1Q82W

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1q82W00
1NJIW 3G6EV 1N8RW 1K9MW 3G71V 3I55V 1VQ7V 1YI2V 1Q82W 1JJ2U 1Q81W 1YIJV 1VQ8V 3CC2V 5DM6V 4WFAV 3I56V 1VQMV 1VQ4V 1VQLV 3CC7V 1YHQV 3CMEV 1YITV 1S72V 1R73A 1QVGU 1KQSU 1YJNV 3CCJV 1VQ9V 2OTLV 2QEXV 1VQ6V 2OTJV 1M90W 1KD1W 3CCUV 1VQPV 3CMAV 3CPWU 3CCSV 3CCEV 1QVFU 1Q86W 4WF9V 3CD6V 3CCMV 3CCQV 1VQOV 1YJWV 1W2BU 1VQNV 3OW2U 1YJ9V 1VQKV 3CCLV 3CCVV 1K73W 1VQ5V 1KC8W 3CCRV 2QA4V 1M1KW 3CXCU 1Q7YW 4WCEV 2D3OW 4WFBV 3G4SV 1K8AW 3CC4V
chains in the Genus database with same CATH superfamily
2R72A 3C3SA 2F43G 5C8YA 3TGUH 5EK0A 3M8AA 1KYOF 2Y4UA 3ASOB 4LF7O 5CN0A 1Q43A 5KAIZ 4JAVA 1I7FA 3L74H 3FB5C 2EILB 3A0BZ 5KUMA 2EBOA 5LHIA 4Z1MG 4FIPC 2EJRA 3TXQA 3G71V 3I55V 3EFFK 1Q5OA 3OGCC 1B6QA 1RP3B 3JAWB 4GUNA 2X7RB 5EZYA 3CP1A 4LF8O 3CMAV 1K7DA 2JDIG 2XTAA 4DV4O 4DUYB 2NNUA 3G80A 2KQXA 1JR9A 4J80A 4D7TA 1MZEA 3MDSA 3R66A 4D7SA 3BPZA 3ZHSA 2P22C 2NN4A 4PA4A 4DR5B 1ORQC 3ZBHA 1E79G 2Q7GA 1GM9A 2Q0OC 4JV5B 2QM4A 2A9HA 3ZHVA 4CS2A 3L9DA 1BQZA 3D3QA 1K73W 3H01A 1I0HA 4PA3A 1ZL8B 2RDCA 2OIGA 4YJ3A 3ZRWB 4X20A 5IYBO 4ZOLB 1VQ9V 1MSWD 3CS5A 2B1IA 1SQQH 3CCUV 3VQWA 4LWSB 5EIBC 2DQ3A 2ZT9B 4OX9B 1WAZA 3W7UA 4MVUA 3BRCA 2ZDIC 3ZMVA 1SQVH 4K8ZA 3PN1A 4DR1B 3VQYA 2OCHA 4JASA 3U0ZA 1SQPH 2F4VB 5DEDA 2D3OW 5D5PA 3LSQA 2WLMA 3OMAB 2LGQA 1Y76A 4OGQB 4MVZA 1XNRB 5LOVB 2RQ6A 3O65A 5BXZA 3H1HH 3ZHQA 4DW1A 4NTWA 4BIOA 3MHHC 4TT3G 4U7OA 2BOBC 1GH6A 1TUBB 2YEVA 5F2VO 3G67A 1O9GA 2V1DA 1RPRA 4DR7B 2R9RB 2QWPB 4JZ2A 5BMVB 2H3OA 4H33A 5LXTA 5LHHA 2FKXA 5FLXN 3ZN0A 1VQMV 2GTSA 5AG2A 1VQ4V 2W0XA 1K34A 2F23A 2A3QA 4WBNB 3STLC 4E4EA 4YIOA 3JSLA 1QHTA 1M4UA 1OCZC 4FM2A 3T1HO 1AP6A 4X62B 4H44B 2OWOA 4YIPA 4XBFA 1OCOC 4MTGA 2EJ7A 4NB5A 4LF6B 5LGTA 1T5EA 2YI9A 4FM0A 4DV0O 4MVSA 4I5SA 1VF7A 4PI0A 4FZ1A 5IJ0B 5KHGA 2DYSC 1K92A 4E2LA 3OE7G 3JARA 4KHPO 5EYPB 1Q6IA 1L0NH 1Q6HA 1AI5A 5LMNO 2AXTZ 3OGIB 2BCCH 2L6LA 2ZR2A 4RUFA 3HKDB 4H37A 2EINB 1XBLA 2QJ1A 2WLKA 1YIJV 1F4NA 2ZXWB 3OTOO 2Y4TA 4MTOA 3WB0A 2QM8A 1K5SA 2BOCC 2OTLV 3HKBB 5LA6B 1NH2B 2PUSA 2YUAA 3K9AA 1QVFU 3SJCC 1K4DC 3ETGA 5KLVH 3CCRV 4D6TH 4BIZA 1S5LZ 5IYCO 2A7WA 3G6EV 2N74A 2ZE5A 1LUVA 1EZJA 1VQ8V 4GX0A 1SRYA 4FLZA 1IBLB 3JD3A 5IWAB 1L1FA 1QLEC 3D3IA 1EN6A 1SA0B 3OD4A 4YJ2A 2X6BA 3ASNC 5IJ9B 4DV6B 4UCVA 4O2BA 2WLLA 4X64B 4QGPA 3AG7A 5L3GA 4X66B 3ASOC 2HP8A 2UUAB 2IJHA 4TOIA 4LFAO 3L72H 3A0RA 4NTXA 1ZLZA 4H0LB 5IYZA 4DR4O 2PYLA 1JMKC 4DV7O 2P7TC 3CRCA 4MTXA 1VQ5V 2UXBO 3WG7B 2YIBA 1PM9A 1BE3H 4K8XA 1B04A 2Q7EA 3M7MX 3LSUA 5FNVA 4DR3O 4UCOA 1PNLA 1IURA 2GSMB 3RVZA 2Q69A 4DV5O 4DR2O 2Y69C 2Q5ZA 3CCEV 1RSOB 5EBLC 3WB2A 2DMXA 4X1YB 2QA4V 3KZIZ 1LUWA 1EN5A 2B1GA 2UXXA 3ZHTA 4AI8A 1E1RG 2E75B 3AG1B 5J9PC 2YSUB 3FAVA 3HKCA 5LP6A 2LO1A 2JGDA 1FFTB 3CXHF 3KCXA 5E79Z 5JJNB 2DYRC 5J2TB 3VQXA 2ZNIA 2VQEB 1U96A 4DR6B 5IY5B 1NI8A 2KSDA 3W7TA 3ZMUA 1JOYA 3ABMC 3FB6C 4ZI7A 3AG4C 4PHZA 4OPAA 4TV9A 3T1YB 1I94O 2E5LO 3RYHA 2VS0A 3CRRA 2B5UA 2DJVA 4O2AB 1HP8A 3BVOA 2XAHA 3K5LA 2AZ0A 2PGGA 1SKVA 5JVDA 4JI5B 3E83A 2CDYA 3K58A 1K4CC 1NH2D 3OUSA 4MT8A 4X62O 1W2BU 4BAYA 4CBCA 3O9OA 4UCTA 3ML0A 2OTJV 1PL4A 1SC5B 5GTIZ 4OPHA 4UCSA 3RYFB 4LP8A 4GLXA 2XAFA 5GTHZ 2CTRA 2QDOA 2GDSA 1TUEB 1XMQO 3CD6V 4CS4A 3E2EA 1Y74B 4J10A 3JALB 2OCCB 1LNQA 2ADQB 4HBNA 2GHYA 5JJJB 3SYPA 3S3WA 3ABKB 1N0NA 3ZEDA 1TVKB 3IFXA 2EIJC 5B1AC 3J7AU 3ZRSA 2Q6AA 2HJFC 4UV9A 4F6RA 4UFZA 3JATA 5KUKA 4B3SB 4IT5A 2V7QG 2IJJA 4FMTA 3QO7A 5B1OA 1FXVA 3WU2Z 4CZZA 4UB6Z 1VQLV 2RN9A 5H2FZ 5IWAO 2FB5A 4W4KA 1HNWB 1MSDA 3F5TA 2R9AA 2UXDO 2Y0IA 1W0JG 1WN7A 3RYIA 3KKYA 2EIKC 4GX1A 4CC6A 4IL6Z 1HWYA 3FYEB 3RT3C 4JI1B 1E1QG 4RQEA 4B3TB 2IBZH 1IBKB 4I50B 4UUJC 4LFCO 2N04A 3OFNG 4B3MB 3F7YC 4NXMO 1H8EG 1K8AW 3LUTB 2OIEA 1UPGA 4I4TA 1ZWIC 2ZCEA 4XDJA 1MOFA 3CC2V 4AHCA 1SQGA 1BHBA 1COWG 3WG7C 4ZKIA 3AG2B 1AI4A 2WLJA 3QTCA 3ZJZA 5L3FA 4DRXB 2ZM6B 3CSXA 3IC9A 2JEUA 2EIMC 3ZRXA 4WFBV 3CJHA 3K79A 5KMGA 4YY3O 1I5XA 3U10A 1N32B 3SJBC 1FFXB 1IZ3A 2LJ2A 3OUFA 5DM6V 3OTFA 4ZIBA 1GMGA 3CYOA 3DXRB 3QO5A 4ZHQA 2M7WA 2WPDG 1R3KC 4U3JA 3K9SA 3DSQA 3FB7C 2FMLA 2RCVA 4K35A 3AK3A 3ZHRA 4PDMA 3H1JH 1NU1H 3OMNB 1BSMA 5LP6C 3FKSG 1HR0B 1A32A 2H8PC 2QWOB 3B40A 4EFBA 4JYAO 3ZX6A 4NKGB 2BSKA 4JTAB 5KX5A 2IM9A 4LF5O 1YVWA 1Z5WA 1BT8A 4GKJB 1QLEB 3E8FA 4PA9A 1L0LH 3NXSA 2IW5A 3E22B 2UU9B 4O4LA 1N8RW 3ASNB 1FPOA 1OZ0A 2RJZA 5J2UA 1H8HG 5C8YB 3E8HA 4UVBA 4K0KO 3QF7A 3SPIA 4FLTA 1XILA 4JI3O 4YHHO 1UJWB 4AQYB 1NVPB 1HNZO 1K97A 1Y6XA 2ETNA 1AJNA 1OHHG 4RUEA 2P4KA 4BW9A 4X1KA 1P84F 2CH7A 5IT9N 3A8TA 4CH6A 4R50A 5EIBD 4DV3B 1YCIA 2QKCA 3J80N 4JI6B 3ZIAG 3SPJA 4GKKO 1YTFB 1VQPV 5EZYB 1P49A 4G2KA 1FAFA 2KG7A 2Y0PA 2JIZG 1GN4A 4HZ3A 4QPJA 3ZCCA 2UUBO 3CB2A 2Y69B 4LF4B 2LGWA 2YC0A 3KCYA 2PI5A 2MK3A 3BHPA 1YJNV 3RW0A 3SYCA 2OCCC 4LF9B 2F1MA 3ABKC 4L8JA 1AI7A 1CPYA 3X2QC 1AR5A 2HEPA 4JI7O 3CC4V 3M99B 1HNXO 4DUZO 3TXSA 1ZTEA 4YJ3B 3UT5A 4X20B 2AHZA 1GAXA 5IE9A 2DYRB 2EX3A 1IX9A 4B7EA 4NXNO 3D8CA 1H2NA 2EZOA 2HG5C 5H9CA 3T2MA 2O57A 2QGNA 1ZAUA 3K5NA 3ABMB 5LGUA 2OT5A 2A0LA 2ZE8A 4P2ZA 2QE7G 1MNGA 3ZRWA 1SS3A 1Q81W 3AG4B 1THZA 3B09A 4TUYA 3W7SA 1TGOA 3H1KH 4ZOLA 1Y76B 4HNAA 2F93B 5EC2C 1GK9A 1VP7A 2HHHO 4R6ZA 4WFHA 2M6YA 2KKWA 5KAFZ 4X1IA 3K04A 1RM1C 1GN3A 5B5EZ 4I55A 2CTWA 2EULA 2E74B 3ABTA 4YXWG 5JQGA 3GB7C 1JFFA 4P9PA 5LXTB 4GZRB 2UUCB 2LQTA 4DV1O 1QNMA 1WP8A 2MW2B 4MVRA 1W59A 5BR8B 1TUBA 2AW9A 4KFMA 3Q4HA 3ZRVA 3GWOA 4EFEA 4O4JA 3AG2C 1Q8IA 4GX5A 4LFBO 1OCRC 1BZKA 4QE7A 4TV8A 3UO2A 2R9IA 3JARB 1N34O 2DQ0A 2VWJA 3J81N 5GONA 1NVPD 2F66C 4LR3A 3LDCA 3CCLV 2EIJB 4JI4B 5B1AB 3RVYA 5IYDO 1IBMB 4LC1A 1X4TA 4N23A 2QKSA 1CP9A 1N33B 4J11A 2YDEA 1Y67A 1S72V 1R73A 4J7KA 1RPOA 2Q8VA 4W4LA 2ADPA 1N36O 1J95A 1YTFD 4FZ0A 3E35A 4DV2O 3OW2U 2LP7A 3ZHUA 4X65O 4LNUA 1KMIZ 4EKWA 1F51A 2OYQA 4WFAV 3I56V 1VF6C 4U7NA 5JCOA 4J7ZA 4NTYA 1AJPA 2EIKB 3DTUB 4YJ2B 5FPOA 4IHJA 4O2BB 4FFKA 4KL1A 2WLLB 1KC8W 4IYIA 5LMUB 1XEQA 1L8DA 1GRJA 5C93A 4UV8A 1VQ6V 1YSCA 1US6A 1KP3A 5IJ9A 5IYZB 1WB8A 1VMGA 3W7WA 3CX5F 1XI1A 4JI2B 1URFA 2CAZC 1FXKA 4DUYO 4BR6A 3OEHG 2VQFB 1FJGB 4J9ZB 4UXNA 3U11A 2H94A 3SR2C 4PDLA 5FNVB 2IJIA 3K57A 2HKOA 4MVOA 1EN4A 3A2FA 3N2KA 4DR5O 4CS3A 2EIMB 4JI0B 4JYCA 3HKEA 1M93A 1WB7A 4EB6A 5H6RA 4WFFA 1NQTA 1JVMA 1WLEA 4JV5O 1BCCH 5LYJB 1K3EA 2K1EA 3UQ8A 3FX7A 2WLIA 3ICXA 3AEIA 1M5IA 1SETA 2YI8A 1AP5A 4FLUA 2AHYA 2YS8A 5L3DA 1NR7A 3FAVB 1RSOA 2CTQA 5LP6B 3K3WA 1S5HC 4I9WA 4OX9O 1AROP 3L73H 3UM7A 2HVJC 4PI2A 4DR1O 3G4SV 2F4VO 1PL0A 2CUGA 3OAAG 2UXCB 4X88A 5LHGA 3ETDA 2ZIMA 5EBWC 1OCCB 2G38A 4PV1B 1YHQV 1VIBA 3N2GA 4J41A 1XNRO 3QVNA 2E3CA 1D2DA 4L87A 4G27B 4X9QA 2V4DA 1G8MA 3ZS8C 4MTFA 2YIDA 1YJWV 4TQFA 3LNNA 4TV9B 5CA1A 3RYHB 4DR7O 2XOKG 1YEWA 1ZUQA 2ZQMA 1J5EB 2JVDA 1XMOB 5JVDB 1GKFA 1PNMA 3IAYA 3OT7A 3K59A 2GV9A 4ZBMA 1XNQB 2N05A 2Y48A 4IYHA 2ZINA 4F6EA 4B3RB 1Q6UA 4KUMA 4LF6O 4GX2A 5CMUA 3SYQA 4KP4A 4JAAA 3FFQA 2ZE6A 2PTMA 4LF7B 1CXZB 1M9NA 1WP7A 2ARHA 1KBHA 5CA0A 3CCSV 4B7KA 5KHKA 4AILC 1NBMG 1M1KW 2P5OA 1GM7A 1XDCA 4QNHB 3CC7V 1V54B 3RYCA 3X2QB 1XHXA 4UVAA 4LF8B 3JATB 1SF9A 4DV4B 3CCMV 2CTPA 5JH7A 2CK3G 3B8NA 2ZNJA 1BS3A 1XOUA 2EZPA 1JJ2U 2GBOA 2YIBD 3DC6A 1K33A 1IBLO 1SQBH 4PA7A 1Y4MA 2VRZA 3MHSC 4FFBA 4DV6O 3JASA 2ITCC 2JJ2G 3L75H 5JCOC 4X64O 3RYIB 1VEWA 4X66O 1R6TA 3B4SA 1F23A 2UUAO 4A5UB 1K9MW 1QR8A 1H2LA 5B66Z 1KKDA 3KG2A 2ZDIA 1RM1B 3I5DA 5KHIA 1CEZA 3K08A 3C90A 4PJ0Z 3SGIA 2YICA 1U97A 3APOA 3CXCU 5ITZB 4JAUA 4GT1A 1GN2A 4I4TB 1OV9A 1Z2GA 2L35A 1R3JC 1FXKC 1NZ6A 4HAMA 1I5YA 4FLVA 1GN6A 2CE4A 4JTCB 1OCRB 1KB9F 2DE0X 3G6BA 3LSSA 3SPHA 5CB4A 1NTMH 2NLJC 2QWQB 1PP9H 4UVCA 4QPKA 3CJHB 5KMGB 1SQXH 1KP2A 1JQ0A 3AG3C 4WFGA 5HFLA 4K3AA 3K06A 4ZHQB 4DRXA 1S77D 1DF4A 1DK1A 2JJ1G 3T1HB 1AI6A 4C7UA 1UFIA 1AILA 1M57C 2JRIA 1D5AA 1P7BA 2LFSA 2HVKC 4DV0B 1ENVA 3P32A 3AK1A 4RQFA 1G6UA 2WSSG 3RBZA 2VQEO 4O4HB 3OR7C 1WA8A 2ITDC 2DW4A 1FKAO 4DR6O 3T4DA 4KHPB 4O4IA 3BA8A 3CE2A 2BSKB 3K03A 5KX5B 1OCCC 5LMNB 2JGUA 2BTQA 2GUZB 3SDLA 3T1YO 2LW1A 1LR1A 2Z3YA 1SESA 3BCCH 3OTOB 2P90A 2RMKB 5J2UB 3D36A 4I0XA 3JAKA 4JI5O 1NS1A 4CH3A 5LBQA 4IIJA 2HR3A 4GCZA 4JI8B 3FD9A 2ZKOA 4WCEV 3H1LH 4OXSA 3TK1A 3ZN1A 4F4LA 4X1KB 1NKDA 2CH7B 2P6JA 2E76B 5B3SC 2Q68A 1W0KG 3DGEA 1QVGU 4TSFG 3E86A 3W7XA 3R65A 2QEXV 4XDLA 2JEXA 3HB3B 4BW5A 2HFEC 2KG7B 4DK1A 2LW7A 3K0GA 4IGGA 5FL7G 4FLXA 5A9GA 3JCZA 2JS5A 4J9YB 4LFAB 3QO8A 2W6IG 3SPCA 1V9PA 1Z5VA 3JAWA 4DW0A 4DR4B 1M90W 3E8GA 3JD4A 4DV7B 2YXLA 3CPWU 1R1BA 5L3EA 3CCQV 4FK5C 2QKAA 1V54C 4R7CA 5JJEB 2UXBB 2WAMA 4B3SO 4EEQA 4DR3B 3IC7A 5KHHA 2PYJA 1DLBA 3UT5B 2BTOA 1HNWO 5GW7A 4DV5B 4DR2B 2XUMA 4QE9A 1NTZH 2W6JG 1S5JA 1PNKA 4PELA 1O9HA 2IU0A 3VQVA 1ZL8A 3P3NA 5L3CA 3T4ZA 3BAAA 4I7ZB 4XDKA 3BABA 4JI1O 4MS2A 1OJHA 4TUYB 2XASA 3LDDA 4HNAB 4B3TO 4LWSA 1IBKO 4MSWC 5B1NA 4U3FH 1XREA 1DTOA 4X1IB 2YEVB 3TJTA 5DECA 4B3MO 1M56B 1FYJA 3S3XA 4I55B 5B1BC 4B08A 4HYOA 1KECA 4MW8A 4Q6GA 5JQGB 1BQ0A 1JFFB 2PI4A 3JCUZ 2XAGA 1JPXA 1HDJA 1Q3EA 5LOVA 3LNMB 1D5NA 1FXHA 2ODMA 1MZFA 1I94B 2ZM6O 1EZVH 3Q4HB 2E5LB 4DK0A 4RWUA 1R6KA 3LDEA 2ZE7A 4O4JB 4FJCC 5BMVA 2YIAA 3P3PA 1N32O 3ETQA 5KA6A 1YI2V 1G1XB 1MABG 4TV8B 2ILMA 4RAIA 1EM1A 2QTOA 4WBNA 1QCEA 3SJAC 4ABMA 4UB8Z 3F7VC 1SQFA 4TWKA 1RFYA 2YXYA 3TCUA 2Q67A 3E89A 1YF2A 4JPRA 5GONB 3UCSC 4Q20A 5JWPA 1P4RA 1JX9A 2A06H 5A2QN 5IJ0A 1Q82W 2WWWA 1HR0O 3B8MA 1N4CA 3CRQA 1PKXA 2QR4A 4P9OA 5EYPA 3QNEA 3UO3A 4LBEC 1XMQB 3ABLC 4FM1A 4NVPA 1VQOV 3UKMA 3APQA 3HKDA 4LNUB 3TETA 4GKJO 2FTKA 5KA5A 4FLWA 2UU9O 4JZGA 4QJFB 2AGAA 3JD1A 3RWRD 3EVKA 1KKCA 1H2SB 3HKBA 5LA6A 1V55B 1XL6A 2WLNA 5IDJA 4AQYO 1BGYH 4JTDB 2K9PA 4IHJB 4PD4F 2P67A 4JI8O 2PZSA 1VF5B 2IU3A 3D36C 4JF3A 3H1IH 4BWAA 5EC1C 4X8AA 1R6NA 3E8BA 4DV3O 4NR1A 4UCRA 1SA0A 4JI6O 2X0LA 1IDSA 4MVQA 2UXDB 1XUQA 1WJZA 2FYUH 5CBGA 1VQNV 1WPBA 3CRMA 3JD2A 1TA8A 1H2GA 2C2AA 1DGSA 1FXKB 3ABUA 3L71H 1BHAA 1GTOA 3GWKC 1BMFG 2DWEC 2F95B 3CEIA 2EILC 4RO2A 4LF4O 5K1XA 4QIWF 2B9ZA 1P7GA 1QLNA 3N2KB 4LFCB 3HKEB 2JS3A 4EB6B 2FL4A 1WNSA 4LF9O 1AB3A 4GYCB 2XT9A 4NXMB 5CBFA 2QWNB 3AG3B 1IXBA 1BL8A 1Q90D 2CGOA 2WLIB 4TQDA 1EFRG 3F5WC 3OMIB 5LGNA 2Q9LA 4ASUG 3CMEV 2R70A 3B2EE 1M57B 2QSAA 1KD1W 1B3QA 1AVMA 1IXMA 3HKCB 3JYCA 4WF9V 1MMMA 2JK5C 5LYJA 3P30A 2RNBA 2JGDB 4J42A 4X1YA 1YXBA 2Z5UA 3SJQC 4YY3B 2Q0AA 1QU7A 3SYAA 2X6AA 3JAMN 1GM8A 2A79B 1SZXA 4CC5A 1TAEA 3N2GB 1NT2B 2DWDC 3K5MA 2P4VA 4ZI7B 2W0FC 5BY1A 3BFRA 3RGBA 1G4YB 4KXRA 5KHJA 5J2TA 4PDRA 2X6CA 5CA1B 3CWBH 5TISZ 4DO2A 3N27A 3WB1A 1PPJH 3QG5A 3THOA 2UUCO 3OR6C 1WPXA 4JYAB 1M56C 2ZD9A 3OM3B 4MVMA 5H5NA 5BR8O 3CRAA 2LFRA 4PA6A 3IJ4A 4LF5B 5B3SB 1QBZA 3HPLC 1YJ9V 1IVSA 4NYKA 3IGAC 3EXAA 1NR1A 4O2AA 1NJIW 2CGNA 1QR9A 4K0KB 1JJOA 4FLYA 2P06A 4JI3B 4YHHB 2Q73A 1XHZA 2GTAA 1HNZB 1Q86W 5CA0B 1FS0G 1AR1B 3ETEA 2WA4A 4JI4O 2PF4E 1IBMO 4LH6A 3K0DA 4JYBA 1VQ7V 2ATKC 2IJKA 1N33O 3RYFA 5E1AC 2YXHA 1YITV 4GKKB 5HFMA 3RYCB 4CH5A 3VOUA 1S76D 2XAQA 1AJQA 1X59A 2QM7A 4PDVA 1AR4A 4F6RB 1Y74A 1EBOA 5JH7B 3CCVV 1KUQA 1KU9A 4WFEA 3JALA 2UUBB 2HLDG 3SYOA 4BIUA 2PY5A 4R8CA 2WLHA 4DXWA 1TVKA 4LH7A 1JCHA 2Q7HA 1PD3A 1KQSU 3GVMA 5EBMC 3VBBA 3CCJV 1S3JA 1ZX3A 2EINC 2ZIOA 3JSNA 1XL4A 4CH4A 2ZXWC 1YZBA 4FFBB 3H9VA 4JI7B 1JA8A 2Q4PA 3JASB 1V55C 5LMUO 5L3BA 4H13B 1N0JA 3AK2A 3BY6A 3C3TA 1HNXB 4DUZB 1Y66A 3STZC 3RFRA 4Z2WA 3FB8C 3ZMSA 4NXNB 1MG1A 5FPRA 5B1BB 3OEEG 1QQCA 1MA1A 2VWKA 1FD9A 2D2CB 4JYYA 4JI2O 1VQKV 4J7JA 5D5QA 1NTKH 1VARA 2VQFO 1FJGO 4JGSA 1H2MA 1SZTA 2BE3A 4DYLA 3NR7A 4I50A 2QWRB 2HHHB 1R3IC 1ROPA 4JI0O 2XNDG 1H38A 5LL6Y 4FPPA 1GO3F 5ITZA 1DF5A 3JD0A 5CB4B 5K1PA 1R3LC 2QTSA 3BEHA 5DN6G 1OCZB 4DV1B 1OCOB 2DN9A 5BZBA 1I08A 3WFVA 4U3JB 3EHBB 1XQ8A 2DYSB 1F7YA 2IH1C 3MAQA 1Q7YW 1SERA 1PV0A 4LFBB 1FFXA 2IH3C 4ICGA 3SPGA 3K5OA 2UXCO 2KB1A 1YDXA 2WA3A 3ABLB 3DC5A 1F4MA 3HR0A 2ZR3A 1WA8B 3ZMZA 3DXRA 2AZ2A 1N34B 4P30A 4O4IB 1ZSPA 4FVMA 5CA3A 2Z0AA 2HJDA 3FYIB 4UCUA 5H6QA 1HW7A 3ZMTA 3CHXA 2BTQB 3RN4A 3AG1C 4N21A 2XAJA 1S0VA 1H2KA 2DOSA 2UXNA 1B06A 4O4HA 3T1CA 4O4LB 1J5EO 3BA9A 4I9QA 1XMOO 4MW3A 2NR5A 1N36B 4I0XB 3A0HZ 3JAKB 3MD0A 4IIJB 2GUZA 3B77A 4X89A 5IY5C 4DV2B 1K5QA 4G28B 5CBHA 1XNQO 1VF6A 3L70H 4LCUC 4X65B 2XHBA 3PJSK 4Z1VA 3E22A 4B3RO
chains in the Genus database with same CATH topology
3AEIA 5B1OA 1FXVA 5KA6A 1YI2V 1MABG 1SETA 2F43G 5EK0A 2AHYA 4RAIA 4CZZA 1VQLV 2QTOA 1QCEA 5L3DA 3ASOB 1NR7A 3F7VC 5CN0A 4TWKA 3K3WA 4JAVA 3TCUA 1S5HC 4I9WA 2Q67A 3E89A 4JPRA 1AROP 2EILB 3FB5C 3UM7A 1W0JG 5KUMA 2HVJC 4Q20A 2EBOA 5LHIA 4Z1MG 2EIKC 3G4SV 4FIPC 4GX1A 2EJRA 1PL0A 1P4RA 1JX9A 3OAAG 1HWYA 3FYEB 3G71V 3I55V 1Q82W 2WWWA 4X88A 3EFFK 3ETDA 3OGCC 5EBWC 1E1QG 1OCCB 3B8MA 5LHGA 1PKXA 1YHQV 4RQEA 1B6QA 4P9OA 4L87A 4G27B 4UUJC 2X7RB 3QNEA 3CP1A 3CMAV 4LBEC 3ABLC 1G8MA 1K7DA 4MTFA 2JDIG 3OFNG 1VQOV 1YJWV 3UKMA 3F7YC 2NNUA 1H8EG 3TETA 1K8AW 3LUTB 2FTKA 5KA5A 1ZWIC 2XOKG 4XDJA 1MOFA 2ZQMA 4QJFB 3JD1A 3CC2V 1BHBA 1COWG 4PA4A 1ORQC 3WG7C 1GKFA 1PNMA 4ZKIA 1E79G 1V55B 1XL6A 2WLNA 3AG2B 1AI4A 2WLJA 5IDJA 3ZJZA 5L3FA 1GM9A 4ZBMA 4JTDB 2A9HA 2P67A 2Y48A 2IU3A 2JEUA 1K73W 4JF3A 2EIMC 3H01A 3ZRXA 4KUMA 4PA3A 4WFBV 3K79A 4GX2A 5EC1C 1I5XA 5CMUA 3SYQA 4KP4A 3OUFA 4X8AA 5DM6V 3ZRWB 1R6NA 3E8BA 1GMGA 3CYOA 5IYBO 1VQ9V 3QO5A 2M7WA 1M9NA 2WPDG 1R3KC 2X0LA 2B1IA 1MSWD 3CCUV 3FB7C 2DQ3A 4MVQA 3CCSV 4PDMA 3W7UA 4MVUA 5CBGA 1VQNV 2ZDIC 1NBMG 3ZMVA 3JD2A 1H2GA 2C2AA 3ABUA 1FXKB 4JASA 1M1KW 1BHAA 1GTOA 2D3OW 3OMNB 1GM7A 1BMFG 2DWEC 3FKSG 3LSQA 4QNHB 2WLMA 2H8PC 2EILC 4RO2A 3OMAB 4QIWF 1V54B 3CC7V 4MVZA 3X2QB 1QLNA 4UVAA 3MHHC 4TT3G 4U7OA 2BOBC 2YEVA 4JTAB 3CCMV 5CBFA 2V1DA 1RPRA 2CK3G 3AG3B 1QLEB 3B8NA 1BL8A 3E8FA 4PA9A 2R9RB 2IW5A 3NXSA 2EZPA 1N8RW 2WLIB 1EFRG 1JJ2U 4H33A 3F5WC 3ASNB 1OZ0A 5LHHA 3OMIB 3ZN0A 5LGNA 1VQMV 1VQ4V 1H8HG 1K33A 3E8HA 4UVBA 4ASUG 3CMEV 1K34A 1M57B 3SPIA 3STLC 4PA7A 1Y4MA 1KD1W 1UJWB 1NVPB 1IXMA 1OCZC 3MHSC 3JYCA 1K97A 4WF9V 2JK5C 4XBFA 3P30A 1OCOC 1AJNA 2Z5UA 1OHHG 2ITCC 4RUEA 2JJ2G 4MTGA 3SJQC 5LGTA 4MVSA 4I5SA 1F23A 2X6AA 3SYAA 1K9MW 1QR8A 1KKDA 1GM8A 4R50A 2DYSC 1K92A 2A79B 2ZDIA 3KG2A 4E2LA 3OE7G 1RM1B 3ZIAG 1CEZA 3SPJA 1YTFB 2DWDC 3K08A 1VQPV 4G2KA 2W0FC 1AI5A 2JIZG 1G4YB 2ZR2A 4RUFA 4HZ3A 3CXCU 4PDRA 2X6CA 4H37A 4JAUA 2EINB 4GT1A 4QPJA 3ZCCA 4DO2A 2Y69B 2WLKA 1YIJV 1F4NA 2ZXWB 1R3JC 3OR6C 2MK3A 2PI5A 1WPXA 1FXKC 4HAMA 1M56C 4MTOA 1I5YA 2ZD9A 2QM8A 1K5SA 2BOCC 3OM3B 3RW0A 3SYCA 1YJNV 1NH2B 2OTLV 2OCCC 4MVMA 3K9AA 4JTCB 1OCRB 1QVFU 2LFRA 3ABKC 4PA6A 1CPYA 1AI7A 1QBZA 1K4DC 3HPLC 3LSSA 3SPHA 5B3SB 3X2QC 1YJ9V 2NLJC 3ETGA 3CCRV 4UVCA 4BIZA 3IGAC 1NR1A 4QPKA 5IYCO 3CC4V 1NJIW 3G6EV 2QEXV 1QR9A 1KP2A 1EZJA 1VQ8V 3M99B 1SRYA 1JQ0A 4GX0A 3JD3A 3AG3C 1L1FA 1QLEC 2AHZA 4WFGA 5HFLA 2DYRB 3D3IA 3K06A 1S77D 1DF4A 2JJ1G 1AI6A 2X6BA 3ASNC 1Q86W 2EZOA 2HG5C 5H9CA 1FS0G 3T2MA 1AR1B 2WLLA 1M57C 3ETEA 1P7BA 2LFSA 2HVKC 5L3GA 1ENVA 3P32A 3ASOC 3ABMB 5LGUA 4RQFA 2WSSG 2OT5A 2A0LA 4P2ZA 2QE7G 2IJHA 3K0DA 4JYBA 3ZRWA 1VQ7V 2ATKC 1Q81W 2IJKA 3AG4B 1THZA 3RBZA 3OR7C 2ITDC 3W7SA 2DW4A 5E1AC 3A0RA 1YITV 3T4DA 5HFMA 3VOUA 5EC2C 1GK9A 1S76D 2XAQA 1AJQA 4R6ZA 4WFHA 2P7TC 2QM7A 4PDVA 3K04A 3K03A 4MTXA 1OCCC 1RM1C 1EBOA 3CCVV 1VQ5V 3WG7B 4WFEA 3ABTA 2HLDG 2Z3YA 3SYOA 4YXWG 4BIUA 1SESA 4R8CA 1PNLA 3GB7C 2WLHA 4DXWA 4P9PA 2P90A 1JCHA 1PD3A 2GSMB 4MVRA 1KQSU 3D36A 5EBMC 3VBBA 3CCJV 1S3JA 3RVZA 2EINC 5LBQA 2Q69A 2Y69C 1XL4A 2HR3A 4GCZA 4KFMA 3CCEV 2ZXWC 5EBLC 3ZRVA 3GWOA 2QA4V 4WCEV 1V55C 4OXSA 3AG2C 4GX5A 3TK1A 1OCRC 3ZN1A 4F4LA 5L3BA 2B1GA 3BY6A 4QE7A 2UXXA 1NKDA 1Y66A 2P6JA 5B3SC 2Q68A 3STZC 1E1RG 1W0KG 2R9IA 3DGEA 3FB8C 1QVGU 4FJCC 3AG1B 3E86A 3R65A 2YSUB 4TSFG 3ZMSA 5J9PC 3W7XA 4XDLA 1MG1A 5B1BB 2DQ0A 3OEEG 2JEXA 3HB3B 4BW5A 1FFTB 1NVPD 3LDCA 1VQKV 3CCLV 2DYRC 2HFEC 2EIJB 5B1AB 3K0GA 3RVYA 5IYDO 4LC1A 5FL7G 4JGSA 1SZTA 3JCZA 4N23A 2QKSA 1CP9A 4J9YB 5IY5B 3QO8A 2W6IG 3SPCA 3W7TA 1S72V 1R73A 3ZMUA 1RPOA 1JOYA 3ABMC 1R3IC 1M90W 1ROPA 3FB6C 1J95A 3E8GA 2XNDG 3JD4A 1YTFD 3CPWU 3AG4C 1H38A 5L3EA 4FPPA 3E35A 1GO3F 3CCQV 4FK5C 3OW2U 1V54C 2LP7A 4R7CA 1DF5A 3JD0A 2WAMA 1R3LC 4EKWA 1F51A 2B5UA 3BEHA 5DN6G 1OCZB 3IC7A 2XAHA 1OCOB 4WFAV 3I56V 5BZBA 1DLBA 4U7NA 3E83A 5GW7A 3WFVA 1AJPA 2EIKB 3DTUB 1K4CC 1NH2D 3OUSA 4MT8A 3EHBB 4QE9A 2DYSB 2W6JG 1W2BU 1PNKA 4BAYA 4CBCA 4PELA 2IH1C 2WLLB 1KC8W 2IU0A 1Q7YW 1SERA 3ML0A 2IH3C 5L3CA 3T4ZA 2OTJV 4XDKA 3SPGA 2KB1A 5C93A 3ABLB 1F4MA 4UV8A 2ZR3A 4MS2A 3ZMZA 2XASA 3LDDA 4LP8A 1YSCA 1VQ6V 4P30A 2XAFA 1KP3A 4MSWC 5CA3A 3W7WA 3FYIB 5B1NA 1TUEB 3CD6V 5H6QA 3E2EA 1DTOA 3ZMTA 2YEVB 3AG1C 1FXKA 4N21A 1M56B 3OEHG 4J9ZB 4UXNA 2XAJA 5B1BC 4HYOA 1S0VA 2OCCB 2H94A 1LNQA 1KECA 2UXNA 4MW8A 2GHYA 4PDLA 3SYPA 3T1CA 2IJIA 3ABKB 2HKOA 2PI4A 4MVOA 2XAGA 1JPXA 3IFXA 4MW3A 2EIJC 5B1AC 3ZRSA 2EIMB 2Q6AA 2HJFC 4UV9A 4JYCA 3LNMB 1FXHA 3MD0A 5H6RA 4WFFA 1NQTA 3B77A 5IY5C 4X89A 1JVMA 1K5QA 1WLEA 4G28B 5CBHA 5KUKA 4LCUC 1K3EA 1R6KA 3LDEA 2V7QG 3PJSK 2K1EA 2IJJA 4FMTA 3QO7A 2WLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI W;  3G6E V;  1N8R W;  1K9M W;  3G71 V;  3I55 V;  1VQ7 V;  1YI2 V;  1Q82 W;  1JJ2 U;  1Q81 W;  1YIJ V;  1VQ8 V;  3CC2 V;  5DM6 V;  4WFA V;  3I56 V;  1VQM V;  1VQ4 V;  1VQL V;  3CC7 V;  1YHQ V;  3CME V;  1YIT V;  1S72 V;  1R73 A;  1QVG U;  1KQS U;  1YJN V;  3CCJ V;  1VQ9 V;  2OTL V;  2QEX V;  1VQ6 V;  2OTJ V;  1M90 W;  1KD1 W;  3CCU V;  1VQP V;  3CMA V;  3CPW U;  3CCS V;  3CCE V;  1QVF U;  1Q86 W;  4WF9 V;  3CD6 V;  3CCM V;  3CCQ V;  1VQO V;  1YJW V;  1W2B U;  1VQN V;  3OW2 U;  1YJ9 V;  1VQK V;  3CCL V;  3CCV V;  1K73 W;  1VQ5 V;  1KC8 W;  3CCR V;  2QA4 V;  1M1K W;  3CXC U;  1Q7Y W;  4WCE V;  2D3O W;  4WFB V;  3G4S V;  1K8A W;  3CC4 V; 
#chains in the Genus database with same CATH topology
 2R72 A;  3C3S A;  2F43 G;  5C8Y A;  3TGU H;  5EK0 A;  3M8A A;  1KYO F;  2Y4U A;  3ASO B;  4LF7 O;  5CN0 A;  1Q43 A;  5KAI Z;  4JAV A;  1I7F A;  3L74 H;  3FB5 C;  2EIL B;  3A0B Z;  5KUM A;  2EBO A;  5LHI A;  4Z1M G;  4FIP C;  2EJR A;  3TXQ A;  3G71 V;  3I55 V;  3EFF K;  1Q5O A;  3OGC C;  1B6Q A;  1RP3 B;  3JAW B;  4GUN A;  2X7R B;  5EZY A;  3CP1 A;  4LF8 O;  3CMA V;  1K7D A;  2JDI G;  2XTA A;  4DV4 O;  4DUY B;  2NNU A;  3G80 A;  2KQX A;  1JR9 A;  4J80 A;  4D7T A;  1MZE A;  3MDS A;  3R66 A;  4D7S A;  3BPZ A;  3ZHS A;  2P22 C;  2NN4 A;  4PA4 A;  4DR5 B;  1ORQ C;  3ZBH A;  1E79 G;  2Q7G A;  1GM9 A;  2Q0O C;  4JV5 B;  2QM4 A;  2A9H A;  3ZHV A;  4CS2 A;  3L9D A;  1BQZ A;  3D3Q A;  1K73 W;  3H01 A;  1I0H A;  4PA3 A;  1ZL8 B;  2RDC A;  2OIG A;  4YJ3 A;  3ZRW B;  4X20 A;  5IYB O;  4ZOL B;  1VQ9 V;  1MSW D;  3CS5 A;  2B1I A;  1SQQ H;  3CCU V;  3VQW A;  4LWS B;  5EIB C;  2DQ3 A;  2ZT9 B;  4OX9 B;  1WAZ A;  3W7U A;  4MVU A;  3BRC A;  2ZDI C;  3ZMV A;  1SQV H;  4K8Z A;  3PN1 A;  4DR1 B;  3VQY A;  2OCH A;  4JAS A;  3U0Z A;  1SQP H;  2F4V B;  5DED A;  2D3O W;  5D5P A;  3LSQ A;  2WLM A;  3OMA B;  2LGQ A;  1Y76 A;  4OGQ B;  4MVZ A;  1XNR B;  5LOV B;  2RQ6 A;  3O65 A;  5BXZ A;  3H1H H;  3ZHQ A;  4DW1 A;  4NTW A;  4BIO A;  3MHH C;  4TT3 G;  4U7O A;  2BOB C;  1GH6 A;  1TUB B;  2YEV A;  5F2V O;  3G67 A;  1O9G A;  2V1D A;  1RPR A;  4DR7 B;  2R9R B;  2QWP B;  4JZ2 A;  5BMV B;  2H3O A;  4H33 A;  5LXT A;  5LHH A;  2FKX A;  5FLX N;  3ZN0 A;  1VQM V;  2GTS A;  5AG2 A;  1VQ4 V;  2W0X A;  1K34 A;  2F23 A;  2A3Q A;  4WBN B;  3STL C;  4E4E A;  4YIO A;  3JSL A;  1QHT A;  1M4U A;  1OCZ C;  4FM2 A;  3T1H O;  1AP6 A;  4X62 B;  4H44 B;  2OWO A;  4YIP A;  4XBF A;  1OCO C;  4MTG A;  2EJ7 A;  4NB5 A;  4LF6 B;  5LGT A;  1T5E A;  2YI9 A;  4FM0 A;  4DV0 O;  4MVS A;  4I5S A;  1VF7 A;  4PI0 A;  4FZ1 A;  5IJ0 B;  5KHG A;  2DYS C;  1K92 A;  4E2L A;  3OE7 G;  3JAR A;  4KHP O;  5EYP B;  1Q6I A;  1L0N H;  1Q6H A;  1AI5 A;  5LMN O;  2AXT Z;  3OGI B;  2BCC H;  2L6L A;  2ZR2 A;  4RUF A;  3HKD B;  4H37 A;  2EIN B;  1XBL A;  2QJ1 A;  2WLK A;  1YIJ V;  1F4N A;  2ZXW B;  3OTO O;  2Y4T A;  4MTO A;  3WB0 A;  2QM8 A;  1K5S A;  2BOC C;  2OTL V;  3HKB B;  5LA6 B;  1NH2 B;  2PUS A;  2YUA A;  3K9A A;  1QVF U;  3SJC C;  1K4D C;  3ETG A;  5KLV H;  3CCR V;  4D6T H;  4BIZ A;  1S5L Z;  5IYC O;  2A7W A;  3G6E V;  2N74 A;  2ZE5 A;  1LUV A;  1EZJ A;  1VQ8 V;  4GX0 A;  1SRY A;  4FLZ A;  1IBL B;  3JD3 A;  5IWA B;  1L1F A;  1QLE C;  3D3I A;  1EN6 A;  1SA0 B;  3OD4 A;  4YJ2 A;  2X6B A;  3ASN C;  5IJ9 B;  4DV6 B;  4UCV A;  4O2B A;  2WLL A;  4X64 B;  4QGP A;  3AG7 A;  5L3G A;  4X66 B;  3ASO C;  2HP8 A;  2UUA B;  2IJH A;  4TOI A;  4LFA O;  3L72 H;  3A0R A;  4NTX A;  1ZLZ A;  4H0L B;  5IYZ A;  4DR4 O;  2PYL A;  1JMK C;  4DV7 O;  2P7T C;  3CRC A;  4MTX A;  1VQ5 V;  2UXB O;  3WG7 B;  2YIB A;  1PM9 A;  1BE3 H;  4K8X A;  1B04 A;  2Q7E A;  3M7M X;  3LSU A;  5FNV A;  4DR3 O;  4UCO A;  1PNL A;  1IUR A;  2GSM B;  3RVZ A;  2Q69 A;  4DV5 O;  4DR2 O;  2Y69 C;  2Q5Z A;  3CCE V;  1RSO B;  5EBL C;  3WB2 A;  2DMX A;  4X1Y B;  2QA4 V;  3KZI Z;  1LUW A;  1EN5 A;  2B1G A;  2UXX A;  3ZHT A;  4AI8 A;  1E1R G;  2E75 B;  3AG1 B;  5J9P C;  2YSU B;  3FAV A;  3HKC A;  5LP6 A;  2LO1 A;  2JGD A;  1FFT B;  3CXH F;  3KCX A;  5E79 Z;  5JJN B;  2DYR C;  5J2T B;  3VQX A;  2ZNI A;  2VQE B;  1U96 A;  4DR6 B;  5IY5 B;  1NI8 A;  2KSD A;  3W7T A;  3ZMU A;  1JOY A;  3ABM C;  3FB6 C;  4ZI7 A;  3AG4 C;  4PHZ A;  4OPA A;  4TV9 A;  3T1Y B;  1I94 O;  2E5L O;  3RYH A;  2VS0 A;  3CRR A;  2B5U A;  2DJV A;  4O2A B;  1HP8 A;  3BVO A;  2XAH A;  3K5L A;  2AZ0 A;  2PGG A;  1SKV A;  5JVD A;  4JI5 B;  3E83 A;  2CDY A;  3K58 A;  1K4C C;  1NH2 D;  3OUS A;  4MT8 A;  4X62 O;  1W2B U;  4BAY A;  4CBC A;  3O9O A;  4UCT A;  3ML0 A;  2OTJ V;  1PL4 A;  1SC5 B;  5GTI Z;  4OPH A;  4UCS A;  3RYF B;  4LP8 A;  4GLX A;  2XAF A;  5GTH Z;  2CTR A;  2QDO A;  2GDS A;  1TUE B;  1XMQ O;  3CD6 V;  4CS4 A;  3E2E A;  1Y74 B;  4J10 A;  3JAL B;  2OCC B;  1LNQ A;  2ADQ B;  4HBN A;  2GHY A;  5JJJ B;  3SYP A;  3S3W A;  3ABK B;  1N0N A;  3ZED A;  1TVK B;  3IFX A;  2EIJ C;  5B1A C;  3J7A U;  3ZRS A;  2Q6A A;  2HJF C;  4UV9 A;  4F6R A;  4UFZ A;  3JAT A;  5KUK A;  4B3S B;  4IT5 A;  2V7Q G;  2IJJ A;  4FMT A;  3QO7 A;  5B1O A;  1FXV A;  3WU2 Z;  4CZZ A;  4UB6 Z;  1VQL V;  2RN9 A;  5H2F Z;  5IWA O;  2FB5 A;  4W4K A;  1HNW B;  1MSD A;  3F5T A;  2R9A A;  2UXD O;  2Y0I A;  1W0J G;  1WN7 A;  3RYI A;  3KKY A;  2EIK C;  4GX1 A;  4CC6 A;  4IL6 Z;  1HWY A;  3FYE B;  3RT3 C;  4JI1 B;  1E1Q G;  4RQE A;  4B3T B;  2IBZ H;  1IBK B;  4I50 B;  4UUJ C;  4LFC O;  2N04 A;  3OFN G;  4B3M B;  3F7Y C;  4NXM O;  1H8E G;  1K8A W;  3LUT B;  2OIE A;  1UPG A;  4I4T A;  1ZWI C;  2ZCE A;  4XDJ A;  1MOF A;  3CC2 V;  4AHC A;  1SQG A;  1BHB A;  1COW G;  3WG7 C;  4ZKI A;  3AG2 B;  1AI4 A;  2WLJ A;  3QTC A;  3ZJZ A;  5L3F A;  4DRX B;  2ZM6 B;  3CSX A;  3IC9 A;  2JEU A;  2EIM C;  3ZRX A;  4WFB V;  3CJH A;  3K79 A;  5KMG A;  4YY3 O;  1I5X A;  3U10 A;  1N32 B;  3SJB C;  1FFX B;  1IZ3 A;  2LJ2 A;  3OUF A;  5DM6 V;  3OTF A;  4ZIB A;  1GMG A;  3CYO A;  3DXR B;  3QO5 A;  4ZHQ A;  2M7W A;  2WPD G;  1R3K C;  4U3J A;  3K9S A;  3DSQ A;  3FB7 C;  2FML A;  2RCV A;  4K35 A;  3AK3 A;  3ZHR A;  4PDM A;  3H1J H;  1NU1 H;  3OMN B;  1BSM A;  5LP6 C;  3FKS G;  1HR0 B;  1A32 A;  2H8P C;  2QWO B;  3B40 A;  4EFB A;  4JYA O;  3ZX6 A;  4NKG B;  2BSK A;  4JTA B;  5KX5 A;  2IM9 A;  4LF5 O;  1YVW A;  1Z5W A;  1BT8 A;  4GKJ B;  1QLE B;  3E8F A;  4PA9 A;  1L0L H;  3NXS A;  2IW5 A;  3E22 B;  2UU9 B;  4O4L A;  1N8R W;  3ASN B;  1FPO A;  1OZ0 A;  2RJZ A;  5J2U A;  1H8H G;  5C8Y B;  3E8H A;  4UVB A;  4K0K O;  3QF7 A;  3SPI A;  4FLT A;  1XIL A;  4JI3 O;  4YHH O;  1UJW B;  4AQY B;  1NVP B;  1HNZ O;  1K97 A;  1Y6X A;  2ETN A;  1AJN A;  1OHH G;  4RUE A;  2P4K A;  4BW9 A;  4X1K A;  1P84 F;  2CH7 A;  5IT9 N;  3A8T A;  4CH6 A;  4R50 A;  5EIB D;  4DV3 B;  1YCI A;  2QKC A;  3J80 N;  4JI6 B;  3ZIA G;  3SPJ A;  4GKK O;  1YTF B;  1VQP V;  5EZY B;  1P49 A;  4G2K A;  1FAF A;  2KG7 A;  2Y0P A;  2JIZ G;  1GN4 A;  4HZ3 A;  4QPJ A;  3ZCC A;  2UUB O;  3CB2 A;  2Y69 B;  4LF4 B;  2LGW A;  2YC0 A;  3KCY A;  2PI5 A;  2MK3 A;  3BHP A;  1YJN V;  3RW0 A;  3SYC A;  2OCC C;  4LF9 B;  2F1M A;  3ABK C;  4L8J A;  1AI7 A;  1CPY A;  3X2Q C;  1AR5 A;  2HEP A;  4JI7 O;  3CC4 V;  3M99 B;  1HNX O;  4DUZ O;  3TXS A;  1ZTE A;  4YJ3 B;  3UT5 A;  4X20 B;  2AHZ A;  1GAX A;  5IE9 A;  2DYR B;  2EX3 A;  1IX9 A;  4B7E A;  4NXN O;  3D8C A;  1H2N A;  2EZO A;  2HG5 C;  5H9C A;  3T2M A;  2O57 A;  2QGN A;  1ZAU A;  3K5N A;  3ABM B;  5LGU A;  2OT5 A;  2A0L A;  2ZE8 A;  4P2Z A;  2QE7 G;  1MNG A;  3ZRW A;  1SS3 A;  1Q81 W;  3AG4 B;  1THZ A;  3B09 A;  4TUY A;  3W7S A;  1TGO A;  3H1K H;  4ZOL A;  1Y76 B;  4HNA A;  2F93 B;  5EC2 C;  1GK9 A;  1VP7 A;  2HHH O;  4R6Z A;  4WFH A;  2M6Y A;  2KKW A;  5KAF Z;  4X1I A;  3K04 A;  1RM1 C;  1GN3 A;  5B5E Z;  4I55 A;  2CTW A;  2EUL A;  2E74 B;  3ABT A;  4YXW G;  5JQG A;  3GB7 C;  1JFF A;  4P9P A;  5LXT B;  4GZR B;  2UUC B;  2LQT A;  4DV1 O;  1QNM A;  1WP8 A;  2MW2 B;  4MVR A;  1W59 A;  5BR8 B;  1TUB A;  2AW9 A;  4KFM A;  3Q4H A;  3ZRV A;  3GWO A;  4EFE A;  4O4J A;  3AG2 C;  1Q8I A;  4GX5 A;  4LFB O;  1OCR C;  1BZK A;  4QE7 A;  4TV8 A;  3UO2 A;  2R9I A;  3JAR B;  1N34 O;  2DQ0 A;  2VWJ A;  3J81 N;  5GON A;  1NVP D;  2F66 C;  4LR3 A;  3LDC A;  3CCL V;  2EIJ B;  4JI4 B;  5B1A B;  3RVY A;  5IYD O;  1IBM B;  4LC1 A;  1X4T A;  4N23 A;  2QKS A;  1CP9 A;  1N33 B;  4J11 A;  2YDE A;  1Y67 A;  1S72 V;  1R73 A;  4J7K A;  1RPO A;  2Q8V A;  4W4L A;  2ADP A;  1N36 O;  1J95 A;  1YTF D;  4FZ0 A;  3E35 A;  4DV2 O;  3OW2 U;  2LP7 A;  3ZHU A;  4X65 O;  4LNU A;  1KMI Z;  4EKW A;  1F51 A;  2OYQ A;  4WFA V;  3I56 V;  1VF6 C;  4U7N A;  5JCO A;  4J7Z A;  4NTY A;  1AJP A;  2EIK B;  3DTU B;  4YJ2 B;  5FPO A;  4IHJ A;  4O2B B;  4FFK A;  4KL1 A;  2WLL B;  1KC8 W;  4IYI A;  5LMU B;  1XEQ A;  1L8D A;  1GRJ A;  5C93 A;  4UV8 A;  1VQ6 V;  1YSC A;  1US6 A;  1KP3 A;  5IJ9 A;  5IYZ B;  1WB8 A;  1VMG A;  3W7W A;  3CX5 F;  1XI1 A;  4JI2 B;  1URF A;  2CAZ C;  1FXK A;  4DUY O;  4BR6 A;  3OEH G;  2VQF B;  1FJG B;  4J9Z B;  4UXN A;  3U11 A;  2H94 A;  3SR2 C;  4PDL A;  5FNV B;  2IJI A;  3K57 A;  2HKO A;  4MVO A;  1EN4 A;  3A2F A;  3N2K A;  4DR5 O;  4CS3 A;  2EIM B;  4JI0 B;  4JYC A;  3HKE A;  1M93 A;  1WB7 A;  4EB6 A;  5H6R A;  4WFF A;  1NQT A;  1JVM A;  1WLE A;  4JV5 O;  1BCC H;  5LYJ B;  1K3E A;  2K1E A;  3UQ8 A;  3FX7 A;  2WLI A;  3ICX A;  3AEI A;  1M5I A;  1SET A;  2YI8 A;  1AP5 A;  4FLU A;  2AHY A;  2YS8 A;  5L3D A;  1NR7 A;  3FAV B;  1RSO A;  2CTQ A;  5LP6 B;  3K3W A;  1S5H C;  4I9W A;  4OX9 O;  1ARO P;  3L73 H;  3UM7 A;  2HVJ C;  4PI2 A;  4DR1 O;  3G4S V;  2F4V O;  1PL0 A;  2CUG A;  3OAA G;  2UXC B;  4X88 A;  5LHG A;  3ETD A;  2ZIM A;  5EBW C;  1OCC B;  2G38 A;  4PV1 B;  1YHQ V;  1VIB A;  3N2G A;  4J41 A;  1XNR O;  3QVN A;  2E3C A;  1D2D A;  4L87 A;  4G27 B;  4X9Q A;  2V4D A;  1G8M A;  3ZS8 C;  4MTF A;  2YID A;  1YJW V;  4TQF A;  3LNN A;  4TV9 B;  5CA1 A;  3RYH B;  4DR7 O;  2XOK G;  1YEW A;  1ZUQ A;  2ZQM A;  1J5E B;  2JVD A;  1XMO B;  5JVD B;  1GKF A;  1PNM A;  3IAY A;  3OT7 A;  3K59 A;  2GV9 A;  4ZBM A;  1XNQ B;  2N05 A;  2Y48 A;  4IYH A;  2ZIN A;  4F6E A;  4B3R B;  1Q6U A;  4KUM A;  4LF6 O;  4GX2 A;  5CMU A;  3SYQ A;  4KP4 A;  4JAA A;  3FFQ A;  2ZE6 A;  2PTM A;  4LF7 B;  1CXZ B;  1M9N A;  1WP7 A;  2ARH A;  1KBH A;  5CA0 A;  3CCS V;  4B7K A;  5KHK A;  4AIL C;  1NBM G;  1M1K W;  2P5O A;  1GM7 A;  1XDC A;  4QNH B;  3CC7 V;  1V54 B;  3RYC A;  3X2Q B;  1XHX A;  4UVA A;  4LF8 B;  3JAT B;  1SF9 A;  4DV4 B;  3CCM V;  2CTP A;  5JH7 A;  2CK3 G;  3B8N A;  2ZNJ A;  1BS3 A;  1XOU A;  2EZP A;  1JJ2 U;  2GBO A;  2YIB D;  3DC6 A;  1K33 A;  1IBL O;  1SQB H;  4PA7 A;  1Y4M A;  2VRZ A;  3MHS C;  4FFB A;  4DV6 O;  3JAS A;  2ITC C;  2JJ2 G;  3L75 H;  5JCO C;  4X64 O;  3RYI B;  1VEW A;  4X66 O;  1R6T A;  3B4S A;  1F23 A;  2UUA O;  4A5U B;  1K9M W;  1QR8 A;  1H2L A;  5B66 Z;  1KKD A;  3KG2 A;  2ZDI A;  1RM1 B;  3I5D A;  5KHI A;  1CEZ A;  3K08 A;  3C90 A;  4PJ0 Z;  3SGI A;  2YIC A;  1U97 A;  3APO A;  3CXC U;  5ITZ B;  4JAU A;  4GT1 A;  1GN2 A;  4I4T B;  1OV9 A;  1Z2G A;  2L35 A;  1R3J C;  1FXK C;  1NZ6 A;  4HAM A;  1I5Y A;  4FLV A;  1GN6 A;  2CE4 A;  4JTC B;  1OCR B;  1KB9 F;  2DE0 X;  3G6B A;  3LSS A;  3SPH A;  5CB4 A;  1NTM H;  2NLJ C;  2QWQ B;  1PP9 H;  4UVC A;  4QPK A;  3CJH B;  5KMG B;  1SQX H;  1KP2 A;  1JQ0 A;  3AG3 C;  4WFG A;  5HFL A;  4K3A A;  3K06 A;  4ZHQ B;  4DRX A;  1S77 D;  1DF4 A;  1DK1 A;  2JJ1 G;  3T1H B;  1AI6 A;  4C7U A;  1UFI A;  1AIL A;  1M57 C;  2JRI A;  1D5A A;  1P7B A;  2LFS A;  2HVK C;  4DV0 B;  1ENV A;  3P32 A;  3AK1 A;  4RQF A;  1G6U A;  2WSS G;  3RBZ A;  2VQE O;  4O4H B;  3OR7 C;  1WA8 A;  2ITD C;  2DW4 A;  1FKA O;  4DR6 O;  3T4D A;  4KHP B;  4O4I A;  3BA8 A;  3CE2 A;  2BSK B;  3K03 A;  5KX5 B;  1OCC C;  5LMN B;  2JGU A;  2BTQ A;  2GUZ B;  3SDL A;  3T1Y O;  2LW1 A;  1LR1 A;  2Z3Y A;  1SES A;  3BCC H;  3OTO B;  2P90 A;  2RMK B;  5J2U B;  3D36 A;  4I0X A;  3JAK A;  4JI5 O;  1NS1 A;  4CH3 A;  5LBQ A;  4IIJ A;  2HR3 A;  4GCZ A;  4JI8 B;  3FD9 A;  2ZKO A;  4WCE V;  3H1L H;  4OXS A;  3TK1 A;  3ZN1 A;  4F4L A;  4X1K B;  1NKD A;  2CH7 B;  2P6J A;  2E76 B;  5B3S C;  2Q68 A;  1W0K G;  3DGE A;  1QVG U;  4TSF G;  3E86 A;  3W7X A;  3R65 A;  2QEX V;  4XDL A;  2JEX A;  3HB3 B;  4BW5 A;  2HFE C;  2KG7 B;  4DK1 A;  2LW7 A;  3K0G A;  4IGG A;  5FL7 G;  4FLX A;  5A9G A;  3JCZ A;  2JS5 A;  4J9Y B;  4LFA B;  3QO8 A;  2W6I G;  3SPC A;  1V9P A;  1Z5V A;  3JAW A;  4DW0 A;  4DR4 B;  1M90 W;  3E8G A;  3JD4 A;  4DV7 B;  2YXL A;  3CPW U;  1R1B A;  5L3E A;  3CCQ V;  4FK5 C;  2QKA A;  1V54 C;  4R7C A;  5JJE B;  2UXB B;  2WAM A;  4B3S O;  4EEQ A;  4DR3 B;  3IC7 A;  5KHH A;  2PYJ A;  1DLB A;  3UT5 B;  2BTO A;  1HNW O;  5GW7 A;  4DV5 B;  4DR2 B;  2XUM A;  4QE9 A;  1NTZ H;  2W6J G;  1S5J A;  1PNK A;  4PEL A;  1O9H A;  2IU0 A;  3VQV A;  1ZL8 A;  3P3N A;  5L3C A;  3T4Z A;  3BAA A;  4I7Z B;  4XDK A;  3BAB A;  4JI1 O;  4MS2 A;  1OJH A;  4TUY B;  2XAS A;  3LDD A;  4HNA B;  4B3T O;  4LWS A;  1IBK O;  4MSW C;  5B1N A;  4U3F H;  1XRE A;  1DTO A;  4X1I B;  2YEV B;  3TJT A;  5DEC A;  4B3M O;  1M56 B;  1FYJ A;  3S3X A;  4I55 B;  5B1B C;  4B08 A;  4HYO A;  1KEC A;  4MW8 A;  4Q6G A;  5JQG B;  1BQ0 A;  1JFF B;  2PI4 A;  3JCU Z;  2XAG A;  1JPX A;  1HDJ A;  1Q3E A;  5LOV A;  3LNM B;  1D5N A;  1FXH A;  2ODM A;  1MZF A;  1I94 B;  2ZM6 O;  1EZV H;  3Q4H B;  2E5L B;  4DK0 A;  4RWU A;  1R6K A;  3LDE A;  2ZE7 A;  4O4J B;  4FJC C;  5BMV A;  2YIA A;  3P3P A;  1N32 O;  3ETQ A;  5KA6 A;  1YI2 V;  1G1X B;  1MAB G;  4TV8 B;  2ILM A;  4RAI A;  1EM1 A;  2QTO A;  4WBN A;  1QCE A;  3SJA C;  4ABM A;  4UB8 Z;  3F7V C;  1SQF A;  4TWK A;  1RFY A;  2YXY A;  3TCU A;  2Q67 A;  3E89 A;  1YF2 A;  4JPR A;  5GON B;  3UCS C;  4Q20 A;  5JWP A;  1P4R A;  1JX9 A;  2A06 H;  5A2Q N;  5IJ0 A;  1Q82 W;  2WWW A;  1HR0 O;  3B8M A;  1N4C A;  3CRQ A;  1PKX A;  2QR4 A;  4P9O A;  5EYP A;  3QNE A;  3UO3 A;  4LBE C;  1XMQ B;  3ABL C;  4FM1 A;  4NVP A;  1VQO V;  3UKM A;  3APQ A;  3HKD A;  4LNU B;  3TET A;  4GKJ O;  2FTK A;  5KA5 A;  4FLW A;  2UU9 O;  4JZG A;  4QJF B;  2AGA A;  3JD1 A;  3RWR D;  3EVK A;  1KKC A;  1H2S B;  3HKB A;  5LA6 A;  1V55 B;  1XL6 A;  2WLN A;  5IDJ A;  4AQY O;  1BGY H;  4JTD B;  2K9P A;  4IHJ B;  4PD4 F;  2P67 A;  4JI8 O;  2PZS A;  1VF5 B;  2IU3 A;  3D36 C;  4JF3 A;  3H1I H;  4BWA A;  5EC1 C;  4X8A A;  1R6N A;  3E8B A;  4DV3 O;  4NR1 A;  4UCR A;  1SA0 A;  4JI6 O;  2X0L A;  1IDS A;  4MVQ A;  2UXD B;  1XUQ A;  1WJZ A;  2FYU H;  5CBG A;  1VQN V;  1WPB A;  3CRM A;  3JD2 A;  1TA8 A;  1H2G A;  2C2A A;  1DGS A;  1FXK B;  3ABU A;  3L71 H;  1BHA A;  1GTO A;  3GWK C;  1BMF G;  2DWE C;  2F95 B;  3CEI A;  2EIL C;  4RO2 A;  4LF4 O;  5K1X A;  4QIW F;  2B9Z A;  1P7G A;  1QLN A;  3N2K B;  4LFC B;  3HKE B;  2JS3 A;  4EB6 B;  2FL4 A;  1WNS A;  4LF9 O;  1AB3 A;  4GYC B;  2XT9 A;  4NXM B;  5CBF A;  2QWN B;  3AG3 B;  1IXB A;  1BL8 A;  1Q90 D;  2CGO A;  2WLI B;  4TQD A;  1EFR G;  3F5W C;  3OMI B;  5LGN A;  2Q9L A;  4ASU G;  3CME V;  2R70 A;  3B2E E;  1M57 B;  2QSA A;  1KD1 W;  1B3Q A;  1AVM A;  1IXM A;  3HKC B;  3JYC A;  4WF9 V;  1MMM A;  2JK5 C;  5LYJ A;  3P30 A;  2RNB A;  2JGD B;  4J42 A;  4X1Y A;  1YXB A;  2Z5U A;  3SJQ C;  4YY3 B;  2Q0A A;  1QU7 A;  3SYA A;  2X6A A;  3JAM N;  1GM8 A;  2A79 B;  1SZX A;  4CC5 A;  1TAE A;  3N2G B;  1NT2 B;  2DWD C;  3K5M A;  2P4V A;  4ZI7 B;  2W0F C;  5BY1 A;  3BFR A;  3RGB A;  1G4Y B;  4KXR A;  5KHJ A;  5J2T A;  4PDR A;  2X6C A;  5CA1 B;  3CWB H;  5TIS Z;  4DO2 A;  3N27 A;  3WB1 A;  1PPJ H;  3QG5 A;  3THO A;  2UUC O;  3OR6 C;  1WPX A;  4JYA B;  1M56 C;  2ZD9 A;  3OM3 B;  4MVM A;  5H5N A;  5BR8 O;  3CRA A;  2LFR A;  4PA6 A;  3IJ4 A;  4LF5 B;  5B3S B;  1QBZ A;  3HPL C;  1YJ9 V;  1IVS A;  4NYK A;  3IGA C;  3EXA A;  1NR1 A;  4O2A A;  1NJI W;  2CGN A;  1QR9 A;  4K0K B;  1JJO A;  4FLY A;  2P06 A;  4JI3 B;  4YHH B;  2Q73 A;  1XHZ A;  2GTA A;  1HNZ B;  1Q86 W;  5CA0 B;  1FS0 G;  1AR1 B;  3ETE A;  2WA4 A;  4JI4 O;  2PF4 E;  1IBM O;  4LH6 A;  3K0D A;  4JYB A;  1VQ7 V;  2ATK C;  2IJK A;  1N33 O;  3RYF A;  5E1A C;  2YXH A;  1YIT V;  4GKK B;  5HFM A;  3RYC B;  4CH5 A;  3VOU A;  1S76 D;  2XAQ A;  1AJQ A;  1X59 A;  2QM7 A;  4PDV A;  1AR4 A;  4F6R B;  1Y74 A;  1EBO A;  5JH7 B;  3CCV V;  1KUQ A;  1KU9 A;  4WFE A;  3JAL A;  2UUB B;  2HLD G;  3SYO A;  4BIU A;  2PY5 A;  4R8C A;  2WLH A;  4DXW A;  1TVK A;  4LH7 A;  1JCH A;  2Q7H A;  1PD3 A;  1KQS U;  3GVM A;  5EBM C;  3VBB A;  3CCJ V;  1S3J A;  1ZX3 A;  2EIN C;  2ZIO A;  3JSN A;  1XL4 A;  4CH4 A;  2ZXW C;  1YZB A;  4FFB B;  3H9V A;  4JI7 B;  1JA8 A;  2Q4P A;  3JAS B;  1V55 C;  5LMU O;  5L3B A;  4H13 B;  1N0J A;  3AK2 A;  3BY6 A;  3C3T A;  1HNX B;  4DUZ B;  1Y66 A;  3STZ C;  3RFR A;  4Z2W A;  3FB8 C;  3ZMS A;  4NXN B;  1MG1 A;  5FPR A;  5B1B B;  3OEE G;  1QQC A;  1MA1 A;  2VWK A;  1FD9 A;  2D2C B;  4JYY A;  4JI2 O;  1VQK V;  4J7J A;  5D5Q A;  1NTK H;  1VAR A;  2VQF O;  1FJG O;  4JGS A;  1H2M A;  1SZT A;  2BE3 A;  4DYL A;  3NR7 A;  4I50 A;  2QWR B;  2HHH B;  1R3I C;  1ROP A;  4JI0 O;  2XND G;  1H38 A;  5LL6 Y;  4FPP A;  1GO3 F;  5ITZ A;  1DF5 A;  3JD0 A;  5CB4 B;  5K1P A;  1R3L C;  2QTS A;  3BEH A;  5DN6 G;  1OCZ B;  4DV1 B;  1OCO B;  2DN9 A;  5BZB A;  1I08 A;  3WFV A;  4U3J B;  3EHB B;  1XQ8 A;  2DYS B;  1F7Y A;  2IH1 C;  3MAQ A;  1Q7Y W;  1SER A;  1PV0 A;  4LFB B;  1FFX A;  2IH3 C;  4ICG A;  3SPG A;  3K5O A;  2UXC O;  2KB1 A;  1YDX A;  2WA3 A;  3ABL B;  3DC5 A;  1F4M A;  3HR0 A;  2ZR3 A;  1WA8 B;  3ZMZ A;  3DXR A;  2AZ2 A;  1N34 B;  4P30 A;  4O4I B;  1ZSP A;  4FVM A;  5CA3 A;  2Z0A A;  2HJD A;  3FYI B;  4UCU A;  5H6Q A;  1HW7 A;  3ZMT A;  3CHX A;  2BTQ B;  3RN4 A;  3AG1 C;  4N21 A;  2XAJ A;  1S0V A;  1H2K A;  2DOS A;  2UXN A;  1B06 A;  4O4H A;  3T1C A;  4O4L B;  1J5E O;  3BA9 A;  4I9Q A;  1XMO O;  4MW3 A;  2NR5 A;  1N36 B;  4I0X B;  3A0H Z;  3JAK B;  3MD0 A;  4IIJ B;  2GUZ A;  3B77 A;  4X89 A;  5IY5 C;  4DV2 B;  1K5Q A;  4G28 B;  5CBH A;  1XNQ O;  1VF6 A;  3L70 H;  4LCU C;  4X65 B;  2XHB A;  3PJS K;  4Z1V A;  3E22 A;  4B3R O; 
#chains in the Genus database with same CATH homology
 3AEI A;  5B1O A;  1FXV A;  5KA6 A;  1YI2 V;  1MAB G;  1SET A;  2F43 G;  5EK0 A;  2AHY A;  4RAI A;  4CZZ A;  1VQL V;  2QTO A;  1QCE A;  5L3D A;  3ASO B;  1NR7 A;  3F7V C;  5CN0 A;  4TWK A;  3K3W A;  4JAV A;  3TCU A;  1S5H C;  4I9W A;  2Q67 A;  3E89 A;  4JPR A;  1ARO P;  2EIL B;  3FB5 C;  3UM7 A;  1W0J G;  5KUM A;  2HVJ C;  4Q20 A;  2EBO A;  5LHI A;  4Z1M G;  2EIK C;  3G4S V;  4FIP C;  4GX1 A;  2EJR A;  1PL0 A;  1P4R A;  1JX9 A;  3OAA G;  1HWY A;  3FYE B;  3G71 V;  3I55 V;  1Q82 W;  2WWW A;  4X88 A;  3EFF K;  3ETD A;  3OGC C;  5EBW C;  1E1Q G;  1OCC B;  3B8M A;  5LHG A;  1PKX A;  1YHQ V;  4RQE A;  1B6Q A;  4P9O A;  4L87 A;  4G27 B;  4UUJ C;  2X7R B;  3QNE A;  3CP1 A;  3CMA V;  4LBE C;  3ABL C;  1G8M A;  1K7D A;  4MTF A;  2JDI G;  3OFN G;  1VQO V;  1YJW V;  3UKM A;  3F7Y C;  2NNU A;  1H8E G;  3TET A;  1K8A W;  3LUT B;  2FTK A;  5KA5 A;  1ZWI C;  2XOK G;  4XDJ A;  1MOF A;  2ZQM A;  4QJF B;  3JD1 A;  3CC2 V;  1BHB A;  1COW G;  4PA4 A;  1ORQ C;  3WG7 C;  1GKF A;  1PNM A;  4ZKI A;  1E79 G;  1V55 B;  1XL6 A;  2WLN A;  3AG2 B;  1AI4 A;  2WLJ A;  5IDJ A;  3ZJZ A;  5L3F A;  1GM9 A;  4ZBM A;  4JTD B;  2A9H A;  2P67 A;  2Y48 A;  2IU3 A;  2JEU A;  1K73 W;  4JF3 A;  2EIM C;  3H01 A;  3ZRX A;  4KUM A;  4PA3 A;  4WFB V;  3K79 A;  4GX2 A;  5EC1 C;  1I5X A;  5CMU A;  3SYQ A;  4KP4 A;  3OUF A;  4X8A A;  5DM6 V;  3ZRW B;  1R6N A;  3E8B A;  1GMG A;  3CYO A;  5IYB O;  1VQ9 V;  3QO5 A;  2M7W A;  1M9N A;  2WPD G;  1R3K C;  2X0L A;  2B1I A;  1MSW D;  3CCU V;  3FB7 C;  2DQ3 A;  4MVQ A;  3CCS V;  4PDM A;  3W7U A;  4MVU A;  5CBG A;  1VQN V;  2ZDI C;  1NBM G;  3ZMV A;  3JD2 A;  1H2G A;  2C2A A;  3ABU A;  1FXK B;  4JAS A;  1M1K W;  1BHA A;  1GTO A;  2D3O W;  3OMN B;  1GM7 A;  1BMF G;  2DWE C;  3FKS G;  3LSQ A;  4QNH B;  2WLM A;  2H8P C;  2EIL C;  4RO2 A;  3OMA B;  4QIW F;  1V54 B;  3CC7 V;  4MVZ A;  3X2Q B;  1QLN A;  4UVA A;  3MHH C;  4TT3 G;  4U7O A;  2BOB C;  2YEV A;  4JTA B;  3CCM V;  5CBF A;  2V1D A;  1RPR A;  2CK3 G;  3AG3 B;  1QLE B;  3B8N A;  1BL8 A;  3E8F A;  4PA9 A;  2R9R B;  2IW5 A;  3NXS A;  2EZP A;  1N8R W;  2WLI B;  1EFR G;  1JJ2 U;  4H33 A;  3F5W C;  3ASN B;  1OZ0 A;  5LHH A;  3OMI B;  3ZN0 A;  5LGN A;  1VQM V;  1VQ4 V;  1H8H G;  1K33 A;  3E8H A;  4UVB A;  4ASU G;  3CME V;  1K34 A;  1M57 B;  3SPI A;  3STL C;  4PA7 A;  1Y4M A;  1KD1 W;  1UJW B;  1NVP B;  1IXM A;  1OCZ C;  3MHS C;  3JYC A;  1K97 A;  4WF9 V;  2JK5 C;  4XBF A;  3P30 A;  1OCO C;  1AJN A;  2Z5U A;  1OHH G;  2ITC C;  4RUE A;  2JJ2 G;  4MTG A;  3SJQ C;  5LGT A;  4MVS A;  4I5S A;  1F23 A;  2X6A A;  3SYA A;  1K9M W;  1QR8 A;  1KKD A;  1GM8 A;  4R50 A;  2DYS C;  1K92 A;  2A79 B;  2ZDI A;  3KG2 A;  4E2L A;  3OE7 G;  1RM1 B;  3ZIA G;  1CEZ A;  3SPJ A;  1YTF B;  2DWD C;  3K08 A;  1VQP V;  4G2K A;  2W0F C;  1AI5 A;  2JIZ G;  1G4Y B;  2ZR2 A;  4RUF A;  4HZ3 A;  3CXC U;  4PDR A;  2X6C A;  4H37 A;  4JAU A;  2EIN B;  4GT1 A;  4QPJ A;  3ZCC A;  4DO2 A;  2Y69 B;  2WLK A;  1YIJ V;  1F4N A;  2ZXW B;  1R3J C;  3OR6 C;  2MK3 A;  2PI5 A;  1WPX A;  1FXK C;  4HAM A;  1M56 C;  4MTO A;  1I5Y A;  2ZD9 A;  2QM8 A;  1K5S A;  2BOC C;  3OM3 B;  3RW0 A;  3SYC A;  1YJN V;  1NH2 B;  2OTL V;  2OCC C;  4MVM A;  3K9A A;  4JTC B;  1OCR B;  1QVF U;  2LFR A;  3ABK C;  4PA6 A;  1CPY A;  1AI7 A;  1QBZ A;  1K4D C;  3HPL C;  3LSS A;  3SPH A;  5B3S B;  3X2Q C;  1YJ9 V;  2NLJ C;  3ETG A;  3CCR V;  4UVC A;  4BIZ A;  3IGA C;  1NR1 A;  4QPK A;  5IYC O;  3CC4 V;  1NJI W;  3G6E V;  2QEX V;  1QR9 A;  1KP2 A;  1EZJ A;  1VQ8 V;  3M99 B;  1SRY A;  1JQ0 A;  4GX0 A;  3JD3 A;  3AG3 C;  1L1F A;  1QLE C;  2AHZ A;  4WFG A;  5HFL A;  2DYR B;  3D3I A;  3K06 A;  1S77 D;  1DF4 A;  2JJ1 G;  1AI6 A;  2X6B A;  3ASN C;  1Q86 W;  2EZO A;  2HG5 C;  5H9C A;  1FS0 G;  3T2M A;  1AR1 B;  2WLL A;  1M57 C;  3ETE A;  1P7B A;  2LFS A;  2HVK C;  5L3G A;  1ENV A;  3P32 A;  3ASO C;  3ABM B;  5LGU A;  4RQF A;  2WSS G;  2OT5 A;  2A0L A;  4P2Z A;  2QE7 G;  2IJH A;  3K0D A;  4JYB A;  3ZRW A;  1VQ7 V;  2ATK C;  1Q81 W;  2IJK A;  3AG4 B;  1THZ A;  3RBZ A;  3OR7 C;  2ITD C;  3W7S A;  2DW4 A;  5E1A C;  3A0R A;  1YIT V;  3T4D A;  5HFM A;  3VOU A;  5EC2 C;  1GK9 A;  1S76 D;  2XAQ A;  1AJQ A;  4R6Z A;  4WFH A;  2P7T C;  2QM7 A;  4PDV A;  3K04 A;  3K03 A;  4MTX A;  1OCC C;  1RM1 C;  1EBO A;  3CCV V;  1VQ5 V;  3WG7 B;  4WFE A;  3ABT A;  2HLD G;  2Z3Y A;  3SYO A;  4YXW G;  4BIU A;  1SES A;  4R8C A;  1PNL A;  3GB7 C;  2WLH A;  4DXW A;  4P9P A;  2P90 A;  1JCH A;  1PD3 A;  2GSM B;  4MVR A;  1KQS U;  3D36 A;  5EBM C;  3VBB A;  3CCJ V;  1S3J A;  3RVZ A;  2EIN C;  5LBQ A;  2Q69 A;  2Y69 C;  1XL4 A;  2HR3 A;  4GCZ A;  4KFM A;  3CCE V;  2ZXW C;  5EBL C;  3ZRV A;  3GWO A;  2QA4 V;  4WCE V;  1V55 C;  4OXS A;  3AG2 C;  4GX5 A;  3TK1 A;  1OCR C;  3ZN1 A;  4F4L A;  5L3B A;  2B1G A;  3BY6 A;  4QE7 A;  2UXX A;  1NKD A;  1Y66 A;  2P6J A;  5B3S C;  2Q68 A;  3STZ C;  1E1R G;  1W0K G;  2R9I A;  3DGE A;  3FB8 C;  1QVG U;  4FJC C;  3AG1 B;  3E86 A;  3R65 A;  2YSU B;  4TSF G;  3ZMS A;  5J9P C;  3W7X A;  4XDL A;  1MG1 A;  5B1B B;  2DQ0 A;  3OEE G;  2JEX A;  3HB3 B;  4BW5 A;  1FFT B;  1NVP D;  3LDC A;  1VQK V;  3CCL V;  2DYR C;  2HFE C;  2EIJ B;  5B1A B;  3K0G A;  3RVY A;  5IYD O;  4LC1 A;  5FL7 G;  4JGS A;  1SZT A;  3JCZ A;  4N23 A;  2QKS A;  1CP9 A;  4J9Y B;  5IY5 B;  3QO8 A;  2W6I G;  3SPC A;  3W7T A;  1S72 V;  1R73 A;  3ZMU A;  1RPO A;  1JOY A;  3ABM C;  1R3I C;  1M90 W;  1ROP A;  3FB6 C;  1J95 A;  3E8G A;  2XND G;  3JD4 A;  1YTF D;  3CPW U;  3AG4 C;  1H38 A;  5L3E A;  4FPP A;  3E35 A;  1GO3 F;  3CCQ V;  4FK5 C;  3OW2 U;  1V54 C;  2LP7 A;  4R7C A;  1DF5 A;  3JD0 A;  2WAM A;  1R3L C;  4EKW A;  1F51 A;  2B5U A;  3BEH A;  5DN6 G;  1OCZ B;  3IC7 A;  2XAH A;  1OCO B;  4WFA V;  3I56 V;  5BZB A;  1DLB A;  4U7N A;  3E83 A;  5GW7 A;  3WFV A;  1AJP A;  2EIK B;  3DTU B;  1K4C C;  1NH2 D;  3OUS A;  4MT8 A;  3EHB B;  4QE9 A;  2DYS B;  2W6J G;  1W2B U;  1PNK A;  4BAY A;  4CBC A;  4PEL A;  2IH1 C;  2WLL B;  1KC8 W;  2IU0 A;  1Q7Y W;  1SER A;  3ML0 A;  2IH3 C;  5L3C A;  3T4Z A;  2OTJ V;  4XDK A;  3SPG A;  2KB1 A;  5C93 A;  3ABL B;  1F4M A;  4UV8 A;  2ZR3 A;  4MS2 A;  3ZMZ A;  2XAS A;  3LDD A;  4LP8 A;  1YSC A;  1VQ6 V;  4P30 A;  2XAF A;  1KP3 A;  4MSW C;  5CA3 A;  3W7W A;  3FYI B;  5B1N A;  1TUE B;  3CD6 V;  5H6Q A;  3E2E A;  1DTO A;  3ZMT A;  2YEV B;  3AG1 C;  1FXK A;  4N21 A;  1M56 B;  3OEH G;  4J9Z B;  4UXN A;  2XAJ A;  5B1B C;  4HYO A;  1S0V A;  2OCC B;  2H94 A;  1LNQ A;  1KEC A;  2UXN A;  4MW8 A;  2GHY A;  4PDL A;  3SYP A;  3T1C A;  2IJI A;  3ABK B;  2HKO A;  2PI4 A;  4MVO A;  2XAG A;  1JPX A;  3IFX A;  4MW3 A;  2EIJ C;  5B1A C;  3ZRS A;  2EIM B;  2Q6A A;  2HJF C;  4UV9 A;  4JYC A;  3LNM B;  1FXH A;  3MD0 A;  5H6R A;  4WFF A;  1NQT A;  3B77 A;  5IY5 C;  4X89 A;  1JVM A;  1K5Q A;  1WLE A;  4G28 B;  5CBH A;  5KUK A;  4LCU C;  1K3E A;  1R6K A;  3LDE A;  2V7Q G;  3PJS K;  2K1E A;  2IJJ A;  4FMT A;  3QO7 A;  2WLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...