1Q82W

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1q82W00
3CCLV 1YJNV 1K73W 3CCSV 3CCQV 3CC7V 1VQNV 3CCJV 1K8AW 1Q81W 1VQ5V 1N8RW 1W2BU 3I56V 3G71V 4WF9V 1M90W 1JJ2U 1Q82W 3CXCU 3OW2U 2D3OW 1VQ4V 1VQLV 1VQ7V 3CC4V 1Q7YW 1VQOV 1QVFU 1KQSU 1YI2V 3G6EV 1KD1W 1M1KW 4WFAV 1YITV 1VQ6V 3CC2V 1S72V 1NJIW 1VQ8V 3CMAV 1YHQV 1VQ9V 4WCEV 3CCEV 1YJWV 1KC8W 1R73A 3CCUV 1VQPV 3CMEV 5DM6V 1QVGU 2QA4V 1YJ9V 3CD6V 3CCRV 3CCVV 2OTLV 2QEXV 2OTJV 1YIJV 1K9MW 3I55V 3CPWU 1VQKV 3CCMV 1VQMV 4WFBV 3G4SV 1Q86W
chains in the Genus database with same CATH superfamily
4JI3O 1QCEA 5JQGA 2EZOA 3ZMSA 1YXBA 4JTCB 2DYSB 2YICA 4NXNO 2RDCA 2LP7A 2ODMA 1VQ6V 3NR7A 3B09A 1L8DA 2WA4A 3ZN0A 5ITZA 5LA6A 4FFKA 4X20B 2X7RB 4UCRA 3K5MA 4LBEC 1I5YA 1RPOA 2YDEA 4PA7A 4LFCB 1Q86W 4JI3B 2Q7GA 3OE7G 4IT5A 3CJHB 1ZUQA 4JF3A 5FNVA 2UXCO 2R70A 4NXNB 2DYRB 3ZS8C 1S5JA 4DRXB 5L3BA 2D2CB 3A0BZ 1IXMA 1P7BA 3K04A 2B1GA 4TV8A 1FFXA 1KUQA 1HP8A 3AG2C 3HKEA 4PELA 2E76B 3AG4C 4ICGA 5KAIZ 1Q82W 4JI4O 4MVQA 4BW5A 1IXBA 2A7WA 1HNXO 1BZKA 2EULA 5EIBD 3RYCA 4X1KB 5H5NA 3GWKC 4MTFA 1B3QA 2HJFC 1YIJV 3JYCA 3SPJA 5FL7G 1JMKC 4YJ3B 3OEHG 1YTFB 5KAFZ 2WLHA 2Q0AA 2WLJA 4ZI7B 4JI4B 2CTWA 1Y74A 2P4KA 4U3FH 4RAIA 1HNXB 4DR5O 5CA0A 4PI2A 3A2FA 4KHPO 1BQZA 5J2UB 1X4TA 3IJ4A 3N2GA 3PN1A 1FS0G 1VF6C 2EX3A 4UCOA 4XDJA 1V9PA 3L75H 3X2QB 3KCYA 1I94O 1XREA 4DR5B 1FD9A 2ADQB 4DR3O 3G4SV 4JGSA 4JTDB 5IYCO 2Y4TA 1N0NA 2XNDG 1R1BA 2CGOA 2YI9A 3ASNC 4PA6A 3D3IA 1MSDA 2FYUH 2XUMA 1PPJH 4MTGA 5DM6V 3R65A 3H1IH 2AZ2A 1AI5A 3AK1A 4WBNB 3I55V 5L3FA 5B3SB 4DR3B 1AJPA 4MVUA 4X1KA 3JAKB 3CRAA 4BIZA 4YJ2A 3ETDA 2OCCB 5TISZ 1YEWA 3HKBB 1AB3A 1SS3A 2F66C 5IJ0B 2DJVA 2QJ1A 3QF7A 1OZ0A 5LP6C 1H8EG 4BIUA 2OTLV 3W7WA 4DO2A 4JYCA 1OCCC 4X1IB 3ABTA 2BOCC 4JV5O 1OCZB 2W0FC 3LNMB 3M8AA 4HYOA 5F2VO 1GRJA 1Y76B 3H1JH 2JIZG 2QWOB 3FX7A 1YTFD 5LGTA 2EIMC 2E3CA 1X59A 1B06A 4ZHQB 2HG5C 4FLWA 1XEQA 3QTCA 2CAZC 3WB1A 1V55C 2DE0X 2PZSA 1EZJA 1YJ9V 3K06A 1GAXA 4B3MB 1K73W 2EIJB 1QU7A 3W7SA 5KUMA 4O2AA 3BABA 2DQ0A 3N27A 3ABMC 1JX9A 3VQWA 3I56V 3OUSA 1WLEA 3P3NA 4KUMA 1MZFA 1GK9A 1HNWO 4NVPA 4IHJA 5IJ9B 1LR1A 3ZCCA 1CP9A 5E79Z 4MW8A 4FLZA 4B3SO 4JZGA 1AI7A 4FM1A 1FXKC 5CBFA 1E1QG 1MZEA 4U7OA 3LDEA 4IIJB 3RWRD 4DR4O 4AQYO 4JPRA 5CA3A 2ZM6O 3ZX6A 1HNWB 4P9OA 1COWG 3DC5A 1D5AA 3MAQA 5EYPB 2GUZA 1PNLA 3O9OA 4O4HB 2RQ6A 4J41A 3T2MA 5IE9A 3H1LH 2F93B 2VQFB 4B3SB 2Y0PA 3HKBA 1RSOA 5KLVH 2RJZA 3DGEA 4PA3A 5LXTB 4WFFA 4O4LA 5CB4B 2HR3A 2ZD9A 4DR4B 4F6EA 4B3RO 1R73A 1TVKA 4KP4A 2E5LO 4LNUA 5IYBO 4LF7O 2JJ1G 4X1YB 1L1FA 4N23A 1VQNV 4MTOA 3JD0A 4OX9B 4TUYA 4IYHA 3K5LA 4DV4O 4I0XA 3WFVA 4HNAA 3S3WA 3DTUB 1BT8A 1DLBA 4CH4A 2UU9O 3GB7C 2UXNA 1K5QA 4B3RB 2LO1A 4J9YB 4UB6Z 2E5LB 4DR2B 3RGBA 2CH7B 2IU3A 2XAFA 4H0LB 3UM7A 5IJ9A 1FAFA 3U0ZA 5J2TB 2EINC 4F6RA 3IC9A 3OAAG 3BY6A 1AR5A 2BOBC 1N33O 4B3TO 4FM2A 1QBZA 1L0NH 1F23A 2W0XA 1SQXH 4IIJA 1TA8A 1XNRO 4X8AA 1ZWIC 3FB7C 3JARA 3APOA 3EXAA 4X64O 3B2EE 4P9PA 2ZKOA 1TUBB 5FPOA 4B3TB 1QVGU 3DXRB 5IWAO 2W6IG 1Q8IA 2ZE8A 5FLXN 3WG7C 4EB6A 1XNRB 3JALB 1UFIA 2X0LA 1M90W 2IJKA 3FAVA 4LR3A 3F5TA 4H13B 2MK3A 4DK1A 1JOYA 4JYAO 4CS3A 2XAJA 1BHBA 5DEDA 2PI5A 2F95B 5KUKA 3CD6V 1GTOA 1XL6A 1XMOO 2QTOA 5IWAB 1SA0B 4I4TB 3E89A 2H3OA 4YXWG 3G71V 1H38A 4FM0A 2KKWA 2PUSA 4ZBMA 4TV9A 4D7TA 1NTZH 3ABKB 3JAMN 4FLUA 3PJSK 2IJIA 3U11A 1QLEC 4JYAB 2UUBB 1XNQB 1G1XB 4UB8Z 3JCUZ 1UJWB 1XMOB 1R3LC 1NVPB 3FB6C 1BQ0A 3G80A 4P2ZA 2G38A 4BIOA 2IH3C 1FFTB 3TK1A 3K03A 1YI2V 2JS5A 2OIGA 2HLDG 2KG7B 1XUQA 3RYIB 4UXNA 1N36O 4Z1MG 3CCUV 1YSCA 4WFEA 3G6BA 3W7UA 5KX5B 2KQXA 3EVKA 2ZIOA 3CE2A 3E8FA 1W2BU 2JEXA 3ABUA 4KL1A 1FPOA 2YIBA 5JVDB 5LOVB 3BRCA 4Q6GA 4JI6O 5H6RA 2HVKC 3QVNA 1N36B 4MVZA 4Z1VA 1M57B 5BMVB 2EJ7A 1M56C 4UVBA 3CX5F 4NYKA 5LHHA 1AI6A 4YIOA 5B1AC 4LF9B 1YZBA 4JI7B 5JCOA 2UUAB 1VQ7V 4YIPA 1JQ0A 1YDXA 4JYYA 1VQ8V 1BHAA 4JI6B 1PP9H 4K3AA 5KHIA 2FL4A 1TAEA 4B08A 4EEQA 3UCSC 3JCZA 3ZHUA 1G4YB 2AW9A 3CC4V 1P84F 1BL8A 1AP6A 3HKCA 2XAGA 3BVOA 2ZXWC 2BE3A 1SF9A 3RYFA 1JFFA 1U97A 3RFRA 3ETGA 3AG2B 3UO3A 1VQOV 3AG4B 4B7KA 2EIKC 4WFBV 2HVJC 1MA1A 4ASUG 3ZHSA 3CCSV 3IGAC 3WU2Z 1NH2D 1ROPA 5L3DA 3NXSA 4UVAA 3SPGA 4GT1A 1NBMG 1D5NA 3OGCC 3RW0A 1N32O 2CUGA 1GN3A 5KX5A 1YITV 3I5DA 1VARA 3ZRVA 4PDLA 1DGSA 2ZNJA 5JVDA 1SQVH 5BXZA 1THZA 4JI0B 4PA9A 5BR8B 1XMQB 3SYAA 3ZHVA 3B77A 2VS0A 3BHPA 1NKDA 4AILC 4GX0A 2RNBA 2Z0AA 3LSSA 4J7KA 1WAZA 2DWEC 4Q20A 4PDVA 4LP8A 3B8MA 1KKCA 4XDKA 3HB3B 2WAMA 4NR1A 5LYJA 3UQ8A 4FLTA 1J5EO 1XI1A 1AVMA 2VQEO 2NNUA 5KHHA 4AHCA 3N2KB 4XDLA 5KMGB 2Q67A 3EHBB 4GZRB 1ZL8B 3E8BA 3OTOO 1R3IC 2YEVB 4DK0A 1HWYA 3ZMVA 2QKCA 4RUFA 1SQBH 5CA1B 1GH6A 5IYZA 3FD9A 1J5EB 1ZTEA 2WLIA 3AG1C 4G2KA 1PKXA 3OT7A 2VQEB 2AZ0A 4YHHO 3E22A 3K9AA 1NZ6A 3THOA 3ASNB 1SKVA 4CH5A 4DV7O 2E75B 4R7CA 1Y66A 4I55A 4O2BB 1EZVH 3TXSA 4O4IB 5DECA 2UXCB 4QGPA 1S77D 3OTOB 5EIBC 1GM8A 1AJNA 2UXXA 2ILMA 4ZIBA 1XHXA 4CH3A 3ZEDA 4X9QA 3T1CA 1PNKA 3CCMV 3K5OA 3WB0A 3EFFK 4U3JB 2VRZA 4LC1A 1K34A 4K0KO 4YY3O 1WA8B 4YHHB 4LWSB 2WLMA 4DV7B 2ZR3A 1G8MA 1R6TA 5LP6B 4A5UB 4OPHA 1W0KG 3VOUA 1RM1C 4H33A 2QA4V 1OCCB 3ZMUA 2CK3G 3OFNG 3BA8A 4LF4O 2EIMB 2AXTZ 3RVZA 4JYBA 4K0KB 1P7GA 4YY3B 3TXQA 3VQYA 4X20A 4MW3A 4QJFB 2B5UA 1M1KW 4R6ZA 3IFXA 1AJQA 5LHIA 1W59A 4QPJA 1IBLO 4OPAA 2DWDC 2P90A 2Q6AA 3N2KA 1S0VA 2A9HA 2Q0OC 3E2EA 2IBZH 3ZIAG 2P22C 3CJHA 2LFSA 1NI8A 4HBNA 4QIWF 1VF6A 3UT5B 2PF4E 2XAHA 4X89A 3ABMB 2GHYA 3CCQV 1QHTA 3CEIA 3ETQA 1K92A 4I5SA 2GBOA 4KHPB 4LF4B 4P30A 5C8YB 4DRXA 1SRYA 1H2NA 3AG3C 4J7ZA 3CRMA 1OHHG 1M93A 3JATB 1IX9A 1KECA 4PHZA 1FXKB 1SESA 1I94B 1F4NA 2IJHA 3L72H 4RQEA 3J80N 1Q5OA 2HEPA 3VBBA 5K1XA 2CTQA 3H1KH 4ZKIA 4J42A 1E79G 2AGAA 1F51A 3T4ZA 2RCVA 4YJ3A 3GWOA 1S3JA 2LW7A 2FMLA 1KYOF 2XT9A 4ZI7A 1NS1A 4JZ2A 3LDCA 3P32A 1WB8A 1N34O 1K5SA 5LMUO 1XQ8A 1AR4A 2LFRA 1NR1A 1JCHA 1EM1A 2R9RB 2QWRB 1WP7A 4X65O 2EZPA 2BTQB 5J2UA 3VQVA 3OMAB 1M4UA 4PDMA 3SR2C 4FIPC 4IYIA 2QM7A 2QR4A 4QE9A 2H94A 1JJ2U 1HR0O 4JV5B 1KP3A 2XASA 5LMUB 1H2LA 1H2KA 2CTPA 3QNEA 4RO2A 1EBOA 2YIDA 4NTXA 4XBFA 4CH6A 4LFBO 3ETEA 4X65B 5C8YA 1VQMV 3CRRA 1K9MW 2EINB 4KFMA 2OCHA 4CC5A 3JASB 5KHKA 4JASA 1HR0B 1FXKA 5EBMC 4AI8A 4WBNA 4MT8A 1NU1H 1FYJA 4NTWA 3TETA 4FLYA 1VEWA 3C3SA 4CS2A 4D7SA 2XAQA 2FTKA 4LFBB 4C7UA 3CPWU 1B6QA 5HFLA 2YSUB 3JAKA 2PYJA 1OCRC 1N8RW 2Z3YA 2HJDA 4GKKO 5B1NA 3SJCC 5IJ0A 2WSSG 2EILC 1FXVA 1K7DA 2GTAA 1F7YA 2JRIA 3FB8C 5CBGA 1B04A 2JDIG 3LDDA 1L0LH 5EC1C 2XOKG 4AQYB 3K5NA 4X1IA 2ZM6B 1OV9A 4O4JB 3ASOB 1Y76A 5L3GA 2UUCO 2QKAA 3WG7B 1WP8A 4U7NA 3CCLV 4DV6O 1IBMO 4FZ0A 2ZDIA 2N05A 4ZHQA 1VQ4V 4QPKA 2D3OW 4JAUA 3ZN1A 1Q7YW 3F7VC 1Q43A 1WN7A 2XTAA 2X6CA 3C3TA 2CE4A 3ZBHA 5GTIZ 4UV9A 1NJIW 1K4DC 1NR7A 3L70H 4MSWC 2IM9A 3GVMA 3CRCA 4TQFA 4J80A 3JD3A 2UUCB 1GMGA 1T5EA 2V4DA 3MHHC 4LF7B 5GONB 4DV6B 1OCOC 1SERA 2H8PC 1IBMB 3OW2U 2IU0A 1Q90D 1QLEB 1GN4A 2CGNA 4MTXA 4DV4B 2X6AA 2UU9B 3W7TA 4R8CA 3CP1A 4J9ZB 2HFEC 4DV3O 4I50B 2VWKA 5D5QA 1OJHA 3OD4A 4LF8O 4LH7A 2R72A 3HPLC 5EYPA 4UCSA 1KQSU 4O4HA 2P67A 3ZHRA 2OT5A 3CHXA 1N33B 1MG1A 2DMXA 1K4CC 4CS4A 4E4EA 5LXTA 3TGUH 4X66O 1SZXA 1AROP 3ABLC 4UCTA 5CB4A 3CCJV 1H2MA 1FXHA 1Y67A 1DTOA 4O4JA 3BPZA 1Y6XA 3G6EV 4X64B 4X1YA 4K8ZA 2A3QA 1QR9A 4DR6O 1M56B 4FVMA 2JGUA 1WNSA 3E8GA 2AHZA 2C2AA 5LGUA 5B1AB 3B40A 4X66B 1XOUA 3SYQA 3JAWB 4DW1A 5KHJA 3LSUA 5JH7B 4MS2A 4DUZO 2ARHA 1PL4A 4CC6A 4WCEV 3IAYA 2CH7A 3O65A 5JJEB 1S5LZ 5J2TA 4DR6B 5KA5A 1YJNV 4R50A 5IY5B 1KMIZ 1PM9A 3Q4HB 2WA3A 2B1IA 3QG5A 4J7JA 4QNHB 2A79B 3CYOA 3K3WA 1QQCA 1R3KC 4DUZB 3ZRXA 1TGOA 3BA9A 3BCCH 2EIKB 1N4CA 4PD4F 1NQTA 3RN4A 3JSNA 3L73H 4RQFA 4UCUA 4DR7O 1XBLA 1TUBA 3KG2A 3HKDB 4LFAO 2JGDB 4GKJO 1RP3B 3DXRA 4TSFG 5IDJA 1BS3A 3SJBC 1GKFA 2LJ2A 1AILA 3L71H 3AG7A 3JALA 5BY1A 3SYOA 1EFRG 2UXDO 4MVOA 1I5XA 2ZE7A 3E8HA 1CPYA 4FFBB 4K35A 4DR7B 2ZNIA 2LGWA 4WFHA 4LFAB 4GKJB 5JQGB 1BSMA 4W4KA 4F4LA 1SA0A 4I4TA 5CMUA 3H01A 4FPPA 2IJJA 5EC2C 3K59A 1IDSA 2QTSA 5JCOC 1Z5VA 4UV8A 3D8CA 2ZE5A 3CCRV 2FB5A 4ZOLB 5LL6Y 3OR6C 3H9VA 2LQTA 2UXDB 1S5HC 5CBHA 1Y4MA 2P6JA 2KSDA 2WLLB 1PD3A 2GTSA 2CTRA 1KP2A 4G27B 2Q9LA 3D36A 4BAYA 5FNVB 1VIBA 2DN9A 1XHZA 3TCUA 1K97A 3OTFA 3AG1B 1M5IA 3Q4HA 3CMEV 2BSKB 2NLJC 1H8HG 4NXMO 1WPBA 2KG7A 1NVPD 2JS3A 1SETA 3RYIA 2N04A 3J81N 4TV8B 1HW7A 2CDYA 1FFXB 1MABG 3HKEB 1JPXA 4FLXA 5JJJB 1M9NA 1VQ9V 3CMAV 1YHQV 4HAMA 2JGDA 1EN4A 3P30A 4MVMA 4TT3G 5LOVA 2OYQA 4GUNA 4PJ0Z 3RYCB 1V54C 4TWKA 4TQDA 4UFZA 3ZRWB 4NXMB 3ZMZA 1AI4A 3BAAA 5LHGA 4FJCC 4FZ1A 5BMVA 1RM1B 2Y69C 1N32B 1I0HA 4BWAA 1Y74B 4LFCO 2QKSA 5B5EZ 1SQQH 2Y0IA 1VQLV 3SJAC 2W6JG 1W0JG 5CA0B 2QSAA 3JD1A 3KCXA 4ZOLA 4G28B 4H37A 1QR8A 2P5OA 2F4VO 5GW7A 2X6BA 1JVMA 2ITDC 1J95A 2JEUA 3N2GB 1LUWA 2PTMA 2WLLA 5H6QA 2ITCC 2Z5UA 4L87A 2Q7HA 4UCVA 1ENVA 1JJOA 2MW2B 2Q5ZA 2N74A 3LUTB 1CXZB 2A06H 1QVFU 4DYLA 1IBKO 3K58A 3AG3B 2BSKA 1O9GA 2F4VB 4DXWA 1A32A 4BR6A 3SJQC 5B1BC 2Q73A 1VQKV 5H2FZ 1KKDA 3CXHF 3ZJZA 3L9DA 2YIAA 2JVDA 3RBZA 3D3QA 2EJRA 1I08A 1GO3F 1IBKB 2F43G 3HR0A 3ZRWA 3K0DA 2V1DA 4YJ2B 3JD4A 3JSLA 5IT9N 4NKGB 2PY5A 2K9PA 1Q6HA 4FLVA 1MMMA 2HHHO 2Q69A 1MSWD 2DYSC 4PI0A 1V55B 1VF7A 2XHBA 4JTAB 3K57A 3L74H 3T4DA 2OTJV 5DN6G 3BEHA 5KMGA 2P06A 2WLNA 1EN6A 1ZL8A 1KBHA 2YEVA 2R9IA 1Z5WA 4CBCA 3DSQA 2EBOA 2ZINA 5CA1A 2HHHB 4O2AB 2O57A 5GTHZ 2DYRC 4RWUA 2ETNA 1IBLB 2BTOA 4IHJB 4O2BA 4J11A 2YXHA 3A0RA 4O4IA 3A8TA 1Q6UA 4DV1O 3B4SA 1RFYA 2Q4PA 5E1AC 3SPIA 4U3JA 1IVSA 2QEXV 1OCRB 1WA8A 3OM3B 5J9PC 2F1MA 4K8XA 2QGNA 4LWSA 2LW1A 1IZ3A 1K8AW 4DV2O 4LH6A 2GUZB 2YUAA 5LP6A 3VQXA 2EILB 2ATKC 1ZSPA 3R66A 3J7AU 5A9GA 4X62O 1GM7A 1RSOB 5HFMA 1VP7A 4DV1B 3IC7A 4B3MO 1EN5A 4O4LB 3F7YC 4I9QA 1WPXA 1DF5A 1MOFA 1TVKB 2F23A 4EFBA 1SZTA 2OIEA 1XDCA 4LNUB 3STLC 4DV2B 2E74B 1N34B 3F5WC 3OGIB 4EKWA 4TUYB 4X62B 1AP5A 1S72V 3UT5A 3E86A 3H1HH 4I0XB 4DV0O 1BCCH 4HNAB 4PA4A 1HNZO 3TJTA 2FKXA 3X2QC 3BFRA 2LGQA 3RYHB 1OCOB 3CXCU 5LMNO 2L6LA 3KKYA 2YXLA 1JR9A 3AK2A 3JATA 4D6TH 2YC0A 1F4MA 2ZCEA 4Z2WA 3E35A 3CRQA 2HP8A 4F6RB 4PV1B 4DR1O 4DV0B 4CZZA 1SQGA 2VQFO 3ICXA 1HNZB 4GCZA 2WWWA 4OXSA 3WB2A 3FB5C 5B3SC 4WF9V 1E1RG 1WB7A 1HDJA 5D5PA 3SDLA 5LMNB 1P49A 2Y4UA 3JARB 2VWJA 2M6YA 4QE7A 2OCCC 1N0JA 3K08A 3A0HZ 3LSQA 3ABLB 3SYCA 3B8NA 3DC6A 4DR1B 4OX9O 3OUFA 1Q3EA 1R6NA 2YI8A 2ZT9B 4JAAA 1YVWA 2Q68A 4JAVA 2PI4A 1OCZC 3C90A 2QE7G 4GKKB 2BTQA 4EB6B 5L3CA 4DV5O 1BMFG 2ZIMA 3FAVB 2ZDIC 4DR2O 5K1PA 2K1EA 4E2LA 2BCCH 3SPHA 3K9SA 1FJGO 4WFGA 3G67A 3M7MX 2RN9A 3LNNA 2EIJC 4NB5A 1PL0A 3MDSA 2B9ZA 3MHSC 3RYHA 1VMGA 3CCEV 2R9AA 4DV5B 4LCUC 4TV9B 2RMKB 3M99B 5LBQA 5CN0A 2ZQMA 4FK5C 4JI1O 3JASA 3ZHTA 2ZR2A 5EZYB 3U10A 2QWQB 1LNQA 4I9WA 1FJGB 2HKOA 1VQ5V 2JJ2G 2OWOA 1I7FA 4I7ZB 2AHYA 4UVCA 4GX5A 3CB2A 2DOSA 3S3XA 4JI1B 2V7QG 1Q81W 4DV3B 1P4RA 4LF8B 1JA8A 1XILA 4H44B 3RVYA 4OGQB 5KA6A 3MD0A 3JD2A 2QWPB 3AEIA 2KB1A 3SYPA 2UXBO 1MNGA 3K0GA 1GN2A 2PYLA 3ASOC 4JI8O 1PNMA 4IGGA 4HZ3A 2PGGA 3E83A 3AK3A 3OEEG 2ADPA 2NN4A 3UKMA 1K3EA 1RPRA 3ZHQA 4DUYO 1K33A 4L8JA 2UUBO 2DQ3A 1XNQO 4GLXA 3KZIZ 3STZC 2YS8A 2P4VA 5GONA 4DW0A 1URFA 5A2QN 4B7EA 3QO8A 2UXBB 2GSMB 1NTKH 2QWNB 1GM9A 4JI8B 1D2DA 2WPDG 5L3EA 3ZRSA 1BGYH 1NT2B 1H2SB 4ABMA 3ZMTA 2ZXWB 2ZE6A 2IH1C 4FMTA 3W7XA 5EBWC 3K79A 4GYCB 5EZYA 2GDSA 4IL6Z 4GX1A 1YF2A 3FFQA 4I50A 4DUYB 3HKCB 4TOIA 4JI5O 4MVSA 1NH2B 2L35A 3RYFB 1JFFB 1U96A 3T1HO 4UUJC 4BW9A 1US6A 2GV9A 1YCIA 2NR5A 5C93A 1G6UA 5B66Z 2QDOA 1ZLZA 3CSXA 1KC8W 5KHGA 5IYDO 1SQFA 2P7TC 4RUEA 4PDRA 5AG2A 1XL4A 1ZAUA 3FYEB 1V54B 5FPRA 1SQPH 4LF9O 4JI5B 4JI7O 4LF6O 2UUAO 2IW5A 5EBLC 4MVRA 5H9CA 2YXYA 3T1HB 4NTYA 3SPCA 3T1YO 2Y69B 4X88A 1SC5B 3APQA 1ZX3A 5JJNB 1VQPV 1LUVA 1S76D 2YIBD 1Z2GA 3JAWA 1R3JC 1DK1A 3SGIA 3CS5A 5JWPA 2QM4A 1KB9F 5JH7A 5ITZB 5LYJB 3OMIB 1VF5B 5LA6B 2WLKA 4LF6B 2M7WA 1BE3H 3QO7A 1AR1B 4J10A 3T1YB 1KU9A 3CC2V 3ABKC 3CWBH 1YJWV 1TUEB 1QNMA 3FYIB 3FKSG 1O9HA 1DF4A 3CCVV 3QO5A 4JI2O 3RT3C 4N21A 3CC7V 2DW4A 1H2GA 1ORQC 3D36C 5IYZB 4LF5O 3ML0A 5IY5C 2WLIB 5EK0A 5LGNA 1KD1W 4WFAV 1R6KA 3E22B 1Q6IA 4KXRA 2A0LA 5B1BB 4EFEA 1QLNA 2Y48A 4I55B 1GN6A 3HKDA 4JI0O 4W4LA 1UPGA 5BR8O 1XMQO 4GX2A 1PV0A 1CEZA 4JI2B 5B1OA 3OMNB 4LF5B 1WJZA 5BZBA 2Q7EA 1NTMH 3OR7C 3UO2A 4FFBA 3P3PA 2JK5C 2QM8A 2Q8VA 1FKAO 1IURA 1M57C
chains in the Genus database with same CATH topology
3CCLV 1QCEA 3A0RA 2EZOA 3ZMSA 4P2ZA 2ZDIA 2IH3C 1VQ4V 4QPKA 2D3OW 1FFTB 4JTCB 4JAUA 3TK1A 3ZN1A 2DYSB 1Q7YW 3F7VC 3K03A 1YI2V 2X6CA 2LP7A 2HLDG 1VQ6V 4UV9A 1NJIW 1K4DC 4UXNA 3ZN0A 1NR7A 4Z1MG 5E1AC 3SPIA 3CCUV 4MSWC 1YSCA 4WFEA 2X7RB 3JD3A 3W7UA 2QEXV 4LBEC 1OCRB 3OM3B 1I5YA 1RPOA 5J9PC 4PA7A 1Q86W 1GMGA 3MHHC 1K8AW 3E8FA 1W2BU 1OCOC 3OE7G 1SERA 2JEXA 2EILB 3ABUA 2H8PC 2ATKC 3OW2U 2IU0A 4JF3A 1QLEB 4MTXA 1GM7A 5H6RA 5HFMA 2DYRB 2HVKC 3IC7A 2X6AA 4MVZA 3W7TA 5L3BA 3F7YC 4R8CA 1M57B 1IXMA 1P7BA 3CP1A 3K04A 4J9ZB 2HFEC 1M56C 1WPXA 1DF5A 2B1GA 4UVBA 1MOFA 5LHHA 1AI6A 3AG2C 4PELA 1SZTA 3AG4C 5B1AC 3STLC 1Q82W 4MVQA 3HPLC 1VQ7V 4BW5A 1JQ0A 1KQSU 3F5WC 4EKWA 2P67A 1S72V 1VQ8V 1BHAA 3E86A 2OT5A 1MG1A 4PA4A 4MTFA 1K4CC 3X2QC 2HJFC 1YIJV 3JYCA 1AROP 3SPJA 1OCOB 3ABLC 5FL7G 3CCJV 3JCZA 3OEHG 1G4YB 1FXHA 1YTFB 1DTOA 3CXCU 2WLHA 3CC4V 1BL8A 2WLJA 3G6EV 2XAGA 2ZXWC 1F4MA 3E35A 4RAIA 1QR9A 1M56B 4CZZA 3ETGA 3E8GA 3AG2B 2AHZA 2C2AA 1VQOV 5LGUA 3AG4B 4WFBV 2EIKC 5B1AB 2HVJC 4ASUG 3CCSV 4GCZA 3SYQA 3IGAC 2WWWA 4OXSA 3FB5C 5B3SC 1NH2D 1ROPA 5L3DA 1E1RG 3NXSA 4UVAA 4GT1A 1NBMG 3SPGA 4WF9V 3OGCC 3RW0A 4MS2A 1FS0G 1YITV 4XDJA 4WCEV 3X2QB 4QE7A 2OCCC 3ZRVA 3K08A 4PDLA 3LSQA 3ABLB 3SYCA 3B8NA 5KA5A 1THZA 3OUFA 1YJNV 4PA9A 3G4SV 1R6NA 4R50A 3SYAA 4JGSA 4JTDB 5IYCO 5IY5B 3B77A 2Q68A 4JAVA 2PI4A 1OCZC 2B1IA 1NKDA 2QE7G 4GX0A 2XNDG 4QNHB 3LSSA 4Q20A 2A79B 2DWEC 3ASNC 4PA6A 3D3IA 3CYOA 4PDVA 3K3WA 5L3CA 1R3KC 1BMFG 4LP8A 3B8MA 3ZRXA 4XDKA 3HB3B 4MTGA 2WAMA 2ZDIC 5DM6V 3R65A 2K1EA 4E2LA 2EIKB 1AI5A 3SPHA 1NQTA 4WFGA 4RQFA 3I55V 5L3FA 5B3SB 2NNUA 3KG2A 4XDLA 2EIJC 1AJPA 4MVUA 1PL0A 2Q67A 3EHBB 4TSFG 3E8BA 4BIZA 5IDJA 3ETDA 1R3IC 2OCCB 2YEVB 3MHSC 1HWYA 3ZMVA 1GKFA 3CCEV 4LCUC 1OZ0A 3M99B 5LBQA 5CN0A 4RUFA 2ZQMA 4FK5C 1H8EG 3SYOA 1EFRG 2ZR2A 4BIUA 3W7WA 2OTLV 4I9WA 1LNQA 4MVOA 4DO2A 1OCCC 2WLIA 3AG1C 4G2KA 1I5XA 1PKXA 4JYCA 3E8HA 2HKOA 1CPYA 3ABTA 2BOCC 1OCZB 1VQ5V 2W0FC 3LNMB 4HYOA 2JJ2G 3K9AA 4WFHA 3ASNB 2JIZG 4R7CA 1YTFD 1Y66A 2EIMC 5LGTA 4F4LA 5CMUA 2HG5C 3H01A 4FPPA 1S77D 1GM8A 2AHYA 2IJJA 1AJNA 1V55C 5EC2C 2UXXA 4GX5A 4UVCA 1EZJA 1YJ9V 3K06A 4UV8A 3CCRV 3OR6C 3T1CA 1PNKA 3CCMV 1K73W 2V7QG 2EIJB 3W7SA 1S5HC 5CBHA 1Q81W 3EFFK 1Y4MA 2P6JA 2DQ0A 4LC1A 3ABMC 1K34A 1JX9A 5KUMA 3I56V 3OUSA 1NVPB 1WLEA 1P4RA 2WLLB 1PD3A 4KUMA 2WLMA 3RVYA 1GK9A 2ZR3A 1G8MA 1KP2A 4G27B 5KA6A 3MD0A 3D36A 4BAYA 3JD2A 1W0KG 3VOUA 3ZCCA 1CP9A 3AEIA 4H33A 3TCUA 2KB1A 3SYPA 2QA4V 1K97A 1RM1C 1OCCB 3AG1B 3K0GA 4MW8A 3ZMUA 2CK3G 3ASOC 1PNMA 3OFNG 4HZ3A 3CMEV 1AI7A 2NLJC 1H8HG 1FXKC 3E83A 5CBFA 3OEEG 1E1QG 2EIMB 1NVPD 1SETA 4U7OA 3RVZA 4JYBA 3LDEA 3UKMA 1K3EA 4JPRA 4MW3A 1MABG 1RPRA 2B5UA 4QJFB 5CA3A 1M1KW 4R6ZA 1JPXA 3IFXA 1AJQA 1M9NA 1VQ9V 4P9OA 1K33A 3CMAV 1COWG 2DQ3A 5LHIA 1YHQV 4QPJA 3STZC 2DWDC 2P90A 2Q6AA 1S0VA 2A9HA 3E2EA 1PNLA 3ZIAG 4HAMA 3QO8A 2LFSA 3T2MA 3P30A 2GSMB 4QIWF 4MVMA 2XAHA 4TT3G 1GM9A 3ABMB 4X89A 2GHYA 3CCQV 1V54C 2WPDG 4TWKA 5L3EA 3ZRSA 3ZRWB 1K92A 4I5SA 1AI4A 3DGEA 4PA3A 3ZMZA 4P30A 4WFFA 3ZMTA 2ZXWB 5LHGA 2IH1C 4FMTA 3W7XA 4FJCC 5EBWC 3K79A 2HR3A 2ZD9A 1RM1B 1SRYA 2Y69C 4GX1A 3AG3C 1R73A 4KP4A 1OHHG 1KECA 1FXKB 1SESA 5IYBO 2QKSA 1F4NA 2JJ1G 4MVSA 1L1FA 2IJHA 1NH2B 4RQEA 1VQLV 4N23A 1VQNV 4MTOA 3JD0A 3VBBA 2W6JG 1W0JG 4UUJC 3JD1A 3WFVA 4ZKIA 3DTUB 4G28B 5C93A 4H37A 1QR8A 1E79G 1DLBA 5GW7A 1F51A 2X6BA 1JVMA 5IYDO 3GB7C 3T4ZA 2ITDC 1J95A 2P7TC 1KC8W 4RUEA 3GWOA 2UXNA 1K5QA 4PDRA 1S3JA 2JEUA 1XL4A 4J9YB 3FYEB 2WLLA 1V54B 2ITCC 2Z5UA 4L87A 5H6QA 2IU3A 2XAFA 1ENVA 2IW5A 3LDCA 3UM7A 3P32A 5EBLC 4MVRA 5H9CA 1K5SA 2EINC 3LUTB 3OAAG 3BY6A 3SPCA 2LFRA 2Y69B 4X88A 2BOBC 1QVFU 1NR1A 3AG3B 1JCHA 1QBZA 2R9RB 1F23A 4DXWA 1VQPV 1S76D 3SJQC 2EZPA 5B1BC 1R3JC 3OMAB 4PDMA 1VQKV 4FIPC 4X8AA 1KKDA 2QM7A 3ZJZA 1ZWIC 3OMIB 4QE9A 2WLKA 3FB7C 2H94A 2M7WA 1JJ2U 3QO7A 1KP3A 3RBZA 2XASA 4P9PA 1AR1B 2EJRA 1GO3F 3CC2V 2F43G 3QNEA 3ABKC 4RO2A 1YJWV 1EBOA 1TUEB 3FYIB 1QVGU 3ZRWA 3FKSG 3K0DA 4XBFA 2V1DA 3JD4A 1DF4A 2W6IG 3ETEA 3CCVV 3QO5A 1VQMV 1K9MW 4N21A 3CC7V 3WG7C 2EINB 2DW4A 4KFMA 1H2GA 1ORQC 2X0LA 1M90W 3ML0A 2IJKA 4JASA 5IY5C 2WLIB 5EK0A 1FXKA 5LGNA 2Q69A 1KD1W 1MSWD 4WFAV 1R6KA 2DYSC 2MK3A 5EBMC 1V55B 1JOYA 2A0LA 4MT8A 5B1BB 2XAJA 1QLNA 1BHBA 2Y48A 4JTAB 3TETA 2PI5A 5KUKA 3CD6V 1GTOA 1XL6A 2XAQA 2FTKA 2QTOA 3T4DA 2OTJV 3E89A 3BEHA 5DN6G 4GX2A 3CPWU 2WLNA 1B6QA 1CEZA 5HFLA 2YSUB 1OCRC 1N8RW 2Z3YA 2YEVA 2R9IA 5B1OA 4YXWG 3G71V 1H38A 3OMNB 5B1NA 2WSSG 4ZBMA 4CBCA 2EILC 1FXVA 2EBOA 1K7DA 3ABKB 5BZBA 3PJSK 2IJIA 3FB8C 5CBGA 3OR7C 2JDIG 3LDDA 1QLEC 5EC1C 2XOKG 3ASOB 2DYRC 2JK5C 5L3GA 2QM8A 3WG7B 1UJWB 4U7NA 1R3LC 3FB6C 1M57C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL V;  1YJN V;  1K73 W;  3CCS V;  3CCQ V;  3CC7 V;  1VQN V;  3CCJ V;  1K8A W;  1Q81 W;  1VQ5 V;  1N8R W;  1W2B U;  3I56 V;  3G71 V;  4WF9 V;  1M90 W;  1JJ2 U;  1Q82 W;  3CXC U;  3OW2 U;  2D3O W;  1VQ4 V;  1VQL V;  1VQ7 V;  3CC4 V;  1Q7Y W;  1VQO V;  1QVF U;  1KQS U;  1YI2 V;  3G6E V;  1KD1 W;  1M1K W;  4WFA V;  1YIT V;  1VQ6 V;  3CC2 V;  1S72 V;  1NJI W;  1VQ8 V;  3CMA V;  1YHQ V;  1VQ9 V;  4WCE V;  3CCE V;  1YJW V;  1KC8 W;  1R73 A;  3CCU V;  1VQP V;  3CME V;  5DM6 V;  1QVG U;  2QA4 V;  1YJ9 V;  3CD6 V;  3CCR V;  3CCV V;  2OTL V;  2QEX V;  2OTJ V;  1YIJ V;  1K9M W;  3I55 V;  3CPW U;  1VQK V;  3CCM V;  1VQM V;  4WFB V;  3G4S V;  1Q86 W; 
#chains in the Genus database with same CATH topology
 4JI3 O;  1QCE A;  5JQG A;  2EZO A;  3ZMS A;  1YXB A;  4JTC B;  2DYS B;  2YIC A;  4NXN O;  2RDC A;  2LP7 A;  2ODM A;  1VQ6 V;  3NR7 A;  3B09 A;  1L8D A;  2WA4 A;  3ZN0 A;  5ITZ A;  5LA6 A;  4FFK A;  4X20 B;  2X7R B;  4UCR A;  3K5M A;  4LBE C;  1I5Y A;  1RPO A;  2YDE A;  4PA7 A;  4LFC B;  1Q86 W;  4JI3 B;  2Q7G A;  3OE7 G;  4IT5 A;  3CJH B;  1ZUQ A;  4JF3 A;  5FNV A;  2UXC O;  2R70 A;  4NXN B;  2DYR B;  3ZS8 C;  1S5J A;  4DRX B;  5L3B A;  2D2C B;  3A0B Z;  1IXM A;  1P7B A;  3K04 A;  2B1G A;  4TV8 A;  1FFX A;  1KUQ A;  1HP8 A;  3AG2 C;  3HKE A;  4PEL A;  2E76 B;  3AG4 C;  4ICG A;  5KAI Z;  1Q82 W;  4JI4 O;  4MVQ A;  4BW5 A;  1IXB A;  2A7W A;  1HNX O;  1BZK A;  2EUL A;  5EIB D;  3RYC A;  4X1K B;  5H5N A;  3GWK C;  4MTF A;  1B3Q A;  2HJF C;  1YIJ V;  3JYC A;  3SPJ A;  5FL7 G;  1JMK C;  4YJ3 B;  3OEH G;  1YTF B;  5KAF Z;  2WLH A;  2Q0A A;  2WLJ A;  4ZI7 B;  4JI4 B;  2CTW A;  1Y74 A;  2P4K A;  4U3F H;  4RAI A;  1HNX B;  4DR5 O;  5CA0 A;  4PI2 A;  3A2F A;  4KHP O;  1BQZ A;  5J2U B;  1X4T A;  3IJ4 A;  3N2G A;  3PN1 A;  1FS0 G;  1VF6 C;  2EX3 A;  4UCO A;  4XDJ A;  1V9P A;  3L75 H;  3X2Q B;  3KCY A;  1I94 O;  1XRE A;  4DR5 B;  1FD9 A;  2ADQ B;  4DR3 O;  3G4S V;  4JGS A;  4JTD B;  5IYC O;  2Y4T A;  1N0N A;  2XND G;  1R1B A;  2CGO A;  2YI9 A;  3ASN C;  4PA6 A;  3D3I A;  1MSD A;  2FYU H;  2XUM A;  1PPJ H;  4MTG A;  5DM6 V;  3R65 A;  3H1I H;  2AZ2 A;  1AI5 A;  3AK1 A;  4WBN B;  3I55 V;  5L3F A;  5B3S B;  4DR3 B;  1AJP A;  4MVU A;  4X1K A;  3JAK B;  3CRA A;  4BIZ A;  4YJ2 A;  3ETD A;  2OCC B;  5TIS Z;  1YEW A;  3HKB B;  1AB3 A;  1SS3 A;  2F66 C;  5IJ0 B;  2DJV A;  2QJ1 A;  3QF7 A;  1OZ0 A;  5LP6 C;  1H8E G;  4BIU A;  2OTL V;  3W7W A;  4DO2 A;  4JYC A;  1OCC C;  4X1I B;  3ABT A;  2BOC C;  4JV5 O;  1OCZ B;  2W0F C;  3LNM B;  3M8A A;  4HYO A;  5F2V O;  1GRJ A;  1Y76 B;  3H1J H;  2JIZ G;  2QWO B;  3FX7 A;  1YTF D;  5LGT A;  2EIM C;  2E3C A;  1X59 A;  1B06 A;  4ZHQ B;  2HG5 C;  4FLW A;  1XEQ A;  3QTC A;  2CAZ C;  3WB1 A;  1V55 C;  2DE0 X;  2PZS A;  1EZJ A;  1YJ9 V;  3K06 A;  1GAX A;  4B3M B;  1K73 W;  2EIJ B;  1QU7 A;  3W7S A;  5KUM A;  4O2A A;  3BAB A;  2DQ0 A;  3N27 A;  3ABM C;  1JX9 A;  3VQW A;  3I56 V;  3OUS A;  1WLE A;  3P3N A;  4KUM A;  1MZF A;  1GK9 A;  1HNW O;  4NVP A;  4IHJ A;  5IJ9 B;  1LR1 A;  3ZCC A;  1CP9 A;  5E79 Z;  4MW8 A;  4FLZ A;  4B3S O;  4JZG A;  1AI7 A;  4FM1 A;  1FXK C;  5CBF A;  1E1Q G;  1MZE A;  4U7O A;  3LDE A;  4IIJ B;  3RWR D;  4DR4 O;  4AQY O;  4JPR A;  5CA3 A;  2ZM6 O;  3ZX6 A;  1HNW B;  4P9O A;  1COW G;  3DC5 A;  1D5A A;  3MAQ A;  5EYP B;  2GUZ A;  1PNL A;  3O9O A;  4O4H B;  2RQ6 A;  4J41 A;  3T2M A;  5IE9 A;  3H1L H;  2F93 B;  2VQF B;  4B3S B;  2Y0P A;  3HKB A;  1RSO A;  5KLV H;  2RJZ A;  3DGE A;  4PA3 A;  5LXT B;  4WFF A;  4O4L A;  5CB4 B;  2HR3 A;  2ZD9 A;  4DR4 B;  4F6E A;  4B3R O;  1R73 A;  1TVK A;  4KP4 A;  2E5L O;  4LNU A;  5IYB O;  4LF7 O;  2JJ1 G;  4X1Y B;  1L1F A;  4N23 A;  1VQN V;  4MTO A;  3JD0 A;  4OX9 B;  4TUY A;  4IYH A;  3K5L A;  4DV4 O;  4I0X A;  3WFV A;  4HNA A;  3S3W A;  3DTU B;  1BT8 A;  1DLB A;  4CH4 A;  2UU9 O;  3GB7 C;  2UXN A;  1K5Q A;  4B3R B;  2LO1 A;  4J9Y B;  4UB6 Z;  2E5L B;  4DR2 B;  3RGB A;  2CH7 B;  2IU3 A;  2XAF A;  4H0L B;  3UM7 A;  5IJ9 A;  1FAF A;  3U0Z A;  5J2T B;  2EIN C;  4F6R A;  3IC9 A;  3OAA G;  3BY6 A;  1AR5 A;  2BOB C;  1N33 O;  4B3T O;  4FM2 A;  1QBZ A;  1L0N H;  1F23 A;  2W0X A;  1SQX H;  4IIJ A;  1TA8 A;  1XNR O;  4X8A A;  1ZWI C;  3FB7 C;  3JAR A;  3APO A;  3EXA A;  4X64 O;  3B2E E;  4P9P A;  2ZKO A;  1TUB B;  5FPO A;  4B3T B;  1QVG U;  3DXR B;  5IWA O;  2W6I G;  1Q8I A;  2ZE8 A;  5FLX N;  3WG7 C;  4EB6 A;  1XNR B;  3JAL B;  1UFI A;  2X0L A;  1M90 W;  2IJK A;  3FAV A;  4LR3 A;  3F5T A;  4H13 B;  2MK3 A;  4DK1 A;  1JOY A;  4JYA O;  4CS3 A;  2XAJ A;  1BHB A;  5DED A;  2PI5 A;  2F95 B;  5KUK A;  3CD6 V;  1GTO A;  1XL6 A;  1XMO O;  2QTO A;  5IWA B;  1SA0 B;  4I4T B;  3E89 A;  2H3O A;  4YXW G;  3G71 V;  1H38 A;  4FM0 A;  2KKW A;  2PUS A;  4ZBM A;  4TV9 A;  4D7T A;  1NTZ H;  3ABK B;  3JAM N;  4FLU A;  3PJS K;  2IJI A;  3U11 A;  1QLE C;  4JYA B;  2UUB B;  1XNQ B;  1G1X B;  4UB8 Z;  3JCU Z;  1UJW B;  1XMO B;  1R3L C;  1NVP B;  3FB6 C;  1BQ0 A;  3G80 A;  4P2Z A;  2G38 A;  4BIO A;  2IH3 C;  1FFT B;  3TK1 A;  3K03 A;  1YI2 V;  2JS5 A;  2OIG A;  2HLD G;  2KG7 B;  1XUQ A;  3RYI B;  4UXN A;  1N36 O;  4Z1M G;  3CCU V;  1YSC A;  4WFE A;  3G6B A;  3W7U A;  5KX5 B;  2KQX A;  3EVK A;  2ZIO A;  3CE2 A;  3E8F A;  1W2B U;  2JEX A;  3ABU A;  4KL1 A;  1FPO A;  2YIB A;  5JVD B;  5LOV B;  3BRC A;  4Q6G A;  4JI6 O;  5H6R A;  2HVK C;  3QVN A;  1N36 B;  4MVZ A;  4Z1V A;  1M57 B;  5BMV B;  2EJ7 A;  1M56 C;  4UVB A;  3CX5 F;  4NYK A;  5LHH A;  1AI6 A;  4YIO A;  5B1A C;  4LF9 B;  1YZB A;  4JI7 B;  5JCO A;  2UUA B;  1VQ7 V;  4YIP A;  1JQ0 A;  1YDX A;  4JYY A;  1VQ8 V;  1BHA A;  4JI6 B;  1PP9 H;  4K3A A;  5KHI A;  2FL4 A;  1TAE A;  4B08 A;  4EEQ A;  3UCS C;  3JCZ A;  3ZHU A;  1G4Y B;  2AW9 A;  3CC4 V;  1P84 F;  1BL8 A;  1AP6 A;  3HKC A;  2XAG A;  3BVO A;  2ZXW C;  2BE3 A;  1SF9 A;  3RYF A;  1JFF A;  1U97 A;  3RFR A;  3ETG A;  3AG2 B;  3UO3 A;  1VQO V;  3AG4 B;  4B7K A;  2EIK C;  4WFB V;  2HVJ C;  1MA1 A;  4ASU G;  3ZHS A;  3CCS V;  3IGA C;  3WU2 Z;  1NH2 D;  1ROP A;  5L3D A;  3NXS A;  4UVA A;  3SPG A;  4GT1 A;  1NBM G;  1D5N A;  3OGC C;  3RW0 A;  1N32 O;  2CUG A;  1GN3 A;  5KX5 A;  1YIT V;  3I5D A;  1VAR A;  3ZRV A;  4PDL A;  1DGS A;  2ZNJ A;  5JVD A;  1SQV H;  5BXZ A;  1THZ A;  4JI0 B;  4PA9 A;  5BR8 B;  1XMQ B;  3SYA A;  3ZHV A;  3B77 A;  2VS0 A;  3BHP A;  1NKD A;  4AIL C;  4GX0 A;  2RNB A;  2Z0A A;  3LSS A;  4J7K A;  1WAZ A;  2DWE C;  4Q20 A;  4PDV A;  4LP8 A;  3B8M A;  1KKC A;  4XDK A;  3HB3 B;  2WAM A;  4NR1 A;  5LYJ A;  3UQ8 A;  4FLT A;  1J5E O;  1XI1 A;  1AVM A;  2VQE O;  2NNU A;  5KHH A;  4AHC A;  3N2K B;  4XDL A;  5KMG B;  2Q67 A;  3EHB B;  4GZR B;  1ZL8 B;  3E8B A;  3OTO O;  1R3I C;  2YEV B;  4DK0 A;  1HWY A;  3ZMV A;  2QKC A;  4RUF A;  1SQB H;  5CA1 B;  1GH6 A;  5IYZ A;  3FD9 A;  1J5E B;  1ZTE A;  2WLI A;  3AG1 C;  4G2K A;  1PKX A;  3OT7 A;  2VQE B;  2AZ0 A;  4YHH O;  3E22 A;  3K9A A;  1NZ6 A;  3THO A;  3ASN B;  1SKV A;  4CH5 A;  4DV7 O;  2E75 B;  4R7C A;  1Y66 A;  4I55 A;  4O2B B;  1EZV H;  3TXS A;  4O4I B;  5DEC A;  2UXC B;  4QGP A;  1S77 D;  3OTO B;  5EIB C;  1GM8 A;  1AJN A;  2UXX A;  2ILM A;  4ZIB A;  1XHX A;  4CH3 A;  3ZED A;  4X9Q A;  3T1C A;  1PNK A;  3CCM V;  3K5O A;  3WB0 A;  3EFF K;  4U3J B;  2VRZ A;  4LC1 A;  1K34 A;  4K0K O;  4YY3 O;  1WA8 B;  4YHH B;  4LWS B;  2WLM A;  4DV7 B;  2ZR3 A;  1G8M A;  1R6T A;  5LP6 B;  4A5U B;  4OPH A;  1W0K G;  3VOU A;  1RM1 C;  4H33 A;  2QA4 V;  1OCC B;  3ZMU A;  2CK3 G;  3OFN G;  3BA8 A;  4LF4 O;  2EIM B;  2AXT Z;  3RVZ A;  4JYB A;  4K0K B;  1P7G A;  4YY3 B;  3TXQ A;  3VQY A;  4X20 A;  4MW3 A;  4QJF B;  2B5U A;  1M1K W;  4R6Z A;  3IFX A;  1AJQ A;  5LHI A;  1W59 A;  4QPJ A;  1IBL O;  4OPA A;  2DWD C;  2P90 A;  2Q6A A;  3N2K A;  1S0V A;  2A9H A;  2Q0O C;  3E2E A;  2IBZ H;  3ZIA G;  2P22 C;  3CJH A;  2LFS A;  1NI8 A;  4HBN A;  4QIW F;  1VF6 A;  3UT5 B;  2PF4 E;  2XAH A;  4X89 A;  3ABM B;  2GHY A;  3CCQ V;  1QHT A;  3CEI A;  3ETQ A;  1K92 A;  4I5S A;  2GBO A;  4KHP B;  4LF4 B;  4P30 A;  5C8Y B;  4DRX A;  1SRY A;  1H2N A;  3AG3 C;  4J7Z A;  3CRM A;  1OHH G;  1M93 A;  3JAT B;  1IX9 A;  1KEC A;  4PHZ A;  1FXK B;  1SES A;  1I94 B;  1F4N A;  2IJH A;  3L72 H;  4RQE A;  3J80 N;  1Q5O A;  2HEP A;  3VBB A;  5K1X A;  2CTQ A;  3H1K H;  4ZKI A;  4J42 A;  1E79 G;  2AGA A;  1F51 A;  3T4Z A;  2RCV A;  4YJ3 A;  3GWO A;  1S3J A;  2LW7 A;  2FML A;  1KYO F;  2XT9 A;  4ZI7 A;  1NS1 A;  4JZ2 A;  3LDC A;  3P32 A;  1WB8 A;  1N34 O;  1K5S A;  5LMU O;  1XQ8 A;  1AR4 A;  2LFR A;  1NR1 A;  1JCH A;  1EM1 A;  2R9R B;  2QWR B;  1WP7 A;  4X65 O;  2EZP A;  2BTQ B;  5J2U A;  3VQV A;  3OMA B;  1M4U A;  4PDM A;  3SR2 C;  4FIP C;  4IYI A;  2QM7 A;  2QR4 A;  4QE9 A;  2H94 A;  1JJ2 U;  1HR0 O;  4JV5 B;  1KP3 A;  2XAS A;  5LMU B;  1H2L A;  1H2K A;  2CTP A;  3QNE A;  4RO2 A;  1EBO A;  2YID A;  4NTX A;  4XBF A;  4CH6 A;  4LFB O;  3ETE A;  4X65 B;  5C8Y A;  1VQM V;  3CRR A;  1K9M W;  2EIN B;  4KFM A;  2OCH A;  4CC5 A;  3JAS B;  5KHK A;  4JAS A;  1HR0 B;  1FXK A;  5EBM C;  4AI8 A;  4WBN A;  4MT8 A;  1NU1 H;  1FYJ A;  4NTW A;  3TET A;  4FLY A;  1VEW A;  3C3S A;  4CS2 A;  4D7S A;  2XAQ A;  2FTK A;  4LFB B;  4C7U A;  3CPW U;  1B6Q A;  5HFL A;  2YSU B;  3JAK A;  2PYJ A;  1OCR C;  1N8R W;  2Z3Y A;  2HJD A;  4GKK O;  5B1N A;  3SJC C;  5IJ0 A;  2WSS G;  2EIL C;  1FXV A;  1K7D A;  2GTA A;  1F7Y A;  2JRI A;  3FB8 C;  5CBG A;  1B04 A;  2JDI G;  3LDD A;  1L0L H;  5EC1 C;  2XOK G;  4AQY B;  3K5N A;  4X1I A;  2ZM6 B;  1OV9 A;  4O4J B;  3ASO B;  1Y76 A;  5L3G A;  2UUC O;  2QKA A;  3WG7 B;  1WP8 A;  4U7N A;  3CCL V;  4DV6 O;  1IBM O;  4FZ0 A;  2ZDI A;  2N05 A;  4ZHQ A;  1VQ4 V;  4QPK A;  2D3O W;  4JAU A;  3ZN1 A;  1Q7Y W;  3F7V C;  1Q43 A;  1WN7 A;  2XTA A;  2X6C A;  3C3T A;  2CE4 A;  3ZBH A;  5GTI Z;  4UV9 A;  1NJI W;  1K4D C;  1NR7 A;  3L70 H;  4MSW C;  2IM9 A;  3GVM A;  3CRC A;  4TQF A;  4J80 A;  3JD3 A;  2UUC B;  1GMG A;  1T5E A;  2V4D A;  3MHH C;  4LF7 B;  5GON B;  4DV6 B;  1OCO C;  1SER A;  2H8P C;  1IBM B;  3OW2 U;  2IU0 A;  1Q90 D;  1QLE B;  1GN4 A;  2CGN A;  4MTX A;  4DV4 B;  2X6A A;  2UU9 B;  3W7T A;  4R8C A;  3CP1 A;  4J9Z B;  2HFE C;  4DV3 O;  4I50 B;  2VWK A;  5D5Q A;  1OJH A;  3OD4 A;  4LF8 O;  4LH7 A;  2R72 A;  3HPL C;  5EYP A;  4UCS A;  1KQS U;  4O4H A;  2P67 A;  3ZHR A;  2OT5 A;  3CHX A;  1N33 B;  1MG1 A;  2DMX A;  1K4C C;  4CS4 A;  4E4E A;  5LXT A;  3TGU H;  4X66 O;  1SZX A;  1ARO P;  3ABL C;  4UCT A;  5CB4 A;  3CCJ V;  1H2M A;  1FXH A;  1Y67 A;  1DTO A;  4O4J A;  3BPZ A;  1Y6X A;  3G6E V;  4X64 B;  4X1Y A;  4K8Z A;  2A3Q A;  1QR9 A;  4DR6 O;  1M56 B;  4FVM A;  2JGU A;  1WNS A;  3E8G A;  2AHZ A;  2C2A A;  5LGU A;  5B1A B;  3B40 A;  4X66 B;  1XOU A;  3SYQ A;  3JAW B;  4DW1 A;  5KHJ A;  3LSU A;  5JH7 B;  4MS2 A;  4DUZ O;  2ARH A;  1PL4 A;  4CC6 A;  4WCE V;  3IAY A;  2CH7 A;  3O65 A;  5JJE B;  1S5L Z;  5J2T A;  4DR6 B;  5KA5 A;  1YJN V;  4R50 A;  5IY5 B;  1KMI Z;  1PM9 A;  3Q4H B;  2WA3 A;  2B1I A;  3QG5 A;  4J7J A;  4QNH B;  2A79 B;  3CYO A;  3K3W A;  1QQC A;  1R3K C;  4DUZ B;  3ZRX A;  1TGO A;  3BA9 A;  3BCC H;  2EIK B;  1N4C A;  4PD4 F;  1NQT A;  3RN4 A;  3JSN A;  3L73 H;  4RQF A;  4UCU A;  4DR7 O;  1XBL A;  1TUB A;  3KG2 A;  3HKD B;  4LFA O;  2JGD B;  4GKJ O;  1RP3 B;  3DXR A;  4TSF G;  5IDJ A;  1BS3 A;  3SJB C;  1GKF A;  2LJ2 A;  1AIL A;  3L71 H;  3AG7 A;  3JAL A;  5BY1 A;  3SYO A;  1EFR G;  2UXD O;  4MVO A;  1I5X A;  2ZE7 A;  3E8H A;  1CPY A;  4FFB B;  4K35 A;  4DR7 B;  2ZNI A;  2LGW A;  4WFH A;  4LFA B;  4GKJ B;  5JQG B;  1BSM A;  4W4K A;  4F4L A;  1SA0 A;  4I4T A;  5CMU A;  3H01 A;  4FPP A;  2IJJ A;  5EC2 C;  3K59 A;  1IDS A;  2QTS A;  5JCO C;  1Z5V A;  4UV8 A;  3D8C A;  2ZE5 A;  3CCR V;  2FB5 A;  4ZOL B;  5LL6 Y;  3OR6 C;  3H9V A;  2LQT A;  2UXD B;  1S5H C;  5CBH A;  1Y4M A;  2P6J A;  2KSD A;  2WLL B;  1PD3 A;  2GTS A;  2CTR A;  1KP2 A;  4G27 B;  2Q9L A;  3D36 A;  4BAY A;  5FNV B;  1VIB A;  2DN9 A;  1XHZ A;  3TCU A;  1K97 A;  3OTF A;  3AG1 B;  1M5I A;  3Q4H A;  3CME V;  2BSK B;  2NLJ C;  1H8H G;  4NXM O;  1WPB A;  2KG7 A;  1NVP D;  2JS3 A;  1SET A;  3RYI A;  2N04 A;  3J81 N;  4TV8 B;  1HW7 A;  2CDY A;  1FFX B;  1MAB G;  3HKE B;  1JPX A;  4FLX A;  5JJJ B;  1M9N A;  1VQ9 V;  3CMA V;  1YHQ V;  4HAM A;  2JGD A;  1EN4 A;  3P30 A;  4MVM A;  4TT3 G;  5LOV A;  2OYQ A;  4GUN A;  4PJ0 Z;  3RYC B;  1V54 C;  4TWK A;  4TQD A;  4UFZ A;  3ZRW B;  4NXM B;  3ZMZ A;  1AI4 A;  3BAA A;  5LHG A;  4FJC C;  4FZ1 A;  5BMV A;  1RM1 B;  2Y69 C;  1N32 B;  1I0H A;  4BWA A;  1Y74 B;  4LFC O;  2QKS A;  5B5E Z;  1SQQ H;  2Y0I A;  1VQL V;  3SJA C;  2W6J G;  1W0J G;  5CA0 B;  2QSA A;  3JD1 A;  3KCX A;  4ZOL A;  4G28 B;  4H37 A;  1QR8 A;  2P5O A;  2F4V O;  5GW7 A;  2X6B A;  1JVM A;  2ITD C;  1J95 A;  2JEU A;  3N2G B;  1LUW A;  2PTM A;  2WLL A;  5H6Q A;  2ITC C;  2Z5U A;  4L87 A;  2Q7H A;  4UCV A;  1ENV A;  1JJO A;  2MW2 B;  2Q5Z A;  2N74 A;  3LUT B;  1CXZ B;  2A06 H;  1QVF U;  4DYL A;  1IBK O;  3K58 A;  3AG3 B;  2BSK A;  1O9G A;  2F4V B;  4DXW A;  1A32 A;  4BR6 A;  3SJQ C;  5B1B C;  2Q73 A;  1VQK V;  5H2F Z;  1KKD A;  3CXH F;  3ZJZ A;  3L9D A;  2YIA A;  2JVD A;  3RBZ A;  3D3Q A;  2EJR A;  1I08 A;  1GO3 F;  1IBK B;  2F43 G;  3HR0 A;  3ZRW A;  3K0D A;  2V1D A;  4YJ2 B;  3JD4 A;  3JSL A;  5IT9 N;  4NKG B;  2PY5 A;  2K9P A;  1Q6H A;  4FLV A;  1MMM A;  2HHH O;  2Q69 A;  1MSW D;  2DYS C;  4PI0 A;  1V55 B;  1VF7 A;  2XHB A;  4JTA B;  3K57 A;  3L74 H;  3T4D A;  2OTJ V;  5DN6 G;  3BEH A;  5KMG A;  2P06 A;  2WLN A;  1EN6 A;  1ZL8 A;  1KBH A;  2YEV A;  2R9I A;  1Z5W A;  4CBC A;  3DSQ A;  2EBO A;  2ZIN A;  5CA1 A;  2HHH B;  4O2A B;  2O57 A;  5GTH Z;  2DYR C;  4RWU A;  2ETN A;  1IBL B;  2BTO A;  4IHJ B;  4O2B A;  4J11 A;  2YXH A;  3A0R A;  4O4I A;  3A8T A;  1Q6U A;  4DV1 O;  3B4S A;  1RFY A;  2Q4P A;  5E1A C;  3SPI A;  4U3J A;  1IVS A;  2QEX V;  1OCR B;  1WA8 A;  3OM3 B;  5J9P C;  2F1M A;  4K8X A;  2QGN A;  4LWS A;  2LW1 A;  1IZ3 A;  1K8A W;  4DV2 O;  4LH6 A;  2GUZ B;  2YUA A;  5LP6 A;  3VQX A;  2EIL B;  2ATK C;  1ZSP A;  3R66 A;  3J7A U;  5A9G A;  4X62 O;  1GM7 A;  1RSO B;  5HFM A;  1VP7 A;  4DV1 B;  3IC7 A;  4B3M O;  1EN5 A;  4O4L B;  3F7Y C;  4I9Q A;  1WPX A;  1DF5 A;  1MOF A;  1TVK B;  2F23 A;  4EFB A;  1SZT A;  2OIE A;  1XDC A;  4LNU B;  3STL C;  4DV2 B;  2E74 B;  1N34 B;  3F5W C;  3OGI B;  4EKW A;  4TUY B;  4X62 B;  1AP5 A;  1S72 V;  3UT5 A;  3E86 A;  3H1H H;  4I0X B;  4DV0 O;  1BCC H;  4HNA B;  4PA4 A;  1HNZ O;  3TJT A;  2FKX A;  3X2Q C;  3BFR A;  2LGQ A;  3RYH B;  1OCO B;  3CXC U;  5LMN O;  2L6L A;  3KKY A;  2YXL A;  1JR9 A;  3AK2 A;  3JAT A;  4D6T H;  2YC0 A;  1F4M A;  2ZCE A;  4Z2W A;  3E35 A;  3CRQ A;  2HP8 A;  4F6R B;  4PV1 B;  4DR1 O;  4DV0 B;  4CZZ A;  1SQG A;  2VQF O;  3ICX A;  1HNZ B;  4GCZ A;  2WWW A;  4OXS A;  3WB2 A;  3FB5 C;  5B3S C;  4WF9 V;  1E1R G;  1WB7 A;  1HDJ A;  5D5P A;  3SDL A;  5LMN B;  1P49 A;  2Y4U A;  3JAR B;  2VWJ A;  2M6Y A;  4QE7 A;  2OCC C;  1N0J A;  3K08 A;  3A0H Z;  3LSQ A;  3ABL B;  3SYC A;  3B8N A;  3DC6 A;  4DR1 B;  4OX9 O;  3OUF A;  1Q3E A;  1R6N A;  2YI8 A;  2ZT9 B;  4JAA A;  1YVW A;  2Q68 A;  4JAV A;  2PI4 A;  1OCZ C;  3C90 A;  2QE7 G;  4GKK B;  2BTQ A;  4EB6 B;  5L3C A;  4DV5 O;  1BMF G;  2ZIM A;  3FAV B;  2ZDI C;  4DR2 O;  5K1P A;  2K1E A;  4E2L A;  2BCC H;  3SPH A;  3K9S A;  1FJG O;  4WFG A;  3G67 A;  3M7M X;  2RN9 A;  3LNN A;  2EIJ C;  4NB5 A;  1PL0 A;  3MDS A;  2B9Z A;  3MHS C;  3RYH A;  1VMG A;  3CCE V;  2R9A A;  4DV5 B;  4LCU C;  4TV9 B;  2RMK B;  3M99 B;  5LBQ A;  5CN0 A;  2ZQM A;  4FK5 C;  4JI1 O;  3JAS A;  3ZHT A;  2ZR2 A;  5EZY B;  3U10 A;  2QWQ B;  1LNQ A;  4I9W A;  1FJG B;  2HKO A;  1VQ5 V;  2JJ2 G;  2OWO A;  1I7F A;  4I7Z B;  2AHY A;  4UVC A;  4GX5 A;  3CB2 A;  2DOS A;  3S3X A;  4JI1 B;  2V7Q G;  1Q81 W;  4DV3 B;  1P4R A;  4LF8 B;  1JA8 A;  1XIL A;  4H44 B;  3RVY A;  4OGQ B;  5KA6 A;  3MD0 A;  3JD2 A;  2QWP B;  3AEI A;  2KB1 A;  3SYP A;  2UXB O;  1MNG A;  3K0G A;  1GN2 A;  2PYL A;  3ASO C;  4JI8 O;  1PNM A;  4IGG A;  4HZ3 A;  2PGG A;  3E83 A;  3AK3 A;  3OEE G;  2ADP A;  2NN4 A;  3UKM A;  1K3E A;  1RPR A;  3ZHQ A;  4DUY O;  1K33 A;  4L8J A;  2UUB O;  2DQ3 A;  1XNQ O;  4GLX A;  3KZI Z;  3STZ C;  2YS8 A;  2P4V A;  5GON A;  4DW0 A;  1URF A;  5A2Q N;  4B7E A;  3QO8 A;  2UXB B;  2GSM B;  1NTK H;  2QWN B;  1GM9 A;  4JI8 B;  1D2D A;  2WPD G;  5L3E A;  3ZRS A;  1BGY H;  1NT2 B;  1H2S B;  4ABM A;  3ZMT A;  2ZXW B;  2ZE6 A;  2IH1 C;  4FMT A;  3W7X A;  5EBW C;  3K79 A;  4GYC B;  5EZY A;  2GDS A;  4IL6 Z;  4GX1 A;  1YF2 A;  3FFQ A;  4I50 A;  4DUY B;  3HKC B;  4TOI A;  4JI5 O;  4MVS A;  1NH2 B;  2L35 A;  3RYF B;  1JFF B;  1U96 A;  3T1H O;  4UUJ C;  4BW9 A;  1US6 A;  2GV9 A;  1YCI A;  2NR5 A;  5C93 A;  1G6U A;  5B66 Z;  2QDO A;  1ZLZ A;  3CSX A;  1KC8 W;  5KHG A;  5IYD O;  1SQF A;  2P7T C;  4RUE A;  4PDR A;  5AG2 A;  1XL4 A;  1ZAU A;  3FYE B;  1V54 B;  5FPR A;  1SQP H;  4LF9 O;  4JI5 B;  4JI7 O;  4LF6 O;  2UUA O;  2IW5 A;  5EBL C;  4MVR A;  5H9C A;  2YXY A;  3T1H B;  4NTY A;  3SPC A;  3T1Y O;  2Y69 B;  4X88 A;  1SC5 B;  3APQ A;  1ZX3 A;  5JJN B;  1VQP V;  1LUV A;  1S76 D;  2YIB D;  1Z2G A;  3JAW A;  1R3J C;  1DK1 A;  3SGI A;  3CS5 A;  5JWP A;  2QM4 A;  1KB9 F;  5JH7 A;  5ITZ B;  5LYJ B;  3OMI B;  1VF5 B;  5LA6 B;  2WLK A;  4LF6 B;  2M7W A;  1BE3 H;  3QO7 A;  1AR1 B;  4J10 A;  3T1Y B;  1KU9 A;  3CC2 V;  3ABK C;  3CWB H;  1YJW V;  1TUE B;  1QNM A;  3FYI B;  3FKS G;  1O9H A;  1DF4 A;  3CCV V;  3QO5 A;  4JI2 O;  3RT3 C;  4N21 A;  3CC7 V;  2DW4 A;  1H2G A;  1ORQ C;  3D36 C;  5IYZ B;  4LF5 O;  3ML0 A;  5IY5 C;  2WLI B;  5EK0 A;  5LGN A;  1KD1 W;  4WFA V;  1R6K A;  3E22 B;  1Q6I A;  4KXR A;  2A0L A;  5B1B B;  4EFE A;  1QLN A;  2Y48 A;  4I55 B;  1GN6 A;  3HKD A;  4JI0 O;  4W4L A;  1UPG A;  5BR8 O;  1XMQ O;  4GX2 A;  1PV0 A;  1CEZ A;  4JI2 B;  5B1O A;  3OMN B;  4LF5 B;  1WJZ A;  5BZB A;  2Q7E A;  1NTM H;  3OR7 C;  3UO2 A;  4FFB A;  3P3P A;  2JK5 C;  2QM8 A;  2Q8V A;  1FKA O;  1IUR A;  1M57 C; 
#chains in the Genus database with same CATH homology
 3CCL V;  1QCE A;  3A0R A;  2EZO A;  3ZMS A;  4P2Z A;  2ZDI A;  2IH3 C;  1VQ4 V;  4QPK A;  2D3O W;  1FFT B;  4JTC B;  4JAU A;  3TK1 A;  3ZN1 A;  2DYS B;  1Q7Y W;  3F7V C;  3K03 A;  1YI2 V;  2X6C A;  2LP7 A;  2HLD G;  1VQ6 V;  4UV9 A;  1NJI W;  1K4D C;  4UXN A;  3ZN0 A;  1NR7 A;  4Z1M G;  5E1A C;  3SPI A;  3CCU V;  4MSW C;  1YSC A;  4WFE A;  2X7R B;  3JD3 A;  3W7U A;  2QEX V;  4LBE C;  1OCR B;  3OM3 B;  1I5Y A;  1RPO A;  5J9P C;  4PA7 A;  1Q86 W;  1GMG A;  3MHH C;  1K8A W;  3E8F A;  1W2B U;  1OCO C;  3OE7 G;  1SER A;  2JEX A;  2EIL B;  3ABU A;  2H8P C;  2ATK C;  3OW2 U;  2IU0 A;  4JF3 A;  1QLE B;  4MTX A;  1GM7 A;  5H6R A;  5HFM A;  2DYR B;  2HVK C;  3IC7 A;  2X6A A;  4MVZ A;  3W7T A;  5L3B A;  3F7Y C;  4R8C A;  1M57 B;  1IXM A;  1P7B A;  3CP1 A;  3K04 A;  4J9Z B;  2HFE C;  1M56 C;  1WPX A;  1DF5 A;  2B1G A;  4UVB A;  1MOF A;  5LHH A;  1AI6 A;  3AG2 C;  4PEL A;  1SZT A;  3AG4 C;  5B1A C;  3STL C;  1Q82 W;  4MVQ A;  3HPL C;  1VQ7 V;  4BW5 A;  1JQ0 A;  1KQS U;  3F5W C;  4EKW A;  2P67 A;  1S72 V;  1VQ8 V;  1BHA A;  3E86 A;  2OT5 A;  1MG1 A;  4PA4 A;  4MTF A;  1K4C C;  3X2Q C;  2HJF C;  1YIJ V;  3JYC A;  1ARO P;  3SPJ A;  1OCO B;  3ABL C;  5FL7 G;  3CCJ V;  3JCZ A;  3OEH G;  1G4Y B;  1FXH A;  1YTF B;  1DTO A;  3CXC U;  2WLH A;  3CC4 V;  1BL8 A;  2WLJ A;  3G6E V;  2XAG A;  2ZXW C;  1F4M A;  3E35 A;  4RAI A;  1QR9 A;  1M56 B;  4CZZ A;  3ETG A;  3E8G A;  3AG2 B;  2AHZ A;  2C2A A;  1VQO V;  5LGU A;  3AG4 B;  4WFB V;  2EIK C;  5B1A B;  2HVJ C;  4ASU G;  3CCS V;  4GCZ A;  3SYQ A;  3IGA C;  2WWW A;  4OXS A;  3FB5 C;  5B3S C;  1NH2 D;  1ROP A;  5L3D A;  1E1R G;  3NXS A;  4UVA A;  4GT1 A;  1NBM G;  3SPG A;  4WF9 V;  3OGC C;  3RW0 A;  4MS2 A;  1FS0 G;  1YIT V;  4XDJ A;  4WCE V;  3X2Q B;  4QE7 A;  2OCC C;  3ZRV A;  3K08 A;  4PDL A;  3LSQ A;  3ABL B;  3SYC A;  3B8N A;  5KA5 A;  1THZ A;  3OUF A;  1YJN V;  4PA9 A;  3G4S V;  1R6N A;  4R50 A;  3SYA A;  4JGS A;  4JTD B;  5IYC O;  5IY5 B;  3B77 A;  2Q68 A;  4JAV A;  2PI4 A;  1OCZ C;  2B1I A;  1NKD A;  2QE7 G;  4GX0 A;  2XND G;  4QNH B;  3LSS A;  4Q20 A;  2A79 B;  2DWE C;  3ASN C;  4PA6 A;  3D3I A;  3CYO A;  4PDV A;  3K3W A;  5L3C A;  1R3K C;  1BMF G;  4LP8 A;  3B8M A;  3ZRX A;  4XDK A;  3HB3 B;  4MTG A;  2WAM A;  2ZDI C;  5DM6 V;  3R65 A;  2K1E A;  4E2L A;  2EIK B;  1AI5 A;  3SPH A;  1NQT A;  4WFG A;  4RQF A;  3I55 V;  5L3F A;  5B3S B;  2NNU A;  3KG2 A;  4XDL A;  2EIJ C;  1AJP A;  4MVU A;  1PL0 A;  2Q67 A;  3EHB B;  4TSF G;  3E8B A;  4BIZ A;  5IDJ A;  3ETD A;  1R3I C;  2OCC B;  2YEV B;  3MHS C;  1HWY A;  3ZMV A;  1GKF A;  3CCE V;  4LCU C;  1OZ0 A;  3M99 B;  5LBQ A;  5CN0 A;  4RUF A;  2ZQM A;  4FK5 C;  1H8E G;  3SYO A;  1EFR G;  2ZR2 A;  4BIU A;  3W7W A;  2OTL V;  4I9W A;  1LNQ A;  4MVO A;  4DO2 A;  1OCC C;  2WLI A;  3AG1 C;  4G2K A;  1I5X A;  1PKX A;  4JYC A;  3E8H A;  2HKO A;  1CPY A;  3ABT A;  2BOC C;  1OCZ B;  1VQ5 V;  2W0F C;  3LNM B;  4HYO A;  2JJ2 G;  3K9A A;  4WFH A;  3ASN B;  2JIZ G;  4R7C A;  1YTF D;  1Y66 A;  2EIM C;  5LGT A;  4F4L A;  5CMU A;  2HG5 C;  3H01 A;  4FPP A;  1S77 D;  1GM8 A;  2AHY A;  2IJJ A;  1AJN A;  1V55 C;  5EC2 C;  2UXX A;  4GX5 A;  4UVC A;  1EZJ A;  1YJ9 V;  3K06 A;  4UV8 A;  3CCR V;  3OR6 C;  3T1C A;  1PNK A;  3CCM V;  1K73 W;  2V7Q G;  2EIJ B;  3W7S A;  1S5H C;  5CBH A;  1Q81 W;  3EFF K;  1Y4M A;  2P6J A;  2DQ0 A;  4LC1 A;  3ABM C;  1K34 A;  1JX9 A;  5KUM A;  3I56 V;  3OUS A;  1NVP B;  1WLE A;  1P4R A;  2WLL B;  1PD3 A;  4KUM A;  2WLM A;  3RVY A;  1GK9 A;  2ZR3 A;  1G8M A;  1KP2 A;  4G27 B;  5KA6 A;  3MD0 A;  3D36 A;  4BAY A;  3JD2 A;  1W0K G;  3VOU A;  3ZCC A;  1CP9 A;  3AEI A;  4H33 A;  3TCU A;  2KB1 A;  3SYP A;  2QA4 V;  1K97 A;  1RM1 C;  1OCC B;  3AG1 B;  3K0G A;  4MW8 A;  3ZMU A;  2CK3 G;  3ASO C;  1PNM A;  3OFN G;  4HZ3 A;  3CME V;  1AI7 A;  2NLJ C;  1H8H G;  1FXK C;  3E83 A;  5CBF A;  3OEE G;  1E1Q G;  2EIM B;  1NVP D;  1SET A;  4U7O A;  3RVZ A;  4JYB A;  3LDE A;  3UKM A;  1K3E A;  4JPR A;  4MW3 A;  1MAB G;  1RPR A;  2B5U A;  4QJF B;  5CA3 A;  1M1K W;  4R6Z A;  1JPX A;  3IFX A;  1AJQ A;  1M9N A;  1VQ9 V;  4P9O A;  1K33 A;  3CMA V;  1COW G;  2DQ3 A;  5LHI A;  1YHQ V;  4QPJ A;  3STZ C;  2DWD C;  2P90 A;  2Q6A A;  1S0V A;  2A9H A;  3E2E A;  1PNL A;  3ZIA G;  4HAM A;  3QO8 A;  2LFS A;  3T2M A;  3P30 A;  2GSM B;  4QIW F;  4MVM A;  2XAH A;  4TT3 G;  1GM9 A;  3ABM B;  4X89 A;  2GHY A;  3CCQ V;  1V54 C;  2WPD G;  4TWK A;  5L3E A;  3ZRS A;  3ZRW B;  1K92 A;  4I5S A;  1AI4 A;  3DGE A;  4PA3 A;  3ZMZ A;  4P30 A;  4WFF A;  3ZMT A;  2ZXW B;  5LHG A;  2IH1 C;  4FMT A;  3W7X A;  4FJC C;  5EBW C;  3K79 A;  2HR3 A;  2ZD9 A;  1RM1 B;  1SRY A;  2Y69 C;  4GX1 A;  3AG3 C;  1R73 A;  4KP4 A;  1OHH G;  1KEC A;  1FXK B;  1SES A;  5IYB O;  2QKS A;  1F4N A;  2JJ1 G;  4MVS A;  1L1F A;  2IJH A;  1NH2 B;  4RQE A;  1VQL V;  4N23 A;  1VQN V;  4MTO A;  3JD0 A;  3VBB A;  2W6J G;  1W0J G;  4UUJ C;  3JD1 A;  3WFV A;  4ZKI A;  3DTU B;  4G28 B;  5C93 A;  4H37 A;  1QR8 A;  1E79 G;  1DLB A;  5GW7 A;  1F51 A;  2X6B A;  1JVM A;  5IYD O;  3GB7 C;  3T4Z A;  2ITD C;  1J95 A;  2P7T C;  1KC8 W;  4RUE A;  3GWO A;  2UXN A;  1K5Q A;  4PDR A;  1S3J A;  2JEU A;  1XL4 A;  4J9Y B;  3FYE B;  2WLL A;  1V54 B;  2ITC C;  2Z5U A;  4L87 A;  5H6Q A;  2IU3 A;  2XAF A;  1ENV A;  2IW5 A;  3LDC A;  3UM7 A;  3P32 A;  5EBL C;  4MVR A;  5H9C A;  1K5S A;  2EIN C;  3LUT B;  3OAA G;  3BY6 A;  3SPC A;  2LFR A;  2Y69 B;  4X88 A;  2BOB C;  1QVF U;  1NR1 A;  3AG3 B;  1JCH A;  1QBZ A;  2R9R B;  1F23 A;  4DXW A;  1VQP V;  1S76 D;  3SJQ C;  2EZP A;  5B1B C;  1R3J C;  3OMA B;  4PDM A;  1VQK V;  4FIP C;  4X8A A;  1KKD A;  2QM7 A;  3ZJZ A;  1ZWI C;  3OMI B;  4QE9 A;  2WLK A;  3FB7 C;  2H94 A;  2M7W A;  1JJ2 U;  3QO7 A;  1KP3 A;  3RBZ A;  2XAS A;  4P9P A;  1AR1 B;  2EJR A;  1GO3 F;  3CC2 V;  2F43 G;  3QNE A;  3ABK C;  4RO2 A;  1YJW V;  1EBO A;  1TUE B;  3FYI B;  1QVG U;  3ZRW A;  3FKS G;  3K0D A;  4XBF A;  2V1D A;  3JD4 A;  1DF4 A;  2W6I G;  3ETE A;  3CCV V;  3QO5 A;  1VQM V;  1K9M W;  4N21 A;  3CC7 V;  3WG7 C;  2EIN B;  2DW4 A;  4KFM A;  1H2G A;  1ORQ C;  2X0L A;  1M90 W;  3ML0 A;  2IJK A;  4JAS A;  5IY5 C;  2WLI B;  5EK0 A;  1FXK A;  5LGN A;  2Q69 A;  1KD1 W;  1MSW D;  4WFA V;  1R6K A;  2DYS C;  2MK3 A;  5EBM C;  1V55 B;  1JOY A;  2A0L A;  4MT8 A;  5B1B B;  2XAJ A;  1QLN A;  1BHB A;  2Y48 A;  4JTA B;  3TET A;  2PI5 A;  5KUK A;  3CD6 V;  1GTO A;  1XL6 A;  2XAQ A;  2FTK A;  2QTO A;  3T4D A;  2OTJ V;  3E89 A;  3BEH A;  5DN6 G;  4GX2 A;  3CPW U;  2WLN A;  1B6Q A;  1CEZ A;  5HFL A;  2YSU B;  1OCR C;  1N8R W;  2Z3Y A;  2YEV A;  2R9I A;  5B1O A;  4YXW G;  3G71 V;  1H38 A;  3OMN B;  5B1N A;  2WSS G;  4ZBM A;  4CBC A;  2EIL C;  1FXV A;  2EBO A;  1K7D A;  3ABK B;  5BZB A;  3PJS K;  2IJI A;  3FB8 C;  5CBG A;  3OR7 C;  2JDI G;  3LDD A;  1QLE C;  5EC1 C;  2XOK G;  3ASO B;  2DYR C;  2JK5 C;  5L3G A;  2QM8 A;  3WG7 B;  1UJW B;  4U7N A;  1R3L C;  3FB6 C;  1M57 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...