5EC2C

Kcsa with v76ester+g77da mutations
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
102
structure length
100
Chain Sequence
b'ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 39
structure length 100
sequence length 102
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ec2C00
5B1AC 4MTFA 3SYQA 2AHYA 4RO2A 3K06A 3IGAC 3GB7C 4JTDB 4TWKA 4XDLA 3SPHA 5J9PC 3ABLC 3UKMA 2X6CA 4QE7A 4PA9A 2NLJC 4PA3A 3T1CA 3JYCA 3SPCA 4JTCB 4MW8A 4WFHA 3OUSA 4MTGA 5EK0A 1ORQC 4GX0A 3AG2C 1M56C 4PDLA 2WLHA 3KG2A 3SYAA 1S5HC 4MSWC 3R65A 4RUEA 4PDMA 3T2MA 2KB1A 4QNHB 3K08A 3T4ZA 5EC1C 2Q6AA 2WLKA 5KUMA 4CBCA 2WLMA 3RBZA 3SPJA 4MVUA 4OXSA 4F4LA 3LDCA 1R3JC 4R7CA 3ASNC 3E8BA 3X2QC 3SYCA 3LNMB 2WLLA 2EINC 3RVYA 1JVMA 3F7VC 3AG1C 2Q69A 2AHZA 3K03A 3OGCC 4J9ZB 5B3SC 2EIMC 3ABKC 4MVMA 4EKWA 4GX2A 3FB8C 4HZ3A 5EBMC 3OR6C 3SPIA 1XL6A 2HJFC 2WLLB 4MVOA 3T4DA 3SYPA 1V55C 3F7YC 3K04A 5CBHA 4R8CA 4XDJA 2HFEC 3STZC 3FB5C 3EFFK 2DWDC 2ZXWC 2EIKC 4QE9A 4R6ZA 2A0LA 4UUJC 2Q68A 2IH3C 4PDRA 1G4YB 1XL4A 2X6BA 4H37A 3SPGA 3E89A 4PA6A 1P7BA 4WFFA 2K1EA 2EILC 3ZRSA 4LBEC 1M57C 2X6AA 2HG5C 1BL8A 1R3KC 5EBLC 4KFMA 4MVSA 3E8FA 4LCUC 4P9PA 4WFEA 4RAIA 4P30A 3E8GA 3OUFA 2BOBC 2R9RB 3E83A 3FB7C 4ZBMA 3OR7C 3SYOA 4MTOA 3WG7C 4MS2A 2OCCC 1K4CC 1V54C 4GX1A 4H33A 2YEVA 3RVZA 1R3LC 2JK5C 4X89A 4X8AA 2BOCC 2DWEC 2HVKC 2ITDC 3E8HA 4MVQA 1LNQA 4P9OA 3BEHA 4R50A 4GX5A 4PA7A 2DYSC 2DYRC 1R3IC 4I9WA 3LUTB 4PA4A 2Q67A 5E1AC 2EIJC 2WLJA 3STLC 4RUFA 1OCOC 1OCCC 4WFGA 3K0GA 4XDKA 2ITCC 5IY5C 4P2ZA 5EC2C 3HPLC 4PDVA 3RW0A 4J9YB 5BZBA 5CBFA 3AG4C 5CBGA 2A79B 1QLEC 3ASOC 4HYOA 4X88A 2Y69C 2HVJC 3LDEA 4DXWA 5KUKA 2WLIA 3TCUA 2QTOA 3ZJZA 2P7TC 3PJSK 5B1BC 4MVRA 5EBWC 3SJQC 2W0FC 3IFXA 4JTAB 2QKSA 3LDDA 2WLIB 2ZD9A 4LP8A 1OCZC 2IH1C 2H8PC 4MW3A 3VOUA 3TETA 1K4DC 3E86A 1OCRC 2A9HA 3AG3C 1ZWIC 1KKDA 3F5WC 4MVZA 4G28B 3ABMC 3K0DA 4G27B 1J95A 3UM7A 3FB6C 2ATKC 4BW5A 2WLNA
chains in the Genus database with same CATH superfamily
4TQDA 3NR7A 1EM1A 4LF6B 2P67A 4XDLA 1YCIA 2AXTZ 3AG2B 1TUBA 3JSLA 2ILMA 4X1KB 3W7WA 3GVMA 4JI7B 1MZEA 3SYAA 5DEDA 1SS3A 2WLKA 1SZXA 4DR3O 1QR8A 1FJGB 2WLLA 3ZEDA 3RVYA 3HKEB 5LMUO 2UUAO 5A2QN 1N32O 3CB2A 4GLXA 1PNMA 4FMTA 4JI4O 1VQ8V 4ZKIA 1S5JA 3IC7A 4DV2O 1OCCB 1JR9A 2IW5A 2WWWA 5GONB 3ETGA 4NR1A 1VF5B 5BMVB 2CUGA 1IBKB 4PA6A 1YDXA 2K1EA 3E2EA 1EBOA 1CP9A 1V54B 1CEZA 1HNZB 2WSSG 2EZOA 4TSFG 4TV9B 2HVKC 4GKKB 1Q43A 4BIOA 1JQ0A 2QEXV 4I9WA 1GM7A 2FKXA 4WFGA 1BGYH 2JVDA 5CBGA 4JI2O 4PD4F 4TV8B 1N36O 2RQ6A 4LC1A 3CRAA 5EBWC 2BTQB 2XAGA 1VIBA 1PV0A 1VQ4V 1FKAO 3HKEA 4IT5A 4LF5O 4DR3B 2BSKB 4X1IB 3AG3C 4J11A 2OWOA 4LR3A 5C93A 5LMUB 4DR7O 4G28B 2UUAB 1J95A 1QBZA 5KHKA 1M93A 3CMEV 5B1AC 1N32B 1N33O 3AK1A 3CCVV 3SPHA 4JI4B 1MSDA 5GONA 3IAYA 3LNNA 3A0RA 1S76D 4JTCB 2B9ZA 4DV2B 1U97A 1ORQC 1XI1A 1H8EG 4FZ0A 4YY3O 3O9OA 2EINB 2Q6AA 2XNDG 4DV7B 4K8ZA 3ASNC 1JVMA 2UXCO 3ZBHA 1I5XA 2R9IA 5D5PA 4YIOA 4X64O 1D2DA 1YJWV 3CRCA 2A06H 2QM8A 3JD0A 3CXCU 5LHGA 2ZM6O 1AI4A 4CC6A 1BT8A 3CPWU 4H37A 4TV8A 2YIBD 4LF8O 1M1KW 1L1FA 1Y6XA 2P22C 2B5UA 2UXXA 1NT2B 4JI2B 1AP5A 2BTQA 1N36B 2A7WA 3SJBC 1OHHG 3JD1A 2A3QA 4IYHA 1NR7A 4O4LB 3KKYA 4LF5B 2FL4A 3CMAV 1BHBA 4DR7B 3VQWA 4CC5A 1FAFA 1MA1A 3K0GA 4UCVA 1HW7A 1MSWD 1US6A 3AG4C 2KG7B 2DJVA 3K5NA 1AI5A 1L8DA 5B5EZ 3TK1A 3OFNG 3ZHVA 1WP8A 1WPBA 3B8NA 1H2KA 3CS5A 5IJ9B 4K3AA 2N04A 5EYPB 4LP8A 1B04A 3HR0A 2L35A 3VOUA 2PTMA 2XASA 2FYUH 2K9PA 1WNSA 3FB6C 3NXSA 3WFVA 4X64B 5KMGB 3JALB 2F4VO 3B8MA 1XHXA 3EHBB 1KB9F 3BY6A 5LP6C 3VQYA 1XUQA 2IJHA 3EXAA 2ZM6B 4TQFA 2FMLA 3A0HZ 2FTKA 5IWAO 1K9MW 2E76B 5JQGA 3RBZA 4LF8B 2N74A 3BCCH 1R3JC 5JVDB 5L3BA 5E79Z 4X20B 3B4SA 1NTZH 3BVOA 4O4LA 4NXNO 2ZE7A 3H01A 1FXVA 2JJ1G 1E1QG 4I4TA 2ZKOA 3D3IA 4LWSA 5JCOC 1NI8A 1SA0B 1ZUQA 3K04A 5F2VO 2PYJA 3EVKA 4FM1A 3E35A 4EB6B 2EIKC 2JRIA 1WA8A 1QLEB 5LGTA 4JI8O 2YSUB 1VQKV 2E75B 5H5NA 1YJNV 3C3TA 5IJ9A 2V1DA 4MTOA 3ZHTA 2YEVA 1H2MA 3H1IH 3BABA 5C8YA 3IJ4A 2LW1A 5H9CA 1IZ3A 5KMGA 2Y69B 3ABTA 1OCOC 2ADPA 4JZGA 3DGEA 1MG1A 3K9SA 1GKFA 4DUYO 1FXKB 1P49A 1OZ0A 1QVGU 2W0FC 5IWAB 5JVDA 2BCCH 1SQFA 1WAZA 1ZSPA 1S3JA 4WCEV 1OCRC 2A9HA 3ABLB 1QNMA 4PJ0Z 3FAVA 3APQA 4NXNB 1SA0A 2AHYA 1D5AA 1V9PA 3APOA 3O65A 1GN3A 1PP9H 4QE7A 4MTXA 2DQ0A 3OUSA 4MTGA 4LNUB 3K57A 1VQNV 4J80A 3T2MA 4QNHB 2ZDIC 4JI8B 4FJCC 4H13B 1YJ9V 1WP7A 1RM1B 4MVUA 1AJQA 3P3NA 4N23A 1KMIZ 3OT7A 2Q69A 1R1BA 2Q9LA 4KUMA 4HZ3A 4FVMA 3ZMZA 4JAVA 3SPIA 5ITZA 2HJFC 3T1YO 2Y48A 4D6TH 1JOYA 5CN0A 2HFEC 2MK3A 2GDSA 3Q4HB 1SQVH 2QWNB 2Z5UA 2JJ2G 1M57C 2QJ1A 4DUYB 3E8FA 1OCZB 2KQXA 1K4CC 2EIJB 4ASUG 1Q7YW 2RDCA 2YI8A 1BCCH 1AR4A 4UB6Z 3STLC 4I0XA 5KX5B 1JFFB 4JYBA 3TGUH 2JIZG 4XDKA 5JJEB 3CCSV 2VS0A 2XTAA 4X88A 3CCEV 4QPKA 1HNXO 1FXHA 3J81N 1PL0A 4DV3O 3K3WA 1S77D 2IH1C 1EN6A 4NB5A 2YUAA 3DXRB 5L3EA 4YIPA 4BW5A 4JYAO 3ICXA 4GCZA 3T1YB 3A2FA 4CH4A 2R9AA 3I56V 3N2KB 5LXTB 5EK0A 3WB1A 1F4MA 3AG2C 4YJ2B 4PDLA 3ZMVA 3OEEG 4MSWC 1P4RA 5JCOA 4EFBA 2YS8A 4CS2A 1ZL8B 4NKGB 4F4LA 1NS1A 5B66Z 3R66A 1IXBA 5KAIZ 3FB8C 3AG7A 4AHCA 5KHHA 5KX5A 1SC5B 2P90A 1IURA 3AK3A 4WFBV 1EN4A 1VP7A 5JJJB 1PNLA 2DQ3A 1ZLZA 4LH6A 1VEWA 2EILC 1W0JG 4JAUA 4LCUC 2HHHO 2JS5A 1HNXB 4MS2A 4UCRA 1V54C 4ZHQA 1WN7A 1IVSA 3HKCB 4DV3B 3TXSA 2YXYA 3S3XA 4ZOLB 1GMGA 1YVWA 3DSQA 4ZI7A 4JI7O 4JYAB 5LXTA 2N05A 1DK1A 2UXBO 1N34O 4FFBA 4YJ2A 1FJGO 1Y66A 2IJKA 1WPXA 4AI8A 2P06A 2FB5A 3DC6A 2GBOA 4DK0A 3CCLV 3P3PA 4CH5A 3TETA 2ZR3A 4RQFA 4NTXA 4K35A 2YIBA 3SDLA 2GHYA 3K06A 4BW9A 2XT9A 1T5EA 3UO3A 2QKAA 4MW8A 1H2GA 2Q0OC 5KHGA 2QA4V 2HEPA 1EZJA 1UJWB 1K92A 1S5HC 3JAWB 2QE7G 1HDJA 5LA6B 5GTIZ 5LGNA 1F51A 1K3EA 3JAKB 1Y74B 2LP7A 3PN1A 2EINC 3HKCA 2HHHB 3K03A 4J9ZB 2LGWA 5FLXN 4LH7A 1BHAA 1TVKB 2ZXWB 4ZOLA 3UQ8A 1JJ2U 3FB5C 3CRMA 4FLXA 2Y0PA 3JASB 4JYCA 3MD0A 1KKCA 2Q68A 2IH3C 1QHTA 4UCTA 2OCHA 3E89A 1TGOA 2XAQA 1W2BU 2UXBB 1G8MA 2HR3A 1BL8A 2X6AA 1LUVA 1N34B 4IYIA 5K1XA 1AROP 1R6TA 3E8GA 2ODMA 3FB7C 5JJNB 4UCOA 2DWEC 2RCVA 3A8TA 1AR1B 3FD9A 4IL6Z 4R50A 4JI1O 1OV9A 1YI2V 2XUMA 1YITV 4O4HB 2CTRA 4DO2A 1E1RG 1G6UA 2AZ2A 1KECA 3AEIA 4DV7O 4FIPC 2QGNA 3BFRA 4AQYO 2EJRA 3TCUA 3CJHA 3JAWA 5LA6A 1YTFB 1AB3A 2KSDA 3IFXA 1SQPH 4BIZA 1TVKA 1ZWIC 1FD9A 4LFAB 4DR4O 3ZX6A 1HR0O 5CMUA 1Q5OA 4MTFA 4L8JA 4X1KA 2XAHA 2HP8A 1VF6A 2X6CA 3JASA 3T1CA 5BY1A 2E74B 2P4VA 4ICGA 2OYQA 1M56C 1UPGA 3KG2A 2CE4A 2JS3A 5LYJB 3HKDB 5EC1C 1EFRG 3LSSA 3ZS8C 2RJZA 4IHJB 2AGAA 2CTWA 2AHZA 5B3SC 3D8CA 2E5LO 3ETQA 1K5QA 5D5QA 3G6BA 4WFAV 3ML0A 3F7YC 4IIJB 3QVNA 1GM8A 1I5YA 5BMVA 1XILA 4XDJA 4YJ3B 1XBLA 4JI1B 4LF7O 3EFFK 5IYDO 4O4IB 4W4LA 5JH7B 1SQXH 4QJFB 1EZVH 3VQVA 2MW2B 2HG5C 2GSMB 4AQYB 4JZ2A 4P9PA 4TV9A 1KC8W 4FLYA 3QO5A 2DN9A 1XMQB 5KHIA 4J7KA 2DYSB 4O2BB 3RVZA 4O4JB 3ZRXA 3ZHSA 1MABG 4DV4B 2NNUA 4CH3A 4DR4B 2Y4TA 2BTOA 3LUTB 1HR0B 4I9QA 3RWRD 1NVPD 1L0NH 2QWRB 1JCHA 3E22B 3ZN0A 5BZBA 3VBBA 2JGUA 2ZE5A 2Y69C 3ZCCA 4DXWA 1WLEA 5LMNO 5GW7A 4BAYA 3ABUA 1DTOA 2BSKA 4X1IA 4PELA 3TXQA 1FXKC 2UUCO 4IHJA 5EIBD 2IJJA 2EJ7A 3D36C 3MHSC 1JPXA 1YZBA 2GTAA 3OD4A 3K59A 2G38A 2ATKC 3H1KH 3SYQA 2E5LB 4IIJA 3IGAC 4YJ3A 4L87A 1NH2B 3ABLC 2LO1A 4PA9A 4O4IA 5EZYB 3JYCA 3SPCA 5JH7A 4LF7B 1YSCA 4FLTA 2PYLA 2IJIA 4GT1A 1JMKC 1MNGA 1N8RW 1S72V 5CA0B 4FLZA 5BR8O 4O2BA 1RPRA 4O4JA 4DW0A 4UB8Z 1RM1C 1DF5A 5EBMC 1KYOF 3SYPA 1V55C 3CCRV 2YIDA 4H0LB 2M7WA 3E22A 2Y4UA 4G2KA 5IYZB 4R6ZA 2OIEA 1VQ6V 1XNQO 5IJ0B 4Z1MG 2JGDB 5EBLC 2OT5A 5LMNB 2CDYA 4JGSA 4P30A 4DR5O 2L6LA 3OR7C 3SYOA 3P32A 4K0KO 3AG3B 5IE9A 2UUCB 4NVPA 5AG2A 3RYHB 3G67A 2PI5A 5A9GA 4HAMA 1X4TA 1R3IC 2R72A 2EIJC 2KG7A 4RUFA 5EZYA 2P5OA 2VQEO 4JI3O 1KU9A 2X7RB 1GN6A 3ASOC 2C2AA 1AI6A 5EYPA 2EULA 2IBZH 4JASA 5GTHZ 2LQTA 2EX3A 1QR9A 3LSUA 4MVRA 4UVAA 5CA0A 4JTAB 3ASNB 3WB2A 3L70H 4HBNA 1I0HA 2ZR2A 5FPRA 5BR8B 1I94O 3JALA 5H2FZ 1QVFU 4TWKA 3HB3B 3UKMA 3OTOO 2QSAA 2F1MA 5LL6Y 3UT5B 5IJ0A 5KHJA 3N2GB 2JGDA 1XNQB 3AG1B 4X20A 3ABKB 4OXSA 4R7CA 5H6QA 1YTFD 3CP1A 3CC7V 4X66O 1VQOV 4DR5B 3RYHA 4K0KB 4FK5C 4ZIBA 4UXNA 2OTJV 4EB6A 1H8HG 2Q0AA 4B7EA 2M6YA 4A5UB 4X65O 3JATB 1QLNA 4R8CA 4PHZA 1RSOB 2HLDG 2A0LA 2Q7GA 4PDRA 2VQEB 2XAFA 4FM2A 3CYOA 4JI3B 4HNAB 3J80N 2V7QG 2KKWA 3OEHG 2UXDO 4ZBMA 2D2CB 2JK5C 3RYFB 1E79G 4FLUA 1LUWA 1NR1A 5FNVB 2DOSA 2B1GA 1JA8A 1IDSA 5DECA 3K79A 1I94B 2DYRC 5IDJA 2YI9A 1GN2A 1FXKA 1DGSA 3D36A 5B1BB 5LP6B 3OTOB 2RN9A 3UT5A 3C90A 4I5SA 1SQBH 3RYCB 2HVJC 5KUKA 5KA6A 2P7TC 4CH6A 1X59A 4PI2A 2WLIB 4U3FH 3KCYA 3OGIB 1RFYA 3CCJV 3LSQA 4MVZA 4B08A 4X66B 2JEUA 1NJIW 2WLNA 5LGUA 3JATA 3BRCA 4CS3A 5KLVH 4LNUA 1AP6A 4X65B 5BXZA 4JI0O 3W7UA 2ZNIA 4FZ1A 4QIWF 3X2QB 2WLHA 3QTCA 1NTKH 3R65A 5JWPA 2KB1A 4HNAA 5KAFZ 3K5MA 2EIMB 5B1OA 3CX5F 1N4CA 1AR5A 4UCUA 1I7FA 2UXDB 4I7ZB 3CEIA 1G1XB 4MVMA 5FNVA 4LF4O 2LGQA 2CGNA 1VARA 2LFSA 4E2LA 2VQFO 5CBHA 1GO3F 3Q4HA 2PI4A 1OCOB 2ZXWC 4I50B 2ZT9B 2CH7B 1YEWA 3KCXA 1NH2D 1WJZA 3RYCA 1VQLV 3DC5A 1Q6IA 2AW9A 2OIGA 3SPGA 1VF6C 4X1YB 4EEQA 2OCCB 2YDEA 2W6IG 1XDCA 2ZE6A 3ZRWB 2R9RB 3L73H 1IBLO 1NVPB 3SGIA 1R3LC 4X8AA 3IC9A 2PZSA 3HKBB 2D3OW 1JFFA 1KD1W 3B40A 1GM9A 5IY5B 4DRXB 4PA4A 1NKDA 1OCCC 2ITCC 5CBFA 4E4EA 1F23A 1WB8A 2R70A 5J2TB 4JI0B 3CCMV 1TA8A 2ZQMA 4U3JB 3ZJZA 5TISZ 4CZZA 4D7SA 3DXRA 4B3RO 2ZD9A 2Q7HA 4JV5O 1Y76B 4MW3A 1K4DC 1AILA 4B3SO 2PGGA 4X62O 3SJCC 1XQ8A 4FLVA 3WU2Z 4U7OA 4W4KA 3N2KA 5LOVB 4LF4B 2CGOA 1GAXA 4I50A 2VQFB 3RFRA 5IYCO 3TJTA 1COWG 4UV8A 1NU1H 3UCSC 1ZL8A 1O9GA 4GX0A 4X1YA 1TUBB 1M57B 1L0LH 1KP3A 4JF3A 2CAZC 2CK3G 4YXWG 1VQ7V 1WB7A 3SPJA 3A0BZ 2X0LA 1R73A 3LDCA 4JPRA 1K34A 2Y0IA 1AJPA 1U96A 1IBLB 1CXZB 2WLLB 1IBMO 4J41A 2XOKG 1BZKA 3C3SA 4DV0O 2PY5A 4LFBO 2Z3YA 1SERA 5J2TA 4U3JA 1S5LZ 5L3FA 2O57A 3WG7B 4LFAO 3S3WA 3K5OA 1HWYA 2BOBC 1H38A 5CA1B 2JEXA 3JD2A 1Q8IA 4B3RB 4OGQB 2VWJA 4JV5B 1M9NA 3FYIB 4J10A 4B3SB 2DYSC 4X62B 1Q6HA 4NTWA 5LOVA 5E1AC 1GRJA 4JI6B 1K97A 4P2ZA 5LHIA 1Q82W 1Z5WA 1O9HA 3CC4V 1QU7A 1AI7A 2LW7A 2QM7A 2QKSA 3BAAA 3OE7G 4UVBA 4GZRB 3T1HO 4J42A 1CPYA 3OMAB 4MT8A 4ABMA 3G4SV 1B3QA 3JAMN 5HFMA 3ZIAG 2F93B 1IBMB 4DYLA 4DV0B 3JD4A 1YF2A 1XMQO 4DW1A 4LFBB 3BHPA 2EILB 4GYCB 3JAKA 2UUBO 1Y74A 4PDMA 1GK9A 3K08A 3T4ZA 4DV4O 3ZN1A 5J2UB 5CA1A 2RNBA 1F7YA 2Q5ZA 3F7VC 5KA5A 4LFCO 4JYYA 4EKWA 4F6RB 4NXMO 3ZRVA 1XMOO 1XL6A 3JD3A 5CB4B 4J7ZA 2QKCA 4DR6B 4OX9O 1SZTA 1G4YB 1XL4A 3B09A 2W0XA 3RYIB 3ZRSA 2XAJA 4UVCA 5B1NA 1RPOA 3ZHQA 4DR1O 5IT9N 4X89A 2BOCC 4O4HA 3T1HB 3E8HA 1K8AW 1Z5VA 4K8XA 4P9OA 4PA7A 2IU0A 5DM6V 5DN6G 2BE3A 1SRYA 3M99B 1IX9A 1GTOA 2H3OA 2WLJA 3OMIB 2Z0AA 1PD3A 3RW0A 1SF9A 1QLEC 2OTLV 3QO8A 1H2LA 2QM4A 2Q4PA 4F6EA 5L3GA 2UUBB 1M90W 2VRZA 5J2UA 1NTMH 2F66C 1A32A 3ABMB 3H1HH 5LBQA 4F6RA 4Z1VA 4RQEA 1R6NA 2DMXA 1Q6UA 4LFCB 5CB4A 3ZHRA 3GWKC 1PL4A 5K1PA 4DV6O 4NXMB 1PM9A 1XMOB 1Y4MA 5IYBO 1JJOA 3SJAC 2NLJC 5LYJA 3HKDA 1GN4A 3WB0A 3ZMTA 1XHZA 1Z2GA 2Q8VA 4OX9B 3BA9A 3I55V 3RYIA 2QWOB 1VQ5V 3KZIZ 2W6JG 1PPJH 2V4DA 1SQQH 3LNMB 5JQGB 3AG1C 2P4KA 4IGGA 2P6JA 3U0ZA 4DR1B 3ABKC 4NTYA 2YIAA 1IXMA 3G71V 4B7KA 3JCUZ 2PF4E 3AK2A 4TUYB 4I4TB 1XNRO 4LWSB 1P84F 4UFZA 4UUJC 4PI0A 3U11A 1K73W 4H44B 1N33B 1BE3H 4WFFA 4U7NA 1WA8B 1R6KA 4MVSA 4WFEA 4RAIA 2YXLA 4YY3B 5LHHA 2ITDC 1Q3EA 3CE2A 3JARB 2YEVB 2RMKB 2WPDG 1ZTEA 2UXCB 4DV6B 5C8YB 4JI5O 4C7UA 5EC2C 4TOIA 2PUSA 4UCSA 3RT3C 2A79B 1M56B 2GUZB 1UFIA 3QF7A 1VQ9V 2QTOA 1S0VA 5B1BC 3SJQC 1W59A 1OCZC 2QTSA 2ZIMA 1VQMV 2IU3A 4B3TO 3M8AA 3UO2A 5B1AB 3ZHUA 5B3SB 1KKDA 1FFTB 3QG5A 2NN4A 1H2SB 4JTDB 2AZ0A 3QNEA 4FPPA 4TUYA 3W7XA 3ETEA 3FAVB 3JCZA 2ZCEA 3M7MX 2DW4A 1XNRB 1ENVA 1SESA 4BR6A 1TUEB 2WLMA 1URFA 3P30A 4UV9A 3E8BA 3I5DA 3X2QC 4WF9V 4KL1A 3K9AA 3OGCC 2QR4A 2EIMC 4O2AB 3JARA 4DR2O 1KP2A 3MAQA 5IYZA 3T4DA 5ITZB 2GUZA 1B06A 4J7JA 2X6BA 3OTFA 4JI5B 1P7BA 2GTSA 2ZIOA 3ZMSA 5CA3A 3U10A 2VWKA 2F4VB 4KFMA 1BQ0A 3JSNA 4GKJO 3OUFA 2WAMA 1MZFA 2B1IA 2H94A 3MHHC 2QWPB 2OCCC 1DF4A 4H33A 1Q81W 5L3CA 2ZINA 4B3TB 1M4UA 3CXHF 4MVQA 2F95B 3BEHA 4OPHA 1P7GA 1D5NA 4BIUA 3H1JH 3AG4B 2Q67A 1OJHA 4LF9O 4GUNA 5IY5C 1BS3A 4J9YB 4I0XB 4WBNB 1NBMG 3LDEA 3THOA 1HP8A 1K7DA 3PJSK 4DV5O 1Q86W 1YHQV 5EIBC 1B6QA 3FKSG 3LDDA 2WA4A 4FFKA 1SQGA 1QQCA 1KBHA 4O2AA 5L3DA 1H2NA 1GH6A 3K0DA 1V55B 4OPAA 4RO2A 3W7SA 1FYJA 4DR2B 3GB7C 4Z2WA 1HNWO 1XOUA 3VQXA 3G6EV 3BA8A 4PA3A 3N2GA 3K5LA 3L74H 3K58A 1NQTA 2YC0A 4Q6GA 4CS4A 1SKVA 4YHHO 4CBCA 1TAEA 1FS0G 4GKJB 1FFXB 2DE0X 4EFEA 4DUZO 3ETDA 4TT3G 1FPOA 2LFRA 1YXBA 3OR6C 2HJDA 1N0JA 1RSOA 3G80A 2EIKB 4MVOA 1XEQA 2UU9O 3STZC 1M5IA 2YICA 4QE9A 4LF9B 3QO7A 3ASOB 3B2EE 4WBNA 4QPJA 3GWOA 4N21A 1W0KG 1BMFG 4LBEC 4RWUA 3RGBA 3F5TA 3L72H 3RYFA 3D3QA 4DV5B 2YXHA 3WG7C 1NZ6A 4D7TA 4I55B 1LNQA 4ZHQB 5LP6A 1J5EO 3CD6V 4PV1B 2IM9A 1HNWB 1AVMA 2ARHA 4ZI7B 4AILC 2CTQA 4B3MO 2WLIA 3MDSA 5HFLA 4KXRA 1ZAUA 4FFBB 1OCRB 4YHHB 1FFXA 1I08A 2H8PC 1Y67A 2CTPA 3CC2V 2EBOA 3E86A 5FPOA 4DV1O 4DUZB 2NR5A 2JDIG 1JX9A 3SR2C 3B77A 1QCEA 5J9PC 5FL7G 2UU9B 3CRRA 4DK1A 4KHPO 3RN4A 4WFHA 3CWBH 4FM0A 3DTUB 1YIJV 4RUEA 1BQZA 1XREA 3L9DA 1SETA 5KUMA 1F4NA 1VMGA 3OM3B 5H6RA 3H1LH 3SYCA 1AJNA 1N0NA 1K5SA 2QWQB 3W7TA 4I55A 1ROPA 4JI6O 4GX2A 4LF6O 3CCUV 2CH7A 4FLWA 2DYRB 1KUQA 3J7AU 3H9VA 1THZA 4KP4A 2DWDC 3CCQV 2ETNA 4XBFA 1J5EB 1Q90D 3FFQA 1VF7A 3OW2U 3OMNB 3ZRWA 2WA3A 2LJ2A 1BSMA 2ZNJA 2E3CA 1R3KC 4B3MB 3HKBA 4QGPA 3E83A 3L75H 4GX1A 2ZE8A 3N27A 3OAAG 2F23A 3CRQA 3CSXA 4DRXA 1DLBA 1KQSU 3L71H 4Q20A 1MOFA 1EN5A 4GX5A 3CHXA 1RP3B 4DV1B 1MMMA 4NYKA 2ZDIA 1IBKO 2ADQB 1PNKA 3HPLC 4PDVA 1VQPV 1PKXA 4KHPB 4HYOA 2Q7EA 1K33A 1ZX3A 1HNZO 2XHBA 1LR1A 1Y76A 2UXNA 3FYEB 4X9QA 2F43G 3FX7A 3CJHB 4JAAA 2EZPA 2HKOA 4GKKO 4DR6O 2QDOA 2Q73A 4BWAA 3F5WC 2GV9A 3UM7A 3ABMC 4G27B 3ZMUA 3BPZA
chains in the Genus database with same CATH topology
1QVFU 1Y4MA 4GCZA 2P67A 4TWKA 4XDLA 5IYBO 3HB3B 3AG2B 3UKMA 2NLJC 3I56V 3W7WA 3ZMTA 5EK0A 1F4MA 3I55V 3AG2C 4PDLA 1VQ5V 3ZMVA 3OEEG 3SYAA 4MSWC 1P4RA 2W6JG 3AG1B 2WLKA 3ABKB 4OXSA 4F4LA 4R7CA 5H6QA 1QR8A 3LNMB 2WLLA 3CP1A 1YTFD 3RVYA 3CC7V 3AG1C 1VQOV 2P6JA 3ABKC 4FK5C 3FB8C 4UXNA 2OTJV 1IXMA 1PNMA 4FMTA 1H8HG 3G71V 1VQ8V 4ZKIA 1QLNA 4R8CA 3IC7A 1OCCB 2IW5A 2P90A 2WWWA 3ETGA 2HLDG 4WFBV 2A0LA 4UUJC 4PDRA 1PNLA 1K73W 2DQ3A 2XAFA 4PA6A 4WFFA 3CYOA 2K1EA 2EILC 3E2EA 1EBOA 1CP9A 1W0JG 1V54B 4U7NA 1CEZA 1R6KA 4MVSA 4JAUA 4LCUC 4WFEA 4RAIA 2V7QG 3OEHG 4ZBMA 4MS2A 1V54C 2WSSG 2JK5C 2EZOA 4TSFG 1E79G 5LHHA 2HVKC 2ITDC 1NR1A 2B1GA 1JQ0A 2YEVB 1GMGA 3K79A 2DYRC 2QEXV 4I9WA 2WPDG 5IDJA 1GM7A 1FXKA 4WFGA 3D36A 5B1BB 5EC2C 4I5SA 5CBGA 2A79B 1M56B 1VQ9V 2HVJC 5KUKA 5KA6A 2QTOA 1S0VA 2P7TC 4LC1A 1Y66A 2IJKA 5B1BC 5EBWC 1WPXA 3SJQC 2WLIB 1OCZC 2XAGA 1VQMV 1VQ4V 2IU3A 3CCLV 5B1AB 5B3SB 3TETA 2ZR3A 3AG3C 4RQFA 3CCJV 1KKDA 5C93A 3LSQA 4MVZA 4G28B 1FFTB 2JEUA 1J95A 1NJIW 1QBZA 2WLNA 3CMEV 5B1AC 5LGUA 2GHYA 3K06A 4JTDB 3CCVV 3QNEA 4FPPA 3SPHA 3W7XA 3ETEA 3A0RA 3JCZA 1S76D 4JTCB 4MW8A 3W7UA 1H2GA 2DW4A 1ORQC 1ENVA 1H8EG 1SESA 4QIWF 2QA4V 3X2QB 1EZJA 2WLHA 1UJWB 1K92A 1S5HC 2EINB 2QE7G 3R65A 2KB1A 2Q6AA 1TUEB 2EIMB 2WLMA 2XNDG 5B1OA 3P30A 5LGNA 1F51A 1K3EA 4UV9A 2LP7A 3ASNC 3E8BA 3X2QC 4WF9V 2EINC 1JVMA 3K9AA 3OGCC 3K03A 4J9ZB 2EIMC 1I5XA 2R9IA 4MVMA 1BHAA 2ZXWB 1KP2A 3T4DA 2LFSA 4E2LA 1YJWV 5CBHA 1GO3F 1JJ2U 3FB5C 2PI4A 1OCOB 2ZXWC 4JYCA 2QM8A 3CXCU 3JD0A 5LHGA 3MD0A 2Q68A 2IH3C 1AI4A 1NH2D 1VQLV 2X6BA 3CPWU 4H37A 3SPGA 3E89A 1P7BA 2XAQA 1W2BU 1G8MA 2HR3A 1BL8A 2OCCB 2X6AA 3ZMSA 1L1FA 5CA3A 2UXXA 2B5UA 2W6IG 1M1KW 4KFMA 1AROP 3E8GA 2WAMA 3OUFA 3ZRWB 2R9RB 1OHHG 2B1IA 2H94A 3FB7C 3MHHC 1NVPB 2OCCC 1DF4A 3JD1A 4H33A 1Q81W 5L3CA 1R3LC 4X8AA 2DWEC 1NR7A 2D3OW 1AR1B 1KD1W 4MVQA 3BEHA 4R50A 1GM9A 1YI2V 5IY5B 3CMAV 4BIUA 1BHBA 1YITV 3AG4B 4PA4A 2Q67A 4DO2A 1NKDA 1E1RG 1OCCC 3K0GA 1KECA 2ITCC 3AEIA 5IY5C 4FIPC 5CBFA 4J9YB 1MSWD 1F23A 3AG4C 1NBMG 3LDEA 2ZQMA 1AI5A 3CCMV 2EJRA 3TCUA 3ZJZA 3TK1A 1K7DA 3OFNG 3PJSK 1Q86W 1YHQV 3B8NA 1YTFB 1B6QA 3FKSG 4CZZA 3IFXA 3LDDA 4LP8A 2ZD9A 4BIZA 4MW3A 3VOUA 1K4DC 5L3DA 1ZWIC 2XASA 3K0DA 5CMUA 3FB6C 1V55B 3NXSA 4MTFA 2XAHA 4RO2A 4U7OA 3WFVA 3GB7C 3W7SA 2X6CA 3G6EV 3B8MA 4PA3A 3T1CA 3EHBB 1N8RW 5IYCO 1COWG 3BY6A 4UV8A 2IJHA 4GX0A 1M56C 1M57B 3KG2A 1NQTA 1KP3A 4JF3A 1K9MW 2FTKA 2CK3G 4YXWG 5EC1C 1VQ7V 1EFRG 4CBCA 3RBZA 3SPJA 3LSSA 2X0LA 1R73A 1FS0G 1R3JC 3LDCA 4JPRA 5L3BA 1K34A 3ETDA 1AJPA 2AHZA 4TT3G 5B3SC 2LFRA 3H01A 1FXVA 2JJ1G 3OR6C 1E1QG 2EIKB 2WLLB 1K5QA 3D3IA 4MVOA 4WFAV 3ML0A 2XOKG 3F7YC 3K04A 1GM8A 1I5YA 4XDJA 3STZC 3EFFK 3E35A 5IYDO 2EIKC 4QE9A 2Z3YA 3QO7A 1SERA 3ASOB 1QLEB 5LGTA 4QPJA 3GWOA 4QJFB 2YSUB 4N21A 5L3FA 1W0KG 1BMFG 1VQKV 4LBEC 3WG7B 2HG5C 2GSMB 1YJNV 4P9PA 2V1DA 1HWYA 2BOBC 1KC8W 3QO5A 1H38A 2JEXA 4MTOA 3WG7C 3JD2A 2DYSB 3RVZA 2YEVA 3ZRXA 1MABG 1M9NA 3FYIB 1LNQA 2NNUA 2DYSC 5H9CA 3LUTB 5E1AC 3CD6V 1NVPD 2Y69B 3ABTA 1OCOC 1JCHA 1K97A 4P2ZA 3ZN0A 5BZBA 3VBBA 5LHIA 3DGEA 1Q82W 1MG1A 1GKFA 2Y69C 3ZCCA 4DXWA 1WLEA 1FXKB 2WLIA 3CC4V 5HFLA 5GW7A 1OZ0A 4BAYA 3ABUA 1QVGU 1AI7A 1DTOA 2W0FC 1OCRB 2QM7A 4PELA 2QKSA 3OE7G 4UVBA 1FXKC 2IJJA 2H8PC 3CC2V 3MHSC 1JPXA 2EBOA 1CPYA 1S3JA 4WCEV 3E86A 1OCRC 2A9HA 3ABLB 3OMAB 2ATKC 4MT8A 3G4SV 3SYQA 2JDIG 2AHYA 1JX9A 3B77A 3IGAC 1QCEA 4L87A 5J9PC 5HFMA 3ZIAG 3ABLC 1NH2B 4QE7A 4PA9A 5FL7G 3JYCA 3SPCA 4MTXA 2DQ0A 1YSCA 4WFHA 3OUSA 2IJIA 3JD4A 4MTGA 2EILB 3DTUB 1YIJV 4GT1A 1VQNV 3T2MA 4QNHB 4RUEA 4PDMA 2ZDIC 1GK9A 3K08A 4FJCC 1SETA 3T4ZA 5KUMA 1YJ9V 3ZN1A 1F4NA 1S72V 1RM1B 4MVUA 3OM3B 5H6RA 1AJQA 3SYCA 4N23A 1AJNA 1RPRA 3F7VC 5KA5A 2Q69A 1K5SA 3W7TA 1ROPA 4EKWA 1RM1C 4KUMA 4GX2A 3ZRVA 1DF5A 4HZ3A 5EBMC 3ZMZA 4JAVA 3SPIA 1XL6A 2HJFC 3CCUV 3JD3A 2DYRB 2Y48A 3SYPA 1V55C 3CCRV 1JOYA 5CN0A 2HFEC 2MK3A 1THZA 4KP4A 2M7WA 2DWDC 3CCQV 4G2KA 1SZTA 4XBFA 4R6ZA 1G4YB 3OW2U 1XL4A 1VQ6V 3OMNB 3ZRWA 2Z5UA 2JJ2G 3ZRSA 1M57C 2XAJA 4UVCA 4Z1MG 1R3KC 5EBLC 2OT5A 5B1NA 3E8FA 4JGSA 4P30A 1RPOA 1OCZB 3E83A 3OR7C 3SYOA 3P32A 1K4CC 4GX1A 3OAAG 4X89A 2BOCC 3AG3B 2EIJB 1DLBA 4ASUG 3E8HA 4Q20A 1KQSU 1Q7YW 1K8AW 2PI5A 4P9OA 1MOFA 4HAMA 4GX5A 4PA7A 2IU0A 5DM6V 5DN6G 1SRYA 1R3IC 3M99B 1GTOA 2EIJC 2WLJA 3STLC 4RUFA 4JYBA 3OMIB 2JIZG 2ZDIA 4XDKA 1PD3A 3RW0A 1PNKA 3HPLC 4PDVA 3CCSV 1VQPV 1PKXA 2X7RB 3ASOC 1QLEC 4HYOA 4X88A 2C2AA 1K33A 1AI6A 2OTLV 3QO8A 4JASA 3CCEV 4QPKA 2UXNA 1QR9A 4MVRA 4UVAA 3FYEB 5L3GA 1M90W 1FXHA 4JTAB 2F43G 3ASNB 1PL0A 3K3WA 3ABMB 2EZPA 1S77D 5LBQA 2IH1C 2HKOA 2ZR2A 4RQEA 5L3EA 3F5WC 1R6NA 3UM7A 3ABMC 4G27B 3ZMUA 4BW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1A C;  4MTF A;  3SYQ A;  2AHY A;  4RO2 A;  3K06 A;  3IGA C;  3GB7 C;  4JTD B;  4TWK A;  4XDL A;  3SPH A;  5J9P C;  3ABL C;  3UKM A;  2X6C A;  4QE7 A;  4PA9 A;  2NLJ C;  4PA3 A;  3T1C A;  3JYC A;  3SPC A;  4JTC B;  4MW8 A;  4WFH A;  3OUS A;  4MTG A;  5EK0 A;  1ORQ C;  4GX0 A;  3AG2 C;  1M56 C;  4PDL A;  2WLH A;  3KG2 A;  3SYA A;  1S5H C;  4MSW C;  3R65 A;  4RUE A;  4PDM A;  3T2M A;  2KB1 A;  4QNH B;  3K08 A;  3T4Z A;  5EC1 C;  2Q6A A;  2WLK A;  5KUM A;  4CBC A;  2WLM A;  3RBZ A;  3SPJ A;  4MVU A;  4OXS A;  4F4L A;  3LDC A;  1R3J C;  4R7C A;  3ASN C;  3E8B A;  3X2Q C;  3SYC A;  3LNM B;  2WLL A;  2EIN C;  3RVY A;  1JVM A;  3F7V C;  3AG1 C;  2Q69 A;  2AHZ A;  3K03 A;  3OGC C;  4J9Z B;  5B3S C;  2EIM C;  3ABK C;  4MVM A;  4EKW A;  4GX2 A;  3FB8 C;  4HZ3 A;  5EBM C;  3OR6 C;  3SPI A;  1XL6 A;  2HJF C;  2WLL B;  4MVO A;  3T4D A;  3SYP A;  1V55 C;  3F7Y C;  3K04 A;  5CBH A;  4R8C A;  4XDJ A;  2HFE C;  3STZ C;  3FB5 C;  3EFF K;  2DWD C;  2ZXW C;  2EIK C;  4QE9 A;  4R6Z A;  2A0L A;  4UUJ C;  2Q68 A;  2IH3 C;  4PDR A;  1G4Y B;  1XL4 A;  2X6B A;  4H37 A;  3SPG A;  3E89 A;  4PA6 A;  1P7B A;  4WFF A;  2K1E A;  2EIL C;  3ZRS A;  4LBE C;  1M57 C;  2X6A A;  2HG5 C;  1BL8 A;  1R3K C;  5EBL C;  4KFM A;  4MVS A;  3E8F A;  4LCU C;  4P9P A;  4WFE A;  4RAI A;  4P30 A;  3E8G A;  3OUF A;  2BOB C;  2R9R B;  3E83 A;  3FB7 C;  4ZBM A;  3OR7 C;  3SYO A;  4MTO A;  3WG7 C;  4MS2 A;  2OCC C;  1K4C C;  1V54 C;  4GX1 A;  4H33 A;  2YEV A;  3RVZ A;  1R3L C;  2JK5 C;  4X89 A;  4X8A A;  2BOC C;  2DWE C;  2HVK C;  2ITD C;  3E8H A;  4MVQ A;  1LNQ A;  4P9O A;  3BEH A;  4R50 A;  4GX5 A;  4PA7 A;  2DYS C;  2DYR C;  1R3I C;  4I9W A;  3LUT B;  4PA4 A;  2Q67 A;  5E1A C;  2EIJ C;  2WLJ A;  3STL C;  4RUF A;  1OCO C;  1OCC C;  4WFG A;  3K0G A;  4XDK A;  2ITC C;  5IY5 C;  4P2Z A;  5EC2 C;  3HPL C;  4PDV A;  3RW0 A;  4J9Y B;  5BZB A;  5CBF A;  3AG4 C;  5CBG A;  2A79 B;  1QLE C;  3ASO C;  4HYO A;  4X88 A;  2Y69 C;  2HVJ C;  3LDE A;  4DXW A;  5KUK A;  2WLI A;  3TCU A;  2QTO A;  3ZJZ A;  2P7T C;  3PJS K;  5B1B C;  4MVR A;  5EBW C;  3SJQ C;  2W0F C;  3IFX A;  4JTA B;  2QKS A;  3LDD A;  2WLI B;  2ZD9 A;  4LP8 A;  1OCZ C;  2IH1 C;  2H8P C;  4MW3 A;  3VOU A;  3TET A;  1K4D C;  3E86 A;  1OCR C;  2A9H A;  3AG3 C;  1ZWI C;  1KKD A;  3F5W C;  4MVZ A;  4G28 B;  3ABM C;  3K0D A;  4G27 B;  1J95 A;  3UM7 A;  3FB6 C;  2ATK C;  4BW5 A;  2WLN A; 
#chains in the Genus database with same CATH topology
 4TQD A;  3NR7 A;  1EM1 A;  4LF6 B;  2P67 A;  4XDL A;  1YCI A;  2AXT Z;  3AG2 B;  1TUB A;  3JSL A;  2ILM A;  4X1K B;  3W7W A;  3GVM A;  4JI7 B;  1MZE A;  3SYA A;  5DED A;  1SS3 A;  2WLK A;  1SZX A;  4DR3 O;  1QR8 A;  1FJG B;  2WLL A;  3ZED A;  3RVY A;  3HKE B;  5LMU O;  2UUA O;  5A2Q N;  1N32 O;  3CB2 A;  4GLX A;  1PNM A;  4FMT A;  4JI4 O;  1VQ8 V;  4ZKI A;  1S5J A;  3IC7 A;  4DV2 O;  1OCC B;  1JR9 A;  2IW5 A;  2WWW A;  5GON B;  3ETG A;  4NR1 A;  1VF5 B;  5BMV B;  2CUG A;  1IBK B;  4PA6 A;  1YDX A;  2K1E A;  3E2E A;  1EBO A;  1CP9 A;  1V54 B;  1CEZ A;  1HNZ B;  2WSS G;  2EZO A;  4TSF G;  4TV9 B;  2HVK C;  4GKK B;  1Q43 A;  4BIO A;  1JQ0 A;  2QEX V;  4I9W A;  1GM7 A;  2FKX A;  4WFG A;  1BGY H;  2JVD A;  5CBG A;  4JI2 O;  4PD4 F;  4TV8 B;  1N36 O;  2RQ6 A;  4LC1 A;  3CRA A;  5EBW C;  2BTQ B;  2XAG A;  1VIB A;  1PV0 A;  1VQ4 V;  1FKA O;  3HKE A;  4IT5 A;  4LF5 O;  4DR3 B;  2BSK B;  4X1I B;  3AG3 C;  4J11 A;  2OWO A;  4LR3 A;  5C93 A;  5LMU B;  4DR7 O;  4G28 B;  2UUA B;  1J95 A;  1QBZ A;  5KHK A;  1M93 A;  3CME V;  5B1A C;  1N32 B;  1N33 O;  3AK1 A;  3CCV V;  3SPH A;  4JI4 B;  1MSD A;  5GON A;  3IAY A;  3LNN A;  3A0R A;  1S76 D;  4JTC B;  2B9Z A;  4DV2 B;  1U97 A;  1ORQ C;  1XI1 A;  1H8E G;  4FZ0 A;  4YY3 O;  3O9O A;  2EIN B;  2Q6A A;  2XND G;  4DV7 B;  4K8Z A;  3ASN C;  1JVM A;  2UXC O;  3ZBH A;  1I5X A;  2R9I A;  5D5P A;  4YIO A;  4X64 O;  1D2D A;  1YJW V;  3CRC A;  2A06 H;  2QM8 A;  3JD0 A;  3CXC U;  5LHG A;  2ZM6 O;  1AI4 A;  4CC6 A;  1BT8 A;  3CPW U;  4H37 A;  4TV8 A;  2YIB D;  4LF8 O;  1M1K W;  1L1F A;  1Y6X A;  2P22 C;  2B5U A;  2UXX A;  1NT2 B;  4JI2 B;  1AP5 A;  2BTQ A;  1N36 B;  2A7W A;  3SJB C;  1OHH G;  3JD1 A;  2A3Q A;  4IYH A;  1NR7 A;  4O4L B;  3KKY A;  4LF5 B;  2FL4 A;  3CMA V;  1BHB A;  4DR7 B;  3VQW A;  4CC5 A;  1FAF A;  1MA1 A;  3K0G A;  4UCV A;  1HW7 A;  1MSW D;  1US6 A;  3AG4 C;  2KG7 B;  2DJV A;  3K5N A;  1AI5 A;  1L8D A;  5B5E Z;  3TK1 A;  3OFN G;  3ZHV A;  1WP8 A;  1WPB A;  3B8N A;  1H2K A;  3CS5 A;  5IJ9 B;  4K3A A;  2N04 A;  5EYP B;  4LP8 A;  1B04 A;  3HR0 A;  2L35 A;  3VOU A;  2PTM A;  2XAS A;  2FYU H;  2K9P A;  1WNS A;  3FB6 C;  3NXS A;  3WFV A;  4X64 B;  5KMG B;  3JAL B;  2F4V O;  3B8M A;  1XHX A;  3EHB B;  1KB9 F;  3BY6 A;  5LP6 C;  3VQY A;  1XUQ A;  2IJH A;  3EXA A;  2ZM6 B;  4TQF A;  2FML A;  3A0H Z;  2FTK A;  5IWA O;  1K9M W;  2E76 B;  5JQG A;  3RBZ A;  4LF8 B;  2N74 A;  3BCC H;  1R3J C;  5JVD B;  5L3B A;  5E79 Z;  4X20 B;  3B4S A;  1NTZ H;  3BVO A;  4O4L A;  4NXN O;  2ZE7 A;  3H01 A;  1FXV A;  2JJ1 G;  1E1Q G;  4I4T A;  2ZKO A;  3D3I A;  4LWS A;  5JCO C;  1NI8 A;  1SA0 B;  1ZUQ A;  3K04 A;  5F2V O;  2PYJ A;  3EVK A;  4FM1 A;  3E35 A;  4EB6 B;  2EIK C;  2JRI A;  1WA8 A;  1QLE B;  5LGT A;  4JI8 O;  2YSU B;  1VQK V;  2E75 B;  5H5N A;  1YJN V;  3C3T A;  5IJ9 A;  2V1D A;  4MTO A;  3ZHT A;  2YEV A;  1H2M A;  3H1I H;  3BAB A;  5C8Y A;  3IJ4 A;  2LW1 A;  5H9C A;  1IZ3 A;  5KMG A;  2Y69 B;  3ABT A;  1OCO C;  2ADP A;  4JZG A;  3DGE A;  1MG1 A;  3K9S A;  1GKF A;  4DUY O;  1FXK B;  1P49 A;  1OZ0 A;  1QVG U;  2W0F C;  5IWA B;  5JVD A;  2BCC H;  1SQF A;  1WAZ A;  1ZSP A;  1S3J A;  4WCE V;  1OCR C;  2A9H A;  3ABL B;  1QNM A;  4PJ0 Z;  3FAV A;  3APQ A;  4NXN B;  1SA0 A;  2AHY A;  1D5A A;  1V9P A;  3APO A;  3O65 A;  1GN3 A;  1PP9 H;  4QE7 A;  4MTX A;  2DQ0 A;  3OUS A;  4MTG A;  4LNU B;  3K57 A;  1VQN V;  4J80 A;  3T2M A;  4QNH B;  2ZDI C;  4JI8 B;  4FJC C;  4H13 B;  1YJ9 V;  1WP7 A;  1RM1 B;  4MVU A;  1AJQ A;  3P3N A;  4N23 A;  1KMI Z;  3OT7 A;  2Q69 A;  1R1B A;  2Q9L A;  4KUM A;  4HZ3 A;  4FVM A;  3ZMZ A;  4JAV A;  3SPI A;  5ITZ A;  2HJF C;  3T1Y O;  2Y48 A;  4D6T H;  1JOY A;  5CN0 A;  2HFE C;  2MK3 A;  2GDS A;  3Q4H B;  1SQV H;  2QWN B;  2Z5U A;  2JJ2 G;  1M57 C;  2QJ1 A;  4DUY B;  3E8F A;  1OCZ B;  2KQX A;  1K4C C;  2EIJ B;  4ASU G;  1Q7Y W;  2RDC A;  2YI8 A;  1BCC H;  1AR4 A;  4UB6 Z;  3STL C;  4I0X A;  5KX5 B;  1JFF B;  4JYB A;  3TGU H;  2JIZ G;  4XDK A;  5JJE B;  3CCS V;  2VS0 A;  2XTA A;  4X88 A;  3CCE V;  4QPK A;  1HNX O;  1FXH A;  3J81 N;  1PL0 A;  4DV3 O;  3K3W A;  1S77 D;  2IH1 C;  1EN6 A;  4NB5 A;  2YUA A;  3DXR B;  5L3E A;  4YIP A;  4BW5 A;  4JYA O;  3ICX A;  4GCZ A;  3T1Y B;  3A2F A;  4CH4 A;  2R9A A;  3I56 V;  3N2K B;  5LXT B;  5EK0 A;  3WB1 A;  1F4M A;  3AG2 C;  4YJ2 B;  4PDL A;  3ZMV A;  3OEE G;  4MSW C;  1P4R A;  5JCO A;  4EFB A;  2YS8 A;  4CS2 A;  1ZL8 B;  4NKG B;  4F4L A;  1NS1 A;  5B66 Z;  3R66 A;  1IXB A;  5KAI Z;  3FB8 C;  3AG7 A;  4AHC A;  5KHH A;  5KX5 A;  1SC5 B;  2P90 A;  1IUR A;  3AK3 A;  4WFB V;  1EN4 A;  1VP7 A;  5JJJ B;  1PNL A;  2DQ3 A;  1ZLZ A;  4LH6 A;  1VEW A;  2EIL C;  1W0J G;  4JAU A;  4LCU C;  2HHH O;  2JS5 A;  1HNX B;  4MS2 A;  4UCR A;  1V54 C;  4ZHQ A;  1WN7 A;  1IVS A;  3HKC B;  4DV3 B;  3TXS A;  2YXY A;  3S3X A;  4ZOL B;  1GMG A;  1YVW A;  3DSQ A;  4ZI7 A;  4JI7 O;  4JYA B;  5LXT A;  2N05 A;  1DK1 A;  2UXB O;  1N34 O;  4FFB A;  4YJ2 A;  1FJG O;  1Y66 A;  2IJK A;  1WPX A;  4AI8 A;  2P06 A;  2FB5 A;  3DC6 A;  2GBO A;  4DK0 A;  3CCL V;  3P3P A;  4CH5 A;  3TET A;  2ZR3 A;  4RQF A;  4NTX A;  4K35 A;  2YIB A;  3SDL A;  2GHY A;  3K06 A;  4BW9 A;  2XT9 A;  1T5E A;  3UO3 A;  2QKA A;  4MW8 A;  1H2G A;  2Q0O C;  5KHG A;  2QA4 V;  2HEP A;  1EZJ A;  1UJW B;  1K92 A;  1S5H C;  3JAW B;  2QE7 G;  1HDJ A;  5LA6 B;  5GTI Z;  5LGN A;  1F51 A;  1K3E A;  3JAK B;  1Y74 B;  2LP7 A;  3PN1 A;  2EIN C;  3HKC A;  2HHH B;  3K03 A;  4J9Z B;  2LGW A;  5FLX N;  4LH7 A;  1BHA A;  1TVK B;  2ZXW B;  4ZOL A;  3UQ8 A;  1JJ2 U;  3FB5 C;  3CRM A;  4FLX A;  2Y0P A;  3JAS B;  4JYC A;  3MD0 A;  1KKC A;  2Q68 A;  2IH3 C;  1QHT A;  4UCT A;  2OCH A;  3E89 A;  1TGO A;  2XAQ A;  1W2B U;  2UXB B;  1G8M A;  2HR3 A;  1BL8 A;  2X6A A;  1LUV A;  1N34 B;  4IYI A;  5K1X A;  1ARO P;  1R6T A;  3E8G A;  2ODM A;  3FB7 C;  5JJN B;  4UCO A;  2DWE C;  2RCV A;  3A8T A;  1AR1 B;  3FD9 A;  4IL6 Z;  4R50 A;  4JI1 O;  1OV9 A;  1YI2 V;  2XUM A;  1YIT V;  4O4H B;  2CTR A;  4DO2 A;  1E1R G;  1G6U A;  2AZ2 A;  1KEC A;  3AEI A;  4DV7 O;  4FIP C;  2QGN A;  3BFR A;  4AQY O;  2EJR A;  3TCU A;  3CJH A;  3JAW A;  5LA6 A;  1YTF B;  1AB3 A;  2KSD A;  3IFX A;  1SQP H;  4BIZ A;  1TVK A;  1ZWI C;  1FD9 A;  4LFA B;  4DR4 O;  3ZX6 A;  1HR0 O;  5CMU A;  1Q5O A;  4MTF A;  4L8J A;  4X1K A;  2XAH A;  2HP8 A;  1VF6 A;  2X6C A;  3JAS A;  3T1C A;  5BY1 A;  2E74 B;  2P4V A;  4ICG A;  2OYQ A;  1M56 C;  1UPG A;  3KG2 A;  2CE4 A;  2JS3 A;  5LYJ B;  3HKD B;  5EC1 C;  1EFR G;  3LSS A;  3ZS8 C;  2RJZ A;  4IHJ B;  2AGA A;  2CTW A;  2AHZ A;  5B3S C;  3D8C A;  2E5L O;  3ETQ A;  1K5Q A;  5D5Q A;  3G6B A;  4WFA V;  3ML0 A;  3F7Y C;  4IIJ B;  3QVN A;  1GM8 A;  1I5Y A;  5BMV A;  1XIL A;  4XDJ A;  4YJ3 B;  1XBL A;  4JI1 B;  4LF7 O;  3EFF K;  5IYD O;  4O4I B;  4W4L A;  5JH7 B;  1SQX H;  4QJF B;  1EZV H;  3VQV A;  2MW2 B;  2HG5 C;  2GSM B;  4AQY B;  4JZ2 A;  4P9P A;  4TV9 A;  1KC8 W;  4FLY A;  3QO5 A;  2DN9 A;  1XMQ B;  5KHI A;  4J7K A;  2DYS B;  4O2B B;  3RVZ A;  4O4J B;  3ZRX A;  3ZHS A;  1MAB G;  4DV4 B;  2NNU A;  4CH3 A;  4DR4 B;  2Y4T A;  2BTO A;  3LUT B;  1HR0 B;  4I9Q A;  3RWR D;  1NVP D;  1L0N H;  2QWR B;  1JCH A;  3E22 B;  3ZN0 A;  5BZB A;  3VBB A;  2JGU A;  2ZE5 A;  2Y69 C;  3ZCC A;  4DXW A;  1WLE A;  5LMN O;  5GW7 A;  4BAY A;  3ABU A;  1DTO A;  2BSK A;  4X1I A;  4PEL A;  3TXQ A;  1FXK C;  2UUC O;  4IHJ A;  5EIB D;  2IJJ A;  2EJ7 A;  3D36 C;  3MHS C;  1JPX A;  1YZB A;  2GTA A;  3OD4 A;  3K59 A;  2G38 A;  2ATK C;  3H1K H;  3SYQ A;  2E5L B;  4IIJ A;  3IGA C;  4YJ3 A;  4L87 A;  1NH2 B;  3ABL C;  2LO1 A;  4PA9 A;  4O4I A;  5EZY B;  3JYC A;  3SPC A;  5JH7 A;  4LF7 B;  1YSC A;  4FLT A;  2PYL A;  2IJI A;  4GT1 A;  1JMK C;  1MNG A;  1N8R W;  1S72 V;  5CA0 B;  4FLZ A;  5BR8 O;  4O2B A;  1RPR A;  4O4J A;  4DW0 A;  4UB8 Z;  1RM1 C;  1DF5 A;  5EBM C;  1KYO F;  3SYP A;  1V55 C;  3CCR V;  2YID A;  4H0L B;  2M7W A;  3E22 A;  2Y4U A;  4G2K A;  5IYZ B;  4R6Z A;  2OIE A;  1VQ6 V;  1XNQ O;  5IJ0 B;  4Z1M G;  2JGD B;  5EBL C;  2OT5 A;  5LMN B;  2CDY A;  4JGS A;  4P30 A;  4DR5 O;  2L6L A;  3OR7 C;  3SYO A;  3P32 A;  4K0K O;  3AG3 B;  5IE9 A;  2UUC B;  4NVP A;  5AG2 A;  3RYH B;  3G67 A;  2PI5 A;  5A9G A;  4HAM A;  1X4T A;  1R3I C;  2R72 A;  2EIJ C;  2KG7 A;  4RUF A;  5EZY A;  2P5O A;  2VQE O;  4JI3 O;  1KU9 A;  2X7R B;  1GN6 A;  3ASO C;  2C2A A;  1AI6 A;  5EYP A;  2EUL A;  2IBZ H;  4JAS A;  5GTH Z;  2LQT A;  2EX3 A;  1QR9 A;  3LSU A;  4MVR A;  4UVA A;  5CA0 A;  4JTA B;  3ASN B;  3WB2 A;  3L70 H;  4HBN A;  1I0H A;  2ZR2 A;  5FPR A;  5BR8 B;  1I94 O;  3JAL A;  5H2F Z;  1QVF U;  4TWK A;  3HB3 B;  3UKM A;  3OTO O;  2QSA A;  2F1M A;  5LL6 Y;  3UT5 B;  5IJ0 A;  5KHJ A;  3N2G B;  2JGD A;  1XNQ B;  3AG1 B;  4X20 A;  3ABK B;  4OXS A;  4R7C A;  5H6Q A;  1YTF D;  3CP1 A;  3CC7 V;  4X66 O;  1VQO V;  4DR5 B;  3RYH A;  4K0K B;  4FK5 C;  4ZIB A;  4UXN A;  2OTJ V;  4EB6 A;  1H8H G;  2Q0A A;  4B7E A;  2M6Y A;  4A5U B;  4X65 O;  3JAT B;  1QLN A;  4R8C A;  4PHZ A;  1RSO B;  2HLD G;  2A0L A;  2Q7G A;  4PDR A;  2VQE B;  2XAF A;  4FM2 A;  3CYO A;  4JI3 B;  4HNA B;  3J80 N;  2V7Q G;  2KKW A;  3OEH G;  2UXD O;  4ZBM A;  2D2C B;  2JK5 C;  3RYF B;  1E79 G;  4FLU A;  1LUW A;  1NR1 A;  5FNV B;  2DOS A;  2B1G A;  1JA8 A;  1IDS A;  5DEC A;  3K79 A;  1I94 B;  2DYR C;  5IDJ A;  2YI9 A;  1GN2 A;  1FXK A;  1DGS A;  3D36 A;  5B1B B;  5LP6 B;  3OTO B;  2RN9 A;  3UT5 A;  3C90 A;  4I5S A;  1SQB H;  3RYC B;  2HVJ C;  5KUK A;  5KA6 A;  2P7T C;  4CH6 A;  1X59 A;  4PI2 A;  2WLI B;  4U3F H;  3KCY A;  3OGI B;  1RFY A;  3CCJ V;  3LSQ A;  4MVZ A;  4B08 A;  4X66 B;  2JEU A;  1NJI W;  2WLN A;  5LGU A;  3JAT A;  3BRC A;  4CS3 A;  5KLV H;  4LNU A;  1AP6 A;  4X65 B;  5BXZ A;  4JI0 O;  3W7U A;  2ZNI A;  4FZ1 A;  4QIW F;  3X2Q B;  2WLH A;  3QTC A;  1NTK H;  3R65 A;  5JWP A;  2KB1 A;  4HNA A;  5KAF Z;  3K5M A;  2EIM B;  5B1O A;  3CX5 F;  1N4C A;  1AR5 A;  4UCU A;  1I7F A;  2UXD B;  4I7Z B;  3CEI A;  1G1X B;  4MVM A;  5FNV A;  4LF4 O;  2LGQ A;  2CGN A;  1VAR A;  2LFS A;  4E2L A;  2VQF O;  5CBH A;  1GO3 F;  3Q4H A;  2PI4 A;  1OCO B;  2ZXW C;  4I50 B;  2ZT9 B;  2CH7 B;  1YEW A;  3KCX A;  1NH2 D;  1WJZ A;  3RYC A;  1VQL V;  3DC5 A;  1Q6I A;  2AW9 A;  2OIG A;  3SPG A;  1VF6 C;  4X1Y B;  4EEQ A;  2OCC B;  2YDE A;  2W6I G;  1XDC A;  2ZE6 A;  3ZRW B;  2R9R B;  3L73 H;  1IBL O;  1NVP B;  3SGI A;  1R3L C;  4X8A A;  3IC9 A;  2PZS A;  3HKB B;  2D3O W;  1JFF A;  1KD1 W;  3B40 A;  1GM9 A;  5IY5 B;  4DRX B;  4PA4 A;  1NKD A;  1OCC C;  2ITC C;  5CBF A;  4E4E A;  1F23 A;  1WB8 A;  2R70 A;  5J2T B;  4JI0 B;  3CCM V;  1TA8 A;  2ZQM A;  4U3J B;  3ZJZ A;  5TIS Z;  4CZZ A;  4D7S A;  3DXR A;  4B3R O;  2ZD9 A;  2Q7H A;  4JV5 O;  1Y76 B;  4MW3 A;  1K4D C;  1AIL A;  4B3S O;  2PGG A;  4X62 O;  3SJC C;  1XQ8 A;  4FLV A;  3WU2 Z;  4U7O A;  4W4K A;  3N2K A;  5LOV B;  4LF4 B;  2CGO A;  1GAX A;  4I50 A;  2VQF B;  3RFR A;  5IYC O;  3TJT A;  1COW G;  4UV8 A;  1NU1 H;  3UCS C;  1ZL8 A;  1O9G A;  4GX0 A;  4X1Y A;  1TUB B;  1M57 B;  1L0L H;  1KP3 A;  4JF3 A;  2CAZ C;  2CK3 G;  4YXW G;  1VQ7 V;  1WB7 A;  3SPJ A;  3A0B Z;  2X0L A;  1R73 A;  3LDC A;  4JPR A;  1K34 A;  2Y0I A;  1AJP A;  1U96 A;  1IBL B;  1CXZ B;  2WLL B;  1IBM O;  4J41 A;  2XOK G;  1BZK A;  3C3S A;  4DV0 O;  2PY5 A;  4LFB O;  2Z3Y A;  1SER A;  5J2T A;  4U3J A;  1S5L Z;  5L3F A;  2O57 A;  3WG7 B;  4LFA O;  3S3W A;  3K5O A;  1HWY A;  2BOB C;  1H38 A;  5CA1 B;  2JEX A;  3JD2 A;  1Q8I A;  4B3R B;  4OGQ B;  2VWJ A;  4JV5 B;  1M9N A;  3FYI B;  4J10 A;  4B3S B;  2DYS C;  4X62 B;  1Q6H A;  4NTW A;  5LOV A;  5E1A C;  1GRJ A;  4JI6 B;  1K97 A;  4P2Z A;  5LHI A;  1Q82 W;  1Z5W A;  1O9H A;  3CC4 V;  1QU7 A;  1AI7 A;  2LW7 A;  2QM7 A;  2QKS A;  3BAA A;  3OE7 G;  4UVB A;  4GZR B;  3T1H O;  4J42 A;  1CPY A;  3OMA B;  4MT8 A;  4ABM A;  3G4S V;  1B3Q A;  3JAM N;  5HFM A;  3ZIA G;  2F93 B;  1IBM B;  4DYL A;  4DV0 B;  3JD4 A;  1YF2 A;  1XMQ O;  4DW1 A;  4LFB B;  3BHP A;  2EIL B;  4GYC B;  3JAK A;  2UUB O;  1Y74 A;  4PDM A;  1GK9 A;  3K08 A;  3T4Z A;  4DV4 O;  3ZN1 A;  5J2U B;  5CA1 A;  2RNB A;  1F7Y A;  2Q5Z A;  3F7V C;  5KA5 A;  4LFC O;  4JYY A;  4EKW A;  4F6R B;  4NXM O;  3ZRV A;  1XMO O;  1XL6 A;  3JD3 A;  5CB4 B;  4J7Z A;  2QKC A;  4DR6 B;  4OX9 O;  1SZT A;  1G4Y B;  1XL4 A;  3B09 A;  2W0X A;  3RYI B;  3ZRS A;  2XAJ A;  4UVC A;  5B1N A;  1RPO A;  3ZHQ A;  4DR1 O;  5IT9 N;  4X89 A;  2BOC C;  4O4H A;  3T1H B;  3E8H A;  1K8A W;  1Z5V A;  4K8X A;  4P9O A;  4PA7 A;  2IU0 A;  5DM6 V;  5DN6 G;  2BE3 A;  1SRY A;  3M99 B;  1IX9 A;  1GTO A;  2H3O A;  2WLJ A;  3OMI B;  2Z0A A;  1PD3 A;  3RW0 A;  1SF9 A;  1QLE C;  2OTL V;  3QO8 A;  1H2L A;  2QM4 A;  2Q4P A;  4F6E A;  5L3G A;  2UUB B;  1M90 W;  2VRZ A;  5J2U A;  1NTM H;  2F66 C;  1A32 A;  3ABM B;  3H1H H;  5LBQ A;  4F6R A;  4Z1V A;  4RQE A;  1R6N A;  2DMX A;  1Q6U A;  4LFC B;  5CB4 A;  3ZHR A;  3GWK C;  1PL4 A;  5K1P A;  4DV6 O;  4NXM B;  1PM9 A;  1XMO B;  1Y4M A;  5IYB O;  1JJO A;  3SJA C;  2NLJ C;  5LYJ A;  3HKD A;  1GN4 A;  3WB0 A;  3ZMT A;  1XHZ A;  1Z2G A;  2Q8V A;  4OX9 B;  3BA9 A;  3I55 V;  3RYI A;  2QWO B;  1VQ5 V;  3KZI Z;  2W6J G;  1PPJ H;  2V4D A;  1SQQ H;  3LNM B;  5JQG B;  3AG1 C;  2P4K A;  4IGG A;  2P6J A;  3U0Z A;  4DR1 B;  3ABK C;  4NTY A;  2YIA A;  1IXM A;  3G71 V;  4B7K A;  3JCU Z;  2PF4 E;  3AK2 A;  4TUY B;  4I4T B;  1XNR O;  4LWS B;  1P84 F;  4UFZ A;  4UUJ C;  4PI0 A;  3U11 A;  1K73 W;  4H44 B;  1N33 B;  1BE3 H;  4WFF A;  4U7N A;  1WA8 B;  1R6K A;  4MVS A;  4WFE A;  4RAI A;  2YXL A;  4YY3 B;  5LHH A;  2ITD C;  1Q3E A;  3CE2 A;  3JAR B;  2YEV B;  2RMK B;  2WPD G;  1ZTE A;  2UXC B;  4DV6 B;  5C8Y B;  4JI5 O;  4C7U A;  5EC2 C;  4TOI A;  2PUS A;  4UCS A;  3RT3 C;  2A79 B;  1M56 B;  2GUZ B;  1UFI A;  3QF7 A;  1VQ9 V;  2QTO A;  1S0V A;  5B1B C;  3SJQ C;  1W59 A;  1OCZ C;  2QTS A;  2ZIM A;  1VQM V;  2IU3 A;  4B3T O;  3M8A A;  3UO2 A;  5B1A B;  3ZHU A;  5B3S B;  1KKD A;  1FFT B;  3QG5 A;  2NN4 A;  1H2S B;  4JTD B;  2AZ0 A;  3QNE A;  4FPP A;  4TUY A;  3W7X A;  3ETE A;  3FAV B;  3JCZ A;  2ZCE A;  3M7M X;  2DW4 A;  1XNR B;  1ENV A;  1SES A;  4BR6 A;  1TUE B;  2WLM A;  1URF A;  3P30 A;  4UV9 A;  3E8B A;  3I5D A;  3X2Q C;  4WF9 V;  4KL1 A;  3K9A A;  3OGC C;  2QR4 A;  2EIM C;  4O2A B;  3JAR A;  4DR2 O;  1KP2 A;  3MAQ A;  5IYZ A;  3T4D A;  5ITZ B;  2GUZ A;  1B06 A;  4J7J A;  2X6B A;  3OTF A;  4JI5 B;  1P7B A;  2GTS A;  2ZIO A;  3ZMS A;  5CA3 A;  3U10 A;  2VWK A;  2F4V B;  4KFM A;  1BQ0 A;  3JSN A;  4GKJ O;  3OUF A;  2WAM A;  1MZF A;  2B1I A;  2H94 A;  3MHH C;  2QWP B;  2OCC C;  1DF4 A;  4H33 A;  1Q81 W;  5L3C A;  2ZIN A;  4B3T B;  1M4U A;  3CXH F;  4MVQ A;  2F95 B;  3BEH A;  4OPH A;  1P7G A;  1D5N A;  4BIU A;  3H1J H;  3AG4 B;  2Q67 A;  1OJH A;  4LF9 O;  4GUN A;  5IY5 C;  1BS3 A;  4J9Y B;  4I0X B;  4WBN B;  1NBM G;  3LDE A;  3THO A;  1HP8 A;  1K7D A;  3PJS K;  4DV5 O;  1Q86 W;  1YHQ V;  5EIB C;  1B6Q A;  3FKS G;  3LDD A;  2WA4 A;  4FFK A;  1SQG A;  1QQC A;  1KBH A;  4O2A A;  5L3D A;  1H2N A;  1GH6 A;  3K0D A;  1V55 B;  4OPA A;  4RO2 A;  3W7S A;  1FYJ A;  4DR2 B;  3GB7 C;  4Z2W A;  1HNW O;  1XOU A;  3VQX A;  3G6E V;  3BA8 A;  4PA3 A;  3N2G A;  3K5L A;  3L74 H;  3K58 A;  1NQT A;  2YC0 A;  4Q6G A;  4CS4 A;  1SKV A;  4YHH O;  4CBC A;  1TAE A;  1FS0 G;  4GKJ B;  1FFX B;  2DE0 X;  4EFE A;  4DUZ O;  3ETD A;  4TT3 G;  1FPO A;  2LFR A;  1YXB A;  3OR6 C;  2HJD A;  1N0J A;  1RSO A;  3G80 A;  2EIK B;  4MVO A;  1XEQ A;  2UU9 O;  3STZ C;  1M5I A;  2YIC A;  4QE9 A;  4LF9 B;  3QO7 A;  3ASO B;  3B2E E;  4WBN A;  4QPJ A;  3GWO A;  4N21 A;  1W0K G;  1BMF G;  4LBE C;  4RWU A;  3RGB A;  3F5T A;  3L72 H;  3RYF A;  3D3Q A;  4DV5 B;  2YXH A;  3WG7 C;  1NZ6 A;  4D7T A;  4I55 B;  1LNQ A;  4ZHQ B;  5LP6 A;  1J5E O;  3CD6 V;  4PV1 B;  2IM9 A;  1HNW B;  1AVM A;  2ARH A;  4ZI7 B;  4AIL C;  2CTQ A;  4B3M O;  2WLI A;  3MDS A;  5HFL A;  4KXR A;  1ZAU A;  4FFB B;  1OCR B;  4YHH B;  1FFX A;  1I08 A;  2H8P C;  1Y67 A;  2CTP A;  3CC2 V;  2EBO A;  3E86 A;  5FPO A;  4DV1 O;  4DUZ B;  2NR5 A;  2JDI G;  1JX9 A;  3SR2 C;  3B77 A;  1QCE A;  5J9P C;  5FL7 G;  2UU9 B;  3CRR A;  4DK1 A;  4KHP O;  3RN4 A;  4WFH A;  3CWB H;  4FM0 A;  3DTU B;  1YIJ V;  4RUE A;  1BQZ A;  1XRE A;  3L9D A;  1SET A;  5KUM A;  1F4N A;  1VMG A;  3OM3 B;  5H6R A;  3H1L H;  3SYC A;  1AJN A;  1N0N A;  1K5S A;  2QWQ B;  3W7T A;  4I55 A;  1ROP A;  4JI6 O;  4GX2 A;  4LF6 O;  3CCU V;  2CH7 A;  4FLW A;  2DYR B;  1KUQ A;  3J7A U;  3H9V A;  1THZ A;  4KP4 A;  2DWD C;  3CCQ V;  2ETN A;  4XBF A;  1J5E B;  1Q90 D;  3FFQ A;  1VF7 A;  3OW2 U;  3OMN B;  3ZRW A;  2WA3 A;  2LJ2 A;  1BSM A;  2ZNJ A;  2E3C A;  1R3K C;  4B3M B;  3HKB A;  4QGP A;  3E83 A;  3L75 H;  4GX1 A;  2ZE8 A;  3N27 A;  3OAA G;  2F23 A;  3CRQ A;  3CSX A;  4DRX A;  1DLB A;  1KQS U;  3L71 H;  4Q20 A;  1MOF A;  1EN5 A;  4GX5 A;  3CHX A;  1RP3 B;  4DV1 B;  1MMM A;  4NYK A;  2ZDI A;  1IBK O;  2ADQ B;  1PNK A;  3HPL C;  4PDV A;  1VQP V;  1PKX A;  4KHP B;  4HYO A;  2Q7E A;  1K33 A;  1ZX3 A;  1HNZ O;  2XHB A;  1LR1 A;  1Y76 A;  2UXN A;  3FYE B;  4X9Q A;  2F43 G;  3FX7 A;  3CJH B;  4JAA A;  2EZP A;  2HKO A;  4GKK O;  4DR6 O;  2QDO A;  2Q73 A;  4BWA A;  3F5W C;  2GV9 A;  3UM7 A;  3ABM C;  4G27 B;  3ZMU A;  3BPZ A; 
#chains in the Genus database with same CATH homology
 1QVF U;  1Y4M A;  4GCZ A;  2P67 A;  4TWK A;  4XDL A;  5IYB O;  3HB3 B;  3AG2 B;  3UKM A;  2NLJ C;  3I56 V;  3W7W A;  3ZMT A;  5EK0 A;  1F4M A;  3I55 V;  3AG2 C;  4PDL A;  1VQ5 V;  3ZMV A;  3OEE G;  3SYA A;  4MSW C;  1P4R A;  2W6J G;  3AG1 B;  2WLK A;  3ABK B;  4OXS A;  4F4L A;  4R7C A;  5H6Q A;  1QR8 A;  3LNM B;  2WLL A;  3CP1 A;  1YTF D;  3RVY A;  3CC7 V;  3AG1 C;  1VQO V;  2P6J A;  3ABK C;  4FK5 C;  3FB8 C;  4UXN A;  2OTJ V;  1IXM A;  1PNM A;  4FMT A;  1H8H G;  3G71 V;  1VQ8 V;  4ZKI A;  1QLN A;  4R8C A;  3IC7 A;  1OCC B;  2IW5 A;  2P90 A;  2WWW A;  3ETG A;  2HLD G;  4WFB V;  2A0L A;  4UUJ C;  4PDR A;  1PNL A;  1K73 W;  2DQ3 A;  2XAF A;  4PA6 A;  4WFF A;  3CYO A;  2K1E A;  2EIL C;  3E2E A;  1EBO A;  1CP9 A;  1W0J G;  1V54 B;  4U7N A;  1CEZ A;  1R6K A;  4MVS A;  4JAU A;  4LCU C;  4WFE A;  4RAI A;  2V7Q G;  3OEH G;  4ZBM A;  4MS2 A;  1V54 C;  2WSS G;  2JK5 C;  2EZO A;  4TSF G;  1E79 G;  5LHH A;  2HVK C;  2ITD C;  1NR1 A;  2B1G A;  1JQ0 A;  2YEV B;  1GMG A;  3K79 A;  2DYR C;  2QEX V;  4I9W A;  2WPD G;  5IDJ A;  1GM7 A;  1FXK A;  4WFG A;  3D36 A;  5B1B B;  5EC2 C;  4I5S A;  5CBG A;  2A79 B;  1M56 B;  1VQ9 V;  2HVJ C;  5KUK A;  5KA6 A;  2QTO A;  1S0V A;  2P7T C;  4LC1 A;  1Y66 A;  2IJK A;  5B1B C;  5EBW C;  1WPX A;  3SJQ C;  2WLI B;  1OCZ C;  2XAG A;  1VQM V;  1VQ4 V;  2IU3 A;  3CCL V;  5B1A B;  5B3S B;  3TET A;  2ZR3 A;  3AG3 C;  4RQF A;  3CCJ V;  1KKD A;  5C93 A;  3LSQ A;  4MVZ A;  4G28 B;  1FFT B;  2JEU A;  1J95 A;  1NJI W;  1QBZ A;  2WLN A;  3CME V;  5B1A C;  5LGU A;  2GHY A;  3K06 A;  4JTD B;  3CCV V;  3QNE A;  4FPP A;  3SPH A;  3W7X A;  3ETE A;  3A0R A;  3JCZ A;  1S76 D;  4JTC B;  4MW8 A;  3W7U A;  1H2G A;  2DW4 A;  1ORQ C;  1ENV A;  1H8E G;  1SES A;  4QIW F;  2QA4 V;  3X2Q B;  1EZJ A;  2WLH A;  1UJW B;  1K92 A;  1S5H C;  2EIN B;  2QE7 G;  3R65 A;  2KB1 A;  2Q6A A;  1TUE B;  2EIM B;  2WLM A;  2XND G;  5B1O A;  3P30 A;  5LGN A;  1F51 A;  1K3E A;  4UV9 A;  2LP7 A;  3ASN C;  3E8B A;  3X2Q C;  4WF9 V;  2EIN C;  1JVM A;  3K9A A;  3OGC C;  3K03 A;  4J9Z B;  2EIM C;  1I5X A;  2R9I A;  4MVM A;  1BHA A;  2ZXW B;  1KP2 A;  3T4D A;  2LFS A;  4E2L A;  1YJW V;  5CBH A;  1GO3 F;  1JJ2 U;  3FB5 C;  2PI4 A;  1OCO B;  2ZXW C;  4JYC A;  2QM8 A;  3CXC U;  3JD0 A;  5LHG A;  3MD0 A;  2Q68 A;  2IH3 C;  1AI4 A;  1NH2 D;  1VQL V;  2X6B A;  3CPW U;  4H37 A;  3SPG A;  3E89 A;  1P7B A;  2XAQ A;  1W2B U;  1G8M A;  2HR3 A;  1BL8 A;  2OCC B;  2X6A A;  3ZMS A;  1L1F A;  5CA3 A;  2UXX A;  2B5U A;  2W6I G;  1M1K W;  4KFM A;  1ARO P;  3E8G A;  2WAM A;  3OUF A;  3ZRW B;  2R9R B;  1OHH G;  2B1I A;  2H94 A;  3FB7 C;  3MHH C;  1NVP B;  2OCC C;  1DF4 A;  3JD1 A;  4H33 A;  1Q81 W;  5L3C A;  1R3L C;  4X8A A;  2DWE C;  1NR7 A;  2D3O W;  1AR1 B;  1KD1 W;  4MVQ A;  3BEH A;  4R50 A;  1GM9 A;  1YI2 V;  5IY5 B;  3CMA V;  4BIU A;  1BHB A;  1YIT V;  3AG4 B;  4PA4 A;  2Q67 A;  4DO2 A;  1NKD A;  1E1R G;  1OCC C;  3K0G A;  1KEC A;  2ITC C;  3AEI A;  5IY5 C;  4FIP C;  5CBF A;  4J9Y B;  1MSW D;  1F23 A;  3AG4 C;  1NBM G;  3LDE A;  2ZQM A;  1AI5 A;  3CCM V;  2EJR A;  3TCU A;  3ZJZ A;  3TK1 A;  1K7D A;  3OFN G;  3PJS K;  1Q86 W;  1YHQ V;  3B8N A;  1YTF B;  1B6Q A;  3FKS G;  4CZZ A;  3IFX A;  3LDD A;  4LP8 A;  2ZD9 A;  4BIZ A;  4MW3 A;  3VOU A;  1K4D C;  5L3D A;  1ZWI C;  2XAS A;  3K0D A;  5CMU A;  3FB6 C;  1V55 B;  3NXS A;  4MTF A;  2XAH A;  4RO2 A;  4U7O A;  3WFV A;  3GB7 C;  3W7S A;  2X6C A;  3G6E V;  3B8M A;  4PA3 A;  3T1C A;  3EHB B;  1N8R W;  5IYC O;  1COW G;  3BY6 A;  4UV8 A;  2IJH A;  4GX0 A;  1M56 C;  1M57 B;  3KG2 A;  1NQT A;  1KP3 A;  4JF3 A;  1K9M W;  2FTK A;  2CK3 G;  4YXW G;  5EC1 C;  1VQ7 V;  1EFR G;  4CBC A;  3RBZ A;  3SPJ A;  3LSS A;  2X0L A;  1R73 A;  1FS0 G;  1R3J C;  3LDC A;  4JPR A;  5L3B A;  1K34 A;  3ETD A;  1AJP A;  2AHZ A;  4TT3 G;  5B3S C;  2LFR A;  3H01 A;  1FXV A;  2JJ1 G;  3OR6 C;  1E1Q G;  2EIK B;  2WLL B;  1K5Q A;  3D3I A;  4MVO A;  4WFA V;  3ML0 A;  2XOK G;  3F7Y C;  3K04 A;  1GM8 A;  1I5Y A;  4XDJ A;  3STZ C;  3EFF K;  3E35 A;  5IYD O;  2EIK C;  4QE9 A;  2Z3Y A;  3QO7 A;  1SER A;  3ASO B;  1QLE B;  5LGT A;  4QPJ A;  3GWO A;  4QJF B;  2YSU B;  4N21 A;  5L3F A;  1W0K G;  1BMF G;  1VQK V;  4LBE C;  3WG7 B;  2HG5 C;  2GSM B;  1YJN V;  4P9P A;  2V1D A;  1HWY A;  2BOB C;  1KC8 W;  3QO5 A;  1H38 A;  2JEX A;  4MTO A;  3WG7 C;  3JD2 A;  2DYS B;  3RVZ A;  2YEV A;  3ZRX A;  1MAB G;  1M9N A;  3FYI B;  1LNQ A;  2NNU A;  2DYS C;  5H9C A;  3LUT B;  5E1A C;  3CD6 V;  1NVP D;  2Y69 B;  3ABT A;  1OCO C;  1JCH A;  1K97 A;  4P2Z A;  3ZN0 A;  5BZB A;  3VBB A;  5LHI A;  3DGE A;  1Q82 W;  1MG1 A;  1GKF A;  2Y69 C;  3ZCC A;  4DXW A;  1WLE A;  1FXK B;  2WLI A;  3CC4 V;  5HFL A;  5GW7 A;  1OZ0 A;  4BAY A;  3ABU A;  1QVG U;  1AI7 A;  1DTO A;  2W0F C;  1OCR B;  2QM7 A;  4PEL A;  2QKS A;  3OE7 G;  4UVB A;  1FXK C;  2IJJ A;  2H8P C;  3CC2 V;  3MHS C;  1JPX A;  2EBO A;  1CPY A;  1S3J A;  4WCE V;  3E86 A;  1OCR C;  2A9H A;  3ABL B;  3OMA B;  2ATK C;  4MT8 A;  3G4S V;  3SYQ A;  2JDI G;  2AHY A;  1JX9 A;  3B77 A;  3IGA C;  1QCE A;  4L87 A;  5J9P C;  5HFM A;  3ZIA G;  3ABL C;  1NH2 B;  4QE7 A;  4PA9 A;  5FL7 G;  3JYC A;  3SPC A;  4MTX A;  2DQ0 A;  1YSC A;  4WFH A;  3OUS A;  2IJI A;  3JD4 A;  4MTG A;  2EIL B;  3DTU B;  1YIJ V;  4GT1 A;  1VQN V;  3T2M A;  4QNH B;  4RUE A;  4PDM A;  2ZDI C;  1GK9 A;  3K08 A;  4FJC C;  1SET A;  3T4Z A;  5KUM A;  1YJ9 V;  3ZN1 A;  1F4N A;  1S72 V;  1RM1 B;  4MVU A;  3OM3 B;  5H6R A;  1AJQ A;  3SYC A;  4N23 A;  1AJN A;  1RPR A;  3F7V C;  5KA5 A;  2Q69 A;  1K5S A;  3W7T A;  1ROP A;  4EKW A;  1RM1 C;  4KUM A;  4GX2 A;  3ZRV A;  1DF5 A;  4HZ3 A;  5EBM C;  3ZMZ A;  4JAV A;  3SPI A;  1XL6 A;  2HJF C;  3CCU V;  3JD3 A;  2DYR B;  2Y48 A;  3SYP A;  1V55 C;  3CCR V;  1JOY A;  5CN0 A;  2HFE C;  2MK3 A;  1THZ A;  4KP4 A;  2M7W A;  2DWD C;  3CCQ V;  4G2K A;  1SZT A;  4XBF A;  4R6Z A;  1G4Y B;  3OW2 U;  1XL4 A;  1VQ6 V;  3OMN B;  3ZRW A;  2Z5U A;  2JJ2 G;  3ZRS A;  1M57 C;  2XAJ A;  4UVC A;  4Z1M G;  1R3K C;  5EBL C;  2OT5 A;  5B1N A;  3E8F A;  4JGS A;  4P30 A;  1RPO A;  1OCZ B;  3E83 A;  3OR7 C;  3SYO A;  3P32 A;  1K4C C;  4GX1 A;  3OAA G;  4X89 A;  2BOC C;  3AG3 B;  2EIJ B;  1DLB A;  4ASU G;  3E8H A;  4Q20 A;  1KQS U;  1Q7Y W;  1K8A W;  2PI5 A;  4P9O A;  1MOF A;  4HAM A;  4GX5 A;  4PA7 A;  2IU0 A;  5DM6 V;  5DN6 G;  1SRY A;  1R3I C;  3M99 B;  1GTO A;  2EIJ C;  2WLJ A;  3STL C;  4RUF A;  4JYB A;  3OMI B;  2JIZ G;  2ZDI A;  4XDK A;  1PD3 A;  3RW0 A;  1PNK A;  3HPL C;  4PDV A;  3CCS V;  1VQP V;  1PKX A;  2X7R B;  3ASO C;  1QLE C;  4HYO A;  4X88 A;  2C2A A;  1K33 A;  1AI6 A;  2OTL V;  3QO8 A;  4JAS A;  3CCE V;  4QPK A;  2UXN A;  1QR9 A;  4MVR A;  4UVA A;  3FYE B;  5L3G A;  1M90 W;  1FXH A;  4JTA B;  2F43 G;  3ASN B;  1PL0 A;  3K3W A;  3ABM B;  2EZP A;  1S77 D;  5LBQ A;  2IH1 C;  2HKO A;  2ZR2 A;  4RQE A;  5L3E A;  3F5W C;  1R6N A;  3UM7 A;  3ABM C;  4G27 B;  3ZMU A;  4BW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...