5EBMC

Kcsa t75g mutant in the nonconductive state
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATGVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ebmC00
4JTDB 1OCOC 4QE7A 2Q69A 1BL8A 3FB6C 5J9PC 2EIMC 4PDLA 1JVMA 1XL6A 3ABMC 3E83A 4HYOA 5EBMC 3ASOC 4JTAB 2Q6AA 4P30A 2WLJA 2AHYA 3SPJA 3AG3C 2WLIA 3F7YC 1KKDA 3SYPA 2OCCC 3SYQA 3KG2A 2WLMA 4WFHA 2DWEC 3OUSA 4GX5A 3JYCA 3SYCA 2WLNA 3BEHA 4GX1A 4XDLA 4MVUA 4MVOA 3RW0A 3E89A 2WLLB 4P9PA 5CBHA 2X6CA 4PA6A 2QTOA 5EBLC 3E8HA 3SPGA 3LUTB 2WLKA 2ITDC 2X6AA 3E8FA 4I9WA 2W0FC 4R7CA 4RAIA 4RUEA 5BZBA 4BW5A 4MVQA 4LBEC 2P7TC 5EBWC 3FB7C 3AG4C 4MTFA 3T1CA 4PDRA 1ZWIC 2HVJC 1G4YB 2JK5C 4PA7A 1R3LC 5KUMA 3RVYA 3UKMA 4TWKA 4LCUC 1R3IC 4EKWA 3SYAA 4RUFA 4PA9A 2HVKC 5EC1C 3TCUA 1OCCC 3TETA 3AG2C 3EFFK 3F7VC 4DXWA 1J95A 4G28B 2K1EA 3WG7C 4KFMA 3ASNC 3X2QC 2EIJC 2HFEC 4MS2A 4P2ZA 4XDJA 3LDEA 4JTCB 4PDMA 5E1AC 1K4DC 2R9RB 2DYRC 4RO2A 4MW8A 3SPCA 1R3JC 3K06A 3VOUA 1S5HC 3FB8C 4QNHB 4MTOA 2A79B 3SPIA 5IY5C 3RVZA 5EK0A 1OCRC 2ATKC 4UUJC 4WFFA 1V55C 4J9YB 3K0DA 4H33A 4MVSA 3IGAC 3K04A 4P9OA 2YEVA 4WFGA 3ZRSA 2H8PC 2HG5C 3K0GA 4GX2A 4X88A 4HZ3A 5CBGA 5B1BC 3E8GA 2BOCC 2DWDC 2ZD9A 3K08A 4H37A 2AHZA 3E8BA 3LNMB 3STZC 3OR6C 4MVRA 4MTGA 4XDKA 1R3KC 2WLHA 4R50A 3R65A 3RBZA 2QKSA 3SPHA 5CBFA 3IFXA 3E86A 4PA4A 5B3SC 3OUFA 2DYSC 4X89A 3PJSK 3T2MA 1V54C 2IH1C 4MVZA 4PDVA 3SYOA 1OCZC 3GB7C 2BOBC 4ZBMA 4R8CA 5EC2C 2ZXWC 4X8AA 4J9ZB 4F4LA 5KUKA 3K03A 4WFEA 4QE9A 1K4CC 4LP8A 3UM7A 3AG1C 3SJQC 2EINC 2NLJC 3OR7C 3ZJZA 2ITCC 4R6ZA 3LDDA 2HJFC 1ORQC 2X6BA 4MW3A 2A0LA 3T4ZA 3OGCC 5B1AC 3ABKC 4OXSA 2Q67A 3T4DA 1LNQA 2A9HA 3LDCA 2KB1A 1P7BA 2WLIB 3ABLC 3F5WC 4PA3A 2Y69C 3STLC 1M56C 2EILC 2WLLA 4MVMA 1M57C 2EIKC 2Q68A 3HPLC 1QLEC 2IH3C 4CBCA 1XL4A 4G27B 4GX0A 4MSWC 3FB5C
chains in the Genus database with same CATH superfamily
4UB8Z 1K34A 1HR0O 5KHGA 4JI3B 3ABKB 4JTAB 1KB9F 4O2BB 4O2AB 3D36C 3FD9A 1B3QA 2VRZA 4TQDA 1IDSA 1TUEB 5GTHZ 1BGYH 2EBOA 2N04A 3CP1A 3QO8A 1K5SA 1GN6A 4B3TB 4DUZO 3MHSC 4JI3O 2W0FC 1HR0B 4DV2B 3FB7C 1N4CA 1JQ0A 3BHPA 1HNWO 4EFEA 3F7VC 1FKAO 4U3JA 5JCOC 4KXRA 4PDMA 4PI2A 2JIZG 2ZM6O 4LF4B 4PV1B 3M8AA 1FXKB 4WFBV 3OGIB 5LL6Y 4WFGA 2ZM6B 2XNDG 5ITZA 1RPRA 1VQ7V 2YC0A 1BMFG 2V4DA 4R50A 4D7TA 1SETA 2QKSA 5LP6B 2F4VO 1GH6A 1EN5A 3JARA 3L71H 3OUFA 3T2MA 4JAVA 1K5QA 4NTWA 4TUYA 3L72H 4IHJA 4I9QA 1BS3A 4QE9A 1VQLV 1LR1A 3ZHSA 4TQFA 4JAAA 1VARA 1N8RW 2KQXA 1XNQO 2A9HA 1Z2GA 1SKVA 1JPXA 1QLEC 2IJJA 3RGBA 2QDOA 3CRCA 5H6RA 2Y4UA 3AK2A 4EFBA 1BCCH 1A32A 2OCCC 4U3FH 2OTJV 1EZJA 1ZL8B 2XOKG 1TUBB 2ETNA 3OFNG 4R7CA 4FLYA 5KUMA 4BIUA 3N2KA 3CC2V 1LUVA 1K9MW 3TCUA 1N32O 5IYZA 3DC5A 1Y6XA 3ASNC 5IYZB 5D5PA 5EZYA 2JRIA 4MS2A 4LF9O 4JI8O 4I0XB 4GKKB 1KD1W 1R6NA 4KHPO 3SJCC 1EZVH 3SPIA 2QKCA 3ETGA 4JI7O 4J7ZA 2B9ZA 1ZLZA 3EXAA 3K57A 3JAMN 3ZRSA 1XMQO 1MABG 1BQ0A 3I56V 3JCUZ 4FLTA 1H2LA 4LFCB 4BW9A 3R65A 4EEQA 4RQEA 3ZHTA 1IBMO 1NVPD 3OMAB 4LF5O 3KCXA 1RFYA 4YHHO 2Q7EA 3BA8A 3CC4V 4DV7B 3ETDA 2LO1A 3O9OA 3A0HZ 3HKEA 2Q67A 4DR7B 2ZCEA 3WB2A 4DV1O 4MVMA 1SESA 1SQQH 1P7GA 1F7YA 2IH3C 1BHAA 1QQCA 1VEWA 3OMNB 3ABUA 3JATA 1IBLO 5JJNB 3N2GA 1KKDA 2UXCB 5JH7B 4LH7A 2WLMA 1GAXA 1VQMV 4X66O 3AK1A 4B7KA 2A06H 5KX5A 1KECA 1K33A 2UUCO 1Y76A 3P32A 4Z2WA 5B1BB 4FJCC 3E8FA 4LWSB 3UO3A 4Q20A 1M56B 3ZRWB 4XBFA 3LSSA 3WU2Z 5H9CA 2FL4A 2HLDG 3C3TA 3SYAA 2WPDG 4G2KA 4X1KB 3E22B 1M9NA 3G6BA 1SRYA 1G6UA 3ZBHA 2A7WA 2X0LA 4JTCB 1K4DC 3JD0A 4DV5O 2RN9A 1US6A 3CCLV 4FVMA 3IJ4A 4J42A 1K8AW 1CPYA 3PN1A 3CSXA 5FPOA 4MVSA 2YEVA 2HG5C 3ZMZA 4OX9B 2Q7HA 1R6KA 3D8CA 5LYJA 4H13B 1P49A 5B66Z 3CCVV 3X2QB 2FMLA 5IJ9A 3B77A 4JASA 5C93A 4WBNB 4D6TH 2M6YA 4JI7B 4H44B 4CH5A 4GKKO 4DUYB 4R6ZA 1XMOO 1MMMA 1W59A 1NVPB 1N33O 2CDYA 3OM3B 1PD3A 1WB8A 2F23A 4X1YB 2ADQB 3AK3A 2YIBA 3OMIB 1GRJA 4W4LA 1OCOC 2AZ2A 1BL8A 3W7UA 4PDLA 1XL6A 3E83A 3K3WA 2XAQA 2L35A 3ZIAG 3F7YC 4O2AA 2KKWA 1GTOA 4K3AA 3JD2A 3N2GB 1UJWB 4DR2O 1DF5A 2RCVA 4X20B 4MVOA 5HFLA 4GKJB 2WLLB 1BQZA 4FLXA 5BZBA 2CUGA 3RYCB 3K5MA 3ZRWA 1IBMB 5IJ0B 4LWSA 4LF6B 5C8YA 2E3CA 1FFTB 5IJ0A 4UVBA 3D36A 3U10A 1H8HG 3JALA 4KFMA 4LFAO 3X2QC 1O9HA 4FPPA 5B1OA 1JMKC 4YJ3B 3MD0A 1XNRO 3T1YB 1FYJA 4MTOA 2YDEA 3GWKC 4GCZA 5BY1A 4OPAA 1ZL8A 4J9YB 1L0LH 2H8PC 1D5NA 3M7MX 4DW1A 3E2EA 3K08A 4QJFB 3L73H 2GV9A 3SR2C 1FXVA 1MOFA 3OT7A 2WWWA 1FJGB 2CH7A 4HAMA 2QWPB 1NU1H 1P4RA 2BOBC 4ZBMA 4LNUA 2EIJB 3ZHVA 1M90W 1SQPH 4UCOA 1JFFB 3CE2A 3RN4A 1XQ8A 5LGUA 4X64O 1P84F 3QVNA 2CTPA 1GO3F 3NXSA 2EINB 3JAWA 5LHHA 5J2TA 3ZN1A 3AG7A 5CN0A 3K79A 5KHJA 4F6RA 1HNZB 3WB0A 2QWQB 4MT8A 1JVMA 2HJDA 1AR4A 5EBMC 3ASOC 1YIJV 3U11A 4Q6GA 2MW2B 1QVFU 4B08A 4J80A 3M99B 4DV6O 2ZDIA 2N74A 2W0XA 4O4JA 5LXTB 1RM1B 1Q86W 2IU0A 1VQ6V 4BWAA 1PNLA 3B8MA 3L9DA 5IYCO 3HKCB 1YI2V 2Z0AA 4IYIA 1BSMA 4FM0A 4IIJA 3LSQA 4TWKA 4JYAO 4EKWA 1XHXA 3AEIA 4IIJB 1XDCA 1J95A 3RYCA 1GN3A 2K1EA 2EJ7A 1Q3EA 1VMGA 4TV8B 3UT5A 5LMUB 3CRAA 4RO2A 3SPCA 2H94A 3OEHG 1JR9A 2LW1A 4FLVA 4NVPA 4LF4O 4E2LA 4P9OA 3IGAC 5TISZ 2CAZC 4H0LB 4KUMA 2Q5ZA 4GX2A 1NKDA 4ZOLA 5JCOA 2QM7A 4F6RB 1HDJA 1AROP 3OD4A 3PJSK 3H1JH 4I50A 4B3MO 2QJ1A 1XREA 4PD4F 2L6LA 1TVKB 3T1YO 2CGOA 1K4CC 5LXTA 4ZHQA 4IT5A 2HP8A 4B3TO 4LR3A 3HKEB 4TUYB 1MSWD 4U7OA 1FXKC 2Q8VA 4J7JA 3CMEV 1Q6UA 1P7BA 3G80A 1KKCA 2EILC 2EIKC 1B06A 4DV6B 2YXYA 3ZMVA 1Q6IA 3RYIB 2F93B 1F51A 4JGSA 3HKDB 3L74H 3ASNB 3DGEA 1ZSPA 5J2TB 4JPRA 1DF4A 3UO2A 1X59A 4DR2B 3RT3C 4AI8A 1R73A 4NXMO 2OTLV 4DR6B 4GX1A 4E4EA 3UCSC 4JI6O 2IM9A 2ZKOA 3E89A 4O4IB 4BAYA 1H2MA 4B3SB 3ZS8C 1CP9A 4I9WA 1ZTEA 4NR1A 2E74B 2V7QG 4I0XA 3A0RA 4QGPA 4AHCA 1SQBH 2AZ0A 1KC8W 2P6JA 1FAFA 3K5OA 2HVKC 4GT1A 3BVOA 3J81N 5IDJA 4FM1A 3HR0A 4ZIBA 3N2KB 3CCQV 4YIOA 2ILMA 1Q82W 1VQKV 2UXDB 3A8TA 1AR1B 1VQOV 4K35A 5J2UA 1NBMG 3OR6C 1JJOA 1AP5A 4JI4B 2BCCH 3DSQA 1S77D 2KSDA 1I5YA 4AQYB 3BAAA 3IC9A 2GSMB 1OCZC 1VF6C 3UT5B 3GB7C 2QM4A 4J41A 4FLWA 4F4LA 5KMGB 3AG4B 3HKDA 4X65B 2XHBA 5H6QA 4YXWG 4TOIA 1LNQA 5LGNA 1S5JA 2QM8A 3P30A 1VIBA 4TSFG 5ITZB 4G27B 3JSLA 3VQWA 3S3XA 1H2SB 5LMNB 3VQYA 4HNAB 5GTIZ 4U7NA 4J11A 2NN4A 1AI6A 4X66B 3CCEV 1KQSU 1NZ6A 4JI0B 1QU7A 2DE0X 1QCEA 2ZDIC 3JYCA 3SYCA 3BEHA 4BR6A 3K9SA 2ODMA 2DYRB 1IX9A 2Q4PA 3SPGA 1F4MA 2WLKA 2JGDB 5LMNO 4JI2O 1G8MA 3W7XA 4PDRA 2F43G 5KAIZ 4LCUC 4A5UB 1R3IC 2QGNA 5L3FA 4RUFA 1AI7A 2Z5UA 2CTQA 4PA9A 1EM1A 3VQVA 1KU9A 5L3GA 4DV4B 3ASOB 3JARB 2Q73A 1FD9A 5BMVB 5KX5B 1Y76B 1HNXB 3FB8C 4PELA 4DV7O 4JV5B 3JD4A 2E76B 4JI1B 4DV0O 4UUJC 1V55C 2Q9LA 3LSUA 4QIWF 4BIOA 4X88A 1NJIW 4AILC 2BOCC 3BCCH 5LGTA 4JAUA 4LFCO 2PF4E 2UUBB 5CBFA 1MG1A 5KLVH 1XMQB 2H3OA 1V54C 4ABMA 1NQTA 2OCCB 3D3QA 5CMUA 3APOA 1QHTA 3C3SA 3UM7A 4KHPB 2QSAA 3W7WA 1AVMA 1MZEA 4LF9B 5JJEB 2N05A 5KMGA 1G1XB 3LDCA 2KB1A 1Y4MA 1THZA 4UCUA 3HPLC 3JATB 5KHIA 1VQ8V 4RWUA 4L8JA 2R9AA 4HYOA 1H38A 2VS0A 4WFAV 4JZ2A 4JI6B 1I94B 2WLIA 3B2EE 4NTYA 1CEZA 3ETEA 4DV3O 5C8YB 1YJNV 3QG5A 3OTFA 4X65O 1HP8A 4P9PA 4IGGA 1DTOA 2E5LB 4BW5A 5L3BA 1ZWIC 4YJ3A 1AI4A 5CA0B 2BTQB 2PY5A 4EB6A 5B1NA 4RQFA 1FS0G 2QE7G 3JD3A 2Z3YA 1E79G 2RNBA 1N0JA 1RSOB 4UVAA 1QLNA 2LFSA 1MA1A 2ZIOA 4IL6Z 2YSUB 2VQEB 4FFBA 3WG7B 2PZSA 5JVDB 5L3DA 3K0GA 3BABA 4H37A 3E8BA 4LC1A 3ZRXA 1Y67A 1B04A 2XTAA 2DYSC 1J5EB 3Q4HA 1YXBA 2EZPA 4WF9V 2LGQA 3JASA 3RYFA 4X8AA 3KCYA 5KUKA 2KG7B 3MDSA 3EVKA 5GONA 1TAEA 1FFXB 4X1YA 1H2NA 4JI5O 5EYPB 1ORQC 1WPBA 4JF3A 2X7RB 5FL7G 3UQ8A 1OZ0A 1RP3B 2WA3A 2ZINA 5LA6B 1I08A 1HNWB 1XI1A 2UU9B 2QTSA 5CA1A 4JYAB 1SF9A 2LW7A 2WSSG 3I5DA 2YIDA 3FB5C 4J10A 4O2BA 2EIMC 3OTOO 4FLZA 2FYUH 4TV9A 1DLBA 2XAJA 5FNVA 5JH7A 3TXSA 5IJ9B 2AHYA 1SC5B 2ADPA 1BE3H 5IY5B 4KP4A 2YI8A 3B40A 4O4LB 1JA8A 1HNZO 3ZMTA 1PP9H 1E1QG 2LP7A 4YJ2B 1SZTA 1R3LC 2ZE6A 3K5NA 2LFRA 4YJ2A 1EN4A 4DXWA 1K92A 5DM6V 5CB4A 5IT9N 3BRCA 2HKOA 4JI5B 1JOYA 5E1AC 2OCHA 4UVCA 5EIBC 3G71V 1S5HC 2RQ6A 3RVZA 1WA8B 4I50B 5LYJB 1J5EO 3BA9A 5J2UB 2JVDA 4HZ3A 1M93A 5IE9A 2DWDC 1NTKH 4UCSA 3TK1A 1V55B 4GZRB 3QO7A 3IFXA 4X89A 5LA6A 5JWPA 4B3RO 5CA1B 2M7WA 3FFQA 2ZXWC 3SGIA 2VWKA 2R72A 1M1KW 2E75B 4I5SA 5JJJB 2DOSA 5GONB 4I55A 4NB5A 2Y0PA 2UXXA 5B1AC 2KG7A 4X20A 2LGWA 2P67A 2OYQA 1WP7A 4DR1O 3IAYA 2V1DA 1B6QA 3OE7G 1K73W 2XAGA 2XAHA 4JTDB 1VF7A 3QF7A 2E5LO 2GBOA 2ZT9B 3CCSV 1WJZA 3I55V 4UCVA 5L3CA 5GW7A 3SPJA 3AG3C 1YJ9V 1IZ3A 1NTZH 4DRXB 3D3IA 2LQTA 4XDLA 3K58A 2ZNJA 1URFA 1PL4A 2X6CA 4PA6A 5EBLC 2QA4V 4FM2A 1FXHA 1R6TA 2CK3G 4RUEA 2GUZB 1Q90D 3G4SV 1RPOA 3T1CA 1AP6A 4FIPC 4NTXA 1OCCB 1OJHA 1N33B 2IW5A 1Y74B 1KMIZ 3CRQA 3K06A 1SA0B 5AG2A 5BR8O 3JAKB 2VQEO 5JQGB 4ZOLB 1XNRB 3K0DA 2WA4A 1GM9A 3K04A 3SJBC 4LF7B 1WB7A 3E8GA 2UUBO 1WA8A 2PYLA 3AG2B 3STZC 3LNMB 1NS1A 3CC7V 3CHXA 4PI0A 5B3SC 1SS3A 2R9IA 3SYOA 4NXNO 2P4VA 4UV8A 1IURA 1S3JA 5EYPA 1NT2B 1X4TA 4WFEA 2UXNA 3K03A 1FPOA 3L70H 4UB6Z 1PNMA 3W7TA 5EIBD 1GMGA 1Q81W 5A9GA 4DV5B 3RYIA 3AG3B 3CXHF 2A0LA 3HKBA 2XAFA 2RDCA 3WFVA 1UPGA 2Y69C 1BZKA 1U97A 4I55B 5B3SB 3RWRD 4B7EA 2DYSB 3QO5A 2WAMA 3G6EV 4K0KO 3ABTA 3FB6C 1KP3A 4X9QA 5KA5A 1H8EG 4DR4B 5DN6G 4NYKA 1YTFD 4DR3O 2DWEC 1SQVH 1XBLA 1S0VA 3QTCA 4DUYO 1XMOB 2DN9A 2ZNIA 4DR4O 3JALB 1QNMA 1MZFA 4FZ0A 2QTOA 1VQ9V 3HKCA 1D5AA 1Y74A 3E22A 1JX9A 1AJQA 4RAIA 2EILB 2AXTZ 3ZX6A 4PA7A 2FKXA 1Z5WA 5EC1C 2JGDA 1OCCC 3AG2C 4O4JB 5B5EZ 4BIZA 4CS3A 3DXRB 5F2VO 1Y66A 2JEXA 3EHBB 4OX9O 4MW8A 1VQPV 3B8NA 1PV0A 2VQFB 4YHHB 5LBQA 5LP6A 2ATKC 1LUWA 4F6EA 2VQFO 4NXNB 3MAQA 5BMVA 2IJHA 2EZOA 3OAAG 4KL1A 1V54B 5JVDA 4AQYO 2P22C 2P06A 4FZ1A 3CJHA 2ZD9A 2AHZA 2QEXV 3CS5A 3ML0A 1R3KC 3R66A 1JFFA 3BFRA 2YEVB 2UXDO 1PL0A 4JI2B 2OT5A 2Q0AA 3QNEA 1JCHA 2QWNB 3JASB 4MTXA 2CE4A 2YXHA 2NLJC 1R1BA 5K1XA 3JD1A 4JI8B 1GK9A 2ITCC 1XUQA 3RYHA 2UUCB 1Q8IA 4WBNA 3CEIA 1YSCA 5E79Z 4PA3A 2YS8A 4DR5O 2NR5A 1AR5A 1M57C 2RMKB 5KHHA 4ZKIA 4PHZA 1F4NA 1N34B 3B09A 2Q69A 3H1HH 1PKXA 4O4HA 4UFZA 3ABMC 4B3SO 4P30A 1H2GA 1S72V 2ZR3A 5FNVB 5IYBO 4WFHA 3HKBB 3OUSA 3H01A 3RW0A 4EB6B 3NR7A 1EBOA 4UCRA 3LUTB 4X1IB 1Z5VA 2K9PA 2X6AA 3TJTA 1IXMA 2R70A 4LF5B 1NR1A 4LBEC 1VF6A 2HVJC 3UKMA 2QKAA 2O57A 2OIEA 3JSNA 3RYFB 2ZE5A 3EFFK 1XNQB 3ICXA 1AILA 4WCEV 1COWG 5DECA 3DC6A 3LDEA 2XT9A 2R9RB 1TUBA 5K1PA 3GVMA 5JQGA 4I4TB 3FAVA 5IY5C 4FMTA 4DRXA 2YUAA 2YIAA 4WFFA 1U96A 2DJVA 3BPZA 5CBGA 4K8ZA 1N32B 4N21A 4TV9B 1Q6HA 2ZR2A 4D7SA 4TT3G 1WAZA 1DGSA 4I7ZB 1VP7A 1IVSA 1YVWA 3BY6A 2P5OA 3ZHUA 1PNKA 1AI5A 2B1IA 2JEUA 2JS3A 3RFRA 5LMUO 1NTMH 1I5XA 2X6BA 4X1IA 4CZZA 2RJZA 3O65A 2YICA 2UXBO 3RYHB 3A0BZ 1L1FA 3GWOA 3STLC 1ZAUA 1Q7YW 1QR8A 1YZBA 4J9ZB 4LH6A 4GX0A 1M4UA 3P3NA 1WLEA 1AB3A 4QE7A 3KKYA 5J9PC 1XHZA 1NR7A 3FX7A 4O4LA 2JJ2G 2WLJA 3LNNA 4W4KA 3H9VA 1S76D 4JYYA 1KYOF 2ZE7A 5H2FZ 4HNAA 2EX3A 2PTMA 3ZMUA 3K9AA 4LFBO 3C90A 3E8HA 3CCUV 1YDXA 2IJIA 3TGUH 4YIPA 2Y69B 3CX5F 1N0NA 4B3RB 5EBWC 3SJAC 3RVYA 1NH2B 4K8XA 3T1HO 1HW7A 1SQFA 1Q43A 2D3OW 3E35A 4X64B 4X1KA 2HFEC 3ZHQA 3DTUB 5HFMA 1XEQA 1N36O 1R3JC 1OCZB 4IHJB 2YXLA 2A79B 2OWOA 1GKFA 5B1AB 1VQ4V 4LF8B 5LP6C 1HWYA 4TV8A 3Q4HB 1AJPA 4QPJA 5B1BC 3JCZA 1SQGA 2JDIG 1YTFB 1I7FA 3FYIB 2D2CB 3T1HB 1ZX3A 4C7UA 2A3QA 4MVZA 4OGQB 1OV9A 4ZI7A 3HB3B 5LOVA 3TXQA 4DV2O 1ROPA 2BTOA 1K3EA 1PPJH 1YITV 5CA3A 1W2BU 4U3JB 2HEPA 2OIGA 2Y48A 3OR7C 4UV9A 4DUZB 4FFKA 4LFBB 2BE3A 1T5EA 2AGAA 3ETQA 4LFAB 3ABKC 3T4DA 2GUZA 4IYHA 1IBKB 4LF6O 2ZE8A 4UXNA 3F5WC 2Y0IA 2UUAO 1M56C 3THOA 1PM9A 4CBCA 2YIBD 4Z1VA 3OEEG 5IYDO 2F1MA 3OTOB 3F5TA 2GHYA 4Z1MG 3OW2U 4GKJO 3CCJV 4DV3B 4GLXA 1Q5OA 2UU9O 4X62B 3K5LA 3SYQA 1SQXH 2UXBB 1ENVA 4GYCB 5EZYB 1TA8A 2F95B 1VF5B 2P4KA 2EJRA 1MNGA 1YHQV 1M57B 4MVUA 1I94O 1FFXA 4DYLA 4PJ0Z 5A2QN 2QR4A 3CRMA 3P3PA 1WN7A 4MVQA 2BTQA 1N34O 3AG4C 4ASUG 1D2DA 2ZQMA 1K7DA 1FJGO 4DR5B 1K97A 5KAFZ 1W0JG 1SZXA 4G28B 2HR3A 2Q0OC 5LHGA 1OHHG 3IC7A 3MHHC 3J7AU 3L75H 2PI4A 4CC5A 1YJWV 1YF2A 2PYJA 3ABMB 2JS5A 4H33A 3AG1B 3ZMSA 1F23A 1SA0A 2B1GA 2BSKA 4QPKA 1NI8A 2EIMB 4MVRA 3RBZA 1YEWA 1EFRG 4L87A 2IH1C 1GN4A 3J80N 4DV0B 4DK0A 1M5IA 4ZI7B 5LOVB 1HNXO 3AG1C 1KUQA 3APQA 3LDDA 1WPXA 4ICGA 3T4ZA 3CWBH 3OGCC 1QVGU 3FKSG 4OXSA 2GTAA 2WLIB 4UCTA 4O4IA 2DQ3A 1WP8A 1XL4A 2GDSA 4ZHQB 4O4HB 5IWAB 2MK3A 1VQNV 2W6JG 4FK5C 3H1IH 1KBHA 2DW4A 3SYPA 2HHHO 3H1KH 1QBZA 5CB4B 4GX5A 3SDLA 3CPWU 1TGOA 1BT8A 4CH4A 5CBHA 3JAWB 3DXRA 3CMAV 3ZHRA 1H2KA 2ITDC 4YY3O 4K0KB 4OPHA 5H5NA 4MTFA 1XILA 2JK5C 2IBZH 4DV1B 2CTRA 1ZUQA 4N23A 2ARHA 3WG7C 1NH2D 2ZIMA 2EIJC 2IU3A 3FYEB 2BSKB 2DYRC 2GTSA 1AJNA 2C2AA 3CXCU 4JI1O 1O9GA 1V9PA 3U0ZA 1OCRC 4JV5O 2FTKA 2G38A 4JZGA 5LHIA 1S5LZ 2Q7GA 3VQXA 3CB2A 1FXKA 3N27A 1L8DA 4DV4O 5L3EA 4I4TA 4XDKA 4LF7O 2PGGA 3E86A 1XOUA 1W0KG 4DO2A 3B4SA 4PDVA 1GM7A 5D5QA 1UFIA 4R8CA 4YY3B 5EC2C 1GN2A 2W6IG 2PUSA 4LP8A 5FPRA 2CH7B 2NNUA 3H1LH 4JYBA 4JI0O 3WB1A 4DR3B 2HHHB 3ABLC 3CD6V 2PI5A 2WLLA 4HBNA 2UXCO 2DQ0A 1IBLB 2AW9A 2QWRB 4CC6A 2XASA 4MSWC 4DW0A 3CYOA 1IXBA 4CS2A 5KHKA 2P90A 2DMXA 2JGUA 5IWAO 1I0HA 2Q6AA 2EIKB 3A2FA 2QWOB 1JJ2U 3G67A 2CTWA 4DR6O 4DR7O 1MSDA 3KG2A 3S3WA 1BHBA 2WLNA 4X62O 4CH3A 1L0NH 2FB5A 3CRRA 3W7SA 5KA6A 2P7TC 3FAVB 1RSOA 1G4YB 4DK1A 3CCRV 3ZEDA 4DR1B 2UUAB 1OCOB 3TETA 1IBKO 2VWJA 4JI4O 1SERA 3ABLB 3VBBA 1DK1A 4P2ZA 4XDJA 5CA0A 3VOUA 1VQ5V 4QNHB 5BR8B 2LJ2A 5EK0A 2JJ1G 4CH6A 4B3MB 1RM1C 3CJHB 3ZN0A 3K59A 1KP2A 1E1RG 4FFBB 3KZIZ 2F4VB 2ZXWB 4J7KA 4MTGA 2WLHA 1EN6A 2EULA 2IJKA 3SPHA 2YI9A 3ZCCA 1YCIA 1QLEB 4PA4A 3CCMV 4CS4A 3JAKA 3ZRVA 4GUNA 2CGNA 4LF8O 1OCRB 5BXZA 3SJQC 2EINC 1N36B 5FLXN 3ZJZA 2B5UA 5DEDA 2HJFC 1CXZB 4MW3A 4NXMB 4FLUA 2XUMA 4NKGB 1TVKA 1QR9A 1GM8A 4LNUB 2Y4TA 4JYCA 2Q68A 1WNSA 2F66C
chains in the Genus database with same CATH topology
1K34A 5CN0A 3K79A 4QE7A 5J9PC 2EIMC 4MT8A 1JVMA 3ABKB 1NR7A 5EBMC 3ASOC 1YIJV 4JTAB 1QVFU 2JJ2G 1DLBA 2XAJA 2WLJA 3M99B 2AHYA 1S76D 2ZDIA 1TUEB 5IY5B 4KP4A 2EBOA 3CP1A 3QO8A 1K5SA 3ZMUA 3K9AA 1RM1B 1Q86W 2IU0A 1VQ6V 3E8HA 3MHSC 1PNLA 3B8MA 3CCUV 5IYCO 2IJIA 2W0FC 3ZMTA 1YI2V 2Y69B 1E1QG 2LP7A 5EBWC 3FB7C 3RVYA 1SZTA 3LSQA 1R3LC 1NH2B 1JQ0A 4TWKA 4EKWA 2LFRA 3AEIA 3F7VC 4DXWA 1J95A 2D3OW 3E35A 2K1EA 5DM6V 2HFEC 5HFMA 3DTUB 2HKOA 4PDMA 1JOYA 5E1AC 4UVCA 4RO2A 3SPCA 2JIZG 1R3JC 1OCZB 2H94A 3OEHG 3G71V 1S5HC 2A79B 1GKFA 1FXKB 5B1AB 3RVZA 1VQ4V 1HWYA 4E2LA 4WFBV 4P9OA 3IGAC 4WFGA 4KUMA 4GX2A 1NKDA 1AJPA 2XNDG 4QPJA 4HZ3A 1RPRA 5B1BC 1VQ7V 2DWDC 2QM7A 3JCZA 1BMFG 2JDIG 1YTFB 3TK1A 1AROP 4R50A 3FYIB 1SETA 2QKSA 1V55B 3QO7A 3IFXA 3OUFA 4X89A 3PJSK 3T2MA 4MVZA 3HB3B 4JAVA 1K5QA 2M7WA 1ROPA 2ZXWC 1K3EA 4QE9A 1M1KW 1K4CC 1YITV 5CA3A 4I5SA 1VQLV 1W2BU 2Y48A 4UV9A 3OR7C 1N8RW 1MSWD 4U7OA 2UXXA 1FXKC 3ABKC 5B1AC 3T4DA 2A9HA 2P67A 3CMEV 1P7BA 3F5WC 4UXNA 1M56C 2EILC 1JPXA 2V1DA 2EIKC 1B6QA 1QLEC 3ZMVA 2IJJA 4CBCA 3OE7G 1F51A 4JGSA 1K73W 2XAGA 2XAHA 4JTDB 3OEEG 5IYDO 2GHYA 3CCSV 3ASNB 4Z1MG 3DGEA 3I55V 4JPRA 3OW2U 5H6RA 1DF4A 5L3CA 5GW7A 3SPJA 3AG3C 3CCJV 1YJ9V 2OCCC 3SYQA 2OTJV 1ENVA 1EZJA 1R73A 2XOKG 3D3IA 2EJRA 2OTLV 4GX1A 4XDLA 1YHQV 1M57B 4MVUA 3E89A 4BAYA 3OFNG 2X6CA 4PA6A 5EBLC 2QA4V 1CP9A 1FXHA 4R7CA 2CK3G 4I9WA 4RUEA 4MVQA 3G4SV 1RPOA 2V7QG 3A0RA 3T1CA 3AG4C 4ASUG 2ZQMA 1K7DA 5KUMA 1KC8W 2P6JA 4BIUA 3CC2V 1K97A 2HVKC 4GT1A 1K9MW 3TCUA 4FIPC 5IDJA 1W0JG 1OCCB 4G28B 2HR3A 5LHGA 2IW5A 3ASNC 4MS2A 1OHHG 3IC7A 1KD1W 1R6NA 3MHHC 3CCQV 3K06A 2PI4A 3SPIA 3ETGA 1YJWV 3ABMB 3K0DA 4H33A 1GM9A 3K04A 3AG1B 3ZRSA 3ZMSA 1Q82W 1VQKV 1AR1B 1MABG 1VQOV 1F23A 3E8GA 1NBMG 3I56V 2B1GA 4QPKA 3AG2B 3LNMB 3STZC 3OR6C 2EIMB 4MVRA 3RBZA 3CC7V 3R65A 1S77D 4RQEA 1I5YA 1NVPD 5B3SC 1EFRG 2IH1C 4L87A 2GSMB 3OMAB 2R9IA 3SYOA 1OCZC 3GB7C 4UV8A 1S3JA 4J9ZB 4F4LA 3CC4V 3K03A 3AG4B 2UXNA 3ETDA 4WFEA 3W7TA 1PNMA 3AG1C 1GMGA 1Q81W 3AG3B 3LDDA 1WPXA 5H6QA 4YXWG 2A0LA 3T4ZA 3OGCC 2XAFA 1QVGU 3FKSG 4OXSA 3WFVA 2Q67A 1LNQA 5LGNA 2WLIB 2Y69C 4MVMA 2QM8A 1SESA 2DQ3A 3P30A 5B3SB 2IH3C 2DYSB 1BHAA 4TSFG 1XL4A 3QO5A 4G27B 2WAMA 3G6EV 2MK3A 1VQNV 2W6JG 3ABTA 1KP3A 3FB6C 3OMNB 4FK5C 3ABUA 5KA5A 1H8EG 4U7NA 5DN6G 1KKDA 2DW4A 3SYPA 1AI6A 1YTFD 2WLMA 3CCEV 1KQSU 1QBZA 2DWEC 4GX5A 1VQMV 2ZDIC 1QCEA 3JYCA 3SYCA 1S0VA 3CPWU 3BEHA 1KECA 1K33A 3P32A 2DYRB 5CBHA 2QTOA 1VQ9V 5B1BB 3SPGA 1F4MA 2WLKA 4FJCC 1JX9A 3CMAV 1AJQA 2ITDC 3E8FA 4Q20A 4RAIA 1M56B 2EILB 3ZRWB 1G8MA 3W7XA 4XBFA 3LSSA 4MTFA 4PDRA 2JK5C 4PA7A 2F43G 5H9CA 2HLDG 4LCUC 5L3FA 1R3IC 3SYAA 1AI7A 4RUFA 2Z5UA 4PA9A 5EC1C 2WPDG 4G2KA 1OCCC 3AG2C 4BIZA 1M9NA 5L3GA 4N23A 1Y66A 3WG7C 1SRYA 1NH2D 3ASOB 2EIJC 2IU3A 3FYEB 2JEXA 2X0LA 4JTCB 1K4DC 3JD0A 2DYRC 3EHBB 1AJNA 4MW8A 2C2AA 1VQPV 3B8NA 3CCLV 3FB8C 4PELA 1K8AW 3CXCU 3JD4A 5LBQA 1OCRC 2ATKC 1CPYA 4UUJC 1V55C 2FTKA 5LHIA 4MVSA 4QIWF 2YEVA 2HG5C 2IJHA 3ZMZA 2EZOA 4X88A 1NJIW 3OAAG 1V54B 1R6KA 1FXKA 2BOCC 2ZD9A 5L3EA 5LGTA 2AHZA 4JAUA 2QEXV 4XDKA 3ML0A 1R3KC 3CCVV 5CBFA 3X2QB 1MG1A 2YEVB 3E86A 1V54C 1W0KG 4DO2A 1NQTA 3B77A 4PDVA 1PL0A 2OCCB 2OT5A 4JASA 5C93A 3QNEA 1GM7A 4R8CA 5CMUA 1JCHA 5EC2C 4MTXA 2W6IG 4LP8A 3UM7A 3W7WA 2NLJC 3JD1A 1GK9A 2ITCC 4R6ZA 1NVPB 2NNUA 4JYBA 3OM3B 1PD3A 1YSCA 3LDCA 2KB1A 3ABLC 1Y4MA 4PA3A 3CD6V 2PI5A 2WLLA 1M57C 1THZA 3HPLC 2DQ0A 4ZKIA 1VQ8V 3OMIB 2XASA 1F4NA 4MSWC 1OCOC 3CYOA 2Q69A 1BL8A 1PKXA 4PDLA 3W7UA 1XL6A 2P90A 3ABMC 3E83A 3K3WA 4HYOA 1H38A 2XAQA 2Q6AA 4P30A 1H2GA 3ZIAG 2EIKB 4WFAV 1JJ2U 1S72V 2WLIA 2ZR3A 3F7YC 5IYBO 3KG2A 1GTOA 1CEZA 3JD2A 4WFHA 3ETEA 3OUSA 1UJWB 1DF5A 2WLNA 1BHBA 3H01A 1YJNV 4MVOA 3RW0A 5HFLA 2WLLB 1EBOA 4P9PA 3W7SA 1DTOA 3LUTB 2X6AA 5BZBA 1IXMA 5KA6A 4BW5A 1NR1A 4LBEC 2P7TC 5L3BA 1ZWIC 2HVJC 1G4YB 1AI4A 3UKMA 3CCRV 3ZRWA 5B1NA 1OCOB 3TETA 4RQFA 1FFTB 3EFFK 1SERA 1FS0G 2QE7G 3ABLB 3JD3A 4UVBA 3D36A 2Z3YA 1E79G 1H8HG 4KFMA 3VBBA 3X2QC 4WCEV 4P2ZA 4FPPA 1COWG 5B1OA 4XDJA 4UVAA 3LDEA 1QLNA 2R9RB 2LFSA 3MD0A 3VOUA 1VQ5V 4QNHB 4MTOA 2YSUB 4GCZA 5IY5C 4FMTA 5EK0A 2JJ1G 4WFFA 4J9YB 3WG7B 1RM1C 3ZN0A 2H8PC 5L3DA 3K0GA 1KP2A 1E1RG 5CBGA 3E2EA 3K08A 2ZXWB 4H37A 4QJFB 3E8BA 4LC1A 3ZRXA 4MTGA 1FXVA 2WLHA 4N21A 2ZR2A 2IJKA 3SPHA 3ZCCA 1MOFA 1QLEB 2WWWA 4PA4A 3CCMV 2DYSC 4TT3G 4HAMA 4WF9V 2EZPA 1P4RA 3BY6A 3ZRVA 2BOBC 4ZBMA 4X8AA 1PNKA 1OCRB 2EIJB 5KUKA 1AI5A 1M90W 3SJQC 2EINC 2B1IA 2JEUA 3ZJZA 5LGUA 2B5UA 1I5XA 2HJFC 1ORQC 2X6BA 4JF3A 4MW3A 2X7RB 5FL7G 4CZZA 1OZ0A 1GO3F 1QR9A 1L1FA 1GM8A 3GWOA 3STLC 1Q7YW 4JYCA 2Q68A 3NXSA 2EINB 5LHHA 2WSSG 3ZN1A 1QR8A 4GX0A 1K92A 1WLEA 3FB5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JTD B;  1OCO C;  4QE7 A;  2Q69 A;  1BL8 A;  3FB6 C;  5J9P C;  2EIM C;  4PDL A;  1JVM A;  1XL6 A;  3ABM C;  3E83 A;  4HYO A;  5EBM C;  3ASO C;  4JTA B;  2Q6A A;  4P30 A;  2WLJ A;  2AHY A;  3SPJ A;  3AG3 C;  2WLI A;  3F7Y C;  1KKD A;  3SYP A;  2OCC C;  3SYQ A;  3KG2 A;  2WLM A;  4WFH A;  2DWE C;  3OUS A;  4GX5 A;  3JYC A;  3SYC A;  2WLN A;  3BEH A;  4GX1 A;  4XDL A;  4MVU A;  4MVO A;  3RW0 A;  3E89 A;  2WLL B;  4P9P A;  5CBH A;  2X6C A;  4PA6 A;  2QTO A;  5EBL C;  3E8H A;  3SPG A;  3LUT B;  2WLK A;  2ITD C;  2X6A A;  3E8F A;  4I9W A;  2W0F C;  4R7C A;  4RAI A;  4RUE A;  5BZB A;  4BW5 A;  4MVQ A;  4LBE C;  2P7T C;  5EBW C;  3FB7 C;  3AG4 C;  4MTF A;  3T1C A;  4PDR A;  1ZWI C;  2HVJ C;  1G4Y B;  2JK5 C;  4PA7 A;  1R3L C;  5KUM A;  3RVY A;  3UKM A;  4TWK A;  4LCU C;  1R3I C;  4EKW A;  3SYA A;  4RUF A;  4PA9 A;  2HVK C;  5EC1 C;  3TCU A;  1OCC C;  3TET A;  3AG2 C;  3EFF K;  3F7V C;  4DXW A;  1J95 A;  4G28 B;  2K1E A;  3WG7 C;  4KFM A;  3ASN C;  3X2Q C;  2EIJ C;  2HFE C;  4MS2 A;  4P2Z A;  4XDJ A;  3LDE A;  4JTC B;  4PDM A;  5E1A C;  1K4D C;  2R9R B;  2DYR C;  4RO2 A;  4MW8 A;  3SPC A;  1R3J C;  3K06 A;  3VOU A;  1S5H C;  3FB8 C;  4QNH B;  4MTO A;  2A79 B;  3SPI A;  5IY5 C;  3RVZ A;  5EK0 A;  1OCR C;  2ATK C;  4UUJ C;  4WFF A;  1V55 C;  4J9Y B;  3K0D A;  4H33 A;  4MVS A;  3IGA C;  3K04 A;  4P9O A;  2YEV A;  4WFG A;  3ZRS A;  2H8P C;  2HG5 C;  3K0G A;  4GX2 A;  4X88 A;  4HZ3 A;  5CBG A;  5B1B C;  3E8G A;  2BOC C;  2DWD C;  2ZD9 A;  3K08 A;  4H37 A;  2AHZ A;  3E8B A;  3LNM B;  3STZ C;  3OR6 C;  4MVR A;  4MTG A;  4XDK A;  1R3K C;  2WLH A;  4R50 A;  3R65 A;  3RBZ A;  2QKS A;  3SPH A;  5CBF A;  3IFX A;  3E86 A;  4PA4 A;  5B3S C;  3OUF A;  2DYS C;  4X89 A;  3PJS K;  3T2M A;  1V54 C;  2IH1 C;  4MVZ A;  4PDV A;  3SYO A;  1OCZ C;  3GB7 C;  2BOB C;  4ZBM A;  4R8C A;  5EC2 C;  2ZXW C;  4X8A A;  4J9Z B;  4F4L A;  5KUK A;  3K03 A;  4WFE A;  4QE9 A;  1K4C C;  4LP8 A;  3UM7 A;  3AG1 C;  3SJQ C;  2EIN C;  2NLJ C;  3OR7 C;  3ZJZ A;  2ITC C;  4R6Z A;  3LDD A;  2HJF C;  1ORQ C;  2X6B A;  4MW3 A;  2A0L A;  3T4Z A;  3OGC C;  5B1A C;  3ABK C;  4OXS A;  2Q67 A;  3T4D A;  1LNQ A;  2A9H A;  3LDC A;  2KB1 A;  1P7B A;  2WLI B;  3ABL C;  3F5W C;  4PA3 A;  2Y69 C;  3STL C;  1M56 C;  2EIL C;  2WLL A;  4MVM A;  1M57 C;  2EIK C;  2Q68 A;  3HPL C;  1QLE C;  2IH3 C;  4CBC A;  1XL4 A;  4G27 B;  4GX0 A;  4MSW C;  3FB5 C; 
#chains in the Genus database with same CATH topology
 4UB8 Z;  1K34 A;  1HR0 O;  5KHG A;  4JI3 B;  3ABK B;  4JTA B;  1KB9 F;  4O2B B;  4O2A B;  3D36 C;  3FD9 A;  1B3Q A;  2VRZ A;  4TQD A;  1IDS A;  1TUE B;  5GTH Z;  1BGY H;  2EBO A;  2N04 A;  3CP1 A;  3QO8 A;  1K5S A;  1GN6 A;  4B3T B;  4DUZ O;  3MHS C;  4JI3 O;  2W0F C;  1HR0 B;  4DV2 B;  3FB7 C;  1N4C A;  1JQ0 A;  3BHP A;  1HNW O;  4EFE A;  3F7V C;  1FKA O;  4U3J A;  5JCO C;  4KXR A;  4PDM A;  4PI2 A;  2JIZ G;  2ZM6 O;  4LF4 B;  4PV1 B;  3M8A A;  1FXK B;  4WFB V;  3OGI B;  5LL6 Y;  4WFG A;  2ZM6 B;  2XND G;  5ITZ A;  1RPR A;  1VQ7 V;  2YC0 A;  1BMF G;  2V4D A;  4R50 A;  4D7T A;  1SET A;  2QKS A;  5LP6 B;  2F4V O;  1GH6 A;  1EN5 A;  3JAR A;  3L71 H;  3OUF A;  3T2M A;  4JAV A;  1K5Q A;  4NTW A;  4TUY A;  3L72 H;  4IHJ A;  4I9Q A;  1BS3 A;  4QE9 A;  1VQL V;  1LR1 A;  3ZHS A;  4TQF A;  4JAA A;  1VAR A;  1N8R W;  2KQX A;  1XNQ O;  2A9H A;  1Z2G A;  1SKV A;  1JPX A;  1QLE C;  2IJJ A;  3RGB A;  2QDO A;  3CRC A;  5H6R A;  2Y4U A;  3AK2 A;  4EFB A;  1BCC H;  1A32 A;  2OCC C;  4U3F H;  2OTJ V;  1EZJ A;  1ZL8 B;  2XOK G;  1TUB B;  2ETN A;  3OFN G;  4R7C A;  4FLY A;  5KUM A;  4BIU A;  3N2K A;  3CC2 V;  1LUV A;  1K9M W;  3TCU A;  1N32 O;  5IYZ A;  3DC5 A;  1Y6X A;  3ASN C;  5IYZ B;  5D5P A;  5EZY A;  2JRI A;  4MS2 A;  4LF9 O;  4JI8 O;  4I0X B;  4GKK B;  1KD1 W;  1R6N A;  4KHP O;  3SJC C;  1EZV H;  3SPI A;  2QKC A;  3ETG A;  4JI7 O;  4J7Z A;  2B9Z A;  1ZLZ A;  3EXA A;  3K57 A;  3JAM N;  3ZRS A;  1XMQ O;  1MAB G;  1BQ0 A;  3I56 V;  3JCU Z;  4FLT A;  1H2L A;  4LFC B;  4BW9 A;  3R65 A;  4EEQ A;  4RQE A;  3ZHT A;  1IBM O;  1NVP D;  3OMA B;  4LF5 O;  3KCX A;  1RFY A;  4YHH O;  2Q7E A;  3BA8 A;  3CC4 V;  4DV7 B;  3ETD A;  2LO1 A;  3O9O A;  3A0H Z;  3HKE A;  2Q67 A;  4DR7 B;  2ZCE A;  3WB2 A;  4DV1 O;  4MVM A;  1SES A;  1SQQ H;  1P7G A;  1F7Y A;  2IH3 C;  1BHA A;  1QQC A;  1VEW A;  3OMN B;  3ABU A;  3JAT A;  1IBL O;  5JJN B;  3N2G A;  1KKD A;  2UXC B;  5JH7 B;  4LH7 A;  2WLM A;  1GAX A;  1VQM V;  4X66 O;  3AK1 A;  4B7K A;  2A06 H;  5KX5 A;  1KEC A;  1K33 A;  2UUC O;  1Y76 A;  3P32 A;  4Z2W A;  5B1B B;  4FJC C;  3E8F A;  4LWS B;  3UO3 A;  4Q20 A;  1M56 B;  3ZRW B;  4XBF A;  3LSS A;  3WU2 Z;  5H9C A;  2FL4 A;  2HLD G;  3C3T A;  3SYA A;  2WPD G;  4G2K A;  4X1K B;  3E22 B;  1M9N A;  3G6B A;  1SRY A;  1G6U A;  3ZBH A;  2A7W A;  2X0L A;  4JTC B;  1K4D C;  3JD0 A;  4DV5 O;  2RN9 A;  1US6 A;  3CCL V;  4FVM A;  3IJ4 A;  4J42 A;  1K8A W;  1CPY A;  3PN1 A;  3CSX A;  5FPO A;  4MVS A;  2YEV A;  2HG5 C;  3ZMZ A;  4OX9 B;  2Q7H A;  1R6K A;  3D8C A;  5LYJ A;  4H13 B;  1P49 A;  5B66 Z;  3CCV V;  3X2Q B;  2FML A;  5IJ9 A;  3B77 A;  4JAS A;  5C93 A;  4WBN B;  4D6T H;  2M6Y A;  4JI7 B;  4H44 B;  4CH5 A;  4GKK O;  4DUY B;  4R6Z A;  1XMO O;  1MMM A;  1W59 A;  1NVP B;  1N33 O;  2CDY A;  3OM3 B;  1PD3 A;  1WB8 A;  2F23 A;  4X1Y B;  2ADQ B;  3AK3 A;  2YIB A;  3OMI B;  1GRJ A;  4W4L A;  1OCO C;  2AZ2 A;  1BL8 A;  3W7U A;  4PDL A;  1XL6 A;  3E83 A;  3K3W A;  2XAQ A;  2L35 A;  3ZIA G;  3F7Y C;  4O2A A;  2KKW A;  1GTO A;  4K3A A;  3JD2 A;  3N2G B;  1UJW B;  4DR2 O;  1DF5 A;  2RCV A;  4X20 B;  4MVO A;  5HFL A;  4GKJ B;  2WLL B;  1BQZ A;  4FLX A;  5BZB A;  2CUG A;  3RYC B;  3K5M A;  3ZRW A;  1IBM B;  5IJ0 B;  4LWS A;  4LF6 B;  5C8Y A;  2E3C A;  1FFT B;  5IJ0 A;  4UVB A;  3D36 A;  3U10 A;  1H8H G;  3JAL A;  4KFM A;  4LFA O;  3X2Q C;  1O9H A;  4FPP A;  5B1O A;  1JMK C;  4YJ3 B;  3MD0 A;  1XNR O;  3T1Y B;  1FYJ A;  4MTO A;  2YDE A;  3GWK C;  4GCZ A;  5BY1 A;  4OPA A;  1ZL8 A;  4J9Y B;  1L0L H;  2H8P C;  1D5N A;  3M7M X;  4DW1 A;  3E2E A;  3K08 A;  4QJF B;  3L73 H;  2GV9 A;  3SR2 C;  1FXV A;  1MOF A;  3OT7 A;  2WWW A;  1FJG B;  2CH7 A;  4HAM A;  2QWP B;  1NU1 H;  1P4R A;  2BOB C;  4ZBM A;  4LNU A;  2EIJ B;  3ZHV A;  1M90 W;  1SQP H;  4UCO A;  1JFF B;  3CE2 A;  3RN4 A;  1XQ8 A;  5LGU A;  4X64 O;  1P84 F;  3QVN A;  2CTP A;  1GO3 F;  3NXS A;  2EIN B;  3JAW A;  5LHH A;  5J2T A;  3ZN1 A;  3AG7 A;  5CN0 A;  3K79 A;  5KHJ A;  4F6R A;  1HNZ B;  3WB0 A;  2QWQ B;  4MT8 A;  1JVM A;  2HJD A;  1AR4 A;  5EBM C;  3ASO C;  1YIJ V;  3U11 A;  4Q6G A;  2MW2 B;  1QVF U;  4B08 A;  4J80 A;  3M99 B;  4DV6 O;  2ZDI A;  2N74 A;  2W0X A;  4O4J A;  5LXT B;  1RM1 B;  1Q86 W;  2IU0 A;  1VQ6 V;  4BWA A;  1PNL A;  3B8M A;  3L9D A;  5IYC O;  3HKC B;  1YI2 V;  2Z0A A;  4IYI A;  1BSM A;  4FM0 A;  4IIJ A;  3LSQ A;  4TWK A;  4JYA O;  4EKW A;  1XHX A;  3AEI A;  4IIJ B;  1XDC A;  1J95 A;  3RYC A;  1GN3 A;  2K1E A;  2EJ7 A;  1Q3E A;  1VMG A;  4TV8 B;  3UT5 A;  5LMU B;  3CRA A;  4RO2 A;  3SPC A;  2H94 A;  3OEH G;  1JR9 A;  2LW1 A;  4FLV A;  4NVP A;  4LF4 O;  4E2L A;  4P9O A;  3IGA C;  5TIS Z;  2CAZ C;  4H0L B;  4KUM A;  2Q5Z A;  4GX2 A;  1NKD A;  4ZOL A;  5JCO A;  2QM7 A;  4F6R B;  1HDJ A;  1ARO P;  3OD4 A;  3PJS K;  3H1J H;  4I50 A;  4B3M O;  2QJ1 A;  1XRE A;  4PD4 F;  2L6L A;  1TVK B;  3T1Y O;  2CGO A;  1K4C C;  5LXT A;  4ZHQ A;  4IT5 A;  2HP8 A;  4B3T O;  4LR3 A;  3HKE B;  4TUY B;  1MSW D;  4U7O A;  1FXK C;  2Q8V A;  4J7J A;  3CME V;  1Q6U A;  1P7B A;  3G80 A;  1KKC A;  2EIL C;  2EIK C;  1B06 A;  4DV6 B;  2YXY A;  3ZMV A;  1Q6I A;  3RYI B;  2F93 B;  1F51 A;  4JGS A;  3HKD B;  3L74 H;  3ASN B;  3DGE A;  1ZSP A;  5J2T B;  4JPR A;  1DF4 A;  3UO2 A;  1X59 A;  4DR2 B;  3RT3 C;  4AI8 A;  1R73 A;  4NXM O;  2OTL V;  4DR6 B;  4GX1 A;  4E4E A;  3UCS C;  4JI6 O;  2IM9 A;  2ZKO A;  3E89 A;  4O4I B;  4BAY A;  1H2M A;  4B3S B;  3ZS8 C;  1CP9 A;  4I9W A;  1ZTE A;  4NR1 A;  2E74 B;  2V7Q G;  4I0X A;  3A0R A;  4QGP A;  4AHC A;  1SQB H;  2AZ0 A;  1KC8 W;  2P6J A;  1FAF A;  3K5O A;  2HVK C;  4GT1 A;  3BVO A;  3J81 N;  5IDJ A;  4FM1 A;  3HR0 A;  4ZIB A;  3N2K B;  3CCQ V;  4YIO A;  2ILM A;  1Q82 W;  1VQK V;  2UXD B;  3A8T A;  1AR1 B;  1VQO V;  4K35 A;  5J2U A;  1NBM G;  3OR6 C;  1JJO A;  1AP5 A;  4JI4 B;  2BCC H;  3DSQ A;  1S77 D;  2KSD A;  1I5Y A;  4AQY B;  3BAA A;  3IC9 A;  2GSM B;  1OCZ C;  1VF6 C;  3UT5 B;  3GB7 C;  2QM4 A;  4J41 A;  4FLW A;  4F4L A;  5KMG B;  3AG4 B;  3HKD A;  4X65 B;  2XHB A;  5H6Q A;  4YXW G;  4TOI A;  1LNQ A;  5LGN A;  1S5J A;  2QM8 A;  3P30 A;  1VIB A;  4TSF G;  5ITZ B;  4G27 B;  3JSL A;  3VQW A;  3S3X A;  1H2S B;  5LMN B;  3VQY A;  4HNA B;  5GTI Z;  4U7N A;  4J11 A;  2NN4 A;  1AI6 A;  4X66 B;  3CCE V;  1KQS U;  1NZ6 A;  4JI0 B;  1QU7 A;  2DE0 X;  1QCE A;  2ZDI C;  3JYC A;  3SYC A;  3BEH A;  4BR6 A;  3K9S A;  2ODM A;  2DYR B;  1IX9 A;  2Q4P A;  3SPG A;  1F4M A;  2WLK A;  2JGD B;  5LMN O;  4JI2 O;  1G8M A;  3W7X A;  4PDR A;  2F43 G;  5KAI Z;  4LCU C;  4A5U B;  1R3I C;  2QGN A;  5L3F A;  4RUF A;  1AI7 A;  2Z5U A;  2CTQ A;  4PA9 A;  1EM1 A;  3VQV A;  1KU9 A;  5L3G A;  4DV4 B;  3ASO B;  3JAR B;  2Q73 A;  1FD9 A;  5BMV B;  5KX5 B;  1Y76 B;  1HNX B;  3FB8 C;  4PEL A;  4DV7 O;  4JV5 B;  3JD4 A;  2E76 B;  4JI1 B;  4DV0 O;  4UUJ C;  1V55 C;  2Q9L A;  3LSU A;  4QIW F;  4BIO A;  4X88 A;  1NJI W;  4AIL C;  2BOC C;  3BCC H;  5LGT A;  4JAU A;  4LFC O;  2PF4 E;  2UUB B;  5CBF A;  1MG1 A;  5KLV H;  1XMQ B;  2H3O A;  1V54 C;  4ABM A;  1NQT A;  2OCC B;  3D3Q A;  5CMU A;  3APO A;  1QHT A;  3C3S A;  3UM7 A;  4KHP B;  2QSA A;  3W7W A;  1AVM A;  1MZE A;  4LF9 B;  5JJE B;  2N05 A;  5KMG A;  1G1X B;  3LDC A;  2KB1 A;  1Y4M A;  1THZ A;  4UCU A;  3HPL C;  3JAT B;  5KHI A;  1VQ8 V;  4RWU A;  4L8J A;  2R9A A;  4HYO A;  1H38 A;  2VS0 A;  4WFA V;  4JZ2 A;  4JI6 B;  1I94 B;  2WLI A;  3B2E E;  4NTY A;  1CEZ A;  3ETE A;  4DV3 O;  5C8Y B;  1YJN V;  3QG5 A;  3OTF A;  4X65 O;  1HP8 A;  4P9P A;  4IGG A;  1DTO A;  2E5L B;  4BW5 A;  5L3B A;  1ZWI C;  4YJ3 A;  1AI4 A;  5CA0 B;  2BTQ B;  2PY5 A;  4EB6 A;  5B1N A;  4RQF A;  1FS0 G;  2QE7 G;  3JD3 A;  2Z3Y A;  1E79 G;  2RNB A;  1N0J A;  1RSO B;  4UVA A;  1QLN A;  2LFS A;  1MA1 A;  2ZIO A;  4IL6 Z;  2YSU B;  2VQE B;  4FFB A;  3WG7 B;  2PZS A;  5JVD B;  5L3D A;  3K0G A;  3BAB A;  4H37 A;  3E8B A;  4LC1 A;  3ZRX A;  1Y67 A;  1B04 A;  2XTA A;  2DYS C;  1J5E B;  3Q4H A;  1YXB A;  2EZP A;  4WF9 V;  2LGQ A;  3JAS A;  3RYF A;  4X8A A;  3KCY A;  5KUK A;  2KG7 B;  3MDS A;  3EVK A;  5GON A;  1TAE A;  1FFX B;  4X1Y A;  1H2N A;  4JI5 O;  5EYP B;  1ORQ C;  1WPB A;  4JF3 A;  2X7R B;  5FL7 G;  3UQ8 A;  1OZ0 A;  1RP3 B;  2WA3 A;  2ZIN A;  5LA6 B;  1I08 A;  1HNW B;  1XI1 A;  2UU9 B;  2QTS A;  5CA1 A;  4JYA B;  1SF9 A;  2LW7 A;  2WSS G;  3I5D A;  2YID A;  3FB5 C;  4J10 A;  4O2B A;  2EIM C;  3OTO O;  4FLZ A;  2FYU H;  4TV9 A;  1DLB A;  2XAJ A;  5FNV A;  5JH7 A;  3TXS A;  5IJ9 B;  2AHY A;  1SC5 B;  2ADP A;  1BE3 H;  5IY5 B;  4KP4 A;  2YI8 A;  3B40 A;  4O4L B;  1JA8 A;  1HNZ O;  3ZMT A;  1PP9 H;  1E1Q G;  2LP7 A;  4YJ2 B;  1SZT A;  1R3L C;  2ZE6 A;  3K5N A;  2LFR A;  4YJ2 A;  1EN4 A;  4DXW A;  1K92 A;  5DM6 V;  5CB4 A;  5IT9 N;  3BRC A;  2HKO A;  4JI5 B;  1JOY A;  5E1A C;  2OCH A;  4UVC A;  5EIB C;  3G71 V;  1S5H C;  2RQ6 A;  3RVZ A;  1WA8 B;  4I50 B;  5LYJ B;  1J5E O;  3BA9 A;  5J2U B;  2JVD A;  4HZ3 A;  1M93 A;  5IE9 A;  2DWD C;  1NTK H;  4UCS A;  3TK1 A;  1V55 B;  4GZR B;  3QO7 A;  3IFX A;  4X89 A;  5LA6 A;  5JWP A;  4B3R O;  5CA1 B;  2M7W A;  3FFQ A;  2ZXW C;  3SGI A;  2VWK A;  2R72 A;  1M1K W;  2E75 B;  4I5S A;  5JJJ B;  2DOS A;  5GON B;  4I55 A;  4NB5 A;  2Y0P A;  2UXX A;  5B1A C;  2KG7 A;  4X20 A;  2LGW A;  2P67 A;  2OYQ A;  1WP7 A;  4DR1 O;  3IAY A;  2V1D A;  1B6Q A;  3OE7 G;  1K73 W;  2XAG A;  2XAH A;  4JTD B;  1VF7 A;  3QF7 A;  2E5L O;  2GBO A;  2ZT9 B;  3CCS V;  1WJZ A;  3I55 V;  4UCV A;  5L3C A;  5GW7 A;  3SPJ A;  3AG3 C;  1YJ9 V;  1IZ3 A;  1NTZ H;  4DRX B;  3D3I A;  2LQT A;  4XDL A;  3K58 A;  2ZNJ A;  1URF A;  1PL4 A;  2X6C A;  4PA6 A;  5EBL C;  2QA4 V;  4FM2 A;  1FXH A;  1R6T A;  2CK3 G;  4RUE A;  2GUZ B;  1Q90 D;  3G4S V;  1RPO A;  3T1C A;  1AP6 A;  4FIP C;  4NTX A;  1OCC B;  1OJH A;  1N33 B;  2IW5 A;  1Y74 B;  1KMI Z;  3CRQ A;  3K06 A;  1SA0 B;  5AG2 A;  5BR8 O;  3JAK B;  2VQE O;  5JQG B;  4ZOL B;  1XNR B;  3K0D A;  2WA4 A;  1GM9 A;  3K04 A;  3SJB C;  4LF7 B;  1WB7 A;  3E8G A;  2UUB O;  1WA8 A;  2PYL A;  3AG2 B;  3STZ C;  3LNM B;  1NS1 A;  3CC7 V;  3CHX A;  4PI0 A;  5B3S C;  1SS3 A;  2R9I A;  3SYO A;  4NXN O;  2P4V A;  4UV8 A;  1IUR A;  1S3J A;  5EYP A;  1NT2 B;  1X4T A;  4WFE A;  2UXN A;  3K03 A;  1FPO A;  3L70 H;  4UB6 Z;  1PNM A;  3W7T A;  5EIB D;  1GMG A;  1Q81 W;  5A9G A;  4DV5 B;  3RYI A;  3AG3 B;  3CXH F;  2A0L A;  3HKB A;  2XAF A;  2RDC A;  3WFV A;  1UPG A;  2Y69 C;  1BZK A;  1U97 A;  4I55 B;  5B3S B;  3RWR D;  4B7E A;  2DYS B;  3QO5 A;  2WAM A;  3G6E V;  4K0K O;  3ABT A;  3FB6 C;  1KP3 A;  4X9Q A;  5KA5 A;  1H8E G;  4DR4 B;  5DN6 G;  4NYK A;  1YTF D;  4DR3 O;  2DWE C;  1SQV H;  1XBL A;  1S0V A;  3QTC A;  4DUY O;  1XMO B;  2DN9 A;  2ZNI A;  4DR4 O;  3JAL B;  1QNM A;  1MZF A;  4FZ0 A;  2QTO A;  1VQ9 V;  3HKC A;  1D5A A;  1Y74 A;  3E22 A;  1JX9 A;  1AJQ A;  4RAI A;  2EIL B;  2AXT Z;  3ZX6 A;  4PA7 A;  2FKX A;  1Z5W A;  5EC1 C;  2JGD A;  1OCC C;  3AG2 C;  4O4J B;  5B5E Z;  4BIZ A;  4CS3 A;  3DXR B;  5F2V O;  1Y66 A;  2JEX A;  3EHB B;  4OX9 O;  4MW8 A;  1VQP V;  3B8N A;  1PV0 A;  2VQF B;  4YHH B;  5LBQ A;  5LP6 A;  2ATK C;  1LUW A;  4F6E A;  2VQF O;  4NXN B;  3MAQ A;  5BMV A;  2IJH A;  2EZO A;  3OAA G;  4KL1 A;  1V54 B;  5JVD A;  4AQY O;  2P22 C;  2P06 A;  4FZ1 A;  3CJH A;  2ZD9 A;  2AHZ A;  2QEX V;  3CS5 A;  3ML0 A;  1R3K C;  3R66 A;  1JFF A;  3BFR A;  2YEV B;  2UXD O;  1PL0 A;  4JI2 B;  2OT5 A;  2Q0A A;  3QNE A;  1JCH A;  2QWN B;  3JAS B;  4MTX A;  2CE4 A;  2YXH A;  2NLJ C;  1R1B A;  5K1X A;  3JD1 A;  4JI8 B;  1GK9 A;  2ITC C;  1XUQ A;  3RYH A;  2UUC B;  1Q8I A;  4WBN A;  3CEI A;  1YSC A;  5E79 Z;  4PA3 A;  2YS8 A;  4DR5 O;  2NR5 A;  1AR5 A;  1M57 C;  2RMK B;  5KHH A;  4ZKI A;  4PHZ A;  1F4N A;  1N34 B;  3B09 A;  2Q69 A;  3H1H H;  1PKX A;  4O4H A;  4UFZ A;  3ABM C;  4B3S O;  4P30 A;  1H2G A;  1S72 V;  2ZR3 A;  5FNV B;  5IYB O;  4WFH A;  3HKB B;  3OUS A;  3H01 A;  3RW0 A;  4EB6 B;  3NR7 A;  1EBO A;  4UCR A;  3LUT B;  4X1I B;  1Z5V A;  2K9P A;  2X6A A;  3TJT A;  1IXM A;  2R70 A;  4LF5 B;  1NR1 A;  4LBE C;  1VF6 A;  2HVJ C;  3UKM A;  2QKA A;  2O57 A;  2OIE A;  3JSN A;  3RYF B;  2ZE5 A;  3EFF K;  1XNQ B;  3ICX A;  1AIL A;  4WCE V;  1COW G;  5DEC A;  3DC6 A;  3LDE A;  2XT9 A;  2R9R B;  1TUB A;  5K1P A;  3GVM A;  5JQG A;  4I4T B;  3FAV A;  5IY5 C;  4FMT A;  4DRX A;  2YUA A;  2YIA A;  4WFF A;  1U96 A;  2DJV A;  3BPZ A;  5CBG A;  4K8Z A;  1N32 B;  4N21 A;  4TV9 B;  1Q6H A;  2ZR2 A;  4D7S A;  4TT3 G;  1WAZ A;  1DGS A;  4I7Z B;  1VP7 A;  1IVS A;  1YVW A;  3BY6 A;  2P5O A;  3ZHU A;  1PNK A;  1AI5 A;  2B1I A;  2JEU A;  2JS3 A;  3RFR A;  5LMU O;  1NTM H;  1I5X A;  2X6B A;  4X1I A;  4CZZ A;  2RJZ A;  3O65 A;  2YIC A;  2UXB O;  3RYH B;  3A0B Z;  1L1F A;  3GWO A;  3STL C;  1ZAU A;  1Q7Y W;  1QR8 A;  1YZB A;  4J9Z B;  4LH6 A;  4GX0 A;  1M4U A;  3P3N A;  1WLE A;  1AB3 A;  4QE7 A;  3KKY A;  5J9P C;  1XHZ A;  1NR7 A;  3FX7 A;  4O4L A;  2JJ2 G;  2WLJ A;  3LNN A;  4W4K A;  3H9V A;  1S76 D;  4JYY A;  1KYO F;  2ZE7 A;  5H2F Z;  4HNA A;  2EX3 A;  2PTM A;  3ZMU A;  3K9A A;  4LFB O;  3C90 A;  3E8H A;  3CCU V;  1YDX A;  2IJI A;  3TGU H;  4YIP A;  2Y69 B;  3CX5 F;  1N0N A;  4B3R B;  5EBW C;  3SJA C;  3RVY A;  1NH2 B;  4K8X A;  3T1H O;  1HW7 A;  1SQF A;  1Q43 A;  2D3O W;  3E35 A;  4X64 B;  4X1K A;  2HFE C;  3ZHQ A;  3DTU B;  5HFM A;  1XEQ A;  1N36 O;  1R3J C;  1OCZ B;  4IHJ B;  2YXL A;  2A79 B;  2OWO A;  1GKF A;  5B1A B;  1VQ4 V;  4LF8 B;  5LP6 C;  1HWY A;  4TV8 A;  3Q4H B;  1AJP A;  4QPJ A;  5B1B C;  3JCZ A;  1SQG A;  2JDI G;  1YTF B;  1I7F A;  3FYI B;  2D2C B;  3T1H B;  1ZX3 A;  4C7U A;  2A3Q A;  4MVZ A;  4OGQ B;  1OV9 A;  4ZI7 A;  3HB3 B;  5LOV A;  3TXQ A;  4DV2 O;  1ROP A;  2BTO A;  1K3E A;  1PPJ H;  1YIT V;  5CA3 A;  1W2B U;  4U3J B;  2HEP A;  2OIG A;  2Y48 A;  3OR7 C;  4UV9 A;  4DUZ B;  4FFK A;  4LFB B;  2BE3 A;  1T5E A;  2AGA A;  3ETQ A;  4LFA B;  3ABK C;  3T4D A;  2GUZ A;  4IYH A;  1IBK B;  4LF6 O;  2ZE8 A;  4UXN A;  3F5W C;  2Y0I A;  2UUA O;  1M56 C;  3THO A;  1PM9 A;  4CBC A;  2YIB D;  4Z1V A;  3OEE G;  5IYD O;  2F1M A;  3OTO B;  3F5T A;  2GHY A;  4Z1M G;  3OW2 U;  4GKJ O;  3CCJ V;  4DV3 B;  4GLX A;  1Q5O A;  2UU9 O;  4X62 B;  3K5L A;  3SYQ A;  1SQX H;  2UXB B;  1ENV A;  4GYC B;  5EZY B;  1TA8 A;  2F95 B;  1VF5 B;  2P4K A;  2EJR A;  1MNG A;  1YHQ V;  1M57 B;  4MVU A;  1I94 O;  1FFX A;  4DYL A;  4PJ0 Z;  5A2Q N;  2QR4 A;  3CRM A;  3P3P A;  1WN7 A;  4MVQ A;  2BTQ A;  1N34 O;  3AG4 C;  4ASU G;  1D2D A;  2ZQM A;  1K7D A;  1FJG O;  4DR5 B;  1K97 A;  5KAF Z;  1W0J G;  1SZX A;  4G28 B;  2HR3 A;  2Q0O C;  5LHG A;  1OHH G;  3IC7 A;  3MHH C;  3J7A U;  3L75 H;  2PI4 A;  4CC5 A;  1YJW V;  1YF2 A;  2PYJ A;  3ABM B;  2JS5 A;  4H33 A;  3AG1 B;  3ZMS A;  1F23 A;  1SA0 A;  2B1G A;  2BSK A;  4QPK A;  1NI8 A;  2EIM B;  4MVR A;  3RBZ A;  1YEW A;  1EFR G;  4L87 A;  2IH1 C;  1GN4 A;  3J80 N;  4DV0 B;  4DK0 A;  1M5I A;  4ZI7 B;  5LOV B;  1HNX O;  3AG1 C;  1KUQ A;  3APQ A;  3LDD A;  1WPX A;  4ICG A;  3T4Z A;  3CWB H;  3OGC C;  1QVG U;  3FKS G;  4OXS A;  2GTA A;  2WLI B;  4UCT A;  4O4I A;  2DQ3 A;  1WP8 A;  1XL4 A;  2GDS A;  4ZHQ B;  4O4H B;  5IWA B;  2MK3 A;  1VQN V;  2W6J G;  4FK5 C;  3H1I H;  1KBH A;  2DW4 A;  3SYP A;  2HHH O;  3H1K H;  1QBZ A;  5CB4 B;  4GX5 A;  3SDL A;  3CPW U;  1TGO A;  1BT8 A;  4CH4 A;  5CBH A;  3JAW B;  3DXR A;  3CMA V;  3ZHR A;  1H2K A;  2ITD C;  4YY3 O;  4K0K B;  4OPH A;  5H5N A;  4MTF A;  1XIL A;  2JK5 C;  2IBZ H;  4DV1 B;  2CTR A;  1ZUQ A;  4N23 A;  2ARH A;  3WG7 C;  1NH2 D;  2ZIM A;  2EIJ C;  2IU3 A;  3FYE B;  2BSK B;  2DYR C;  2GTS A;  1AJN A;  2C2A A;  3CXC U;  4JI1 O;  1O9G A;  1V9P A;  3U0Z A;  1OCR C;  4JV5 O;  2FTK A;  2G38 A;  4JZG A;  5LHI A;  1S5L Z;  2Q7G A;  3VQX A;  3CB2 A;  1FXK A;  3N27 A;  1L8D A;  4DV4 O;  5L3E A;  4I4T A;  4XDK A;  4LF7 O;  2PGG A;  3E86 A;  1XOU A;  1W0K G;  4DO2 A;  3B4S A;  4PDV A;  1GM7 A;  5D5Q A;  1UFI A;  4R8C A;  4YY3 B;  5EC2 C;  1GN2 A;  2W6I G;  2PUS A;  4LP8 A;  5FPR A;  2CH7 B;  2NNU A;  3H1L H;  4JYB A;  4JI0 O;  3WB1 A;  4DR3 B;  2HHH B;  3ABL C;  3CD6 V;  2PI5 A;  2WLL A;  4HBN A;  2UXC O;  2DQ0 A;  1IBL B;  2AW9 A;  2QWR B;  4CC6 A;  2XAS A;  4MSW C;  4DW0 A;  3CYO A;  1IXB A;  4CS2 A;  5KHK A;  2P90 A;  2DMX A;  2JGU A;  5IWA O;  1I0H A;  2Q6A A;  2EIK B;  3A2F A;  2QWO B;  1JJ2 U;  3G67 A;  2CTW A;  4DR6 O;  4DR7 O;  1MSD A;  3KG2 A;  3S3W A;  1BHB A;  2WLN A;  4X62 O;  4CH3 A;  1L0N H;  2FB5 A;  3CRR A;  3W7S A;  5KA6 A;  2P7T C;  3FAV B;  1RSO A;  1G4Y B;  4DK1 A;  3CCR V;  3ZED A;  4DR1 B;  2UUA B;  1OCO B;  3TET A;  1IBK O;  2VWJ A;  4JI4 O;  1SER A;  3ABL B;  3VBB A;  1DK1 A;  4P2Z A;  4XDJ A;  5CA0 A;  3VOU A;  1VQ5 V;  4QNH B;  5BR8 B;  2LJ2 A;  5EK0 A;  2JJ1 G;  4CH6 A;  4B3M B;  1RM1 C;  3CJH B;  3ZN0 A;  3K59 A;  1KP2 A;  1E1R G;  4FFB B;  3KZI Z;  2F4V B;  2ZXW B;  4J7K A;  4MTG A;  2WLH A;  1EN6 A;  2EUL A;  2IJK A;  3SPH A;  2YI9 A;  3ZCC A;  1YCI A;  1QLE B;  4PA4 A;  3CCM V;  4CS4 A;  3JAK A;  3ZRV A;  4GUN A;  2CGN A;  4LF8 O;  1OCR B;  5BXZ A;  3SJQ C;  2EIN C;  1N36 B;  5FLX N;  3ZJZ A;  2B5U A;  5DED A;  2HJF C;  1CXZ B;  4MW3 A;  4NXM B;  4FLU A;  2XUM A;  4NKG B;  1TVK A;  1QR9 A;  1GM8 A;  4LNU B;  2Y4T A;  4JYC A;  2Q68 A;  1WNS A;  2F66 C; 
#chains in the Genus database with same CATH homology
 1K34 A;  5CN0 A;  3K79 A;  4QE7 A;  5J9P C;  2EIM C;  4MT8 A;  1JVM A;  3ABK B;  1NR7 A;  5EBM C;  3ASO C;  1YIJ V;  4JTA B;  1QVF U;  2JJ2 G;  1DLB A;  2XAJ A;  2WLJ A;  3M99 B;  2AHY A;  1S76 D;  2ZDI A;  1TUE B;  5IY5 B;  4KP4 A;  2EBO A;  3CP1 A;  3QO8 A;  1K5S A;  3ZMU A;  3K9A A;  1RM1 B;  1Q86 W;  2IU0 A;  1VQ6 V;  3E8H A;  3MHS C;  1PNL A;  3B8M A;  3CCU V;  5IYC O;  2IJI A;  2W0F C;  3ZMT A;  1YI2 V;  2Y69 B;  1E1Q G;  2LP7 A;  5EBW C;  3FB7 C;  3RVY A;  1SZT A;  3LSQ A;  1R3L C;  1NH2 B;  1JQ0 A;  4TWK A;  4EKW A;  2LFR A;  3AEI A;  3F7V C;  4DXW A;  1J95 A;  2D3O W;  3E35 A;  2K1E A;  5DM6 V;  2HFE C;  5HFM A;  3DTU B;  2HKO A;  4PDM A;  1JOY A;  5E1A C;  4UVC A;  4RO2 A;  3SPC A;  2JIZ G;  1R3J C;  1OCZ B;  2H94 A;  3OEH G;  3G71 V;  1S5H C;  2A79 B;  1GKF A;  1FXK B;  5B1A B;  3RVZ A;  1VQ4 V;  1HWY A;  4E2L A;  4WFB V;  4P9O A;  3IGA C;  4WFG A;  4KUM A;  4GX2 A;  1NKD A;  1AJP A;  2XND G;  4QPJ A;  4HZ3 A;  1RPR A;  5B1B C;  1VQ7 V;  2DWD C;  2QM7 A;  3JCZ A;  1BMF G;  2JDI G;  1YTF B;  3TK1 A;  1ARO P;  4R50 A;  3FYI B;  1SET A;  2QKS A;  1V55 B;  3QO7 A;  3IFX A;  3OUF A;  4X89 A;  3PJS K;  3T2M A;  4MVZ A;  3HB3 B;  4JAV A;  1K5Q A;  2M7W A;  1ROP A;  2ZXW C;  1K3E A;  4QE9 A;  1M1K W;  1K4C C;  1YIT V;  5CA3 A;  4I5S A;  1VQL V;  1W2B U;  2Y48 A;  4UV9 A;  3OR7 C;  1N8R W;  1MSW D;  4U7O A;  2UXX A;  1FXK C;  3ABK C;  5B1A C;  3T4D A;  2A9H A;  2P67 A;  3CME V;  1P7B A;  3F5W C;  4UXN A;  1M56 C;  2EIL C;  1JPX A;  2V1D A;  2EIK C;  1B6Q A;  1QLE C;  3ZMV A;  2IJJ A;  4CBC A;  3OE7 G;  1F51 A;  4JGS A;  1K73 W;  2XAG A;  2XAH A;  4JTD B;  3OEE G;  5IYD O;  2GHY A;  3CCS V;  3ASN B;  4Z1M G;  3DGE A;  3I55 V;  4JPR A;  3OW2 U;  5H6R A;  1DF4 A;  5L3C A;  5GW7 A;  3SPJ A;  3AG3 C;  3CCJ V;  1YJ9 V;  2OCC C;  3SYQ A;  2OTJ V;  1ENV A;  1EZJ A;  1R73 A;  2XOK G;  3D3I A;  2EJR A;  2OTL V;  4GX1 A;  4XDL A;  1YHQ V;  1M57 B;  4MVU A;  3E89 A;  4BAY A;  3OFN G;  2X6C A;  4PA6 A;  5EBL C;  2QA4 V;  1CP9 A;  1FXH A;  4R7C A;  2CK3 G;  4I9W A;  4RUE A;  4MVQ A;  3G4S V;  1RPO A;  2V7Q G;  3A0R A;  3T1C A;  3AG4 C;  4ASU G;  2ZQM A;  1K7D A;  5KUM A;  1KC8 W;  2P6J A;  4BIU A;  3CC2 V;  1K97 A;  2HVK C;  4GT1 A;  1K9M W;  3TCU A;  4FIP C;  5IDJ A;  1W0J G;  1OCC B;  4G28 B;  2HR3 A;  5LHG A;  2IW5 A;  3ASN C;  4MS2 A;  1OHH G;  3IC7 A;  1KD1 W;  1R6N A;  3MHH C;  3CCQ V;  3K06 A;  2PI4 A;  3SPI A;  3ETG A;  1YJW V;  3ABM B;  3K0D A;  4H33 A;  1GM9 A;  3K04 A;  3AG1 B;  3ZRS A;  3ZMS A;  1Q82 W;  1VQK V;  1AR1 B;  1MAB G;  1VQO V;  1F23 A;  3E8G A;  1NBM G;  3I56 V;  2B1G A;  4QPK A;  3AG2 B;  3LNM B;  3STZ C;  3OR6 C;  2EIM B;  4MVR A;  3RBZ A;  3CC7 V;  3R65 A;  1S77 D;  4RQE A;  1I5Y A;  1NVP D;  5B3S C;  1EFR G;  2IH1 C;  4L87 A;  2GSM B;  3OMA B;  2R9I A;  3SYO A;  1OCZ C;  3GB7 C;  4UV8 A;  1S3J A;  4J9Z B;  4F4L A;  3CC4 V;  3K03 A;  3AG4 B;  2UXN A;  3ETD A;  4WFE A;  3W7T A;  1PNM A;  3AG1 C;  1GMG A;  1Q81 W;  3AG3 B;  3LDD A;  1WPX A;  5H6Q A;  4YXW G;  2A0L A;  3T4Z A;  3OGC C;  2XAF A;  1QVG U;  3FKS G;  4OXS A;  3WFV A;  2Q67 A;  1LNQ A;  5LGN A;  2WLI B;  2Y69 C;  4MVM A;  2QM8 A;  1SES A;  2DQ3 A;  3P30 A;  5B3S B;  2IH3 C;  2DYS B;  1BHA A;  4TSF G;  1XL4 A;  3QO5 A;  4G27 B;  2WAM A;  3G6E V;  2MK3 A;  1VQN V;  2W6J G;  3ABT A;  1KP3 A;  3FB6 C;  3OMN B;  4FK5 C;  3ABU A;  5KA5 A;  1H8E G;  4U7N A;  5DN6 G;  1KKD A;  2DW4 A;  3SYP A;  1AI6 A;  1YTF D;  2WLM A;  3CCE V;  1KQS U;  1QBZ A;  2DWE C;  4GX5 A;  1VQM V;  2ZDI C;  1QCE A;  3JYC A;  3SYC A;  1S0V A;  3CPW U;  3BEH A;  1KEC A;  1K33 A;  3P32 A;  2DYR B;  5CBH A;  2QTO A;  1VQ9 V;  5B1B B;  3SPG A;  1F4M A;  2WLK A;  4FJC C;  1JX9 A;  3CMA V;  1AJQ A;  2ITD C;  3E8F A;  4Q20 A;  4RAI A;  1M56 B;  2EIL B;  3ZRW B;  1G8M A;  3W7X A;  4XBF A;  3LSS A;  4MTF A;  4PDR A;  2JK5 C;  4PA7 A;  2F43 G;  5H9C A;  2HLD G;  4LCU C;  5L3F A;  1R3I C;  3SYA A;  1AI7 A;  4RUF A;  2Z5U A;  4PA9 A;  5EC1 C;  2WPD G;  4G2K A;  1OCC C;  3AG2 C;  4BIZ A;  1M9N A;  5L3G A;  4N23 A;  1Y66 A;  3WG7 C;  1SRY A;  1NH2 D;  3ASO B;  2EIJ C;  2IU3 A;  3FYE B;  2JEX A;  2X0L A;  4JTC B;  1K4D C;  3JD0 A;  2DYR C;  3EHB B;  1AJN A;  4MW8 A;  2C2A A;  1VQP V;  3B8N A;  3CCL V;  3FB8 C;  4PEL A;  1K8A W;  3CXC U;  3JD4 A;  5LBQ A;  1OCR C;  2ATK C;  1CPY A;  4UUJ C;  1V55 C;  2FTK A;  5LHI A;  4MVS A;  4QIW F;  2YEV A;  2HG5 C;  2IJH A;  3ZMZ A;  2EZO A;  4X88 A;  1NJI W;  3OAA G;  1V54 B;  1R6K A;  1FXK A;  2BOC C;  2ZD9 A;  5L3E A;  5LGT A;  2AHZ A;  4JAU A;  2QEX V;  4XDK A;  3ML0 A;  1R3K C;  3CCV V;  5CBF A;  3X2Q B;  1MG1 A;  2YEV B;  3E86 A;  1V54 C;  1W0K G;  4DO2 A;  1NQT A;  3B77 A;  4PDV A;  1PL0 A;  2OCC B;  2OT5 A;  4JAS A;  5C93 A;  3QNE A;  1GM7 A;  4R8C A;  5CMU A;  1JCH A;  5EC2 C;  4MTX A;  2W6I G;  4LP8 A;  3UM7 A;  3W7W A;  2NLJ C;  3JD1 A;  1GK9 A;  2ITC C;  4R6Z A;  1NVP B;  2NNU A;  4JYB A;  3OM3 B;  1PD3 A;  1YSC A;  3LDC A;  2KB1 A;  3ABL C;  1Y4M A;  4PA3 A;  3CD6 V;  2PI5 A;  2WLL A;  1M57 C;  1THZ A;  3HPL C;  2DQ0 A;  4ZKI A;  1VQ8 V;  3OMI B;  2XAS A;  1F4N A;  4MSW C;  1OCO C;  3CYO A;  2Q69 A;  1BL8 A;  1PKX A;  4PDL A;  3W7U A;  1XL6 A;  2P90 A;  3ABM C;  3E83 A;  3K3W A;  4HYO A;  1H38 A;  2XAQ A;  2Q6A A;  4P30 A;  1H2G A;  3ZIA G;  2EIK B;  4WFA V;  1JJ2 U;  1S72 V;  2WLI A;  2ZR3 A;  3F7Y C;  5IYB O;  3KG2 A;  1GTO A;  1CEZ A;  3JD2 A;  4WFH A;  3ETE A;  3OUS A;  1UJW B;  1DF5 A;  2WLN A;  1BHB A;  3H01 A;  1YJN V;  4MVO A;  3RW0 A;  5HFL A;  2WLL B;  1EBO A;  4P9P A;  3W7S A;  1DTO A;  3LUT B;  2X6A A;  5BZB A;  1IXM A;  5KA6 A;  4BW5 A;  1NR1 A;  4LBE C;  2P7T C;  5L3B A;  1ZWI C;  2HVJ C;  1G4Y B;  1AI4 A;  3UKM A;  3CCR V;  3ZRW A;  5B1N A;  1OCO B;  3TET A;  4RQF A;  1FFT B;  3EFF K;  1SER A;  1FS0 G;  2QE7 G;  3ABL B;  3JD3 A;  4UVB A;  3D36 A;  2Z3Y A;  1E79 G;  1H8H G;  4KFM A;  3VBB A;  3X2Q C;  4WCE V;  4P2Z A;  4FPP A;  1COW G;  5B1O A;  4XDJ A;  4UVA A;  3LDE A;  1QLN A;  2R9R B;  2LFS A;  3MD0 A;  3VOU A;  1VQ5 V;  4QNH B;  4MTO A;  2YSU B;  4GCZ A;  5IY5 C;  4FMT A;  5EK0 A;  2JJ1 G;  4WFF A;  4J9Y B;  3WG7 B;  1RM1 C;  3ZN0 A;  2H8P C;  5L3D A;  3K0G A;  1KP2 A;  1E1R G;  5CBG A;  3E2E A;  3K08 A;  2ZXW B;  4H37 A;  4QJF B;  3E8B A;  4LC1 A;  3ZRX A;  4MTG A;  1FXV A;  2WLH A;  4N21 A;  2ZR2 A;  2IJK A;  3SPH A;  3ZCC A;  1MOF A;  1QLE B;  2WWW A;  4PA4 A;  3CCM V;  2DYS C;  4TT3 G;  4HAM A;  4WF9 V;  2EZP A;  1P4R A;  3BY6 A;  3ZRV A;  2BOB C;  4ZBM A;  4X8A A;  1PNK A;  1OCR B;  2EIJ B;  5KUK A;  1AI5 A;  1M90 W;  3SJQ C;  2EIN C;  2B1I A;  2JEU A;  3ZJZ A;  5LGU A;  2B5U A;  1I5X A;  2HJF C;  1ORQ C;  2X6B A;  4JF3 A;  4MW3 A;  2X7R B;  5FL7 G;  4CZZ A;  1OZ0 A;  1GO3 F;  1QR9 A;  1L1F A;  1GM8 A;  3GWO A;  3STL C;  1Q7Y W;  4JYC A;  2Q68 A;  3NXS A;  2EIN B;  5LHH A;  2WSS G;  3ZN1 A;  1QR8 A;  4GX0 A;  1K92 A;  1WLE A;  3FB5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...