5EC2C

Kcsa with v76ester+g77da mutations
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
102
structure length
100
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
total genus 39
structure length 100
sequence length 102
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ec2C00
3E8GA 4J9ZB 4MVOA 3TETA 2QKSA 2QTOA 2HFEC 2ITDC 1V55C 1J95A 4HYOA 3X2QC 3UM7A 5CBFA 3AG2C 4P9PA 1R3IC 2JK5C 3K0DA 2WLKA 3F5WC 1QLEC 3K06A 2DWDC 3ASOC 3LUTB 4PA4A 4TWKA 3LNMB 2ZXWC 1S5HC 3ABLC 2WLIA 3K03A 4MS2A 2EINC 3K08A 4PA9A 4PDLA 2YEVA 4GX0A 2K1EA 3ZRSA 1LNQA 2DYSC 2W0FC 3LDDA 2EILC 5J9PC 2DWEC 2NLJC 2WLHA 3IGAC 4PA6A 3WG7C 1XL4A 1R3LC 4MTFA 4WFEA 4EKWA 2WLNA 2EIJC 2OCCC 4RAIA 4LCUC 5E1AC 3R65A 4JTCB 4QE9A 3E86A 3LDEA 1R3KC 2EIKC 3OUFA 3FB6C 4RO2A 1P7BA 2X6CA 4MVMA 4GX5A 4KFMA 4RUFA 2A0LA 3KG2A 3F7VC 3SPJA 3SYPA 3SYOA 3E8HA 4X88A 3RVZA 2Q6AA 2ATKC 4BW5A 3STLC 4G27B 5BZBA 3SPIA 3T4DA 4CBCA 3E83A 3E8FA 3HPLC 4R6ZA 2R9RB 3E89A 1K4DC 3RVYA 2Q69A 2WLMA 3K0GA 4JTDB 4X89A 4PDVA 3LDCA 4P2ZA 3T2MA 2HVJC 4GX2A 4J9YB 2DYRC 5EBMC 3ABMC 5EC2C 4XDLA 3VOUA 4R50A 2WLLA 5IY5C 3K04A 1OCZC 2HG5C 4LP8A 3IFXA 3UKMA 3ASNC 4MVQA 2Q68A 5KUMA 3SPHA 4MVUA 3STZC 3SYAA 4I9WA 4WFGA 1M57C 1R3JC 4MVRA 2IH1C 2HJFC 1OCOC 1XL6A 4MTGA 3ZJZA 4F4LA 3TCUA 4MVSA 4XDKA 3GB7C 3SJQC 5EBLC 4HZ3A 2EIMC 4RUEA 3SYCA 1OCRC 3OR7C 3SYQA 4WFFA 5B1BC 4DXWA 4ZBMA 4XDJA 3AG3C 3E8BA 4QNHB 5B1AC 4QE7A 3RW0A 4WFHA 3F7YC 2BOBC 2AHZA 2ZD9A 4MW8A 2A9HA 3JYCA 3AG4C 3OR6C 4UUJC 4P9OA 2AHYA 5EC1C 2ITCC 1G4YB 5CBHA 3T1CA 1BL8A 1ORQC 4MVZA 2Q67A 1KKDA 2WLJA 5EK0A 5KUKA 4G28B 5CBGA 2P7TC 4MSWC 3SPGA 2Y69C 2X6AA 3BEHA 4JTAB 4H37A 4MTOA 4LBEC 4P30A 4PDMA 4H33A 5EBWC 3PJSK 2KB1A 2WLIB 3FB7C 2X6BA 3SPCA 3OUSA 2BOCC 4PA3A 1K4CC 3EFFK 1ZWIC 1V54C 2A79B 2H8PC 2IH3C 3FB5C 3OGCC 3FB8C 4X8AA 1OCCC 3T4ZA 4R8CA 2WLLB 5B3SC 1M56C 4OXSA 1JVMA 4PA7A 2HVKC 3ABKC 4PDRA 4R7CA 3RBZA 3AG1C 4MW3A 4GX1A
chains in the Genus database with same CATH superfamily
2JRIA 1FXKC 1W59A 1K9MW 2RCVA 1D5AA 1YITV 1XI1A 2ZDIA 4HYOA 3X2QC 5CMUA 1F51A 4LFCB 3N2GA 2W6JG 1SZXA 4U3FH 4JYAB 4YJ3A 3QO7A 2K1EA 4JGSA 1L1FA 4J80A 1K8AW 4TV9B 3OEHG 4DV1B 2HP8A 2LFSA 4LFBO 4JTCB 1VIBA 1AP5A 4MVMA 2IJHA 4O4JA 4NTYA 4JI5B 2N74A 1IBMB 3K9AA 3OD4A 1FFTB 4FFBB 4DR1O 2W6IG 1AR4A 1FFXB 4GX2A 4BIZA 2BTQB 5EBMC 5LBQA 1UFIA 1K73W 2H94A 3K5LA 1K34A 3JAKA 1TGOA 1DGSA 5BR8O 3H1JH 3CC2V 1ROPA 4DR4B 1FPOA 4JI8O 2UXXA 1N33O 5J2UB 1AB3A 4L87A 4CC6A 3J80N 3KKYA 1XREA 3MD0A 2OWOA 4ABMA 4I7ZB 5GONA 2QJ1A 2ITCC 4F6EA 4WBNB 2DYRB 4O2AB 2WLJA 4H0LB 2OYQA 2E74B 2GDSA 1PPJH 4JTAB 3L71H 1XBLA 2BSKA 3CRQA 3W7XA 3CC7V 5H5NA 4FM0A 2QGNA 1ZX3A 3JSLA 3ABKC 1KC8W 1K5SA 1Q43A 3ZMVA 1SQFA 1IVSA 4JI3O 2QTOA 1IDSA 4JAVA 1RPRA 2DYSB 1N32O 1CXZB 4P9PA 1VQ5V 2CH7A 4UVAA 1YJNV 1EBOA 1KMIZ 3VQXA 1Q82W 4B3TB 1AVMA 5FNVA 3AG2B 3K5OA 2JEXA 1XMQB 2WLNA 5LXTA 1RSOA 5E1AC 3THOA 1GN2A 4DR7B 2P90A 4D7TA 2PUSA 3APQA 1AILA 2OIGA 1AI4A 4X88A 5HFLA 3ZBHA 5FLXN 1BQZA 3JATA 1V55B 5L3FA 4LFAB 2XAJA 5IYZB 1HDJA 2OTJV 2YEVB 4PI0A 3QVNA 2HVJC 4TV8A 2QWRB 2HJFC 1I0HA 3ZJZA 2OCHA 4DR4O 5KHGA 4LF9O 1VQPV 2C2AA 1K7DA 2DW4A 3OTFA 1WNSA 5BXZA 4AI8A 3RGBA 3M8AA 1K92A 2RNBA 4TUYB 1N0JA 1G4YB 1H2SB 2Q7GA 2VQEO 1SA0B 5L3EA 1PD3A 1WA8A 1G8MA 4DV2B 3CCEV 3IC7A 4IL6Z 4WBNA 1RM1C 1SQXH 1D5NA 3EFFK 2EZOA 2OCCB 3P32A 3JAWB 5D5PA 1GKFA 2L35A 4X9QA 4DUZO 1SKVA 4K0KO 3FAVB 3A0RA 3RBZA 3OFNG 4NTXA 1I08A 2F4VB 1H2GA 4TV8B 3ZHUA 4QGPA 1V55C 1PP9H 4OGQB 2LW1A 2UXBO 1R3IC 1VF5B 1I5YA 1Q6HA 1YSCA 1NTMH 2O57A 1M1KW 3ZN0A 2UUCB 1WN7A 1J5EO 1TUEB 2Y4TA 3HKBB 4GX0A 3E22A 3LDDA 3IGAC 4L8JA 1R3LC 4JV5B 1Q90D 1H8HG 4TUYA 4JI7O 4F6RA 4GKKB 2QSAA 2Q6AA 1URFA 3SPIA 2WWWA 1I94B 1BHAA 1RFYA 2BSKB 1MOFA 1MSDA 1OCOB 1QHTA 1WP8A 3K04A 2AZ2A 4JI6B 3HB3B 4U3JA 4DUYB 2VS0A 4UB8Z 4DO2A 1HNZO 1FYJA 1S5LZ 3H9VA 5EBLC 1GMGA 2JDIG 5EIBD 4X1IB 1KYOF 5LMNB 4ASUG 4EFBA 1YJ9V 1ZL8A 3L74H 4ZBMA 4IHJB 2YI8A 1NS1A 1VQOV 1HNWB 3EVKA 4MTXA 3HKCB 3OR6C 1K33A 3JD2A 3ML0A 1M4UA 1GN4A 4MTOA 3JAKB 4LF5B 3ABLB 2Z5UA 4O4HB 2X6BA 3MDSA 1ZWIC 1VQ7V 4U7NA 1Q3EA 3FB5C 2XAGA 3O9OA 4ICGA 3ZRXA 4BW9A 4R7CA 2QKAA 3A8TA 3AG1C 5J2TA 4X65O 5A2QN 3HR0A 5LMNO 3G67A 1MMMA 4X1YA 4EEQA 1AP6A 4DR5B 2GTAA 3K0DA 3RYCA 5LP6C 3OW2U 3OM3B 4LR3A 1XNRO 3LNMB 2EINC 4PA9A 4PDLA 3C3TA 5J9PC 4DV6O 2PF4E 3GWKC 3N2GB 3KCXA 2KQXA 4O2AA 4LFCO 1N0NA 1P7BA 3NR7A 2E75B 1NKDA 1HWYA 4Z1VA 2ATKC 2XOKG 3H01A 2YXLA 3U11A 4JI7B 5BMVA 3ZRWA 3HPLC 2Z3YA 3ZRVA 2JS3A 3LSSA 2OTLV 3K0GA 5CA0B 4QJFB 3LDCA 2E5LO 5IY5C 4R50A 2WLLA 5BY1A 1MSWD 3UCSC 4B3SB 2Q4PA 1GN6A 1IBLB 1EN5A 1RM1B 4W4LA 1M57C 1FXHA 1V54B 4DV0B 4ZI7A 1M9NA 1YTFD 4O4LA 3B8NA 4JI2B 2XUMA 4YJ2B 1YF2A 1M93A 1OHHG 2V1DA 2FYUH 4MVZA 2VRZA 1MNGA 2BCCH 2VWKA 4UVBA 2PYJA 2P7TC 3ETEA 4I0XB 3BVOA 5JQGB 4J10A 2Q8VA 4K0KB 1LUVA 2BOCC 1TVKB 1O9GA 3OEEG 5JH7A 4DR6B 4X8AA 3H1IH 5JVDA 3WG7B 3T4ZA 1G6UA 2WPDG 1JVMA 1IZ3A 4Q6GA 1IX9A 1DLBA 4DYLA 1N34O 4MVOA 3TETA 2ITDC 2R9AA 2IU3A 2P06A 3Q4HB 3CHXA 2CGNA 2WLKA 4X1KB 2B9ZA 3ZMUA 2F1MA 2RMKB 3N2KA 4FLYA 5LA6A 3NXSA 4ZKIA 2CH7B 3CCMV 1LNQA 2W0FC 5KA5A 4PA6A 5B3SB 3RN4A 1N36O 4LF9B 1K97A 2QWNB 5KMGB 4H13B 5JJJB 4I55A 4DR6O 1Q8IA 2LGQA 5FPRA 1X4TA 1VQMV 4D7SA 2VQFO 3OE7G 4I0XA 5BZBA 4E2LA 1WAZA 4DR7O 4JASA 2F95B 1OV9A 3K58A 5LGUA 3J81N 1NI8A 3AG4B 3T2MA 5IJ9B 2RQ6A 2IW5A 4JI4B 3AG3B 5IYDO 3ABUA 2Q5ZA 1XL6A 2N05A 3W7UA 3BCCH 3RYHA 2GUZA 2WAMA 2DN9A 3BHPA 2F43G 4XDJA 3AG3C 2GUZB 1VP7A 3EXAA 1Q7YW 4CH5A 3SJAC 5ITZB 4DR3B 5LXTB 1BL8A 2UXCB 3BPZA 3SJCC 4Z2WA 1Q81W 3O65A 1LUWA 4I9QA 1SF9A 1NU1H 5L3CA 3OGCC 3B40A 4ZHQA 2EJRA 1RSOB 4FM1A 2WLLB 1QU7A 3ZHTA 3ZS8C 1S3JA 2UU9B 5KLVH 1QNMA 2V7QG 3H1KH 4N21A 4QPJA 4LF4B 2VQFB 2W0XA 2EBOA 3JCUZ 4DR2O 3VQVA 1HR0O 1JJ2U 3IAYA 1DTOA 4LF7O 3QO8A 5A9GA 1YZBA 1AJPA 2P4VA 3WU2Z 1W0KG 1M57B 1NT2B 2EIJC 5KAFZ 3A0BZ 4RAIA 5B5EZ 5LA6B 1FXKA 3CCVV 3HKBA 1P49A 2EIKC 2JGUA 2CDYA 3ZEDA 5JJNB 1GO3F 4JYCA 1Y74A 3E2EA 3ASNB 1DF4A 4R6ZA 4O4JB 1K4DC 4GZRB 4JTDB 5JH7B 5EC2C 3BAAA 2ZT9B 2JS5A 1YEWA 4WF9V 2IBZH 1WP7A 4MVQA 4MT8A 1OZ0A 4MVRA 3OMIB 4X1KA 5LOVB 2PTMA 2EIMC 4YIOA 1IXMA 5EC1C 2XNDG 1LR1A 4I50A 4DV4O 5CA1A 5KMGA 5EK0A 2AW9A 2PI4A 4TQDA 1NVPD 4ZHQB 1GM7A 3OUSA 4B3SO 2B1GA 3JALA 1WLEA 4JI2O 1VF6A 2XHBA 2EX3A 5GTHZ 2ZNJA 5LGTA 1TVKA 4DV5O 3CMEV 1IXBA 1FJGO 3EHBB 1FJGB 1THZA 1YVWA 2IJIA 1NQTA 3DSQA 1R6NA 1TAEA 3AG2C 1OCCB 1NR1A 2UXDB 3AK1A 3OMNB 3H1LH 3L72H 1XNQO 1S76D 3K06A 3ASOC 3K03A 2WLIA 5AG2A 5KAIZ 2QEXV 2LO1A 2DWEC 1PL0A 2VWJA 3CJHB 4BIOA 1GM8A 4FLWA 1N4CA 1Y67A 1AI5A 4QE9A 3LDEA 5EZYA 2GTSA 1GH6A 4X64O 1KD1W 1FKAO 2DOSA 4B3RB 4HAMA 4OPAA 4NTWA 2PGGA 3RVYA 2X0LA 1VQ4V 2PZSA 4LC1A 1U97A 4J9YB 1VF7A 4XDLA 2ZQMA 3ZRWB 3ABTA 5B1NA 3RYIB 1COWG 4ZI7B 1XMOB 1DK1A 4X62B 2Y69B 4X65B 3I56V 4NXNB 4FK5C 4H44B 3LNNA 4FLTA 4WFHA 1MZFA 2P67A 4UCRA 3F7YC 3BY6A 4MW8A 2XASA 5L3DA 4LF5O 3BABA 4UUJC 2AHYA 1SQPH 3IC9A 1ORQC 2H3OA 1KKDA 1MZEA 2FB5A 1Q86W 2B5UA 4DUYO 2ZM6O 4DW0A 2Q7EA 2ZXWB 2F66C 2ARHA 4FIPC 3SPCA 3SJBC 3TXQA 2IU0A 1PNMA 5IWAO 2IH3C 1KECA 3AEIA 4JF3A 1NR7A 4OXSA 1PV0A 1XMQO 1BQ0A 3DTUB 3CMAV 1BGYH 1M90W 4GKKO 2JGDA 4X66O 5B66Z 3CEIA 1WA8B 4PV1B 2MK3A 1Z5WA 1QR8A 5CA0A 2NLJC 2F23A 1QVGU 3OMAB 3N2KB 1SZTA 5JJEB 4I4TB 1NVPB 4BIUA 2X6CA 1YJWV 4JI4O 2YXHA 4G27B 1QR9A 2IM9A 5H6QA 1TUBA 5DN6G 2IJKA 2LFRA 3QTCA 4DUZB 4GT1A 2QE7G 4B7KA 4YY3B 4FFKA 1NTZH 1EZVH 3VQYA 3TXSA 1Q5OA 1HNXO 5LGNA 4RWUA 3KCYA 3AG7A 4MTGA 4YJ2A 2ILMA 3TCUA 1MG1A 3JD3A 4JI8B 3P3PA 1FXVA 5KHJA 3OR7C 5B1OA 1UPGA 5B1BC 1SETA 3MHHC 5BR8B 1VQ8V 1KQSU 4QNHB 5GW7A 4O4LB 3AG4C 4CH4A 4ZIBA 3T1CA 1PL4A 4JYYA 4HBNA 1QLEB 4G28B 3RYCB 4IT5A 1B6QA 1S72V 4KUMA 2KSDA 3CSXA 1IBMO 1SA0A 2V4DA 3JD0A 1O9HA 3JSNA 4YHHO 4EFEA 4FZ0A 1ZL8B 2M6YA 4R8CA 3SGIA 5B3SC 3RYIA 1BCCH 2YIBD 2QM7A 2WA3A 1D2DA 2OIEA 4UCUA 4AQYB 4K8ZA 1DF5A 3SR2C 2D3OW 3FAVA 1PNLA 2WSSG 5LMUO 3L75H 2F93B 1G1XB 3K79A 3MHSC 1H2LA 5LHGA 1R73A 2DYSC 4PI2A 3JAWA 4B7EA 2HHHO 5FL7G 3R65A 3ZN1A 4B3MO 2RN9A 4RO2A 1H38A 2P4KA 3SYPA 3CPWU 5LP6A 3JD1A 1I5XA 5B1BB 3UT5A 4J7ZA 3PN1A 3UQ8A 5K1XA 2LQTA 2QTSA 4B3TO 2UXCO 1JA8A 2Y4UA 2DYRC 1E79G 4FVMA 3OTOO 5EYPA 3QF7A 3FFQA 5JWPA 2HG5C 1SESA 2Q0OC 2WA4A 3SYAA 4I9WA 4WFGA 1F4MA 5H9CA 1SERA 1Q6UA 4TT3G 5H2FZ 4CS3A 4GUNA 3A2FA 4RUEA 1XHXA 2QA4V 1WB8A 5IWAB 4NB5A 3E8BA 4QE7A 2DQ3A 1VQLV 2BOBC 1VF6C 1YI2V 4O4IB 1S77D 2ZM6B 2QM4A 2L6LA 3CCRV 2PY5A 3SDLA 3R66A 4MSWC 3SPGA 4U3JB 4LBEC 4H33A 5EBWC 4UCTA 4IIJB 1K4CC 1VMGA 1XNRB 1E1QG 2EIJB 3ZCCA 4Z1MG 4GYCB 1BS3A 4LF8B 3FYEB 2Q7HA 5E79Z 2YDEA 5LYJB 3HKCA 3ETGA 1XMOO 1RP3B 1W0JG 3UM7A 4LF8O 1Y74B 2CUGA 3F5WC 2KG7A 4FLVA 4NXMO 2DWDC 4NXMB 2ZINA 1H2MA 4NXNO 1R6TA 4O4HA 4KL1A 5IY5B 2YEVA 3K57A 4DR1B 1JCHA 1N34B 3X2QB 4X62O 3FYIB 1SQVH 1L0LH 4D6TH 4NYKA 1JX9A 2ETNA 3FKSG 3TJTA 2EJ7A 4B08A 4FFBA 4GX5A 4JI0O 1EFRG 1GM9A 4X64B 2FTKA 3MAQA 2UUBO 4CZZA 3RFRA 3K9SA 3K59A 1I7FA 2Q69A 3VOUA 5DECA 1Y66A 3ETQA 5KUMA 2Q68A 1JFFA 3ZHSA 3CRAA 2IH1C 1T5EA 3SJQC 3N27A 3P30A 3QG5A 4LF6O 4RQEA 1IBKO 5F2VO 3JARB 2AHZA 2FMLA 2Q0AA 1FS0G 3ZMSA 1PM9A 1XUQA 4IHJA 4FMTA 4FZ1A 4JV5O 2GBOA 3UO2A 4F6RB 1QBZA 1AR5A 2YIBA 3G4SV 1YCIA 3L9DA 2UUCO 2JVDA 2H8PC 2D2CB 4TV9A 2ZR2A 4KXRA 1OCCC 2UXBB 3ZMZA 5EIBC 1R6KA 3UO3A 2F4VO 1H2NA 4GX1A 1QCEA 3H1HH 5JVDB 2BTOA 2VQEB 3OAAG 1BHBA 3ZHRA 4TWKA 1YIJV 3K08A 2CGOA 1FFXA 3ZRSA 3D36C 3CC4V 4J42A 4I55B 2ZIMA 3WG7C 4EKWA 1NJIW 3ZHQA 3FX7A 4PELA 4LCUC 4YHHB 4KFMA 2YIAA 3KG2A 3E8HA 1HW7A 2EZPA 5D5QA 3CS5A 1QLNA 5JCOA 2X7RB 2JIZG 2M7WA 4LNUB 2YIDA 2GSMB 4GCZA 1HR0B 4LFAO 2E3CA 1TUBB 2CE4A 3KZIZ 1ZLZA 3STZC 4LF4O 5LYJA 3HKDB 4UV8A 5B1AB 4BWAA 4DR2B 2QWPB 2GHYA 1HNZB 3TK1A 1B06A 4LF7B 4C7UA 3JATB 4LWSB 4WFFA 4DXWA 4JI6O 5HFMA 3L73H 2OT5A 2XAQA 4CS4A 2EILB 3RT3C 5LHIA 3DC6A 1VQNV 1B04A 5EYPB 5LHHA 4K3AA 4XBFA 2XT9A 3ABMB 4JI1O 3CCSV 5GONB 1BT8A 4PDMA 4GKJO 5CA1B 3U0ZA 5TISZ 2LW7A 1QVFU 1XOUA 1V54C 2A79B 4AHCA 1KBHA 1P7GA 4B3MB 1N32B 1JQ0A 4DR3O 5KHKA 3E8GA 2QKSA 4GLXA 1J95A 1EZJA 1K5QA 3WB2A 4OX9B 2Y48A 1VQKV 3LUTB 1XEQA 5IYCO 1L0NH 2ZXWC 4MS2A 2ADQB 3Q4HA 1F4NA 5IJ9A 3DXRA 4WFEA 1CP9A 3D8CA 2YUAA 4DRXA 1MA1A 1M56B 2K9PA 5C8YA 2BE3A 3FB6C 5KHHA 3CE2A 4DK0A 1AI6A 3SYOA 3APOA 3F7VC 2E76B 4CH3A 3K5NA 1N36B 4KP4A 3RWRD 2N04A 3E8FA 3CCQV 4O2BA 5LP6B 1Y4MA 3HKDA 2ZE8A 2FL4A 4PDVA 1OCZC 1A32A 2AZ0A 1H2KA 1N8RW 4MVUA 4DV7B 1YDXA 3ETDA 2PYLA 2CTPA 3G71V 2HJDA 4MVSA 4DV1O 4HZ3A 1BE3H 3SYCA 4CS2A 1EN4A 3ABKB 1HNXB 2XAHA 1SQQH 1TA8A 2NNUA 3CCLV 4AILC 4W4KA 4YY3O 3T1HB 4JZGA 4H37A 3VBBA 3ASOB 2DMXA 5IE9A 3HKEA 2ZE7A 1YHQV 1AJQA 2QWQB 1EN6A 2A06H 1KU9A 2Q9LA 2ZR3A 4UCVA 1BMFG 1KUQA 3BFRA 1GTOA 4MW3A 3FD9A 4LF6B 1U96A 3D3IA 1Q6IA 3B77A 1WPBA 1AJNA 1VQ6V 1KP2A 2G38A 1SS3A 2JK5C 4FJCC 4KHPB 1UJWB 2XAFA 1P4RA 1FXKB 3VQWA 4J7JA 3GWOA 4I5SA 2E5LB 2EILC 5GTIZ 1Y76B 2OCCC 3WFVA 2R70A 3AK3A 1PKXA 1IBLO 4TOIA 3CCUV 4A5UB 3SPJA 3RVZA 2QDOA 1SQBH 4NKGB 3W7SA 1JR9A 3C3SA 2DJVA 2RJZA 4N23A 1KP3A 1JPXA 4TSFG 1YTFB 4JPRA 3T1HO 3ABMC 5IJ0B 1FD9A 1ZTEA 4FM2A 4ZOLA 1R3JC 4LH6A 4DR5O 3TGUH 1F7YA 3JALB 2KG7B 1SRYA 1JFFB 4CC5A 2QR4A 5L3BA 5B1AC 5J2TB 2YSUB 5LL6Y 3OT7A 1M5IA 2IJJA 3B8MA 2Q67A 2A3QA 4UXNA 5JQGA 2YXYA 4UFZA 3I5DA 4OPHA 2AXTZ 2X6AA 3F5TA 4EB6A 4P30A 2KB1A 3CYOA 1GK9A 3K3WA 5CN0A 2AGAA 2R72A 1VQ9V 4JAAA 2XTAA 1H8EG 3CWBH 1YXBA 2ODMA 1US6A 1NZ6A 1XDCA 5IYBO 5EZYB 3JD4A 3RYFA 2RDCA 3HKEB 5KX5B 3U10A 4JYAO 2HFEC 4G2KA 5CBFA 3CXHF 3A0HZ 1OJHA 4YJ3B 4UCOA 1CEZA 1XNQB 1EM1A 1KKCA 4J7KA 2QKCA 1S5HC 1VARA 1XQ8A 3M99B 1JJOA 1QQCA 5KHIA 1CPYA 3JCZA 4CH6A 2WLHA 4IYIA 2ZCEA 4MTFA 3CXCU 3QNEA 3JARA 2NR5A 2LJ2A 4X20B 3E86A 3ZHVA 2ZDIC 5FNVB 1I94O 2ZNIA 2YC0A 1FAFA 1R1BA 1SC5B 3OTOB 1ZUQA 3GVMA 4DRXB 4PHZA 4DV5B 1WJZA 5IDJA 4DV3B 2QWOB 4JI1B 3CP1A 1J5EB 1HP8A 2LGWA 3AG1B 4LP8A 3SPHA 3P3NA 1S5JA 3ZIAG 5J2UA 3T1YB 1Z2GA 2DQ0A 1NH2D 5IJ0A 5LMUB 3B2EE 1OCOC 1Z5VA 4WCEV 4F4LA 3W7WA 2HHHB 2YICA 2LP7A 4FLXA 4DV4B 2CK3G 4AQYO 4HNAA 1WPXA 2P6JA 4NVPA 4IGGA 4PD4F 3W7TA 1X59A 1XILA 2ZD9A 3L70H 3CCJV 4HNAB 4P9OA 1OCZB 1JOYA 5CBHA 1SQGA 5KUKA 3B4SA 5H6RA 3BA9A 3UT5B 4YIPA 2UUAB 2DE0X 4QPKA 2WLIB 1NBMG 3RYFB 3J7AU 4DV2O 5CB4A 3OGIB 4DK1A 1M56C 4I4TA 2HVKC 2CAZC 3G80A 3WB0A 3JAMN 2BTQA 2HR3A 5DEDA 4DV7O 2KKWA 4J11A 3C90A 4JZ2A 2Q73A 1ZAUA 4RQFA 2EIKB 4E4EA 4YXWG 4FPPA 5C93A 2CTRA 1XL4A 2ZE5A 4BAYA 2HLDG 1MABG 2MW2B 1XHZA 3CD6V 1W2BU 3OUFA 5BMVB 3ZX6A 3I55V 1S0VA 3RYHB 1Y76A 3WB1A 4OX9O 3LSQA 1BZKA 1K3EA 3ICXA 4UV9A 4IIJA 3G6EV 3T4DA 4CBCA 2Y0IA 5C8YB 2UU9O 3E89A 4DV3O 2JJ1G 3S3WA 2Y0PA 4X89A 2B1IA 5DM6V 4P2ZA 2ZE6A 4LNUA 3IFXA 4GKJB 5KX5A 4WFAV 1IBKB 2GV9A 2Z0AA 2ZKOA 1WB7A 3M7MX 1F23A 1P84F 4JI3B 1OCRC 3SYQA 1B3QA 4UB6Z 1IURA 2A9HA 3BRCA 3JYCA 4LWSA 4X20A 4X66B 3CB2A 1NTKH 2CTQA 1ENVA 4DV6B 5ITZA 1AROP 2Y69C 1AI7A 2EINB 3QO5A 2UUBB 3FB7C 2YS8A 4FLUA 1AR1B 2P5OA 4JI0B 4J41A 2CTWA 1BSMA 4U7OA 4PJ0Z 4X1YB 2HEPA 4J9ZB 5CB4B 5FPOA 1KB9F 3E35A 1V9PA 3E22B 4LH7A 1QLEC 4PA4A 3G6BA 1N33B 3ABLC 2A7WA 2ADPA 4FLZA 3LSUA 1GAXA 4JI5O 3ZMTA 2QM8A 1R3KC 2YI9A 2EIMB 2JEUA 3DXRB 4RUFA 2A0LA 1HNWO 2PI5A 3D3QA 4BW5A 3STLC 2ZIOA 2UUAO 2UXNA 3CRMA 3E83A 5KA6A 2JJ2G 2JGDB 4QIWF 4LFBB 4B3RO 2NN4A 3D36A 2R9RB 5K1PA 4O4IA 4NR1A 2WLMA 3DC5A 4I50B 2FKXA 4O2BB 5IT9N 3CJHA 4UVCA 1OCRB 3UKMA 2HKOA 3ASNC 4X1IA 5CA3A 4JAUA 4Q20A 1VEWA 3BA8A 2R9IA 2UXDO 4XDKA 3GB7C 5JCOC 4ZOLB 3CRRA 4DW1A 4IYHA 4TQFA 3T1YO 5L3GA 1Y6XA 3JASA 5LOVA 3S3XA 1GRJA 3AK2A 3RW0A 4JYBA 1RPOA 3CX5F 3JASB 3K5MA 4UCSA 4DV0O 2EULA 4BR6A 4K8XA 1JMKC 3B09A 5CBGA 3CRCA 4WFBV 4K35A 3BEHA 1E1RG 3DGEA 3PJSK 3IJ4A 1GN3A 4PA3A 1PNKA 1L8DA 4EB6B 3FB8C 4KHPO 1ZSPA 1NH2B 5IYZA 4PA7A 4PDRA 2P22C
chains in the Genus database with same CATH topology
1DLBA 1FXKC 1K9MW 4MVOA 3D3IA 3TETA 3B77A 1YITV 1DF5A 2ITDC 1AJNA 2ZDIA 4HYOA 3X2QC 2IU3A 5CMUA 2D3OW 1VQ6V 1KP2A 1PNLA 2WSSG 2JK5C 4FJCC 2WLKA 1UJWB 1F51A 2XAFA 3ZMUA 1P4RA 2W6JG 1FXKB 3K79A 3NXSA 4ZKIA 3MHSC 5LHGA 3QO7A 1R73A 2K1EA 4JGSA 3GWOA 1LNQA 1L1FA 2DYSC 2W0FC 4I5SA 3CCMV 2EILC 5KA5A 1K8AW 4PA6A 5B3SB 3OEHG 2OCCC 3WFVA 1K97A 1PKXA 5FL7G 2LFSA 3R65A 3ZN1A 4JTCB 4RO2A 1H38A 3CCUV 4MVMA 2IJHA 3SYPA 3SPJA 1VQMV 3CPWU 3RVZA 3JD1A 3OE7G 1I5XA 3K9AA 5B1BB 5BZBA 3W7SA 4E2LA 1FFTB 4N23A 4JASA 2W6IG 1KP3A 1JPXA 5LGUA 4TSFG 3AG4B 1YTFB 4JPRA 4GX2A 3T2MA 4BIZA 2DYRC 5EBMC 3ABMC 1E79G 5LBQA 2IW5A 2HG5C 1SESA 1K73W 2H94A 3SYAA 4I9WA 4WFGA 1K34A 1F4MA 1R3JC 3AG3B 5IYDO 3ABUA 5H9CA 1SERA 1XL6A 4TT3G 3W7UA 3CC2V 1ROPA 2UXXA 2WAMA 4RUEA 1SRYA 2QA4V 2F43G 4L87A 4XDJA 3AG3C 3E8BA 5L3BA 5B1AC 4QE7A 2DQ3A 2YSUB 1Q7YW 3MD0A 2BOBC 1VQLV 1YI2V 1S77D 2ITCC 3CCRV 2IJJA 3B8MA 1BL8A 2DYRB 2Q67A 4UXNA 2WLJA 4MSWC 3SPGA 2X6AA 4JTAB 1Q81W 4LBEC 4P30A 4H33A 5EBWC 2KB1A 1K4CC 5L3CA 3W7XA 3CYOA 1E1QG 3CC7V 2EIJB 1GK9A 3K3WA 5CN0A 1VQ9V 3OGCC 3ZCCA 4Z1MG 2EJRA 1H8EG 3FYEB 2WLLB 3ABKC 5IYBO 1K5SA 1KC8W 1S3JA 3JD4A 3ZMVA 2V7QG 4N21A 2QTOA 3ETGA 4QPJA 2HFEC 4JAVA 1RPRA 1W0JG 2DYSB 4G2KA 3UM7A 5CBFA 2EBOA 4P9PA 1VQ5V 4UVAA 1CEZA 3F5WC 2DWDC 1YJNV 1JJ2U 1EBOA 1DTOA 3QO8A 1S5HC 1Q82W 5IY5B 2YEVA 3M99B 1AJPA 1JCHA 3X2QB 1CPYA 3FYIB 3JCZA 2WLHA 3AG2B 2JEXA 1W0KG 4MTFA 1M57B 3QNEA 3CXCU 2WLNA 2EIJC 4RAIA 1FXKA 5E1AC 3CCVV 1JX9A 2P90A 3FKSG 3E86A 2EIKC 2ZDIC 4GX5A 1AI4A 1EFRG 1GM9A 4X88A 5HFLA 2FTKA 1GO3F 4JYCA 1V55B 5L3FA 4CZZA 2XAJA 3E2EA 3ASNB 1DF4A 4R6ZA 5IDJA 3CP1A 1K4DC 2Q69A 4JTDB 2OTJV 2YEVB 3VOUA 2HVJC 5EC2C 1Y66A 3AG1B 4WF9V 4LP8A 4MVQA 5KUMA 2Q68A 3SPHA 3ZIAG 4MT8A 1OZ0A 2DQ0A 4MVRA 1NH2D 2IH1C 2HJFC 3OMIB 1OCOC 4WCEV 3ZJZA 4F4LA 3W7WA 2LP7A 3SJQC 1VQPV 2EIMC 3P30A 2C2AA 2CK3G 1K7DA 2DW4A 4RQEA 1WPXA 2P6JA 3W7TA 2AHZA 2ZD9A 3CCJV 1IXMA 1K92A 4P9OA 1OCZB 5EC1C 2XNDG 1G4YB 1FS0G 5CBHA 1JOYA 3ZMSA 5EK0A 5KUKA 4FMTA 5L3EA 1PD3A 2PI4A 5H6RA 1G8MA 1QBZA 1NVPD 3CCEV 3IC7A 3G4SV 4QPKA 1RM1C 1GM7A 2WLIB 1NBMG 3OUSA 3EFFK 2B1GA 1WLEA 2H8PC 2EZOA 2OCCB 3P32A 1GKFA 2ZR2A 1OCCC 1M56C 5LGTA 3ZMZA 2HVKC 3A0RA 3RBZA 3OFNG 1R6KA 3CMEV 3EHBB 4GX1A 2HR3A 1QCEA 1THZA 1H2GA 2IJIA 1NQTA 1V55C 3OAAG 1R6NA 3AG2C 1OCCB 1NR1A 1BHBA 1R3IC 3OMNB 1I5YA 1YSCA 1S76D 3K06A 4RQFA 3ASOC 1M1KW 3ZN0A 2EIKB 4TWKA 3K03A 2WLIA 1YIJV 3K08A 1TUEB 4GX0A 3ZRSA 2QEXV 4YXWG 3CC4V 3LDDA 4FPPA 5C93A 2DWEC 3WG7C 3IGAC 1PL0A 1XL4A 4BAYA 1R3LC 4EKWA 1NJIW 2HLDG 4PELA 1GM8A 1MABG 4LCUC 3CD6V 1AI5A 1H8HG 4QE9A 3LDEA 1W2BU 3OUFA 3I55V 4KFMA 1S0VA 3KG2A 3LSQA 3E8HA 1K3EA 2Q6AA 2EZPA 1KD1W 4UV9A 3SPIA 3G6EV 2WWWA 3T4DA 4CBCA 1QLNA 1BHAA 4HAMA 1MOFA 2X7RB 2JIZG 2M7WA 3E89A 3RVYA 2X0LA 2JJ1G 1VQ4V 1OCOB 4X89A 2B1IA 5DM6V 2GSMB 4GCZA 4LC1A 4P2ZA 4J9YB 4XDLA 2ZQMA 3ZRWB 3ABTA 3K04A 5B1NA 1COWG 3IFXA 3STZC 4WFAV 3HB3B 4UV8A 5B1AB 2Y69B 4DO2A 2GHYA 3I56V 1F23A 5EBLC 1GMGA 2JDIG 3TK1A 4FK5C 1OCRC 4ASUG 3SYQA 4WFFA 4DXWA 1YJ9V 4ZBMA 5HFMA 2OT5A 2XAQA 4WFHA 2EILB 2P67A 3F7YC 3BY6A 4MW8A 4MTXA 1VQOV 5LHIA 2A9HA 2XASA 5L3DA 3JYCA 3OR6C 4UUJC 1VQNV 2AHYA 1K33A 1ORQC 5LHHA 1KKDA 4XBFA 3JD2A 3ABMB 3ML0A 1ENVA 1Q86W 2B5UA 3CCSV 1AROP 2Y69C 4MTOA 1AI7A 2EINB 3QO5A 2ZXWB 2Z5UA 3ABLB 4PDMA 3FB7C 4FIPC 2X6BA 3SPCA 1QVFU 1ZWIC 2IU0A 1PNMA 1V54C 2A79B 1AR1B 1VQ7V 4U7NA 2IH3C 3FB5C 2XAGA 1KECA 3AEIA 4JF3A 3ZRXA 1NR7A 4U7OA 4OXSA 1JQ0A 4R7CA 3AG1C 3E8GA 4J9ZB 2QKSA 1J95A 3DTUB 3CMAV 1EZJA 3E35A 1K5QA 1M90W 2Y48A 3K0DA 3OW2U 1QLEC 3OM3B 1VQKV 3LUTB 2MK3A 4PA4A 5IYCO 3LNMB 2ZXWC 3ABLC 4MS2A 1F4NA 1QR8A 2EINC 4PA9A 4PDLA 5J9PC 2NLJC 1QVGU 4WFEA 3OMAB 1CP9A 1SZTA 3ZMTA 2QM8A 1NVPB 1M56B 1R3KC 4BIUA 3FB6C 1P7BA 2X6CA 1YJWV 2EIMB 1AI6A 2JEUA 4RUFA 2A0LA 3SYOA 1NKDA 3F7VC 1HWYA 2PI5A 2ATKC 4BW5A 3STLC 2XOKG 3H01A 4G27B 2UXNA 4KP4A 3E83A 1QR9A 5H6QA 3E8FA 2JJ2G 5KA6A 4QIWF 3CCQV 3ZRWA 3HPLC 5DN6G 2IJKA 2LFRA 3D36A 2R9RB 2Z3YA 3ZRVA 1Y4MA 3LSSA 2OTLV 4GT1A 2WLMA 3K0GA 2QE7G 4PDVA 4QJFB 3LDCA 5IY5C 4R50A 2WLLA 1OCZC 1MSWD 4UVCA 1OCRB 3UKMA 2HKOA 3ASNC 1N8RW 5CA3A 4MVUA 4JAUA 1RM1B 5LGNA 1M57C 3ETDA 4Q20A 2R9IA 4MTGA 3G71V 3TCUA 1FXHA 1MG1A 3GB7C 4MVSA 3JD3A 1V54B 4HZ3A 4XDKA 1FXVA 1M9NA 3SYCA 1YTFD 3OR7C 5B1OA 5L3GA 3B8NA 5B1BC 1SETA 3ABKB 3MHHC 2XAHA 1VQ8V 1KQSU 4QNHB 2NNUA 3RW0A 4JYBA 3CCLV 1RPOA 1OHHG 2V1DA 5GW7A 3AG4C 3T1CA 4MVZA 1QLEB 4G28B 4UVBA 2P7TC 5CBGA 4WFBV 3ETEA 3BEHA 1B6QA 4H37A 1S72V 1E1RG 3DGEA 4KUMA 3VBBA 3PJSK 3ASOB 2BOCC 4PA3A 1PNKA 3JD0A 3OEEG 3FB8C 1AJQA 1YHQV 4X8AA 3WG7B 3T4ZA 1NH2B 4R8CA 5B3SC 2WPDG 2ZR3A 1JVMA 4PA7A 2QM7A 4PDRA 1BMFG 1GTOA 4MW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E8G A;  4J9Z B;  4MVO A;  3TET A;  2QKS A;  2QTO A;  2HFE C;  2ITD C;  1V55 C;  1J95 A;  4HYO A;  3X2Q C;  3UM7 A;  5CBF A;  3AG2 C;  4P9P A;  1R3I C;  2JK5 C;  3K0D A;  2WLK A;  3F5W C;  1QLE C;  3K06 A;  2DWD C;  3ASO C;  3LUT B;  4PA4 A;  4TWK A;  3LNM B;  2ZXW C;  1S5H C;  3ABL C;  2WLI A;  3K03 A;  4MS2 A;  2EIN C;  3K08 A;  4PA9 A;  4PDL A;  2YEV A;  4GX0 A;  2K1E A;  3ZRS A;  1LNQ A;  2DYS C;  2W0F C;  3LDD A;  2EIL C;  5J9P C;  2DWE C;  2NLJ C;  2WLH A;  3IGA C;  4PA6 A;  3WG7 C;  1XL4 A;  1R3L C;  4MTF A;  4WFE A;  4EKW A;  2WLN A;  2EIJ C;  2OCC C;  4RAI A;  4LCU C;  5E1A C;  3R65 A;  4JTC B;  4QE9 A;  3E86 A;  3LDE A;  1R3K C;  2EIK C;  3OUF A;  3FB6 C;  4RO2 A;  1P7B A;  2X6C A;  4MVM A;  4GX5 A;  4KFM A;  4RUF A;  2A0L A;  3KG2 A;  3F7V C;  3SPJ A;  3SYP A;  3SYO A;  3E8H A;  4X88 A;  3RVZ A;  2Q6A A;  2ATK C;  4BW5 A;  3STL C;  4G27 B;  5BZB A;  3SPI A;  3T4D A;  4CBC A;  3E83 A;  3E8F A;  3HPL C;  4R6Z A;  2R9R B;  3E89 A;  1K4D C;  3RVY A;  2Q69 A;  2WLM A;  3K0G A;  4JTD B;  4X89 A;  4PDV A;  3LDC A;  4P2Z A;  3T2M A;  2HVJ C;  4GX2 A;  4J9Y B;  2DYR C;  5EBM C;  3ABM C;  5EC2 C;  4XDL A;  3VOU A;  4R50 A;  2WLL A;  5IY5 C;  3K04 A;  1OCZ C;  2HG5 C;  4LP8 A;  3IFX A;  3UKM A;  3ASN C;  4MVQ A;  2Q68 A;  5KUM A;  3SPH A;  4MVU A;  3STZ C;  3SYA A;  4I9W A;  4WFG A;  1M57 C;  1R3J C;  4MVR A;  2IH1 C;  2HJF C;  1OCO C;  1XL6 A;  4MTG A;  3ZJZ A;  4F4L A;  3TCU A;  4MVS A;  4XDK A;  3GB7 C;  3SJQ C;  5EBL C;  4HZ3 A;  2EIM C;  4RUE A;  3SYC A;  1OCR C;  3OR7 C;  3SYQ A;  4WFF A;  5B1B C;  4DXW A;  4ZBM A;  4XDJ A;  3AG3 C;  3E8B A;  4QNH B;  5B1A C;  4QE7 A;  3RW0 A;  4WFH A;  3F7Y C;  2BOB C;  2AHZ A;  2ZD9 A;  4MW8 A;  2A9H A;  3JYC A;  3AG4 C;  3OR6 C;  4UUJ C;  4P9O A;  2AHY A;  5EC1 C;  2ITC C;  1G4Y B;  5CBH A;  3T1C A;  1BL8 A;  1ORQ C;  4MVZ A;  2Q67 A;  1KKD A;  2WLJ A;  5EK0 A;  5KUK A;  4G28 B;  5CBG A;  2P7T C;  4MSW C;  3SPG A;  2Y69 C;  2X6A A;  3BEH A;  4JTA B;  4H37 A;  4MTO A;  4LBE C;  4P30 A;  4PDM A;  4H33 A;  5EBW C;  3PJS K;  2KB1 A;  2WLI B;  3FB7 C;  2X6B A;  3SPC A;  3OUS A;  2BOC C;  4PA3 A;  1K4C C;  3EFF K;  1ZWI C;  1V54 C;  2A79 B;  2H8P C;  2IH3 C;  3FB5 C;  3OGC C;  3FB8 C;  4X8A A;  1OCC C;  3T4Z A;  4R8C A;  2WLL B;  5B3S C;  1M56 C;  4OXS A;  1JVM A;  4PA7 A;  2HVK C;  3ABK C;  4PDR A;  4R7C A;  3RBZ A;  3AG1 C;  4MW3 A;  4GX1 A; 
#chains in the Genus database with same CATH topology
 2JRI A;  1FXK C;  1W59 A;  1K9M W;  2RCV A;  1D5A A;  1YIT V;  1XI1 A;  2ZDI A;  4HYO A;  3X2Q C;  5CMU A;  1F51 A;  4LFC B;  3N2G A;  2W6J G;  1SZX A;  4U3F H;  4JYA B;  4YJ3 A;  3QO7 A;  2K1E A;  4JGS A;  1L1F A;  4J80 A;  1K8A W;  4TV9 B;  3OEH G;  4DV1 B;  2HP8 A;  2LFS A;  4LFB O;  4JTC B;  1VIB A;  1AP5 A;  4MVM A;  2IJH A;  4O4J A;  4NTY A;  4JI5 B;  2N74 A;  1IBM B;  3K9A A;  3OD4 A;  1FFT B;  4FFB B;  4DR1 O;  2W6I G;  1AR4 A;  1FFX B;  4GX2 A;  4BIZ A;  2BTQ B;  5EBM C;  5LBQ A;  1UFI A;  1K73 W;  2H94 A;  3K5L A;  1K34 A;  3JAK A;  1TGO A;  1DGS A;  5BR8 O;  3H1J H;  3CC2 V;  1ROP A;  4DR4 B;  1FPO A;  4JI8 O;  2UXX A;  1N33 O;  5J2U B;  1AB3 A;  4L87 A;  4CC6 A;  3J80 N;  3KKY A;  1XRE A;  3MD0 A;  2OWO A;  4ABM A;  4I7Z B;  5GON A;  2QJ1 A;  2ITC C;  4F6E A;  4WBN B;  2DYR B;  4O2A B;  2WLJ A;  4H0L B;  2OYQ A;  2E74 B;  2GDS A;  1PPJ H;  4JTA B;  3L71 H;  1XBL A;  2BSK A;  3CRQ A;  3W7X A;  3CC7 V;  5H5N A;  4FM0 A;  2QGN A;  1ZX3 A;  3JSL A;  3ABK C;  1KC8 W;  1K5S A;  1Q43 A;  3ZMV A;  1SQF A;  1IVS A;  4JI3 O;  2QTO A;  1IDS A;  4JAV A;  1RPR A;  2DYS B;  1N32 O;  1CXZ B;  4P9P A;  1VQ5 V;  2CH7 A;  4UVA A;  1YJN V;  1EBO A;  1KMI Z;  3VQX A;  1Q82 W;  4B3T B;  1AVM A;  5FNV A;  3AG2 B;  3K5O A;  2JEX A;  1XMQ B;  2WLN A;  5LXT A;  1RSO A;  5E1A C;  3THO A;  1GN2 A;  4DR7 B;  2P90 A;  4D7T A;  2PUS A;  3APQ A;  1AIL A;  2OIG A;  1AI4 A;  4X88 A;  5HFL A;  3ZBH A;  5FLX N;  1BQZ A;  3JAT A;  1V55 B;  5L3F A;  4LFA B;  2XAJ A;  5IYZ B;  1HDJ A;  2OTJ V;  2YEV B;  4PI0 A;  3QVN A;  2HVJ C;  4TV8 A;  2QWR B;  2HJF C;  1I0H A;  3ZJZ A;  2OCH A;  4DR4 O;  5KHG A;  4LF9 O;  1VQP V;  2C2A A;  1K7D A;  2DW4 A;  3OTF A;  1WNS A;  5BXZ A;  4AI8 A;  3RGB A;  3M8A A;  1K92 A;  2RNB A;  4TUY B;  1N0J A;  1G4Y B;  1H2S B;  2Q7G A;  2VQE O;  1SA0 B;  5L3E A;  1PD3 A;  1WA8 A;  1G8M A;  4DV2 B;  3CCE V;  3IC7 A;  4IL6 Z;  4WBN A;  1RM1 C;  1SQX H;  1D5N A;  3EFF K;  2EZO A;  2OCC B;  3P32 A;  3JAW B;  5D5P A;  1GKF A;  2L35 A;  4X9Q A;  4DUZ O;  1SKV A;  4K0K O;  3FAV B;  3A0R A;  3RBZ A;  3OFN G;  4NTX A;  1I08 A;  2F4V B;  1H2G A;  4TV8 B;  3ZHU A;  4QGP A;  1V55 C;  1PP9 H;  4OGQ B;  2LW1 A;  2UXB O;  1R3I C;  1VF5 B;  1I5Y A;  1Q6H A;  1YSC A;  1NTM H;  2O57 A;  1M1K W;  3ZN0 A;  2UUC B;  1WN7 A;  1J5E O;  1TUE B;  2Y4T A;  3HKB B;  4GX0 A;  3E22 A;  3LDD A;  3IGA C;  4L8J A;  1R3L C;  4JV5 B;  1Q90 D;  1H8H G;  4TUY A;  4JI7 O;  4F6R A;  4GKK B;  2QSA A;  2Q6A A;  1URF A;  3SPI A;  2WWW A;  1I94 B;  1BHA A;  1RFY A;  2BSK B;  1MOF A;  1MSD A;  1OCO B;  1QHT A;  1WP8 A;  3K04 A;  2AZ2 A;  4JI6 B;  3HB3 B;  4U3J A;  4DUY B;  2VS0 A;  4UB8 Z;  4DO2 A;  1HNZ O;  1FYJ A;  1S5L Z;  3H9V A;  5EBL C;  1GMG A;  2JDI G;  5EIB D;  4X1I B;  1KYO F;  5LMN B;  4ASU G;  4EFB A;  1YJ9 V;  1ZL8 A;  3L74 H;  4ZBM A;  4IHJ B;  2YI8 A;  1NS1 A;  1VQO V;  1HNW B;  3EVK A;  4MTX A;  3HKC B;  3OR6 C;  1K33 A;  3JD2 A;  3ML0 A;  1M4U A;  1GN4 A;  4MTO A;  3JAK B;  4LF5 B;  3ABL B;  2Z5U A;  4O4H B;  2X6B A;  3MDS A;  1ZWI C;  1VQ7 V;  4U7N A;  1Q3E A;  3FB5 C;  2XAG A;  3O9O A;  4ICG A;  3ZRX A;  4BW9 A;  4R7C A;  2QKA A;  3A8T A;  3AG1 C;  5J2T A;  4X65 O;  5A2Q N;  3HR0 A;  5LMN O;  3G67 A;  1MMM A;  4X1Y A;  4EEQ A;  1AP6 A;  4DR5 B;  2GTA A;  3K0D A;  3RYC A;  5LP6 C;  3OW2 U;  3OM3 B;  4LR3 A;  1XNR O;  3LNM B;  2EIN C;  4PA9 A;  4PDL A;  3C3T A;  5J9P C;  4DV6 O;  2PF4 E;  3GWK C;  3N2G B;  3KCX A;  2KQX A;  4O2A A;  4LFC O;  1N0N A;  1P7B A;  3NR7 A;  2E75 B;  1NKD A;  1HWY A;  4Z1V A;  2ATK C;  2XOK G;  3H01 A;  2YXL A;  3U11 A;  4JI7 B;  5BMV A;  3ZRW A;  3HPL C;  2Z3Y A;  3ZRV A;  2JS3 A;  3LSS A;  2OTL V;  3K0G A;  5CA0 B;  4QJF B;  3LDC A;  2E5L O;  5IY5 C;  4R50 A;  2WLL A;  5BY1 A;  1MSW D;  3UCS C;  4B3S B;  2Q4P A;  1GN6 A;  1IBL B;  1EN5 A;  1RM1 B;  4W4L A;  1M57 C;  1FXH A;  1V54 B;  4DV0 B;  4ZI7 A;  1M9N A;  1YTF D;  4O4L A;  3B8N A;  4JI2 B;  2XUM A;  4YJ2 B;  1YF2 A;  1M93 A;  1OHH G;  2V1D A;  2FYU H;  4MVZ A;  2VRZ A;  1MNG A;  2BCC H;  2VWK A;  4UVB A;  2PYJ A;  2P7T C;  3ETE A;  4I0X B;  3BVO A;  5JQG B;  4J10 A;  2Q8V A;  4K0K B;  1LUV A;  2BOC C;  1TVK B;  1O9G A;  3OEE G;  5JH7 A;  4DR6 B;  4X8A A;  3H1I H;  5JVD A;  3WG7 B;  3T4Z A;  1G6U A;  2WPD G;  1JVM A;  1IZ3 A;  4Q6G A;  1IX9 A;  1DLB A;  4DYL A;  1N34 O;  4MVO A;  3TET A;  2ITD C;  2R9A A;  2IU3 A;  2P06 A;  3Q4H B;  3CHX A;  2CGN A;  2WLK A;  4X1K B;  2B9Z A;  3ZMU A;  2F1M A;  2RMK B;  3N2K A;  4FLY A;  5LA6 A;  3NXS A;  4ZKI A;  2CH7 B;  3CCM V;  1LNQ A;  2W0F C;  5KA5 A;  4PA6 A;  5B3S B;  3RN4 A;  1N36 O;  4LF9 B;  1K97 A;  2QWN B;  5KMG B;  4H13 B;  5JJJ B;  4I55 A;  4DR6 O;  1Q8I A;  2LGQ A;  5FPR A;  1X4T A;  1VQM V;  4D7S A;  2VQF O;  3OE7 G;  4I0X A;  5BZB A;  4E2L A;  1WAZ A;  4DR7 O;  4JAS A;  2F95 B;  1OV9 A;  3K58 A;  5LGU A;  3J81 N;  1NI8 A;  3AG4 B;  3T2M A;  5IJ9 B;  2RQ6 A;  2IW5 A;  4JI4 B;  3AG3 B;  5IYD O;  3ABU A;  2Q5Z A;  1XL6 A;  2N05 A;  3W7U A;  3BCC H;  3RYH A;  2GUZ A;  2WAM A;  2DN9 A;  3BHP A;  2F43 G;  4XDJ A;  3AG3 C;  2GUZ B;  1VP7 A;  3EXA A;  1Q7Y W;  4CH5 A;  3SJA C;  5ITZ B;  4DR3 B;  5LXT B;  1BL8 A;  2UXC B;  3BPZ A;  3SJC C;  4Z2W A;  1Q81 W;  3O65 A;  1LUW A;  4I9Q A;  1SF9 A;  1NU1 H;  5L3C A;  3OGC C;  3B40 A;  4ZHQ A;  2EJR A;  1RSO B;  4FM1 A;  2WLL B;  1QU7 A;  3ZHT A;  3ZS8 C;  1S3J A;  2UU9 B;  5KLV H;  1QNM A;  2V7Q G;  3H1K H;  4N21 A;  4QPJ A;  4LF4 B;  2VQF B;  2W0X A;  2EBO A;  3JCU Z;  4DR2 O;  3VQV A;  1HR0 O;  1JJ2 U;  3IAY A;  1DTO A;  4LF7 O;  3QO8 A;  5A9G A;  1YZB A;  1AJP A;  2P4V A;  3WU2 Z;  1W0K G;  1M57 B;  1NT2 B;  2EIJ C;  5KAF Z;  3A0B Z;  4RAI A;  5B5E Z;  5LA6 B;  1FXK A;  3CCV V;  3HKB A;  1P49 A;  2EIK C;  2JGU A;  2CDY A;  3ZED A;  5JJN B;  1GO3 F;  4JYC A;  1Y74 A;  3E2E A;  3ASN B;  1DF4 A;  4R6Z A;  4O4J B;  1K4D C;  4GZR B;  4JTD B;  5JH7 B;  5EC2 C;  3BAA A;  2ZT9 B;  2JS5 A;  1YEW A;  4WF9 V;  2IBZ H;  1WP7 A;  4MVQ A;  4MT8 A;  1OZ0 A;  4MVR A;  3OMI B;  4X1K A;  5LOV B;  2PTM A;  2EIM C;  4YIO A;  1IXM A;  5EC1 C;  2XND G;  1LR1 A;  4I50 A;  4DV4 O;  5CA1 A;  5KMG A;  5EK0 A;  2AW9 A;  2PI4 A;  4TQD A;  1NVP D;  4ZHQ B;  1GM7 A;  3OUS A;  4B3S O;  2B1G A;  3JAL A;  1WLE A;  4JI2 O;  1VF6 A;  2XHB A;  2EX3 A;  5GTH Z;  2ZNJ A;  5LGT A;  1TVK A;  4DV5 O;  3CME V;  1IXB A;  1FJG O;  3EHB B;  1FJG B;  1THZ A;  1YVW A;  2IJI A;  1NQT A;  3DSQ A;  1R6N A;  1TAE A;  3AG2 C;  1OCC B;  1NR1 A;  2UXD B;  3AK1 A;  3OMN B;  3H1L H;  3L72 H;  1XNQ O;  1S76 D;  3K06 A;  3ASO C;  3K03 A;  2WLI A;  5AG2 A;  5KAI Z;  2QEX V;  2LO1 A;  2DWE C;  1PL0 A;  2VWJ A;  3CJH B;  4BIO A;  1GM8 A;  4FLW A;  1N4C A;  1Y67 A;  1AI5 A;  4QE9 A;  3LDE A;  5EZY A;  2GTS A;  1GH6 A;  4X64 O;  1KD1 W;  1FKA O;  2DOS A;  4B3R B;  4HAM A;  4OPA A;  4NTW A;  2PGG A;  3RVY A;  2X0L A;  1VQ4 V;  2PZS A;  4LC1 A;  1U97 A;  4J9Y B;  1VF7 A;  4XDL A;  2ZQM A;  3ZRW B;  3ABT A;  5B1N A;  3RYI B;  1COW G;  4ZI7 B;  1XMO B;  1DK1 A;  4X62 B;  2Y69 B;  4X65 B;  3I56 V;  4NXN B;  4FK5 C;  4H44 B;  3LNN A;  4FLT A;  4WFH A;  1MZF A;  2P67 A;  4UCR A;  3F7Y C;  3BY6 A;  4MW8 A;  2XAS A;  5L3D A;  4LF5 O;  3BAB A;  4UUJ C;  2AHY A;  1SQP H;  3IC9 A;  1ORQ C;  2H3O A;  1KKD A;  1MZE A;  2FB5 A;  1Q86 W;  2B5U A;  4DUY O;  2ZM6 O;  4DW0 A;  2Q7E A;  2ZXW B;  2F66 C;  2ARH A;  4FIP C;  3SPC A;  3SJB C;  3TXQ A;  2IU0 A;  1PNM A;  5IWA O;  2IH3 C;  1KEC A;  3AEI A;  4JF3 A;  1NR7 A;  4OXS A;  1PV0 A;  1XMQ O;  1BQ0 A;  3DTU B;  3CMA V;  1BGY H;  1M90 W;  4GKK O;  2JGD A;  4X66 O;  5B66 Z;  3CEI A;  1WA8 B;  4PV1 B;  2MK3 A;  1Z5W A;  1QR8 A;  5CA0 A;  2NLJ C;  2F23 A;  1QVG U;  3OMA B;  3N2K B;  1SZT A;  5JJE B;  4I4T B;  1NVP B;  4BIU A;  2X6C A;  1YJW V;  4JI4 O;  2YXH A;  4G27 B;  1QR9 A;  2IM9 A;  5H6Q A;  1TUB A;  5DN6 G;  2IJK A;  2LFR A;  3QTC A;  4DUZ B;  4GT1 A;  2QE7 G;  4B7K A;  4YY3 B;  4FFK A;  1NTZ H;  1EZV H;  3VQY A;  3TXS A;  1Q5O A;  1HNX O;  5LGN A;  4RWU A;  3KCY A;  3AG7 A;  4MTG A;  4YJ2 A;  2ILM A;  3TCU A;  1MG1 A;  3JD3 A;  4JI8 B;  3P3P A;  1FXV A;  5KHJ A;  3OR7 C;  5B1O A;  1UPG A;  5B1B C;  1SET A;  3MHH C;  5BR8 B;  1VQ8 V;  1KQS U;  4QNH B;  5GW7 A;  4O4L B;  3AG4 C;  4CH4 A;  4ZIB A;  3T1C A;  1PL4 A;  4JYY A;  4HBN A;  1QLE B;  4G28 B;  3RYC B;  4IT5 A;  1B6Q A;  1S72 V;  4KUM A;  2KSD A;  3CSX A;  1IBM O;  1SA0 A;  2V4D A;  3JD0 A;  1O9H A;  3JSN A;  4YHH O;  4EFE A;  4FZ0 A;  1ZL8 B;  2M6Y A;  4R8C A;  3SGI A;  5B3S C;  3RYI A;  1BCC H;  2YIB D;  2QM7 A;  2WA3 A;  1D2D A;  2OIE A;  4UCU A;  4AQY B;  4K8Z A;  1DF5 A;  3SR2 C;  2D3O W;  3FAV A;  1PNL A;  2WSS G;  5LMU O;  3L75 H;  2F93 B;  1G1X B;  3K79 A;  3MHS C;  1H2L A;  5LHG A;  1R73 A;  2DYS C;  4PI2 A;  3JAW A;  4B7E A;  2HHH O;  5FL7 G;  3R65 A;  3ZN1 A;  4B3M O;  2RN9 A;  4RO2 A;  1H38 A;  2P4K A;  3SYP A;  3CPW U;  5LP6 A;  3JD1 A;  1I5X A;  5B1B B;  3UT5 A;  4J7Z A;  3PN1 A;  3UQ8 A;  5K1X A;  2LQT A;  2QTS A;  4B3T O;  2UXC O;  1JA8 A;  2Y4U A;  2DYR C;  1E79 G;  4FVM A;  3OTO O;  5EYP A;  3QF7 A;  3FFQ A;  5JWP A;  2HG5 C;  1SES A;  2Q0O C;  2WA4 A;  3SYA A;  4I9W A;  4WFG A;  1F4M A;  5H9C A;  1SER A;  1Q6U A;  4TT3 G;  5H2F Z;  4CS3 A;  4GUN A;  3A2F A;  4RUE A;  1XHX A;  2QA4 V;  1WB8 A;  5IWA B;  4NB5 A;  3E8B A;  4QE7 A;  2DQ3 A;  1VQL V;  2BOB C;  1VF6 C;  1YI2 V;  4O4I B;  1S77 D;  2ZM6 B;  2QM4 A;  2L6L A;  3CCR V;  2PY5 A;  3SDL A;  3R66 A;  4MSW C;  3SPG A;  4U3J B;  4LBE C;  4H33 A;  5EBW C;  4UCT A;  4IIJ B;  1K4C C;  1VMG A;  1XNR B;  1E1Q G;  2EIJ B;  3ZCC A;  4Z1M G;  4GYC B;  1BS3 A;  4LF8 B;  3FYE B;  2Q7H A;  5E79 Z;  2YDE A;  5LYJ B;  3HKC A;  3ETG A;  1XMO O;  1RP3 B;  1W0J G;  3UM7 A;  4LF8 O;  1Y74 B;  2CUG A;  3F5W C;  2KG7 A;  4FLV A;  4NXM O;  2DWD C;  4NXM B;  2ZIN A;  1H2M A;  4NXN O;  1R6T A;  4O4H A;  4KL1 A;  5IY5 B;  2YEV A;  3K57 A;  4DR1 B;  1JCH A;  1N34 B;  3X2Q B;  4X62 O;  3FYI B;  1SQV H;  1L0L H;  4D6T H;  4NYK A;  1JX9 A;  2ETN A;  3FKS G;  3TJT A;  2EJ7 A;  4B08 A;  4FFB A;  4GX5 A;  4JI0 O;  1EFR G;  1GM9 A;  4X64 B;  2FTK A;  3MAQ A;  2UUB O;  4CZZ A;  3RFR A;  3K9S A;  3K59 A;  1I7F A;  2Q69 A;  3VOU A;  5DEC A;  1Y66 A;  3ETQ A;  5KUM A;  2Q68 A;  1JFF A;  3ZHS A;  3CRA A;  2IH1 C;  1T5E A;  3SJQ C;  3N27 A;  3P30 A;  3QG5 A;  4LF6 O;  4RQE A;  1IBK O;  5F2V O;  3JAR B;  2AHZ A;  2FML A;  2Q0A A;  1FS0 G;  3ZMS A;  1PM9 A;  1XUQ A;  4IHJ A;  4FMT A;  4FZ1 A;  4JV5 O;  2GBO A;  3UO2 A;  4F6R B;  1QBZ A;  1AR5 A;  2YIB A;  3G4S V;  1YCI A;  3L9D A;  2UUC O;  2JVD A;  2H8P C;  2D2C B;  4TV9 A;  2ZR2 A;  4KXR A;  1OCC C;  2UXB B;  3ZMZ A;  5EIB C;  1R6K A;  3UO3 A;  2F4V O;  1H2N A;  4GX1 A;  1QCE A;  3H1H H;  5JVD B;  2BTO A;  2VQE B;  3OAA G;  1BHB A;  3ZHR A;  4TWK A;  1YIJ V;  3K08 A;  2CGO A;  1FFX A;  3ZRS A;  3D36 C;  3CC4 V;  4J42 A;  4I55 B;  2ZIM A;  3WG7 C;  4EKW A;  1NJI W;  3ZHQ A;  3FX7 A;  4PEL A;  4LCU C;  4YHH B;  4KFM A;  2YIA A;  3KG2 A;  3E8H A;  1HW7 A;  2EZP A;  5D5Q A;  3CS5 A;  1QLN A;  5JCO A;  2X7R B;  2JIZ G;  2M7W A;  4LNU B;  2YID A;  2GSM B;  4GCZ A;  1HR0 B;  4LFA O;  2E3C A;  1TUB B;  2CE4 A;  3KZI Z;  1ZLZ A;  3STZ C;  4LF4 O;  5LYJ A;  3HKD B;  4UV8 A;  5B1A B;  4BWA A;  4DR2 B;  2QWP B;  2GHY A;  1HNZ B;  3TK1 A;  1B06 A;  4LF7 B;  4C7U A;  3JAT B;  4LWS B;  4WFF A;  4DXW A;  4JI6 O;  5HFM A;  3L73 H;  2OT5 A;  2XAQ A;  4CS4 A;  2EIL B;  3RT3 C;  5LHI A;  3DC6 A;  1VQN V;  1B04 A;  5EYP B;  5LHH A;  4K3A A;  4XBF A;  2XT9 A;  3ABM B;  4JI1 O;  3CCS V;  5GON B;  1BT8 A;  4PDM A;  4GKJ O;  5CA1 B;  3U0Z A;  5TIS Z;  2LW7 A;  1QVF U;  1XOU A;  1V54 C;  2A79 B;  4AHC A;  1KBH A;  1P7G A;  4B3M B;  1N32 B;  1JQ0 A;  4DR3 O;  5KHK A;  3E8G A;  2QKS A;  4GLX A;  1J95 A;  1EZJ A;  1K5Q A;  3WB2 A;  4OX9 B;  2Y48 A;  1VQK V;  3LUT B;  1XEQ A;  5IYC O;  1L0N H;  2ZXW C;  4MS2 A;  2ADQ B;  3Q4H A;  1F4N A;  5IJ9 A;  3DXR A;  4WFE A;  1CP9 A;  3D8C A;  2YUA A;  4DRX A;  1MA1 A;  1M56 B;  2K9P A;  5C8Y A;  2BE3 A;  3FB6 C;  5KHH A;  3CE2 A;  4DK0 A;  1AI6 A;  3SYO A;  3APO A;  3F7V C;  2E76 B;  4CH3 A;  3K5N A;  1N36 B;  4KP4 A;  3RWR D;  2N04 A;  3E8F A;  3CCQ V;  4O2B A;  5LP6 B;  1Y4M A;  3HKD A;  2ZE8 A;  2FL4 A;  4PDV A;  1OCZ C;  1A32 A;  2AZ0 A;  1H2K A;  1N8R W;  4MVU A;  4DV7 B;  1YDX A;  3ETD A;  2PYL A;  2CTP A;  3G71 V;  2HJD A;  4MVS A;  4DV1 O;  4HZ3 A;  1BE3 H;  3SYC A;  4CS2 A;  1EN4 A;  3ABK B;  1HNX B;  2XAH A;  1SQQ H;  1TA8 A;  2NNU A;  3CCL V;  4AIL C;  4W4K A;  4YY3 O;  3T1H B;  4JZG A;  4H37 A;  3VBB A;  3ASO B;  2DMX A;  5IE9 A;  3HKE A;  2ZE7 A;  1YHQ V;  1AJQ A;  2QWQ B;  1EN6 A;  2A06 H;  1KU9 A;  2Q9L A;  2ZR3 A;  4UCV A;  1BMF G;  1KUQ A;  3BFR A;  1GTO A;  4MW3 A;  3FD9 A;  4LF6 B;  1U96 A;  3D3I A;  1Q6I A;  3B77 A;  1WPB A;  1AJN A;  1VQ6 V;  1KP2 A;  2G38 A;  1SS3 A;  2JK5 C;  4FJC C;  4KHP B;  1UJW B;  2XAF A;  1P4R A;  1FXK B;  3VQW A;  4J7J A;  3GWO A;  4I5S A;  2E5L B;  2EIL C;  5GTI Z;  1Y76 B;  2OCC C;  3WFV A;  2R70 A;  3AK3 A;  1PKX A;  1IBL O;  4TOI A;  3CCU V;  4A5U B;  3SPJ A;  3RVZ A;  2QDO A;  1SQB H;  4NKG B;  3W7S A;  1JR9 A;  3C3S A;  2DJV A;  2RJZ A;  4N23 A;  1KP3 A;  1JPX A;  4TSF G;  1YTF B;  4JPR A;  3T1H O;  3ABM C;  5IJ0 B;  1FD9 A;  1ZTE A;  4FM2 A;  4ZOL A;  1R3J C;  4LH6 A;  4DR5 O;  3TGU H;  1F7Y A;  3JAL B;  2KG7 B;  1SRY A;  1JFF B;  4CC5 A;  2QR4 A;  5L3B A;  5B1A C;  5J2T B;  2YSU B;  5LL6 Y;  3OT7 A;  1M5I A;  2IJJ A;  3B8M A;  2Q67 A;  2A3Q A;  4UXN A;  5JQG A;  2YXY A;  4UFZ A;  3I5D A;  4OPH A;  2AXT Z;  2X6A A;  3F5T A;  4EB6 A;  4P30 A;  2KB1 A;  3CYO A;  1GK9 A;  3K3W A;  5CN0 A;  2AGA A;  2R72 A;  1VQ9 V;  4JAA A;  2XTA A;  1H8E G;  3CWB H;  1YXB A;  2ODM A;  1US6 A;  1NZ6 A;  1XDC A;  5IYB O;  5EZY B;  3JD4 A;  3RYF A;  2RDC A;  3HKE B;  5KX5 B;  3U10 A;  4JYA O;  2HFE C;  4G2K A;  5CBF A;  3CXH F;  3A0H Z;  1OJH A;  4YJ3 B;  4UCO A;  1CEZ A;  1XNQ B;  1EM1 A;  1KKC A;  4J7K A;  2QKC A;  1S5H C;  1VAR A;  1XQ8 A;  3M99 B;  1JJO A;  1QQC A;  5KHI A;  1CPY A;  3JCZ A;  4CH6 A;  2WLH A;  4IYI A;  2ZCE A;  4MTF A;  3CXC U;  3QNE A;  3JAR A;  2NR5 A;  2LJ2 A;  4X20 B;  3E86 A;  3ZHV A;  2ZDI C;  5FNV B;  1I94 O;  2ZNI A;  2YC0 A;  1FAF A;  1R1B A;  1SC5 B;  3OTO B;  1ZUQ A;  3GVM A;  4DRX B;  4PHZ A;  4DV5 B;  1WJZ A;  5IDJ A;  4DV3 B;  2QWO B;  4JI1 B;  3CP1 A;  1J5E B;  1HP8 A;  2LGW A;  3AG1 B;  4LP8 A;  3SPH A;  3P3N A;  1S5J A;  3ZIA G;  5J2U A;  3T1Y B;  1Z2G A;  2DQ0 A;  1NH2 D;  5IJ0 A;  5LMU B;  3B2E E;  1OCO C;  1Z5V A;  4WCE V;  4F4L A;  3W7W A;  2HHH B;  2YIC A;  2LP7 A;  4FLX A;  4DV4 B;  2CK3 G;  4AQY O;  4HNA A;  1WPX A;  2P6J A;  4NVP A;  4IGG A;  4PD4 F;  3W7T A;  1X59 A;  1XIL A;  2ZD9 A;  3L70 H;  3CCJ V;  4HNA B;  4P9O A;  1OCZ B;  1JOY A;  5CBH A;  1SQG A;  5KUK A;  3B4S A;  5H6R A;  3BA9 A;  3UT5 B;  4YIP A;  2UUA B;  2DE0 X;  4QPK A;  2WLI B;  1NBM G;  3RYF B;  3J7A U;  4DV2 O;  5CB4 A;  3OGI B;  4DK1 A;  1M56 C;  4I4T A;  2HVK C;  2CAZ C;  3G80 A;  3WB0 A;  3JAM N;  2BTQ A;  2HR3 A;  5DED A;  4DV7 O;  2KKW A;  4J11 A;  3C90 A;  4JZ2 A;  2Q73 A;  1ZAU A;  4RQF A;  2EIK B;  4E4E A;  4YXW G;  4FPP A;  5C93 A;  2CTR A;  1XL4 A;  2ZE5 A;  4BAY A;  2HLD G;  1MAB G;  2MW2 B;  1XHZ A;  3CD6 V;  1W2B U;  3OUF A;  5BMV B;  3ZX6 A;  3I55 V;  1S0V A;  3RYH B;  1Y76 A;  3WB1 A;  4OX9 O;  3LSQ A;  1BZK A;  1K3E A;  3ICX A;  4UV9 A;  4IIJ A;  3G6E V;  3T4D A;  4CBC A;  2Y0I A;  5C8Y B;  2UU9 O;  3E89 A;  4DV3 O;  2JJ1 G;  3S3W A;  2Y0P A;  4X89 A;  2B1I A;  5DM6 V;  4P2Z A;  2ZE6 A;  4LNU A;  3IFX A;  4GKJ B;  5KX5 A;  4WFA V;  1IBK B;  2GV9 A;  2Z0A A;  2ZKO A;  1WB7 A;  3M7M X;  1F23 A;  1P84 F;  4JI3 B;  1OCR C;  3SYQ A;  1B3Q A;  4UB6 Z;  1IUR A;  2A9H A;  3BRC A;  3JYC A;  4LWS A;  4X20 A;  4X66 B;  3CB2 A;  1NTK H;  2CTQ A;  1ENV A;  4DV6 B;  5ITZ A;  1ARO P;  2Y69 C;  1AI7 A;  2EIN B;  3QO5 A;  2UUB B;  3FB7 C;  2YS8 A;  4FLU A;  1AR1 B;  2P5O A;  4JI0 B;  4J41 A;  2CTW A;  1BSM A;  4U7O A;  4PJ0 Z;  4X1Y B;  2HEP A;  4J9Z B;  5CB4 B;  5FPO A;  1KB9 F;  3E35 A;  1V9P A;  3E22 B;  4LH7 A;  1QLE C;  4PA4 A;  3G6B A;  1N33 B;  3ABL C;  2A7W A;  2ADP A;  4FLZ A;  3LSU A;  1GAX A;  4JI5 O;  3ZMT A;  2QM8 A;  1R3K C;  2YI9 A;  2EIM B;  2JEU A;  3DXR B;  4RUF A;  2A0L A;  1HNW O;  2PI5 A;  3D3Q A;  4BW5 A;  3STL C;  2ZIO A;  2UUA O;  2UXN A;  3CRM A;  3E83 A;  5KA6 A;  2JJ2 G;  2JGD B;  4QIW F;  4LFB B;  4B3R O;  2NN4 A;  3D36 A;  2R9R B;  5K1P A;  4O4I A;  4NR1 A;  2WLM A;  3DC5 A;  4I50 B;  2FKX A;  4O2B B;  5IT9 N;  3CJH A;  4UVC A;  1OCR B;  3UKM A;  2HKO A;  3ASN C;  4X1I A;  5CA3 A;  4JAU A;  4Q20 A;  1VEW A;  3BA8 A;  2R9I A;  2UXD O;  4XDK A;  3GB7 C;  5JCO C;  4ZOL B;  3CRR A;  4DW1 A;  4IYH A;  4TQF A;  3T1Y O;  5L3G A;  1Y6X A;  3JAS A;  5LOV A;  3S3X A;  1GRJ A;  3AK2 A;  3RW0 A;  4JYB A;  1RPO A;  3CX5 F;  3JAS B;  3K5M A;  4UCS A;  4DV0 O;  2EUL A;  4BR6 A;  4K8X A;  1JMK C;  3B09 A;  5CBG A;  3CRC A;  4WFB V;  4K35 A;  3BEH A;  1E1R G;  3DGE A;  3PJS K;  3IJ4 A;  1GN3 A;  4PA3 A;  1PNK A;  1L8D A;  4EB6 B;  3FB8 C;  4KHP O;  1ZSP A;  1NH2 B;  5IYZ A;  4PA7 A;  4PDR A;  2P22 C; 
#chains in the Genus database with same CATH homology
 1DLB A;  1FXK C;  1K9M W;  4MVO A;  3D3I A;  3TET A;  3B77 A;  1YIT V;  1DF5 A;  2ITD C;  1AJN A;  2ZDI A;  4HYO A;  3X2Q C;  2IU3 A;  5CMU A;  2D3O W;  1VQ6 V;  1KP2 A;  1PNL A;  2WSS G;  2JK5 C;  4FJC C;  2WLK A;  1UJW B;  1F51 A;  2XAF A;  3ZMU A;  1P4R A;  2W6J G;  1FXK B;  3K79 A;  3NXS A;  4ZKI A;  3MHS C;  5LHG A;  3QO7 A;  1R73 A;  2K1E A;  4JGS A;  3GWO A;  1LNQ A;  1L1F A;  2DYS C;  2W0F C;  4I5S A;  3CCM V;  2EIL C;  5KA5 A;  1K8A W;  4PA6 A;  5B3S B;  3OEH G;  2OCC C;  3WFV A;  1K97 A;  1PKX A;  5FL7 G;  2LFS A;  3R65 A;  3ZN1 A;  4JTC B;  4RO2 A;  1H38 A;  3CCU V;  4MVM A;  2IJH A;  3SYP A;  3SPJ A;  1VQM V;  3CPW U;  3RVZ A;  3JD1 A;  3OE7 G;  1I5X A;  3K9A A;  5B1B B;  5BZB A;  3W7S A;  4E2L A;  1FFT B;  4N23 A;  4JAS A;  2W6I G;  1KP3 A;  1JPX A;  5LGU A;  4TSF G;  3AG4 B;  1YTF B;  4JPR A;  4GX2 A;  3T2M A;  4BIZ A;  2DYR C;  5EBM C;  3ABM C;  1E79 G;  5LBQ A;  2IW5 A;  2HG5 C;  1SES A;  1K73 W;  2H94 A;  3SYA A;  4I9W A;  4WFG A;  1K34 A;  1F4M A;  1R3J C;  3AG3 B;  5IYD O;  3ABU A;  5H9C A;  1SER A;  1XL6 A;  4TT3 G;  3W7U A;  3CC2 V;  1ROP A;  2UXX A;  2WAM A;  4RUE A;  1SRY A;  2QA4 V;  2F43 G;  4L87 A;  4XDJ A;  3AG3 C;  3E8B A;  5L3B A;  5B1A C;  4QE7 A;  2DQ3 A;  2YSU B;  1Q7Y W;  3MD0 A;  2BOB C;  1VQL V;  1YI2 V;  1S77 D;  2ITC C;  3CCR V;  2IJJ A;  3B8M A;  1BL8 A;  2DYR B;  2Q67 A;  4UXN A;  2WLJ A;  4MSW C;  3SPG A;  2X6A A;  4JTA B;  1Q81 W;  4LBE C;  4P30 A;  4H33 A;  5EBW C;  2KB1 A;  1K4C C;  5L3C A;  3W7X A;  3CYO A;  1E1Q G;  3CC7 V;  2EIJ B;  1GK9 A;  3K3W A;  5CN0 A;  1VQ9 V;  3OGC C;  3ZCC A;  4Z1M G;  2EJR A;  1H8E G;  3FYE B;  2WLL B;  3ABK C;  5IYB O;  1K5S A;  1KC8 W;  1S3J A;  3JD4 A;  3ZMV A;  2V7Q G;  4N21 A;  2QTO A;  3ETG A;  4QPJ A;  2HFE C;  4JAV A;  1RPR A;  1W0J G;  2DYS B;  4G2K A;  3UM7 A;  5CBF A;  2EBO A;  4P9P A;  1VQ5 V;  4UVA A;  1CEZ A;  3F5W C;  2DWD C;  1YJN V;  1JJ2 U;  1EBO A;  1DTO A;  3QO8 A;  1S5H C;  1Q82 W;  5IY5 B;  2YEV A;  3M99 B;  1AJP A;  1JCH A;  3X2Q B;  1CPY A;  3FYI B;  3JCZ A;  2WLH A;  3AG2 B;  2JEX A;  1W0K G;  4MTF A;  1M57 B;  3QNE A;  3CXC U;  2WLN A;  2EIJ C;  4RAI A;  1FXK A;  5E1A C;  3CCV V;  1JX9 A;  2P90 A;  3FKS G;  3E86 A;  2EIK C;  2ZDI C;  4GX5 A;  1AI4 A;  1EFR G;  1GM9 A;  4X88 A;  5HFL A;  2FTK A;  1GO3 F;  4JYC A;  1V55 B;  5L3F A;  4CZZ A;  2XAJ A;  3E2E A;  3ASN B;  1DF4 A;  4R6Z A;  5IDJ A;  3CP1 A;  1K4D C;  2Q69 A;  4JTD B;  2OTJ V;  2YEV B;  3VOU A;  2HVJ C;  5EC2 C;  1Y66 A;  3AG1 B;  4WF9 V;  4LP8 A;  4MVQ A;  5KUM A;  2Q68 A;  3SPH A;  3ZIA G;  4MT8 A;  1OZ0 A;  2DQ0 A;  4MVR A;  1NH2 D;  2IH1 C;  2HJF C;  3OMI B;  1OCO C;  4WCE V;  3ZJZ A;  4F4L A;  3W7W A;  2LP7 A;  3SJQ C;  1VQP V;  2EIM C;  3P30 A;  2C2A A;  2CK3 G;  1K7D A;  2DW4 A;  4RQE A;  1WPX A;  2P6J A;  3W7T A;  2AHZ A;  2ZD9 A;  3CCJ V;  1IXM A;  1K92 A;  4P9O A;  1OCZ B;  5EC1 C;  2XND G;  1G4Y B;  1FS0 G;  5CBH A;  1JOY A;  3ZMS A;  5EK0 A;  5KUK A;  4FMT A;  5L3E A;  1PD3 A;  2PI4 A;  5H6R A;  1G8M A;  1QBZ A;  1NVP D;  3CCE V;  3IC7 A;  3G4S V;  4QPK A;  1RM1 C;  1GM7 A;  2WLI B;  1NBM G;  3OUS A;  3EFF K;  2B1G A;  1WLE A;  2H8P C;  2EZO A;  2OCC B;  3P32 A;  1GKF A;  2ZR2 A;  1OCC C;  1M56 C;  5LGT A;  3ZMZ A;  2HVK C;  3A0R A;  3RBZ A;  3OFN G;  1R6K A;  3CME V;  3EHB B;  4GX1 A;  2HR3 A;  1QCE A;  1THZ A;  1H2G A;  2IJI A;  1NQT A;  1V55 C;  3OAA G;  1R6N A;  3AG2 C;  1OCC B;  1NR1 A;  1BHB A;  1R3I C;  3OMN B;  1I5Y A;  1YSC A;  1S76 D;  3K06 A;  4RQF A;  3ASO C;  1M1K W;  3ZN0 A;  2EIK B;  4TWK A;  3K03 A;  2WLI A;  1YIJ V;  3K08 A;  1TUE B;  4GX0 A;  3ZRS A;  2QEX V;  4YXW G;  3CC4 V;  3LDD A;  4FPP A;  5C93 A;  2DWE C;  3WG7 C;  3IGA C;  1PL0 A;  1XL4 A;  4BAY A;  1R3L C;  4EKW A;  1NJI W;  2HLD G;  4PEL A;  1GM8 A;  1MAB G;  4LCU C;  3CD6 V;  1AI5 A;  1H8H G;  4QE9 A;  3LDE A;  1W2B U;  3OUF A;  3I55 V;  4KFM A;  1S0V A;  3KG2 A;  3LSQ A;  3E8H A;  1K3E A;  2Q6A A;  2EZP A;  1KD1 W;  4UV9 A;  3SPI A;  3G6E V;  2WWW A;  3T4D A;  4CBC A;  1QLN A;  1BHA A;  4HAM A;  1MOF A;  2X7R B;  2JIZ G;  2M7W A;  3E89 A;  3RVY A;  2X0L A;  2JJ1 G;  1VQ4 V;  1OCO B;  4X89 A;  2B1I A;  5DM6 V;  2GSM B;  4GCZ A;  4LC1 A;  4P2Z A;  4J9Y B;  4XDL A;  2ZQM A;  3ZRW B;  3ABT A;  3K04 A;  5B1N A;  1COW G;  3IFX A;  3STZ C;  4WFA V;  3HB3 B;  4UV8 A;  5B1A B;  2Y69 B;  4DO2 A;  2GHY A;  3I56 V;  1F23 A;  5EBL C;  1GMG A;  2JDI G;  3TK1 A;  4FK5 C;  1OCR C;  4ASU G;  3SYQ A;  4WFF A;  4DXW A;  1YJ9 V;  4ZBM A;  5HFM A;  2OT5 A;  2XAQ A;  4WFH A;  2EIL B;  2P67 A;  3F7Y C;  3BY6 A;  4MW8 A;  4MTX A;  1VQO V;  5LHI A;  2A9H A;  2XAS A;  5L3D A;  3JYC A;  3OR6 C;  4UUJ C;  1VQN V;  2AHY A;  1K33 A;  1ORQ C;  5LHH A;  1KKD A;  4XBF A;  3JD2 A;  3ABM B;  3ML0 A;  1ENV A;  1Q86 W;  2B5U A;  3CCS V;  1ARO P;  2Y69 C;  4MTO A;  1AI7 A;  2EIN B;  3QO5 A;  2ZXW B;  2Z5U A;  3ABL B;  4PDM A;  3FB7 C;  4FIP C;  2X6B A;  3SPC A;  1QVF U;  1ZWI C;  2IU0 A;  1PNM A;  1V54 C;  2A79 B;  1AR1 B;  1VQ7 V;  4U7N A;  2IH3 C;  3FB5 C;  2XAG A;  1KEC A;  3AEI A;  4JF3 A;  3ZRX A;  1NR7 A;  4U7O A;  4OXS A;  1JQ0 A;  4R7C A;  3AG1 C;  3E8G A;  4J9Z B;  2QKS A;  1J95 A;  3DTU B;  3CMA V;  1EZJ A;  3E35 A;  1K5Q A;  1M90 W;  2Y48 A;  3K0D A;  3OW2 U;  1QLE C;  3OM3 B;  1VQK V;  3LUT B;  2MK3 A;  4PA4 A;  5IYC O;  3LNM B;  2ZXW C;  3ABL C;  4MS2 A;  1F4N A;  1QR8 A;  2EIN C;  4PA9 A;  4PDL A;  5J9P C;  2NLJ C;  1QVG U;  4WFE A;  3OMA B;  1CP9 A;  1SZT A;  3ZMT A;  2QM8 A;  1NVP B;  1M56 B;  1R3K C;  4BIU A;  3FB6 C;  1P7B A;  2X6C A;  1YJW V;  2EIM B;  1AI6 A;  2JEU A;  4RUF A;  2A0L A;  3SYO A;  1NKD A;  3F7V C;  1HWY A;  2PI5 A;  2ATK C;  4BW5 A;  3STL C;  2XOK G;  3H01 A;  4G27 B;  2UXN A;  4KP4 A;  3E83 A;  1QR9 A;  5H6Q A;  3E8F A;  2JJ2 G;  5KA6 A;  4QIW F;  3CCQ V;  3ZRW A;  3HPL C;  5DN6 G;  2IJK A;  2LFR A;  3D36 A;  2R9R B;  2Z3Y A;  3ZRV A;  1Y4M A;  3LSS A;  2OTL V;  4GT1 A;  2WLM A;  3K0G A;  2QE7 G;  4PDV A;  4QJF B;  3LDC A;  5IY5 C;  4R50 A;  2WLL A;  1OCZ C;  1MSW D;  4UVC A;  1OCR B;  3UKM A;  2HKO A;  3ASN C;  1N8R W;  5CA3 A;  4MVU A;  4JAU A;  1RM1 B;  5LGN A;  1M57 C;  3ETD A;  4Q20 A;  2R9I A;  4MTG A;  3G71 V;  3TCU A;  1FXH A;  1MG1 A;  3GB7 C;  4MVS A;  3JD3 A;  1V54 B;  4HZ3 A;  4XDK A;  1FXV A;  1M9N A;  3SYC A;  1YTF D;  3OR7 C;  5B1O A;  5L3G A;  3B8N A;  5B1B C;  1SET A;  3ABK B;  3MHH C;  2XAH A;  1VQ8 V;  1KQS U;  4QNH B;  2NNU A;  3RW0 A;  4JYB A;  3CCL V;  1RPO A;  1OHH G;  2V1D A;  5GW7 A;  3AG4 C;  3T1C A;  4MVZ A;  1QLE B;  4G28 B;  4UVB A;  2P7T C;  5CBG A;  4WFB V;  3ETE A;  3BEH A;  1B6Q A;  4H37 A;  1S72 V;  1E1R G;  3DGE A;  4KUM A;  3VBB A;  3PJS K;  3ASO B;  2BOC C;  4PA3 A;  1PNK A;  3JD0 A;  3OEE G;  3FB8 C;  1AJQ A;  1YHQ V;  4X8A A;  3WG7 B;  3T4Z A;  1NH2 B;  4R8C A;  5B3S C;  2WPD G;  2ZR3 A;  1JVM A;  4PA7 A;  2QM7 A;  4PDR A;  1BMF G;  1GTO A;  4MW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...