2VRZA

Structural analysis of homodimeric staphylococcal aureus esxa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
98
structure length
98
Chain Sequence
AHMAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords VIRULENCE FACTOR ESXA
publication title Structure of Staphylococcus Aureus Esxa Suggests a Contribution to Virulence by Action as a Transport Chaperone and/or Adaptor Protein.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 44
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2vrzA00
1WA8A 3TXQA 1WA8B 4ABMA 3FAVA 3FAVB 4LWSA 4LWSB 2KG7A 2KG7B 2AZ2A 3TXSA 2AZ0A 2VS0A 3GWKC 4GZRB 2B9ZA 4I0XA 4I0XB 3GVMA 3ZBHA 2VRZA 2DE0X 3OGIB 3Q4HA 3Q4HB 3G80A 3O9OA 3FD9A 3HR0A
chains in the Genus database with same CATH superfamily
2YC0A 3CC7V 3UKMA 5LXTB 3OMNB 3CCJV 1AJPA 2L35A 5KMGB 4C7UA 2HEPA 1AR5A 5JJNB 3B4SA 1DLBA 3UQ8A 2YIDA 3APOA 2CK3G 4LF9B 1SESA 1E79G 3BEHA 2E75B 3ZRWA 1FJGO 1Q8IA 2LP7A 2ZT9B 3ZHQA 4X8AA 4RAIA 4PDRA 5IE9A 3E8BA 1M4UA 1KUQA 2OCCB 4LWSB 4LH6A 1YCIA 4UCSA 1D5AA 4G2KA 2ZE8A 5KA5A 1XOUA 3ZBHA 4PHZA 3N2GA 4NXNO 3AG2C 5LMNO 5BY1A 1JX9A 4I7ZB 4GX5A 5DM6V 3U10A 3CRQA 3OTFA 1DGSA 1J95A 3RYHA 1VF5B 1H2KA 2QM7A 1I94O 1B04A 5H9CA 4LH7A 1KKCA 1D2DA 4CBCA 2GDSA 1IVSA 1OCOC 3UT5B 5LA6A 4DR2O 1CP9A 1I5YA 4RQFA 3EVKA 1ZL8B 2RN9A 3O9OA 3IGAC 3TCUA 2HHHB 4GKJO 4MTXA 3FFQA 3T4DA 3APQA 4NYKA 5EBWC 4WCEV 3M7MX 3DSQA 4F6EA 1BCCH 2BSKA 4KL1A 5JVDA 4FMTA 2F4VO 2BSKB 2YEVB 4QNHB 2XAFA 4JI6B 3D36A 1M90W 3H1JH 1MSWD 3CCVV 4DO2A 2GHYA 1OCZC 3B40A 4J80A 4LF8B 4B3SB 2FTKA 3FB6C 2DE0X 4GT1A 4X1IB 1NTMH 1SKVA 4FFBB 4K0KO 1UJWB 1WN7A 4XBFA 1QLNA 2K9PA 2ZQMA 3G67A 5IWAB 3I56V 2XTAA 4CH3A 2OIGA 1X4TA 4DR4O 1Y76B 1FYJA 1GM7A 3BCCH 1F7YA 4JI4B 4CC5A 4I55B 4IHJA 2C2AA 3JD3A 5CA1B 4FLZA 5B5EZ 5H6QA 3G4SV 2YICA 1NQTA 2P6JA 3A2FA 1S3JA 2YSUB 2ZCEA 1B06A 3L72H 4MTFA 2AZ0A 3K59A 2LW1A 4LR3A 1JA8A 3OR7C 4LF7B 1XEQA 3CMAV 3A8TA 4BW9A 1HNWO 3RYIA 3B8MA 3RYIB 3LDDA 3TXQA 4B08A 4JAUA 1YZBA 4O4LA 1K4CC 4GX0A 5CA0A 4QE9A 4TQDA 1FFXA 1TVKB 3J81N 3ASOB 2X7RB 3K0GA 2E5LB 3CRMA 5D5PA 3WG7B 4F6RA 3LNMB 5BZBA 1VQ7V 4DR3O 1N32B 5AG2A 3HR0A 4J9YB 2F93B 4O2BB 2R9IA 4IIJA 2RCVA 3ABKB 3N2KB 3SPGA 4U3FH 4EKWA 2JGDB 1ZUQA 4E2LA 1HNXO 2Y69B 2W0FC 3DC6A 4FZ0A 4ZI7B 3ASNC 2L6LA 1IZ3A 2HJFC 1K34A 2EINC 1M5IA 1Y67A 3K57A 2ZINA 4RUEA 3K5LA 4DW0A 1R3JC 4DV0B 1H8EG 4IL6Z 4DUYB 1VARA 3WB2A 1AI5A 4DV7B 4HZ3A 3EHBB 4FLYA 1MZEA 3JASB 3S3WA 2P7TC 1TUBB 3ZHTA 4DR1O 1IDSA 3F5WC 4FLTA 2DMXA 2R9AA 2A3QA 2P67A 3W7SA 3OT7A 3AG2B 1UFIA 4U7OA 1AJQA 1VF6C 4Q20A 4FLWA 2YI8A 4DV1O 4JF3A 1V55C 2IJIA 3J80N 2BTQA 1LNQA 3K06A 4U7NA 3STLC 3K5NA 3CE2A 3CXHF 2EBOA 1OCOB 2HLDG 5BMVB 1XMOO 2QM8A 3HKEB 4WFFA 4J9ZB 1NBMG 4OXSA 4X1YB 1JFFB 3ABMC 2ODMA 4NKGB 5DN6G 4DV4O 4PV1B 1HW7A 3OMIB 4O4IA 5LGUA 4DR6O 4LF4O 5L3DA 3E8FA 3ETEA 4PI2A 1JJ2U 5CB4B 4UV8A 3K08A 4L8JA 4RWUA 4DXWA 5KX5B 4DV2O 3T1YB 1KQSU 2Q7HA 3K5MA 5DECA 2QKSA 1PKXA 5K1PA 1Q82W 2YXYA 3DXRA 4ZHQB 4WFBV 1YTFD 2NLJC 3JAKB 1K5SA 1OCZB 3EFFK 4DUZO 4KHPO 3LSUA 3AG3B 4YJ3B 3F5TA 4P2ZA 1K33A 1ZAUA 2W6JG 3OFNG 1N33B 4AQYO 3CXCU 3M8AA 4CS4A 4A5UB 3Q4HB 4UCRA 3L73H 2OCHA 2CTWA 1TAEA 3RVZA 2Q68A 3EXAA 3HKDB 4LC1A 1K73W 2VQEO 4E4EA 3VBBA 2A79B 2H3OA 2AXTZ 4GYCB 4PI0A 4I9WA 3L75H 2JRIA 1QR8A 4X88A 4TSFG 4F4LA 2QWQB 2RJZA 1BMFG 1I7FA 3IC9A 2UU9B 5C93A 2WWWA 3A0HZ 1AR1B 1XDCA 1W0KG 1FXHA 1MMMA 3K9AA 4JI0B 4H44B 2ITCC 3I55V 3G6BA 3KCXA 3AG1C 3JSLA 1WNSA 2VQFO 4OX9O 1NH2B 3KKYA 2ARHA 3BFRA 4Z1MG 2HR3A 1HR0B 1OV9A 1MABG 3BA9A 4DV6O 5IDJA 1VQMV 4FLXA 3RVYA 5B3SB 2F43G 4MW3A 1H8HG 2LJ2A 1WPXA 3BVOA 4X64O 4PA9A 1R3LC 3SYAA 3SPCA 2UXBO 1XILA 4NXMB 1KB9F 2XASA 3B09A 4YY3B 4ABMA 5TISZ 4TV9A 3B77A 5IYZB 5J9PC 5JJEB 2ZE5A 3OTOB 1PL4A 5ITZA 5JH7B 4ZIBA 1GM9A 1OJHA 3WFVA 3ASNB 3JAMN 3OGCC 2DQ3A 1Q5OA 5EZYA 2GUZB 5EZYB 1V54C 3IFXA 4AI8A 1XNQB 1FAFA 3CD6V 4LFAO 1GMGA 4JI8B 3RT3C 4ZOLA 4TOIA 5H2FZ 2XAJA 4J7ZA 5J2TA 5J2TB 3A0RA 1Y74B 4Z1VA 1YIJV 1NH2D 3HPLC 2UUCO 4JZGA 3VQXA 3AK3A 1PNKA 1BT8A 2IH1C 1NU1H 1AVMA 1UPGA 2A7WA 2R72A 4PA7A 2EX3A 5EYPB 1P4RA 2QE7G 2V7QG 4HNAA 1WA8B 1EZJA 1VF6A 4DRXA 4TV8A 2D3OW 4QIWF 5LYJA 2PZSA 1WB7A 2KG7A 3ZIAG 4MTGA 1BZKA 1RSOA 5LOVB 4X62B 1CPYA 2ILMA 3RYCB 4FLUA 5B1BB 1F51A 2ZE6A 3K9SA 4MT8A 2VWKA 2QTOA 4JI5O 2AHZA 2FMLA 3OR6C 4PDVA 3ABMB 2PYLA 2R9RB 3H1KH 3ASOC 4H37A 2JGUA 2V4DA 2CTPA 3HB3B 1RFYA 4JI3B 1DF5A 2Z3YA 4CH6A 2KKWA 4LF9O 4GKKB 3CJHB 3AG7A 3ZRSA 4K8XA 1JVMA 5EBLC 1LUWA 3CHXA 4HYOA 1Y6XA 5IJ0A 3RBZA 2VWJA 5B1NA 1Q6HA 2ZM6B 1QVGU 2RNBA 2O57A 1O9GA 5LXTA 3ZHRA 2Y69C 2OTLV 5KMGA 1DF4A 3ML0A 4H13B 2QGNA 4JYCA 4DV3B 4X65B 3CS5A 3FX7A 2GBOA 4PA6A 5JJJB 2D2CB 4JI7B 2LQTA 1VIBA 1IURA 4P9PA 3L70H 1SQVH 3GWOA 2RQ6A 4TQFA 4WFGA 2QWNB 1S0VA 1M56B 3WB0A 1H38A 3ZMSA 1H2LA 3CCUV 4LWSA 3E8GA 1VQ5V 2E3CA 2X6AA 2LGQA 3H01A 3MHHC 3H1HH 2WPDG 2JS5A 1NZ6A 2WSSG 2HHHO 5A2QN 1Q43A 5IYDO 2PUSA 4R8CA 1PM9A 1VQOV 1B3QA 1BSMA 1HWYA 3QO8A 4LF5B 1PNLA 2A9HA 2CDYA 4DW1A 2QTSA 3IC7A 2UUBB 3UT5A 2Q67A 5GW7A 1AR4A 5KHGA 4JI6O 2H94A 3SJQC 1NTZH 2ZIOA 1ZL8A 1SZXA 2OT5A 1J5EB 4MW8A 1SQPH 2EIMC 3AG1B 4MVUA 4QPJA 2AZ2A 2OIEA 4B3SO 4I9QA 1VF7A 3FB7C 2W0XA 3JARB 2YEVA 4DK0A 5JQGB 1ZSPA 1YITV 2B1IA 1QCEA 4MSWC 1I0HA 5IWAO 1G6UA 1PP9H 1LUVA 2YUAA 1Q86W 3CRAA 1JJOA 5EBMC 5CBFA 4TUYB 2YIAA 4JI4O 2NR5A 4JASA 3AEIA 4Q6GA 1XBLA 5KAIZ 2CUGA 3CSXA 3CCMV 1NTKH 4BR6A 4B3RB 2Y0IA 3VOUA 1SC5B 3AG3C 5KHKA 2B1GA 3K03A 4X1IA 5F2VO 4FFBA 3W7WA 4GUNA 5LMUB 4PA4A 2RDCA 5FNVB 1P49A 4LF7O 3TXSA 1V54B 3GB7C 1Y76A 1W2BU 1F23A 1R6KA 1WLEA 5DEDA 2GSMB 2BTOA 1Q81W 2ZE7A 4I55A 3I5DA 4MTOA 5CA1A 4B3TB 3DC5A 3E2EA 2N74A 1TA8A 3E8HA 1N0NA 3JAWB 1E1RG 4B3MB 1ZWIC 4MVRA 4YIPA 3SYPA 5JCOC 2IJHA 2PYJA 4YJ2B 2ZR3A 4O4JA 2E5LO 4EEQA 1EN6A 1SQGA 5EC1C 4O4JB 2ITDC 3TJTA 4I0XB 3SYOA 1N32O 3ZMZA 1XQ8A 4AILC 1R3KC 1N8RW 3ZJZA 2ZKOA 4FVMA 2QWRB 3G80A 5GONB 3L9DA 1GK9A 1CXZB 1QLEC 4PD4F 2QA4V 2IW5A 3FAVB 1ZLZA 4U3JA 2QWOB 4U3JB 3RFRA 4BAYA 3ZCCA 1TVKA 2CE4A 2LFSA 5EIBC 2WLIB 5J2UB 2F1MA 3OUSA 4MS2A 5B3SC 1ROPA 3E89A 3SYCA 4CC6A 4O2BA 2ATKC 1BQZA 1K7DA 4I5SA 4DUYO 2X6CA 1OCCC 3K58A 2JJ1G 1H2MA 2N04A 3N2KA 1IXBA 4ICGA 4DV7O 4HAMA 1L1FA 3RYFB 2JGDA 2BE3A 1US6A 2DWEC 1GRJA 4B7EA 5JWPA 1Q6UA 2ADQB 4LF6B 5IJ9B 4ZI7A 2DQ0A 4WFHA 1BHBA 2Q73A 1VQPV 1EFRG 3D3IA 3JD2A 4MVZA 2DYSC 5K1XA 3CCLV 1KU9A 2EJRA 2QEXV 5GTIZ 3BY6A 4DK1A 1P7BA 3SGIA 3VQYA 2V1DA 4LNUB 3JCUZ 1SERA 3JASA 1TUBA 3KCYA 1KBHA 4RO2A 4UCTA 3TGUH 2UXDB 1XMQB 5L3FA 4XDLA 5H5NA 4JYAB 2LW7A 2H8PC 2LFRA 3AG4C 1GO3F 5CMUA 3ABUA 1L8DA 4LFCB 2EILC 3SR2C 1JOYA 1XHXA 2JDIG 2ZR2A 4FJCC 3SPJA 3OUFA 3T1CA 3JATB 3T1YO 5B1BC 2HKOA 1AP5A 1IX9A 5LP6C 1AROP 4X66B 5BMVA 2JJ2G 4FPPA 4K35A 1N36B 2YIBD 3HKEA 2M7WA 1S5LZ 4X1YA 1JFFA 1NT2B 4GX1A 2NN4A 1PPJH 1LR1A 3OEHG 4FM0A 4DR5B 4N23A 5E1AC 3HKCA 5KHIA 5FPOA 2EIMB 4YIOA 3HKCB 4DV5B 4FFKA 3CCEV 3RW0A 5CB4A 3DTUB 1MG1A 3ZS8C 5KX5A 1FXVA 1N33O 4BIOA 2CGNA 5BR8B 2Q9LA 2IJJA 1M57C 2Q5ZA 4DR7B 1NR7A 2UXNA 4O4HB 3SYQA 3STZC 1IXMA 2UUAB 3A0BZ 2DJVA 2RMKB 1BL8A 2QR4A 1SETA 4FLVA 3THOA 1M1KW 4X20B 4ZHQA 2WAMA 3QVNA 4D6TH 3JAKA 2LO1A 2JVDA 4R7CA 1IBMB 4PELA 3H9VA 1ENVA 1IBKB 3PN1A 4YJ3A 3ZMTA 1RPRA 1XI1A 1M56C 3OEEG 2YDEA 1HNZB 3Q4HA 1R6TA 2UU9O 1BGYH 3ZHVA 1P7GA 2Q4PA 3HKDA 3HKBA 4JI0O 3SPIA 1GN2A 3HKBB 1CEZA 1MNGA 2WLLB 1DK1A 1WB8A 1YSCA 1XHZA 2FKXA 3ZN1A 3T1HB 1YI2V 1K4DC 1XNRB 2YI9A 5JCOA 3QO5A 4FZ1A 3JALB 1FD9A 2X0LA 2EIJC 1HR0O 2CGOA 1KC8W 2EIKC 1QQCA 4IYHA 1F4NA 5LHIA 4UB6Z 3WU2Z 5IYBO 3ZHUA 2ADPA 3SJAC 1NI8A 3OE7G 3CWBH 2KQXA 1QHTA 4JZ2A 1QLEB 3CC2V 3B2EE 5L3GA 4NXMO 4YY3O 3B8NA 2Q7GA 4PDLA 5FL7G 3OTOO 5KHJA 4JAVA 1N0JA 2WLNA 2Y48A 3E22B 2A06H 3OAAG 1KP2A 1NKDA 1XNQO 1R6NA 2XNDG 4FM2A 4JI8O 3QTCA 3K79A 4YHHB 1YVWA 2EJ7A 1N34O 1OCCB 4JI2B 3ZEDA 2IH3C 4H0LB 3ETQA 4EB6B 5IYZA 4UCUA 3TK1A 5JH7A 3BA8A 1U97A 3TETA 1RPOA 2FYUH 4DYLA 1Z5WA 2XOKG 2QKCA 2GUZA 5IY5C 3U0ZA 3CPWU 4J7JA 3QF7A 3RWRD 2IM9A 2DYSB 5LHGA 1XL6A 5KHHA 3ZX6A 5KUMA 4X62O 1Y74A 1W59A 4LCUC 1NVPB 4KXRA 4JI1B 5EIBD 4WF9V 4XDJA 2PTMA 3IAYA 3UM7A 3JYCA 4WBNB 4G27B 3S3XA 3BPZA 5EYPA 1URFA 4JI3O 3AG4B 1OCRB 4NR1A 2UXCB 5KA6A 1WA8A 1COWG 5EC2C 3X2QB 2EILB 4GKKO 1NS1A 1FPOA 2ETNA 2DW4A 3CX5F 5LOVA 1SA0B 4LFBB 3RYCA 1H2GA 5L3BA 5LP6A 1TUEB 1XREA 4I50B 5LP6B 2ZM6O 1GKFA 3ABTA 3P3NA 2GV9A 4UCVA 1GM8A 4G28B 2KB1A 4O2AB 1FXKC 1EM1A 2E76B 3JD4A 4X65O 4CS2A 2A0LA 2ZDIC 4PJ0Z 4JI7O 2HVJC 1VQ8V 3CJHA 1NVPD 1R3IC 3WB1A 2XHBA 1G4YB 1SF9A 3C3TA 2PY5A 1K3EA 1MA1A 2WLKA 4J7KA 1FS0G 2Q6AA 4CH5A 2OTJV 1S76D 1M57B 5GTHZ 1BS3A 4X89A 2P4VA 2N05A 4J42A 2WA3A 4GZRB 5C8YB 2QKAA 3JD1A 1RM1C 4L87A 1EN5A 2Y4UA 2P5OA 2CAZC 4H33A 4LF5O 2P06A 2W6IG 3BABA 2NNUA 2UUBO 5B1AB 2HJDA 4FIPC 3P30A 1R1BA 4JV5B 2ZD9A 5CA3A 1KP3A 1IBLB 3OMAB 3U11A 1FFTB 1J5EO 4IYIA 3FKSG 2IJKA 3OGIB 1VP7A 1TGOA 2IBZH 3ZRWB 3W7UA 4GX2A 1AP6A 4OPAA 2AHYA 1K97A 1WJZA 1AJNA 4IGGA 4PA3A 4WFEA 3QO7A 4RQEA 3RGBA 3M99B 2EIJB 3VQVA 1AB3A 2EIKB 3AK2A 2EZOA 2VRZA 3N2GB 4JYYA 1PNMA 1GH6A 2Z5UA 4UVCA 1FJGB 3RYHB 1G8MA 4B3RO 1G1XB 3UO2A 4LF8O 2ZXWB 3ABLC 1WP8A 2PI4A 3JARA 4UCOA 5LA6B 4EFEA 2X6BA 5JQGA 1MSDA 2WLHA 4QPKA 4R50A 5LMUO 3IJ4A 3CCQV 4MVSA 4NXNB 3C90A 5LMNB 2OWOA 4K3AA 4TUYA 1VQKV 5CBHA 4KFMA 2G38A 1T5EA 4EFBA 4B3TO 4X1KA 4X1KB 4JAAA 1I94B 5JVDB 3FB8C 1H2SB 4B3MO 2P4KA 1E1QG 3SDLA 4AHCA 4DR2B 4X9QA 1VEWA 2ZNIA 4MVQA 4J11A 5IY5B 5FNVA 3O65A 4GKJB 1DTOA 3CC4V 1SQFA 3R66A 3CRRA 4JTAB 3J7AU 3MDSA 1SQBH 2F4VB 3LDEA 3OW2U 4MVMA 3JAWA 1XUQA 3FD9A 3P3PA 3VQWA 3MAQA 3CCSV 3G6EV 4KUMA 5BXZA 1HP8A 4YJ2A 3D3QA 1GN4A 5KLVH 4I0XA 3LSSA 1VQNV 1I08A 3FB5C 2QJ1A 1V9PA 4UVBA 5LGNA 1WAZA 1I5XA 4IHJB 2Q0OC 5GONA 4FM1A 1MZFA 1N4CA 4HBNA 4KP4A 1YJ9V 3FAVA 4K0KB 5D5QA 3NR7A 5B1OA 1M9NA 4J41A 2CTQA 5HFLA 4NB5A 4MVOA 1BHAA 4LF6O 1EBOA 3PJSK 4D7TA 4WFAV 1SQXH 1FXKA 2WLIA 5J2UA 1FXKB 4DR4B 3E83A 5E79Z 1HDJA 3K04A 1GN3A 2ZDIA 2CTRA 4R6ZA 1MOFA 4UB8Z 4UV9A 2QM4A 4DV0O 2DYRB 4O4LB 2DOSA 1K5QA 5CA0B 3ZHSA 3RYFA 1AI4A 2VS0A 1FFXB 1S72V 1VQ9V 3GVMA 3CB2A 2UXDO 1ZTEA 5IJ9A 1XMQO 4F6RB 3QNEA 4JYAO 1U96A 1VMGA 1PL0A 3UO3A 1L0LH 2Y0PA 3ETDA 2BOBC 4JPRA 2YIBA 4QGPA 2Y4TA 2LGWA 4CZZA 1RM1B 1HNWB 4IIJB 4LFCO 2MK3A 3JCZA 3T2MA 2ZIMA 4NTWA 1AI6A 3P32A 4BIUA 4J10A 3FYIB 1X59A 3K0DA 1YJWV 3BHPA 4LNUA 4X66O 5EK0A 1A32A 4JGSA 1N36O 2XAQA 1S77D 3C3SA 5FLXN 1YJNV 4DR3B 1KYOF 3LNNA 1M93A 4DR5O 5LBQA 1Q3EA 2R70A 1KECA 3ZMVA 2GTSA 1OCRC 4DV5O 1WP7A 3X2QC 3ZMUA 4ZKIA 3JATA 4UUJC 1VQ4V 4FK5C 1Q6IA 3H1LH 5BR8O 2Q7EA 1YHQV 1HNXB 3JD0A 1JQ0A 1AI7A 4TT3G 4PDMA 5IT9N 4DR7O 2OYQA 2UUAO 1EN4A 4UXNA 2UXXA 4IT5A 3R65A 1YTFB 1QR9A 1IBMO 2BTQB 5LHHA 1IBKO 2BOCC 3ABLB 2QWPB 1GN6A 1SQQH 1O9HA 4XDKA 2JEUA 1S5JA 4DR1B 4BIZA 1L0NH 1HNZO 3KZIZ 3CMEV 4JYBA 4B7KA 1GAXA 4O4HA 1BQ0A 3CP1A 1Q7YW 2IU0A 4O4IB 3F7VC 1OHHG 3K5OA 1Z2GA 2WLMA 3MD0A 1YXBA 3OD4A 4X20A 3K3WA 2P22C 4OPHA 2QDOA 1NR1A 1YF2A 3MHSC 4DV1B 1VQLV 5L3CA 2Q8VA 1PD3A 3T1HO 1R73A 1Q90D 1XNRO 3BRCA 1XMOB 2KSDA 1ORQC 2DN9A 2IU3A 1WPBA 3ZRXA 5B1AC 3CCRV 4QJFB 1QBZA 2HVKC 1KD1W 3DXRB 4DV4B 4QE7A 4NTYA 3H1IH 5CN0A 2WLJA 4DR6B 2YS8A 4LF4B 5CBGA 2EULA 3CYOA 5KAFZ 4LP8A 2PGGA 1RP3B 2WLLA 1W0JG 2GTAA 2XT9A 4ASUG 2B5UA 2Q0AA 4DV2B 3SJBC 2OCCC 3SJCC 3QG5A 1JR9A 4BW5A 5IYCO 3ZRVA 3G71V 3JALA 4NTXA 1JCHA 2WA4A 3L74H 5HFMA 3FYEB 3CEIA 1VQ6V 3BAAA 4DUZB 4KHPB 4YHHO 4JI2O 4I4TA 2QSAA 3W7TA 4I4TB 2HFEC 4TWKA 3LDCA 2XUMA 2E74B 2ZXWC 4AQYB 4JTCB 1S5HC 2FL4A 5FPRA 2DWDC 1K9MW 2CH7A 3E22A 2CH7B 2Z0AA 3W7XA 5L3EA 2JEXA 5KUKA 1JMKC 2M6YA 2VQEB 1D5NA 1QVFU 5LGTA 1NJIW 2Q69A 2XAHA 1GTOA 4P9OA 3AK1A 1P84F 4JI1O 3LSQA 4K8ZA 1Y4MA 4EB6A 3JSNA 5B66Z 4Z2WA 2FB5A 3F7YC 1YDXA 4W4LA 3D36C 3ICXA 3GWKC 2JIZG 3DGEA 1QU7A 1SRYA 1JPXA 2UXCO 1KMIZ 4UFZA 1B6QA 1SZTA 2YXLA 4LFBO 4TV9B 1Z5VA 1THZA 2VQFB 3SPHA 5ITZB 4OX9B 4D7SA 3CRCA 4WBNA 2EINB 1Y66A 2P90A 4ZBMA 3UCSC 4GLXA 2HP8A 2ZNJA 3T4ZA 4BWAA 2F95B 4YXWG 2JS3A 4DV6B 1EZVH 4X64B 3D8CA 5H6RA 4CS3A 1N34B 4ZOLB 4P30A 2AW9A 2HG5C 1H2NA 2UXBB 1PV0A 1QNMA 2BCCH 3L71H 1SA0A 2PI5A 3ETGA 2XAGA 2MW2B 2B9ZA 5A9GA 4I50A 3NXSA 3E35A 3E86A 4CH4A 3N27A 4N21A 2YXHA 1ZX3A 2F23A 4HNAB 1K92A 1FKAO 1K8AW 4O2AA 2F66C 1OZ0A 1YEWA 4DRXB 4TV8B 4DV3O 1SS3A 2JK5C 5LYJB 4LFAB 2KG7B 1V55B 1RSOB 4UVAA 2PF4E 2UUCB 2AGAA 2DYRC 1KKDA 4LBEC 5LL6Y 4JTDB 4RUFA 4W4KA 4JV5O 1AILA 3ZN0A 3OM3B 4OGQB 3WG7C 3KG2A 1IBLO 1BE3H 3LUTB 2K1EA 1XL4A 2EZPA 5C8YA 4NVPA 3ABKC 5IJ0B 3RN4A 4GCZA 1F4MA 4JI5B
chains in the Genus database with same CATH topology
1WA8A 3TXQA 1WA8B 4ABMA 3FAVA 3FAVB 4LWSA 4LWSB 2KG7A 2KG7B 2AZ2A 3TXSA 2AZ0A 2VS0A 3GWKC 4GZRB 2B9ZA 4I0XA 4I0XB 3GVMA 3ZBHA 2VRZA 2DE0X 3OGIB 3Q4HA 3Q4HB 3G80A 3O9OA 3FD9A 3HR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WA8 A;  3TXQ A;  1WA8 B;  4ABM A;  3FAV A;  3FAV B;  4LWS A;  4LWS B;  2KG7 A;  2KG7 B;  2AZ2 A;  3TXS A;  2AZ0 A;  2VS0 A;  3GWK C;  4GZR B;  2B9Z A;  4I0X A;  4I0X B;  3GVM A;  3ZBH A;  2VRZ A;  2DE0 X;  3OGI B;  3Q4H A;  3Q4H B;  3G80 A;  3O9O A;  3FD9 A;  3HR0 A; 
#chains in the Genus database with same CATH topology
 2YC0 A;  3CC7 V;  3UKM A;  5LXT B;  3OMN B;  3CCJ V;  1AJP A;  2L35 A;  5KMG B;  4C7U A;  2HEP A;  1AR5 A;  5JJN B;  3B4S A;  1DLB A;  3UQ8 A;  2YID A;  3APO A;  2CK3 G;  4LF9 B;  1SES A;  1E79 G;  3BEH A;  2E75 B;  3ZRW A;  1FJG O;  1Q8I A;  2LP7 A;  2ZT9 B;  3ZHQ A;  4X8A A;  4RAI A;  4PDR A;  5IE9 A;  3E8B A;  1M4U A;  1KUQ A;  2OCC B;  4LWS B;  4LH6 A;  1YCI A;  4UCS A;  1D5A A;  4G2K A;  2ZE8 A;  5KA5 A;  1XOU A;  3ZBH A;  4PHZ A;  3N2G A;  4NXN O;  3AG2 C;  5LMN O;  5BY1 A;  1JX9 A;  4I7Z B;  4GX5 A;  5DM6 V;  3U10 A;  3CRQ A;  3OTF A;  1DGS A;  1J95 A;  3RYH A;  1VF5 B;  1H2K A;  2QM7 A;  1I94 O;  1B04 A;  5H9C A;  4LH7 A;  1KKC A;  1D2D A;  4CBC A;  2GDS A;  1IVS A;  1OCO C;  3UT5 B;  5LA6 A;  4DR2 O;  1CP9 A;  1I5Y A;  4RQF A;  3EVK A;  1ZL8 B;  2RN9 A;  3O9O A;  3IGA C;  3TCU A;  2HHH B;  4GKJ O;  4MTX A;  3FFQ A;  3T4D A;  3APQ A;  4NYK A;  5EBW C;  4WCE V;  3M7M X;  3DSQ A;  4F6E A;  1BCC H;  2BSK A;  4KL1 A;  5JVD A;  4FMT A;  2F4V O;  2BSK B;  2YEV B;  4QNH B;  2XAF A;  4JI6 B;  3D36 A;  1M90 W;  3H1J H;  1MSW D;  3CCV V;  4DO2 A;  2GHY A;  1OCZ C;  3B40 A;  4J80 A;  4LF8 B;  4B3S B;  2FTK A;  3FB6 C;  2DE0 X;  4GT1 A;  4X1I B;  1NTM H;  1SKV A;  4FFB B;  4K0K O;  1UJW B;  1WN7 A;  4XBF A;  1QLN A;  2K9P A;  2ZQM A;  3G67 A;  5IWA B;  3I56 V;  2XTA A;  4CH3 A;  2OIG A;  1X4T A;  4DR4 O;  1Y76 B;  1FYJ A;  1GM7 A;  3BCC H;  1F7Y A;  4JI4 B;  4CC5 A;  4I55 B;  4IHJ A;  2C2A A;  3JD3 A;  5CA1 B;  4FLZ A;  5B5E Z;  5H6Q A;  3G4S V;  2YIC A;  1NQT A;  2P6J A;  3A2F A;  1S3J A;  2YSU B;  2ZCE A;  1B06 A;  3L72 H;  4MTF A;  2AZ0 A;  3K59 A;  2LW1 A;  4LR3 A;  1JA8 A;  3OR7 C;  4LF7 B;  1XEQ A;  3CMA V;  3A8T A;  4BW9 A;  1HNW O;  3RYI A;  3B8M A;  3RYI B;  3LDD A;  3TXQ A;  4B08 A;  4JAU A;  1YZB A;  4O4L A;  1K4C C;  4GX0 A;  5CA0 A;  4QE9 A;  4TQD A;  1FFX A;  1TVK B;  3J81 N;  3ASO B;  2X7R B;  3K0G A;  2E5L B;  3CRM A;  5D5P A;  3WG7 B;  4F6R A;  3LNM B;  5BZB A;  1VQ7 V;  4DR3 O;  1N32 B;  5AG2 A;  3HR0 A;  4J9Y B;  2F93 B;  4O2B B;  2R9I A;  4IIJ A;  2RCV A;  3ABK B;  3N2K B;  3SPG A;  4U3F H;  4EKW A;  2JGD B;  1ZUQ A;  4E2L A;  1HNX O;  2Y69 B;  2W0F C;  3DC6 A;  4FZ0 A;  4ZI7 B;  3ASN C;  2L6L A;  1IZ3 A;  2HJF C;  1K34 A;  2EIN C;  1M5I A;  1Y67 A;  3K57 A;  2ZIN A;  4RUE A;  3K5L A;  4DW0 A;  1R3J C;  4DV0 B;  1H8E G;  4IL6 Z;  4DUY B;  1VAR A;  3WB2 A;  1AI5 A;  4DV7 B;  4HZ3 A;  3EHB B;  4FLY A;  1MZE A;  3JAS B;  3S3W A;  2P7T C;  1TUB B;  3ZHT A;  4DR1 O;  1IDS A;  3F5W C;  4FLT A;  2DMX A;  2R9A A;  2A3Q A;  2P67 A;  3W7S A;  3OT7 A;  3AG2 B;  1UFI A;  4U7O A;  1AJQ A;  1VF6 C;  4Q20 A;  4FLW A;  2YI8 A;  4DV1 O;  4JF3 A;  1V55 C;  2IJI A;  3J80 N;  2BTQ A;  1LNQ A;  3K06 A;  4U7N A;  3STL C;  3K5N A;  3CE2 A;  3CXH F;  2EBO A;  1OCO B;  2HLD G;  5BMV B;  1XMO O;  2QM8 A;  3HKE B;  4WFF A;  4J9Z B;  1NBM G;  4OXS A;  4X1Y B;  1JFF B;  3ABM C;  2ODM A;  4NKG B;  5DN6 G;  4DV4 O;  4PV1 B;  1HW7 A;  3OMI B;  4O4I A;  5LGU A;  4DR6 O;  4LF4 O;  5L3D A;  3E8F A;  3ETE A;  4PI2 A;  1JJ2 U;  5CB4 B;  4UV8 A;  3K08 A;  4L8J A;  4RWU A;  4DXW A;  5KX5 B;  4DV2 O;  3T1Y B;  1KQS U;  2Q7H A;  3K5M A;  5DEC A;  2QKS A;  1PKX A;  5K1P A;  1Q82 W;  2YXY A;  3DXR A;  4ZHQ B;  4WFB V;  1YTF D;  2NLJ C;  3JAK B;  1K5S A;  1OCZ B;  3EFF K;  4DUZ O;  4KHP O;  3LSU A;  3AG3 B;  4YJ3 B;  3F5T A;  4P2Z A;  1K33 A;  1ZAU A;  2W6J G;  3OFN G;  1N33 B;  4AQY O;  3CXC U;  3M8A A;  4CS4 A;  4A5U B;  3Q4H B;  4UCR A;  3L73 H;  2OCH A;  2CTW A;  1TAE A;  3RVZ A;  2Q68 A;  3EXA A;  3HKD B;  4LC1 A;  1K73 W;  2VQE O;  4E4E A;  3VBB A;  2A79 B;  2H3O A;  2AXT Z;  4GYC B;  4PI0 A;  4I9W A;  3L75 H;  2JRI A;  1QR8 A;  4X88 A;  4TSF G;  4F4L A;  2QWQ B;  2RJZ A;  1BMF G;  1I7F A;  3IC9 A;  2UU9 B;  5C93 A;  2WWW A;  3A0H Z;  1AR1 B;  1XDC A;  1W0K G;  1FXH A;  1MMM A;  3K9A A;  4JI0 B;  4H44 B;  2ITC C;  3I55 V;  3G6B A;  3KCX A;  3AG1 C;  3JSL A;  1WNS A;  2VQF O;  4OX9 O;  1NH2 B;  3KKY A;  2ARH A;  3BFR A;  4Z1M G;  2HR3 A;  1HR0 B;  1OV9 A;  1MAB G;  3BA9 A;  4DV6 O;  5IDJ A;  1VQM V;  4FLX A;  3RVY A;  5B3S B;  2F43 G;  4MW3 A;  1H8H G;  2LJ2 A;  1WPX A;  3BVO A;  4X64 O;  4PA9 A;  1R3L C;  3SYA A;  3SPC A;  2UXB O;  1XIL A;  4NXM B;  1KB9 F;  2XAS A;  3B09 A;  4YY3 B;  4ABM A;  5TIS Z;  4TV9 A;  3B77 A;  5IYZ B;  5J9P C;  5JJE B;  2ZE5 A;  3OTO B;  1PL4 A;  5ITZ A;  5JH7 B;  4ZIB A;  1GM9 A;  1OJH A;  3WFV A;  3ASN B;  3JAM N;  3OGC C;  2DQ3 A;  1Q5O A;  5EZY A;  2GUZ B;  5EZY B;  1V54 C;  3IFX A;  4AI8 A;  1XNQ B;  1FAF A;  3CD6 V;  4LFA O;  1GMG A;  4JI8 B;  3RT3 C;  4ZOL A;  4TOI A;  5H2F Z;  2XAJ A;  4J7Z A;  5J2T A;  5J2T B;  3A0R A;  1Y74 B;  4Z1V A;  1YIJ V;  1NH2 D;  3HPL C;  2UUC O;  4JZG A;  3VQX A;  3AK3 A;  1PNK A;  1BT8 A;  2IH1 C;  1NU1 H;  1AVM A;  1UPG A;  2A7W A;  2R72 A;  4PA7 A;  2EX3 A;  5EYP B;  1P4R A;  2QE7 G;  2V7Q G;  4HNA A;  1WA8 B;  1EZJ A;  1VF6 A;  4DRX A;  4TV8 A;  2D3O W;  4QIW F;  5LYJ A;  2PZS A;  1WB7 A;  2KG7 A;  3ZIA G;  4MTG A;  1BZK A;  1RSO A;  5LOV B;  4X62 B;  1CPY A;  2ILM A;  3RYC B;  4FLU A;  5B1B B;  1F51 A;  2ZE6 A;  3K9S A;  4MT8 A;  2VWK A;  2QTO A;  4JI5 O;  2AHZ A;  2FML A;  3OR6 C;  4PDV A;  3ABM B;  2PYL A;  2R9R B;  3H1K H;  3ASO C;  4H37 A;  2JGU A;  2V4D A;  2CTP A;  3HB3 B;  1RFY A;  4JI3 B;  1DF5 A;  2Z3Y A;  4CH6 A;  2KKW A;  4LF9 O;  4GKK B;  3CJH B;  3AG7 A;  3ZRS A;  4K8X A;  1JVM A;  5EBL C;  1LUW A;  3CHX A;  4HYO A;  1Y6X A;  5IJ0 A;  3RBZ A;  2VWJ A;  5B1N A;  1Q6H A;  2ZM6 B;  1QVG U;  2RNB A;  2O57 A;  1O9G A;  5LXT A;  3ZHR A;  2Y69 C;  2OTL V;  5KMG A;  1DF4 A;  3ML0 A;  4H13 B;  2QGN A;  4JYC A;  4DV3 B;  4X65 B;  3CS5 A;  3FX7 A;  2GBO A;  4PA6 A;  5JJJ B;  2D2C B;  4JI7 B;  2LQT A;  1VIB A;  1IUR A;  4P9P A;  3L70 H;  1SQV H;  3GWO A;  2RQ6 A;  4TQF A;  4WFG A;  2QWN B;  1S0V A;  1M56 B;  3WB0 A;  1H38 A;  3ZMS A;  1H2L A;  3CCU V;  4LWS A;  3E8G A;  1VQ5 V;  2E3C A;  2X6A A;  2LGQ A;  3H01 A;  3MHH C;  3H1H H;  2WPD G;  2JS5 A;  1NZ6 A;  2WSS G;  2HHH O;  5A2Q N;  1Q43 A;  5IYD O;  2PUS A;  4R8C A;  1PM9 A;  1VQO V;  1B3Q A;  1BSM A;  1HWY A;  3QO8 A;  4LF5 B;  1PNL A;  2A9H A;  2CDY A;  4DW1 A;  2QTS A;  3IC7 A;  2UUB B;  3UT5 A;  2Q67 A;  5GW7 A;  1AR4 A;  5KHG A;  4JI6 O;  2H94 A;  3SJQ C;  1NTZ H;  2ZIO A;  1ZL8 A;  1SZX A;  2OT5 A;  1J5E B;  4MW8 A;  1SQP H;  2EIM C;  3AG1 B;  4MVU A;  4QPJ A;  2AZ2 A;  2OIE A;  4B3S O;  4I9Q A;  1VF7 A;  3FB7 C;  2W0X A;  3JAR B;  2YEV A;  4DK0 A;  5JQG B;  1ZSP A;  1YIT V;  2B1I A;  1QCE A;  4MSW C;  1I0H A;  5IWA O;  1G6U A;  1PP9 H;  1LUV A;  2YUA A;  1Q86 W;  3CRA A;  1JJO A;  5EBM C;  5CBF A;  4TUY B;  2YIA A;  4JI4 O;  2NR5 A;  4JAS A;  3AEI A;  4Q6G A;  1XBL A;  5KAI Z;  2CUG A;  3CSX A;  3CCM V;  1NTK H;  4BR6 A;  4B3R B;  2Y0I A;  3VOU A;  1SC5 B;  3AG3 C;  5KHK A;  2B1G A;  3K03 A;  4X1I A;  5F2V O;  4FFB A;  3W7W A;  4GUN A;  5LMU B;  4PA4 A;  2RDC A;  5FNV B;  1P49 A;  4LF7 O;  3TXS A;  1V54 B;  3GB7 C;  1Y76 A;  1W2B U;  1F23 A;  1R6K A;  1WLE A;  5DED A;  2GSM B;  2BTO A;  1Q81 W;  2ZE7 A;  4I55 A;  3I5D A;  4MTO A;  5CA1 A;  4B3T B;  3DC5 A;  3E2E A;  2N74 A;  1TA8 A;  3E8H A;  1N0N A;  3JAW B;  1E1R G;  4B3M B;  1ZWI C;  4MVR A;  4YIP A;  3SYP A;  5JCO C;  2IJH A;  2PYJ A;  4YJ2 B;  2ZR3 A;  4O4J A;  2E5L O;  4EEQ A;  1EN6 A;  1SQG A;  5EC1 C;  4O4J B;  2ITD C;  3TJT A;  4I0X B;  3SYO A;  1N32 O;  3ZMZ A;  1XQ8 A;  4AIL C;  1R3K C;  1N8R W;  3ZJZ A;  2ZKO A;  4FVM A;  2QWR B;  3G80 A;  5GON B;  3L9D A;  1GK9 A;  1CXZ B;  1QLE C;  4PD4 F;  2QA4 V;  2IW5 A;  3FAV B;  1ZLZ A;  4U3J A;  2QWO B;  4U3J B;  3RFR A;  4BAY A;  3ZCC A;  1TVK A;  2CE4 A;  2LFS A;  5EIB C;  2WLI B;  5J2U B;  2F1M A;  3OUS A;  4MS2 A;  5B3S C;  1ROP A;  3E89 A;  3SYC A;  4CC6 A;  4O2B A;  2ATK C;  1BQZ A;  1K7D A;  4I5S A;  4DUY O;  2X6C A;  1OCC C;  3K58 A;  2JJ1 G;  1H2M A;  2N04 A;  3N2K A;  1IXB A;  4ICG A;  4DV7 O;  4HAM A;  1L1F A;  3RYF B;  2JGD A;  2BE3 A;  1US6 A;  2DWE C;  1GRJ A;  4B7E A;  5JWP A;  1Q6U A;  2ADQ B;  4LF6 B;  5IJ9 B;  4ZI7 A;  2DQ0 A;  4WFH A;  1BHB A;  2Q73 A;  1VQP V;  1EFR G;  3D3I A;  3JD2 A;  4MVZ A;  2DYS C;  5K1X A;  3CCL V;  1KU9 A;  2EJR A;  2QEX V;  5GTI Z;  3BY6 A;  4DK1 A;  1P7B A;  3SGI A;  3VQY A;  2V1D A;  4LNU B;  3JCU Z;  1SER A;  3JAS A;  1TUB A;  3KCY A;  1KBH A;  4RO2 A;  4UCT A;  3TGU H;  2UXD B;  1XMQ B;  5L3F A;  4XDL A;  5H5N A;  4JYA B;  2LW7 A;  2H8P C;  2LFR A;  3AG4 C;  1GO3 F;  5CMU A;  3ABU A;  1L8D A;  4LFC B;  2EIL C;  3SR2 C;  1JOY A;  1XHX A;  2JDI G;  2ZR2 A;  4FJC C;  3SPJ A;  3OUF A;  3T1C A;  3JAT B;  3T1Y O;  5B1B C;  2HKO A;  1AP5 A;  1IX9 A;  5LP6 C;  1ARO P;  4X66 B;  5BMV A;  2JJ2 G;  4FPP A;  4K35 A;  1N36 B;  2YIB D;  3HKE A;  2M7W A;  1S5L Z;  4X1Y A;  1JFF A;  1NT2 B;  4GX1 A;  2NN4 A;  1PPJ H;  1LR1 A;  3OEH G;  4FM0 A;  4DR5 B;  4N23 A;  5E1A C;  3HKC A;  5KHI A;  5FPO A;  2EIM B;  4YIO A;  3HKC B;  4DV5 B;  4FFK A;  3CCE V;  3RW0 A;  5CB4 A;  3DTU B;  1MG1 A;  3ZS8 C;  5KX5 A;  1FXV A;  1N33 O;  4BIO A;  2CGN A;  5BR8 B;  2Q9L A;  2IJJ A;  1M57 C;  2Q5Z A;  4DR7 B;  1NR7 A;  2UXN A;  4O4H B;  3SYQ A;  3STZ C;  1IXM A;  2UUA B;  3A0B Z;  2DJV A;  2RMK B;  1BL8 A;  2QR4 A;  1SET A;  4FLV A;  3THO A;  1M1K W;  4X20 B;  4ZHQ A;  2WAM A;  3QVN A;  4D6T H;  3JAK A;  2LO1 A;  2JVD A;  4R7C A;  1IBM B;  4PEL A;  3H9V A;  1ENV A;  1IBK B;  3PN1 A;  4YJ3 A;  3ZMT A;  1RPR A;  1XI1 A;  1M56 C;  3OEE G;  2YDE A;  1HNZ B;  3Q4H A;  1R6T A;  2UU9 O;  1BGY H;  3ZHV A;  1P7G A;  2Q4P A;  3HKD A;  3HKB A;  4JI0 O;  3SPI A;  1GN2 A;  3HKB B;  1CEZ A;  1MNG A;  2WLL B;  1DK1 A;  1WB8 A;  1YSC A;  1XHZ A;  2FKX A;  3ZN1 A;  3T1H B;  1YI2 V;  1K4D C;  1XNR B;  2YI9 A;  5JCO A;  3QO5 A;  4FZ1 A;  3JAL B;  1FD9 A;  2X0L A;  2EIJ C;  1HR0 O;  2CGO A;  1KC8 W;  2EIK C;  1QQC A;  4IYH A;  1F4N A;  5LHI A;  4UB6 Z;  3WU2 Z;  5IYB O;  3ZHU A;  2ADP A;  3SJA C;  1NI8 A;  3OE7 G;  3CWB H;  2KQX A;  1QHT A;  4JZ2 A;  1QLE B;  3CC2 V;  3B2E E;  5L3G A;  4NXM O;  4YY3 O;  3B8N A;  2Q7G A;  4PDL A;  5FL7 G;  3OTO O;  5KHJ A;  4JAV A;  1N0J A;  2WLN A;  2Y48 A;  3E22 B;  2A06 H;  3OAA G;  1KP2 A;  1NKD A;  1XNQ O;  1R6N A;  2XND G;  4FM2 A;  4JI8 O;  3QTC A;  3K79 A;  4YHH B;  1YVW A;  2EJ7 A;  1N34 O;  1OCC B;  4JI2 B;  3ZED A;  2IH3 C;  4H0L B;  3ETQ A;  4EB6 B;  5IYZ A;  4UCU A;  3TK1 A;  5JH7 A;  3BA8 A;  1U97 A;  3TET A;  1RPO A;  2FYU H;  4DYL A;  1Z5W A;  2XOK G;  2QKC A;  2GUZ A;  5IY5 C;  3U0Z A;  3CPW U;  4J7J A;  3QF7 A;  3RWR D;  2IM9 A;  2DYS B;  5LHG A;  1XL6 A;  5KHH A;  3ZX6 A;  5KUM A;  4X62 O;  1Y74 A;  1W59 A;  4LCU C;  1NVP B;  4KXR A;  4JI1 B;  5EIB D;  4WF9 V;  4XDJ A;  2PTM A;  3IAY A;  3UM7 A;  3JYC A;  4WBN B;  4G27 B;  3S3X A;  3BPZ A;  5EYP A;  1URF A;  4JI3 O;  3AG4 B;  1OCR B;  4NR1 A;  2UXC B;  5KA6 A;  1WA8 A;  1COW G;  5EC2 C;  3X2Q B;  2EIL B;  4GKK O;  1NS1 A;  1FPO A;  2ETN A;  2DW4 A;  3CX5 F;  5LOV A;  1SA0 B;  4LFB B;  3RYC A;  1H2G A;  5L3B A;  5LP6 A;  1TUE B;  1XRE A;  4I50 B;  5LP6 B;  2ZM6 O;  1GKF A;  3ABT A;  3P3N A;  2GV9 A;  4UCV A;  1GM8 A;  4G28 B;  2KB1 A;  4O2A B;  1FXK C;  1EM1 A;  2E76 B;  3JD4 A;  4X65 O;  4CS2 A;  2A0L A;  2ZDI C;  4PJ0 Z;  4JI7 O;  2HVJ C;  1VQ8 V;  3CJH A;  1NVP D;  1R3I C;  3WB1 A;  2XHB A;  1G4Y B;  1SF9 A;  3C3T A;  2PY5 A;  1K3E A;  1MA1 A;  2WLK A;  4J7K A;  1FS0 G;  2Q6A A;  4CH5 A;  2OTJ V;  1S76 D;  1M57 B;  5GTH Z;  1BS3 A;  4X89 A;  2P4V A;  2N05 A;  4J42 A;  2WA3 A;  4GZR B;  5C8Y B;  2QKA A;  3JD1 A;  1RM1 C;  4L87 A;  1EN5 A;  2Y4U A;  2P5O A;  2CAZ C;  4H33 A;  4LF5 O;  2P06 A;  2W6I G;  3BAB A;  2NNU A;  2UUB O;  5B1A B;  2HJD A;  4FIP C;  3P30 A;  1R1B A;  4JV5 B;  2ZD9 A;  5CA3 A;  1KP3 A;  1IBL B;  3OMA B;  3U11 A;  1FFT B;  1J5E O;  4IYI A;  3FKS G;  2IJK A;  3OGI B;  1VP7 A;  1TGO A;  2IBZ H;  3ZRW B;  3W7U A;  4GX2 A;  1AP6 A;  4OPA A;  2AHY A;  1K97 A;  1WJZ A;  1AJN A;  4IGG A;  4PA3 A;  4WFE A;  3QO7 A;  4RQE A;  3RGB A;  3M99 B;  2EIJ B;  3VQV A;  1AB3 A;  2EIK B;  3AK2 A;  2EZO A;  2VRZ A;  3N2G B;  4JYY A;  1PNM A;  1GH6 A;  2Z5U A;  4UVC A;  1FJG B;  3RYH B;  1G8M A;  4B3R O;  1G1X B;  3UO2 A;  4LF8 O;  2ZXW B;  3ABL C;  1WP8 A;  2PI4 A;  3JAR A;  4UCO A;  5LA6 B;  4EFE A;  2X6B A;  5JQG A;  1MSD A;  2WLH A;  4QPK A;  4R50 A;  5LMU O;  3IJ4 A;  3CCQ V;  4MVS A;  4NXN B;  3C90 A;  5LMN B;  2OWO A;  4K3A A;  4TUY A;  1VQK V;  5CBH A;  4KFM A;  2G38 A;  1T5E A;  4EFB A;  4B3T O;  4X1K A;  4X1K B;  4JAA A;  1I94 B;  5JVD B;  3FB8 C;  1H2S B;  4B3M O;  2P4K A;  1E1Q G;  3SDL A;  4AHC A;  4DR2 B;  4X9Q A;  1VEW A;  2ZNI A;  4MVQ A;  4J11 A;  5IY5 B;  5FNV A;  3O65 A;  4GKJ B;  1DTO A;  3CC4 V;  1SQF A;  3R66 A;  3CRR A;  4JTA B;  3J7A U;  3MDS A;  1SQB H;  2F4V B;  3LDE A;  3OW2 U;  4MVM A;  3JAW A;  1XUQ A;  3FD9 A;  3P3P A;  3VQW A;  3MAQ A;  3CCS V;  3G6E V;  4KUM A;  5BXZ A;  1HP8 A;  4YJ2 A;  3D3Q A;  1GN4 A;  5KLV H;  4I0X A;  3LSS A;  1VQN V;  1I08 A;  3FB5 C;  2QJ1 A;  1V9P A;  4UVB A;  5LGN A;  1WAZ A;  1I5X A;  4IHJ B;  2Q0O C;  5GON A;  4FM1 A;  1MZF A;  1N4C A;  4HBN A;  4KP4 A;  1YJ9 V;  3FAV A;  4K0K B;  5D5Q A;  3NR7 A;  5B1O A;  1M9N A;  4J41 A;  2CTQ A;  5HFL A;  4NB5 A;  4MVO A;  1BHA A;  4LF6 O;  1EBO A;  3PJS K;  4D7T A;  4WFA V;  1SQX H;  1FXK A;  2WLI A;  5J2U A;  1FXK B;  4DR4 B;  3E83 A;  5E79 Z;  1HDJ A;  3K04 A;  1GN3 A;  2ZDI A;  2CTR A;  4R6Z A;  1MOF A;  4UB8 Z;  4UV9 A;  2QM4 A;  4DV0 O;  2DYR B;  4O4L B;  2DOS A;  1K5Q A;  5CA0 B;  3ZHS A;  3RYF A;  1AI4 A;  2VS0 A;  1FFX B;  1S72 V;  1VQ9 V;  3GVM A;  3CB2 A;  2UXD O;  1ZTE A;  5IJ9 A;  1XMQ O;  4F6R B;  3QNE A;  4JYA O;  1U96 A;  1VMG A;  1PL0 A;  3UO3 A;  1L0L H;  2Y0P A;  3ETD A;  2BOB C;  4JPR A;  2YIB A;  4QGP A;  2Y4T A;  2LGW A;  4CZZ A;  1RM1 B;  1HNW B;  4IIJ B;  4LFC O;  2MK3 A;  3JCZ A;  3T2M A;  2ZIM A;  4NTW A;  1AI6 A;  3P32 A;  4BIU A;  4J10 A;  3FYI B;  1X59 A;  3K0D A;  1YJW V;  3BHP A;  4LNU A;  4X66 O;  5EK0 A;  1A32 A;  4JGS A;  1N36 O;  2XAQ A;  1S77 D;  3C3S A;  5FLX N;  1YJN V;  4DR3 B;  1KYO F;  3LNN A;  1M93 A;  4DR5 O;  5LBQ A;  1Q3E A;  2R70 A;  1KEC A;  3ZMV A;  2GTS A;  1OCR C;  4DV5 O;  1WP7 A;  3X2Q C;  3ZMU A;  4ZKI A;  3JAT A;  4UUJ C;  1VQ4 V;  4FK5 C;  1Q6I A;  3H1L H;  5BR8 O;  2Q7E A;  1YHQ V;  1HNX B;  3JD0 A;  1JQ0 A;  1AI7 A;  4TT3 G;  4PDM A;  5IT9 N;  4DR7 O;  2OYQ A;  2UUA O;  1EN4 A;  4UXN A;  2UXX A;  4IT5 A;  3R65 A;  1YTF B;  1QR9 A;  1IBM O;  2BTQ B;  5LHH A;  1IBK O;  2BOC C;  3ABL B;  2QWP B;  1GN6 A;  1SQQ H;  1O9H A;  4XDK A;  2JEU A;  1S5J A;  4DR1 B;  4BIZ A;  1L0N H;  1HNZ O;  3KZI Z;  3CME V;  4JYB A;  4B7K A;  1GAX A;  4O4H A;  1BQ0 A;  3CP1 A;  1Q7Y W;  2IU0 A;  4O4I B;  3F7V C;  1OHH G;  3K5O A;  1Z2G A;  2WLM A;  3MD0 A;  1YXB A;  3OD4 A;  4X20 A;  3K3W A;  2P22 C;  4OPH A;  2QDO A;  1NR1 A;  1YF2 A;  3MHS C;  4DV1 B;  1VQL V;  5L3C A;  2Q8V A;  1PD3 A;  3T1H O;  1R73 A;  1Q90 D;  1XNR O;  3BRC A;  1XMO B;  2KSD A;  1ORQ C;  2DN9 A;  2IU3 A;  1WPB A;  3ZRX A;  5B1A C;  3CCR V;  4QJF B;  1QBZ A;  2HVK C;  1KD1 W;  3DXR B;  4DV4 B;  4QE7 A;  4NTY A;  3H1I H;  5CN0 A;  2WLJ A;  4DR6 B;  2YS8 A;  4LF4 B;  5CBG A;  2EUL A;  3CYO A;  5KAF Z;  4LP8 A;  2PGG A;  1RP3 B;  2WLL A;  1W0J G;  2GTA A;  2XT9 A;  4ASU G;  2B5U A;  2Q0A A;  4DV2 B;  3SJB C;  2OCC C;  3SJC C;  3QG5 A;  1JR9 A;  4BW5 A;  5IYC O;  3ZRV A;  3G71 V;  3JAL A;  4NTX A;  1JCH A;  2WA4 A;  3L74 H;  5HFM A;  3FYE B;  3CEI A;  1VQ6 V;  3BAA A;  4DUZ B;  4KHP B;  4YHH O;  4JI2 O;  4I4T A;  2QSA A;  3W7T A;  4I4T B;  2HFE C;  4TWK A;  3LDC A;  2XUM A;  2E74 B;  2ZXW C;  4AQY B;  4JTC B;  1S5H C;  2FL4 A;  5FPR A;  2DWD C;  1K9M W;  2CH7 A;  3E22 A;  2CH7 B;  2Z0A A;  3W7X A;  5L3E A;  2JEX A;  5KUK A;  1JMK C;  2M6Y A;  2VQE B;  1D5N A;  1QVF U;  5LGT A;  1NJI W;  2Q69 A;  2XAH A;  1GTO A;  4P9O A;  3AK1 A;  1P84 F;  4JI1 O;  3LSQ A;  4K8Z A;  1Y4M A;  4EB6 A;  3JSN A;  5B66 Z;  4Z2W A;  2FB5 A;  3F7Y C;  1YDX A;  4W4L A;  3D36 C;  3ICX A;  3GWK C;  2JIZ G;  3DGE A;  1QU7 A;  1SRY A;  1JPX A;  2UXC O;  1KMI Z;  4UFZ A;  1B6Q A;  1SZT A;  2YXL A;  4LFB O;  4TV9 B;  1Z5V A;  1THZ A;  2VQF B;  3SPH A;  5ITZ B;  4OX9 B;  4D7S A;  3CRC A;  4WBN A;  2EIN B;  1Y66 A;  2P90 A;  4ZBM A;  3UCS C;  4GLX A;  2HP8 A;  2ZNJ A;  3T4Z A;  4BWA A;  2F95 B;  4YXW G;  2JS3 A;  4DV6 B;  1EZV H;  4X64 B;  3D8C A;  5H6R A;  4CS3 A;  1N34 B;  4ZOL B;  4P30 A;  2AW9 A;  2HG5 C;  1H2N A;  2UXB B;  1PV0 A;  1QNM A;  2BCC H;  3L71 H;  1SA0 A;  2PI5 A;  3ETG A;  2XAG A;  2MW2 B;  2B9Z A;  5A9G A;  4I50 A;  3NXS A;  3E35 A;  3E86 A;  4CH4 A;  3N27 A;  4N21 A;  2YXH A;  1ZX3 A;  2F23 A;  4HNA B;  1K92 A;  1FKA O;  1K8A W;  4O2A A;  2F66 C;  1OZ0 A;  1YEW A;  4DRX B;  4TV8 B;  4DV3 O;  1SS3 A;  2JK5 C;  5LYJ B;  4LFA B;  2KG7 B;  1V55 B;  1RSO B;  4UVA A;  2PF4 E;  2UUC B;  2AGA A;  2DYR C;  1KKD A;  4LBE C;  5LL6 Y;  4JTD B;  4RUF A;  4W4K A;  4JV5 O;  1AIL A;  3ZN0 A;  3OM3 B;  4OGQ B;  3WG7 C;  3KG2 A;  1IBL O;  1BE3 H;  3LUT B;  2K1E A;  1XL4 A;  2EZP A;  5C8Y A;  4NVP A;  3ABK C;  5IJ0 B;  3RN4 A;  4GCZ A;  1F4M A;  4JI5 B; 
#chains in the Genus database with same CATH homology
 1WA8 A;  3TXQ A;  1WA8 B;  4ABM A;  3FAV A;  3FAV B;  4LWS A;  4LWS B;  2KG7 A;  2KG7 B;  2AZ2 A;  3TXS A;  2AZ0 A;  2VS0 A;  3GWK C;  4GZR B;  2B9Z A;  4I0X A;  4I0X B;  3GVM A;  3ZBH A;  2VRZ A;  2DE0 X;  3OGI B;  3Q4H A;  3Q4H B;  3G80 A;  3O9O A;  3FD9 A;  3HR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...