5EC2C

Kcsa with v76ester+g77da mutations
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
102
structure length
100
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 100
sequence length 102
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ec2C00
1K4CC 1JVMA 3GB7C 3FB7C 3SPHA 4BW5A 3ASOC 1XL6A 3AG1C 4X8AA 3F7YC 2WLNA 4WFEA 2HFEC 3K06A 5KUMA 3K04A 3ZJZA 4MVQA 5CBFA 2HVKC 2K1EA 3KG2A 3OUSA 3SYPA 3T4DA 3OUFA 3EFFK 4PDLA 2WLKA 2ZXWC 4RUFA 3SPGA 4PA3A 4MW3A 3K0DA 1V54C 3PJSK 3ABMC 4PDVA 5EC2C 5EBWC 2AHZA 4PA4A 3ABKC 4R50A 4EKWA 3SPJA 5B1BC 3ABLC 2A9HA 4MSWC 2R9RB 3E8FA 3T2MA 3R65A 2WLLA 3JYCA 1R3LC 2WLMA 3E8GA 3SPCA 3SYOA 3OR6C 4P30A 3T1CA 2W0FC 2ITDC 4G27B 2Q68A 1J95A 4PDMA 3LNMB 4MTGA 2HJFC 4UUJC 5BZBA 1V55C 3AG3C 3AG2C 3K0GA 3OGCC 3SJQC 5EBMC 3RW0A 4GX5A 3UKMA 2EIJC 4QE9A 1M57C 4KFMA 3LDEA 4XDKA 2WLIB 3HPLC 4P9PA 4PDRA 3SYCA 2DWDC 3UM7A 5CBHA 4WFGA 3F5WC 2OCCC 5IY5C 1P7BA 2A79B 3F7VC 4P2ZA 3LDCA 4WFHA 2A0LA 2QTOA 4RAIA 2AHYA 4PA7A 1G4YB 3ZRSA 4CBCA 2IH1C 4RUEA 4GX0A 4GX2A 3SYAA 4MVOA 3LUTB 4J9YB 2ATKC 2DWEC 3IGAC 2WLLB 4JTAB 4MVSA 3RVYA 5EC1C 4MW8A 5CBGA 4TWKA 2EINC 2BOCC 3RBZA 4MS2A 3T4ZA 4XDJA 4P9OA 2QKSA 2HVJC 3VOUA 2EIKC 1OCZC 2P7TC 4LP8A 4QNHB 4J9ZB 2Y69C 2X6AA 5EK0A 2EIMC 2H8PC 2KB1A 2X6BA 3FB6C 2HG5C 4LBEC 2WLJA 1ZWIC 2EILC 3STZC 4LCUC 2DYSC 4MVUA 4RO2A 1OCCC 2X6CA 4WFFA 4JTCB 3K03A 3FB8C 1ORQC 2Q67A 5EBLC 4X89A 4HYOA 2Q69A 1KKDA 3E8BA 4ZBMA 4H33A 2JK5C 3STLC 4R6ZA 4MTOA 3TETA 2WLIA 3K08A 2BOBC 3E86A 1QLEC 2WLHA 1OCRC 4G28B 3SYQA 3RVZA 4R7CA 5KUKA 4QE7A 1XL4A 3IFXA 3E8HA 3AG4C 2Q6AA 4XDLA 2ITCC 4H37A 3TCUA 4GX1A 2IH3C 4MVMA 4MVZA 5J9PC 3LDDA 3E89A 1OCOC 3ASNC 5B1AC 4OXSA 1R3JC 1S5HC 4PA6A 3X2QC 3WG7C 1BL8A 5B3SC 2DYRC 3E83A 4HZ3A 5E1AC 2ZD9A 3FB5C 3SPIA 4R8CA 4DXWA 1LNQA 3BEHA 4JTDB 4MTFA 4X88A 1R3IC 2NLJC 4F4LA 4I9WA 3OR7C 4PA9A 1M56C 1K4DC 2YEVA 1R3KC 4MVRA
chains in the Genus database with same CATH superfamily
1GN4A 4O4LB 4HAMA 4MVQA 2K1EA 5IE9A 4UXNA 3SPGA 4Z1MG 3CCMV 3JAWA 3PJSK 5B1BC 3CC2V 2XTAA 2LP7A 2O57A 2PI4A 3EVKA 4I55A 5CN0A 5JH7A 1GN2A 5KX5A 5CB4A 4MTGA 3Q4HB 3HKBA 4UB6Z 1PD3A 1FPOA 1WPXA 3OW2U 3SYCA 1SQPH 1YDXA 5JCOA 2IJHA 1K9MW 4DK1A 3ETEA 1H8HG 1FFXA 2QDOA 4QGPA 1SC5B 4CC5A 2DJVA 5C8YB 1F7YA 3HKEB 2Y4TA 4WF9V 1HWYA 4ZI7B 4XDJA 4UCUA 3ZHRA 1XDCA 3ABTA 1WAZA 4RQEA 4LWSB 4DV3O 2ILMA 4OGQB 4TUYA 1PKXA 2EILC 2JJ2G 1AI7A 1I08A 4WFFA 2PGGA 3VQVA 2P4KA 4J11A 5B1BB 3DC6A 1OHHG 2JGUA 5EBLC 1QVGU 3FAVA 4HYOA 1CP9A 2IM9A 1WLEA 2L6LA 3K5MA 2OT5A 3TETA 3MHSC 3QNEA 4HBNA 4LFAB 1XL4A 3AK1A 1H2KA 3CCJV 1OJHA 2LW7A 3TCUA 2IH3C 5J9PC 1QBZA 2X0LA 2OCHA 4E4EA 4PA6A 2XT9A 5H9CA 2LJ2A 1N0JA 2CAZC 2GTAA 3U11A 1CPYA 2XAJA 1XNRO 3FB7C 1SQVH 4O2AB 4PD4F 2P4VA 3SJBC 2E5LO 2EILB 2R72A 2WA4A 2QE7G 4LR3A 4NXMB 5L3DA 4FJCC 2BTQB 1BQZA 3SPCA 2XUMA 4G27B 4PDMA 5LP6A 1KC8W 5EIBC 1VQOV 1JPXA 1V55C 3A0RA 5IDJA 2Q7HA 3RYFB 4O2BB 3SJQC 3UKMA 5LMNO 1Q7YW 1M57C 4BIUA 1N36B 1NR1A 4WFGA 3RYCA 4JI4B 4DV0O 5BMVB 1R6TA 3UQ8A 2HR3A 1K34A 2P06A 3ZRSA 1QR9A 2E74B 4JI2O 4KL1A 4KHPB 3DGEA 4GX2A 4DYLA 2F66C 1SETA 4O4LA 4DR6O 1K5QA 5CA1A 1SS3A 2AGAA 2P6JA 2BE3A 4TQDA 3RGBA 2HG5C 3E35A 4BIZA 5KAIZ 5B5EZ 5HFLA 2YIDA 4AI8A 2UUAO 3K03A 1SQXH 2ZIMA 2Q67A 2EZOA 3Q4HA 1VF6A 4AILC 5JJNB 2JK5C 1N34O 5KLVH 1V55B 4JI7O 3ASOB 1IBMB 3AG4C 3E2EA 1F51A 1I94B 3LDDA 5KHKA 3WB2A 4JZ2A 1VF5B 4LC1A 3CEIA 5C8YA 5LHHA 1E79G 3HKEA 4MTFA 3BEHA 2UUBB 3MDSA 4DV6O 1E1QG 4ZI7A 2GTSA 1KP2A 5J2TA 2YDEA 2Y48A 3P32A 5EZYB 3N27A 3N2GB 4LWSA 2FL4A 3T4DA 2WLKA 4RUFA 1L0NH 2QJ1A 4AHCA 4O4JA 4R50A 2EJ7A 4IL6Z 1VQKV 1XMOB 2ZDIC 4UCTA 4ASUG 1IBLO 1MG1A 1JR9A 1XREA 3JD0A 3W7WA 3CRRA 5AG2A 2Z3YA 3C3SA 5H6QA 3GWOA 2XASA 1IDSA 2G38A 3ZHQA 3AG4B 4LF8O 3F7VC 2Y4UA 3H1HH 1N8RW 4FFBB 2KG7B 2HP8A 3UCSC 1KYOF 4DR1B 4RUEA 3JSNA 2Q73A 3QO7A 2QSAA 2PZSA 1VP7A 5IYBO 3LNNA 1IX9A 2P67A 4O2AA 3W7XA 2BOCC 1ZSPA 2YI9A 4X65O 3J7AU 5LL6Y 3CB2A 2ZR2A 1AR1B 3OE7G 2IU3A 2QM8A 1N32O 1P84F 2BTQA 2GBOA 3LSQA 1URFA 3B8MA 2ZM6B 2OIEA 4I50B 3DXRB 3HKDB 3JCUZ 2ZQMA 4CH5A 3T1YB 3E8BA 3RYFA 4O2BA 3OTOB 1H2LA 2EJRA 1FYJA 2BOBC 1M1KW 1FXHA 4OX9O 1VARA 1NKDA 1ENVA 3IFXA 3ZN1A 4XDLA 4DW0A 5JJEB 1Q6HA 2CTRA 2CH7B 4LF7O 3A2FA 4PV1B 1V54B 1VIBA 1PPJH 4DV1O 1L1FA 2YIBA 1HDJA 5KA6A 2YEVA 1R3KC 4DR2B 5LA6B 4YY3O 1LUVA 4DV2O 1KECA 3SYPA 3EXAA 2HJDA 4X64B 2BCCH 4CH3A 3RN4A 1NU1H 1G1XB 2DOSA 5JVDB 3R65A 2GDSA 1BZKA 3BVOA 1XHZA 3CC4V 1XMQO 1MZEA 3N2KB 4JI6B 1FXVA 4ZKIA 3DSQA 2WLIB 1BGYH 5IYZB 1OCZB 1TAEA 1AR5A 3W7TA 3THOA 4CZZA 1BCCH 5L3CA 4CBCA 1PNKA 2D3OW 1HW7A 3UO3A 4WBNB 3IGAC 5K1PA 3IC7A 5EZYA 3TXQA 3N2GA 5FNVB 2JVDA 3QTCA 4UCOA 1YF2A 2HVJC 2Z0AA 2Q7GA 3QO5A 4A5UB 2UUCB 1OCCC 5IYCO 2UU9B 2OTJV 3FB8C 5B3SB 4YIPA 1AI6A 2UXDB 1N4CA 4GUNA 5KUKA 2CTWA 1AJPA 3E86A 3I5DA 3BA8A 1HP8A 2JDIG 1GMGA 1QR8A 1QQCA 2D2CB 1XBLA 3E8HA 4WFBV 2KG7A 1L0LH 1JCHA 2QM7A 5D5QA 3E89A 1AJQA 4PHZA 2PYLA 2VQEO 3L75H 4K35A 3E83A 2R9IA 4JTDB 1A32A 1K4CC 1NTKH 4NTWA 4NB5A 3ZJZA 2Q4PA 2F95B 1GKFA 4JI5B 3K0DA 4TV9B 4I50A 3DXRA 3HKDA 2Q7EA 2ODMA 1XQ8A 1OCCB 4JPRA 3JALB 4LFAO 1BE3H 1EN6A 1R3LC 4UCVA 3LNMB 4MT8A 1FFTB 1SRYA 2LO1A 3OGCC 3WB0A 4KFMA 3UM7A 2CH7A 4U3FH 1Y76B 3F5WC 2OCCC 1P7BA 3K9SA 4WFHA 4UV9A 2HKOA 1GM8A 5E79Z 1EN4A 4MVOA 2DWEC 2WLLB 5LGNA 4MW8A 5LA6A 1Z2GA 1NR7A 1PP9H 4DUYB 2AZ2A 2VQFB 4NXMO 1I5XA 2WLJA 3I55V 1I0HA 4YHHB 5IYDO 2AXTZ 4RO2A 1AROP 3MHHC 4IIJB 1SKVA 3TGUH 2ZT9B 1JMKC 3L70H 3OM3B 1N36O 3N2KA 1JX9A 1WN7A 3VQXA 1GTOA 2WLIA 1NH2D 2UXNA 4JI4O 5IYZA 3CHXA 2Q8VA 1US6A 5GW7A 3BFRA 3AK3A 1K7DA 3G6BA 4N21A 4KHPO 4MVZA 1KBHA 1OCOC 1R3JC 1WA8B 1IBKB 4WBNA 2F93B 1S3JA 4QPKA 4FLUA 2CK3G 5FNVA 4DV7B 1XUQA 3BCCH 1THZA 1XOUA 3GB7C 4FIPC 3C90A 3AG1C 3G6EV 4BIOA 1UFIA 1PNLA 5A9GA 4JYAB 3L73H 2GSMB 3W7UA 2OYQA 5LHGA 1MSWD 1SQGA 5BY1A 5D5PA 4LF4B 1JQ0A 1TVKA 2CGOA 1F4NA 2PF4E 3ZMSA 2FTKA 4YXWG 4JF3A 3JARB 3HKCB 2IJIA 4FPPA 1J95A 3FKSG 3M99B 4UUJC 1I94O 3AG3C 3AG2C 4DV5B 4B3MB 3ZBHA 4BWAA 1HNZB 2W0XA 4P9PA 4LF6B 1WP7A 2UUBO 5IY5C 1KKCA 1LUWA 2IJJA 2F1MA 4FZ1A 1OCOB 3VQWA 4DV4B 4O4HB 1JJOA 3K57A 1NQTA 4H44B 3CMEV 1QVFU 4U3JB 2ATKC 1EN5A 3K3WA 4TV9A 1XMOO 5LBQA 1QLNA 2H8PC 3BAAA 2W6JG 3JALA 3CMAV 4NVPA 2WAMA 5FPOA 1B04A 1PV0A 1IXBA 1VF7A 2RMKB 1M56B 3AEIA 2WSSG 2MW2B 1Y76A 1VQ7V 3AG2B 1VQ5V 4IT5A 1OZ0A 2YS8A 4DR5B 4J7JA 5IY5B 2B9ZA 2YXHA 1J5EB 1YEWA 1LNQA 5KHGA 3K5LA 1QU7A 4U7NA 1SESA 1K97A 3OT7A 4B3SB 1AP6A 1Q81W 1GK9A 1XL6A 2F4VB 1S76D 4JASA 1NS1A 4CS3A 2ZM6O 3OUSA 1N33B 3JD4A 4IIJA 1WB8A 3ETQA 2AHZA 4PA4A 1VQ8V 2XAHA 4B3TB 1RPRA 3ABUA 1V9PA 4X1KB 3E8GA 5HFMA 1DTOA 4TV8B 1RFYA 2HJFC 4DUZB 1R6KA 3IJ4A 1W2BU 2V1DA 3OEEG 4LF9B 3JATB 3ZRWB 4RQFA 4KUMA 1AI5A 2KKWA 5H5NA 2DQ3A 1MABG 3W7SA 1WA8A 1K33A 1KU9A 2A79B 3P3PA 2JIZG 3QG5A 4DR2O 3WU2Z 5CMUA 4NTXA 3ZHUA 4X64O 4TWKA 2ZR3A 4EB6B 2QKSA 1Y66A 4ZOLB 3S3XA 4I0XB 2XNDG 4LBEC 1YTFD 1YJ9V 5BR8B 1QCEA 4LFCB 1XNQB 4GKKB 4NYKA 1BHBA 3JARA 3HKCA 2UXCB 3I56V 4D7SA 4JI6O 2N74A 4B08A 5L3BA 1HNWB 3A0BZ 3L9DA 3RYIB 3D36C 4AQYB 1SERA 1IZ3A 3C3TA 4PJ0Z 2QWOB 1X59A 3B8NA 1SZTA 4O4HA 3ASNC 4OXSA 1QNMA 5DECA 2DYRC 4U3JA 2W6IG 2NR5A 3ZS8C 1K4DC 3BY6A 2PTMA 1AP5A 3SPHA 1M90W 4H13B 3K06A 5KUMA 5B66Z 2PYJA 2UU9O 1M57B 3BRCA 4BW9A 3E22B 2QWNB 2FB5A 2UXDO 1NT2B 3ABKC 5GONB 2Q9LA 3ABLC 1JFFB 1H38A 1Q82W 4GKJB 3H1KH 3EHBB 2ZINA 3TXSA 2LQTA 4LF5B 1PM9A 2JEXA 3O65A 2X7RB 2IU0A 2JS3A 5IJ9B 2XAGA 4D6TH 3RT3C 4GT1A 5CBHA 5IT9N 1VQNV 2ZNJA 4J42A 4P2ZA 2RJZA 3ASNB 4C7UA 1MSDA 2CGNA 4J41A 4TOIA 2DYRB 1YJWV 1H8EG 1VQ4V 3K58A 4J9YB 4JTAB 5B1OA 5EC1C 3H01A 2EINC 4JZGA 4JI5O 4J10A 4DR4B 4FZ0A 2WPDG 2B1IA 1YSCA 4QNHB 2BSKB 2R70A 2FMLA 1UPGA 4JYYA 3M8AA 3CSXA 1E1RG 4JTCB 1ZUQA 4TV8A 4X66B 4BAYA 4GZRB 5L3EA 2Q69A 1Z5WA 3JATA 3LSUA 3ZRWA 3CCQV 4CH4A 4LFBB 4G28B 3SYQA 1OCRC 4XBFA 4FLYA 3ETGA 4EEQA 4JI0B 3CXCU 1HR0B 3CRMA 2ITCC 2N04A 1NTMH 1PL0A 4TSFG 3CC7V 3JSLA 4F6EA 2P5OA 3ETDA 3J80N 2ZD9A 5IWAB 4DV3B 4DUYO 2QKAA 4B3RB 1K92A 3OR7C 4EB6A 1BSMA 3CE2A 4ZOLA 4MVRA 1G6UA 5KHJA 4YHHO 1VQMV 2N05A 3K04A 4I0XA 1NI8A 2QGNA 4JYCA 3EFFK 5BMVA 1FXKC 2QKCA 4K8XA 5EBWC 4EKWA 5JQGB 4MSWC 3RYIA 2KSDA 4MTXA 3OEHG 3BHPA 4Q20A 1Q43A 2E75B 1MA1A 2UXBB 1G8MA 2IBZH 3HPLC 2Q0AA 2A0LA 1B6QA 5CA0B 4PA7A 2HLDG 4PELA 2K9PA 2E5LB 4JYAO 1EFRG 1GRJA 1YITV 1Q90D 3T1HB 1U97A 4N23A 1OV9A 1BMFG 1R1BA 1DLBA 5GTHZ 2CE4A 2Q0OC 4LP8A 3E22A 4W4KA 5LGTA 2Y69C 4LF4O 2EULA 5EK0A 5GONA 2YIAA 4UVBA 1BHAA 5KHHA 3M7MX 3HB3B 4KP4A 1ORQC 2RQ6A 2VRZA 4B3MO 1HNZO 3MAQA 4LF6O 4X1YB 5IJ9A 3JD2A 1RP3B 4GCZA 4I5SA 5LMUB 2WLHA 3RVZA 3OAAG 4DV4O 1RM1C 4I4TB 1XEQA 2A3QA 2VWKA 3FYIB 5L3GA 2E3CA 4BR6A 3QO8A 3JD3A 3X2QC 1BL8A 3FB5C 1SQBH 2F43G 2BSKA 4X8AA 1Q3EA 4JI3B 1Y74B 4FFKA 2GHYA 3P30A 1ZX3A 3ZEDA 1EM1A 5JCOC 2JEUA 2Y69B 4JAVA 4FFBA 1GM7A 3ABMC 1AJNA 1D5NA 2OIGA 4DRXB 3APOA 3T2MA 3WB1A 3B40A 4DR5O 1ZL8B 1SQQH 1VMGA 4DV6B 4FLTA 3DC5A 1J5EO 1W0JG 1RM1B 3AK2A 4E2LA 4K3AA 4UV8A 1P4RA 2EZPA 4B3SO 1ZAUA 3UT5B 4K8ZA 2ZDIA 2F4VO 4NKGB 2EX3A 1N33O 1P49A 2M6YA 3CJHB 3T4ZA 1IBLB 3ZHTA 1NJIW 3CPWU 3ZMZA 4JI8B 4B3TO 1BS3A 4OPHA 4OPAA 2XHBA 2DYSC 3SR2C 1SZXA 3ABMB 4DUZO 1TUBB 3ZRXA 3ZN0A 2MK3A 4LF9O 3A0HZ 4YIOA 3CCSV 1VQPV 1YIJV 2YXLA 4X20B 4R7CA 3CXHF 3ML0A 3ZHSA 5KA5A 1VQ9V 4H37A 4Z1VA 4MVMA 5CA0A 4X65B 4FM2A 3SJCC 5JVDA 1FJGB 5KAFZ 2ZIOA 3ZMTA 4JV5B 5E1AC 3JAKB 5KHIA 1K73W 1R6NA 1R3IC 1ZLZA 2V4DA 2ZE6A 4FMTA 5LP6C 2WLNA 1GN3A 3VQYA 4LFCO 3SJAC 5L3FA 1KQSU 2UXCO 1P7GA 1K8AW 1HNWO 2ZXWC 1Q6UA 3VBBA 2OCCB 3G71V 2HHHB 4ABMA 4K0KB 3H1LH 4X1YA 4AQYO 2AZ0A 3UO2A 1I7FA 2NN4A 4LF7B 3T1CA 2W0FC 3B2EE 3OMAB 1RPOA 1JJ2U 4Z2WA 5KMGB 1Q6IA 3OMIB 3OMNB 3MD0A 4DR3B 4QE9A 4XDKA 2AW9A 2DWDC 3ZCCA 4ZHQB 4IYIA 3DTUB 3TJTA 1WPBA 2V7QG 1W59A 3QF7A 2ETNA 4TT3G 3ZIAG 5DN6G 2P90A 3KZIZ 4H0LB 2YICA 1Y74A 1IBMO 5CBGA 2XOKG 1TA8A 1F23A 4MS2A 3OFNG 4DR7B 4IYHA 4J9ZB 4PI2A 3FFQA 2KB1A 4GKJO 3CWBH 3STZC 4DRXA 1WJZA 4MVUA 2XAFA 5JJJB 1AILA 2VS0A 1BQ0A 3BPZA 1ZTEA 1ZL8A 2CTPA 1KKDA 1GAXA 2NNUA 4PI0A 1RSOB 4X9QA 3K08A 2QWPB 4QE7A 3CCRV 3AG1B 2A7WA 5CA1B 1IURA 3UT5A 4IHJB 4JGSA 4DR4O 4X88A 2RCVA 5GTIZ 3CJHA 3F7YC 1M9NA 2HFEC 2RNBA 5H6RA 2EBOA 3AG3B 1QHTA 2B1GA 1GH6A 4X66O 4PDLA 4DR1O 1TUBA 2DE0X 1WP8A 4UVCA 2H3OA 2DMXA 4L8JA 4LFBO 1W0KG 4NTYA 4CS4A 2WLLA 4B7EA 1B06A 2WLMA 4JI0O 4X62B 2VQEB 1YXBA 5FL7G 4X20A 1HR0O 2Q68A 5BZBA 2L35A 3K0GA 3CX5F 2F23A 5J2TB 1XHXA 5IWAO 2ADPA 4JI1B 4O4IB 4B3RO 4DW1A 3JAKA 3T1YO 1TGOA 4GYCB 3K79A 3OTOO 4O4JB 2IH1C 3NXSA 1PNMA 2HEPA 4J7ZA 5LOVB 2FKXA 3FX7A 5C93A 3G67A 2QM4A 4LH7A 3A8TA 2JRIA 3QVNA 5IJ0B 1X4TA 1UJWB 3IAYA 4UCRA 2UXBO 3ZMVA 5KMGA 4J80A 4MTOA 3P3NA 4FVMA 4ZHQA 1F4MA 5ITZB 5LHIA 4NXNB 2E76B 3OGIB 3T1HO 3SPIA 4R8CA 4DXWA 5B1NA 4W4LA 4DK0A 1JVMA 1FAFA 4HNAB 3ASOC 3IC9A 1H2NA 3CRAA 5CBFA 3KG2A 3OUFA 2RN9A 1AB3A 4PA3A 3CRCA 5EC2C 1T5EA 1H2SB 4I7ZB 5LMUO 2Q5ZA 1RSOA 2C2AA 3HR0A 3JASB 1NVPD 2YEVB 5BXZA 4D7TA 2UUCO 3LDEA 4IHJA 1MZFA 1K5SA 2KQXA 1D5AA 1O9HA 3ICXA 2ZCEA 2AHYA 4JI3O 5DEDA 2M7WA 3JCZA 1R73A 1KMIZ 2UXXA 4FLXA 3VOUA 1EZJA 2P7TC 2R9AA 3BABA 5CA3A 1AR4A 1HNXB 3FB6C 2X6BA 1Q5OA 1Z5VA 1EZVH 1ZWIC 2ZE7A 2ZE5A 3D3IA 4LCUC 1GM9A 2X6CA 2ZE8A 5EYPB 4F6RB 4X89A 3KCYA 4ICGA 3CCVV 4EFBA 4FLZA 2YUAA 1NH2B 1KP3A 3CP1A 1QLEC 3CCEV 1Q86W 1YHQV 1YVWA 3APQA 4O4IA 2LW1A 2Q6AA 2JGDB 5LYJB 4X1IB 2QEXV 3SGIA 1AI4A 4X1KA 4YJ2B 3ABKB 2PI5A 5LOVA 3ABLB 2Y0PA 3F5TA 4PA9A 1WB7A 4JI8O 4RAIA 5TISZ 4BW5A 4YJ3B 1DF5A 2QTSA 2WA3A 3FYEB 3WFVA 5IJ0A 1DK1A 4FM0A 2CUGA 4QJFB 1V54C 1S5LZ 1Y4MA 4LH6A 4PDVA 3CCLV 3CD6V 3E8FA 2RDCA 3OR6C 5LGUA 2VQFO 2QWRB 1XI1A 3R66A 3OTFA 5ITZA 1COWG 1Y6XA 5EBMC 1QLEB 2EINB 5DM6V 1FJGO 4PDRA 4JV5O 1O9GA 1B3QA 2LFSA 5LXTB 4IGGA 1H2GA 3RYHB 2JS5A 3KKYA 1G4YB 4CS2A 4UVAA 3ZHVA 3CYOA 4GX0A 1D2DA 3LUTB 4HNAA 2DW4A 2DN9A 2WWWA 2HHHO 1FD9A 1OCZC 4FLWA 1OCRB 1GO3F 4K0KO 1IBKO 2EIMC 1XNRB 1VQ6V 3CRQA 1WNSA 4DV7O 3U0ZA 4KXRA 5J2UB 1M5IA 4DR3O 3JASA 1LR1A 4I9QA 2A06H 2JJ1G 5JWPA 3RFRA 4J7KA 3ZX6A 2QA4V 1XILA 1MNGA 2IJKA 3CS5A 5B1AC 1SA0B 1JFFA 1FXKB 1S5HC 5LMNB 1M93A 5B3SC 1SF9A 3G4SV 4CC6A 4DV5O 2GUZB 4CH6A 4DV0B 1S0VA 4DR7O 3TK1A 1Y67A 1MOFA 2DQ0A 2ZNIA 3D36A 4UFZA 4JI2B 4WFEA 3S3WA 1SQFA 3K9AA 2PY5A 2HVKC 4Q6GA 5H2FZ 3K5OA 4DR6B 2QWQB 4MW3A 2EIMB 2ARHA 3AG7A 4JYBA 1S77D 5EYPA 4F6RA 3GWKC 2A9HA 2PUSA 1YJNV 1NBMG 1U96A 2UUAB 1H2MA 4G2KA 3SDLA 5K1XA 3RW0A 4GX5A 2JGDA 4B7KA 2EIJC 3KCXA 3H9VA 1AVMA 5LYJA 4X1IA 3L71H 2QR4A 1N34B 5FPRA 4WFAV 4JAAA 4YJ2A 4JI7B 5B1AB 3ZRVA 2H94A 3D8CA 1TVKB 4MVSA 1S5JA 3RVYA 4YJ3A 2VWJA 4U7OA 3RBZA 1EBOA 4LNUB 1L8DA 2EIKC 1S72V 3OD4A 1YTFB 1YZBA 1N0NA 4FK5C 4X62O 2IW5A 1IVSA 1DGSA 1MMMA 3JAWB 3G80A 4QIWF 1YI2V 1VEWA 3X2QB 4QPJA 4ZBMA 4H33A 3CCUV 3STLC 4R6ZA 4JI1O 3PN1A 4ZIBA 4I55B 4TQFA 2YIBD 5JH7B 5KX5B 5CB4B 5LXTA 4DO2A 1CXZB 3HKBB 2EIJB 3B4SA 3RYHA 3K5NA 2Z5UA 1JA8A 5JQGA 2OWOA 3WG7C 1IXMA 1FS0G 3ZMUA 1I5YA 2CTQA 3JD1A 1FFXB 2ADQB 3H1IH 4FLVA 2LGWA 1M4UA 2YC0A 4LF8B 2YSUB 4UCSA 1NVPB 4NR1A 3NR7A 1ROPA 1DF4A 5EIBD 2ZKOA 2EIKB 1NTZH 3RWRD 2B5UA 3B77A 2YXYA 5J2UA 4TUYB 3SPJA 1KD1W 1GN6A 2R9RB 2YI8A 1BT8A 3JYCA 4UB8Z 3SYOA 1Q8IA 4P30A 1N32B 4NXNO 1CEZA 2ITDC 1K3EA 2P22C 3FAVB 5BR8O 3BA9A 3J81N 1XNQO 4GKKO 1SA0A 1FXKA 4WCEV 3LDCA 4OX9B 4FM1A 2QTOA 4L87A 1JOYA 2GUZA 2DYSB 3WG7B 3SYAA 3L74H 1KUQA 3L72H 4P9OA 4I4TA 4GLXA 4DV1B 3K59A 3FD9A 1KB9F 2XAQA 2X6AA 3GVMA 4YY3B 4DV2B 2Y0IA 1PL4A 1FKAO 1NZ6A 5A2QN 1VF6C 2LGQA 4JAUA 2LFRA 2BTOA 2OTLV 1YCIA 3B09A 3JAMN 1VQLV 5LP6B 3H1JH 4GX1A 2CDYA 1XMQB 4EFEA 2GV9A 3O9OA 3RYCB 4LF5O 2ZXWB 5F2VO 3LSSA 3D3QA 4HZ3A 5FLXN 3U10A 4F4LA 2NLJC 4I9WA 1TUEB 1M56C 4RWUA 4LNUA 2FYUH 1HNXO
chains in the Genus database with same CATH topology
1K4CC 1JVMA 3ASOC 1VQMV 3K04A 3ZJZA 4HAMA 4MVQA 5CBFA 2K1EA 3KG2A 4UXNA 4JYCA 3OUFA 3EFFK 1GKFA 1FXKC 3SPGA 4Z1MG 4PA3A 3CCMV 3K0DA 3PJSK 5EC2C 5EBWC 4EKWA 5B1BC 3CC2V 4MSWC 1OCCB 2LP7A 2PI4A 4JPRA 2C2AA 1R3LC 5CN0A 4MTXA 3LNMB 3OEHG 4MTGA 4Q20A 1NVPD 2YEVB 4MT8A 1PD3A 1FFTB 1SRYA 1WPXA 3OGCC 3OW2U 1G8MA 4KFMA 3SYCA 3LDEA 3HPLC 3UM7A 3F5WC 2IJHA 2OCCC 1K9MW 1P7BA 1K5SA 4WFHA 4UV9A 2A0LA 3ETEA 1B6QA 1H8HG 2AHYA 2HKOA 4PA7A 1GM8A 2HLDG 4PELA 4MVOA 1EFRG 2M7WA 3JCZA 1YITV 2DWEC 2WLLB 5LGNA 4MW8A 4WF9V 1HWYA 4N23A 1R73A 1BMFG 1NR7A 4XDJA 1DLBA 2UXXA 3VOUA 1EZJA 2P7TC 4LP8A 5CA3A 3ABTA 5LGTA 2Y69C 4RQEA 5EK0A 3FB6C 2X6BA 1I5XA 1PKXA 2WLJA 1ZWIC 2EILC 2JJ2G 1AI7A 4UVBA 3D3IA 4LCUC 3I55V 1BHAA 1GM9A 5IYDO 4RO2A 2X6CA 1AROP 3MHHC 4WFFA 3HB3B 4KP4A 5B1BB 1ORQC 1OHHG 5EBLC 4X89A 1QVGU 4HYOA 1CP9A 3OM3B 3CCVV 1JX9A 1WLEA 1NH2B 1GTOA 3JD2A 2OT5A 3TETA 1KP3A 2WLIA 3CP1A 3MHSC 2UXNA 1QLEC 2WLHA 3QNEA 4GCZA 4I5SA 3RVZA 3CCEV 1Q86W 1YHQV 3OAAG 5GW7A 1XL4A 1RM1C 1K7DA 2Q6AA 3CCJV 5L3GA 3FYIB 4N21A 3TCUA 2IH3C 5J9PC 4MVZA 1QBZA 1OCOC 2X0LA 3QO8A 1R3JC 2QEXV 4PA6A 3JD3A 3X2QC 1BL8A 1AI4A 5H9CA 3FB5C 3ABKB 2PI5A 1S3JA 4QPKA 3ABLB 2CK3G 4PA9A 1CPYA 2F43G 1THZA 4RAIA 2XAJA 3GB7C 3FB7C 4BW5A 4FIPC 3G6EV 3AG1C 4X8AA 2GHYA 3P30A 1PNLA 1DF5A 2GSMB 3FYEB 3W7UA 3WFVA 2JEUA 2Y69B 4JAVA 5LHGA 1MSWD 4QJFB 1V54C 1GM7A 1Y4MA 2EILB 3ABMC 4PDVA 1AJNA 2QE7G 1JQ0A 5L3DA 4FJCC 3CCLV 1F4NA 3CD6V 3E8FA 3ZMSA 3T2MA 2FTKA 4YXWG 4JF3A 3SPCA 3OR6C 5LGUA 2IJIA 4G27B 4FPPA 1J95A 4PDMA 3FKSG 1KC8W 3M99B 4UUJC 1VQOV 1JPXA 1V55C 3A0RA 5IDJA 3AG3C 3AG2C 1COWG 3SJQC 5EBMC 3UKMA 1QLEB 1Q7YW 2EINB 1M57C 5DM6V 4BIUA 4P9PA 4PDRA 1NR1A 1W0JG 2LFSA 4WFGA 1RM1B 5IY5C 4E2LA 2IJJA 1H2GA 4UV8A 1OCOB 1P4RA 2EZPA 2HR3A 1G4YB 1K34A 3ZRSA 2ZDIA 1QR9A 4UVAA 1NQTA 3CYOA 3DGEA 4GX2A 4GX0A 3CMEV 1SETA 1QVFU 3LUTB 2ATKC 2DW4A 3K3WA 3T4ZA 1NJIW 1K5QA 3ZMZA 3CPWU 2WWWA 1OCZC 2P6JA 1OCRB 1GO3F 5LBQA 1QLNA 2EIMC 2H8PC 1VQ6V 2HG5C 3E35A 4BIZA 2DYSC 5HFLA 2W6JG 3ABMB 3CMAV 3ZRXA 2WAMA 3ZN0A 3K03A 2MK3A 2Q67A 2EZOA 3CCSV 1VQPV 1YIJV 2JJ1G 2JK5C 1M56B 3AEIA 2WSSG 1V55B 4R7CA 1VQ7V 3AG2B 2QA4V 3ML0A 3ASOB 5KA5A 1VQ9V 1VQ5V 3AG4C 1OZ0A 3E2EA 4H37A 2IJKA 1F51A 4MVMA 3LDDA 5B1AC 5IY5B 1FXKB 1S5HC 4LC1A 5B3SC 5LHHA 1E79G 3ZMTA 5E1AC 1K73W 1LNQA 1R6NA 3BEHA 4MTFA 3G4SV 1R3IC 1S0VA 4U7NA 1E1QG 1NH2D 1SESA 3TK1A 1K97A 2DQ0A 1MOFA 4FMTA 1Q81W 3D36A 1GK9A 1KP2A 1XL6A 2WLNA 2Y48A 3P32A 4JASA 4WFEA 1S76D 3K9AA 2HVKC 5L3FA 1KQSU 3OUSA 3T4DA 1K8AW 2WLKA 2ZXWC 3JD4A 4RUFA 2EIMB 4MW3A 3VBBA 4JYBA 2OCCB 3G71V 2AHZA 4PA4A 4R50A 2XAHA 1VQ8V 1S77D 1VQKV 2A9HA 2ZDIC 1YJNV 4ASUG 1RPRA 3ABUA 1MG1A 3E8GA 1NBMG 3T1CA 5HFMA 1DTOA 2W0FC 3OMAB 1RPOA 1JJ2U 2HJFC 1R6KA 3JD0A 3W7WA 4G2KA 3OMIB 1W2BU 2Z3YA 2V1DA 3OEEG 3OMNB 3MD0A 4GX5A 3GWOA 2EIJC 4QE9A 5H6QA 3RW0A 2XASA 1AI5A 4KUMA 4XDKA 3ZRWB 4RQFA 2DQ3A 1MABG 2DWDC 3ZCCA 3W7SA 3DTUB 1K33A 3AG4B 2A79B 3F7VC 4WFAV 2V7QG 1N8RW 2JIZG 5B1AB 3ZRVA 2H94A 4RUEA 4TT3G 3ZIAG 5DN6G 5CMUA 3QO7A 2P90A 4MVSA 3RVYA 5IYBO 5CBGA 2P67A 4TWKA 2ZR3A 2XOKG 4U7OA 1F23A 2BOCC 3RBZA 4MS2A 3W7XA 1EBOA 2QKSA 3OFNG 1Y66A 2EIKC 1S72V 4J9ZB 2ZR2A 1YTFB 1AR1B 2KB1A 3OE7G 2IU3A 2QM8A 2XNDG 4LBEC 1YTFD 1YJ9V 3STZC 4FK5C 1QCEA 2IW5A 4MVUA 2XAFA 3LSQA 3B8MA 4QIWF 1BHBA 3I56V 3X2QB 1YI2V 5L3BA 4QPJA 2ZQMA 1KKDA 3E8BA 2NNUA 4H33A 4ZBMA 3CCUV 3STLC 4R6ZA 2EJRA 3K08A 2BOBC 1M1KW 1FXHA 1SERA 4QE7A 3CCRV 1NKDA 1ENVA 4DO2A 3AG1B 3IFXA 3ZN1A 2EIJB 4XDLA 3B8NA 1SZTA 2Z5UA 3ASNC 4OXSA 4JGSA 3WG7C 1IXMA 1FS0G 2DYRC 1V54B 2W6IG 3ZMUA 1I5YA 4X88A 3JD1A 1L1FA 2YSUB 5KA6A 1NVPB 1K4DC 3BY6A 2YEVA 1R3KC 1ROPA 3SPHA 1M90W 1DF4A 3F7YC 1M9NA 2HFEC 3K06A 5KUMA 5H6RA 2EBOA 3AG3B 2B1GA 1KECA 2EIKB 3SYPA 1M57B 4PDLA 2B5UA 3B77A 4UVCA 3ABKC 3SPJA 3ABLC 1KD1W 1W0KG 2R9RB 1H38A 3R65A 2WLLA 1Q82W 3EHBB 3JYCA 2WLMA 3SYOA 4P30A 5FL7G 2ITDC 1CEZA 2Q68A 3CC4V 1K3EA 2JEXA 5BZBA 2X7RB 3K0GA 2IU0A 1FXVA 2XAGA 4ZKIA 2WLIB 4GT1A 5CBHA 1FXKA 1OCZB 1VQNV 4WCEV 3W7TA 4P2ZA 3LDCA 4CZZA 1JOYA 2QTOA 4L87A 3ASNB 5L3CA 3K79A 2DYSB 4CBCA 1PNKA 3WG7B 2IH1C 2DYRB 3NXSA 1H8EG 1YJWV 2D3OW 3SYAA 1VQ4V 1PNMA 4J9YB 4JTAB 3IGAC 5B1OA 5EC1C 3IC7A 3H01A 2EINC 5C93A 4P9OA 2HVJC 2WPDG 2B1IA 1YSCA 4QNHB 2XAQA 2X6AA 3QO5A 1UJWB 1OCCC 1E1RG 4JTCB 5IYCO 2OTJV 3FB8C 4BAYA 5B3SB 3ZMVA 5L3EA 2Q69A 1AI6A 4JAUA 2LFRA 3ZRWA 4MTOA 3CCQV 2OTLV 5KUKA 3E86A 1AJPA 4G28B 1OCRC 3SYQA 4XBFA 1VQLV 3ETGA 1F4MA 2JDIG 1GMGA 5LHIA 1QR8A 3E8HA 4WFBV 3CXCU 2ITCC 4GX1A 1JCHA 2QM7A 1PL0A 3E89A 1AJQA 4TSFG 3CC7V 2ZXWB 3LSSA 3ETDA 3E83A 4HZ3A 2ZD9A 3SPIA 4R8CA 2R9IA 4JTDB 4DXWA 4F4LA 2NLJC 5B1NA 4I9WA 1K92A 1TUEB 3OR7C 1M56C 4MVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4C C;  1JVM A;  3GB7 C;  3FB7 C;  3SPH A;  4BW5 A;  3ASO C;  1XL6 A;  3AG1 C;  4X8A A;  3F7Y C;  2WLN A;  4WFE A;  2HFE C;  3K06 A;  5KUM A;  3K04 A;  3ZJZ A;  4MVQ A;  5CBF A;  2HVK C;  2K1E A;  3KG2 A;  3OUS A;  3SYP A;  3T4D A;  3OUF A;  3EFF K;  4PDL A;  2WLK A;  2ZXW C;  4RUF A;  3SPG A;  4PA3 A;  4MW3 A;  3K0D A;  1V54 C;  3PJS K;  3ABM C;  4PDV A;  5EC2 C;  5EBW C;  2AHZ A;  4PA4 A;  3ABK C;  4R50 A;  4EKW A;  3SPJ A;  5B1B C;  3ABL C;  2A9H A;  4MSW C;  2R9R B;  3E8F A;  3T2M A;  3R65 A;  2WLL A;  3JYC A;  1R3L C;  2WLM A;  3E8G A;  3SPC A;  3SYO A;  3OR6 C;  4P30 A;  3T1C A;  2W0F C;  2ITD C;  4G27 B;  2Q68 A;  1J95 A;  4PDM A;  3LNM B;  4MTG A;  2HJF C;  4UUJ C;  5BZB A;  1V55 C;  3AG3 C;  3AG2 C;  3K0G A;  3OGC C;  3SJQ C;  5EBM C;  3RW0 A;  4GX5 A;  3UKM A;  2EIJ C;  4QE9 A;  1M57 C;  4KFM A;  3LDE A;  4XDK A;  2WLI B;  3HPL C;  4P9P A;  4PDR A;  3SYC A;  2DWD C;  3UM7 A;  5CBH A;  4WFG A;  3F5W C;  2OCC C;  5IY5 C;  1P7B A;  2A79 B;  3F7V C;  4P2Z A;  3LDC A;  4WFH A;  2A0L A;  2QTO A;  4RAI A;  2AHY A;  4PA7 A;  1G4Y B;  3ZRS A;  4CBC A;  2IH1 C;  4RUE A;  4GX0 A;  4GX2 A;  3SYA A;  4MVO A;  3LUT B;  4J9Y B;  2ATK C;  2DWE C;  3IGA C;  2WLL B;  4JTA B;  4MVS A;  3RVY A;  5EC1 C;  4MW8 A;  5CBG A;  4TWK A;  2EIN C;  2BOC C;  3RBZ A;  4MS2 A;  3T4Z A;  4XDJ A;  4P9O A;  2QKS A;  2HVJ C;  3VOU A;  2EIK C;  1OCZ C;  2P7T C;  4LP8 A;  4QNH B;  4J9Z B;  2Y69 C;  2X6A A;  5EK0 A;  2EIM C;  2H8P C;  2KB1 A;  2X6B A;  3FB6 C;  2HG5 C;  4LBE C;  2WLJ A;  1ZWI C;  2EIL C;  3STZ C;  4LCU C;  2DYS C;  4MVU A;  4RO2 A;  1OCC C;  2X6C A;  4WFF A;  4JTC B;  3K03 A;  3FB8 C;  1ORQ C;  2Q67 A;  5EBL C;  4X89 A;  4HYO A;  2Q69 A;  1KKD A;  3E8B A;  4ZBM A;  4H33 A;  2JK5 C;  3STL C;  4R6Z A;  4MTO A;  3TET A;  2WLI A;  3K08 A;  2BOB C;  3E86 A;  1QLE C;  2WLH A;  1OCR C;  4G28 B;  3SYQ A;  3RVZ A;  4R7C A;  5KUK A;  4QE7 A;  1XL4 A;  3IFX A;  3E8H A;  3AG4 C;  2Q6A A;  4XDL A;  2ITC C;  4H37 A;  3TCU A;  4GX1 A;  2IH3 C;  4MVM A;  4MVZ A;  5J9P C;  3LDD A;  3E89 A;  1OCO C;  3ASN C;  5B1A C;  4OXS A;  1R3J C;  1S5H C;  4PA6 A;  3X2Q C;  3WG7 C;  1BL8 A;  5B3S C;  2DYR C;  3E83 A;  4HZ3 A;  5E1A C;  2ZD9 A;  3FB5 C;  3SPI A;  4R8C A;  4DXW A;  1LNQ A;  3BEH A;  4JTD B;  4MTF A;  4X88 A;  1R3I C;  2NLJ C;  4F4L A;  4I9W A;  3OR7 C;  4PA9 A;  1M56 C;  1K4D C;  2YEV A;  1R3K C;  4MVR A; 
#chains in the Genus database with same CATH topology
 1GN4 A;  4O4L B;  4HAM A;  4MVQ A;  2K1E A;  5IE9 A;  4UXN A;  3SPG A;  4Z1M G;  3CCM V;  3JAW A;  3PJS K;  5B1B C;  3CC2 V;  2XTA A;  2LP7 A;  2O57 A;  2PI4 A;  3EVK A;  4I55 A;  5CN0 A;  5JH7 A;  1GN2 A;  5KX5 A;  5CB4 A;  4MTG A;  3Q4H B;  3HKB A;  4UB6 Z;  1PD3 A;  1FPO A;  1WPX A;  3OW2 U;  3SYC A;  1SQP H;  1YDX A;  5JCO A;  2IJH A;  1K9M W;  4DK1 A;  3ETE A;  1H8H G;  1FFX A;  2QDO A;  4QGP A;  1SC5 B;  4CC5 A;  2DJV A;  5C8Y B;  1F7Y A;  3HKE B;  2Y4T A;  4WF9 V;  1HWY A;  4ZI7 B;  4XDJ A;  4UCU A;  3ZHR A;  1XDC A;  3ABT A;  1WAZ A;  4RQE A;  4LWS B;  4DV3 O;  2ILM A;  4OGQ B;  4TUY A;  1PKX A;  2EIL C;  2JJ2 G;  1AI7 A;  1I08 A;  4WFF A;  2PGG A;  3VQV A;  2P4K A;  4J11 A;  5B1B B;  3DC6 A;  1OHH G;  2JGU A;  5EBL C;  1QVG U;  3FAV A;  4HYO A;  1CP9 A;  2IM9 A;  1WLE A;  2L6L A;  3K5M A;  2OT5 A;  3TET A;  3MHS C;  3QNE A;  4HBN A;  4LFA B;  1XL4 A;  3AK1 A;  1H2K A;  3CCJ V;  1OJH A;  2LW7 A;  3TCU A;  2IH3 C;  5J9P C;  1QBZ A;  2X0L A;  2OCH A;  4E4E A;  4PA6 A;  2XT9 A;  5H9C A;  2LJ2 A;  1N0J A;  2CAZ C;  2GTA A;  3U11 A;  1CPY A;  2XAJ A;  1XNR O;  3FB7 C;  1SQV H;  4O2A B;  4PD4 F;  2P4V A;  3SJB C;  2E5L O;  2EIL B;  2R72 A;  2WA4 A;  2QE7 G;  4LR3 A;  4NXM B;  5L3D A;  4FJC C;  2BTQ B;  1BQZ A;  3SPC A;  2XUM A;  4G27 B;  4PDM A;  5LP6 A;  1KC8 W;  5EIB C;  1VQO V;  1JPX A;  1V55 C;  3A0R A;  5IDJ A;  2Q7H A;  3RYF B;  4O2B B;  3SJQ C;  3UKM A;  5LMN O;  1Q7Y W;  1M57 C;  4BIU A;  1N36 B;  1NR1 A;  4WFG A;  3RYC A;  4JI4 B;  4DV0 O;  5BMV B;  1R6T A;  3UQ8 A;  2HR3 A;  1K34 A;  2P06 A;  3ZRS A;  1QR9 A;  2E74 B;  4JI2 O;  4KL1 A;  4KHP B;  3DGE A;  4GX2 A;  4DYL A;  2F66 C;  1SET A;  4O4L A;  4DR6 O;  1K5Q A;  5CA1 A;  1SS3 A;  2AGA A;  2P6J A;  2BE3 A;  4TQD A;  3RGB A;  2HG5 C;  3E35 A;  4BIZ A;  5KAI Z;  5B5E Z;  5HFL A;  2YID A;  4AI8 A;  2UUA O;  3K03 A;  1SQX H;  2ZIM A;  2Q67 A;  2EZO A;  3Q4H A;  1VF6 A;  4AIL C;  5JJN B;  2JK5 C;  1N34 O;  5KLV H;  1V55 B;  4JI7 O;  3ASO B;  1IBM B;  3AG4 C;  3E2E A;  1F51 A;  1I94 B;  3LDD A;  5KHK A;  3WB2 A;  4JZ2 A;  1VF5 B;  4LC1 A;  3CEI A;  5C8Y A;  5LHH A;  1E79 G;  3HKE A;  4MTF A;  3BEH A;  2UUB B;  3MDS A;  4DV6 O;  1E1Q G;  4ZI7 A;  2GTS A;  1KP2 A;  5J2T A;  2YDE A;  2Y48 A;  3P32 A;  5EZY B;  3N27 A;  3N2G B;  4LWS A;  2FL4 A;  3T4D A;  2WLK A;  4RUF A;  1L0N H;  2QJ1 A;  4AHC A;  4O4J A;  4R50 A;  2EJ7 A;  4IL6 Z;  1VQK V;  1XMO B;  2ZDI C;  4UCT A;  4ASU G;  1IBL O;  1MG1 A;  1JR9 A;  1XRE A;  3JD0 A;  3W7W A;  3CRR A;  5AG2 A;  2Z3Y A;  3C3S A;  5H6Q A;  3GWO A;  2XAS A;  1IDS A;  2G38 A;  3ZHQ A;  3AG4 B;  4LF8 O;  3F7V C;  2Y4U A;  3H1H H;  1N8R W;  4FFB B;  2KG7 B;  2HP8 A;  3UCS C;  1KYO F;  4DR1 B;  4RUE A;  3JSN A;  2Q73 A;  3QO7 A;  2QSA A;  2PZS A;  1VP7 A;  5IYB O;  3LNN A;  1IX9 A;  2P67 A;  4O2A A;  3W7X A;  2BOC C;  1ZSP A;  2YI9 A;  4X65 O;  3J7A U;  5LL6 Y;  3CB2 A;  2ZR2 A;  1AR1 B;  3OE7 G;  2IU3 A;  2QM8 A;  1N32 O;  1P84 F;  2BTQ A;  2GBO A;  3LSQ A;  1URF A;  3B8M A;  2ZM6 B;  2OIE A;  4I50 B;  3DXR B;  3HKD B;  3JCU Z;  2ZQM A;  4CH5 A;  3T1Y B;  3E8B A;  3RYF A;  4O2B A;  3OTO B;  1H2L A;  2EJR A;  1FYJ A;  2BOB C;  1M1K W;  1FXH A;  4OX9 O;  1VAR A;  1NKD A;  1ENV A;  3IFX A;  3ZN1 A;  4XDL A;  4DW0 A;  5JJE B;  1Q6H A;  2CTR A;  2CH7 B;  4LF7 O;  3A2F A;  4PV1 B;  1V54 B;  1VIB A;  1PPJ H;  4DV1 O;  1L1F A;  2YIB A;  1HDJ A;  5KA6 A;  2YEV A;  1R3K C;  4DR2 B;  5LA6 B;  4YY3 O;  1LUV A;  4DV2 O;  1KEC A;  3SYP A;  3EXA A;  2HJD A;  4X64 B;  2BCC H;  4CH3 A;  3RN4 A;  1NU1 H;  1G1X B;  2DOS A;  5JVD B;  3R65 A;  2GDS A;  1BZK A;  3BVO A;  1XHZ A;  3CC4 V;  1XMQ O;  1MZE A;  3N2K B;  4JI6 B;  1FXV A;  4ZKI A;  3DSQ A;  2WLI B;  1BGY H;  5IYZ B;  1OCZ B;  1TAE A;  1AR5 A;  3W7T A;  3THO A;  4CZZ A;  1BCC H;  5L3C A;  4CBC A;  1PNK A;  2D3O W;  1HW7 A;  3UO3 A;  4WBN B;  3IGA C;  5K1P A;  3IC7 A;  5EZY A;  3TXQ A;  3N2G A;  5FNV B;  2JVD A;  3QTC A;  4UCO A;  1YF2 A;  2HVJ C;  2Z0A A;  2Q7G A;  3QO5 A;  4A5U B;  2UUC B;  1OCC C;  5IYC O;  2UU9 B;  2OTJ V;  3FB8 C;  5B3S B;  4YIP A;  1AI6 A;  2UXD B;  1N4C A;  4GUN A;  5KUK A;  2CTW A;  1AJP A;  3E86 A;  3I5D A;  3BA8 A;  1HP8 A;  2JDI G;  1GMG A;  1QR8 A;  1QQC A;  2D2C B;  1XBL A;  3E8H A;  4WFB V;  2KG7 A;  1L0L H;  1JCH A;  2QM7 A;  5D5Q A;  3E89 A;  1AJQ A;  4PHZ A;  2PYL A;  2VQE O;  3L75 H;  4K35 A;  3E83 A;  2R9I A;  4JTD B;  1A32 A;  1K4C C;  1NTK H;  4NTW A;  4NB5 A;  3ZJZ A;  2Q4P A;  2F95 B;  1GKF A;  4JI5 B;  3K0D A;  4TV9 B;  4I50 A;  3DXR A;  3HKD A;  2Q7E A;  2ODM A;  1XQ8 A;  1OCC B;  4JPR A;  3JAL B;  4LFA O;  1BE3 H;  1EN6 A;  1R3L C;  4UCV A;  3LNM B;  4MT8 A;  1FFT B;  1SRY A;  2LO1 A;  3OGC C;  3WB0 A;  4KFM A;  3UM7 A;  2CH7 A;  4U3F H;  1Y76 B;  3F5W C;  2OCC C;  1P7B A;  3K9S A;  4WFH A;  4UV9 A;  2HKO A;  1GM8 A;  5E79 Z;  1EN4 A;  4MVO A;  2DWE C;  2WLL B;  5LGN A;  4MW8 A;  5LA6 A;  1Z2G A;  1NR7 A;  1PP9 H;  4DUY B;  2AZ2 A;  2VQF B;  4NXM O;  1I5X A;  2WLJ A;  3I55 V;  1I0H A;  4YHH B;  5IYD O;  2AXT Z;  4RO2 A;  1ARO P;  3MHH C;  4IIJ B;  1SKV A;  3TGU H;  2ZT9 B;  1JMK C;  3L70 H;  3OM3 B;  1N36 O;  3N2K A;  1JX9 A;  1WN7 A;  3VQX A;  1GTO A;  2WLI A;  1NH2 D;  2UXN A;  4JI4 O;  5IYZ A;  3CHX A;  2Q8V A;  1US6 A;  5GW7 A;  3BFR A;  3AK3 A;  1K7D A;  3G6B A;  4N21 A;  4KHP O;  4MVZ A;  1KBH A;  1OCO C;  1R3J C;  1WA8 B;  1IBK B;  4WBN A;  2F93 B;  1S3J A;  4QPK A;  4FLU A;  2CK3 G;  5FNV A;  4DV7 B;  1XUQ A;  3BCC H;  1THZ A;  1XOU A;  3GB7 C;  4FIP C;  3C90 A;  3AG1 C;  3G6E V;  4BIO A;  1UFI A;  1PNL A;  5A9G A;  4JYA B;  3L73 H;  2GSM B;  3W7U A;  2OYQ A;  5LHG A;  1MSW D;  1SQG A;  5BY1 A;  5D5P A;  4LF4 B;  1JQ0 A;  1TVK A;  2CGO A;  1F4N A;  2PF4 E;  3ZMS A;  2FTK A;  4YXW G;  4JF3 A;  3JAR B;  3HKC B;  2IJI A;  4FPP A;  1J95 A;  3FKS G;  3M99 B;  4UUJ C;  1I94 O;  3AG3 C;  3AG2 C;  4DV5 B;  4B3M B;  3ZBH A;  4BWA A;  1HNZ B;  2W0X A;  4P9P A;  4LF6 B;  1WP7 A;  2UUB O;  5IY5 C;  1KKC A;  1LUW A;  2IJJ A;  2F1M A;  4FZ1 A;  1OCO B;  3VQW A;  4DV4 B;  4O4H B;  1JJO A;  3K57 A;  1NQT A;  4H44 B;  3CME V;  1QVF U;  4U3J B;  2ATK C;  1EN5 A;  3K3W A;  4TV9 A;  1XMO O;  5LBQ A;  1QLN A;  2H8P C;  3BAA A;  2W6J G;  3JAL A;  3CMA V;  4NVP A;  2WAM A;  5FPO A;  1B04 A;  1PV0 A;  1IXB A;  1VF7 A;  2RMK B;  1M56 B;  3AEI A;  2WSS G;  2MW2 B;  1Y76 A;  1VQ7 V;  3AG2 B;  1VQ5 V;  4IT5 A;  1OZ0 A;  2YS8 A;  4DR5 B;  4J7J A;  5IY5 B;  2B9Z A;  2YXH A;  1J5E B;  1YEW A;  1LNQ A;  5KHG A;  3K5L A;  1QU7 A;  4U7N A;  1SES A;  1K97 A;  3OT7 A;  4B3S B;  1AP6 A;  1Q81 W;  1GK9 A;  1XL6 A;  2F4V B;  1S76 D;  4JAS A;  1NS1 A;  4CS3 A;  2ZM6 O;  3OUS A;  1N33 B;  3JD4 A;  4IIJ A;  1WB8 A;  3ETQ A;  2AHZ A;  4PA4 A;  1VQ8 V;  2XAH A;  4B3T B;  1RPR A;  3ABU A;  1V9P A;  4X1K B;  3E8G A;  5HFM A;  1DTO A;  4TV8 B;  1RFY A;  2HJF C;  4DUZ B;  1R6K A;  3IJ4 A;  1W2B U;  2V1D A;  3OEE G;  4LF9 B;  3JAT B;  3ZRW B;  4RQF A;  4KUM A;  1AI5 A;  2KKW A;  5H5N A;  2DQ3 A;  1MAB G;  3W7S A;  1WA8 A;  1K33 A;  1KU9 A;  2A79 B;  3P3P A;  2JIZ G;  3QG5 A;  4DR2 O;  3WU2 Z;  5CMU A;  4NTX A;  3ZHU A;  4X64 O;  4TWK A;  2ZR3 A;  4EB6 B;  2QKS A;  1Y66 A;  4ZOL B;  3S3X A;  4I0X B;  2XND G;  4LBE C;  1YTF D;  1YJ9 V;  5BR8 B;  1QCE A;  4LFC B;  1XNQ B;  4GKK B;  4NYK A;  1BHB A;  3JAR A;  3HKC A;  2UXC B;  3I56 V;  4D7S A;  4JI6 O;  2N74 A;  4B08 A;  5L3B A;  1HNW B;  3A0B Z;  3L9D A;  3RYI B;  3D36 C;  4AQY B;  1SER A;  1IZ3 A;  3C3T A;  4PJ0 Z;  2QWO B;  1X59 A;  3B8N A;  1SZT A;  4O4H A;  3ASN C;  4OXS A;  1QNM A;  5DEC A;  2DYR C;  4U3J A;  2W6I G;  2NR5 A;  3ZS8 C;  1K4D C;  3BY6 A;  2PTM A;  1AP5 A;  3SPH A;  1M90 W;  4H13 B;  3K06 A;  5KUM A;  5B66 Z;  2PYJ A;  2UU9 O;  1M57 B;  3BRC A;  4BW9 A;  3E22 B;  2QWN B;  2FB5 A;  2UXD O;  1NT2 B;  3ABK C;  5GON B;  2Q9L A;  3ABL C;  1JFF B;  1H38 A;  1Q82 W;  4GKJ B;  3H1K H;  3EHB B;  2ZIN A;  3TXS A;  2LQT A;  4LF5 B;  1PM9 A;  2JEX A;  3O65 A;  2X7R B;  2IU0 A;  2JS3 A;  5IJ9 B;  2XAG A;  4D6T H;  3RT3 C;  4GT1 A;  5CBH A;  5IT9 N;  1VQN V;  2ZNJ A;  4J42 A;  4P2Z A;  2RJZ A;  3ASN B;  4C7U A;  1MSD A;  2CGN A;  4J41 A;  4TOI A;  2DYR B;  1YJW V;  1H8E G;  1VQ4 V;  3K58 A;  4J9Y B;  4JTA B;  5B1O A;  5EC1 C;  3H01 A;  2EIN C;  4JZG A;  4JI5 O;  4J10 A;  4DR4 B;  4FZ0 A;  2WPD G;  2B1I A;  1YSC A;  4QNH B;  2BSK B;  2R70 A;  2FML A;  1UPG A;  4JYY A;  3M8A A;  3CSX A;  1E1R G;  4JTC B;  1ZUQ A;  4TV8 A;  4X66 B;  4BAY A;  4GZR B;  5L3E A;  2Q69 A;  1Z5W A;  3JAT A;  3LSU A;  3ZRW A;  3CCQ V;  4CH4 A;  4LFB B;  4G28 B;  3SYQ A;  1OCR C;  4XBF A;  4FLY A;  3ETG A;  4EEQ A;  4JI0 B;  3CXC U;  1HR0 B;  3CRM A;  2ITC C;  2N04 A;  1NTM H;  1PL0 A;  4TSF G;  3CC7 V;  3JSL A;  4F6E A;  2P5O A;  3ETD A;  3J80 N;  2ZD9 A;  5IWA B;  4DV3 B;  4DUY O;  2QKA A;  4B3R B;  1K92 A;  3OR7 C;  4EB6 A;  1BSM A;  3CE2 A;  4ZOL A;  4MVR A;  1G6U A;  5KHJ A;  4YHH O;  1VQM V;  2N05 A;  3K04 A;  4I0X A;  1NI8 A;  2QGN A;  4JYC A;  3EFF K;  5BMV A;  1FXK C;  2QKC A;  4K8X A;  5EBW C;  4EKW A;  5JQG B;  4MSW C;  3RYI A;  2KSD A;  4MTX A;  3OEH G;  3BHP A;  4Q20 A;  1Q43 A;  2E75 B;  1MA1 A;  2UXB B;  1G8M A;  2IBZ H;  3HPL C;  2Q0A A;  2A0L A;  1B6Q A;  5CA0 B;  4PA7 A;  2HLD G;  4PEL A;  2K9P A;  2E5L B;  4JYA O;  1EFR G;  1GRJ A;  1YIT V;  1Q90 D;  3T1H B;  1U97 A;  4N23 A;  1OV9 A;  1BMF G;  1R1B A;  1DLB A;  5GTH Z;  2CE4 A;  2Q0O C;  4LP8 A;  3E22 A;  4W4K A;  5LGT A;  2Y69 C;  4LF4 O;  2EUL A;  5EK0 A;  5GON A;  2YIA A;  4UVB A;  1BHA A;  5KHH A;  3M7M X;  3HB3 B;  4KP4 A;  1ORQ C;  2RQ6 A;  2VRZ A;  4B3M O;  1HNZ O;  3MAQ A;  4LF6 O;  4X1Y B;  5IJ9 A;  3JD2 A;  1RP3 B;  4GCZ A;  4I5S A;  5LMU B;  2WLH A;  3RVZ A;  3OAA G;  4DV4 O;  1RM1 C;  4I4T B;  1XEQ A;  2A3Q A;  2VWK A;  3FYI B;  5L3G A;  2E3C A;  4BR6 A;  3QO8 A;  3JD3 A;  3X2Q C;  1BL8 A;  3FB5 C;  1SQB H;  2F43 G;  2BSK A;  4X8A A;  1Q3E A;  4JI3 B;  1Y74 B;  4FFK A;  2GHY A;  3P30 A;  1ZX3 A;  3ZED A;  1EM1 A;  5JCO C;  2JEU A;  2Y69 B;  4JAV A;  4FFB A;  1GM7 A;  3ABM C;  1AJN A;  1D5N A;  2OIG A;  4DRX B;  3APO A;  3T2M A;  3WB1 A;  3B40 A;  4DR5 O;  1ZL8 B;  1SQQ H;  1VMG A;  4DV6 B;  4FLT A;  3DC5 A;  1J5E O;  1W0J G;  1RM1 B;  3AK2 A;  4E2L A;  4K3A A;  4UV8 A;  1P4R A;  2EZP A;  4B3S O;  1ZAU A;  3UT5 B;  4K8Z A;  2ZDI A;  2F4V O;  4NKG B;  2EX3 A;  1N33 O;  1P49 A;  2M6Y A;  3CJH B;  3T4Z A;  1IBL B;  3ZHT A;  1NJI W;  3CPW U;  3ZMZ A;  4JI8 B;  4B3T O;  1BS3 A;  4OPH A;  4OPA A;  2XHB A;  2DYS C;  3SR2 C;  1SZX A;  3ABM B;  4DUZ O;  1TUB B;  3ZRX A;  3ZN0 A;  2MK3 A;  4LF9 O;  3A0H Z;  4YIO A;  3CCS V;  1VQP V;  1YIJ V;  2YXL A;  4X20 B;  4R7C A;  3CXH F;  3ML0 A;  3ZHS A;  5KA5 A;  1VQ9 V;  4H37 A;  4Z1V A;  4MVM A;  5CA0 A;  4X65 B;  4FM2 A;  3SJC C;  5JVD A;  1FJG B;  5KAF Z;  2ZIO A;  3ZMT A;  4JV5 B;  5E1A C;  3JAK B;  5KHI A;  1K73 W;  1R6N A;  1R3I C;  1ZLZ A;  2V4D A;  2ZE6 A;  4FMT A;  5LP6 C;  2WLN A;  1GN3 A;  3VQY A;  4LFC O;  3SJA C;  5L3F A;  1KQS U;  2UXC O;  1P7G A;  1K8A W;  1HNW O;  2ZXW C;  1Q6U A;  3VBB A;  2OCC B;  3G71 V;  2HHH B;  4ABM A;  4K0K B;  3H1L H;  4X1Y A;  4AQY O;  2AZ0 A;  3UO2 A;  1I7F A;  2NN4 A;  4LF7 B;  3T1C A;  2W0F C;  3B2E E;  3OMA B;  1RPO A;  1JJ2 U;  4Z2W A;  5KMG B;  1Q6I A;  3OMI B;  3OMN B;  3MD0 A;  4DR3 B;  4QE9 A;  4XDK A;  2AW9 A;  2DWD C;  3ZCC A;  4ZHQ B;  4IYI A;  3DTU B;  3TJT A;  1WPB A;  2V7Q G;  1W59 A;  3QF7 A;  2ETN A;  4TT3 G;  3ZIA G;  5DN6 G;  2P90 A;  3KZI Z;  4H0L B;  2YIC A;  1Y74 A;  1IBM O;  5CBG A;  2XOK G;  1TA8 A;  1F23 A;  4MS2 A;  3OFN G;  4DR7 B;  4IYH A;  4J9Z B;  4PI2 A;  3FFQ A;  2KB1 A;  4GKJ O;  3CWB H;  3STZ C;  4DRX A;  1WJZ A;  4MVU A;  2XAF A;  5JJJ B;  1AIL A;  2VS0 A;  1BQ0 A;  3BPZ A;  1ZTE A;  1ZL8 A;  2CTP A;  1KKD A;  1GAX A;  2NNU A;  4PI0 A;  1RSO B;  4X9Q A;  3K08 A;  2QWP B;  4QE7 A;  3CCR V;  3AG1 B;  2A7W A;  5CA1 B;  1IUR A;  3UT5 A;  4IHJ B;  4JGS A;  4DR4 O;  4X88 A;  2RCV A;  5GTI Z;  3CJH A;  3F7Y C;  1M9N A;  2HFE C;  2RNB A;  5H6R A;  2EBO A;  3AG3 B;  1QHT A;  2B1G A;  1GH6 A;  4X66 O;  4PDL A;  4DR1 O;  1TUB A;  2DE0 X;  1WP8 A;  4UVC A;  2H3O A;  2DMX A;  4L8J A;  4LFB O;  1W0K G;  4NTY A;  4CS4 A;  2WLL A;  4B7E A;  1B06 A;  2WLM A;  4JI0 O;  4X62 B;  2VQE B;  1YXB A;  5FL7 G;  4X20 A;  1HR0 O;  2Q68 A;  5BZB A;  2L35 A;  3K0G A;  3CX5 F;  2F23 A;  5J2T B;  1XHX A;  5IWA O;  2ADP A;  4JI1 B;  4O4I B;  4B3R O;  4DW1 A;  3JAK A;  3T1Y O;  1TGO A;  4GYC B;  3K79 A;  3OTO O;  4O4J B;  2IH1 C;  3NXS A;  1PNM A;  2HEP A;  4J7Z A;  5LOV B;  2FKX A;  3FX7 A;  5C93 A;  3G67 A;  2QM4 A;  4LH7 A;  3A8T A;  2JRI A;  3QVN A;  5IJ0 B;  1X4T A;  1UJW B;  3IAY A;  4UCR A;  2UXB O;  3ZMV A;  5KMG A;  4J80 A;  4MTO A;  3P3N A;  4FVM A;  4ZHQ A;  1F4M A;  5ITZ B;  5LHI A;  4NXN B;  2E76 B;  3OGI B;  3T1H O;  3SPI A;  4R8C A;  4DXW A;  5B1N A;  4W4L A;  4DK0 A;  1JVM A;  1FAF A;  4HNA B;  3ASO C;  3IC9 A;  1H2N A;  3CRA A;  5CBF A;  3KG2 A;  3OUF A;  2RN9 A;  1AB3 A;  4PA3 A;  3CRC A;  5EC2 C;  1T5E A;  1H2S B;  4I7Z B;  5LMU O;  2Q5Z A;  1RSO A;  2C2A A;  3HR0 A;  3JAS B;  1NVP D;  2YEV B;  5BXZ A;  4D7T A;  2UUC O;  3LDE A;  4IHJ A;  1MZF A;  1K5S A;  2KQX A;  1D5A A;  1O9H A;  3ICX A;  2ZCE A;  2AHY A;  4JI3 O;  5DED A;  2M7W A;  3JCZ A;  1R73 A;  1KMI Z;  2UXX A;  4FLX A;  3VOU A;  1EZJ A;  2P7T C;  2R9A A;  3BAB A;  5CA3 A;  1AR4 A;  1HNX B;  3FB6 C;  2X6B A;  1Q5O A;  1Z5V A;  1EZV H;  1ZWI C;  2ZE7 A;  2ZE5 A;  3D3I A;  4LCU C;  1GM9 A;  2X6C A;  2ZE8 A;  5EYP B;  4F6R B;  4X89 A;  3KCY A;  4ICG A;  3CCV V;  4EFB A;  4FLZ A;  2YUA A;  1NH2 B;  1KP3 A;  3CP1 A;  1QLE C;  3CCE V;  1Q86 W;  1YHQ V;  1YVW A;  3APQ A;  4O4I A;  2LW1 A;  2Q6A A;  2JGD B;  5LYJ B;  4X1I B;  2QEX V;  3SGI A;  1AI4 A;  4X1K A;  4YJ2 B;  3ABK B;  2PI5 A;  5LOV A;  3ABL B;  2Y0P A;  3F5T A;  4PA9 A;  1WB7 A;  4JI8 O;  4RAI A;  5TIS Z;  4BW5 A;  4YJ3 B;  1DF5 A;  2QTS A;  2WA3 A;  3FYE B;  3WFV A;  5IJ0 A;  1DK1 A;  4FM0 A;  2CUG A;  4QJF B;  1V54 C;  1S5L Z;  1Y4M A;  4LH6 A;  4PDV A;  3CCL V;  3CD6 V;  3E8F A;  2RDC A;  3OR6 C;  5LGU A;  2VQF O;  2QWR B;  1XI1 A;  3R66 A;  3OTF A;  5ITZ A;  1COW G;  1Y6X A;  5EBM C;  1QLE B;  2EIN B;  5DM6 V;  1FJG O;  4PDR A;  4JV5 O;  1O9G A;  1B3Q A;  2LFS A;  5LXT B;  4IGG A;  1H2G A;  3RYH B;  2JS5 A;  3KKY A;  1G4Y B;  4CS2 A;  4UVA A;  3ZHV A;  3CYO A;  4GX0 A;  1D2D A;  3LUT B;  4HNA A;  2DW4 A;  2DN9 A;  2WWW A;  2HHH O;  1FD9 A;  1OCZ C;  4FLW A;  1OCR B;  1GO3 F;  4K0K O;  1IBK O;  2EIM C;  1XNR B;  1VQ6 V;  3CRQ A;  1WNS A;  4DV7 O;  3U0Z A;  4KXR A;  5J2U B;  1M5I A;  4DR3 O;  3JAS A;  1LR1 A;  4I9Q A;  2A06 H;  2JJ1 G;  5JWP A;  3RFR A;  4J7K A;  3ZX6 A;  2QA4 V;  1XIL A;  1MNG A;  2IJK A;  3CS5 A;  5B1A C;  1SA0 B;  1JFF A;  1FXK B;  1S5H C;  5LMN B;  1M93 A;  5B3S C;  1SF9 A;  3G4S V;  4CC6 A;  4DV5 O;  2GUZ B;  4CH6 A;  4DV0 B;  1S0V A;  4DR7 O;  3TK1 A;  1Y67 A;  1MOF A;  2DQ0 A;  2ZNI A;  3D36 A;  4UFZ A;  4JI2 B;  4WFE A;  3S3W A;  1SQF A;  3K9A A;  2PY5 A;  2HVK C;  4Q6G A;  5H2F Z;  3K5O A;  4DR6 B;  2QWQ B;  4MW3 A;  2EIM B;  2ARH A;  3AG7 A;  4JYB A;  1S77 D;  5EYP A;  4F6R A;  3GWK C;  2A9H A;  2PUS A;  1YJN V;  1NBM G;  1U96 A;  2UUA B;  1H2M A;  4G2K A;  3SDL A;  5K1X A;  3RW0 A;  4GX5 A;  2JGD A;  4B7K A;  2EIJ C;  3KCX A;  3H9V A;  1AVM A;  5LYJ A;  4X1I A;  3L71 H;  2QR4 A;  1N34 B;  5FPR A;  4WFA V;  4JAA A;  4YJ2 A;  4JI7 B;  5B1A B;  3ZRV A;  2H94 A;  3D8C A;  1TVK B;  4MVS A;  1S5J A;  3RVY A;  4YJ3 A;  2VWJ A;  4U7O A;  3RBZ A;  1EBO A;  4LNU B;  1L8D A;  2EIK C;  1S72 V;  3OD4 A;  1YTF B;  1YZB A;  1N0N A;  4FK5 C;  4X62 O;  2IW5 A;  1IVS A;  1DGS A;  1MMM A;  3JAW B;  3G80 A;  4QIW F;  1YI2 V;  1VEW A;  3X2Q B;  4QPJ A;  4ZBM A;  4H33 A;  3CCU V;  3STL C;  4R6Z A;  4JI1 O;  3PN1 A;  4ZIB A;  4I55 B;  4TQF A;  2YIB D;  5JH7 B;  5KX5 B;  5CB4 B;  5LXT A;  4DO2 A;  1CXZ B;  3HKB B;  2EIJ B;  3B4S A;  3RYH A;  3K5N A;  2Z5U A;  1JA8 A;  5JQG A;  2OWO A;  3WG7 C;  1IXM A;  1FS0 G;  3ZMU A;  1I5Y A;  2CTQ A;  3JD1 A;  1FFX B;  2ADQ B;  3H1I H;  4FLV A;  2LGW A;  1M4U A;  2YC0 A;  4LF8 B;  2YSU B;  4UCS A;  1NVP B;  4NR1 A;  3NR7 A;  1ROP A;  1DF4 A;  5EIB D;  2ZKO A;  2EIK B;  1NTZ H;  3RWR D;  2B5U A;  3B77 A;  2YXY A;  5J2U A;  4TUY B;  3SPJ A;  1KD1 W;  1GN6 A;  2R9R B;  2YI8 A;  1BT8 A;  3JYC A;  4UB8 Z;  3SYO A;  1Q8I A;  4P30 A;  1N32 B;  4NXN O;  1CEZ A;  2ITD C;  1K3E A;  2P22 C;  3FAV B;  5BR8 O;  3BA9 A;  3J81 N;  1XNQ O;  4GKK O;  1SA0 A;  1FXK A;  4WCE V;  3LDC A;  4OX9 B;  4FM1 A;  2QTO A;  4L87 A;  1JOY A;  2GUZ A;  2DYS B;  3WG7 B;  3SYA A;  3L74 H;  1KUQ A;  3L72 H;  4P9O A;  4I4T A;  4GLX A;  4DV1 B;  3K59 A;  3FD9 A;  1KB9 F;  2XAQ A;  2X6A A;  3GVM A;  4YY3 B;  4DV2 B;  2Y0I A;  1PL4 A;  1FKA O;  1NZ6 A;  5A2Q N;  1VF6 C;  2LGQ A;  4JAU A;  2LFR A;  2BTO A;  2OTL V;  1YCI A;  3B09 A;  3JAM N;  1VQL V;  5LP6 B;  3H1J H;  4GX1 A;  2CDY A;  1XMQ B;  4EFE A;  2GV9 A;  3O9O A;  3RYC B;  4LF5 O;  2ZXW B;  5F2V O;  3LSS A;  3D3Q A;  4HZ3 A;  5FLX N;  3U10 A;  4F4L A;  2NLJ C;  4I9W A;  1TUE B;  1M56 C;  4RWU A;  4LNU A;  2FYU H;  1HNX O; 
#chains in the Genus database with same CATH homology
 1K4C C;  1JVM A;  3ASO C;  1VQM V;  3K04 A;  3ZJZ A;  4HAM A;  4MVQ A;  5CBF A;  2K1E A;  3KG2 A;  4UXN A;  4JYC A;  3OUF A;  3EFF K;  1GKF A;  1FXK C;  3SPG A;  4Z1M G;  4PA3 A;  3CCM V;  3K0D A;  3PJS K;  5EC2 C;  5EBW C;  4EKW A;  5B1B C;  3CC2 V;  4MSW C;  1OCC B;  2LP7 A;  2PI4 A;  4JPR A;  2C2A A;  1R3L C;  5CN0 A;  4MTX A;  3LNM B;  3OEH G;  4MTG A;  4Q20 A;  1NVP D;  2YEV B;  4MT8 A;  1PD3 A;  1FFT B;  1SRY A;  1WPX A;  3OGC C;  3OW2 U;  1G8M A;  4KFM A;  3SYC A;  3LDE A;  3HPL C;  3UM7 A;  3F5W C;  2IJH A;  2OCC C;  1K9M W;  1P7B A;  1K5S A;  4WFH A;  4UV9 A;  2A0L A;  3ETE A;  1B6Q A;  1H8H G;  2AHY A;  2HKO A;  4PA7 A;  1GM8 A;  2HLD G;  4PEL A;  4MVO A;  1EFR G;  2M7W A;  3JCZ A;  1YIT V;  2DWE C;  2WLL B;  5LGN A;  4MW8 A;  4WF9 V;  1HWY A;  4N23 A;  1R73 A;  1BMF G;  1NR7 A;  4XDJ A;  1DLB A;  2UXX A;  3VOU A;  1EZJ A;  2P7T C;  4LP8 A;  5CA3 A;  3ABT A;  5LGT A;  2Y69 C;  4RQE A;  5EK0 A;  3FB6 C;  2X6B A;  1I5X A;  1PKX A;  2WLJ A;  1ZWI C;  2EIL C;  2JJ2 G;  1AI7 A;  4UVB A;  3D3I A;  4LCU C;  3I55 V;  1BHA A;  1GM9 A;  5IYD O;  4RO2 A;  2X6C A;  1ARO P;  3MHH C;  4WFF A;  3HB3 B;  4KP4 A;  5B1B B;  1ORQ C;  1OHH G;  5EBL C;  4X89 A;  1QVG U;  4HYO A;  1CP9 A;  3OM3 B;  3CCV V;  1JX9 A;  1WLE A;  1NH2 B;  1GTO A;  3JD2 A;  2OT5 A;  3TET A;  1KP3 A;  2WLI A;  3CP1 A;  3MHS C;  2UXN A;  1QLE C;  2WLH A;  3QNE A;  4GCZ A;  4I5S A;  3RVZ A;  3CCE V;  1Q86 W;  1YHQ V;  3OAA G;  5GW7 A;  1XL4 A;  1RM1 C;  1K7D A;  2Q6A A;  3CCJ V;  5L3G A;  3FYI B;  4N21 A;  3TCU A;  2IH3 C;  5J9P C;  4MVZ A;  1QBZ A;  1OCO C;  2X0L A;  3QO8 A;  1R3J C;  2QEX V;  4PA6 A;  3JD3 A;  3X2Q C;  1BL8 A;  1AI4 A;  5H9C A;  3FB5 C;  3ABK B;  2PI5 A;  1S3J A;  4QPK A;  3ABL B;  2CK3 G;  4PA9 A;  1CPY A;  2F43 G;  1THZ A;  4RAI A;  2XAJ A;  3GB7 C;  3FB7 C;  4BW5 A;  4FIP C;  3G6E V;  3AG1 C;  4X8A A;  2GHY A;  3P30 A;  1PNL A;  1DF5 A;  2GSM B;  3FYE B;  3W7U A;  3WFV A;  2JEU A;  2Y69 B;  4JAV A;  5LHG A;  1MSW D;  4QJF B;  1V54 C;  1GM7 A;  1Y4M A;  2EIL B;  3ABM C;  4PDV A;  1AJN A;  2QE7 G;  1JQ0 A;  5L3D A;  4FJC C;  3CCL V;  1F4N A;  3CD6 V;  3E8F A;  3ZMS A;  3T2M A;  2FTK A;  4YXW G;  4JF3 A;  3SPC A;  3OR6 C;  5LGU A;  2IJI A;  4G27 B;  4FPP A;  1J95 A;  4PDM A;  3FKS G;  1KC8 W;  3M99 B;  4UUJ C;  1VQO V;  1JPX A;  1V55 C;  3A0R A;  5IDJ A;  3AG3 C;  3AG2 C;  1COW G;  3SJQ C;  5EBM C;  3UKM A;  1QLE B;  1Q7Y W;  2EIN B;  1M57 C;  5DM6 V;  4BIU A;  4P9P A;  4PDR A;  1NR1 A;  1W0J G;  2LFS A;  4WFG A;  1RM1 B;  5IY5 C;  4E2L A;  2IJJ A;  1H2G A;  4UV8 A;  1OCO B;  1P4R A;  2EZP A;  2HR3 A;  1G4Y B;  1K34 A;  3ZRS A;  2ZDI A;  1QR9 A;  4UVA A;  1NQT A;  3CYO A;  3DGE A;  4GX2 A;  4GX0 A;  3CME V;  1SET A;  1QVF U;  3LUT B;  2ATK C;  2DW4 A;  3K3W A;  3T4Z A;  1NJI W;  1K5Q A;  3ZMZ A;  3CPW U;  2WWW A;  1OCZ C;  2P6J A;  1OCR B;  1GO3 F;  5LBQ A;  1QLN A;  2EIM C;  2H8P C;  1VQ6 V;  2HG5 C;  3E35 A;  4BIZ A;  2DYS C;  5HFL A;  2W6J G;  3ABM B;  3CMA V;  3ZRX A;  2WAM A;  3ZN0 A;  3K03 A;  2MK3 A;  2Q67 A;  2EZO A;  3CCS V;  1VQP V;  1YIJ V;  2JJ1 G;  2JK5 C;  1M56 B;  3AEI A;  2WSS G;  1V55 B;  4R7C A;  1VQ7 V;  3AG2 B;  2QA4 V;  3ML0 A;  3ASO B;  5KA5 A;  1VQ9 V;  1VQ5 V;  3AG4 C;  1OZ0 A;  3E2E A;  4H37 A;  2IJK A;  1F51 A;  4MVM A;  3LDD A;  5B1A C;  5IY5 B;  1FXK B;  1S5H C;  4LC1 A;  5B3S C;  5LHH A;  1E79 G;  3ZMT A;  5E1A C;  1K73 W;  1LNQ A;  1R6N A;  3BEH A;  4MTF A;  3G4S V;  1R3I C;  1S0V A;  4U7N A;  1E1Q G;  1NH2 D;  1SES A;  3TK1 A;  1K97 A;  2DQ0 A;  1MOF A;  4FMT A;  1Q81 W;  3D36 A;  1GK9 A;  1KP2 A;  1XL6 A;  2WLN A;  2Y48 A;  3P32 A;  4JAS A;  4WFE A;  1S76 D;  3K9A A;  2HVK C;  5L3F A;  1KQS U;  3OUS A;  3T4D A;  1K8A W;  2WLK A;  2ZXW C;  3JD4 A;  4RUF A;  2EIM B;  4MW3 A;  3VBB A;  4JYB A;  2OCC B;  3G71 V;  2AHZ A;  4PA4 A;  4R50 A;  2XAH A;  1VQ8 V;  1S77 D;  1VQK V;  2A9H A;  2ZDI C;  1YJN V;  4ASU G;  1RPR A;  3ABU A;  1MG1 A;  3E8G A;  1NBM G;  3T1C A;  5HFM A;  1DTO A;  2W0F C;  3OMA B;  1RPO A;  1JJ2 U;  2HJF C;  1R6K A;  3JD0 A;  3W7W A;  4G2K A;  3OMI B;  1W2B U;  2Z3Y A;  2V1D A;  3OEE G;  3OMN B;  3MD0 A;  4GX5 A;  3GWO A;  2EIJ C;  4QE9 A;  5H6Q A;  3RW0 A;  2XAS A;  1AI5 A;  4KUM A;  4XDK A;  3ZRW B;  4RQF A;  2DQ3 A;  1MAB G;  2DWD C;  3ZCC A;  3W7S A;  3DTU B;  1K33 A;  3AG4 B;  2A79 B;  3F7V C;  4WFA V;  2V7Q G;  1N8R W;  2JIZ G;  5B1A B;  3ZRV A;  2H94 A;  4RUE A;  4TT3 G;  3ZIA G;  5DN6 G;  5CMU A;  3QO7 A;  2P90 A;  4MVS A;  3RVY A;  5IYB O;  5CBG A;  2P67 A;  4TWK A;  2ZR3 A;  2XOK G;  4U7O A;  1F23 A;  2BOC C;  3RBZ A;  4MS2 A;  3W7X A;  1EBO A;  2QKS A;  3OFN G;  1Y66 A;  2EIK C;  1S72 V;  4J9Z B;  2ZR2 A;  1YTF B;  1AR1 B;  2KB1 A;  3OE7 G;  2IU3 A;  2QM8 A;  2XND G;  4LBE C;  1YTF D;  1YJ9 V;  3STZ C;  4FK5 C;  1QCE A;  2IW5 A;  4MVU A;  2XAF A;  3LSQ A;  3B8M A;  4QIW F;  1BHB A;  3I56 V;  3X2Q B;  1YI2 V;  5L3B A;  4QPJ A;  2ZQM A;  1KKD A;  3E8B A;  2NNU A;  4H33 A;  4ZBM A;  3CCU V;  3STL C;  4R6Z A;  2EJR A;  3K08 A;  2BOB C;  1M1K W;  1FXH A;  1SER A;  4QE7 A;  3CCR V;  1NKD A;  1ENV A;  4DO2 A;  3AG1 B;  3IFX A;  3ZN1 A;  2EIJ B;  4XDL A;  3B8N A;  1SZT A;  2Z5U A;  3ASN C;  4OXS A;  4JGS A;  3WG7 C;  1IXM A;  1FS0 G;  2DYR C;  1V54 B;  2W6I G;  3ZMU A;  1I5Y A;  4X88 A;  3JD1 A;  1L1F A;  2YSU B;  5KA6 A;  1NVP B;  1K4D C;  3BY6 A;  2YEV A;  1R3K C;  1ROP A;  3SPH A;  1M90 W;  1DF4 A;  3F7Y C;  1M9N A;  2HFE C;  3K06 A;  5KUM A;  5H6R A;  2EBO A;  3AG3 B;  2B1G A;  1KEC A;  2EIK B;  3SYP A;  1M57 B;  4PDL A;  2B5U A;  3B77 A;  4UVC A;  3ABK C;  3SPJ A;  3ABL C;  1KD1 W;  1W0K G;  2R9R B;  1H38 A;  3R65 A;  2WLL A;  1Q82 W;  3EHB B;  3JYC A;  2WLM A;  3SYO A;  4P30 A;  5FL7 G;  2ITD C;  1CEZ A;  2Q68 A;  3CC4 V;  1K3E A;  2JEX A;  5BZB A;  2X7R B;  3K0G A;  2IU0 A;  1FXV A;  2XAG A;  4ZKI A;  2WLI B;  4GT1 A;  5CBH A;  1FXK A;  1OCZ B;  1VQN V;  4WCE V;  3W7T A;  4P2Z A;  3LDC A;  4CZZ A;  1JOY A;  2QTO A;  4L87 A;  3ASN B;  5L3C A;  3K79 A;  2DYS B;  4CBC A;  1PNK A;  3WG7 B;  2IH1 C;  2DYR B;  3NXS A;  1H8E G;  1YJW V;  2D3O W;  3SYA A;  1VQ4 V;  1PNM A;  4J9Y B;  4JTA B;  3IGA C;  5B1O A;  5EC1 C;  3IC7 A;  3H01 A;  2EIN C;  5C93 A;  4P9O A;  2HVJ C;  2WPD G;  2B1I A;  1YSC A;  4QNH B;  2XAQ A;  2X6A A;  3QO5 A;  1UJW B;  1OCC C;  1E1R G;  4JTC B;  5IYC O;  2OTJ V;  3FB8 C;  4BAY A;  5B3S B;  3ZMV A;  5L3E A;  2Q69 A;  1AI6 A;  4JAU A;  2LFR A;  3ZRW A;  4MTO A;  3CCQ V;  2OTL V;  5KUK A;  3E86 A;  1AJP A;  4G28 B;  1OCR C;  3SYQ A;  4XBF A;  1VQL V;  3ETG A;  1F4M A;  2JDI G;  1GMG A;  5LHI A;  1QR8 A;  3E8H A;  4WFB V;  3CXC U;  2ITC C;  4GX1 A;  1JCH A;  2QM7 A;  1PL0 A;  3E89 A;  1AJQ A;  4TSF G;  3CC7 V;  2ZXW B;  3LSS A;  3ETD A;  3E83 A;  4HZ3 A;  2ZD9 A;  3SPI A;  4R8C A;  2R9I A;  4JTD B;  4DXW A;  4F4L A;  2NLJ C;  5B1N A;  4I9W A;  1K92 A;  1TUE B;  3OR7 C;  1M56 C;  4MVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...