5EBMC

Kcsa t75g mutant in the nonconductive state
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
b'LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATGVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ebmC00
3F7YC 4G28B 2WLMA 4LP8A 3OUSA 2NLJC 3IFXA 3K03A 3TETA 3BEHA 2X6CA 4HYOA 4MTGA 1OCOC 5BZBA 4GX0A 3UKMA 3TCUA 2W0FC 3F5WC 4LCUC 1M57C 4WFEA 4ZBMA 2Q69A 4MSWC 3K04A 1LNQA 1XL4A 4MTFA 3T4ZA 4J9YB 4WFFA 1G4YB 3ABKC 3STLC 3LUTB 4QE9A 5KUMA 4MW8A 3SPGA 3SYOA 4PA7A 3EFFK 5EC1C 3OUFA 4JTCB 2WLLB 3AG3C 3PJSK 4R6ZA 4XDKA 3FB8C 4GX2A 2WLIA 1R3IC 3LDCA 5B1AC 2AHZA 4PDRA 5CBFA 1OCCC 3FB5C 4G27B 4XDJA 3IGAC 2EIKC 3UM7A 3X2QC 3E89A 4LBEC 3K0GA 1OCRC 5EK0A 2ZD9A 3AG1C 1QLEC 4P30A 4EKWA 2KB1A 2Q67A 4H33A 4I9WA 3VOUA 3T1CA 1J95A 4WFGA 2ATKC 2ITCC 4RAIA 1K4CC 2QKSA 4MVSA 2HVJC 2EINC 3SYAA 1ZWIC 3SJQC 2IH3C 4MVMA 4WFHA 4H37A 1S5HC 3T4DA 2WLLA 2DWDC 2X6AA 2EIJC 3AG4C 4X89A 3R65A 3ZRSA 2ZXWC 3E8GA 3LDDA 2WLJA 3SPCA 1R3LC 4X8AA 3HPLC 4MVOA 5B1BC 3K08A 3SPHA 4PDLA 4XDLA 2Q68A 5EBMC 2R9RB 3RVZA 2HVKC 1M56C 3OGCC 2JK5C 4CBCA 4F4LA 2HG5C 2AHYA 3E8HA 4P2ZA 2YEVA 3SPIA 4MTOA 2A9HA 4GX1A 4GX5A 4DXWA 1OCZC 2DYRC 2HFEC 1KKDA 4JTAB 4BW5A 3SPJA 4J9ZB 5EC2C 2EILC 4R50A 4PDMA 3E8FA 3KG2A 2A79B 4MVQA 4PDVA 4QE7A 4PA4A 4RUFA 5IY5C 3SYPA 2DWEC 4RUEA 5E1AC 3WG7C 2BOBC 3ABLC 3GB7C 1R3JC 2IH1C 3RVYA 3E8BA 3E83A 2H8PC 3ASOC 4QNHB 2OCCC 4OXSA 3ASNC 4X88A 2ITDC 3E86A 3AG2C 2WLIB 1V55C 2K1EA 3ZJZA 2WLNA 4HZ3A 2P7TC 4TWKA 3RBZA 1XL6A 1R3KC 2HJFC 4MVZA 3FB7C 5EBLC 1JVMA 4KFMA 3F7VC 5EBWC 5J9PC 1ORQC 3T2MA 4MVUA 5CBGA 3OR7C 3OR6C 4RO2A 2Y69C 3LDEA 4JTDB 4MS2A 4UUJC 4PA3A 3FB6C 3SYQA 1K4DC 4R7CA 2WLKA 4PA6A 2DYSC 3JYCA 4MW3A 2EIMC 1V54C 1BL8A 2QTOA 1P7BA 3SYCA 5B3SC 3LNMB 2WLHA 4P9OA 5KUKA 4MVRA 2BOCC 3ABMC 3RW0A 3K06A 3STZC 2Q6AA 2A0LA 4PA9A 5CBHA 2X6BA 3K0DA 4P9PA 4R8CA
chains in the Genus database with same CATH superfamily
1P49A 4LF7B 1VQ6V 5B1AB 3N2KA 3QNEA 4L8JA 2E3CA 1WAZA 1Y74B 4ZBMA 2QKAA 3P30A 1WA8B 1CPYA 2IBZH 2KG7B 5EIBC 1EZJA 3RT3C 5KUMA 4MW8A 4FPPA 2RMKB 1S77D 2BSKB 1AB3A 1H2NA 3FB8C 5BXZA 1O9GA 5B1BB 3K5MA 2ARHA 1ZX3A 5LP6C 3Q4HB 2CH7A 2WA3A 5IE9A 3ABUA 2ZD9A 2Q4PA 1F23A 1CEZA 2KB1A 4I9WA 5JVDB 2IJKA 2QR4A 3C90A 3MDSA 3G6BA 1BGYH 1OCZB 4J7JA 3JAWA 4B3SO 3ZCCA 1AI4A 3KCYA 3CJHB 3M99B 1U97A 4O4LB 5FLXN 5C93A 5LL6Y 5JJNB 1R1BA 1JOYA 1IXBA 2YSUB 1QBZA 1VP7A 5HFMA 1JMKC 1WB8A 5CB4B 2N05A 3JARB 4DXWA 3HKDA 1KBHA 4R50A 4LH7A 4N21A 3G80A 2ZE6A 3P3NA 1YI2V 3ABMB 3APQA 5B66Z 3ASNC 2HR3A 2FB5A 3O65A 3ZMSA 5HFLA 4LF8B 3F7VC 1AJQA 3OT7A 1K4DC 2XAFA 1Y76B 4O2BB 3J80N 2DYSC 3JYCA 5DM6V 2MW2B 3B8NA 4LFAO 3CSXA 4JI5B 3RYIB 2WLHA 4ICGA 4K35A 3BVOA 3CCJV 3DXRA 1Q6UA 2Q6AA 4PA9A 2CE4A 3JASB 3SDLA 5LGNA 1IBLO 3CMEV 2NN4A 1JPXA 1AILA 2EIKB 5BZBA 3F5WC 5LGTA 1M57C 1NH2D 4W4LA 1D5AA 1CP9A 2Q73A 4X65O 1KB9F 4AQYO 2BTOA 4NXNO 5IJ0A 3D36C 1F4MA 1QQCA 2JEXA 3OD4A 1NBMG 4ZOLA 3B09A 4DV5B 2ZE5A 3ZRXA 2Y48A 1WN7A 5EC1C 1KMIZ 1OZ0A 3T1YO 1PL4A 5B1AC 5J2TA 5CBFA 2Y0IA 5LYJA 4JI7O 4DV1O 1SC5B 5K1XA 1OCRC 1XNQO 4BIOA 1R73A 4ZIBA 4DV4B 1J95A 1HDJA 4QPJA 1K4CC 2F4VO 4NTWA 1F51A 1ZWIC 3L72H 2QEXV 4FLVA 5BR8O 5JQGB 3LDDA 3HPLC 4MVOA 5B1BC 3L71H 4XDLA 4YHHB 2HJDA 5IYZB 2ZR2A 5FNVA 3I55V 1SA0A 3BA9A 2CGOA 2HG5C 3BCCH 5LOVB 1PV0A 2F1MA 1EM1A 1OCZC 2ZQMA 2LGQA 1GM9A 3GWOA 3SYPA 1R3JC 1RPOA 3B2EE 4FM0A 2PI4A 2PY5A 2WWWA 3ZJZA 2E76B 3RBZA 3W7TA 5EBLC 3G67A 1FKAO 3ETDA 2UXXA 2UUBB 1BE3H 1Z5WA 4UCVA 4DV6B 5LXTA 2UUCB 3A8TA 1XHZA 1BSMA 3LNMB 1K33A 3ABMC 1AP6A 1EN6A 2NNUA 2P5OA 1NU1H 4DV0O 1H8HG 4CS4A 1VMGA 5EYPB 2YUAA 3TK1A 1P84F 4J41A 3BPZA 3L75H 4DK0A 2ZM6B 2RNBA 5KAIZ 3VQYA 4HNAA 1PPJH 4WFFA 1N4CA 2ZNJA 3P32A 4QJFB 3LUTB 3CCEV 3DC5A 1HNZB 2JDIG 3AK2A 3KZIZ 3EHBB 1R3IC 1SS3A 1XMOB 3L9DA 4HBNA 2EIKC 5LP6A 1RM1B 4DR1B 2YIAA 1G6UA 4LF8O 5TISZ 1MA1A 1MABG 5L3CA 2A7WA 1VF5B 4RAIA 4LF4B 4JI5O 2V1DA 1S5HC 3E2EA 4WFBV 1WLEA 1XOUA 2LW1A 3QO8A 4O4IA 1S5JA 1SQFA 1SZTA 2YIDA 5FPOA 3SPIA 3A0HZ 2JEUA 5L3FA 1Q3EA 3SJBC 5J2UA 2Q8VA 1M1KW 1LUWA 2A79B 3JD2A 2EULA 3IJ4A 1O9HA 4DV5O 2CAZC 3JSLA 2PYJA 1GO3F 1N33B 4TWKA 3LSUA 1R6TA 2KQXA 1OCOB 3K58A 3CS5A 4DV4O 3JAMN 4CC6A 1YDXA 2BOCC 4FLYA 1GH6A 1VQMV 4X66B 4AI8A 1L0LH 1YITV 2LO1A 3F7YC 3CXCU 1JFFA 4YHHO 1TGOA 3OEEG 3E22A 2GTAA 1MNGA 2JS3A 3W7WA 1TUBA 1W0JG 2ZR3A 3WB0A 3JALB 4ZI7B 4KXRA 3RYHB 1YIJV 3EFFK 1NJIW 3CX5F 3ABKB 3OUFA 4I55B 1GN3A 3UCSC 1VQOV 2G38A 3CCMV 4KL1A 2E75B 1F4NA 3UM7A 1OHHG 1JA8A 1M93A 1Q5OA 1WA8A 2UUBO 2KG7A 4CS2A 3HKEB 4DV6O 1YZBA 2UUCO 4Z1MG 4JI3B 5CA1B 5KHGA 4WBNB 2BSKA 1XUQA 2UUAB 1GK9A 2YXYA 4C7UA 1IVSA 2WLJA 1BZKA 1FXKB 2ZIOA 2ZT9B 3Q4HA 1K9MW 2AHYA 5JVDA 1YCIA 2F43G 1XDCA 3A0RA 2ZM6O 1BT8A 4I9QA 1URFA 3WU2Z 3DSQA 2HFEC 5EC2C 1TAEA 2Q7GA 3KG2A 4PDMA 4MVQA 3CJHA 4LFBB 4X1YA 4O4LA 3K9SA 1VQ9V 3RVYA 4FZ0A 1Q81W 1HNZO 4X88A 3E86A 4FLTA 2OYQA 1JCHA 1IZ3A 1XMOO 3K3WA 4DR1O 5CB4A 3JARA 4BIUA 1Q8IA 3BY6A 2UU9B 1F7YA 3ZBHA 4XBFA 4OX9B 1HR0B 1PM9A 2EIMB 3OFNG 2M7WA 4P9OA 4LF4O 1PD3A 2ZCEA 3VQXA 2CTQA 3LSQA 3ZEDA 2W6JG 1Y6XA 2NR5A 4LNUB 1OCOC 1Y76A 4O2BA 5L3BA 3QTCA 4RWUA 2Q69A 4UCRA 1AI5A 3RYIA 2QWOB 2AW9A 5B1OA 4IIJB 4MTXA 4FVMA 3JASA 2Z5UA 4R6ZA 2ZE8A 4JI1B 5GW7A 1VF6A 1KKCA 1QNMA 4XDJA 3JATB 1N33O 1JR9A 5CA0A 2QA4V 3N27A 4W4KA 5CN0A 1Q43A 4X1KA 1N8RW 4WFGA 2ZDIA 4PV1B 4MVSA 1GN2A 2CTRA 3H1IH 3B4SA 3SJQC 3K5NA 4X89A 2OCHA 4X66O 3ASOB 1N32B 4GCZA 4FM1A 1V55B 3RVZA 1I94B 5B1NA 1YF2A 2YS8A 4F4LA 2W6IG 2Q0AA 3K79A 1BQZA 1TVKB 4NB5A 4B7EA 3JCZA 2XTAA 4PDVA 4JYYA 5JQGA 2JJ1G 1GRJA 5GTHZ 3B77A 5IYZA 1G8MA 2ITDC 3CRMA 4FLWA 3CCQV 4YIPA 2LW7A 3T2MA 5LOVA 1VQKV 1SERA 1I0HA 3GVMA 3CRRA 2FKXA 3H1HH 3R66A 2WLKA 3LSSA 1LR1A 4AQYB 2X7RB 5GONB 2DYSB 4JI3O 3CE2A 4UV8A 1OV9A 2UUAO 5BMVB 2DW4A 4UVBA 2XAJA 4UVCA 3WB2A 3AG7A 1YJ9V 2LFSA 2DN9A 3KCXA 1BCCH 4LCUC 3BHPA 1UFIA 2FL4A 3U0ZA 4DR2B 3AG1B 1M57B 2VQFB 1RP3B 4ZHQB 3CCVV 1M90W 4LFBO 1VF7A 4IL6Z 3PJSK 4DR3B 1PKXA 4U7OA 5JCOA 2FYUH 4ASUG 1XQ8A 4NXMB 3BAAA 2HLDG 1XI1A 3ETGA 1L0NH 3X2QC 3E89A 1VQLV 4CH4A 4Z2WA 2ADQB 1FYJA 4H13B 1M5IA 4H33A 4D7SA 1OCRB 3K5LA 2UU9O 2IH3C 1E1QG 3G4SV 4OX9O 2EILB 1HR0O 4JASA 1YEWA 3OTOB 3WG7B 3E8GA 3CEIA 1PL0A 2PTMA 4DRXB 2XNDG 3ZMTA 2HVKC 3OMAB 3OEHG 4I4TB 2Z0AA 1VQ4V 2CUGA 1SQBH 3E8FA 4J11A 2AXTZ 1J5EB 3ASOC 2XAQA 4OXSA 4DV0B 4JI1O 1V55C 2XAGA 2WLNA 2HJFC 4TV9B 1B3QA 5H9CA 4A5UB 5J9PC 1MZFA 1WP7A 5CA3A 2L35A 3FB6C 3JD3A 1WB7A 1NT2B 2GUZB 2QTOA 3RN4A 1NQTA 2YC0A 2EZOA 4YXWG 1P4RA 4UV9A 4OPAA 3OAAG 5CBHA 3MAQA 3N2GB 5IT9N 1QHTA 3OM3B 1N32O 1QCEA 4LF6B 5KHKA 1I94O 5LBQA 3ZN1A 1Q6IA 1BHBA 4JZ2A 3CWBH 3K59A 3FFQA 3SPGA 5EIBD 1SKVA 3JD0A 1U96A 1Q6HA 4E4EA 5D5QA 1KU9A 2WA4A 2N74A 3ZRVA 1JQ0A 2QM4A 3AG1C 1EN4A 5H6RA 5AG2A 4B08A 3JALA 1FS0G 3T1CA 4IT5A 3RYHA 2OTLV 2CK3G 1ZL8B 4I55A 3SJCC 2X6AA 1KC8W 3QO7A 1Y67A 1R6NA 2QSAA 2R9RB 1HNXB 4LF5B 3HKEA 5LHGA 2Y69B 5CA1A 4GX1A 1K73W 4WBNA 4DR2O 5LMNB 2VQFO 2EILC 4LWSB 4QE7A 3WG7C 1B6QA 1FXKA 3T1HB 3CP1A 2MK3A 5IYBO 3MHSC 4DR3O 1YJWV 4NXMO 4X20B 1KQSU 1JVMA 5EBWC 3UO2A 4JGSA 1S0VA 3W7XA 4MS2A 4X1IB 3ETQA 1H8EG 1MSDA 2JGUA 1PNLA 2IW5A 1IBMB 1E79G 2FMLA 4IGGA 3STZC 4UFZA 2LJ2A 2YXLA 3OTOO 3K0DA 1H38A 3AG3B 4LP8A 3I5DA 3EXAA 2QDOA 3TETA 4FMTA 4HYOA 4MTGA 1BHAA 1MZEA 3K04A 2QJ1A 3T4ZA 4J9YB 4I50A 3CPWU 2EBOA 4JAAA 4IYHA 2PZSA 5JWPA 1J5EO 2WLLB 1CXZB 3SJAC 3OMIB 1X4TA 2WLIA 5IYDO 1GMGA 3UT5B 4JYBA 4LNUA 3OE7G 2V7QG 2M6YA 2ZE7A 3H9VA 2IJIA 2ITCC 1IURA 2DYRB 2QWRB 4EB6B 1K8AW 4X64B 3R65A 2GTSA 3SPCA 3JATA 4FFKA 5EZYB 4PDLA 2WSSG 4PJ0Z 5EBMC 2CDYA 4LF6O 5KA6A 1XEQA 4Q20A 5H6QA 4JYCA 3LNNA 4P2ZA 2P22C 4MTOA 1QVGU 3JSNA 5L3DA 1YTFB 4QIWF 4JTAB 4KP4A 1ZAUA 4WFAV 1XHXA 4RUFA 4N23A 4K8ZA 2DWEC 2ZNIA 3ABLC 3F5TA 3E8BA 2Q0OC 4RQEA 4D6TH 1GN4A 4DYLA 4PI0A 2P7TC 2CTWA 2QKCA 1QR8A 3H1LH 3KKYA 4DO2A 4EFEA 2Y69C 1TVKA 2P4KA 3I56V 4FLUA 2PF4E 3SYCA 4JI6B 3RW0A 1ROPA 2JVDA 1K5QA 1VARA 4BW9A 4G28B 2VQEB 3IFXA 2X6CA 1MMMA 1B04A 1HNXO 2FTKA 4LF5O 2PGGA 5GONA 3JD4A 2VWKA 4BR6A 5LMNO 1AROP 3O9OA 4PA7A 5BMVA 4JAUA 5L3EA 3AG3C 5JH7B 3T1HO 1YJNV 2R9IA 4IHJB 1MOFA 1OCCC 1KP2A 3IC9A 1DF4A 3FAVB 1K5SA 5EK0A 1UPGA 4JV5O 1WNSA 4ZHQA 4DW1A 2YEVB 4FFBB 3MHHC 3D36A 3NXSA 1IBMO 3RWRD 1QU7A 2AZ0A 2EZPA 2C2AA 2Q68A 2B1GA 1P7GA 1Y74A 3CD6V 3M8AA 4OPHA 4JYAB 2ETNA 2DYRC 3ICXA 4F6EA 1XREA 4KUMA 3SPJA 2F95B 4U7NA 4KHPB 4RUEA 2P6JA 4LH6A 2BOBC 1K34A 1Z5VA 3E83A 4DRXA 2P4VA 4WF9V 1NZ6A 1H2SB 4HZ3A 4NTYA 4J7KA 4MVZA 3FB7C 3JD1A 2BTQB 4I4TA 3CCRV 4QGPA 1RSOB 1FFXB 1V54C 2E5LB 1EZVH 4B3TB 1KD1W 2YXHA 2RJZA 4X64O 3FD9A 4TV8B 1Q82W 3CB2A 4P9PA 4Q6GA 1HW7A 3L70H 2QM7A 1AI6A 1DTOA 4TV9A 2PYLA 3ZHVA 4EFBA 5LGUA 1SA0B 2L6LA 2GUZA 5IDJA 5K1PA 1ZTEA 5B5EZ 2UXDB 3N2GA 2HEPA 3CCSV 1AP5A 1IXMA 3FKSG 1H2KA 3ZRWB 3G6EV 1WPXA 1W2BU 5KHJA 4WCEV 1M56B 3X2QB 4GZRB 2E74B 1GAXA 4LFCB 2GBOA 1W59A 1GM8A 2QWNB 5DECA 2KSDA 4JI6O 3M7MX 2RN9A 1Q86W 2B1IA 3B8MA 2ODMA 4X8AA 4O2AB 3K08A 1H2LA 2OWOA 2QWQB 2VQEO 1BS3A 3HR0A 4CZZA 5LMUB 3OGCC 2JK5C 3QF7A 1NKDA 3ZHRA 1YTFD 4PELA 3CCUV 2F66C 1NTMH 1KKDA 4HNAB 1ZL8A 1YVWA 3RFRA 3QO5A 3THOA 4FK5C 4CS3A 3GB7C 2ZKOA 1ZLZA 2R9AA 3P3PA 3HKBB 4F6RB 4DR4B 1XNRB 4PHZA 1M9NA 1V9PA 4UUJC 1K7DA 4LWSA 2XHBA 1MG1A 4B3MB 3BRCA 1K97A 3K5OA 5KUKA 4MVRA 2F93B 2A3QA 1I08A 2A0LA 2OTJV 3CHXA 4X20A 3OMNB 2O57A 2WLMA 3PN1A 2W0XA 2HHHB 3BEHA 4X1IA 3TCUA 4X9QA 3OW2U 1ZUQA 5LA6B 1XMQB 3ZHSA 1LNQA 4MTFA 4JYAO 2JGDB 1DGSA 3J81N 2EINB 2GSMB 4KHPO 2GHYA 1SQXH 4GX2A 5LHHA 4K3AA 4JI0B 4DV2B 3VQVA 2Z3YA 2VRZA 1KUQA 2ZIMA 1Q7YW 4B3RB 4BWAA 1QLNA 3SYAA 2QKSA 5KHIA 2E5LO 4B3TO 2WLLA 4O4JB 2EIJC 5DEDA 5KHHA 4TQDA 2HKOA 4H44B 3UT5A 4DV3B 3C3TA 4TT3G 5KLVH 3W7UA 2R72A 5EYPA 1MSWD 2IM9A 1SESA 1M56C 2RQ6A 1RPRA 3E22B 4CBCA 1DF5A 1WPBA 4DUYB 4EB6A 2XASA 4DV7B 1G1XB 4DW0A 1K3EA 4YJ2B 3HKCB 2UXDO 5KA5A 1AR5A 4RQFA 1THZA 2K1EA 3DC6A 2RCVA 1ORQC 1S5LZ 2AGAA 5CMUA 1QR9A 4GKJO 4PA6A 3WFVA 1NVPB 4LFCO 5FL7G 2GDSA 3A2FA 1KECA 3K06A 3L74H 2EJ7A 4R8CA 2NLJC 1AI7A 1KYOF 4YY3B 4TUYB 4GX0A 5LMUO 1AJPA 4TQFA 2CGNA 4H0LB 1FD9A 1VIBA 2BCCH 1JJ2U 4JI8B 1G4YB 5KX5B 4D7TA 1AR1B 3CMAV 4X62B 1TA8A 4X1YB 1HNWB 1I7FA 3ZX6A 4J80A 2AHZA 1T5EA 4PDRA 4I0XB 4DR4O 4UCSA 4FLXA 1XNRO 3K0GA 4YIOA 2YIBD 4GT1A 2ATKC 1GN6A 2EINC 4B3MO 4ABMA 4WFHA 4H37A 3S3XA 3TXSA 5JH7A 1H2GA 2IU3A 4IHJA 4TSFG 3ZRSA 2ZXWC 1ENVA 1FPOA 3RYCB 5DN6G 1NR7A 4YJ3B 4U3JB 3CC7V 4FZ1A 3MD0A 1I5XA 3FAVA 5KMGB 2HHHO 1YHQV 3E8HA 2YEVA 4FFBA 1XMQO 3U11A 4ZI7A 3EVKA 3CXHF 2JRIA 2QTSA 2WAMA 1US6A 2IH1C 5H2FZ 5FPRA 4CH6A 3ABLB 4UXNA 4OGQB 3QG5A 5ITZB 4JI0O 3U10A 1JX9A 1R3KC 2B5UA 5C8YB 4DV2O 5CA0B 1XBLA 3OR7C 5JJJB 4R7CA 1Y4MA 2ZINA 4CH5A 1DLBA 3K57A 4X1KB 4B3RO 1WJZA 2CTPA 3ABTA 1E1RG 4LF9B 1N34B 2AZ2A 2LGWA 2X6BA 1HWYA 4I7ZB 4DV3O 3AK1A 3OUSA 3JCUZ 2BTQA 3K03A 1I5YA 3RYFB 3L73H 1RSOA 4FM2A 2W0FC 1FFXA 4JV5B 3G71V 4DUYO 3STLC 2YI9A 4O4HB 4DV7O 4TV8A 3SR2C 1K92A 2UXNA 2QE7G 1FFTB 4K0KB 3LDCA 4LF7O 5L3GA 3FB5C 1HP8A 2H3OA 1FXVA 2DQ0A 1OCCB 2A06H 3AK3A 2VS0A 5IJ9B 4EKWA 1S72V 3TXQA 4FIPC 2UXBB 2H94A 4UCOA 4FLZA 2DWDC 3W7SA 5IYCO 5F2VO 2Y4TA 3ZRWA 1S3JA 2Q7EA 3OTFA 2YIBA 2DOSA 4YY3O 4BAYA 4NTXA 3JAKB 3QVNA 4IIJA 2N04A 1VQNV 4JI8O 4I5SA 5B3SB 5E1AC 2DQ3A 2XT9A 4O2AA 4QNHB 4X62O 3K9AA 3DGEA 1VQ5V 1HNWO 5A2QN 2VWJA 1N0JA 1SQQH 4L87A 4FJCC 3N2KB 3D8CA 1FAFA 1GM7A 4CH3A 1NVPD 1S76D 1Y66A 1BL8A 5IWAB 1P7BA 3FYEB 1SRYA 1V54B 1ZSPA 3HKBA 1SQVH 4F6RA 3ZS8C 3H1JH 1VF6C 3BFRA 4DUZB 2XOKG 3ZMVA 4QPKA 2QGNA 4NVPA 2YICA 3DTUB 2EJRA 4EEQA 4DR7B 1H2MA 4MSWC 2CH7B 2Y4UA 3HB3B 1QLEB 2ZDIC 3A0BZ 1OJHA 3UO3A 1N0NA 5GTIZ 3FYIB 1N36B 2JS5A 3JAWB 3H1KH 4G27B 4DK1A 3AEIA 5LA6A 2ADPA 1R6KA 4U3FH 2UXCB 1AVMA 2YI8A 2JGDA 2Q67A 3RGBA 2DJVA 2HVJC 4JAVA 4LR3A 3HKDB 5IY5B 1JJOA 4BIZA 4LF9O 1N34O 2Q9LA 2OIGA 4J42A 2OCCB 4HAMA 3ZHTA 4UB8Z 3SGIA 4J10A 4DR6B 5BY1A 2WPDG 1IDSA 3NR7A 2R70A 3ETEA 2RDCA 4O4JA 1SQPH 3ZN0A 1WP8A 1GTOA 3CRAA 2H8PC 1SZXA 2D3OW 3DXRB 1AJNA 4K0KO 4NYKA 4IYIA 1KP3A 4KFMA 1NTZH 3BA8A 3OR6C 4JTDB 5H5NA 3APOA 1L1FA 3ML0A 4GKKB 4DR5B 4NR1A 1Z2GA 4JI4B 4YJ2A 3HKCA 3S3WA 5B3SC 4UCTA 5IJ0B 2UXBO 4ZOLB 1SF9A 5JCOC 3C3SA 5J2TB 1TUEB 4E2LA 1SETA 4GUNA 5LYJB 1NI8A 3E35A 4JZGA 4WFEA 3UKMA 4AHCA 2XUMA 5E79Z 1NR1A 1XL4A 3H01A 5JJEB 4MT8A 4JI2B 1FJGB 4JTCB 3AG4B 5D5PA 3CCLV 1NS1A 1RM1C 3VQWA 3IAYA 4AILC 3ZMZA 3BABA 4TUYA 3IGAC 2X0LA 2HP8A 2D2CB 2JJ2G 4LBEC 5FNVB 3ZHUA 1IBKB 1Q90D 1YSCA 3GWKC 1QLEC 4J7ZA 5KX5A 2DMXA 1EFRG 2P90A 5IWAO 2F23A 3IC7A 1EN5A 4I0XA 1A32A 2EIJB 3D3IA 2LQTA 3TJTA 3AG2B 4DUZO 2OT5A 5LHIA 4NKGB 4GKJB 3CC4V 1EBOA 2A9HA 4DR7O 2XAHA 1NTKH 2GV9A 2YDEA 5LXTB 1LUVA 4BW5A 4I50B 2IU0A 5IY5C 1FXHA 2V4DA 3FX7A 4GLXA 1AR4A 3RYCA 1N36O 4YJ3A 4U3JA 3ZHQA 2PI5A 2OCCC 2WLIB 4PI2A 5KMGA 4ZKIA 5CBGA 4RO2A 1VQ8V 2DE0X 2IJJA 4PA3A 3SYQA 2UXCO 3ZIAG 4MW3A 4B3SB 1PNKA 2ILMA 1X59A 3J7AU 5ITZA 1M4UA 2JIZG 2Y0PA 5C8YA 1COWG 2P06A 3CYOA 4DR6O 5LP6B 3CRQA 1NH2B 1YXBA 4G2KA 4B7KA 1IX9A 4JF3A 3ABKC 2EX3A 4QE9A 3SYOA 4CC5A 4K8XA 4XDKA 4JPRA 3D3QA 4TOIA 3RYFA 4UCUA 3ZMUA 2PUSA 2BE3A 4O4IB 4P30A 3VBBA 3CC2V 4LFAB 3VOUA 2KKWA 2OIEA 4O4HA 4GKKO 4DR5O 4Z1VA 5J2UB 2Q7HA 4MVMA 3T4DA 4JI4O 2B9ZA 1L8DA 1FXKC 3AG4C 1VQPV 4UB6Z 4LC1A 1R3LC 1GKFA 1IBLB 3SPHA 1DK1A 2LP7A 2ZXWB 3ASNB 3TGUH 1BQ0A 2LFRA 1B06A 5IJ9A 2Q5ZA 5A9GA 1UJWB 4PD4F 4X65B 1PP9H 1RFYA 2K9PA 4GX5A 4NXNB 2IJHA 4J9ZB 1QVFU 4PA4A 4JI2O 2QM8A 2P67A 1FJGO 3T1YB 1VQ7V 3WB1A 3OGIB 3AG2C 4GYCB 1D2DA 3UQ8A 4JI7B 4DV1B 1BMFG 1XL6A 3CRCA 1JFFB 4MVUA 3JAKA 2QWPB 1IBKO 1XNQB 3LDEA 1PNMA 1W0KG 2F4VB 2EIMC 1TUBB 5BR8B 1D5NA 5KAFZ 1VEWA 3B40A 4UVAA 5EZYA 1XILA 1SQGA
chains in the Genus database with same CATH topology
3LSQA 4G28B 1VQ6V 2W6JG 3OUSA 5B1AB 3IFXA 3QNEA 3K03A 1I5YA 2X6CA 1OCOC 2W0FC 4ZBMA 5L3BA 2FTKA 2Q69A 3G71V 1AI5A 3P30A 5B1OA 1CPYA 3JD4A 4MTXA 1EZJA 3STLC 1AROP 5KUMA 4MW8A 4PA7A 4FPPA 1S77D 4JAUA 5L3EA 1K92A 3AG3C 2Z5UA 4R6ZA 2UXNA 2QE7G 1FFTB 3FB8C 1YJNV 2R9IA 5GW7A 1MOFA 3LDCA 5B1BB 5L3GA 1OCCC 3FB5C 1KP2A 4XDJA 1FXVA 1DF4A 2DQ0A 1OCCB 2QA4V 1K5SA 3ABUA 5EK0A 2ZD9A 5CN0A 1F23A 4EKWA 2KB1A 1N8RW 4I9WA 1CEZA 2IJKA 4WFGA 2YEVB 2ZDIA 1S72V 4MVSA 1OCZB 3MHHC 4FIPC 3D36A 3SJQC 2H94A 3NXSA 3ZCCA 1AI4A 2DWDC 4X89A 3M99B 3W7SA 5IYCO 3ZRWA 3ASOB 5C93A 4GCZA 2EZPA 1S3JA 2C2AA 2Q68A 1JOYA 1V55B 2B1GA 3RVZA 5B1NA 2YSUB 1QBZA 4F4LA 3CD6V 4BAYA 2W6IG 5HFMA 3K79A 4DXWA 2DYRC 4KUMA 3SPJA 1VQNV 4R50A 3JCZA 4PDVA 4I5SA 4N21A 2JJ1G 4U7NA 5B3SB 4RUEA 2DQ3A 2P6JA 2BOBC 5E1AC 1K34A 1YI2V 3ABMB 3B77A 3E83A 4QNHB 3K9AA 3DGEA 1VQ5V 1G8MA 3ASNC 4WF9V 2HR3A 2ITDC 4HZ3A 3ZMSA 3CCQV 5HFLA 4MVZA 3FB7C 4L87A 4FJCC 3F7VC 3T2MA 1VQKV 3JD1A 1SERA 1GM7A 1AJQA 3CCRV 1K4DC 2XAFA 2WLKA 3LSSA 1NVPD 2DYSC 3JYCA 1Y66A 1S76D 5DM6V 1V54C 1BL8A 3B8NA 2X7RB 1P7BA 3FYEB 1SRYA 2DYSB 1KD1W 1V54B 2WLHA 3CCJV 4UV8A 2Q6AA 4PA9A 1Q82W 4P9PA 2DW4A 4UVBA 2QM7A 1AI6A 1DTOA 2XAJA 2XOKG 3ZMVA 4QPKA 5LGNA 4UVCA 3CMEV 1JPXA 1YJ9V 2LFSA 5LGUA 3DTUB 2EIKB 5BZBA 2EJRA 3F5WC 4LCUC 1M57C 5LGTA 1NH2D 5IDJA 1CP9A 4MSWC 3AG1B 3HB3B 1QLEB 1M57B 2ZDIC 1F4MA 3CCVV 2JEXA 1M90W 3FYIB 1NBMG 3ZRXA 2Y48A 5EC1C 3CCSV 1IXMA 3PJSK 1PKXA 1OZ0A 4U7OA 4ASUG 3FKSG 5B1AC 5CBFA 3ZRWB 2HLDG 3ETGA 4G27B 3G6EV 3X2QC 3E89A 1WPXA 1W2BU 1VQLV 3AEIA 4WCEV 1M56B 1OCRC 1R6KA 3X2QB 1R73A 2Q67A 4H33A 1J95A 1OCRB 4QPJA 1GM8A 1K4CC 2HVJC 4JAVA 1F51A 1ZWIC 2IH3C 1E1QG 3G4SV 2QEXV 2EILB 5IY5B 4JASA 4BIZA 3WG7B 3E8GA 3LDDA 1Q86W 2B1IA 3B8MA 4X8AA 3HPLC 4MVOA 1PL0A 3K08A 5B1BC 4XDLA 2OCCB 4HAMA 2ZR2A 2XNDG 3ZMTA 3I55V 4CZZA 2HVKC 3OGCC 2JK5C 2WPDG 2HG5C 1NKDA 3OMAB 3OEHG 1YTFD 4PELA 3CCUV 3ETEA 1VQ4V 1OCZC 2ZQMA 1KKDA 1GM9A 3GWOA 3E8FA 3QO5A 3ZN0A 4FK5C 3SYPA 1GTOA 3GB7C 1R3JC 1RPOA 2PI4A 2H8PC 3ASOC 2D3OW 2XAQA 4OXSA 2WWWA 1AJNA 1V55C 2XAGA 2WLNA 3ZJZA 3RBZA 2HJFC 5H9CA 3W7TA 5EBLC 1KP3A 1M9NA 4KFMA 5J9PC 3ETDA 2UXXA 3OR6C 5CA3A 4JTDB 4UUJC 1K7DA 3FB6C 3JD3A 1L1FA 3ML0A 1MG1A 2QTOA 1K97A 1NQTA 5B3SC 3LNMB 1K33A 2EZOA 5KUKA 4MVRA 4YXWG 3ABMC 1P4RA 4UV9A 2NNUA 3OAAG 2A0LA 5CBHA 2OTJV 3OMNB 3OM3B 2WLMA 1H8HG 1QCEA 1TUEB 4E2LA 1SETA 3BEHA 3TK1A 3E35A 3TCUA 3UKMA 4WFEA 5LBQA 3OW2U 3ZN1A 1NR1A 1LNQA 1XL4A 1BHBA 3H01A 4MTFA 4WFFA 4MT8A 3P32A 4QJFB 3LUTB 3SPGA 3CCEV 2EINB 3JD0A 2GSMB 2GHYA 4JTCB 2JDIG 3AG4B 3CCLV 3EHBB 4GX2A 5LHHA 1R3IC 1RM1C 3ZMZA 3ZRVA 3IGAC 2EIKC 2X0LA 1RM1B 1JQ0A 4LBEC 2JJ2G 2Z3YA 1YSCA 3AG1C 1Q7YW 1QLEC 1MABG 5H6RA 1FS0G 3T1CA 1EFRG 5L3CA 2P90A 1QLNA 4RAIA 3SYAA 2QKSA 2OTLV 2CK3G 2V1DA 1S5HC 2WLLA 2X6AA 2EIJC 3E2EA 4WFBV 2HKOA 1KC8W 3QO7A 1WLEA 3IC7A 2EIJB 3D3IA 4TT3G 1R6NA 3W7UA 3QO8A 3AG2B 1MSWD 2OT5A 5LHIA 1SZTA 2R9RB 1SESA 1M56C 1RPRA 4CBCA 5LHGA 1DF5A 3SPIA 3CC4V 1EBOA 2A9HA 2JEUA 2Y69B 4GX1A 5L3FA 1K73W 2XAHA 4BW5A 1M1KW 2XASA 2IU0A 2EILC 5IY5C 1FXHA 2A79B 4QE7A 3JD2A 1K3EA 3WG7C 1B6QA 1FXKA 5KA5A 4RQFA 3CP1A 2MK3A 2PI5A 2OCCC 5IYBO 3MHSC 1GO3F 1THZA 1YJWV 2WLIB 2K1EA 4TWKA 1KQSU 1JVMA 4ZKIA 5EBWC 1ORQC 5CBGA 4JGSA 4RO2A 3W7XA 1VQ8V 5CMUA 1S0VA 4MS2A 1OCOB 1QR9A 2IJJA 4PA3A 3SYQA 4PA6A 3WFVA 3ZIAG 4MW3A 1NVPB 1H8EG 1PNLA 1PNKA 5FL7G 2IW5A 2BOCC 1E79G 1KECA 3K06A 3STZC 1VQMV 1YITV 3K0DA 2JIZG 1H38A 3AG3B 4R8CA 3F7YC 3CXCU 4LP8A 1COWG 2NLJC 1AI7A 3TETA 3CYOA 3OEEG 4FMTA 4HYOA 4MTGA 4GX0A 1BHAA 1AJPA 1JJ2U 1NH2B 3W7WA 3K04A 1W0JG 3T4ZA 4J9YB 4G2KA 2ZR3A 1G4YB 3CPWU 2EBOA 4JF3A 3ABKC 4QE9A 3SYOA 1YIJV 3EFFK 1NJIW 3ABKB 1AR1B 3CMAV 3OUFA 2WLLB 4XDKA 4JPRA 3OMIB 1VQOV 2WLIA 5IYDO 3CCMV 1GMGA 2AHZA 4PDRA 1F4NA 4JYBA 3OE7G 3ZMUA 2V7QG 3UM7A 3K0GA 1OHHG 4P30A 3VBBA 2IJIA 3CC2V 3VOUA 4GT1A 2ATKC 4Z1MG 2ITCC 2DYRB 2EINC 4WFHA 4MVMA 3T4DA 4H37A 1K8AW 1FXKC 1H2GA 3AG4C 1GK9A 2IU3A 3R65A 1VQPV 4TSFG 3ZRSA 2ZXWC 1ENVA 2WLJA 4LC1A 1R3LC 3SPCA 1FXKB 1GKFA 1NR7A 5DN6G 3SPHA 3CC7V 2LP7A 2WSSG 2ZXWB 4PDLA 3ASNB 2LFRA 1I5XA 3MD0A 5EBMC 5KA6A 4Q20A 1UJWB 5H6QA 1K9MW 4JYCA 2AHYA 3E8HA 1YHQV 4P2ZA 2F43G 2YEVA 3A0RA 4MTOA 1QVGU 5L3DA 1YTFB 4GX5A 4QIWF 2HFEC 4JTAB 4KP4A 2IJHA 4J9ZB 5EC2C 4WFAV 1QVFU 4PDMA 3KG2A 4MVQA 2WAMA 4PA4A 4RUFA 4N23A 2QM8A 2DWEC 2P67A 3ABLC 2IH1C 1VQ9V 3RVYA 3E8BA 4RQEA 1Q81W 1VQ7V 3ABLB 4UXNA 4X88A 3E86A 3AG2C 1JCHA 2P7TC 1BMFG 1QR8A 1JX9A 1R3KC 1XL6A 2B5UA 3K3WA 4MVUA 4DO2A 3OR7C 2Y69C 3LDEA 4R7CA 1PNMA 1Y4MA 4BIUA 3BY6A 1W0KG 3I56V 1DLBA 2EIMC 3SYCA 4XBFA 2EIMB 3OFNG 3ABTA 2M7WA 4P9OA 1E1RG 3RW0A 1ROPA 1PD3A 1K5QA 4UVAA 2X6BA 1HWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F7Y C;  4G28 B;  2WLM A;  4LP8 A;  3OUS A;  2NLJ C;  3IFX A;  3K03 A;  3TET A;  3BEH A;  2X6C A;  4HYO A;  4MTG A;  1OCO C;  5BZB A;  4GX0 A;  3UKM A;  3TCU A;  2W0F C;  3F5W C;  4LCU C;  1M57 C;  4WFE A;  4ZBM A;  2Q69 A;  4MSW C;  3K04 A;  1LNQ A;  1XL4 A;  4MTF A;  3T4Z A;  4J9Y B;  4WFF A;  1G4Y B;  3ABK C;  3STL C;  3LUT B;  4QE9 A;  5KUM A;  4MW8 A;  3SPG A;  3SYO A;  4PA7 A;  3EFF K;  5EC1 C;  3OUF A;  4JTC B;  2WLL B;  3AG3 C;  3PJS K;  4R6Z A;  4XDK A;  3FB8 C;  4GX2 A;  2WLI A;  1R3I C;  3LDC A;  5B1A C;  2AHZ A;  4PDR A;  5CBF A;  1OCC C;  3FB5 C;  4G27 B;  4XDJ A;  3IGA C;  2EIK C;  3UM7 A;  3X2Q C;  3E89 A;  4LBE C;  3K0G A;  1OCR C;  5EK0 A;  2ZD9 A;  3AG1 C;  1QLE C;  4P30 A;  4EKW A;  2KB1 A;  2Q67 A;  4H33 A;  4I9W A;  3VOU A;  3T1C A;  1J95 A;  4WFG A;  2ATK C;  2ITC C;  4RAI A;  1K4C C;  2QKS A;  4MVS A;  2HVJ C;  2EIN C;  3SYA A;  1ZWI C;  3SJQ C;  2IH3 C;  4MVM A;  4WFH A;  4H37 A;  1S5H C;  3T4D A;  2WLL A;  2DWD C;  2X6A A;  2EIJ C;  3AG4 C;  4X89 A;  3R65 A;  3ZRS A;  2ZXW C;  3E8G A;  3LDD A;  2WLJ A;  3SPC A;  1R3L C;  4X8A A;  3HPL C;  4MVO A;  5B1B C;  3K08 A;  3SPH A;  4PDL A;  4XDL A;  2Q68 A;  5EBM C;  2R9R B;  3RVZ A;  2HVK C;  1M56 C;  3OGC C;  2JK5 C;  4CBC A;  4F4L A;  2HG5 C;  2AHY A;  3E8H A;  4P2Z A;  2YEV A;  3SPI A;  4MTO A;  2A9H A;  4GX1 A;  4GX5 A;  4DXW A;  1OCZ C;  2DYR C;  2HFE C;  1KKD A;  4JTA B;  4BW5 A;  3SPJ A;  4J9Z B;  5EC2 C;  2EIL C;  4R50 A;  4PDM A;  3E8F A;  3KG2 A;  2A79 B;  4MVQ A;  4PDV A;  4QE7 A;  4PA4 A;  4RUF A;  5IY5 C;  3SYP A;  2DWE C;  4RUE A;  5E1A C;  3WG7 C;  2BOB C;  3ABL C;  3GB7 C;  1R3J C;  2IH1 C;  3RVY A;  3E8B A;  3E83 A;  2H8P C;  3ASO C;  4QNH B;  2OCC C;  4OXS A;  3ASN C;  4X88 A;  2ITD C;  3E86 A;  3AG2 C;  2WLI B;  1V55 C;  2K1E A;  3ZJZ A;  2WLN A;  4HZ3 A;  2P7T C;  4TWK A;  3RBZ A;  1XL6 A;  1R3K C;  2HJF C;  4MVZ A;  3FB7 C;  5EBL C;  1JVM A;  4KFM A;  3F7V C;  5EBW C;  5J9P C;  1ORQ C;  3T2M A;  4MVU A;  5CBG A;  3OR7 C;  3OR6 C;  4RO2 A;  2Y69 C;  3LDE A;  4JTD B;  4MS2 A;  4UUJ C;  4PA3 A;  3FB6 C;  3SYQ A;  1K4D C;  4R7C A;  2WLK A;  4PA6 A;  2DYS C;  3JYC A;  4MW3 A;  2EIM C;  1V54 C;  1BL8 A;  2QTO A;  1P7B A;  3SYC A;  5B3S C;  3LNM B;  2WLH A;  4P9O A;  5KUK A;  4MVR A;  2BOC C;  3ABM C;  3RW0 A;  3K06 A;  3STZ C;  2Q6A A;  2A0L A;  4PA9 A;  5CBH A;  2X6B A;  3K0D A;  4P9P A;  4R8C A; 
#chains in the Genus database with same CATH topology
 1P49 A;  4LF7 B;  1VQ6 V;  5B1A B;  3N2K A;  3QNE A;  4L8J A;  2E3C A;  1WAZ A;  1Y74 B;  4ZBM A;  2QKA A;  3P30 A;  1WA8 B;  1CPY A;  2IBZ H;  2KG7 B;  5EIB C;  1EZJ A;  3RT3 C;  5KUM A;  4MW8 A;  4FPP A;  2RMK B;  1S77 D;  2BSK B;  1AB3 A;  1H2N A;  3FB8 C;  5BXZ A;  1O9G A;  5B1B B;  3K5M A;  2ARH A;  1ZX3 A;  5LP6 C;  3Q4H B;  2CH7 A;  2WA3 A;  5IE9 A;  3ABU A;  2ZD9 A;  2Q4P A;  1F23 A;  1CEZ A;  2KB1 A;  4I9W A;  5JVD B;  2IJK A;  2QR4 A;  3C90 A;  3MDS A;  3G6B A;  1BGY H;  1OCZ B;  4J7J A;  3JAW A;  4B3S O;  3ZCC A;  1AI4 A;  3KCY A;  3CJH B;  3M99 B;  1U97 A;  4O4L B;  5FLX N;  5C93 A;  5LL6 Y;  5JJN B;  1R1B A;  1JOY A;  1IXB A;  2YSU B;  1QBZ A;  1VP7 A;  5HFM A;  1JMK C;  1WB8 A;  5CB4 B;  2N05 A;  3JAR B;  4DXW A;  3HKD A;  1KBH A;  4R50 A;  4LH7 A;  4N21 A;  3G80 A;  2ZE6 A;  3P3N A;  1YI2 V;  3ABM B;  3APQ A;  5B66 Z;  3ASN C;  2HR3 A;  2FB5 A;  3O65 A;  3ZMS A;  5HFL A;  4LF8 B;  3F7V C;  1AJQ A;  3OT7 A;  1K4D C;  2XAF A;  1Y76 B;  4O2B B;  3J80 N;  2DYS C;  3JYC A;  5DM6 V;  2MW2 B;  3B8N A;  4LFA O;  3CSX A;  4JI5 B;  3RYI B;  2WLH A;  4ICG A;  4K35 A;  3BVO A;  3CCJ V;  3DXR A;  1Q6U A;  2Q6A A;  4PA9 A;  2CE4 A;  3JAS B;  3SDL A;  5LGN A;  1IBL O;  3CME V;  2NN4 A;  1JPX A;  1AIL A;  2EIK B;  5BZB A;  3F5W C;  5LGT A;  1M57 C;  1NH2 D;  4W4L A;  1D5A A;  1CP9 A;  2Q73 A;  4X65 O;  1KB9 F;  4AQY O;  2BTO A;  4NXN O;  5IJ0 A;  3D36 C;  1F4M A;  1QQC A;  2JEX A;  3OD4 A;  1NBM G;  4ZOL A;  3B09 A;  4DV5 B;  2ZE5 A;  3ZRX A;  2Y48 A;  1WN7 A;  5EC1 C;  1KMI Z;  1OZ0 A;  3T1Y O;  1PL4 A;  5B1A C;  5J2T A;  5CBF A;  2Y0I A;  5LYJ A;  4JI7 O;  4DV1 O;  1SC5 B;  5K1X A;  1OCR C;  1XNQ O;  4BIO A;  1R73 A;  4ZIB A;  4DV4 B;  1J95 A;  1HDJ A;  4QPJ A;  1K4C C;  2F4V O;  4NTW A;  1F51 A;  1ZWI C;  3L72 H;  2QEX V;  4FLV A;  5BR8 O;  5JQG B;  3LDD A;  3HPL C;  4MVO A;  5B1B C;  3L71 H;  4XDL A;  4YHH B;  2HJD A;  5IYZ B;  2ZR2 A;  5FNV A;  3I55 V;  1SA0 A;  3BA9 A;  2CGO A;  2HG5 C;  3BCC H;  5LOV B;  1PV0 A;  2F1M A;  1EM1 A;  1OCZ C;  2ZQM A;  2LGQ A;  1GM9 A;  3GWO A;  3SYP A;  1R3J C;  1RPO A;  3B2E E;  4FM0 A;  2PI4 A;  2PY5 A;  2WWW A;  3ZJZ A;  2E76 B;  3RBZ A;  3W7T A;  5EBL C;  3G67 A;  1FKA O;  3ETD A;  2UXX A;  2UUB B;  1BE3 H;  1Z5W A;  4UCV A;  4DV6 B;  5LXT A;  2UUC B;  3A8T A;  1XHZ A;  1BSM A;  3LNM B;  1K33 A;  3ABM C;  1AP6 A;  1EN6 A;  2NNU A;  2P5O A;  1NU1 H;  4DV0 O;  1H8H G;  4CS4 A;  1VMG A;  5EYP B;  2YUA A;  3TK1 A;  1P84 F;  4J41 A;  3BPZ A;  3L75 H;  4DK0 A;  2ZM6 B;  2RNB A;  5KAI Z;  3VQY A;  4HNA A;  1PPJ H;  4WFF A;  1N4C A;  2ZNJ A;  3P32 A;  4QJF B;  3LUT B;  3CCE V;  3DC5 A;  1HNZ B;  2JDI G;  3AK2 A;  3KZI Z;  3EHB B;  1R3I C;  1SS3 A;  1XMO B;  3L9D A;  4HBN A;  2EIK C;  5LP6 A;  1RM1 B;  4DR1 B;  2YIA A;  1G6U A;  4LF8 O;  5TIS Z;  1MA1 A;  1MAB G;  5L3C A;  2A7W A;  1VF5 B;  4RAI A;  4LF4 B;  4JI5 O;  2V1D A;  1S5H C;  3E2E A;  4WFB V;  1WLE A;  1XOU A;  2LW1 A;  3QO8 A;  4O4I A;  1S5J A;  1SQF A;  1SZT A;  2YID A;  5FPO A;  3SPI A;  3A0H Z;  2JEU A;  5L3F A;  1Q3E A;  3SJB C;  5J2U A;  2Q8V A;  1M1K W;  1LUW A;  2A79 B;  3JD2 A;  2EUL A;  3IJ4 A;  1O9H A;  4DV5 O;  2CAZ C;  3JSL A;  2PYJ A;  1GO3 F;  1N33 B;  4TWK A;  3LSU A;  1R6T A;  2KQX A;  1OCO B;  3K58 A;  3CS5 A;  4DV4 O;  3JAM N;  4CC6 A;  1YDX A;  2BOC C;  4FLY A;  1GH6 A;  1VQM V;  4X66 B;  4AI8 A;  1L0L H;  1YIT V;  2LO1 A;  3F7Y C;  3CXC U;  1JFF A;  4YHH O;  1TGO A;  3OEE G;  3E22 A;  2GTA A;  1MNG A;  2JS3 A;  3W7W A;  1TUB A;  1W0J G;  2ZR3 A;  3WB0 A;  3JAL B;  4ZI7 B;  4KXR A;  3RYH B;  1YIJ V;  3EFF K;  1NJI W;  3CX5 F;  3ABK B;  3OUF A;  4I55 B;  1GN3 A;  3UCS C;  1VQO V;  2G38 A;  3CCM V;  4KL1 A;  2E75 B;  1F4N A;  3UM7 A;  1OHH G;  1JA8 A;  1M93 A;  1Q5O A;  1WA8 A;  2UUB O;  2KG7 A;  4CS2 A;  3HKE B;  4DV6 O;  1YZB A;  2UUC O;  4Z1M G;  4JI3 B;  5CA1 B;  5KHG A;  4WBN B;  2BSK A;  1XUQ A;  2UUA B;  1GK9 A;  2YXY A;  4C7U A;  1IVS A;  2WLJ A;  1BZK A;  1FXK B;  2ZIO A;  2ZT9 B;  3Q4H A;  1K9M W;  2AHY A;  5JVD A;  1YCI A;  2F43 G;  1XDC A;  3A0R A;  2ZM6 O;  1BT8 A;  4I9Q A;  1URF A;  3WU2 Z;  3DSQ A;  2HFE C;  5EC2 C;  1TAE A;  2Q7G A;  3KG2 A;  4PDM A;  4MVQ A;  3CJH A;  4LFB B;  4X1Y A;  4O4L A;  3K9S A;  1VQ9 V;  3RVY A;  4FZ0 A;  1Q81 W;  1HNZ O;  4X88 A;  3E86 A;  4FLT A;  2OYQ A;  1JCH A;  1IZ3 A;  1XMO O;  3K3W A;  4DR1 O;  5CB4 A;  3JAR A;  4BIU A;  1Q8I A;  3BY6 A;  2UU9 B;  1F7Y A;  3ZBH A;  4XBF A;  4OX9 B;  1HR0 B;  1PM9 A;  2EIM B;  3OFN G;  2M7W A;  4P9O A;  4LF4 O;  1PD3 A;  2ZCE A;  3VQX A;  2CTQ A;  3LSQ A;  3ZED A;  2W6J G;  1Y6X A;  2NR5 A;  4LNU B;  1OCO C;  1Y76 A;  4O2B A;  5L3B A;  3QTC A;  4RWU A;  2Q69 A;  4UCR A;  1AI5 A;  3RYI A;  2QWO B;  2AW9 A;  5B1O A;  4IIJ B;  4MTX A;  4FVM A;  3JAS A;  2Z5U A;  4R6Z A;  2ZE8 A;  4JI1 B;  5GW7 A;  1VF6 A;  1KKC A;  1QNM A;  4XDJ A;  3JAT B;  1N33 O;  1JR9 A;  5CA0 A;  2QA4 V;  3N27 A;  4W4K A;  5CN0 A;  1Q43 A;  4X1K A;  1N8R W;  4WFG A;  2ZDI A;  4PV1 B;  4MVS A;  1GN2 A;  2CTR A;  3H1I H;  3B4S A;  3SJQ C;  3K5N A;  4X89 A;  2OCH A;  4X66 O;  3ASO B;  1N32 B;  4GCZ A;  4FM1 A;  1V55 B;  3RVZ A;  1I94 B;  5B1N A;  1YF2 A;  2YS8 A;  4F4L A;  2W6I G;  2Q0A A;  3K79 A;  1BQZ A;  1TVK B;  4NB5 A;  4B7E A;  3JCZ A;  2XTA A;  4PDV A;  4JYY A;  5JQG A;  2JJ1 G;  1GRJ A;  5GTH Z;  3B77 A;  5IYZ A;  1G8M A;  2ITD C;  3CRM A;  4FLW A;  3CCQ V;  4YIP A;  2LW7 A;  3T2M A;  5LOV A;  1VQK V;  1SER A;  1I0H A;  3GVM A;  3CRR A;  2FKX A;  3H1H H;  3R66 A;  2WLK A;  3LSS A;  1LR1 A;  4AQY B;  2X7R B;  5GON B;  2DYS B;  4JI3 O;  3CE2 A;  4UV8 A;  1OV9 A;  2UUA O;  5BMV B;  2DW4 A;  4UVB A;  2XAJ A;  4UVC A;  3WB2 A;  3AG7 A;  1YJ9 V;  2LFS A;  2DN9 A;  3KCX A;  1BCC H;  4LCU C;  3BHP A;  1UFI A;  2FL4 A;  3U0Z A;  4DR2 B;  3AG1 B;  1M57 B;  2VQF B;  1RP3 B;  4ZHQ B;  3CCV V;  1M90 W;  4LFB O;  1VF7 A;  4IL6 Z;  3PJS K;  4DR3 B;  1PKX A;  4U7O A;  5JCO A;  2FYU H;  4ASU G;  1XQ8 A;  4NXM B;  3BAA A;  2HLD G;  1XI1 A;  3ETG A;  1L0N H;  3X2Q C;  3E89 A;  1VQL V;  4CH4 A;  4Z2W A;  2ADQ B;  1FYJ A;  4H13 B;  1M5I A;  4H33 A;  4D7S A;  1OCR B;  3K5L A;  2UU9 O;  2IH3 C;  1E1Q G;  3G4S V;  4OX9 O;  2EIL B;  1HR0 O;  4JAS A;  1YEW A;  3OTO B;  3WG7 B;  3E8G A;  3CEI A;  1PL0 A;  2PTM A;  4DRX B;  2XND G;  3ZMT A;  2HVK C;  3OMA B;  3OEH G;  4I4T B;  2Z0A A;  1VQ4 V;  2CUG A;  1SQB H;  3E8F A;  4J11 A;  2AXT Z;  1J5E B;  3ASO C;  2XAQ A;  4OXS A;  4DV0 B;  4JI1 O;  1V55 C;  2XAG A;  2WLN A;  2HJF C;  4TV9 B;  1B3Q A;  5H9C A;  4A5U B;  5J9P C;  1MZF A;  1WP7 A;  5CA3 A;  2L35 A;  3FB6 C;  3JD3 A;  1WB7 A;  1NT2 B;  2GUZ B;  2QTO A;  3RN4 A;  1NQT A;  2YC0 A;  2EZO A;  4YXW G;  1P4R A;  4UV9 A;  4OPA A;  3OAA G;  5CBH A;  3MAQ A;  3N2G B;  5IT9 N;  1QHT A;  3OM3 B;  1N32 O;  1QCE A;  4LF6 B;  5KHK A;  1I94 O;  5LBQ A;  3ZN1 A;  1Q6I A;  1BHB A;  4JZ2 A;  3CWB H;  3K59 A;  3FFQ A;  3SPG A;  5EIB D;  1SKV A;  3JD0 A;  1U96 A;  1Q6H A;  4E4E A;  5D5Q A;  1KU9 A;  2WA4 A;  2N74 A;  3ZRV A;  1JQ0 A;  2QM4 A;  3AG1 C;  1EN4 A;  5H6R A;  5AG2 A;  4B08 A;  3JAL A;  1FS0 G;  3T1C A;  4IT5 A;  3RYH A;  2OTL V;  2CK3 G;  1ZL8 B;  4I55 A;  3SJC C;  2X6A A;  1KC8 W;  3QO7 A;  1Y67 A;  1R6N A;  2QSA A;  2R9R B;  1HNX B;  4LF5 B;  3HKE A;  5LHG A;  2Y69 B;  5CA1 A;  4GX1 A;  1K73 W;  4WBN A;  4DR2 O;  5LMN B;  2VQF O;  2EIL C;  4LWS B;  4QE7 A;  3WG7 C;  1B6Q A;  1FXK A;  3T1H B;  3CP1 A;  2MK3 A;  5IYB O;  3MHS C;  4DR3 O;  1YJW V;  4NXM O;  4X20 B;  1KQS U;  1JVM A;  5EBW C;  3UO2 A;  4JGS A;  1S0V A;  3W7X A;  4MS2 A;  4X1I B;  3ETQ A;  1H8E G;  1MSD A;  2JGU A;  1PNL A;  2IW5 A;  1IBM B;  1E79 G;  2FML A;  4IGG A;  3STZ C;  4UFZ A;  2LJ2 A;  2YXL A;  3OTO O;  3K0D A;  1H38 A;  3AG3 B;  4LP8 A;  3I5D A;  3EXA A;  2QDO A;  3TET A;  4FMT A;  4HYO A;  4MTG A;  1BHA A;  1MZE A;  3K04 A;  2QJ1 A;  3T4Z A;  4J9Y B;  4I50 A;  3CPW U;  2EBO A;  4JAA A;  4IYH A;  2PZS A;  5JWP A;  1J5E O;  2WLL B;  1CXZ B;  3SJA C;  3OMI B;  1X4T A;  2WLI A;  5IYD O;  1GMG A;  3UT5 B;  4JYB A;  4LNU A;  3OE7 G;  2V7Q G;  2M6Y A;  2ZE7 A;  3H9V A;  2IJI A;  2ITC C;  1IUR A;  2DYR B;  2QWR B;  4EB6 B;  1K8A W;  4X64 B;  3R65 A;  2GTS A;  3SPC A;  3JAT A;  4FFK A;  5EZY B;  4PDL A;  2WSS G;  4PJ0 Z;  5EBM C;  2CDY A;  4LF6 O;  5KA6 A;  1XEQ A;  4Q20 A;  5H6Q A;  4JYC A;  3LNN A;  4P2Z A;  2P22 C;  4MTO A;  1QVG U;  3JSN A;  5L3D A;  1YTF B;  4QIW F;  4JTA B;  4KP4 A;  1ZAU A;  4WFA V;  1XHX A;  4RUF A;  4N23 A;  4K8Z A;  2DWE C;  2ZNI A;  3ABL C;  3F5T A;  3E8B A;  2Q0O C;  4RQE A;  4D6T H;  1GN4 A;  4DYL A;  4PI0 A;  2P7T C;  2CTW A;  2QKC A;  1QR8 A;  3H1L H;  3KKY A;  4DO2 A;  4EFE A;  2Y69 C;  1TVK A;  2P4K A;  3I56 V;  4FLU A;  2PF4 E;  3SYC A;  4JI6 B;  3RW0 A;  1ROP A;  2JVD A;  1K5Q A;  1VAR A;  4BW9 A;  4G28 B;  2VQE B;  3IFX A;  2X6C A;  1MMM A;  1B04 A;  1HNX O;  2FTK A;  4LF5 O;  2PGG A;  5GON A;  3JD4 A;  2VWK A;  4BR6 A;  5LMN O;  1ARO P;  3O9O A;  4PA7 A;  5BMV A;  4JAU A;  5L3E A;  3AG3 C;  5JH7 B;  3T1H O;  1YJN V;  2R9I A;  4IHJ B;  1MOF A;  1OCC C;  1KP2 A;  3IC9 A;  1DF4 A;  3FAV B;  1K5S A;  5EK0 A;  1UPG A;  4JV5 O;  1WNS A;  4ZHQ A;  4DW1 A;  2YEV B;  4FFB B;  3MHH C;  3D36 A;  3NXS A;  1IBM O;  3RWR D;  1QU7 A;  2AZ0 A;  2EZP A;  2C2A A;  2Q68 A;  2B1G A;  1P7G A;  1Y74 A;  3CD6 V;  3M8A A;  4OPH A;  4JYA B;  2ETN A;  2DYR C;  3ICX A;  4F6E A;  1XRE A;  4KUM A;  3SPJ A;  2F95 B;  4U7N A;  4KHP B;  4RUE A;  2P6J A;  4LH6 A;  2BOB C;  1K34 A;  1Z5V A;  3E83 A;  4DRX A;  2P4V A;  4WF9 V;  1NZ6 A;  1H2S B;  4HZ3 A;  4NTY A;  4J7K A;  4MVZ A;  3FB7 C;  3JD1 A;  2BTQ B;  4I4T A;  3CCR V;  4QGP A;  1RSO B;  1FFX B;  1V54 C;  2E5L B;  1EZV H;  4B3T B;  1KD1 W;  2YXH A;  2RJZ A;  4X64 O;  3FD9 A;  4TV8 B;  1Q82 W;  3CB2 A;  4P9P A;  4Q6G A;  1HW7 A;  3L70 H;  2QM7 A;  1AI6 A;  1DTO A;  4TV9 A;  2PYL A;  3ZHV A;  4EFB A;  5LGU A;  1SA0 B;  2L6L A;  2GUZ A;  5IDJ A;  5K1P A;  1ZTE A;  5B5E Z;  2UXD B;  3N2G A;  2HEP A;  3CCS V;  1AP5 A;  1IXM A;  3FKS G;  1H2K A;  3ZRW B;  3G6E V;  1WPX A;  1W2B U;  5KHJ A;  4WCE V;  1M56 B;  3X2Q B;  4GZR B;  2E74 B;  1GAX A;  4LFC B;  2GBO A;  1W59 A;  1GM8 A;  2QWN B;  5DEC A;  2KSD A;  4JI6 O;  3M7M X;  2RN9 A;  1Q86 W;  2B1I A;  3B8M A;  2ODM A;  4X8A A;  4O2A B;  3K08 A;  1H2L A;  2OWO A;  2QWQ B;  2VQE O;  1BS3 A;  3HR0 A;  4CZZ A;  5LMU B;  3OGC C;  2JK5 C;  3QF7 A;  1NKD A;  3ZHR A;  1YTF D;  4PEL A;  3CCU V;  2F66 C;  1NTM H;  1KKD A;  4HNA B;  1ZL8 A;  1YVW A;  3RFR A;  3QO5 A;  3THO A;  4FK5 C;  4CS3 A;  3GB7 C;  2ZKO A;  1ZLZ A;  2R9A A;  3P3P A;  3HKB B;  4F6R B;  4DR4 B;  1XNR B;  4PHZ A;  1M9N A;  1V9P A;  4UUJ C;  1K7D A;  4LWS A;  2XHB A;  1MG1 A;  4B3M B;  3BRC A;  1K97 A;  3K5O A;  5KUK A;  4MVR A;  2F93 B;  2A3Q A;  1I08 A;  2A0L A;  2OTJ V;  3CHX A;  4X20 A;  3OMN B;  2O57 A;  2WLM A;  3PN1 A;  2W0X A;  2HHH B;  3BEH A;  4X1I A;  3TCU A;  4X9Q A;  3OW2 U;  1ZUQ A;  5LA6 B;  1XMQ B;  3ZHS A;  1LNQ A;  4MTF A;  4JYA O;  2JGD B;  1DGS A;  3J81 N;  2EIN B;  2GSM B;  4KHP O;  2GHY A;  1SQX H;  4GX2 A;  5LHH A;  4K3A A;  4JI0 B;  4DV2 B;  3VQV A;  2Z3Y A;  2VRZ A;  1KUQ A;  2ZIM A;  1Q7Y W;  4B3R B;  4BWA A;  1QLN A;  3SYA A;  2QKS A;  5KHI A;  2E5L O;  4B3T O;  2WLL A;  4O4J B;  2EIJ C;  5DED A;  5KHH A;  4TQD A;  2HKO A;  4H44 B;  3UT5 A;  4DV3 B;  3C3T A;  4TT3 G;  5KLV H;  3W7U A;  2R72 A;  5EYP A;  1MSW D;  2IM9 A;  1SES A;  1M56 C;  2RQ6 A;  1RPR A;  3E22 B;  4CBC A;  1DF5 A;  1WPB A;  4DUY B;  4EB6 A;  2XAS A;  4DV7 B;  1G1X B;  4DW0 A;  1K3E A;  4YJ2 B;  3HKC B;  2UXD O;  5KA5 A;  1AR5 A;  4RQF A;  1THZ A;  2K1E A;  3DC6 A;  2RCV A;  1ORQ C;  1S5L Z;  2AGA A;  5CMU A;  1QR9 A;  4GKJ O;  4PA6 A;  3WFV A;  1NVP B;  4LFC O;  5FL7 G;  2GDS A;  3A2F A;  1KEC A;  3K06 A;  3L74 H;  2EJ7 A;  4R8C A;  2NLJ C;  1AI7 A;  1KYO F;  4YY3 B;  4TUY B;  4GX0 A;  5LMU O;  1AJP A;  4TQF A;  2CGN A;  4H0L B;  1FD9 A;  1VIB A;  2BCC H;  1JJ2 U;  4JI8 B;  1G4Y B;  5KX5 B;  4D7T A;  1AR1 B;  3CMA V;  4X62 B;  1TA8 A;  4X1Y B;  1HNW B;  1I7F A;  3ZX6 A;  4J80 A;  2AHZ A;  1T5E A;  4PDR A;  4I0X B;  4DR4 O;  4UCS A;  4FLX A;  1XNR O;  3K0G A;  4YIO A;  2YIB D;  4GT1 A;  2ATK C;  1GN6 A;  2EIN C;  4B3M O;  4ABM A;  4WFH A;  4H37 A;  3S3X A;  3TXS A;  5JH7 A;  1H2G A;  2IU3 A;  4IHJ A;  4TSF G;  3ZRS A;  2ZXW C;  1ENV A;  1FPO A;  3RYC B;  5DN6 G;  1NR7 A;  4YJ3 B;  4U3J B;  3CC7 V;  4FZ1 A;  3MD0 A;  1I5X A;  3FAV A;  5KMG B;  2HHH O;  1YHQ V;  3E8H A;  2YEV A;  4FFB A;  1XMQ O;  3U11 A;  4ZI7 A;  3EVK A;  3CXH F;  2JRI A;  2QTS A;  2WAM A;  1US6 A;  2IH1 C;  5H2F Z;  5FPR A;  4CH6 A;  3ABL B;  4UXN A;  4OGQ B;  3QG5 A;  5ITZ B;  4JI0 O;  3U10 A;  1JX9 A;  1R3K C;  2B5U A;  5C8Y B;  4DV2 O;  5CA0 B;  1XBL A;  3OR7 C;  5JJJ B;  4R7C A;  1Y4M A;  2ZIN A;  4CH5 A;  1DLB A;  3K57 A;  4X1K B;  4B3R O;  1WJZ A;  2CTP A;  3ABT A;  1E1R G;  4LF9 B;  1N34 B;  2AZ2 A;  2LGW A;  2X6B A;  1HWY A;  4I7Z B;  4DV3 O;  3AK1 A;  3OUS A;  3JCU Z;  2BTQ A;  3K03 A;  1I5Y A;  3RYF B;  3L73 H;  1RSO A;  4FM2 A;  2W0F C;  1FFX A;  4JV5 B;  3G71 V;  4DUY O;  3STL C;  2YI9 A;  4O4H B;  4DV7 O;  4TV8 A;  3SR2 C;  1K92 A;  2UXN A;  2QE7 G;  1FFT B;  4K0K B;  3LDC A;  4LF7 O;  5L3G A;  3FB5 C;  1HP8 A;  2H3O A;  1FXV A;  2DQ0 A;  1OCC B;  2A06 H;  3AK3 A;  2VS0 A;  5IJ9 B;  4EKW A;  1S72 V;  3TXQ A;  4FIP C;  2UXB B;  2H94 A;  4UCO A;  4FLZ A;  2DWD C;  3W7S A;  5IYC O;  5F2V O;  2Y4T A;  3ZRW A;  1S3J A;  2Q7E A;  3OTF A;  2YIB A;  2DOS A;  4YY3 O;  4BAY A;  4NTX A;  3JAK B;  3QVN A;  4IIJ A;  2N04 A;  1VQN V;  4JI8 O;  4I5S A;  5B3S B;  5E1A C;  2DQ3 A;  2XT9 A;  4O2A A;  4QNH B;  4X62 O;  3K9A A;  3DGE A;  1VQ5 V;  1HNW O;  5A2Q N;  2VWJ A;  1N0J A;  1SQQ H;  4L87 A;  4FJC C;  3N2K B;  3D8C A;  1FAF A;  1GM7 A;  4CH3 A;  1NVP D;  1S76 D;  1Y66 A;  1BL8 A;  5IWA B;  1P7B A;  3FYE B;  1SRY A;  1V54 B;  1ZSP A;  3HKB A;  1SQV H;  4F6R A;  3ZS8 C;  3H1J H;  1VF6 C;  3BFR A;  4DUZ B;  2XOK G;  3ZMV A;  4QPK A;  2QGN A;  4NVP A;  2YIC A;  3DTU B;  2EJR A;  4EEQ A;  4DR7 B;  1H2M A;  4MSW C;  2CH7 B;  2Y4U A;  3HB3 B;  1QLE B;  2ZDI C;  3A0B Z;  1OJH A;  3UO3 A;  1N0N A;  5GTI Z;  3FYI B;  1N36 B;  2JS5 A;  3JAW B;  3H1K H;  4G27 B;  4DK1 A;  3AEI A;  5LA6 A;  2ADP A;  1R6K A;  4U3F H;  2UXC B;  1AVM A;  2YI8 A;  2JGD A;  2Q67 A;  3RGB A;  2DJV A;  2HVJ C;  4JAV A;  4LR3 A;  3HKD B;  5IY5 B;  1JJO A;  4BIZ A;  4LF9 O;  1N34 O;  2Q9L A;  2OIG A;  4J42 A;  2OCC B;  4HAM A;  3ZHT A;  4UB8 Z;  3SGI A;  4J10 A;  4DR6 B;  5BY1 A;  2WPD G;  1IDS A;  3NR7 A;  2R70 A;  3ETE A;  2RDC A;  4O4J A;  1SQP H;  3ZN0 A;  1WP8 A;  1GTO A;  3CRA A;  2H8P C;  1SZX A;  2D3O W;  3DXR B;  1AJN A;  4K0K O;  4NYK A;  4IYI A;  1KP3 A;  4KFM A;  1NTZ H;  3BA8 A;  3OR6 C;  4JTD B;  5H5N A;  3APO A;  1L1F A;  3ML0 A;  4GKK B;  4DR5 B;  4NR1 A;  1Z2G A;  4JI4 B;  4YJ2 A;  3HKC A;  3S3W A;  5B3S C;  4UCT A;  5IJ0 B;  2UXB O;  4ZOL B;  1SF9 A;  5JCO C;  3C3S A;  5J2T B;  1TUE B;  4E2L A;  1SET A;  4GUN A;  5LYJ B;  1NI8 A;  3E35 A;  4JZG A;  4WFE A;  3UKM A;  4AHC A;  2XUM A;  5E79 Z;  1NR1 A;  1XL4 A;  3H01 A;  5JJE B;  4MT8 A;  4JI2 B;  1FJG B;  4JTC B;  3AG4 B;  5D5P A;  3CCL V;  1NS1 A;  1RM1 C;  3VQW A;  3IAY A;  4AIL C;  3ZMZ A;  3BAB A;  4TUY A;  3IGA C;  2X0L A;  2HP8 A;  2D2C B;  2JJ2 G;  4LBE C;  5FNV B;  3ZHU A;  1IBK B;  1Q90 D;  1YSC A;  3GWK C;  1QLE C;  4J7Z A;  5KX5 A;  2DMX A;  1EFR G;  2P90 A;  5IWA O;  2F23 A;  3IC7 A;  1EN5 A;  4I0X A;  1A32 A;  2EIJ B;  3D3I A;  2LQT A;  3TJT A;  3AG2 B;  4DUZ O;  2OT5 A;  5LHI A;  4NKG B;  4GKJ B;  3CC4 V;  1EBO A;  2A9H A;  4DR7 O;  2XAH A;  1NTK H;  2GV9 A;  2YDE A;  5LXT B;  1LUV A;  4BW5 A;  4I50 B;  2IU0 A;  5IY5 C;  1FXH A;  2V4D A;  3FX7 A;  4GLX A;  1AR4 A;  3RYC A;  1N36 O;  4YJ3 A;  4U3J A;  3ZHQ A;  2PI5 A;  2OCC C;  2WLI B;  4PI2 A;  5KMG A;  4ZKI A;  5CBG A;  4RO2 A;  1VQ8 V;  2DE0 X;  2IJJ A;  4PA3 A;  3SYQ A;  2UXC O;  3ZIA G;  4MW3 A;  4B3S B;  1PNK A;  2ILM A;  1X59 A;  3J7A U;  5ITZ A;  1M4U A;  2JIZ G;  2Y0P A;  5C8Y A;  1COW G;  2P06 A;  3CYO A;  4DR6 O;  5LP6 B;  3CRQ A;  1NH2 B;  1YXB A;  4G2K A;  4B7K A;  1IX9 A;  4JF3 A;  3ABK C;  2EX3 A;  4QE9 A;  3SYO A;  4CC5 A;  4K8X A;  4XDK A;  4JPR A;  3D3Q A;  4TOI A;  3RYF A;  4UCU A;  3ZMU A;  2PUS A;  2BE3 A;  4O4I B;  4P30 A;  3VBB A;  3CC2 V;  4LFA B;  3VOU A;  2KKW A;  2OIE A;  4O4H A;  4GKK O;  4DR5 O;  4Z1V A;  5J2U B;  2Q7H A;  4MVM A;  3T4D A;  4JI4 O;  2B9Z A;  1L8D A;  1FXK C;  3AG4 C;  1VQP V;  4UB6 Z;  4LC1 A;  1R3L C;  1GKF A;  1IBL B;  3SPH A;  1DK1 A;  2LP7 A;  2ZXW B;  3ASN B;  3TGU H;  1BQ0 A;  2LFR A;  1B06 A;  5IJ9 A;  2Q5Z A;  5A9G A;  1UJW B;  4PD4 F;  4X65 B;  1PP9 H;  1RFY A;  2K9P A;  4GX5 A;  4NXN B;  2IJH A;  4J9Z B;  1QVF U;  4PA4 A;  4JI2 O;  2QM8 A;  2P67 A;  1FJG O;  3T1Y B;  1VQ7 V;  3WB1 A;  3OGI B;  3AG2 C;  4GYC B;  1D2D A;  3UQ8 A;  4JI7 B;  4DV1 B;  1BMF G;  1XL6 A;  3CRC A;  1JFF B;  4MVU A;  3JAK A;  2QWP B;  1IBK O;  1XNQ B;  3LDE A;  1PNM A;  1W0K G;  2F4V B;  2EIM C;  1TUB B;  5BR8 B;  1D5N A;  5KAF Z;  1VEW A;  3B40 A;  4UVA A;  5EZY A;  1XIL A;  1SQG A; 
#chains in the Genus database with same CATH homology
 3LSQ A;  4G28 B;  1VQ6 V;  2W6J G;  3OUS A;  5B1A B;  3IFX A;  3QNE A;  3K03 A;  1I5Y A;  2X6C A;  1OCO C;  2W0F C;  4ZBM A;  5L3B A;  2FTK A;  2Q69 A;  3G71 V;  1AI5 A;  3P30 A;  5B1O A;  1CPY A;  3JD4 A;  4MTX A;  1EZJ A;  3STL C;  1ARO P;  5KUM A;  4MW8 A;  4PA7 A;  4FPP A;  1S77 D;  4JAU A;  5L3E A;  1K92 A;  3AG3 C;  2Z5U A;  4R6Z A;  2UXN A;  2QE7 G;  1FFT B;  3FB8 C;  1YJN V;  2R9I A;  5GW7 A;  1MOF A;  3LDC A;  5B1B B;  5L3G A;  1OCC C;  3FB5 C;  1KP2 A;  4XDJ A;  1FXV A;  1DF4 A;  2DQ0 A;  1OCC B;  2QA4 V;  1K5S A;  3ABU A;  5EK0 A;  2ZD9 A;  5CN0 A;  1F23 A;  4EKW A;  2KB1 A;  1N8R W;  4I9W A;  1CEZ A;  2IJK A;  4WFG A;  2YEV B;  2ZDI A;  1S72 V;  4MVS A;  1OCZ B;  3MHH C;  4FIP C;  3D36 A;  3SJQ C;  2H94 A;  3NXS A;  3ZCC A;  1AI4 A;  2DWD C;  4X89 A;  3M99 B;  3W7S A;  5IYC O;  3ZRW A;  3ASO B;  5C93 A;  4GCZ A;  2EZP A;  1S3J A;  2C2A A;  2Q68 A;  1JOY A;  1V55 B;  2B1G A;  3RVZ A;  5B1N A;  2YSU B;  1QBZ A;  4F4L A;  3CD6 V;  4BAY A;  2W6I G;  5HFM A;  3K79 A;  4DXW A;  2DYR C;  4KUM A;  3SPJ A;  1VQN V;  4R50 A;  3JCZ A;  4PDV A;  4I5S A;  4N21 A;  2JJ1 G;  4U7N A;  5B3S B;  4RUE A;  2DQ3 A;  2P6J A;  2BOB C;  5E1A C;  1K34 A;  1YI2 V;  3ABM B;  3B77 A;  3E83 A;  4QNH B;  3K9A A;  3DGE A;  1VQ5 V;  1G8M A;  3ASN C;  4WF9 V;  2HR3 A;  2ITD C;  4HZ3 A;  3ZMS A;  3CCQ V;  5HFL A;  4MVZ A;  3FB7 C;  4L87 A;  4FJC C;  3F7V C;  3T2M A;  1VQK V;  3JD1 A;  1SER A;  1GM7 A;  1AJQ A;  3CCR V;  1K4D C;  2XAF A;  2WLK A;  3LSS A;  1NVP D;  2DYS C;  3JYC A;  1Y66 A;  1S76 D;  5DM6 V;  1V54 C;  1BL8 A;  3B8N A;  2X7R B;  1P7B A;  3FYE B;  1SRY A;  2DYS B;  1KD1 W;  1V54 B;  2WLH A;  3CCJ V;  4UV8 A;  2Q6A A;  4PA9 A;  1Q82 W;  4P9P A;  2DW4 A;  4UVB A;  2QM7 A;  1AI6 A;  1DTO A;  2XAJ A;  2XOK G;  3ZMV A;  4QPK A;  5LGN A;  4UVC A;  3CME V;  1JPX A;  1YJ9 V;  2LFS A;  5LGU A;  3DTU B;  2EIK B;  5BZB A;  2EJR A;  3F5W C;  4LCU C;  1M57 C;  5LGT A;  1NH2 D;  5IDJ A;  1CP9 A;  4MSW C;  3AG1 B;  3HB3 B;  1QLE B;  1M57 B;  2ZDI C;  1F4M A;  3CCV V;  2JEX A;  1M90 W;  3FYI B;  1NBM G;  3ZRX A;  2Y48 A;  5EC1 C;  3CCS V;  1IXM A;  3PJS K;  1PKX A;  1OZ0 A;  4U7O A;  4ASU G;  3FKS G;  5B1A C;  5CBF A;  3ZRW B;  2HLD G;  3ETG A;  4G27 B;  3G6E V;  3X2Q C;  3E89 A;  1WPX A;  1W2B U;  1VQL V;  3AEI A;  4WCE V;  1M56 B;  1OCR C;  1R6K A;  3X2Q B;  1R73 A;  2Q67 A;  4H33 A;  1J95 A;  1OCR B;  4QPJ A;  1GM8 A;  1K4C C;  2HVJ C;  4JAV A;  1F51 A;  1ZWI C;  2IH3 C;  1E1Q G;  3G4S V;  2QEX V;  2EIL B;  5IY5 B;  4JAS A;  4BIZ A;  3WG7 B;  3E8G A;  3LDD A;  1Q86 W;  2B1I A;  3B8M A;  4X8A A;  3HPL C;  4MVO A;  1PL0 A;  3K08 A;  5B1B C;  4XDL A;  2OCC B;  4HAM A;  2ZR2 A;  2XND G;  3ZMT A;  3I55 V;  4CZZ A;  2HVK C;  3OGC C;  2JK5 C;  2WPD G;  2HG5 C;  1NKD A;  3OMA B;  3OEH G;  1YTF D;  4PEL A;  3CCU V;  3ETE A;  1VQ4 V;  1OCZ C;  2ZQM A;  1KKD A;  1GM9 A;  3GWO A;  3E8F A;  3QO5 A;  3ZN0 A;  4FK5 C;  3SYP A;  1GTO A;  3GB7 C;  1R3J C;  1RPO A;  2PI4 A;  2H8P C;  3ASO C;  2D3O W;  2XAQ A;  4OXS A;  2WWW A;  1AJN A;  1V55 C;  2XAG A;  2WLN A;  3ZJZ A;  3RBZ A;  2HJF C;  5H9C A;  3W7T A;  5EBL C;  1KP3 A;  1M9N A;  4KFM A;  5J9P C;  3ETD A;  2UXX A;  3OR6 C;  5CA3 A;  4JTD B;  4UUJ C;  1K7D A;  3FB6 C;  3JD3 A;  1L1F A;  3ML0 A;  1MG1 A;  2QTO A;  1K97 A;  1NQT A;  5B3S C;  3LNM B;  1K33 A;  2EZO A;  5KUK A;  4MVR A;  4YXW G;  3ABM C;  1P4R A;  4UV9 A;  2NNU A;  3OAA G;  2A0L A;  5CBH A;  2OTJ V;  3OMN B;  3OM3 B;  2WLM A;  1H8H G;  1QCE A;  1TUE B;  4E2L A;  1SET A;  3BEH A;  3TK1 A;  3E35 A;  3TCU A;  3UKM A;  4WFE A;  5LBQ A;  3OW2 U;  3ZN1 A;  1NR1 A;  1LNQ A;  1XL4 A;  1BHB A;  3H01 A;  4MTF A;  4WFF A;  4MT8 A;  3P32 A;  4QJF B;  3LUT B;  3SPG A;  3CCE V;  2EIN B;  3JD0 A;  2GSM B;  2GHY A;  4JTC B;  2JDI G;  3AG4 B;  3CCL V;  3EHB B;  4GX2 A;  5LHH A;  1R3I C;  1RM1 C;  3ZMZ A;  3ZRV A;  3IGA C;  2EIK C;  2X0L A;  1RM1 B;  1JQ0 A;  4LBE C;  2JJ2 G;  2Z3Y A;  1YSC A;  3AG1 C;  1Q7Y W;  1QLE C;  1MAB G;  5H6R A;  1FS0 G;  3T1C A;  1EFR G;  5L3C A;  2P90 A;  1QLN A;  4RAI A;  3SYA A;  2QKS A;  2OTL V;  2CK3 G;  2V1D A;  1S5H C;  2WLL A;  2X6A A;  2EIJ C;  3E2E A;  4WFB V;  2HKO A;  1KC8 W;  3QO7 A;  1WLE A;  3IC7 A;  2EIJ B;  3D3I A;  4TT3 G;  1R6N A;  3W7U A;  3QO8 A;  3AG2 B;  1MSW D;  2OT5 A;  5LHI A;  1SZT A;  2R9R B;  1SES A;  1M56 C;  1RPR A;  4CBC A;  5LHG A;  1DF5 A;  3SPI A;  3CC4 V;  1EBO A;  2A9H A;  2JEU A;  2Y69 B;  4GX1 A;  5L3F A;  1K73 W;  2XAH A;  4BW5 A;  1M1K W;  2XAS A;  2IU0 A;  2EIL C;  5IY5 C;  1FXH A;  2A79 B;  4QE7 A;  3JD2 A;  1K3E A;  3WG7 C;  1B6Q A;  1FXK A;  5KA5 A;  4RQF A;  3CP1 A;  2MK3 A;  2PI5 A;  2OCC C;  5IYB O;  3MHS C;  1GO3 F;  1THZ A;  1YJW V;  2WLI B;  2K1E A;  4TWK A;  1KQS U;  1JVM A;  4ZKI A;  5EBW C;  1ORQ C;  5CBG A;  4JGS A;  4RO2 A;  3W7X A;  1VQ8 V;  5CMU A;  1S0V A;  4MS2 A;  1OCO B;  1QR9 A;  2IJJ A;  4PA3 A;  3SYQ A;  4PA6 A;  3WFV A;  3ZIA G;  4MW3 A;  1NVP B;  1H8E G;  1PNL A;  1PNK A;  5FL7 G;  2IW5 A;  2BOC C;  1E79 G;  1KEC A;  3K06 A;  3STZ C;  1VQM V;  1YIT V;  3K0D A;  2JIZ G;  1H38 A;  3AG3 B;  4R8C A;  3F7Y C;  3CXC U;  4LP8 A;  1COW G;  2NLJ C;  1AI7 A;  3TET A;  3CYO A;  3OEE G;  4FMT A;  4HYO A;  4MTG A;  4GX0 A;  1BHA A;  1AJP A;  1JJ2 U;  1NH2 B;  3W7W A;  3K04 A;  1W0J G;  3T4Z A;  4J9Y B;  4G2K A;  2ZR3 A;  1G4Y B;  3CPW U;  2EBO A;  4JF3 A;  3ABK C;  4QE9 A;  3SYO A;  1YIJ V;  3EFF K;  1NJI W;  3ABK B;  1AR1 B;  3CMA V;  3OUF A;  2WLL B;  4XDK A;  4JPR A;  3OMI B;  1VQO V;  2WLI A;  5IYD O;  3CCM V;  1GMG A;  2AHZ A;  4PDR A;  1F4N A;  4JYB A;  3OE7 G;  3ZMU A;  2V7Q G;  3UM7 A;  3K0G A;  1OHH G;  4P30 A;  3VBB A;  2IJI A;  3CC2 V;  3VOU A;  4GT1 A;  2ATK C;  4Z1M G;  2ITC C;  2DYR B;  2EIN C;  4WFH A;  4MVM A;  3T4D A;  4H37 A;  1K8A W;  1FXK C;  1H2G A;  3AG4 C;  1GK9 A;  2IU3 A;  3R65 A;  1VQP V;  4TSF G;  3ZRS A;  2ZXW C;  1ENV A;  2WLJ A;  4LC1 A;  1R3L C;  3SPC A;  1FXK B;  1GKF A;  1NR7 A;  5DN6 G;  3SPH A;  3CC7 V;  2LP7 A;  2WSS G;  2ZXW B;  4PDL A;  3ASN B;  2LFR A;  1I5X A;  3MD0 A;  5EBM C;  5KA6 A;  4Q20 A;  1UJW B;  5H6Q A;  1K9M W;  4JYC A;  2AHY A;  3E8H A;  1YHQ V;  4P2Z A;  2F43 G;  2YEV A;  3A0R A;  4MTO A;  1QVG U;  5L3D A;  1YTF B;  4GX5 A;  4QIW F;  2HFE C;  4JTA B;  4KP4 A;  2IJH A;  4J9Z B;  5EC2 C;  4WFA V;  1QVF U;  4PDM A;  3KG2 A;  4MVQ A;  2WAM A;  4PA4 A;  4RUF A;  4N23 A;  2QM8 A;  2DWE C;  2P67 A;  3ABL C;  2IH1 C;  1VQ9 V;  3RVY A;  3E8B A;  4RQE A;  1Q81 W;  1VQ7 V;  3ABL B;  4UXN A;  4X88 A;  3E86 A;  3AG2 C;  1JCH A;  2P7T C;  1BMF G;  1QR8 A;  1JX9 A;  1R3K C;  1XL6 A;  2B5U A;  3K3W A;  4MVU A;  4DO2 A;  3OR7 C;  2Y69 C;  3LDE A;  4R7C A;  1PNM A;  1Y4M A;  4BIU A;  3BY6 A;  1W0K G;  3I56 V;  1DLB A;  2EIM C;  3SYC A;  4XBF A;  2EIM B;  3OFN G;  3ABT A;  2M7W A;  4P9O A;  1E1R G;  3RW0 A;  1ROP A;  1PD3 A;  1K5Q A;  4UVA A;  2X6B A;  1HWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...