2VRZA

Structural analysis of homodimeric staphylococcal aureus esxa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
98
structure length
98
Chain Sequence
b'AHMAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIRULENCE FACTOR ESXA
molecule tags Cell invasion
source organism Staphylococcus aureus
publication title Structure of Staphylococcus Aureus Esxa Suggests a Contribution to Virulence by Action as a Transport Chaperone and/or Adaptor Protein.
pubmed doi rcsb
total genus 44
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2vrzA00
3Q4HA 3ZBHA 2AZ0A 3HR0A 1WA8A 3Q4HB 2VRZA 2VS0A 3TXQA 2DE0X 3FAVA 4LWSB 3OGIB 3FD9A 2KG7B 4LWSA 4I0XA 3G80A 3TXSA 3FAVB 3GVMA 4GZRB 3O9OA 4I0XB 2KG7A 2AZ2A 1WA8B 2B9ZA 4ABMA 3GWKC
chains in the Genus database with same CATH superfamily
1A32A 2EIJC 1SRYA 1P4RA 1US6A 1BGYH 4YY3B 4ZBMA 4LF7B 4F6RA 2ZR2A 4DUZB 3TJTA 1KU9A 5CB4A 2UUAB 5IY5C 4FK5C 3CCVV 1E1QG 1H38A 3ZJZA 3BAAA 4DV5B 3K5LA 1FJGB 4YJ3A 2IM9A 3SJAC 5LHGA 4JZ2A 2Q0OC 2JRIA 3ABMB 5KHGA 5BXZA 1IXBA 3G6EV 4X1KA 3M8AA 1VARA 5FPOA 1EZVH 3CEIA 3HKCA 3PJSK 2UUCO 1G8MA 3CD6V 1WPBA 4F6RB 4U3JB 3RYHB 1IVSA 1Y74B 4K0KO 3BY6A 1Q3EA 3SR2C 2UXXA 3DXRA 4JAVA 1UPGA 1VQPV 4NB5A 1ZAUA 3FD9A 4MVMA 3OE7G 3FKSG 3N2GA 4MTOA 2QR4A 2FTKA 3AG7A 3RFRA 2D2CB 4QPJA 1TUEB 2CDYA 1HWYA 2ZE6A 2QEXV 2P5OA 4DR2B 3CRMA 3WB2A 5L3CA 1PPJH 4K0KB 2A9HA 1OV9A 2F93B 1JFFA 2N05A 2Z0AA 3FAVA 4X89A 3CRRA 4G2KA 4X88A 2HG5C 3MD0A 4DV6O 4JI6O 4MVZA 2UXDO 2ITCC 3HKDA 4JI7O 1XL4A 1WLEA 1Y4MA 2DYSC 2Z3YA 1UFIA 1BHBA 3LDDA 3T1YO 1F7YA 2BTOA 2ZXWB 4WFAV 4DV2O 3EVKA 5BZBA 2Q69A 1VQOV 2W0XA 1B06A 4I50B 3QNEA 4BAYA 3E8HA 1P7GA 1VF6A 2F23A 4JI3B 1Y67A 2B1GA 4TWKA 1F23A 4GX5A 5EIBD 1ZSPA 1I0HA 1L1FA 4MVQA 2BTQB 2PY5A 2OWOA 3UKMA 2AW9A 4EKWA 2CTRA 4NXMO 2OTJV 1R3JC 1XOUA 4PDLA 4KP4A 1QCEA 1FKAO 2PYJA 5GTIZ 2Q4PA 2GV9A 2RQ6A 1RP3B 3F5TA 5JCOC 2Q8VA 3RYCA 3CHXA 2FKXA 2Y0IA 1ZLZA 4X9QA 2CH7B 1VF5B 3G71V 5JWPA 4B3TB 1SQPH 4WFBV 3ZN0A 4JTDB 1BL8A 2UU9O 4IHJB 2EX3A 4B3MO 4X65B 5EYPA 2N04A 3E2EA 1HR0O 1YHQV 2YC0A 1XL6A 3LNMB 1M9NA 2W6IG 1LNQA 4JI2B 3APOA 2QDOA 2VQEO 1TUBA 1R3IC 2NLJC 3ZHTA 5D5QA 1QLEB 1VEWA 5B1AC 4LFAB 2YIBD 1N32B 5EBMC 1K8AW 3IJ4A 4X64B 1YJNV 4B3MB 2B1IA 4JI5B 1VQMV 2UU9B 3TGUH 4LF6B 3E22A 1N36O 2JK5C 1E1RG 5L3GA 3E86A 2QWNB 4JI1O 4H13B 2JS3A 1FXKB 4K35A 4B3SB 3ZRWA 5CA1B 5IJ0B 1THZA 2FB5A 3TXSA 2P4KA 4Q20A 4UV9A 1QQCA 2UUBB 3U10A 1NT2B 1Q5OA 2H94A 3C3TA 4DYLA 4JI3O 3AG4B 4N21A 3RGBA 4O4IB 1ZUQA 4EFBA 2UXBO 4BIZA 1YTFD 1FS0G 4YXWG 1OCRB 4CH4A 3AG2C 5FPRA 3TXQA 3CRQA 2JIZG 4JYYA 4O2BB 4WFGA 1AP5A 4PV1B 5CA1A 5KX5A 5L3EA 4DR5B 4J42A 4WF9V 4G28B 4UCUA 4J10A 1QLEC 5LA6A 4JI0O 3CMEV 4YHHO 5D5PA 5DM6V 3RT3C 1XQ8A 2LFRA 1EN6A 4NVPA 5LL6Y 1KKCA 1K34A 5J2TB 4LFCB 2KQXA 1XBLA 2ZQMA 4X66O 2YI9A 1RSOA 4ZI7B 2KG7A 2V4DA 2QJ1A 3I55V 1XNRB 2OCCB 4K3AA 4IGGA 4PA3A 2OCCC 4MVSA 5CBGA 2WLMA 1MZFA 1H8EG 3FYIB 1XMOB 4JV5O 1DK1A 2WLKA 3QO5A 2Y4TA 4GLXA 4O4LA 1R3LC 2FMLA 4RUFA 1AR1B 3ZX6A 2WA4A 3FB8C 4E2LA 4LFBO 1OJHA 1GAXA 2IH3C 3AG1C 5A2QN 3WU2Z 1VQLV 4X66B 1YF2A 3KG2A 3CCQV 4LFCO 2IH1C 1AI5A 5ITZB 1JJ2U 2DMXA 3ZIAG 2ZKOA 1K3EA 5KHHA 4TQFA 4O2BA 2CGOA 5JQGB 4AI8A 3JALA 2WLIB 1URFA 1XMQO 1NKDA 3H1LH 4GZRB 5LYJA 4BIOA 4I0XB 4AQYO 4UXNA 1VQ8V 1GTOA 1RPRA 4O4HB 1MABG 4X62O 5CMUA 1Z5WA 4JI4O 3U0ZA 4CH5A 4J9ZB 2IJJA 4AILC 2E74B 2QM7A 4FM0A 1WB7A 2HHHO 1RSOB 3K9AA 1K5SA 3OW2U 2UXBB 5C8YA 2WLLA 1IURA 5J2UB 4JAAA 5CA0A 4JYAB 1S76D 2ATKC 1YSCA 5L3BA 1XMQB 3J81N 2W0FC 3T4ZA 2CTWA 1BCCH 1M56B 4LFBB 2E76B 2DWEC 1P49A 5LMNO 4I4TB 2F95B 3ZRSA 3AG4C 4XBFA 4W4KA 1JA8A 4G27B 2F4VO 1XHZA 1GN4A 1GKFA 2EILB 3THOA 4K8XA 1XNRO 1NTZH 3MDSA 2XAGA 5JQGA 3LSQA 1R3KC 2XTAA 3CX5F 1WAZA 3ASOB 5LYJB 3BEHA 2DQ0A 4LF6O 2OT5A 1Z5VA 2YICA 2A06H 3ZHSA 4JF3A 4I9WA 1AI7A 1N32O 2WLJA 2VS0A 2ZE7A 1DF5A 5FLXN 1RFYA 2K9PA 3EXAA 1YI2V 2AXTZ 2YXHA 2VWKA 2VWJA 5GTHZ 4DV1O 5KA5A 2QM8A 4GUNA 2ILMA 1W0JG 3KCYA 4X8AA 2OCHA 1S0VA 3ETEA 3L70H 1BZKA 3E35A 3L73H 2HVJC 1QLNA 2EZPA 1K97A 4GX1A 5IDJA 1WN7A 2LO1A 3OTOB 3OFNG 4LNUB 1Q81W 1HNXB 3H1KH 3CP1A 4JTAB 1WA8B 4B08A 1YITV 1K4CC 1R73A 4TV8A 1RM1B 4NTWA 4UCVA 1PV0A 2QSAA 4DV7O 3VQYA 3IFXA 1XNQO 2A3QA 1IBMO 3JATB 4GCZA 2Q7GA 1ZL8A 4DV2B 1XI1A 1SF9A 3JYCA 1W0KG 3CB2A 3TK1A 4X64O 4ABMA 1K9MW 2RN9A 1L0LH 1F51A 3GWKC 1VF7A 1HNWO 2X0LA 3CXCU 2AHZA 4XDKA 2YXLA 1F4MA 1NH2B 3N2GB 1KUQA 4UB6Z 5EZYA 2CGNA 5L3FA 4MS2A 3T2MA 1H2SB 1DF4A 1M4UA 1VQ4V 5K1XA 4DV7B 4DV0B 5KHIA 2B5UA 2JDIG 1AVMA 4YY3O 4ICGA 1RM1C 2M7WA 1Q82W 3Q4HB 1J95A 2P06A 2ZNIA 2PYLA 4LR3A 1SA0B 2IU0A 4D6TH 1EBOA 1YEWA 4DR2O 3ABMC 3SYQA 3DSQA 3ZMZA 3JCUZ 5IJ0A 4JYBA 3W7UA 1VQ5V 1Y76B 1SKVA 2MW2B 4MVOA 2LP7A 4EFEA 2WWWA 1QVGU 4D7TA 1G6UA 1GN6A 2OIGA 5LMUB 1MZEA 3JALB 3PN1A 5EYPB 1K73W 1AR5A 2GTSA 5H5NA 4DV4B 3ASNC 5CBHA 1GM9A 1FJGO 1FFXA 2Q0AA 1M57B 4J7JA 1EN5A 4LBEC 1W59A 1IBMB 1RPOA 3W7TA 4JI7B 1FD9A 4FVMA 4JI0B 3VBBA 3VQVA 4MW3A 4IL6Z 2QKCA 2Q7HA 4GKKB 3AG2B 4P9OA 4U3JA 3CMAV 3ABLC 2FL4A 3STZC 1GK9A 2HEPA 3T4DA 4DV4O 1J5EB 1SESA 3BHPA 3FX7A 4PA4A 1N0JA 2JJ1G 2R72A 5B1BC 3ZRVA 2EIKC 4I55B 1LUVA 4E4EA 1FXKA 2V1DA 3IGAC 3NXSA 1CPYA 5FNVA 1H2LA 3VOUA 1DLBA 1OCCC 4LH7A 3SPJA 4W4LA 1HNZO 3K03A 3JD2A 1AR4A 3CC4V 4MTXA 3WG7B 3K0GA 1IBKO 1N33O 3JARB 4FIPC 3P32A 4KUMA 1K7DA 1VIBA 2PUSA 3H9VA 1WNSA 3HKCB 4PI2A 1JPXA 4FLUA 2RMKB 4DV0O 1PP9H 2Y69B 4MSWC 3HKBB 4CH6A 4DV3O 4RAIA 2WAMA 4LF9O 4L8JA 1V55C 4TSFG 3SJBC 4NYKA 3ZMVA 2Q9LA 2M6YA 2HLDG 2WSSG 1D5NA 3H1HH 2CTQA 3WB0A 4FZ0A 4U7NA 1GO3F 4DRXA 2VQFO 3LSSA 4UCOA 2GUZB 1PNMA 4FLTA 1MA1A 5JH7B 4QGPA 1H2KA 4HNAA 1JOYA 5IYBO 4I55A 2ADQB 2Y0PA 3JASA 4UCTA 1XNQB 3ETQA 4FM1A 4JI1B 1LR1A 1O9GA 2RCVA 5KA6A 2QGNA 3H1IH 5GONB 3AEIA 3W7SA 1JCHA 5LBQA 1AILA 3X2QB 3ZMTA 1WB8A 4GX0A 3N2KA 5JJEB 3OEHG 1XEQA 4WBNB 1O9HA 3E8FA 1COWG 4TUYA 4RUEA 4TV9A 2ADPA 5CN0A 2ZIMA 5IYZA 1PNLA 1YJ9V 3P3PA 3UM7A 2HVKC 2VQFB 3AG3C 4FLZA 4JI4B 1N0NA 5B3SC 4NTYA 3NR7A 1WP8A 1Q43A 5H6QA 1AI6A 3T1YB 3GWOA 1KYOF 4DR6O 2XOKG 2JGDB 3BA8A 4BR6A 3OGIB 2ZT9B 3A0RA 1SA0A 4DRXB 5IWAB 3FB7C 1G1XB 1NJIW 4OXSA 3QO7A 3DTUB 1FAFA 3OUFA 3KCXA 4GYCB 4LF4B 2MK3A 1V54B 1YDXA 5JJNB 4F4LA 1DTOA 1M1KW 2QA4V 2HFEC 1K33A 1I5YA 3OGCC 3QG5A 1OHHG 1N34O 3DC6A 5C93A 4QNHB 2UXCO 2HJFC 3JD1A 2DN9A 4PA7A 3G80A 3GVMA 4OPHA 2CK3G 2GTAA 3JSNA 1ORQC 3LSUA 3TETA 5A9GA 3L72H 3BFRA 1ENVA 4OX9B 1QVFU 5LXTB 2A0LA 1FFTB 4NXNO 1H2NA 2P6JA 1V54C 4PDMA 3I56V 5K1PA 4CS3A 4JYAO 4ZHQB 1CXZB 3JSLA 1WJZA 4JPRA 1L8DA 1SQGA 3JAWA 2YEVB 3BABA 1GN3A 2L6LA 5B1AB 3AK3A 1EN4A 3SPIA 1BHAA 2PGGA 1KECA 4P2ZA 1Q90D 2EIMC 1OCZB 2QWOB 3LNNA 2UXDB 5H2FZ 3R65A 1P7BA 4JI6B 3L75H 3RYIA 2V7QG 2CUGA 2JGDA 4UUJC 3K0DA 4X1IA 2ZXWC 4ZOLB 1S5JA 4B3RB 3STLC 3HKBA 2P4VA 2GUZA 2BCCH 3SJCC 3LUTB 1MNGA 4CZZA 4J41A 1ROPA 3ABKC 4RO2A 4DR4O 4P30A 4AHCA 4CS4A 1PL4A 4R7CA 4I0XA 2EIMB 2F4VB 3RYFB 3OM3B 4I9QA 2XHBA 1IX9A 1JJOA 2QKSA 4Q6GA 5KAIZ 1NVPD 2ODMA 4D7SA 1NBMG 1GRJA 1Y76A 3KZIZ 1YJWV 1TA8A 3T1HB 2IW5A 4IYHA 4MVRA 1FXVA 4B3RO 3C90A 3ZHVA 3J80N 2IBZH 3RBZA 1BS3A 1I94B 3ABKB 4TV9B 5B3SB 5C8YB 1G4YB 4IIJB 1D5AA 3W7WA 4UV8A 4YJ2A 4DO2A 4R6ZA 2DWDC 4FLVA 4PA9A 5TISZ 3DC5A 5LA6B 4LP8A 2LQTA 4DR1O 3OMIB 1DGSA 1BMFG 2ZIOA 3K06A 3JD0A 3G67A 2HR3A 4J7KA 1BQZA 1CP9A 2AZ0A 2ZCEA 4DV3B 2GHYA 3LDEA 2XT9A 3H01A 2YXYA 1ZL8B 1AJNA 3CRCA 5DEDA 1I5XA 2ITDC 2BOCC 2LGQA 3H1JH 4OX9O 4JGSA 3E8GA 1SC5B 3HKEB 1OCCB 4O4HA 4PDRA 5LP6A 1NH2D 3U11A 4DK1A 4HYOA 2YSUB 3CCEV 3UO2A 2BSKB 2XASA 4LF4O 1QR9A 2IJHA 2DE0X 1MSDA 4DUYB 4JI8B 1IXMA 4PI0A 5L3DA 1KB9F 1T5EA 2PTMA 1H2MA 1B3QA 5HFLA 5KHKA 1SETA 3ABLB 3F5WC 2E75B 2VRZA 4DV5O 1YZBA 5LP6B 1F4NA 2PF4E 2YDEA 3IC9A 2FYUH 2QKAA 2X6AA 3UT5A 3ABUA 5E1AC 3P3NA 2Q6AA 1VQ6V 2R70A 3IAYA 4UFZA 3ASNB 2JEUA 4PELA 1XUQA 2RNBA 4IHJA 3OTFA 1SQBH 3EFFK 1SQVH 3VQWA 2PZSA 1MG1A 1VMGA 1M90W 2A7WA 2RDCA 4B7EA 4U7OA 1P84F 5IT9N 1VF6C 4NXNB 1OCOC 3OMNB 5EC1C 1HP8A 2IJIA 2AZ2A 2X6CA 3HKDB 3OAAG 5ITZA 4FLYA 3JAMN 4JV5B 1GMGA 1XHXA 2K1EA 2Y48A 5LGNA 4LWSA 1R6TA 1NI8A 1VQNV 4CS2A 1KC8W 4TV8B 3HPLC 2EINC 3F7VC 4DR4B 3Q4HA 3B09A 2YIDA 2NN4A 1JMKC 5CA3A 2P22C 2R9RB 1R1BA 4DK0A 1ZWIC 1KP3A 4DW1A 3BA9A 3JAKB 5JJJB 5CBFA 3A8TA 3A0HZ 3HB3B 4FFBA 3B4SA 1B04A 2YUAA 4YJ3B 2DQ3A 4GKJB 3CPWU 1NU1H 2LW1A 4TOIA 4DR3B 2E5LO 3D3QA 1N33B 3OEEG 3M99B 4X20A 1OCOB 3CC2V 2JVDA 2JS5A 1LUWA 4B3TO 2Q7EA 4JI8O 1R6NA 2X6BA 5GONA 3D3IA 1M93A 3S3WA 5KX5B 4JASA 2UUBO 2G38A 1M5IA 4OGQB 3UCSC 1YXBA 4YJ2B 4KHPB 2QTOA 5LOVA 3GB7C 5H6RA 1H2GA 3QTCA 3ZN1A 4LWSB 3FB5C 4UVBA 1GN2A 3RVYA 2BTQA 2ETNA 1PKXA 2R9IA 2EIKB 2Q73A 2DW4A 1W2BU 4WFEA 1SS3A 1QNMA 2YEVA 2HKOA 4J7ZA 3ETDA 1Q6HA 4YIPA 5FL7G 1R6KA 4HBNA 4MW8A 5IE9A 3RWRD 5EC2C 4GKKO 1Y66A 2R9AA 1ZX3A 1FYJA 4Z1MG 2ZDIC 3K04A 3CJHB 3D36A 4J80A 4UVCA 5E79Z 1HW7A 2EJRA 4ZKIA 5LHIA 2PI5A 3WFVA 5FNVB 4CC6A 2ZE5A 3BVOA 2W6JG 5GW7A 4U3FH 3OTOO 1ZTEA 1I94O 3F7YC 2DOSA 3CCLV 3M7MX 5CB4B 3K5MA 3T1HO 1Q8IA 1NTKH 1HNXO 4FJCC 4JTCB 4C7UA 3UO3A 1Q6IA 2JEXA 1N36B 4Z1VA 1QR8A 3AK1A 5B1BB 2ZM6B 2GSMB 4FFBB 2KG7B 2OIEA 5LHHA 1SQXH 1PNKA 4X1IB 4YIOA 1BE3H 4LF8B 4JAUA 1WP7A 4O4JB 3AG3B 3CC7V 3E8BA 3CCSV 2E3CA 3K08A 4UCRA 1J5EO 3SGIA 2WLHA 3L9DA 4RQFA 2VQEB 1XDCA 2O57A 1AB3A 5EK0A 2Q5ZA 4JI2O 3CCRV 1NR1A 2XNDG 2QTSA 3CCJV 1HNWB 4UCSA 2BOBC 2UUAO 2OYQA 2WPDG 4LC1A 1HR0B 2Y69C 3ZRXA 4IYIA 5B5EZ 4HAMA 1X59A 1AP6A 4JYCA 4DV6B 2KSDA 5KAFZ 2DYRC 5H9CA 1TVKB 4DR7B 3QVNA 4EB6A 1YTFB 4FFKA 1IBKB 1JVMA 5LMNB 3JATA 4PJ0Z 2XUMA 3JASB 2ZINA 3B40A 3G6BA 4MT8A 3A0BZ 4DW0A 1SQQH 3OD4A 3CWBH 4GT1A 1WA8A 3SYPA 3OUSA 3ETGA 3JD4A 4FMTA 4I50A 3RVZA 4NXMB 1H8HG 1XMOO 3ABTA 5LOVB 3ZMUA 5JVDA 5IYZB 1GM8A 4O4IA 2WLNA 1SQFA 1K5QA 5DECA 4R8CA 2DJVA 4R50A 3R66A 1S77D 1OCZC 3SPCA 1TGOA 2WA3A 1VQ9V 2HHHB 4DV1B 1NTMH 2CAZC 3WB1A 1IDSA 3RW0A 3SYAA 4CBCA 4WFFA 1SZTA 3LDCA 4F6EA 5BY1A 2OTLV 2X7RB 3I5DA 4LNUA 3N27A 4H0LB 3N2KB 2YIAA 1I7FA 2H8PC 4LF5O 5KMGA 2LFSA 4LF8O 1VP7A 4J11A 3K57A 4EB6B 1IZ3A 5LGUA 1JFFB 3FAVB 3SYOA 4I5SA 3JARA 4H44B 4XDJA 5LMUO 2UXCB 1GM7A 1IBLB 3ZMSA 2ZNJA 1QU7A 4X1KB 4H33A 1N4CA 1OZ0A 2XAJA 5J9PC 4ZHQA 4RQEA 4P9PA 5JH7A 4TQDA 1NR7A 1PL0A 2QM4A 5EBLC 3JCZA 2GDSA 4FLWA 2UUCB 1YCIA 3CSXA 4NKGB 3ZCCA 1AROP 3B8NA 3DXRB 1FFXB 2HJDA 4IIJA 3RYIB 1Z2GA 5KUMA 2UXNA 5AG2A 3FYEB 2WLIA 2DYRB 2ZD9A 3K79A 2LJ2A 3B77A 1AI4A 1TAEA 2KKWA 3SPHA 5B66Z 3QF7A 1OCRC 4OPAA 3JAKA 1TUBB 1V9PA 4LF9B 2LGWA 4GX2A 4DUZO 1I08A 2XAQA 1MSWD 2CH7A 2BSKA 3O65A 2P7TC 5LXTA 3HR0A 4QJFB 1UJWB 2LW7A 1YVWA 3MHSC 2Q67A 2EJ7A 5BMVB 3L74H 4ASUG 2DYSB 1X4TA 3ZHQA 4YHHB 5EBWC 5EIBC 1FXKC 4DUYO 1PM9A 3ML0A 1NVPB 3DGEA 1VQKV 1KQSU 1QBZA 1NZ6A 1VQ7V 1GH6A 2EIJB 4MTFA 2D3OW 2B9ZA 2ZR3A 3RN4A 4WCEV 3J7AU 3K9SA 4BW5A 5KUKA 1BQ0A 1AJPA 1Q86W 2AHYA 3T1CA 5BMVA 1KD1W 1Q6UA 4LFAO 4O4LB 1EFRG 3E83A 1K4DC 3CCUV 4LF5B 3K3WA 1NS1A 4DXWA 5LGTA 3MAQA 1KMIZ 4NR1A 4GKJO 3BCCH 3E89A 4MTGA 2F43G 1MMMA 4X20B 4BIUA 3QO8A 4CC5A 4X65O 1V55B 2GBOA 3BRCA 5IWAO 1S3JA 4FM2A 5JCOA 3HKEA 3FFQA 1M57C 1FXHA 4WBNA 1JQ0A 4O2AA 2PI4A 4UB8Z 2Y4UA 4X1YA 4AQYB 3SPGA 2AGAA 5KMGB 1FPOA 2EILC 2KB1A 5EZYB 3SJQC 1N34B 3EHBB 1KBHA 4KXRA 3C3SA 4EEQA 4NTXA 3K58A 1K92A 2CTPA 1Y74A 2NR5A 2P67A 4UVAA 5F2VO 4IT5A 4J9YB 4WFHA 3K59A 2ZDIA 3WG7C 3FB6C 4FPPA 2IU3A 1AJQA 4ZIBA 5IYCO 3B8MA 5IYDO 3ZRWB 4CH3A 4PA6A 5IJ9B 1B6QA 4HNAB 3CE2A 2CE4A 4ZOLA 4DR3O 4PD4F 5BR8B 3E22B 1N8RW 1JR9A 3L71H 3UQ8A 2H3OA 3OR6C 3K5NA 3ZS8C 3S3XA 4A5UB 3CCMV 4I7ZB 1S5LZ 1PD3A 1BT8A 5LP6C 3SYCA 3RYHA 5DN6G 1D2DA 1XREA 5HFMA 3BPZA 4LH6A 3IC7A 3VQXA 1WPXA 1YIJV 5IJ9A 1SERA 4X62B 4KL1A 3ZBHA 1S72V 1Y6XA 2EULA 4X1YB 2QE7G 2XAFA 4O2AB 3OMAB 1EM1A 4Z2WA 2EINB 4HZ3A 4XDLA 5BR8O 1TVKA 3RYFA 3KKYA 5J2TA 1EZJA 3APQA 1MOFA 2HP8A 1IBLO 3AG1B 2ARHA 4JZGA 4QIWF 2ZM6O 1U96A 2ZE8A 4N23A 4LCUC 5B1OA 1SZXA 1HNZB 1KP2A 3CRAA 4QE9A 3ASOC 4PHZA 2C2AA 3UT5B 4H37A 4FZ1A 3RYCB 3CJHA 2F66C 1CEZA 3X2QC 3OR7C 2EBOA 4B7KA 1NQTA 2JGUA 3D8CA 2EZOA 4KHPO 3K5OA 5JVDB 3MHHC 3JD3A 3P30A 4O4JA 2YIBA 2QWPB 5J2UA 2N74A 1U97A 2F1MA 5CA0B 4DR7O 4K8ZA 2JJ2G 5IY5B 2L35A 3ZEDA 2Z5UA 4QPKA 4BW9A 4PDVA 4DR6B 3ZHUA 2E5LB 4I4TA 4MVUA 4DR1B 4QE7A 2Q68A 5B1NA 3ICXA 5KLVH 3AK2A 1Q7YW 3G4SV 3D36C 4TUYB 4RWUA 1HDJA 3CS5A 4DR5O 2A79B 3SDLA 4FLXA 3JAWB 2XAHA 4BWAA 2BE3A 2RJZA 4KFMA 3W7XA 3CYOA 2QWQB 5KHJA 3ZHRA 4LF7O 2IJKA 3TCUA 1JX9A 1S5HC 4TT3G 3OT7A 1E79G 1BSMA 2WLLB 2NNUA 4JI5O 1KKDA 2YS8A 1M56C 3O9OA 2P90A 4L87A 1QHTA 4B3SO 1XILA 2QWRB 2YI8A 1L0NH 3B2EE 3CXHF 4ZI7A 3A2FA
chains in the Genus database with same CATH topology
3Q4HA 3ZBHA 2AZ0A 3HR0A 1WA8A 3Q4HB 2VRZA 2VS0A 3TXQA 2DE0X 3FAVA 4LWSB 3OGIB 3FD9A 2KG7B 4LWSA 4I0XA 3G80A 3TXSA 3FAVB 3GVMA 4GZRB 3O9OA 4I0XB 2KG7A 2AZ2A 1WA8B 2B9ZA 4ABMA 3GWKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q4H A;  3ZBH A;  2AZ0 A;  3HR0 A;  1WA8 A;  3Q4H B;  2VRZ A;  2VS0 A;  3TXQ A;  2DE0 X;  3FAV A;  4LWS B;  3OGI B;  3FD9 A;  2KG7 B;  4LWS A;  4I0X A;  3G80 A;  3TXS A;  3FAV B;  3GVM A;  4GZR B;  3O9O A;  4I0X B;  2KG7 A;  2AZ2 A;  1WA8 B;  2B9Z A;  4ABM A;  3GWK C; 
#chains in the Genus database with same CATH topology
 1A32 A;  2EIJ C;  1SRY A;  1P4R A;  1US6 A;  1BGY H;  4YY3 B;  4ZBM A;  4LF7 B;  4F6R A;  2ZR2 A;  4DUZ B;  3TJT A;  1KU9 A;  5CB4 A;  2UUA B;  5IY5 C;  4FK5 C;  3CCV V;  1E1Q G;  1H38 A;  3ZJZ A;  3BAA A;  4DV5 B;  3K5L A;  1FJG B;  4YJ3 A;  2IM9 A;  3SJA C;  5LHG A;  4JZ2 A;  2Q0O C;  2JRI A;  3ABM B;  5KHG A;  5BXZ A;  1IXB A;  3G6E V;  4X1K A;  3M8A A;  1VAR A;  5FPO A;  1EZV H;  3CEI A;  3HKC A;  3PJS K;  2UUC O;  1G8M A;  3CD6 V;  1WPB A;  4F6R B;  4U3J B;  3RYH B;  1IVS A;  1Y74 B;  4K0K O;  3BY6 A;  1Q3E A;  3SR2 C;  2UXX A;  3DXR A;  4JAV A;  1UPG A;  1VQP V;  4NB5 A;  1ZAU A;  3FD9 A;  4MVM A;  3OE7 G;  3FKS G;  3N2G A;  4MTO A;  2QR4 A;  2FTK A;  3AG7 A;  3RFR A;  2D2C B;  4QPJ A;  1TUE B;  2CDY A;  1HWY A;  2ZE6 A;  2QEX V;  2P5O A;  4DR2 B;  3CRM A;  3WB2 A;  5L3C A;  1PPJ H;  4K0K B;  2A9H A;  1OV9 A;  2F93 B;  1JFF A;  2N05 A;  2Z0A A;  3FAV A;  4X89 A;  3CRR A;  4G2K A;  4X88 A;  2HG5 C;  3MD0 A;  4DV6 O;  4JI6 O;  4MVZ A;  2UXD O;  2ITC C;  3HKD A;  4JI7 O;  1XL4 A;  1WLE A;  1Y4M A;  2DYS C;  2Z3Y A;  1UFI A;  1BHB A;  3LDD A;  3T1Y O;  1F7Y A;  2BTO A;  2ZXW B;  4WFA V;  4DV2 O;  3EVK A;  5BZB A;  2Q69 A;  1VQO V;  2W0X A;  1B06 A;  4I50 B;  3QNE A;  4BAY A;  3E8H A;  1P7G A;  1VF6 A;  2F23 A;  4JI3 B;  1Y67 A;  2B1G A;  4TWK A;  1F23 A;  4GX5 A;  5EIB D;  1ZSP A;  1I0H A;  1L1F A;  4MVQ A;  2BTQ B;  2PY5 A;  2OWO A;  3UKM A;  2AW9 A;  4EKW A;  2CTR A;  4NXM O;  2OTJ V;  1R3J C;  1XOU A;  4PDL A;  4KP4 A;  1QCE A;  1FKA O;  2PYJ A;  5GTI Z;  2Q4P A;  2GV9 A;  2RQ6 A;  1RP3 B;  3F5T A;  5JCO C;  2Q8V A;  3RYC A;  3CHX A;  2FKX A;  2Y0I A;  1ZLZ A;  4X9Q A;  2CH7 B;  1VF5 B;  3G71 V;  5JWP A;  4B3T B;  1SQP H;  4WFB V;  3ZN0 A;  4JTD B;  1BL8 A;  2UU9 O;  4IHJ B;  2EX3 A;  4B3M O;  4X65 B;  5EYP A;  2N04 A;  3E2E A;  1HR0 O;  1YHQ V;  2YC0 A;  1XL6 A;  3LNM B;  1M9N A;  2W6I G;  1LNQ A;  4JI2 B;  3APO A;  2QDO A;  2VQE O;  1TUB A;  1R3I C;  2NLJ C;  3ZHT A;  5D5Q A;  1QLE B;  1VEW A;  5B1A C;  4LFA B;  2YIB D;  1N32 B;  5EBM C;  1K8A W;  3IJ4 A;  4X64 B;  1YJN V;  4B3M B;  2B1I A;  4JI5 B;  1VQM V;  2UU9 B;  3TGU H;  4LF6 B;  3E22 A;  1N36 O;  2JK5 C;  1E1R G;  5L3G A;  3E86 A;  2QWN B;  4JI1 O;  4H13 B;  2JS3 A;  1FXK B;  4K35 A;  4B3S B;  3ZRW A;  5CA1 B;  5IJ0 B;  1THZ A;  2FB5 A;  3TXS A;  2P4K A;  4Q20 A;  4UV9 A;  1QQC A;  2UUB B;  3U10 A;  1NT2 B;  1Q5O A;  2H94 A;  3C3T A;  4DYL A;  4JI3 O;  3AG4 B;  4N21 A;  3RGB A;  4O4I B;  1ZUQ A;  4EFB A;  2UXB O;  4BIZ A;  1YTF D;  1FS0 G;  4YXW G;  1OCR B;  4CH4 A;  3AG2 C;  5FPR A;  3TXQ A;  3CRQ A;  2JIZ G;  4JYY A;  4O2B B;  4WFG A;  1AP5 A;  4PV1 B;  5CA1 A;  5KX5 A;  5L3E A;  4DR5 B;  4J42 A;  4WF9 V;  4G28 B;  4UCU A;  4J10 A;  1QLE C;  5LA6 A;  4JI0 O;  3CME V;  4YHH O;  5D5P A;  5DM6 V;  3RT3 C;  1XQ8 A;  2LFR A;  1EN6 A;  4NVP A;  5LL6 Y;  1KKC A;  1K34 A;  5J2T B;  4LFC B;  2KQX A;  1XBL A;  2ZQM A;  4X66 O;  2YI9 A;  1RSO A;  4ZI7 B;  2KG7 A;  2V4D A;  2QJ1 A;  3I55 V;  1XNR B;  2OCC B;  4K3A A;  4IGG A;  4PA3 A;  2OCC C;  4MVS A;  5CBG A;  2WLM A;  1MZF A;  1H8E G;  3FYI B;  1XMO B;  4JV5 O;  1DK1 A;  2WLK A;  3QO5 A;  2Y4T A;  4GLX A;  4O4L A;  1R3L C;  2FML A;  4RUF A;  1AR1 B;  3ZX6 A;  2WA4 A;  3FB8 C;  4E2L A;  4LFB O;  1OJH A;  1GAX A;  2IH3 C;  3AG1 C;  5A2Q N;  3WU2 Z;  1VQL V;  4X66 B;  1YF2 A;  3KG2 A;  3CCQ V;  4LFC O;  2IH1 C;  1AI5 A;  5ITZ B;  1JJ2 U;  2DMX A;  3ZIA G;  2ZKO A;  1K3E A;  5KHH A;  4TQF A;  4O2B A;  2CGO A;  5JQG B;  4AI8 A;  3JAL A;  2WLI B;  1URF A;  1XMQ O;  1NKD A;  3H1L H;  4GZR B;  5LYJ A;  4BIO A;  4I0X B;  4AQY O;  4UXN A;  1VQ8 V;  1GTO A;  1RPR A;  4O4H B;  1MAB G;  4X62 O;  5CMU A;  1Z5W A;  4JI4 O;  3U0Z A;  4CH5 A;  4J9Z B;  2IJJ A;  4AIL C;  2E74 B;  2QM7 A;  4FM0 A;  1WB7 A;  2HHH O;  1RSO B;  3K9A A;  1K5S A;  3OW2 U;  2UXB B;  5C8Y A;  2WLL A;  1IUR A;  5J2U B;  4JAA A;  5CA0 A;  4JYA B;  1S76 D;  2ATK C;  1YSC A;  5L3B A;  1XMQ B;  3J81 N;  2W0F C;  3T4Z A;  2CTW A;  1BCC H;  1M56 B;  4LFB B;  2E76 B;  2DWE C;  1P49 A;  5LMN O;  4I4T B;  2F95 B;  3ZRS A;  3AG4 C;  4XBF A;  4W4K A;  1JA8 A;  4G27 B;  2F4V O;  1XHZ A;  1GN4 A;  1GKF A;  2EIL B;  3THO A;  4K8X A;  1XNR O;  1NTZ H;  3MDS A;  2XAG A;  5JQG A;  3LSQ A;  1R3K C;  2XTA A;  3CX5 F;  1WAZ A;  3ASO B;  5LYJ B;  3BEH A;  2DQ0 A;  4LF6 O;  2OT5 A;  1Z5V A;  2YIC A;  2A06 H;  3ZHS A;  4JF3 A;  4I9W A;  1AI7 A;  1N32 O;  2WLJ A;  2VS0 A;  2ZE7 A;  1DF5 A;  5FLX N;  1RFY A;  2K9P A;  3EXA A;  1YI2 V;  2AXT Z;  2YXH A;  2VWK A;  2VWJ A;  5GTH Z;  4DV1 O;  5KA5 A;  2QM8 A;  4GUN A;  2ILM A;  1W0J G;  3KCY A;  4X8A A;  2OCH A;  1S0V A;  3ETE A;  3L70 H;  1BZK A;  3E35 A;  3L73 H;  2HVJ C;  1QLN A;  2EZP A;  1K97 A;  4GX1 A;  5IDJ A;  1WN7 A;  2LO1 A;  3OTO B;  3OFN G;  4LNU B;  1Q81 W;  1HNX B;  3H1K H;  3CP1 A;  4JTA B;  1WA8 B;  4B08 A;  1YIT V;  1K4C C;  1R73 A;  4TV8 A;  1RM1 B;  4NTW A;  4UCV A;  1PV0 A;  2QSA A;  4DV7 O;  3VQY A;  3IFX A;  1XNQ O;  2A3Q A;  1IBM O;  3JAT B;  4GCZ A;  2Q7G A;  1ZL8 A;  4DV2 B;  1XI1 A;  1SF9 A;  3JYC A;  1W0K G;  3CB2 A;  3TK1 A;  4X64 O;  4ABM A;  1K9M W;  2RN9 A;  1L0L H;  1F51 A;  3GWK C;  1VF7 A;  1HNW O;  2X0L A;  3CXC U;  2AHZ A;  4XDK A;  2YXL A;  1F4M A;  1NH2 B;  3N2G B;  1KUQ A;  4UB6 Z;  5EZY A;  2CGN A;  5L3F A;  4MS2 A;  3T2M A;  1H2S B;  1DF4 A;  1M4U A;  1VQ4 V;  5K1X A;  4DV7 B;  4DV0 B;  5KHI A;  2B5U A;  2JDI G;  1AVM A;  4YY3 O;  4ICG A;  1RM1 C;  2M7W A;  1Q82 W;  3Q4H B;  1J95 A;  2P06 A;  2ZNI A;  2PYL A;  4LR3 A;  1SA0 B;  2IU0 A;  4D6T H;  1EBO A;  1YEW A;  4DR2 O;  3ABM C;  3SYQ A;  3DSQ A;  3ZMZ A;  3JCU Z;  5IJ0 A;  4JYB A;  3W7U A;  1VQ5 V;  1Y76 B;  1SKV A;  2MW2 B;  4MVO A;  2LP7 A;  4EFE A;  2WWW A;  1QVG U;  4D7T A;  1G6U A;  1GN6 A;  2OIG A;  5LMU B;  1MZE A;  3JAL B;  3PN1 A;  5EYP B;  1K73 W;  1AR5 A;  2GTS A;  5H5N A;  4DV4 B;  3ASN C;  5CBH A;  1GM9 A;  1FJG O;  1FFX A;  2Q0A A;  1M57 B;  4J7J A;  1EN5 A;  4LBE C;  1W59 A;  1IBM B;  1RPO A;  3W7T A;  4JI7 B;  1FD9 A;  4FVM A;  4JI0 B;  3VBB A;  3VQV A;  4MW3 A;  4IL6 Z;  2QKC A;  2Q7H A;  4GKK B;  3AG2 B;  4P9O A;  4U3J A;  3CMA V;  3ABL C;  2FL4 A;  3STZ C;  1GK9 A;  2HEP A;  3T4D A;  4DV4 O;  1J5E B;  1SES A;  3BHP A;  3FX7 A;  4PA4 A;  1N0J A;  2JJ1 G;  2R72 A;  5B1B C;  3ZRV A;  2EIK C;  4I55 B;  1LUV A;  4E4E A;  1FXK A;  2V1D A;  3IGA C;  3NXS A;  1CPY A;  5FNV A;  1H2L A;  3VOU A;  1DLB A;  1OCC C;  4LH7 A;  3SPJ A;  4W4L A;  1HNZ O;  3K03 A;  3JD2 A;  1AR4 A;  3CC4 V;  4MTX A;  3WG7 B;  3K0G A;  1IBK O;  1N33 O;  3JAR B;  4FIP C;  3P32 A;  4KUM A;  1K7D A;  1VIB A;  2PUS A;  3H9V A;  1WNS A;  3HKC B;  4PI2 A;  1JPX A;  4FLU A;  2RMK B;  4DV0 O;  1PP9 H;  2Y69 B;  4MSW C;  3HKB B;  4CH6 A;  4DV3 O;  4RAI A;  2WAM A;  4LF9 O;  4L8J A;  1V55 C;  4TSF G;  3SJB C;  4NYK A;  3ZMV A;  2Q9L A;  2M6Y A;  2HLD G;  2WSS G;  1D5N A;  3H1H H;  2CTQ A;  3WB0 A;  4FZ0 A;  4U7N A;  1GO3 F;  4DRX A;  2VQF O;  3LSS A;  4UCO A;  2GUZ B;  1PNM A;  4FLT A;  1MA1 A;  5JH7 B;  4QGP A;  1H2K A;  4HNA A;  1JOY A;  5IYB O;  4I55 A;  2ADQ B;  2Y0P A;  3JAS A;  4UCT A;  1XNQ B;  3ETQ A;  4FM1 A;  4JI1 B;  1LR1 A;  1O9G A;  2RCV A;  5KA6 A;  2QGN A;  3H1I H;  5GON B;  3AEI A;  3W7S A;  1JCH A;  5LBQ A;  1AIL A;  3X2Q B;  3ZMT A;  1WB8 A;  4GX0 A;  3N2K A;  5JJE B;  3OEH G;  1XEQ A;  4WBN B;  1O9H A;  3E8F A;  1COW G;  4TUY A;  4RUE A;  4TV9 A;  2ADP A;  5CN0 A;  2ZIM A;  5IYZ A;  1PNL A;  1YJ9 V;  3P3P A;  3UM7 A;  2HVK C;  2VQF B;  3AG3 C;  4FLZ A;  4JI4 B;  1N0N A;  5B3S C;  4NTY A;  3NR7 A;  1WP8 A;  1Q43 A;  5H6Q A;  1AI6 A;  3T1Y B;  3GWO A;  1KYO F;  4DR6 O;  2XOK G;  2JGD B;  3BA8 A;  4BR6 A;  3OGI B;  2ZT9 B;  3A0R A;  1SA0 A;  4DRX B;  5IWA B;  3FB7 C;  1G1X B;  1NJI W;  4OXS A;  3QO7 A;  3DTU B;  1FAF A;  3OUF A;  3KCX A;  4GYC B;  4LF4 B;  2MK3 A;  1V54 B;  1YDX A;  5JJN B;  4F4L A;  1DTO A;  1M1K W;  2QA4 V;  2HFE C;  1K33 A;  1I5Y A;  3OGC C;  3QG5 A;  1OHH G;  1N34 O;  3DC6 A;  5C93 A;  4QNH B;  2UXC O;  2HJF C;  3JD1 A;  2DN9 A;  4PA7 A;  3G80 A;  3GVM A;  4OPH A;  2CK3 G;  2GTA A;  3JSN A;  1ORQ C;  3LSU A;  3TET A;  5A9G A;  3L72 H;  3BFR A;  1ENV A;  4OX9 B;  1QVF U;  5LXT B;  2A0L A;  1FFT B;  4NXN O;  1H2N A;  2P6J A;  1V54 C;  4PDM A;  3I56 V;  5K1P A;  4CS3 A;  4JYA O;  4ZHQ B;  1CXZ B;  3JSL A;  1WJZ A;  4JPR A;  1L8D A;  1SQG A;  3JAW A;  2YEV B;  3BAB A;  1GN3 A;  2L6L A;  5B1A B;  3AK3 A;  1EN4 A;  3SPI A;  1BHA A;  2PGG A;  1KEC A;  4P2Z A;  1Q90 D;  2EIM C;  1OCZ B;  2QWO B;  3LNN A;  2UXD B;  5H2F Z;  3R65 A;  1P7B A;  4JI6 B;  3L75 H;  3RYI A;  2V7Q G;  2CUG A;  2JGD A;  4UUJ C;  3K0D A;  4X1I A;  2ZXW C;  4ZOL B;  1S5J A;  4B3R B;  3STL C;  3HKB A;  2P4V A;  2GUZ A;  2BCC H;  3SJC C;  3LUT B;  1MNG A;  4CZZ A;  4J41 A;  1ROP A;  3ABK C;  4RO2 A;  4DR4 O;  4P30 A;  4AHC A;  4CS4 A;  1PL4 A;  4R7C A;  4I0X A;  2EIM B;  2F4V B;  3RYF B;  3OM3 B;  4I9Q A;  2XHB A;  1IX9 A;  1JJO A;  2QKS A;  4Q6G A;  5KAI Z;  1NVP D;  2ODM A;  4D7S A;  1NBM G;  1GRJ A;  1Y76 A;  3KZI Z;  1YJW V;  1TA8 A;  3T1H B;  2IW5 A;  4IYH A;  4MVR A;  1FXV A;  4B3R O;  3C90 A;  3ZHV A;  3J80 N;  2IBZ H;  3RBZ A;  1BS3 A;  1I94 B;  3ABK B;  4TV9 B;  5B3S B;  5C8Y B;  1G4Y B;  4IIJ B;  1D5A A;  3W7W A;  4UV8 A;  4YJ2 A;  4DO2 A;  4R6Z A;  2DWD C;  4FLV A;  4PA9 A;  5TIS Z;  3DC5 A;  5LA6 B;  4LP8 A;  2LQT A;  4DR1 O;  3OMI B;  1DGS A;  1BMF G;  2ZIO A;  3K06 A;  3JD0 A;  3G67 A;  2HR3 A;  4J7K A;  1BQZ A;  1CP9 A;  2AZ0 A;  2ZCE A;  4DV3 B;  2GHY A;  3LDE A;  2XT9 A;  3H01 A;  2YXY A;  1ZL8 B;  1AJN A;  3CRC A;  5DED A;  1I5X A;  2ITD C;  2BOC C;  2LGQ A;  3H1J H;  4OX9 O;  4JGS A;  3E8G A;  1SC5 B;  3HKE B;  1OCC B;  4O4H A;  4PDR A;  5LP6 A;  1NH2 D;  3U11 A;  4DK1 A;  4HYO A;  2YSU B;  3CCE V;  3UO2 A;  2BSK B;  2XAS A;  4LF4 O;  1QR9 A;  2IJH A;  2DE0 X;  1MSD A;  4DUY B;  4JI8 B;  1IXM A;  4PI0 A;  5L3D A;  1KB9 F;  1T5E A;  2PTM A;  1H2M A;  1B3Q A;  5HFL A;  5KHK A;  1SET A;  3ABL B;  3F5W C;  2E75 B;  2VRZ A;  4DV5 O;  1YZB A;  5LP6 B;  1F4N A;  2PF4 E;  2YDE A;  3IC9 A;  2FYU H;  2QKA A;  2X6A A;  3UT5 A;  3ABU A;  5E1A C;  3P3N A;  2Q6A A;  1VQ6 V;  2R70 A;  3IAY A;  4UFZ A;  3ASN B;  2JEU A;  4PEL A;  1XUQ A;  2RNB A;  4IHJ A;  3OTF A;  1SQB H;  3EFF K;  1SQV H;  3VQW A;  2PZS A;  1MG1 A;  1VMG A;  1M90 W;  2A7W A;  2RDC A;  4B7E A;  4U7O A;  1P84 F;  5IT9 N;  1VF6 C;  4NXN B;  1OCO C;  3OMN B;  5EC1 C;  1HP8 A;  2IJI A;  2AZ2 A;  2X6C A;  3HKD B;  3OAA G;  5ITZ A;  4FLY A;  3JAM N;  4JV5 B;  1GMG A;  1XHX A;  2K1E A;  2Y48 A;  5LGN A;  4LWS A;  1R6T A;  1NI8 A;  1VQN V;  4CS2 A;  1KC8 W;  4TV8 B;  3HPL C;  2EIN C;  3F7V C;  4DR4 B;  3Q4H A;  3B09 A;  2YID A;  2NN4 A;  1JMK C;  5CA3 A;  2P22 C;  2R9R B;  1R1B A;  4DK0 A;  1ZWI C;  1KP3 A;  4DW1 A;  3BA9 A;  3JAK B;  5JJJ B;  5CBF A;  3A8T A;  3A0H Z;  3HB3 B;  4FFB A;  3B4S A;  1B04 A;  2YUA A;  4YJ3 B;  2DQ3 A;  4GKJ B;  3CPW U;  1NU1 H;  2LW1 A;  4TOI A;  4DR3 B;  2E5L O;  3D3Q A;  1N33 B;  3OEE G;  3M99 B;  4X20 A;  1OCO B;  3CC2 V;  2JVD A;  2JS5 A;  1LUW A;  4B3T O;  2Q7E A;  4JI8 O;  1R6N A;  2X6B A;  5GON A;  3D3I A;  1M93 A;  3S3W A;  5KX5 B;  4JAS A;  2UUB O;  2G38 A;  1M5I A;  4OGQ B;  3UCS C;  1YXB A;  4YJ2 B;  4KHP B;  2QTO A;  5LOV A;  3GB7 C;  5H6R A;  1H2G A;  3QTC A;  3ZN1 A;  4LWS B;  3FB5 C;  4UVB A;  1GN2 A;  3RVY A;  2BTQ A;  2ETN A;  1PKX A;  2R9I A;  2EIK B;  2Q73 A;  2DW4 A;  1W2B U;  4WFE A;  1SS3 A;  1QNM A;  2YEV A;  2HKO A;  4J7Z A;  3ETD A;  1Q6H A;  4YIP A;  5FL7 G;  1R6K A;  4HBN A;  4MW8 A;  5IE9 A;  3RWR D;  5EC2 C;  4GKK O;  1Y66 A;  2R9A A;  1ZX3 A;  1FYJ A;  4Z1M G;  2ZDI C;  3K04 A;  3CJH B;  3D36 A;  4J80 A;  4UVC A;  5E79 Z;  1HW7 A;  2EJR A;  4ZKI A;  5LHI A;  2PI5 A;  3WFV A;  5FNV B;  4CC6 A;  2ZE5 A;  3BVO A;  2W6J G;  5GW7 A;  4U3F H;  3OTO O;  1ZTE A;  1I94 O;  3F7Y C;  2DOS A;  3CCL V;  3M7M X;  5CB4 B;  3K5M A;  3T1H O;  1Q8I A;  1NTK H;  1HNX O;  4FJC C;  4JTC B;  4C7U A;  3UO3 A;  1Q6I A;  2JEX A;  1N36 B;  4Z1V A;  1QR8 A;  3AK1 A;  5B1B B;  2ZM6 B;  2GSM B;  4FFB B;  2KG7 B;  2OIE A;  5LHH A;  1SQX H;  1PNK A;  4X1I B;  4YIO A;  1BE3 H;  4LF8 B;  4JAU A;  1WP7 A;  4O4J B;  3AG3 B;  3CC7 V;  3E8B A;  3CCS V;  2E3C A;  3K08 A;  4UCR A;  1J5E O;  3SGI A;  2WLH A;  3L9D A;  4RQF A;  2VQE B;  1XDC A;  2O57 A;  1AB3 A;  5EK0 A;  2Q5Z A;  4JI2 O;  3CCR V;  1NR1 A;  2XND G;  2QTS A;  3CCJ V;  1HNW B;  4UCS A;  2BOB C;  2UUA O;  2OYQ A;  2WPD G;  4LC1 A;  1HR0 B;  2Y69 C;  3ZRX A;  4IYI A;  5B5E Z;  4HAM A;  1X59 A;  1AP6 A;  4JYC A;  4DV6 B;  2KSD A;  5KAF Z;  2DYR C;  5H9C A;  1TVK B;  4DR7 B;  3QVN A;  4EB6 A;  1YTF B;  4FFK A;  1IBK B;  1JVM A;  5LMN B;  3JAT A;  4PJ0 Z;  2XUM A;  3JAS B;  2ZIN A;  3B40 A;  3G6B A;  4MT8 A;  3A0B Z;  4DW0 A;  1SQQ H;  3OD4 A;  3CWB H;  4GT1 A;  1WA8 A;  3SYP A;  3OUS A;  3ETG A;  3JD4 A;  4FMT A;  4I50 A;  3RVZ A;  4NXM B;  1H8H G;  1XMO O;  3ABT A;  5LOV B;  3ZMU A;  5JVD A;  5IYZ B;  1GM8 A;  4O4I A;  2WLN A;  1SQF A;  1K5Q A;  5DEC A;  4R8C A;  2DJV A;  4R50 A;  3R66 A;  1S77 D;  1OCZ C;  3SPC A;  1TGO A;  2WA3 A;  1VQ9 V;  2HHH B;  4DV1 B;  1NTM H;  2CAZ C;  3WB1 A;  1IDS A;  3RW0 A;  3SYA A;  4CBC A;  4WFF A;  1SZT A;  3LDC A;  4F6E A;  5BY1 A;  2OTL V;  2X7R B;  3I5D A;  4LNU A;  3N27 A;  4H0L B;  3N2K B;  2YIA A;  1I7F A;  2H8P C;  4LF5 O;  5KMG A;  2LFS A;  4LF8 O;  1VP7 A;  4J11 A;  3K57 A;  4EB6 B;  1IZ3 A;  5LGU A;  1JFF B;  3FAV B;  3SYO A;  4I5S A;  3JAR A;  4H44 B;  4XDJ A;  5LMU O;  2UXC B;  1GM7 A;  1IBL B;  3ZMS A;  2ZNJ A;  1QU7 A;  4X1K B;  4H33 A;  1N4C A;  1OZ0 A;  2XAJ A;  5J9P C;  4ZHQ A;  4RQE A;  4P9P A;  5JH7 A;  4TQD A;  1NR7 A;  1PL0 A;  2QM4 A;  5EBL C;  3JCZ A;  2GDS A;  4FLW A;  2UUC B;  1YCI A;  3CSX A;  4NKG B;  3ZCC A;  1ARO P;  3B8N A;  3DXR B;  1FFX B;  2HJD A;  4IIJ A;  3RYI B;  1Z2G A;  5KUM A;  2UXN A;  5AG2 A;  3FYE B;  2WLI A;  2DYR B;  2ZD9 A;  3K79 A;  2LJ2 A;  3B77 A;  1AI4 A;  1TAE A;  2KKW A;  3SPH A;  5B66 Z;  3QF7 A;  1OCR C;  4OPA A;  3JAK A;  1TUB B;  1V9P A;  4LF9 B;  2LGW A;  4GX2 A;  4DUZ O;  1I08 A;  2XAQ A;  1MSW D;  2CH7 A;  2BSK A;  3O65 A;  2P7T C;  5LXT A;  3HR0 A;  4QJF B;  1UJW B;  2LW7 A;  1YVW A;  3MHS C;  2Q67 A;  2EJ7 A;  5BMV B;  3L74 H;  4ASU G;  2DYS B;  1X4T A;  3ZHQ A;  4YHH B;  5EBW C;  5EIB C;  1FXK C;  4DUY O;  1PM9 A;  3ML0 A;  1NVP B;  3DGE A;  1VQK V;  1KQS U;  1QBZ A;  1NZ6 A;  1VQ7 V;  1GH6 A;  2EIJ B;  4MTF A;  2D3O W;  2B9Z A;  2ZR3 A;  3RN4 A;  4WCE V;  3J7A U;  3K9S A;  4BW5 A;  5KUK A;  1BQ0 A;  1AJP A;  1Q86 W;  2AHY A;  3T1C A;  5BMV A;  1KD1 W;  1Q6U A;  4LFA O;  4O4L B;  1EFR G;  3E83 A;  1K4D C;  3CCU V;  4LF5 B;  3K3W A;  1NS1 A;  4DXW A;  5LGT A;  3MAQ A;  1KMI Z;  4NR1 A;  4GKJ O;  3BCC H;  3E89 A;  4MTG A;  2F43 G;  1MMM A;  4X20 B;  4BIU A;  3QO8 A;  4CC5 A;  4X65 O;  1V55 B;  2GBO A;  3BRC A;  5IWA O;  1S3J A;  4FM2 A;  5JCO A;  3HKE A;  3FFQ A;  1M57 C;  1FXH A;  4WBN A;  1JQ0 A;  4O2A A;  2PI4 A;  4UB8 Z;  2Y4U A;  4X1Y A;  4AQY B;  3SPG A;  2AGA A;  5KMG B;  1FPO A;  2EIL C;  2KB1 A;  5EZY B;  3SJQ C;  1N34 B;  3EHB B;  1KBH A;  4KXR A;  3C3S A;  4EEQ A;  4NTX A;  3K58 A;  1K92 A;  2CTP A;  1Y74 A;  2NR5 A;  2P67 A;  4UVA A;  5F2V O;  4IT5 A;  4J9Y B;  4WFH A;  3K59 A;  2ZDI A;  3WG7 C;  3FB6 C;  4FPP A;  2IU3 A;  1AJQ A;  4ZIB A;  5IYC O;  3B8M A;  5IYD O;  3ZRW B;  4CH3 A;  4PA6 A;  5IJ9 B;  1B6Q A;  4HNA B;  3CE2 A;  2CE4 A;  4ZOL A;  4DR3 O;  4PD4 F;  5BR8 B;  3E22 B;  1N8R W;  1JR9 A;  3L71 H;  3UQ8 A;  2H3O A;  3OR6 C;  3K5N A;  3ZS8 C;  3S3X A;  4A5U B;  3CCM V;  4I7Z B;  1S5L Z;  1PD3 A;  1BT8 A;  5LP6 C;  3SYC A;  3RYH A;  5DN6 G;  1D2D A;  1XRE A;  5HFM A;  3BPZ A;  4LH6 A;  3IC7 A;  3VQX A;  1WPX A;  1YIJ V;  5IJ9 A;  1SER A;  4X62 B;  4KL1 A;  3ZBH A;  1S72 V;  1Y6X A;  2EUL A;  4X1Y B;  2QE7 G;  2XAF A;  4O2A B;  3OMA B;  1EM1 A;  4Z2W A;  2EIN B;  4HZ3 A;  4XDL A;  5BR8 O;  1TVK A;  3RYF A;  3KKY A;  5J2T A;  1EZJ A;  3APQ A;  1MOF A;  2HP8 A;  1IBL O;  3AG1 B;  2ARH A;  4JZG A;  4QIW F;  2ZM6 O;  1U96 A;  2ZE8 A;  4N23 A;  4LCU C;  5B1O A;  1SZX A;  1HNZ B;  1KP2 A;  3CRA A;  4QE9 A;  3ASO C;  4PHZ A;  2C2A A;  3UT5 B;  4H37 A;  4FZ1 A;  3RYC B;  3CJH A;  2F66 C;  1CEZ A;  3X2Q C;  3OR7 C;  2EBO A;  4B7K A;  1NQT A;  2JGU A;  3D8C A;  2EZO A;  4KHP O;  3K5O A;  5JVD B;  3MHH C;  3JD3 A;  3P30 A;  4O4J A;  2YIB A;  2QWP B;  5J2U A;  2N74 A;  1U97 A;  2F1M A;  5CA0 B;  4DR7 O;  4K8Z A;  2JJ2 G;  5IY5 B;  2L35 A;  3ZED A;  2Z5U A;  4QPK A;  4BW9 A;  4PDV A;  4DR6 B;  3ZHU A;  2E5L B;  4I4T A;  4MVU A;  4DR1 B;  4QE7 A;  2Q68 A;  5B1N A;  3ICX A;  5KLV H;  3AK2 A;  1Q7Y W;  3G4S V;  3D36 C;  4TUY B;  4RWU A;  1HDJ A;  3CS5 A;  4DR5 O;  2A79 B;  3SDL A;  4FLX A;  3JAW B;  2XAH A;  4BWA A;  2BE3 A;  2RJZ A;  4KFM A;  3W7X A;  3CYO A;  2QWQ B;  5KHJ A;  3ZHR A;  4LF7 O;  2IJK A;  3TCU A;  1JX9 A;  1S5H C;  4TT3 G;  3OT7 A;  1E79 G;  1BSM A;  2WLL B;  2NNU A;  4JI5 O;  1KKD A;  2YS8 A;  1M56 C;  3O9O A;  2P90 A;  4L87 A;  1QHT A;  4B3S O;  1XIL A;  2QWR B;  2YI8 A;  1L0N H;  3B2E E;  3CXH F;  4ZI7 A;  3A2F A; 
#chains in the Genus database with same CATH homology
 3Q4H A;  3ZBH A;  2AZ0 A;  3HR0 A;  1WA8 A;  3Q4H B;  2VRZ A;  2VS0 A;  3TXQ A;  2DE0 X;  3FAV A;  4LWS B;  3OGI B;  3FD9 A;  2KG7 B;  4LWS A;  4I0X A;  3G80 A;  3TXS A;  3FAV B;  3GVM A;  4GZR B;  3O9O A;  4I0X B;  2KG7 A;  2AZ2 A;  1WA8 B;  2B9Z A;  4ABM A;  3GWK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...