2VRZA

Structural analysis of homodimeric staphylococcal aureus esxa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
98
structure length
98
Chain Sequence
AHMAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIRULENCE FACTOR ESXA
publication title Structure of Staphylococcus Aureus Esxa Suggests a Contribution to Virulence by Action as a Transport Chaperone and/or Adaptor Protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell invasion
total genus 44
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2vrzA00
2VS0A 3OGIB 3Q4HB 2AZ0A 2KG7B 4LWSB 3Q4HA 2KG7A 2VRZA 4LWSA 2DE0X 4I0XB 3HR0A 3O9OA 4ABMA 3FD9A 3FAVB 4GZRB 4I0XA 3TXQA 3FAVA 3TXSA 1WA8B 3GWKC 2AZ2A 3ZBHA 3G80A 1WA8A 2B9ZA 3GVMA
chains in the Genus database with same CATH superfamily
2ZR2A 3CCLV 1P49A 1NQTA 2OCHA 5BMVB 1VQLV 2QM7A 1W2BU 1WAZA 1GH6A 4DV3B 1AR5A 2EX3A 2YI9A 4U3FH 2EZPA 4RUFA 2F66C 2ADPA 4H37A 4UCOA 3SPHA 4EKWA 5LA6A 4K0KO 1AI7A 3CJHA 4IL6Z 4J10A 3ZRSA 4PA6A 1SZXA 3L71H 1PKXA 5B1BB 3T1YB 3SJBC 3ETQA 2IJJA 5LGUA 4ZOLA 4PD4F 1JFFB 3CHXA 3G67A 4TOIA 3IFXA 2QKAA 2ITDC 1XOUA 2DWDC 1YHQV 4LFAO 5A2QN 2F95B 3JALA 4EFEA 5H5NA 3ABMC 1M57C 3GWKC 4HBNA 5EZYA 3ZMUA 3K3WA 3RYHB 1CP9A 5ITZA 4WF9V 4XDLA 4DW1A 1YI2V 4H13B 1YDXA 5K1PA 4BW5A 5KA6A 1DLBA 2F23A 2EZOA 4X89A 3HKDA 4TV8B 3E22A 4LF4O 1JOYA 1BCCH 5CA0A 5IWAO 4O4LA 1NR1A 3SJQC 4JI8O 2WLLB 1PNLA 3ZMZA 3ZN1A 1XNRB 1QNMA 3G71V 3AG1B 1B6QA 3JASB 5KMGB 1XL4A 1ZUQA 2WA4A 2LFRA 1MSWD 3CPWU 1V55C 1BZKA 3VOUA 1WJZA 3RYIA 2LGQA 2HJFC 3ML0A 3L75H 1OCZB 3AG2C 4CS2A 2V7QG 4JZ2A 1FFXB 5C8YB 2N74A 3CXCU 4TUYA 3K5MA 3C3TA 2JIZG 1W59A 5L3FA 4X65B 1AP6A 4X66B 2KQXA 4X9QA 3DXRA 4P9PA 1NTKH 1JX9A 2EULA 1NR7A 1MA1A 2BOBC 4JYAB 1ZAUA 4LCUC 4MVUA 4L8JA 2HG5C 3CS5A 1X4TA 3UO2A 4WBNB 1QU7A 2XUMA 2GDSA 3JATB 2B9ZA 3STZC 2AHYA 3SPCA 3JD4A 4JGSA 4DV6B 3CYOA 1M57B 4NVPA 2RMKB 4PJ0Z 3OT7A 4Q6GA 4YHHB 3OEHG 2E5LO 2XAGA 4DRXA 2EINC 4MVZA 3TK1A 5LA6B 3SDLA 3CJHB 5B1OA 2Y4UA 4DR7O 2BTQB 4JI2B 1EZVH 2CDYA 3O65A 3FX7A 2B1IA 4DV0O 4ZOLB 1KU9A 3SYQA 1EFRG 3RYCA 2NNUA 1OCOC 3Q4HA 4JI1O 1L0LH 4N23A 1S3JA 3JALB 4U3JA 3ZN0A 4J42A 3F7YC 5KLVH 3TJTA 2ETNA 3ZHSA 2PTMA 3JAWA 3PJSK 5H6QA 1IZ3A 5EZYB 2XHBA 1NT2B 2H94A 2K9PA 2HVJC 4NXNO 1UPGA 2CTPA 1EZJA 2DYRB 5ITZB 3BA9A 1BQ0A 3H1JH 5BZBA 1NS1A 1VF6C 4DR4B 2H8PC 4OX9O 4I9QA 2VRZA 4RQFA 3RN4A 1I94O 3HKDB 3E22B 4FLXA 3B40A 5CA0B 1S76D 3WG7B 4PELA 4O4LB 2ZE6A 4DK0A 1THZA 4DUYB 3FYIB 2QWRB 4J9ZB 4JAUA 1GM7A 3THOA 4UCSA 2XT9A 3J7AU 1K34A 1OCRC 1SESA 3L73H 1COWG 1M93A 3LDDA 1AI5A 2Q7EA 1GAXA 4YY3O 4B3SO 4FMTA 5LXTA 5JCOC 4X1IA 4LF7B 2HEPA 3D36C 3P3NA 1Y74A 4RUEA 3RYIB 1EM1A 2Q68A 3MAQA 2UUAO 1GK9A 2ZDIA 5EC1C 4TUYB 3KCXA 4FJCC 4X64O 1F4NA 4RQEA 1KB9F 5FPRA 2AZ2A 2VQFO 4H0LB 5B1AC 4PA4A 3DXRB 5E1AC 1TUBB 4DV5O 4JI0B 2NR5A 3ZRXA 3R65A 1SS3A 4RWUA 3C3SA 4DV7O 3CC7V 2CAZC 1K7DA 3QO5A 4PI2A 2UXBB 4DV1B 1G1XB 2DYSC 1FXKA 1QLEC 3SGIA 3BEHA 1MG1A 3E8BA 1QCEA 4ICGA 1FXVA 3BAAA 1V54B 3APOA 4J9YB 4UCTA 1IBLO 2IU3A 1Y76B 5IYDO 3AEIA 4CC6A 3VQWA 3HKEA 2R9AA 3W7TA 5IY5B 2UXCB 2P67A 3E89A 4DRXB 4JI5O 3ZEDA 3JAKB 2UU9B 4UUJC 3JCUZ 2EIMC 1DTOA 5J2UA 4MT8A 3ZHQA 3FB7C 4JV5O 1AROP 2YICA 1ZWIC 1K9MW 3G4SV 3AG3C 3J80N 3RYCB 1YTFB 1XREA 2PZSA 3AK3A 5CBGA 3Q4HB 4LF4B 4ASUG 1GN2A 5IWAB 2WPDG 1YSCA 1FJGO 4U3JB 4QPJA 4JI8B 3K79A 1H8HG 3JAMN 3JAWB 3EFFK 1RP3B 3CCJV 4LFBB 3CCQV 4D7TA 5BY1A 2FYUH 5LL6Y 1GO3F 4YXWG 1VQ4V 4CS4A 4R6ZA 1K92A 3RVZA 3UCSC 3K57A 1A32A 3OUFA 1S72V 5IYCO 2ARHA 4CH5A 3QNEA 1AI6A 1KD1W 4MW8A 1P7GA 3FKSG 5BXZA 2UUCO 3N2GA 1MNGA 2LW7A 2P4VA 4U7OA 3ZHUA 3OM3B 2P4KA 4CBCA 2QEXV 2ZCEA 4LF6O 3MDSA 4GX1A 3KZIZ 4ABMA 3ASOC 2G38A 5CBFA 4DR5O 4R7CA 1Y74B 2WLJA 1F4MA 1NTZH 2ODMA 5LHIA 2JJ2G 5F2VO 3D3QA 1R6NA 4NR1A 3K59A 1Q7YW 1AP5A 2RNBA 2RN9A 1JJ2U 4IYIA 4FLYA 2GBOA 1NU1H 1IXMA 1SF9A 2V4DA 3SYPA 4QIWF 1OZ0A 4NYKA 1VF5B 1XMOO 3ZBHA 1ENVA 3VQXA 1YIJV 2E5LB 3K5OA 2JEUA 3A0HZ 3QVNA 1SERA 2HHHO 3N27A 1N0NA 2DQ0A 4UVAA 4GLXA 4JTCB 2WLHA 3DTUB 1CEZA 3VQYA 4DR1O 2RJZA 5DM6V 2QA4V 4DV0B 3BPZA 4MVMA 4JF3A 2K1EA 4X8AA 4TWKA 4JI6B 1FXKB 1FYJA 1SKVA 4JI1B 5B1BC 4O2BA 1QVFU 5AG2A 1D5NA 4W4LA 4X1YA 1KUQA 3OGIB 5B66Z 3OTOO 1AJPA 1GN6A 3HKEB 2YSUB 1SQVH 3ICXA 2X6CA 4NXNB 2JGDA 1PM9A 1SQBH 5D5PA 3TCUA 4UB6Z 5J2UB 2EJ7A 2Q0AA 5KX5A 2O57A 2ZNIA 5CA1A 3G6BA 1H2MA 2BSKA 4K8ZA 4J7JA 5JJNB 2YIBA 5IYBO 2D2CB 3AK2A 5GONB 2GHYA 3A8TA 1SA0B 4IYHA 4MSWC 4PHZA 3ABLB 4UB8Z 3G6EV 1KP3A 2QKSA 2P06A 1NTMH 4DR3O 1GRJA 2GUZA 3ASNB 4BIZA 4DR2B 3K5NA 5LMUO 2YXLA 1Y66A 4MTGA 1M9NA 1KKCA 4YY3B 1PL0A 4B3SB 3AG1C 1LR1A 3E83A 4IHJA 2OIEA 3H9VA 4WFFA 2L6LA 2ADQB 4QE9A 2LQTA 4PV1B 2UUAB 2DMXA 3N2KA 2P22C 1T5EA 3OE7G 1Q81W 3K9AA 3ZHRA 1OCZC 3N2GB 1NZ6A 1YJ9V 1AI4A 4TQDA 1PL4A 2VQFB 2PUSA 1MOFA 5FLXN 4GUNA 4DV7B 4FLUA 3FB8C 1ZLZA 3B2EE 1IBKO 1R3LC 3K08A 3E35A 3H1HH 4QNHB 2YUAA 3W7UA 2IJHA 2XAJA 3M99B 3GWOA 3JSNA 1B06A 4ZI7B 4QE7A 3L72H 4MVRA 1IBLB 1OCCB 2CGNA 2EILB 4GZRB 1H38A 1JQ0A 4ZBMA 2YC0A 4UCUA 2MK3A 4E4EA 4K3AA 4LNUA 4JI5B 4YIPA 4EFBA 1K4DC 2PF4E 1KBHA 3P30A 3OW2U 2DN9A 2DWEC 3F7VC 3JCZA 3HKCA 3LUTB 4JV5B 4DUZB 1R6TA 4XDKA 2JJ1G 4D7SA 3OFNG 1DK1A 5LGTA 1I0HA 1WPXA 1SC5B 4O2BB 4LC1A 4WBNA 3X2QB 3R66A 2N04A 3TXSA 4NXMO 1PD3A 2FKXA 4X1YB 1YZBA 3CCMV 1WB7A 1O9HA 2VQEO 4DK1A 2JGDB 1AVMA 2X7RB 4ZKIA 1GM8A 2AW9A 5KX5B 4HAMA 5CA1B 2N05A 2BSKB 4LFCB 2DYRC 3JARA 3A0BZ 4UVBA 4P2ZA 1WPBA 4LH7A 4DV2B 3G80A 3KKYA 3K5LA 5JJEB 1K3EA 1M1KW 1B3QA 4Z1MG 4KUMA 3WG7C 1AJNA 4ZHQA 3M8AA 1R3IC 2CTRA 4IGGA 3K0DA 1NJIW 3JD0A 4JPRA 4EEQA 1ZSPA 2YI8A 4LF6B 1YTFD 3WU2Z 3KG2A 2JGUA 3B8NA 3E8FA 1AR4A 3BCCH 3OMNB 2L35A 4IHJB 1N36O 1P7BA 2Q7GA 4DYLA 2WLIA 2Q5ZA 4Z1VA 5EC2C 3T1HO 2Z5UA 2XNDG 5LHGA 3FD9A 3N2KB 3RBZA 1E1RG 3ZMSA 3W7XA 4P9OA 3T1CA 3P32A 1XMQO 4O2AA 4LF9B 1MZFA 1F7YA 2F4VO 1Q3EA 1XNQB 1TVKA 3L74H 4K8XA 3DC5A 1Z5WA 2Q4PA 2ZE7A 4JAAA 3AK1A 1E1QG 1IBMO 1XMOB 4B3RB 1R3KC 1S5JA 4UV9A 3APQA 4YJ2A 4JTAB 2CTWA 1H2LA 1ZX3A 4D6TH 1Y67A 2PI5A 5L3BA 4PDLA 4GCZA 1G4YB 4TQFA 3VQVA 1VQOV 4FM2A 1HDJA 4GX5A 4JI4O 5J9PC 5LYJA 2IH1C 1JMKC 1PP9H 4DO2A 3OTOB 1S77D 2JS3A 1V54C 3DSQA 1FFTB 4B3MB 2B5UA 4LNUB 1ZL8A 3HKCB 5IY5C 4BIUA 4KHPB 3UT5A 1J5EB 3S3WA 1UFIA 2Y69B 1L8DA 4CS3A 4TV9A 1QQCA 1MMMA 3EHBB 1VP7A 3QF7A 4C7UA 1PV0A 4DR6B 3W7SA 3RYFA 3S3XA 5IT9N 3OGCC 1I5XA 1Q90D 4FFKA 1HNWO 2YIAA 5BR8O 1Q5OA 2A9HA 5JQGA 5JJJB 1N34B 3JARB 4B7EA 2CH7A 5B1NA 2QKCA 4BW9A 1SRYA 2IW5A 3H1KH 2P90A 1R3JC 2ZQMA 4WFAV 1K73W 1CPYA 2WWWA 4O4IA 3TGUH 2IJIA 4P30A 2UXDO 4RO2A 5CN0A 3BHPA 2OCCB 4RAIA 1WN7A 3ZIAG 4X20A 3K06A 4FM0A 1G8MA 2EIJB 3JSLA 1MABG 3CRQA 2FL4A 1IBKB 1F51A 4O4JA 3LDCA 3NXSA 4K0KB 4J41A 2DE0X 2HP8A 4O2AB 1JR9A 3CCEV 1S5LZ 2XOKG 4UXNA 3OTFA 3IC9A 2IH3C 2IM9A 2ZDIC 4LFAB 5L3GA 1GMGA 4UFZA 3KCYA 2NN4A 4JYBA 1HP8A 3AG4B 5E79Z 1JVMA 1XI1A 1AB3A 2NLJC 3UQ8A 2FB5A 4NTYA 2GTAA 4EB6A 3H1LH 1HR0O 3T1YO 4DW0A 4LBEC 5HFLA 1BE3H 3GVMA 1H2SB 4MS2A 1NH2B 5B5EZ 4LF5O 3P3PA 3WB0A 4O4HA 5CA3A 5LYJB 1I7FA 1DF5A 2QR4A 1FXKC 3RVYA 3RGBA 1K5SA 1VQKV 5H2FZ 2EBOA 2ZKOA 2X0LA 3IC7A 1ZL8B 4B7KA 1M90W 4MVQA 1KYOF 3FYEB 4HNAA 2E76B 2QM8A 3UT5B 3LNNA 2LW1A 4CC5A 4TV9B 1HWYA 3OMAB 1KP2A 3U11A 1VQ5V 1IDSA 1M56B 2BCCH 3LDEA 1R6KA 4F4LA 1JJOA 1BMFG 4K35A 3SJCC 1EN6A 4PDRA 3RYFB 3ABLC 1VMGA 2A7WA 1JPXA 3ASNC 1YITV 5JQGB 4W4KA 2CH7B 3BA8A 2GSMB 2KKWA 3OR7C 1KC8W 1W0JG 1LUWA 1N36B 1VQ8V 2YXYA 3IAYA 4MTFA 2Q67A 5LXTB 4O4IB 4X1IB 3B77A 3EXAA 1U96A 1AJQA 4N21A 2AHZA 3JD2A 1QBZA 2XASA 1OV9A 1AILA 5KAFZ 2ATKC 1H2KA 1KQSU 3ZRWA 2A0LA 4E2LA 4X65O 3OAAG 1QVGU 2ZM6O 2YIBD 4X62O 4JASA 5EBLC 3CP1A 4AQYO 1YJWV 4FZ0A 4JYAO 1Q8IA 4O4JB 3WFVA 3ABTA 1F23A 1K8AW 2WA3A 1Y4MA 3K58A 2JRIA 4DR7B 1GM9A 1Q6HA 2Z0AA 2B1GA 2A79B 3CRCA 1NVPB 3RT3C 3U0ZA 5L3EA 5GW7A 2Z3YA 1QR9A 2HJDA 2Y4TA 1VEWA 2PYJA 4GKJO 5GTHZ 4OXSA 3W7WA 4WFEA 1EBOA 1OCCC 2EILC 1Q86W 4R50A 1O9GA 4EB6B 4JI2O 4J7ZA 4PDMA 3CX5F 3J81N 3BY6A 3SPJA 4OX9B 4I4TA 1RM1B 3E8HA 1DGSA 4MW3A 4TV8A 4I7ZB 1N33O 3CEIA 4I55A 2HLDG 3SYCA 1I94B 1OHHG 2XAHA 3CB2A 4O4HB 5LP6A 5KUMA 3SR2C 3WB1A 1VIBA 3T4DA 3OEEG 1BSMA 3X2QC 2ZXWB 3ABKB 4CH3A 1S5HC 1YEWA 3IJ4A 4JI7O 3BABA 2PGGA 1VQ7V 4BAYA 4B3TO 1HNWB 2MW2B 5EYPA 5BR8B 3EVKA 3CWBH 5CMUA 2QM4A 3FB5C 4PI0A 2UXNA 4HNAB 1QLNA 2QWNB 3B4SA 4NB5A 4GYCB 4QPKA 1HNXO 2AGAA 3ZRVA 3CSXA 1VQPV 2CK3G 1XHZA 3O9OA 5GTIZ 2F43G 1OJHA 4DUYO 3K03A 2ZT9B 5CB4A 4G2KA 3FAVA 2Q0OC 4B08A 2LO1A 3HKBA 4FIPC 4UVCA 3CMAV 2ZD9A 4X64B 5A9GA 2YEVA 1H2GA 1MSDA 2EIKB 4DV5B 1BQZA 2DW4A 4YJ3A 4HYOA 1WB8A 4UCVA 5EBWC 1HNZO 3VBBA 3OMIB 2OIGA 1U97A 2ZINA 2PI4A 5KAIZ 3ZRWB 1BS3A 3BVOA 1YF2A 1VQ9V 1NI8A 1Q82W 2R9IA 2E3CA 2JS5A 1H2NA 1GKFA 4X88A 4PDVA 4JI0O 5L3CA 5IDJA 4CZZA 1RPRA 2KB1A 3LSQA 1RPOA 1D2DA 2FTKA 2W6JG 4IIJA 2BTQA 4WCEV 1HR0B 1BHBA 3ZHVA 3ZCCA 2UXBO 2QJ1A 3JYCA 4DV1O 1SZTA 2W0XA 4NTWA 4LF5B 5H9CA 3SYOA 1K33A 2JVDA 5FNVA 1IVSA 2QSAA 1FJGB 1S0VA 2GV9A 2DOSA 2UXCO 5KHGA 1XL6A 4IT5A 2Q9LA 2UU9O 1L1FA 5LGNA 2IU0A 1MZEA 3JD3A 3K0GA 2IJKA 1NBMG 2JK5C 3ABUA 3F5WC 1SQPH 2Q6AA 4I4TB 4GX0A 4XDJA 5B3SB 4WFBV 4I55B 4JZGA 2OYQA 1WA8A 2EJRA 3AG7A 4FZ1A 4OPAA 2Y69C 5LP6B 4JTDB 2CE4A 4L87A 4LFBO 4TSFG 4LWSA 4FM1A 1FKAO 2GUZB 2UUCB 1RFYA 2QE7G 4HZ3A 5EYPB 4DV4O 3E2EA 5IJ0A 3L70H 4BIOA 5IJ9A 1AR1B 2XTAA 4BR6A 3ETGA 1NH2D 5CBHA 2CGOA 4JI3O 2F93B 4LH6A 3D8CA 4G27B 3TETA 4H44B 4DR5B 3H01A 3HPLC 5CB4B 3FAVB 4AHCA 2JDIG 1XQ8A 2OTLV 3HKBB 5L3DA 4GKKO 1ORQC 3IGAC 3MHSC 2ZM6B 1VQ6V 4X62B 3JD1A 2OCCC 1JCHA 1TUBA 4AQYB 1XUQA 1N32O 1VARA 5KA5A 2YEVB 2R70A 3CRRA 2Q8VA 5J2TA 1VQNV 2Y0PA 1XHXA 3T2MA 4F6RA 5LMNO 1SQXH 5TISZ 4I50A 4YJ3B 2EIJC 2HHHB 2GTSA 3LSUA 5K1XA 1I08A 3K9SA 2LFSA 4DR1B 2OTJV 1KECA 3SJAC 2WLMA 4I9WA 5HFMA 3ZX6A 5KUKA 3ABMB 4KXRA 4OGQB 5KHKA 1Y76A 1IXBA 2M6YA 2PY5A 2DJVA 4J11A 1XDCA 4GKJB 2LJ2A 2X6AA 2DQ3A 4F6EA 3JAKA 1VF6A 2UUBO 4IIJB 3AG4C 4MVOA 1US6A 2WLNA 4JAVA 4JI6O 4CH4A 3CCUV 1N33B 5JVDA 1Q43A 3NR7A 1IX9A 3ZJZA 4KFMA 2Q7HA 1TAEA 1ZTEA 3K04A 2X6BA 4R8CA 5FNVB 2F1MA 4FFBA 3CC2V 4QJFB 3CC4V 3CE2A 3F5TA 5EBMC 2P7TC 1KMIZ 4JI7B 1Z2GA 2Q73A 4DR3B 4B3TB 2VS0A 4U7NA 1FS0G 2QWPB 5DN6G 1R73A 5LMUB 4DXWA 2YIDA 3SYAA 2AXTZ 2HFEC 5JH7A 1N0JA 5EIBD 3RW0A 1V55B 5JCOA 3L9DA 3D36A 1NVPD 2A06H 2QTSA 1HNXB 1L0NH 1W0KG 3CRMA 3ZMTA 3AG2B 1M5IA 3BRCA 1WA8B 2FMLA 1LNQA 2BOCC 4X1KA 3OR6C 2YS8A 1M56C 5KHJA 4LWSB 3ETEA 4DR2O 2KSDA 4J7KA 4ZHQB 4TT3G 3A2FA 1RSOA 1GN4A 5IJ0B 2ZE5A 4I0XA 4YIOA 3B8MA 4WFHA 5IJ9B 2CTQA 4BWAA 1VQMV 2LP7A 4LF8O 4OPHA 2ZE8A 2CUGA 3QTCA 3WB2A 1PNKA 4FVMA 3ETDA 4Z2WA 1I5YA 5H6RA 1IURA 2WLIB 5FPOA 1URFA 1BGYH 1HNZB 3CCSV 3DC6A 2H3OA 5IYZA 4G28B 2QWQB 1SQGA 2OWOA 4I5SA 1TVKB 2ILMA 2A3QA 2EINB 1XEQA 4DV3O 1FXHA 1QHTA 2M7WA 1G6UA 5LOVA 4NKGB 4PA7A 1B04A 1V9PA 2YDEA 5J2TB 3I56V 1EN4A 4YJ2B 1TA8A 4F6RB 2QDOA 2R72A 4GX2A 4I50B 2W6IG 4XBFA 1J95A 3I5DA 1ROPA 4FLZA 1WNSA 2ZNJA 2ZR3A 4UV8A 1OCOB 5IE9A 2D3OW 2W0FC 4LR3A 3HB3B 5LBQA 1EN5A 1DF4A 1QR8A 3RWRD 5EIBC 4NXMB 3FB6C 3QO7A 3D3IA 3E8GA 2VQEB 3CRAA 1UJWB 1BT8A 5LHHA 2RDCA 1FD9A 4DUZO 1XBLA 2HKOA 2ITCC 2Y48A 5DECA 1P4RA 2ZIOA 2VWJA 3SPGA 4KL1A 5GONA 5JVDB 1SA0A 2P6JA 2KG7A 2WSSG 2HR3A 4AILC 1RM1C 4AI8A 3LNMB 3OUSA 2V1DA 4FFBB 1K4CC 3TXQA 3CCVV 5FL7G 2IBZH 3RFRA 2WAMA 3CMEV 2R9RB 1OCRB 4FLVA 4DV4B 4J80A 1XNRO 2ZXWC 3ABKC 5JH7B 3UO3A 2ZIMA 4LFCO 2AZ0A 2QGNA 4ZIBA 4JYYA 3LSSA 3PN1A 2PYLA 2BE3A 4JI3B 4DV2O 5C93A 1R1BA 3SPIA 3I55V 1CXZB 4QGPA 4H33A 2QWOB 2QTOA 3M7MX 3T1HB 3STLC 5EK0A 2UXXA 4X1KB 1XILA 3UKMA 1XMQB 2F4VB 2Y0IA 4GKKB 1RSOB 5B1AB 2YXHA 2RQ6A 5BMVA 4I0XB 1HW7A 2LGWA 4MVSA 4X20B 3BFRA 1N32B 1IBMB 1YXBA 1Z5VA 3E86A 4X66O 1TGOA 5DEDA 1P84F 1PPJH 5LMNB 3DGEA 2E74B 2P5OA 3MHHC 2DYSB 1QLEB 2EIKC 1WP8A 2JEXA 4WFGA 3ZS8C 4LF9O 1XNQO 1GTOA 1X59A 4ZI7A 5IYZB 1JFFA 1N8RW 4JI4B 1VF7A 2XAQA 2BTOA 3CCRV 4DV6O 1YCIA 4GT1A 4FPPA 4B3RO 4Q20A 2EIMB 4NTXA 2C2AA 5LOVB 2UUBB 3RYHA 2E75B 4YHHO 1SQQH 3C90A 3AG3B 1LUVA 4A5UB 5D5QA 3GB7C 1Q6UA 3CD6V 5KHIA 3T4ZA 5JWPA 1K5QA 1FPOA 1Q6IA 1SETA 1WP7A 1SQFA 4FK5C 2RCVA 2XAFA 1D5AA 4B3MO 2WLLA 1PNMA 1YJNV 3HR0A 1WLEA 3ZMVA 3MD0A 1E79G 2VWKA 3QO8A 3OD4A 5KHHA 4DR4O 4KHPO 1J5EO 2OT5A 3JASA 2WLKA 4JYCA 5KMGA 1GN3A 2KG7B 1N4CA 3CXHF 4CH6A 2Q69A 1M4UA 1Y6XA 4PA9A 5B3SC 2HVKC 1K97A 4DR6O 3UM7A 1FFXA 4KP4A 5C8YA 2UXDB 5LP6C 1BHAA 3QG5A 3U10A 3ASOB 1TUEB 1N34O 3ZHTA 1FAFA 3A0RA 1KKDA 4LF8B 4MTOA 3B09A 4MTXA 4UCRA 4FLWA 1JA8A 4PA3A 1H8EG 4LP8A 4LF7O 4FLTA 1NKDA 3H1IH 1BL8A 1YVWA 3FFQA 3JATA
chains in the Genus database with same CATH topology
2VS0A 3OGIB 3Q4HB 2AZ0A 2KG7B 4LWSB 3Q4HA 2KG7A 2VRZA 4LWSA 2DE0X 4I0XB 3HR0A 3O9OA 4ABMA 3FD9A 3FAVB 4GZRB 4I0XA 3TXQA 3FAVA 3TXSA 1WA8B 3GWKC 2AZ2A 3ZBHA 3G80A 1WA8A 2B9ZA 3GVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VS0 A;  3OGI B;  3Q4H B;  2AZ0 A;  2KG7 B;  4LWS B;  3Q4H A;  2KG7 A;  2VRZ A;  4LWS A;  2DE0 X;  4I0X B;  3HR0 A;  3O9O A;  4ABM A;  3FD9 A;  3FAV B;  4GZR B;  4I0X A;  3TXQ A;  3FAV A;  3TXS A;  1WA8 B;  3GWK C;  2AZ2 A;  3ZBH A;  3G80 A;  1WA8 A;  2B9Z A;  3GVM A; 
#chains in the Genus database with same CATH topology
 2ZR2 A;  3CCL V;  1P49 A;  1NQT A;  2OCH A;  5BMV B;  1VQL V;  2QM7 A;  1W2B U;  1WAZ A;  1GH6 A;  4DV3 B;  1AR5 A;  2EX3 A;  2YI9 A;  4U3F H;  2EZP A;  4RUF A;  2F66 C;  2ADP A;  4H37 A;  4UCO A;  3SPH A;  4EKW A;  5LA6 A;  4K0K O;  1AI7 A;  3CJH A;  4IL6 Z;  4J10 A;  3ZRS A;  4PA6 A;  1SZX A;  3L71 H;  1PKX A;  5B1B B;  3T1Y B;  3SJB C;  3ETQ A;  2IJJ A;  5LGU A;  4ZOL A;  4PD4 F;  1JFF B;  3CHX A;  3G67 A;  4TOI A;  3IFX A;  2QKA A;  2ITD C;  1XOU A;  2DWD C;  1YHQ V;  4LFA O;  5A2Q N;  2F95 B;  3JAL A;  4EFE A;  5H5N A;  3ABM C;  1M57 C;  3GWK C;  4HBN A;  5EZY A;  3ZMU A;  3K3W A;  3RYH B;  1CP9 A;  5ITZ A;  4WF9 V;  4XDL A;  4DW1 A;  1YI2 V;  4H13 B;  1YDX A;  5K1P A;  4BW5 A;  5KA6 A;  1DLB A;  2F23 A;  2EZO A;  4X89 A;  3HKD A;  4TV8 B;  3E22 A;  4LF4 O;  1JOY A;  1BCC H;  5CA0 A;  5IWA O;  4O4L A;  1NR1 A;  3SJQ C;  4JI8 O;  2WLL B;  1PNL A;  3ZMZ A;  3ZN1 A;  1XNR B;  1QNM A;  3G71 V;  3AG1 B;  1B6Q A;  3JAS B;  5KMG B;  1XL4 A;  1ZUQ A;  2WA4 A;  2LFR A;  1MSW D;  3CPW U;  1V55 C;  1BZK A;  3VOU A;  1WJZ A;  3RYI A;  2LGQ A;  2HJF C;  3ML0 A;  3L75 H;  1OCZ B;  3AG2 C;  4CS2 A;  2V7Q G;  4JZ2 A;  1FFX B;  5C8Y B;  2N74 A;  3CXC U;  4TUY A;  3K5M A;  3C3T A;  2JIZ G;  1W59 A;  5L3F A;  4X65 B;  1AP6 A;  4X66 B;  2KQX A;  4X9Q A;  3DXR A;  4P9P A;  1NTK H;  1JX9 A;  2EUL A;  1NR7 A;  1MA1 A;  2BOB C;  4JYA B;  1ZAU A;  4LCU C;  4MVU A;  4L8J A;  2HG5 C;  3CS5 A;  1X4T A;  3UO2 A;  4WBN B;  1QU7 A;  2XUM A;  2GDS A;  3JAT B;  2B9Z A;  3STZ C;  2AHY A;  3SPC A;  3JD4 A;  4JGS A;  4DV6 B;  3CYO A;  1M57 B;  4NVP A;  2RMK B;  4PJ0 Z;  3OT7 A;  4Q6G A;  4YHH B;  3OEH G;  2E5L O;  2XAG A;  4DRX A;  2EIN C;  4MVZ A;  3TK1 A;  5LA6 B;  3SDL A;  3CJH B;  5B1O A;  2Y4U A;  4DR7 O;  2BTQ B;  4JI2 B;  1EZV H;  2CDY A;  3O65 A;  3FX7 A;  2B1I A;  4DV0 O;  4ZOL B;  1KU9 A;  3SYQ A;  1EFR G;  3RYC A;  2NNU A;  1OCO C;  3Q4H A;  4JI1 O;  1L0L H;  4N23 A;  1S3J A;  3JAL B;  4U3J A;  3ZN0 A;  4J42 A;  3F7Y C;  5KLV H;  3TJT A;  2ETN A;  3ZHS A;  2PTM A;  3JAW A;  3PJS K;  5H6Q A;  1IZ3 A;  5EZY B;  2XHB A;  1NT2 B;  2H94 A;  2K9P A;  2HVJ C;  4NXN O;  1UPG A;  2CTP A;  1EZJ A;  2DYR B;  5ITZ B;  3BA9 A;  1BQ0 A;  3H1J H;  5BZB A;  1NS1 A;  1VF6 C;  4DR4 B;  2H8P C;  4OX9 O;  4I9Q A;  2VRZ A;  4RQF A;  3RN4 A;  1I94 O;  3HKD B;  3E22 B;  4FLX A;  3B40 A;  5CA0 B;  1S76 D;  3WG7 B;  4PEL A;  4O4L B;  2ZE6 A;  4DK0 A;  1THZ A;  4DUY B;  3FYI B;  2QWR B;  4J9Z B;  4JAU A;  1GM7 A;  3THO A;  4UCS A;  2XT9 A;  3J7A U;  1K34 A;  1OCR C;  1SES A;  3L73 H;  1COW G;  1M93 A;  3LDD A;  1AI5 A;  2Q7E A;  1GAX A;  4YY3 O;  4B3S O;  4FMT A;  5LXT A;  5JCO C;  4X1I A;  4LF7 B;  2HEP A;  3D36 C;  3P3N A;  1Y74 A;  4RUE A;  3RYI B;  1EM1 A;  2Q68 A;  3MAQ A;  2UUA O;  1GK9 A;  2ZDI A;  5EC1 C;  4TUY B;  3KCX A;  4FJC C;  4X64 O;  1F4N A;  4RQE A;  1KB9 F;  5FPR A;  2AZ2 A;  2VQF O;  4H0L B;  5B1A C;  4PA4 A;  3DXR B;  5E1A C;  1TUB B;  4DV5 O;  4JI0 B;  2NR5 A;  3ZRX A;  3R65 A;  1SS3 A;  4RWU A;  3C3S A;  4DV7 O;  3CC7 V;  2CAZ C;  1K7D A;  3QO5 A;  4PI2 A;  2UXB B;  4DV1 B;  1G1X B;  2DYS C;  1FXK A;  1QLE C;  3SGI A;  3BEH A;  1MG1 A;  3E8B A;  1QCE A;  4ICG A;  1FXV A;  3BAA A;  1V54 B;  3APO A;  4J9Y B;  4UCT A;  1IBL O;  2IU3 A;  1Y76 B;  5IYD O;  3AEI A;  4CC6 A;  3VQW A;  3HKE A;  2R9A A;  3W7T A;  5IY5 B;  2UXC B;  2P67 A;  3E89 A;  4DRX B;  4JI5 O;  3ZED A;  3JAK B;  2UU9 B;  4UUJ C;  3JCU Z;  2EIM C;  1DTO A;  5J2U A;  4MT8 A;  3ZHQ A;  3FB7 C;  4JV5 O;  1ARO P;  2YIC A;  1ZWI C;  1K9M W;  3G4S V;  3AG3 C;  3J80 N;  3RYC B;  1YTF B;  1XRE A;  2PZS A;  3AK3 A;  5CBG A;  3Q4H B;  4LF4 B;  4ASU G;  1GN2 A;  5IWA B;  2WPD G;  1YSC A;  1FJG O;  4U3J B;  4QPJ A;  4JI8 B;  3K79 A;  1H8H G;  3JAM N;  3JAW B;  3EFF K;  1RP3 B;  3CCJ V;  4LFB B;  3CCQ V;  4D7T A;  5BY1 A;  2FYU H;  5LL6 Y;  1GO3 F;  4YXW G;  1VQ4 V;  4CS4 A;  4R6Z A;  1K92 A;  3RVZ A;  3UCS C;  3K57 A;  1A32 A;  3OUF A;  1S72 V;  5IYC O;  2ARH A;  4CH5 A;  3QNE A;  1AI6 A;  1KD1 W;  4MW8 A;  1P7G A;  3FKS G;  5BXZ A;  2UUC O;  3N2G A;  1MNG A;  2LW7 A;  2P4V A;  4U7O A;  3ZHU A;  3OM3 B;  2P4K A;  4CBC A;  2QEX V;  2ZCE A;  4LF6 O;  3MDS A;  4GX1 A;  3KZI Z;  4ABM A;  3ASO C;  2G38 A;  5CBF A;  4DR5 O;  4R7C A;  1Y74 B;  2WLJ A;  1F4M A;  1NTZ H;  2ODM A;  5LHI A;  2JJ2 G;  5F2V O;  3D3Q A;  1R6N A;  4NR1 A;  3K59 A;  1Q7Y W;  1AP5 A;  2RNB A;  2RN9 A;  1JJ2 U;  4IYI A;  4FLY A;  2GBO A;  1NU1 H;  1IXM A;  1SF9 A;  2V4D A;  3SYP A;  4QIW F;  1OZ0 A;  4NYK A;  1VF5 B;  1XMO O;  3ZBH A;  1ENV A;  3VQX A;  1YIJ V;  2E5L B;  3K5O A;  2JEU A;  3A0H Z;  3QVN A;  1SER A;  2HHH O;  3N27 A;  1N0N A;  2DQ0 A;  4UVA A;  4GLX A;  4JTC B;  2WLH A;  3DTU B;  1CEZ A;  3VQY A;  4DR1 O;  2RJZ A;  5DM6 V;  2QA4 V;  4DV0 B;  3BPZ A;  4MVM A;  4JF3 A;  2K1E A;  4X8A A;  4TWK A;  4JI6 B;  1FXK B;  1FYJ A;  1SKV A;  4JI1 B;  5B1B C;  4O2B A;  1QVF U;  5AG2 A;  1D5N A;  4W4L A;  4X1Y A;  1KUQ A;  3OGI B;  5B66 Z;  3OTO O;  1AJP A;  1GN6 A;  3HKE B;  2YSU B;  1SQV H;  3ICX A;  2X6C A;  4NXN B;  2JGD A;  1PM9 A;  1SQB H;  5D5P A;  3TCU A;  4UB6 Z;  5J2U B;  2EJ7 A;  2Q0A A;  5KX5 A;  2O57 A;  2ZNI A;  5CA1 A;  3G6B A;  1H2M A;  2BSK A;  4K8Z A;  4J7J A;  5JJN B;  2YIB A;  5IYB O;  2D2C B;  3AK2 A;  5GON B;  2GHY A;  3A8T A;  1SA0 B;  4IYH A;  4MSW C;  4PHZ A;  3ABL B;  4UB8 Z;  3G6E V;  1KP3 A;  2QKS A;  2P06 A;  1NTM H;  4DR3 O;  1GRJ A;  2GUZ A;  3ASN B;  4BIZ A;  4DR2 B;  3K5N A;  5LMU O;  2YXL A;  1Y66 A;  4MTG A;  1M9N A;  1KKC A;  4YY3 B;  1PL0 A;  4B3S B;  3AG1 C;  1LR1 A;  3E83 A;  4IHJ A;  2OIE A;  3H9V A;  4WFF A;  2L6L A;  2ADQ B;  4QE9 A;  2LQT A;  4PV1 B;  2UUA B;  2DMX A;  3N2K A;  2P22 C;  1T5E A;  3OE7 G;  1Q81 W;  3K9A A;  3ZHR A;  1OCZ C;  3N2G B;  1NZ6 A;  1YJ9 V;  1AI4 A;  4TQD A;  1PL4 A;  2VQF B;  2PUS A;  1MOF A;  5FLX N;  4GUN A;  4DV7 B;  4FLU A;  3FB8 C;  1ZLZ A;  3B2E E;  1IBK O;  1R3L C;  3K08 A;  3E35 A;  3H1H H;  4QNH B;  2YUA A;  3W7U A;  2IJH A;  2XAJ A;  3M99 B;  3GWO A;  3JSN A;  1B06 A;  4ZI7 B;  4QE7 A;  3L72 H;  4MVR A;  1IBL B;  1OCC B;  2CGN A;  2EIL B;  4GZR B;  1H38 A;  1JQ0 A;  4ZBM A;  2YC0 A;  4UCU A;  2MK3 A;  4E4E A;  4K3A A;  4LNU A;  4JI5 B;  4YIP A;  4EFB A;  1K4D C;  2PF4 E;  1KBH A;  3P30 A;  3OW2 U;  2DN9 A;  2DWE C;  3F7V C;  3JCZ A;  3HKC A;  3LUT B;  4JV5 B;  4DUZ B;  1R6T A;  4XDK A;  2JJ1 G;  4D7S A;  3OFN G;  1DK1 A;  5LGT A;  1I0H A;  1WPX A;  1SC5 B;  4O2B B;  4LC1 A;  4WBN A;  3X2Q B;  3R66 A;  2N04 A;  3TXS A;  4NXM O;  1PD3 A;  2FKX A;  4X1Y B;  1YZB A;  3CCM V;  1WB7 A;  1O9H A;  2VQE O;  4DK1 A;  2JGD B;  1AVM A;  2X7R B;  4ZKI A;  1GM8 A;  2AW9 A;  5KX5 B;  4HAM A;  5CA1 B;  2N05 A;  2BSK B;  4LFC B;  2DYR C;  3JAR A;  3A0B Z;  4UVB A;  4P2Z A;  1WPB A;  4LH7 A;  4DV2 B;  3G80 A;  3KKY A;  3K5L A;  5JJE B;  1K3E A;  1M1K W;  1B3Q A;  4Z1M G;  4KUM A;  3WG7 C;  1AJN A;  4ZHQ A;  3M8A A;  1R3I C;  2CTR A;  4IGG A;  3K0D A;  1NJI W;  3JD0 A;  4JPR A;  4EEQ A;  1ZSP A;  2YI8 A;  4LF6 B;  1YTF D;  3WU2 Z;  3KG2 A;  2JGU A;  3B8N A;  3E8F A;  1AR4 A;  3BCC H;  3OMN B;  2L35 A;  4IHJ B;  1N36 O;  1P7B A;  2Q7G A;  4DYL A;  2WLI A;  2Q5Z A;  4Z1V A;  5EC2 C;  3T1H O;  2Z5U A;  2XND G;  5LHG A;  3FD9 A;  3N2K B;  3RBZ A;  1E1R G;  3ZMS A;  3W7X A;  4P9O A;  3T1C A;  3P32 A;  1XMQ O;  4O2A A;  4LF9 B;  1MZF A;  1F7Y A;  2F4V O;  1Q3E A;  1XNQ B;  1TVK A;  3L74 H;  4K8X A;  3DC5 A;  1Z5W A;  2Q4P A;  2ZE7 A;  4JAA A;  3AK1 A;  1E1Q G;  1IBM O;  1XMO B;  4B3R B;  1R3K C;  1S5J A;  4UV9 A;  3APQ A;  4YJ2 A;  4JTA B;  2CTW A;  1H2L A;  1ZX3 A;  4D6T H;  1Y67 A;  2PI5 A;  5L3B A;  4PDL A;  4GCZ A;  1G4Y B;  4TQF A;  3VQV A;  1VQO V;  4FM2 A;  1HDJ A;  4GX5 A;  4JI4 O;  5J9P C;  5LYJ A;  2IH1 C;  1JMK C;  1PP9 H;  4DO2 A;  3OTO B;  1S77 D;  2JS3 A;  1V54 C;  3DSQ A;  1FFT B;  4B3M B;  2B5U A;  4LNU B;  1ZL8 A;  3HKC B;  5IY5 C;  4BIU A;  4KHP B;  3UT5 A;  1J5E B;  3S3W A;  1UFI A;  2Y69 B;  1L8D A;  4CS3 A;  4TV9 A;  1QQC A;  1MMM A;  3EHB B;  1VP7 A;  3QF7 A;  4C7U A;  1PV0 A;  4DR6 B;  3W7S A;  3RYF A;  3S3X A;  5IT9 N;  3OGC C;  1I5X A;  1Q90 D;  4FFK A;  1HNW O;  2YIA A;  5BR8 O;  1Q5O A;  2A9H A;  5JQG A;  5JJJ B;  1N34 B;  3JAR B;  4B7E A;  2CH7 A;  5B1N A;  2QKC A;  4BW9 A;  1SRY A;  2IW5 A;  3H1K H;  2P90 A;  1R3J C;  2ZQM A;  4WFA V;  1K73 W;  1CPY A;  2WWW A;  4O4I A;  3TGU H;  2IJI A;  4P30 A;  2UXD O;  4RO2 A;  5CN0 A;  3BHP A;  2OCC B;  4RAI A;  1WN7 A;  3ZIA G;  4X20 A;  3K06 A;  4FM0 A;  1G8M A;  2EIJ B;  3JSL A;  1MAB G;  3CRQ A;  2FL4 A;  1IBK B;  1F51 A;  4O4J A;  3LDC A;  3NXS A;  4K0K B;  4J41 A;  2DE0 X;  2HP8 A;  4O2A B;  1JR9 A;  3CCE V;  1S5L Z;  2XOK G;  4UXN A;  3OTF A;  3IC9 A;  2IH3 C;  2IM9 A;  2ZDI C;  4LFA B;  5L3G A;  1GMG A;  4UFZ A;  3KCY A;  2NN4 A;  4JYB A;  1HP8 A;  3AG4 B;  5E79 Z;  1JVM A;  1XI1 A;  1AB3 A;  2NLJ C;  3UQ8 A;  2FB5 A;  4NTY A;  2GTA A;  4EB6 A;  3H1L H;  1HR0 O;  3T1Y O;  4DW0 A;  4LBE C;  5HFL A;  1BE3 H;  3GVM A;  1H2S B;  4MS2 A;  1NH2 B;  5B5E Z;  4LF5 O;  3P3P A;  3WB0 A;  4O4H A;  5CA3 A;  5LYJ B;  1I7F A;  1DF5 A;  2QR4 A;  1FXK C;  3RVY A;  3RGB A;  1K5S A;  1VQK V;  5H2F Z;  2EBO A;  2ZKO A;  2X0L A;  3IC7 A;  1ZL8 B;  4B7K A;  1M90 W;  4MVQ A;  1KYO F;  3FYE B;  4HNA A;  2E76 B;  2QM8 A;  3UT5 B;  3LNN A;  2LW1 A;  4CC5 A;  4TV9 B;  1HWY A;  3OMA B;  1KP2 A;  3U11 A;  1VQ5 V;  1IDS A;  1M56 B;  2BCC H;  3LDE A;  1R6K A;  4F4L A;  1JJO A;  1BMF G;  4K35 A;  3SJC C;  1EN6 A;  4PDR A;  3RYF B;  3ABL C;  1VMG A;  2A7W A;  1JPX A;  3ASN C;  1YIT V;  5JQG B;  4W4K A;  2CH7 B;  3BA8 A;  2GSM B;  2KKW A;  3OR7 C;  1KC8 W;  1W0J G;  1LUW A;  1N36 B;  1VQ8 V;  2YXY A;  3IAY A;  4MTF A;  2Q67 A;  5LXT B;  4O4I B;  4X1I B;  3B77 A;  3EXA A;  1U96 A;  1AJQ A;  4N21 A;  2AHZ A;  3JD2 A;  1QBZ A;  2XAS A;  1OV9 A;  1AIL A;  5KAF Z;  2ATK C;  1H2K A;  1KQS U;  3ZRW A;  2A0L A;  4E2L A;  4X65 O;  3OAA G;  1QVG U;  2ZM6 O;  2YIB D;  4X62 O;  4JAS A;  5EBL C;  3CP1 A;  4AQY O;  1YJW V;  4FZ0 A;  4JYA O;  1Q8I A;  4O4J B;  3WFV A;  3ABT A;  1F23 A;  1K8A W;  2WA3 A;  1Y4M A;  3K58 A;  2JRI A;  4DR7 B;  1GM9 A;  1Q6H A;  2Z0A A;  2B1G A;  2A79 B;  3CRC A;  1NVP B;  3RT3 C;  3U0Z A;  5L3E A;  5GW7 A;  2Z3Y A;  1QR9 A;  2HJD A;  2Y4T A;  1VEW A;  2PYJ A;  4GKJ O;  5GTH Z;  4OXS A;  3W7W A;  4WFE A;  1EBO A;  1OCC C;  2EIL C;  1Q86 W;  4R50 A;  1O9G A;  4EB6 B;  4JI2 O;  4J7Z A;  4PDM A;  3CX5 F;  3J81 N;  3BY6 A;  3SPJ A;  4OX9 B;  4I4T A;  1RM1 B;  3E8H A;  1DGS A;  4MW3 A;  4TV8 A;  4I7Z B;  1N33 O;  3CEI A;  4I55 A;  2HLD G;  3SYC A;  1I94 B;  1OHH G;  2XAH A;  3CB2 A;  4O4H B;  5LP6 A;  5KUM A;  3SR2 C;  3WB1 A;  1VIB A;  3T4D A;  3OEE G;  1BSM A;  3X2Q C;  2ZXW B;  3ABK B;  4CH3 A;  1S5H C;  1YEW A;  3IJ4 A;  4JI7 O;  3BAB A;  2PGG A;  1VQ7 V;  4BAY A;  4B3T O;  1HNW B;  2MW2 B;  5EYP A;  5BR8 B;  3EVK A;  3CWB H;  5CMU A;  2QM4 A;  3FB5 C;  4PI0 A;  2UXN A;  4HNA B;  1QLN A;  2QWN B;  3B4S A;  4NB5 A;  4GYC B;  4QPK A;  1HNX O;  2AGA A;  3ZRV A;  3CSX A;  1VQP V;  2CK3 G;  1XHZ A;  3O9O A;  5GTI Z;  2F43 G;  1OJH A;  4DUY O;  3K03 A;  2ZT9 B;  5CB4 A;  4G2K A;  3FAV A;  2Q0O C;  4B08 A;  2LO1 A;  3HKB A;  4FIP C;  4UVC A;  3CMA V;  2ZD9 A;  4X64 B;  5A9G A;  2YEV A;  1H2G A;  1MSD A;  2EIK B;  4DV5 B;  1BQZ A;  2DW4 A;  4YJ3 A;  4HYO A;  1WB8 A;  4UCV A;  5EBW C;  1HNZ O;  3VBB A;  3OMI B;  2OIG A;  1U97 A;  2ZIN A;  2PI4 A;  5KAI Z;  3ZRW B;  1BS3 A;  3BVO A;  1YF2 A;  1VQ9 V;  1NI8 A;  1Q82 W;  2R9I A;  2E3C A;  2JS5 A;  1H2N A;  1GKF A;  4X88 A;  4PDV A;  4JI0 O;  5L3C A;  5IDJ A;  4CZZ A;  1RPR A;  2KB1 A;  3LSQ A;  1RPO A;  1D2D A;  2FTK A;  2W6J G;  4IIJ A;  2BTQ A;  4WCE V;  1HR0 B;  1BHB A;  3ZHV A;  3ZCC A;  2UXB O;  2QJ1 A;  3JYC A;  4DV1 O;  1SZT A;  2W0X A;  4NTW A;  4LF5 B;  5H9C A;  3SYO A;  1K33 A;  2JVD A;  5FNV A;  1IVS A;  2QSA A;  1FJG B;  1S0V A;  2GV9 A;  2DOS A;  2UXC O;  5KHG A;  1XL6 A;  4IT5 A;  2Q9L A;  2UU9 O;  1L1F A;  5LGN A;  2IU0 A;  1MZE A;  3JD3 A;  3K0G A;  2IJK A;  1NBM G;  2JK5 C;  3ABU A;  3F5W C;  1SQP H;  2Q6A A;  4I4T B;  4GX0 A;  4XDJ A;  5B3S B;  4WFB V;  4I55 B;  4JZG A;  2OYQ A;  1WA8 A;  2EJR A;  3AG7 A;  4FZ1 A;  4OPA A;  2Y69 C;  5LP6 B;  4JTD B;  2CE4 A;  4L87 A;  4LFB O;  4TSF G;  4LWS A;  4FM1 A;  1FKA O;  2GUZ B;  2UUC B;  1RFY A;  2QE7 G;  4HZ3 A;  5EYP B;  4DV4 O;  3E2E A;  5IJ0 A;  3L70 H;  4BIO A;  5IJ9 A;  1AR1 B;  2XTA A;  4BR6 A;  3ETG A;  1NH2 D;  5CBH A;  2CGO A;  4JI3 O;  2F93 B;  4LH6 A;  3D8C A;  4G27 B;  3TET A;  4H44 B;  4DR5 B;  3H01 A;  3HPL C;  5CB4 B;  3FAV B;  4AHC A;  2JDI G;  1XQ8 A;  2OTL V;  3HKB B;  5L3D A;  4GKK O;  1ORQ C;  3IGA C;  3MHS C;  2ZM6 B;  1VQ6 V;  4X62 B;  3JD1 A;  2OCC C;  1JCH A;  1TUB A;  4AQY B;  1XUQ A;  1N32 O;  1VAR A;  5KA5 A;  2YEV B;  2R70 A;  3CRR A;  2Q8V A;  5J2T A;  1VQN V;  2Y0P A;  1XHX A;  3T2M A;  4F6R A;  5LMN O;  1SQX H;  5TIS Z;  4I50 A;  4YJ3 B;  2EIJ C;  2HHH B;  2GTS A;  3LSU A;  5K1X A;  1I08 A;  3K9S A;  2LFS A;  4DR1 B;  2OTJ V;  1KEC A;  3SJA C;  2WLM A;  4I9W A;  5HFM A;  3ZX6 A;  5KUK A;  3ABM B;  4KXR A;  4OGQ B;  5KHK A;  1Y76 A;  1IXB A;  2M6Y A;  2PY5 A;  2DJV A;  4J11 A;  1XDC A;  4GKJ B;  2LJ2 A;  2X6A A;  2DQ3 A;  4F6E A;  3JAK A;  1VF6 A;  2UUB O;  4IIJ B;  3AG4 C;  4MVO A;  1US6 A;  2WLN A;  4JAV A;  4JI6 O;  4CH4 A;  3CCU V;  1N33 B;  5JVD A;  1Q43 A;  3NR7 A;  1IX9 A;  3ZJZ A;  4KFM A;  2Q7H A;  1TAE A;  1ZTE A;  3K04 A;  2X6B A;  4R8C A;  5FNV B;  2F1M A;  4FFB A;  3CC2 V;  4QJF B;  3CC4 V;  3CE2 A;  3F5T A;  5EBM C;  2P7T C;  1KMI Z;  4JI7 B;  1Z2G A;  2Q73 A;  4DR3 B;  4B3T B;  2VS0 A;  4U7N A;  1FS0 G;  2QWP B;  5DN6 G;  1R73 A;  5LMU B;  4DXW A;  2YID A;  3SYA A;  2AXT Z;  2HFE C;  5JH7 A;  1N0J A;  5EIB D;  3RW0 A;  1V55 B;  5JCO A;  3L9D A;  3D36 A;  1NVP D;  2A06 H;  2QTS A;  1HNX B;  1L0N H;  1W0K G;  3CRM A;  3ZMT A;  3AG2 B;  1M5I A;  3BRC A;  1WA8 B;  2FML A;  1LNQ A;  2BOC C;  4X1K A;  3OR6 C;  2YS8 A;  1M56 C;  5KHJ A;  4LWS B;  3ETE A;  4DR2 O;  2KSD A;  4J7K A;  4ZHQ B;  4TT3 G;  3A2F A;  1RSO A;  1GN4 A;  5IJ0 B;  2ZE5 A;  4I0X A;  4YIO A;  3B8M A;  4WFH A;  5IJ9 B;  2CTQ A;  4BWA A;  1VQM V;  2LP7 A;  4LF8 O;  4OPH A;  2ZE8 A;  2CUG A;  3QTC A;  3WB2 A;  1PNK A;  4FVM A;  3ETD A;  4Z2W A;  1I5Y A;  5H6R A;  1IUR A;  2WLI B;  5FPO A;  1URF A;  1BGY H;  1HNZ B;  3CCS V;  3DC6 A;  2H3O A;  5IYZ A;  4G28 B;  2QWQ B;  1SQG A;  2OWO A;  4I5S A;  1TVK B;  2ILM A;  2A3Q A;  2EIN B;  1XEQ A;  4DV3 O;  1FXH A;  1QHT A;  2M7W A;  1G6U A;  5LOV A;  4NKG B;  4PA7 A;  1B04 A;  1V9P A;  2YDE A;  5J2T B;  3I56 V;  1EN4 A;  4YJ2 B;  1TA8 A;  4F6R B;  2QDO A;  2R72 A;  4GX2 A;  4I50 B;  2W6I G;  4XBF A;  1J95 A;  3I5D A;  1ROP A;  4FLZ A;  1WNS A;  2ZNJ A;  2ZR3 A;  4UV8 A;  1OCO B;  5IE9 A;  2D3O W;  2W0F C;  4LR3 A;  3HB3 B;  5LBQ A;  1EN5 A;  1DF4 A;  1QR8 A;  3RWR D;  5EIB C;  4NXM B;  3FB6 C;  3QO7 A;  3D3I A;  3E8G A;  2VQE B;  3CRA A;  1UJW B;  1BT8 A;  5LHH A;  2RDC A;  1FD9 A;  4DUZ O;  1XBL A;  2HKO A;  2ITC C;  2Y48 A;  5DEC A;  1P4R A;  2ZIO A;  2VWJ A;  3SPG A;  4KL1 A;  5GON A;  5JVD B;  1SA0 A;  2P6J A;  2KG7 A;  2WSS G;  2HR3 A;  4AIL C;  1RM1 C;  4AI8 A;  3LNM B;  3OUS A;  2V1D A;  4FFB B;  1K4C C;  3TXQ A;  3CCV V;  5FL7 G;  2IBZ H;  3RFR A;  2WAM A;  3CME V;  2R9R B;  1OCR B;  4FLV A;  4DV4 B;  4J80 A;  1XNR O;  2ZXW C;  3ABK C;  5JH7 B;  3UO3 A;  2ZIM A;  4LFC O;  2AZ0 A;  2QGN A;  4ZIB A;  4JYY A;  3LSS A;  3PN1 A;  2PYL A;  2BE3 A;  4JI3 B;  4DV2 O;  5C93 A;  1R1B A;  3SPI A;  3I55 V;  1CXZ B;  4QGP A;  4H33 A;  2QWO B;  2QTO A;  3M7M X;  3T1H B;  3STL C;  5EK0 A;  2UXX A;  4X1K B;  1XIL A;  3UKM A;  1XMQ B;  2F4V B;  2Y0I A;  4GKK B;  1RSO B;  5B1A B;  2YXH A;  2RQ6 A;  5BMV A;  4I0X B;  1HW7 A;  2LGW A;  4MVS A;  4X20 B;  3BFR A;  1N32 B;  1IBM B;  1YXB A;  1Z5V A;  3E86 A;  4X66 O;  1TGO A;  5DED A;  1P84 F;  1PPJ H;  5LMN B;  3DGE A;  2E74 B;  2P5O A;  3MHH C;  2DYS B;  1QLE B;  2EIK C;  1WP8 A;  2JEX A;  4WFG A;  3ZS8 C;  4LF9 O;  1XNQ O;  1GTO A;  1X59 A;  4ZI7 A;  5IYZ B;  1JFF A;  1N8R W;  4JI4 B;  1VF7 A;  2XAQ A;  2BTO A;  3CCR V;  4DV6 O;  1YCI A;  4GT1 A;  4FPP A;  4B3R O;  4Q20 A;  2EIM B;  4NTX A;  2C2A A;  5LOV B;  2UUB B;  3RYH A;  2E75 B;  4YHH O;  1SQQ H;  3C90 A;  3AG3 B;  1LUV A;  4A5U B;  5D5Q A;  3GB7 C;  1Q6U A;  3CD6 V;  5KHI A;  3T4Z A;  5JWP A;  1K5Q A;  1FPO A;  1Q6I A;  1SET A;  1WP7 A;  1SQF A;  4FK5 C;  2RCV A;  2XAF A;  1D5A A;  4B3M O;  2WLL A;  1PNM A;  1YJN V;  3HR0 A;  1WLE A;  3ZMV A;  3MD0 A;  1E79 G;  2VWK A;  3QO8 A;  3OD4 A;  5KHH A;  4DR4 O;  4KHP O;  1J5E O;  2OT5 A;  3JAS A;  2WLK A;  4JYC A;  5KMG A;  1GN3 A;  2KG7 B;  1N4C A;  3CXH F;  4CH6 A;  2Q69 A;  1M4U A;  1Y6X A;  4PA9 A;  5B3S C;  2HVK C;  1K97 A;  4DR6 O;  3UM7 A;  1FFX A;  4KP4 A;  5C8Y A;  2UXD B;  5LP6 C;  1BHA A;  3QG5 A;  3U10 A;  3ASO B;  1TUE B;  1N34 O;  3ZHT A;  1FAF A;  3A0R A;  1KKD A;  4LF8 B;  4MTO A;  3B09 A;  4MTX A;  4UCR A;  4FLW A;  1JA8 A;  4PA3 A;  1H8E G;  4LP8 A;  4LF7 O;  4FLT A;  1NKD A;  3H1I H;  1BL8 A;  1YVW A;  3FFQ A;  3JAT A; 
#chains in the Genus database with same CATH homology
 2VS0 A;  3OGI B;  3Q4H B;  2AZ0 A;  2KG7 B;  4LWS B;  3Q4H A;  2KG7 A;  2VRZ A;  4LWS A;  2DE0 X;  4I0X B;  3HR0 A;  3O9O A;  4ABM A;  3FD9 A;  3FAV B;  4GZR B;  4I0X A;  3TXQ A;  3FAV A;  3TXS A;  1WA8 B;  3GWK C;  2AZ2 A;  3ZBH A;  3G80 A;  1WA8 A;  2B9Z A;  3GVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...