5EBMC

Kcsa t75g mutant in the nonconductive state
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATGVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ebmC00
4LCUC 4JTCB 5EBMC 2EIMC 2DYRC 1M57C 2WLHA 2DWEC 2W0FC 3SYCA 3BEHA 4GX2A 5EBLC 3K04A 3SYOA 1P7BA 4WFFA 4PA6A 3FB5C 3ASOC 5KUKA 3STLC 1R3JC 4I9WA 4JTDB 1K4CC 4PDLA 4XDKA 4F4LA 3R65A 2KB1A 4HYOA 4MTGA 1G4YB 4J9YB 2ITCC 1V55C 5B3SC 3ZRSA 4P9OA 1JVMA 2WLKA 2AHZA 3EFFK 4X89A 2Y69C 1R3LC 2ITDC 3K08A 1BL8A 2BOCC 2WLNA 3SPCA 4H33A 1J95A 1KKDA 4KFMA 4DXWA 4X88A 3SPJA 3K0GA 1S5HC 4WFGA 3E8BA 2EILC 2AHYA 2Q6AA 3HPLC 3OUSA 4P9PA 3STZC 4EKWA 2R9RB 5BZBA 3RBZA 2HG5C 3SPHA 3KG2A 2A9HA 2HJFC 3VOUA 1XL6A 5IY5C 4MVSA 3T1CA 2EIKC 2X6AA 2ZD9A 2WLLA 4MTOA 5CBFA 4J9ZB 4WFHA 3K06A 3E86A 3UKMA 4MSWC 4ZBMA 3SPIA 3OGCC 4P30A 3PJSK 4MW8A 2H8PC 1LNQA 4H37A 1OCOC 1ZWIC 2P7TC 2WLJA 2Q68A 1QLEC 4PA4A 4R6ZA 3ASNC 4MW3A 1K4DC 2NLJC 2YEVA 4G27B 2WLIB 3IFXA 4QE7A 4GX5A 4PA7A 5J9PC 3F7YC 3WG7C 5KUMA 2OCCC 3GB7C 3FB7C 3K03A 3RW0A 4PA3A 3TCUA 2WLMA 3E89A 2JK5C 3E8GA 3FB8C 3F5WC 3LDCA 2X6BA 2IH1C 3LNMB 4MS2A 5CBHA 5EBWC 3RVYA 2ATKC 2WLIA 3E8HA 3TETA 3IGAC 4PDVA 4RUEA 4TWKA 4PDRA 4OXSA 2DYSC 2HVJC 4PA9A 4QNHB 4XDJA 3SJQC 3LDDA 3JYCA 4GX1A 4HZ3A 3LDEA 2QTOA 1R3KC 4MVZA 3AG4C 4MTFA 4G28B 4MVMA 3SYAA 4MVUA 4WFEA 2HVKC 2HFEC 3K0DA 4LP8A 2IH3C 4QE9A 4RUFA 1ORQC 4XDLA 4R50A 1OCRC 1M56C 3F7VC 2Q67A 3X2QC 2ZXWC 4UUJC 4X8AA 3OR6C 3T4DA 3ZJZA 4MVRA 2DWDC 3OUFA 5EK0A 3OR7C 4LBEC 5EC1C 2EINC 3AG2C 1OCZC 4PDMA 4RO2A 3SYPA 4GX0A 4CBCA 3ABMC 4R7CA 3T4ZA 3UM7A 2A0LA 3AG3C 4BW5A 4MVQA 2EIJC 3FB6C 5E1AC 2WLLB 3ABLC 1V54C 2K1EA 4P2ZA 5B1BC 3E83A 3SPGA 2Q69A 4RAIA 3T2MA 2X6CA 3LUTB 2A79B 4MVOA 1R3IC 2BOBC 2QKSA 3E8FA 4R8CA 3ABKC 1XL4A 1OCCC 3RVZA 5B1AC 5CBGA 5EC2C 4JTAB 3AG1C 3SYQA
chains in the Genus database with same CATH superfamily
5GW7A 1NI8A 2R9IA 2DWEC 5CB4A 1GN2A 4I9QA 3APOA 3NR7A 4PA6A 5B66Z 4ZHQA 3OEEG 2YICA 2CAZC 4OX9O 1FXKA 5B1BB 1PPJH 2Y69C 3JALA 3B40A 3S3XA 5LOVA 1AB3A 1GM8A 4O4IA 4GUNA 5B5EZ 4DR5B 4DV6O 2Q0AA 4JI2O 4TT3G 1IX9A 3BFRA 3SPHA 4FZ0A 1BMFG 1WNSA 2C2AA 1XMQB 4UCOA 1AR4A 3K5LA 1PP9H 2WLLA 2NR5A 5IJ0B 3AG4B 3UKMA 3OEHG 2GV9A 1QLEC 3AK3A 3ASNC 2PGGA 3RW0A 1LR1A 4QPJA 1Q90D 3JAMN 1E79G 4BAYA 5DN6G 1Z5WA 3BABA 1JPXA 4LFBO 3IAYA 5A9GA 1YDXA 5LGNA 4PI2A 4PV1B 4CS3A 1BQZA 1FPOA 3AG7A 4O4HA 5D5QA 4WFEA 3ZRWB 4DR4B 1AILA 1OCRC 1M56C 3VQVA 1K5QA 1H2NA 4TV8A 1HNZB 5LXTA 3ZMVA 2CTRA 2Y0PA 4CBCA 3L71H 1NVPD 2Y69B 4D7SA 3OD4A 3JASB 4DRXA 1V54C 3CCJV 4DV2O 4RAIA 1ZLZA 1VARA 4FVMA 4H0LB 2IJIA 2ZM6O 2F4VO 5EC2C 1HNZO 4YJ2A 5DEDA 1H2LA 2DN9A 1PNMA 5LA6B 2QSAA 2CUGA 2L6LA 4LFCB 3L70H 2KB1A 3R65A 2F4VB 5JQGB 1NQTA 4JYYA 4X89A 4JI0B 1FS0G 2QWRB 3ETDA 3JD1A 4KP4A 1PKXA 1N0NA 3STZC 4AQYO 2R9RB 1IBLO 1MSDA 4LWSA 4J80A 4X1YB 4ZOLA 5LYJB 3RYIA 1JR9A 3W7UA 3B8NA 4DR6O 2ADPA 1IDSA 4MSWC 3PJSK 4DV3O 4QE7A 1K73W 2H3OA 2QWQB 3IFXA 3MD0A 3I56V 3GB7C 3MHHC 5LMUB 3FB8C 3F5WC 3BA9A 4IHJB 4MS2A 2UXCB 2UUAB 3H1HH 1RSOB 5K1XA 4K0KO 4H44B 3SJQC 3K5OA 1WAZA 3CXHF 4PD4F 4DK1A 4DV5B 1Z5VA 1GKFA 5EZYB 3CHXA 1FD9A 3CB2A 3OR7C 5H6QA 3HB3B 4UV9A 4K0KB 4GLXA 3CMAV 3U0ZA 2EX3A 3G6EV 1HNXO 4BWAA 4FLXA 4MVOA 5DM6V 4E4EA 1OCCC 1GTOA 1YF2A 4JI0O 4OPAA 4MTXA 3P3NA 4DW0A 3CMEV 5JH7A 3ZRXA 3ZMTA 1MA1A 4YJ3B 2XASA 1P7GA 1XI1A 2FB5A 1SQPH 4ABMA 4NTYA 1BSMA 1B6QA 3N2GB 2E76B 3HR0A 1VF6C 1QQCA 4J9YB 5BMVA 1V55C 5B3SC 5C93A 1K33A 4DR3B 1AR1B 1FXKC 1WPBA 2EJRA 1JOYA 2EIMB 1FXVA 1Q5OA 1Y67A 4NB5A 4NTWA 2XOKG 3ZIAG 2XAGA 4X9QA 3K0GA 1BQ0A 4WFGA 1MABG 2QGNA 1KU9A 1KYOF 3OFNG 4I55A 4J7JA 5CN0A 3UT5A 2QWOB 2UUBB 1WA8B 2VWKA 3FX7A 1BHBA 1SF9A 5CBFA 4LF9O 1WJZA 3EHBB 4KHPB 4UVCA 2IJHA 1SETA 2Q68A 1WB7A 2E75B 4O4LB 4X64B 1FXHA 4AILC 5JVDA 3ZRWA 4LR3A 4U3FH 3LNMB 4B3RB 1KB9F 1WB8A 2LFRA 1NBMG 1PV0A 4L87A 3CP1A 2Q8VA 1SZTA 3AG3B 4EB6B 5CA0A 4LF8B 2YXYA 4JI4O 1Y74A 2RQ6A 4FFKA 4OPHA 4HNAA 2VS0A 4E2LA 4X8AA 5KHIA 3D3IA 3UM7A 1AR5A 1NTZH 2QM8A 3VQYA 3B09A 2YI9A 2Q69A 4K8XA 1S5JA 1TVKB 1M56B 5LGTA 4EB6A 4JI5O 3SGIA 3CJHA 1K8AW 2CGOA 4CS4A 3K59A 1XMOO 1LUVA 2F66C 4JI8O 1OZ0A 3IC7A 1XILA 5LGUA 4NXNO 4HYOA 1VQLV 3ABMB 3OAAG 4JASA 1XREA 1N34B 1S72V 4ZIBA 4UCTA 5B1OA 3JATA 5JJEB 1KKDA 4KFMA 1FFTB 4X20A 3OTOO 3MDSA 1WA8A 1QLEB 1UFIA 2EILC 1QBZA 4ZKIA 2P90A 2DYRB 2X7RB 3RYCB 1NKDA 1XL6A 2X0LA 4MVSA 4X66B 3GWKC 2GDSA 3K06A 5KHJA 3J7AU 3OGCC 3UO2A 3BRCA 4H37A 3FAVA 3ZHRA 4DR2O 4O2AB 1VQ9V 1YVWA 2HHHB 4GCZA 5LMUO 1R1BA 3DSQA 3H1LH 1KMIZ 3TETA 1EN4A 1I5YA 2PYJA 4PDRA 2E74B 4LNUA 2JDIG 1EZJA 2F43G 4B3SO 4MVMA 3NXSA 4GKKO 4RUFA 1XOUA 4FLYA 2WSSG 4O4LA 1DK1A 1JFFA 1ZTEA 2PF4E 5EK0A 4IIJA 4CZZA 1ZUQA 1DF5A 4P2ZA 3T2MA 4EEQA 5K1PA 5EZYA 3QG5A 4X64O 3OTFA 2CGNA 3GVMA 2ZXWB 5KHGA 1N32B 2B5UA 3R66A 1CP9A 4KUMA 4B3TB 2PI5A 3CCEV 4JI3B 3UO3A 4FFBB 1JX9A 1Y66A 1Q81W 1OCZB 4JI2B 2YIBA 3IJ4A 3VQWA 4DV4O 1JQ0A 1H2KA 1F4NA 2E5LO 2IM9A 5F2VO 4Q20A 1HP8A 3E22B 3HKEB 3DC5A 4TV9B 3KCXA 2A9HA 3B77A 1FFXB 2XAFA 2DYSB 3F5TA 2Z5UA 1K92A 4J9ZB 4FMTA 3M7MX 3H1KH 1SRYA 4UCSA 1K4DC 4DV6B 2KKWA 2ZR2A 5IYDO 3LDCA 3ML0A 4I50A 2X6BA 3BHPA 4BIUA 4LF7O 3IGAC 3L74H 4TWKA 1E1RG 2UUCB 2HVJC 3Q4HB 2ODMA 3LDDA 3JSLA 5IE9A 5KMGA 3KZIZ 1ZX3A 4I55B 4QE9A 3JASA 2OYQA 4JYAB 2YIDA 2YEVB 3ASNB 4GZRB 4LBEC 3AG2C 1WN7A 5JWPA 4FLTA 3T1HO 1XBLA 2WPDG 2BOBC 5EYPA 1NS1A 3BPZA 4GKJB 2KSDA 1Q82W 2Z3YA 2GTAA 3K9SA 2W0FC 5JJJB 2WA4A 3BEHA 1AI4A 1JJOA 1KBHA 3STLC 1OJHA 2CH7A 1H2MA 2LP7A 1I94B 1SQXH 1AI6A 4F4LA 2D3OW 2Q5ZA 2R70A 4C7UA 5IWAO 4MTGA 4B3RO 4JI3O 2LO1A 3TK1A 4J7KA 4YY3O 1VQ7V 3PN1A 5J2UB 1I5XA 4X1IA 1S77D 3CRAA 2DOSA 1J95A 4H33A 4JI7O 4X88A 3G6BA 3HKBA 1G8MA 1SQGA 4JAVA 1IXMA 3H1IH 1VQMV 3RGBA 3APQA 4O4JB 4X66O 4KHPO 4AI8A 5ITZA 2X6AA 3HKBB 4DRXB 5E79Z 1M4UA 1QVFU 4X62O 5LXTB 4FJCC 4MW8A 4IT5A 1HR0B 1G6UA 5J9PC 1BS3A 2BTQB 2JGDB 2ZE5A 1O9GA 2IH1C 1R73A 3CCRV 4JZGA 1N36B 5CMUA 1YEWA 2ZE6A 2ATKC 3RVYA 2NNUA 2ZDIC 2LFSA 3OT7A 3CSXA 3N27A 2JEXA 4QNHB 4LFBB 4TV9A 4DO2A 4MVZA 3HKDA 1HWYA 1URFA 4I7ZB 3ABKB 1H8EG 2QE7G 3I5DA 3UQ8A 3X2QC 2HKOA 3FYIB 3JD2A 4PDMA 4RO2A 1LUWA 2VWJA 4LF6B 4I4TB 3S3WA 2WLLB 5IJ0A 1XMOB 3HKCB 4YY3B 3J80N 1EZVH 3A0BZ 4DR3O 5A2QN 2A06H 3AG1C 1Y76A 4JI8B 3WB1A 1M57C 1AJPA 4JPRA 4WFFA 3JALB 2AW9A 3QO5A 4XDKA 3O65A 2ITCC 4EFEA 4YIOA 1G1XB 2YIAA 2WLNA 4NVPA 2CTQA 3ZCCA 3P30A 2IU0A 4ZI7A 4UB6Z 4PI0A 1CPYA 3ABTA 3DXRA 3ICXA 1Q6HA 5BR8O 2CTWA 2QR4A 2WLIB 2AGAA 4YHHB 4GX5A 3Q4HA 2ZNIA 3ZHQA 4O2BA 1S0VA 4UCRA 1YHQV 1VEWA 2WLIA 2P4KA 4HBNA 2QEXV 2XAJA 4X65O 4GYCB 3WU2Z 2XHBA 1YJ9V 1F7YA 5EIBC 3C3SA 2KG7B 2Q7HA 1XQ8A 2Y4TA 2VQFB 4DV7B 2M7WA 2ZXWC 3WG7B 3L72H 3OGIB 4N21A 4AHCA 1VIBA 3T4ZA 2XAQA 3SPGA 1GN6A 3K58A 2QWNB 4K3AA 5FLXN 3OM3B 5LP6B 5IYBO 5EBMC 2DYRC 4UVAA 3CJHB 1RM1C 2JIZG 2HEPA 1RPOA 1P7BA 4YXWG 5L3EA 3CRCA 3ASOC 1VQ5V 4DR4O 4B7KA 1YJNV 2OT5A 1P84F 3ZHVA 4CH3A 1YI2V 3QNEA 2QDOA 5GTIZ 1I94O 5D5PA 1X59A 5C8YA 1F51A 2ITDC 3JD4A 4UVBA 3G4SV 2H94A 1AP6A 3AK2A 2QTSA 1KP2A 5KA5A 1IBMB 1TA8A 1VF6A 2HHHO 2FMLA 3TGUH 2HJFC 5IY5C 4RWUA 2YS8A 4X1KB 2F1MA 4JV5B 2P67A 1TAEA 3E86A 1QR8A 2ZR3A 1M1KW 1FJGB 4IGGA 4LC1A 1ZL8A 5CA1B 1IURA 4MW3A 3RYHA 4LNUB 1TGOA 3E89A 1OCRB 1QVGU 1MZEA 4UCUA 2UUCO 3RFRA 1FJGO 4DUYB 5IDJA 2UUAO 4J42A 3CD6V 5LA6A 1UPGA 3JYCA 4DXWA 5HFLA 3BY6A 4TQFA 3A8TA 4N23A 3ZN1A 4DV2B 3JAKB 5LMNB 4MVRA 1GMGA 3OUFA 2XT9A 3AK1A 2Y48A 1VQ8V 4JAAA 5FNVB 1MMMA 4BW9A 1BHAA 2N04A 1H2GA 3FB6C 4WF9V 4WBNA 3L73H 3QTCA 3RYCA 3ABKC 3JATB 2JRIA 3W7SA 3T1YO 3K3WA 3N2GA 2EIMC 1THZA 2WLHA 1HR0O 2P6JA 1BT8A 5EBLC 3K04A 3QF7A 5IT9N 5IYZB 5JH7B 1VQKV 5JVDB 1S5LZ 1KUQA 4JTDB 3RYHB 1G4YB 1MG1A 4FM2A 2LW7A 2L35A 2JGDA 4CH5A 2A7WA 4DR7B 2QJ1A 3BCCH 4X1KA 4UB8Z 4FIPC 1JA8A 1J5EO 4QIWF 4ASUG 2W6JG 1AP5A 5EIBD 1R6TA 1Z2GA 2EIKC 3CCMV 5LHGA 2E5LB 1XDCA 4X1IB 4B08A 1SQBH 3M99B 2H8PC 4NXMO 5GONB 3D3QA 1H38A 1OCOC 2BSKB 4R6ZA 5FPOA 1X4TA 2VQEO 1JCHA 1XHZA 2XAHA 3QO8A 2IW5A 3JAWB 1AVMA 2AZ0A 3ABLB 2EIJB 4NTXA 5KHKA 4X65B 4YIPA 4PJ0Z 2HJDA 4TSFG 5GTHZ 4ZI7B 5IYZA 5CB4B 4DV5O 2LQTA 4GX1A 3LDEA 4CH6A 2ZE8A 1W2BU 1AJQA 4LP8A 1N33O 2IH3C 5KX5B 4XDLA 3W7TA 4R50A 2XNDG 1SERA 3CRRA 4JV5O 4UV8A 1M5IA 2KQXA 5EC1C 4YHHO 1D5AA 1N34O 1QR9A 2KG7A 4GKKB 1NZ6A 2A0LA 2ZQMA 2GUZB 4BR6A 2YXHA 3P3PA 3CCVV 5LMNO 2A79B 1V9PA 1D5NA 1XL4A 2PTMA 2CTPA 2BCCH 4O2BB 4FFBA 3I55V 4YJ2B 1B3QA 1HDJA 2RCVA 1IBKB 4U7NA 2ZCEA 4TOIA 1AI7A 2OTLV 3M8AA 1BGYH 1SA0B 4PDLA 2V1DA 4BIOA 2E3CA 4JZ2A 3SR2C 4DR6B 4P9OA 4F6EA 4B3MO 2EIKB 5L3FA 4A5UB 2OCCB 1M9NA 4IIJB 3ZEDA 2FKXA 1TUEB 4LF4B 3HKDB 3SJBC 3BAAA 5LYJA 4X1YA 1NTKH 4O4HB 1JFFB 2ZIOA 1RFYA 4Z2WA 2IJJA 4ICGA 2JEUA 5B1AB 5TISZ 3RN4A 3CC4V 2FTKA 4TUYB 2QM4A 3B2EE 2GBOA 3OE7G 4AQYB 2N05A 5IYCO 2RJZA 2BTQA 4QGPA 4G27B 4LF5B 2P5OA 3F7YC 1Q6UA 3K03A 2UU9B 1F23A 2WLMA 1YXBA 1U97A 2N74A 3E8GA 1KQSU 3RYFB 1Q86W 1Q7YW 4O2AA 1TVKA 3E8HA 2OCHA 4DW1A 4DV3B 3QO7A 1FAFA 1VF5B 2JS3A 3RYFA 3VOUA 2QTOA 1R3KC 1Q43A 3FD9A 2HFEC 3K0DA 5B1NA 1GO3F 2UXDO 5LP6A 1N36O 2Q7EA 1P49A 2ZNJA 5FPRA 4X20B 1ZAUA 2ARHA 2GTSA 2DQ0A 3MHSC 4NXMB 2K1EA 2OIGA 4QPKA 3U10A 2X6CA 1R6NA 4ZOLB 2PYLA 1SQQH 4JTAB 1T5EA 3SYQA 2DE0X 1L1FA 1NR1A 4LF4O 1W0KG 4ZHQB 4GX2A 1MNGA 3RT3C 4NR1A 1QHTA 4IYIA 2DMXA 1IBMO 3ZRSA 4W4KA 4DUYO 5FL7G 2HLDG 4HAMA 5IWAB 3K08A 1NT2B 4JI5B 1GK9A 1VQNV 1OCCB 3FAVB 4DR5O 3G71V 5H5NA 2UXBB 1I08A 3E2EA 4FM1A 1ROPA 1WP7A 4FZ1A 2ADQB 4MTOA 1S3JA 3SPIA 4I50B 1S76D 4JI6O 2W6IG 1RP3B 1ZWIC 1US6A 3ZX6A 2B1IA 2UXXA 4PA7A 4DR1B 4LF8O 4LH7A 3FB7C 3TCUA 1GN4A 1EFRG 2YI8A 2Q73A 4OXSA 3QVNA 4PHZA 1BZKA 4XDJA 5CA3A 1RM1B 1D2DA 2ZT9B 1SC5B 2HVKC 3THOA 1YTFB 1IBLB 3CCLV 1YCIA 4JYBA 3SJCC 1QU7A 1SESA 3OR6C 2UXDB 3CCUV 4XBFA 4HNAB 4J10A 4O4JA 2QM7A 2ZDIA 3ABMC 4J11A 4DYLA 3ABUA 4MVQA 4B7EA 5B1BC 2F95B 1K97A 3JCUZ 3EVKA 4B3TO 2QKSA 3CC7V 4L8JA 3RVZA 3D36C 4FPPA 1VP7A 4JI1O 1K3EA 2GSMB 3K5NA 1R6KA 5LOVB 4H13B 1N8RW 2UXBO 3SYOA 4X62B 2JS5A 1PD3A 1R3JC 4Z1VA 1FXKB 1GH6A 1MSWD 5H6RA 1FYJA 2YXLA 1ZSPA 4CH4A 1ZL8B 3ZHTA 1BL8A 4RQEA 1S5HC 2Q6AA 2AHYA 1VMGA 1K34A 1U96A 4GKJO 2ILMA 4I0XB 4Z1MG 3D36A 2V4DA 1SZXA 1Y4MA 1IBKO 2ZE7A 1EBOA 2YIBD 3OTOB 1Y6XA 2B9ZA 2M6YA 2YSUB 4LF9B 1GRJA 1L0LH 1PNKA 2WLJA 4LFCO 2ZIMA 1DLBA 3D8CA 2PI4A 3L75H 5KUMA 4I5SA 3AG1B 1BE3H 4CC6A 1NTMH 4YJ3A 5CBHA 3JSNA 3WB0A 4JF3A 4PDVA 1K7DA 2DYSC 2GUZA 2QKAA 1OHHG 3TXQA 1NH2B 1EN5A 4EFBA 2IU3A 2QWPB 1VQ4V 2AXTZ 4D6TH 4UFZA 3ZN0A 2UXNA 3CYOA 2Q67A 4LWSB 4DV1B 4KXRA 2WA3A 1GM9A 1W59A 1AJNA 1NU1H 4R7CA 4NXNB 4LF7B 2CDYA 3C3TA 4U3JA 3CXCU 5LL6Y 1KECA 3AG2B 1YSCA 5CBGA 3UT5B 4JTCB 2JJ1G 1DTOA 2EZOA 3ZMZA 4CC5A 1M93A 3B4SA 1Y76B 1QCEA 3G80A 1CEZA 1FKAO 2RNBA 2YUAA 3WB2A 1IZ3A 1K4CC 2AZ2A 2LW1A 1ENVA 5HFMA 3K57A 2Q7GA 1QNMA 1JJ2U 5AG2A 4JI7B 4WFBV 3EFFK 5DECA 2BOCC 2ZM6B 4LF6O 4LFAO 1CXZB 2IJKA 2HR3A 3DXRB 4FM0A 3CS5A 1Y74B 3E8BA 2XUMA 3TXSA 5L3CA 3CCQV 5LHHA 1SS3A 4D7TA 3K5MA 3MAQA 1XHXA 3LSQA 2UU9O 3AEIA 4ZBMA 4Q6GA 5LHIA 1WP8A 5L3BA 3OMIB 2RN9A 3KCYA 4PA3A 2LJ2A 4CS2A 5BXZA 5LP6C 1XNRO 4U7OA 3A2FA 2R9AA 2LGWA 1VF7A 5KAIZ 3LNNA 4NKGB 1NJIW 3SDLA 2UUBO 3AG4C 3JARA 2JJ2G 3SYAA 3ZMSA 2JVDA 4MT8A 1O9HA 4J7ZA 4JGSA 4UUJC 3ZJZA 2QA4V 2DWDC 1V54B 2R72A 3JCZA 4DUZO 2W0XA 2EINC 3SYPA 1HNWB 4GX0A 1MZFA 1YJWV 2B1GA 5KX5A 3IC9A 4BW5A 5E1AC 2MW2B 5KA6A 4DK0A 3LUTB 1NVPB 3OW2U 2Q4PA 2FL4A 3VQXA 3SYCA 1J5EB 1M90W 3H1JH 3P32A 3WFVA 2P22C 4FLZA 2YC0A 5GONA 2WLKA 3CE2A 3H9VA 2LGQA 3VBBA 1JMKC 2BSKA 1KC8W 3HPLC 2PUSA 2Q9LA 4P9PA 5JCOA 3CC2V 4K8ZA 2ZKOA 3CCSV 1WPXA 2WAMA 3BA8A 3FKSG 2ETNA 2ZD9A 1KD1W 1XMQO 1BCCH 3RWRD 1LNQA 1PNLA 4TV8B 1VQ6V 1I7FA 1XNQB 3A0HZ 3ETEA 5KHHA 1XEQA 3DTUB 4QJFB 2HP8A 4J41A 1N4CA 1GAXA 3CEIA 4JI4B 2F93B 3LSSA 1PL0A 2G38A 3RYIB 2EINB 1N32O 1KKCA 1UJWB 2F23A 2VQFO 4DV7O 4HZ3A 4MTFA 2ZINA 1M57B 2OTJV 1A32A 1EN6A 3N2KB 2BE3A 2UXCO 1ORQC 1Q8IA 3UCSC 2D2CB 1Q6IA 3HKEA 5ITZB 5B3SB 1NR7A 5J2TA 1I0HA 2BTOA 2EIJC 4GT1A 4K35A 4DUZB 4G2KA 4TQDA 2EULA 3H01A 1IVSA 1RSOA 5KMGB 3CPWU 3J81N 4NYKA 5H9CA 2EILB 1QLNA 3LSUA 1OV9A 3ETQA 2EZPA 4F6RA 1HNXB 1W0JG 1AROP 1XUQA 5CA0B 5KUKA 3ETGA 5JJNB 1NH2D 4OGQB 3K79A 3K9AA 5L3DA 5IJ9A 3OMAB 2CH7B 2DQ3A 4DV4B 2AHZA 1YITV 4LFAB 2EJ7A 2YDEA 3CWBH 3SPCA 4WFAV 4DR7O 4JI6B 4LF5O 3EXAA 1GN3A 3L9DA 3SPJA 2CK3G 4FLWA 2NN4A 2K9PA 5EYPB 3FYEB 3ZHUA 2HG5C 1H2SB 5L3GA 3T1CA 1V55B 4WBNB 3ZRVA 2QKCA 2Q0OC 3JD3A 3C90A 1HW7A 3JAWA 4IL6Z 2Y0IA 3B8MA 4W4LA 1IXBA 2YEVA 1B06A 2NLJC 3ASOB 2P06A 5JQGA 3ZMUA 4F6RB 2OCCC 3SJAC 1XNRB 1Q3EA 2Z0AA 4DV0O 2JK5C 3JARB 5EBWC 2FYUH 2OWOA 5LBQA 2A3QA 2Y4UA 1YTFD 1DGSA 1K5SA 1N33B 4G28B 3X2QB 1H8HG 4DR1O 2DJVA 2IBZH 3W7WA 3FFQA 1B04A 4TUYA 3T4DA 3ZS8C 1OCZC 2RMKB 1HNWO 5KAFZ 3GWOA 3DGEA 3AG3C 4UCVA 4BIZA 1SQVH 4JYCA 1VQPV 1FFXA 3CX5F 3T1HB 5IJ9B 5B1AC 4LCUC 1MOFA 3E22A 4RQFA 2PY5A 3OMNB 1SQFA 4DV1O 4OX9B 3FB5C 1SA0A 4I9WA 4JYAO 1EM1A 2VRZA 4IHJA 3KKYA 2P4VA 1AI5A 3TJTA 4FLVA 1JVMA 1L0NH 1R3LC 2MK3A 4I4TA 1P4RA 5KLVH 4U3JB 3OUSA 4EKWA 4DV0B 5BZBA 1SKVA 3RBZA 3KG2A 1K9MW 3G67A 1L8DA 5H2FZ 4O4IB 4WFHA 4FLUA 3W7XA 4P30A 1N0JA 3A0RA 3JD0A 2VQEB 1KP3A 2P7TC 4PA4A 3ZHSA 3U11A 1GM7A 2DW4A 3BVOA 1YZBA 1RPRA 4B3SB 3WG7C 1DF4A 5JCOC 1F4MA 5CA1A 1E1QG 4PELA 1PL4A 1OCOB 2GHYA 2WWWA 2RDCA 5BR8B 2CE4A 2EBOA 4IYHA 3DC6A 4RUEA 5IY5B 5BY1A 4PA9A 1COWG 5FNVA 4DR2B 4MVUA 2OIEA 1TUBB 1YIJV 2JGUA 4JI1B 2XTAA 1VQOV 4B3MB 3CRMA 3JAKA 3E35A 3ZBHA 3T1YB 4WCEV 1PM9A 3F7VC 1WLEA 3HKCA 5C8YB 1XNQO 1TUBA 3CRQA 4KL1A 5J2TB 4FK5C 5BMVB 2PZSA 4UXNA 4JAUA 3O9OA 3N2KA 3ABLC 3E83A 5J2UA 2V7QG 1R3IC 3E8FA 4R8CA 4I0XA 2O57A 4LH6A
chains in the Genus database with same CATH topology
5GW7A 3K3WA 2ZXWB 4JTCB 2EIMC 1THZA 2JJ1G 1DTOA 2EZOA 2R9IA 3ZMZA 2WLHA 2B5UA 2P6JA 1QCEA 2DWEC 1CP9A 1CEZA 4KUMA 5EBLC 3K04A 2PI5A 4PA6A 3CCEV 1VQKV 3OEEG 4JTDB 1JX9A 1K4CC 1Y66A 5HFMA 1ENVA 1Q81W 1OCZB 1G4YB 1JJ2U 1MG1A 1JQ0A 1FXKA 1F4NA 5B1BB 4WFBV 3EFFK 2Y69C 2BOCC 2IJKA 1GM8A 2HR3A 4Q20A 3E8BA 4FIPC 4QIWF 4TT3G 4ASUG 2W6JG 3SPHA 5L3CA 1BMFG 2A9HA 2C2AA 3B77A 2XAFA 3CCQV 2DYSB 5LHHA 2EIKC 1K92A 2Z5UA 2WLLA 3AG4B 3LSQA 4J9ZB 3CCMV 4FMTA 5LHGA 3UKMA 3AEIA 3OEHG 4ZBMA 5LHIA 3M99B 2H8PC 1SRYA 1H38A 1OCOC 1QLEC 3OMIB 4R6ZA 5L3BA 3ASNC 1K4DC 3RW0A 1JCHA 4PA3A 2XAHA 2ZR2A 3QO8A 4QPJA 5IYDO 2IW5A 1E79G 4BAYA 5DN6G 3LDCA 3ML0A 2X6BA 4U7OA 3ABLB 2EIJB 1JPXA 4BIUA 3IGAC 4TWKA 1E1RG 4TSFG 1NJIW 2HVJC 5LGNA 3LDDA 4GX1A 3LDEA 3AG4C 2JJ2G 3SYAA 4WFEA 3ZMSA 3ZRWB 1W2BU 1AJQA 4LP8A 4QE9A 2IH3C 4XDLA 3W7TA 4MT8A 4R50A 2XNDG 1OCRC 1M56C 4JGSA 2YEVB 3ASNB 4UUJC 3ZJZA 2QA4V 1SERA 1K5QA 2DWDC 4UV8A 1V54B 3JCZA 4LBEC 5EC1C 2EINC 3AG2C 3SYPA 3ZMVA 4GX0A 4CBCA 1QR9A 1YJWV 2B1GA 1NVPD 2A0LA 2Y69B 2ZQMA 4BW5A 5E1AC 5KA6A 1V54C 3CCJV 4RAIA 3CCVV 3LUTB 2A79B 1NVPB 2WPDG 2BOBC 1XL4A 3OW2U 2IJIA 5EC2C 1Q82W 2Z3YA 3I55V 2W0FC 3SYCA 3BEHA 1AI4A 4U7NA 1PNMA 1M90W 3STLC 1AI7A 2OTLV 3P32A 3WFVA 2LP7A 4PDLA 1AI6A 4F4LA 3R65A 2KB1A 2D3OW 2V1DA 4MTGA 1NQTA 3TK1A 1VQ7V 4P9OA 2WLKA 1I5XA 2EIKB 4X89A 1S77D 5L3FA 2OCCB 4H33A 1J95A 1M9NA 1FS0G 3VBBA 4X88A 1TUEB 3ETDA 1G8MA 4JAVA 1KC8W 1IXMA 3JD1A 4KP4A 3HPLC 1PKXA 1VQMV 3STZC 4P9PA 3CC2V 2R9RB 3CCSV 1WPXA 2WAMA 3FKSG 2IJJA 2JEUA 2X6AA 2ZD9A 5B1AB 3W7UA 3B8NA 3CC4V 2FTKA 1KD1W 1QVFU 4MSWC 3PJSK 3OE7G 4FJCC 1LNQA 4MW8A 1PNLA 5IYCO 1VQ6V 4QE7A 1K73W 4G27B 3IFXA 3ETEA 3MD0A 5J9PC 3F7YC 3I56V 3GB7C 3K03A 3MHHC 1F23A 3DTUB 4QJFB 2WLMA 3E8GA 3FB8C 3F5WC 1KQSU 2IH1C 1R73A 3CCRV 1Q86W 4MS2A 1Q7YW 5CMUA 3RVYA 2ATKC 3LSSA 2NNUA 2ZDIC 3E8HA 3QO7A 1PL0A 2LFSA 2EINB 2JEXA 4QNHB 3SJQC 1UJWB 4HZ3A 4DO2A 4MVZA 3VOUA 2QTOA 1R3KC 4MTFA 1M57B 2OTJV 2HFEC 3K0DA 5B1NA 1GO3F 1HWYA 1ORQC 3ABKB 1H8EG 1GKFA 2QE7G 3X2QC 2HKOA 3FYIB 3JD2A 3OR7C 4PDMA 4RO2A 3HB3B 4UV9A 5H6QA 5B3SB 3CMAV 1NR7A 2DQ0A 3G6EV 3MHSC 2EIJC 4GT1A 2WLLB 2K1EA 4G2KA 3H01A 4QPKA 2X6CA 3CPWU 1R6NA 4MVOA 5DM6V 1OCCC 1GTOA 5H9CA 4JTAB 3AG1C 3SYQA 2EILB 1QLNA 1M57C 4MTXA 1L1FA 1NR1A 1AJPA 3CMEV 1W0KG 3ZRXA 3ZMTA 2EZPA 2XASA 4GX2A 4JPRA 1W0JG 1AROP 4WFFA 5KUKA 1B6QA 3ETGA 3QO5A 4XDKA 1NH2D 3K79A 3K9AA 4J9YB 2ITCC 1V55C 5B3SC 5C93A 1K33A 5L3DA 3ZRSA 1AR1B 1FXKC 3OMAB 5FL7G 2DQ3A 2EJRA 2HLDG 2AHZA 4HAMA 2EIMB 1FXVA 1YITV 1JOYA 3K08A 2WLNA 3SPCA 1GK9A 4WFAV 1VQNV 2XOKG 1OCCB 3ZIAG 2XAGA 3SPJA 3K0GA 3G71V 4WFGA 1MABG 2CK3G 3OFNG 5CN0A 3E2EA 3FYEB 2HG5C 1ROPA 3ZCCA 3P30A 5L3GA 2IU0A 3T1CA 1V55B 1CPYA 1BHBA 3ABTA 4MTOA 5CBFA 1S3JA 3ZRVA 3EHBB 3JD3A 3SPIA 1S76D 2W6IG 4UVCA 1ZWIC 3B8MA 2IJHA 1SETA 2Q68A 2YEVA 2NLJC 2B1IA 2UXXA 2WLIB 3ASOB 4GX5A 4PA7A 3ZMUA 2OCCC 3FB7C 3TCUA 1FXHA 3ZRWA 2JK5C 1EFRG 1S0VA 3LNMB 1YHQV 5EBWC 2LFRA 2WLIA 1NBMG 2QEXV 4L87A 2XAJA 5LBQA 4OXSA 3CP1A 1SZTA 3AG3B 1YJ9V 1YTFD 4XDJA 5CA3A 1K5SA 1RM1B 4G28B 3X2QB 1H8HG 2HVKC 1YTFB 3CCLV 3W7WA 4JYBA 2M7WA 2ZXWC 1SESA 4E2LA 4X8AA 3OR6C 3T4DA 3WG7B 3CCUV 4XBFA 1OCZC 4N21A 3D3IA 2QM7A 2ZDIA 3ABMC 3T4ZA 3UM7A 3GWOA 3DGEA 3AG3C 3ABUA 2QM8A 2XAQA 4MVQA 5B1BC 3SPGA 4BIZA 2Q69A 4JYCA 1K97A 1VQPV 2QKSA 3CC7V 1M56B 3RVZA 5B1AC 5LGTA 3OM3B 4FPPA 4LCUC 5IYBO 1K8AW 5EBMC 1K3EA 1MOFA 2DYRC 4UVAA 4RQFA 1RM1C 2JIZG 2GSMB 1R6KA 3OMNB 1N8RW 1RPOA 3SYOA 1P7BA 4YXWG 5L3EA 3FB5C 3ASOC 1VQ5V 1OZ0A 3IC7A 1PD3A 1R3JC 4I9WA 1FXKB 1YJNV 2OT5A 5LGUA 1YI2V 1MSWD 3QNEA 4HYOA 1VQLV 3ABMB 3OAAG 4JASA 5H6RA 1AI5A 1JVMA 1F51A 1R3LC 2ITDC 3JD4A 4UVBA 2MK3A 1S72V 1BL8A 4RQEA 5B1OA 3G4SV 2H94A 1KKDA 1P4RA 4KFMA 1FFTB 1KP2A 5KA5A 1S5HC 1QLEB 3OUSA 2EILC 2AHYA 2Q6AA 4EKWA 1QBZA 5BZBA 1K34A 4ZKIA 2P90A 3RBZA 2DYRB 2X7RB 3KG2A 4Z1MG 1K9MW 2HJFC 5IY5C 1NKDA 1XL6A 2X0LA 3D36A 4MVSA 1Y4MA 2P67A 4WFHA 3K06A 3E86A 1EBOA 3W7XA 1QR8A 2ZR3A 3OGCC 4P30A 1M1KW 3A0RA 2YSUB 3JD0A 4H37A 1KP3A 2P7TC 4PA4A 2WLJA 1PNKA 4LC1A 4MW3A 1GM7A 1DLBA 2DW4A 2PI4A 1RPRA 3WG7C 1DF4A 5KUMA 1F4MA 1VQ9V 1E1QG 4PELA 1OCOB 4I5SA 3E89A 4GCZA 3AG1B 1OCRB 1QVGU 2GHYA 2WWWA 5CBHA 2EBOA 3TETA 4JF3A 1I5YA 4PDVA 1K7DA 5IDJA 4RUEA 5IY5B 4PDRA 2JDIG 3CD6V 1EZJA 2DYSC 4PA9A 2F43G 1COWG 1OHHG 1NH2B 3JYCA 4DXWA 4MVMA 5HFLA 4MVUA 3BY6A 3NXSA 1YIJV 1VQOV 2IU3A 4N23A 4RUFA 3E35A 1VQ4V 4WCEV 3ZN1A 2WSSG 3ZN0A 3CYOA 2UXNA 3F7VC 2Q67A 1WLEA 4MVRA 1GMGA 3OUFA 1GM9A 5EK0A 1AJNA 2Y48A 4FK5C 1VQ8V 4R7CA 4CZZA 1BHAA 4UXNA 4JAUA 1H2GA 3FB6C 4WF9V 3ABLC 1DF5A 4P2ZA 3E83A 3CXCU 1KECA 3AG2B 3T2MA 1YSCA 2V7QG 1R3IC 3E8FA 4R8CA 3ABKC 5CBGA 3W7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LCU C;  4JTC B;  5EBM C;  2EIM C;  2DYR C;  1M57 C;  2WLH A;  2DWE C;  2W0F C;  3SYC A;  3BEH A;  4GX2 A;  5EBL C;  3K04 A;  3SYO A;  1P7B A;  4WFF A;  4PA6 A;  3FB5 C;  3ASO C;  5KUK A;  3STL C;  1R3J C;  4I9W A;  4JTD B;  1K4C C;  4PDL A;  4XDK A;  4F4L A;  3R65 A;  2KB1 A;  4HYO A;  4MTG A;  1G4Y B;  4J9Y B;  2ITC C;  1V55 C;  5B3S C;  3ZRS A;  4P9O A;  1JVM A;  2WLK A;  2AHZ A;  3EFF K;  4X89 A;  2Y69 C;  1R3L C;  2ITD C;  3K08 A;  1BL8 A;  2BOC C;  2WLN A;  3SPC A;  4H33 A;  1J95 A;  1KKD A;  4KFM A;  4DXW A;  4X88 A;  3SPJ A;  3K0G A;  1S5H C;  4WFG A;  3E8B A;  2EIL C;  2AHY A;  2Q6A A;  3HPL C;  3OUS A;  4P9P A;  3STZ C;  4EKW A;  2R9R B;  5BZB A;  3RBZ A;  2HG5 C;  3SPH A;  3KG2 A;  2A9H A;  2HJF C;  3VOU A;  1XL6 A;  5IY5 C;  4MVS A;  3T1C A;  2EIK C;  2X6A A;  2ZD9 A;  2WLL A;  4MTO A;  5CBF A;  4J9Z B;  4WFH A;  3K06 A;  3E86 A;  3UKM A;  4MSW C;  4ZBM A;  3SPI A;  3OGC C;  4P30 A;  3PJS K;  4MW8 A;  2H8P C;  1LNQ A;  4H37 A;  1OCO C;  1ZWI C;  2P7T C;  2WLJ A;  2Q68 A;  1QLE C;  4PA4 A;  4R6Z A;  3ASN C;  4MW3 A;  1K4D C;  2NLJ C;  2YEV A;  4G27 B;  2WLI B;  3IFX A;  4QE7 A;  4GX5 A;  4PA7 A;  5J9P C;  3F7Y C;  3WG7 C;  5KUM A;  2OCC C;  3GB7 C;  3FB7 C;  3K03 A;  3RW0 A;  4PA3 A;  3TCU A;  2WLM A;  3E89 A;  2JK5 C;  3E8G A;  3FB8 C;  3F5W C;  3LDC A;  2X6B A;  2IH1 C;  3LNM B;  4MS2 A;  5CBH A;  5EBW C;  3RVY A;  2ATK C;  2WLI A;  3E8H A;  3TET A;  3IGA C;  4PDV A;  4RUE A;  4TWK A;  4PDR A;  4OXS A;  2DYS C;  2HVJ C;  4PA9 A;  4QNH B;  4XDJ A;  3SJQ C;  3LDD A;  3JYC A;  4GX1 A;  4HZ3 A;  3LDE A;  2QTO A;  1R3K C;  4MVZ A;  3AG4 C;  4MTF A;  4G28 B;  4MVM A;  3SYA A;  4MVU A;  4WFE A;  2HVK C;  2HFE C;  3K0D A;  4LP8 A;  2IH3 C;  4QE9 A;  4RUF A;  1ORQ C;  4XDL A;  4R50 A;  1OCR C;  1M56 C;  3F7V C;  2Q67 A;  3X2Q C;  2ZXW C;  4UUJ C;  4X8A A;  3OR6 C;  3T4D A;  3ZJZ A;  4MVR A;  2DWD C;  3OUF A;  5EK0 A;  3OR7 C;  4LBE C;  5EC1 C;  2EIN C;  3AG2 C;  1OCZ C;  4PDM A;  4RO2 A;  3SYP A;  4GX0 A;  4CBC A;  3ABM C;  4R7C A;  3T4Z A;  3UM7 A;  2A0L A;  3AG3 C;  4BW5 A;  4MVQ A;  2EIJ C;  3FB6 C;  5E1A C;  2WLL B;  3ABL C;  1V54 C;  2K1E A;  4P2Z A;  5B1B C;  3E83 A;  3SPG A;  2Q69 A;  4RAI A;  3T2M A;  2X6C A;  3LUT B;  2A79 B;  4MVO A;  1R3I C;  2BOB C;  2QKS A;  3E8F A;  4R8C A;  3ABK C;  1XL4 A;  1OCC C;  3RVZ A;  5B1A C;  5CBG A;  5EC2 C;  4JTA B;  3AG1 C;  3SYQ A; 
#chains in the Genus database with same CATH topology
 5GW7 A;  1NI8 A;  2R9I A;  2DWE C;  5CB4 A;  1GN2 A;  4I9Q A;  3APO A;  3NR7 A;  4PA6 A;  5B66 Z;  4ZHQ A;  3OEE G;  2YIC A;  2CAZ C;  4OX9 O;  1FXK A;  5B1B B;  1PPJ H;  2Y69 C;  3JAL A;  3B40 A;  3S3X A;  5LOV A;  1AB3 A;  1GM8 A;  4O4I A;  4GUN A;  5B5E Z;  4DR5 B;  4DV6 O;  2Q0A A;  4JI2 O;  4TT3 G;  1IX9 A;  3BFR A;  3SPH A;  4FZ0 A;  1BMF G;  1WNS A;  2C2A A;  1XMQ B;  4UCO A;  1AR4 A;  3K5L A;  1PP9 H;  2WLL A;  2NR5 A;  5IJ0 B;  3AG4 B;  3UKM A;  3OEH G;  2GV9 A;  1QLE C;  3AK3 A;  3ASN C;  2PGG A;  3RW0 A;  1LR1 A;  4QPJ A;  1Q90 D;  3JAM N;  1E79 G;  4BAY A;  5DN6 G;  1Z5W A;  3BAB A;  1JPX A;  4LFB O;  3IAY A;  5A9G A;  1YDX A;  5LGN A;  4PI2 A;  4PV1 B;  4CS3 A;  1BQZ A;  1FPO A;  3AG7 A;  4O4H A;  5D5Q A;  4WFE A;  3ZRW B;  4DR4 B;  1AIL A;  1OCR C;  1M56 C;  3VQV A;  1K5Q A;  1H2N A;  4TV8 A;  1HNZ B;  5LXT A;  3ZMV A;  2CTR A;  2Y0P A;  4CBC A;  3L71 H;  1NVP D;  2Y69 B;  4D7S A;  3OD4 A;  3JAS B;  4DRX A;  1V54 C;  3CCJ V;  4DV2 O;  4RAI A;  1ZLZ A;  1VAR A;  4FVM A;  4H0L B;  2IJI A;  2ZM6 O;  2F4V O;  5EC2 C;  1HNZ O;  4YJ2 A;  5DED A;  1H2L A;  2DN9 A;  1PNM A;  5LA6 B;  2QSA A;  2CUG A;  2L6L A;  4LFC B;  3L70 H;  2KB1 A;  3R65 A;  2F4V B;  5JQG B;  1NQT A;  4JYY A;  4X89 A;  4JI0 B;  1FS0 G;  2QWR B;  3ETD A;  3JD1 A;  4KP4 A;  1PKX A;  1N0N A;  3STZ C;  4AQY O;  2R9R B;  1IBL O;  1MSD A;  4LWS A;  4J80 A;  4X1Y B;  4ZOL A;  5LYJ B;  3RYI A;  1JR9 A;  3W7U A;  3B8N A;  4DR6 O;  2ADP A;  1IDS A;  4MSW C;  3PJS K;  4DV3 O;  4QE7 A;  1K73 W;  2H3O A;  2QWQ B;  3IFX A;  3MD0 A;  3I56 V;  3GB7 C;  3MHH C;  5LMU B;  3FB8 C;  3F5W C;  3BA9 A;  4IHJ B;  4MS2 A;  2UXC B;  2UUA B;  3H1H H;  1RSO B;  5K1X A;  4K0K O;  4H44 B;  3SJQ C;  3K5O A;  1WAZ A;  3CXH F;  4PD4 F;  4DK1 A;  4DV5 B;  1Z5V A;  1GKF A;  5EZY B;  3CHX A;  1FD9 A;  3CB2 A;  3OR7 C;  5H6Q A;  3HB3 B;  4UV9 A;  4K0K B;  4GLX A;  3CMA V;  3U0Z A;  2EX3 A;  3G6E V;  1HNX O;  4BWA A;  4FLX A;  4MVO A;  5DM6 V;  4E4E A;  1OCC C;  1GTO A;  1YF2 A;  4JI0 O;  4OPA A;  4MTX A;  3P3N A;  4DW0 A;  3CME V;  5JH7 A;  3ZRX A;  3ZMT A;  1MA1 A;  4YJ3 B;  2XAS A;  1P7G A;  1XI1 A;  2FB5 A;  1SQP H;  4ABM A;  4NTY A;  1BSM A;  1B6Q A;  3N2G B;  2E76 B;  3HR0 A;  1VF6 C;  1QQC A;  4J9Y B;  5BMV A;  1V55 C;  5B3S C;  5C93 A;  1K33 A;  4DR3 B;  1AR1 B;  1FXK C;  1WPB A;  2EJR A;  1JOY A;  2EIM B;  1FXV A;  1Q5O A;  1Y67 A;  4NB5 A;  4NTW A;  2XOK G;  3ZIA G;  2XAG A;  4X9Q A;  3K0G A;  1BQ0 A;  4WFG A;  1MAB G;  2QGN A;  1KU9 A;  1KYO F;  3OFN G;  4I55 A;  4J7J A;  5CN0 A;  3UT5 A;  2QWO B;  2UUB B;  1WA8 B;  2VWK A;  3FX7 A;  1BHB A;  1SF9 A;  5CBF A;  4LF9 O;  1WJZ A;  3EHB B;  4KHP B;  4UVC A;  2IJH A;  1SET A;  2Q68 A;  1WB7 A;  2E75 B;  4O4L B;  4X64 B;  1FXH A;  4AIL C;  5JVD A;  3ZRW A;  4LR3 A;  4U3F H;  3LNM B;  4B3R B;  1KB9 F;  1WB8 A;  2LFR A;  1NBM G;  1PV0 A;  4L87 A;  3CP1 A;  2Q8V A;  1SZT A;  3AG3 B;  4EB6 B;  5CA0 A;  4LF8 B;  2YXY A;  4JI4 O;  1Y74 A;  2RQ6 A;  4FFK A;  4OPH A;  4HNA A;  2VS0 A;  4E2L A;  4X8A A;  5KHI A;  3D3I A;  3UM7 A;  1AR5 A;  1NTZ H;  2QM8 A;  3VQY A;  3B09 A;  2YI9 A;  2Q69 A;  4K8X A;  1S5J A;  1TVK B;  1M56 B;  5LGT A;  4EB6 A;  4JI5 O;  3SGI A;  3CJH A;  1K8A W;  2CGO A;  4CS4 A;  3K59 A;  1XMO O;  1LUV A;  2F66 C;  4JI8 O;  1OZ0 A;  3IC7 A;  1XIL A;  5LGU A;  4NXN O;  4HYO A;  1VQL V;  3ABM B;  3OAA G;  4JAS A;  1XRE A;  1N34 B;  1S72 V;  4ZIB A;  4UCT A;  5B1O A;  3JAT A;  5JJE B;  1KKD A;  4KFM A;  1FFT B;  4X20 A;  3OTO O;  3MDS A;  1WA8 A;  1QLE B;  1UFI A;  2EIL C;  1QBZ A;  4ZKI A;  2P90 A;  2DYR B;  2X7R B;  3RYC B;  1NKD A;  1XL6 A;  2X0L A;  4MVS A;  4X66 B;  3GWK C;  2GDS A;  3K06 A;  5KHJ A;  3J7A U;  3OGC C;  3UO2 A;  3BRC A;  4H37 A;  3FAV A;  3ZHR A;  4DR2 O;  4O2A B;  1VQ9 V;  1YVW A;  2HHH B;  4GCZ A;  5LMU O;  1R1B A;  3DSQ A;  3H1L H;  1KMI Z;  3TET A;  1EN4 A;  1I5Y A;  2PYJ A;  4PDR A;  2E74 B;  4LNU A;  2JDI G;  1EZJ A;  2F43 G;  4B3S O;  4MVM A;  3NXS A;  4GKK O;  4RUF A;  1XOU A;  4FLY A;  2WSS G;  4O4L A;  1DK1 A;  1JFF A;  1ZTE A;  2PF4 E;  5EK0 A;  4IIJ A;  4CZZ A;  1ZUQ A;  1DF5 A;  4P2Z A;  3T2M A;  4EEQ A;  5K1P A;  5EZY A;  3QG5 A;  4X64 O;  3OTF A;  2CGN A;  3GVM A;  2ZXW B;  5KHG A;  1N32 B;  2B5U A;  3R66 A;  1CP9 A;  4KUM A;  4B3T B;  2PI5 A;  3CCE V;  4JI3 B;  3UO3 A;  4FFB B;  1JX9 A;  1Y66 A;  1Q81 W;  1OCZ B;  4JI2 B;  2YIB A;  3IJ4 A;  3VQW A;  4DV4 O;  1JQ0 A;  1H2K A;  1F4N A;  2E5L O;  2IM9 A;  5F2V O;  4Q20 A;  1HP8 A;  3E22 B;  3HKE B;  3DC5 A;  4TV9 B;  3KCX A;  2A9H A;  3B77 A;  1FFX B;  2XAF A;  2DYS B;  3F5T A;  2Z5U A;  1K92 A;  4J9Z B;  4FMT A;  3M7M X;  3H1K H;  1SRY A;  4UCS A;  1K4D C;  4DV6 B;  2KKW A;  2ZR2 A;  5IYD O;  3LDC A;  3ML0 A;  4I50 A;  2X6B A;  3BHP A;  4BIU A;  4LF7 O;  3IGA C;  3L74 H;  4TWK A;  1E1R G;  2UUC B;  2HVJ C;  3Q4H B;  2ODM A;  3LDD A;  3JSL A;  5IE9 A;  5KMG A;  3KZI Z;  1ZX3 A;  4I55 B;  4QE9 A;  3JAS A;  2OYQ A;  4JYA B;  2YID A;  2YEV B;  3ASN B;  4GZR B;  4LBE C;  3AG2 C;  1WN7 A;  5JWP A;  4FLT A;  3T1H O;  1XBL A;  2WPD G;  2BOB C;  5EYP A;  1NS1 A;  3BPZ A;  4GKJ B;  2KSD A;  1Q82 W;  2Z3Y A;  2GTA A;  3K9S A;  2W0F C;  5JJJ B;  2WA4 A;  3BEH A;  1AI4 A;  1JJO A;  1KBH A;  3STL C;  1OJH A;  2CH7 A;  1H2M A;  2LP7 A;  1I94 B;  1SQX H;  1AI6 A;  4F4L A;  2D3O W;  2Q5Z A;  2R70 A;  4C7U A;  5IWA O;  4MTG A;  4B3R O;  4JI3 O;  2LO1 A;  3TK1 A;  4J7K A;  4YY3 O;  1VQ7 V;  3PN1 A;  5J2U B;  1I5X A;  4X1I A;  1S77 D;  3CRA A;  2DOS A;  1J95 A;  4H33 A;  4JI7 O;  4X88 A;  3G6B A;  3HKB A;  1G8M A;  1SQG A;  4JAV A;  1IXM A;  3H1I H;  1VQM V;  3RGB A;  3APQ A;  4O4J B;  4X66 O;  4KHP O;  4AI8 A;  5ITZ A;  2X6A A;  3HKB B;  4DRX B;  5E79 Z;  1M4U A;  1QVF U;  4X62 O;  5LXT B;  4FJC C;  4MW8 A;  4IT5 A;  1HR0 B;  1G6U A;  5J9P C;  1BS3 A;  2BTQ B;  2JGD B;  2ZE5 A;  1O9G A;  2IH1 C;  1R73 A;  3CCR V;  4JZG A;  1N36 B;  5CMU A;  1YEW A;  2ZE6 A;  2ATK C;  3RVY A;  2NNU A;  2ZDI C;  2LFS A;  3OT7 A;  3CSX A;  3N27 A;  2JEX A;  4QNH B;  4LFB B;  4TV9 A;  4DO2 A;  4MVZ A;  3HKD A;  1HWY A;  1URF A;  4I7Z B;  3ABK B;  1H8E G;  2QE7 G;  3I5D A;  3UQ8 A;  3X2Q C;  2HKO A;  3FYI B;  3JD2 A;  4PDM A;  4RO2 A;  1LUW A;  2VWJ A;  4LF6 B;  4I4T B;  3S3W A;  2WLL B;  5IJ0 A;  1XMO B;  3HKC B;  4YY3 B;  3J80 N;  1EZV H;  3A0B Z;  4DR3 O;  5A2Q N;  2A06 H;  3AG1 C;  1Y76 A;  4JI8 B;  3WB1 A;  1M57 C;  1AJP A;  4JPR A;  4WFF A;  3JAL B;  2AW9 A;  3QO5 A;  4XDK A;  3O65 A;  2ITC C;  4EFE A;  4YIO A;  1G1X B;  2YIA A;  2WLN A;  4NVP A;  2CTQ A;  3ZCC A;  3P30 A;  2IU0 A;  4ZI7 A;  4UB6 Z;  4PI0 A;  1CPY A;  3ABT A;  3DXR A;  3ICX A;  1Q6H A;  5BR8 O;  2CTW A;  2QR4 A;  2WLI B;  2AGA A;  4YHH B;  4GX5 A;  3Q4H A;  2ZNI A;  3ZHQ A;  4O2B A;  1S0V A;  4UCR A;  1YHQ V;  1VEW A;  2WLI A;  2P4K A;  4HBN A;  2QEX V;  2XAJ A;  4X65 O;  4GYC B;  3WU2 Z;  2XHB A;  1YJ9 V;  1F7Y A;  5EIB C;  3C3S A;  2KG7 B;  2Q7H A;  1XQ8 A;  2Y4T A;  2VQF B;  4DV7 B;  2M7W A;  2ZXW C;  3WG7 B;  3L72 H;  3OGI B;  4N21 A;  4AHC A;  1VIB A;  3T4Z A;  2XAQ A;  3SPG A;  1GN6 A;  3K58 A;  2QWN B;  4K3A A;  5FLX N;  3OM3 B;  5LP6 B;  5IYB O;  5EBM C;  2DYR C;  4UVA A;  3CJH B;  1RM1 C;  2JIZ G;  2HEP A;  1RPO A;  1P7B A;  4YXW G;  5L3E A;  3CRC A;  3ASO C;  1VQ5 V;  4DR4 O;  4B7K A;  1YJN V;  2OT5 A;  1P84 F;  3ZHV A;  4CH3 A;  1YI2 V;  3QNE A;  2QDO A;  5GTI Z;  1I94 O;  5D5P A;  1X59 A;  5C8Y A;  1F51 A;  2ITD C;  3JD4 A;  4UVB A;  3G4S V;  2H94 A;  1AP6 A;  3AK2 A;  2QTS A;  1KP2 A;  5KA5 A;  1IBM B;  1TA8 A;  1VF6 A;  2HHH O;  2FML A;  3TGU H;  2HJF C;  5IY5 C;  4RWU A;  2YS8 A;  4X1K B;  2F1M A;  4JV5 B;  2P67 A;  1TAE A;  3E86 A;  1QR8 A;  2ZR3 A;  1M1K W;  1FJG B;  4IGG A;  4LC1 A;  1ZL8 A;  5CA1 B;  1IUR A;  4MW3 A;  3RYH A;  4LNU B;  1TGO A;  3E89 A;  1OCR B;  1QVG U;  1MZE A;  4UCU A;  2UUC O;  3RFR A;  1FJG O;  4DUY B;  5IDJ A;  2UUA O;  4J42 A;  3CD6 V;  5LA6 A;  1UPG A;  3JYC A;  4DXW A;  5HFL A;  3BY6 A;  4TQF A;  3A8T A;  4N23 A;  3ZN1 A;  4DV2 B;  3JAK B;  5LMN B;  4MVR A;  1GMG A;  3OUF A;  2XT9 A;  3AK1 A;  2Y48 A;  1VQ8 V;  4JAA A;  5FNV B;  1MMM A;  4BW9 A;  1BHA A;  2N04 A;  1H2G A;  3FB6 C;  4WF9 V;  4WBN A;  3L73 H;  3QTC A;  3RYC A;  3ABK C;  3JAT B;  2JRI A;  3W7S A;  3T1Y O;  3K3W A;  3N2G A;  2EIM C;  1THZ A;  2WLH A;  1HR0 O;  2P6J A;  1BT8 A;  5EBL C;  3K04 A;  3QF7 A;  5IT9 N;  5IYZ B;  5JH7 B;  1VQK V;  5JVD B;  1S5L Z;  1KUQ A;  4JTD B;  3RYH B;  1G4Y B;  1MG1 A;  4FM2 A;  2LW7 A;  2L35 A;  2JGD A;  4CH5 A;  2A7W A;  4DR7 B;  2QJ1 A;  3BCC H;  4X1K A;  4UB8 Z;  4FIP C;  1JA8 A;  1J5E O;  4QIW F;  4ASU G;  2W6J G;  1AP5 A;  5EIB D;  1R6T A;  1Z2G A;  2EIK C;  3CCM V;  5LHG A;  2E5L B;  1XDC A;  4X1I B;  4B08 A;  1SQB H;  3M99 B;  2H8P C;  4NXM O;  5GON B;  3D3Q A;  1H38 A;  1OCO C;  2BSK B;  4R6Z A;  5FPO A;  1X4T A;  2VQE O;  1JCH A;  1XHZ A;  2XAH A;  3QO8 A;  2IW5 A;  3JAW B;  1AVM A;  2AZ0 A;  3ABL B;  2EIJ B;  4NTX A;  5KHK A;  4X65 B;  4YIP A;  4PJ0 Z;  2HJD A;  4TSF G;  5GTH Z;  4ZI7 B;  5IYZ A;  5CB4 B;  4DV5 O;  2LQT A;  4GX1 A;  3LDE A;  4CH6 A;  2ZE8 A;  1W2B U;  1AJQ A;  4LP8 A;  1N33 O;  2IH3 C;  5KX5 B;  4XDL A;  3W7T A;  4R50 A;  2XND G;  1SER A;  3CRR A;  4JV5 O;  4UV8 A;  1M5I A;  2KQX A;  5EC1 C;  4YHH O;  1D5A A;  1N34 O;  1QR9 A;  2KG7 A;  4GKK B;  1NZ6 A;  2A0L A;  2ZQM A;  2GUZ B;  4BR6 A;  2YXH A;  3P3P A;  3CCV V;  5LMN O;  2A79 B;  1V9P A;  1D5N A;  1XL4 A;  2PTM A;  2CTP A;  2BCC H;  4O2B B;  4FFB A;  3I55 V;  4YJ2 B;  1B3Q A;  1HDJ A;  2RCV A;  1IBK B;  4U7N A;  2ZCE A;  4TOI A;  1AI7 A;  2OTL V;  3M8A A;  1BGY H;  1SA0 B;  4PDL A;  2V1D A;  4BIO A;  2E3C A;  4JZ2 A;  3SR2 C;  4DR6 B;  4P9O A;  4F6E A;  4B3M O;  2EIK B;  5L3F A;  4A5U B;  2OCC B;  1M9N A;  4IIJ B;  3ZED A;  2FKX A;  1TUE B;  4LF4 B;  3HKD B;  3SJB C;  3BAA A;  5LYJ A;  4X1Y A;  1NTK H;  4O4H B;  1JFF B;  2ZIO A;  1RFY A;  4Z2W A;  2IJJ A;  4ICG A;  2JEU A;  5B1A B;  5TIS Z;  3RN4 A;  3CC4 V;  2FTK A;  4TUY B;  2QM4 A;  3B2E E;  2GBO A;  3OE7 G;  4AQY B;  2N05 A;  5IYC O;  2RJZ A;  2BTQ A;  4QGP A;  4G27 B;  4LF5 B;  2P5O A;  3F7Y C;  1Q6U A;  3K03 A;  2UU9 B;  1F23 A;  2WLM A;  1YXB A;  1U97 A;  2N74 A;  3E8G A;  1KQS U;  3RYF B;  1Q86 W;  1Q7Y W;  4O2A A;  1TVK A;  3E8H A;  2OCH A;  4DW1 A;  4DV3 B;  3QO7 A;  1FAF A;  1VF5 B;  2JS3 A;  3RYF A;  3VOU A;  2QTO A;  1R3K C;  1Q43 A;  3FD9 A;  2HFE C;  3K0D A;  5B1N A;  1GO3 F;  2UXD O;  5LP6 A;  1N36 O;  2Q7E A;  1P49 A;  2ZNJ A;  5FPR A;  4X20 B;  1ZAU A;  2ARH A;  2GTS A;  2DQ0 A;  3MHS C;  4NXM B;  2K1E A;  2OIG A;  4QPK A;  3U10 A;  2X6C A;  1R6N A;  4ZOL B;  2PYL A;  1SQQ H;  4JTA B;  1T5E A;  3SYQ A;  2DE0 X;  1L1F A;  1NR1 A;  4LF4 O;  1W0K G;  4ZHQ B;  4GX2 A;  1MNG A;  3RT3 C;  4NR1 A;  1QHT A;  4IYI A;  2DMX A;  1IBM O;  3ZRS A;  4W4K A;  4DUY O;  5FL7 G;  2HLD G;  4HAM A;  5IWA B;  3K08 A;  1NT2 B;  4JI5 B;  1GK9 A;  1VQN V;  1OCC B;  3FAV B;  4DR5 O;  3G71 V;  5H5N A;  2UXB B;  1I08 A;  3E2E A;  4FM1 A;  1ROP A;  1WP7 A;  4FZ1 A;  2ADQ B;  4MTO A;  1S3J A;  3SPI A;  4I50 B;  1S76 D;  4JI6 O;  2W6I G;  1RP3 B;  1ZWI C;  1US6 A;  3ZX6 A;  2B1I A;  2UXX A;  4PA7 A;  4DR1 B;  4LF8 O;  4LH7 A;  3FB7 C;  3TCU A;  1GN4 A;  1EFR G;  2YI8 A;  2Q73 A;  4OXS A;  3QVN A;  4PHZ A;  1BZK A;  4XDJ A;  5CA3 A;  1RM1 B;  1D2D A;  2ZT9 B;  1SC5 B;  2HVK C;  3THO A;  1YTF B;  1IBL B;  3CCL V;  1YCI A;  4JYB A;  3SJC C;  1QU7 A;  1SES A;  3OR6 C;  2UXD B;  3CCU V;  4XBF A;  4HNA B;  4J10 A;  4O4J A;  2QM7 A;  2ZDI A;  3ABM C;  4J11 A;  4DYL A;  3ABU A;  4MVQ A;  4B7E A;  5B1B C;  2F95 B;  1K97 A;  3JCU Z;  3EVK A;  4B3T O;  2QKS A;  3CC7 V;  4L8J A;  3RVZ A;  3D36 C;  4FPP A;  1VP7 A;  4JI1 O;  1K3E A;  2GSM B;  3K5N A;  1R6K A;  5LOV B;  4H13 B;  1N8R W;  2UXB O;  3SYO A;  4X62 B;  2JS5 A;  1PD3 A;  1R3J C;  4Z1V A;  1FXK B;  1GH6 A;  1MSW D;  5H6R A;  1FYJ A;  2YXL A;  1ZSP A;  4CH4 A;  1ZL8 B;  3ZHT A;  1BL8 A;  4RQE A;  1S5H C;  2Q6A A;  2AHY A;  1VMG A;  1K34 A;  1U96 A;  4GKJ O;  2ILM A;  4I0X B;  4Z1M G;  3D36 A;  2V4D A;  1SZX A;  1Y4M A;  1IBK O;  2ZE7 A;  1EBO A;  2YIB D;  3OTO B;  1Y6X A;  2B9Z A;  2M6Y A;  2YSU B;  4LF9 B;  1GRJ A;  1L0L H;  1PNK A;  2WLJ A;  4LFC O;  2ZIM A;  1DLB A;  3D8C A;  2PI4 A;  3L75 H;  5KUM A;  4I5S A;  3AG1 B;  1BE3 H;  4CC6 A;  1NTM H;  4YJ3 A;  5CBH A;  3JSN A;  3WB0 A;  4JF3 A;  4PDV A;  1K7D A;  2DYS C;  2GUZ A;  2QKA A;  1OHH G;  3TXQ A;  1NH2 B;  1EN5 A;  4EFB A;  2IU3 A;  2QWP B;  1VQ4 V;  2AXT Z;  4D6T H;  4UFZ A;  3ZN0 A;  2UXN A;  3CYO A;  2Q67 A;  4LWS B;  4DV1 B;  4KXR A;  2WA3 A;  1GM9 A;  1W59 A;  1AJN A;  1NU1 H;  4R7C A;  4NXN B;  4LF7 B;  2CDY A;  3C3T A;  4U3J A;  3CXC U;  5LL6 Y;  1KEC A;  3AG2 B;  1YSC A;  5CBG A;  3UT5 B;  4JTC B;  2JJ1 G;  1DTO A;  2EZO A;  3ZMZ A;  4CC5 A;  1M93 A;  3B4S A;  1Y76 B;  1QCE A;  3G80 A;  1CEZ A;  1FKA O;  2RNB A;  2YUA A;  3WB2 A;  1IZ3 A;  1K4C C;  2AZ2 A;  2LW1 A;  1ENV A;  5HFM A;  3K57 A;  2Q7G A;  1QNM A;  1JJ2 U;  5AG2 A;  4JI7 B;  4WFB V;  3EFF K;  5DEC A;  2BOC C;  2ZM6 B;  4LF6 O;  4LFA O;  1CXZ B;  2IJK A;  2HR3 A;  3DXR B;  4FM0 A;  3CS5 A;  1Y74 B;  3E8B A;  2XUM A;  3TXS A;  5L3C A;  3CCQ V;  5LHH A;  1SS3 A;  4D7T A;  3K5M A;  3MAQ A;  1XHX A;  3LSQ A;  2UU9 O;  3AEI A;  4ZBM A;  4Q6G A;  5LHI A;  1WP8 A;  5L3B A;  3OMI B;  2RN9 A;  3KCY A;  4PA3 A;  2LJ2 A;  4CS2 A;  5BXZ A;  5LP6 C;  1XNR O;  4U7O A;  3A2F A;  2R9A A;  2LGW A;  1VF7 A;  5KAI Z;  3LNN A;  4NKG B;  1NJI W;  3SDL A;  2UUB O;  3AG4 C;  3JAR A;  2JJ2 G;  3SYA A;  3ZMS A;  2JVD A;  4MT8 A;  1O9H A;  4J7Z A;  4JGS A;  4UUJ C;  3ZJZ A;  2QA4 V;  2DWD C;  1V54 B;  2R72 A;  3JCZ A;  4DUZ O;  2W0X A;  2EIN C;  3SYP A;  1HNW B;  4GX0 A;  1MZF A;  1YJW V;  2B1G A;  5KX5 A;  3IC9 A;  4BW5 A;  5E1A C;  2MW2 B;  5KA6 A;  4DK0 A;  3LUT B;  1NVP B;  3OW2 U;  2Q4P A;  2FL4 A;  3VQX A;  3SYC A;  1J5E B;  1M90 W;  3H1J H;  3P32 A;  3WFV A;  2P22 C;  4FLZ A;  2YC0 A;  5GON A;  2WLK A;  3CE2 A;  3H9V A;  2LGQ A;  3VBB A;  1JMK C;  2BSK A;  1KC8 W;  3HPL C;  2PUS A;  2Q9L A;  4P9P A;  5JCO A;  3CC2 V;  4K8Z A;  2ZKO A;  3CCS V;  1WPX A;  2WAM A;  3BA8 A;  3FKS G;  2ETN A;  2ZD9 A;  1KD1 W;  1XMQ O;  1BCC H;  3RWR D;  1LNQ A;  1PNL A;  4TV8 B;  1VQ6 V;  1I7F A;  1XNQ B;  3A0H Z;  3ETE A;  5KHH A;  1XEQ A;  3DTU B;  4QJF B;  2HP8 A;  4J41 A;  1N4C A;  1GAX A;  3CEI A;  4JI4 B;  2F93 B;  3LSS A;  1PL0 A;  2G38 A;  3RYI B;  2EIN B;  1N32 O;  1KKC A;  1UJW B;  2F23 A;  2VQF O;  4DV7 O;  4HZ3 A;  4MTF A;  2ZIN A;  1M57 B;  2OTJ V;  1A32 A;  1EN6 A;  3N2K B;  2BE3 A;  2UXC O;  1ORQ C;  1Q8I A;  3UCS C;  2D2C B;  1Q6I A;  3HKE A;  5ITZ B;  5B3S B;  1NR7 A;  5J2T A;  1I0H A;  2BTO A;  2EIJ C;  4GT1 A;  4K35 A;  4DUZ B;  4G2K A;  4TQD A;  2EUL A;  3H01 A;  1IVS A;  1RSO A;  5KMG B;  3CPW U;  3J81 N;  4NYK A;  5H9C A;  2EIL B;  1QLN A;  3LSU A;  1OV9 A;  3ETQ A;  2EZP A;  4F6R A;  1HNX B;  1W0J G;  1ARO P;  1XUQ A;  5CA0 B;  5KUK A;  3ETG A;  5JJN B;  1NH2 D;  4OGQ B;  3K79 A;  3K9A A;  5L3D A;  5IJ9 A;  3OMA B;  2CH7 B;  2DQ3 A;  4DV4 B;  2AHZ A;  1YIT V;  4LFA B;  2EJ7 A;  2YDE A;  3CWB H;  3SPC A;  4WFA V;  4DR7 O;  4JI6 B;  4LF5 O;  3EXA A;  1GN3 A;  3L9D A;  3SPJ A;  2CK3 G;  4FLW A;  2NN4 A;  2K9P A;  5EYP B;  3FYE B;  3ZHU A;  2HG5 C;  1H2S B;  5L3G A;  3T1C A;  1V55 B;  4WBN B;  3ZRV A;  2QKC A;  2Q0O C;  3JD3 A;  3C90 A;  1HW7 A;  3JAW A;  4IL6 Z;  2Y0I A;  3B8M A;  4W4L A;  1IXB A;  2YEV A;  1B06 A;  2NLJ C;  3ASO B;  2P06 A;  5JQG A;  3ZMU A;  4F6R B;  2OCC C;  3SJA C;  1XNR B;  1Q3E A;  2Z0A A;  4DV0 O;  2JK5 C;  3JAR B;  5EBW C;  2FYU H;  2OWO A;  5LBQ A;  2A3Q A;  2Y4U A;  1YTF D;  1DGS A;  1K5S A;  1N33 B;  4G28 B;  3X2Q B;  1H8H G;  4DR1 O;  2DJV A;  2IBZ H;  3W7W A;  3FFQ A;  1B04 A;  4TUY A;  3T4D A;  3ZS8 C;  1OCZ C;  2RMK B;  1HNW O;  5KAF Z;  3GWO A;  3DGE A;  3AG3 C;  4UCV A;  4BIZ A;  1SQV H;  4JYC A;  1VQP V;  1FFX A;  3CX5 F;  3T1H B;  5IJ9 B;  5B1A C;  4LCU C;  1MOF A;  3E22 A;  4RQF A;  2PY5 A;  3OMN B;  1SQF A;  4DV1 O;  4OX9 B;  3FB5 C;  1SA0 A;  4I9W A;  4JYA O;  1EM1 A;  2VRZ A;  4IHJ A;  3KKY A;  2P4V A;  1AI5 A;  3TJT A;  4FLV A;  1JVM A;  1L0N H;  1R3L C;  2MK3 A;  4I4T A;  1P4R A;  5KLV H;  4U3J B;  3OUS A;  4EKW A;  4DV0 B;  5BZB A;  1SKV A;  3RBZ A;  3KG2 A;  1K9M W;  3G67 A;  1L8D A;  5H2F Z;  4O4I B;  4WFH A;  4FLU A;  3W7X A;  4P30 A;  1N0J A;  3A0R A;  3JD0 A;  2VQE B;  1KP3 A;  2P7T C;  4PA4 A;  3ZHS A;  3U11 A;  1GM7 A;  2DW4 A;  3BVO A;  1YZB A;  1RPR A;  4B3S B;  3WG7 C;  1DF4 A;  5JCO C;  1F4M A;  5CA1 A;  1E1Q G;  4PEL A;  1PL4 A;  1OCO B;  2GHY A;  2WWW A;  2RDC A;  5BR8 B;  2CE4 A;  2EBO A;  4IYH A;  3DC6 A;  4RUE A;  5IY5 B;  5BY1 A;  4PA9 A;  1COW G;  5FNV A;  4DR2 B;  4MVU A;  2OIE A;  1TUB B;  1YIJ V;  2JGU A;  4JI1 B;  2XTA A;  1VQO V;  4B3M B;  3CRM A;  3JAK A;  3E35 A;  3ZBH A;  3T1Y B;  4WCE V;  1PM9 A;  3F7V C;  1WLE A;  3HKC A;  5C8Y B;  1XNQ O;  1TUB A;  3CRQ A;  4KL1 A;  5J2T B;  4FK5 C;  5BMV B;  2PZS A;  4UXN A;  4JAU A;  3O9O A;  3N2K A;  3ABL C;  3E83 A;  5J2U A;  2V7Q G;  1R3I C;  3E8F A;  4R8C A;  4I0X A;  2O57 A;  4LH6 A; 
#chains in the Genus database with same CATH homology
 5GW7 A;  3K3W A;  2ZXW B;  4JTC B;  2EIM C;  1THZ A;  2JJ1 G;  1DTO A;  2EZO A;  2R9I A;  3ZMZ A;  2WLH A;  2B5U A;  2P6J A;  1QCE A;  2DWE C;  1CP9 A;  1CEZ A;  4KUM A;  5EBL C;  3K04 A;  2PI5 A;  4PA6 A;  3CCE V;  1VQK V;  3OEE G;  4JTD B;  1JX9 A;  1K4C C;  1Y66 A;  5HFM A;  1ENV A;  1Q81 W;  1OCZ B;  1G4Y B;  1JJ2 U;  1MG1 A;  1JQ0 A;  1FXK A;  1F4N A;  5B1B B;  4WFB V;  3EFF K;  2Y69 C;  2BOC C;  2IJK A;  1GM8 A;  2HR3 A;  4Q20 A;  3E8B A;  4FIP C;  4QIW F;  4TT3 G;  4ASU G;  2W6J G;  3SPH A;  5L3C A;  1BMF G;  2A9H A;  2C2A A;  3B77 A;  2XAF A;  3CCQ V;  2DYS B;  5LHH A;  2EIK C;  1K92 A;  2Z5U A;  2WLL A;  3AG4 B;  3LSQ A;  4J9Z B;  3CCM V;  4FMT A;  5LHG A;  3UKM A;  3AEI A;  3OEH G;  4ZBM A;  5LHI A;  3M99 B;  2H8P C;  1SRY A;  1H38 A;  1OCO C;  1QLE C;  3OMI B;  4R6Z A;  5L3B A;  3ASN C;  1K4D C;  3RW0 A;  1JCH A;  4PA3 A;  2XAH A;  2ZR2 A;  3QO8 A;  4QPJ A;  5IYD O;  2IW5 A;  1E79 G;  4BAY A;  5DN6 G;  3LDC A;  3ML0 A;  2X6B A;  4U7O A;  3ABL B;  2EIJ B;  1JPX A;  4BIU A;  3IGA C;  4TWK A;  1E1R G;  4TSF G;  1NJI W;  2HVJ C;  5LGN A;  3LDD A;  4GX1 A;  3LDE A;  3AG4 C;  2JJ2 G;  3SYA A;  4WFE A;  3ZMS A;  3ZRW B;  1W2B U;  1AJQ A;  4LP8 A;  4QE9 A;  2IH3 C;  4XDL A;  3W7T A;  4MT8 A;  4R50 A;  2XND G;  1OCR C;  1M56 C;  4JGS A;  2YEV B;  3ASN B;  4UUJ C;  3ZJZ A;  2QA4 V;  1SER A;  1K5Q A;  2DWD C;  4UV8 A;  1V54 B;  3JCZ A;  4LBE C;  5EC1 C;  2EIN C;  3AG2 C;  3SYP A;  3ZMV A;  4GX0 A;  4CBC A;  1QR9 A;  1YJW V;  2B1G A;  1NVP D;  2A0L A;  2Y69 B;  2ZQM A;  4BW5 A;  5E1A C;  5KA6 A;  1V54 C;  3CCJ V;  4RAI A;  3CCV V;  3LUT B;  2A79 B;  1NVP B;  2WPD G;  2BOB C;  1XL4 A;  3OW2 U;  2IJI A;  5EC2 C;  1Q82 W;  2Z3Y A;  3I55 V;  2W0F C;  3SYC A;  3BEH A;  1AI4 A;  4U7N A;  1PNM A;  1M90 W;  3STL C;  1AI7 A;  2OTL V;  3P32 A;  3WFV A;  2LP7 A;  4PDL A;  1AI6 A;  4F4L A;  3R65 A;  2KB1 A;  2D3O W;  2V1D A;  4MTG A;  1NQT A;  3TK1 A;  1VQ7 V;  4P9O A;  2WLK A;  1I5X A;  2EIK B;  4X89 A;  1S77 D;  5L3F A;  2OCC B;  4H33 A;  1J95 A;  1M9N A;  1FS0 G;  3VBB A;  4X88 A;  1TUE B;  3ETD A;  1G8M A;  4JAV A;  1KC8 W;  1IXM A;  3JD1 A;  4KP4 A;  3HPL C;  1PKX A;  1VQM V;  3STZ C;  4P9P A;  3CC2 V;  2R9R B;  3CCS V;  1WPX A;  2WAM A;  3FKS G;  2IJJ A;  2JEU A;  2X6A A;  2ZD9 A;  5B1A B;  3W7U A;  3B8N A;  3CC4 V;  2FTK A;  1KD1 W;  1QVF U;  4MSW C;  3PJS K;  3OE7 G;  4FJC C;  1LNQ A;  4MW8 A;  1PNL A;  5IYC O;  1VQ6 V;  4QE7 A;  1K73 W;  4G27 B;  3IFX A;  3ETE A;  3MD0 A;  5J9P C;  3F7Y C;  3I56 V;  3GB7 C;  3K03 A;  3MHH C;  1F23 A;  3DTU B;  4QJF B;  2WLM A;  3E8G A;  3FB8 C;  3F5W C;  1KQS U;  2IH1 C;  1R73 A;  3CCR V;  1Q86 W;  4MS2 A;  1Q7Y W;  5CMU A;  3RVY A;  2ATK C;  3LSS A;  2NNU A;  2ZDI C;  3E8H A;  3QO7 A;  1PL0 A;  2LFS A;  2EIN B;  2JEX A;  4QNH B;  3SJQ C;  1UJW B;  4HZ3 A;  4DO2 A;  4MVZ A;  3VOU A;  2QTO A;  1R3K C;  4MTF A;  1M57 B;  2OTJ V;  2HFE C;  3K0D A;  5B1N A;  1GO3 F;  1HWY A;  1ORQ C;  3ABK B;  1H8E G;  1GKF A;  2QE7 G;  3X2Q C;  2HKO A;  3FYI B;  3JD2 A;  3OR7 C;  4PDM A;  4RO2 A;  3HB3 B;  4UV9 A;  5H6Q A;  5B3S B;  3CMA V;  1NR7 A;  2DQ0 A;  3G6E V;  3MHS C;  2EIJ C;  4GT1 A;  2WLL B;  2K1E A;  4G2K A;  3H01 A;  4QPK A;  2X6C A;  3CPW U;  1R6N A;  4MVO A;  5DM6 V;  1OCC C;  1GTO A;  5H9C A;  4JTA B;  3AG1 C;  3SYQ A;  2EIL B;  1QLN A;  1M57 C;  4MTX A;  1L1F A;  1NR1 A;  1AJP A;  3CME V;  1W0K G;  3ZRX A;  3ZMT A;  2EZP A;  2XAS A;  4GX2 A;  4JPR A;  1W0J G;  1ARO P;  4WFF A;  5KUK A;  1B6Q A;  3ETG A;  3QO5 A;  4XDK A;  1NH2 D;  3K79 A;  3K9A A;  4J9Y B;  2ITC C;  1V55 C;  5B3S C;  5C93 A;  1K33 A;  5L3D A;  3ZRS A;  1AR1 B;  1FXK C;  3OMA B;  5FL7 G;  2DQ3 A;  2EJR A;  2HLD G;  2AHZ A;  4HAM A;  2EIM B;  1FXV A;  1YIT V;  1JOY A;  3K08 A;  2WLN A;  3SPC A;  1GK9 A;  4WFA V;  1VQN V;  2XOK G;  1OCC B;  3ZIA G;  2XAG A;  3SPJ A;  3K0G A;  3G71 V;  4WFG A;  1MAB G;  2CK3 G;  3OFN G;  5CN0 A;  3E2E A;  3FYE B;  2HG5 C;  1ROP A;  3ZCC A;  3P30 A;  5L3G A;  2IU0 A;  3T1C A;  1V55 B;  1CPY A;  1BHB A;  3ABT A;  4MTO A;  5CBF A;  1S3J A;  3ZRV A;  3EHB B;  3JD3 A;  3SPI A;  1S76 D;  2W6I G;  4UVC A;  1ZWI C;  3B8M A;  2IJH A;  1SET A;  2Q68 A;  2YEV A;  2NLJ C;  2B1I A;  2UXX A;  2WLI B;  3ASO B;  4GX5 A;  4PA7 A;  3ZMU A;  2OCC C;  3FB7 C;  3TCU A;  1FXH A;  3ZRW A;  2JK5 C;  1EFR G;  1S0V A;  3LNM B;  1YHQ V;  5EBW C;  2LFR A;  2WLI A;  1NBM G;  2QEX V;  4L87 A;  2XAJ A;  5LBQ A;  4OXS A;  3CP1 A;  1SZT A;  3AG3 B;  1YJ9 V;  1YTF D;  4XDJ A;  5CA3 A;  1K5S A;  1RM1 B;  4G28 B;  3X2Q B;  1H8H G;  2HVK C;  1YTF B;  3CCL V;  3W7W A;  4JYB A;  2M7W A;  2ZXW C;  1SES A;  4E2L A;  4X8A A;  3OR6 C;  3T4D A;  3WG7 B;  3CCU V;  4XBF A;  1OCZ C;  4N21 A;  3D3I A;  2QM7 A;  2ZDI A;  3ABM C;  3T4Z A;  3UM7 A;  3GWO A;  3DGE A;  3AG3 C;  3ABU A;  2QM8 A;  2XAQ A;  4MVQ A;  5B1B C;  3SPG A;  4BIZ A;  2Q69 A;  4JYC A;  1K97 A;  1VQP V;  2QKS A;  3CC7 V;  1M56 B;  3RVZ A;  5B1A C;  5LGT A;  3OM3 B;  4FPP A;  4LCU C;  5IYB O;  1K8A W;  5EBM C;  1K3E A;  1MOF A;  2DYR C;  4UVA A;  4RQF A;  1RM1 C;  2JIZ G;  2GSM B;  1R6K A;  3OMN B;  1N8R W;  1RPO A;  3SYO A;  1P7B A;  4YXW G;  5L3E A;  3FB5 C;  3ASO C;  1VQ5 V;  1OZ0 A;  3IC7 A;  1PD3 A;  1R3J C;  4I9W A;  1FXK B;  1YJN V;  2OT5 A;  5LGU A;  1YI2 V;  1MSW D;  3QNE A;  4HYO A;  1VQL V;  3ABM B;  3OAA G;  4JAS A;  5H6R A;  1AI5 A;  1JVM A;  1F51 A;  1R3L C;  2ITD C;  3JD4 A;  4UVB A;  2MK3 A;  1S72 V;  1BL8 A;  4RQE A;  5B1O A;  3G4S V;  2H94 A;  1KKD A;  1P4R A;  4KFM A;  1FFT B;  1KP2 A;  5KA5 A;  1S5H C;  1QLE B;  3OUS A;  2EIL C;  2AHY A;  2Q6A A;  4EKW A;  1QBZ A;  5BZB A;  1K34 A;  4ZKI A;  2P90 A;  3RBZ A;  2DYR B;  2X7R B;  3KG2 A;  4Z1M G;  1K9M W;  2HJF C;  5IY5 C;  1NKD A;  1XL6 A;  2X0L A;  3D36 A;  4MVS A;  1Y4M A;  2P67 A;  4WFH A;  3K06 A;  3E86 A;  1EBO A;  3W7X A;  1QR8 A;  2ZR3 A;  3OGC C;  4P30 A;  1M1K W;  3A0R A;  2YSU B;  3JD0 A;  4H37 A;  1KP3 A;  2P7T C;  4PA4 A;  2WLJ A;  1PNK A;  4LC1 A;  4MW3 A;  1GM7 A;  1DLB A;  2DW4 A;  2PI4 A;  1RPR A;  3WG7 C;  1DF4 A;  5KUM A;  1F4M A;  1VQ9 V;  1E1Q G;  4PEL A;  1OCO B;  4I5S A;  3E89 A;  4GCZ A;  3AG1 B;  1OCR B;  1QVG U;  2GHY A;  2WWW A;  5CBH A;  2EBO A;  3TET A;  4JF3 A;  1I5Y A;  4PDV A;  1K7D A;  5IDJ A;  4RUE A;  5IY5 B;  4PDR A;  2JDI G;  3CD6 V;  1EZJ A;  2DYS C;  4PA9 A;  2F43 G;  1COW G;  1OHH G;  1NH2 B;  3JYC A;  4DXW A;  4MVM A;  5HFL A;  4MVU A;  3BY6 A;  3NXS A;  1YIJ V;  1VQO V;  2IU3 A;  4N23 A;  4RUF A;  3E35 A;  1VQ4 V;  4WCE V;  3ZN1 A;  2WSS G;  3ZN0 A;  3CYO A;  2UXN A;  3F7V C;  2Q67 A;  1WLE A;  4MVR A;  1GMG A;  3OUF A;  1GM9 A;  5EK0 A;  1AJN A;  2Y48 A;  4FK5 C;  1VQ8 V;  4R7C A;  4CZZ A;  1BHA A;  4UXN A;  4JAU A;  1H2G A;  3FB6 C;  4WF9 V;  3ABL C;  1DF5 A;  4P2Z A;  3E83 A;  3CXC U;  1KEC A;  3AG2 B;  3T2M A;  1YSC A;  2V7Q G;  1R3I C;  3E8F A;  4R8C A;  3ABK C;  5CBG A;  3W7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...