2VRZA

Structural analysis of homodimeric staphylococcal aureus esxa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
98
structure length
98
Chain Sequence
b'AHMAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIRULENCE FACTOR ESXA
publication title Structure of Staphylococcus Aureus Esxa Suggests a Contribution to Virulence by Action as a Transport Chaperone and/or Adaptor Protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell invasion
total genus 44
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2vrzA00
4ABMA 4LWSB 2AZ2A 2VRZA 3GWKC 2KG7B 3FD9A 4I0XA 3ZBHA 3Q4HA 1WA8A 4GZRB 3O9OA 2DE0X 3FAVA 4LWSA 3TXSA 2VS0A 3GVMA 4I0XB 3HR0A 3OGIB 3TXQA 2AZ0A 2KG7A 2B9ZA 3G80A 3Q4HB 1WA8B 3FAVB
chains in the Genus database with same CATH superfamily
4Z1MG 4ASUG 1PP9H 2Z0AA 3WG7B 4YJ3A 2RQ6A 2RDCA 2CAZC 5JQGA 5LHGA 2F93B 2EZOA 4MTOA 3E83A 4YIPA 1TUEB 3CCVV 1LUWA 3T4ZA 4H13B 1AI4A 4D7SA 2IJHA 4DV6O 2WLLA 1F4NA 1HW7A 1BS3A 3P32A 1N33O 4MTFA 1VQMV 2JK5C 1XUQA 4GCZA 5HFLA 1JJ2U 5GTIZ 4I5SA 4O2BB 4JI2B 2QM4A 3CE2A 4JV5B 4PA4A 2NR5A 2F43G 3CYOA 1Q86W 1XMOB 4ZOLB 1JFFB 4NKGB 1KP2A 3D8CA 1NT2B 2F23A 1XILA 3RVZA 1NKDA 2RN9A 2UXXA 1DF5A 3EVKA 4FVMA 5H6QA 4X1YA 4LF5O 4Z1VA 3VQVA 3B77A 1G6UA 4K3AA 3J7AU 5JCOA 1N8RW 4JI6O 1Q3EA 1FXKA 4UB8Z 1W59A 1MOFA 5J9PC 4I7ZB 4YJ2B 3PN1A 4MVUA 1WJZA 4RO2A 2QM7A 3W7WA 1ZL8B 1Y66A 4H37A 4UVBA 4RQEA 1NR7A 3C3TA 2VQEO 3ZMTA 4MVSA 5LYJB 1YJWV 2R9RB 3U10A 1MABG 4DO2A 2JGDA 1XNQO 4P9OA 1KKDA 4X9QA 5CA0A 1ZSPA 4DR5B 1PD3A 1XL4A 4DR1B 2LFRA 1HNXB 2HEPA 3RYCA 3CP1A 2XNDG 2YIAA 2AZ2A 3WB2A 4DW0A 5IWAO 1XMQO 3ZRWA 3ZMZA 2IBZH 1I5YA 1A32A 3JARA 3ZHTA 1VQNV 2Q69A 5B1BB 3ETQA 2ATKC 2XOKG 3CRMA 2VWJA 4BR6A 4LH6A 4EB6B 3WB1A 4K0KB 1KU9A 3NR7A 3TETA 2QEXV 4JI0B 2ETNA 3CSXA 1AP5A 1PNLA 1R3LC 2QE7G 5C8YB 3ABKB 4OPAA 5EYPB 1NTZH 3CC2V 4MVOA 1M56C 4A5UB 4WFBV 2EJ7A 1Q8IA 1D2DA 4CZZA 2LFSA 1YEWA 4B08A 4BAYA 3STLC 4O4JB 2Q9LA 1NTKH 4CS3A 3CB2A 1URFA 5KLVH 2BCCH 4FFBB 1Q6UA 3T1YB 1KB9F 1OV9A 2BTQA 1R6TA 2QWPB 1RM1B 4IHJA 2QKSA 2ZCEA 3JD3A 5K1PA 3ZHUA 1Q5OA 4CS2A 5LA6A 4GLXA 2RNBA 2JS3A 4JI3O 3K0DA 4UCOA 3T4DA 3LDEA 2ITCC 3K79A 3ZN0A 2EX3A 3E35A 4ZIBA 4LBEC 4W4KA 2LGQA 1OCZC 2V7QG 1IXMA 3LSSA 4JAUA 4BW9A 3ABMB 1GTOA 2YIDA 2UXCO 2VQFO 3PJSK 1DK1A 2OIGA 4RQFA 3SPGA 1GMGA 1TA8A 2KQXA 5H6RA 1YTFB 3EFFK 4MTGA 4DRXA 3A0BZ 1MNGA 3OR6C 2ILMA 1R1BA 2ZE6A 4TV9A 1VARA 3BABA 2JVDA 1D5NA 5IYCO 4QE7A 1FS0G 1I5XA 1SERA 1SA0B 1IBMO 2Q0AA 3FB8C 1HNWB 3SPCA 4IGGA 1NTMH 4DV1O 4KHPB 3MAQA 1SS3A 4PV1B 4O2AA 1S5HC 2B5UA 2GTSA 2BOCC 3GWOA 5FPOA 2PF4E 2CTPA 2CUGA 3A0HZ 2AXTZ 2JEXA 3BPZA 4WBNA 4DV0B 1H2MA 2DOSA 4G27B 3CMAV 2M6YA 3OUSA 5E1AC 5IJ9A 1N32O 1EZVH 4B3RO 3UO3A 1GKFA 2N04A 3B4SA 4FLZA 1WP8A 5IE9A 2W6JG 3HKDA 2JIZG 4B7KA 2KSDA 3J80N 3G4SV 1RP3B 5KMGB 3ZMSA 2WAMA 3BEHA 5B66Z 4D6TH 4LF7B 4QIWF 3RYIA 1MZEA 2JRIA 1WB8A 4B7EA 4JTDB 4OPHA 1V9PA 5LMNO 1PKXA 2EJRA 4LF4O 3RYHA 2C2AA 1B3QA 4I0XA 4Q20A 3ZBHA 1ENVA 2P4VA 5BZBA 4PA3A 1E1RG 3ASOC 4B3MO 1QCEA 3O9OA 1YXBA 3M8AA 2Y0IA 1OCZB 2BTOA 4N23A 3OR7C 3AG2B 5CBFA 1UPGA 1K5SA 1SQFA 2NN4A 3CRCA 5IJ0B 3QVNA 1XDCA 1V54B 2A79B 1RSOA 4QGPA 4CH4A 3E2EA 3UCSC 2AZ0A 3TGUH 1N0NA 3B2EE 2UUBO 4JYAB 4CH5A 3RWRD 1Z5WA 4UVCA 3FB5C 2DYRC 4TUYA 5CN0A 2X7RB 1AP6A 4JI5B 4FLXA 1VQ4V 3L70H 1KQSU 2EINB 1ZWIC 3IJ4A 1N34B 4BWAA 5IY5C 4YY3B 2L35A 3JAKA 3E86A 4MT8A 3W7UA 1KUQA 1XNRO 1W2BU 3FFQA 4X1KB 4DV7B 3H1HH 4GKKB 5BR8B 3KCYA 5KA5A 5EBMC 1YCIA 1YHQV 3OUFA 4HAMA 4JI4O 1BQZA 3AK3A 5JH7B 1BQ0A 2B1GA 4TWKA 4O4LB 3G80A 3T1CA 2NNUA 4I50A 2B1IA 1N4CA 2UU9B 1F7YA 2GTAA 2Q5ZA 4GT1A 4QE9A 1K33A 3RGBA 5JJEB 4J41A 3SPIA 3CXHF 1OCOB 1VQ9V 1ORQC 1TGOA 4AHCA 3W7SA 1XREA 4JPRA 4U7OA 3W7TA 2UXNA 2CGOA 4DR7O 4R6ZA 5A9GA 5H2FZ 2Z5UA 3CJHA 1GN3A 5EK0A 3WG7C 1IX9A 1JR9A 5L3GA 1NI8A 4LFCO 4PJ0Z 3F5WC 5KHJA 2H94A 2XAFA 3FB7C 1IBLB 1FYJA 3FX7A 2DE0X 3QG5A 5CA3A 4X20B 2P6JA 4WFGA 2ITDC 3OD4A 2LW1A 3UT5A 3OFNG 1VQ8V 1Q6IA 5LHHA 1BL8A 2QDOA 4X65B 4U7NA 3CEIA 3JATA 1LUVA 1XL6A 4YHHO 3ZX6A 5BMVB 2YIBA 1I7FA 1AJNA 3DC6A 2DYRB 1AR1B 3H1JH 4RWUA 1P4RA 1L0NH 4N21A 2Q7EA 4KP4A 4QPJA 2ARHA 1CP9A 3OTOO 4QJFB 5LHIA 1MG1A 1WB7A 1I94O 2KG7A 4JTAB 1QQCA 5JVDB 4LWSB 5CA1B 2KB1A 1TVKB 2BE3A 2AHZA 2HVJC 2ZR2A 1PPJH 1YZBA 2YIBD 3SPHA 3ZRVA 2P5OA 1FPOA 3BA8A 1G8MA 3FYEB 1P7GA 4GKJO 1D5AA 2AHYA 5K1XA 4UVAA 2KKWA 4IL6Z 3OGCC 4LF6B 3ABUA 3DXRA 4BW5A 4H0LB 2EIKB 1FJGB 4IT5A 3UM7A 1SRYA 3E8BA 2YI9A 2RMKB 1GM9A 4ICGA 3E22A 2CE4A 3B09A 4JI7B 2LJ2A 2G38A 4ZI7A 3G71V 4B3TO 1U96A 4FFKA 4P9PA 3N27A 4FMTA 1N36B 1R3JC 3JAWB 5CB4A 2H8PC 3MHHC 2GBOA 2JJ1G 1M1KW 4LF9B 1TUBA 2UXBB 1S3JA 4X62B 2ZXWB 3BAAA 3ZHQA 2BSKA 3OEEG 3P3NA 1DGSA 3RFRA 4LNUA 4I4TB 1BHAA 3JCUZ 2ZM6B 5BY1A 1LR1A 4JI2O 4O4IA 4JV5O 1XMOO 3TCUA 5B1BC 1I0HA 1BHBA 1QNMA 2V4DA 3H01A 2GUZB 3LNMB 3ML0A 1XHXA 2WLIB 2YEVB 1VEWA 3KCXA 4NTXA 3H1KH 2IU3A 1X4TA 3U0ZA 2PI4A 2W6IG 2N05A 3JSLA 3OW2U 3ABKC 3CCMV 1S5JA 3T1HB 3APQA 4XDJA 1QVGU 1K4DC 1VQPV 3D3IA 3AG3C 4WFFA 3WB0A 3K9AA 1GRJA 5J2UB 4LFBB 3L9DA 5FL7G 2QKCA 3SGIA 4G2KA 4H33A 3RT3C 3SPJA 2Q7HA 3CWBH 2E5LO 2E76B 3AG1B 3L72H 2A7WA 2UUCB 1RM1C 1QHTA 1GM7A 1SESA 1WP7A 3F5TA 4O2BA 1CEZA 3K5LA 1FXVA 4IYHA 4DUZO 5LP6B 5EBWC 1RFYA 2YS8A 4ZOLA 2YXLA 1ZX3A 1HNXO 2GSMB 1WPXA 4J42A 5L3FA 1AJPA 2IH3C 1P84F 2HJFC 3SYPA 2NLJC 4FJCC 3BY6A 1Q81W 3ABMC 3ZRWB 2K1EA 5E79Z 3ZHVA 2ZDIC 5LMUB 3TJTA 1HNZO 1XBLA 2FKXA 1PNMA 5EIBC 5FNVB 2VWKA 4AILC 3ZS8C 4K0KO 4YJ2A 4R8CA 4DR2B 4JZ2A 5JJNB 4JI0O 1ZL8A 3JD2A 4RAIA 3DSQA 1DLBA 4G28B 3N2KA 1IBKB 4J9YB 2HHHB 3P30A 5LYJA 2LP7A 1AR4A 2P7TC 2VQEB 2HG5C 3IFXA 2F95B 3HKEB 3ETDA 1V55B 5H5NA 1VF6C 1M93A 1NS1A 3HKCB 4X1IB 2UXDB 1I08A 5B1AB 3AG3B 5LBQA 2CK3G 4JYYA 1BT8A 3Q4HB 3QTCA 2ZKOA 3IC7A 1AI5A 5IDJA 3SDLA 5LA6B 2Q6AA 1NQTA 5B3SC 3DC5A 1KKCA 2Y4UA 4GZRB 1IXBA 1IZ3A 4DW1A 2QKAA 4FZ0A 4UV8A 1P49A 4DUYB 5EZYB 3NXSA 2L6LA 5C8YA 4X8AA 4DR4B 3SYCA 5B5EZ 5EYPA 3FKSG 1SKVA 2JJ2G 3CMEV 1EM1A 1LNQA 3MHSC 2XASA 2WA4A 3K03A 1P7BA 3R65A 1AB3A 3UO2A 1SC5B 2EBOA 4U3JB 1JQ0A 3RN4A 2MK3A 3ZHRA 1ROPA 2QM8A 3K9SA 1Q90D 1GAXA 3JD1A 1N0JA 4KFMA 3AG2C 2JS5A 4YIOA 4HNAB 1AI7A 4DV5B 4TQFA 3QO8A 5IYZB 1HNWO 3A0RA 2VRZA 2EILB 4KXRA 1V54C 2D3OW 4PELA 3ZHSA 4KHPO 3JASB 5LOVB 2X0LA 4I55B 4W4LA 1GN4A 2R70A 2A06H 3E8GA 4O2AB 5KHIA 1ZTEA 1F23A 4JI3B 1DF4A 2F1MA 4DV0O 4GX1A 2DWDC 1KECA 1WA8B 5KX5B 4P2ZA 2YXHA 4MSWC 3C90A 1AI6A 2PGGA 3AG4B 3ICXA 4O4HA 5EC1C 2EINC 3G6EV 3JALB 4ZBMA 3LSQA 2ZDIA 4FM1A 3O65A 2UXCB 4F6RB 5D5QA 4C7UA 4FLWA 1UFIA 2IM9A 3S3WA 3K59A 4LF7O 1WAZA 2FYUH 4DK1A 4DR6B 1NVPB 3L75H 2CTRA 3K3WA 2DJVA 4GX0A 4WFHA 1SQVH 4OGQB 4FIPC 4IIJB 1SA0A 2Q67A 5B3SB 2UUAO 5EIBD 1K3EA 2Y0PA 2OCHA 2A3QA 4FLVA 4DR3B 5DN6G 2IW5A 3JAMN 4L8JA 3WU2Z 3OE7G 1YTFD 1M57C 1Q82W 2ZE8A 2ZNJA 4TOIA 2GDSA 3OTFA 4FZ1A 2ODMA 1OCOC 1BMFG 1NJIW 1L0LH 4K35A 2ZIOA 3DTUB 2ADPA 3I56V 5L3BA 1N32B 2EIJC 1H2GA 4J7ZA 3VQXA 4B3SO 4PA7A 2OCCC 4UCRA 3SYQA 4JYAO 3DGEA 5KMGA 3ABLB 1ZAUA 4J80A 1OJHA 4JI5O 3CD6V 2WLJA 1K4CC 3FAVA 3CCRV 1NVPD 1VQ7V 1VQ6V 3GVMA 4OX9B 1NZ6A 1Y74B 1JPXA 4DV7O 3HKBB 4GKKO 2IJKA 5BR8O 3N2GB 3U11A 4PI2A 1HP8A 3TXSA 1MSDA 3W7XA 4DV3B 3C3SA 3UKMA 1JCHA 4X64O 4NR1A 3CPWU 5F2VO 3CCQV 2A9HA 5IJ0A 1US6A 5BXZA 1SZXA 1K34A 2Q7GA 4R50A 4J11A 3L74H 2K9PA 3AEIA 5GONA 1M90W 2LQTA 2QJ1A 1RPOA 3BRCA 2PUSA 5L3DA 2QA4V 1JOYA 4WCEV 3JD0A 2UUBB 2B9ZA 4MW3A 2EIKC 3F7YC 4P30A 4JYCA 2OTJV 2WPDG 2EIMB 4JAAA 1NH2B 2F4VO 5L3EA 4UFZA 3CRAA 1E79G 3RVYA 5DM6V 1VMGA 5ITZB 1M57B 1SQQH 3THOA 4NTYA 4X1KA 1IBLO 4CC6A 3HR0A 4ZHQB 1J5EB 3RW0A 1Y67A 4JI8B 2EIJB 1GO3F 4FM0A 4X65O 5JH7A 4LFAB 3LDDA 2OCCB 4JI4B 4JYBA 1JVMA 2ZXWC 4O4LA 1AVMA 1F51A 2DQ0A 5C93A 4UB6Z 1Y76B 1DTOA 2E75B 4UUJC 5LXTB 5B1NA 4NXNB 2MW2B 3CCLV 3ASNB 1WNSA 1CXZB 1AILA 4NXMB 5TISZ 3IC9A 3KZIZ 4J7JA 1VQKV 1WPBA 1W0KG 3K58A 3BCCH 2OIEA 1T5EA 2PTMA 4TV8B 2DN9A 1WLEA 1K92A 2ZT9B 4JAVA 1NR1A 1OCRC 3E8HA 4LF6O 3CCJV 3CRQA 1VQ5V 1EBOA 1S5LZ 2Y69C 3TK1A 1FJGO 5LL6Y 4U3FH 3ZEDA 1O9HA 2HJDA 4PI0A 4EEQA 1QLNA 3UQ8A 2XAGA 1FXKC 2Y4TA 2XAJA 5J2TB 2X6CA 1H2NA 2IH1C 3LNNA 1RPRA 3EXAA 1QR9A 4XDLA 3AG1C 4JI7O 5BMVA 1YVWA 1PL4A 2CH7B 1HR0B 1AJQA 2CTWA 3B40A 1HDJA 4DV2O 2PI5A 3RYFB 1EN6A 1GM8A 1FFXB 4E4EA 5LP6C 3X2QC 3OEHG 3SJQC 1EN5A 4LF9O 2UXBO 5JVDA 4LWSA 4JI1B 3ZMUA 4EFBA 1KP3A 5CBHA 5CA1A 4X62O 4GUNA 1TVKA 3F7VC 4MS2A 4YJ3B 1VIBA 2OT5A 5JQGB 4LF8B 1FAFA 2ZM6O 5FPRA 4F6EA 2ZR3A 4X66B 3JCZA 4AQYB 4WF9V 1XHZA 1KMIZ 2WLLB 4LH7A 3CC7V 2M7WA 2WLMA 3K5NA 4PA9A 2R9AA 2IU0A 4EFEA 3OAAG 5LGNA 1GH6A 3MD0A 3ETGA 2CGNA 1JA8A 2YXYA 3B8MA 1VF7A 4DV4B 3T1HO 2FL4A 3L73H 3STZC 5KAFZ 4WFAV 4LFBO 2X6AA 4B3TB 2Q0OC 3JAWA 4WFEA 1V55C 1QLEC 1XEQA 1YSCA 2WLNA 1M9NA 1OCRB 2A0LA 1SETA 2UUCO 1PM9A 5B1AC 4X1YB 3AG7A 4I4TA 2JDIG 2R72A 2Y69B 5JJJB 1Y4MA 4YXWG 3R66A 5KAIZ 4MVQA 2H3OA 3K04A 1FXKB 4CS4A 4DV6B 1XOUA 2HKOA 2PY5A 4MW8A 2GUZA 2DWEC 1G1XB 1B6QA 2WA3A 2YICA 1OCCB 2WLIA 1N33B 2OTLV 2YEVA 2XHBA 1YIJV 4NTWA 1GN6A 1FD9A 1TAEA 4X88A 4DYLA 3X2QB 2JGDB 4DR5O 4UCUA 2QR4A 3VQWA 3FB6C 3OGIB 5CA0B 5LMUO 1JFFA 4DR1O 3D3QA 5J2UA 2P90A 5IYDO 2QWNB 1OZ0A 4DR2O 3G67A 3RYCB 2QSAA 2PYLA 3CHXA 4EKWA 4R7CA 1OHHG 1IBKO 3J81N 3GB7C 1R3KC 3QO5A 2HHHO 1K8AW 2E5LB 3JARB 1EFRG 3N2KB 4LF5B 2IJIA 3P3PA 3EHBB 3ZRXA 2EILC 4JI6B 5LP6A 1K97A 4DUZB 3SYAA 1QVFU 4PDLA 4AI8A 1K7DA 3BVOA 2UXDO 5KHGA 3AK1A 1O9GA 4MVMA 1QU7A 4PD4F 3AG4C 2HP8A 2W0XA 1XNQB 2HFEC 2XAQA 1QLEB 2P06A 2Q73A 3CS5A 4FK5C 4DK0A 5FNVA 3T1YO 4JF3A 4ZKIA 1ZUQA 1KC8W 1HNZB 2DMXA 3K5MA 1VQLV 1W0JG 2VS0A 4PHZA 2JEUA 3I55V 2BTQB 4DUYO 2V1DA 3SR2C 1NBMG 4DR4O 2DYSC 4IHJB 5IWAB 1XMQB 4NVPA 2F66C 5KHKA 1VP7A 4L87A 4BIUA 3QNEA 3CXCU 2P4KA 3H9VA 4EB6A 2EZPA 3HKEA 1QBZA 3ETEA 4HBNA 1MA1A 4E2LA 3JYCA 1SF9A 3HKCA 4X1IA 1FFTB 3BFRA 2N74A 1PNKA 2YDEA 1SZTA 4DV5O 2QWRB 2ZINA 2ADQB 4LR3A 4TT3G 1FKAO 2WSSG 5H9CA 3Q4HA 4O4JA 1S76D 2YI8A 3ZJZA 4I9QA 2AGAA 5EC2C 5KUMA 3ZCCA 4J7KA 1GK9A 4FFBA 4JTCB 2QWQB 3B8NA 4DRXB 1BGYH 1BZKA 3A2FA 4FM2A 4KL1A 3ABLC 4TV9B 4PDVA 2Z3YA 3KKYA 4K8ZA 5EZYA 4JASA 1U97A 4UCSA 4JGSA 2XT9A 2PYJA 3M7MX 4O4HB 1H2KA 1G4YB 4J10A 4U3JA 1KYOF 5D5PA 4DR6O 4WBNB 1H2LA 4D7TA 2Q4PA 3FD9A 1MSWD 1YI2V 5HFMA 5IJ9B 4HNAA 3CRRA 2D2CB 2QTSA 2BOBC 5IYZA 1XQ8A 1UJWB 2VQFB 1IDSA 2WWWA 3QF7A 1SQBH 3JASA 3HKDB 5LOVA 4DR3O 1BCCH 3H1LH 4I55A 1JMKC 1IVSA 4JZGA 4ABMA 1COWG 2DYSB 1YJNV 1XI1A 4LP8A 4H44B 3AK2A 1JX9A 4TSFG 3RYIB 1Z2GA 5L3CA 1L1FA 5KUKA 1WA8A 5KX5A 3ABTA 3RYHB 2HR3A 1S72V 3WFVA 1Z5VA 4KUMA 5B1OA 3RBZA 1M56B 4I0XB 3TXQA 1IBMB 2GV9A 3JALA 2EIMC 1VF6A 1ZLZA 4DV1B 2XTAA 4CC5A 4NB5A 4X89A 3GWKC 4F6RA 1R6KA 3OM3B 5AG2A 1AR5A 3SJCC 2ZE5A 4TQDA 2PZSA 1B04A 1IURA 2WLHA 5A2QN 3QO7A 2ZQMA 3CCSV 5KHHA 4PDMA 4IIJA 4DXWA 3FAVB 4B3RB 1RSOB 5FLXN 1X59A 4OX9O 3E89A 2OWOA 1L8DA 3SJBC 3OT7A 1R73A 5DEDA 4LC1A 3BA9A 3D36C 2UUAB 2R9IA 2ZIMA 3LSUA 4XDKA 4TUYB 4PA6A 2Q68A 3T2MA 4BIOA 1N34O 2O57A 5JWPA 4LCUC 3ASNC 4YY3O 4DV3O 5EBLC 5LMNB 4LF4B 2HVKC 1MZFA 3G6BA 2CDYA 2EULA 5GW7A 1R6NA 3JAKB 1H8EG 2DQ3A 3SYOA 1FXHA 2WLKA 4FLYA 4B3MB 3K0GA 2DW4A 2YSUB 4F4LA 1S0VA 3CCEV 1AROP 4B3SB 2X6BA 2QWOB 3VBBA 1E1QG 5GONB 3LDCA 3OMIB 2Y48A 4QNHB 3LUTB 1SQPH 2QGNA 2UU9O 1SQGA 3KG2A 4I50B 1BSMA 4RUFA 4GYCB 3IGAC 3VOUA 1Y74A 3MDSA 3HKBA 4CBCA 5KA6A 4CH6A 1BE3H 3A8TA 3BHPA 4QPKA 4RUEA 1J5EO 2FMLA 4XBFA 1GN2A 3N2GA 1YDXA 4JI8O 4LFAO 2ZD9A 4UCVA 1YITV 3CJHB 2P22C 4FLUA 2P67A 4X64B 1YJ9V 1XNRB 3SJAC 1M4UA 5IT9N 1J95A 3K08A 1Q6HA 4NXNO 2FTKA 3UT5B 1K9MW 3L71H 4NXMO 5CMUA 3I5DA 5CBGA 1VF5B 3JATB 4K8XA 3ASOB 4MTXA 2JGUA 2HLDG 5ITZA 3OMAB 2RCVA 1JJOA 2Q8VA 2F4VB 2LO1A 3HB3B 2W0FC 5IYBO 3HPLC 1K73W 4UV9A 3ZRSA 2YUAA 3K5OA 3CCUV 5GTHZ 2KG7B 3H1IH 1MMMA 1KD1W 4ZHQA 2E3CA 1PV0A 1KBHA 3E8FA 3FYIB 3CC4V 1H8HG 4Q6GA 1B06A 1NH2D 4GX2A 5DECA 4DR7B 3ZMVA 4BIZA 4MVZA 3ZN1A 3JD4A 1HR0O 4LFCB 3D36A 4UCTA 2ZE7A 4HZ3A 1SQXH 2AW9A 4X20A 1HWYA 1Y76A 1Q43A 3APOA 5JCOC 5LXTA 4IYIA 3DXRB 5LGUA 1K5QA 3S3XA 3M99B 1QR8A 4JI1O 4HYOA 2ZNIA 1H2SB 3VQYA 2YC0A 5IY5B 2CTQA 2LW7A 1CPYA 1PL0A 3E22B 5LGTA 1OCCC 4I9WA 4OXSA 4YHHB 1EZJA 2XAHA 3IAYA 4LF8O 4ZI7B 1N36O 4FPPA 2FB5A 3JSNA 4TV8A 2QTOA 2LGWA 4X66O 4AQYO 1M5IA 1EN4A 3OTOB 1YF2A 5CB4B 4Z2WA 2XUMA 3OMNB 1I94B 1H38A 1TUBB 3K57A 4UXNA 3ZIAG 1NU1H 1THZA 2E74B 5J2TA 2BSKB 2OYQA 4J9ZB 1Q7YW 4LNUB 1R3IC 2RJZA 4PDRA 4DV4O 1WN7A 1Y6XA 3K06A 2CH7A 4GKJB 4O4IB 3CX5F 1F4MA 1S77D 4GX5A 3RYFA 2IJJA 4FLTA 1VQOV 2GHYA 4NYKA 1FFXA 4DV2B 4MVRA 4CH3A
chains in the Genus database with same CATH topology
4ABMA 4LWSB 2AZ2A 2VRZA 3GWKC 2KG7B 3FD9A 4I0XA 3ZBHA 3Q4HA 1WA8A 4GZRB 3O9OA 2DE0X 3FAVA 4LWSA 3TXSA 2VS0A 3GVMA 4I0XB 3HR0A 3OGIB 3TXQA 2AZ0A 2KG7A 2B9ZA 3G80A 3Q4HB 1WA8B 3FAVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ABM A;  4LWS B;  2AZ2 A;  2VRZ A;  3GWK C;  2KG7 B;  3FD9 A;  4I0X A;  3ZBH A;  3Q4H A;  1WA8 A;  4GZR B;  3O9O A;  2DE0 X;  3FAV A;  4LWS A;  3TXS A;  2VS0 A;  3GVM A;  4I0X B;  3HR0 A;  3OGI B;  3TXQ A;  2AZ0 A;  2KG7 A;  2B9Z A;  3G80 A;  3Q4H B;  1WA8 B;  3FAV B; 
#chains in the Genus database with same CATH topology
 4Z1M G;  4ASU G;  1PP9 H;  2Z0A A;  3WG7 B;  4YJ3 A;  2RQ6 A;  2RDC A;  2CAZ C;  5JQG A;  5LHG A;  2F93 B;  2EZO A;  4MTO A;  3E83 A;  4YIP A;  1TUE B;  3CCV V;  1LUW A;  3T4Z A;  4H13 B;  1AI4 A;  4D7S A;  2IJH A;  4DV6 O;  2WLL A;  1F4N A;  1HW7 A;  1BS3 A;  3P32 A;  1N33 O;  4MTF A;  1VQM V;  2JK5 C;  1XUQ A;  4GCZ A;  5HFL A;  1JJ2 U;  5GTI Z;  4I5S A;  4O2B B;  4JI2 B;  2QM4 A;  3CE2 A;  4JV5 B;  4PA4 A;  2NR5 A;  2F43 G;  3CYO A;  1Q86 W;  1XMO B;  4ZOL B;  1JFF B;  4NKG B;  1KP2 A;  3D8C A;  1NT2 B;  2F23 A;  1XIL A;  3RVZ A;  1NKD A;  2RN9 A;  2UXX A;  1DF5 A;  3EVK A;  4FVM A;  5H6Q A;  4X1Y A;  4LF5 O;  4Z1V A;  3VQV A;  3B77 A;  1G6U A;  4K3A A;  3J7A U;  5JCO A;  1N8R W;  4JI6 O;  1Q3E A;  1FXK A;  4UB8 Z;  1W59 A;  1MOF A;  5J9P C;  4I7Z B;  4YJ2 B;  3PN1 A;  4MVU A;  1WJZ A;  4RO2 A;  2QM7 A;  3W7W A;  1ZL8 B;  1Y66 A;  4H37 A;  4UVB A;  4RQE A;  1NR7 A;  3C3T A;  2VQE O;  3ZMT A;  4MVS A;  5LYJ B;  1YJW V;  2R9R B;  3U10 A;  1MAB G;  4DO2 A;  2JGD A;  1XNQ O;  4P9O A;  1KKD A;  4X9Q A;  5CA0 A;  1ZSP A;  4DR5 B;  1PD3 A;  1XL4 A;  4DR1 B;  2LFR A;  1HNX B;  2HEP A;  3RYC A;  3CP1 A;  2XND G;  2YIA A;  2AZ2 A;  3WB2 A;  4DW0 A;  5IWA O;  1XMQ O;  3ZRW A;  3ZMZ A;  2IBZ H;  1I5Y A;  1A32 A;  3JAR A;  3ZHT A;  1VQN V;  2Q69 A;  5B1B B;  3ETQ A;  2ATK C;  2XOK G;  3CRM A;  2VWJ A;  4BR6 A;  4LH6 A;  4EB6 B;  3WB1 A;  4K0K B;  1KU9 A;  3NR7 A;  3TET A;  2QEX V;  4JI0 B;  2ETN A;  3CSX A;  1AP5 A;  1PNL A;  1R3L C;  2QE7 G;  5C8Y B;  3ABK B;  4OPA A;  5EYP B;  1NTZ H;  3CC2 V;  4MVO A;  1M56 C;  4A5U B;  4WFB V;  2EJ7 A;  1Q8I A;  1D2D A;  4CZZ A;  2LFS A;  1YEW A;  4B08 A;  4BAY A;  3STL C;  4O4J B;  2Q9L A;  1NTK H;  4CS3 A;  3CB2 A;  1URF A;  5KLV H;  2BCC H;  4FFB B;  1Q6U A;  3T1Y B;  1KB9 F;  1OV9 A;  2BTQ A;  1R6T A;  2QWP B;  1RM1 B;  4IHJ A;  2QKS A;  2ZCE A;  3JD3 A;  5K1P A;  3ZHU A;  1Q5O A;  4CS2 A;  5LA6 A;  4GLX A;  2RNB A;  2JS3 A;  4JI3 O;  3K0D A;  4UCO A;  3T4D A;  3LDE A;  2ITC C;  3K79 A;  3ZN0 A;  2EX3 A;  3E35 A;  4ZIB A;  4LBE C;  4W4K A;  2LGQ A;  1OCZ C;  2V7Q G;  1IXM A;  3LSS A;  4JAU A;  4BW9 A;  3ABM B;  1GTO A;  2YID A;  2UXC O;  2VQF O;  3PJS K;  1DK1 A;  2OIG A;  4RQF A;  3SPG A;  1GMG A;  1TA8 A;  2KQX A;  5H6R A;  1YTF B;  3EFF K;  4MTG A;  4DRX A;  3A0B Z;  1MNG A;  3OR6 C;  2ILM A;  1R1B A;  2ZE6 A;  4TV9 A;  1VAR A;  3BAB A;  2JVD A;  1D5N A;  5IYC O;  4QE7 A;  1FS0 G;  1I5X A;  1SER A;  1SA0 B;  1IBM O;  2Q0A A;  3FB8 C;  1HNW B;  3SPC A;  4IGG A;  1NTM H;  4DV1 O;  4KHP B;  3MAQ A;  1SS3 A;  4PV1 B;  4O2A A;  1S5H C;  2B5U A;  2GTS A;  2BOC C;  3GWO A;  5FPO A;  2PF4 E;  2CTP A;  2CUG A;  3A0H Z;  2AXT Z;  2JEX A;  3BPZ A;  4WBN A;  4DV0 B;  1H2M A;  2DOS A;  4G27 B;  3CMA V;  2M6Y A;  3OUS A;  5E1A C;  5IJ9 A;  1N32 O;  1EZV H;  4B3R O;  3UO3 A;  1GKF A;  2N04 A;  3B4S A;  4FLZ A;  1WP8 A;  5IE9 A;  2W6J G;  3HKD A;  2JIZ G;  4B7K A;  2KSD A;  3J80 N;  3G4S V;  1RP3 B;  5KMG B;  3ZMS A;  2WAM A;  3BEH A;  5B66 Z;  4D6T H;  4LF7 B;  4QIW F;  3RYI A;  1MZE A;  2JRI A;  1WB8 A;  4B7E A;  4JTD B;  4OPH A;  1V9P A;  5LMN O;  1PKX A;  2EJR A;  4LF4 O;  3RYH A;  2C2A A;  1B3Q A;  4I0X A;  4Q20 A;  3ZBH A;  1ENV A;  2P4V A;  5BZB A;  4PA3 A;  1E1R G;  3ASO C;  4B3M O;  1QCE A;  3O9O A;  1YXB A;  3M8A A;  2Y0I A;  1OCZ B;  2BTO A;  4N23 A;  3OR7 C;  3AG2 B;  5CBF A;  1UPG A;  1K5S A;  1SQF A;  2NN4 A;  3CRC A;  5IJ0 B;  3QVN A;  1XDC A;  1V54 B;  2A79 B;  1RSO A;  4QGP A;  4CH4 A;  3E2E A;  3UCS C;  2AZ0 A;  3TGU H;  1N0N A;  3B2E E;  2UUB O;  4JYA B;  4CH5 A;  3RWR D;  1Z5W A;  4UVC A;  3FB5 C;  2DYR C;  4TUY A;  5CN0 A;  2X7R B;  1AP6 A;  4JI5 B;  4FLX A;  1VQ4 V;  3L70 H;  1KQS U;  2EIN B;  1ZWI C;  3IJ4 A;  1N34 B;  4BWA A;  5IY5 C;  4YY3 B;  2L35 A;  3JAK A;  3E86 A;  4MT8 A;  3W7U A;  1KUQ A;  1XNR O;  1W2B U;  3FFQ A;  4X1K B;  4DV7 B;  3H1H H;  4GKK B;  5BR8 B;  3KCY A;  5KA5 A;  5EBM C;  1YCI A;  1YHQ V;  3OUF A;  4HAM A;  4JI4 O;  1BQZ A;  3AK3 A;  5JH7 B;  1BQ0 A;  2B1G A;  4TWK A;  4O4L B;  3G80 A;  3T1C A;  2NNU A;  4I50 A;  2B1I A;  1N4C A;  2UU9 B;  1F7Y A;  2GTA A;  2Q5Z A;  4GT1 A;  4QE9 A;  1K33 A;  3RGB A;  5JJE B;  4J41 A;  3SPI A;  3CXH F;  1OCO B;  1VQ9 V;  1ORQ C;  1TGO A;  4AHC A;  3W7S A;  1XRE A;  4JPR A;  4U7O A;  3W7T A;  2UXN A;  2CGO A;  4DR7 O;  4R6Z A;  5A9G A;  5H2F Z;  2Z5U A;  3CJH A;  1GN3 A;  5EK0 A;  3WG7 C;  1IX9 A;  1JR9 A;  5L3G A;  1NI8 A;  4LFC O;  4PJ0 Z;  3F5W C;  5KHJ A;  2H94 A;  2XAF A;  3FB7 C;  1IBL B;  1FYJ A;  3FX7 A;  2DE0 X;  3QG5 A;  5CA3 A;  4X20 B;  2P6J A;  4WFG A;  2ITD C;  3OD4 A;  2LW1 A;  3UT5 A;  3OFN G;  1VQ8 V;  1Q6I A;  5LHH A;  1BL8 A;  2QDO A;  4X65 B;  4U7N A;  3CEI A;  3JAT A;  1LUV A;  1XL6 A;  4YHH O;  3ZX6 A;  5BMV B;  2YIB A;  1I7F A;  1AJN A;  3DC6 A;  2DYR B;  1AR1 B;  3H1J H;  4RWU A;  1P4R A;  1L0N H;  4N21 A;  2Q7E A;  4KP4 A;  4QPJ A;  2ARH A;  1CP9 A;  3OTO O;  4QJF B;  5LHI A;  1MG1 A;  1WB7 A;  1I94 O;  2KG7 A;  4JTA B;  1QQC A;  5JVD B;  4LWS B;  5CA1 B;  2KB1 A;  1TVK B;  2BE3 A;  2AHZ A;  2HVJ C;  2ZR2 A;  1PPJ H;  1YZB A;  2YIB D;  3SPH A;  3ZRV A;  2P5O A;  1FPO A;  3BA8 A;  1G8M A;  3FYE B;  1P7G A;  4GKJ O;  1D5A A;  2AHY A;  5K1X A;  4UVA A;  2KKW A;  4IL6 Z;  3OGC C;  4LF6 B;  3ABU A;  3DXR A;  4BW5 A;  4H0L B;  2EIK B;  1FJG B;  4IT5 A;  3UM7 A;  1SRY A;  3E8B A;  2YI9 A;  2RMK B;  1GM9 A;  4ICG A;  3E22 A;  2CE4 A;  3B09 A;  4JI7 B;  2LJ2 A;  2G38 A;  4ZI7 A;  3G71 V;  4B3T O;  1U96 A;  4FFK A;  4P9P A;  3N27 A;  4FMT A;  1N36 B;  1R3J C;  3JAW B;  5CB4 A;  2H8P C;  3MHH C;  2GBO A;  2JJ1 G;  1M1K W;  4LF9 B;  1TUB A;  2UXB B;  1S3J A;  4X62 B;  2ZXW B;  3BAA A;  3ZHQ A;  2BSK A;  3OEE G;  3P3N A;  1DGS A;  3RFR A;  4LNU A;  4I4T B;  1BHA A;  3JCU Z;  2ZM6 B;  5BY1 A;  1LR1 A;  4JI2 O;  4O4I A;  4JV5 O;  1XMO O;  3TCU A;  5B1B C;  1I0H A;  1BHB A;  1QNM A;  2V4D A;  3H01 A;  2GUZ B;  3LNM B;  3ML0 A;  1XHX A;  2WLI B;  2YEV B;  1VEW A;  3KCX A;  4NTX A;  3H1K H;  2IU3 A;  1X4T A;  3U0Z A;  2PI4 A;  2W6I G;  2N05 A;  3JSL A;  3OW2 U;  3ABK C;  3CCM V;  1S5J A;  3T1H B;  3APQ A;  4XDJ A;  1QVG U;  1K4D C;  1VQP V;  3D3I A;  3AG3 C;  4WFF A;  3WB0 A;  3K9A A;  1GRJ A;  5J2U B;  4LFB B;  3L9D A;  5FL7 G;  2QKC A;  3SGI A;  4G2K A;  4H33 A;  3RT3 C;  3SPJ A;  2Q7H A;  3CWB H;  2E5L O;  2E76 B;  3AG1 B;  3L72 H;  2A7W A;  2UUC B;  1RM1 C;  1QHT A;  1GM7 A;  1SES A;  1WP7 A;  3F5T A;  4O2B A;  1CEZ A;  3K5L A;  1FXV A;  4IYH A;  4DUZ O;  5LP6 B;  5EBW C;  1RFY A;  2YS8 A;  4ZOL A;  2YXL A;  1ZX3 A;  1HNX O;  2GSM B;  1WPX A;  4J42 A;  5L3F A;  1AJP A;  2IH3 C;  1P84 F;  2HJF C;  3SYP A;  2NLJ C;  4FJC C;  3BY6 A;  1Q81 W;  3ABM C;  3ZRW B;  2K1E A;  5E79 Z;  3ZHV A;  2ZDI C;  5LMU B;  3TJT A;  1HNZ O;  1XBL A;  2FKX A;  1PNM A;  5EIB C;  5FNV B;  2VWK A;  4AIL C;  3ZS8 C;  4K0K O;  4YJ2 A;  4R8C A;  4DR2 B;  4JZ2 A;  5JJN B;  4JI0 O;  1ZL8 A;  3JD2 A;  4RAI A;  3DSQ A;  1DLB A;  4G28 B;  3N2K A;  1IBK B;  4J9Y B;  2HHH B;  3P30 A;  5LYJ A;  2LP7 A;  1AR4 A;  2P7T C;  2VQE B;  2HG5 C;  3IFX A;  2F95 B;  3HKE B;  3ETD A;  1V55 B;  5H5N A;  1VF6 C;  1M93 A;  1NS1 A;  3HKC B;  4X1I B;  2UXD B;  1I08 A;  5B1A B;  3AG3 B;  5LBQ A;  2CK3 G;  4JYY A;  1BT8 A;  3Q4H B;  3QTC A;  2ZKO A;  3IC7 A;  1AI5 A;  5IDJ A;  3SDL A;  5LA6 B;  2Q6A A;  1NQT A;  5B3S C;  3DC5 A;  1KKC A;  2Y4U A;  4GZR B;  1IXB A;  1IZ3 A;  4DW1 A;  2QKA A;  4FZ0 A;  4UV8 A;  1P49 A;  4DUY B;  5EZY B;  3NXS A;  2L6L A;  5C8Y A;  4X8A A;  4DR4 B;  3SYC A;  5B5E Z;  5EYP A;  3FKS G;  1SKV A;  2JJ2 G;  3CME V;  1EM1 A;  1LNQ A;  3MHS C;  2XAS A;  2WA4 A;  3K03 A;  1P7B A;  3R65 A;  1AB3 A;  3UO2 A;  1SC5 B;  2EBO A;  4U3J B;  1JQ0 A;  3RN4 A;  2MK3 A;  3ZHR A;  1ROP A;  2QM8 A;  3K9S A;  1Q90 D;  1GAX A;  3JD1 A;  1N0J A;  4KFM A;  3AG2 C;  2JS5 A;  4YIO A;  4HNA B;  1AI7 A;  4DV5 B;  4TQF A;  3QO8 A;  5IYZ B;  1HNW O;  3A0R A;  2VRZ A;  2EIL B;  4KXR A;  1V54 C;  2D3O W;  4PEL A;  3ZHS A;  4KHP O;  3JAS B;  5LOV B;  2X0L A;  4I55 B;  4W4L A;  1GN4 A;  2R70 A;  2A06 H;  3E8G A;  4O2A B;  5KHI A;  1ZTE A;  1F23 A;  4JI3 B;  1DF4 A;  2F1M A;  4DV0 O;  4GX1 A;  2DWD C;  1KEC A;  1WA8 B;  5KX5 B;  4P2Z A;  2YXH A;  4MSW C;  3C90 A;  1AI6 A;  2PGG A;  3AG4 B;  3ICX A;  4O4H A;  5EC1 C;  2EIN C;  3G6E V;  3JAL B;  4ZBM A;  3LSQ A;  2ZDI A;  4FM1 A;  3O65 A;  2UXC B;  4F6R B;  5D5Q A;  4C7U A;  4FLW A;  1UFI A;  2IM9 A;  3S3W A;  3K59 A;  4LF7 O;  1WAZ A;  2FYU H;  4DK1 A;  4DR6 B;  1NVP B;  3L75 H;  2CTR A;  3K3W A;  2DJV A;  4GX0 A;  4WFH A;  1SQV H;  4OGQ B;  4FIP C;  4IIJ B;  1SA0 A;  2Q67 A;  5B3S B;  2UUA O;  5EIB D;  1K3E A;  2Y0P A;  2OCH A;  2A3Q A;  4FLV A;  4DR3 B;  5DN6 G;  2IW5 A;  3JAM N;  4L8J A;  3WU2 Z;  3OE7 G;  1YTF D;  1M57 C;  1Q82 W;  2ZE8 A;  2ZNJ A;  4TOI A;  2GDS A;  3OTF A;  4FZ1 A;  2ODM A;  1OCO C;  1BMF G;  1NJI W;  1L0L H;  4K35 A;  2ZIO A;  3DTU B;  2ADP A;  3I56 V;  5L3B A;  1N32 B;  2EIJ C;  1H2G A;  4J7Z A;  3VQX A;  4B3S O;  4PA7 A;  2OCC C;  4UCR A;  3SYQ A;  4JYA O;  3DGE A;  5KMG A;  3ABL B;  1ZAU A;  4J80 A;  1OJH A;  4JI5 O;  3CD6 V;  2WLJ A;  1K4C C;  3FAV A;  3CCR V;  1NVP D;  1VQ7 V;  1VQ6 V;  3GVM A;  4OX9 B;  1NZ6 A;  1Y74 B;  1JPX A;  4DV7 O;  3HKB B;  4GKK O;  2IJK A;  5BR8 O;  3N2G B;  3U11 A;  4PI2 A;  1HP8 A;  3TXS A;  1MSD A;  3W7X A;  4DV3 B;  3C3S A;  3UKM A;  1JCH A;  4X64 O;  4NR1 A;  3CPW U;  5F2V O;  3CCQ V;  2A9H A;  5IJ0 A;  1US6 A;  5BXZ A;  1SZX A;  1K34 A;  2Q7G A;  4R50 A;  4J11 A;  3L74 H;  2K9P A;  3AEI A;  5GON A;  1M90 W;  2LQT A;  2QJ1 A;  1RPO A;  3BRC A;  2PUS A;  5L3D A;  2QA4 V;  1JOY A;  4WCE V;  3JD0 A;  2UUB B;  2B9Z A;  4MW3 A;  2EIK C;  3F7Y C;  4P30 A;  4JYC A;  2OTJ V;  2WPD G;  2EIM B;  4JAA A;  1NH2 B;  2F4V O;  5L3E A;  4UFZ A;  3CRA A;  1E79 G;  3RVY A;  5DM6 V;  1VMG A;  5ITZ B;  1M57 B;  1SQQ H;  3THO A;  4NTY A;  4X1K A;  1IBL O;  4CC6 A;  3HR0 A;  4ZHQ B;  1J5E B;  3RW0 A;  1Y67 A;  4JI8 B;  2EIJ B;  1GO3 F;  4FM0 A;  4X65 O;  5JH7 A;  4LFA B;  3LDD A;  2OCC B;  4JI4 B;  4JYB A;  1JVM A;  2ZXW C;  4O4L A;  1AVM A;  1F51 A;  2DQ0 A;  5C93 A;  4UB6 Z;  1Y76 B;  1DTO A;  2E75 B;  4UUJ C;  5LXT B;  5B1N A;  4NXN B;  2MW2 B;  3CCL V;  3ASN B;  1WNS A;  1CXZ B;  1AIL A;  4NXM B;  5TIS Z;  3IC9 A;  3KZI Z;  4J7J A;  1VQK V;  1WPB A;  1W0K G;  3K58 A;  3BCC H;  2OIE A;  1T5E A;  2PTM A;  4TV8 B;  2DN9 A;  1WLE A;  1K92 A;  2ZT9 B;  4JAV A;  1NR1 A;  1OCR C;  3E8H A;  4LF6 O;  3CCJ V;  3CRQ A;  1VQ5 V;  1EBO A;  1S5L Z;  2Y69 C;  3TK1 A;  1FJG O;  5LL6 Y;  4U3F H;  3ZED A;  1O9H A;  2HJD A;  4PI0 A;  4EEQ A;  1QLN A;  3UQ8 A;  2XAG A;  1FXK C;  2Y4T A;  2XAJ A;  5J2T B;  2X6C A;  1H2N A;  2IH1 C;  3LNN A;  1RPR A;  3EXA A;  1QR9 A;  4XDL A;  3AG1 C;  4JI7 O;  5BMV A;  1YVW A;  1PL4 A;  2CH7 B;  1HR0 B;  1AJQ A;  2CTW A;  3B40 A;  1HDJ A;  4DV2 O;  2PI5 A;  3RYF B;  1EN6 A;  1GM8 A;  1FFX B;  4E4E A;  5LP6 C;  3X2Q C;  3OEH G;  3SJQ C;  1EN5 A;  4LF9 O;  2UXB O;  5JVD A;  4LWS A;  4JI1 B;  3ZMU A;  4EFB A;  1KP3 A;  5CBH A;  5CA1 A;  4X62 O;  4GUN A;  1TVK A;  3F7V C;  4MS2 A;  4YJ3 B;  1VIB A;  2OT5 A;  5JQG B;  4LF8 B;  1FAF A;  2ZM6 O;  5FPR A;  4F6E A;  2ZR3 A;  4X66 B;  3JCZ A;  4AQY B;  4WF9 V;  1XHZ A;  1KMI Z;  2WLL B;  4LH7 A;  3CC7 V;  2M7W A;  2WLM A;  3K5N A;  4PA9 A;  2R9A A;  2IU0 A;  4EFE A;  3OAA G;  5LGN A;  1GH6 A;  3MD0 A;  3ETG A;  2CGN A;  1JA8 A;  2YXY A;  3B8M A;  1VF7 A;  4DV4 B;  3T1H O;  2FL4 A;  3L73 H;  3STZ C;  5KAF Z;  4WFA V;  4LFB O;  2X6A A;  4B3T B;  2Q0O C;  3JAW A;  4WFE A;  1V55 C;  1QLE C;  1XEQ A;  1YSC A;  2WLN A;  1M9N A;  1OCR B;  2A0L A;  1SET A;  2UUC O;  1PM9 A;  5B1A C;  4X1Y B;  3AG7 A;  4I4T A;  2JDI G;  2R72 A;  2Y69 B;  5JJJ B;  1Y4M A;  4YXW G;  3R66 A;  5KAI Z;  4MVQ A;  2H3O A;  3K04 A;  1FXK B;  4CS4 A;  4DV6 B;  1XOU A;  2HKO A;  2PY5 A;  4MW8 A;  2GUZ A;  2DWE C;  1G1X B;  1B6Q A;  2WA3 A;  2YIC A;  1OCC B;  2WLI A;  1N33 B;  2OTL V;  2YEV A;  2XHB A;  1YIJ V;  4NTW A;  1GN6 A;  1FD9 A;  1TAE A;  4X88 A;  4DYL A;  3X2Q B;  2JGD B;  4DR5 O;  4UCU A;  2QR4 A;  3VQW A;  3FB6 C;  3OGI B;  5CA0 B;  5LMU O;  1JFF A;  4DR1 O;  3D3Q A;  5J2U A;  2P90 A;  5IYD O;  2QWN B;  1OZ0 A;  4DR2 O;  3G67 A;  3RYC B;  2QSA A;  2PYL A;  3CHX A;  4EKW A;  4R7C A;  1OHH G;  1IBK O;  3J81 N;  3GB7 C;  1R3K C;  3QO5 A;  2HHH O;  1K8A W;  2E5L B;  3JAR B;  1EFR G;  3N2K B;  4LF5 B;  2IJI A;  3P3P A;  3EHB B;  3ZRX A;  2EIL C;  4JI6 B;  5LP6 A;  1K97 A;  4DUZ B;  3SYA A;  1QVF U;  4PDL A;  4AI8 A;  1K7D A;  3BVO A;  2UXD O;  5KHG A;  3AK1 A;  1O9G A;  4MVM A;  1QU7 A;  4PD4 F;  3AG4 C;  2HP8 A;  2W0X A;  1XNQ B;  2HFE C;  2XAQ A;  1QLE B;  2P06 A;  2Q73 A;  3CS5 A;  4FK5 C;  4DK0 A;  5FNV A;  3T1Y O;  4JF3 A;  4ZKI A;  1ZUQ A;  1KC8 W;  1HNZ B;  2DMX A;  3K5M A;  1VQL V;  1W0J G;  2VS0 A;  4PHZ A;  2JEU A;  3I55 V;  2BTQ B;  4DUY O;  2V1D A;  3SR2 C;  1NBM G;  4DR4 O;  2DYS C;  4IHJ B;  5IWA B;  1XMQ B;  4NVP A;  2F66 C;  5KHK A;  1VP7 A;  4L87 A;  4BIU A;  3QNE A;  3CXC U;  2P4K A;  3H9V A;  4EB6 A;  2EZP A;  3HKE A;  1QBZ A;  3ETE A;  4HBN A;  1MA1 A;  4E2L A;  3JYC A;  1SF9 A;  3HKC A;  4X1I A;  1FFT B;  3BFR A;  2N74 A;  1PNK A;  2YDE A;  1SZT A;  4DV5 O;  2QWR B;  2ZIN A;  2ADQ B;  4LR3 A;  4TT3 G;  1FKA O;  2WSS G;  5H9C A;  3Q4H A;  4O4J A;  1S76 D;  2YI8 A;  3ZJZ A;  4I9Q A;  2AGA A;  5EC2 C;  5KUM A;  3ZCC A;  4J7K A;  1GK9 A;  4FFB A;  4JTC B;  2QWQ B;  3B8N A;  4DRX B;  1BGY H;  1BZK A;  3A2F A;  4FM2 A;  4KL1 A;  3ABL C;  4TV9 B;  4PDV A;  2Z3Y A;  3KKY A;  4K8Z A;  5EZY A;  4JAS A;  1U97 A;  4UCS A;  4JGS A;  2XT9 A;  2PYJ A;  3M7M X;  4O4H B;  1H2K A;  1G4Y B;  4J10 A;  4U3J A;  1KYO F;  5D5P A;  4DR6 O;  4WBN B;  1H2L A;  4D7T A;  2Q4P A;  3FD9 A;  1MSW D;  1YI2 V;  5HFM A;  5IJ9 B;  4HNA A;  3CRR A;  2D2C B;  2QTS A;  2BOB C;  5IYZ A;  1XQ8 A;  1UJW B;  2VQF B;  1IDS A;  2WWW A;  3QF7 A;  1SQB H;  3JAS A;  3HKD B;  5LOV A;  4DR3 O;  1BCC H;  3H1L H;  4I55 A;  1JMK C;  1IVS A;  4JZG A;  4ABM A;  1COW G;  2DYS B;  1YJN V;  1XI1 A;  4LP8 A;  4H44 B;  3AK2 A;  1JX9 A;  4TSF G;  3RYI B;  1Z2G A;  5L3C A;  1L1F A;  5KUK A;  1WA8 A;  5KX5 A;  3ABT A;  3RYH B;  2HR3 A;  1S72 V;  3WFV A;  1Z5V A;  4KUM A;  5B1O A;  3RBZ A;  1M56 B;  4I0X B;  3TXQ A;  1IBM B;  2GV9 A;  3JAL A;  2EIM C;  1VF6 A;  1ZLZ A;  4DV1 B;  2XTA A;  4CC5 A;  4NB5 A;  4X89 A;  3GWK C;  4F6R A;  1R6K A;  3OM3 B;  5AG2 A;  1AR5 A;  3SJC C;  2ZE5 A;  4TQD A;  2PZS A;  1B04 A;  1IUR A;  2WLH A;  5A2Q N;  3QO7 A;  2ZQM A;  3CCS V;  5KHH A;  4PDM A;  4IIJ A;  4DXW A;  3FAV B;  4B3R B;  1RSO B;  5FLX N;  1X59 A;  4OX9 O;  3E89 A;  2OWO A;  1L8D A;  3SJB C;  3OT7 A;  1R73 A;  5DED A;  4LC1 A;  3BA9 A;  3D36 C;  2UUA B;  2R9I A;  2ZIM A;  3LSU A;  4XDK A;  4TUY B;  4PA6 A;  2Q68 A;  3T2M A;  4BIO A;  1N34 O;  2O57 A;  5JWP A;  4LCU C;  3ASN C;  4YY3 O;  4DV3 O;  5EBL C;  5LMN B;  4LF4 B;  2HVK C;  1MZF A;  3G6B A;  2CDY A;  2EUL A;  5GW7 A;  1R6N A;  3JAK B;  1H8E G;  2DQ3 A;  3SYO A;  1FXH A;  2WLK A;  4FLY A;  4B3M B;  3K0G A;  2DW4 A;  2YSU B;  4F4L A;  1S0V A;  3CCE V;  1ARO P;  4B3S B;  2X6B A;  2QWO B;  3VBB A;  1E1Q G;  5GON B;  3LDC A;  3OMI B;  2Y48 A;  4QNH B;  3LUT B;  1SQP H;  2QGN A;  2UU9 O;  1SQG A;  3KG2 A;  4I50 B;  1BSM A;  4RUF A;  4GYC B;  3IGA C;  3VOU A;  1Y74 A;  3MDS A;  3HKB A;  4CBC A;  5KA6 A;  4CH6 A;  1BE3 H;  3A8T A;  3BHP A;  4QPK A;  4RUE A;  1J5E O;  2FML A;  4XBF A;  1GN2 A;  3N2G A;  1YDX A;  4JI8 O;  4LFA O;  2ZD9 A;  4UCV A;  1YIT V;  3CJH B;  2P22 C;  4FLU A;  2P67 A;  4X64 B;  1YJ9 V;  1XNR B;  3SJA C;  1M4U A;  5IT9 N;  1J95 A;  3K08 A;  1Q6H A;  4NXN O;  2FTK A;  3UT5 B;  1K9M W;  3L71 H;  4NXM O;  5CMU A;  3I5D A;  5CBG A;  1VF5 B;  3JAT B;  4K8X A;  3ASO B;  4MTX A;  2JGU A;  2HLD G;  5ITZ A;  3OMA B;  2RCV A;  1JJO A;  2Q8V A;  2F4V B;  2LO1 A;  3HB3 B;  2W0F C;  5IYB O;  3HPL C;  1K73 W;  4UV9 A;  3ZRS A;  2YUA A;  3K5O A;  3CCU V;  5GTH Z;  2KG7 B;  3H1I H;  1MMM A;  1KD1 W;  4ZHQ A;  2E3C A;  1PV0 A;  1KBH A;  3E8F A;  3FYI B;  3CC4 V;  1H8H G;  4Q6G A;  1B06 A;  1NH2 D;  4GX2 A;  5DEC A;  4DR7 B;  3ZMV A;  4BIZ A;  4MVZ A;  3ZN1 A;  3JD4 A;  1HR0 O;  4LFC B;  3D36 A;  4UCT A;  2ZE7 A;  4HZ3 A;  1SQX H;  2AW9 A;  4X20 A;  1HWY A;  1Y76 A;  1Q43 A;  3APO A;  5JCO C;  5LXT A;  4IYI A;  3DXR B;  5LGU A;  1K5Q A;  3S3X A;  3M99 B;  1QR8 A;  4JI1 O;  4HYO A;  2ZNI A;  1H2S B;  3VQY A;  2YC0 A;  5IY5 B;  2CTQ A;  2LW7 A;  1CPY A;  1PL0 A;  3E22 B;  5LGT A;  1OCC C;  4I9W A;  4OXS A;  4YHH B;  1EZJ A;  2XAH A;  3IAY A;  4LF8 O;  4ZI7 B;  1N36 O;  4FPP A;  2FB5 A;  3JSN A;  4TV8 A;  2QTO A;  2LGW A;  4X66 O;  4AQY O;  1M5I A;  1EN4 A;  3OTO B;  1YF2 A;  5CB4 B;  4Z2W A;  2XUM A;  3OMN B;  1I94 B;  1H38 A;  1TUB B;  3K57 A;  4UXN A;  3ZIA G;  1NU1 H;  1THZ A;  2E74 B;  5J2T A;  2BSK B;  2OYQ A;  4J9Z B;  1Q7Y W;  4LNU B;  1R3I C;  2RJZ A;  4PDR A;  4DV4 O;  1WN7 A;  1Y6X A;  3K06 A;  2CH7 A;  4GKJ B;  4O4I B;  3CX5 F;  1F4M A;  1S77 D;  4GX5 A;  3RYF A;  2IJJ A;  4FLT A;  1VQO V;  2GHY A;  4NYK A;  1FFX A;  4DV2 B;  4MVR A;  4CH3 A; 
#chains in the Genus database with same CATH homology
 4ABM A;  4LWS B;  2AZ2 A;  2VRZ A;  3GWK C;  2KG7 B;  3FD9 A;  4I0X A;  3ZBH A;  3Q4H A;  1WA8 A;  4GZR B;  3O9O A;  2DE0 X;  3FAV A;  4LWS A;  3TXS A;  2VS0 A;  3GVM A;  4I0X B;  3HR0 A;  3OGI B;  3TXQ A;  2AZ0 A;  2KG7 A;  2B9Z A;  3G80 A;  3Q4H B;  1WA8 B;  3FAV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...