5EBMC

Kcsa t75g mutant in the nonconductive state
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATGVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ebmC00
5EK0A 3TETA 4R6ZA 2HFEC 2R9RB 1BL8A 3JYCA 3K04A 3ZRSA 4P2ZA 3SYCA 4XDLA 2A79B 2WLIB 3STZC 1OCZC 2X6CA 3OR7C 3SYPA 1OCCC 1P7BA 2DWEC 2WLLA 4RUFA 4F4LA 1R3KC 4GX5A 3SPIA 4DXWA 3K06A 3E8GA 3RW0A 4GX1A 4HZ3A 2WLLB 2A0LA 4X89A 3AG4C 4XDKA 5EBLC 5B1AC 4PDVA 3E83A 3IGAC 3SJQC 1KKDA 3ABMC 3EFFK 2EIKC 4MVOA 2ZXWC 4I9WA 3SPJA 3AG2C 5CBFA 3FB5C 5CBHA 4J9ZB 3SYAA 5KUKA 3SYQA 3ASOC 4X8AA 3RVYA 3AG3C 4KFMA 3AG1C 1JVMA 4LP8A 1ZWIC 2BOCC 4PDRA 4WFFA 1G4YB 2KB1A 2IH1C 2NLJC 2EINC 2JK5C 4R8CA 3WG7C 3F5WC 4UUJC 5KUMA 1XL4A 3K0DA 2WLKA 4MVSA 1ORQC 3GB7C 4J9YB 4PA3A 5IY5C 2WLJA 4MVQA 2WLMA 4MVUA 2H8PC 4R7CA 4G27B 4JTDB 3E8FA 3E8BA 3T1CA 4XDJA 3HPLC 3T2MA 2EIMC 5E1AC 3OGCC 2HJFC 4MVMA 3T4ZA 2ZD9A 3PJSK 4MW8A 1M57C 2ITCC 2Y69C 5B3SC 1QLEC 2OCCC 1OCOC 4CBCA 3LNMB 4MVZA 3ASNC 3OUSA 4TWKA 3LDDA 2IH3C 3ABLC 3LUTB 4H33A 2DWDC 2YEVA 2QKSA 4RAIA 2P7TC 4P9PA 2WLNA 1S5HC 4P30A 3RBZA 2DYRC 1OCRC 2Q69A 3F7VC 4LCUC 1R3IC 4PA4A 3SPHA 4ZBMA 5BZBA 5B1BC 2Q68A 4HYOA 2HVKC 2Q6AA 4PDMA 3SYOA 4QNHB 4EKWA 3FB6C 4QE7A 3ZJZA 1V55C 4JTCB 3FB7C 3K0GA 4P9OA 4WFHA 5EBWC 5CBGA 4MS2A 4OXSA 3R65A 2AHYA 5EBMC 2Q67A 1K4DC 4MSWC 4WFGA 2EILC 2AHZA 4PA9A 4MW3A 3KG2A 4PA7A 3E8HA 3SPCA 3IFXA 1R3JC 4RO2A 3SPGA 4GX0A 1M56C 2DYSC 5EC2C 1R3LC 3X2QC 2WLIA 3TCUA 1K4CC 4G28B 5J9PC 3UKMA 3LDCA 2X6BA 2K1EA 2HVJC 2ATKC 3T4DA 4JTAB 1XL6A 4H37A 3UM7A 4BW5A 4WFEA 3OUFA 3LDEA 3K03A 4MTOA 2WLHA 3BEHA 4MTGA 1J95A 2QTOA 3ABKC 2X6AA 5EC1C 2HG5C 2EIJC 4QE9A 2ITDC 3FB8C 3E86A 3VOUA 3E89A 3F7YC 3K08A 2BOBC 1LNQA 1V54C 4PA6A 3STLC 4RUEA 3OR6C 4GX2A 4MTFA 4MVRA 2W0FC 4R50A 4X88A 4PDLA 3RVZA 2A9HA 4LBEC
chains in the Genus database with same CATH superfamily
4EB6A 1YF2A 3UT5B 2UXDO 2EILB 4CC5A 3ZRSA 4DV4O 2BSKB 4YJ3B 4BIZA 3OR7C 2XAFA 1PP9H 3E8GA 4U3JB 4X62O 3CCRV 5LMUB 1FFXA 1MA1A 4UCSA 2JGUA 5KX5A 2EZPA 1P7GA 4I0XA 1NR1A 1FXVA 1S5LZ 1CXZB 3LSSA 3A2FA 2JK5C 5LOVA 1IX9A 4J9YB 3W7XA 4X1KA 1G1XB 3P3NA 1Q6HA 1YCIA 1L0LH 1QLEC 4JI8O 3QF7A 3FX7A 5LP6A 3D3IA 2E5LB 3K5NA 4BIUA 1YIJV 2ZE5A 5D5PA 3OEHG 4UVCA 4B3MB 1GH6A 2LGQA 4ZKIA 1H2SB 3UO2A 1N4CA 3ZJZA 4X1YA 3T1HB 4TT3G 3A0RA 3R65A 3ASOB 5EBMC 5L3EA 1K34A 4D7TA 5H6QA 3RYFA 1N36B 4AILC 4QPKA 1IURA 3NXSA 1EN4A 3I56V 3N2KA 1LR1A 2LFSA 1NTMH 3K9SA 1NJIW 2RJZA 5DM6V 5B3SB 1MZEA 5LYJA 1NR7A 4PELA 4TV9B 2WA3A 5JCOA 4OX9O 4U3FH 2OTJV 3ASNB 2JJ1G 3E35A 4I50B 1M4UA 3W7TA 3B09A 4DV1O 4GX2A 3T1YB 2W0FC 3J7AU 4B3RB 3A0BZ 1H2GA 1JA8A 1AJQA 1FXKC 3OGIB 2XAQA 1AI5A 2WLIB 3J80N 3SPIA 3JD3A 4O4LA 1H2LA 2A0LA 2VQEB 3C3TA 1WN7A 3WB2A 5CBFA 3DC5A 1XHXA 4I5SA 1J5EB 4K8XA 5JJEB 4O2AA 5IYBO 3CRAA 4B3MO 1XDCA 3JSNA 1AILA 4PHZA 1XL4A 3K0DA 1WB7A 5K1PA 3T1HO 1ZUQA 4MVQA 1SQGA 1Q3EA 1K33A 1PD3A 3T4ZA 2ZD9A 3L9DA 4YIOA 2QM4A 5L3CA 1OCOC 1N36O 3LNMB 4YJ2A 1XNRO 2P5OA 1OCCB 2JGDA 3JASA 1US6A 4ZBMA 4TSFG 2HVKC 1XNQO 4KUMA 2Q4PA 3AG2B 1FD9A 2W6IG 4UXNA 1QQCA 4UV8A 2EX3A 1OV9A 4JPRA 3BA8A 4GCZA 2ETNA 5HFMA 5LMNO 3IFXA 3T1YO 3OEEG 3DTUB 3N27A 2N05A 3CRQA 4EFEA 2DE0X 1UPGA 3HKDB 5J9PC 4BIOA 3CJHA 5GONB 3D3QA 4O2BA 3CCQV 1SQBH 2VQEO 3OAAG 2QSAA 4DV0O 4GYCB 3BCCH 4B3SB 4LF7O 1ZX3A 4DUYB 4IYIA 1NKDA 1N33B 3K04A 4JI5B 2AW9A 2UUBB 1K73W 1ZL8A 2X6CA 2DWEC 4RUFA 2KKWA 1LUVA 3CCSV 2ZXWC 1VQLV 1XILA 2DQ0A 5DECA 1Q5OA 2F95B 4IHJB 3RYIA 4X66O 2GTAA 3AK2A 1JOYA 2KG7A 4TOIA 3ZRWB 2GTSA 5F2VO 1ORQC 4AI8A 2YIDA 2WLMA 3O65A 1N0NA 4LWSB 2QTSA 5LP6C 3JD4A 1N34B 3PN1A 3F5TA 5L3FA 1GAXA 4GZRB 3ZS8C 4NKGB 3IAYA 4J41A 3FAVA 3LUTB 2ZNIA 2WLNA 4NYKA 5KA5A 4UCVA 5KAIZ 3HKEB 1FYJA 4TQFA 1T5EA 5CMUA 4I55B 4LR3A 5TISZ 5EYPB 3TK1A 4DV2B 2ZM6B 1I5YA 2E75B 1KU9A 1DGSA 2HJDA 3CX5F 4B3SO 1SQXH 5KHIA 4UB8Z 4DUYO 4BAYA 2QGNA 5FPRA 2CTWA 4JZGA 5JCOC 4JTAB 3CMAV 4JI5O 4DR4B 2UUBO 2Y69B 2WA4A 2YS8A 4ZHQA 2LO1A 1BT8A 3EHBB 4LFCB 1SA0B 1HNZB 5GW7A 4FLXA 1PL0A 2Y4UA 5JVDA 4PJ0Z 1TUEB 2ZCEA 5BR8B 2WWWA 1BE3H 1TUBB 4K0KB 4JYBA 3X2QB 1F4MA 1KBHA 3G71V 3AG4C 1AP5A 3DXRA 4U7NA 1ZWIC 3VQVA 3ZMUA 4C7UA 5CN0A 5JQGA 2XASA 3CRRA 3JAWA 1I08A 4JTDB 4DV2O 3QO8A 4IL6Z 3B77A 4O4IB 1PNKA 2YXLA 5H9CA 4D7SA 2XAHA 1KMIZ 1CPYA 2OYQA 2XUMA 3QO5A 2IH3C 1K8AW 4H33A 3HKBA 3BAAA 4DR4O 1VF7A 2RDCA 5B1BC 4ZOLB 4QE7A 4H13B 4I9QA 2Q8VA 1YSCA 4K3AA 4WFGA 1B3QA 1R3JC 1HNZO 4IIJA 1M56C 1YJNV 2D3OW 1E79G 2N74A 1O9HA 2HP8A 5HFLA 5BR8O 3K59A 4I4TB 4K0KO 3K03A 1IZ3A 4RQFA 4MTGA 3CC4V 1J95A 1F23A 3ABKC 5EC1C 2HG5C 1VQ6V 2ITDC 2BTOA 3FB8C 2Z0AA 3ETGA 1K5SA 3LNNA 4MTFA 2F4VB 4LBEC 1KECA 4UCOA 3SJCC 2YIBA 2IJHA 3L73H 2R9RB 1GN2A 2W0XA 3WFVA 3JSLA 3JATA 3H01A 1VP7A 1OCZC 1SESA 3K58A 1BS3A 4DXWA 2CTRA 2GHYA 3RW0A 2KQXA 1XMQB 5CA3A 1AI4A 1F4NA 3HKCB 5LHHA 3H1HH 3JARB 2CAZC 1G8MA 4FLVA 4FFBB 4FFKA 1D2DA 2NLJC 4JGSA 4X20A 4DR1B 1QHTA 1VF5B 5LGTA 4ZIBA 1F51A 4CS2A 5B1NA 3VBBA 3K9AA 3ZN1A 1K3EA 3PJSK 3A8TA 4DO2A 1YEWA 1EFRG 4DRXA 3KCYA 5LA6B 1MOFA 2V4DA 4JI1B 2WSSG 3ZX6A 2Q69A 1K5QA 2F1MA 1H38A 4GUNA 2UXDB 3SYOA 3U10A 5BMVB 3ABMB 2EIKB 3K0GA 4LF6B 4MS2A 5FNVA 1NVPD 2AHYA 1Y66A 2HEPA 4HBNA 3CD6V 4X62B 1JFFA 5J2TA 1GO3F 4F6RA 3WG7B 2JJ2G 3M7MX 1M5IA 2F4VO 5GTHZ 3CC2V 4MTXA 4DUZO 3K57A 2QA4V 3FYIB 3OT7A 1GN3A 1WB8A 4FJCC 1RSOB 1VARA 3Q4HA 4LF5O 3BEHA 5L3BA 2B5UA 1ZSPA 3L75H 4JI7B 3ABLB 1Y76A 2UU9B 1JPXA 5LXTB 1XMQO 1X59A 2DYRB 1FPOA 2ZR2A 4DV5O 2CUGA 2P6JA 3ZHTA 1VQ4V 3ZIAG 4WBNB 2CH7B 4GKJB 5H2FZ 3SGIA 3ZMZA 1B06A 4R6ZA 2A7WA 4DYLA 2A79B 3SYPA 1BHBA 1P7BA 4JI3B 2X0LA 5C8YA 2GV9A 1R1BA 2Y0PA 3RGBA 3RYHA 4JI1O 3ZMSA 5B5EZ 1SQQH 4BW9A 3G80A 2KSDA 5KUMA 3L74H 2X7RB 3WU2Z 4LF6O 3KKYA 4MVUA 2H8PC 4OX9B 2OWOA 1ZLZA 3E8FA 3T1CA 1PPJH 5KMGA 4YXWG 3OGCC 4J10A 1XEQA 2ITCC 1HW7A 4D6TH 2PTMA 2LFRA 4DV1B 1AVMA 2RNBA 2DJVA 4DR3O 3N2GA 2YEVA 3RBZA 1WNSA 2QR4A 3RFRA 2JGDB 4WFHA 2ZR3A 5EBWC 4O4HB 4J7ZA 3M8AA 2D2CB 4JI7O 4Z2WA 2ZT9B 2UU9O 1OJHA 4QJFB 1N0JA 3E22A 1SQPH 2CTPA 2DYSC 2XTAA 4GKJO 2GUZA 4G28B 3UKMA 2HVJC 5ITZA 3T4DA 5JJNB 1SZTA 1PL4A 1XOUA 4KHPB 1QCEA 5CA0B 3JD2A 4PD4F 4JI3O 3OTOB 4LH7A 4CZZA 2BOBC 3UCSC 4PA6A 3STLC 1XUQA 3CSXA 1KD1W 1V55B 4PDLA 1XNRB 2DOSA 3OFNG 2PYLA 1FS0G 4PV1B 2NN4A 1SF9A 1MG1A 3K79A 1GKFA 1XNQB 1S72V 1QR9A 4HZ3A 1KKDA 3E83A 5LMNB 3CP1A 2P06A 5CBHA 1AJPA 1HNXB 2FB5A 4X8AA 4O4JA 1HWYA 3RWRD 1EN6A 2KB1A 1YI2V 5IE9A 2ZNJA 4PI2A 1R6TA 3JAKA 2UUAB 3B8NA 4JZ2A 3QTCA 4R7CA 4YIPA 3H1KH 5IJ0A 1KUQA 1FJGO 3RN4A 1Q6UA 2HLDG 4TUYB 2AZ0A 2A06H 5IYZA 2OCCC 4DV0B 1ENVA 3ETEA 2F66C 2FYUH 4LF7B 3SYQA 1H8EG 1S5HC 4JYAB 1L1FA 3SPHA 4QNHB 4KHPO 4MT8A 3E2EA 1XMOO 3OTOO 5JH7B 1K4DC 3AEIA 1QU7A 3AG1B 2JIZG 2BCCH 4L8JA 3MDSA 1FAFA 5IJ9B 2ADQB 1WP8A 3E8HA 3RYCB 4FM2A 1KP3A 3UT5A 4DW1A 1QR8A 1WA8A 2BSKA 2WAMA 4YJ3A 1D5AA 1SETA 5EIBC 4X66B 4JAAA 3BA9A 1M57B 4FPPA 2QWPB 4WFEA 3OUFA 1Q82W 3CWBH 3TGUH 3G67A 2RMKB 3CCMV 2DN9A 4Q20A 1HNXO 1NVPB 1VQKV 2HFEC 1YTFD 1AR1B 1BZKA 2UUAO 3K5OA 2WLLA 4FM1A 1K92A 4GX5A 2P4KA 2P22C 2BTQB 3ZMVA 1VQOV 4B08A 3AG3C 1JVMA 4JYAO 4WFFA 4B3TO 3JALA 4HNAB 1KC8W 4UUJC 4NXMB 1SRYA 2CDYA 1NQTA 3GB7C 4JI4B 4EFBA 1GM8A 1CP9A 1SC5B 3E8BA 4J7JA 2O57A 4LF8B 2EIMC 4LC1A 1P4RA 3S3XA 5BY1A 3O9OA 1IDSA 3CRMA 2E76B 3ZRXA 3OE7G 4FM0A 4FLTA 2E74B 4P30A 4TV9A 2ZKOA 1OCRC 1HNWB 4LCUC 5FL7G 4I50A 4CH4A 5CB4B 4EKWA 4ZI7B 2RCVA 2JEUA 3FFQA 5CBGA 1NTKH 3G6EV 2R70A 1V9PA 4MSWC 3APOA 4PA9A 4JI2B 2PF4E 3SPCA 1PKXA 3SPGA 2FTKA 4CH5A 1R3LC 5BXZA 1U97A 2WLIA 4E4EA 2JEXA 3CHXA 3UM7A 1QLEB 2YIAA 3BHPA 1JX9A 1OZ0A 4WCEV 2EIJC 4BWAA 2PUSA 3TXQA 1K7DA 1M93A 1BMFG 3CRCA 1XHZA 1VQMV 2UXCB 2BE3A 2CGNA 2GBOA 4MVRA 3D36A 2A9HA 5B66Z 3ZEDA 1SS3A 3H1LH 4X9QA 2H3OA 4NXMO 4P2ZA 4JI4O 4TV8B 4LF8O 5H6RA 5H5NA 4J11A 2AGAA 5B1AC 1SQFA 1Y4MA 4QGPA 3GWKC 1QVGU 2N04A 5KUKA 2ZE6A 1X4TA 3H1IH 2XNDG 4PDRA 1HNWO 2EINC 4MVSA 2PI5A 5IY5C 3ML0A 3ZHRA 2NR5A 4YHHO 2IJKA 1AJNA 1FXKB 5B1OA 1S77D 4JI0B 1QLNA 4JI2O 1K9MW 5KAFZ 3ABUA 3HKDA 5K1XA 3BPZA 1WPXA 4UV9A 2QM7A 3P30A 1NS1A 2ZDIA 4FK5C 3B8MA 5GONA 1FKAO 1KKCA 3FB6C 1KB9F 1XQ8A 1UFIA 5CA1B 1NT2B 3CCLV 2EILC 3LSQA 4X64B 1GN4A 2UXCO 1W2BU 3CXHF 3HR0A 1KQSU 4DV7B 1JCHA 1WP7A 1K4CC 4X1IB 2ATKC 2F43G 4KXRA 3G6BA 1AB3A 4H37A 4RWUA 5DEDA 5IDJA 1OCOB 3JCUZ 1Z5VA 2JS3A 1TVKB 1AROP 1GRJA 2R9AA 5EZYB 1HDJA 5J2UB 1LNQA 4IHJA 1R6KA 4KL1A 1VF6A 5KLVH 1IXMA 2UXBB 3ZRWA 2LQTA 5JWPA 1VQ9V 1Q43A 1Y74A 4CS3A 4JV5B 4LWSA 1VQNV 2PYJA 1R73A 4CH3A 4LNUB 1Y6XA 2JDIG 1H2MA 3I55V 4JI0O 3UQ8A 2WPDG 3DGEA 4MVOA 3HKEA 2AZ2A 1W59A 3ASOC 4J42A 4I55A 2Q0AA 3LSUA 2IW5A 2H94A 4UCTA 2OIGA 2IH1C 1EZVH 4DUZB 5EYPA 2ODMA 4EB6B 1PNLA 4QIWF 4G27B 1XBLA 4LF5B 1IVSA 2XT9A 2Q5ZA 2YI9A 4JAUA 3CYOA 4X64O 1YTFB 3ZCCA 3EXAA 4DV5B 5B3SC 5KHHA 4CBCA 1MSWD 2EJRA 3ASNC 1H2KA 4FIPC 4DV7O 1RFYA 3ZHUA 1FFXB 4B7EA 1M9NA 1THZA 5KX5B 4PDMA 4HYOA 3MHSC 5LHIA 4I0XB 2ZXWB 3UO3A 1SA0A 1MABG 1I5XA 1GM9A 5LOVB 3OMNB 1L0NH 4X1KB 3OM3B 4W4KA 3SJBC 4DV6B 2UXBO 2OCHA 1UJWB 5EC2C 1TUBA 4Q6GA 5IT9N 3G4SV 1VQPV 5LP6B 2K1EA 4NVPA 4JV5O 1CEZA 1HP8A 4MTOA 3ETQA 4LFBO 1JMKC 1YHQV 3JD0A 2X6AA 2QE7G 3WB0A 2IJIA 3E86A 2F93B 3ZHVA 3J81N 4X1YB 3D36C 1NH2D 3APQA 4ASUG 4LF9B 3GVMA 1SKVA 2A3QA 3OR6C 4R50A 3RVZA 2Q73A 3SJAC 2EJ7A 2IBZH 3VQYA 1JR9A 1U96A 3RYFB 3TJTA 3ABTA 4DR3B 1WLEA 2AXTZ 3N2KB 1EM1A 1OCCC 1VQ8V 3K06A 3DC6A 1N8RW 2B9ZA 2QKAA 5LYJB 4WFAV 2G38A 3AG2C 2F23A 4ZOLA 2Y4TA 2RQ6A 1W0KG 5LL6Y 2P90A 3BRCA 2DQ3A 3AK1A 1VMGA 2ADPA 1E1RG 1DF5A 5IWAB 2PI4A 4GT1A 2ZDIC 2HKOA 3QVNA 4DV6O 4OGQB 4MVZA 3OUSA 4O4LB 2DWDC 4I4TA 1H2NA 3D8CA 3F7VC 1R3IC 2YSUB 2Q68A 3AG4B 2FL4A 3CCEV 4NB5A 1V54B 4O2AB 1FXHA 4DR2O 2K9PA 4LFAB 4LF4B 4AQYO 2AHZA 4MW3A 4LF9O 3K5MA 4RO2A 3OMAB 1BQ0A 1FFTB 1RPOA 4N23A 3LDCA 1GMGA 1WA8B 4YJ2B 3ZN0A 4E2LA 3JASB 2QDOA 3HKCA 1ZAUA 3JARA 1XI1A 3BABA 1VF6C 5AG2A 4AHCA 2JRIA 1FJGB 1YDXA 4FFBA 5B1BB 3FYEB 4UB6Z 1BQZA 3CXCU 2YIBD 3JD1A 2GDSA 1I7FA 1WPBA 1Y67A 5GTIZ 3KCXA 4DK0A 2Q0OC 3WB1A 1M56B 4QPJA 5LA6A 3CJHB 1XMOB 5IWAO 4YY3O 1YXBA 2NNUA 4GX1A 2WLLB 3FD9A 1SERA 3IGAC 4O2BB 1GK9A 3EFFK 4J9ZB 3ABKB 5BMVA 5L3GA 2BOCC 3CMEV 4WF9V 4K8ZA 2HHHB 3CE2A 1NBMG 1B6QA 3JALB 4FLUA 1VEWA 2ZIOA 2P4VA 2Q9LA 3BFRA 4J7KA 3T2MA 4LFAO 4LF4O 1ZL8B 1QVFU 2Y69C 2B1GA 1VQ5V 4H44B 4LH6A 3RT3C 1OCZB 4TWKA 1RSOA 3B2EE 1B04A 4P9PA 3U11A 3OD4A 2CTQA 3VQWA 2DW4A 4L87A 2LJ2A 1Q7YW 3AK3A 5LXTA 1L8DA 4KP4A 3RYIB 4Z1VA 1JJOA 4PI0A 4N21A 2KG7B 1PV0A 3OMIB 4WBNA 2C2AA 5LMUO 2CH7A 4G2KA 4PA7A 4GKKB 4EEQA 3GWOA 3BY6A 4OPHA 3X2QC 2UXNA 5EIBD 1ZTEA 1AI6A 4B3TB 4U7OA 3FAVB 1XL6A 4BW5A 3S3WA 4ABMA 2R72A 3H1JH 1IBKB 4GLXA 4IT5A 1BGYH 3H9VA 2P67A 2E5LO 2Z3YA 2RN9A 2YUAA 1I94B 2VS0A 2HHHO 2XAJA 3JYCA 4DR7B 4X65B 3CPWU 4U3JA 1COWG 3STZC 2QWNB 4WFBV 5KHJA 2YXYA 2YXHA 1GN6A 1S76D 4F4LA 5E79Z 1R3KC 1LUWA 2QKCA 4FMTA 4FLYA 4CH6A 1AR5A 1AP6A 3W7WA 3QNEA 1VQ7V 4ZHQB 2EZOA 2XOKG 3K5LA 5LGNA 3SPJA 3CEIA 1IBMB 3CCUV 5A9GA 4O4HA 4XBFA 1NH2B 2HR3A 1URFA 5JVDB 2VWJA 3ZRVA 1M90W 1JJ2U 3HPLC 2M6YA 2V1DA 2HJFC 1S5JA 2Z5UA 5LHGA 4GKKO 1RM1B 1TAEA 4B3RO 1MZFA 1YZBA 3LDDA 3OW2U 1VIBA 5CA0A 1IBLB 5FPOA 4DW0A 3DXRB 4UVBA 3P3PA 3ZMTA 1IBKO 4J80A 4P9OA 3L71H 2LW7A 5JQGB 3KZIZ 3DSQA 3JAWB 2EBOA 4JYCA 3W7UA 1QBZA 1J5EO 4NXNB 1I94O 2CK3G 2EULA 3TCUA 1TA8A 3K3WA 3AG7A 1KP2A 3QG5A 4DR7O 4X65O 1NI8A 2VQFB 3HKBB 4NTWA 4DK1A 4YHHB 4JAVA 1MMMA 2L35A 4UVAA 3E89A 1Z2GA 4FZ0A 1DTOA 3U0ZA 1GTOA 1IBMO 3SR2C 2QM8A 1S3JA 4FLZA 3OTFA 4IIJB 3TXSA 3SYCA 3P32A 3CS5A 1Y74B 4TUYA 1Q6IA 1SQVH 2VWKA 3CCJV 2DYSB 5A2QN 1S0VA 4IYHA 1K97A 4W4LA 2QJ1A 1H8HG 5DN6G 3SJQC 4DR5B 2XHBA 2JVDA 3ABMC 2EIKC 5D5QA 1O9GA 3VQXA 1IBLO 2YICA 2Q7GA 2ZQMA 5JH7A 2LGWA 4R8CA 3WG7C 1I0HA 4PA3A 5IJ9A 1OHHG 1R6NA 2W6JG 3RYCA 3JATB 1G6UA 1BSMA 3JAMN 4NXNO 2ILMA 1Q90D 3ABLC 3ETDA 2ZINA 4H0LB 3EVKA 1NZ6A 2DYRC 4NTXA 3IC9A 4CC6A 1N33O 4B7KA 2VQFO 4JTCB 3FB7C 1WJZA 2FKXA 1RPRA 2UUCB 4OXSA 1QNMA 5LGUA 3R66A 4DR6B 4X20B 4NR1A 3KG2A 5KHKA 1EN5A 2Q7EA 2QWOB 1P84F 4NTYA 1GM7A 4DRXB 3C90A 1P49A 2X6BA 2LW1A 2BTQA 2OCCB 3LDEA 2WLHA 4BR6A 3VOUA 1N34O 4ICGA 1YITV 1V54C 3SDLA 4DR5O 1AR4A 5FNVB 4UFZA 1EBOA 2Y48A 4HNAA 1JFFB 5J2TB 2DMXA 2QWRB 4F6RB 2IU3A 2IU0A 2CGOA 4FLWA 3L70H 1W0JG 2ZM6O 3IC7A 4IGGA 3Q4HB 5IYCO 1NU1H 2B1IA 4JYYA 3ZHQA 4XDKA 4PDVA 1Y76B 5CB4A 1NTZH 4ZI7A 4KFMA 1MSDA 2OTLV 2MW2B 2GSMB 1G4YB 3CC7V 1HR0B 2LP7A 4JI6B 3F5WC 2YI8A 5L3DA 2WLKA 1ROPA 2UXXA 2WLJA 1BCCH 2UUCO 4LFBB 1E1QG 5KA6A 4XDJA 5E1AC 2PY5A 4LFCO 4DR6O 4A5UB 4F6EA 4Z1MG 1D5NA 2QWQB 1AI7A 1DK1A 1PNMA 2ZIMA 2YDEA 3B40A 1PM9A 2MK3A 5C8YB 4PA4A 3RYHB 3BVOA 3THOA 3FKSG 1V55C 3AG3B 3W7SA 1SZXA 3IJ4A 1IXBA 5KMGB 4GX0A 4CS4A 3B4SA 1RP3B 3ZBHA 5C93A 2EIMB 4UCUA 4TV8A 3MD0A 1DF4A 2L6LA 1TGOA 3JCZA 3N2GB 3ICXA 2YEVB 2V7QG 2XAGA 5IYDO 1N32B 2QTOA 2Q7HA 1OCRB 1KYOF 2IM9A 3K08A 2M7WA 4RUEA 2Y0IA 2VRZA 3E22B 3QO7A 5EK0A 3TETA 2ZE8A 1HR0O 1BL8A 4JI6O 1JQ0A 1FXKA 4XDLA 2GUZB 3MHHC 5ITZB 2JS5A 1BHAA 4RQEA 4DR2B 3CB2A 1Z5WA 2PGGA 3L72H 4OPAA 5JJJB 4AQYB 4X89A 5EBLC 4I9WA 4DV3B 3FB5C 3SYAA 1DLBA 4UCRA 3RVYA 3AG1C 4LP8A 2EIJB 5CA1A 1A32A 3C3SA 4DV4B 1Q81W 4O4IA 3NR7A 4HAMA 4MVMA 3CCVV 4MW8A 1M57C 2PZSA 4X1IA 2QKSA 4RAIA 2P7TC 2ARHA 5FLXN 1TVKA 1EZJA 5BZBA 5B1AB 1YJWV 2Q6AA 5EZYA 4O4JB 5J2UA 1Q86W 1N32O 2OIEA 2Q67A 2QEXV 3JAKB 4YY3B 2EINB 4TQDA 2YC0A 5KHGA 5LBQA 4JI8B 1MNGA 4K35A 3ZHSA 3HB3B 1YVWA 2IJJA 5IJ0B 4JF3A 5IY5B 3MAQA 2R9IA 1F7YA 5IYZB 2FMLA 4LNUA 1RM1C 4DR1O 1Q8IA 3I5DA 2CE4A 1WAZA 2E3CA 1XREA 4JASA 4QE9A 1M1KW 3F7YC 2ZE7A 3A0HZ 4FZ1A 1YJ9V 2OT5A 4DV3O 4X88A 3M99B 4FVMA 4I7ZB
chains in the Genus database with same CATH topology
2IJHA 2XAJA 2R9RB 3JYCA 3WFVA 2EILB 3ZRSA 3CPWU 4P2ZA 3H01A 1COWG 3STZC 1OCZC 4BIZA 3OR7C 4WFBV 2XAFA 1SESA 1S76D 4F4LA 1R3KC 4DXWA 5H6RA 2GHYA 4FMTA 3E8GA 3RW0A 3CCRV 5CA3A 3W7WA 3QNEA 5B1AC 1VQ7V 2EZOA 1Y4MA 1AI4A 1F4NA 5LHHA 2XOKG 5LGNA 3SPJA 1QVGU 2EZPA 5KUKA 1G8MA 1NR1A 1FXVA 2XNDG 3CCUV 4PDRA 4XBFA 2NLJC 3LSSA 2EINC 4JGSA 2JK5C 1NH2B 2HR3A 4MVSA 2PI5A 5IY5C 4J9YB 3W7XA 5LGTA 3ML0A 3ZRVA 1M90W 1F51A 1JJ2U 3HPLC 5B1NA 3VBBA 2IJKA 2V1DA 3K9AA 1AJNA 1FXKB 2HJFC 5B1OA 3ZN1A 1K3EA 3PJSK 2Z5UA 4DO2A 5LHGA 1S77D 1EFRG 1QLNA 1K9MW 3ABUA 1RM1B 1QLEC 1WPXA 1MOFA 3D3IA 4UV9A 2QM7A 3P30A 1VQOV 2ZDIA 3LDDA 2WSSG 4FK5C 4BIUA 1YIJV 3B8MA 3OW2U 3OEHG 2Q69A 4UVCA 1K5QA 1H38A 4UVBA 4ZKIA 3SYOA 3ZMTA 3FB6C 3ZJZA 3ABMB 2EIKB 4TT3G 3K0GA 4P9OA 4MS2A 3A0RA 3R65A 3ASOB 1NVPD 2AHYA 5EBMC 5L3EA 1Y66A 3CCLV 3CD6V 1K34A 2EILC 3LSQA 5H6QA 1GO3F 2EBOA 3WG7B 4JYCA 2JJ2G 3W7UA 1QBZA 1W2BU 1KQSU 4QPKA 1JCHA 3NXSA 3CC2V 2CK3G 4MTXA 3I56V 3TCUA 1K4CC 3K3WA 2QA4V 1KP2A 2LFSA 3FYIB 2ATKC 1NJIW 2F43G 4FJCC 5DM6V 4H37A 5B3SB 1NR7A 5IDJA 1OCOB 4PELA 3BEHA 5L3BA 2OTJV 2B5UA 3ASNB 2JJ1G 1AROP 3ABLB 3E35A 4JAVA 1JPXA 2DYRB 4UVAA 3W7TA 3E89A 2ZR2A 1LNQA 1R6KA 2P6JA 4GX2A 2W0FC 1VQ4V 1IXMA 3ZIAG 1DTOA 3ZRWA 1GTOA 1H2GA 1AJQA 1FXKC 1VQ9V 3ZMZA 2QM8A 1S3JA 4R6ZA 1VQNV 2XAQA 3SYCA 1AI5A 3P32A 2A79B 2WLIB 1R73A 3SYPA 1BHBA 1P7BA 3CCJV 2DYSB 2X0LA 3SPIA 1S0VA 2JDIG 3I55V 1K97A 3JD3A 2A0LA 1H8HG 5DN6G 3SJQC 2WPDG 3ABMC 3DGEA 2EIKC 4MVOA 5CBFA 4I5SA 3ZMSA 3ASOC 5IYBO 2IW5A 2H94A 2IH1C 2ZQMA 4R8CA 3WG7C 5KUMA 1XL4A 2X7RB 3K0DA 4PA3A 1PNLA 1OHHG 1R6NA 4MVQA 4MVUA 4QIWF 2H8PC 2W6JG 4G27B 3E8FA 3T1CA 1K33A 4YXWG 1PD3A 3OGCC 3T4ZA 2ZD9A 4JAUA 3CYOA 1YTFB 2ITCC 3ZCCA 5B3SC 2LFRA 1OCOC 4CBCA 5L3CA 1MSWD 2EJRA 3LNMB 3ASNC 4FIPC 1OCCB 3ABLC 3ETDA 2YEVA 3RBZA 2DYRC 1M9NA 1THZA 4ZBMA 4PDMA 4HYOA 2HVKC 3MHSC 4TSFG 5LHIA 4KUMA 2ZXWB 4JTCB 3AG2B 3FB7C 2ZR3A 1MABG 1RPRA 4WFHA 5EBWC 4OXSA 2W6IG 5LGUA 1I5XA 1GM9A 4UXNA 3OMNB 4UV8A 4JPRA 4GCZA 4QJFB 3OM3B 5HFMA 3KG2A 3IFXA 3OEEG 2DYSC 3DTUB 1UJWB 5EC2C 1GM7A 3G4SV 1VQPV 4G28B 5J9PC 3UKMA 2X6BA 2K1EA 1CEZA 2HVJC 3T4DA 1SZTA 2OCCB 1QCEA 3LDEA 4MTOA 2WLHA 3JD2A 1YHQV 3JD0A 2X6AA 2QE7G 3CCQV 4CZZA 2IJIA 3E86A 3VOUA 1YITV 2BOBC 1NH2D 3OAAG 1V54C 4PA6A 3STLC 4ASUG 1KD1W 1EBOA 3OR6C 4R50A 2Y48A 3RVZA 1V55B 4PDLA 3OFNG 3ABTA 2IU3A 2IU0A 1FS0G 1WLEA 1NKDA 3K04A 1W0JG 1MG1A 3K79A 1K73W 1GKFA 2X6CA 1S72V 1OCCC 2DWEC 4RUFA 1VQ8V 1QR9A 3K06A 1N8RW 3IC7A 4HZ3A 5IYCO 2B1IA 4XDKA 4PDVA 3E83A 4WFAV 1KKDA 3CP1A 3CCSV 2ZXWC 5CBHA 1VQLV 3AG2C 2DQ0A 1AJPA 4X8AA 4KFMA 1HWYA 2OTLV 1W0KG 2GSMB 1G4YB 2KB1A 1YI2V 3CC7V 1JOYA 2P90A 2LP7A 3F5WC 5L3DA 3ZRWB 2DQ3A 2WLKA 1ORQC 1ROPA 2UXXA 2WLJA 3B8NA 2WLMA 4R7CA 1E1QG 1E1RG 4XDJA 5KA6A 1DF5A 5E1AC 4Z1MG 3JD4A 2HLDG 2PI4A 4GT1A 2ZDIC 2HKOA 5L3FA 2OCCC 1AI7A 1ENVA 3ETEA 1PNMA 4MVZA 3OUSA 3LUTB 2DWDC 2MK3A 3SYQA 1H8EG 1S5HC 2WLNA 5KA5A 1L1FA 3F7VC 3SPHA 1R3IC 4PA4A 2YSUB 2Q68A 3AG4B 4QNHB 3CCEV 1V54B 3FKSG 1FXHA 5CMUA 4MT8A 1V55C 3E2EA 4LBEC 3TK1A 1K4DC 3AG3B 3AEIA 3AG1B 3W7SA 1I5YA 2JIZG 2AHZA 4MW3A 3E8HA 4RO2A 1KP3A 4GX0A 1QR8A 3OMAB 5C93A 2WAMA 1FFTB 1RPOA 2EIMB 4BAYA 4N23A 1SETA 3MD0A 1DF4A 3LDCA 1GMGA 4JTAB 3CMAV 1M57B 3ZN0A 4E2LA 2Y69B 3JCZA 4FPPA 2YEVB 4WFEA 3OUFA 2V7QG 2XAGA 5IYDO 1Q82W 2QTOA 3EHBB 1OCRB 3CCMV 3K08A 4Q20A 5B1BB 3FYEB 2M7WA 4RUEA 5GW7A 1PL0A 3CXCU 3JD1A 1NVPB 1VQKV 1TUEB 3QO7A 5EK0A 3TETA 2HFEC 2WWWA 1YTFD 1BL8A 1AR1B 1JQ0A 1FXKA 4XDLA 4JYBA 2WLLA 3MHHC 1M56B 4QPJA 1K92A 4GX5A 3X2QB 1BHAA 1F4MA 4RQEA 2NNUA 4GX1A 3G71V 2WLLB 3ZMVA 4X89A 3AG4C 5EBLC 1SERA 3IGAC 1GK9A 3EFFK 4I9WA 3FB5C 4J9ZB 3SYAA 1DLBA 3ABKB 3RVYA 3AG3C 5L3GA 3AG1C 1JVMA 4LP8A 1ZWIC 2BOCC 4U7NA 2EIJB 4WFFA 4WF9V 3CMEV 3ZMUA 5CN0A 1KC8W 1NBMG 4UUJC 1B6QA 1SRYA 1NQTA 3GB7C 2XASA 1GM8A 1CP9A 1Q81W 4JTDB 3E8BA 3T2MA 2EIMC 4LC1A 3QO8A 1P4RA 4HAMA 3B77A 4MVMA 3CCVV 1PNKA 4MW8A 1M57C 5H9CA 1QVFU 2XAHA 2Y69C 2B1GA 1VQ5V 1CPYA 3QO5A 1OCZB 4TWKA 3ZRXA 3OE7G 2IH3C 1K8AW 4H33A 2QKSA 4RAIA 2P7TC 4P9PA 4P30A 1OCRC 4LCUC 1EZJA 5FL7G 5BZBA 2DW4A 4L87A 5B1AB 5B1BC 2Q6AA 1YJWV 1Q7YW 4EKWA 4KP4A 4QE7A 1Q86W 2JEUA 5CBGA 4N21A 3G6EV 1YSCA 2Q67A 2QEXV 4MSWC 3OMIB 4WFGA 2C2AA 4PA9A 4G2KA 2EINB 4PA7A 5LBQA 3GWOA 3SPCA 3BY6A 1PKXA 1R3JC 3SPGA 3HB3B 5IY5B 2FTKA 2IJJA 1M56C 4JF3A 1YJNV 2D3OW 3X2QC 1R3LC 2R9IA 1E79G 2WLIA 5HFLA 2UXNA 2JEXA 1AI6A 1RM1C 4U7OA 1XL6A 3UM7A 4BW5A 1QLEB 3K03A 4RQFA 4MTGA 1JX9A 1OZ0A 1J95A 1F23A 3CC4V 3ABKC 4WCEV 5EC1C 2HG5C 4JASA 1VQ6V 2EIJC 4QE9A 1M1KW 2ITDC 3FB8C 1K7DA 3F7YC 3ETGA 1BMFG 1K5SA 2P67A 1VQMV 1YJ9V 2OT5A 4MTFA 4MVRA 4X88A 3M99B 3D36A 2Z3YA 2A9HA 1KECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EK0 A;  3TET A;  4R6Z A;  2HFE C;  2R9R B;  1BL8 A;  3JYC A;  3K04 A;  3ZRS A;  4P2Z A;  3SYC A;  4XDL A;  2A79 B;  2WLI B;  3STZ C;  1OCZ C;  2X6C A;  3OR7 C;  3SYP A;  1OCC C;  1P7B A;  2DWE C;  2WLL A;  4RUF A;  4F4L A;  1R3K C;  4GX5 A;  3SPI A;  4DXW A;  3K06 A;  3E8G A;  3RW0 A;  4GX1 A;  4HZ3 A;  2WLL B;  2A0L A;  4X89 A;  3AG4 C;  4XDK A;  5EBL C;  5B1A C;  4PDV A;  3E83 A;  3IGA C;  3SJQ C;  1KKD A;  3ABM C;  3EFF K;  2EIK C;  4MVO A;  2ZXW C;  4I9W A;  3SPJ A;  3AG2 C;  5CBF A;  3FB5 C;  5CBH A;  4J9Z B;  3SYA A;  5KUK A;  3SYQ A;  3ASO C;  4X8A A;  3RVY A;  3AG3 C;  4KFM A;  3AG1 C;  1JVM A;  4LP8 A;  1ZWI C;  2BOC C;  4PDR A;  4WFF A;  1G4Y B;  2KB1 A;  2IH1 C;  2NLJ C;  2EIN C;  2JK5 C;  4R8C A;  3WG7 C;  3F5W C;  4UUJ C;  5KUM A;  1XL4 A;  3K0D A;  2WLK A;  4MVS A;  1ORQ C;  3GB7 C;  4J9Y B;  4PA3 A;  5IY5 C;  2WLJ A;  4MVQ A;  2WLM A;  4MVU A;  2H8P C;  4R7C A;  4G27 B;  4JTD B;  3E8F A;  3E8B A;  3T1C A;  4XDJ A;  3HPL C;  3T2M A;  2EIM C;  5E1A C;  3OGC C;  2HJF C;  4MVM A;  3T4Z A;  2ZD9 A;  3PJS K;  4MW8 A;  1M57 C;  2ITC C;  2Y69 C;  5B3S C;  1QLE C;  2OCC C;  1OCO C;  4CBC A;  3LNM B;  4MVZ A;  3ASN C;  3OUS A;  4TWK A;  3LDD A;  2IH3 C;  3ABL C;  3LUT B;  4H33 A;  2DWD C;  2YEV A;  2QKS A;  4RAI A;  2P7T C;  4P9P A;  2WLN A;  1S5H C;  4P30 A;  3RBZ A;  2DYR C;  1OCR C;  2Q69 A;  3F7V C;  4LCU C;  1R3I C;  4PA4 A;  3SPH A;  4ZBM A;  5BZB A;  5B1B C;  2Q68 A;  4HYO A;  2HVK C;  2Q6A A;  4PDM A;  3SYO A;  4QNH B;  4EKW A;  3FB6 C;  4QE7 A;  3ZJZ A;  1V55 C;  4JTC B;  3FB7 C;  3K0G A;  4P9O A;  4WFH A;  5EBW C;  5CBG A;  4MS2 A;  4OXS A;  3R65 A;  2AHY A;  5EBM C;  2Q67 A;  1K4D C;  4MSW C;  4WFG A;  2EIL C;  2AHZ A;  4PA9 A;  4MW3 A;  3KG2 A;  4PA7 A;  3E8H A;  3SPC A;  3IFX A;  1R3J C;  4RO2 A;  3SPG A;  4GX0 A;  1M56 C;  2DYS C;  5EC2 C;  1R3L C;  3X2Q C;  2WLI A;  3TCU A;  1K4C C;  4G28 B;  5J9P C;  3UKM A;  3LDC A;  2X6B A;  2K1E A;  2HVJ C;  2ATK C;  3T4D A;  4JTA B;  1XL6 A;  4H37 A;  3UM7 A;  4BW5 A;  4WFE A;  3OUF A;  3LDE A;  3K03 A;  4MTO A;  2WLH A;  3BEH A;  4MTG A;  1J95 A;  2QTO A;  3ABK C;  2X6A A;  5EC1 C;  2HG5 C;  2EIJ C;  4QE9 A;  2ITD C;  3FB8 C;  3E86 A;  3VOU A;  3E89 A;  3F7Y C;  3K08 A;  2BOB C;  1LNQ A;  1V54 C;  4PA6 A;  3STL C;  4RUE A;  3OR6 C;  4GX2 A;  4MTF A;  4MVR A;  2W0F C;  4R50 A;  4X88 A;  4PDL A;  3RVZ A;  2A9H A;  4LBE C; 
#chains in the Genus database with same CATH topology
 4EB6 A;  1YF2 A;  3UT5 B;  2UXD O;  2EIL B;  4CC5 A;  3ZRS A;  4DV4 O;  2BSK B;  4YJ3 B;  4BIZ A;  3OR7 C;  2XAF A;  1PP9 H;  3E8G A;  4U3J B;  4X62 O;  3CCR V;  5LMU B;  1FFX A;  1MA1 A;  4UCS A;  2JGU A;  5KX5 A;  2EZP A;  1P7G A;  4I0X A;  1NR1 A;  1FXV A;  1S5L Z;  1CXZ B;  3LSS A;  3A2F A;  2JK5 C;  5LOV A;  1IX9 A;  4J9Y B;  3W7X A;  4X1K A;  1G1X B;  3P3N A;  1Q6H A;  1YCI A;  1L0L H;  1QLE C;  4JI8 O;  3QF7 A;  3FX7 A;  5LP6 A;  3D3I A;  2E5L B;  3K5N A;  4BIU A;  1YIJ V;  2ZE5 A;  5D5P A;  3OEH G;  4UVC A;  4B3M B;  1GH6 A;  2LGQ A;  4ZKI A;  1H2S B;  3UO2 A;  1N4C A;  3ZJZ A;  4X1Y A;  3T1H B;  4TT3 G;  3A0R A;  3R65 A;  3ASO B;  5EBM C;  5L3E A;  1K34 A;  4D7T A;  5H6Q A;  3RYF A;  1N36 B;  4AIL C;  4QPK A;  1IUR A;  3NXS A;  1EN4 A;  3I56 V;  3N2K A;  1LR1 A;  2LFS A;  1NTM H;  3K9S A;  1NJI W;  2RJZ A;  5DM6 V;  5B3S B;  1MZE A;  5LYJ A;  1NR7 A;  4PEL A;  4TV9 B;  2WA3 A;  5JCO A;  4OX9 O;  4U3F H;  2OTJ V;  3ASN B;  2JJ1 G;  3E35 A;  4I50 B;  1M4U A;  3W7T A;  3B09 A;  4DV1 O;  4GX2 A;  3T1Y B;  2W0F C;  3J7A U;  4B3R B;  3A0B Z;  1H2G A;  1JA8 A;  1AJQ A;  1FXK C;  3OGI B;  2XAQ A;  1AI5 A;  2WLI B;  3J80 N;  3SPI A;  3JD3 A;  4O4L A;  1H2L A;  2A0L A;  2VQE B;  3C3T A;  1WN7 A;  3WB2 A;  5CBF A;  3DC5 A;  1XHX A;  4I5S A;  1J5E B;  4K8X A;  5JJE B;  4O2A A;  5IYB O;  3CRA A;  4B3M O;  1XDC A;  3JSN A;  1AIL A;  4PHZ A;  1XL4 A;  3K0D A;  1WB7 A;  5K1P A;  3T1H O;  1ZUQ A;  4MVQ A;  1SQG A;  1Q3E A;  1K33 A;  1PD3 A;  3T4Z A;  2ZD9 A;  3L9D A;  4YIO A;  2QM4 A;  5L3C A;  1OCO C;  1N36 O;  3LNM B;  4YJ2 A;  1XNR O;  2P5O A;  1OCC B;  2JGD A;  3JAS A;  1US6 A;  4ZBM A;  4TSF G;  2HVK C;  1XNQ O;  4KUM A;  2Q4P A;  3AG2 B;  1FD9 A;  2W6I G;  4UXN A;  1QQC A;  4UV8 A;  2EX3 A;  1OV9 A;  4JPR A;  3BA8 A;  4GCZ A;  2ETN A;  5HFM A;  5LMN O;  3IFX A;  3T1Y O;  3OEE G;  3DTU B;  3N27 A;  2N05 A;  3CRQ A;  4EFE A;  2DE0 X;  1UPG A;  3HKD B;  5J9P C;  4BIO A;  3CJH A;  5GON B;  3D3Q A;  4O2B A;  3CCQ V;  1SQB H;  2VQE O;  3OAA G;  2QSA A;  4DV0 O;  4GYC B;  3BCC H;  4B3S B;  4LF7 O;  1ZX3 A;  4DUY B;  4IYI A;  1NKD A;  1N33 B;  3K04 A;  4JI5 B;  2AW9 A;  2UUB B;  1K73 W;  1ZL8 A;  2X6C A;  2DWE C;  4RUF A;  2KKW A;  1LUV A;  3CCS V;  2ZXW C;  1VQL V;  1XIL A;  2DQ0 A;  5DEC A;  1Q5O A;  2F95 B;  4IHJ B;  3RYI A;  4X66 O;  2GTA A;  3AK2 A;  1JOY A;  2KG7 A;  4TOI A;  3ZRW B;  2GTS A;  5F2V O;  1ORQ C;  4AI8 A;  2YID A;  2WLM A;  3O65 A;  1N0N A;  4LWS B;  2QTS A;  5LP6 C;  3JD4 A;  1N34 B;  3PN1 A;  3F5T A;  5L3F A;  1GAX A;  4GZR B;  3ZS8 C;  4NKG B;  3IAY A;  4J41 A;  3FAV A;  3LUT B;  2ZNI A;  2WLN A;  4NYK A;  5KA5 A;  4UCV A;  5KAI Z;  3HKE B;  1FYJ A;  4TQF A;  1T5E A;  5CMU A;  4I55 B;  4LR3 A;  5TIS Z;  5EYP B;  3TK1 A;  4DV2 B;  2ZM6 B;  1I5Y A;  2E75 B;  1KU9 A;  1DGS A;  2HJD A;  3CX5 F;  4B3S O;  1SQX H;  5KHI A;  4UB8 Z;  4DUY O;  4BAY A;  2QGN A;  5FPR A;  2CTW A;  4JZG A;  5JCO C;  4JTA B;  3CMA V;  4JI5 O;  4DR4 B;  2UUB O;  2Y69 B;  2WA4 A;  2YS8 A;  4ZHQ A;  2LO1 A;  1BT8 A;  3EHB B;  4LFC B;  1SA0 B;  1HNZ B;  5GW7 A;  4FLX A;  1PL0 A;  2Y4U A;  5JVD A;  4PJ0 Z;  1TUE B;  2ZCE A;  5BR8 B;  2WWW A;  1BE3 H;  1TUB B;  4K0K B;  4JYB A;  3X2Q B;  1F4M A;  1KBH A;  3G71 V;  3AG4 C;  1AP5 A;  3DXR A;  4U7N A;  1ZWI C;  3VQV A;  3ZMU A;  4C7U A;  5CN0 A;  5JQG A;  2XAS A;  3CRR A;  3JAW A;  1I08 A;  4JTD B;  4DV2 O;  3QO8 A;  4IL6 Z;  3B77 A;  4O4I B;  1PNK A;  2YXL A;  5H9C A;  4D7S A;  2XAH A;  1KMI Z;  1CPY A;  2OYQ A;  2XUM A;  3QO5 A;  2IH3 C;  1K8A W;  4H33 A;  3HKB A;  3BAA A;  4DR4 O;  1VF7 A;  2RDC A;  5B1B C;  4ZOL B;  4QE7 A;  4H13 B;  4I9Q A;  2Q8V A;  1YSC A;  4K3A A;  4WFG A;  1B3Q A;  1R3J C;  1HNZ O;  4IIJ A;  1M56 C;  1YJN V;  2D3O W;  1E79 G;  2N74 A;  1O9H A;  2HP8 A;  5HFL A;  5BR8 O;  3K59 A;  4I4T B;  4K0K O;  3K03 A;  1IZ3 A;  4RQF A;  4MTG A;  3CC4 V;  1J95 A;  1F23 A;  3ABK C;  5EC1 C;  2HG5 C;  1VQ6 V;  2ITD C;  2BTO A;  3FB8 C;  2Z0A A;  3ETG A;  1K5S A;  3LNN A;  4MTF A;  2F4V B;  4LBE C;  1KEC A;  4UCO A;  3SJC C;  2YIB A;  2IJH A;  3L73 H;  2R9R B;  1GN2 A;  2W0X A;  3WFV A;  3JSL A;  3JAT A;  3H01 A;  1VP7 A;  1OCZ C;  1SES A;  3K58 A;  1BS3 A;  4DXW A;  2CTR A;  2GHY A;  3RW0 A;  2KQX A;  1XMQ B;  5CA3 A;  1AI4 A;  1F4N A;  3HKC B;  5LHH A;  3H1H H;  3JAR B;  2CAZ C;  1G8M A;  4FLV A;  4FFB B;  4FFK A;  1D2D A;  2NLJ C;  4JGS A;  4X20 A;  4DR1 B;  1QHT A;  1VF5 B;  5LGT A;  4ZIB A;  1F51 A;  4CS2 A;  5B1N A;  3VBB A;  3K9A A;  3ZN1 A;  1K3E A;  3PJS K;  3A8T A;  4DO2 A;  1YEW A;  1EFR G;  4DRX A;  3KCY A;  5LA6 B;  1MOF A;  2V4D A;  4JI1 B;  2WSS G;  3ZX6 A;  2Q69 A;  1K5Q A;  2F1M A;  1H38 A;  4GUN A;  2UXD B;  3SYO A;  3U10 A;  5BMV B;  3ABM B;  2EIK B;  3K0G A;  4LF6 B;  4MS2 A;  5FNV A;  1NVP D;  2AHY A;  1Y66 A;  2HEP A;  4HBN A;  3CD6 V;  4X62 B;  1JFF A;  5J2T A;  1GO3 F;  4F6R A;  3WG7 B;  2JJ2 G;  3M7M X;  1M5I A;  2F4V O;  5GTH Z;  3CC2 V;  4MTX A;  4DUZ O;  3K57 A;  2QA4 V;  3FYI B;  3OT7 A;  1GN3 A;  1WB8 A;  4FJC C;  1RSO B;  1VAR A;  3Q4H A;  4LF5 O;  3BEH A;  5L3B A;  2B5U A;  1ZSP A;  3L75 H;  4JI7 B;  3ABL B;  1Y76 A;  2UU9 B;  1JPX A;  5LXT B;  1XMQ O;  1X59 A;  2DYR B;  1FPO A;  2ZR2 A;  4DV5 O;  2CUG A;  2P6J A;  3ZHT A;  1VQ4 V;  3ZIA G;  4WBN B;  2CH7 B;  4GKJ B;  5H2F Z;  3SGI A;  3ZMZ A;  1B06 A;  4R6Z A;  2A7W A;  4DYL A;  2A79 B;  3SYP A;  1BHB A;  1P7B A;  4JI3 B;  2X0L A;  5C8Y A;  2GV9 A;  1R1B A;  2Y0P A;  3RGB A;  3RYH A;  4JI1 O;  3ZMS A;  5B5E Z;  1SQQ H;  4BW9 A;  3G80 A;  2KSD A;  5KUM A;  3L74 H;  2X7R B;  3WU2 Z;  4LF6 O;  3KKY A;  4MVU A;  2H8P C;  4OX9 B;  2OWO A;  1ZLZ A;  3E8F A;  3T1C A;  1PPJ H;  5KMG A;  4YXW G;  3OGC C;  4J10 A;  1XEQ A;  2ITC C;  1HW7 A;  4D6T H;  2PTM A;  2LFR A;  4DV1 B;  1AVM A;  2RNB A;  2DJV A;  4DR3 O;  3N2G A;  2YEV A;  3RBZ A;  1WNS A;  2QR4 A;  3RFR A;  2JGD B;  4WFH A;  2ZR3 A;  5EBW C;  4O4H B;  4J7Z A;  3M8A A;  2D2C B;  4JI7 O;  4Z2W A;  2ZT9 B;  2UU9 O;  1OJH A;  4QJF B;  1N0J A;  3E22 A;  1SQP H;  2CTP A;  2DYS C;  2XTA A;  4GKJ O;  2GUZ A;  4G28 B;  3UKM A;  2HVJ C;  5ITZ A;  3T4D A;  5JJN B;  1SZT A;  1PL4 A;  1XOU A;  4KHP B;  1QCE A;  5CA0 B;  3JD2 A;  4PD4 F;  4JI3 O;  3OTO B;  4LH7 A;  4CZZ A;  2BOB C;  3UCS C;  4PA6 A;  3STL C;  1XUQ A;  3CSX A;  1KD1 W;  1V55 B;  4PDL A;  1XNR B;  2DOS A;  3OFN G;  2PYL A;  1FS0 G;  4PV1 B;  2NN4 A;  1SF9 A;  1MG1 A;  3K79 A;  1GKF A;  1XNQ B;  1S72 V;  1QR9 A;  4HZ3 A;  1KKD A;  3E83 A;  5LMN B;  3CP1 A;  2P06 A;  5CBH A;  1AJP A;  1HNX B;  2FB5 A;  4X8A A;  4O4J A;  1HWY A;  3RWR D;  1EN6 A;  2KB1 A;  1YI2 V;  5IE9 A;  2ZNJ A;  4PI2 A;  1R6T A;  3JAK A;  2UUA B;  3B8N A;  4JZ2 A;  3QTC A;  4R7C A;  4YIP A;  3H1K H;  5IJ0 A;  1KUQ A;  1FJG O;  3RN4 A;  1Q6U A;  2HLD G;  4TUY B;  2AZ0 A;  2A06 H;  5IYZ A;  2OCC C;  4DV0 B;  1ENV A;  3ETE A;  2F66 C;  2FYU H;  4LF7 B;  3SYQ A;  1H8E G;  1S5H C;  4JYA B;  1L1F A;  3SPH A;  4QNH B;  4KHP O;  4MT8 A;  3E2E A;  1XMO O;  3OTO O;  5JH7 B;  1K4D C;  3AEI A;  1QU7 A;  3AG1 B;  2JIZ G;  2BCC H;  4L8J A;  3MDS A;  1FAF A;  5IJ9 B;  2ADQ B;  1WP8 A;  3E8H A;  3RYC B;  4FM2 A;  1KP3 A;  3UT5 A;  4DW1 A;  1QR8 A;  1WA8 A;  2BSK A;  2WAM A;  4YJ3 A;  1D5A A;  1SET A;  5EIB C;  4X66 B;  4JAA A;  3BA9 A;  1M57 B;  4FPP A;  2QWP B;  4WFE A;  3OUF A;  1Q82 W;  3CWB H;  3TGU H;  3G67 A;  2RMK B;  3CCM V;  2DN9 A;  4Q20 A;  1HNX O;  1NVP B;  1VQK V;  2HFE C;  1YTF D;  1AR1 B;  1BZK A;  2UUA O;  3K5O A;  2WLL A;  4FM1 A;  1K92 A;  4GX5 A;  2P4K A;  2P22 C;  2BTQ B;  3ZMV A;  1VQO V;  4B08 A;  3AG3 C;  1JVM A;  4JYA O;  4WFF A;  4B3T O;  3JAL A;  4HNA B;  1KC8 W;  4UUJ C;  4NXM B;  1SRY A;  2CDY A;  1NQT A;  3GB7 C;  4JI4 B;  4EFB A;  1GM8 A;  1CP9 A;  1SC5 B;  3E8B A;  4J7J A;  2O57 A;  4LF8 B;  2EIM C;  4LC1 A;  1P4R A;  3S3X A;  5BY1 A;  3O9O A;  1IDS A;  3CRM A;  2E76 B;  3ZRX A;  3OE7 G;  4FM0 A;  4FLT A;  2E74 B;  4P30 A;  4TV9 A;  2ZKO A;  1OCR C;  1HNW B;  4LCU C;  5FL7 G;  4I50 A;  4CH4 A;  5CB4 B;  4EKW A;  4ZI7 B;  2RCV A;  2JEU A;  3FFQ A;  5CBG A;  1NTK H;  3G6E V;  2R70 A;  1V9P A;  4MSW C;  3APO A;  4PA9 A;  4JI2 B;  2PF4 E;  3SPC A;  1PKX A;  3SPG A;  2FTK A;  4CH5 A;  1R3L C;  5BXZ A;  1U97 A;  2WLI A;  4E4E A;  2JEX A;  3CHX A;  3UM7 A;  1QLE B;  2YIA A;  3BHP A;  1JX9 A;  1OZ0 A;  4WCE V;  2EIJ C;  4BWA A;  2PUS A;  3TXQ A;  1K7D A;  1M93 A;  1BMF G;  3CRC A;  1XHZ A;  1VQM V;  2UXC B;  2BE3 A;  2CGN A;  2GBO A;  4MVR A;  3D36 A;  2A9H A;  5B66 Z;  3ZED A;  1SS3 A;  3H1L H;  4X9Q A;  2H3O A;  4NXM O;  4P2Z A;  4JI4 O;  4TV8 B;  4LF8 O;  5H6R A;  5H5N A;  4J11 A;  2AGA A;  5B1A C;  1SQF A;  1Y4M A;  4QGP A;  3GWK C;  1QVG U;  2N04 A;  5KUK A;  2ZE6 A;  1X4T A;  3H1I H;  2XND G;  4PDR A;  1HNW O;  2EIN C;  4MVS A;  2PI5 A;  5IY5 C;  3ML0 A;  3ZHR A;  2NR5 A;  4YHH O;  2IJK A;  1AJN A;  1FXK B;  5B1O A;  1S77 D;  4JI0 B;  1QLN A;  4JI2 O;  1K9M W;  5KAF Z;  3ABU A;  3HKD A;  5K1X A;  3BPZ A;  1WPX A;  4UV9 A;  2QM7 A;  3P30 A;  1NS1 A;  2ZDI A;  4FK5 C;  3B8M A;  5GON A;  1FKA O;  1KKC A;  3FB6 C;  1KB9 F;  1XQ8 A;  1UFI A;  5CA1 B;  1NT2 B;  3CCL V;  2EIL C;  3LSQ A;  4X64 B;  1GN4 A;  2UXC O;  1W2B U;  3CXH F;  3HR0 A;  1KQS U;  4DV7 B;  1JCH A;  1WP7 A;  1K4C C;  4X1I B;  2ATK C;  2F43 G;  4KXR A;  3G6B A;  1AB3 A;  4H37 A;  4RWU A;  5DED A;  5IDJ A;  1OCO B;  3JCU Z;  1Z5V A;  2JS3 A;  1TVK B;  1ARO P;  1GRJ A;  2R9A A;  5EZY B;  1HDJ A;  5J2U B;  1LNQ A;  4IHJ A;  1R6K A;  4KL1 A;  1VF6 A;  5KLV H;  1IXM A;  2UXB B;  3ZRW A;  2LQT A;  5JWP A;  1VQ9 V;  1Q43 A;  1Y74 A;  4CS3 A;  4JV5 B;  4LWS A;  1VQN V;  2PYJ A;  1R73 A;  4CH3 A;  4LNU B;  1Y6X A;  2JDI G;  1H2M A;  3I55 V;  4JI0 O;  3UQ8 A;  2WPD G;  3DGE A;  4MVO A;  3HKE A;  2AZ2 A;  1W59 A;  3ASO C;  4J42 A;  4I55 A;  2Q0A A;  3LSU A;  2IW5 A;  2H94 A;  4UCT A;  2OIG A;  2IH1 C;  1EZV H;  4DUZ B;  5EYP A;  2ODM A;  4EB6 B;  1PNL A;  4QIW F;  4G27 B;  1XBL A;  4LF5 B;  1IVS A;  2XT9 A;  2Q5Z A;  2YI9 A;  4JAU A;  3CYO A;  4X64 O;  1YTF B;  3ZCC A;  3EXA A;  4DV5 B;  5B3S C;  5KHH A;  4CBC A;  1MSW D;  2EJR A;  3ASN C;  1H2K A;  4FIP C;  4DV7 O;  1RFY A;  3ZHU A;  1FFX B;  4B7E A;  1M9N A;  1THZ A;  5KX5 B;  4PDM A;  4HYO A;  3MHS C;  5LHI A;  4I0X B;  2ZXW B;  3UO3 A;  1SA0 A;  1MAB G;  1I5X A;  1GM9 A;  5LOV B;  3OMN B;  1L0N H;  4X1K B;  3OM3 B;  4W4K A;  3SJB C;  4DV6 B;  2UXB O;  2OCH A;  1UJW B;  5EC2 C;  1TUB A;  4Q6G A;  5IT9 N;  3G4S V;  1VQP V;  5LP6 B;  2K1E A;  4NVP A;  4JV5 O;  1CEZ A;  1HP8 A;  4MTO A;  3ETQ A;  4LFB O;  1JMK C;  1YHQ V;  3JD0 A;  2X6A A;  2QE7 G;  3WB0 A;  2IJI A;  3E86 A;  2F93 B;  3ZHV A;  3J81 N;  4X1Y B;  3D36 C;  1NH2 D;  3APQ A;  4ASU G;  4LF9 B;  3GVM A;  1SKV A;  2A3Q A;  3OR6 C;  4R50 A;  3RVZ A;  2Q73 A;  3SJA C;  2EJ7 A;  2IBZ H;  3VQY A;  1JR9 A;  1U96 A;  3RYF B;  3TJT A;  3ABT A;  4DR3 B;  1WLE A;  2AXT Z;  3N2K B;  1EM1 A;  1OCC C;  1VQ8 V;  3K06 A;  3DC6 A;  1N8R W;  2B9Z A;  2QKA A;  5LYJ B;  4WFA V;  2G38 A;  3AG2 C;  2F23 A;  4ZOL A;  2Y4T A;  2RQ6 A;  1W0K G;  5LL6 Y;  2P90 A;  3BRC A;  2DQ3 A;  3AK1 A;  1VMG A;  2ADP A;  1E1R G;  1DF5 A;  5IWA B;  2PI4 A;  4GT1 A;  2ZDI C;  2HKO A;  3QVN A;  4DV6 O;  4OGQ B;  4MVZ A;  3OUS A;  4O4L B;  2DWD C;  4I4T A;  1H2N A;  3D8C A;  3F7V C;  1R3I C;  2YSU B;  2Q68 A;  3AG4 B;  2FL4 A;  3CCE V;  4NB5 A;  1V54 B;  4O2A B;  1FXH A;  4DR2 O;  2K9P A;  4LFA B;  4LF4 B;  4AQY O;  2AHZ A;  4MW3 A;  4LF9 O;  3K5M A;  4RO2 A;  3OMA B;  1BQ0 A;  1FFT B;  1RPO A;  4N23 A;  3LDC A;  1GMG A;  1WA8 B;  4YJ2 B;  3ZN0 A;  4E2L A;  3JAS B;  2QDO A;  3HKC A;  1ZAU A;  3JAR A;  1XI1 A;  3BAB A;  1VF6 C;  5AG2 A;  4AHC A;  2JRI A;  1FJG B;  1YDX A;  4FFB A;  5B1B B;  3FYE B;  4UB6 Z;  1BQZ A;  3CXC U;  2YIB D;  3JD1 A;  2GDS A;  1I7F A;  1WPB A;  1Y67 A;  5GTI Z;  3KCX A;  4DK0 A;  2Q0O C;  3WB1 A;  1M56 B;  4QPJ A;  5LA6 A;  3CJH B;  1XMO B;  5IWA O;  4YY3 O;  1YXB A;  2NNU A;  4GX1 A;  2WLL B;  3FD9 A;  1SER A;  3IGA C;  4O2B B;  1GK9 A;  3EFF K;  4J9Z B;  3ABK B;  5BMV A;  5L3G A;  2BOC C;  3CME V;  4WF9 V;  4K8Z A;  2HHH B;  3CE2 A;  1NBM G;  1B6Q A;  3JAL B;  4FLU A;  1VEW A;  2ZIO A;  2P4V A;  2Q9L A;  3BFR A;  4J7K A;  3T2M A;  4LFA O;  4LF4 O;  1ZL8 B;  1QVF U;  2Y69 C;  2B1G A;  1VQ5 V;  4H44 B;  4LH6 A;  3RT3 C;  1OCZ B;  4TWK A;  1RSO A;  3B2E E;  1B04 A;  4P9P A;  3U11 A;  3OD4 A;  2CTQ A;  3VQW A;  2DW4 A;  4L87 A;  2LJ2 A;  1Q7Y W;  3AK3 A;  5LXT A;  1L8D A;  4KP4 A;  3RYI B;  4Z1V A;  1JJO A;  4PI0 A;  4N21 A;  2KG7 B;  1PV0 A;  3OMI B;  4WBN A;  2C2A A;  5LMU O;  2CH7 A;  4G2K A;  4PA7 A;  4GKK B;  4EEQ A;  3GWO A;  3BY6 A;  4OPH A;  3X2Q C;  2UXN A;  5EIB D;  1ZTE A;  1AI6 A;  4B3T B;  4U7O A;  3FAV B;  1XL6 A;  4BW5 A;  3S3W A;  4ABM A;  2R72 A;  3H1J H;  1IBK B;  4GLX A;  4IT5 A;  1BGY H;  3H9V A;  2P67 A;  2E5L O;  2Z3Y A;  2RN9 A;  2YUA A;  1I94 B;  2VS0 A;  2HHH O;  2XAJ A;  3JYC A;  4DR7 B;  4X65 B;  3CPW U;  4U3J A;  1COW G;  3STZ C;  2QWN B;  4WFB V;  5KHJ A;  2YXY A;  2YXH A;  1GN6 A;  1S76 D;  4F4L A;  5E79 Z;  1R3K C;  1LUW A;  2QKC A;  4FMT A;  4FLY A;  4CH6 A;  1AR5 A;  1AP6 A;  3W7W A;  3QNE A;  1VQ7 V;  4ZHQ B;  2EZO A;  2XOK G;  3K5L A;  5LGN A;  3SPJ A;  3CEI A;  1IBM B;  3CCU V;  5A9G A;  4O4H A;  4XBF A;  1NH2 B;  2HR3 A;  1URF A;  5JVD B;  2VWJ A;  3ZRV A;  1M90 W;  1JJ2 U;  3HPL C;  2M6Y A;  2V1D A;  2HJF C;  1S5J A;  2Z5U A;  5LHG A;  4GKK O;  1RM1 B;  1TAE A;  4B3R O;  1MZF A;  1YZB A;  3LDD A;  3OW2 U;  1VIB A;  5CA0 A;  1IBL B;  5FPO A;  4DW0 A;  3DXR B;  4UVB A;  3P3P A;  3ZMT A;  1IBK O;  4J80 A;  4P9O A;  3L71 H;  2LW7 A;  5JQG B;  3KZI Z;  3DSQ A;  3JAW B;  2EBO A;  4JYC A;  3W7U A;  1QBZ A;  1J5E O;  4NXN B;  1I94 O;  2CK3 G;  2EUL A;  3TCU A;  1TA8 A;  3K3W A;  3AG7 A;  1KP2 A;  3QG5 A;  4DR7 O;  4X65 O;  1NI8 A;  2VQF B;  3HKB B;  4NTW A;  4DK1 A;  4YHH B;  4JAV A;  1MMM A;  2L35 A;  4UVA A;  3E89 A;  1Z2G A;  4FZ0 A;  1DTO A;  3U0Z A;  1GTO A;  1IBM O;  3SR2 C;  2QM8 A;  1S3J A;  4FLZ A;  3OTF A;  4IIJ B;  3TXS A;  3SYC A;  3P32 A;  3CS5 A;  1Y74 B;  4TUY A;  1Q6I A;  1SQV H;  2VWK A;  3CCJ V;  2DYS B;  5A2Q N;  1S0V A;  4IYH A;  1K97 A;  4W4L A;  2QJ1 A;  1H8H G;  5DN6 G;  3SJQ C;  4DR5 B;  2XHB A;  2JVD A;  3ABM C;  2EIK C;  5D5Q A;  1O9G A;  3VQX A;  1IBL O;  2YIC A;  2Q7G A;  2ZQM A;  5JH7 A;  2LGW A;  4R8C A;  3WG7 C;  1I0H A;  4PA3 A;  5IJ9 A;  1OHH G;  1R6N A;  2W6J G;  3RYC A;  3JAT B;  1G6U A;  1BSM A;  3JAM N;  4NXN O;  2ILM A;  1Q90 D;  3ABL C;  3ETD A;  2ZIN A;  4H0L B;  3EVK A;  1NZ6 A;  2DYR C;  4NTX A;  3IC9 A;  4CC6 A;  1N33 O;  4B7K A;  2VQF O;  4JTC B;  3FB7 C;  1WJZ A;  2FKX A;  1RPR A;  2UUC B;  4OXS A;  1QNM A;  5LGU A;  3R66 A;  4DR6 B;  4X20 B;  4NR1 A;  3KG2 A;  5KHK A;  1EN5 A;  2Q7E A;  2QWO B;  1P84 F;  4NTY A;  1GM7 A;  4DRX B;  3C90 A;  1P49 A;  2X6B A;  2LW1 A;  2BTQ A;  2OCC B;  3LDE A;  2WLH A;  4BR6 A;  3VOU A;  1N34 O;  4ICG A;  1YIT V;  1V54 C;  3SDL A;  4DR5 O;  1AR4 A;  5FNV B;  4UFZ A;  1EBO A;  2Y48 A;  4HNA A;  1JFF B;  5J2T B;  2DMX A;  2QWR B;  4F6R B;  2IU3 A;  2IU0 A;  2CGO A;  4FLW A;  3L70 H;  1W0J G;  2ZM6 O;  3IC7 A;  4IGG A;  3Q4H B;  5IYC O;  1NU1 H;  2B1I A;  4JYY A;  3ZHQ A;  4XDK A;  4PDV A;  1Y76 B;  5CB4 A;  1NTZ H;  4ZI7 A;  4KFM A;  1MSD A;  2OTL V;  2MW2 B;  2GSM B;  1G4Y B;  3CC7 V;  1HR0 B;  2LP7 A;  4JI6 B;  3F5W C;  2YI8 A;  5L3D A;  2WLK A;  1ROP A;  2UXX A;  2WLJ A;  1BCC H;  2UUC O;  4LFB B;  1E1Q G;  5KA6 A;  4XDJ A;  5E1A C;  2PY5 A;  4LFC O;  4DR6 O;  4A5U B;  4F6E A;  4Z1M G;  1D5N A;  2QWQ B;  1AI7 A;  1DK1 A;  1PNM A;  2ZIM A;  2YDE A;  3B40 A;  1PM9 A;  2MK3 A;  5C8Y B;  4PA4 A;  3RYH B;  3BVO A;  3THO A;  3FKS G;  1V55 C;  3AG3 B;  3W7S A;  1SZX A;  3IJ4 A;  1IXB A;  5KMG B;  4GX0 A;  4CS4 A;  3B4S A;  1RP3 B;  3ZBH A;  5C93 A;  2EIM B;  4UCU A;  4TV8 A;  3MD0 A;  1DF4 A;  2L6L A;  1TGO A;  3JCZ A;  3N2G B;  3ICX A;  2YEV B;  2V7Q G;  2XAG A;  5IYD O;  1N32 B;  2QTO A;  2Q7H A;  1OCR B;  1KYO F;  2IM9 A;  3K08 A;  2M7W A;  4RUE A;  2Y0I A;  2VRZ A;  3E22 B;  3QO7 A;  5EK0 A;  3TET A;  2ZE8 A;  1HR0 O;  1BL8 A;  4JI6 O;  1JQ0 A;  1FXK A;  4XDL A;  2GUZ B;  3MHH C;  5ITZ B;  2JS5 A;  1BHA A;  4RQE A;  4DR2 B;  3CB2 A;  1Z5W A;  2PGG A;  3L72 H;  4OPA A;  5JJJ B;  4AQY B;  4X89 A;  5EBL C;  4I9W A;  4DV3 B;  3FB5 C;  3SYA A;  1DLB A;  4UCR A;  3RVY A;  3AG1 C;  4LP8 A;  2EIJ B;  5CA1 A;  1A32 A;  3C3S A;  4DV4 B;  1Q81 W;  4O4I A;  3NR7 A;  4HAM A;  4MVM A;  3CCV V;  4MW8 A;  1M57 C;  2PZS A;  4X1I A;  2QKS A;  4RAI A;  2P7T C;  2ARH A;  5FLX N;  1TVK A;  1EZJ A;  5BZB A;  5B1A B;  1YJW V;  2Q6A A;  5EZY A;  4O4J B;  5J2U A;  1Q86 W;  1N32 O;  2OIE A;  2Q67 A;  2QEX V;  3JAK B;  4YY3 B;  2EIN B;  4TQD A;  2YC0 A;  5KHG A;  5LBQ A;  4JI8 B;  1MNG A;  4K35 A;  3ZHS A;  3HB3 B;  1YVW A;  2IJJ A;  5IJ0 B;  4JF3 A;  5IY5 B;  3MAQ A;  2R9I A;  1F7Y A;  5IYZ B;  2FML A;  4LNU A;  1RM1 C;  4DR1 O;  1Q8I A;  3I5D A;  2CE4 A;  1WAZ A;  2E3C A;  1XRE A;  4JAS A;  4QE9 A;  1M1K W;  3F7Y C;  2ZE7 A;  3A0H Z;  4FZ1 A;  1YJ9 V;  2OT5 A;  4DV3 O;  4X88 A;  3M99 B;  4FVM A;  4I7Z B; 
#chains in the Genus database with same CATH homology
 2IJH A;  2XAJ A;  2R9R B;  3JYC A;  3WFV A;  2EIL B;  3ZRS A;  3CPW U;  4P2Z A;  3H01 A;  1COW G;  3STZ C;  1OCZ C;  4BIZ A;  3OR7 C;  4WFB V;  2XAF A;  1SES A;  1S76 D;  4F4L A;  1R3K C;  4DXW A;  5H6R A;  2GHY A;  4FMT A;  3E8G A;  3RW0 A;  3CCR V;  5CA3 A;  3W7W A;  3QNE A;  5B1A C;  1VQ7 V;  2EZO A;  1Y4M A;  1AI4 A;  1F4N A;  5LHH A;  2XOK G;  5LGN A;  3SPJ A;  1QVG U;  2EZP A;  5KUK A;  1G8M A;  1NR1 A;  1FXV A;  2XND G;  3CCU V;  4PDR A;  4XBF A;  2NLJ C;  3LSS A;  2EIN C;  4JGS A;  2JK5 C;  1NH2 B;  2HR3 A;  4MVS A;  2PI5 A;  5IY5 C;  4J9Y B;  3W7X A;  5LGT A;  3ML0 A;  3ZRV A;  1M90 W;  1F51 A;  1JJ2 U;  3HPL C;  5B1N A;  3VBB A;  2IJK A;  2V1D A;  3K9A A;  1AJN A;  1FXK B;  2HJF C;  5B1O A;  3ZN1 A;  1K3E A;  3PJS K;  2Z5U A;  4DO2 A;  5LHG A;  1S77 D;  1EFR G;  1QLN A;  1K9M W;  3ABU A;  1RM1 B;  1QLE C;  1WPX A;  1MOF A;  3D3I A;  4UV9 A;  2QM7 A;  3P30 A;  1VQO V;  2ZDI A;  3LDD A;  2WSS G;  4FK5 C;  4BIU A;  1YIJ V;  3B8M A;  3OW2 U;  3OEH G;  2Q69 A;  4UVC A;  1K5Q A;  1H38 A;  4UVB A;  4ZKI A;  3SYO A;  3ZMT A;  3FB6 C;  3ZJZ A;  3ABM B;  2EIK B;  4TT3 G;  3K0G A;  4P9O A;  4MS2 A;  3A0R A;  3R65 A;  3ASO B;  1NVP D;  2AHY A;  5EBM C;  5L3E A;  1Y66 A;  3CCL V;  3CD6 V;  1K34 A;  2EIL C;  3LSQ A;  5H6Q A;  1GO3 F;  2EBO A;  3WG7 B;  4JYC A;  2JJ2 G;  3W7U A;  1QBZ A;  1W2B U;  1KQS U;  4QPK A;  1JCH A;  3NXS A;  3CC2 V;  2CK3 G;  4MTX A;  3I56 V;  3TCU A;  1K4C C;  3K3W A;  2QA4 V;  1KP2 A;  2LFS A;  3FYI B;  2ATK C;  1NJI W;  2F43 G;  4FJC C;  5DM6 V;  4H37 A;  5B3S B;  1NR7 A;  5IDJ A;  1OCO B;  4PEL A;  3BEH A;  5L3B A;  2OTJ V;  2B5U A;  3ASN B;  2JJ1 G;  1ARO P;  3ABL B;  3E35 A;  4JAV A;  1JPX A;  2DYR B;  4UVA A;  3W7T A;  3E89 A;  2ZR2 A;  1LNQ A;  1R6K A;  2P6J A;  4GX2 A;  2W0F C;  1VQ4 V;  1IXM A;  3ZIA G;  1DTO A;  3ZRW A;  1GTO A;  1H2G A;  1AJQ A;  1FXK C;  1VQ9 V;  3ZMZ A;  2QM8 A;  1S3J A;  4R6Z A;  1VQN V;  2XAQ A;  3SYC A;  1AI5 A;  3P32 A;  2A79 B;  2WLI B;  1R73 A;  3SYP A;  1BHB A;  1P7B A;  3CCJ V;  2DYS B;  2X0L A;  3SPI A;  1S0V A;  2JDI G;  3I55 V;  1K97 A;  3JD3 A;  2A0L A;  1H8H G;  5DN6 G;  3SJQ C;  2WPD G;  3ABM C;  3DGE A;  2EIK C;  4MVO A;  5CBF A;  4I5S A;  3ZMS A;  3ASO C;  5IYB O;  2IW5 A;  2H94 A;  2IH1 C;  2ZQM A;  4R8C A;  3WG7 C;  5KUM A;  1XL4 A;  2X7R B;  3K0D A;  4PA3 A;  1PNL A;  1OHH G;  1R6N A;  4MVQ A;  4MVU A;  4QIW F;  2H8P C;  2W6J G;  4G27 B;  3E8F A;  3T1C A;  1K33 A;  4YXW G;  1PD3 A;  3OGC C;  3T4Z A;  2ZD9 A;  4JAU A;  3CYO A;  1YTF B;  2ITC C;  3ZCC A;  5B3S C;  2LFR A;  1OCO C;  4CBC A;  5L3C A;  1MSW D;  2EJR A;  3LNM B;  3ASN C;  4FIP C;  1OCC B;  3ABL C;  3ETD A;  2YEV A;  3RBZ A;  2DYR C;  1M9N A;  1THZ A;  4ZBM A;  4PDM A;  4HYO A;  2HVK C;  3MHS C;  4TSF G;  5LHI A;  4KUM A;  2ZXW B;  4JTC B;  3AG2 B;  3FB7 C;  2ZR3 A;  1MAB G;  1RPR A;  4WFH A;  5EBW C;  4OXS A;  2W6I G;  5LGU A;  1I5X A;  1GM9 A;  4UXN A;  3OMN B;  4UV8 A;  4JPR A;  4GCZ A;  4QJF B;  3OM3 B;  5HFM A;  3KG2 A;  3IFX A;  3OEE G;  2DYS C;  3DTU B;  1UJW B;  5EC2 C;  1GM7 A;  3G4S V;  1VQP V;  4G28 B;  5J9P C;  3UKM A;  2X6B A;  2K1E A;  1CEZ A;  2HVJ C;  3T4D A;  1SZT A;  2OCC B;  1QCE A;  3LDE A;  4MTO A;  2WLH A;  3JD2 A;  1YHQ V;  3JD0 A;  2X6A A;  2QE7 G;  3CCQ V;  4CZZ A;  2IJI A;  3E86 A;  3VOU A;  1YIT V;  2BOB C;  1NH2 D;  3OAA G;  1V54 C;  4PA6 A;  3STL C;  4ASU G;  1KD1 W;  1EBO A;  3OR6 C;  4R50 A;  2Y48 A;  3RVZ A;  1V55 B;  4PDL A;  3OFN G;  3ABT A;  2IU3 A;  2IU0 A;  1FS0 G;  1WLE A;  1NKD A;  3K04 A;  1W0J G;  1MG1 A;  3K79 A;  1K73 W;  1GKF A;  2X6C A;  1S72 V;  1OCC C;  2DWE C;  4RUF A;  1VQ8 V;  1QR9 A;  3K06 A;  1N8R W;  3IC7 A;  4HZ3 A;  5IYC O;  2B1I A;  4XDK A;  4PDV A;  3E83 A;  4WFA V;  1KKD A;  3CP1 A;  3CCS V;  2ZXW C;  5CBH A;  1VQL V;  3AG2 C;  2DQ0 A;  1AJP A;  4X8A A;  4KFM A;  1HWY A;  2OTL V;  1W0K G;  2GSM B;  1G4Y B;  2KB1 A;  1YI2 V;  3CC7 V;  1JOY A;  2P90 A;  2LP7 A;  3F5W C;  5L3D A;  3ZRW B;  2DQ3 A;  2WLK A;  1ORQ C;  1ROP A;  2UXX A;  2WLJ A;  3B8N A;  2WLM A;  4R7C A;  1E1Q G;  1E1R G;  4XDJ A;  5KA6 A;  1DF5 A;  5E1A C;  4Z1M G;  3JD4 A;  2HLD G;  2PI4 A;  4GT1 A;  2ZDI C;  2HKO A;  5L3F A;  2OCC C;  1AI7 A;  1ENV A;  3ETE A;  1PNM A;  4MVZ A;  3OUS A;  3LUT B;  2DWD C;  2MK3 A;  3SYQ A;  1H8E G;  1S5H C;  2WLN A;  5KA5 A;  1L1F A;  3F7V C;  3SPH A;  1R3I C;  4PA4 A;  2YSU B;  2Q68 A;  3AG4 B;  4QNH B;  3CCE V;  1V54 B;  3FKS G;  1FXH A;  5CMU A;  4MT8 A;  1V55 C;  3E2E A;  4LBE C;  3TK1 A;  1K4D C;  3AG3 B;  3AEI A;  3AG1 B;  3W7S A;  1I5Y A;  2JIZ G;  2AHZ A;  4MW3 A;  3E8H A;  4RO2 A;  1KP3 A;  4GX0 A;  1QR8 A;  3OMA B;  5C93 A;  2WAM A;  1FFT B;  1RPO A;  2EIM B;  4BAY A;  4N23 A;  1SET A;  3MD0 A;  1DF4 A;  3LDC A;  1GMG A;  4JTA B;  3CMA V;  1M57 B;  3ZN0 A;  4E2L A;  2Y69 B;  3JCZ A;  4FPP A;  2YEV B;  4WFE A;  3OUF A;  2V7Q G;  2XAG A;  5IYD O;  1Q82 W;  2QTO A;  3EHB B;  1OCR B;  3CCM V;  3K08 A;  4Q20 A;  5B1B B;  3FYE B;  2M7W A;  4RUE A;  5GW7 A;  1PL0 A;  3CXC U;  3JD1 A;  1NVP B;  1VQK V;  1TUE B;  3QO7 A;  5EK0 A;  3TET A;  2HFE C;  2WWW A;  1YTF D;  1BL8 A;  1AR1 B;  1JQ0 A;  1FXK A;  4XDL A;  4JYB A;  2WLL A;  3MHH C;  1M56 B;  4QPJ A;  1K92 A;  4GX5 A;  3X2Q B;  1BHA A;  1F4M A;  4RQE A;  2NNU A;  4GX1 A;  3G71 V;  2WLL B;  3ZMV A;  4X89 A;  3AG4 C;  5EBL C;  1SER A;  3IGA C;  1GK9 A;  3EFF K;  4I9W A;  3FB5 C;  4J9Z B;  3SYA A;  1DLB A;  3ABK B;  3RVY A;  3AG3 C;  5L3G A;  3AG1 C;  1JVM A;  4LP8 A;  1ZWI C;  2BOC C;  4U7N A;  2EIJ B;  4WFF A;  4WF9 V;  3CME V;  3ZMU A;  5CN0 A;  1KC8 W;  1NBM G;  4UUJ C;  1B6Q A;  1SRY A;  1NQT A;  3GB7 C;  2XAS A;  1GM8 A;  1CP9 A;  1Q81 W;  4JTD B;  3E8B A;  3T2M A;  2EIM C;  4LC1 A;  3QO8 A;  1P4R A;  4HAM A;  3B77 A;  4MVM A;  3CCV V;  1PNK A;  4MW8 A;  1M57 C;  5H9C A;  1QVF U;  2XAH A;  2Y69 C;  2B1G A;  1VQ5 V;  1CPY A;  3QO5 A;  1OCZ B;  4TWK A;  3ZRX A;  3OE7 G;  2IH3 C;  1K8A W;  4H33 A;  2QKS A;  4RAI A;  2P7T C;  4P9P A;  4P30 A;  1OCR C;  4LCU C;  1EZJ A;  5FL7 G;  5BZB A;  2DW4 A;  4L87 A;  5B1A B;  5B1B C;  2Q6A A;  1YJW V;  1Q7Y W;  4EKW A;  4KP4 A;  4QE7 A;  1Q86 W;  2JEU A;  5CBG A;  4N21 A;  3G6E V;  1YSC A;  2Q67 A;  2QEX V;  4MSW C;  3OMI B;  4WFG A;  2C2A A;  4PA9 A;  4G2K A;  2EIN B;  4PA7 A;  5LBQ A;  3GWO A;  3SPC A;  3BY6 A;  1PKX A;  1R3J C;  3SPG A;  3HB3 B;  5IY5 B;  2FTK A;  2IJJ A;  1M56 C;  4JF3 A;  1YJN V;  2D3O W;  3X2Q C;  1R3L C;  2R9I A;  1E79 G;  2WLI A;  5HFL A;  2UXN A;  2JEX A;  1AI6 A;  1RM1 C;  4U7O A;  1XL6 A;  3UM7 A;  4BW5 A;  1QLE B;  3K03 A;  4RQF A;  4MTG A;  1JX9 A;  1OZ0 A;  1J95 A;  1F23 A;  3CC4 V;  3ABK C;  4WCE V;  5EC1 C;  2HG5 C;  4JAS A;  1VQ6 V;  2EIJ C;  4QE9 A;  1M1K W;  2ITD C;  3FB8 C;  1K7D A;  3F7Y C;  3ETG A;  1BMF G;  1K5S A;  2P67 A;  1VQM V;  1YJ9 V;  2OT5 A;  4MTF A;  4MVR A;  4X88 A;  3M99 B;  3D36 A;  2Z3Y A;  2A9H A;  1KEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...