5EC2C

Kcsa with v76ester+g77da mutations
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
102
structure length
100
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 39
structure length 100
sequence length 102
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ec2C00
1P7BA 4J9ZB 4ZBMA 2X6BA 2Y69C 4JTCB 4GX1A 4LCUC 4MVQA 2HFEC 3GB7C 4RAIA 1OCOC 2EIMC 1XL6A 4WFFA 3SYOA 2EINC 4MVSA 3SPJA 4MS2A 5B1BC 2WLLA 3AG2C 2P7TC 3FB8C 3SYQA 5CBFA 1QLEC 4MVRA 4R8CA 3RVYA 4MTOA 2NLJC 4R50A 2A79B 3SPIA 3E86A 4WFGA 4P9OA 5IY5C 1K4DC 4G28B 3VOUA 3SYCA 2QKSA 3X2QC 2DYRC 1XL4A 2K1EA 3K08A 2QTOA 3SPGA 4QNHB 5KUKA 3R65A 3K04A 2WLJA 3OGCC 3SYPA 4R6ZA 4LBEC 3OUFA 2W0FC 1R3LC 4TWKA 3SYAA 3T2MA 3TCUA 3RBZA 5EBWC 2IH1C 2DYSC 4P30A 2JK5C 5E1AC 4H33A 4QE9A 4UUJC 2H8PC 3ABMC 3LNMB 1R3KC 2DWEC 3TETA 2WLMA 2Q69A 4P9PA 4WFEA 4MW8A 4RUEA 3RW0A 2ATKC 4QE7A 3IFXA 4PDRA 4G27B 2Q6AA 4PA9A 2WLKA 2EIKC 2EILC 3STLC 5CBHA 4PDLA 2HVKC 4MVOA 3ASNC 3FB6C 2IH3C 2KB1A 5B1AC 3FB7C 1OCRC 2Q67A 2ITCC 3JYCA 5J9PC 3STZC 1BL8A 2WLIA 4RO2A 4HYOA 3E83A 3AG4C 2HG5C 1V55C 3UM7A 3ZRSA 4DXWA 4KFMA 3T4ZA 3F7YC 3K06A 3OUSA 1OCZC 3HPLC 4PDMA 2R9RB 3K0DA 4JTDB 3SJQC 4GX5A 4MVUA 3E8FA 4MW3A 4MTFA 4R7CA 5EBLC 1R3IC 1K4CC 3T1CA 4F4LA 3LUTB 3OR7C 3BEHA 4LP8A 1R3JC 3PJSK 3E8HA 3E8GA 4MVZA 2EIJC 4X88A 3SPCA 4BW5A 3AG3C 1LNQA 3IGAC 3T4DA 4XDJA 4EKWA 4JTAB 3LDEA 1V54C 4MSWC 4OXSA 3K0GA 1ORQC 4PA6A 2WLLB 5KUMA 3OR6C 4MTGA 5EK0A 3UKMA 4J9YB 3WG7C 4X89A 4X8AA 5EC2C 3EFFK 4WFHA 3ASOC 4XDKA 3ABKC 5CBGA 3E89A 2A9HA 3FB5C 4PA4A 3RVZA 4RUFA 4PDVA 3LDCA 1OCCC 4GX2A 2YEVA 4XDLA 2WLNA 3AG1C 3K03A 3LDDA 5EBMC 3SPHA 4H37A 1G4YB 1J95A 4HZ3A 2AHZA 2A0LA 3F7VC 2ZD9A 3E8BA 2X6AA 2WLHA 3F5WC 3ZJZA 4MVMA 5BZBA 4PA3A 2AHYA 1JVMA 2X6CA 2BOBC 2WLIB 1M57C 4PA7A 1KKDA 4I9WA 4P2ZA 1M56C 5EC1C 2HJFC 2BOCC 1S5HC 1ZWIC 5B3SC 2OCCC 3KG2A 4GX0A 2DWDC 4CBCA 2ZXWC 2Q68A 2ITDC 3ABLC 2HVJC
chains in the Genus database with same CATH superfamily
2ODMA 1W0KG 2HFEC 3SYOA 4HNAA 3WG7B 1N36O 1WLEA 4BW9A 4KXRA 3D36A 3K5OA 3AEIA 2QKSA 5FLXN 4D7SA 3H1IH 4JI2B 3BRCA 1KECA 1G8MA 3UO3A 2AZ0A 1SQFA 5LP6A 1EZJA 5L3GA 3L70H 4DW1A 1S76D 4ZOLA 2IH1C 5KX5B 4DUZO 3JARA 4NVPA 1EN6A 1V9PA 1B04A 4DK0A 4JI5B 4CH6A 1IX9A 4LH6A 2ATKC 2ZDIC 4J11A 3HKEA 3OT7A 2XAGA 3CEIA 5CA3A 1JQ0A 5B1OA 1Q8IA 5LMUB 5AG2A 1K73W 3SGIA 1V55C 1FXKC 4YHHB 3J81N 3AK2A 4JI0B 1K9MW 1QR9A 4X88A 1KUQA 1HNXO 3FD9A 3CCVV 2E5LO 3BABA 1VQOV 1Y76B 1Z2GA 4MTGA 5L3EA 1EN5A 1XBLA 4CC6A 3H1LH 3JSNA 2PF4E 5LYJB 1YI2V 3JAWB 4LF8O 1W59A 1HNZB 1GK9A 4GX2A 1Q3EA 1U96A 1G4YB 1NI8A 3AG4B 2MW2B 1XNQB 3E8BA 1YTFB 2UU9B 1KP3A 3FKSG 3J80N 2Y0PA 5KX5A 1ZWIC 1XQ8A 1BS3A 2OCCC 2BSKB 4J9ZB 1K34A 1VQ4V 4EB6B 4X64O 1JX9A 2Y69B 4PD4F 5EZYA 1WPXA 2RCVA 2JGDB 3SJBC 5BR8O 1GAXA 3U11A 2RMKB 1IZ3A 1M57B 2WLJA 4DV2O 3OGCC 4LBEC 1DF5A 1BQZA 4DV1O 4FZ0A 1W2BU 1P7GA 1US6A 2D3OW 1Y76A 5IYZB 2JEUA 5H5NA 2Q69A 4WFEA 3JAWA 2VQEB 3M7MX 3BHPA 3OAAG 1IBKB 1X59A 4UCRA 2YI8A 4B7EA 5H6RA 1OCRC 2ZT9B 2Q67A 1I08A 1ZLZA 2A7WA 3CD6V 4JAVA 4PDMA 4GLXA 5CN0A 2VQFB 3C90A 3SJQC 3Q4HB 2Y0IA 5LBQA 5K1XA 1QU7A 2JJ1G 5LGTA 3RYHA 4BWAA 3BPZA 1D5AA 4ZHQB 5EC2C 4WFHA 3A8TA 3E89A 3FB5C 4O4LB 5DN6G 3LDCA 1KKCA 1EFRG 1AP6A 1FYJA 5BMVA 2P90A 3AG1B 2FMLA 3G6EV 3L9DA 4DV5O 1S5HC 1SZTA 1FAFA 2F23A 5IYZA 2BE3A 5LHIA 4JYAO 3JSLA 4JI6B 3GWOA 3OMAB 1XL6A 5KHKA 1XNRO 4MVSA 1TUBA 2UXDO 4J41A 2WWWA 4ZI7B 1XUQA 3CB2A 2ZM6O 2JGUA 3W7SA 3WU2Z 3E86A 2ILMA 3A0HZ 1TUEB 4X1YB 2DOSA 1M9NA 3A0BZ 4QJFB 4QNHB 1WA8B 3CHXA 1I94B 4F6RB 3Q4HA 3ABTA 2HP8A 1R3LC 3QNEA 3G4SV 4DW0A 3VBBA 1IBLB 1VF6A 4JI3O 4NXMB 4EEQA 4KUMA 4PELA 4FLUA 2EINB 1VQKV 3RW0A 4PJ0Z 5B1BB 1N4CA 5LMUO 4X1KB 2R70A 4WBNA 3RYFA 2QM4A 2HG5C 3OD4A 1LUWA 2L6LA 4FFBB 5L3CA 4JI0O 5EIBD 3CRAA 5L3BA 1N33B 3CCRV 3DGEA 3L71H 1Q6HA 1YF2A 4I4TB 3CCEV 4QPKA 1K4CC 2DYSB 3LUTB 3VQVA 1QVGU 5KAFZ 3JAKA 1IXMA 2XTAA 2OCHA 1HNZO 1E1QG 3CMEV 2QWNB 2EIKB 3WG7C 5GONA 5CBGA 1PNMA 4HAMA 3K9SA 4PDVA 4DR7B 2D2CB 2XAFA 3K5NA 3ZJZA 4F6RA 3ZN1A 3ZHSA 1JJOA 1JVMA 2BOBC 2E3CA 2V4DA 2WLIB 1KKDA 2DE0X 4P2ZA 5JH7A 4U7NA 1M90W 3KG2A 4N23A 4YJ3A 2QKCA 4JTCB 4DYLA 4GX1A 5IDJA 4I9QA 4WFFA 3SPJA 2ZE7A 3AG2C 2IJKA 1GTOA 1H2MA 4X1KA 3TXQA 4MTOA 3CCSV 3SPIA 4FFBA 1S5JA 3X2QC 3K08A 2UXCO 1AJQA 3K04A 4JYBA 1M56B 2YXLA 1VP7A 2A06H 4W4KA 3ZMSA 1IBKO 2K9PA 1J5EO 1DLBA 1LUVA 4PDRA 3L73H 3STLC 4ABMA 1I0HA 2HVKC 4MVOA 2XOKG 4HBNA 1SQBH 3IC7A 2KB1A 5LHHA 3U10A 2WLIA 3AG4C 3JD2A 4AILC 1B06A 2ZR3A 3ZHUA 2JIZG 1Y74A 1VMGA 3ZBHA 1AP5A 1R6TA 1XMOB 2HKOA 3W7TA 2EX3A 2YICA 4LNUA 3IGAC 5LOVB 4WFBV 2WLLB 3H1HH 1H2NA 3W7WA 2IJHA 4X8AA 4L87A 2UUAB 1KYOF 1I5YA 4ASUG 4IHJB 4K0KO 3ICXA 1IVSA 3JASA 4B3MO 3H01A 5LGUA 2PY5A 1HR0O 4DRXA 3FAVB 2AGAA 3KCXA 4GKKO 1M57C 2JEXA 4JI6O 4IYIA 4O2BB 4UB8Z 3FYIB 4CBCA 5J2TB 5IYCO 3BFRA 3JD4A 1S77D 1AR5A 4LCUC 3T1HO 5D5PA 2GUZA 4FK5C 2DQ3A 2P7TC 1FFXA 3E22B 3CJHB 3LSSA 4QIWF 5JCOA 2M6YA 4LFCO 2PYLA 4NTXA 1IBLO 2CK3G 2JS5A 3RYIB 3SJCC 1VEWA 1AJPA 4LF9B 4MTXA 2H8PC 2N05A 1GRJA 4X20B 4BIUA 2HEPA 2YSUB 5BY1A 5K1PA 2HJDA 1HDJA 4IHJA 4UB6Z 1U97A 1T5EA 2EILC 2Q73A 4H13B 5CBHA 2IBZH 2ZE5A 4PDLA 2UUCB 3W7UA 4K8ZA 2Y48A 3AG7A 3FAVA 3UQ8A 5J2UA 1FXVA 1MABG 5J9PC 5HFLA 1VQ7V 4CS2A 1BCCH 3E83A 2UUBO 3ZRSA 4DXWA 2PI5A 1SC5B 4O2BA 4TV9A 1NT2B 3I55V 2O57A 4GX5A 1S5LZ 4F4LA 3FFQA 4MVZA 3T4DA 1JJ2U 2CTRA 2LGQA 4HNAB 3E22A 1Q86W 1JFFB 3ETQA 3ETGA 3AG3B 1YZBA 3DXRB 4LF5B 4WF9V 2Q0OC 1PNKA 4PHZA 4FMTA 4XDLA 4DV6B 3ZMUA 1F4MA 4DV3B 2X6AA 1PP9H 5FPRA 2F66C 3ABUA 5LP6B 5KHHA 4O2AA 3P3PA 4ZOLB 5LHGA 2G38A 2BOCC 4GX0A 1H2GA 4YXWG 2OWOA 5KHIA 2FB5A 3JARB 4X20A 4KHPO 4ZBMA 1AI4A 2LO1A 3P32A 1F23A 2EINC 3I56V 1THZA 1KD1W 5B1BC 2RNBA 2WA3A 3HKEB 2Y4TA 5FNVB 2P22C 3RVYA 4AHCA 5LXTA 4I5SA 1QHTA 4JI1B 3JCZA 3SPGA 1RSOA 1NQTA 5KLVH 1VQMV 2WAMA 3KCYA 3OUFA 2ARHA 5IWAO 4U3JA 2ZXWB 3RBZA 2DYSC 1JFFA 1PNLA 3DXRA 1OV9A 3ABMB 3LNNA 4E4EA 2EIKC 1HNWO 4CZZA 4UCOA 1Y67A 1BQ0A 4LF7O 3CS5A 4I0XA 2RDCA 3G80A 4KFMA 4U3FH 2QM7A 3EXAA 1YHQV 1R3IC 1RFYA 3BA8A 4NXNB 2QGNA 2ZKOA 1K3EA 1ZTEA 5EZYB 5LMNO 5D5QA 5FNVA 1WAZA 2P6JA 3CXHF 3ZRWA 1BZKA 1S3JA 4DR2B 4PA4A 4ZIBA 4DV0B 4X62O 3F7VC 5FPOA 4OX9O 4FM1A 2F4VO 3CRRA 4LF4B 1CXZB 5C8YA 1M56C 4LFAO 3CSXA 1TAEA 4Q20A 4DV4O 3OM3B 4JI7O 3QO5A 1PPJH 2EBOA 4DO2A 2EIJB 4J10A 1JR9A 1L8DA 1RPOA 5IT9N 4B7KA 3I5DA 1R6NA 3JD3A 3FB8C 4JAAA 3SYQA 1N32O 5IJ9B 1UPGA 2RJZA 3CX5F 4YJ2A 3FX7A 4DR1O 4JYYA 3DSQA 2CTQA 3R65A 1VF5B 4AQYB 1QLNA 2HR3A 1VQLV 2Z3YA 4BR6A 1GM8A 3MHSC 2W0FC 3SYAA 1SRYA 1JOYA 1DF4A 3RYHB 1K5QA 2ZE6A 2GTSA 1AR1B 4E2LA 2EZOA 1YCIA 1VQ6V 1QLEB 4GT1A 1AI6A 3JALB 5BMVB 1XHZA 2DYRB 4JI8B 4DR5B 4IL6Z 4N21A 1KU9A 2R9RB 2X0LA 1ZSPA 2P5OA 4JYCA 2LW7A 1AI7A 3M8AA 4GKJO 2LFRA 4J7JA 4ZKIA 4MTFA 1N0NA 3T1CA 4FM2A 4UFZA 1FJGB 1TUBB 5IJ9A 1YSCA 1QQCA 1IBMO 1SQQH 1S72V 3CCLV 4RUFA 4JI4B 1PL4A 3EHBB 2QSAA 3RYCA 4EFBA 4D7TA 3QF7A 2WA4A 1F4NA 5BZBA 1TA8A 4IIJA 3P3NA 1GN4A 5JVDB 3QO7A 1H2SB 5ITZB 2Y4UA 2Q5ZA 1ZAUA 3K5MA 5KMGB 2OT5A 1JPXA 1M5IA 4DR4O 1FPOA 3AK3A 4MS2A 1KBHA 4OPAA 2AZ2A 3ABKB 4ICGA 1XDCA 2YC0A 4R8CA 3JALA 3L75H 3M99B 2A79B 1OCCB 4P9OA 4LFBB 1K5SA 4EFEA 4WBNB 3RYFB 1RP3B 1AI5A 1MOFA 5FL7G 1AROP 3SJAC 2ZQMA 4TWKA 3H9VA 5CA0B 4CH5A 1K8AW 1B6QA 1Q6IA 3JAKB 3WB1A 1VQPV 1XMQB 1IDSA 5LA6A 3CPWU 2ZNJA 1NKDA 2Q7GA 4MW8A 4JI2O 5GONB 3GVMA 4DR3B 1PV0A 4PA9A 4JASA 2HHHB 3D36C 3FB6C 4FM0A 4WCEV 3FB7C 5JVDA 1WNSA 2NR5A 5GTIZ 1VQ9V 5ITZA 4JI5O 4OGQB 5JH7B 5LP6C 4J42A 1AJNA 4B3RB 2W6JG 3CWBH 3E8FA 3QO8A 4YJ3B 1YJNV 5KMGA 4Z1MG 3WB0A 3MAQA 3SPCA 2WSSG 4XDJA 4JTAB 4DR2O 1ORQC 3N2GB 1P49A 3ASOC 1N8RW 1K7DA 5L3DA 4YHHO 4DR6B 4DV7B 3DC6A 5LGNA 5EYPA 1DK1A 2PGGA 3B8MA 1J95A 1SESA 2AHZA 3K59A 1M4UA 2F43G 3F5WC 3H1JH 4PA3A 2DJVA 5CA0A 2HJFC 3RWRD 3EVKA 4DUYB 3HKDA 2ZXWC 2OIEA 4RQEA 3ZRXA 2ITDC 3UT5A 2HVJC 2ZE8A 4TT3G 4RQFA 4X1IA 2UXBB 1XNQO 2UU9O 4Z2WA 3JD1A 4LF6B 3ZRVA 4UVCA 5CBFA 1VQ8V 4YY3B 4AQYO 4JV5B 1I7FA 3ZHQA 5CB4A 1RM1B 3E2EA 4B3SB 2V7QG 1DTOA 4CC5A 3CC2V 2PI4A 1VQNV 3LSQA 1MSDA 1Y74B 2Q8VA 2ZIMA 1TVKB 2IW5A 2BTOA 3TCUA 3AK1A 1NBMG 2CTWA 4LNUB 4TQDA 3ZIAG 2W6IG 4BIZA 3N2GA 2JJ2G 1NTKH 5A2QN 1R3KC 2QTSA 3TETA 1YITV 3TJTA 4P9PA 4RUEA 1EZVH 2IH3C 1NZ6A 3JASB 1GH6A 4DRXB 1COWG 2Q4PA 2PZSA 2DQ0A 1SQPH 4F6EA 3OMNB 2HLDG 4FLTA 3UM7A 4TQFA 2VQEO 3H1KH 1G6UA 4MVUA 1FXKB 3PN1A 2EIJC 4JZ2A 2GUZB 3L74H 1URFA 1KQSU 4OXSA 2ADPA 2PTMA 1E79G 1Q82W 3QG5A 1FFXB 1P84F 2VQFO 2A9HA 4KP4A 1BHAA 3MHHC 2R9AA 2FKXA 2EZPA 1TVKA 4I55A 3BVOA 1Q7YW 4MVMA 2AHYA 1X4TA 2ZNIA 1AB3A 1SA0B 2JS3A 5GTHZ 3OFNG 5KHJA 2DMXA 2GV9A 5CA1B 4B3TB 2Y69C 1QVFU 3CRCA 3N2KB 2JRIA 5B1NA 2ZDIA 4TOIA 1QLEC 2KSDA 1Y66A 2QWQB 3B09A 2NLJC 1W0JG 4DUZB 3HKBA 5J2UB 2C2AA 3QVNA 4J80A 2DYRC 2QTOA 1H38A 2NNUA 4TV9B 1NTZH 1FXKA 2YXYA 1XMQO 5JQGB 3TGUH 4PI2A 3ABLB 4P30A 5JJJB 4IYHA 4QGPA 2WPDG 1OCOB 2DWEC 3T1YB 1I94O 1Z5WA 3RN4A 2YXHA 1CEZA 4NXMO 5LL6Y 3KZIZ 5F2VO 2E5LB 1SA0A 2DW4A 2GTAA 4O2AB 1H8HG 1H2LA 1SF9A 2LFSA 1AILA 1FS0G 4LF8B 3ZX6A 5CA1A 2CAZC 1VF6C 2QWRB 3CCQV 2ZCEA 3N2KA 2R72A 2CDYA 4EKWA 4DR6O 1BT8A 3UO2A 3J7AU 3N27A 1N33O 4XDKA 3ABKC 2Q9LA 3C3TA 5B1AB 2IM9A 2QE7G 1OCCC 3HR0A 3WB2A 5LXTB 3AG1C 2IU3A 4H37A 2ZIOA 2AXTZ 4FLWA 4DUYO 1RSOB 3D3IA 3ZS8C 5JQGA 1OCZB 5B66Z 1OJHA 4U3JB 5BR8B 4CH3A 2UXBO 1PKXA 3ZMVA 2OYQA 1IURA 1JCHA 4DR7O 5DEDA 2XHBA 4UVBA 4MVQA 1V54B 4UV9A 2F93B 3THOA 2ADQB 4MVRA 4DV1B 3B77A 4X65B 1L0LH 4O4JB 4R50A 2EJRA 3A0RA 4I0XB 2YEVB 2CH7B 1SZXA 1N34B 1NVPB 1GN2A 2IJIA 5B3SB 2FL4A 1YVWA 3ZHRA 5CMUA 3BA9A 2LGWA 4LC1A 5JWPA 2YUAA 4H33A 2OIGA 2CUGA 1D5NA 3F5TA 3ZRWB 4BAYA 4QE7A 1Q43A 5B5EZ 3APOA 5IY5B 2ITCC 2QM8A 4RO2A 5C8YB 5JJNB 3F7YC 4XBFA 1NR7A 2Q7HA 5EBLC 1MNGA 4LP8A 3OEHG 2YI9A 1LNQA 1M93A 2N74A 3LDEA 4YIOA 3UKMA 4DV5B 4O4JA 4NB5A 1QCEA 4UV8A 4X89A 4TUYB 3ZHVA 2YIBA 4YJ2B 4JYAB 1F7YA 3S3XA 2YEVA 1XMOO 4H0LB 1HWYA 3SPHA 3RGBA 4O4HB 2CH7A 1RM1C 3C3SA 1XNRB 5GW7A 2OTLV 2UXDB 3CYOA 1G1XB 2XAHA 4PA7A 2YIDA 4B3TO 5DM6V 2ZM6B 3ZHTA 2UUAO 2KG7A 3S3WA 1H8EG 4J7KA 1XI1A 1ZL8B 3GB7C 4UCTA 1B3QA 1YDXA 1I5XA 2L35A 5IE9A 3K57A 1SETA 1Q81W 4JI3B 3QTCA 3AG2B 1K4DC 2MK3A 4CS4A 3ZMZA 3K3WA 3JATA 4DK1A 3CRQA 3X2QB 3SYPA 1OZ0A 1GMGA 4NYKA 1VQ5V 3OMIB 3G67A 5EBWC 2CTPA 3T1YO 1VARA 3DC5A 4TUYA 1MSWD 1FXHA 1Q90D 4G27B 4UXNA 4CS3A 2WLKA 1K92A 3CRMA 2B9ZA 5H9CA 4O4HA 5JCOC 1OHHG 2CGOA 1MZEA 4GZRB 3L72H 3RYCB 2E75B 1NU1H 4LF9O 2BCCH 3CP1A 1ZUQA 4IIJB 5IJ0B 3T4ZA 2V1DA 3VQYA 2UXNA 1XHXA 1MZFA 1WP8A 3D8CA 2PYJA 2P4VA 1KMIZ 1ZL8A 4IGGA 3K5LA 2UUCO 3VQXA 2ZR2A 3PJSK 4D6TH 4WFAV 1NTMH 4Q6GA 1D2DA 2R9IA 2AW9A 3SDLA 3VQWA 2RQ6A 3OR6C 2UXXA 5EK0A 4X66B 2FYUH 2B5UA 1TGOA 3G6BA 1R1BA 1XOUA 3K03A 2A0LA 1NH2D 2ZD9A 4IT5A 2GDSA 2WLHA 1R73A 2QWOB 5EC1C 1PL0A 4LF5O 1IXBA 3ABLC 5LA6B 4DV6O 2UXCB 1SQGA 3OGIB 2P4KA 2XNDG 1OCOC 1WB7A 2YIAA 4DV3O 4X65O 2Z0AA 1LR1A 4TV8B 3A2FA 1EM1A 3ML0A 4L8JA 1N0JA 2ZINA 5LYJA 4K35A 1N34O 3E35A 5IJ0A 1J5EB 3ETDA 3K9AA 5KUKA 1QBZA 3CC4V 5E1AC 3DTUB 4UUJC 2BSKA 2GHYA 3LNMB 1F51A 2QR4A 3W7XA 2EIMB 4JI1O 2LJ2A 4EB6A 4FLYA 2H3OA 2JGDA 5EYPB 2M7WA 4U7OA 4YIPA 2P67A 5B1AC 2XUMA 3ZMTA 2EILB 1AR4A 4K3AA 4G2KA 2YIBD 2N04A 2Z5UA 4LR3A 2EULA 4JF3A 1OCZC 3CXCU 2B1IA 4GUNA 3OTOB 1NVPD 3HKDB 4K0KB 3UT5B 3G71V 3SR2C 4B3MB 3OR7C 1ZX3A 3OEEG 1HR0B 4X1IB 3AG3C 4GKKB 4TV8A 1V54C 3K58A 2JDIG 1QR8A 1VF7A 4PA6A 1M1KW 1MG1A 4JZGA 1KB9F 3NR7A 3ASNB 4GYCB 4QPJA 4KL1A 3IJ4A 5CB4B 1Q6UA 1Y6XA 1YXBA 2NN4A 3T1HB 1S0VA 4NXNO 4FLXA 4FLZA 1SQXH 5C93A 5B3SC 2DWDC 1QNMA 1HP8A 1P7BA 4LFCB 3WFVA 4DV0O 1EBOA 1SS3A 1YEWA 4RAIA 1NR1A 2IU0A 2Q7EA 1K97A 5IYDO 5KA5A 3FYEB 4LF4O 4TSFG 4ZHQA 2XT9A 1XILA 2E76B 3CC7V 5IY5C 1L0NH 4O4LA 4PI0A 4MT8A 5A9GA 1Y4MA 3SYCA 5E79Z 1YJWV 4W4LA 4I7ZB 2PUSA 3OW2U 2GSMB 1A32A 3UCSC 1GO3F 1AVMA 4B08A 4I50B 2QWPB 3OE7G 1NJIW 3ABMC 2UUBB 1WJZA 4O4IB 5KA6A 2WLMA 3CCJV 3IFXA 5EIBC 4NTWA 4OPHA 3KKYA 4ZI7A 3D3QA 1YIJV 2KQXA 1SKVA 3IC9A 4I55B 3JYCA 3STZC 2F1MA 3GWKC 4X1YA 3HB3B 1WA8A 3K0DA 1VIBA 3NXSA 1CP9A 2Q0AA 1XREA 1O9GA 4RWUA 3BEHA 1BHBA 3E8HA 3RT3C 4PV1B 4X66O 2F95B 2W0XA 4JI8O 3U0ZA 1CPYA 1JA8A 4DR5O 3K0GA 1FD9A 3R66A 2YDEA 3HKBB 1UJWB 1EN4A 4KHPB 2WLNA 3K79A 2DN9A 4H44B 5EBMC 5KAIZ 2P06A 4K8XA 1V55B 2X6CA 1FJGO 5HFMA 1WPBA 5TISZ 4I50A 4NTYA 1JMKC 1YTFD 4I4TA 5H6QA 4O4IA 4JI4O 1UFIA 2X6BA 4UCSA 1GN3A 5IYBO 1Q5OA 1SQVH 4FZ1A 4FJCC 4FFKA 3ETEA 5IWAB 1XEQA 2QDOA 2LQTA 4UVAA 3TXSA 2GBOA 5KHGA 3JAMN 4FIPC 4G28B 1O9HA 3VOUA 2QA4V 1N36B 3JD0A 3HKCB 1HNWB 2OCCB 1ENVA 2CE4A 4FVMA 4J7ZA 2JK5C 4LFBO 4LF7B 4QE9A 1BE3H 2E74B 1E1RG 2BTQB 2VS0A 4A5UB 4FPPA 2VRZA 1BSMA 3OTOO 1R6KA 2LP7A 3RFRA 1GM9A 5LMNB 4LH7A 2XASA 1BMFG 3K06A 3OUSA 1K33A 2FTKA 4JGSA 4DR3O 2OTJV 2HHHO 4NR1A 2JVDA 4X62B 3E8GA 4BW5A 4UCVA 4OX9B 2F4VB 5KUMA 4LFAB 1FKAO 4J9YB 1HNXB 1NH2B 2VWKA 4DV4B 4JI7B 4B3RO 4FLVA 1OCRB 3LDDA 4HZ3A 2ETNA 1P4RA 1GN6A 2LW1A 3HKCA 1WB8A 3O9OA 1N32B 2XAQA 3P30A 1KP2A 1WP7A 2Q68A 2BTQA 2CGNA 4DV7O 2QEXV 2H94A 1L1FA 4DR1B 4JPRA 1FFTB 2EIMC 5LOVA 2B1GA 5DECA 3BY6A 3ZEDA 2WLLA 1Z5VA 3MDSA 4X64B 4WFGA 2RN9A 4UCUA 4LWSB 2VWJA 1XL4A 2K1EA 1PM9A 2YS8A 3B2EE 3B40A 4LF6O 4R6ZA 2QJ1A 3T2MA 2A3QA 4YY3O 4CH4A 1GKFA 1PD3A 4DV2B 3LSUA 3IAYA 4JV5O 1ROPA 3B8NA 5BXZA 5J2TA 1YJ9V 4B3SO 4BIOA 1MA1A 4X9QA 2Q6AA 4GKJB 3TK1A 5H2FZ 1DGSA 3CCUV 3ASNC 3ZCCA 3CJHA 4C7UA 2EJ7A 3O65A 3JCUZ 4JAUA 1BL8A 4HYOA 1KC8W 1IBMB 5JJEB 3ZN0A 3B4SA 3BCCH 3HPLC 3BAAA 4JTDB 3RYIA 4AI8A 2KG7B 4MW3A 4R7CA 5L3FA 1R3JC 2QKAA 4MSWC 1H2KA 2IJJA 3EFFK 3APQA 2KKWA 1GM7A 1BGYH 4LWSA 3RVZA 1RPRA 1WN7A 1HW7A 3ASOB 1MMMA 3CE2A 3JATB 4Z1VA 4DR4B 4GCZA 2XAJA 1SERA 1NS1A 2X7RB 4NKGB 3MD0A 3OTFA 3CCMV 4I9WA 3CMAV
chains in the Genus database with same CATH topology
5IYCO 3JD4A 1S77D 4TT3G 4RQFA 4LCUC 1W0KG 2HFEC 2XNDG 1OCOC 4FK5C 3SYOA 2DQ3A 3JD1A 3ZRVA 3WG7B 4UVCA 5CBFA 2P7TC 1VQ8V 1WLEA 3ML0A 3LSSA 3D36A 4QIWF 3AEIA 3E35A 3E2EA 1RM1B 2QKSA 2V7QG 3ETDA 1DTOA 3CC2V 3K9AA 5KUKA 2PI4A 1VQNV 2CK3G 3LSQA 1KECA 1G8MA 1EZJA 5L3GA 1S76D 2IW5A 1QBZA 3TCUA 1NBMG 3CC4V 1AJPA 2IH1C 3ZIAG 2W6IG 4BIZA 5E1AC 3DTUB 4MTXA 4UUJC 2H8PC 2GHYA 3LNMB 2JJ2G 1F51A 3W7XA 1R3KC 3TETA 2EIMB 1YITV 4BIUA 4P9PA 2YSUB 4RUEA 2ATKC 2ZDIC 2EILC 5CBHA 4PDLA 2IH3C 2M7WA 4U7OA 3W7UA 2P67A 2Y48A 5B1AC 3ZMTA 2XAGA 2EILB 1FXVA 1COWG 1JQ0A 1MABG 4G2KA 5B1OA 5CA3A 5J9PC 5HFLA 1VQ7V 2DQ0A 2Z5UA 3E83A 3OMNB 1K73W 2HLDG 1V55C 3UM7A 3ZRSA 4DXWA 4JF3A 2PI5A 1OCZC 3CXCU 1FXKC 2B1IA 3I55V 1NVPD 4GX5A 4MVUA 3G71V 1FXKB 3OR7C 4F4LA 1K9MW 1QR9A 3OEEG 4MVZA 2EIJC 4X88A 3AG3C 3T4DA 1JJ2U 1KQSU 3CCVV 1V54C 4OXSA 2JDIG 1QR8A 4PA6A 1VQOV 1Q86W 4MTGA 1E79G 3ETGA 5L3EA 1Q82W 1M1KW 1MG1A 3AG3B 1YI2V 4WF9V 3ASNB 2A9HA 1PNKA 4QPJA 1GK9A 4FMTA 4KP4A 4GX2A 1BHAA 4XDLA 3ZMUA 3MHHC 1F4MA 1G4YB 2EZPA 1S0VA 3AG4B 3E8BA 1YTFB 1Q7YW 2X6AA 4MVMA 2AHYA 3ABUA 1KP3A 3FKSG 5LHGA 2BOCC 5C93A 1ZWIC 5B3SC 2OCCC 4GX0A 1H2GA 4YXWG 3OFNG 2DWDC 1P7BA 3WFVA 4J9ZB 1AI4A 1EBOA 4ZBMA 1K34A 2Y69C 4RAIA 2IU0A 1NR1A 1VQ4V 3P32A 1QVFU 1F23A 1K97A 5IYDO 2EINC 5KA5A 3I56V 1THZA 1JX9A 1KD1W 3FYEB 5B1BC 5B1NA 2ZDIA 2Y69B 1WPXA 1QLEC 4TSFG 1Y66A 3RVYA 2NLJC 1W0JG 3CC7V 2C2AA 5IY5C 4MT8A 1Y4MA 4I5SA 3SYCA 2DYRC 1YJWV 2QTOA 3JCZA 3SPGA 1H38A 1M57B 1NQTA 2NNUA 2WLJA 3OGCC 3OW2U 1VQMV 2GSMB 1FXKA 2WAMA 3OUFA 4LBEC 1DF5A 1GO3F 2ZXWB 3RBZA 1W2BU 3ABLB 2DYSC 4P30A 3OE7G 1NJIW 2D3OW 2WPDG 3ABMC 2JEUA 1OCOB 2DWEC 1PNLA 5KA6A 2WLMA 2Q69A 4WFEA 3CCJV 3IFXA 3ABMB 3OAAG 2EIKC 5H6RA 1YIJV 4CZZA 1OCRC 1CEZA 2Q67A 3JYCA 3STZC 3HB3B 3CD6V 2DW4A 4JAVA 4KFMA 2QM7A 1H8HG 4PDMA 5CN0A 2LFSA 3K0DA 1FS0G 3SJQC 3NXSA 1CP9A 1YHQV 1R3IC 3CCQV 3BEHA 1BHBA 3E8HA 5LBQA 2JJ1G 5LGTA 4EKWA 1CPYA 1K3EA 3K0GA 2P6JA 3ZRWA 5EC2C 4WFHA 1S3JA 4XDKA 3ABKC 3E89A 3FB5C 4PA4A 1UJWB 5B1AB 5DN6G 3LDCA 2QE7G 1OCCC 1EFRG 2WLNA 3AG1C 3K79A 5EBMC 2IU3A 4H37A 3F7VC 1V55B 2P90A 2X6CA 3D3IA 3AG1B 1OCZB 3G6EV 5HFMA 1M56C 1S5HC 4Q20A 1SZTA 1PKXA 3OM3B 3ZMVA 1YTFD 5H6QA 3QO5A 2EBOA 5LHIA 1JCHA 4DO2A 2EIJB 1RPOA 3GWOA 2X6BA 4UVBA 4MVQA 1V54B 3OMAB 4UV9A 1XL6A 1R6NA 4MVSA 5IYBO 3JD3A 2WWWA 3FB8C 4FJCC 3SYQA 3ETEA 4MVRA 3W7SA 3B77A 4UVAA 4R50A 3E86A 4FIPC 1TUEB 2EJRA 4G28B 3A0RA 3VOUA 2QA4V 2YEVB 1M9NA 4QNHB 4QJFB 3R65A 1QLNA 2HR3A 1VQLV 1NVPB 2Z3YA 1GM8A 3ABTA 3JD0A 3MHSC 2IJIA 5B3SB 2W0FC 1R3LC 2OCCB 3QNEA 3SYAA 1SRYA 3G4SV 1ENVA 3VBBA 5CMUA 1JOYA 2JK5C 4LC1A 1DF4A 4H33A 4QE9A 1E1RG 1K5QA 4KUMA 4PELA 2EINB 1VQKV 1AR1B 4E2LA 2EZOA 3ZRWB 3RW0A 4BAYA 4QE7A 5B1BB 1VQ6V 4FPPA 1QLEB 4GT1A 5IY5B 1AI6A 2ITCC 2DYRB 2QM8A 4RO2A 1R6KA 2HG5C 2LP7A 1GM9A 5L3CA 4N21A 2XASA 1BMFG 3F7YC 3K06A 3OUSA 4XBFA 1K33A 2FTKA 2R9RB 2X0LA 5L3BA 3CCRV 1NR7A 3DGEA 1AI7A 4JGSA 4JYCA 2LFRA 2OTJV 4ZKIA 4MTFA 5EBLC 3CCEV 4QPKA 3T1CA 1K4CC 2DYSB 3LUTB 4LP8A 1QVGU 3E8GA 3OEHG 4BW5A 1LNQA 1IXMA 3LDEA 1YSCA 5KUMA 1E1QG 3CMEV 1S72V 3UKMA 2EIKB 4J9YB 1QCEA 3WG7C 4UV8A 4X89A 1NH2B 5CBGA 1PNMA 4HAMA 3CCLV 4RUFA 4PDVA 2YEVA 1OCRB 1HWYA 3LDDA 3EHBB 2XAFA 3SPHA 4HZ3A 1RM1C 1P4RA 1F4NA 3ZJZA 5GW7A 5BZBA 3ZN1A 2OTLV 1JVMA 3CYOA 2BOBC 2WLIB 2XAHA 4PA7A 1KKDA 4P2ZA 3QO7A 2XAQA 3P30A 5DM6V 1KP2A 4U7NA 1M90W 3KG2A 4N23A 2Q68A 1H8EG 2QEXV 2H94A 1L1FA 4JPRA 1FFTB 4JTCB 2OT5A 4GX1A 5IDJA 1JPXA 3GB7C 2EIMC 4WFFA 2B1GA 3SPJA 3BY6A 4MS2A 2WLLA 3AG2C 1I5XA 2IJKA 1GTOA 3ABKB 1SETA 4R8CA 1Q81W 4MTOA 3CCSV 3M99B 2A79B 1OCCB 3SPIA 4WFGA 3AG2B 4P9OA 1K5SA 1K4DC 2MK3A 3ZMZA 3X2QC 3K08A 1XL4A 2K1EA 3K3WA 1AJQA 1AI5A 1MOFA 5FL7G 1AROP 3K04A 4JYBA 1M56B 3X2QB 3SYPA 4R6ZA 2ZQMA 1OZ0A 1GMGA 4TWKA 3T2MA 1VQ5V 3OMIB 5EBWC 3ZMSA 1GKFA 1PD3A 1K8AW 1B6QA 1VQPV 1ROPA 3B8NA 1YJ9V 3CPWU 1NKDA 1DLBA 1FXHA 4MW8A 1MSWD 4PDRA 4G27B 4UXNA 2Q6AA 4PA9A 2WLKA 3STLC 3TK1A 4JASA 1K92A 3CCUV 2HVKC 4MVOA 2XOKG 3ASNC 5H9CA 3ZCCA 3FB6C 3IC7A 1OHHG 2KB1A 4WCEV 5LHHA 3FB7C 4JAUA 3CP1A 1BL8A 2WLIA 4HYOA 3AG4C 1KC8W 1VQ9V 3JD2A 3T4ZA 3ZN0A 2ZR3A 3HPLC 2JIZG 4JTDB 1AJNA 2V1DA 2UXNA 2W6JG 4MW3A 3E8FA 3QO8A 4R7CA 1YJNV 4Z1MG 2HKOA 3W7TA 5L3FA 1R3JC 2ZR2A 3PJSK 4WFAV 3SPCA 2WSSG 3IGAC 2R9IA 4XDJA 4JTAB 4MSWC 4WFBV 1ORQC 2WLLB 3OR6C 5EK0A 2UXXA 3W7WA 2IJHA 2IJJA 4X8AA 3EFFK 4L87A 3ASOC 2B5UA 1N8RW 1I5YA 1GM7A 1K7DA 5L3DA 4ASUG 3RVZA 5LGNA 1RPRA 3K03A 3H01A 5LGUA 3ASOB 3B8MA 1J95A 1SESA 2AHZA 2A0LA 4GCZA 2ZD9A 1NH2D 2F43G 2WLHA 3F5WC 2XAJA 4PA3A 1SERA 1M57C 2JEXA 1R73A 5EC1C 2HJFC 2X7RB 1PL0A 3MD0A 3CCMV 3FYIB 4CBCA 2ZXWC 4I9WA 3CMAV 4RQEA 3ZRXA 2ITDC 3ABLC 2HVJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7B A;  4J9Z B;  4ZBM A;  2X6B A;  2Y69 C;  4JTC B;  4GX1 A;  4LCU C;  4MVQ A;  2HFE C;  3GB7 C;  4RAI A;  1OCO C;  2EIM C;  1XL6 A;  4WFF A;  3SYO A;  2EIN C;  4MVS A;  3SPJ A;  4MS2 A;  5B1B C;  2WLL A;  3AG2 C;  2P7T C;  3FB8 C;  3SYQ A;  5CBF A;  1QLE C;  4MVR A;  4R8C A;  3RVY A;  4MTO A;  2NLJ C;  4R50 A;  2A79 B;  3SPI A;  3E86 A;  4WFG A;  4P9O A;  5IY5 C;  1K4D C;  4G28 B;  3VOU A;  3SYC A;  2QKS A;  3X2Q C;  2DYR C;  1XL4 A;  2K1E A;  3K08 A;  2QTO A;  3SPG A;  4QNH B;  5KUK A;  3R65 A;  3K04 A;  2WLJ A;  3OGC C;  3SYP A;  4R6Z A;  4LBE C;  3OUF A;  2W0F C;  1R3L C;  4TWK A;  3SYA A;  3T2M A;  3TCU A;  3RBZ A;  5EBW C;  2IH1 C;  2DYS C;  4P30 A;  2JK5 C;  5E1A C;  4H33 A;  4QE9 A;  4UUJ C;  2H8P C;  3ABM C;  3LNM B;  1R3K C;  2DWE C;  3TET A;  2WLM A;  2Q69 A;  4P9P A;  4WFE A;  4MW8 A;  4RUE A;  3RW0 A;  2ATK C;  4QE7 A;  3IFX A;  4PDR A;  4G27 B;  2Q6A A;  4PA9 A;  2WLK A;  2EIK C;  2EIL C;  3STL C;  5CBH A;  4PDL A;  2HVK C;  4MVO A;  3ASN C;  3FB6 C;  2IH3 C;  2KB1 A;  5B1A C;  3FB7 C;  1OCR C;  2Q67 A;  2ITC C;  3JYC A;  5J9P C;  3STZ C;  1BL8 A;  2WLI A;  4RO2 A;  4HYO A;  3E83 A;  3AG4 C;  2HG5 C;  1V55 C;  3UM7 A;  3ZRS A;  4DXW A;  4KFM A;  3T4Z A;  3F7Y C;  3K06 A;  3OUS A;  1OCZ C;  3HPL C;  4PDM A;  2R9R B;  3K0D A;  4JTD B;  3SJQ C;  4GX5 A;  4MVU A;  3E8F A;  4MW3 A;  4MTF A;  4R7C A;  5EBL C;  1R3I C;  1K4C C;  3T1C A;  4F4L A;  3LUT B;  3OR7 C;  3BEH A;  4LP8 A;  1R3J C;  3PJS K;  3E8H A;  3E8G A;  4MVZ A;  2EIJ C;  4X88 A;  3SPC A;  4BW5 A;  3AG3 C;  1LNQ A;  3IGA C;  3T4D A;  4XDJ A;  4EKW A;  4JTA B;  3LDE A;  1V54 C;  4MSW C;  4OXS A;  3K0G A;  1ORQ C;  4PA6 A;  2WLL B;  5KUM A;  3OR6 C;  4MTG A;  5EK0 A;  3UKM A;  4J9Y B;  3WG7 C;  4X89 A;  4X8A A;  5EC2 C;  3EFF K;  4WFH A;  3ASO C;  4XDK A;  3ABK C;  5CBG A;  3E89 A;  2A9H A;  3FB5 C;  4PA4 A;  3RVZ A;  4RUF A;  4PDV A;  3LDC A;  1OCC C;  4GX2 A;  2YEV A;  4XDL A;  2WLN A;  3AG1 C;  3K03 A;  3LDD A;  5EBM C;  3SPH A;  4H37 A;  1G4Y B;  1J95 A;  4HZ3 A;  2AHZ A;  2A0L A;  3F7V C;  2ZD9 A;  3E8B A;  2X6A A;  2WLH A;  3F5W C;  3ZJZ A;  4MVM A;  5BZB A;  4PA3 A;  2AHY A;  1JVM A;  2X6C A;  2BOB C;  2WLI B;  1M57 C;  4PA7 A;  1KKD A;  4I9W A;  4P2Z A;  1M56 C;  5EC1 C;  2HJF C;  2BOC C;  1S5H C;  1ZWI C;  5B3S C;  2OCC C;  3KG2 A;  4GX0 A;  2DWD C;  4CBC A;  2ZXW C;  2Q68 A;  2ITD C;  3ABL C;  2HVJ C; 
#chains in the Genus database with same CATH topology
 2ODM A;  1W0K G;  2HFE C;  3SYO A;  4HNA A;  3WG7 B;  1N36 O;  1WLE A;  4BW9 A;  4KXR A;  3D36 A;  3K5O A;  3AEI A;  2QKS A;  5FLX N;  4D7S A;  3H1I H;  4JI2 B;  3BRC A;  1KEC A;  1G8M A;  3UO3 A;  2AZ0 A;  1SQF A;  5LP6 A;  1EZJ A;  5L3G A;  3L70 H;  4DW1 A;  1S76 D;  4ZOL A;  2IH1 C;  5KX5 B;  4DUZ O;  3JAR A;  4NVP A;  1EN6 A;  1V9P A;  1B04 A;  4DK0 A;  4JI5 B;  4CH6 A;  1IX9 A;  4LH6 A;  2ATK C;  2ZDI C;  4J11 A;  3HKE A;  3OT7 A;  2XAG A;  3CEI A;  5CA3 A;  1JQ0 A;  5B1O A;  1Q8I A;  5LMU B;  5AG2 A;  1K73 W;  3SGI A;  1V55 C;  1FXK C;  4YHH B;  3J81 N;  3AK2 A;  4JI0 B;  1K9M W;  1QR9 A;  4X88 A;  1KUQ A;  1HNX O;  3FD9 A;  3CCV V;  2E5L O;  3BAB A;  1VQO V;  1Y76 B;  1Z2G A;  4MTG A;  5L3E A;  1EN5 A;  1XBL A;  4CC6 A;  3H1L H;  3JSN A;  2PF4 E;  5LYJ B;  1YI2 V;  3JAW B;  4LF8 O;  1W59 A;  1HNZ B;  1GK9 A;  4GX2 A;  1Q3E A;  1U96 A;  1G4Y B;  1NI8 A;  3AG4 B;  2MW2 B;  1XNQ B;  3E8B A;  1YTF B;  2UU9 B;  1KP3 A;  3FKS G;  3J80 N;  2Y0P A;  5KX5 A;  1ZWI C;  1XQ8 A;  1BS3 A;  2OCC C;  2BSK B;  4J9Z B;  1K34 A;  1VQ4 V;  4EB6 B;  4X64 O;  1JX9 A;  2Y69 B;  4PD4 F;  5EZY A;  1WPX A;  2RCV A;  2JGD B;  3SJB C;  5BR8 O;  1GAX A;  3U11 A;  2RMK B;  1IZ3 A;  1M57 B;  2WLJ A;  4DV2 O;  3OGC C;  4LBE C;  1DF5 A;  1BQZ A;  4DV1 O;  4FZ0 A;  1W2B U;  1P7G A;  1US6 A;  2D3O W;  1Y76 A;  5IYZ B;  2JEU A;  5H5N A;  2Q69 A;  4WFE A;  3JAW A;  2VQE B;  3M7M X;  3BHP A;  3OAA G;  1IBK B;  1X59 A;  4UCR A;  2YI8 A;  4B7E A;  5H6R A;  1OCR C;  2ZT9 B;  2Q67 A;  1I08 A;  1ZLZ A;  2A7W A;  3CD6 V;  4JAV A;  4PDM A;  4GLX A;  5CN0 A;  2VQF B;  3C90 A;  3SJQ C;  3Q4H B;  2Y0I A;  5LBQ A;  5K1X A;  1QU7 A;  2JJ1 G;  5LGT A;  3RYH A;  4BWA A;  3BPZ A;  1D5A A;  4ZHQ B;  5EC2 C;  4WFH A;  3A8T A;  3E89 A;  3FB5 C;  4O4L B;  5DN6 G;  3LDC A;  1KKC A;  1EFR G;  1AP6 A;  1FYJ A;  5BMV A;  2P90 A;  3AG1 B;  2FML A;  3G6E V;  3L9D A;  4DV5 O;  1S5H C;  1SZT A;  1FAF A;  2F23 A;  5IYZ A;  2BE3 A;  5LHI A;  4JYA O;  3JSL A;  4JI6 B;  3GWO A;  3OMA B;  1XL6 A;  5KHK A;  1XNR O;  4MVS A;  1TUB A;  2UXD O;  4J41 A;  2WWW A;  4ZI7 B;  1XUQ A;  3CB2 A;  2ZM6 O;  2JGU A;  3W7S A;  3WU2 Z;  3E86 A;  2ILM A;  3A0H Z;  1TUE B;  4X1Y B;  2DOS A;  1M9N A;  3A0B Z;  4QJF B;  4QNH B;  1WA8 B;  3CHX A;  1I94 B;  4F6R B;  3Q4H A;  3ABT A;  2HP8 A;  1R3L C;  3QNE A;  3G4S V;  4DW0 A;  3VBB A;  1IBL B;  1VF6 A;  4JI3 O;  4NXM B;  4EEQ A;  4KUM A;  4PEL A;  4FLU A;  2EIN B;  1VQK V;  3RW0 A;  4PJ0 Z;  5B1B B;  1N4C A;  5LMU O;  4X1K B;  2R70 A;  4WBN A;  3RYF A;  2QM4 A;  2HG5 C;  3OD4 A;  1LUW A;  2L6L A;  4FFB B;  5L3C A;  4JI0 O;  5EIB D;  3CRA A;  5L3B A;  1N33 B;  3CCR V;  3DGE A;  3L71 H;  1Q6H A;  1YF2 A;  4I4T B;  3CCE V;  4QPK A;  1K4C C;  2DYS B;  3LUT B;  3VQV A;  1QVG U;  5KAF Z;  3JAK A;  1IXM A;  2XTA A;  2OCH A;  1HNZ O;  1E1Q G;  3CME V;  2QWN B;  2EIK B;  3WG7 C;  5GON A;  5CBG A;  1PNM A;  4HAM A;  3K9S A;  4PDV A;  4DR7 B;  2D2C B;  2XAF A;  3K5N A;  3ZJZ A;  4F6R A;  3ZN1 A;  3ZHS A;  1JJO A;  1JVM A;  2BOB C;  2E3C A;  2V4D A;  2WLI B;  1KKD A;  2DE0 X;  4P2Z A;  5JH7 A;  4U7N A;  1M90 W;  3KG2 A;  4N23 A;  4YJ3 A;  2QKC A;  4JTC B;  4DYL A;  4GX1 A;  5IDJ A;  4I9Q A;  4WFF A;  3SPJ A;  2ZE7 A;  3AG2 C;  2IJK A;  1GTO A;  1H2M A;  4X1K A;  3TXQ A;  4MTO A;  3CCS V;  3SPI A;  4FFB A;  1S5J A;  3X2Q C;  3K08 A;  2UXC O;  1AJQ A;  3K04 A;  4JYB A;  1M56 B;  2YXL A;  1VP7 A;  2A06 H;  4W4K A;  3ZMS A;  1IBK O;  2K9P A;  1J5E O;  1DLB A;  1LUV A;  4PDR A;  3L73 H;  3STL C;  4ABM A;  1I0H A;  2HVK C;  4MVO A;  2XOK G;  4HBN A;  1SQB H;  3IC7 A;  2KB1 A;  5LHH A;  3U10 A;  2WLI A;  3AG4 C;  3JD2 A;  4AIL C;  1B06 A;  2ZR3 A;  3ZHU A;  2JIZ G;  1Y74 A;  1VMG A;  3ZBH A;  1AP5 A;  1R6T A;  1XMO B;  2HKO A;  3W7T A;  2EX3 A;  2YIC A;  4LNU A;  3IGA C;  5LOV B;  4WFB V;  2WLL B;  3H1H H;  1H2N A;  3W7W A;  2IJH A;  4X8A A;  4L87 A;  2UUA B;  1KYO F;  1I5Y A;  4ASU G;  4IHJ B;  4K0K O;  3ICX A;  1IVS A;  3JAS A;  4B3M O;  3H01 A;  5LGU A;  2PY5 A;  1HR0 O;  4DRX A;  3FAV B;  2AGA A;  3KCX A;  4GKK O;  1M57 C;  2JEX A;  4JI6 O;  4IYI A;  4O2B B;  4UB8 Z;  3FYI B;  4CBC A;  5J2T B;  5IYC O;  3BFR A;  3JD4 A;  1S77 D;  1AR5 A;  4LCU C;  3T1H O;  5D5P A;  2GUZ A;  4FK5 C;  2DQ3 A;  2P7T C;  1FFX A;  3E22 B;  3CJH B;  3LSS A;  4QIW F;  5JCO A;  2M6Y A;  4LFC O;  2PYL A;  4NTX A;  1IBL O;  2CK3 G;  2JS5 A;  3RYI B;  3SJC C;  1VEW A;  1AJP A;  4LF9 B;  4MTX A;  2H8P C;  2N05 A;  1GRJ A;  4X20 B;  4BIU A;  2HEP A;  2YSU B;  5BY1 A;  5K1P A;  2HJD A;  1HDJ A;  4IHJ A;  4UB6 Z;  1U97 A;  1T5E A;  2EIL C;  2Q73 A;  4H13 B;  5CBH A;  2IBZ H;  2ZE5 A;  4PDL A;  2UUC B;  3W7U A;  4K8Z A;  2Y48 A;  3AG7 A;  3FAV A;  3UQ8 A;  5J2U A;  1FXV A;  1MAB G;  5J9P C;  5HFL A;  1VQ7 V;  4CS2 A;  1BCC H;  3E83 A;  2UUB O;  3ZRS A;  4DXW A;  2PI5 A;  1SC5 B;  4O2B A;  4TV9 A;  1NT2 B;  3I55 V;  2O57 A;  4GX5 A;  1S5L Z;  4F4L A;  3FFQ A;  4MVZ A;  3T4D A;  1JJ2 U;  2CTR A;  2LGQ A;  4HNA B;  3E22 A;  1Q86 W;  1JFF B;  3ETQ A;  3ETG A;  3AG3 B;  1YZB A;  3DXR B;  4LF5 B;  4WF9 V;  2Q0O C;  1PNK A;  4PHZ A;  4FMT A;  4XDL A;  4DV6 B;  3ZMU A;  1F4M A;  4DV3 B;  2X6A A;  1PP9 H;  5FPR A;  2F66 C;  3ABU A;  5LP6 B;  5KHH A;  4O2A A;  3P3P A;  4ZOL B;  5LHG A;  2G38 A;  2BOC C;  4GX0 A;  1H2G A;  4YXW G;  2OWO A;  5KHI A;  2FB5 A;  3JAR B;  4X20 A;  4KHP O;  4ZBM A;  1AI4 A;  2LO1 A;  3P32 A;  1F23 A;  2EIN C;  3I56 V;  1THZ A;  1KD1 W;  5B1B C;  2RNB A;  2WA3 A;  3HKE B;  2Y4T A;  5FNV B;  2P22 C;  3RVY A;  4AHC A;  5LXT A;  4I5S A;  1QHT A;  4JI1 B;  3JCZ A;  3SPG A;  1RSO A;  1NQT A;  5KLV H;  1VQM V;  2WAM A;  3KCY A;  3OUF A;  2ARH A;  5IWA O;  4U3J A;  2ZXW B;  3RBZ A;  2DYS C;  1JFF A;  1PNL A;  3DXR A;  1OV9 A;  3ABM B;  3LNN A;  4E4E A;  2EIK C;  1HNW O;  4CZZ A;  4UCO A;  1Y67 A;  1BQ0 A;  4LF7 O;  3CS5 A;  4I0X A;  2RDC A;  3G80 A;  4KFM A;  4U3F H;  2QM7 A;  3EXA A;  1YHQ V;  1R3I C;  1RFY A;  3BA8 A;  4NXN B;  2QGN A;  2ZKO A;  1K3E A;  1ZTE A;  5EZY B;  5LMN O;  5D5Q A;  5FNV A;  1WAZ A;  2P6J A;  3CXH F;  3ZRW A;  1BZK A;  1S3J A;  4DR2 B;  4PA4 A;  4ZIB A;  4DV0 B;  4X62 O;  3F7V C;  5FPO A;  4OX9 O;  4FM1 A;  2F4V O;  3CRR A;  4LF4 B;  1CXZ B;  5C8Y A;  1M56 C;  4LFA O;  3CSX A;  1TAE A;  4Q20 A;  4DV4 O;  3OM3 B;  4JI7 O;  3QO5 A;  1PPJ H;  2EBO A;  4DO2 A;  2EIJ B;  4J10 A;  1JR9 A;  1L8D A;  1RPO A;  5IT9 N;  4B7K A;  3I5D A;  1R6N A;  3JD3 A;  3FB8 C;  4JAA A;  3SYQ A;  1N32 O;  5IJ9 B;  1UPG A;  2RJZ A;  3CX5 F;  4YJ2 A;  3FX7 A;  4DR1 O;  4JYY A;  3DSQ A;  2CTQ A;  3R65 A;  1VF5 B;  4AQY B;  1QLN A;  2HR3 A;  1VQL V;  2Z3Y A;  4BR6 A;  1GM8 A;  3MHS C;  2W0F C;  3SYA A;  1SRY A;  1JOY A;  1DF4 A;  3RYH B;  1K5Q A;  2ZE6 A;  2GTS A;  1AR1 B;  4E2L A;  2EZO A;  1YCI A;  1VQ6 V;  1QLE B;  4GT1 A;  1AI6 A;  3JAL B;  5BMV B;  1XHZ A;  2DYR B;  4JI8 B;  4DR5 B;  4IL6 Z;  4N21 A;  1KU9 A;  2R9R B;  2X0L A;  1ZSP A;  2P5O A;  4JYC A;  2LW7 A;  1AI7 A;  3M8A A;  4GKJ O;  2LFR A;  4J7J A;  4ZKI A;  4MTF A;  1N0N A;  3T1C A;  4FM2 A;  4UFZ A;  1FJG B;  1TUB B;  5IJ9 A;  1YSC A;  1QQC A;  1IBM O;  1SQQ H;  1S72 V;  3CCL V;  4RUF A;  4JI4 B;  1PL4 A;  3EHB B;  2QSA A;  3RYC A;  4EFB A;  4D7T A;  3QF7 A;  2WA4 A;  1F4N A;  5BZB A;  1TA8 A;  4IIJ A;  3P3N A;  1GN4 A;  5JVD B;  3QO7 A;  1H2S B;  5ITZ B;  2Y4U A;  2Q5Z A;  1ZAU A;  3K5M A;  5KMG B;  2OT5 A;  1JPX A;  1M5I A;  4DR4 O;  1FPO A;  3AK3 A;  4MS2 A;  1KBH A;  4OPA A;  2AZ2 A;  3ABK B;  4ICG A;  1XDC A;  2YC0 A;  4R8C A;  3JAL A;  3L75 H;  3M99 B;  2A79 B;  1OCC B;  4P9O A;  4LFB B;  1K5S A;  4EFE A;  4WBN B;  3RYF B;  1RP3 B;  1AI5 A;  1MOF A;  5FL7 G;  1ARO P;  3SJA C;  2ZQM A;  4TWK A;  3H9V A;  5CA0 B;  4CH5 A;  1K8A W;  1B6Q A;  1Q6I A;  3JAK B;  3WB1 A;  1VQP V;  1XMQ B;  1IDS A;  5LA6 A;  3CPW U;  2ZNJ A;  1NKD A;  2Q7G A;  4MW8 A;  4JI2 O;  5GON B;  3GVM A;  4DR3 B;  1PV0 A;  4PA9 A;  4JAS A;  2HHH B;  3D36 C;  3FB6 C;  4FM0 A;  4WCE V;  3FB7 C;  5JVD A;  1WNS A;  2NR5 A;  5GTI Z;  1VQ9 V;  5ITZ A;  4JI5 O;  4OGQ B;  5JH7 B;  5LP6 C;  4J42 A;  1AJN A;  4B3R B;  2W6J G;  3CWB H;  3E8F A;  3QO8 A;  4YJ3 B;  1YJN V;  5KMG A;  4Z1M G;  3WB0 A;  3MAQ A;  3SPC A;  2WSS G;  4XDJ A;  4JTA B;  4DR2 O;  1ORQ C;  3N2G B;  1P49 A;  3ASO C;  1N8R W;  1K7D A;  5L3D A;  4YHH O;  4DR6 B;  4DV7 B;  3DC6 A;  5LGN A;  5EYP A;  1DK1 A;  2PGG A;  3B8M A;  1J95 A;  1SES A;  2AHZ A;  3K59 A;  1M4U A;  2F43 G;  3F5W C;  3H1J H;  4PA3 A;  2DJV A;  5CA0 A;  2HJF C;  3RWR D;  3EVK A;  4DUY B;  3HKD A;  2ZXW C;  2OIE A;  4RQE A;  3ZRX A;  2ITD C;  3UT5 A;  2HVJ C;  2ZE8 A;  4TT3 G;  4RQF A;  4X1I A;  2UXB B;  1XNQ O;  2UU9 O;  4Z2W A;  3JD1 A;  4LF6 B;  3ZRV A;  4UVC A;  5CBF A;  1VQ8 V;  4YY3 B;  4AQY O;  4JV5 B;  1I7F A;  3ZHQ A;  5CB4 A;  1RM1 B;  3E2E A;  4B3S B;  2V7Q G;  1DTO A;  4CC5 A;  3CC2 V;  2PI4 A;  1VQN V;  3LSQ A;  1MSD A;  1Y74 B;  2Q8V A;  2ZIM A;  1TVK B;  2IW5 A;  2BTO A;  3TCU A;  3AK1 A;  1NBM G;  2CTW A;  4LNU B;  4TQD A;  3ZIA G;  2W6I G;  4BIZ A;  3N2G A;  2JJ2 G;  1NTK H;  5A2Q N;  1R3K C;  2QTS A;  3TET A;  1YIT V;  3TJT A;  4P9P A;  4RUE A;  1EZV H;  2IH3 C;  1NZ6 A;  3JAS B;  1GH6 A;  4DRX B;  1COW G;  2Q4P A;  2PZS A;  2DQ0 A;  1SQP H;  4F6E A;  3OMN B;  2HLD G;  4FLT A;  3UM7 A;  4TQF A;  2VQE O;  3H1K H;  1G6U A;  4MVU A;  1FXK B;  3PN1 A;  2EIJ C;  4JZ2 A;  2GUZ B;  3L74 H;  1URF A;  1KQS U;  4OXS A;  2ADP A;  2PTM A;  1E79 G;  1Q82 W;  3QG5 A;  1FFX B;  1P84 F;  2VQF O;  2A9H A;  4KP4 A;  1BHA A;  3MHH C;  2R9A A;  2FKX A;  2EZP A;  1TVK A;  4I55 A;  3BVO A;  1Q7Y W;  4MVM A;  2AHY A;  1X4T A;  2ZNI A;  1AB3 A;  1SA0 B;  2JS3 A;  5GTH Z;  3OFN G;  5KHJ A;  2DMX A;  2GV9 A;  5CA1 B;  4B3T B;  2Y69 C;  1QVF U;  3CRC A;  3N2K B;  2JRI A;  5B1N A;  2ZDI A;  4TOI A;  1QLE C;  2KSD A;  1Y66 A;  2QWQ B;  3B09 A;  2NLJ C;  1W0J G;  4DUZ B;  3HKB A;  5J2U B;  2C2A A;  3QVN A;  4J80 A;  2DYR C;  2QTO A;  1H38 A;  2NNU A;  4TV9 B;  1NTZ H;  1FXK A;  2YXY A;  1XMQ O;  5JQG B;  3TGU H;  4PI2 A;  3ABL B;  4P30 A;  5JJJ B;  4IYH A;  4QGP A;  2WPD G;  1OCO B;  2DWE C;  3T1Y B;  1I94 O;  1Z5W A;  3RN4 A;  2YXH A;  1CEZ A;  4NXM O;  5LL6 Y;  3KZI Z;  5F2V O;  2E5L B;  1SA0 A;  2DW4 A;  2GTA A;  4O2A B;  1H8H G;  1H2L A;  1SF9 A;  2LFS A;  1AIL A;  1FS0 G;  4LF8 B;  3ZX6 A;  5CA1 A;  2CAZ C;  1VF6 C;  2QWR B;  3CCQ V;  2ZCE A;  3N2K A;  2R72 A;  2CDY A;  4EKW A;  4DR6 O;  1BT8 A;  3UO2 A;  3J7A U;  3N27 A;  1N33 O;  4XDK A;  3ABK C;  2Q9L A;  3C3T A;  5B1A B;  2IM9 A;  2QE7 G;  1OCC C;  3HR0 A;  3WB2 A;  5LXT B;  3AG1 C;  2IU3 A;  4H37 A;  2ZIO A;  2AXT Z;  4FLW A;  4DUY O;  1RSO B;  3D3I A;  3ZS8 C;  5JQG A;  1OCZ B;  5B66 Z;  1OJH A;  4U3J B;  5BR8 B;  4CH3 A;  2UXB O;  1PKX A;  3ZMV A;  2OYQ A;  1IUR A;  1JCH A;  4DR7 O;  5DED A;  2XHB A;  4UVB A;  4MVQ A;  1V54 B;  4UV9 A;  2F93 B;  3THO A;  2ADQ B;  4MVR A;  4DV1 B;  3B77 A;  4X65 B;  1L0L H;  4O4J B;  4R50 A;  2EJR A;  3A0R A;  4I0X B;  2YEV B;  2CH7 B;  1SZX A;  1N34 B;  1NVP B;  1GN2 A;  2IJI A;  5B3S B;  2FL4 A;  1YVW A;  3ZHR A;  5CMU A;  3BA9 A;  2LGW A;  4LC1 A;  5JWP A;  2YUA A;  4H33 A;  2OIG A;  2CUG A;  1D5N A;  3F5T A;  3ZRW B;  4BAY A;  4QE7 A;  1Q43 A;  5B5E Z;  3APO A;  5IY5 B;  2ITC C;  2QM8 A;  4RO2 A;  5C8Y B;  5JJN B;  3F7Y C;  4XBF A;  1NR7 A;  2Q7H A;  5EBL C;  1MNG A;  4LP8 A;  3OEH G;  2YI9 A;  1LNQ A;  1M93 A;  2N74 A;  3LDE A;  4YIO A;  3UKM A;  4DV5 B;  4O4J A;  4NB5 A;  1QCE A;  4UV8 A;  4X89 A;  4TUY B;  3ZHV A;  2YIB A;  4YJ2 B;  4JYA B;  1F7Y A;  3S3X A;  2YEV A;  1XMO O;  4H0L B;  1HWY A;  3SPH A;  3RGB A;  4O4H B;  2CH7 A;  1RM1 C;  3C3S A;  1XNR B;  5GW7 A;  2OTL V;  2UXD B;  3CYO A;  1G1X B;  2XAH A;  4PA7 A;  2YID A;  4B3T O;  5DM6 V;  2ZM6 B;  3ZHT A;  2UUA O;  2KG7 A;  3S3W A;  1H8E G;  4J7K A;  1XI1 A;  1ZL8 B;  3GB7 C;  4UCT A;  1B3Q A;  1YDX A;  1I5X A;  2L35 A;  5IE9 A;  3K57 A;  1SET A;  1Q81 W;  4JI3 B;  3QTC A;  3AG2 B;  1K4D C;  2MK3 A;  4CS4 A;  3ZMZ A;  3K3W A;  3JAT A;  4DK1 A;  3CRQ A;  3X2Q B;  3SYP A;  1OZ0 A;  1GMG A;  4NYK A;  1VQ5 V;  3OMI B;  3G67 A;  5EBW C;  2CTP A;  3T1Y O;  1VAR A;  3DC5 A;  4TUY A;  1MSW D;  1FXH A;  1Q90 D;  4G27 B;  4UXN A;  4CS3 A;  2WLK A;  1K92 A;  3CRM A;  2B9Z A;  5H9C A;  4O4H A;  5JCO C;  1OHH G;  2CGO A;  1MZE A;  4GZR B;  3L72 H;  3RYC B;  2E75 B;  1NU1 H;  4LF9 O;  2BCC H;  3CP1 A;  1ZUQ A;  4IIJ B;  5IJ0 B;  3T4Z A;  2V1D A;  3VQY A;  2UXN A;  1XHX A;  1MZF A;  1WP8 A;  3D8C A;  2PYJ A;  2P4V A;  1KMI Z;  1ZL8 A;  4IGG A;  3K5L A;  2UUC O;  3VQX A;  2ZR2 A;  3PJS K;  4D6T H;  4WFA V;  1NTM H;  4Q6G A;  1D2D A;  2R9I A;  2AW9 A;  3SDL A;  3VQW A;  2RQ6 A;  3OR6 C;  2UXX A;  5EK0 A;  4X66 B;  2FYU H;  2B5U A;  1TGO A;  3G6B A;  1R1B A;  1XOU A;  3K03 A;  2A0L A;  1NH2 D;  2ZD9 A;  4IT5 A;  2GDS A;  2WLH A;  1R73 A;  2QWO B;  5EC1 C;  1PL0 A;  4LF5 O;  1IXB A;  3ABL C;  5LA6 B;  4DV6 O;  2UXC B;  1SQG A;  3OGI B;  2P4K A;  2XND G;  1OCO C;  1WB7 A;  2YIA A;  4DV3 O;  4X65 O;  2Z0A A;  1LR1 A;  4TV8 B;  3A2F A;  1EM1 A;  3ML0 A;  4L8J A;  1N0J A;  2ZIN A;  5LYJ A;  4K35 A;  1N34 O;  3E35 A;  5IJ0 A;  1J5E B;  3ETD A;  3K9A A;  5KUK A;  1QBZ A;  3CC4 V;  5E1A C;  3DTU B;  4UUJ C;  2BSK A;  2GHY A;  3LNM B;  1F51 A;  2QR4 A;  3W7X A;  2EIM B;  4JI1 O;  2LJ2 A;  4EB6 A;  4FLY A;  2H3O A;  2JGD A;  5EYP B;  2M7W A;  4U7O A;  4YIP A;  2P67 A;  5B1A C;  2XUM A;  3ZMT A;  2EIL B;  1AR4 A;  4K3A A;  4G2K A;  2YIB D;  2N04 A;  2Z5U A;  4LR3 A;  2EUL A;  4JF3 A;  1OCZ C;  3CXC U;  2B1I A;  4GUN A;  3OTO B;  1NVP D;  3HKD B;  4K0K B;  3UT5 B;  3G71 V;  3SR2 C;  4B3M B;  3OR7 C;  1ZX3 A;  3OEE G;  1HR0 B;  4X1I B;  3AG3 C;  4GKK B;  4TV8 A;  1V54 C;  3K58 A;  2JDI G;  1QR8 A;  1VF7 A;  4PA6 A;  1M1K W;  1MG1 A;  4JZG A;  1KB9 F;  3NR7 A;  3ASN B;  4GYC B;  4QPJ A;  4KL1 A;  3IJ4 A;  5CB4 B;  1Q6U A;  1Y6X A;  1YXB A;  2NN4 A;  3T1H B;  1S0V A;  4NXN O;  4FLX A;  4FLZ A;  1SQX H;  5C93 A;  5B3S C;  2DWD C;  1QNM A;  1HP8 A;  1P7B A;  4LFC B;  3WFV A;  4DV0 O;  1EBO A;  1SS3 A;  1YEW A;  4RAI A;  1NR1 A;  2IU0 A;  2Q7E A;  1K97 A;  5IYD O;  5KA5 A;  3FYE B;  4LF4 O;  4TSF G;  4ZHQ A;  2XT9 A;  1XIL A;  2E76 B;  3CC7 V;  5IY5 C;  1L0N H;  4O4L A;  4PI0 A;  4MT8 A;  5A9G A;  1Y4M A;  3SYC A;  5E79 Z;  1YJW V;  4W4L A;  4I7Z B;  2PUS A;  3OW2 U;  2GSM B;  1A32 A;  3UCS C;  1GO3 F;  1AVM A;  4B08 A;  4I50 B;  2QWP B;  3OE7 G;  1NJI W;  3ABM C;  2UUB B;  1WJZ A;  4O4I B;  5KA6 A;  2WLM A;  3CCJ V;  3IFX A;  5EIB C;  4NTW A;  4OPH A;  3KKY A;  4ZI7 A;  3D3Q A;  1YIJ V;  2KQX A;  1SKV A;  3IC9 A;  4I55 B;  3JYC A;  3STZ C;  2F1M A;  3GWK C;  4X1Y A;  3HB3 B;  1WA8 A;  3K0D A;  1VIB A;  3NXS A;  1CP9 A;  2Q0A A;  1XRE A;  1O9G A;  4RWU A;  3BEH A;  1BHB A;  3E8H A;  3RT3 C;  4PV1 B;  4X66 O;  2F95 B;  2W0X A;  4JI8 O;  3U0Z A;  1CPY A;  1JA8 A;  4DR5 O;  3K0G A;  1FD9 A;  3R66 A;  2YDE A;  3HKB B;  1UJW B;  1EN4 A;  4KHP B;  2WLN A;  3K79 A;  2DN9 A;  4H44 B;  5EBM C;  5KAI Z;  2P06 A;  4K8X A;  1V55 B;  2X6C A;  1FJG O;  5HFM A;  1WPB A;  5TIS Z;  4I50 A;  4NTY A;  1JMK C;  1YTF D;  4I4T A;  5H6Q A;  4O4I A;  4JI4 O;  1UFI A;  2X6B A;  4UCS A;  1GN3 A;  5IYB O;  1Q5O A;  1SQV H;  4FZ1 A;  4FJC C;  4FFK A;  3ETE A;  5IWA B;  1XEQ A;  2QDO A;  2LQT A;  4UVA A;  3TXS A;  2GBO A;  5KHG A;  3JAM N;  4FIP C;  4G28 B;  1O9H A;  3VOU A;  2QA4 V;  1N36 B;  3JD0 A;  3HKC B;  1HNW B;  2OCC B;  1ENV A;  2CE4 A;  4FVM A;  4J7Z A;  2JK5 C;  4LFB O;  4LF7 B;  4QE9 A;  1BE3 H;  2E74 B;  1E1R G;  2BTQ B;  2VS0 A;  4A5U B;  4FPP A;  2VRZ A;  1BSM A;  3OTO O;  1R6K A;  2LP7 A;  3RFR A;  1GM9 A;  5LMN B;  4LH7 A;  2XAS A;  1BMF G;  3K06 A;  3OUS A;  1K33 A;  2FTK A;  4JGS A;  4DR3 O;  2OTJ V;  2HHH O;  4NR1 A;  2JVD A;  4X62 B;  3E8G A;  4BW5 A;  4UCV A;  4OX9 B;  2F4V B;  5KUM A;  4LFA B;  1FKA O;  4J9Y B;  1HNX B;  1NH2 B;  2VWK A;  4DV4 B;  4JI7 B;  4B3R O;  4FLV A;  1OCR B;  3LDD A;  4HZ3 A;  2ETN A;  1P4R A;  1GN6 A;  2LW1 A;  3HKC A;  1WB8 A;  3O9O A;  1N32 B;  2XAQ A;  3P30 A;  1KP2 A;  1WP7 A;  2Q68 A;  2BTQ A;  2CGN A;  4DV7 O;  2QEX V;  2H94 A;  1L1F A;  4DR1 B;  4JPR A;  1FFT B;  2EIM C;  5LOV A;  2B1G A;  5DEC A;  3BY6 A;  3ZED A;  2WLL A;  1Z5V A;  3MDS A;  4X64 B;  4WFG A;  2RN9 A;  4UCU A;  4LWS B;  2VWJ A;  1XL4 A;  2K1E A;  1PM9 A;  2YS8 A;  3B2E E;  3B40 A;  4LF6 O;  4R6Z A;  2QJ1 A;  3T2M A;  2A3Q A;  4YY3 O;  4CH4 A;  1GKF A;  1PD3 A;  4DV2 B;  3LSU A;  3IAY A;  4JV5 O;  1ROP A;  3B8N A;  5BXZ A;  5J2T A;  1YJ9 V;  4B3S O;  4BIO A;  1MA1 A;  4X9Q A;  2Q6A A;  4GKJ B;  3TK1 A;  5H2F Z;  1DGS A;  3CCU V;  3ASN C;  3ZCC A;  3CJH A;  4C7U A;  2EJ7 A;  3O65 A;  3JCU Z;  4JAU A;  1BL8 A;  4HYO A;  1KC8 W;  1IBM B;  5JJE B;  3ZN0 A;  3B4S A;  3BCC H;  3HPL C;  3BAA A;  4JTD B;  3RYI A;  4AI8 A;  2KG7 B;  4MW3 A;  4R7C A;  5L3F A;  1R3J C;  2QKA A;  4MSW C;  1H2K A;  2IJJ A;  3EFF K;  3APQ A;  2KKW A;  1GM7 A;  1BGY H;  4LWS A;  3RVZ A;  1RPR A;  1WN7 A;  1HW7 A;  3ASO B;  1MMM A;  3CE2 A;  3JAT B;  4Z1V A;  4DR4 B;  4GCZ A;  2XAJ A;  1SER A;  1NS1 A;  2X7R B;  4NKG B;  3MD0 A;  3OTF A;  3CCM V;  4I9W A;  3CMA V; 
#chains in the Genus database with same CATH homology
 5IYC O;  3JD4 A;  1S77 D;  4TT3 G;  4RQF A;  4LCU C;  1W0K G;  2HFE C;  2XND G;  1OCO C;  4FK5 C;  3SYO A;  2DQ3 A;  3JD1 A;  3ZRV A;  3WG7 B;  4UVC A;  5CBF A;  2P7T C;  1VQ8 V;  1WLE A;  3ML0 A;  3LSS A;  3D36 A;  4QIW F;  3AEI A;  3E35 A;  3E2E A;  1RM1 B;  2QKS A;  2V7Q G;  3ETD A;  1DTO A;  3CC2 V;  3K9A A;  5KUK A;  2PI4 A;  1VQN V;  2CK3 G;  3LSQ A;  1KEC A;  1G8M A;  1EZJ A;  5L3G A;  1S76 D;  2IW5 A;  1QBZ A;  3TCU A;  1NBM G;  3CC4 V;  1AJP A;  2IH1 C;  3ZIA G;  2W6I G;  4BIZ A;  5E1A C;  3DTU B;  4MTX A;  4UUJ C;  2H8P C;  2GHY A;  3LNM B;  2JJ2 G;  1F51 A;  3W7X A;  1R3K C;  3TET A;  2EIM B;  1YIT V;  4BIU A;  4P9P A;  2YSU B;  4RUE A;  2ATK C;  2ZDI C;  2EIL C;  5CBH A;  4PDL A;  2IH3 C;  2M7W A;  4U7O A;  3W7U A;  2P67 A;  2Y48 A;  5B1A C;  3ZMT A;  2XAG A;  2EIL B;  1FXV A;  1COW G;  1JQ0 A;  1MAB G;  4G2K A;  5B1O A;  5CA3 A;  5J9P C;  5HFL A;  1VQ7 V;  2DQ0 A;  2Z5U A;  3E83 A;  3OMN B;  1K73 W;  2HLD G;  1V55 C;  3UM7 A;  3ZRS A;  4DXW A;  4JF3 A;  2PI5 A;  1OCZ C;  3CXC U;  1FXK C;  2B1I A;  3I55 V;  1NVP D;  4GX5 A;  4MVU A;  3G71 V;  1FXK B;  3OR7 C;  4F4L A;  1K9M W;  1QR9 A;  3OEE G;  4MVZ A;  2EIJ C;  4X88 A;  3AG3 C;  3T4D A;  1JJ2 U;  1KQS U;  3CCV V;  1V54 C;  4OXS A;  2JDI G;  1QR8 A;  4PA6 A;  1VQO V;  1Q86 W;  4MTG A;  1E79 G;  3ETG A;  5L3E A;  1Q82 W;  1M1K W;  1MG1 A;  3AG3 B;  1YI2 V;  4WF9 V;  3ASN B;  2A9H A;  1PNK A;  4QPJ A;  1GK9 A;  4FMT A;  4KP4 A;  4GX2 A;  1BHA A;  4XDL A;  3ZMU A;  3MHH C;  1F4M A;  1G4Y B;  2EZP A;  1S0V A;  3AG4 B;  3E8B A;  1YTF B;  1Q7Y W;  2X6A A;  4MVM A;  2AHY A;  3ABU A;  1KP3 A;  3FKS G;  5LHG A;  2BOC C;  5C93 A;  1ZWI C;  5B3S C;  2OCC C;  4GX0 A;  1H2G A;  4YXW G;  3OFN G;  2DWD C;  1P7B A;  3WFV A;  4J9Z B;  1AI4 A;  1EBO A;  4ZBM A;  1K34 A;  2Y69 C;  4RAI A;  2IU0 A;  1NR1 A;  1VQ4 V;  3P32 A;  1QVF U;  1F23 A;  1K97 A;  5IYD O;  2EIN C;  5KA5 A;  3I56 V;  1THZ A;  1JX9 A;  1KD1 W;  3FYE B;  5B1B C;  5B1N A;  2ZDI A;  2Y69 B;  1WPX A;  1QLE C;  4TSF G;  1Y66 A;  3RVY A;  2NLJ C;  1W0J G;  3CC7 V;  2C2A A;  5IY5 C;  4MT8 A;  1Y4M A;  4I5S A;  3SYC A;  2DYR C;  1YJW V;  2QTO A;  3JCZ A;  3SPG A;  1H38 A;  1M57 B;  1NQT A;  2NNU A;  2WLJ A;  3OGC C;  3OW2 U;  1VQM V;  2GSM B;  1FXK A;  2WAM A;  3OUF A;  4LBE C;  1DF5 A;  1GO3 F;  2ZXW B;  3RBZ A;  1W2B U;  3ABL B;  2DYS C;  4P30 A;  3OE7 G;  1NJI W;  2D3O W;  2WPD G;  3ABM C;  2JEU A;  1OCO B;  2DWE C;  1PNL A;  5KA6 A;  2WLM A;  2Q69 A;  4WFE A;  3CCJ V;  3IFX A;  3ABM B;  3OAA G;  2EIK C;  5H6R A;  1YIJ V;  4CZZ A;  1OCR C;  1CEZ A;  2Q67 A;  3JYC A;  3STZ C;  3HB3 B;  3CD6 V;  2DW4 A;  4JAV A;  4KFM A;  2QM7 A;  1H8H G;  4PDM A;  5CN0 A;  2LFS A;  3K0D A;  1FS0 G;  3SJQ C;  3NXS A;  1CP9 A;  1YHQ V;  1R3I C;  3CCQ V;  3BEH A;  1BHB A;  3E8H A;  5LBQ A;  2JJ1 G;  5LGT A;  4EKW A;  1CPY A;  1K3E A;  3K0G A;  2P6J A;  3ZRW A;  5EC2 C;  4WFH A;  1S3J A;  4XDK A;  3ABK C;  3E89 A;  3FB5 C;  4PA4 A;  1UJW B;  5B1A B;  5DN6 G;  3LDC A;  2QE7 G;  1OCC C;  1EFR G;  2WLN A;  3AG1 C;  3K79 A;  5EBM C;  2IU3 A;  4H37 A;  3F7V C;  1V55 B;  2P90 A;  2X6C A;  3D3I A;  3AG1 B;  1OCZ B;  3G6E V;  5HFM A;  1M56 C;  1S5H C;  4Q20 A;  1SZT A;  1PKX A;  3OM3 B;  3ZMV A;  1YTF D;  5H6Q A;  3QO5 A;  2EBO A;  5LHI A;  1JCH A;  4DO2 A;  2EIJ B;  1RPO A;  3GWO A;  2X6B A;  4UVB A;  4MVQ A;  1V54 B;  3OMA B;  4UV9 A;  1XL6 A;  1R6N A;  4MVS A;  5IYB O;  3JD3 A;  2WWW A;  3FB8 C;  4FJC C;  3SYQ A;  3ETE A;  4MVR A;  3W7S A;  3B77 A;  4UVA A;  4R50 A;  3E86 A;  4FIP C;  1TUE B;  2EJR A;  4G28 B;  3A0R A;  3VOU A;  2QA4 V;  2YEV B;  1M9N A;  4QNH B;  4QJF B;  3R65 A;  1QLN A;  2HR3 A;  1VQL V;  1NVP B;  2Z3Y A;  1GM8 A;  3ABT A;  3JD0 A;  3MHS C;  2IJI A;  5B3S B;  2W0F C;  1R3L C;  2OCC B;  3QNE A;  3SYA A;  1SRY A;  3G4S V;  1ENV A;  3VBB A;  5CMU A;  1JOY A;  2JK5 C;  4LC1 A;  1DF4 A;  4H33 A;  4QE9 A;  1E1R G;  1K5Q A;  4KUM A;  4PEL A;  2EIN B;  1VQK V;  1AR1 B;  4E2L A;  2EZO A;  3ZRW B;  3RW0 A;  4BAY A;  4QE7 A;  5B1B B;  1VQ6 V;  4FPP A;  1QLE B;  4GT1 A;  5IY5 B;  1AI6 A;  2ITC C;  2DYR B;  2QM8 A;  4RO2 A;  1R6K A;  2HG5 C;  2LP7 A;  1GM9 A;  5L3C A;  4N21 A;  2XAS A;  1BMF G;  3F7Y C;  3K06 A;  3OUS A;  4XBF A;  1K33 A;  2FTK A;  2R9R B;  2X0L A;  5L3B A;  3CCR V;  1NR7 A;  3DGE A;  1AI7 A;  4JGS A;  4JYC A;  2LFR A;  2OTJ V;  4ZKI A;  4MTF A;  5EBL C;  3CCE V;  4QPK A;  3T1C A;  1K4C C;  2DYS B;  3LUT B;  4LP8 A;  1QVG U;  3E8G A;  3OEH G;  4BW5 A;  1LNQ A;  1IXM A;  3LDE A;  1YSC A;  5KUM A;  1E1Q G;  3CME V;  1S72 V;  3UKM A;  2EIK B;  4J9Y B;  1QCE A;  3WG7 C;  4UV8 A;  4X89 A;  1NH2 B;  5CBG A;  1PNM A;  4HAM A;  3CCL V;  4RUF A;  4PDV A;  2YEV A;  1OCR B;  1HWY A;  3LDD A;  3EHB B;  2XAF A;  3SPH A;  4HZ3 A;  1RM1 C;  1P4R A;  1F4N A;  3ZJZ A;  5GW7 A;  5BZB A;  3ZN1 A;  2OTL V;  1JVM A;  3CYO A;  2BOB C;  2WLI B;  2XAH A;  4PA7 A;  1KKD A;  4P2Z A;  3QO7 A;  2XAQ A;  3P30 A;  5DM6 V;  1KP2 A;  4U7N A;  1M90 W;  3KG2 A;  4N23 A;  2Q68 A;  1H8E G;  2QEX V;  2H94 A;  1L1F A;  4JPR A;  1FFT B;  4JTC B;  2OT5 A;  4GX1 A;  5IDJ A;  1JPX A;  3GB7 C;  2EIM C;  4WFF A;  2B1G A;  3SPJ A;  3BY6 A;  4MS2 A;  2WLL A;  3AG2 C;  1I5X A;  2IJK A;  1GTO A;  3ABK B;  1SET A;  4R8C A;  1Q81 W;  4MTO A;  3CCS V;  3M99 B;  2A79 B;  1OCC B;  3SPI A;  4WFG A;  3AG2 B;  4P9O A;  1K5S A;  1K4D C;  2MK3 A;  3ZMZ A;  3X2Q C;  3K08 A;  1XL4 A;  2K1E A;  3K3W A;  1AJQ A;  1AI5 A;  1MOF A;  5FL7 G;  1ARO P;  3K04 A;  4JYB A;  1M56 B;  3X2Q B;  3SYP A;  4R6Z A;  2ZQM A;  1OZ0 A;  1GMG A;  4TWK A;  3T2M A;  1VQ5 V;  3OMI B;  5EBW C;  3ZMS A;  1GKF A;  1PD3 A;  1K8A W;  1B6Q A;  1VQP V;  1ROP A;  3B8N A;  1YJ9 V;  3CPW U;  1NKD A;  1DLB A;  1FXH A;  4MW8 A;  1MSW D;  4PDR A;  4G27 B;  4UXN A;  2Q6A A;  4PA9 A;  2WLK A;  3STL C;  3TK1 A;  4JAS A;  1K92 A;  3CCU V;  2HVK C;  4MVO A;  2XOK G;  3ASN C;  5H9C A;  3ZCC A;  3FB6 C;  3IC7 A;  1OHH G;  2KB1 A;  4WCE V;  5LHH A;  3FB7 C;  4JAU A;  3CP1 A;  1BL8 A;  2WLI A;  4HYO A;  3AG4 C;  1KC8 W;  1VQ9 V;  3JD2 A;  3T4Z A;  3ZN0 A;  2ZR3 A;  3HPL C;  2JIZ G;  4JTD B;  1AJN A;  2V1D A;  2UXN A;  2W6J G;  4MW3 A;  3E8F A;  3QO8 A;  4R7C A;  1YJN V;  4Z1M G;  2HKO A;  3W7T A;  5L3F A;  1R3J C;  2ZR2 A;  3PJS K;  4WFA V;  3SPC A;  2WSS G;  3IGA C;  2R9I A;  4XDJ A;  4JTA B;  4MSW C;  4WFB V;  1ORQ C;  2WLL B;  3OR6 C;  5EK0 A;  2UXX A;  3W7W A;  2IJH A;  2IJJ A;  4X8A A;  3EFF K;  4L87 A;  3ASO C;  2B5U A;  1N8R W;  1I5Y A;  1GM7 A;  1K7D A;  5L3D A;  4ASU G;  3RVZ A;  5LGN A;  1RPR A;  3K03 A;  3H01 A;  5LGU A;  3ASO B;  3B8M A;  1J95 A;  1SES A;  2AHZ A;  2A0L A;  4GCZ A;  2ZD9 A;  1NH2 D;  2F43 G;  2WLH A;  3F5W C;  2XAJ A;  4PA3 A;  1SER A;  1M57 C;  2JEX A;  1R73 A;  5EC1 C;  2HJF C;  2X7R B;  1PL0 A;  3MD0 A;  3CCM V;  3FYI B;  4CBC A;  2ZXW C;  4I9W A;  3CMA V;  4RQE A;  3ZRX A;  2ITD C;  3ABL C;  2HVJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...