5EBMC

Kcsa t75g mutant in the nonconductive state
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATGVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ebmC00
3E86A 4GX2A 2IH3C 5B1BC 2A0LA 5EC2C 5CBGA 3F7YC 3UKMA 1ORQC 4OXSA 4ZBMA 3VOUA 1BL8A 4TWKA 3LNMB 2Q6AA 1R3IC 1K4DC 5EBMC 3SPJA 2HG5C 3SYCA 3FB8C 1M56C 4MS2A 2QKSA 2HVJC 1K4CC 4J9ZB 2ATKC 1LNQA 3LUTB 4JTDB 2EIMC 3STLC 4RUEA 1R3JC 3ZJZA 3SYPA 2HFEC 5CBFA 4P30A 3AG3C 5KUKA 3X2QC 4WFHA 4GX5A 2WLHA 4WFFA 3SPHA 4PA9A 3OGCC 4WFGA 3FB7C 2OCCC 4MVRA 5B1AC 2A9HA 4J9YB 4CBCA 3SJQC 1XL6A 3K0DA 2HJFC 2ITCC 2HVKC 1J95A 5E1AC 2DYRC 2WLNA 5B3SC 4GX1A 4JTAB 2ITDC 4X8AA 4QE7A 4P2ZA 4PDRA 2P7TC 3RVZA 4H37A 4MW3A 4MVZA 3AG2C 3LDDA 4R50A 3IFXA 3ABLC 1JVMA 4UUJC 2Q68A 2YEVA 3T4DA 3OUFA 4MVMA 5BZBA 4RUFA 1P7BA 4I9WA 4QE9A 3SPCA 3RW0A 4QNHB 3T4ZA 3UM7A 2WLKA 3EFFK 4PDLA 3OR7C 4RAIA 4MTOA 1OCRC 2K1EA 2Q69A 4R8CA 3ZRSA 3TCUA 3BEHA 2BOCC 4P9OA 1ZWIC 2BOBC 3ABMC 2ZXWC 4KFMA 1R3LC 5KUMA 1V54C 2QTOA 2EINC 3FB6C 2KB1A 3OUSA 2DYSC 4G27B 1KKDA 3K08A 5EC1C 3SYQA 3IGAC 2R9RB 2ZD9A 4GX0A 4HYOA 4MTGA 3K06A 3E83A 5EK0A 4XDJA 3FB5C 3SYAA 2A79B 2AHYA 2IH1C 4MSWC 4EKWA 3KG2A 3E8GA 4H33A 3F5WC 4MVOA 1OCCC 2WLMA 4R7CA 3HPLC 3K03A 2WLLB 3STZC 3GB7C 3RVYA 1OCOC 3ASNC 4MW8A 4PA6A 2Y69C 2JK5C 4HZ3A 4MVQA 2Q67A 3ASOC 3LDCA 4PDVA 4X88A 3SPGA 3WG7C 1S5HC 3JYCA 2WLIA 4F4LA 2EIJC 2H8PC 4WFEA 4LP8A 4PA7A 2WLLA 4DXWA 2DWDC 4LCUC 3PJSK 1V55C 3T2MA 2EILC 4P9PA 3E8BA 4XDKA 3SYOA 4LBEC 5EBLC 4PA3A 5EBWC 2AHZA 4MVUA 4BW5A 3E8HA 3T1CA 3TETA 1G4YB 3AG4C 3OR6C 3SPIA 5CBHA 1QLEC 4MTFA 4R6ZA 5IY5C 2NLJC 3K0GA 1XL4A 2X6CA 3RBZA 2WLIB 3LDEA 4X89A 3AG1C 4XDLA 2X6AA 4MVSA 3ABKC 2X6BA 3E8FA 2W0FC 4G28B 4JTCB 3R65A 3K04A 2EIKC 2WLJA 3E89A 2DWEC 3F7VC 4PDMA 4RO2A 1OCZC 1R3KC 5J9PC 1M57C 4PA4A
chains in the Genus database with same CATH superfamily
4CS4A 1K34A 4I0XA 1YI2V 2Q6AA 1NI8A 1MSDA 4UVBA 4DR2B 1I0HA 2QKSA 3CCUV 2JIZG 4IYIA 1VQKV 2PF4E 2XAJA 3AG3B 2BTQB 1SZTA 4OX9O 1YHQV 3KZIZ 4J9YB 4LF9O 1XL6A 2HJFC 1FXVA 2ZKOA 4WBNA 4CH5A 3Q4HA 3CCLV 2ZDIA 4FLUA 1K92A 1AI4A 4P9OA 4ZOLA 5IJ0A 5KX5B 1M9NA 3C3TA 1GKFA 3OUSA 2DYSC 5BXZA 1KKDA 2FB5A 4GX0A 4UCSA 4JI7O 1P4RA 2GTSA 3JATA 3RYHB 1XNQO 1XI1A 1OCOC 1FXHA 5KA6A 4K35A 5H5NA 5KLVH 1MSWD 4TSFG 1WP7A 3L71H 1OHHG 2ILMA 3E8BA 3D36C 3I5DA 3ZHVA 4GCZA 1RPRA 4MTFA 1N33B 1XL4A 4X64O 3JD4A 3ABKC 1Z2GA 3N2KB 1Y6XA 4X1YB 3U10A 3E89A 1PKXA 2DWEC 4JYBA 3FYIB 4LF7B 4PDMA 3ZEDA 1MZEA 2GDSA 2UUCO 1SZXA 5DN6G 3ZRSA 1M57B 1US6A 2QR4A 4K0KO 4DR4O 5DM6V 2YIDA 3EVKA 1P84F 5AG2A 1R3IC 5KHJA 4I7ZB 3VQXA 2RQ6A 3WFVA 5J2UB 1EBOA 1JOYA 4IYHA 5KHIA 3THOA 5HFMA 2HFEC 3HB3B 3CXHF 3M7MX 3P30A 1N34B 4I55A 3VQYA 4UVCA 4J11A 2MK3A 3CP1A 4O2BB 4AQYO 4B08A 2ZR3A 2GSMB 2UU9O 4U3JA 2HVKC 4JV5O 5EYPB 4TV9B 2DYRC 3B4SA 4IHJA 1YSCA 4X8AA 1W59A 3IFXA 3QF7A 2VQEB 2E75B 4H44B 1SA0A 5LMNO 3TCUA 4AI8A 5H2FZ 2VRZA 1QU7A 1YITV 4F6EA 1R3LC 2EINC 1WB7A 4G27B 3ZRWB 2ZD9A 4HAMA 4WCEV 4UB8Z 3UCSC 5IJ9B 1XMQO 2XASA 2WLMA 4FIPC 3ZMTA 1XOUA 4LF8B 3RYIB 2P90A 4FZ0A 2Y69C 3TK1A 4ZI7B 2FTKA 2IJIA 3CCMV 4DXWA 1WJZA 2DWDC 2V7QG 4Z1VA 5EBLC 4DW1A 4Q20A 5JVDB 3ZHUA 4LFAB 3SPIA 3BCCH 1CXZB 4DV2O 1ZL8B 1H2GA 2HJDA 2DQ3A 2FYUH 1OCOB 2PI4A 4NYKA 2V4DA 4KP4A 2ZQMA 4X20B 4DK1A 5KHHA 4CS3A 2P4KA 4ZBMA 3ETQA 2YIBD 1YF2A 2QSAA 2YI9A 5DEDA 1NR7A 1KB9F 3QTCA 4CZZA 5LA6B 1FXKB 4LWSB 3ABKB 1QCEA 2Z5UA 1UJWB 3K5LA 4B3TB 1O9HA 1Y67A 4WFHA 3SJBC 1SKVA 2VWJA 2VQFO 1I94O 5GTHZ 2A9HA 1QVFU 4CC6A 1N4CA 2BTQA 4CS2A 4WF9V 4GX1A 3OEEG 1IBMO 2ZDIC 3ABUA 1MZFA 2FMLA 3PN1A 2QM8A 3L75H 2X0LA 4QE9A 4DUYB 4JAAA 1VQ8V 3G4SV 1IBKO 3H1HH 4LF5O 1E1RG 3ABMB 1Q82W 2XAHA 1VQOV 2QM7A 3CE2A 1PP9H 1KUQA 4TUYB 4O4IB 2DOSA 5KAIZ 3LSUA 2DYRB 4JI0B 1RSOA 1K33A 2WLLB 4JI3B 3EXAA 3WG7C 4MVQA 3RYHA 3KCXA 2ZE5A 5BMVB 2Q73A 4ABMA 2EINB 3W7XA 1NTKH 4DW0A 1VQ9V 2F66C 4R6ZA 5IY5B 4QJFB 1H38A 4BIUA 4JTCB 3TXQA 3R65A 1YEWA 3K04A 1Q86W 4QIWF 3I56V 4GX2A 3OMIB 5B1BC 4X1YA 2GV9A 4LFBB 4FM0A 1ORQC 2Q0OC 1KMIZ 2WAMA 3CB2A 1BL8A 1AROP 4TWKA 2ETNA 3LNMB 2RDCA 2Q7HA 1SRYA 1NTZH 3LUTB 3STLC 3K5NA 5LXTB 3SYPA 1TGOA 1PNLA 5J2UA 2PI5A 1VF7A 1VEWA 4DV7B 5C93A 3SJCC 1NZ6A 2E76B 4CBCA 1H2KA 2A06H 2B1IA 3MD0A 2YEVB 3E35A 3ZMUA 4O2BA 1RP3B 1GRJA 4FK5C 2CTWA 3LSQA 5EYPA 4TV9A 1R6TA 2JEUA 2UXCO 1OV9A 1MOFA 4RAIA 4KFMA 5L3DA 1PPJH 3VQWA 3CHXA 4MT8A 4GZRB 1K5QA 2A79B 2AHYA 3HPLC 3K03A 3GB7C 2JGDB 3RVYA 2AZ0A 4PHZA 4ZOLB 2Q67A 5IJ9A 3K59A 3S3XA 4DR6B 1IURA 5EZYA 4DUZB 2EIJB 2Q7GA 1COWG 2BE3A 4LP8A 1FFXB 1AJNA 3RYIA 2JGUA 2R9AA 4JI2O 3JATB 4QPKA 4ZI7A 3SYOA 4LFCO 5EBWC 5GTIZ 3OR6C 4ASUG 1S72V 1FFTB 4XDLA 1KKCA 5JVDA 5J2TA 3E22B 1KU9A 3F7VC 3WG7B 5IYZB 1VQLV 2FKXA 4OX9B 2QWQB 5L3CA 4FLYA 1ZL8A 2XUMA 1MG1A 3FYEB 4LF9B 4X20A 1LUVA 1TUBB 1HNZO 1NKDA 5IE9A 4KHPO 4X1KB 1H8HG 3GVMA 5H6QA 1K4CC 3QO7A 3D36A 2F4VO 4YHHO 4RUEA 3RYFB 3AG3C 1UFIA 2IM9A 5LA6A 2EBOA 1FXKA 2WLHA 3APQA 4RWUA 4O4LB 1HNWO 4LWSA 1VF6A 5K1PA 1IX9A 3IC9A 1VMGA 5GW7A 3K0DA 4JI7B 2NN4A 5E1AC 4J7KA 1SQQH 5KHKA 1XNQB 4QE7A 3U0ZA 4B3MO 5JJEB 2RN9A 1FYJA 3SPCA 4QNHB 3T4ZA 1AR1B 3H01A 2ZINA 2Q69A 5EIBC 4N23A 1K73W 3QVNA 3MDSA 4KUMA 4DV0O 1WB8A 2DN9A 1MNGA 1Z5WA 2ZNIA 5LL6Y 4ZKIA 2IH1C 4TV8A 4X64B 3KG2A 1SA0B 4MVOA 1BHBA 5LGTA 1OCCB 4R7CA 4TUYA 1PL0A 4O4IA 1QNMA 4MW8A 1GH6A 4FMTA 4DYLA 2HHHO 3H9VA 2UUCB 1NJIW 2PGGA 3NR7A 2CH7A 2WLLA 4K0KB 4DR4B 4IGGA 1V55C 2M7WA 4JI1O 3RYCB 5BMVA 3WB2A 3BABA 2AHZA 4X1IA 3G6EV 1K3EA 3HR0A 3CX5F 2F1MA 5JCOA 2V1DA 2LP7A 2Y4TA 5IYCO 4L87A 1XHZA 1M57C 4AQYB 3H1LH 5D5QA 3ZRXA 2UU9B 2ADPA 1QLNA 4JV5B 4JI8O 3AK3A 4MS2A 1GN6A 2ATKC 3RWRD 2EIMC 4ZIBA 5LMNB 3ZJZA 2GHYA 2F43G 1PV0A 4WFFA 3OGCC 3N2GA 3OGIB 4UB6Z 5LXTA 2PUSA 3CC7V 3FAVB 2ZE6A 4YJ3B 2WLNA 1XMQB 3M8AA 2CTPA 4A5UB 2QGNA 3ZHQA 1TA8A 3MHHC 2XNDG 3JAMN 2YEVA 1P7BA 2IBZH 5LYJB 2YIAA 1NU1H 1EN5A 2K1EA 1GK9A 5FNVA 1JQ0A 2KG7B 4GYCB 4O4HA 3K9SA 2JRIA 4X62O 4XDJA 3DC6A 3G6BA 4DV2B 4X9QA 1AVMA 2YIBA 3STZC 3N27A 2QEXV 3JALB 4PELA 3ASOC 4EFBA 1MMMA 2M6YA 3JD0A 3OTOO 2JGDA 1M90W 1NBMG 2UUBO 2IU3A 1G8MA 2ZM6O 1RSOB 1DF4A 4BIOA 1FFXA 4PA3A 1EFRG 1NVPB 3CRAA 4BAYA 3JARB 4X89A 4Z2WA 1Y76B 2OTJV 1R3KC 1DTOA 1OCZB 2VQFB 4B3RO 1I94B 3CCJV 3E86A 3JD3A 3E22A 2HLDG 3C90A 5IYZA 1V55B 1S5LZ 4DR5O 5CA3A 1AI7A 2JDIG 1IBMB 5EBMC 5GONB 4UCOA 1FXKC 4EB6A 1TUBA 5JJNB 2RJZA 4X1KA 1VF6C 1IBKB 4B7KA 5CBFA 2P5OA 3JAWB 4I5SA 4LF4O 3B09A 1SQPH 4LF5B 1S0VA 3BPZA 2P67A 4JGSA 2OTLV 1GM8A 1XQ8A 3FB7C 1GN4A 3RYFA 4DK0A 2ZE7A 3SJQC 4UCUA 4O4LA 5L3GA 1AR4A 2NR5A 5BZBA 3BY6A 3DGEA 2EIMB 1EZJA 4H13B 4Z1MG 2JS3A 3ABMC 1F4NA 3CWBH 3ZX6A 4NR1A 2OIEA 3NXSA 3DSQA 2LQTA 4FFKA 2PYLA 2R9RB 1RM1C 3JAKA 4GT1A 3FKSG 3OM3B 1L0NH 2YI8A 1D5AA 2KQXA 2W6IG 3ML0A 1S5HC 1B06A 5IYBO 4I9QA 1Y66A 3G71V 4K8XA 1DGSA 3HKCB 4EEQA 5L3EA 4LBEC 5JCOC 2IJJA 4GUNA 1QR8A 3CCSV 2JJ1G 5IY5C 1Q6HA 2QA4V 1IVSA 3RYCA 5EZYB 3AG1B 1SQBH 2X6BA 3RT3C 5KA5A 3WB1A 4DO2A 3ASOB 1JJ2U 3ZMZA 1FS0G 4U3FH 1WNSA 3SR2C 5JQGB 4J42A 1QR9A 2GTAA 1KYOF 4WFAV 5FPRA 5J2TB 2VS0A 1BHAA 3A2FA 2DW4A 4AHCA 2XAQA 2UXCB 3VBBA 4P30A 4DR7O 2QDOA 3ZN1A 1N8RW 1ROPA 5FPOA 1GM7A 1SF9A 2B5UA 3CEIA 4W4KA 3G67A 1VQMV 2Q0AA 4JZ2A 2P7TC 3GWKC 2E5LO 4DR3O 3FAVA 4YJ3A 1XREA 2XAGA 4I9WA 1FPOA 1JPXA 2WLKA 4K3AA 4O2AB 1AI5A 3MHSC 1XDCA 4JI2B 1VQ7V 2UXDO 5LYJA 3JCUZ 4LFCB 1I5XA 2R72A 3HKBB 1SERA 1XNRO 3ZS8C 2KG7A 1RFYA 3AG7A 1HW7A 4DV4O 5A9GA 1X4TA 5CB4A 4IL6Z 1TUEB 4NXMO 2X7RB 4F4LA 2EIJC 3JASB 4PI0A 3SGIA 3JALA 2P6JA 1S5JA 2YC0A 4TV8B 5LGNA 3T1YO 2QWOB 1HNZB 4KHPB 3ICXA 2CGOA 4HNAA 1RM1B 1H2MA 4BW5A 1ZAUA 3M99B 4B3SO 5CBHA 2Q4PA 1GM9A 2F4VB 1N32O 1K97A 3B8MA 4YHHB 4MVSA 2CH7B 3P3PA 2W0FC 1Q43A 3W7UA 3JARA 2R70A 1M4UA 4JZGA 2WSSG 1HNWB 2Q5ZA 2ADQB 3J7AU 1Y76A 4X1IB 3L9DA 3UKMA 2QM4A 1R73A 1AR5A 3L74H 1M5IA 5FL7G 4NTYA 3O65A 4OPHA 3ZCCA 4B3MB 4I50B 1XHXA 4J9ZB 3A8TA 1BS3A 1E79G 3ETGA 1R3JC 5GONA 3I55V 3OE7G 2Y0IA 3K3WA 1I7FA 2YXLA 3B8NA 2BTOA 4WFGA 4DV0B 2OCCC 3JAWA 3S3WA 1K8AW 3LNNA 2CUGA 3BVOA 2KKWA 2LW1A 5B3SB 2AZ2A 1O9GA 5KMGB 4PDRA 1AP6A 3RVZA 5B1NA 1XMOO 3LDDA 3ABLB 3P32A 3OUFA 2RCVA 4GKKO 3N2GB 2HHHB 1QVGU 3EFFK 5JWPA 3APOA 3OR7C 4R8CA 2UXBO 1PL4A 2ZXWB 3HKEB 4JI1B 5CA1A 2QTOA 3FB6C 2KB1A 4JI6O 2Q8VA 5EK0A 2LFSA 3E83A 2JEXA 2Y4UA 2EJRA 4J7JA 1Q6UA 1TVKA 3F5WC 5CMUA 1OCCC 2F95B 1Q5OA 1SQVH 5A2QN 1THZA 3ASNC 5FNVB 1PD3A 4O4HB 4PDVA 4X88A 4JPRA 4UFZA 2PY5A 1JJOA 1B04A 3D3QA 2RMKB 3ZN0A 2EILC 4G2KA 1VARA 4UCRA 3T1CA 4JI8B 1FJGO 3AG4C 4FVMA 1QLEC 2NLJC 3HKCA 4JYYA 1YZBA 2BSKB 1YJWV 1NT2B 2ZNJA 5E79Z 4DV3O 1HR0O 3UT5A 3UO2A 3W7TA 1F7YA 3CSXA 4LNUA 4RO2A 1LR1A 2LJ2A 2D3OW 4J41A 4NB5A 2ZE8A 2YSUB 2CK3G 4UXNA 4PJ0Z 2QTSA 5JQGA 1H2NA 1VP7A 1F51A 2OIGA 2CTRA 1WPBA 1K5SA 5B1AB 4X62B 1T5EA 4EB6B 2CTQA 3RN4A 3CYOA 4DR1O 2OCHA 5D5PA 4UVAA 1G6UA 4JYAO 4YIOA 3UM7A 4HBNA 1OCRC 3OTOB 4IT5A 5IWAO 2UUBB 1RPOA 1YIJV 1ZLZA 2IJHA 2YDEA 2ZM6B 1V54C 2W0XA 2OCCB 5EC1C 3D8CA 4O2AA 3K5OA 3SYAA 3W7WA 2QWRB 3K79A 1AILA 4X65O 4EKWA 3BA9A 1OJHA 3HKBA 3CC2V 4ICGA 1YDXA 2WLIA 4B3RB 1SQXH 4PA7A 2D2CB 4FM2A 1EZVH 3JAKB 4BWAA 1NQTA 5B5EZ 4DR5B 5IT9N 4BW9A 4DV1O 1PM9A 3JASA 4XDKA 4JYCA 3OMAB 3TETA 1M1KW 1V9PA 1KBHA 1KP2A 3UO3A 2OT5A 1B6QA 2LGQA 2WLJA 3ASNB 1K9MW 4LF4B 1ZTEA 3ZHTA 2WA3A 1BGYH 1OCZC 5L3FA 3CPWU 1HNXO 4LH6A 2IU0A 5EC2C 5LHHA 3ZHRA 2A7WA 4DV5O 1TAEA 2EILB 3ZIAG 4YY3O 3DXRA 2GBOA 1URFA 3AG4B 1BMFG 3FB8C 1L1FA 1QLEB 1NS1A 4IIJB 2ZIOA 3HKDA 4I50A 1VF5B 2N74A 2UXXA 3X2QC 4CC5A 5IYDO 1GTOA 3K5MA 2VWKA 2WPDG 1YJNV 5LMUO 3RFRA 2WA4A 3SDLA 2XOKG 2QKAA 3K58A 3H1IH 2ITDC 1JCHA 5KHGA 4MVZA 3AG2C 2G38A 1XEQA 1S77D 5KMGA 4LF6O 2ZIMA 4PDLA 4JAUA 2CGNA 2BOCC 3CMEV 3CRQA 5HFLA 3BAAA 2RNBA 1FAFA 2LFRA 3L73H 3HKEA 1EN6A 3GWOA 3CXCU 2H3OA 3AK1A 4HZ3A 2HKOA 4X66O 2H8PC 1OCRB 4YJ2B 5KAFZ 3FFQA 1N0JA 5C8YB 1V54B 4FFBB 2Q7EA 2XHBA 5CB4B 5H6RA 1L8DA 4H0LB 5JH7B 3LDEA 3AG1C 2LGWA 3KKYA 3E8FA 3DTUB 4DR7B 1JA8A 5IDJA 1N36O 3JSLA 1SQFA 3IJ4A 3J81N 4D7TA 2BSKA 4HNAB 2L35A 3ZBHA 1SC5B 4OXSA 3CCEV 1WP8A 3SPJA 2HG5C 4UV9A 2E5LB 3SYCA 4DR3B 1LNQA 1R6KA 1YVWA 4B7EA 3J80N 3P3NA 1WN7A 1ZSPA 4NTWA 1Q6IA 2DMXA 3ZMSA 4N21A 2Q9LA 2UXDB 3OD4A 2C2AA 1XNRB 1IXMA 2ITCC 4E4EA 1J95A 4JTAB 1JMKC 4DV4B 1YJ9V 4F6RA 2N04A 4NXMB 1ZUQA 1BE3H 1I5YA 4MVMA 1KQSU 4FZ1A 4JI4O 2R9IA 4C7UA 2LW7A 4JAVA 3X2QB 3JCZA 2AGAA 4FLXA 3T1YB 4JI5O 5LP6B 4NVPA 1XBLA 4KXRA 3K06A 4B3SB 4OGQB 1FD9A 4UCTA 1CEZA 1N32B 3OTFA 3AG2B 4NXNO 1JFFB 4I4TB 3L72H 5CA1B 1W0KG 1BT8A 5CA0B 2UUAO 4NKGB 2HR3A 5ITZB 4FM1A 1JR9A 2H94A 1NH2D 4LH7A 3T2MA 3AEIA 4WFBV 4AILC 1TVKB 3E2EA 1KD1W 3K57A 2OYQA 1VQ4V 1WA8B 1DF5A 1D2DA 1FKAO 3BFRA 1J5EO 4DV6O 5TISZ 3ZMVA 1W0JG 3IAYA 5BR8O 1R1BA 3QNEA 4GKJO 1Y4MA 3QO8A 4TQDA 3CJHB 1JX9A 5LOVB 1VQ6V 1BQ0A 3CRCA 2QE7G 2A0LA 1HDJA 1K7DA 3A0RA 3VOUA 1WPXA 1Q81W 1YTFD 3OAAG 1K4DC 3L70H 3UT5B 3D3IA 1XMOB 4NTXA 4LNUB 1H2SB 1AJQA 4GKKB 3CC4V 4BIZA 1GMGA 3T1HO 3CD6V 4FLTA 4K8ZA 2UXBB 4IIJA 4PA9A 4FLZA 1MA1A 1IBLO 4JI6B 2CAZC 4YXWG 5B3SC 3ABLC 1JVMA 4DR2O 2ZT9B 3ABTA 1Q8IA 2P4VA 1HWYA 2ZXWC 5LHGA 2MW2B 2DYSB 4MTGA 1FJGB 1MABG 5L3BA 4CH3A 3E8GA 4KL1A 4QGPA 2GUZA 1HR0B 4DV3B 1HP8A 2JK5C 4LC1A 3JYCA 1I08A 3BHPA 2Y48A 2UXNA 2JS5A 4LCUC 3U11A 4DRXA 1WAZA 2JVDA 4L8JA 4YJ2A 4FLVA 1H8EG 2NNUA 3ETDA 1M93A 5C8YA 4RQEA 4FFBA 4D6TH 2WLIB 1AB3A 2EZPA 3UQ8A 3AK2A 3JD2A 3OFNG 5JH7A 1KECA 4PA4A 2IH3C 2CE4A 2F93B 4ZHQB 4CH4A 1NTMH 4DR1B 3ETEA 1KC8W 3DC5A 5LHIA 2ODMA 2HVJC 1N33O 4JYAB 4JTDB 2DJVA 4QPJA 2E74B 2P06A 5IWAB 4LF7O 4GX5A 2EX3A 1NH2B 4OPAA 3DXRB 1BSMA 4MVRA 5B1AC 2YXYA 5BY1A 1KP3A 1Y74B 4X65B 5KX5A 1IDSA 3TXSA 3HKDB 4H37A 3CMAV 3F5TA 4PD4F 3RW0A 2Z0AA 4JASA 5K1XA 2YICA 3W7SA 4YIPA 1ZWIC 2BOBC 1N34O 2WWWA 2ZCEA 2KSDA 5KUMA 4DV1B 1VQ5V 1YTFB 4HYOA 2YXHA 3OMNB 1G1XB 2DQ0A 4H33A 2A3QA 1P7GA 5JJJB 5LP6A 1YCIA 4PA6A 2Y69B 2VQEO 1SESA 2IJKA 2QWPB 2OWOA 3N2KA 1HNXB 2BCCH 1JFFA 4XBFA 4I4TA 1LUWA 1QQCA 4DV5B 2HEPA 4PI2A 4YY3B 2Z3YA 5CA0A 1U96A 1XILA 1P49A 3CCRV 5ITZA 1R6NA 4TT3G 4O4JB 3B2EE 1UPGA 3RBZA 2LO1A 2X6AA 1F4MA 1N0NA 4Q6GA 2PTMA 1EN4A 1WA8A 3MAQA 2EIKC 4LF8O 3OT7A 3SJAC 3CS5A 4I0XB 1ZX3A 1SS3A 3CJHA 3JSNA 5LMUB 5LOVA 3A0BZ 3BA8A 4LFAO 1M56C 1X59A 3B77A 1U97A 4LF6B 4MTXA 3CRRA 5LGUA 1QBZA 5KUKA 2YUAA 3SPHA 4JF3A 2B9ZA 1IXBA 3ZRVA 1GN2A 3QO5A 4WBNB 1AI6A 3Q4HB 2P22C 1Z5VA 3ZRWA 2QJ1A 3VQVA 2EULA 3T4DA 4U7OA 5IJ0B 3BRCA 3WU2Z 4X66B 4GLXA 3OEHG 1YXBA 1QHTA 3IC7A 3CCVV 1B3QA 1EM1A 3KCYA 3TGUH 4B3TO 2QWNB 2W6JG 2AXTZ 2HP8A 3K08A 1S76D 4F6RB 3IGAC 1CP9A 4LR3A 3FB5C 4MSWC 1S3JA 1DLBA 2IW5A 1PNKA 3RGBA 3FD9A 3G80A 1N36B 3LDCA 4FLWA 4DUYO 2YS8A 1BQZA 4FJCC 1NR1A 4UCVA 4J80A 5H9CA 1XUQA 1SQGA 1Q7YW 1D5NA 1F23A 1Q3EA 1SETA 4D7SA 4FPPA 2N05A 3K9AA 2XTAA 4JI0O 4JI3O 2DE0X 2F23A 2XAFA 3B40A 1PNMA 4TOIA 2EZOA 1BCCH 2JJ2G 5EIBD 1ENVA 5B1BB 2L6LA 5CBGA 3F7YC 1GAXA 1CPYA 2O57A 5DECA 1A32A 1W2BU 1NVPD 1H2LA 4ZHQA 4I55B 1VQNV 2FL4A 4J7ZA 2ZR2A 1VIBA 4JI4B 2EIKB 4PV1B 2EJ7A 4U3JB 4J10A 3CCQV 1GN3A 4E2LA 4IHJB 4JI5B 3ZHSA 4LFBO 4U7NA 2QKCA 2B1GA 1AP5A 3QG5A 2PZSA 1IZ3A 4P2ZA 3R66A 4UV8A 4MW3A 5F2VO 3EHBB 1M56B 3JD1A 1Y74A 4R50A 4UUJC 4NXNB 2Q68A 5FLXN 4RUFA 1L0LH 2K9PA 2UUAB 4MTOA 2E3CA 3FX7A 3BEHA 4RQFA 5CN0A 4DV7O 4W4LA 3H1JH 5LP6C 4EFEA 3SYQA 1VQPV 5B66Z 3C3SA 5LBQA 1J5EB 4DV6B 1DK1A 5BR8B 1WLEA 4GKJB 3O9OA 2ARHA 1AJPA 3WB0A 3CRMA 3SPGA 1OZ0A 1E1QG 4WFEA 2PYJA 3H1KH 2XT9A 1BZKA 3PJSK 4P9PA 2GUZB 1GO3F 4CH6A 4MVUA 3E8HA 4BR6A 1G4YB 5B1OA 3A0HZ 3OW2U 3K0GA 2X6CA 3T1HB 3TJTA 2CDYA 4TQFA 4G28B 1Q90D 3LSSA 4O4JA 2AW9A 4DRXB 4DR6O 2Y0PA 5J9PC 4DUZO 1IBLB
chains in the Genus database with same CATH topology
2QE7G 3FYEB 2A0LA 1K7DA 3UKMA 1K34A 3A0RA 1R73A 3VOUA 1WPXA 1YI2V 5FL7G 1NKDA 1Q81W 1YTFD 3OAAG 2Q6AA 1K4DC 3ZCCA 1H8HG 3D3IA 4UVBA 5H6QA 2QKSA 4J9ZB 1K4CC 3CCUV 2JIZG 1AJQA 3QO7A 3CC4V 1E79G 3D36A 1VQKV 4BIZA 1GMGA 3CD6V 4RUEA 3ETGA 1R3JC 3I55V 3OE7G 3K3WA 3AG3C 2XAJA 3AG3B 1SZTA 3B8NA 2EBOA 1FXKA 2WLHA 4PA9A 4WFGA 1YHQV 2OCCC 4J9YB 1XL6A 5GW7A 4YXWG 3K0DA 1K8AW 2HJFC 5E1AC 1FXVA 5B3SC 5B3SB 4QE7A 4PDRA 3RVZA 5B1NA 3LDDA 3ABLC 1JVMA 3ABLB 3P32A 3OUFA 3SPCA 4QNHB 1QVGU 3T4ZA 3EFFK 3CCLV 2ZDIA 1AR1B 3OR7C 1K92A 3H01A 3ABTA 1AI4A 2Q69A 4R8CA 4N23A 4P9OA 1K73W 1HWYA 2ZXWC 5LHGA 2ZXWB 1M9NA 4KUMA 1GKFA 2QTOA 3FB6C 2KB1A 3OUSA 2DYSC 1KKDA 2DYSB 4GX0A 4MTGA 5EK0A 2LFSA 3E83A 1P4RA 2JEXA 1MABG 2EJRA 2IH1C 4ZKIA 5L3BA 3KG2A 3E8GA 5CMUA 3F5WC 4MVOA 1BHBA 1OCCC 5LGTA 1OCCB 4R7CA 1OCOC 1PL0A 1THZA 3ASNC 1FXHA 1PD3A 4MW8A 5KA6A 2JK5C 4FMTA 4LC1A 4PDVA 4X88A 4JPRA 3JYCA 1MSWD 1NJIW 4TSFG 2WLLA 3ZN0A 2Y48A 2UXNA 4LCUC 1V55C 2M7WA 1OHHG 2EILC 3E8BA 4G2KA 4GCZA 2AHZA 3T1CA 1RPRA 3AG4C 1H8EG 1K3EA 1QLEC 2NNUA 4MTFA 3G6EV 3ETDA 2NLJC 1XL4A 4RQEA 2WLIB 3JD4A 1YJWV 3ABKC 2EZPA 2V1DA 2LP7A 3W7TA 5IYCO 3E89A 1PKXA 2DWEC 4JYBA 3FYIB 3JD2A 4L87A 4PDMA 4RO2A 3OFNG 1KECA 2D3OW 5DN6G 1M57C 4PA4A 3ZRSA 1M57B 2IH3C 3ZRXA 1QLNA 2YSUB 5DM6V 2CK3G 4UXNA 1R3IC 3ETEA 1KC8W 5LHIA 4MS2A 3WFVA 2HVJC 2ATKC 1EBOA 4JTDB 2EIMC 4QPJA 1JOYA 5HFMA 1F51A 3ZJZA 2HFEC 3HB3B 2GHYA 2F43G 3P30A 4GX5A 1NH2B 4WFFA 4UVCA 3OGCC 2MK3A 3CP1A 4MVRA 1K5SA 5B1AC 5B1AB 2ZR3A 2GSMB 1KP3A 2HVKC 3CC7V 2DYRC 2WLNA 3CYOA 1YSCA 4X8AA 4H37A 3MHHC 3CMAV 3IFXA 2XNDG 4UVAA 2YEVA 1P7BA 3RW0A 3UM7A 4JASA 1OCRC 2K1EA 3TCUA 3W7SA 1GK9A 1RPOA 1ZWIC 2BOBC 1JQ0A 1YIJV 1YITV 2IJHA 1R3LC 2WWWA 5KUMA 1V54C 1VQ5V 2EINC 4G27B 2OCCB 5EC1C 1YTFB 3ZRWB 2ZD9A 4HAMA 4HYOA 3SYAA 3OMNB 3W7WA 4XDJA 3K79A 4WCEV 2DQ0A 4EKWA 4H33A 2XASA 2WLMA 4FIPC 3ZMTA 3STZC 2QEXV 2P90A 4PA6A 3CC2V 4PELA 2Y69C 2Y69B 3ASOC 1SESA 2IJKA 3TK1A 2WLIA 3JD0A 4PA7A 2FTKA 1M90W 2IJIA 1NBMG 3CCMV 4DXWA 2IU3A 1G8MA 2DWDC 1NQTA 2V7QG 4XBFA 2Z3YA 4XDKA 1DF4A 4JYCA 5EBLC 4PA3A 3CCRV 4Q20A 1EFRG 3OMAB 3TETA 3SPIA 1R6NA 1NVPB 1M1KW 4BAYA 4TT3G 3RBZA 4X89A 1H2GA 2X6AA 1KP2A 1F4MA 2DQ3A 2OT5A 1B6QA 1OCOB 2PI4A 2EIKC 2WLJA 3ASNB 1K9MW 2OTJV 4KP4A 2ZQMA 1OCZC 1R3KC 1DTOA 1OCZB 5L3FA 3CPWU 3CCJV 3E86A 3JD3A 2IU0A 5EC2C 5LHHA 2HLDG 1V55B 4ZBMA 2EILB 5CA3A 3ZIAG 1AI7A 2JDIG 5EBMC 1NR7A 3AG4B 1BMFG 3FB8C 1M56C 1L1FA 1QLEB 4CZZA 1FXKC 1FXKB 3B77A 3ABKB 4MTXA 1QCEA 5CBFA 2Z5UA 5LGUA 1QBZA 4I5SA 1UJWB 5KUKA 1S0VA 2P67A 2UXXA 4JGSA 4WFHA 3X2QC 3SPHA 4JF3A 5IYDO 2OTLV 1GM8A 1GTOA 3ZRVA 3QO5A 3FB7C 2A9HA 2WPDG 1YJNV 1QVFU 3SJQC 4WF9V 2XOKG 1AI6A 5L3GA 4GX1A 3OEEG 2ITDC 2ZDIC 3ZRWA 3ABUA 1JCHA 4MVZA 3AG2C 3T4DA 4U7OA 5BZBA 2QM8A 3BY6A 3DGEA 2X0LA 2EIMB 1S77D 4QE9A 3OEHG 1EZJA 1VQ8V 3G4SV 4PDLA 4JAUA 3IC7A 4Z1MG 2BOCC 3CCVV 3ABMC 1E1RG 1F4NA 3ABMB 3CMEV 1Q82W 5HFLA 2W6JG 2XAHA 1VQOV 2QM7A 3NXSA 3K08A 1S76D 2LFRA 3IGAC 2R9RB 1RM1C 1CP9A 3FB5C 4GT1A 3FKSG 2DYRB 4MSWC 1S3JA 3GWOA 1DLBA 3OM3B 1K33A 2WLLB 2IW5A 1PNKA 3CXCU 4HZ3A 2W6IG 4MVQA 3ML0A 3WG7C 3LDCA 2HKOA 1S5HC 2H8PC 5IYBO 4FJCC 1NR1A 1OCRB 5H9CA 1Y66A 3G71V 1V54B 2EINB 5L3EA 1Q7YW 3W7XA 4LBEC 1F23A 2IJJA 5H6RA 1SETA 1QR8A 1VQ9V 4R6ZA 3CCSV 2JJ1G 5IY5C 2QA4V 4FPPA 5IY5B 3K9AA 3LDEA 3AG1C 3AG1B 4QJFB 2X6BA 3E8FA 3DTUB 1H38A 4BIUA 4JTCB 3R65A 3K04A 5KA5A 1Q86W 5IDJA 2XAFA 1PNMA 4DO2A 4QIWF 3ASOB 2EZOA 1JJ2U 3ZMZA 1FS0G 4GX2A 3I56V 3OMIB 2JJ2G 5B1BC 1ENVA 5B1BB 5CBGA 3F7YC 1ORQC 1CPYA 2WAMA 4OXSA 3CCEV 1BL8A 1QR9A 1AROP 4TWKA 3LNMB 1W2BU 4WFAV 3SPJA 2HG5C 4UV9A 3SYCA 1NVPD 1SRYA 1BHAA 1VQNV 1LNQA 3LUTB 3STLC 2ZR2A 2DW4A 2XAQA 1R6KA 3SYPA 3VBBA 1PNLA 4P30A 2EIKB 3CCQV 2PI5A 3ZN1A 3ZMSA 1N8RW 1ROPA 4N21A 5C93A 4E2LA 1GM7A 4CBCA 2C2AA 2B5UA 1IXMA 4U7NA 2B1IA 2ITCC 3MD0A 2B1GA 1J95A 2YEVB 3E35A 3ZMUA 4JTAB 1VQMV 4P2ZA 1YJ9V 4UV8A 2P7TC 4FK5C 4MW3A 3EHBB 1M56B 3JD1A 3LSQA 4R50A 4UUJC 2Q68A 1I5YA 4MVMA 2XAGA 4RUFA 4I9WA 1KQSU 2JEUA 1JPXA 2WLKA 1MOFA 2R9IA 4RAIA 4MTOA 3BEHA 4RQFA 1AI5A 3MHSC 5CN0A 4JAVA 3X2QB 4KFMA 3JCZA 5L3DA 1VQ7V 1I5XA 3SYQA 4MT8A 1K5QA 3K06A 1VQPV 1SERA 2A79B 2AHYA 5LBQA 1CEZA 1WLEA 3HPLC 3K03A 3GB7C 3RVYA 3AG2B 1AJPA 1TUEB 3SPGA 2Q67A 2X7RB 4F4LA 1W0KG 1OZ0A 1E1QG 2EIJC 4WFEA 2EIJB 1COWG 4LP8A 1AJNA 2HR3A 2H94A 2P6JA 1NH2D 3PJSK 3T2MA 3AEIA 4WFBV 4P9PA 5LGNA 3E2EA 4QPKA 1KD1W 3SYOA 1GO3F 5EBWC 4MVUA 1RM1B 4BW5A 1VQ4V 3E8HA 3M99B 1G4YB 3OR6C 1DF5A 5B1OA 5CBHA 3OW2U 3ZMVA 3K0GA 2X6CA 1W0JG 1GM9A 4ASUG 1S72V 1FFTB 1K97A 3B8MA 4XDLA 3QNEA 4MVSA 1Y4MA 2W0FC 3QO8A 4G28B 3W7UA 3LSSA 3F7VC 3WG7B 1VQLV 5L3CA 1JX9A 2WSSG 1VQ6V 5J9PC 1MG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E86 A;  4GX2 A;  2IH3 C;  5B1B C;  2A0L A;  5EC2 C;  5CBG A;  3F7Y C;  3UKM A;  1ORQ C;  4OXS A;  4ZBM A;  3VOU A;  1BL8 A;  4TWK A;  3LNM B;  2Q6A A;  1R3I C;  1K4D C;  5EBM C;  3SPJ A;  2HG5 C;  3SYC A;  3FB8 C;  1M56 C;  4MS2 A;  2QKS A;  2HVJ C;  1K4C C;  4J9Z B;  2ATK C;  1LNQ A;  3LUT B;  4JTD B;  2EIM C;  3STL C;  4RUE A;  1R3J C;  3ZJZ A;  3SYP A;  2HFE C;  5CBF A;  4P30 A;  3AG3 C;  5KUK A;  3X2Q C;  4WFH A;  4GX5 A;  2WLH A;  4WFF A;  3SPH A;  4PA9 A;  3OGC C;  4WFG A;  3FB7 C;  2OCC C;  4MVR A;  5B1A C;  2A9H A;  4J9Y B;  4CBC A;  3SJQ C;  1XL6 A;  3K0D A;  2HJF C;  2ITC C;  2HVK C;  1J95 A;  5E1A C;  2DYR C;  2WLN A;  5B3S C;  4GX1 A;  4JTA B;  2ITD C;  4X8A A;  4QE7 A;  4P2Z A;  4PDR A;  2P7T C;  3RVZ A;  4H37 A;  4MW3 A;  4MVZ A;  3AG2 C;  3LDD A;  4R50 A;  3IFX A;  3ABL C;  1JVM A;  4UUJ C;  2Q68 A;  2YEV A;  3T4D A;  3OUF A;  4MVM A;  5BZB A;  4RUF A;  1P7B A;  4I9W A;  4QE9 A;  3SPC A;  3RW0 A;  4QNH B;  3T4Z A;  3UM7 A;  2WLK A;  3EFF K;  4PDL A;  3OR7 C;  4RAI A;  4MTO A;  1OCR C;  2K1E A;  2Q69 A;  4R8C A;  3ZRS A;  3TCU A;  3BEH A;  2BOC C;  4P9O A;  1ZWI C;  2BOB C;  3ABM C;  2ZXW C;  4KFM A;  1R3L C;  5KUM A;  1V54 C;  2QTO A;  2EIN C;  3FB6 C;  2KB1 A;  3OUS A;  2DYS C;  4G27 B;  1KKD A;  3K08 A;  5EC1 C;  3SYQ A;  3IGA C;  2R9R B;  2ZD9 A;  4GX0 A;  4HYO A;  4MTG A;  3K06 A;  3E83 A;  5EK0 A;  4XDJ A;  3FB5 C;  3SYA A;  2A79 B;  2AHY A;  2IH1 C;  4MSW C;  4EKW A;  3KG2 A;  3E8G A;  4H33 A;  3F5W C;  4MVO A;  1OCC C;  2WLM A;  4R7C A;  3HPL C;  3K03 A;  2WLL B;  3STZ C;  3GB7 C;  3RVY A;  1OCO C;  3ASN C;  4MW8 A;  4PA6 A;  2Y69 C;  2JK5 C;  4HZ3 A;  4MVQ A;  2Q67 A;  3ASO C;  3LDC A;  4PDV A;  4X88 A;  3SPG A;  3WG7 C;  1S5H C;  3JYC A;  2WLI A;  4F4L A;  2EIJ C;  2H8P C;  4WFE A;  4LP8 A;  4PA7 A;  2WLL A;  4DXW A;  2DWD C;  4LCU C;  3PJS K;  1V55 C;  3T2M A;  2EIL C;  4P9P A;  3E8B A;  4XDK A;  3SYO A;  4LBE C;  5EBL C;  4PA3 A;  5EBW C;  2AHZ A;  4MVU A;  4BW5 A;  3E8H A;  3T1C A;  3TET A;  1G4Y B;  3AG4 C;  3OR6 C;  3SPI A;  5CBH A;  1QLE C;  4MTF A;  4R6Z A;  5IY5 C;  2NLJ C;  3K0G A;  1XL4 A;  2X6C A;  3RBZ A;  2WLI B;  3LDE A;  4X89 A;  3AG1 C;  4XDL A;  2X6A A;  4MVS A;  3ABK C;  2X6B A;  3E8F A;  2W0F C;  4G28 B;  4JTC B;  3R65 A;  3K04 A;  2EIK C;  2WLJ A;  3E89 A;  2DWE C;  3F7V C;  4PDM A;  4RO2 A;  1OCZ C;  1R3K C;  5J9P C;  1M57 C;  4PA4 A; 
#chains in the Genus database with same CATH topology
 4CS4 A;  1K34 A;  4I0X A;  1YI2 V;  2Q6A A;  1NI8 A;  1MSD A;  4UVB A;  4DR2 B;  1I0H A;  2QKS A;  3CCU V;  2JIZ G;  4IYI A;  1VQK V;  2PF4 E;  2XAJ A;  3AG3 B;  2BTQ B;  1SZT A;  4OX9 O;  1YHQ V;  3KZI Z;  4J9Y B;  4LF9 O;  1XL6 A;  2HJF C;  1FXV A;  2ZKO A;  4WBN A;  4CH5 A;  3Q4H A;  3CCL V;  2ZDI A;  4FLU A;  1K92 A;  1AI4 A;  4P9O A;  4ZOL A;  5IJ0 A;  5KX5 B;  1M9N A;  3C3T A;  1GKF A;  3OUS A;  2DYS C;  5BXZ A;  1KKD A;  2FB5 A;  4GX0 A;  4UCS A;  4JI7 O;  1P4R A;  2GTS A;  3JAT A;  3RYH B;  1XNQ O;  1XI1 A;  1OCO C;  1FXH A;  5KA6 A;  4K35 A;  5H5N A;  5KLV H;  1MSW D;  4TSF G;  1WP7 A;  3L71 H;  1OHH G;  2ILM A;  3E8B A;  3D36 C;  3I5D A;  3ZHV A;  4GCZ A;  1RPR A;  4MTF A;  1N33 B;  1XL4 A;  4X64 O;  3JD4 A;  3ABK C;  1Z2G A;  3N2K B;  1Y6X A;  4X1Y B;  3U10 A;  3E89 A;  1PKX A;  2DWE C;  4JYB A;  3FYI B;  4LF7 B;  4PDM A;  3ZED A;  1MZE A;  2GDS A;  2UUC O;  1SZX A;  5DN6 G;  3ZRS A;  1M57 B;  1US6 A;  2QR4 A;  4K0K O;  4DR4 O;  5DM6 V;  2YID A;  3EVK A;  1P84 F;  5AG2 A;  1R3I C;  5KHJ A;  4I7Z B;  3VQX A;  2RQ6 A;  3WFV A;  5J2U B;  1EBO A;  1JOY A;  4IYH A;  5KHI A;  3THO A;  5HFM A;  2HFE C;  3HB3 B;  3CXH F;  3M7M X;  3P30 A;  1N34 B;  4I55 A;  3VQY A;  4UVC A;  4J11 A;  2MK3 A;  3CP1 A;  4O2B B;  4AQY O;  4B08 A;  2ZR3 A;  2GSM B;  2UU9 O;  4U3J A;  2HVK C;  4JV5 O;  5EYP B;  4TV9 B;  2DYR C;  3B4S A;  4IHJ A;  1YSC A;  4X8A A;  1W59 A;  3IFX A;  3QF7 A;  2VQE B;  2E75 B;  4H44 B;  1SA0 A;  5LMN O;  3TCU A;  4AI8 A;  5H2F Z;  2VRZ A;  1QU7 A;  1YIT V;  4F6E A;  1R3L C;  2EIN C;  1WB7 A;  4G27 B;  3ZRW B;  2ZD9 A;  4HAM A;  4WCE V;  4UB8 Z;  3UCS C;  5IJ9 B;  1XMQ O;  2XAS A;  2WLM A;  4FIP C;  3ZMT A;  1XOU A;  4LF8 B;  3RYI B;  2P90 A;  4FZ0 A;  2Y69 C;  3TK1 A;  4ZI7 B;  2FTK A;  2IJI A;  3CCM V;  4DXW A;  1WJZ A;  2DWD C;  2V7Q G;  4Z1V A;  5EBL C;  4DW1 A;  4Q20 A;  5JVD B;  3ZHU A;  4LFA B;  3SPI A;  3BCC H;  1CXZ B;  4DV2 O;  1ZL8 B;  1H2G A;  2HJD A;  2DQ3 A;  2FYU H;  1OCO B;  2PI4 A;  4NYK A;  2V4D A;  4KP4 A;  2ZQM A;  4X20 B;  4DK1 A;  5KHH A;  4CS3 A;  2P4K A;  4ZBM A;  3ETQ A;  2YIB D;  1YF2 A;  2QSA A;  2YI9 A;  5DED A;  1NR7 A;  1KB9 F;  3QTC A;  4CZZ A;  5LA6 B;  1FXK B;  4LWS B;  3ABK B;  1QCE A;  2Z5U A;  1UJW B;  3K5L A;  4B3T B;  1O9H A;  1Y67 A;  4WFH A;  3SJB C;  1SKV A;  2VWJ A;  2VQF O;  1I94 O;  5GTH Z;  2A9H A;  1QVF U;  4CC6 A;  1N4C A;  2BTQ A;  4CS2 A;  4WF9 V;  4GX1 A;  3OEE G;  1IBM O;  2ZDI C;  3ABU A;  1MZF A;  2FML A;  3PN1 A;  2QM8 A;  3L75 H;  2X0L A;  4QE9 A;  4DUY B;  4JAA A;  1VQ8 V;  3G4S V;  1IBK O;  3H1H H;  4LF5 O;  1E1R G;  3ABM B;  1Q82 W;  2XAH A;  1VQO V;  2QM7 A;  3CE2 A;  1PP9 H;  1KUQ A;  4TUY B;  4O4I B;  2DOS A;  5KAI Z;  3LSU A;  2DYR B;  4JI0 B;  1RSO A;  1K33 A;  2WLL B;  4JI3 B;  3EXA A;  3WG7 C;  4MVQ A;  3RYH A;  3KCX A;  2ZE5 A;  5BMV B;  2Q73 A;  4ABM A;  2EIN B;  3W7X A;  1NTK H;  4DW0 A;  1VQ9 V;  2F66 C;  4R6Z A;  5IY5 B;  4QJF B;  1H38 A;  4BIU A;  4JTC B;  3TXQ A;  3R65 A;  1YEW A;  3K04 A;  1Q86 W;  4QIW F;  3I56 V;  4GX2 A;  3OMI B;  5B1B C;  4X1Y A;  2GV9 A;  4LFB B;  4FM0 A;  1ORQ C;  2Q0O C;  1KMI Z;  2WAM A;  3CB2 A;  1BL8 A;  1ARO P;  4TWK A;  2ETN A;  3LNM B;  2RDC A;  2Q7H A;  1SRY A;  1NTZ H;  3LUT B;  3STL C;  3K5N A;  5LXT B;  3SYP A;  1TGO A;  1PNL A;  5J2U A;  2PI5 A;  1VF7 A;  1VEW A;  4DV7 B;  5C93 A;  3SJC C;  1NZ6 A;  2E76 B;  4CBC A;  1H2K A;  2A06 H;  2B1I A;  3MD0 A;  2YEV B;  3E35 A;  3ZMU A;  4O2B A;  1RP3 B;  1GRJ A;  4FK5 C;  2CTW A;  3LSQ A;  5EYP A;  4TV9 A;  1R6T A;  2JEU A;  2UXC O;  1OV9 A;  1MOF A;  4RAI A;  4KFM A;  5L3D A;  1PPJ H;  3VQW A;  3CHX A;  4MT8 A;  4GZR B;  1K5Q A;  2A79 B;  2AHY A;  3HPL C;  3K03 A;  3GB7 C;  2JGD B;  3RVY A;  2AZ0 A;  4PHZ A;  4ZOL B;  2Q67 A;  5IJ9 A;  3K59 A;  3S3X A;  4DR6 B;  1IUR A;  5EZY A;  4DUZ B;  2EIJ B;  2Q7G A;  1COW G;  2BE3 A;  4LP8 A;  1FFX B;  1AJN A;  3RYI A;  2JGU A;  2R9A A;  4JI2 O;  3JAT B;  4QPK A;  4ZI7 A;  3SYO A;  4LFC O;  5EBW C;  5GTI Z;  3OR6 C;  4ASU G;  1S72 V;  1FFT B;  4XDL A;  1KKC A;  5JVD A;  5J2T A;  3E22 B;  1KU9 A;  3F7V C;  3WG7 B;  5IYZ B;  1VQL V;  2FKX A;  4OX9 B;  2QWQ B;  5L3C A;  4FLY A;  1ZL8 A;  2XUM A;  1MG1 A;  3FYE B;  4LF9 B;  4X20 A;  1LUV A;  1TUB B;  1HNZ O;  1NKD A;  5IE9 A;  4KHP O;  4X1K B;  1H8H G;  3GVM A;  5H6Q A;  1K4C C;  3QO7 A;  3D36 A;  2F4V O;  4YHH O;  4RUE A;  3RYF B;  3AG3 C;  1UFI A;  2IM9 A;  5LA6 A;  2EBO A;  1FXK A;  2WLH A;  3APQ A;  4RWU A;  4O4L B;  1HNW O;  4LWS A;  1VF6 A;  5K1P A;  1IX9 A;  3IC9 A;  1VMG A;  5GW7 A;  3K0D A;  4JI7 B;  2NN4 A;  5E1A C;  4J7K A;  1SQQ H;  5KHK A;  1XNQ B;  4QE7 A;  3U0Z A;  4B3M O;  5JJE B;  2RN9 A;  1FYJ A;  3SPC A;  4QNH B;  3T4Z A;  1AR1 B;  3H01 A;  2ZIN A;  2Q69 A;  5EIB C;  4N23 A;  1K73 W;  3QVN A;  3MDS A;  4KUM A;  4DV0 O;  1WB8 A;  2DN9 A;  1MNG A;  1Z5W A;  2ZNI A;  5LL6 Y;  4ZKI A;  2IH1 C;  4TV8 A;  4X64 B;  3KG2 A;  1SA0 B;  4MVO A;  1BHB A;  5LGT A;  1OCC B;  4R7C A;  4TUY A;  1PL0 A;  4O4I A;  1QNM A;  4MW8 A;  1GH6 A;  4FMT A;  4DYL A;  2HHH O;  3H9V A;  2UUC B;  1NJI W;  2PGG A;  3NR7 A;  2CH7 A;  2WLL A;  4K0K B;  4DR4 B;  4IGG A;  1V55 C;  2M7W A;  4JI1 O;  3RYC B;  5BMV A;  3WB2 A;  3BAB A;  2AHZ A;  4X1I A;  3G6E V;  1K3E A;  3HR0 A;  3CX5 F;  2F1M A;  5JCO A;  2V1D A;  2LP7 A;  2Y4T A;  5IYC O;  4L87 A;  1XHZ A;  1M57 C;  4AQY B;  3H1L H;  5D5Q A;  3ZRX A;  2UU9 B;  2ADP A;  1QLN A;  4JV5 B;  4JI8 O;  3AK3 A;  4MS2 A;  1GN6 A;  2ATK C;  3RWR D;  2EIM C;  4ZIB A;  5LMN B;  3ZJZ A;  2GHY A;  2F43 G;  1PV0 A;  4WFF A;  3OGC C;  3N2G A;  3OGI B;  4UB6 Z;  5LXT A;  2PUS A;  3CC7 V;  3FAV B;  2ZE6 A;  4YJ3 B;  2WLN A;  1XMQ B;  3M8A A;  2CTP A;  4A5U B;  2QGN A;  3ZHQ A;  1TA8 A;  3MHH C;  2XND G;  3JAM N;  2YEV A;  1P7B A;  2IBZ H;  5LYJ B;  2YIA A;  1NU1 H;  1EN5 A;  2K1E A;  1GK9 A;  5FNV A;  1JQ0 A;  2KG7 B;  4GYC B;  4O4H A;  3K9S A;  2JRI A;  4X62 O;  4XDJ A;  3DC6 A;  3G6B A;  4DV2 B;  4X9Q A;  1AVM A;  2YIB A;  3STZ C;  3N27 A;  2QEX V;  3JAL B;  4PEL A;  3ASO C;  4EFB A;  1MMM A;  2M6Y A;  3JD0 A;  3OTO O;  2JGD A;  1M90 W;  1NBM G;  2UUB O;  2IU3 A;  1G8M A;  2ZM6 O;  1RSO B;  1DF4 A;  4BIO A;  1FFX A;  4PA3 A;  1EFR G;  1NVP B;  3CRA A;  4BAY A;  3JAR B;  4X89 A;  4Z2W A;  1Y76 B;  2OTJ V;  1R3K C;  1DTO A;  1OCZ B;  2VQF B;  4B3R O;  1I94 B;  3CCJ V;  3E86 A;  3JD3 A;  3E22 A;  2HLD G;  3C90 A;  5IYZ A;  1V55 B;  1S5L Z;  4DR5 O;  5CA3 A;  1AI7 A;  2JDI G;  1IBM B;  5EBM C;  5GON B;  4UCO A;  1FXK C;  4EB6 A;  1TUB A;  5JJN B;  2RJZ A;  4X1K A;  1VF6 C;  1IBK B;  4B7K A;  5CBF A;  2P5O A;  3JAW B;  4I5S A;  4LF4 O;  3B09 A;  1SQP H;  4LF5 B;  1S0V A;  3BPZ A;  2P67 A;  4JGS A;  2OTL V;  1GM8 A;  1XQ8 A;  3FB7 C;  1GN4 A;  3RYF A;  4DK0 A;  2ZE7 A;  3SJQ C;  4UCU A;  4O4L A;  5L3G A;  1AR4 A;  2NR5 A;  5BZB A;  3BY6 A;  3DGE A;  2EIM B;  1EZJ A;  4H13 B;  4Z1M G;  2JS3 A;  3ABM C;  1F4N A;  3CWB H;  3ZX6 A;  4NR1 A;  2OIE A;  3NXS A;  3DSQ A;  2LQT A;  4FFK A;  2PYL A;  2R9R B;  1RM1 C;  3JAK A;  4GT1 A;  3FKS G;  3OM3 B;  1L0N H;  2YI8 A;  1D5A A;  2KQX A;  2W6I G;  3ML0 A;  1S5H C;  1B06 A;  5IYB O;  4I9Q A;  1Y66 A;  3G71 V;  4K8X A;  1DGS A;  3HKC B;  4EEQ A;  5L3E A;  4LBE C;  5JCO C;  2IJJ A;  4GUN A;  1QR8 A;  3CCS V;  2JJ1 G;  5IY5 C;  1Q6H A;  2QA4 V;  1IVS A;  3RYC A;  5EZY B;  3AG1 B;  1SQB H;  2X6B A;  3RT3 C;  5KA5 A;  3WB1 A;  4DO2 A;  3ASO B;  1JJ2 U;  3ZMZ A;  1FS0 G;  4U3F H;  1WNS A;  3SR2 C;  5JQG B;  4J42 A;  1QR9 A;  2GTA A;  1KYO F;  4WFA V;  5FPR A;  5J2T B;  2VS0 A;  1BHA A;  3A2F A;  2DW4 A;  4AHC A;  2XAQ A;  2UXC B;  3VBB A;  4P30 A;  4DR7 O;  2QDO A;  3ZN1 A;  1N8R W;  1ROP A;  5FPO A;  1GM7 A;  1SF9 A;  2B5U A;  3CEI A;  4W4K A;  3G67 A;  1VQM V;  2Q0A A;  4JZ2 A;  2P7T C;  3GWK C;  2E5L O;  4DR3 O;  3FAV A;  4YJ3 A;  1XRE A;  2XAG A;  4I9W A;  1FPO A;  1JPX A;  2WLK A;  4K3A A;  4O2A B;  1AI5 A;  3MHS C;  1XDC A;  4JI2 B;  1VQ7 V;  2UXD O;  5LYJ A;  3JCU Z;  4LFC B;  1I5X A;  2R72 A;  3HKB B;  1SER A;  1XNR O;  3ZS8 C;  2KG7 A;  1RFY A;  3AG7 A;  1HW7 A;  4DV4 O;  5A9G A;  1X4T A;  5CB4 A;  4IL6 Z;  1TUE B;  4NXM O;  2X7R B;  4F4L A;  2EIJ C;  3JAS B;  4PI0 A;  3SGI A;  3JAL A;  2P6J A;  1S5J A;  2YC0 A;  4TV8 B;  5LGN A;  3T1Y O;  2QWO B;  1HNZ B;  4KHP B;  3ICX A;  2CGO A;  4HNA A;  1RM1 B;  1H2M A;  4BW5 A;  1ZAU A;  3M99 B;  4B3S O;  5CBH A;  2Q4P A;  1GM9 A;  2F4V B;  1N32 O;  1K97 A;  3B8M A;  4YHH B;  4MVS A;  2CH7 B;  3P3P A;  2W0F C;  1Q43 A;  3W7U A;  3JAR A;  2R70 A;  1M4U A;  4JZG A;  2WSS G;  1HNW B;  2Q5Z A;  2ADQ B;  3J7A U;  1Y76 A;  4X1I B;  3L9D A;  3UKM A;  2QM4 A;  1R73 A;  1AR5 A;  3L74 H;  1M5I A;  5FL7 G;  4NTY A;  3O65 A;  4OPH A;  3ZCC A;  4B3M B;  4I50 B;  1XHX A;  4J9Z B;  3A8T A;  1BS3 A;  1E79 G;  3ETG A;  1R3J C;  5GON A;  3I55 V;  3OE7 G;  2Y0I A;  3K3W A;  1I7F A;  2YXL A;  3B8N A;  2BTO A;  4WFG A;  4DV0 B;  2OCC C;  3JAW A;  3S3W A;  1K8A W;  3LNN A;  2CUG A;  3BVO A;  2KKW A;  2LW1 A;  5B3S B;  2AZ2 A;  1O9G A;  5KMG B;  4PDR A;  1AP6 A;  3RVZ A;  5B1N A;  1XMO O;  3LDD A;  3ABL B;  3P32 A;  3OUF A;  2RCV A;  4GKK O;  3N2G B;  2HHH B;  1QVG U;  3EFF K;  5JWP A;  3APO A;  3OR7 C;  4R8C A;  2UXB O;  1PL4 A;  2ZXW B;  3HKE B;  4JI1 B;  5CA1 A;  2QTO A;  3FB6 C;  2KB1 A;  4JI6 O;  2Q8V A;  5EK0 A;  2LFS A;  3E83 A;  2JEX A;  2Y4U A;  2EJR A;  4J7J A;  1Q6U A;  1TVK A;  3F5W C;  5CMU A;  1OCC C;  2F95 B;  1Q5O A;  1SQV H;  5A2Q N;  1THZ A;  3ASN C;  5FNV B;  1PD3 A;  4O4H B;  4PDV A;  4X88 A;  4JPR A;  4UFZ A;  2PY5 A;  1JJO A;  1B04 A;  3D3Q A;  2RMK B;  3ZN0 A;  2EIL C;  4G2K A;  1VAR A;  4UCR A;  3T1C A;  4JI8 B;  1FJG O;  3AG4 C;  4FVM A;  1QLE C;  2NLJ C;  3HKC A;  4JYY A;  1YZB A;  2BSK B;  1YJW V;  1NT2 B;  2ZNJ A;  5E79 Z;  4DV3 O;  1HR0 O;  3UT5 A;  3UO2 A;  3W7T A;  1F7Y A;  3CSX A;  4LNU A;  4RO2 A;  1LR1 A;  2LJ2 A;  2D3O W;  4J41 A;  4NB5 A;  2ZE8 A;  2YSU B;  2CK3 G;  4UXN A;  4PJ0 Z;  2QTS A;  5JQG A;  1H2N A;  1VP7 A;  1F51 A;  2OIG A;  2CTR A;  1WPB A;  1K5S A;  5B1A B;  4X62 B;  1T5E A;  4EB6 B;  2CTQ A;  3RN4 A;  3CYO A;  4DR1 O;  2OCH A;  5D5P A;  4UVA A;  1G6U A;  4JYA O;  4YIO A;  3UM7 A;  4HBN A;  1OCR C;  3OTO B;  4IT5 A;  5IWA O;  2UUB B;  1RPO A;  1YIJ V;  1ZLZ A;  2IJH A;  2YDE A;  2ZM6 B;  1V54 C;  2W0X A;  2OCC B;  5EC1 C;  3D8C A;  4O2A A;  3K5O A;  3SYA A;  3W7W A;  2QWR B;  3K79 A;  1AIL A;  4X65 O;  4EKW A;  3BA9 A;  1OJH A;  3HKB A;  3CC2 V;  4ICG A;  1YDX A;  2WLI A;  4B3R B;  1SQX H;  4PA7 A;  2D2C B;  4FM2 A;  1EZV H;  3JAK B;  4BWA A;  1NQT A;  5B5E Z;  4DR5 B;  5IT9 N;  4BW9 A;  4DV1 O;  1PM9 A;  3JAS A;  4XDK A;  4JYC A;  3OMA B;  3TET A;  1M1K W;  1V9P A;  1KBH A;  1KP2 A;  3UO3 A;  2OT5 A;  1B6Q A;  2LGQ A;  2WLJ A;  3ASN B;  1K9M W;  4LF4 B;  1ZTE A;  3ZHT A;  2WA3 A;  1BGY H;  1OCZ C;  5L3F A;  3CPW U;  1HNX O;  4LH6 A;  2IU0 A;  5EC2 C;  5LHH A;  3ZHR A;  2A7W A;  4DV5 O;  1TAE A;  2EIL B;  3ZIA G;  4YY3 O;  3DXR A;  2GBO A;  1URF A;  3AG4 B;  1BMF G;  3FB8 C;  1L1F A;  1QLE B;  1NS1 A;  4IIJ B;  2ZIO A;  3HKD A;  4I50 A;  1VF5 B;  2N74 A;  2UXX A;  3X2Q C;  4CC5 A;  5IYD O;  1GTO A;  3K5M A;  2VWK A;  2WPD G;  1YJN V;  5LMU O;  3RFR A;  2WA4 A;  3SDL A;  2XOK G;  2QKA A;  3K58 A;  3H1I H;  2ITD C;  1JCH A;  5KHG A;  4MVZ A;  3AG2 C;  2G38 A;  1XEQ A;  1S77 D;  5KMG A;  4LF6 O;  2ZIM A;  4PDL A;  4JAU A;  2CGN A;  2BOC C;  3CME V;  3CRQ A;  5HFL A;  3BAA A;  2RNB A;  1FAF A;  2LFR A;  3L73 H;  3HKE A;  1EN6 A;  3GWO A;  3CXC U;  2H3O A;  3AK1 A;  4HZ3 A;  2HKO A;  4X66 O;  2H8P C;  1OCR B;  4YJ2 B;  5KAF Z;  3FFQ A;  1N0J A;  5C8Y B;  1V54 B;  4FFB B;  2Q7E A;  2XHB A;  5CB4 B;  5H6R A;  1L8D A;  4H0L B;  5JH7 B;  3LDE A;  3AG1 C;  2LGW A;  3KKY A;  3E8F A;  3DTU B;  4DR7 B;  1JA8 A;  5IDJ A;  1N36 O;  3JSL A;  1SQF A;  3IJ4 A;  3J81 N;  4D7T A;  2BSK A;  4HNA B;  2L35 A;  3ZBH A;  1SC5 B;  4OXS A;  3CCE V;  1WP8 A;  3SPJ A;  2HG5 C;  4UV9 A;  2E5L B;  3SYC A;  4DR3 B;  1LNQ A;  1R6K A;  1YVW A;  4B7E A;  3J80 N;  3P3N A;  1WN7 A;  1ZSP A;  4NTW A;  1Q6I A;  2DMX A;  3ZMS A;  4N21 A;  2Q9L A;  2UXD B;  3OD4 A;  2C2A A;  1XNR B;  1IXM A;  2ITC C;  4E4E A;  1J95 A;  4JTA B;  1JMK C;  4DV4 B;  1YJ9 V;  4F6R A;  2N04 A;  4NXM B;  1ZUQ A;  1BE3 H;  1I5Y A;  4MVM A;  1KQS U;  4FZ1 A;  4JI4 O;  2R9I A;  4C7U A;  2LW7 A;  4JAV A;  3X2Q B;  3JCZ A;  2AGA A;  4FLX A;  3T1Y B;  4JI5 O;  5LP6 B;  4NVP A;  1XBL A;  4KXR A;  3K06 A;  4B3S B;  4OGQ B;  1FD9 A;  4UCT A;  1CEZ A;  1N32 B;  3OTF A;  3AG2 B;  4NXN O;  1JFF B;  4I4T B;  3L72 H;  5CA1 B;  1W0K G;  1BT8 A;  5CA0 B;  2UUA O;  4NKG B;  2HR3 A;  5ITZ B;  4FM1 A;  1JR9 A;  2H94 A;  1NH2 D;  4LH7 A;  3T2M A;  3AEI A;  4WFB V;  4AIL C;  1TVK B;  3E2E A;  1KD1 W;  3K57 A;  2OYQ A;  1VQ4 V;  1WA8 B;  1DF5 A;  1D2D A;  1FKA O;  3BFR A;  1J5E O;  4DV6 O;  5TIS Z;  3ZMV A;  1W0J G;  3IAY A;  5BR8 O;  1R1B A;  3QNE A;  4GKJ O;  1Y4M A;  3QO8 A;  4TQD A;  3CJH B;  1JX9 A;  5LOV B;  1VQ6 V;  1BQ0 A;  3CRC A;  2QE7 G;  2A0L A;  1HDJ A;  1K7D A;  3A0R A;  3VOU A;  1WPX A;  1Q81 W;  1YTF D;  3OAA G;  1K4D C;  3L70 H;  3UT5 B;  3D3I A;  1XMO B;  4NTX A;  4LNU B;  1H2S B;  1AJQ A;  4GKK B;  3CC4 V;  4BIZ A;  1GMG A;  3T1H O;  3CD6 V;  4FLT A;  4K8Z A;  2UXB B;  4IIJ A;  4PA9 A;  4FLZ A;  1MA1 A;  1IBL O;  4JI6 B;  2CAZ C;  4YXW G;  5B3S C;  3ABL C;  1JVM A;  4DR2 O;  2ZT9 B;  3ABT A;  1Q8I A;  2P4V A;  1HWY A;  2ZXW C;  5LHG A;  2MW2 B;  2DYS B;  4MTG A;  1FJG B;  1MAB G;  5L3B A;  4CH3 A;  3E8G A;  4KL1 A;  4QGP A;  2GUZ A;  1HR0 B;  4DV3 B;  1HP8 A;  2JK5 C;  4LC1 A;  3JYC A;  1I08 A;  3BHP A;  2Y48 A;  2UXN A;  2JS5 A;  4LCU C;  3U11 A;  4DRX A;  1WAZ A;  2JVD A;  4L8J A;  4YJ2 A;  4FLV A;  1H8E G;  2NNU A;  3ETD A;  1M93 A;  5C8Y A;  4RQE A;  4FFB A;  4D6T H;  2WLI B;  1AB3 A;  2EZP A;  3UQ8 A;  3AK2 A;  3JD2 A;  3OFN G;  5JH7 A;  1KEC A;  4PA4 A;  2IH3 C;  2CE4 A;  2F93 B;  4ZHQ B;  4CH4 A;  1NTM H;  4DR1 B;  3ETE A;  1KC8 W;  3DC5 A;  5LHI A;  2ODM A;  2HVJ C;  1N33 O;  4JYA B;  4JTD B;  2DJV A;  4QPJ A;  2E74 B;  2P06 A;  5IWA B;  4LF7 O;  4GX5 A;  2EX3 A;  1NH2 B;  4OPA A;  3DXR B;  1BSM A;  4MVR A;  5B1A C;  2YXY A;  5BY1 A;  1KP3 A;  1Y74 B;  4X65 B;  5KX5 A;  1IDS A;  3TXS A;  3HKD B;  4H37 A;  3CMA V;  3F5T A;  4PD4 F;  3RW0 A;  2Z0A A;  4JAS A;  5K1X A;  2YIC A;  3W7S A;  4YIP A;  1ZWI C;  2BOB C;  1N34 O;  2WWW A;  2ZCE A;  2KSD A;  5KUM A;  4DV1 B;  1VQ5 V;  1YTF B;  4HYO A;  2YXH A;  3OMN B;  1G1X B;  2DQ0 A;  4H33 A;  2A3Q A;  1P7G A;  5JJJ B;  5LP6 A;  1YCI A;  4PA6 A;  2Y69 B;  2VQE O;  1SES A;  2IJK A;  2QWP B;  2OWO A;  3N2K A;  1HNX B;  2BCC H;  1JFF A;  4XBF A;  4I4T A;  1LUW A;  1QQC A;  4DV5 B;  2HEP A;  4PI2 A;  4YY3 B;  2Z3Y A;  5CA0 A;  1U96 A;  1XIL A;  1P49 A;  3CCR V;  5ITZ A;  1R6N A;  4TT3 G;  4O4J B;  3B2E E;  1UPG A;  3RBZ A;  2LO1 A;  2X6A A;  1F4M A;  1N0N A;  4Q6G A;  2PTM A;  1EN4 A;  1WA8 A;  3MAQ A;  2EIK C;  4LF8 O;  3OT7 A;  3SJA C;  3CS5 A;  4I0X B;  1ZX3 A;  1SS3 A;  3CJH A;  3JSN A;  5LMU B;  5LOV A;  3A0B Z;  3BA8 A;  4LFA O;  1M56 C;  1X59 A;  3B77 A;  1U97 A;  4LF6 B;  4MTX A;  3CRR A;  5LGU A;  1QBZ A;  5KUK A;  2YUA A;  3SPH A;  4JF3 A;  2B9Z A;  1IXB A;  3ZRV A;  1GN2 A;  3QO5 A;  4WBN B;  1AI6 A;  3Q4H B;  2P22 C;  1Z5V A;  3ZRW A;  2QJ1 A;  3VQV A;  2EUL A;  3T4D A;  4U7O A;  5IJ0 B;  3BRC A;  3WU2 Z;  4X66 B;  4GLX A;  3OEH G;  1YXB A;  1QHT A;  3IC7 A;  3CCV V;  1B3Q A;  1EM1 A;  3KCY A;  3TGU H;  4B3T O;  2QWN B;  2W6J G;  2AXT Z;  2HP8 A;  3K08 A;  1S76 D;  4F6R B;  3IGA C;  1CP9 A;  4LR3 A;  3FB5 C;  4MSW C;  1S3J A;  1DLB A;  2IW5 A;  1PNK A;  3RGB A;  3FD9 A;  3G80 A;  1N36 B;  3LDC A;  4FLW A;  4DUY O;  2YS8 A;  1BQZ A;  4FJC C;  1NR1 A;  4UCV A;  4J80 A;  5H9C A;  1XUQ A;  1SQG A;  1Q7Y W;  1D5N A;  1F23 A;  1Q3E A;  1SET A;  4D7S A;  4FPP A;  2N05 A;  3K9A A;  2XTA A;  4JI0 O;  4JI3 O;  2DE0 X;  2F23 A;  2XAF A;  3B40 A;  1PNM A;  4TOI A;  2EZO A;  1BCC H;  2JJ2 G;  5EIB D;  1ENV A;  5B1B B;  2L6L A;  5CBG A;  3F7Y C;  1GAX A;  1CPY A;  2O57 A;  5DEC A;  1A32 A;  1W2B U;  1NVP D;  1H2L A;  4ZHQ A;  4I55 B;  1VQN V;  2FL4 A;  4J7Z A;  2ZR2 A;  1VIB A;  4JI4 B;  2EIK B;  4PV1 B;  2EJ7 A;  4U3J B;  4J10 A;  3CCQ V;  1GN3 A;  4E2L A;  4IHJ B;  4JI5 B;  3ZHS A;  4LFB O;  4U7N A;  2QKC A;  2B1G A;  1AP5 A;  3QG5 A;  2PZS A;  1IZ3 A;  4P2Z A;  3R66 A;  4UV8 A;  4MW3 A;  5F2V O;  3EHB B;  1M56 B;  3JD1 A;  1Y74 A;  4R50 A;  4UUJ C;  4NXN B;  2Q68 A;  5FLX N;  4RUF A;  1L0L H;  2K9P A;  2UUA B;  4MTO A;  2E3C A;  3FX7 A;  3BEH A;  4RQF A;  5CN0 A;  4DV7 O;  4W4L A;  3H1J H;  5LP6 C;  4EFE A;  3SYQ A;  1VQP V;  5B66 Z;  3C3S A;  5LBQ A;  1J5E B;  4DV6 B;  1DK1 A;  5BR8 B;  1WLE A;  4GKJ B;  3O9O A;  2ARH A;  1AJP A;  3WB0 A;  3CRM A;  3SPG A;  1OZ0 A;  1E1Q G;  4WFE A;  2PYJ A;  3H1K H;  2XT9 A;  1BZK A;  3PJS K;  4P9P A;  2GUZ B;  1GO3 F;  4CH6 A;  4MVU A;  3E8H A;  4BR6 A;  1G4Y B;  5B1O A;  3A0H Z;  3OW2 U;  3K0G A;  2X6C A;  3T1H B;  3TJT A;  2CDY A;  4TQF A;  4G28 B;  1Q90 D;  3LSS A;  4O4J A;  2AW9 A;  4DRX B;  4DR6 O;  2Y0P A;  5J9P C;  4DUZ O;  1IBL B; 
#chains in the Genus database with same CATH homology
 2QE7 G;  3FYE B;  2A0L A;  1K7D A;  3UKM A;  1K34 A;  3A0R A;  1R73 A;  3VOU A;  1WPX A;  1YI2 V;  5FL7 G;  1NKD A;  1Q81 W;  1YTF D;  3OAA G;  2Q6A A;  1K4D C;  3ZCC A;  1H8H G;  3D3I A;  4UVB A;  5H6Q A;  2QKS A;  4J9Z B;  1K4C C;  3CCU V;  2JIZ G;  1AJQ A;  3QO7 A;  3CC4 V;  1E79 G;  3D36 A;  1VQK V;  4BIZ A;  1GMG A;  3CD6 V;  4RUE A;  3ETG A;  1R3J C;  3I55 V;  3OE7 G;  3K3W A;  3AG3 C;  2XAJ A;  3AG3 B;  1SZT A;  3B8N A;  2EBO A;  1FXK A;  2WLH A;  4PA9 A;  4WFG A;  1YHQ V;  2OCC C;  4J9Y B;  1XL6 A;  5GW7 A;  4YXW G;  3K0D A;  1K8A W;  2HJF C;  5E1A C;  1FXV A;  5B3S C;  5B3S B;  4QE7 A;  4PDR A;  3RVZ A;  5B1N A;  3LDD A;  3ABL C;  1JVM A;  3ABL B;  3P32 A;  3OUF A;  3SPC A;  4QNH B;  1QVG U;  3T4Z A;  3EFF K;  3CCL V;  2ZDI A;  1AR1 B;  3OR7 C;  1K92 A;  3H01 A;  3ABT A;  1AI4 A;  2Q69 A;  4R8C A;  4N23 A;  4P9O A;  1K73 W;  1HWY A;  2ZXW C;  5LHG A;  2ZXW B;  1M9N A;  4KUM A;  1GKF A;  2QTO A;  3FB6 C;  2KB1 A;  3OUS A;  2DYS C;  1KKD A;  2DYS B;  4GX0 A;  4MTG A;  5EK0 A;  2LFS A;  3E83 A;  1P4R A;  2JEX A;  1MAB G;  2EJR A;  2IH1 C;  4ZKI A;  5L3B A;  3KG2 A;  3E8G A;  5CMU A;  3F5W C;  4MVO A;  1BHB A;  1OCC C;  5LGT A;  1OCC B;  4R7C A;  1OCO C;  1PL0 A;  1THZ A;  3ASN C;  1FXH A;  1PD3 A;  4MW8 A;  5KA6 A;  2JK5 C;  4FMT A;  4LC1 A;  4PDV A;  4X88 A;  4JPR A;  3JYC A;  1MSW D;  1NJI W;  4TSF G;  2WLL A;  3ZN0 A;  2Y48 A;  2UXN A;  4LCU C;  1V55 C;  2M7W A;  1OHH G;  2EIL C;  3E8B A;  4G2K A;  4GCZ A;  2AHZ A;  3T1C A;  1RPR A;  3AG4 C;  1H8E G;  1K3E A;  1QLE C;  2NNU A;  4MTF A;  3G6E V;  3ETD A;  2NLJ C;  1XL4 A;  4RQE A;  2WLI B;  3JD4 A;  1YJW V;  3ABK C;  2EZP A;  2V1D A;  2LP7 A;  3W7T A;  5IYC O;  3E89 A;  1PKX A;  2DWE C;  4JYB A;  3FYI B;  3JD2 A;  4L87 A;  4PDM A;  4RO2 A;  3OFN G;  1KEC A;  2D3O W;  5DN6 G;  1M57 C;  4PA4 A;  3ZRS A;  1M57 B;  2IH3 C;  3ZRX A;  1QLN A;  2YSU B;  5DM6 V;  2CK3 G;  4UXN A;  1R3I C;  3ETE A;  1KC8 W;  5LHI A;  4MS2 A;  3WFV A;  2HVJ C;  2ATK C;  1EBO A;  4JTD B;  2EIM C;  4QPJ A;  1JOY A;  5HFM A;  1F51 A;  3ZJZ A;  2HFE C;  3HB3 B;  2GHY A;  2F43 G;  3P30 A;  4GX5 A;  1NH2 B;  4WFF A;  4UVC A;  3OGC C;  2MK3 A;  3CP1 A;  4MVR A;  1K5S A;  5B1A C;  5B1A B;  2ZR3 A;  2GSM B;  1KP3 A;  2HVK C;  3CC7 V;  2DYR C;  2WLN A;  3CYO A;  1YSC A;  4X8A A;  4H37 A;  3MHH C;  3CMA V;  3IFX A;  2XND G;  4UVA A;  2YEV A;  1P7B A;  3RW0 A;  3UM7 A;  4JAS A;  1OCR C;  2K1E A;  3TCU A;  3W7S A;  1GK9 A;  1RPO A;  1ZWI C;  2BOB C;  1JQ0 A;  1YIJ V;  1YIT V;  2IJH A;  1R3L C;  2WWW A;  5KUM A;  1V54 C;  1VQ5 V;  2EIN C;  4G27 B;  2OCC B;  5EC1 C;  1YTF B;  3ZRW B;  2ZD9 A;  4HAM A;  4HYO A;  3SYA A;  3OMN B;  3W7W A;  4XDJ A;  3K79 A;  4WCE V;  2DQ0 A;  4EKW A;  4H33 A;  2XAS A;  2WLM A;  4FIP C;  3ZMT A;  3STZ C;  2QEX V;  2P90 A;  4PA6 A;  3CC2 V;  4PEL A;  2Y69 C;  2Y69 B;  3ASO C;  1SES A;  2IJK A;  3TK1 A;  2WLI A;  3JD0 A;  4PA7 A;  2FTK A;  1M90 W;  2IJI A;  1NBM G;  3CCM V;  4DXW A;  2IU3 A;  1G8M A;  2DWD C;  1NQT A;  2V7Q G;  4XBF A;  2Z3Y A;  4XDK A;  1DF4 A;  4JYC A;  5EBL C;  4PA3 A;  3CCR V;  4Q20 A;  1EFR G;  3OMA B;  3TET A;  3SPI A;  1R6N A;  1NVP B;  1M1K W;  4BAY A;  4TT3 G;  3RBZ A;  4X89 A;  1H2G A;  2X6A A;  1KP2 A;  1F4M A;  2DQ3 A;  2OT5 A;  1B6Q A;  1OCO B;  2PI4 A;  2EIK C;  2WLJ A;  3ASN B;  1K9M W;  2OTJ V;  4KP4 A;  2ZQM A;  1OCZ C;  1R3K C;  1DTO A;  1OCZ B;  5L3F A;  3CPW U;  3CCJ V;  3E86 A;  3JD3 A;  2IU0 A;  5EC2 C;  5LHH A;  2HLD G;  1V55 B;  4ZBM A;  2EIL B;  5CA3 A;  3ZIA G;  1AI7 A;  2JDI G;  5EBM C;  1NR7 A;  3AG4 B;  1BMF G;  3FB8 C;  1M56 C;  1L1F A;  1QLE B;  4CZZ A;  1FXK C;  1FXK B;  3B77 A;  3ABK B;  4MTX A;  1QCE A;  5CBF A;  2Z5U A;  5LGU A;  1QBZ A;  4I5S A;  1UJW B;  5KUK A;  1S0V A;  2P67 A;  2UXX A;  4JGS A;  4WFH A;  3X2Q C;  3SPH A;  4JF3 A;  5IYD O;  2OTL V;  1GM8 A;  1GTO A;  3ZRV A;  3QO5 A;  3FB7 C;  2A9H A;  2WPD G;  1YJN V;  1QVF U;  3SJQ C;  4WF9 V;  2XOK G;  1AI6 A;  5L3G A;  4GX1 A;  3OEE G;  2ITD C;  2ZDI C;  3ZRW A;  3ABU A;  1JCH A;  4MVZ A;  3AG2 C;  3T4D A;  4U7O A;  5BZB A;  2QM8 A;  3BY6 A;  3DGE A;  2X0L A;  2EIM B;  1S77 D;  4QE9 A;  3OEH G;  1EZJ A;  1VQ8 V;  3G4S V;  4PDL A;  4JAU A;  3IC7 A;  4Z1M G;  2BOC C;  3CCV V;  3ABM C;  1E1R G;  1F4N A;  3ABM B;  3CME V;  1Q82 W;  5HFL A;  2W6J G;  2XAH A;  1VQO V;  2QM7 A;  3NXS A;  3K08 A;  1S76 D;  2LFR A;  3IGA C;  2R9R B;  1RM1 C;  1CP9 A;  3FB5 C;  4GT1 A;  3FKS G;  2DYR B;  4MSW C;  1S3J A;  3GWO A;  1DLB A;  3OM3 B;  1K33 A;  2WLL B;  2IW5 A;  1PNK A;  3CXC U;  4HZ3 A;  2W6I G;  4MVQ A;  3ML0 A;  3WG7 C;  3LDC A;  2HKO A;  1S5H C;  2H8P C;  5IYB O;  4FJC C;  1NR1 A;  1OCR B;  5H9C A;  1Y66 A;  3G71 V;  1V54 B;  2EIN B;  5L3E A;  1Q7Y W;  3W7X A;  4LBE C;  1F23 A;  2IJJ A;  5H6R A;  1SET A;  1QR8 A;  1VQ9 V;  4R6Z A;  3CCS V;  2JJ1 G;  5IY5 C;  2QA4 V;  4FPP A;  5IY5 B;  3K9A A;  3LDE A;  3AG1 C;  3AG1 B;  4QJF B;  2X6B A;  3E8F A;  3DTU B;  1H38 A;  4BIU A;  4JTC B;  3R65 A;  3K04 A;  5KA5 A;  1Q86 W;  5IDJ A;  2XAF A;  1PNM A;  4DO2 A;  4QIW F;  3ASO B;  2EZO A;  1JJ2 U;  3ZMZ A;  1FS0 G;  4GX2 A;  3I56 V;  3OMI B;  2JJ2 G;  5B1B C;  1ENV A;  5B1B B;  5CBG A;  3F7Y C;  1ORQ C;  1CPY A;  2WAM A;  4OXS A;  3CCE V;  1BL8 A;  1QR9 A;  1ARO P;  4TWK A;  3LNM B;  1W2B U;  4WFA V;  3SPJ A;  2HG5 C;  4UV9 A;  3SYC A;  1NVP D;  1SRY A;  1BHA A;  1VQN V;  1LNQ A;  3LUT B;  3STL C;  2ZR2 A;  2DW4 A;  2XAQ A;  1R6K A;  3SYP A;  3VBB A;  1PNL A;  4P30 A;  2EIK B;  3CCQ V;  2PI5 A;  3ZN1 A;  3ZMS A;  1N8R W;  1ROP A;  4N21 A;  5C93 A;  4E2L A;  1GM7 A;  4CBC A;  2C2A A;  2B5U A;  1IXM A;  4U7N A;  2B1I A;  2ITC C;  3MD0 A;  2B1G A;  1J95 A;  2YEV B;  3E35 A;  3ZMU A;  4JTA B;  1VQM V;  4P2Z A;  1YJ9 V;  4UV8 A;  2P7T C;  4FK5 C;  4MW3 A;  3EHB B;  1M56 B;  3JD1 A;  3LSQ A;  4R50 A;  4UUJ C;  2Q68 A;  1I5Y A;  4MVM A;  2XAG A;  4RUF A;  4I9W A;  1KQS U;  2JEU A;  1JPX A;  2WLK A;  1MOF A;  2R9I A;  4RAI A;  4MTO A;  3BEH A;  4RQF A;  1AI5 A;  3MHS C;  5CN0 A;  4JAV A;  3X2Q B;  4KFM A;  3JCZ A;  5L3D A;  1VQ7 V;  1I5X A;  3SYQ A;  4MT8 A;  1K5Q A;  3K06 A;  1VQP V;  1SER A;  2A79 B;  2AHY A;  5LBQ A;  1CEZ A;  1WLE A;  3HPL C;  3K03 A;  3GB7 C;  3RVY A;  3AG2 B;  1AJP A;  1TUE B;  3SPG A;  2Q67 A;  2X7R B;  4F4L A;  1W0K G;  1OZ0 A;  1E1Q G;  2EIJ C;  4WFE A;  2EIJ B;  1COW G;  4LP8 A;  1AJN A;  2HR3 A;  2H94 A;  2P6J A;  1NH2 D;  3PJS K;  3T2M A;  3AEI A;  4WFB V;  4P9P A;  5LGN A;  3E2E A;  4QPK A;  1KD1 W;  3SYO A;  1GO3 F;  5EBW C;  4MVU A;  1RM1 B;  4BW5 A;  1VQ4 V;  3E8H A;  3M99 B;  1G4Y B;  3OR6 C;  1DF5 A;  5B1O A;  5CBH A;  3OW2 U;  3ZMV A;  3K0G A;  2X6C A;  1W0J G;  1GM9 A;  4ASU G;  1S72 V;  1FFT B;  1K97 A;  3B8M A;  4XDL A;  3QNE A;  4MVS A;  1Y4M A;  2W0F C;  3QO8 A;  4G28 B;  3W7U A;  3LSS A;  3F7V C;  3WG7 B;  1VQL V;  5L3C A;  1JX9 A;  2WSS G;  1VQ6 V;  5J9P C;  1MG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...