5EBMC

Kcsa t75g mutant in the nonconductive state
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATGVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ebmC00
2KB1A 3K03A 3K06A 3UM7A 5BZBA 2A0LA 4ZBMA 3ZJZA 3OR6C 4MTGA 3KG2A 5EK0A 3T2MA 4QE9A 5B3SC 2R9RB 3GB7C 3OUFA 3ASOC 4PA7A 3F5WC 4HZ3A 1J95A 2IH1C 4H33A 3IGAC 4OXSA 2ZXWC 1KKDA 3AG1C 3PJSK 3T1CA 2EINC 5EC1C 2HVKC 3ABKC 3OUSA 4J9ZB 3TETA 4MW3A 1OCOC 2DYRC 3BEHA 3AG4C 4MTFA 3F7VC 4PDMA 1R3JC 4HYOA 4R6ZA 4RAIA 2X6CA 4WFEA 4X89A 2WLMA 3T4ZA 2WLLB 5J9PC 2HJFC 4MS2A 3AG2C 4WFFA 2H8PC 4JTCB 5KUKA 4F4LA 2OCCC 5B1BC 3RW0A 3LUTB 3SPGA 2A79B 5KUMA 2BOBC 5CBFA 3E8GA 3K0GA 2ITDC 3LDCA 4PA9A 2ITCC 2AHZA 1QLEC 3ABLC 5EBWC 1XL6A 4G27B 5B1AC 3FB7C 4GX2A 3SYCA 2EIJC 4PDVA 3TCUA 1V55C 4JTAB 2DWDC 2Q67A 3OGCC 3STZC 4PA3A 2QKSA 4PA6A 4QE7A 1BL8A 4MVUA 3K04A 3LDEA 3SPHA 1S5HC 2DYSC 5CBGA 3FB5C 4MVQA 4RO2A 5EBLC 2BOCC 4MVOA 4MVMA 1M57C 4WFHA 3F7YC 4MVZA 4X8AA 5EC2C 4RUFA 3SPCA 3E8BA 2JK5C 3ASNC 2Q6AA 4PDLA 3LNMB 2K1EA 4BW5A 3K0DA 3E83A 3SYPA 3ABMC 1V54C 4PA4A 2ATKC 5CBHA 2HG5C 3R65A 1ORQC 2WLLA 4I9WA 2DWEC 1OCZC 2WLIB 3FB6C 2EILC 3OR7C 4P9PA 3SYOA 1LNQA 4PDRA 2W0FC 4TWKA 1R3KC 4P30A 2WLJA 4WFGA 2Y69C 2YEVA 1OCRC 1K4DC 3LDDA 4DXWA 3RBZA 2A9HA 4RUEA 2QTOA 2EIMC 4XDKA 2HVJC 3JYCA 4LBEC 3E8FA 4GX0A 3AG3C 3HPLC 4MSWC 4MTOA 4UUJC 2ZD9A 4G28B 3T4DA 3WG7C 3STLC 2AHYA 2X6AA 1M56C 1R3LC 3E86A 4P9OA 3SYAA 4MW8A 3SYQA 3E8HA 1K4CC 1OCCC 2WLKA 4R50A 4XDJA 1R3IC 5IY5C 3X2QC 4KFMA 5EBMC 3VOUA 3ZRSA 4P2ZA 4QNHB 1JVMA 2P7TC 2WLHA 3E89A 4X88A 3SJQC 2IH3C 2Q68A 4GX5A 3RVZA 4J9YB 3EFFK 3FB8C 4R7CA 5E1AC 1XL4A 4H37A 2EIKC 1ZWIC 4MVSA 4LCUC 3RVYA 3SPIA 2HFEC 1P7BA 4LP8A 3K08A 4XDLA 3UKMA 4GX1A 2Q69A 2WLNA 4MVRA 4R8CA 3SPJA 3IFXA 2NLJC 1G4YB 4JTDB 2X6BA 4EKWA 4CBCA 2WLIA
chains in the Genus database with same CATH superfamily
3L71H 1GK9A 5EK0A 3T2MA 2IH1C 2XAQA 1R6KA 2RDCA 5LHIA 2C2AA 4B3MB 1XNRB 1NVPB 5A9GA 4JI7B 4J41A 2ZKOA 4H44B 1Q90D 1Q6IA 3LUTB 4LFBB 1MOFA 4DV4O 3LDCA 1QHTA 1OCRB 3OAAG 1COWG 3K57A 3CXHF 2DWDC 4RQEA 4B3TB 4I4TA 3ZRXA 1WA8A 1GKFA 1MMMA 3SPHA 3SJAC 2P4VA 3FB5C 4TUYA 5BY1A 1FFXA 1VQ6V 4WFHA 3F7YC 5GTIZ 2JK5C 4UVAA 2Q6AA 3T1HO 3LNMB 2ZCEA 1UFIA 3AK2A 4EB6A 3E22A 4JI2B 5JCOA 1F7YA 2VQEB 2FB5A 3K58A 4UCSA 4TQFA 1YI2V 4P9PA 3RN4A 4TV9A 1K4DC 5DEDA 1TGOA 1BHBA 2HVJC 3CCLV 3R66A 5FPOA 4UB6Z 4IT5A 2L6LA 2ZD9A 3ZN1A 2JEUA 4JASA 2JS5A 3W7TA 1FD9A 1JVMA 2WPDG 1FXKC 4TT3G 5B3SB 4DR1B 4O4HA 3I55V 3EFFK 1XL4A 1S5JA 4X66B 5J2UB 5HFMA 1KC8W 1O9GA 2ZNJA 3RYHB 1VF6A 4PHZA 4BIOA 2HEPA 4G2KA 1PV0A 2R9RB 4GYCB 3GB7C 4LF8B 4LF4B 3UO2A 1MZFA 1IBLB 3LSUA 3IGAC 2IJKA 4F6RA 4UVBA 1IVSA 3OUSA 3CCJV 1KKCA 1WAZA 1M56B 4I9QA 3QO8A 4MTFA 4HYOA 4I0XA 1IBKB 1UJWB 1NTMH 4I50A 1P84F 1VIBA 3QG5A 4ASUG 4LFAB 1Q82W 1K5QA 5BR8O 3KKYA 3A0RA 5EBWC 3JAWB 4FLYA 4GX2A 5L3GA 4TOIA 4QIWF 3TCUA 1V55C 3OGCC 1EFRG 4DV0O 3T1YB 5DM6V 1SKVA 1JFFB 1BL8A 3OGIB 4MVQA 5H6QA 5CMUA 1M57C 4B3TO 1OJHA 2XAGA 2FYUH 2GHYA 1R1BA 3L70H 2ZQMA 3DGEA 4DR5B 5LP6C 2ATKC 3ETDA 2E5LB 2DWEC 4AQYO 4TWKA 2WLJA 5K1PA 1Q5OA 1LUVA 1YJWV 3L74H 4CS4A 3VQVA 1NT2B 1BCCH 2QTOA 5LOVB 3APQA 4B3SB 3VQYA 1AR4A 3SYAA 4X1KB 3E8HA 3ETQA 2AXTZ 4FM2A 1WPXA 4XDJA 2BCCH 1X59A 5EBMC 4JI3B 4CZZA 3E89A 2D2CB 4X1IA 3DSQA 3F5TA 3ZHTA 4FMTA 1U96A 4PD4F 2EJ7A 4DR1O 1SA0A 2Q73A 3N2KB 4JTDB 1XNQO 2GDSA 2WLIA 3W7SA 3D3IA 5BZBA 2JIZG 3OR6C 4IHJA 3JAKA 5JJNB 1W0JG 4B7EA 3PJSK 2EZOA 3DC6A 3ABKC 2N05A 3A2FA 1I5XA 4MT8A 1YEWA 3ML0A 3K59A 4GKKB 1VQ7V 1S5LZ 2QDOA 2B9ZA 3OTOO 2E75B 3O9OA 3JSNA 2XT9A 5IJ0B 2QWQB 2BTQB 1BQ0A 4UV9A 3HKBB 5EYPB 1DK1A 3OE7G 1HNXO 3BFRA 1ZX3A 4NTWA 1YSCA 1N32B 1GTOA 2ZINA 4ZOLA 4PDLA 4NXMO 3SYPA 4DR7O 2N74A 2HHHB 1N8RW 3BRCA 3P3PA 1MABG 4LC1A 2YEVA 1QVGU 3ZRVA 2DMXA 2XAFA 3JCUZ 5LHGA 2KG7B 1GMGA 2WA3A 2ARHA 2A7WA 2NN4A 2NNUA 2Q9LA 3VQWA 1W0KG 2AGAA 5B66Z 4JI0O 2MK3A 2Q8VA 3CEIA 1K7DA 3FAVA 2VRZA 1XUQA 4JI5O 1JJ2U 5CA0A 3FB8C 3ASNB 5EIBC 1DLBA 1V54B 4J7KA 3SPIA 3TJTA 4LP8A 2Q69A 1KECA 1JJOA 2IBZH 4JI4B 2NLJC 2E76B 3SDLA 1SESA 2OTLV 2PI5A 2YIBA 3UCSC 1WP8A 2XTAA 3CX5F 4O2BA 4QE9A 1IBLO 3ASOC 1AI5A 2MW2B 4CH4A 5LOVA 2AZ0A 2PGGA 5LBQA 3H9VA 4MW3A 3OM3B 1Q6UA 2DOSA 4FLZA 4DRXA 4CS2A 4JTCB 1K8AW 2ZT9B 3OTFA 1NH2B 3BA9A 1D5AA 2BTOA 1HWYA 2B5UA 1TA8A 4DV2B 2DE0X 4GKKO 1OHHG 1EN4A 5KA6A 4EFEA 1Q3EA 2IJHA 4RO2A 2HHHO 1IDSA 1EN5A 3GVMA 4LF8O 5C8YB 1K34A 2FTKA 4BW5A 4LWSA 1H2LA 1GN2A 2P67A 2EJRA 2AZ2A 2UXXA 4DV7B 1AI6A 4CC5A 2PZSA 2PI4A 3FB6C 1N34O 1SQPH 1PL4A 2W0FC 2V4DA 3MHSC 4GUNA 4O4IA 4UCTA 4DR2B 3ZBHA 1JA8A 3ABUA 1A32A 2IU3A 4K3AA 1SF9A 3AK1A 3IAYA 1Y66A 5IDJA 4W4KA 3EVKA 5D5PA 1SQGA 4KFMA 2QEXV 1ZLZA 3ETEA 1SQBH 2K9PA 1XI1A 5L3BA 4J9YB 4E4EA 1Y74A 1EBOA 1SETA 1VQKV 3RYFB 4LF6B 5AG2A 3N2GB 2P6JA 1P49A 3S3WA 4YJ2B 3ZRWB 2UUBO 4WBNB 2QKAA 4UV8A 3D36A 4DV6B 4J80A 1XREA 1ZSPA 1MG1A 1WP7A 1VQ8V 3CXCU 2KG7A 4QPKA 1Q7YW 2F66C 1G6UA 2ZE5A 4TV9B 2PUSA 4R6ZA 2P06A 1XHZA 1I94O 1FJGB 4WFFA 5B1BB 5KUKA 1YDXA 1MNGA 3CRQA 1NH2D 2EULA 2GUZA 5GW7A 5A2QN 4ZOLB 1M1KW 3FB7C 3EXAA 3L75H 2QGNA 1M90W 4PA3A 3RYCA 4KHPB 1K73W 2LW7A 2V7QG 4PI0A 4DV6O 3W7WA 2PF4E 1NJIW 5J2TB 4MVOA 1S76D 3VBBA 2BTQA 4LH7A 3G71V 5F2VO 3CS5A 4BIZA 2ADQB 2ILMA 4UCRA 1P7GA 4PA4A 2Y4UA 1IXBA 4LF5B 1XMOB 2WLIB 3OR7C 2CGOA 1PM9A 4CH6A 1PL0A 3H1HH 2RNBA 4K8XA 3AG3B 2Y0IA 1QNMA 2BE3A 3N2GA 4B3RO 4JF3A 2O57A 1FXKA 2A06H 3JAKB 2JJ2G 1OZ0A 5H2FZ 1JQ0A 4DV4B 1AI7A 1OCCC 5IY5C 4DR4B 3VOUA 4QNHB 4P2ZA 3O65A 4ZI7A 3M8AA 1PD3A 4FLTA 1CPYA 4JZGA 3G4SV 1P7BA 3ZCCA 2JGUA 3EHBB 3CRRA 4MVRA 1L0LH 5FPRA 2CTPA 3CHXA 2UXDO 2VS0A 2KB1A 3ZJZA 1XQ8A 2Y0PA 3H1KH 3B40A 4LWSB 5IYZA 4JI6O 2CTQA 4RWUA 1NU1H 1H8HG 1LR1A 4U3JA 3AG4C 4GT1A 4DK1A 1HNWO 1M9NA 4Q20A 4F4LA 2YC0A 2A79B 4YIOA 3L73H 1QLEC 4N21A 3TXQA 1VEWA 2WWWA 1XDCA 4DV1O 1SQXH 4C7UA 1H2KA 2WAMA 2UXDB 1K33A 3ABMB 2NR5A 2CAZC 2W6JG 2GV9A 1GN6A 5EBLC 5KHHA 3SR2C 1DF4A 1SERA 3JAWA 3FKSG 4YJ3A 4PJ0Z 3SGIA 3ABMC 4Q6GA 1XBLA 1GH6A 2YDEA 4JYYA 1FPOA 4U7NA 4I0XB 3SYOA 4DK0A 3JALA 3KZIZ 4O4JA 1IXMA 4BW9A 1YJ9V 1HNZB 4CH3A 5IY5B 5BMVA 2F1MA 5J2UA 3W7XA 2OT5A 2A9HA 1BE3H 3CD6V 4ZHQA 1AP5A 1TUEB 5B1AB 1KU9A 4FZ1A 4LFBO 4G28B 1M56C 2QM8A 2YXHA 4IIJA 3WB0A 5JWPA 1GAXA 3KCYA 3J7AU 2FL4A 3D8CA 1BT8A 3UT5A 4BR6A 1K92A 3H01A 3I56V 1HNXB 4GX5A 1R6TA 2EILB 3BVOA 3P32A 3AG7A 1URFA 1GN4A 2P22C 4H37A 2M7WA 4OX9B 2D3OW 3CRMA 1XNQB 5LMNB 5FNVB 1KKDA 3J80N 2JDIG 2UXBB 2EIKB 4DW1A 4XBFA 1CXZB 3E22B 1YTFD 1BS3A 5BXZA 4GCZA 4FZ0A 3K9AA 1AR5A 4HZ3A 3T1HB 3CPWU 4FK5C 5EC1C 1WNSA 1QVFU 3BEHA 3F7VC 1L8DA 1XEQA 4OGQB 1HP8A 5H6RA 3OTOB 1PNKA 2EIMB 3JD4A 3K5NA 1VF7A 4JI0B 4EB6B 5EYPA 3C3TA 3WG7B 2PYLA 2JGDB 4LF6O 5B1AC 4KP4A 3HKEA 2EINB 4J7ZA 3ETGA 1T5EA 5B1NA 1QR9A 3MDSA 2WA4A 3HKDB 2Q0OC 4X20A 4MVMA 4I55A 3BCCH 3HKEB 4Z1MG 2M6YA 4YY3O 4DYLA 2JGDA 2K1EA 2VWJA 1YF2A 4L8JA 4IHJB 3CWBH 3M99B 2OCHA 3APOA 3ICXA 4BIUA 1R3KC 4P30A 1JMKC 1OCRC 4OPAA 1Y4MA 4JV5O 2XASA 1R6NA 4LBEC 3CCUV 3T4DA 4YIPA 4LF7O 4UCOA 4FPPA 3STLC 2AHYA 3E86A 4P9OA 1TUBA 1I08A 2ZR3A 3OFNG 4X1KA 1P4RA 2P7TC 2L35A 4X88A 4DV0B 3T1YO 2QE7G 3ZHSA 1S77D 1JOYA 2F23A 1AVMA 1E79G 2EIKC 3RYIA 3M7MX 1TAEA 1AI4A 3UKMA 2YIAA 3K3WA 3SPJA 3IFXA 2GBOA 2ZR2A 3K5OA 5LGUA 4DR5O 4ZKIA 2Q7EA 2PY5A 4DR7B 1Y76A 3G6BA 2E74B 3OD4A 4J10A 3TETA 5LA6B 2UUCB 4X64O 3JCZA 3PN1A 1AJQA 1R3JC 3Q4HB 4WFEA 3T4ZA 4DW0A 3CCEV 4JI8O 2WSSG 1OCCB 1M5IA 3SJCC 3LNNA 1XMQO 2QA4V 3K0GA 3JARB 1SQVH 2R72A 1MA1A 1AJPA 1SZXA 3RFRA 5LMUO 3AG1B 5TISZ 2YIBD 4ICGA 3ASOB 4Z1VA 2QKSA 4I50B 3LDEA 1S5HC 3ZMZA 3I5DA 2VQFO 4F6RB 1UPGA 3S3XA 2QWRB 1V54C 3A8TA 4HNAA 1J5EO 1Y6XA 2E5LO 2OIEA 4YHHB 4NXNO 1NQTA 1SQQH 1R73A 4ZIBA 1PP9H 4TQDA 3CJHA 3E8FA 4JAUA 1HNWB 5CA3A 4UUJC 5LGNA 1NR7A 2X6AA 3SYQA 1Y67A 4IGGA 3DXRB 3X2QC 1PNLA 1TUBB 1YTFB 1XILA 4KHPO 3RWRD 2Q68A 3ZN0A 1SC5B 5LP6A 4R7CA 5E1AC 1ZWIC 2CTWA 4ZI7B 1N32O 1HW7A 4EEQA 3A0HZ 4CBCA 1SQFA 3B8NA 4LR3A 3L9DA 2CTRA 1DTOA 3OMIB 3OT7A 5KAFZ 4H13B 4H33A 3B09A 4FFKA 1GRJA 2EINC 2H94A 1FFXB 3G80A 4RAIA 2EBOA 5KA5A 1HR0O 2WLLB 5IT9N 2QKCA 3FD9A 4X62O 1NTKH 2XAJA 3VQXA 2BOBC 3E8GA 4UCUA 1W2BU 1JR9A 1V9PA 2RQ6A 4IYIA 1JPXA 4I55B 1XMQB 5J2TA 2ZXWB 3BABA 1WB8A 1RPRA 1AR1B 3RYCB 1LUWA 4OX9O 4MVZA 3SPCA 2KSDA 3E8BA 4DR3B 1XOUA 4AQYB 4WFAV 3K0DA 1ZAUA 5L3EA 1EZJA 4LFCB 1XHXA 2HR3A 2EILC 1F51A 1NR1A 4WFGA 3CP1A 1FYJA 4DXWA 2F93B 3K5LA 1VF5B 5LYJA 2YXLA 1KQSU 1FJGO 2P4KA 3ZMUA 2GTAA 3OW2U 1Z5VA 1AILA 3UO3A 1MSDA 1WB7A 4IIJB 1CEZA 4KL1A 3CCRV 3H1JH 3BPZA 3RYFA 4ZHQB 4DV2O 4MVSA 2YXYA 2FMLA 5BMVB 3K08A 3UT5B 1G4YB 2X6BA 4EKWA 4CS3A 4UXNA 2ZDIC 5GONB 2A0LA 3FYIB 2RJZA 1ROPA 4U7OA 1S0VA 2DQ0A 1IBMO 1F23A 3OEEG 2JJ1G 1HNZO 4ABMA 3CC7V 4DR2O 4O4JB 4EFBA 1QLEB 2R9IA 1GO3F 1I5YA 2X6CA 1SZTA 2JS3A 5KLVH 1VARA 2HJFC 3SJBC 2F4VO 1N34B 2F43G 1BHAA 2VWKA 1QU7A 2OCCC 2Q7HA 4TSFG 3SYCA 2F95B 1PNMA 3JASB 2YS8A 2XUMA 4DV1B 3B77A 4PA6A 1ENVA 5CBGA 4D7SA 4HAMA 1CP9A 3CMAV 3WU2Z 2YICA 5EC2C 3B8MA 3E83A 4DV5O 5EZYB 5CBHA 3HKCB 3R65A 2F4VB 1G1XB 3QO7A 3CCSV 1RSOA 4UFZA 1WJZA 3LDDA 4JI6B 1IZ3A 4X1YB 3RYIB 4RUEA 3D36C 3L72H 4JI8B 1VF6C 5CN0A 1R3LC 1PKXA 3NR7A 1FXHA 3AG2B 3B2EE 2W6IG 4TV8B 4QJFB 3RVZA 1NTZH 1FS0G 1BSMA 5ITZA 3IJ4A 2CGNA 1H38A 2CH7A 1S72V 5JH7A 4XDLA 1QBZA 4R8CA 1L0NH 5JJJB 4I7ZB 3DC5A 4K0KB 3K03A 5KX5A 4FFBA 1K97A 1B04A 1VP7A 1IBKO 1FXKB 5B3SC 4D7TA 5LXTA 1N36B 3OUFA 5FLXN 1J95A 3WB2A 5JJEB 1NI8A 4X20B 2Y48A 2DYRC 2DQ3A 3CMEV 4LF5O 2H3OA 2QJ1A 3HB3B 3KCXA 1XMOO 3AG4B 3X2QB 5KMGB 5CB4B 1Q6HA 2X7RB 2UXCB 4LF7B 1RM1B 5B1BC 3SPGA 4JAVA 4E2LA 2ZM6B 2ITCC 1FKAO 1TVKB 1VMGA 2XHBA 4UB8Z 2GUZB 2RMKB 4DO2A 4JI1O 3OEHG 4BAYA 3QVNA 3IC7A 2ZDIA 4J11A 1RPOA 3ZMTA 3C3SA 4RUFA 1N36O 4YY3B 5IJ0A 5DN6G 4X65O 1XNRO 4AI8A 2XOKG 4WCEV 4LFCO 1KD1W 2PTMA 1AJNA 3OMNB 2QTSA 1WN7A 1KBHA 4JAAA 4WBNA 4NB5A 3QO5A 1B6QA 4KUMA 2UUCO 1ZL8A 1EN6A 2BSKA 2EIMC 3K79A 3AG3C 1O9HA 4FFBB 5IE9A 4MW8A 4O4LB 4JYAO 2IJJA 1VQ5V 1GM8A 3ZEDA 5L3DA 2CDYA 2LGWA 2IH3C 5DECA 4HBNA 2CH7B 3G67A 1B3QA 4X66O 5K1XA 4X1IB 4FM1A 2IM9A 3JALB 1YJNV 1EZVH 2RN9A 3UQ8A 3T1CA 2OWOA 1YXBA 4O4IB 5EIBD 5JCOC 5JQGA 4DV7O 1HDJA 4MS2A 3CE2A 2H8PC 2OCCB 3ABKB 4LNUB 1W59A 2LGQA 4PA9A 1VQNV 5E79Z 3D3QA 4G27B 5C8YA 4W4LA 4I5SA 5IWAB 4FLXA 2LP7A 3N27A 4QGPA 3W7UA 3JATB 4UCVA 1AP6A 4LF4O 1KP3A 5IYZB 2DJVA 4FLWA 4LH6A 4PV1B 2Z0AA 1L1FA 3QF7A 4LNUA 1IX9A 1QR8A 1D2DA 1US6A 3MAQA 2GSMB 3RGBA 5JVDB 2IW5A 2EX3A 4J7JA 5JQGB 2QR4A 3AK3A 4JPRA 1GM9A 5BR8B 4JYBA 2Z5UA 1NS1A 1ZTEA 1FFTB 3MHHC 4NVPA 5CA0B 4O2BB 1B06A 3ZHQA 4JGSA 1RM1C 1K4CC 4H0LB 4BWAA 2HLDG 1R3IC 2KKWA 3ZRSA 4O4LA 1Z2GA 4CC6A 2DYRB 3ZHUA 1RFYA 5GTHZ 2BSKB 1EM1A 4UVCA 4GKJO 3JD0A 4JI5B 2YEVB 4DR3O 4FM0A 5LMNO 4AHCA 3UM7A 1YZBA 4Z2WA 4JI2O 1KYOF 4FLVA 4J42A 2VQEO 3KG2A 2YI9A 4D6TH 4PA7A 2ZXWC 3P3NA 1MZEA 2HVKC 1PPJH 2LW1A 1OCOB 5FL7G 4X62B 3AG2C 3RW0A 5CBFA 5KUMA 3U10A 2ITDC 2HJDA 1VQPV 4IL6Z 2XAHA 1VQOV 5IYDO 3CC2V 3ZX6A 1FXVA 1BQZA 3RT3C 2Q67A 3STZC 1N33O 3E35A 4NTYA 1Q81W 1VQ9V 3K04A 2Z3YA 1WA8B 2BOCC 3TGUH 1H2MA 3NXSA 1SRYA 3ZS8C 3ASNC 1TVKA 2DYSB 2UUAO 5LXTB 2OTJV 3ZHVA 2WLLA 1NZ6A 4I9WA 4PI2A 4DV3O 2ZE6A 4A5UB 3ZRWA 1NBMG 4YJ2A 3MD0A 5KHGA 1QQCA 3FFQA 1M93A 2QSAA 4JV5B 4DUYO 1Y74B 3JYCA 4RQFA 3QTCA 4LF9B 4TV8A 2QM4A 2RCVA 4X64B 3ZMSA 1SA0B 1SS3A 3CRCA 2DN9A 1Z5WA 1OCZB 1YITV 1DGSA 1N0JA 3GWKC 5LP6B 2UXNA 4X1YA 3LSQA 2LFSA 4JI4O 4GX1A 2WLNA 3DXRA 4KXRA 5JVDA 2LJ2A 2OYQA 3K06A 3HKCA 2ZIMA 4F6EA 3ZMVA 1AB3A 3J81N 1IBMB 3F5WC 3AG1C 1BMFG 4FIPC 1YIJV 4WFBV 1OCOC 4PDMA 5H5NA 3JATA 4X89A 2B1GA 1THZA 2IJIA 4HNAB 4O2AB 2CUGA 1VQLV 4B7KA 1E1RG 4JZ2A 3U0ZA 4LFAO 2AHZA 2YUAA 3ABLC 2AW9A 4DR6B 4DRXB 4QE7A 3THOA 2R70A 3JASA 2YI8A 4DUZB 1JX9A 3K9SA 2P5OA 3A0BZ 1I7FA 2QWOB 3CYOA 5B1OA 4DV3B 2HP8A 3CRAA 4N23A 3E2EA 2QWPB 2HG5C 3FYEB 5GONA 4B3RB 1ORQC 1OCZC 2EIJB 1LNQA 3ABLB 4LF9O 1JCHA 3G6EV 2N04A 1WPBA 3LSSA 3RBZA 1MSWD 3JD2A 4GZRB 4DR4O 1RP3B 4GX0A 4MSWC 4MTOA 1Y76B 2YSUB 4PELA 1NVPD 3FAVB 2Q0AA 5HFLA 4JI3O 3JD3A 4X9QA 3BAAA 3JAMN 2UU9O 3IC9A 3TK1A 2ETNA 1H8EG 4O4HB 1ZL8B 2GTSA 4OPHA 5KHJA 4K0KO 3BY6A 4FVMA 4WF9V 3ZIAG 4ZBMA 1V55B 3CC4V 4MTGA 5L3FA 5LYJB 3ABTA 2ADPA 3K5MA 4OXSA 4B3MO 3CSXA 4YXWG 4NR1A 1DF5A 4TUYB 2KQXA 2A3QA 1I94B 1K9MW 2WLMA 3BHPA 5LMUB 5D5QA 4B3SO 1X4TA 3GWOA 4JYAB 3HKBA 1Q8IA 2ZM6O 2LQTA 1XL6A 3JD1A 4DUZO 4NYKA 4PDVA 1K3EA 2VQFB 3CCQV 3HKDA 5H9CA 1KB9F 2B1IA 5CB4A 4JI1B 5KMGA 2UXBO 5KHKA 2DYSC 4I4TB 3AEIA 2V1DA 4GKJB 1K5SA 2EZPA 5LL6Y 4X8AA 4DR6O 1J5EB 1AROP 3C90A 2DW4A 2UUAB 5L3CA 4YHHO 4X65B 2QM7A 1E1QG 2Y4TA 4AILC 2W0XA 5KX5B 1S3JA 1M4UA 3N2KA 4PDRA 2R9AA 5IYCO 2PYJA 2Y69C 5JH7B 1KMIZ 1WLEA 4XDKA 4QPJA 2JRIA 5ITZB 2IU0A 1BZKA 2LFRA 2Y69B 3WFVA 3HR0A 4IYHA 1GM7A 5FNVA 4R50A 3TXSA 2OIGA 2CK3G 2WLHA 3SJQC 2JEXA 1BGYH 1F4NA 1N0NA 3CJHB 1VQMV 1YHQV 4LCUC 2HKOA 2ZNIA 5CA1A 2Q4PA 1RSOB 2ODMA 2UU9B 3H1LH 1QLNA 5IYBO 2ZIOA 5B5EZ 1D5NA 4DV5B 5EZYA 5KHIA 5C93A 1YCIA 1KUQA 4JI7O 1QCEA 5LGTA 3B4SA 4DUYB 2XNDG 4J9ZB 5LHHA 2E3CA 4FJCC 3ZHRA 1IURA 3OMAB 5J9PC 1I0HA 2Q5ZA 1Q86W 1JFFA 1Q43A 2LO1A 4L87A 4B08A 5IJ9A 4NXNB 4K8ZA 2G38A 1F4MA 4MTXA 4YJ3B 2EIJC 4K35A 1KP2A 4JTAB 3U11A 1VQ4V 3QNEA 4MVUA 5IWAO 4GLXA 3Q4HA 3CCMV 2CE4A 1NKDA 1M57B 3CCVV 2P90A 3WB1A 2YIDA 1YVWA 3JARA 5KAIZ 4JYCA 1OV9A 5IJ9B 4O2AA 4NTXA 3JSLA 3BA8A 4U3JB 5LA6A 2JVDA 3RYHA 2ZE7A 4NKGB 4FLUA 1H2NA 2X0LA 3HPLC 1FAFA 3WG7C 3H1IH 3P30A 1GN3A 3FX7A 2WLKA 1G8MA 2QWNB 1HR0B 1N4CA 1ZUQA 2UXCO 5CA1B 1N33B 3CB2A 3DTUB 2FKXA 2ZE8A 4U3FH 3RVYA 2Q7GA 2HFEC 1U97A 1H2SB 1H2GA 4CH5A 2UUBB 4NXMB
chains in the Genus database with same CATH topology
3D36A 3UM7A 1GK9A 3KG2A 1DTOA 1MG1A 3OMIB 5EK0A 3T2MA 1VQ8V 3CXCU 4PA7A 2IH1C 4H33A 2XAQA 2ZXWC 4QPKA 1R6KA 5LHIA 2C2AA 2EINC 2HVKC 1Q7YW 2H94A 1NVPB 4R6ZA 4RAIA 2EBOA 5KA5A 2WLLB 1OCOB 5FL7G 3AG2C 4WFFA 5B1BB 5KUKA 2XAJA 3RW0A 3LUTB 5CBFA 5KUMA 1MOFA 2BOBC 1NH2D 3E8GA 2ITDC 3LDCA 5GW7A 1W2BU 1OCRB 1VQPV 1M1KW 2XAHA 1VQOV 5IYDO 3FB7C 3OAAG 1COWG 3CC2V 1FXVA 1JPXA 2DWDC 2Q67A 4RQEA 2ZXWB 3ZRXA 1M90W 3STZC 4PA3A 1GKFA 1K73W 3E35A 1Q81W 1VQ9V 3K04A 3SPHA 2V7QG 1RPRA 1AR1B 2Z3YA 3FB5C 3W7WA 1NJIW 2BOCC 4MVOA 1S76D 3VBBA 4WFHA 3F7YC 4MVZA 3SPCA 1VQ6V 3E8BA 3NXSA 2JK5C 1SRYA 4UVAA 3ASNC 2Q6AA 3G71V 2DYSB 3LNMB 4WFAV 3K0DA 4BIZA 5L3EA 1EZJA 4PA4A 2OTJV 2WLLA 4I9WA 2WLIB 2HR3A 3OR7C 4P9PA 2EILC 1YI2V 1PL0A 1F51A 3ZRWA 1NBMG 1NR1A 4WFGA 3AG3B 1K4DC 3CP1A 3MD0A 1BHBA 4DXWA 4JF3A 1KQSU 2HVJC 3CCLV 1FXKA 3JYCA 4RQFA 2ZD9A 3ZN1A 2JJ2G 2JEUA 1OZ0A 1JQ0A 4JASA 1AI7A 3ZMSA 1OCCC 3ZMUA 5IY5C 3W7TA 3OW2U 3VOUA 4QNHB 4P2ZA 1CEZA 1JVMA 2WPDG 1FXKC 4TT3G 5B3SB 3I55V 3CCRV 1OCZB 1YITV 3EFFK 1XL4A 1PD3A 4MVSA 1CPYA 2UXNA 3G4SV 1P7BA 3ZCCA 5HFMA 3EHBB 2LFSA 3K08A 3LSQA 1KC8W 4GX1A 2WLNA 4MVRA 1G4YB 2X6BA 4EKWA 4UXNA 2KB1A 2ZDIC 3K06A 4G2KA 2A0LA 3ZJZA 3FYIB 1ROPA 3ZMVA 4U7OA 1S0VA 2DQ0A 1F23A 2R9RB 2JJ1G 3GB7C 3OEEG 3F5WC 3IGAC 3AG1C 1BMFG 2IJKA 4FIPC 4UVBA 3OUSA 3CC7V 1YIJV 1H8HG 4WFBV 3CCJV 1M56B 1OCOC 3AG4C 3QO8A 1QLEB 2R9IA 1GO3F 4GT1A 4HYOA 4MTFA 1I5YA 4PDMA 2X6CA 4X89A 1SZTA 1UJWB 1BHAA 2B1GA 1THZA 2HJFC 2IJIA 1M9NA 2F43G 4Q20A 4F4LA 2OCCC 1VQLV 1E1RG 4ASUG 2A79B 1Q82W 1K5QA 2AHZA 1QLEC 3A0RA 3ABLC 5EBWC 4TSFG 4GX2A 5L3GA 3SYCA 4N21A 4QIWF 3TCUA 1V55C 3OGCC 1EFRG 2WWWA 1PNMA 2WAMA 5DM6V 1K33A 3B77A 1BL8A 3ABMB 4PA6A 4QE7A 1ENVA 2W6JG 5CBGA 4MVQA 5EBLC 1JX9A 4HAMA 1CP9A 3CMAV 5H6QA 5CMUA 1M57C 5EC2C 2XAGA 1DF4A 2GHYA 3CYOA 3B8MA 5B1OA 1SERA 3FKSG 3E83A 3ABMC 2ZQMA 3DGEA 4N23A 3E2EA 2ATKC 3ETDA 5CBHA 2HG5C 3FYEB 3R65A 4U7NA 1ORQC 2DWEC 1OCZC 2EIJB 3SYOA 1LNQA 3QO7A 4TWKA 3ABLB 1IXMA 2WLJA 3CCSV 1JCHA 3G6EV 1YJ9V 3LDDA 5IY5B 1YJWV 3LSSA 3RBZA 2OT5A 2A9HA 3W7XA 1MSWD 4RUEA 2QTOA 3CD6V 3JD2A 1TUEB 5B1AB 4GX0A 4MSWC 4MTOA 2YSUB 4PELA 4G28B 5CN0A 1NVPD 1M56C 2QM8A 1R3LC 3SYAA 1PKXA 3E8HA 5HFLA 1FXHA 3AG2B 1WPXA 2W6IG 4XDJA 3JD3A 5EBMC 4CZZA 1K92A 3E89A 3H01A 3I56V 4QJFB 4GX5A 3RVZA 1FS0G 2EILB 3P32A 1H38A 4H37A 4FMTA 3TK1A 1H8EG 2M7WA 1S72V 2D3OW 4XDLA 1QBZA 4R8CA 4JTDB 1KKDA 3BY6A 2WLIA 2JDIG 2EIKB 3W7SA 3D3IA 3K03A 4WF9V 3ZIAG 5BZBA 4XBFA 4ZBMA 2JIZG 3OR6C 1K97A 1V55B 3CC4V 4MTGA 1YTFD 5L3FA 1FXKB 4GCZA 5B3SC 3OUFA 3K9AA 3ABTA 1W0JG 4HZ3A 1J95A 4OXSA 3CPWU 3PJSK 2EZOA 4FK5C 5EC1C 1QVFU 3ABKC 4YXWG 2Y48A 1I5XA 1DF5A 2DYRC 2DQ3A 3BEHA 3F7VC 4MT8A 3ML0A 3CMEV 3HB3B 1K9MW 2WLMA 3AG4B 5H6RA 3X2QB 1VQ7V 1PNKA 2EIMB 2X7RB 3JD4A 1RM1B 5B1BC 3SPGA 3GWOA 4JAVA 3WG7B 4E2LA 2ITCC 5B1AC 1XL6A 4KP4A 3JD1A 4UV9A 4PDVA 1K3EA 2EINB 3CCQV 4DO2A 3OE7G 5H9CA 3ETGA 2B1IA 5B1NA 4BAYA 3OEHG 1QR9A 2DYSC 3IC7A 1YSCA 2ZDIA 3AEIA 2V1DA 4MVMA 1RPOA 1K5SA 2EZPA 3ZMTA 4X8AA 4RUFA 4Z1MG 1AROP 1GTOA 2DW4A 5L3CA 4PDLA 5DN6G 2K1EA 3SYPA 2QM7A 2XOKG 1E1QG 4WCEV 1N8RW 1KD1W 1AJNA 3OMNB 3M99B 1S3JA 4PDRA 1MABG 5IYCO 4BIUA 4LC1A 1R3KC 3QO5A 1B6QA 4KUMA 2Y69C 2YEVA 1OCRC 4P30A 1QVGU 3ZRVA 1WLEA 2XAFA 1Y4MA 5LHGA 1GMGA 2EIMC 4XDKA 2XASA 3K79A 4QPJA 1R6NA 4LBEC 3CCUV 2NNUA 3T4DA 3AG3C 2IU0A 2LFRA 2Y69B 4FPPA 1W0KG 2AHYA 3STLC 3WFVA 3E86A 4P9OA 4MW8A 1GM7A 2MK3A 2IJJA 1VQ5V 4R50A 2ZR3A 3OFNG 1GM8A 1P4RA 1K7DA 2CK3G 2P7TC 2WLHA 4X88A 5L3DA 3SJQC 2IH3C 2JEXA 2QE7G 1JJ2U 3FB8C 1F4NA 1S77D 1JOYA 3ASNB 1VQMV 1E79G 2EIKC 1DLBA 1V54B 1YHQV 4LCUC 2HKOA 3SPIA 4LP8A 1AI4A 3UKMA 2Q69A 1KECA 3K3WA 3SPJA 3IFXA 2NLJC 1QLNA 2ZR2A 5LGUA 1YJNV 5IYBO 1SESA 2OTLV 2PI5A 4ZKIA 5C93A 4QE9A 1QCEA 5LGTA 3ASOC 1AI5A 3T1CA 2XNDG 5LBQA 4J9ZB 5LHHA 3TETA 4MW3A 3JCZA 3OM3B 1AJQA 4FJCC 1R3JC 3OMAB 4WFEA 3T4ZA 5J9PC 3CCEV 1Q86W 4MS2A 2WSSG 1OCCB 2H8PC 2OCCB 4JTCB 3ABKB 4L87A 1K8AW 2QA4V 1NH2B 1HWYA 3K0GA 4PA9A 1VQNV 1F4MA 2B5UA 4MTXA 4G27B 2EIJC 1KP2A 1AJPA 1OHHG 4JTAB 3AG1B 1VQ4V 3ASOB 3QNEA 4I5SA 2QKSA 4MVUA 2LP7A 5KA6A 3W7UA 3LDEA 1S5HC 2IJHA 3ZMZA 3CCMV 4RO2A 1NKDA 1M57B 3CCVV 2P90A 1KP3A 1K34A 2FTKA 4BW5A 4JYCA 1L1FA 1V54C 2P67A 1QR8A 2EJRA 2UXXA 1AI6A 2GSMB 2PI4A 3FB6C 2IW5A 2W0FC 3MHSC 4JPRA 1GM9A 1NQTA 4JYBA 2Z5UA 1R73A 3ABUA 1FFTB 3MHHC 2IU3A 2X0LA 3E8FA 4JAUA 3HPLC 5CA3A 4UUJC 3WG7C 5LGNA 1NR7A 2X6AA 3P30A 1Y66A 4JGSA 3SYQA 5IDJA 1RM1C 1K4CC 2WLKA 2HLDG 1G8MA 1R3IC 3X2QC 4KFMA 3ZRSA 1PNLA 2QEXV 1YTFB 2DYRB 3ETEA 3ZN0A 2Q68A 3DTUB 5L3BA 4J9YB 4R7CA 1EBOA 1SETA 5E1AC 1VQKV 1ZWIC 3RVYA 4UVCA 2P6JA 2HFEC 3JD0A 2YEVB 1H2GA 3ZRWB 4CBCA 4UV8A 3B8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KB1 A;  3K03 A;  3K06 A;  3UM7 A;  5BZB A;  2A0L A;  4ZBM A;  3ZJZ A;  3OR6 C;  4MTG A;  3KG2 A;  5EK0 A;  3T2M A;  4QE9 A;  5B3S C;  2R9R B;  3GB7 C;  3OUF A;  3ASO C;  4PA7 A;  3F5W C;  4HZ3 A;  1J95 A;  2IH1 C;  4H33 A;  3IGA C;  4OXS A;  2ZXW C;  1KKD A;  3AG1 C;  3PJS K;  3T1C A;  2EIN C;  5EC1 C;  2HVK C;  3ABK C;  3OUS A;  4J9Z B;  3TET A;  4MW3 A;  1OCO C;  2DYR C;  3BEH A;  3AG4 C;  4MTF A;  3F7V C;  4PDM A;  1R3J C;  4HYO A;  4R6Z A;  4RAI A;  2X6C A;  4WFE A;  4X89 A;  2WLM A;  3T4Z A;  2WLL B;  5J9P C;  2HJF C;  4MS2 A;  3AG2 C;  4WFF A;  2H8P C;  4JTC B;  5KUK A;  4F4L A;  2OCC C;  5B1B C;  3RW0 A;  3LUT B;  3SPG A;  2A79 B;  5KUM A;  2BOB C;  5CBF A;  3E8G A;  3K0G A;  2ITD C;  3LDC A;  4PA9 A;  2ITC C;  2AHZ A;  1QLE C;  3ABL C;  5EBW C;  1XL6 A;  4G27 B;  5B1A C;  3FB7 C;  4GX2 A;  3SYC A;  2EIJ C;  4PDV A;  3TCU A;  1V55 C;  4JTA B;  2DWD C;  2Q67 A;  3OGC C;  3STZ C;  4PA3 A;  2QKS A;  4PA6 A;  4QE7 A;  1BL8 A;  4MVU A;  3K04 A;  3LDE A;  3SPH A;  1S5H C;  2DYS C;  5CBG A;  3FB5 C;  4MVQ A;  4RO2 A;  5EBL C;  2BOC C;  4MVO A;  4MVM A;  1M57 C;  4WFH A;  3F7Y C;  4MVZ A;  4X8A A;  5EC2 C;  4RUF A;  3SPC A;  3E8B A;  2JK5 C;  3ASN C;  2Q6A A;  4PDL A;  3LNM B;  2K1E A;  4BW5 A;  3K0D A;  3E83 A;  3SYP A;  3ABM C;  1V54 C;  4PA4 A;  2ATK C;  5CBH A;  2HG5 C;  3R65 A;  1ORQ C;  2WLL A;  4I9W A;  2DWE C;  1OCZ C;  2WLI B;  3FB6 C;  2EIL C;  3OR7 C;  4P9P A;  3SYO A;  1LNQ A;  4PDR A;  2W0F C;  4TWK A;  1R3K C;  4P30 A;  2WLJ A;  4WFG A;  2Y69 C;  2YEV A;  1OCR C;  1K4D C;  3LDD A;  4DXW A;  3RBZ A;  2A9H A;  4RUE A;  2QTO A;  2EIM C;  4XDK A;  2HVJ C;  3JYC A;  4LBE C;  3E8F A;  4GX0 A;  3AG3 C;  3HPL C;  4MSW C;  4MTO A;  4UUJ C;  2ZD9 A;  4G28 B;  3T4D A;  3WG7 C;  3STL C;  2AHY A;  2X6A A;  1M56 C;  1R3L C;  3E86 A;  4P9O A;  3SYA A;  4MW8 A;  3SYQ A;  3E8H A;  1K4C C;  1OCC C;  2WLK A;  4R50 A;  4XDJ A;  1R3I C;  5IY5 C;  3X2Q C;  4KFM A;  5EBM C;  3VOU A;  3ZRS A;  4P2Z A;  4QNH B;  1JVM A;  2P7T C;  2WLH A;  3E89 A;  4X88 A;  3SJQ C;  2IH3 C;  2Q68 A;  4GX5 A;  3RVZ A;  4J9Y B;  3EFF K;  3FB8 C;  4R7C A;  5E1A C;  1XL4 A;  4H37 A;  2EIK C;  1ZWI C;  4MVS A;  4LCU C;  3RVY A;  3SPI A;  2HFE C;  1P7B A;  4LP8 A;  3K08 A;  4XDL A;  3UKM A;  4GX1 A;  2Q69 A;  2WLN A;  4MVR A;  4R8C A;  3SPJ A;  3IFX A;  2NLJ C;  1G4Y B;  4JTD B;  2X6B A;  4EKW A;  4CBC A;  2WLI A; 
#chains in the Genus database with same CATH topology
 3L71 H;  1GK9 A;  5EK0 A;  3T2M A;  2IH1 C;  2XAQ A;  1R6K A;  2RDC A;  5LHI A;  2C2A A;  4B3M B;  1XNR B;  1NVP B;  5A9G A;  4JI7 B;  4J41 A;  2ZKO A;  4H44 B;  1Q90 D;  1Q6I A;  3LUT B;  4LFB B;  1MOF A;  4DV4 O;  3LDC A;  1QHT A;  1OCR B;  3OAA G;  1COW G;  3K57 A;  3CXH F;  2DWD C;  4RQE A;  4B3T B;  4I4T A;  3ZRX A;  1WA8 A;  1GKF A;  1MMM A;  3SPH A;  3SJA C;  2P4V A;  3FB5 C;  4TUY A;  5BY1 A;  1FFX A;  1VQ6 V;  4WFH A;  3F7Y C;  5GTI Z;  2JK5 C;  4UVA A;  2Q6A A;  3T1H O;  3LNM B;  2ZCE A;  1UFI A;  3AK2 A;  4EB6 A;  3E22 A;  4JI2 B;  5JCO A;  1F7Y A;  2VQE B;  2FB5 A;  3K58 A;  4UCS A;  4TQF A;  1YI2 V;  4P9P A;  3RN4 A;  4TV9 A;  1K4D C;  5DED A;  1TGO A;  1BHB A;  2HVJ C;  3CCL V;  3R66 A;  5FPO A;  4UB6 Z;  4IT5 A;  2L6L A;  2ZD9 A;  3ZN1 A;  2JEU A;  4JAS A;  2JS5 A;  3W7T A;  1FD9 A;  1JVM A;  2WPD G;  1FXK C;  4TT3 G;  5B3S B;  4DR1 B;  4O4H A;  3I55 V;  3EFF K;  1XL4 A;  1S5J A;  4X66 B;  5J2U B;  5HFM A;  1KC8 W;  1O9G A;  2ZNJ A;  3RYH B;  1VF6 A;  4PHZ A;  4BIO A;  2HEP A;  4G2K A;  1PV0 A;  2R9R B;  4GYC B;  3GB7 C;  4LF8 B;  4LF4 B;  3UO2 A;  1MZF A;  1IBL B;  3LSU A;  3IGA C;  2IJK A;  4F6R A;  4UVB A;  1IVS A;  3OUS A;  3CCJ V;  1KKC A;  1WAZ A;  1M56 B;  4I9Q A;  3QO8 A;  4MTF A;  4HYO A;  4I0X A;  1IBK B;  1UJW B;  1NTM H;  4I50 A;  1P84 F;  1VIB A;  3QG5 A;  4ASU G;  4LFA B;  1Q82 W;  1K5Q A;  5BR8 O;  3KKY A;  3A0R A;  5EBW C;  3JAW B;  4FLY A;  4GX2 A;  5L3G A;  4TOI A;  4QIW F;  3TCU A;  1V55 C;  3OGC C;  1EFR G;  4DV0 O;  3T1Y B;  5DM6 V;  1SKV A;  1JFF B;  1BL8 A;  3OGI B;  4MVQ A;  5H6Q A;  5CMU A;  1M57 C;  4B3T O;  1OJH A;  2XAG A;  2FYU H;  2GHY A;  1R1B A;  3L70 H;  2ZQM A;  3DGE A;  4DR5 B;  5LP6 C;  2ATK C;  3ETD A;  2E5L B;  2DWE C;  4AQY O;  4TWK A;  2WLJ A;  5K1P A;  1Q5O A;  1LUV A;  1YJW V;  3L74 H;  4CS4 A;  3VQV A;  1NT2 B;  1BCC H;  2QTO A;  5LOV B;  3APQ A;  4B3S B;  3VQY A;  1AR4 A;  3SYA A;  4X1K B;  3E8H A;  3ETQ A;  2AXT Z;  4FM2 A;  1WPX A;  4XDJ A;  2BCC H;  1X59 A;  5EBM C;  4JI3 B;  4CZZ A;  3E89 A;  2D2C B;  4X1I A;  3DSQ A;  3F5T A;  3ZHT A;  4FMT A;  1U96 A;  4PD4 F;  2EJ7 A;  4DR1 O;  1SA0 A;  2Q73 A;  3N2K B;  4JTD B;  1XNQ O;  2GDS A;  2WLI A;  3W7S A;  3D3I A;  5BZB A;  2JIZ G;  3OR6 C;  4IHJ A;  3JAK A;  5JJN B;  1W0J G;  4B7E A;  3PJS K;  2EZO A;  3DC6 A;  3ABK C;  2N05 A;  3A2F A;  1I5X A;  4MT8 A;  1YEW A;  3ML0 A;  3K59 A;  4GKK B;  1VQ7 V;  1S5L Z;  2QDO A;  2B9Z A;  3OTO O;  2E75 B;  3O9O A;  3JSN A;  2XT9 A;  5IJ0 B;  2QWQ B;  2BTQ B;  1BQ0 A;  4UV9 A;  3HKB B;  5EYP B;  1DK1 A;  3OE7 G;  1HNX O;  3BFR A;  1ZX3 A;  4NTW A;  1YSC A;  1N32 B;  1GTO A;  2ZIN A;  4ZOL A;  4PDL A;  4NXM O;  3SYP A;  4DR7 O;  2N74 A;  2HHH B;  1N8R W;  3BRC A;  3P3P A;  1MAB G;  4LC1 A;  2YEV A;  1QVG U;  3ZRV A;  2DMX A;  2XAF A;  3JCU Z;  5LHG A;  2KG7 B;  1GMG A;  2WA3 A;  2ARH A;  2A7W A;  2NN4 A;  2NNU A;  2Q9L A;  3VQW A;  1W0K G;  2AGA A;  5B66 Z;  4JI0 O;  2MK3 A;  2Q8V A;  3CEI A;  1K7D A;  3FAV A;  2VRZ A;  1XUQ A;  4JI5 O;  1JJ2 U;  5CA0 A;  3FB8 C;  3ASN B;  5EIB C;  1DLB A;  1V54 B;  4J7K A;  3SPI A;  3TJT A;  4LP8 A;  2Q69 A;  1KEC A;  1JJO A;  2IBZ H;  4JI4 B;  2NLJ C;  2E76 B;  3SDL A;  1SES A;  2OTL V;  2PI5 A;  2YIB A;  3UCS C;  1WP8 A;  2XTA A;  3CX5 F;  4O2B A;  4QE9 A;  1IBL O;  3ASO C;  1AI5 A;  2MW2 B;  4CH4 A;  5LOV A;  2AZ0 A;  2PGG A;  5LBQ A;  3H9V A;  4MW3 A;  3OM3 B;  1Q6U A;  2DOS A;  4FLZ A;  4DRX A;  4CS2 A;  4JTC B;  1K8A W;  2ZT9 B;  3OTF A;  1NH2 B;  3BA9 A;  1D5A A;  2BTO A;  1HWY A;  2B5U A;  1TA8 A;  4DV2 B;  2DE0 X;  4GKK O;  1OHH G;  1EN4 A;  5KA6 A;  4EFE A;  1Q3E A;  2IJH A;  4RO2 A;  2HHH O;  1IDS A;  1EN5 A;  3GVM A;  4LF8 O;  5C8Y B;  1K34 A;  2FTK A;  4BW5 A;  4LWS A;  1H2L A;  1GN2 A;  2P67 A;  2EJR A;  2AZ2 A;  2UXX A;  4DV7 B;  1AI6 A;  4CC5 A;  2PZS A;  2PI4 A;  3FB6 C;  1N34 O;  1SQP H;  1PL4 A;  2W0F C;  2V4D A;  3MHS C;  4GUN A;  4O4I A;  4UCT A;  4DR2 B;  3ZBH A;  1JA8 A;  3ABU A;  1A32 A;  2IU3 A;  4K3A A;  1SF9 A;  3AK1 A;  3IAY A;  1Y66 A;  5IDJ A;  4W4K A;  3EVK A;  5D5P A;  1SQG A;  4KFM A;  2QEX V;  1ZLZ A;  3ETE A;  1SQB H;  2K9P A;  1XI1 A;  5L3B A;  4J9Y B;  4E4E A;  1Y74 A;  1EBO A;  1SET A;  1VQK V;  3RYF B;  4LF6 B;  5AG2 A;  3N2G B;  2P6J A;  1P49 A;  3S3W A;  4YJ2 B;  3ZRW B;  2UUB O;  4WBN B;  2QKA A;  4UV8 A;  3D36 A;  4DV6 B;  4J80 A;  1XRE A;  1ZSP A;  1MG1 A;  1WP7 A;  1VQ8 V;  3CXC U;  2KG7 A;  4QPK A;  1Q7Y W;  2F66 C;  1G6U A;  2ZE5 A;  4TV9 B;  2PUS A;  4R6Z A;  2P06 A;  1XHZ A;  1I94 O;  1FJG B;  4WFF A;  5B1B B;  5KUK A;  1YDX A;  1MNG A;  3CRQ A;  1NH2 D;  2EUL A;  2GUZ A;  5GW7 A;  5A2Q N;  4ZOL B;  1M1K W;  3FB7 C;  3EXA A;  3L75 H;  2QGN A;  1M90 W;  4PA3 A;  3RYC A;  4KHP B;  1K73 W;  2LW7 A;  2V7Q G;  4PI0 A;  4DV6 O;  3W7W A;  2PF4 E;  1NJI W;  5J2T B;  4MVO A;  1S76 D;  3VBB A;  2BTQ A;  4LH7 A;  3G71 V;  5F2V O;  3CS5 A;  4BIZ A;  2ADQ B;  2ILM A;  4UCR A;  1P7G A;  4PA4 A;  2Y4U A;  1IXB A;  4LF5 B;  1XMO B;  2WLI B;  3OR7 C;  2CGO A;  1PM9 A;  4CH6 A;  1PL0 A;  3H1H H;  2RNB A;  4K8X A;  3AG3 B;  2Y0I A;  1QNM A;  2BE3 A;  3N2G A;  4B3R O;  4JF3 A;  2O57 A;  1FXK A;  2A06 H;  3JAK B;  2JJ2 G;  1OZ0 A;  5H2F Z;  1JQ0 A;  4DV4 B;  1AI7 A;  1OCC C;  5IY5 C;  4DR4 B;  3VOU A;  4QNH B;  4P2Z A;  3O65 A;  4ZI7 A;  3M8A A;  1PD3 A;  4FLT A;  1CPY A;  4JZG A;  3G4S V;  1P7B A;  3ZCC A;  2JGU A;  3EHB B;  3CRR A;  4MVR A;  1L0L H;  5FPR A;  2CTP A;  3CHX A;  2UXD O;  2VS0 A;  2KB1 A;  3ZJZ A;  1XQ8 A;  2Y0P A;  3H1K H;  3B40 A;  4LWS B;  5IYZ A;  4JI6 O;  2CTQ A;  4RWU A;  1NU1 H;  1H8H G;  1LR1 A;  4U3J A;  3AG4 C;  4GT1 A;  4DK1 A;  1HNW O;  1M9N A;  4Q20 A;  4F4L A;  2YC0 A;  2A79 B;  4YIO A;  3L73 H;  1QLE C;  4N21 A;  3TXQ A;  1VEW A;  2WWW A;  1XDC A;  4DV1 O;  1SQX H;  4C7U A;  1H2K A;  2WAM A;  2UXD B;  1K33 A;  3ABM B;  2NR5 A;  2CAZ C;  2W6J G;  2GV9 A;  1GN6 A;  5EBL C;  5KHH A;  3SR2 C;  1DF4 A;  1SER A;  3JAW A;  3FKS G;  4YJ3 A;  4PJ0 Z;  3SGI A;  3ABM C;  4Q6G A;  1XBL A;  1GH6 A;  2YDE A;  4JYY A;  1FPO A;  4U7N A;  4I0X B;  3SYO A;  4DK0 A;  3JAL A;  3KZI Z;  4O4J A;  1IXM A;  4BW9 A;  1YJ9 V;  1HNZ B;  4CH3 A;  5IY5 B;  5BMV A;  2F1M A;  5J2U A;  3W7X A;  2OT5 A;  2A9H A;  1BE3 H;  3CD6 V;  4ZHQ A;  1AP5 A;  1TUE B;  5B1A B;  1KU9 A;  4FZ1 A;  4LFB O;  4G28 B;  1M56 C;  2QM8 A;  2YXH A;  4IIJ A;  3WB0 A;  5JWP A;  1GAX A;  3KCY A;  3J7A U;  2FL4 A;  3D8C A;  1BT8 A;  3UT5 A;  4BR6 A;  1K92 A;  3H01 A;  3I56 V;  1HNX B;  4GX5 A;  1R6T A;  2EIL B;  3BVO A;  3P32 A;  3AG7 A;  1URF A;  1GN4 A;  2P22 C;  4H37 A;  2M7W A;  4OX9 B;  2D3O W;  3CRM A;  1XNQ B;  5LMN B;  5FNV B;  1KKD A;  3J80 N;  2JDI G;  2UXB B;  2EIK B;  4DW1 A;  4XBF A;  1CXZ B;  3E22 B;  1YTF D;  1BS3 A;  5BXZ A;  4GCZ A;  4FZ0 A;  3K9A A;  1AR5 A;  4HZ3 A;  3T1H B;  3CPW U;  4FK5 C;  5EC1 C;  1WNS A;  1QVF U;  3BEH A;  3F7V C;  1L8D A;  1XEQ A;  4OGQ B;  1HP8 A;  5H6R A;  3OTO B;  1PNK A;  2EIM B;  3JD4 A;  3K5N A;  1VF7 A;  4JI0 B;  4EB6 B;  5EYP A;  3C3T A;  3WG7 B;  2PYL A;  2JGD B;  4LF6 O;  5B1A C;  4KP4 A;  3HKE A;  2EIN B;  4J7Z A;  3ETG A;  1T5E A;  5B1N A;  1QR9 A;  3MDS A;  2WA4 A;  3HKD B;  2Q0O C;  4X20 A;  4MVM A;  4I55 A;  3BCC H;  3HKE B;  4Z1M G;  2M6Y A;  4YY3 O;  4DYL A;  2JGD A;  2K1E A;  2VWJ A;  1YF2 A;  4L8J A;  4IHJ B;  3CWB H;  3M99 B;  2OCH A;  3APO A;  3ICX A;  4BIU A;  1R3K C;  4P30 A;  1JMK C;  1OCR C;  4OPA A;  1Y4M A;  4JV5 O;  2XAS A;  1R6N A;  4LBE C;  3CCU V;  3T4D A;  4YIP A;  4LF7 O;  4UCO A;  4FPP A;  3STL C;  2AHY A;  3E86 A;  4P9O A;  1TUB A;  1I08 A;  2ZR3 A;  3OFN G;  4X1K A;  1P4R A;  2P7T C;  2L35 A;  4X88 A;  4DV0 B;  3T1Y O;  2QE7 G;  3ZHS A;  1S77 D;  1JOY A;  2F23 A;  1AVM A;  1E79 G;  2EIK C;  3RYI A;  3M7M X;  1TAE A;  1AI4 A;  3UKM A;  2YIA A;  3K3W A;  3SPJ A;  3IFX A;  2GBO A;  2ZR2 A;  3K5O A;  5LGU A;  4DR5 O;  4ZKI A;  2Q7E A;  2PY5 A;  4DR7 B;  1Y76 A;  3G6B A;  2E74 B;  3OD4 A;  4J10 A;  3TET A;  5LA6 B;  2UUC B;  4X64 O;  3JCZ A;  3PN1 A;  1AJQ A;  1R3J C;  3Q4H B;  4WFE A;  3T4Z A;  4DW0 A;  3CCE V;  4JI8 O;  2WSS G;  1OCC B;  1M5I A;  3SJC C;  3LNN A;  1XMQ O;  2QA4 V;  3K0G A;  3JAR B;  1SQV H;  2R72 A;  1MA1 A;  1AJP A;  1SZX A;  3RFR A;  5LMU O;  3AG1 B;  5TIS Z;  2YIB D;  4ICG A;  3ASO B;  4Z1V A;  2QKS A;  4I50 B;  3LDE A;  1S5H C;  3ZMZ A;  3I5D A;  2VQF O;  4F6R B;  1UPG A;  3S3X A;  2QWR B;  1V54 C;  3A8T A;  4HNA A;  1J5E O;  1Y6X A;  2E5L O;  2OIE A;  4YHH B;  4NXN O;  1NQT A;  1SQQ H;  1R73 A;  4ZIB A;  1PP9 H;  4TQD A;  3CJH A;  3E8F A;  4JAU A;  1HNW B;  5CA3 A;  4UUJ C;  5LGN A;  1NR7 A;  2X6A A;  3SYQ A;  1Y67 A;  4IGG A;  3DXR B;  3X2Q C;  1PNL A;  1TUB B;  1YTF B;  1XIL A;  4KHP O;  3RWR D;  2Q68 A;  3ZN0 A;  1SC5 B;  5LP6 A;  4R7C A;  5E1A C;  1ZWI C;  2CTW A;  4ZI7 B;  1N32 O;  1HW7 A;  4EEQ A;  3A0H Z;  4CBC A;  1SQF A;  3B8N A;  4LR3 A;  3L9D A;  2CTR A;  1DTO A;  3OMI B;  3OT7 A;  5KAF Z;  4H13 B;  4H33 A;  3B09 A;  4FFK A;  1GRJ A;  2EIN C;  2H94 A;  1FFX B;  3G80 A;  4RAI A;  2EBO A;  5KA5 A;  1HR0 O;  2WLL B;  5IT9 N;  2QKC A;  3FD9 A;  4X62 O;  1NTK H;  2XAJ A;  3VQX A;  2BOB C;  3E8G A;  4UCU A;  1W2B U;  1JR9 A;  1V9P A;  2RQ6 A;  4IYI A;  1JPX A;  4I55 B;  1XMQ B;  5J2T A;  2ZXW B;  3BAB A;  1WB8 A;  1RPR A;  1AR1 B;  3RYC B;  1LUW A;  4OX9 O;  4MVZ A;  3SPC A;  2KSD A;  3E8B A;  4DR3 B;  1XOU A;  4AQY B;  4WFA V;  3K0D A;  1ZAU A;  5L3E A;  1EZJ A;  4LFC B;  1XHX A;  2HR3 A;  2EIL C;  1F51 A;  1NR1 A;  4WFG A;  3CP1 A;  1FYJ A;  4DXW A;  2F93 B;  3K5L A;  1VF5 B;  5LYJ A;  2YXL A;  1KQS U;  1FJG O;  2P4K A;  3ZMU A;  2GTA A;  3OW2 U;  1Z5V A;  1AIL A;  3UO3 A;  1MSD A;  1WB7 A;  4IIJ B;  1CEZ A;  4KL1 A;  3CCR V;  3H1J H;  3BPZ A;  3RYF A;  4ZHQ B;  4DV2 O;  4MVS A;  2YXY A;  2FML A;  5BMV B;  3K08 A;  3UT5 B;  1G4Y B;  2X6B A;  4EKW A;  4CS3 A;  4UXN A;  2ZDI C;  5GON B;  2A0L A;  3FYI B;  2RJZ A;  1ROP A;  4U7O A;  1S0V A;  2DQ0 A;  1IBM O;  1F23 A;  3OEE G;  2JJ1 G;  1HNZ O;  4ABM A;  3CC7 V;  4DR2 O;  4O4J B;  4EFB A;  1QLE B;  2R9I A;  1GO3 F;  1I5Y A;  2X6C A;  1SZT A;  2JS3 A;  5KLV H;  1VAR A;  2HJF C;  3SJB C;  2F4V O;  1N34 B;  2F43 G;  1BHA A;  2VWK A;  1QU7 A;  2OCC C;  2Q7H A;  4TSF G;  3SYC A;  2F95 B;  1PNM A;  3JAS B;  2YS8 A;  2XUM A;  4DV1 B;  3B77 A;  4PA6 A;  1ENV A;  5CBG A;  4D7S A;  4HAM A;  1CP9 A;  3CMA V;  3WU2 Z;  2YIC A;  5EC2 C;  3B8M A;  3E83 A;  4DV5 O;  5EZY B;  5CBH A;  3HKC B;  3R65 A;  2F4V B;  1G1X B;  3QO7 A;  3CCS V;  1RSO A;  4UFZ A;  1WJZ A;  3LDD A;  4JI6 B;  1IZ3 A;  4X1Y B;  3RYI B;  4RUE A;  3D36 C;  3L72 H;  4JI8 B;  1VF6 C;  5CN0 A;  1R3L C;  1PKX A;  3NR7 A;  1FXH A;  3AG2 B;  3B2E E;  2W6I G;  4TV8 B;  4QJF B;  3RVZ A;  1NTZ H;  1FS0 G;  1BSM A;  5ITZ A;  3IJ4 A;  2CGN A;  1H38 A;  2CH7 A;  1S72 V;  5JH7 A;  4XDL A;  1QBZ A;  4R8C A;  1L0N H;  5JJJ B;  4I7Z B;  3DC5 A;  4K0K B;  3K03 A;  5KX5 A;  4FFB A;  1K97 A;  1B04 A;  1VP7 A;  1IBK O;  1FXK B;  5B3S C;  4D7T A;  5LXT A;  1N36 B;  3OUF A;  5FLX N;  1J95 A;  3WB2 A;  5JJE B;  1NI8 A;  4X20 B;  2Y48 A;  2DYR C;  2DQ3 A;  3CME V;  4LF5 O;  2H3O A;  2QJ1 A;  3HB3 B;  3KCX A;  1XMO O;  3AG4 B;  3X2Q B;  5KMG B;  5CB4 B;  1Q6H A;  2X7R B;  2UXC B;  4LF7 B;  1RM1 B;  5B1B C;  3SPG A;  4JAV A;  4E2L A;  2ZM6 B;  2ITC C;  1FKA O;  1TVK B;  1VMG A;  2XHB A;  4UB8 Z;  2GUZ B;  2RMK B;  4DO2 A;  4JI1 O;  3OEH G;  4BAY A;  3QVN A;  3IC7 A;  2ZDI A;  4J11 A;  1RPO A;  3ZMT A;  3C3S A;  4RUF A;  1N36 O;  4YY3 B;  5IJ0 A;  5DN6 G;  4X65 O;  1XNR O;  4AI8 A;  2XOK G;  4WCE V;  4LFC O;  1KD1 W;  2PTM A;  1AJN A;  3OMN B;  2QTS A;  1WN7 A;  1KBH A;  4JAA A;  4WBN A;  4NB5 A;  3QO5 A;  1B6Q A;  4KUM A;  2UUC O;  1ZL8 A;  1EN6 A;  2BSK A;  2EIM C;  3K79 A;  3AG3 C;  1O9H A;  4FFB B;  5IE9 A;  4MW8 A;  4O4L B;  4JYA O;  2IJJ A;  1VQ5 V;  1GM8 A;  3ZED A;  5L3D A;  2CDY A;  2LGW A;  2IH3 C;  5DEC A;  4HBN A;  2CH7 B;  3G67 A;  1B3Q A;  4X66 O;  5K1X A;  4X1I B;  4FM1 A;  2IM9 A;  3JAL B;  1YJN V;  1EZV H;  2RN9 A;  3UQ8 A;  3T1C A;  2OWO A;  1YXB A;  4O4I B;  5EIB D;  5JCO C;  5JQG A;  4DV7 O;  1HDJ A;  4MS2 A;  3CE2 A;  2H8P C;  2OCC B;  3ABK B;  4LNU B;  1W59 A;  2LGQ A;  4PA9 A;  1VQN V;  5E79 Z;  3D3Q A;  4G27 B;  5C8Y A;  4W4L A;  4I5S A;  5IWA B;  4FLX A;  2LP7 A;  3N27 A;  4QGP A;  3W7U A;  3JAT B;  4UCV A;  1AP6 A;  4LF4 O;  1KP3 A;  5IYZ B;  2DJV A;  4FLW A;  4LH6 A;  4PV1 B;  2Z0A A;  1L1F A;  3QF7 A;  4LNU A;  1IX9 A;  1QR8 A;  1D2D A;  1US6 A;  3MAQ A;  2GSM B;  3RGB A;  5JVD B;  2IW5 A;  2EX3 A;  4J7J A;  5JQG B;  2QR4 A;  3AK3 A;  4JPR A;  1GM9 A;  5BR8 B;  4JYB A;  2Z5U A;  1NS1 A;  1ZTE A;  1FFT B;  3MHH C;  4NVP A;  5CA0 B;  4O2B B;  1B06 A;  3ZHQ A;  4JGS A;  1RM1 C;  1K4C C;  4H0L B;  4BWA A;  2HLD G;  1R3I C;  2KKW A;  3ZRS A;  4O4L A;  1Z2G A;  4CC6 A;  2DYR B;  3ZHU A;  1RFY A;  5GTH Z;  2BSK B;  1EM1 A;  4UVC A;  4GKJ O;  3JD0 A;  4JI5 B;  2YEV B;  4DR3 O;  4FM0 A;  5LMN O;  4AHC A;  3UM7 A;  1YZB A;  4Z2W A;  4JI2 O;  1KYO F;  4FLV A;  4J42 A;  2VQE O;  3KG2 A;  2YI9 A;  4D6T H;  4PA7 A;  2ZXW C;  3P3N A;  1MZE A;  2HVK C;  1PPJ H;  2LW1 A;  1OCO B;  5FL7 G;  4X62 B;  3AG2 C;  3RW0 A;  5CBF A;  5KUM A;  3U10 A;  2ITD C;  2HJD A;  1VQP V;  4IL6 Z;  2XAH A;  1VQO V;  5IYD O;  3CC2 V;  3ZX6 A;  1FXV A;  1BQZ A;  3RT3 C;  2Q67 A;  3STZ C;  1N33 O;  3E35 A;  4NTY A;  1Q81 W;  1VQ9 V;  3K04 A;  2Z3Y A;  1WA8 B;  2BOC C;  3TGU H;  1H2M A;  3NXS A;  1SRY A;  3ZS8 C;  3ASN C;  1TVK A;  2DYS B;  2UUA O;  5LXT B;  2OTJ V;  3ZHV A;  2WLL A;  1NZ6 A;  4I9W A;  4PI2 A;  4DV3 O;  2ZE6 A;  4A5U B;  3ZRW A;  1NBM G;  4YJ2 A;  3MD0 A;  5KHG A;  1QQC A;  3FFQ A;  1M93 A;  2QSA A;  4JV5 B;  4DUY O;  1Y74 B;  3JYC A;  4RQF A;  3QTC A;  4LF9 B;  4TV8 A;  2QM4 A;  2RCV A;  4X64 B;  3ZMS A;  1SA0 B;  1SS3 A;  3CRC A;  2DN9 A;  1Z5W A;  1OCZ B;  1YIT V;  1DGS A;  1N0J A;  3GWK C;  5LP6 B;  2UXN A;  4X1Y A;  3LSQ A;  2LFS A;  4JI4 O;  4GX1 A;  2WLN A;  3DXR A;  4KXR A;  5JVD A;  2LJ2 A;  2OYQ A;  3K06 A;  3HKC A;  2ZIM A;  4F6E A;  3ZMV A;  1AB3 A;  3J81 N;  1IBM B;  3F5W C;  3AG1 C;  1BMF G;  4FIP C;  1YIJ V;  4WFB V;  1OCO C;  4PDM A;  5H5N A;  3JAT A;  4X89 A;  2B1G A;  1THZ A;  2IJI A;  4HNA B;  4O2A B;  2CUG A;  1VQL V;  4B7K A;  1E1R G;  4JZ2 A;  3U0Z A;  4LFA O;  2AHZ A;  2YUA A;  3ABL C;  2AW9 A;  4DR6 B;  4DRX B;  4QE7 A;  3THO A;  2R70 A;  3JAS A;  2YI8 A;  4DUZ B;  1JX9 A;  3K9S A;  2P5O A;  3A0B Z;  1I7F A;  2QWO B;  3CYO A;  5B1O A;  4DV3 B;  2HP8 A;  3CRA A;  4N23 A;  3E2E A;  2QWP B;  2HG5 C;  3FYE B;  5GON A;  4B3R B;  1ORQ C;  1OCZ C;  2EIJ B;  1LNQ A;  3ABL B;  4LF9 O;  1JCH A;  3G6E V;  2N04 A;  1WPB A;  3LSS A;  3RBZ A;  1MSW D;  3JD2 A;  4GZR B;  4DR4 O;  1RP3 B;  4GX0 A;  4MSW C;  4MTO A;  1Y76 B;  2YSU B;  4PEL A;  1NVP D;  3FAV B;  2Q0A A;  5HFL A;  4JI3 O;  3JD3 A;  4X9Q A;  3BAA A;  3JAM N;  2UU9 O;  3IC9 A;  3TK1 A;  2ETN A;  1H8E G;  4O4H B;  1ZL8 B;  2GTS A;  4OPH A;  5KHJ A;  4K0K O;  3BY6 A;  4FVM A;  4WF9 V;  3ZIA G;  4ZBM A;  1V55 B;  3CC4 V;  4MTG A;  5L3F A;  5LYJ B;  3ABT A;  2ADP A;  3K5M A;  4OXS A;  4B3M O;  3CSX A;  4YXW G;  4NR1 A;  1DF5 A;  4TUY B;  2KQX A;  2A3Q A;  1I94 B;  1K9M W;  2WLM A;  3BHP A;  5LMU B;  5D5Q A;  4B3S O;  1X4T A;  3GWO A;  4JYA B;  3HKB A;  1Q8I A;  2ZM6 O;  2LQT A;  1XL6 A;  3JD1 A;  4DUZ O;  4NYK A;  4PDV A;  1K3E A;  2VQF B;  3CCQ V;  3HKD A;  5H9C A;  1KB9 F;  2B1I A;  5CB4 A;  4JI1 B;  5KMG A;  2UXB O;  5KHK A;  2DYS C;  4I4T B;  3AEI A;  2V1D A;  4GKJ B;  1K5S A;  2EZP A;  5LL6 Y;  4X8A A;  4DR6 O;  1J5E B;  1ARO P;  3C90 A;  2DW4 A;  2UUA B;  5L3C A;  4YHH O;  4X65 B;  2QM7 A;  1E1Q G;  2Y4T A;  4AIL C;  2W0X A;  5KX5 B;  1S3J A;  1M4U A;  3N2K A;  4PDR A;  2R9A A;  5IYC O;  2PYJ A;  2Y69 C;  5JH7 B;  1KMI Z;  1WLE A;  4XDK A;  4QPJ A;  2JRI A;  5ITZ B;  2IU0 A;  1BZK A;  2LFR A;  2Y69 B;  3WFV A;  3HR0 A;  4IYH A;  1GM7 A;  5FNV A;  4R50 A;  3TXS A;  2OIG A;  2CK3 G;  2WLH A;  3SJQ C;  2JEX A;  1BGY H;  1F4N A;  1N0N A;  3CJH B;  1VQM V;  1YHQ V;  4LCU C;  2HKO A;  2ZNI A;  5CA1 A;  2Q4P A;  1RSO B;  2ODM A;  2UU9 B;  3H1L H;  1QLN A;  5IYB O;  2ZIO A;  5B5E Z;  1D5N A;  4DV5 B;  5EZY A;  5KHI A;  5C93 A;  1YCI A;  1KUQ A;  4JI7 O;  1QCE A;  5LGT A;  3B4S A;  4DUY B;  2XND G;  4J9Z B;  5LHH A;  2E3C A;  4FJC C;  3ZHR A;  1IUR A;  3OMA B;  5J9P C;  1I0H A;  2Q5Z A;  1Q86 W;  1JFF A;  1Q43 A;  2LO1 A;  4L87 A;  4B08 A;  5IJ9 A;  4NXN B;  4K8Z A;  2G38 A;  1F4M A;  4MTX A;  4YJ3 B;  2EIJ C;  4K35 A;  1KP2 A;  4JTA B;  3U11 A;  1VQ4 V;  3QNE A;  4MVU A;  5IWA O;  4GLX A;  3Q4H A;  3CCM V;  2CE4 A;  1NKD A;  1M57 B;  3CCV V;  2P90 A;  3WB1 A;  2YID A;  1YVW A;  3JAR A;  5KAI Z;  4JYC A;  1OV9 A;  5IJ9 B;  4O2A A;  4NTX A;  3JSL A;  3BA8 A;  4U3J B;  5LA6 A;  2JVD A;  3RYH A;  2ZE7 A;  4NKG B;  4FLU A;  1H2N A;  2X0L A;  3HPL C;  1FAF A;  3WG7 C;  3H1I H;  3P30 A;  1GN3 A;  3FX7 A;  2WLK A;  1G8M A;  2QWN B;  1HR0 B;  1N4C A;  1ZUQ A;  2UXC O;  5CA1 B;  1N33 B;  3CB2 A;  3DTU B;  2FKX A;  2ZE8 A;  4U3F H;  3RVY A;  2Q7G A;  2HFE C;  1U97 A;  1H2S B;  1H2G A;  4CH5 A;  2UUB B;  4NXM B; 
#chains in the Genus database with same CATH homology
 3D36 A;  3UM7 A;  1GK9 A;  3KG2 A;  1DTO A;  1MG1 A;  3OMI B;  5EK0 A;  3T2M A;  1VQ8 V;  3CXC U;  4PA7 A;  2IH1 C;  4H33 A;  2XAQ A;  2ZXW C;  4QPK A;  1R6K A;  5LHI A;  2C2A A;  2EIN C;  2HVK C;  1Q7Y W;  2H94 A;  1NVP B;  4R6Z A;  4RAI A;  2EBO A;  5KA5 A;  2WLL B;  1OCO B;  5FL7 G;  3AG2 C;  4WFF A;  5B1B B;  5KUK A;  2XAJ A;  3RW0 A;  3LUT B;  5CBF A;  5KUM A;  1MOF A;  2BOB C;  1NH2 D;  3E8G A;  2ITD C;  3LDC A;  5GW7 A;  1W2B U;  1OCR B;  1VQP V;  1M1K W;  2XAH A;  1VQO V;  5IYD O;  3FB7 C;  3OAA G;  1COW G;  3CC2 V;  1FXV A;  1JPX A;  2DWD C;  2Q67 A;  4RQE A;  2ZXW B;  3ZRX A;  1M90 W;  3STZ C;  4PA3 A;  1GKF A;  1K73 W;  3E35 A;  1Q81 W;  1VQ9 V;  3K04 A;  3SPH A;  2V7Q G;  1RPR A;  1AR1 B;  2Z3Y A;  3FB5 C;  3W7W A;  1NJI W;  2BOC C;  4MVO A;  1S76 D;  3VBB A;  4WFH A;  3F7Y C;  4MVZ A;  3SPC A;  1VQ6 V;  3E8B A;  3NXS A;  2JK5 C;  1SRY A;  4UVA A;  3ASN C;  2Q6A A;  3G71 V;  2DYS B;  3LNM B;  4WFA V;  3K0D A;  4BIZ A;  5L3E A;  1EZJ A;  4PA4 A;  2OTJ V;  2WLL A;  4I9W A;  2WLI B;  2HR3 A;  3OR7 C;  4P9P A;  2EIL C;  1YI2 V;  1PL0 A;  1F51 A;  3ZRW A;  1NBM G;  1NR1 A;  4WFG A;  3AG3 B;  1K4D C;  3CP1 A;  3MD0 A;  1BHB A;  4DXW A;  4JF3 A;  1KQS U;  2HVJ C;  3CCL V;  1FXK A;  3JYC A;  4RQF A;  2ZD9 A;  3ZN1 A;  2JJ2 G;  2JEU A;  1OZ0 A;  1JQ0 A;  4JAS A;  1AI7 A;  3ZMS A;  1OCC C;  3ZMU A;  5IY5 C;  3W7T A;  3OW2 U;  3VOU A;  4QNH B;  4P2Z A;  1CEZ A;  1JVM A;  2WPD G;  1FXK C;  4TT3 G;  5B3S B;  3I55 V;  3CCR V;  1OCZ B;  1YIT V;  3EFF K;  1XL4 A;  1PD3 A;  4MVS A;  1CPY A;  2UXN A;  3G4S V;  1P7B A;  3ZCC A;  5HFM A;  3EHB B;  2LFS A;  3K08 A;  3LSQ A;  1KC8 W;  4GX1 A;  2WLN A;  4MVR A;  1G4Y B;  2X6B A;  4EKW A;  4UXN A;  2KB1 A;  2ZDI C;  3K06 A;  4G2K A;  2A0L A;  3ZJZ A;  3FYI B;  1ROP A;  3ZMV A;  4U7O A;  1S0V A;  2DQ0 A;  1F23 A;  2R9R B;  2JJ1 G;  3GB7 C;  3OEE G;  3F5W C;  3IGA C;  3AG1 C;  1BMF G;  2IJK A;  4FIP C;  4UVB A;  3OUS A;  3CC7 V;  1YIJ V;  1H8H G;  4WFB V;  3CCJ V;  1M56 B;  1OCO C;  3AG4 C;  3QO8 A;  1QLE B;  2R9I A;  1GO3 F;  4GT1 A;  4HYO A;  4MTF A;  1I5Y A;  4PDM A;  2X6C A;  4X89 A;  1SZT A;  1UJW B;  1BHA A;  2B1G A;  1THZ A;  2HJF C;  2IJI A;  1M9N A;  2F43 G;  4Q20 A;  4F4L A;  2OCC C;  1VQL V;  1E1R G;  4ASU G;  2A79 B;  1Q82 W;  1K5Q A;  2AHZ A;  1QLE C;  3A0R A;  3ABL C;  5EBW C;  4TSF G;  4GX2 A;  5L3G A;  3SYC A;  4N21 A;  4QIW F;  3TCU A;  1V55 C;  3OGC C;  1EFR G;  2WWW A;  1PNM A;  2WAM A;  5DM6 V;  1K33 A;  3B77 A;  1BL8 A;  3ABM B;  4PA6 A;  4QE7 A;  1ENV A;  2W6J G;  5CBG A;  4MVQ A;  5EBL C;  1JX9 A;  4HAM A;  1CP9 A;  3CMA V;  5H6Q A;  5CMU A;  1M57 C;  5EC2 C;  2XAG A;  1DF4 A;  2GHY A;  3CYO A;  3B8M A;  5B1O A;  1SER A;  3FKS G;  3E83 A;  3ABM C;  2ZQM A;  3DGE A;  4N23 A;  3E2E A;  2ATK C;  3ETD A;  5CBH A;  2HG5 C;  3FYE B;  3R65 A;  4U7N A;  1ORQ C;  2DWE C;  1OCZ C;  2EIJ B;  3SYO A;  1LNQ A;  3QO7 A;  4TWK A;  3ABL B;  1IXM A;  2WLJ A;  3CCS V;  1JCH A;  3G6E V;  1YJ9 V;  3LDD A;  5IY5 B;  1YJW V;  3LSS A;  3RBZ A;  2OT5 A;  2A9H A;  3W7X A;  1MSW D;  4RUE A;  2QTO A;  3CD6 V;  3JD2 A;  1TUE B;  5B1A B;  4GX0 A;  4MSW C;  4MTO A;  2YSU B;  4PEL A;  4G28 B;  5CN0 A;  1NVP D;  1M56 C;  2QM8 A;  1R3L C;  3SYA A;  1PKX A;  3E8H A;  5HFL A;  1FXH A;  3AG2 B;  1WPX A;  2W6I G;  4XDJ A;  3JD3 A;  5EBM C;  4CZZ A;  1K92 A;  3E89 A;  3H01 A;  3I56 V;  4QJF B;  4GX5 A;  3RVZ A;  1FS0 G;  2EIL B;  3P32 A;  1H38 A;  4H37 A;  4FMT A;  3TK1 A;  1H8E G;  2M7W A;  1S72 V;  2D3O W;  4XDL A;  1QBZ A;  4R8C A;  4JTD B;  1KKD A;  3BY6 A;  2WLI A;  2JDI G;  2EIK B;  3W7S A;  3D3I A;  3K03 A;  4WF9 V;  3ZIA G;  5BZB A;  4XBF A;  4ZBM A;  2JIZ G;  3OR6 C;  1K97 A;  1V55 B;  3CC4 V;  4MTG A;  1YTF D;  5L3F A;  1FXK B;  4GCZ A;  5B3S C;  3OUF A;  3K9A A;  3ABT A;  1W0J G;  4HZ3 A;  1J95 A;  4OXS A;  3CPW U;  3PJS K;  2EZO A;  4FK5 C;  5EC1 C;  1QVF U;  3ABK C;  4YXW G;  2Y48 A;  1I5X A;  1DF5 A;  2DYR C;  2DQ3 A;  3BEH A;  3F7V C;  4MT8 A;  3ML0 A;  3CME V;  3HB3 B;  1K9M W;  2WLM A;  3AG4 B;  5H6R A;  3X2Q B;  1VQ7 V;  1PNK A;  2EIM B;  2X7R B;  3JD4 A;  1RM1 B;  5B1B C;  3SPG A;  3GWO A;  4JAV A;  3WG7 B;  4E2L A;  2ITC C;  5B1A C;  1XL6 A;  4KP4 A;  3JD1 A;  4UV9 A;  4PDV A;  1K3E A;  2EIN B;  3CCQ V;  4DO2 A;  3OE7 G;  5H9C A;  3ETG A;  2B1I A;  5B1N A;  4BAY A;  3OEH G;  1QR9 A;  2DYS C;  3IC7 A;  1YSC A;  2ZDI A;  3AEI A;  2V1D A;  4MVM A;  1RPO A;  1K5S A;  2EZP A;  3ZMT A;  4X8A A;  4RUF A;  4Z1M G;  1ARO P;  1GTO A;  2DW4 A;  5L3C A;  4PDL A;  5DN6 G;  2K1E A;  3SYP A;  2QM7 A;  2XOK G;  1E1Q G;  4WCE V;  1N8R W;  1KD1 W;  1AJN A;  3OMN B;  3M99 B;  1S3J A;  4PDR A;  1MAB G;  5IYC O;  4BIU A;  4LC1 A;  1R3K C;  3QO5 A;  1B6Q A;  4KUM A;  2Y69 C;  2YEV A;  1OCR C;  4P30 A;  1QVG U;  3ZRV A;  1WLE A;  2XAF A;  1Y4M A;  5LHG A;  1GMG A;  2EIM C;  4XDK A;  2XAS A;  3K79 A;  4QPJ A;  1R6N A;  4LBE C;  3CCU V;  2NNU A;  3T4D A;  3AG3 C;  2IU0 A;  2LFR A;  2Y69 B;  4FPP A;  1W0K G;  2AHY A;  3STL C;  3WFV A;  3E86 A;  4P9O A;  4MW8 A;  1GM7 A;  2MK3 A;  2IJJ A;  1VQ5 V;  4R50 A;  2ZR3 A;  3OFN G;  1GM8 A;  1P4R A;  1K7D A;  2CK3 G;  2P7T C;  2WLH A;  4X88 A;  5L3D A;  3SJQ C;  2IH3 C;  2JEX A;  2QE7 G;  1JJ2 U;  3FB8 C;  1F4N A;  1S77 D;  1JOY A;  3ASN B;  1VQM V;  1E79 G;  2EIK C;  1DLB A;  1V54 B;  1YHQ V;  4LCU C;  2HKO A;  3SPI A;  4LP8 A;  1AI4 A;  3UKM A;  2Q69 A;  1KEC A;  3K3W A;  3SPJ A;  3IFX A;  2NLJ C;  1QLN A;  2ZR2 A;  5LGU A;  1YJN V;  5IYB O;  1SES A;  2OTL V;  2PI5 A;  4ZKI A;  5C93 A;  4QE9 A;  1QCE A;  5LGT A;  3ASO C;  1AI5 A;  3T1C A;  2XND G;  5LBQ A;  4J9Z B;  5LHH A;  3TET A;  4MW3 A;  3JCZ A;  3OM3 B;  1AJQ A;  4FJC C;  1R3J C;  3OMA B;  4WFE A;  3T4Z A;  5J9P C;  3CCE V;  1Q86 W;  4MS2 A;  2WSS G;  1OCC B;  2H8P C;  2OCC B;  4JTC B;  3ABK B;  4L87 A;  1K8A W;  2QA4 V;  1NH2 B;  1HWY A;  3K0G A;  4PA9 A;  1VQN V;  1F4M A;  2B5U A;  4MTX A;  4G27 B;  2EIJ C;  1KP2 A;  1AJP A;  1OHH G;  4JTA B;  3AG1 B;  1VQ4 V;  3ASO B;  3QNE A;  4I5S A;  2QKS A;  4MVU A;  2LP7 A;  5KA6 A;  3W7U A;  3LDE A;  1S5H C;  2IJH A;  3ZMZ A;  3CCM V;  4RO2 A;  1NKD A;  1M57 B;  3CCV V;  2P90 A;  1KP3 A;  1K34 A;  2FTK A;  4BW5 A;  4JYC A;  1L1F A;  1V54 C;  2P67 A;  1QR8 A;  2EJR A;  2UXX A;  1AI6 A;  2GSM B;  2PI4 A;  3FB6 C;  2IW5 A;  2W0F C;  3MHS C;  4JPR A;  1GM9 A;  1NQT A;  4JYB A;  2Z5U A;  1R73 A;  3ABU A;  1FFT B;  3MHH C;  2IU3 A;  2X0L A;  3E8F A;  4JAU A;  3HPL C;  5CA3 A;  4UUJ C;  3WG7 C;  5LGN A;  1NR7 A;  2X6A A;  3P30 A;  1Y66 A;  4JGS A;  3SYQ A;  5IDJ A;  1RM1 C;  1K4C C;  2WLK A;  2HLD G;  1G8M A;  1R3I C;  3X2Q C;  4KFM A;  3ZRS A;  1PNL A;  2QEX V;  1YTF B;  2DYR B;  3ETE A;  3ZN0 A;  2Q68 A;  3DTU B;  5L3B A;  4J9Y B;  4R7C A;  1EBO A;  1SET A;  5E1A C;  1VQK V;  1ZWI C;  3RVY A;  4UVC A;  2P6J A;  2HFE C;  3JD0 A;  2YEV B;  1H2G A;  3ZRW B;  4CBC A;  4UV8 A;  3B8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...