  1ZWI C;  2F43 G;  1SQB H;  3VQY A;  1B3Q A;  1OCC C;  5CBG A;  3RYI A;  4NTX A;  2X6C A;  3ZBH A;  4JI7 O;  1FFT B;  4MVQ A;  2V7Q G;  2QR4 A;  4X65 O;  3ZMZ A;  2IM9 A;  1WPB A;  2A0L A;  1NJI W;  3CCL V;  2DYR B;  3CXH F;  2O57 A;  4FM0 A;  1DGS A;  3JCZ A;  1WLE A;  1SQP H;  5LA6 A;  1SRY A;  1L0L H;  4LR3 A;  1U96 A;  3CC4 V;  3VQW A;  5LHI A;  1AJN A;  4MTF A;  1XUQ A;  1NS1 A;  1Y66 A;  1DTO A;  4HNA B;  1ZUQ A;  3SPC A;  4G27 B;  3GB7 C;  3GWO A;  4MW3 A;  4NXM B;  1JJ2 U;  4PDM A;  2HHH O;  4DR6 B;  1R3K C;  4A5U B;  1VQ7 V;  2EJ7 A;  1YVW A;  4DV3 B;  4CBC A;  4BIO A;  1Z5W A;  2HG5 C;  3ETE A;  2BTQ B;  3LSQ A;  3RVZ A;  3AG1 C;  4Z1M G;  4MT8 A;  1DLB A;  3QNE A;  2RN9 A;  3JYC A;  3IAY A;  1XI1 A;  2ZDI C;  2RCV A;  1Q43 A;  1QLE C;  4B7K A;  3OM3 B;  3CWB H;  1PPJ H;  3RBZ A;  3L74 H;  4JI8 B;  3FB5 C;  5KHH A;  1MMM A;  2LW7 A;  2GV9 A;  1JCH A;  1G8M A;  1TVK B;  4GT1 A;  4DR2 B;  4DR4 O;  2Q0O C;  1YXB A;  3FFQ A;  4BR6 A;  4YHH O;  2AGA A;  4Q20 A;  2KG7 A;  3FKS G;  4DUZ O;  3JCU Z;  5JVD B;  1Z5V A;  1EN6 A;  1N36 B;  1EZJ A;  4O2A A;  1PM9 A;  2ZNJ A;  2ZR2 A;  5LGU A;  4YY3 B;  3K08 A;  5ITZ B;  4JI1 B;  4LFA B;  1M4U A;  3STZ C;  3R66 A;  1CEZ A;  3ZRX A;  4IIJ B;  3HKE B;  4X1K A;  1M93 A;  1XNR O;  2M6Y A;  2ADP A;  4UXN A;  5LMN B;  4CC6 A;  5H5N A;  5EK0 A;  4JYY A;  4ZKI A;  3TJT A;  5L3G A;  1I08 A;  3KCX A;  1QR8 A;  2DYR C;  4DK1 A;  1GN3 A;  2QM4 A;  4TV8 B;  1YJ9 V;  3F5T A;  2D3O W;  3MD0 A;  3OEE G;  3NR7 A;  4P2Z A;  3JAL A;  5L3F A;  4DV2 B;  1HR0 O;  4CC5 A;  2P5O A;  2WAM A;  4EB6 A;  1S5L Z;  1WB7 A;  1H2K A;  2GBO A;  4JTC B;  3C3S A;  4LF7 O;  3CRR A;  3OGI B;  1JJO A;  1VEW A;  1XBL A;  2W6J G;  2QJ1 A;  1YTF D;  5IE9 A;  2BTO A;  3CD6 V;  1QCE A;  1ARO P;  1US6 A;  5CA3 A;  1H2S B;  4YJ2 B;  4DR5 O;  4FLX A;  4GX2 A;  5DM6 V;  4B3M O;  3DTU B;  1SC5 B;  1SET A;  2HJD A;  2QTO A;  3U10 A;  2K9P A;  1COW G;  4DRX A;  2A79 B;  2UUB O;  3BHP A;  2DQ0 A;  3CCS V;  4DR1 B;  1ZL8 A;  1ZX3 A;  2CDY A;  5BR8 O;  3ZIA G;  1H2G A;  4B3T B;  3UQ8 A;  3FX7 A;  3E8H A;  3BCC H;  2FL4 A;  3AK3 A;  5CA1 A;  3H1I H;  5CB4 A;  4JAV A;  2NN4 A;  4BW5 A;  1NI8 A;  2ZE8 A;  5CA0 A;  4F6R B;  2CH7 B;  1BE3 H;  5H2F Z;  2EIK B;  3QO8 A;  2UU9 O;  4KFM A;  1IBK B;  4FFK A;  2UUA O;  4D7S A;  3QTC A;  4X66 O;  3ASN B;  2AHZ A;  1KD1 W;  1D5A A;  4TUY A;  4WFB V;  3VQX A;  4ZOL B;  3E8B A;  1Q86 W;  2Q7G A;  2WLL B;  2JIZ G;  2PYL A;  3F7V C;  2EUL A;  2LGQ A;  1H8E G;  1NVP B;  4JAU A;  3G71 V;  1PKX A;  3HKC A;  3L71 H;  3U11 A;  4UCO A;  3L73 H;  2Q8V A;  1R3I C;  3LNN A;  2YXH A;  3B40 A;  4R6Z A;  3RYC B;  4K0K O;  3MHS C;  3RGB A;  1HP8 A;  1F23 A;  3N2K A;  1VQ6 V;  2YUA A;  2V4D A;  1BQ0 A;  2YSU B;  3HKD B;  2GHY A;  3FB7 C;  4Z2W A;  5KHG A;  1JQ0 A;  5LBQ A;  1RPO A;  1DK1 A;  1QQC A;  4DW1 A;  3O9O A;  1R6T A;  3TET A;  4PEL A;  4PI2 A;  4MTO A;  1BSM A;  2PI5 A;  2Y69 B;  4JTA B;  2OCH A;  5LOV A;  5IJ0 A;  1J5E B;  4L87 A;  2JEU A;  1ZSP A;  4LF7 B;  1K33 A;  1AI5 A;  3ZRW A;  4ZI7 B;  3P30 A;  1PL4 A;  3RYH A;  3D36 A;  4X64 B;  3KG2 A;  2X6B A;  1YSC A;  1NT2 B;  1BCC H;  3W7W A;  1VQM V;  4FJC C;  4DR5 B;  5FLX N;  1SKV A;  2QWP B;  3OGC C;  4DK0 A;  1GO3 F;  5LHG A;  4Z1V A;  5HFM A;  4DXW A;  4JI5 O;  2PTM A;  3ASO B;  3ZHT A;  2WLN A;  2YXL A;  5AG2 A;  2P90 A;  1WN7 A;  2ODM A;  5B1A B;  2RDC A;  4DV4 B;  1HNX O;  5LMU O;  3LDE A;  1F51 A;  1URF A;  1XL4 A;  4IYI A;  3N2G A;  4QJF B;  1FJG O;  4O4I B;  1THZ A;  2C2A A;  1R6N A;  3UT5 A;  3K5L A;  2EBO A;  5DED A;  5A2Q N;  4GX5 A;  1N0N A;  3L9D A;  5KMG B;  4JYA O;  1R1B A;  3BAA A;  3PN1 A;  1B6Q A;  2E76 B;  4BIZ A;  2IJH A;  1WPX A;  1NTK H;  2XUM A;  4U3J A;  4LBE C;  1XMO B;  4DV5 B;  1VQL V;  4R7C A;  3RYF A;  4O2B B;  2OCC C;  4CH3 A;  3K79 A;  2Q69 A;  3ETQ A;  1XEQ A;  4QE9 A;  5ITZ A;  2GTS A;  1G4Y B;  4J11 A;  3J81 N;  5DN6 G;  2WSS G;  4FIP C;  1Y76 A;  2LFR A;  3L72 H;  3JAK B;  4IIJ A;  2NNU A;  3CCR V;  1EN4 A;  4FM1 A;  1VQ9 V;  4QIW F;  4JGS A;  4JZ2 A;  4JI4 O;  1B06 A;  3OE7 G;  2XAS A;  4J80 A;  4PA6 A;  1M9N A;  4LF5 O;  1IBM O;  4MVM A;  1M57 B;  1YIJ V;  1SES A;  4FFB A;  4EFE A;  1H2M A;  1BMF G;  3EFF K;  3WB2 A;  3JD0 A;  3RT3 C;  1Y67 A;  3JAR B;  3VOU A;  3RFR A;  4FVM A;  4IGG A;  2ZCE A;  4X20 B;  4PDR A;  4X89 A;  3QO5 A;  3WG7 B;  1FXH A;  1VQN V;  4DV1 O;  1RSO B;  3SPH A;  4TV9 B;  3I55 V;  4GX0 A;  3ABK C;  1VF6 A;  3HB3 B;  1BQZ A;  3LDC A;  2JEX A;  4DV7 O;  1I5Y A;  2F23 A;  2IU0 A;  1Y4M A;  2EIJ C;  2EZO A;  5LL6 Y;  5B3S B;  2PZS A;  4YJ3 B;  1SQQ H;  3ASO C;  5LP6 B;  2X0L A;  5EYP A;  4JI5 B;  3B8M A;  4KP4 A;  5EBW C;  1TUE B;  2FML A;  5B1A C;  1MAB G;  3VQV A;  1LR1 A;  2BOC C;  5LMU B;  4FZ1 A;  4RUE A;  3OUS A;  1AVM A;  1KKC A;  5JH7 A;  3ZRV A;  3OFN G;  5FPO A;  1MOF A;  3W7U A;  1NR7 A;  4JZG A;  2YEV A;  1K7D A;  1RM1 C;  1AP5 A;  4YIP A;  1O9H A;  3WFV A;  2AZ0 A;  3U0Z A;  4H33 A;  2M7W A;  2YIC A;  4PI0 A;  4F6R A;  1Q82 W;  2EIM C;  2EZP A;  2CH7 A;  4MSW C;  4UV9 A;  3ZHV A;  2QM8 A;  2CGO A;  2L35 A;  1YEW A;  3T1H B;  4NTY A;  4NVP A;  4G2K A;  4PDV A;  2DJV A;  1DF4 A;  1CXZ B;  4AI8 A;  2F93 B;  5LXT B;  1K4C C;  5IJ9 B;  2Q67 A;  2H3O A;  3AG1 B;  1H8H G;  4LNU A;  4O4L A;  1NQT A;  5KLV H;  3THO A;  1FS0 G;  3AK1 A;  4LWS B;  4JI4 B;  2DYS C;  3ABU A;  4FLU A;  1MSW D;  1MG1 A;  2ITD C;  4UB8 Z;  3HKD A;  1LNQ A;  3TCU A;  3AG3 B;  2EIN B;  1VF5 B;  3WG7 C;  1W0J G;  2LO1 A;  3K04 A;  1OCR B;  4JI2 B;  2XAG A;  5GTI Z;  5B1B B;  2XTA A;  1FPO A;  2HVK C;  2WLI A;  5GTH Z;  1YZB A;  4D6T H;  4WFE A;  2IJJ A;  4LF9 B;  4DV7 B;  3EHB B;  2Q73 A;  4GKJ B;  4FK5 C;  3T2M A;  2XAH A;  3OW2 U;  1EZV H;  2XT9 A;  4TQF A;  2JGU A;  2LFS A;  4P9O A;  2VQF B;  2AW9 A;  3CSX A;  5HFL A;  1FYJ A;  2DQ3 A;  1YHQ V;  1Y74 A;  3CC7 V;  1ROP A;  1HDJ A;  5IYZ B;  2H94 A;  1E1R G;  2HKO A;  1AJQ A;  2CTW A;  4O4I A;  1QLN A;  3ICX A;  4PA4 A;  4FLT A;  2P4V A;  1N34 O;  2AHY A;  3SPG A;  4JF3 A;  3CME V;  4FM2 A;  5FNV A;  3BY6 A;  1WA8 B;  2AXT Z;  3IJ4 A;  3T4D A;  2QKA A;  4UB6 Z;  1I94 B;  4CH4 A;  4QE7 A;  1Z2G A;  1GN4 A;  2R9A A;  4PJ0 Z;  1VQ4 V;  2F4V O;  2QWQ B;  1JPX A;  4DV6 O;  2N05 A;  3DXR A;  1FXK A;  2VQE O;  3LUT B;  5IWA B;  5EBM C;  4FZ0 A;  2MW2 B;  4I4T A;  4HBN A;  2W0X A;  5IT9 N;  1S3J A;  3LDD A;  3ZHS A;  1MZE A;  3WB1 A;  2WWW A;  2EIL C;  5KHJ A;  2Q9L A;  2RQ6 A;  4I0X A;  4K3A A;  3ZCC A;  3SJB C;  4C7U A;  1XOU A;  2DN9 A;  3AG3 C;  2EIN C;  1X4T A;  2WLK A;  1X59 A;  4J42 A;  4I55 B;  1OCR C;  4LFC B;  2IU3 A;  5EC1 C;  3CS5 A;  5B1B C;  1KUQ A;  4NXN O;  3JAR A;  1F7Y A;  3E22 B;  4DV0 O;  1D2D A;  2KB1 A;  1SZX A;  3H1L H;  4TV9 A;  3JSN A;  1FFX A;  1OCZ C;  1EFR G;  4PD4 F;  3A0B Z;  3H1K H;  1WAZ A;  4YIO A;  4B3R O;  5LGN A;  4XBF A;  4LF6 B;  2H8P C;  1VQO V;  4MVO A;  1KYO F;  2KSD A;  1XMQ O;  4WBN A;  3CCJ V;  3JD3 A;  2DW4 A;  3DSQ A;  3CB2 A;  4MVS A;  2ZXW C;  2QDO A;  4ZHQ A;  4YJ3 A;  1GMG A;  1JMK C;  3SYQ A;  1Q6H A;  4JI7 B;  1R3J C;  2YXY A;  3E8F A;  4H0L B;  3G6E V;  4BAY A;  4CH5 A;  4X65 B;  2QWR B;  1SZT A;  5JJE B;  3ABT A;  2RNB A;  1VQ5 V;  2HP8 A;  3JAT B;  2P06 A;  1P7G A;  3TXQ A;  1P49 A;  2PY5 A;  1SQF A;  2GUZ A;  1N34 B;  4X88 A;  1U97 A;  1SA0 A;  5JJJ B;  4WFA V;  5GON B;  2RMK B;  4CZZ A;  2Q68 A;  2UXB O;  4LH7 A;  2HFE C;  2E3C A;  3DC5 A;  3K59 A;  1S0V A;  3Q4H A;  4H44 B;  2QA4 V;  2PI4 A;  1M56 C;  2ITC C;  2IBZ H;  2OWO A;  4JYC A;  1N4C A;  2HHH B;  1TUB A;  3P3N A;  3ZMV A;  4X9Q A;  1KB9 F;  2XOK G;  4AQY O;  4JI3 O;  3OMN B;  2JS3 A;  2Y48 A;  1J95 A;  5IYC O;  5IYB O;  5H6Q A;  1MSD A;  3K9A A;  3D8C A;  4OPH A;  2DOS A;  2K1E A;  2GDS A;  4F6E A;  2X7R B;  5EZY A;  3B8N A;  5CN0 A;  2ZDI A;  5KX5 B;  3FB8 C;  3MHH C;  5J2U A;  3ETG A;  2E5L O;  4I5S A;  1N33 O;  4X1I A;  5IY5 B;  3EXA A;  1JFF A;  4DR4 B;  5LYJ A;  4YHH B;  2R70 A;  4DR3 O;  5CBH A;  4DV0 B;  4OX9 O;  4DUZ B;  1S5J A;  3H1H H;  4O4J B;  2E74 B;  3HKB A;  2NLJ C;  5J2T B;  5JQG A;  5JJN B;  3OMA B;  2OCC B;  4G28 B;  2OYQ A;  3FD9 A;  1RFY A;  3K5N A;  3B2E E;  3A8T A;  1PP9 H;  2N74 A;  3OMI B;  3S3W A;  4MVZ A;  1P84 F;  1XNR B;  1AB3 A;  4DR7 O;  4XDJ A;  2V1D A;  3OT7 A;  2CK3 G;  1O9G A;  2QKS A;  3AEI A;  3J7A U;  1E1Q G;  4DYL A;  4PV1 B;  1ZTE A;  4PHZ A;  1WJZ A;  1SS3 A;  1NBM G;  1XNQ O;  2F66 C;  3P32 A;  4DUY O;  4B08 A;  1HR0 B;  5JCO C;  4UCT A;  3JAM N;  1BZK A;  3CCE V;  1K9M W;  2P4K A;  2UXD O;  1CPY A;  3H1J H;  2JGD B;  3ABK B;  4GX1 A;  5KUM A;  3STL C;  4HNA A;  4EEQ A;  3K0G A;  5KUK A;  3TK1 A;  2B1I A;  3D3Q A;  2IH1 C;  1VF6 C;  1BHB A;  4X1Y B;  2EIJ B;  5C8Y B;  5BZB A;  5L3C A;  1BS3 A;  1VQK V;  2QTS A;  3CE2 A;  4B3M B;  3E35 A;  1KU9 A;  2Q6A A;  2OT5 A;  2QE7 G;  4RAI A;  3SDL A;  2UUB B;  2BTQ A;  2N04 A;  4FLZ A;  4N23 A;  4H37 A;  3BAB A;  4K8X A;  3RYI B;  5BR8 B;  3CC2 V;  2JVD A;  1KBH A;  5TIS Z;  4TQD A;  3SJC C;  4FLV A;  3SJQ C;  1Q5O A;  5IY5 C;  2ZM6 O;  3T1Y O;  1UFI A;  2KKW A;  2YDE A;  1RM1 B;  3QO7 A;  1K8A W;  4N21 A;  3OUF A;  1QNM A;  2P6J A;  1TVK A;  3LNM B;  2UU9 B;  2DWE C;  3E22 A;  4U3F H;  2EIM B;  2UUA B;  4LP8 A;  4X66 B;  3CCQ V;  4YXW G;  5JVD A;  1NKD A;  3M8A A;  5KAI Z;  2YI9 A;  3J80 N;  1S72 V;  1YIT V;  2ZE6 A;  1GRJ A;  4QGP A;  4UFZ A;  4J7Z A;  4GLX A;  2EJR A;  3HKE A;  1AR4 A;  4K0K B;  2WA4 A;  4DR7 B;  3LSU A;  4UCV A;  2Y4U A;  1Q6U A;  3FYE B;  3IC9 A;  2IJI A;  2DYS B;  4I50 B;  2Q7E A;  5H6R A;  3ZMS A;  1XNQ B;  4TV8 A;  5LHH A;  4DUY B;  1S77 D;  3M99 B;  2ZD9 A;  2UXC O;  4UCU A;  2D2C B;  4U7O A;  2E75 B;  1L1F A;  4GZR B;  1JVM A;  3B09 A;  2JJ1 G;  1YCI A;  4TOI A;  2IJK A;  4IT5 A;  1W0K G;  2FKX A;  5GW7 A;  4HYO A;  4NR1 A;  2CE4 A;  2KG7 B;  5BY1 A;  1ZAU A;  3CRC A;  3DC6 A;  1N32 O;  1MNG A;  4KXR A;  4O2A B;  4YJ2 A;  4IHJ B;  1WP7 A;  4KL1 A;  4MVU A;  2YIB A;  4CS2 A;  3K58 A;  2HLD G;  4RO2 A;  2YIB D;  4O4H B;  4BIU A;  3OR7 C;  5DEC A;  4KHP O;  1OCO B;  3ABM C;  2BSK B;  4GUN A;  4UVA A;  3AG4 B;  3SR2 C;  1AI4 A;  1KKD A;  2IH3 C;  1YF2 A;  2HR3 A;  2QWN B;  1HNX B;  4PA9 A;  1BGY H;  3IFX A;  2P7T C;  1XL6 A;  2QGN A;  5K1P A;  1FJG B;  1GN6 A;  1HNZ O;  1V55 B;  1EN5 A;  1I7F A;  3QG5 A;  4JYA B;  4RQF A;  1F4N A;  4OXS A;  4FMT A;  2R9R B;  1I5X A;  3K3W A;  4EB6 B;  3APO A;  4JV5 O;  1BHA A;  3GVM A;  3CEI A;  4GYC B;  2A9H A;  5BMV B;  5CBF A;  4Q6G A;  3F7Y C;  4ZOL A;  2WLL A;  5J2T A;  2LW1 A;  1KEC A;  1YTF B;  4NXM O;  2LJ2 A;  1PD3 A;  2Q7H A;  5EIB C;  4CS3 A;  1QVG U;  1M90 W;  2YI8 A;  2VRZ A;  3FYI B;  1OV9 A;  1FXK C;  4W4L A;  2PGG A;  3RYC A;  4LF4 O;  4EKW A;  4IYH A;  2EIL B;  3JAW B;  1XQ8 A;  3K5M A;  4LF5 B;  1IBM B;  2IW5 A;  4K8Z A;  4DRX B;  5KA6 A;  3K03 A;  2HEP A;  2JK5 C;  2CTR A;  1ZL8 B;  2P22 C;  1KMI Z;  1Q7Y W;  3BFR A;  1V9P A;  1S76 D;  2ZNI A;  2QEX V;  3EVK A;  4DV1 B;  3F5W C;  2QWO B;  4JI8 O;  3BVO A;  4J10 A;  5CA1 B;  2QKC A;  3A2F A;  1RPR A;  3TGU H;  5CB4 B;  3W7T A;  5F2V O;  3ETD A;  1OCZ B;  4E4E A;  4UVB A;  4ZI7 A;  4DR2 O;  1VMG A;  4FPP A;  1NTM H;  3CCV V;  1XDC A;  1WNS A;  3UM7 A;  2WA3 A;  1PV0 A;  4X1Y A;  2BE3 A;  3KCY A;  1N0J A;  3CRM A;  1KP2 A;  1N32 B;  4RWU A;  1N36 O;  1OCO C;  4DV6 B;  4ASU G;  3AG4 C;  1OZ0 A;  4YY3 O;  2Q0A A;  3O65 A;  2ZXW B;  2XAF A;  1K5S A;  4JI1 O;  4LFA O;  2JJ2 G;  2XAQ A;  1V54 C;  1MZF A;  1OHH G;  3RWR D;  4CS4 A;  3WB0 A;  1Q8I A;  1V55 C;  1GM8 A;  1NH2 D;  4LFB O;  3QVN A;  2Z0A A;  4JPR A;  1HNZ B;  2BCC H;  2PF4 E;  3N2K B;  5LMN O;  2A7W A;  5L3E A;  2WPD G;  3X2Q C;  4NTW A;  4JI0 O;  3CCU V;  5KMG A;  4JAA A;  2ZQM A;  1IXM A;  1L0N H;  4J7J A;  3CYO A;  1M56 B;  4DV2 O;  4AHC A;  5E1A C;  4JV5 B;  5LOV B;  2F95 B;  3ZMT A;  5IJ0 B;  1H38 A;  5EIB D;  1GM9 A;  3CRQ A;  3WU2 Z;  2CUG A;  1Q81 W;  3ZRW B;  1QHT A;  3CMA V;  4O2B A;  1ORQ C;  5L3B A;  2Q5Z A;  3RYH B;  3SYA A;  2DWD C;  2ZT9 B;  3AK2 A;  5B1O A;  3L75 H;  3OD4 A;  5KHK A;  3OTF A;  3A0H Z;  3T4Z A;  3JAK A;  4RUF A;  3ZX6 A;  1IBL O;  3KZI Z;  4LF8 O;  4UCR A;  4LF4 B;  5EBL C;  4RQE A;  1Q6I A;  3SGI A;  4PDL A;  4PA7 A;  3N2G B;  4I9W A;  4I50 A;  4LC1 A;  1IXB A;  1FD9 A;  1K5Q A;  4DR1 O;  1AI7 A;  5BXZ A;  3FB6 C;  3UT5 B;  4B3T O;  4X20 A;  4I7Z B;  1QR9 A;  1RSO A;  4BWA A;  3CCM V;  1QU7 A;  4AIL C;  2DE0 X;  4U3J B;  4X8A A;  1T5E A;  1NTZ H;  2FYU H;  2G38 A;  4UVC A;  1BL8 A;  1H2N A;  3K0D A;  1N8R W;  1IBK O;  3CPW U;  3ABL B;  4HAM A;  3SJA C;  1XRE A;  3RYF B;  3ZN0 A;  5FPR A;  4D7T A;  4MTG A;  3BPZ A;  2UUC O;  4IHJ A;  5IYD O;  5LP6 A;  4J9Y B;  4O4H A;  2YS8 A;  5KA5 A;  1HNW O;  1MA1 A;  2BSK A;  3APQ A;  4P30 A;  3E8G A;  1Y76 B;  3A0R A;  3FAV B;  1G1X B;  1YJN V;  3OAA G;  1Y6X A;  2A06 H;  4LFB B;  4EFB A;  4TSF G;  3G80 A;  2P67 A;  5D5Q A;  5E79 Z;  3JAS B;  2B9Z A;  3T1C A;  1YDX A;  4J9Z B;  4JI0 B;  4FFB B;  4F4L A;  3OEH G;  1TAE A;  1JX9 A;  1VF7 A;  1H2L A;  4MW8 A;  1L8D A;  4KUM A;  3SPJ A;  4WFF A;  1ENV A;  4UUJ C;  1AP6 A;  5KAF Z;  1J5E O;  2ARH A;  3UO3 A;  3D36 C;  1UPG A;  4WFG A;  2F4V B;  1UJW B;  2HVJ C;  5BMV A;  3HR0 A;  1M5I A;  2VQE B;  4X64 O;  2Z5U A;  3MAQ A;  5B5E Z;  2OTJ V;  1GK9 A;  2CTP A;  2JS5 A;  2UXN A;  1FAF A;  3H9V A;  1TGO A;  2ATK C;  4P9P A;  5LXT A;  5IJ9 A;  2Q4P A;  1G6U A;  5EYP B;  1IBL B;  2QSA A;  4LF8 B;  3E86 A;  1DF5 A;  4LWS A;  3JAW A;  1B04 A;  2UXX A;  3H01 A;  1K4D C;  4ZBM A;  4DV4 O;  1IDS A;  2X6A A;  3DGE A;  5JH7 B;  3S3X A;  4W4K A;  4NXN B;  1K34 A;  1K73 W;  2YEV B;  3E89 A;  4JI6 O;  3QF7 A;  2VS0 A;  2VWJ A;  1F4M A;  4XDK A;  4WCE V;  1AR1 B;  2JDI G;  4B3R B;  3LSS A;  1PNL A;  1HW7 A;  2ZIN A;  2CGN A;  3ABL C;  1CP9 A;  1XMQ B;  1XMO O;  4L8J A;  3ML0 A;  4GKK O;  1YI2 V;  1SER A;  1GH6 A;  1LUV A;  1GAX A;  1W2B U;  4LH6 A;  2MK3 A;  4DV5 O;  3ZJZ A;  3W7S A;  2ZR3 A;  5A9G A;  2UUC B;  2YID A;  3M7M X;  2Y4T A;  4HZ3 A;  1XHZ A;  1HNW B;  2L6L A;  2WLH A;  4K35 A;  1JOY A;  2Y0I A;  5IYZ A;  2PUS A;  1BT8 A;  1EBO A;  2R9I A;  3OR6 C;  3N27 A;  2KQX A;  4LNU B;  4B7E A;  4O4L B;  4B3S O;  2RJZ A;  1S5H C;  5LGT A;  1GTO A;  1PNM A;  1EM1 A;  2GSM B;  2CTQ A;  2Y0P A;  2LQT A;  1NU1 H;  4ICG A;  4JTD B;  2UXB B;  1SQG A;  1P4R A;  3ZMU A;  2B5U A;  4UV8 A;  1WA8 A;  2WLI B;  4AQY B;  3D3I A;  4JI3 B;  3SYC A;  4WF9 V;  2ZIO A;  5JWP A;  3VBB A;  3ABM B;  1JA8 A;  1M1K W;  3CJH B;  4MTX A;  4BW9 A;  3SYP A;  1XHX A;  5L3D A;  4DW0 A;  3B77 A;  1OJH A;  1SQX H;  4I9Q A;  1AR5 A;  2BOB C;  5J9P C;  5H9C A;  3GWK C;  3CHX A;  1Y74 B;  3L70 H;  3E2E A;  3KKY A;  2E5L B;  4TT3 G;  2W6I G;  1PL0 A;  1FXV A;  1QVF U;  1N33 B;  3OTO O;  1NH2 B;  2ZIM A;  4I55 A;  1QBZ A;  5C93 A;  2B1G A;  3SPI A;  3K57 A;  5LA6 B;  3BRC A;  1KQS U;  4FLY A;  4DR3 B;  4OX9 B;  3ZHU A;  2ETN A;  4JI6 B;  3BA8 A;  1WB8 A;  5D5P A;  5B1N A;  3JSL A;  4J41 A;  3JD1 A;  2EIK C;  5FNV B;  4OGQ B;  4ABM A;  1AIL A;  5CMU A;  1LUW A;  1P7B A;  4MVR A;  3ASN C;  2QM7 A;  3W7X A;  4H13 B;  4IL6 Z;  2CAZ C;  4GKK B;  3ZHR A;  1RP3 B;  3T1H O;  3K06 A;  3ZRS A;  3JD4 A;  3DXR B;  1TA8 A;  1FXK B;  2A3Q A;  3G67 A;  1JR9 A;  2FB5 A;  4WFH A;  4I4T B;  3K9S A;  1GN2 A;  1AJP A;  3FAV A;  1Q90 D;  2ZE7 A;  1IVS A;  4B3S B;  2R72 A;  4I0X B;  3HPL C;  4LCU C;  2EX3 A;  2OTL V;  3JAS A;  2LP7 A;  3JAT A;  1VP7 A;  3AG2 B;  3NXS A;  2UXD B;  5B66 Z;  4FLW A;  5JCO A;  5GON A;  4TWK A;  3CRA A;  1VAR A;  3I56 V;  2YIA A;  3RW0 A;  1K92 A;  2LGW A;  3P3P A;  3JD2 A;  1GM7 A;  4JI2 O;  2Y69 C;  1KC8 W;  2ADQ B;  1FFX B;  3UO2 A;  3G4S V;  1IZ3 A;  3C3T A;  2WLJ A;  4GCZ A;  4LF9 O;  3IC7 A;  5FL7 G;  3E83 A;  1GKF A;  2F1M A;  3RN4 A;  4X62 O;  4WBN B;  1SF9 A;  4GKJ O;  1WP8 A;  1V54 B;  2JRI A;  4X1K B;  1HWY A;  2NR5 A;  2ZE5 A;  1SQV H;  1A32 A;  2PYJ A;  4ZHQ B;  3I5D A;  1KP3 A;  1K97 A;  2VQF O;  4QPK A;  3BA9 A;  1OCC B;  1VQ8 V;  4DO2 A;  2FTK A;  5EC2 C;  5KX5 A;  1NR1 A;  2ZM6 B;  3X2Q B;  3T1Y B;  4XDL A;  3ZN1 A;  3ZED A;  3OTO B;  1PNK A;  3IGA C;  4OPA A;  3TXS A;  3JAL B;  1NZ6 A;  2GUZ B;  1SA0 B;  3UCS C;  4NB5 A;  4QPJ A;  4PA3 A;  3SYO A;  3PJS K;  3CXC U;  1K3E A;  1I0H A;  4O4J A;  4JYB A;  3Q4H B;  1VQP V;  3CP1 A;  4NKG B;  1D5N A;  2XAJ A;  4NYK A;  3C90 A;  1YJW V;  1TUB B;  4DR6 O;  1NVP D;  1ZLZ A;  2AZ2 A;  5K1X A;  1I94 O; 
#chains in the Genus database with same CATH homology
 1N33 O;  1NS1 A;  1N32 O;  4X64 O;  4JI8 O;  4DV6 O;  4B3R O;  1FYJ A;  1FKA O;  4DV3 O;  3F5T A;  4KHP O;  1XMQ O;  4DR3 O;  5IWA O;  4DR1 O;  2HHH O;  4K0K O;  4OX9 O;  4DR2 O;  5BXZ A;  1HR0 O;  1XEQ A;  4A5U B;  2ZM6 O;  4B3T O;  3T1Y O;  3J81 N;  4LF7 O;  4JI2 O;  1N36 O;  4DV4 O;  1N34 O;  1HNZ O;  1DK1 A;  4YY3 O;  3O65 A;  1R6T A;  4JI1 O;  4LFA O;  2N74 A;  4JI4 O;  4LF9 O;  2ZKO A;  1AB3 A;  4LF5 O;  1IBK O;  4DR5 O;  3M8A A;  4LFC O;  1IBM O;  3J80 N;  2DJV A;  4DR7 O;  4JI6 O;  4X62 O;  4LFB O;  2Z0A A;  4GKJ O;  3RT3 C;  4B3M O;  2UUC O;  2JRI A;  3OTO O;  5LMN O;  2UXB O;  1HNW O;  4JV5 O;  1A32 A;  3J7A U;  2F4V O;  2LW7 A;  4JI0 O;  4DV1 O;  2UUB O;  2VQF O;  1XNQ O;  2VQE O;  4DUY O;  5FLX N;  1XMO O;  4DR4 O;  1G1X B;  5BR8 O;  4GKK O;  4LF6 O;  3JAM N;  4DV7 O;  4YHH O;  4DV5 O;  5IT9 N;  2AGA A;  4JI5 O;  4NXM O;  2UXD O;  4DUZ O;  4DV2 O;  4AQY O;  4JI3 O;  4OPA A;  5LL6 Y;  1AIL A;  1HNX O;  5LMU O;  1FJG O;  4JI7 O;  4LF4 O;  1YZB A;  3R66 A;  1X59 A;  2UU9 O;  4OPH A;  4X65 O;  4B3S O;  2UXC O;  3T1H O;  5A2Q N;  2DOS A;  2UUA O;  4JYA O;  1KUQ A;  4X66 O;  4NXN O;  1R1B A;  1F7Y A;  1XNR O;  4DV0 O;  1D2D A;  4DR6 O;  1IBL O;  1J5E O;  4LF8 O;  5H5N A;  2FKX A;  3SDL A;  2E5L O;  5BY1 A;  1I94 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...