1Q82W

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1q82W00
1K9MW 3CCRV 3CCSV 3CMAV 3G71V 1YJNV 3CC2V 3CCEV 1VQKV 1KC8W 1Q81W 1W2BU 3CCMV 5DM6V 1VQNV 1VQ8V 4WCEV 3G4SV 1KD1W 3G6EV 3CMEV 1QVGU 1VQMV 1Q86W 3CXCU 2OTJV 1N8RW 1M1KW 3CD6V 1JJ2U 1YI2V 3CCJV 2QA4V 1YJWV 2D3OW 3CC7V 3OW2U 1KQSU 1S72V 3I55V 4WFAV 1VQ7V 1K8AW 1R73A 4WF9V 4WFBV 3CC4V 3CCLV 2OTLV 3I56V 2QEXV 1Q7YW 1VQ4V 1YIJV 1VQ6V 1YHQV 1VQPV 1NJIW 1YJ9V 1VQLV 1YITV 1VQ9V 3CPWU 1VQOV 1M90W 3CCVV 1QVFU 3CCUV 3CCQV 1Q82W 1VQ5V 1K73W
chains in the Genus database with same CATH superfamily
1BS3A 2UXBO 3TK1A 4F6RB 2PI5A 4AILC 4LF8B 1R6KA 3AG4C 4DUYO 4DR3B 2LQTA 4EB6B 4B3MO 4DV2O 3ABKC 3FB6C 3CJHA 3JASB 1K4DC 3CCJV 1AJQA 1F4MA 3CC4V 4LH7A 5IWAO 1AP5A 2BOBC 1R3KC 1KB9F 2ILMA 1N34O 5H9CA 3W7UA 1AJPA 1GM7A 4GKKO 2FB5A 4MVMA 4JI8B 1H2KA 1XL4A 3JD3A 5FPRA 1OCOC 2KB1A 2QWOB 4DR7B 2JS3A 5IYBO 1FAFA 3TJTA 1N33O 4DV6B 4WFBV 4X62O 3OT7A 1PL0A 1P84F 2DYRC 4Q20A 3UT5B 5IYDO 1Q5OA 4DK1A 5B3SC 2YI9A 2HFEC 5DM6V 2RMKB 1QBZA 4EKWA 5FNVA 4PELA 1IXMA 4YHHO 1IX9A 1FXKC 4KHPO 4FM0A 2HLDG 4E2LA 5CA1A 4DV1B 1JVMA 1WB7A 4GX1A 3RYCA 1FFXB 4FLYA 4PD4F 2QSAA 1KC8W 4FLTA 4LF7O 2ODMA 4BW5A 3HKEB 3IC7A 1VMGA 3L9DA 5C8YA 1SERA 5E1AC 1JFFB 5KX5A 4TUYA 5IDJA 1S72V 5JVDB 5B1BC 4CS4A 4MVUA 3BY6A 1YIJV 2IJJA 4DO2A 3HKCB 1GMGA 2GTSA 3B8MA 2EBOA 1GM9A 5KUMA 3JATB 4BR6A 4TV8A 3RYIA 2JDIG 4NB5A 2KSDA 5CBFA 3ETDA 1A32A 1YZBA 2CTRA 4X88A 4GZRB 3KCYA 4LP8A 2Q69A 1H38A 4U3FH 3ZMSA 4O4LA 2ETNA 3P32A 3BFRA 1QR8A 4X1YB 1WJZA 2UXXA 3UO2A 4ZIBA 3BHPA 1MMMA 1SQBH 2AGAA 3JARB 2UXDB 4O2AA 2ZE7A 1JX9A 4QE7A 3LNNA 5LXTB 4JI3O 4DV6O 2GTAA 1VEWA 1HNZB 2ZCEA 4XBFA 2ZXWC 4YIPA 5JH7A 1T5EA 2ZE8A 4AQYO 3JD2A 4DR5O 3IAYA 5EIBD 3OMAB 2YEVA 1S0VA 3B4SA 2OCCC 1ZL8B 4G28B 2JEUA 4B3TB 4GUNA 1B3QA 5KHIA 3IFXA 4ZHQB 4YY3B 2B1IA 4JV5O 2ZNJA 1KECA 4QPKA 4P9OA 3K5OA 1Q43A 4DV1O 2JGDA 4P2ZA 4PDRA 5IYCO 5J2UB 4LF5O 3CYOA 1FS0G 2WAMA 3CC7V 4KXRA 3SYQA 2HVJC 2UUBO 1B06A 2DN9A 5H6RA 3DGEA 1ZSPA 2YXLA 5IYZB 3A0BZ 1S5HC 1EZVH 4B3SB 2YI8A 1PPJH 1V54C 4K8XA 4K8ZA 1N36O 2YICA 1F51A 1VQ8V 4NTYA 1HR0B 2VWKA 1YTFD 1N8RW 1AVMA 4DV3B 2ZR2A 4XDKA 1KBHA 3OEEG 5K1PA 4G2KA 4DR4B 4B7KA 4X64B 3M7MX 2IW5A 2QGNA 3AG3B 4J41A 4PA7A 3E8FA 5IJ0A 1O9GA 5JCOC 3K79A 2CH7B 2LP7A 1V9PA 4DV5B 3ASNB 3UM7A 3J7AU 1TVKB 3BEHA 2UXDO 1GO3F 2L35A 5LYJB 1PP9H 2ZT9B 3ZEDA 1AI4A 4CC6A 5LHIA 2Y69C 1J5EB 3FFQA 1SA0A 1Y67A 5BMVB 4O2BB 3AK2A 1L1FA 1HNZO 4MVQA 4F4LA 2F1MA 2Q7EA 2KKWA 2BOCC 3K9AA 2QKAA 4JI4O 4IHJB 3WB1A 4D7SA 1XILA 1N0NA 4CH6A 1VF6C 1PL4A 1VQ5V 2OYQA 3T4ZA 5L3FA 4YY3O 3WG7B 3KKYA 5JQGA 5L3DA 3RGBA 4WCEV 4JAUA 5KHGA 1BHAA 4HBNA 2ZNIA 1K34A 3C90A 5GONA 2Q0OC 2F4VB 1SZTA 1SF9A 2A79B 1MA1A 4IYIA 1NH2D 3DC5A 4CC5A 1RM1B 4PA9A 4NXMB 1OCZC 3L74H 2PGGA 1Q90D 4Z1VA 2R9AA 4H44B 1B6QA 1R1BA 1SZXA 2HHHB 1WA8A 5D5QA 1US6A 1HR0O 4WF9V 3CJHB 3AEIA 2RN9A 2JK5C 1FXKA 2VQEO 4Z2WA 4DR4O 3E35A 2JEXA 4X64O 2Z5UA 4F6EA 2ITCC 1SRYA 1I08A 3QO8A 5B1AC 2FKXA 1FXVA 4XDJA 2HJFC 2BSKB 1EZJA 3WB0A 3ZIAG 4DV5O 1JMKC 2ZDIC 3THOA 1HWYA 1G8MA 1Q6IA 2CGNA 2EIMB 2Q7HA 1BHBA 1KU9A 1QLNA 3CS5A 3L71H 2EINB 2A06H 1QVGU 2YXHA 1YEWA 2AZ2A 1KKDA 3W7WA 4P9PA 1YVWA 3KG2A 5LMNO 2DYSC 1IBLO 2Q0AA 3U11A 1TA8A 3TXSA 2QTSA 2AHZA 2ZIOA 5GTIZ 2QDOA 3PJSK 1H8HG 3RYCB 3CEIA 3O9OA 1ZX3A 1AI6A 4R6ZA 4LBEC 2AZ0A 5HFLA 1OJHA 4U7NA 4D7TA 3OW2U 3X2QB 1QLEB 5C8YB 4B3RB 1MSWD 4ZOLA 3R65A 5KX5B 4TUYB 3K57A 1IURA 3STZC 2IJIA 4HNAA 5LA6A 3L73H 1N4CA 1AJNA 3ZRXA 3BRCA 4JYBA 4UV9A 1I0HA 4BW9A 3EVKA 3RYIB 3BAAA 3QO7A 3CXCU 2XAJA 2B9ZA 1FJGO 3CXHF 1VQNV 1Z2GA 1DF5A 2CTQA 3K3WA 4LF9O 3ICXA 4J11A 1Y74A 2K9PA 1XBLA 4O4LB 5JJJB 4FK5C 2XTAA 1VF7A 3K9SA 2E76B 5KMGA 3SPCA 3OGCC 3G6BA 3RBZA 1RPOA 3E22A 3CX5F 3MDSA 4JYAO 5LMUB 1K5QA 1E1QG 2E75B 3ZRSA 2E5LB 3OTOO 4UFZA 1M57C 1YJ9V 1KKCA 1HNXB 3BA8A 2WLNA 2Y48A 3F5TA 4QIWF 4X1IA 4ABMA 5JH7B 4JZ2A 5LOVA 3QNEA 3G6EV 3CMEV 4U3JA 2EZPA 1IBKO 1M1KW 1K4CC 3K5LA 2YEVB 3SDLA 4UB8Z 2UU9O 1XOUA 3F5WC 4FFBB 5KHHA 3HKBA 3EFFK 3H1KH 4J9YB 3ZHSA 3CCUV 4KL1A 3LDCA 2C2AA 1YJNV 1JQ0A 1WPBA 4J7JA 1EN5A 5JCOA 4DUZO 4MVZA 1GH6A 2XT9A 4JI1B 4BWAA 4PA4A 1FYJA 2JGDB 2PTMA 2QA4V 1AR4A 4MTGA 3I55V 4NVPA 4TV9A 3EHBB 1LR1A 5BR8B 5E79Z 2Y0PA 1SETA 4TOIA 2RCVA 4JI2B 4JGSA 2WA3A 2RNBA 1MZFA 1KP3A 4CH3A 1VQMV 4PA3A 5BXZA 3R66A 1BCCH 2P22C 3AG1B 3D3QA 1XNRB 2Q4PA 3ABMC 3H01A 3APOA 3ZMVA 4PDLA 4JI6B 1VF6A 1I7FA 4RQFA 2R70A 5IJ0B 1XI1A 2IJKA 2Q68A 1GN3A 2VQFO 4BAYA 2F66C 3RYFA 3FX7A 1NZ6A 2YUAA 4B08A 2YDEA 3I56V 3VQYA 1R3IC 1JR9A 4UCVA 3IGAC 3Q4HA 5EYPA 3FB5C 3SYPA 1XQ8A 1SQVH 4H0LB 1YTFB 5LBQA 1THZA 5EBWC 3UO3A 4LR3A 5BY1A 1NR1A 1WPXA 4UCTA 4LFCB 1AI5A 3SGIA 3K06A 2DWDC 1RFYA 3ABKB 3H1LH 1XNQO 3CCQV 4YJ3A 5ITZB 3CB2A 4GKJO 2V4DA 4W4KA 5CA0A 5JQGB 2HKOA 2DWEC 1Q8IA 4YXWG 4LF6B 2KQXA 3LDDA 1OCOB 1JJ2U 1P7GA 5KA5A 4MVRA 2BTQA 5GONB 2EIJC 3GVMA 3SR2C 3B77A 1Y76A 4WFGA 1RP3B 3H1HH 3H9VA 2H8PC 2ZDIA 1IVSA 3ZBHA 5L3GA 2DYRB 5BR8O 1I94B 1VIBA 1GAXA 3WFVA 4JI2O 3MHSC 4MVSA 3E8BA 4X89A 4UCUA 5LHGA 3RT3C 3LNMB 3QG5A 4WFAV 4DYLA 4FLXA 4K0KB 4DR2O 3ETQA 2R9IA 2UXCB 3TETA 1WA8B 2ZR3A 4DXWA 3ZRVA 1XNRO 5L3BA 4J80A 1GTOA 1LNQA 1FXKB 2FYUH 3NXSA 3JAWA 1Y66A 2YXYA 3OAAG 3CCMV 4N21A 1EN6A 5J2TB 3RW0A 3KZIZ 4FLVA 4LF8O 1U97A 1NTMH 1NH2B 4DR3O 4GLXA 1TGOA 2QJ1A 1VARA 3CSXA 1MSDA 4R7CA 4PI2A 1UPGA 4JI5B 5TISZ 5KA6A 3JALA 2PI4A 1XDCA 5B1BB 2AW9A 4ZI7A 2AHYA 2WLIA 1AB3A 2W6JG 3DXRA 1ROPA 2NNUA 2QTOA 3ETGA 4JI8O 2M7WA 1V55C 4DR7O 2XOKG 4LF4B 3TCUA 2GDSA 1FPOA 2YIAA 4L8JA 1SQPH 2CDYA 1VQ9V 4HAMA 1Q3EA 2B1GA 3AK3A 1SC5B 4OX9B 2O57A 4IT5A 1AP6A 4JI7B 1ENVA 1HP8A 4TSFG 2EILC 5A9GA 1PKXA 4KUMA 1YI2V 3SPGA 1YXBA 4IIJA 5F2VO 3CWBH 2G38A 4LF6O 3JD1A 2CE4A 3B40A 4DRXA 1W0KG 3T2MA 4JPRA 4HYOA 1Q82W 4X1KA 1E1RG 3CMAV 3VOUA 3M99B 3U0ZA 2F93B 3FB8C 2UUCB 1Z5WA 1SQGA 4RQEA 1W2BU 2EULA 3BA9A 2YIDA 2ZXWB 1I94O 2D3OW 4AHCA 3D36C 2EZOA 4UVBA 2WLLA 2P06A 1LUWA 2MK3A 2HVKC 2OCHA 2OCCB 2E74B 3KCXA 1Y74B 3CCSV 2CK3G 1M56C 1XEQA 4GX5A 2QWRB 2IH3C 5GTHZ 1NKDA 4I0XA 4H37A 3AG3C 3N2GA 3E22B 3OTFA 4RAIA 5EBLC 1K3EA 4PV1B 2CTPA 2W0FC 3NR7A 3ASOC 4MW8A 4D6TH 1OCRC 4MTFA 1XREA 1OHHG 2IU3A 3QO5A 3JAKA 1GK9A 2QM7A 4JI5O 5LHHA 4Z1MG 1NTKH 4X1IB 5DEDA 1V54B 3ZHQA 3RYHA 1NT2B 5FPOA 4U3JB 1BQZA 3FAVA 2DW4A 1D5AA 1DLBA 3CE2A 2ATKC 4H13B 1ZLZA 3DSQA 3HKBB 2P5OA 3SYOA 1BMFG 4FZ0A 4EB6A 1M4UA 4LFBB 1M93A 4DV7B 4QPJA 1I5XA 3P30A 2Q7GA 4NXNB 4AI8A 4LNUA 4BIZA 2GUZA 1MABG 4JZGA 4FLWA 3CPWU 4TV9B 3S3WA 4B3TO 4JF3A 3K0GA 3SPHA 1XHZA 2LJ2A 4K3AA 2BTOA 2N74A 1Q6HA 3AG2B 2IJHA 4I50A 1ZWIC 1SQQH 2JRIA 2Y0IA 2UUCO 1RSOA 4X8AA 3UT5A 1GM8A 1WP7A 3CCLV 1CPYA 2ZINA 1UJWB 2Z0AA 3OMNB 3ABLB 3T1HB 5LGTA 4JI0B 2QKCA 2DJVA 3K04A 5K1XA 1G4YB 1P4RA 4B3SO 1SQFA 3CD6V 3HKDA 3SYCA 1X59A 3J81N 3RYFB 4FM1A 1VQPV 1H2LA 4DV3O 1SKVA 1UFIA 2EJ7A 3Q4HB 5EYPB 2PF4E 2K1EA 3FD9A 1URFA 1Q81W 1JFFA 4ZBMA 2KG7A 3OM3B 2JVDA 3SPIA 2HG5C 4EFBA 4JAAA 1NR7A 1VQ4V 3WU2Z 1N32B 5CB4A 3T4DA 2ZM6B 4I5SA 4BIUA 3OE7G 5AG2A 1J5EO 4YJ3B 4OPHA 4LFBO 2RQ6A 5CA0B 3HB3B 5B1AB 1Q6UA 5C93A 1AILA 2XHBA 5FNVB 4NXNO 2JJ1G 1WP8A 3E8HA 1FXHA 2MW2B 2BTQB 4NYKA 2QM8A 2EIKB 2YS8A 3ZN1A 3JARA 4MS2A 2RJZA 3P3PA 5CA1B 2GV9A 5LGNA 1P7BA 1Y76B 2R72A 1NVPD 3U10A 4QE9A 4LWSA 3OFNG 3A0RA 4C7UA 3HPLC 3LSQA 2ADQB 5B1NA 3APQA 2PY5A 3JSNA 1AROP 1X4TA 3DTUB 4UVCA 5JWPA 4YIOA 5IT9N 5IY5B 4GX2A 4DR1B 4R8CA 3K59A 2F4VO 3UKMA 1OZ0A 3CC2V 2DYSB 4NXMO 4JI0O 1ZL8A 3E2EA 4TV8B 3JAWB 4EEQA 3B2EE 1JPXA 1COWG 1WNSA 3UQ8A 1MG1A 1XMQB 3S3XA 1L0NH 1R6TA 2UUAB 3ZS8C 4I4TA 3P3NA 3GB7C 3ETEA 2HHHO 2UXNA 3K0DA 1S3JA 2QR4A 4I7ZB 5J2UA 3JALB 4BIOA 1B04A 4ZI7B 2WLIB 2JS5A 4QGPA 4E4EA 3GWOA 3VQXA 5H2FZ 1Y6XA 4DK0A 5B1OA 4O2AB 5EZYA 3D36A 3K03A 1H2SB 1H2NA 4DUYB 3SJAC 1N32O 1M5IA 4JYCA 3FB7C 4DV2B 2Z3YA 5HFMA 2V1DA 1SQXH 1SESA 5KUKA 2ZM6O 2H94A 1VF5B 5A2QN 1HW7A 3ZHVA 1N34B 5IJ9A 1AI7A 2Y4TA 4JTCB 3JD0A 4LCUC 4GKKB 4IIJB 3RFRA 1EFRG 1TUBA 2P7TC 4WFEA 2WWWA 4DRXB 4O4HA 1N33B 1M57B 4LH6A 4MT8A 4X1KB 3CRCA 4ICGA 1TVKA 2QWQB 3IC9A 4X62B 1JOYA 2P90A 4R50A 4JASA 2ZIMA 4GX0A 3M8AA 4J7ZA 2F43G 5BZBA 2W0XA 3SJBC 5BMVA 3FYIB 4NR1A 4ZKIA 1CXZB 1VQLV 1CEZA 1HDJA 3ZHUA 1AR5A 2WLLB 3F7VC 1RPRA 1GKFA 4B3RO 1Y4MA 3A0HZ 5GW7A 4ASUG 2GSMB 3AG1C 5CBHA 4TT3G 2DOSA 2P67A 1MOFA 4IL6Z 5IE9A 1DGSA 4KHPB 4FVMA 1ZAUA 4I0XB 3ABUA 5LP6C 4CS2A 4MTXA 1FFTB 1S5JA 3IJ4A 4PDVA 3TGUH 1YITV 4K35A 3E89A 2QM4A 5L3EA 2UUAO 1YDXA 3N2KA 5J9PC 1GN2A 4UCRA 5FLXN 2DE0X 3HR0A 3VQWA 2V7QG 1OCCB 4PI0A 3JCUZ 1WB8A 4DV0B 2YIBA 3CRQA 4DW0A 2CTWA 5DN6G 1KP2A 2QE7G 2P6JA 4KP4A 3RYHB 5LMUO 3FAVB 2E5LO 4WBNA 2HJDA 3G71V 4UCSA 1DTOA 3CCEV 2DMXA 2ZKOA 1SA0B 1HNXO 3SYAA 5KAIZ 2Y4UA 4CH5A 1WLEA 3ABMB 1BT8A 1S77D 1YJWV 3AG4B 1EBOA 3RWRD 1WAZA 2H3OA 2N05A 4LNUB 3RVZA 4J10A 3L72H 1M90W 3CCVV 2DQ3A 2LO1A 1PNMA 2GUZB 3ZJZA 2QKSA 2QWPB 2RDCA 2BSKA 4J9ZB 3BVOA 4I50B 4JI3B 4O4IA 2R9RB 5EBMC 5D5PA 1IZ3A 1VQ7V 3OEHG 4GYCB 2OTLV 1RSOB 2B5UA 2NR5A 4JI1O 4AQYB 4DR5B 1NBMG 4MVOA 2WA4A 3AG7A 1JJOA 4YJ2A 4PDMA 3MAQA 1EM1A 3OGIB 5B3SB 2PYJA 4JV5B 1R73A 4W4LA 2N04A 3HKDB 2YC0A 3ZN0A 1QNMA 3T1YB 2A3QA 3QF7A 4I9QA 2F23A 3JCZA 4TQDA 3MHHC 3CCRV 2PUSA 1L0LH 4LF5B 3E8GA 4RUEA 2EIJB 5JJNB 2UUBB 3G4SV 1QHTA 1GN4A 2EJRA 3D8CA 4JI6O 2D2CB 2KG7B 4DV0O 2XAHA 4CZZA 2QEXV 1J95A 4P30A 1EN4A 2ZE6A 1VQOV 2AXTZ 1NI8A 1N36B 2X6BA 5CB4B 5CN0A 4UVAA 1ZTEA 2XUMA 1F23A 4XDLA 1S76D 1WN7A 5LGUA 1FKAO 3FYEB 5EC2C 1NS1A 1KYOF 4LFCO 4FMTA 1BSMA 2PZSA 1GRJA 2OWOA 3CRRA 4I55A 1BL8A 2OTJV 3VBBA 4LWSB 1P49A 4O4JA 4RWUA 5H5NA 1V55B 2X0LA 2GHYA 3VQVA 4ZOLB 3OD4A 4OGQB 2BCCH 3GWKC 4HNAB 3LSSA 5LA6B 1PNLA 2ADPA 4PJ0Z 2VWJA 3BABA 3ZMUA 4FFBA 3ZX6A 4JI4B 1G1XB 1IDSA 4PHZA 2P4VA 2EILB 3O65A 1KMIZ 3ABTA 4HZ3A 3ZHTA 1NVPB 4I4TB 1R6NA 1BE3H 2DQ0A 4K0KO 1HNWB 2UXCO 4LFAB 3A2FA 3JD4A 3T1YO 4JYYA 4X20A 5KMGB 2ZQMA 3JSLA 3ZRWA 2XAQA 3OR7C 2Q67A 4FLZA 5EZYB 4UUJC 1FD9A 1NTZH 3ASNC 5KLVH 1N0JA 3OUSA 2CUGA 4FZ1A 5B66Z 1Z5VA 2HEPA 3ZMTA 2ARHA 1XUQA 5L3CA 4UCOA 1D5NA 1M56B 5LOVB 2VQEB 3BCCH 2PYLA 5IJ9B 5LP6A 5LL6Y 3CP1A 2OIEA 4F6RA 4LF4O 1TUBB 2A0LA 4PA6A 1F7YA 3ML0A 3JASA 3ASOB 4OX9O 2NN4A 4O4HB 1OCRB 1K5SA 3I5DA 4LC1A 1Q86W 4JI7O 2WLKA 3AG2C 1Q7YW 4Q6GA 3ZMZA 4WFFA 3WG7C 4X9QA 3T1CA 2LFRA 1U96A 4NTWA 1K73W 4QJFB 2WSSG 4CS3A 3SJCC 2Y69B 3ABLC 5EC1C 4CBCA 5LMNB 3RN4A 1RM1C 1IBLB 4DW1A 3OR6C 4JTAB 1TAEA 4J42A 2F95B 1BQ0A 1IBMB 1K92A 2VS0A 2Q73A 5ITZA 1H2GA 1L8DA 3ZHRA 2XNDG 4MSWC 4RO2A 4JAVA 1DK1A 3N2KB 3E83A 1K7DA 1HNWO 4G27B 4LFAO 5CA3A 2ITDC 3J80N 1YCIA 4A5UB 1LUVA 1FFXA 1PM9A 4J7KA 3OUFA 2LW1A 4MW3A 2W6IG 3HKEA 2L6LA 4MTOA 4TQFA 2FTKA 1FJGB 4WBNB 2LFSA 4U7OA 4H33A 4I9WA 5JVDA 4LF9B 1D2DA 1OCZB 3HKCA 2EIMC 1NU1H 1YSCA 3CRAA 3JATA 3LDEA 3E86A 2XAGA 3G67A 2EINC 1JA8A 1E79G 2OIGA 5J2TA 1ZUQA 4JYAB 2BE3A 1PV0A 3OTOB 1XL6A 1DF4A 2VRZA 4DV7O 2CGOA 2JIZG 1W0JG 2EIKC 4O4IB 3LUTB 4L87A 1XMOB 3SPJA 4X1YA 1G6UA 4IYHA 4X66B 2OT5A 2A7WA 1BZKA 1IBKB 2Q9LA 1MNGA 1QR9A 3X2QC 1QLEC 1QQCA 2UU9B 3DC6A 5IY5C 4DR6B 4YJ2B 3K58A 5LXTA 4EFEA 3JYCA 2WLHA 4IGGA 2X6AA 1ORQC 4GCZA 3L75H 3N27A 1OV9A 4DUZB 3WB2A 1IBMO 3F7YC 3W7TA 3D3IA 3CRMA 3T1HO 3SJQC 4DV4B 3LSUA 5KHKA 2M6YA 1YF2A 3L70H 4GT1A 2E3CA 3AK1A 1I5YA 2HR3A 3MD0A 1JCHA 5B5EZ 4ZHQA 2IM9A 1MZEA 2P4KA 4KFMA 3STLC 4OXSA 1NQTA 3H1IH 2EX3A 2JGUA 2Q6AA 4NKGB 5FL7G 5KHJA 5IYZA 3DXRB 2IBZH 1SS3A 4X65B 3PN1A 3W7SA 3G80A 2UXBB 2XAFA 3C3TA 1XHXA 2VQFB 4B3MB 2LGQA 5DECA 2FL4A 5JJEB 3JAMN 1KD1W 1R3JC 2GBOA 5IWAB 3ZCCA 4I55B 1W59A 1PD3A 1H8EG 1S5LZ 1F4NA 3A8TA 1GN6A 1VQ6V 1YHQV 2IU0A 1BGYH 3K5NA 3K08A 4O4JB 2HP8A 1QVFU 3UCSC 3K5MA 3CHXA 2A9HA 2CH7A 4FIPC 1XMOO 4WFHA 4N23A 1R3LC 4RUFA 1IXBA 2WPDG 4CH4A 1VQKV 2WLJA 3BPZA 4X66O 3QTCA 2YSUB 1O9HA 3B8NA 3TXQA 2LW7A 4OPAA 5EIBC 1QU7A 4UXNA 5LYJA 5EK0A 1XNQB 2QWNB 2ZD9A 1K8AW 4DR6O 2ZE5A 4UV8A 4O2BA 1NJIW 1H2MA 2LGWA 5CMUA 4GKJB 2XASA 4B7EA 4FM2A 2YIBD 2NLJC 3OMIB 1K9MW 1PNKA 1KUQA 4DR1O 5CBGA 2X7RB 1VP7A 4FJCC 4YHHB 2FMLA 2WLMA 4FPPA 4NTXA 4DV4O 1CP9A 2X6CA 4IHJA 4X20B 5H6QA 1OCCC 3ZRWB 3B09A 3N2GB 1XMQO 2CAZC 3W7XA 4FFKA 1AR1B 4LF7B 1K97A 1TUEB 3EXAA 2JJ2G 3FKSG 5KAFZ 4UB6Z 3JAKB 4QNHB 4DR2B 4JTDB 2Q5ZA 3QVNA 1KQSU 2Q8VA 3C3SA 1QCEA 1K33A 3RVYA 3H1JH 4TWKA 2IH1C 4FLUA 4X65O 5LP6B 1M9NA
chains in the Genus database with same CATH topology
3ZRXA 3AG2B 2IJHA 3TK1A 4JYBA 2PI5A 1R6KA 1ZWIC 3AG4C 4UV9A 1BL8A 3ABKC 2XAJA 3FB6C 3QO7A 3CXCU 2OTJV 4X8AA 1K4DC 3VBBA 3CCJV 1AJQA 1GM8A 1VQNV 1DF5A 1F4MA 3CC4V 3CCLV 1CPYA 3K3WA 2BOBC 1R3KC 1UJWB 3OMNB 3ABLB 5H9CA 3W7UA 1V55B 2X0LA 2GHYA 1AJPA 4FK5C 1GM7A 5LGTA 4MVMA 3LSSA 3SPCA 3OGCC 1XL4A 3JD3A 1OCOC 2KB1A 3K04A 1PNLA 3RBZA 1G4YB 1P4RA 1RPOA 3ZMUA 5IYBO 3CD6V 3SYCA 1K5QA 1E1QG 3ZRSA 2EILB 4WFBV 1PL0A 3ABTA 4Q20A 1M57C 2DYRC 1VQPV 4HZ3A 5IYDO 1YJ9V 1NVPB 5B3SC 1R6NA 2WLNA 2DQ0A 2Y48A 4QIWF 2K1EA 3JD4A 1Q81W 2HFEC 4ZBMA 5DM6V 3OM3B 1QBZA 3QNEA 4EKWA 3G6EV 3CMEV 2EZPA 2ZQMA 4PELA 1M1KW 1K4CC 1IXMA 3ZRWA 2YEVB 2XAQA 3SPIA 2HG5C 3F5WC 1FXKC 1NR7A 3OR7C 1VQ4V 2Q67A 3EFFK 2HLDG 4E2LA 4J9YB 3CCUV 1JVMA 3LDCA 4UUJC 4GX1A 3T4DA 3ASNC 2C2AA 1YJNV 4I5SA 4BIUA 1JQ0A 3OUSA 3OE7G 1KC8W 4BW5A 3ZMTA 4MVZA 3IC7A 1SERA 5L3CA 5E1AC 4PA4A 2QA4V 1M56B 5IDJA 4MTGA 3HB3B 3I55V 1S72V 5B1AB 5C93A 5B1BC 3EHBB 4MVUA 3BY6A 1YIJV 2JJ1G 2IJJA 3CP1A 4DO2A 3E8HA 1FXHA 1GMGA 3B8MA 2EBOA 1SETA 1GM9A 5KUMA 2QM8A 2EIKB 3ZN1A 4MS2A 4JGSA 2A0LA 4PA6A 3ML0A 2JDIG 5LGNA 1NVPD 1P7BA 3ASOB 4QE9A 5CBFA 3OFNG 1OCRB 1K5SA 3ETDA 3A0RA 1KP3A 3HPLC 4LC1A 3LSQA 4PA3A 1VQMV 1Q86W 4X88A 5B1NA 1AROP 2WLKA 4LP8A 3AG1B 2Q69A 1H38A 3AG2C 3DTUB 4UVCA 3ZMSA 1Q7YW 3ZMZA 4WFFA 3WG7C 5IY5B 4GX2A 3P32A 1QR8A 3T1CA 2LFRA 4R8CA 3UKMA 1OZ0A 1K73W 3ABMC 3H01A 2UXXA 4QJFB 3ZMVA 3CC2V 4PDLA 2DYSB 2WSSG 4RQFA 2IJKA 2Q68A 2Y69B 3E2EA 3ABLC 5EC1C 4BAYA 1JPXA 1COWG 4CBCA 1RM1C 1MG1A 1JX9A 3OR6C 4QE7A 4JTAB 3I56V 1R3IC 1K92A 3IGAC 3GB7C 1H2GA 3FB5C 3SYPA 3ETEA 4XBFA 2UXNA 2ZXWC 3K0DA 1S3JA 1YTFB 2XNDG 4MSWC 5LBQA 4RO2A 4JAVA 1THZA 3JD2A 5EBWC 3OMAB 3E83A 1K7DA 1NR1A 2YEVA 4G27B 1S0VA 5CA3A 2WLIB 1WPXA 3GWOA 2ITDC 1AI5A 2OCCC 4G28B 2JEUA 5B1OA 3K06A 2DWDC 3D36A 3K03A 3ABKB 3IFXA 2B1IA 3CCQV 3OUFA 1KECA 4MW3A 2W6IG 4JYCA 3FB7C 4QPKA 4MTOA 4P9OA 2Z3YA 2FTKA 2LFSA 5HFMA 2V1DA 4U7OA 1SESA 4H33A 4P2ZA 5KUKA 4PDRA 4I9WA 5IYCO 2H94A 2HKOA 2DWEC 1OCZB 4YXWG 3CYOA 1AI7A 3LDDA 1FS0G 1OCOB 2WAMA 3CC7V 4JTCB 1JJ2U 3SYQA 3JD0A 2HVJC 2EIMC 5KA5A 4MVRA 5H6RA 1YSCA 3DGEA 4LCUC 3LDEA 1EFRG 3E86A 2P7TC 2XAGA 2EIJC 4WFEA 2EINC 1E79G 3B77A 2WWWA 1S5HC 4WFGA 2H8PC 2ZDIA 5L3GA 1M57B 1V54C 2DYRB 4MT8A 1F51A 1VQ8V 1XL6A 3WFVA 1DF4A 3MHSC 1YTFD 1JOYA 4MVSA 3E8BA 2P90A 4X89A 1N8RW 2JIZG 4R50A 4JASA 5LHGA 4GX0A 1W0JG 2EIKC 2ZR2A 2F43G 3LNMB 4XDKA 5BZBA 3OEEG 4WFAV 4G2KA 3LUTB 4L87A 2R9IA 3SPJA 3FYIB 3TETA 2IW5A 4ZKIA 1CEZA 1VQLV 2ZR3A 4DXWA 2WLLB 3F7VC 1RPRA 1GKFA 3ZRVA 3AG3B 5L3BA 1Y4MA 2OT5A 4PA7A 5GW7A 3E8FA 1GTOA 1LNQA 1FXKB 3NXSA 4ASUG 3K79A 1Y66A 2GSMB 3AG1C 1QR9A 3OAAG 3X2QC 5CBHA 1QLEC 4TT3G 3CCMV 2P67A 1MOFA 4N21A 5IY5C 3RW0A 2LP7A 3ASNB 3UM7A 1NH2B 3BEHA 3JYCA 3ABUA 2WLHA 4MTXA 1FFTB 4R7CA 2X6AA 1GO3F 1ORQC 4GCZA 4PDVA 1AI4A 1YITV 5LHIA 2Y69C 3E89A 5L3EA 5KA6A 5J9PC 2PI4A 5B1BB 3F7YC 3W7TA 2AHYA 3D3IA 1L1FA 2V7QG 1OCCB 2WLIA 3SJQC 2W6JG 4MVQA 4F4LA 1ROPA 2NNUA 2QTOA 3ETGA 5DN6G 1KP2A 4GT1A 2M7WA 1V55C 1I5YA 2HR3A 2BOCC 3MD0A 1JCHA 2XOKG 3K9AA 3TCUA 2QE7G 2P6JA 4KP4A 4KFMA 1VQ9V 4HAMA 3STLC 2B1GA 1VQ5V 4OXSA 3G71V 3T4ZA 1NQTA 1DTOA 3CCEV 5L3FA 3WG7B 1ENVA 4TSFG 5L3DA 2EILC 3SYAA 2Q6AA 4WCEV 4JAUA 1BHAA 1WLEA 1PKXA 3ABMB 5FL7G 4KUMA 1YI2V 1S77D 1YJWV 3SPGA 1K34A 3AG4B 1EBOA 1SZTA 2A79B 3W7SA 3JD1A 1W0KG 3RVZA 4JPRA 3T2MA 1NH2D 4HYOA 1M90W 3CCVV 2DQ3A 1RM1B 2XAFA 4PA9A 1PNMA 1Q82W 3ZJZA 2QKSA 1OCZC 1E1RG 3CMAV 3VOUA 3M99B 3FB8C 4RQEA 1W2BU 4J9ZB 1KD1W 1R3JC 2ZXWB 1B6QA 2R9RB 3ZCCA 5EBMC 1PD3A 2D3OW 1H8EG 1F4NA 1VQ7V 3OEHG 2EZOA 4UVBA 4WF9V 2WLLA 2OTLV 2MK3A 2B5UA 3AEIA 3SPHA 1YHQV 2HVKC 2IU0A 1VQ6V 2JK5C 1FXKA 3K08A 1QVFU 1NBMG 4MVOA 2A9HA 2OCCB 4FIPC 3E35A 2JEXA 4WFHA 3CCSV 2Z5UA 4N23A 2CK3G 1R3LC 1M56C 2ITCC 4RUFA 2WPDG 1VQKV 1SRYA 4GX5A 2WLJA 3QO8A 5B1AC 4PDMA 2IH3C 2YSUB 1NKDA 1FXVA 4XDJA 5B3SB 2HJFC 3B8NA 4H37A 3AG3C 4UXNA 5EK0A 1EZJA 3ZIAG 4RAIA 2ZD9A 1R73A 1K8AW 5EBLC 1K3EA 2W0FC 4UV8A 1NJIW 3ASOC 4MW8A 2ZDIC 3ZN0A 5CMUA 1HWYA 1OCRC 2XASA 4MTFA 1G8MA 1OHHG 2NLJC 3JCZA 2EIMB 3OMIB 2IU3A 3MHHC 1PNKA 1GK9A 2QM7A 3QO5A 3CCRV 1K9MW 1BHBA 5CBGA 3E8GA 5LHHA 4RUEA 1QLNA 2X7RB 4Z1MG 2EIJB 4FJCC 2EINB 3G4SV 2WLMA 4FPPA 1QVGU 1KKDA 2EJRA 1CP9A 2X6CA 1V54B 3W7WA 4P9PA 3KG2A 2XAHA 2DW4A 4CZZA 5H6QA 1DLBA 1J95A 4P30A 2QEXV 1OCCC 3ZRWB 2ATKC 2DYSC 1VQOV 3W7XA 1AR1B 2X6BA 2AHZA 3SYOA 1K97A 1BMFG 1TUEB 2JJ2G 3PJSK 4QPJA 3FKSG 1H8HG 1I5XA 5CN0A 4UVAA 4QNHB 1AI6A 3P30A 4R6ZA 4JTDB 4LBEC 1F23A 4XDLA 5HFLA 4U7NA 1KQSU 3OW2U 4BIZA 3X2QB 1S76D 1QLEB 1QCEA 1MSWD 1K33A 5LGUA 3FYEB 3R65A 3RVYA 1MABG 5EC2C 4TWKA 2IH1C 3STZC 2IJIA 4FMTA 3CPWU 1AJNA 4JF3A 3K0GA 1M9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M W;  3CCR V;  3CCS V;  3CMA V;  3G71 V;  1YJN V;  3CC2 V;  3CCE V;  1VQK V;  1KC8 W;  1Q81 W;  1W2B U;  3CCM V;  5DM6 V;  1VQN V;  1VQ8 V;  4WCE V;  3G4S V;  1KD1 W;  3G6E V;  3CME V;  1QVG U;  1VQM V;  1Q86 W;  3CXC U;  2OTJ V;  1N8R W;  1M1K W;  3CD6 V;  1JJ2 U;  1YI2 V;  3CCJ V;  2QA4 V;  1YJW V;  2D3O W;  3CC7 V;  3OW2 U;  1KQS U;  1S72 V;  3I55 V;  4WFA V;  1VQ7 V;  1K8A W;  1R73 A;  4WF9 V;  4WFB V;  3CC4 V;  3CCL V;  2OTL V;  3I56 V;  2QEX V;  1Q7Y W;  1VQ4 V;  1YIJ V;  1VQ6 V;  1YHQ V;  1VQP V;  1NJI W;  1YJ9 V;  1VQL V;  1YIT V;  1VQ9 V;  3CPW U;  1VQO V;  1M90 W;  3CCV V;  1QVF U;  3CCU V;  3CCQ V;  1Q82 W;  1VQ5 V;  1K73 W; 
#chains in the Genus database with same CATH topology
 1BS3 A;  2UXB O;  3TK1 A;  4F6R B;  2PI5 A;  4AIL C;  4LF8 B;  1R6K A;  3AG4 C;  4DUY O;  4DR3 B;  2LQT A;  4EB6 B;  4B3M O;  4DV2 O;  3ABK C;  3FB6 C;  3CJH A;  3JAS B;  1K4D C;  3CCJ V;  1AJQ A;  1F4M A;  3CC4 V;  4LH7 A;  5IWA O;  1AP5 A;  2BOB C;  1R3K C;  1KB9 F;  2ILM A;  1N34 O;  5H9C A;  3W7U A;  1AJP A;  1GM7 A;  4GKK O;  2FB5 A;  4MVM A;  4JI8 B;  1H2K A;  1XL4 A;  3JD3 A;  5FPR A;  1OCO C;  2KB1 A;  2QWO B;  4DR7 B;  2JS3 A;  5IYB O;  1FAF A;  3TJT A;  1N33 O;  4DV6 B;  4WFB V;  4X62 O;  3OT7 A;  1PL0 A;  1P84 F;  2DYR C;  4Q20 A;  3UT5 B;  5IYD O;  1Q5O A;  4DK1 A;  5B3S C;  2YI9 A;  2HFE C;  5DM6 V;  2RMK B;  1QBZ A;  4EKW A;  5FNV A;  4PEL A;  1IXM A;  4YHH O;  1IX9 A;  1FXK C;  4KHP O;  4FM0 A;  2HLD G;  4E2L A;  5CA1 A;  4DV1 B;  1JVM A;  1WB7 A;  4GX1 A;  3RYC A;  1FFX B;  4FLY A;  4PD4 F;  2QSA A;  1KC8 W;  4FLT A;  4LF7 O;  2ODM A;  4BW5 A;  3HKE B;  3IC7 A;  1VMG A;  3L9D A;  5C8Y A;  1SER A;  5E1A C;  1JFF B;  5KX5 A;  4TUY A;  5IDJ A;  1S72 V;  5JVD B;  5B1B C;  4CS4 A;  4MVU A;  3BY6 A;  1YIJ V;  2IJJ A;  4DO2 A;  3HKC B;  1GMG A;  2GTS A;  3B8M A;  2EBO A;  1GM9 A;  5KUM A;  3JAT B;  4BR6 A;  4TV8 A;  3RYI A;  2JDI G;  4NB5 A;  2KSD A;  5CBF A;  3ETD A;  1A32 A;  1YZB A;  2CTR A;  4X88 A;  4GZR B;  3KCY A;  4LP8 A;  2Q69 A;  1H38 A;  4U3F H;  3ZMS A;  4O4L A;  2ETN A;  3P32 A;  3BFR A;  1QR8 A;  4X1Y B;  1WJZ A;  2UXX A;  3UO2 A;  4ZIB A;  3BHP A;  1MMM A;  1SQB H;  2AGA A;  3JAR B;  2UXD B;  4O2A A;  2ZE7 A;  1JX9 A;  4QE7 A;  3LNN A;  5LXT B;  4JI3 O;  4DV6 O;  2GTA A;  1VEW A;  1HNZ B;  2ZCE A;  4XBF A;  2ZXW C;  4YIP A;  5JH7 A;  1T5E A;  2ZE8 A;  4AQY O;  3JD2 A;  4DR5 O;  3IAY A;  5EIB D;  3OMA B;  2YEV A;  1S0V A;  3B4S A;  2OCC C;  1ZL8 B;  4G28 B;  2JEU A;  4B3T B;  4GUN A;  1B3Q A;  5KHI A;  3IFX A;  4ZHQ B;  4YY3 B;  2B1I A;  4JV5 O;  2ZNJ A;  1KEC A;  4QPK A;  4P9O A;  3K5O A;  1Q43 A;  4DV1 O;  2JGD A;  4P2Z A;  4PDR A;  5IYC O;  5J2U B;  4LF5 O;  3CYO A;  1FS0 G;  2WAM A;  3CC7 V;  4KXR A;  3SYQ A;  2HVJ C;  2UUB O;  1B06 A;  2DN9 A;  5H6R A;  3DGE A;  1ZSP A;  2YXL A;  5IYZ B;  3A0B Z;  1S5H C;  1EZV H;  4B3S B;  2YI8 A;  1PPJ H;  1V54 C;  4K8X A;  4K8Z A;  1N36 O;  2YIC A;  1F51 A;  1VQ8 V;  4NTY A;  1HR0 B;  2VWK A;  1YTF D;  1N8R W;  1AVM A;  4DV3 B;  2ZR2 A;  4XDK A;  1KBH A;  3OEE G;  5K1P A;  4G2K A;  4DR4 B;  4B7K A;  4X64 B;  3M7M X;  2IW5 A;  2QGN A;  3AG3 B;  4J41 A;  4PA7 A;  3E8F A;  5IJ0 A;  1O9G A;  5JCO C;  3K79 A;  2CH7 B;  2LP7 A;  1V9P A;  4DV5 B;  3ASN B;  3UM7 A;  3J7A U;  1TVK B;  3BEH A;  2UXD O;  1GO3 F;  2L35 A;  5LYJ B;  1PP9 H;  2ZT9 B;  3ZED A;  1AI4 A;  4CC6 A;  5LHI A;  2Y69 C;  1J5E B;  3FFQ A;  1SA0 A;  1Y67 A;  5BMV B;  4O2B B;  3AK2 A;  1L1F A;  1HNZ O;  4MVQ A;  4F4L A;  2F1M A;  2Q7E A;  2KKW A;  2BOC C;  3K9A A;  2QKA A;  4JI4 O;  4IHJ B;  3WB1 A;  4D7S A;  1XIL A;  1N0N A;  4CH6 A;  1VF6 C;  1PL4 A;  1VQ5 V;  2OYQ A;  3T4Z A;  5L3F A;  4YY3 O;  3WG7 B;  3KKY A;  5JQG A;  5L3D A;  3RGB A;  4WCE V;  4JAU A;  5KHG A;  1BHA A;  4HBN A;  2ZNI A;  1K34 A;  3C90 A;  5GON A;  2Q0O C;  2F4V B;  1SZT A;  1SF9 A;  2A79 B;  1MA1 A;  4IYI A;  1NH2 D;  3DC5 A;  4CC5 A;  1RM1 B;  4PA9 A;  4NXM B;  1OCZ C;  3L74 H;  2PGG A;  1Q90 D;  4Z1V A;  2R9A A;  4H44 B;  1B6Q A;  1R1B A;  1SZX A;  2HHH B;  1WA8 A;  5D5Q A;  1US6 A;  1HR0 O;  4WF9 V;  3CJH B;  3AEI A;  2RN9 A;  2JK5 C;  1FXK A;  2VQE O;  4Z2W A;  4DR4 O;  3E35 A;  2JEX A;  4X64 O;  2Z5U A;  4F6E A;  2ITC C;  1SRY A;  1I08 A;  3QO8 A;  5B1A C;  2FKX A;  1FXV A;  4XDJ A;  2HJF C;  2BSK B;  1EZJ A;  3WB0 A;  3ZIA G;  4DV5 O;  1JMK C;  2ZDI C;  3THO A;  1HWY A;  1G8M A;  1Q6I A;  2CGN A;  2EIM B;  2Q7H A;  1BHB A;  1KU9 A;  1QLN A;  3CS5 A;  3L71 H;  2EIN B;  2A06 H;  1QVG U;  2YXH A;  1YEW A;  2AZ2 A;  1KKD A;  3W7W A;  4P9P A;  1YVW A;  3KG2 A;  5LMN O;  2DYS C;  1IBL O;  2Q0A A;  3U11 A;  1TA8 A;  3TXS A;  2QTS A;  2AHZ A;  2ZIO A;  5GTI Z;  2QDO A;  3PJS K;  1H8H G;  3RYC B;  3CEI A;  3O9O A;  1ZX3 A;  1AI6 A;  4R6Z A;  4LBE C;  2AZ0 A;  5HFL A;  1OJH A;  4U7N A;  4D7T A;  3OW2 U;  3X2Q B;  1QLE B;  5C8Y B;  4B3R B;  1MSW D;  4ZOL A;  3R65 A;  5KX5 B;  4TUY B;  3K57 A;  1IUR A;  3STZ C;  2IJI A;  4HNA A;  5LA6 A;  3L73 H;  1N4C A;  1AJN A;  3ZRX A;  3BRC A;  4JYB A;  4UV9 A;  1I0H A;  4BW9 A;  3EVK A;  3RYI B;  3BAA A;  3QO7 A;  3CXC U;  2XAJ A;  2B9Z A;  1FJG O;  3CXH F;  1VQN V;  1Z2G A;  1DF5 A;  2CTQ A;  3K3W A;  4LF9 O;  3ICX A;  4J11 A;  1Y74 A;  2K9P A;  1XBL A;  4O4L B;  5JJJ B;  4FK5 C;  2XTA A;  1VF7 A;  3K9S A;  2E76 B;  5KMG A;  3SPC A;  3OGC C;  3G6B A;  3RBZ A;  1RPO A;  3E22 A;  3CX5 F;  3MDS A;  4JYA O;  5LMU B;  1K5Q A;  1E1Q G;  2E75 B;  3ZRS A;  2E5L B;  3OTO O;  4UFZ A;  1M57 C;  1YJ9 V;  1KKC A;  1HNX B;  3BA8 A;  2WLN A;  2Y48 A;  3F5T A;  4QIW F;  4X1I A;  4ABM A;  5JH7 B;  4JZ2 A;  5LOV A;  3QNE A;  3G6E V;  3CME V;  4U3J A;  2EZP A;  1IBK O;  1M1K W;  1K4C C;  3K5L A;  2YEV B;  3SDL A;  4UB8 Z;  2UU9 O;  1XOU A;  3F5W C;  4FFB B;  5KHH A;  3HKB A;  3EFF K;  3H1K H;  4J9Y B;  3ZHS A;  3CCU V;  4KL1 A;  3LDC A;  2C2A A;  1YJN V;  1JQ0 A;  1WPB A;  4J7J A;  1EN5 A;  5JCO A;  4DUZ O;  4MVZ A;  1GH6 A;  2XT9 A;  4JI1 B;  4BWA A;  4PA4 A;  1FYJ A;  2JGD B;  2PTM A;  2QA4 V;  1AR4 A;  4MTG A;  3I55 V;  4NVP A;  4TV9 A;  3EHB B;  1LR1 A;  5BR8 B;  5E79 Z;  2Y0P A;  1SET A;  4TOI A;  2RCV A;  4JI2 B;  4JGS A;  2WA3 A;  2RNB A;  1MZF A;  1KP3 A;  4CH3 A;  1VQM V;  4PA3 A;  5BXZ A;  3R66 A;  1BCC H;  2P22 C;  3AG1 B;  3D3Q A;  1XNR B;  2Q4P A;  3ABM C;  3H01 A;  3APO A;  3ZMV A;  4PDL A;  4JI6 B;  1VF6 A;  1I7F A;  4RQF A;  2R70 A;  5IJ0 B;  1XI1 A;  2IJK A;  2Q68 A;  1GN3 A;  2VQF O;  4BAY A;  2F66 C;  3RYF A;  3FX7 A;  1NZ6 A;  2YUA A;  4B08 A;  2YDE A;  3I56 V;  3VQY A;  1R3I C;  1JR9 A;  4UCV A;  3IGA C;  3Q4H A;  5EYP A;  3FB5 C;  3SYP A;  1XQ8 A;  1SQV H;  4H0L B;  1YTF B;  5LBQ A;  1THZ A;  5EBW C;  3UO3 A;  4LR3 A;  5BY1 A;  1NR1 A;  1WPX A;  4UCT A;  4LFC B;  1AI5 A;  3SGI A;  3K06 A;  2DWD C;  1RFY A;  3ABK B;  3H1L H;  1XNQ O;  3CCQ V;  4YJ3 A;  5ITZ B;  3CB2 A;  4GKJ O;  2V4D A;  4W4K A;  5CA0 A;  5JQG B;  2HKO A;  2DWE C;  1Q8I A;  4YXW G;  4LF6 B;  2KQX A;  3LDD A;  1OCO B;  1JJ2 U;  1P7G A;  5KA5 A;  4MVR A;  2BTQ A;  5GON B;  2EIJ C;  3GVM A;  3SR2 C;  3B77 A;  1Y76 A;  4WFG A;  1RP3 B;  3H1H H;  3H9V A;  2H8P C;  2ZDI A;  1IVS A;  3ZBH A;  5L3G A;  2DYR B;  5BR8 O;  1I94 B;  1VIB A;  1GAX A;  3WFV A;  4JI2 O;  3MHS C;  4MVS A;  3E8B A;  4X89 A;  4UCU A;  5LHG A;  3RT3 C;  3LNM B;  3QG5 A;  4WFA V;  4DYL A;  4FLX A;  4K0K B;  4DR2 O;  3ETQ A;  2R9I A;  2UXC B;  3TET A;  1WA8 B;  2ZR3 A;  4DXW A;  3ZRV A;  1XNR O;  5L3B A;  4J80 A;  1GTO A;  1LNQ A;  1FXK B;  2FYU H;  3NXS A;  3JAW A;  1Y66 A;  2YXY A;  3OAA G;  3CCM V;  4N21 A;  1EN6 A;  5J2T B;  3RW0 A;  3KZI Z;  4FLV A;  4LF8 O;  1U97 A;  1NTM H;  1NH2 B;  4DR3 O;  4GLX A;  1TGO A;  2QJ1 A;  1VAR A;  3CSX A;  1MSD A;  4R7C A;  4PI2 A;  1UPG A;  4JI5 B;  5TIS Z;  5KA6 A;  3JAL A;  2PI4 A;  1XDC A;  5B1B B;  2AW9 A;  4ZI7 A;  2AHY A;  2WLI A;  1AB3 A;  2W6J G;  3DXR A;  1ROP A;  2NNU A;  2QTO A;  3ETG A;  4JI8 O;  2M7W A;  1V55 C;  4DR7 O;  2XOK G;  4LF4 B;  3TCU A;  2GDS A;  1FPO A;  2YIA A;  4L8J A;  1SQP H;  2CDY A;  1VQ9 V;  4HAM A;  1Q3E A;  2B1G A;  3AK3 A;  1SC5 B;  4OX9 B;  2O57 A;  4IT5 A;  1AP6 A;  4JI7 B;  1ENV A;  1HP8 A;  4TSF G;  2EIL C;  5A9G A;  1PKX A;  4KUM A;  1YI2 V;  3SPG A;  1YXB A;  4IIJ A;  5F2V O;  3CWB H;  2G38 A;  4LF6 O;  3JD1 A;  2CE4 A;  3B40 A;  4DRX A;  1W0K G;  3T2M A;  4JPR A;  4HYO A;  1Q82 W;  4X1K A;  1E1R G;  3CMA V;  3VOU A;  3M99 B;  3U0Z A;  2F93 B;  3FB8 C;  2UUC B;  1Z5W A;  1SQG A;  4RQE A;  1W2B U;  2EUL A;  3BA9 A;  2YID A;  2ZXW B;  1I94 O;  2D3O W;  4AHC A;  3D36 C;  2EZO A;  4UVB A;  2WLL A;  2P06 A;  1LUW A;  2MK3 A;  2HVK C;  2OCH A;  2OCC B;  2E74 B;  3KCX A;  1Y74 B;  3CCS V;  2CK3 G;  1M56 C;  1XEQ A;  4GX5 A;  2QWR B;  2IH3 C;  5GTH Z;  1NKD A;  4I0X A;  4H37 A;  3AG3 C;  3N2G A;  3E22 B;  3OTF A;  4RAI A;  5EBL C;  1K3E A;  4PV1 B;  2CTP A;  2W0F C;  3NR7 A;  3ASO C;  4MW8 A;  4D6T H;  1OCR C;  4MTF A;  1XRE A;  1OHH G;  2IU3 A;  3QO5 A;  3JAK A;  1GK9 A;  2QM7 A;  4JI5 O;  5LHH A;  4Z1M G;  1NTK H;  4X1I B;  5DED A;  1V54 B;  3ZHQ A;  3RYH A;  1NT2 B;  5FPO A;  4U3J B;  1BQZ A;  3FAV A;  2DW4 A;  1D5A A;  1DLB A;  3CE2 A;  2ATK C;  4H13 B;  1ZLZ A;  3DSQ A;  3HKB B;  2P5O A;  3SYO A;  1BMF G;  4FZ0 A;  4EB6 A;  1M4U A;  4LFB B;  1M93 A;  4DV7 B;  4QPJ A;  1I5X A;  3P30 A;  2Q7G A;  4NXN B;  4AI8 A;  4LNU A;  4BIZ A;  2GUZ A;  1MAB G;  4JZG A;  4FLW A;  3CPW U;  4TV9 B;  3S3W A;  4B3T O;  4JF3 A;  3K0G A;  3SPH A;  1XHZ A;  2LJ2 A;  4K3A A;  2BTO A;  2N74 A;  1Q6H A;  3AG2 B;  2IJH A;  4I50 A;  1ZWI C;  1SQQ H;  2JRI A;  2Y0I A;  2UUC O;  1RSO A;  4X8A A;  3UT5 A;  1GM8 A;  1WP7 A;  3CCL V;  1CPY A;  2ZIN A;  1UJW B;  2Z0A A;  3OMN B;  3ABL B;  3T1H B;  5LGT A;  4JI0 B;  2QKC A;  2DJV A;  3K04 A;  5K1X A;  1G4Y B;  1P4R A;  4B3S O;  1SQF A;  3CD6 V;  3HKD A;  3SYC A;  1X59 A;  3J81 N;  3RYF B;  4FM1 A;  1VQP V;  1H2L A;  4DV3 O;  1SKV A;  1UFI A;  2EJ7 A;  3Q4H B;  5EYP B;  2PF4 E;  2K1E A;  3FD9 A;  1URF A;  1Q81 W;  1JFF A;  4ZBM A;  2KG7 A;  3OM3 B;  2JVD A;  3SPI A;  2HG5 C;  4EFB A;  4JAA A;  1NR7 A;  1VQ4 V;  3WU2 Z;  1N32 B;  5CB4 A;  3T4D A;  2ZM6 B;  4I5S A;  4BIU A;  3OE7 G;  5AG2 A;  1J5E O;  4YJ3 B;  4OPH A;  4LFB O;  2RQ6 A;  5CA0 B;  3HB3 B;  5B1A B;  1Q6U A;  5C93 A;  1AIL A;  2XHB A;  5FNV B;  4NXN O;  2JJ1 G;  1WP8 A;  3E8H A;  1FXH A;  2MW2 B;  2BTQ B;  4NYK A;  2QM8 A;  2EIK B;  2YS8 A;  3ZN1 A;  3JAR A;  4MS2 A;  2RJZ A;  3P3P A;  5CA1 B;  2GV9 A;  5LGN A;  1P7B A;  1Y76 B;  2R72 A;  1NVP D;  3U10 A;  4QE9 A;  4LWS A;  3OFN G;  3A0R A;  4C7U A;  3HPL C;  3LSQ A;  2ADQ B;  5B1N A;  3APQ A;  2PY5 A;  3JSN A;  1ARO P;  1X4T A;  3DTU B;  4UVC A;  5JWP A;  4YIO A;  5IT9 N;  5IY5 B;  4GX2 A;  4DR1 B;  4R8C A;  3K59 A;  2F4V O;  3UKM A;  1OZ0 A;  3CC2 V;  2DYS B;  4NXM O;  4JI0 O;  1ZL8 A;  3E2E A;  4TV8 B;  3JAW B;  4EEQ A;  3B2E E;  1JPX A;  1COW G;  1WNS A;  3UQ8 A;  1MG1 A;  1XMQ B;  3S3X A;  1L0N H;  1R6T A;  2UUA B;  3ZS8 C;  4I4T A;  3P3N A;  3GB7 C;  3ETE A;  2HHH O;  2UXN A;  3K0D A;  1S3J A;  2QR4 A;  4I7Z B;  5J2U A;  3JAL B;  4BIO A;  1B04 A;  4ZI7 B;  2WLI B;  2JS5 A;  4QGP A;  4E4E A;  3GWO A;  3VQX A;  5H2F Z;  1Y6X A;  4DK0 A;  5B1O A;  4O2A B;  5EZY A;  3D36 A;  3K03 A;  1H2S B;  1H2N A;  4DUY B;  3SJA C;  1N32 O;  1M5I A;  4JYC A;  3FB7 C;  4DV2 B;  2Z3Y A;  5HFM A;  2V1D A;  1SQX H;  1SES A;  5KUK A;  2ZM6 O;  2H94 A;  1VF5 B;  5A2Q N;  1HW7 A;  3ZHV A;  1N34 B;  5IJ9 A;  1AI7 A;  2Y4T A;  4JTC B;  3JD0 A;  4LCU C;  4GKK B;  4IIJ B;  3RFR A;  1EFR G;  1TUB A;  2P7T C;  4WFE A;  2WWW A;  4DRX B;  4O4H A;  1N33 B;  1M57 B;  4LH6 A;  4MT8 A;  4X1K B;  3CRC A;  4ICG A;  1TVK A;  2QWQ B;  3IC9 A;  4X62 B;  1JOY A;  2P90 A;  4R50 A;  4JAS A;  2ZIM A;  4GX0 A;  3M8A A;  4J7Z A;  2F43 G;  5BZB A;  2W0X A;  3SJB C;  5BMV A;  3FYI B;  4NR1 A;  4ZKI A;  1CXZ B;  1VQL V;  1CEZ A;  1HDJ A;  3ZHU A;  1AR5 A;  2WLL B;  3F7V C;  1RPR A;  1GKF A;  4B3R O;  1Y4M A;  3A0H Z;  5GW7 A;  4ASU G;  2GSM B;  3AG1 C;  5CBH A;  4TT3 G;  2DOS A;  2P67 A;  1MOF A;  4IL6 Z;  5IE9 A;  1DGS A;  4KHP B;  4FVM A;  1ZAU A;  4I0X B;  3ABU A;  5LP6 C;  4CS2 A;  4MTX A;  1FFT B;  1S5J A;  3IJ4 A;  4PDV A;  3TGU H;  1YIT V;  4K35 A;  3E89 A;  2QM4 A;  5L3E A;  2UUA O;  1YDX A;  3N2K A;  5J9P C;  1GN2 A;  4UCR A;  5FLX N;  2DE0 X;  3HR0 A;  3VQW A;  2V7Q G;  1OCC B;  4PI0 A;  3JCU Z;  1WB8 A;  4DV0 B;  2YIB A;  3CRQ A;  4DW0 A;  2CTW A;  5DN6 G;  1KP2 A;  2QE7 G;  2P6J A;  4KP4 A;  3RYH B;  5LMU O;  3FAV B;  2E5L O;  4WBN A;  2HJD A;  3G71 V;  4UCS A;  1DTO A;  3CCE V;  2DMX A;  2ZKO A;  1SA0 B;  1HNX O;  3SYA A;  5KAI Z;  2Y4U A;  4CH5 A;  1WLE A;  3ABM B;  1BT8 A;  1S77 D;  1YJW V;  3AG4 B;  1EBO A;  3RWR D;  1WAZ A;  2H3O A;  2N05 A;  4LNU B;  3RVZ A;  4J10 A;  3L72 H;  1M90 W;  3CCV V;  2DQ3 A;  2LO1 A;  1PNM A;  2GUZ B;  3ZJZ A;  2QKS A;  2QWP B;  2RDC A;  2BSK A;  4J9Z B;  3BVO A;  4I50 B;  4JI3 B;  4O4I A;  2R9R B;  5EBM C;  5D5P A;  1IZ3 A;  1VQ7 V;  3OEH G;  4GYC B;  2OTL V;  1RSO B;  2B5U A;  2NR5 A;  4JI1 O;  4AQY B;  4DR5 B;  1NBM G;  4MVO A;  2WA4 A;  3AG7 A;  1JJO A;  4YJ2 A;  4PDM A;  3MAQ A;  1EM1 A;  3OGI B;  5B3S B;  2PYJ A;  4JV5 B;  1R73 A;  4W4L A;  2N04 A;  3HKD B;  2YC0 A;  3ZN0 A;  1QNM A;  3T1Y B;  2A3Q A;  3QF7 A;  4I9Q A;  2F23 A;  3JCZ A;  4TQD A;  3MHH C;  3CCR V;  2PUS A;  1L0L H;  4LF5 B;  3E8G A;  4RUE A;  2EIJ B;  5JJN B;  2UUB B;  3G4S V;  1QHT A;  1GN4 A;  2EJR A;  3D8C A;  4JI6 O;  2D2C B;  2KG7 B;  4DV0 O;  2XAH A;  4CZZ A;  2QEX V;  1J95 A;  4P30 A;  1EN4 A;  2ZE6 A;  1VQO V;  2AXT Z;  1NI8 A;  1N36 B;  2X6B A;  5CB4 B;  5CN0 A;  4UVA A;  1ZTE A;  2XUM A;  1F23 A;  4XDL A;  1S76 D;  1WN7 A;  5LGU A;  1FKA O;  3FYE B;  5EC2 C;  1NS1 A;  1KYO F;  4LFC O;  4FMT A;  1BSM A;  2PZS A;  1GRJ A;  2OWO A;  3CRR A;  4I55 A;  1BL8 A;  2OTJ V;  3VBB A;  4LWS B;  1P49 A;  4O4J A;  4RWU A;  5H5N A;  1V55 B;  2X0L A;  2GHY A;  3VQV A;  4ZOL B;  3OD4 A;  4OGQ B;  2BCC H;  3GWK C;  4HNA B;  3LSS A;  5LA6 B;  1PNL A;  2ADP A;  4PJ0 Z;  2VWJ A;  3BAB A;  3ZMU A;  4FFB A;  3ZX6 A;  4JI4 B;  1G1X B;  1IDS A;  4PHZ A;  2P4V A;  2EIL B;  3O65 A;  1KMI Z;  3ABT A;  4HZ3 A;  3ZHT A;  1NVP B;  4I4T B;  1R6N A;  1BE3 H;  2DQ0 A;  4K0K O;  1HNW B;  2UXC O;  4LFA B;  3A2F A;  3JD4 A;  3T1Y O;  4JYY A;  4X20 A;  5KMG B;  2ZQM A;  3JSL A;  3ZRW A;  2XAQ A;  3OR7 C;  2Q67 A;  4FLZ A;  5EZY B;  4UUJ C;  1FD9 A;  1NTZ H;  3ASN C;  5KLV H;  1N0J A;  3OUS A;  2CUG A;  4FZ1 A;  5B66 Z;  1Z5V A;  2HEP A;  3ZMT A;  2ARH A;  1XUQ A;  5L3C A;  4UCO A;  1D5N A;  1M56 B;  5LOV B;  2VQE B;  3BCC H;  2PYL A;  5IJ9 B;  5LP6 A;  5LL6 Y;  3CP1 A;  2OIE A;  4F6R A;  4LF4 O;  1TUB B;  2A0L A;  4PA6 A;  1F7Y A;  3ML0 A;  3JAS A;  3ASO B;  4OX9 O;  2NN4 A;  4O4H B;  1OCR B;  1K5S A;  3I5D A;  4LC1 A;  1Q86 W;  4JI7 O;  2WLK A;  3AG2 C;  1Q7Y W;  4Q6G A;  3ZMZ A;  4WFF A;  3WG7 C;  4X9Q A;  3T1C A;  2LFR A;  1U96 A;  4NTW A;  1K73 W;  4QJF B;  2WSS G;  4CS3 A;  3SJC C;  2Y69 B;  3ABL C;  5EC1 C;  4CBC A;  5LMN B;  3RN4 A;  1RM1 C;  1IBL B;  4DW1 A;  3OR6 C;  4JTA B;  1TAE A;  4J42 A;  2F95 B;  1BQ0 A;  1IBM B;  1K92 A;  2VS0 A;  2Q73 A;  5ITZ A;  1H2G A;  1L8D A;  3ZHR A;  2XND G;  4MSW C;  4RO2 A;  4JAV A;  1DK1 A;  3N2K B;  3E83 A;  1K7D A;  1HNW O;  4G27 B;  4LFA O;  5CA3 A;  2ITD C;  3J80 N;  1YCI A;  4A5U B;  1LUV A;  1FFX A;  1PM9 A;  4J7K A;  3OUF A;  2LW1 A;  4MW3 A;  2W6I G;  3HKE A;  2L6L A;  4MTO A;  4TQF A;  2FTK A;  1FJG B;  4WBN B;  2LFS A;  4U7O A;  4H33 A;  4I9W A;  5JVD A;  4LF9 B;  1D2D A;  1OCZ B;  3HKC A;  2EIM C;  1NU1 H;  1YSC A;  3CRA A;  3JAT A;  3LDE A;  3E86 A;  2XAG A;  3G67 A;  2EIN C;  1JA8 A;  1E79 G;  2OIG A;  5J2T A;  1ZUQ A;  4JYA B;  2BE3 A;  1PV0 A;  3OTO B;  1XL6 A;  1DF4 A;  2VRZ A;  4DV7 O;  2CGO A;  2JIZ G;  1W0J G;  2EIK C;  4O4I B;  3LUT B;  4L87 A;  1XMO B;  3SPJ A;  4X1Y A;  1G6U A;  4IYH A;  4X66 B;  2OT5 A;  2A7W A;  1BZK A;  1IBK B;  2Q9L A;  1MNG A;  1QR9 A;  3X2Q C;  1QLE C;  1QQC A;  2UU9 B;  3DC6 A;  5IY5 C;  4DR6 B;  4YJ2 B;  3K58 A;  5LXT A;  4EFE A;  3JYC A;  2WLH A;  4IGG A;  2X6A A;  1ORQ C;  4GCZ A;  3L75 H;  3N27 A;  1OV9 A;  4DUZ B;  3WB2 A;  1IBM O;  3F7Y C;  3W7T A;  3D3I A;  3CRM A;  3T1H O;  3SJQ C;  4DV4 B;  3LSU A;  5KHK A;  2M6Y A;  1YF2 A;  3L70 H;  4GT1 A;  2E3C A;  3AK1 A;  1I5Y A;  2HR3 A;  3MD0 A;  1JCH A;  5B5E Z;  4ZHQ A;  2IM9 A;  1MZE A;  2P4K A;  4KFM A;  3STL C;  4OXS A;  1NQT A;  3H1I H;  2EX3 A;  2JGU A;  2Q6A A;  4NKG B;  5FL7 G;  5KHJ A;  5IYZ A;  3DXR B;  2IBZ H;  1SS3 A;  4X65 B;  3PN1 A;  3W7S A;  3G80 A;  2UXB B;  2XAF A;  3C3T A;  1XHX A;  2VQF B;  4B3M B;  2LGQ A;  5DEC A;  2FL4 A;  5JJE B;  3JAM N;  1KD1 W;  1R3J C;  2GBO A;  5IWA B;  3ZCC A;  4I55 B;  1W59 A;  1PD3 A;  1H8E G;  1S5L Z;  1F4N A;  3A8T A;  1GN6 A;  1VQ6 V;  1YHQ V;  2IU0 A;  1BGY H;  3K5N A;  3K08 A;  4O4J B;  2HP8 A;  1QVF U;  3UCS C;  3K5M A;  3CHX A;  2A9H A;  2CH7 A;  4FIP C;  1XMO O;  4WFH A;  4N23 A;  1R3L C;  4RUF A;  1IXB A;  2WPD G;  4CH4 A;  1VQK V;  2WLJ A;  3BPZ A;  4X66 O;  3QTC A;  2YSU B;  1O9H A;  3B8N A;  3TXQ A;  2LW7 A;  4OPA A;  5EIB C;  1QU7 A;  4UXN A;  5LYJ A;  5EK0 A;  1XNQ B;  2QWN B;  2ZD9 A;  1K8A W;  4DR6 O;  2ZE5 A;  4UV8 A;  4O2B A;  1NJI W;  1H2M A;  2LGW A;  5CMU A;  4GKJ B;  2XAS A;  4B7E A;  4FM2 A;  2YIB D;  2NLJ C;  3OMI B;  1K9M W;  1PNK A;  1KUQ A;  4DR1 O;  5CBG A;  2X7R B;  1VP7 A;  4FJC C;  4YHH B;  2FML A;  2WLM A;  4FPP A;  4NTX A;  4DV4 O;  1CP9 A;  2X6C A;  4IHJ A;  4X20 B;  5H6Q A;  1OCC C;  3ZRW B;  3B09 A;  3N2G B;  1XMQ O;  2CAZ C;  3W7X A;  4FFK A;  1AR1 B;  4LF7 B;  1K97 A;  1TUE B;  3EXA A;  2JJ2 G;  3FKS G;  5KAF Z;  4UB6 Z;  3JAK B;  4QNH B;  4DR2 B;  4JTD B;  2Q5Z A;  3QVN A;  1KQS U;  2Q8V A;  3C3S A;  1QCE A;  1K33 A;  3RVY A;  3H1J H;  4TWK A;  2IH1 C;  4FLU A;  4X65 O;  5LP6 B;  1M9N A; 
#chains in the Genus database with same CATH homology
 3ZRX A;  3AG2 B;  2IJH A;  3TK1 A;  4JYB A;  2PI5 A;  1R6K A;  1ZWI C;  3AG4 C;  4UV9 A;  1BL8 A;  3ABK C;  2XAJ A;  3FB6 C;  3QO7 A;  3CXC U;  2OTJ V;  4X8A A;  1K4D C;  3VBB A;  3CCJ V;  1AJQ A;  1GM8 A;  1VQN V;  1DF5 A;  1F4M A;  3CC4 V;  3CCL V;  1CPY A;  3K3W A;  2BOB C;  1R3K C;  1UJW B;  3OMN B;  3ABL B;  5H9C A;  3W7U A;  1V55 B;  2X0L A;  2GHY A;  1AJP A;  4FK5 C;  1GM7 A;  5LGT A;  4MVM A;  3LSS A;  3SPC A;  3OGC C;  1XL4 A;  3JD3 A;  1OCO C;  2KB1 A;  3K04 A;  1PNL A;  3RBZ A;  1G4Y B;  1P4R A;  1RPO A;  3ZMU A;  5IYB O;  3CD6 V;  3SYC A;  1K5Q A;  1E1Q G;  3ZRS A;  2EIL B;  4WFB V;  1PL0 A;  3ABT A;  4Q20 A;  1M57 C;  2DYR C;  1VQP V;  4HZ3 A;  5IYD O;  1YJ9 V;  1NVP B;  5B3S C;  1R6N A;  2WLN A;  2DQ0 A;  2Y48 A;  4QIW F;  2K1E A;  3JD4 A;  1Q81 W;  2HFE C;  4ZBM A;  5DM6 V;  3OM3 B;  1QBZ A;  3QNE A;  4EKW A;  3G6E V;  3CME V;  2EZP A;  2ZQM A;  4PEL A;  1M1K W;  1K4C C;  1IXM A;  3ZRW A;  2YEV B;  2XAQ A;  3SPI A;  2HG5 C;  3F5W C;  1FXK C;  1NR7 A;  3OR7 C;  1VQ4 V;  2Q67 A;  3EFF K;  2HLD G;  4E2L A;  4J9Y B;  3CCU V;  1JVM A;  3LDC A;  4UUJ C;  4GX1 A;  3T4D A;  3ASN C;  2C2A A;  1YJN V;  4I5S A;  4BIU A;  1JQ0 A;  3OUS A;  3OE7 G;  1KC8 W;  4BW5 A;  3ZMT A;  4MVZ A;  3IC7 A;  1SER A;  5L3C A;  5E1A C;  4PA4 A;  2QA4 V;  1M56 B;  5IDJ A;  4MTG A;  3HB3 B;  3I55 V;  1S72 V;  5B1A B;  5C93 A;  5B1B C;  3EHB B;  4MVU A;  3BY6 A;  1YIJ V;  2JJ1 G;  2IJJ A;  3CP1 A;  4DO2 A;  3E8H A;  1FXH A;  1GMG A;  3B8M A;  2EBO A;  1SET A;  1GM9 A;  5KUM A;  2QM8 A;  2EIK B;  3ZN1 A;  4MS2 A;  4JGS A;  2A0L A;  4PA6 A;  3ML0 A;  2JDI G;  5LGN A;  1NVP D;  1P7B A;  3ASO B;  4QE9 A;  5CBF A;  3OFN G;  1OCR B;  1K5S A;  3ETD A;  3A0R A;  1KP3 A;  3HPL C;  4LC1 A;  3LSQ A;  4PA3 A;  1VQM V;  1Q86 W;  4X88 A;  5B1N A;  1ARO P;  2WLK A;  4LP8 A;  3AG1 B;  2Q69 A;  1H38 A;  3AG2 C;  3DTU B;  4UVC A;  3ZMS A;  1Q7Y W;  3ZMZ A;  4WFF A;  3WG7 C;  5IY5 B;  4GX2 A;  3P32 A;  1QR8 A;  3T1C A;  2LFR A;  4R8C A;  3UKM A;  1OZ0 A;  1K73 W;  3ABM C;  3H01 A;  2UXX A;  4QJF B;  3ZMV A;  3CC2 V;  4PDL A;  2DYS B;  2WSS G;  4RQF A;  2IJK A;  2Q68 A;  2Y69 B;  3E2E A;  3ABL C;  5EC1 C;  4BAY A;  1JPX A;  1COW G;  4CBC A;  1RM1 C;  1MG1 A;  1JX9 A;  3OR6 C;  4QE7 A;  4JTA B;  3I56 V;  1R3I C;  1K92 A;  3IGA C;  3GB7 C;  1H2G A;  3FB5 C;  3SYP A;  3ETE A;  4XBF A;  2UXN A;  2ZXW C;  3K0D A;  1S3J A;  1YTF B;  2XND G;  4MSW C;  5LBQ A;  4RO2 A;  4JAV A;  1THZ A;  3JD2 A;  5EBW C;  3OMA B;  3E83 A;  1K7D A;  1NR1 A;  2YEV A;  4G27 B;  1S0V A;  5CA3 A;  2WLI B;  1WPX A;  3GWO A;  2ITD C;  1AI5 A;  2OCC C;  4G28 B;  2JEU A;  5B1O A;  3K06 A;  2DWD C;  3D36 A;  3K03 A;  3ABK B;  3IFX A;  2B1I A;  3CCQ V;  3OUF A;  1KEC A;  4MW3 A;  2W6I G;  4JYC A;  3FB7 C;  4QPK A;  4MTO A;  4P9O A;  2Z3Y A;  2FTK A;  2LFS A;  5HFM A;  2V1D A;  4U7O A;  1SES A;  4H33 A;  4P2Z A;  5KUK A;  4PDR A;  4I9W A;  5IYC O;  2H94 A;  2HKO A;  2DWE C;  1OCZ B;  4YXW G;  3CYO A;  1AI7 A;  3LDD A;  1FS0 G;  1OCO B;  2WAM A;  3CC7 V;  4JTC B;  1JJ2 U;  3SYQ A;  3JD0 A;  2HVJ C;  2EIM C;  5KA5 A;  4MVR A;  5H6R A;  1YSC A;  3DGE A;  4LCU C;  3LDE A;  1EFR G;  3E86 A;  2P7T C;  2XAG A;  2EIJ C;  4WFE A;  2EIN C;  1E79 G;  3B77 A;  2WWW A;  1S5H C;  4WFG A;  2H8P C;  2ZDI A;  5L3G A;  1M57 B;  1V54 C;  2DYR B;  4MT8 A;  1F51 A;  1VQ8 V;  1XL6 A;  3WFV A;  1DF4 A;  3MHS C;  1YTF D;  1JOY A;  4MVS A;  3E8B A;  2P90 A;  4X89 A;  1N8R W;  2JIZ G;  4R50 A;  4JAS A;  5LHG A;  4GX0 A;  1W0J G;  2EIK C;  2ZR2 A;  2F43 G;  3LNM B;  4XDK A;  5BZB A;  3OEE G;  4WFA V;  4G2K A;  3LUT B;  4L87 A;  2R9I A;  3SPJ A;  3FYI B;  3TET A;  2IW5 A;  4ZKI A;  1CEZ A;  1VQL V;  2ZR3 A;  4DXW A;  2WLL B;  3F7V C;  1RPR A;  1GKF A;  3ZRV A;  3AG3 B;  5L3B A;  1Y4M A;  2OT5 A;  4PA7 A;  5GW7 A;  3E8F A;  1GTO A;  1LNQ A;  1FXK B;  3NXS A;  4ASU G;  3K79 A;  1Y66 A;  2GSM B;  3AG1 C;  1QR9 A;  3OAA G;  3X2Q C;  5CBH A;  1QLE C;  4TT3 G;  3CCM V;  2P67 A;  1MOF A;  4N21 A;  5IY5 C;  3RW0 A;  2LP7 A;  3ASN B;  3UM7 A;  1NH2 B;  3BEH A;  3JYC A;  3ABU A;  2WLH A;  4MTX A;  1FFT B;  4R7C A;  2X6A A;  1GO3 F;  1ORQ C;  4GCZ A;  4PDV A;  1AI4 A;  1YIT V;  5LHI A;  2Y69 C;  3E89 A;  5L3E A;  5KA6 A;  5J9P C;  2PI4 A;  5B1B B;  3F7Y C;  3W7T A;  2AHY A;  3D3I A;  1L1F A;  2V7Q G;  1OCC B;  2WLI A;  3SJQ C;  2W6J G;  4MVQ A;  4F4L A;  1ROP A;  2NNU A;  2QTO A;  3ETG A;  5DN6 G;  1KP2 A;  4GT1 A;  2M7W A;  1V55 C;  1I5Y A;  2HR3 A;  2BOC C;  3MD0 A;  1JCH A;  2XOK G;  3K9A A;  3TCU A;  2QE7 G;  2P6J A;  4KP4 A;  4KFM A;  1VQ9 V;  4HAM A;  3STL C;  2B1G A;  1VQ5 V;  4OXS A;  3G71 V;  3T4Z A;  1NQT A;  1DTO A;  3CCE V;  5L3F A;  3WG7 B;  1ENV A;  4TSF G;  5L3D A;  2EIL C;  3SYA A;  2Q6A A;  4WCE V;  4JAU A;  1BHA A;  1WLE A;  1PKX A;  3ABM B;  5FL7 G;  4KUM A;  1YI2 V;  1S77 D;  1YJW V;  3SPG A;  1K34 A;  3AG4 B;  1EBO A;  1SZT A;  2A79 B;  3W7S A;  3JD1 A;  1W0K G;  3RVZ A;  4JPR A;  3T2M A;  1NH2 D;  4HYO A;  1M90 W;  3CCV V;  2DQ3 A;  1RM1 B;  2XAF A;  4PA9 A;  1PNM A;  1Q82 W;  3ZJZ A;  2QKS A;  1OCZ C;  1E1R G;  3CMA V;  3VOU A;  3M99 B;  3FB8 C;  4RQE A;  1W2B U;  4J9Z B;  1KD1 W;  1R3J C;  2ZXW B;  1B6Q A;  2R9R B;  3ZCC A;  5EBM C;  1PD3 A;  2D3O W;  1H8E G;  1F4N A;  1VQ7 V;  3OEH G;  2EZO A;  4UVB A;  4WF9 V;  2WLL A;  2OTL V;  2MK3 A;  2B5U A;  3AEI A;  3SPH A;  1YHQ V;  2HVK C;  2IU0 A;  1VQ6 V;  2JK5 C;  1FXK A;  3K08 A;  1QVF U;  1NBM G;  4MVO A;  2A9H A;  2OCC B;  4FIP C;  3E35 A;  2JEX A;  4WFH A;  3CCS V;  2Z5U A;  4N23 A;  2CK3 G;  1R3L C;  1M56 C;  2ITC C;  4RUF A;  2WPD G;  1VQK V;  1SRY A;  4GX5 A;  2WLJ A;  3QO8 A;  5B1A C;  4PDM A;  2IH3 C;  2YSU B;  1NKD A;  1FXV A;  4XDJ A;  5B3S B;  2HJF C;  3B8N A;  4H37 A;  3AG3 C;  4UXN A;  5EK0 A;  1EZJ A;  3ZIA G;  4RAI A;  2ZD9 A;  1R73 A;  1K8A W;  5EBL C;  1K3E A;  2W0F C;  4UV8 A;  1NJI W;  3ASO C;  4MW8 A;  2ZDI C;  3ZN0 A;  5CMU A;  1HWY A;  1OCR C;  2XAS A;  4MTF A;  1G8M A;  1OHH G;  2NLJ C;  3JCZ A;  2EIM B;  3OMI B;  2IU3 A;  3MHH C;  1PNK A;  1GK9 A;  2QM7 A;  3QO5 A;  3CCR V;  1K9M W;  1BHB A;  5CBG A;  3E8G A;  5LHH A;  4RUE A;  1QLN A;  2X7R B;  4Z1M G;  2EIJ B;  4FJC C;  2EIN B;  3G4S V;  2WLM A;  4FPP A;  1QVG U;  1KKD A;  2EJR A;  1CP9 A;  2X6C A;  1V54 B;  3W7W A;  4P9P A;  3KG2 A;  2XAH A;  2DW4 A;  4CZZ A;  5H6Q A;  1DLB A;  1J95 A;  4P30 A;  2QEX V;  1OCC C;  3ZRW B;  2ATK C;  2DYS C;  1VQO V;  3W7X A;  1AR1 B;  2X6B A;  2AHZ A;  3SYO A;  1K97 A;  1BMF G;  1TUE B;  2JJ2 G;  3PJS K;  4QPJ A;  3FKS G;  1H8H G;  1I5X A;  5CN0 A;  4UVA A;  4QNH B;  1AI6 A;  3P30 A;  4R6Z A;  4JTD B;  4LBE C;  1F23 A;  4XDL A;  5HFL A;  4U7N A;  1KQS U;  3OW2 U;  4BIZ A;  3X2Q B;  1S76 D;  1QLE B;  1QCE A;  1MSW D;  1K33 A;  5LGU A;  3FYE B;  3R65 A;  3RVY A;  1MAB G;  5EC2 C;  4TWK A;  2IH1 C;  3STZ C;  2IJI A;  4FMT A;  3CPW U;  1AJN A;  4JF3 A;  3K0G A;  1M9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...