1M90W

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m90W00
1VQMV 1YIJV 3CCVV 3CMEV 1YJNV 1VQNV 1VQ9V 1KC8W 1YJWV 4WFBV 3CCRV 2D3OW 1Q7YW 1NJIW 4WF9V 3CC7V 3CXCU 3G4SV 1KQSU 1R73A 2OTJV 3CC2V 1KD1W 4WCEV 3I56V 1S72V 1YJ9V 3G71V 1VQPV 3CPWU 2OTLV 3CCJV 3CCLV 1YHQV 3CCEV 3CCSV 3OW2U 1Q81W 1VQ8V 1VQ4V 3CC4V 1QVFU 1N8RW 1VQOV 1VQ6V 1VQKV 1YITV 3CCQV 2QEXV 1K9MW 3CD6V 3CMAV 3CCMV 1W2BU 1M1KW 1K8AW 1VQ5V 1QVGU 4WFAV 1YI2V 1Q82W 1Q86W 1VQLV 1VQ7V 3I55V 1M90W 1JJ2U 3CCUV 3G6EV 2QA4V 5DM6V 1K73W
chains in the Genus database with same CATH superfamily
4EFBA 3FAVB 2F93B 2YXHA 2Q69A 1BQZA 4B3MO 3T2MA 4NXMO 2JEUA 4DK1A 2YEVA 3CCSV 1B04A 3K06A 4X1KA 4GKKB 1OCCB 4X1IB 3SJBC 2ZM6O 4J11A 4PHZA 2CTPA 5B5EZ 2ADPA 1MA1A 4O4LB 3VQYA 3JASA 5KMGA 1RFYA 5KAFZ 1MZEA 1BE3H 4W4KA 1K5QA 4DXWA 3A0BZ 5JQGA 1SERA 5L3GA 1KMIZ 4JGSA 1YZBA 5EBMC 4PV1B 1HNWO 2VRZA 2JS3A 1SETA 4CH3A 1M5IA 2XT9A 1PP9H 4Z1MG 3ZMVA 3ZHTA 5CBHA 4U3JA 3RN4A 2FB5A 1WA8A 4JI7O 1SESA 4J9ZB 1N4CA 4WCEV 1Y4MA 3ASOB 4B7EA 3D3QA 4AILC 4FFBB 3CC4V 4CH5A 1B6QA 3SJCC 1IXBA 1WAZA 5IYZA 3SGIA 4PDVA 2EIJC 2CH7A 2IH3C 2W6IG 3BA9A 4MS2A 1TVKA 1Z5WA 1FXKA 3Q4HB 1QR8A 5IYBO 4X9QA 3AK3A 1AP6A 1OJHA 1R73A 4DV5O 2QJ1A 1B06A 1F51A 2UXBO 1G6UA 3JSLA 5CB4A 3ZX6A 4YY3O 3OMIB 5IJ9B 5FNVB 1JJ2U 1KECA 5KHJA 1VMGA 1IVSA 3MD0A 4X8AA 5GONA 1I94O 3UT5B 1XMOO 2QKSA 4TQFA 2CGNA 4P9OA 3HKEB 2ZT9B 3GWKC 2CK3G 4IYHA 1IXMA 4PD4F 3F7VC 3ZHQA 2KG7A 2P67A 1M1KW 3FB6C 1IBLO 2N05A 2CGOA 3CJHA 4BIOA 2ZKOA 3T1YB 1JFFA 1Q82W 3S3WA 3P3PA 3CCVV 1YJNV 1VQ9V 2P22C 4J41A 3LSQA 5EZYB 1JX9A 5J2TB 1GN6A 4QJFB 4KUMA 1XQ8A 3L75H 5CA1A 2XASA 2RN9A 4O2BB 5JJNB 5FL7G 3L9DA 3ZRVA 3LDEA 5GTHZ 2QR4A 4NKGB 4IIJB 2NN4A 4A5UB 2QA4V 1AJQA 4H0LB 1BHBA 4O4JB 3MAQA 1V9PA 1S72V 4IYIA 4K3AA 4DW0A 4K8XA 3ZMZA 1WPBA 3G80A 3EVKA 3EFFK 4X1KB 4DV6O 1Q3EA 4JV5B 1P4RA 1US6A 2WA4A 1D5NA 1F4MA 5EIBC 4J42A 5DM6V 2UXDB 2MK3A 1TAEA 2PI5A 3B40A 4YJ3A 4PA3A 2QKCA 3O65A 2OTLV 3RYFB 1AJPA 1TUBB 2Y0IA 3JAMN 1KB9F 4JASA 2HLDG 4UCRA 4LWSA 4YIOA 2X6AA 3SYOA 5J2UA 3GVMA 1Z2GA 1N36B 4LH7A 4O2AA 3BRCA 4QGPA 3ZRWB 3RYIB 3CC7V 1R3JC 1L8DA 4AQYO 2ZDIC 3WU2Z 3TK1A 1F7YA 1K7DA 2Y69B 4CC5A 5DECA 4CZZA 3K5MA 3F5TA 2PTMA 1K9MW 2AGAA 5KLVH 4ZKIA 3FB7C 4JI1O 4U7NA 3JAWB 3KKYA 5IJ0A 3HKBA 3K0GA 4YHHB 1K4CC 5LYJA 1KQSU 1WP7A 3CHXA 2VQFB 5JCOA 3T1HO 1AB3A 4QPKA 5KHHA 3OTOB 1CEZA 2DN9A 2X6CA 2UXCB 4MW3A 3ZCCA 4NVPA 3HB3B 1V54C 1VP7A 2YDEA 1VIBA 3ZRXA 2Z3YA 2QTOA 4LCUC 2LGWA 2WAMA 4JI4O 1Q6HA 2WLLB 3VBBA 2X0LA 4YIPA 5E79Z 4X64B 1SS3A 5CBFA 4MTOA 1CXZB 3BCCH 4DV2O 1QVGU 4WFAV 4B3RB 4YJ2A 3R65A 2ZCEA 2B1GA 2XTAA 4UB6Z 2YC0A 2UUBO 3FFQA 1Y67A 2BTQB 3K79A 1LUVA 4DR5B 4PI0A 3K5OA 2DWEC 1HNZB 1S77D 1Z5VA 3ETGA 1N33B 1R1BA 2C2AA 1E1QG 4X62B 1QLNA 1NS1A 1R3KC 4FMTA 1ENVA 4X62O 1PNKA 4Z2WA 5LMUB 1IDSA 2HEPA 5BY1A 3QO7A 2LW1A 2W0FC 3A8TA 2GTAA 3W7UA 4GKKO 3D36C 4G2KA 4L8JA 3TCUA 2LFSA 2V1DA 2EJ7A 5CMUA 4GX0A 5KUKA 1K73W 1NVPD 1WP8A 2Y4UA 2VWKA 3VOUA 5B1BC 3CRMA 1M9NA 1VF7A 1VQ4V 3IFXA 1YITV 5EIBD 1J95A 5K1XA 5LOVB 2HJDA 4X1YB 2LP7A 1OHHG 4I0XB 1ZX3A 4NYKA 4QE7A 1XDCA 1H2LA 1TUEB 1JQ0A 5BMVB 1YSCA 1YJ9V 3TJTA 5IYDO 4JAAA 4N21A 1GTOA 3L70H 2ZIMA 1BGYH 2ZR3A 4FK5C 4HBNA 4R8CA 1E1RG 2DMXA 1P84F 2ZXWB 4LC1A 3O9OA 3FAVA 3KCXA 1EFRG 5K1PA 2Q4PA 1JMKC 3SPCA 1AP5A 2KKWA 3G71V 3PJSK 1MSWD 3CYOA 1YCIA 3LUTB 2GUZB 1FFXB 4JZGA 3OUFA 2UXXA 4X1IA 3CCMV 3ZJZA 2A7WA 2ARHA 4O4LA 4HZ3A 3B2EE 1OCZB 1NVPB 4LFBB 3LDCA 5B1AB 5CA3A 4GLXA 4BIZA 4DO2A 3DTUB 2LJ2A 2YS8A 1YXBA 3CPWU 1XNQO 1BS3A 2O57A 1GMGA 3E8GA 1GN2A 2N04A 1M57C 3AG7A 2EIKB 4DRXB 2FL4A 3FYEB 3T1YO 2PYJA 5BZBA 3K0DA 1RSOB 4DR2B 4CBCA 1K34A 2V7QG 3AG3C 3G67A 3AK2A 3ZN0A 4FFBA 2E5LB 3CRAA 1GK9A 2X6BA 3CXHF 1OCRC 1IZ3A 3T4DA 3W7SA 1PL4A 3QO5A 4BR6A 1FYJA 3ZIAG 1SQQH 1QR9A 2Q6AA 5B66Z 3Q4HA 5KX5A 1TA8A 4GX1A 3BA8A 1WB7A 4LF4B 1VQ8V 2WLJA 2Q0OC 1IBMB 1JJOA 4JV5O 1H2SB 4LFCB 4E4EA 4X20B 5IJ9A 5FNVA 5L3EA 4DV3B 3ABKC 2UXDO 5JVDB 4UCSA 4GX5A 4DR7B 3CCRV 1JCHA 3UT5A 1X4TA 1AR5A 3ETQA 2ZQMA 3CRQA 3UKMA 3HKEA 1LUWA 1I0HA 2K1EA 3TXSA 3SYCA 2XUMA 1R6TA 2DOSA 3B4SA 1HR0B 4FM2A 4I50B 1V54B 1M90W 2ZIOA 3LNNA 1N36O 2Q7HA 3P32A 5EZYA 2A79B 3WG7C 5J2TA 5JJJB 3I56V 2HJFC 5LMNB 3H1KH 2Y48A 4WFEA 3ABUA 1PD3A 3P30A 4MVSA 4D7SA 4O2BA 2VQEB 3BFRA 1NI8A 3CEIA 3ZHUA 3KZIZ 3K08A 1HNXB 1ZWIC 2IU3A 4IIJA 1QLEC 3CCUV 5H2FZ 2M7WA 1GO3F 1QQCA 3E8HA 3CP1A 4YHHO 2AZ2A 4O4JA 3DSQA 3JD0A 2QWQB 1H2MA 2VQFO 2WLIB 2EILC 1BSMA 1GM7A 4MW8A 4DR1O 4HYOA 2DWDC 1ZL8B 1QCEA 2P4KA 4X88A 3H1IH 4NTWA 3OTOO 2UXCO 4I55B 2KB1A 2JGUA 1AI6A 3E35A 4TT3G 2ZE5A 3B8MA 3QTCA 1P7GA 3T1CA 2WPDG 4PA7A 3RYFA 1TUBA 2F1MA 3T4ZA 3W7XA 4JYAB 3E8BA 3L73H 1TGOA 4X64O 2PY5A 2MW2B 2F23A 5KUMA 2CE4A 2AHYA 3G6BA 3I55V 4B3RO 1WNSA 1Y76B 1MZFA 5B1BB 2QWPB 3ZRWA 3RYIA 4BIUA 2BTOA 1BT8A 2A0LA 1Q5OA 3L74H 2OTJV 2P4VA 3CB2A 3N27A 4KHPB 3E86A 4TV8B 3ZHVA 4FPPA 3AK1A 1SZTA 1JPXA 3SR2C 4DR5O 2RNBA 2GSMB 1AR1B 1HNZO 3DGEA 3E2EA 2P90A 4WBNB 1W2BU 1N33O 5LHGA 3C90A 3JAWA 3K9AA 2RCVA 4DR4B 4O4IB 3JD4A 1AROP 1E79G 4JI5B 4WFBV 4RQFA 4DK0A 3WB0A 5LMUO 5KX5B 4ICGA 5EK0A 3MHSC 1ZAUA 2F66C 1R3LC 4UVAA 2DYSB 5HFLA 1PKXA 2RQ6A 2HFEC 1S3JA 2LO1A 1K3EA 3ABMC 2E3CA 2R70A 3C3SA 3WB2A 3OEHG 2ODMA 4QE9A 4U3FH 1HDJA 2IJKA 5F2VO 2WLLA 4Q6GA 1XNQB 3CCJV 3BY6A 2AHZA 1MMMA 4PDLA 2YXYA 3ABLC 3U10A 2YI9A 4QIWF 2OYQA 2VWJA 4EEQA 4J7KA 1Y74B 2QWRB 2ZXWC 1YEWA 3OUSA 4DV0B 1KP2A 2JS5A 3SPJA 5FPRA 4ZHQB 1M57B 3ZHSA 2BTQA 2K9PA 4H44B 1W0KG 1H2GA 3HR0A 4H13B 2PYLA 1PM9A 1OCZC 2NR5A 1V55C 1Q6UA 4OPHA 3AG3B 1SQPH 4P9PA 1M93A 5B1AC 1AR4A 4JYBA 1VARA 1OV9A 5H9CA 5GTIZ 3RFRA 2IM9A 1OCRB 2Q73A 2OIEA 3L71H 1NQTA 1MNGA 3E8FA 1NKDA 5C93A 1VQKV 2EIKC 2Q67A 1NR7A 1OZ0A 3M7MX 2D3OW 2WA3A 4LFBO 1YDXA 1EN5A 4K8ZA 3U11A 4NXNB 2QKAA 1JVMA 3SYQA 3I5DA 3RT3C 4AHCA 1K92A 4UCTA 2R9AA 3GB7C 1G8MA 1OCOC 1VQ5V 4GYCB 3ABKB 5J9PC 5LOVA 3HKDB 4RWUA 4X1YA 3C3TA 1XBLA 5CA0B 4I0XA 4ZI7A 2YIBA 4TQDA 3HKCB 1NJIW 1D2DA 2EZOA 2EIMB 2JJ2G 4DR2O 5BMVA 4FM1A 1VQPV 4FIPC 4JTCB 2OCHA 2GBOA 3ZEDA 4HAMA 5IDJA 2E5LO 4LFAB 3QO8A 4MTGA 1NH2D 2GDSA 4FFKA 3K5LA 4UV9A 4WFFA 4XDKA 2EBOA 3SPIA 3WG7B 4O4HB 2FKXA 3K03A 4ABMA 1A32A 4DUZB 2QDOA 1FD9A 1YHQV 2GUZA 4LF4O 1FFXA 4ASUG 4BW9A 4DR1B 2Q5ZA 2PZSA 3ZN1A 1IBMO 3ZS8C 1QLEB 3B09A 5B3SC 4LFCO 1SA0B 3JSNA 4KFMA 2IH1C 4GX2A 4ZOLB 4DV3O 1GM8A 2ADQB 4DR7O 1XUQA 3JARB 4JI6B 2XOKG 2YIAA 3E89A 2EILB 1O9HA 3LNMB 2ZD9A 1GRJA 2ZNJA 4I4TB 5EYPB 1XILA 4B7KA 5L3FA 1HR0O 4LF7B 4KP4A 2ZE8A 3N2KB 4DRXA 4JAVA 2JIZG 2YIBD 4MTFA 3MDSA 3OT7A 1RSOA 2OT5A 2ATKC 1PNLA 1Y66A 5LMNO 1LR1A 2M6YA 1N34B 4WFGA 4X65B 2VQEO 2LW7A 3BABA 1HNXO 2HR3A 1NH2B 3M99B 1YIJV 3CSXA 3ICXA 1KC8W 3AG4B 3E22B 2NLJC 2ZDIA 4MVMA 5IY5C 3CC2V 4FLVA 2UUCB 2DW4A 2F4VB 4LF9B 4I9WA 1KP3A 3UO3A 4QPJA 5IYCO 3FX7A 3BHPA 4MVQA 2XAGA 2EINB 4X20A 3IC7A 4LF6B 3W7WA 5JVDA 1GN3A 1K5SA 2RDCA 3JD2A 1NT2B 4DV1B 2PF4E 5KAIZ 2FMLA 2JEXA 3SJAC 2ZR2A 3OW2U 3KCYA 4JYAO 4UUJC 5IWAB 1SZXA 1Y6XA 2H8PC 4I50A 1DK1A 3ABMB 5EC2C 1GAXA 5FPOA 2QM4A 4ZI7B 2B5UA 1S5JA 3OMAB 3ZBHA 1CPYA 5KHIA 2IU0A 3RYHB 1I7FA 1WB8A 3JD3A 5TISZ 4KHPO 4I5SA 2IBZH 3J7AU 2QE7G 1KKCA 3ABLB 3TXQA 2DYSC 1KU9A 4F4LA 4TUYB 3JALB 4LNUA 4DR4O 4JZ2A 4JI5O 3RW0A 4GT1A 1QHTA 2G38A 3SPGA 4CS3A 1JOYA 3CCEV 2WLIA 5KA5A 1MSDA 3RVYA 1EZVH 1ORQC 1Q90D 1ZL8A 4JYYA 3HPLC 5LA6B 5LP6C 3CWBH 4K35A 4I55A 4PDRA 5KA6A 2LFRA 4B3SB 5GW7A 1YJWV 1V55B 3H01A 1FKAO 4DR3B 1THZA 1H2KA 2FTKA 1KD1W 1YTFD 4RQEA 1S5LZ 2BSKB 4NR1A 1VQ6V 3D36A 2N74A 2FYUH 3CX5F 4LF5B 4FLTA 2JGDB 3LSUA 1SQGA 3K3WA 1Y76A 5DEDA 4WF9V 1BHAA 4UVBA 3UM7A 1VF6C 4DV0O 2LQTA 5FLXN 1H38A 4TV8A 5B1NA 2AXTZ 2HKOA 2H3OA 5E1AC 1OCOB 2BCCH 5LHIA 2Z0AA 2WLNA 2QEXV 4JI3B 4BAYA 4H37A 1NR1A 4WBNA 5A9GA 3VQWA 4CS2A 4CS4A 4P2ZA 2ZNIA 3D3IA 4O4IA 4LP8A 1MOFA 5JH7B 3RWRD 2RMKB 3ASNB 1SQXH 4UFZA 2IJJA 4YXWG 1BCCH 4FLUA 1EBOA 1I5XA 4UCVA 1ZUQA 4AI8A 3CMAV 4R7CA 1B3QA 3UCSC 3SYAA 3OAAG 4MVUA 4KL1A 3OE7G 2XAQA 3OGCC 2NNUA 4RUFA 3JATB 3W7TA 1SKVA 2QSAA 4GKJB 2EIMC 4NXNO 4TV9B 1YTFB 4XDJA 2HP8A 4UXNA 3K9SA 2HVKC 5B3SB 1GH6A 3QG5A 3SPHA 5LXTB 4X89A 5IT9N 2ZINA 4MVZA 2UUAB 5BR8B 1XNRB 2YXLA 2P6JA 1AVMA 1Y74A 3A0RA 1NZ6A 2W6JG 3VQVA 1U97A 3RYCB 2QTSA 1S76D 4J10A 3DXRB 4ZHQA 3BAAA 3ABTA 4OX9B 3QNEA 2Z5UA 4FM0A 4LFAO 4D7TA 4IHJB 3JAKB 2ITDC 2UU9B 4FJCC 4LNUB 1DF5A 3CE2A 1FXKC 1J5EB 2JDIG 1ZLZA 1RPRA 4I9QA 3B77A 1SRYA 4DUZO 1ZTEA 4E2LA 5C8YB 3BEHA 3OEEG 4NB5A 2E75B 4HNAB 3SYPA 1X59A 3APQA 5IY5B 3FD9A 4JI6O 3DC6A 1BMFG 4MVRA 2YICA 1SF9A 1QU7A 1DGSA 2DQ3A 2QM7A 1AI4A 1IX9A 1YVWA 1BL8A 4LF7O 3HKDA 3CRCA 1K33A 5CA0A 1NTMH 1AILA 3HKCA 1H8HG 5ITZB 3AG4C 3SDLA 4K0KB 1F4NA 4FLYA 3PN1A 3R66A 4NTXA 5AG2A 4JF3A 4JPRA 1N34O 5CN0A 4X66B 4X65O 1FJGB 3K59A 4XDLA 3TETA 4JI0B 5IE9A 3ML0A 1JR9A 3X2QC 2EINC 4MSWC 2WLHA 1GN4A 2R9IA 4O4HA 4PJ0Z 5EBWC 4J7JA 4UB8Z 3QVNA 3WFVA 1O9GA 2OCCC 2UUCO 4CC6A 1N8RW 2F4VO 4LF9O 2YUAA 4FLXA 4H33A 1PNMA 1VQ7V 1SA0A 4LF6O 1L1FA 4ZOLA 5LGNA 1VQNV 3A2FA 3K57A 4IT5A 1N32B 3JARA 3L72H 1P7BA 4DV1O 3UQ8A 2CTRA 3EXAA 4I4TA 3OMNB 5EYPA 2Q68A 3CRRA 5IWAO 4MT8A 2DJVA 5LP6B 4UV8A 5DN6G 3ZMUA 3FB8C 1F23A 3N2KA 3AG2B 3N2GB 4EKWA 1XOUA 3LSSA 3ZMSA 4FLZA 4WFHA 4JI8B 1WPXA 1I08A 4OXSA 1H8EG 2PI4A 4LF8O 4NTYA 3STZC 3UO2A 4I7ZB 2EULA 2CTWA 2IJHA 2WSSG 1FXVA 4R6ZA 3E22A 3AG1C 3RGBA 4DW1A 1HWYA 2JVDA 3BPZA 5JCOC 1KBHA 3SJQC 3CS5A 2L6LA 1FS0G 3F7YC 4DV7B 4B3TB 4DUYB 1YI2V 4JI2B 5JJEB 2HHHB 3G6EV 5B1OA 2JK5C 1L0NH 3U0ZA 3KG2A 2DYRB 1XMQB 4B3SO 4DR3O 2E76B 1XREA 4IL6Z 2YEVB 2B1IA 5D5QA 1VEWA 4TOIA 4F6RA 3CCLV 2D2CB 1Q81W 4BW5A 3CCQV 4J80A 5KHGA 2YSUB 4LF5O 3JASB 5KMGB 2EX3A 4J9YB 1Q7YW 2GTSA 5JQGB 5A2QN 2A06H 5KHKA 5LGTA 3ASNC 1KYOF 2CUGA 3RYHA 1FXHA 3CD6V 2ZE6A 4JI3O 4G27B 2ITCC 1G1XB 4TUYA 4U3JB 1WA8B 2Q0AA 3JALA 1XHZA 3CMEV 4KXRA 4DV4B 2Q8VA 3H1HH 2QGNA 3NR7A 3F5WC 1COWG 4G28B 2VS0A 1IBKB 3IAYA 2P5OA 2WLKA 1R3IC 2YIDA 1L0LH 4DR6B 2Q7EA 1EN4A 4UCUA 1S0VA 1KKDA 3ZHRA 5IYZB 1MABG 5LA6A 2CH7B 2BOCC 4CH6A 1TVKB 4RAIA 3J80N 1FXKB 3APOA 4B3MB 4NXMB 1HP8A 4ZBMA 1QNMA 3B8NA 1XL6A 1SQVH 3K04A 4GKJO 4EFEA 5CB4B 2X7RB 2BSKA 2ZM6B 4P30A 1AI7A 1HW7A 3FYIB 3OR7C 4R50A 2P7TC 2L35A 1I5YA 3ZRSA 2JGDA 4PELA 5GONB 1RM1C 1XNRO 2UUAO 5BR8O 1LNQA 1M56C 1XL4A 4FZ0A 1WN7A 4UCOA 2DE0X 4FVMA 2PUSA 1SQBH 3IJ4A 4F6EA 2QWNB 2GHYA 1HNWB 1WLEA 2ETNA 3NXSA 2OWOA 1PPJH 1AI5A 4OX9O 2KG7B 2ILMA 3CJHB 1JFFB 4PDMA 5H6QA 4JI7B 2UU9O 5JH7A 1BQ0A 5H6RA 1H2NA 2F95B 5CA1B 1J5EO 2PGGA 1N0NA 4JYCA 2QWOB 2EZPA 1UFIA 1Q43A 2QM8A 4Q20A 1OCCC 1R6KA 2A3QA 3X2QB 1Q86W 3H1LH 2KQXA 2WWWA 2XNDG 3TGUH 4DV5B 3JATA 2ZE7A 2OCCB 4JTDB 4RO2A 2UXBB 3S3XA 4F6RB 4TV9A 4EB6A 2XAFA 1DF4A 4YY3B 3MHHC 1DLBA 2YI8A 5LGUA 5L3DA 2EIJB 3JYCA 4L87A 4FLWA 5CBGA 1EN6A 2BOBC 4ZIBA 5LXTA 2GV9A 1SC5B 4PA6A 4C7UA 1VQMV 4OPAA 2CDYA 3OR6C 1I94B 4TSFG 1XMOB 4YJ3B 3ETEA 4RUEA 5JWPA 1JA8A 4GZRB 3G4SV 1G4YB 2CTQA 4CH4A 3RYCA 2E74B 3ASOC 3LDDA 4K0KO 3DXRA 1QVFU 4GUNA 1Q8IA 1FPOA 3OTFA 4LF8B 4X66O 1IBLB 1FJGO 1NBMG 1SQFA 1W0JG 4LWSB 4W4LA 5J2UB 4IHJA 4JI0O 4O2AB 4U7OA 5LL6Y 3JAKA 2B9ZA 2XAJA 1GKFA 1NTKH 2Q7GA 1PV0A 3ZMTA 2HVJC 3OFNG 5C8YA 5BXZA 4UVCA 2XHBA 1ROPA 2Q9LA 4HNAA 3E83A 5IJ0B 3HKBB 2IJIA 4LR3A 2V4DA 3DC5A 1PL0A 3D8CA 3AG2C 5LYJB 3AG1B 3M8AA 1URFA 3JCUZ 1N32O 4OGQB 1P49A 2AW9A 4PA4A 3OD4A 1BZKA 4JAUA 4PA9A 5L3CA 2EJRA 4DV6B 4FZ1A 2HG5C 2BE3A 1XI1A 5L3BA 1YF2A 2JJ1G 3K5NA 4DYLA 4LH6A 4BWAA 3OGIB 5D5PA 3JD1A 3FB5C 1QBZA 1K97A 4Z1VA 5ITZA 1MG1A 4JI8O 3JCZA 1GM9A 1ZSPA 1VQOV 5HFMA 3EHBB 4GCZA 2W0XA 4YJ2B 2CAZC 2R72A 1DTOA 3OM3B 3CXCU 1U96A 1WJZA 2DYRC 4AQYB 1S5HC 2WLMA 1RP3B 2P06A 2F43G 3H1JH 5LBQA 3RVZA 1NU1H 3GWOA 4JI1B 4PI2A 4DV7O 4B3TO 4DUYO 5H5NA 4JI2O 2HHHO 4N23A 2JRIA 1UPGA 1NTZH 4JTAB 4B08A 2A9HA 1XMQO 1UJWB 3WB1A 1M4UA 3VQXA 3IC9A 3T1HB 2Y0PA 4EB6B 2Y4TA 1Q6IA 2UXNA 1AJNA 4MVOA 2OIGA 1K4DC 3AEIA 5LP6A 1VQLV 2RJZA 1FAFA 3RBZA 3P3NA 3K58A 4J7ZA 4QNHB 1N0JA 3N2GA 1XEQA 4JI4B 4IGGA 1EZJA 3A0HZ 1RPOA 2Y69C 1XHXA 3QF7A 2IW5A 2DQ0A 2AZ0A 4DV2B 2R9RB 1K8AW 1RM1B 4XBFA 1M56B 2XAHA 4LBEC 1R6NA 1IURA 1KUQA 4MTXA 3STLC 2UUBB 1VF6A 4DV4O 1VF5B 1D5AA 3IGAC 1CP9A 3FKSG 1IBKO 3BVOA 3THOA 3H9VA 1FFTB 2KSDA 1T5EA 3ETDA 4DR6O 5EBLC 4D6TH 1EM1A 2H94A 3J81N 5LHHA 1W59A 5EC1C 2LGQA 4TWKA
chains in the Genus database with same CATH topology
1OCZB 2IJHA 4JAVA 2JIZG 2WSSG 1NVPB 4MTFA 1FXVA 2Q69A 4R6ZA 3T2MA 3LDCA 5B1AB 5CA3A 4BIZA 3AG1C 2JEUA 4DO2A 2OT5A 3DTUB 2ATKC 3CPWU 1PNLA 1HWYA 1Y66A 1GMGA 2YEVA 3CCSV 3E8GA 3K06A 1M57C 4WFGA 3SJQC 1OCCB 1FS0G 2EIKB 3F7YC 1YI2V 3FYEB 2HR3A 3G6EV 5B1OA 2JK5C 1NH2B 3M99B 1YIJV 3KG2A 2DYRB 5BZBA 1K5QA 1KC8W 4DXWA 3AG4B 3K0DA 2NLJC 2ZDIA 4MVMA 5IY5C 1SERA 4CBCA 3CC2V 1K34A 2V7QG 5L3GA 3AG3C 4JGSA 2YEVB 2B1IA 3ZN0A 5EBMC 3CCLV 2DW4A 1Q81W 4I9WA 1KP3A 4BW5A 1GK9A 1SETA 2X6BA 4QPJA 3CCQV 5IYCO 1OCRC 3T4DA 4Z1MG 3ZMVA 4MVQA 3QO5A 2XAGA 2EINB 3W7SA 3IC7A 2YSUB 5CBHA 3ZIAG 3W7WA 1QR9A 2Q6AA 4J9YB 1Q7YW 1K5SA 1SESA 3JD2A 4J9ZB 4GX1A 5LGTA 4WCEV 1Y4MA 3ASNC 3ASOB 2JEXA 2ZR2A 1VQ8V 3OW2U 3CC4V 1FXHA 2WLJA 1B6QA 3CD6V 4UUJC 2H8PC 4G27B 3ABMB 2ITCC 5EC2C 4PDVA 2EIJC 5L3EA 2IH3C 2W6IG 3ABKC 4MS2A 3CMEV 4GX5A 1FXKA 5IYBO 1QR8A 3CCRV 1JCHA 2B5UA 2ZQMA 3OMAB 1R73A 3F5WC 1COWG 1CPYA 4G28B 3UKMA 2IU0A 1F51A 2K1EA 3JD3A 3SYCA 4I5SA 2WLKA 1R3IC 2QE7G 3ABLB 2DYSC 3OMIB 4F4LA 1S0VA 1V54B 1JJ2U 1KECA 1KKDA 1M90W 1MABG 2BOCC 3MD0A 4X8AA 4RAIA 1FXKB 3P32A 2QKSA 3RW0A 4GT1A 2A79B 4ZBMA 3WG7C 3SPGA 4P9OA 3B8NA 1XL6A 3I56V 3K04A 2HJFC 2CK3G 1IXMA 1JOYA 2Y48A 4WFEA 3ABUA 2WLIA 1PD3A 5KA5A 3P30A 4MVSA 3CCEV 2X7RB 3RVYA 4P30A 1AI7A 1ORQC 3F7VC 3K08A 2P67A 1M1KW 1ZWIC 3FB6C 3FYIB 3HPLC 3OR7C 2IU3A 4R50A 1QLEC 3CCUV 2P7TC 1Q82W 3ZRSA 1I5YA 2M7WA 4PELA 1RM1C 4PDRA 1GO3F 5KA6A 1LNQA 1M56C 3CCVV 1XL4A 2LFRA 3E8HA 1YJNV 3CP1A 3LSQA 1V55B 5GW7A 1YJWV 1VQ9V 3H01A 1JX9A 1THZA 4QJFB 4KUMA 2FTKA 1KD1W 1YTFD 3JD0A 4RQEA 2XASA 2GHYA 2WLIB 2EILC 1VQ6V 1WLEA 1GM7A 3D36A 4MW8A 4HYOA 3NXSA 2DWDC 5FL7G 1QCEA 3ZRVA 1AI5A 3LDEA 4X88A 4PDMA 2QA4V 5H6QA 1AJQA 3K3WA 2KB1A 1BHBA 1AI6A 4WF9V 1BHAA 4UVBA 3E35A 4TT3G 5H6RA 3UM7A 3B8MA 3T1CA 1S72V 2WPDG 4PA7A 3ZMZA 1H38A 3T4ZA 3W7XA 4JYCA 3E8BA 2HKOA 5B1NA 3EFFK 2EZPA 5E1AC 1OCOB 2QEXV 5LHIA 2WLNA 1P4RA 2QM8A 1F4MA 4Q20A 5KUMA 4BAYA 1OCCC 1R6KA 4H37A 1NR1A 3X2QB 1Q86W 2AHYA 3I55V 5DM6V 4P2ZA 3D3IA 2MK3A 2PI5A 4LP8A 1MOFA 5B1BB 3ZRWA 2WWWA 3ASNB 4PA3A 4BIUA 2XNDG 2A0LA 2OTJV 2OCCB 4JTDB 4RO2A 2OTLV 2IJJA 1AJPA 3E86A 4FPPA 4YXWG 1JPXA 1SZTA 2XAFA 1DF4A 1EBOA 1I5XA 3MHHC 1DLBA 3CMAV 4JASA 2GSMB 4R7CA 5LGUA 1AR1B 3E2EA 2HLDG 2EIJB 3DGEA 2P90A 3JYCA 4L87A 5L3DA 5CBGA 2BOBC 5LHGA 1W2BU 2X6AA 3SYAA 3OAAG 3SYOA 4MVUA 4PA6A 3K9AA 1VQMV 3OR6C 3JD4A 1AROP 4TSFG 3OE7G 2XAQA 1E79G 2NNUA 3OGCC 4RUFA 4WFBV 3ETEA 3ZRWB 4RQFA 4RUEA 3CC7V 3G4SV 3W7TA 1G4YB 1R3JC 2ZDIC 5EK0A 3MHSC 3TK1A 1K7DA 1R3LC 2Y69B 2EIMC 4UVAA 1YTFB 2DYSB 3ASOC 4XDJA 3LDDA 4CZZA 1RM1B 5HFLA 1QVFU 1PKXA 4UXNA 2HVKC 5B3SB 2HFEC 1K9MW 1S3JA 4ZKIA 1NBMG 3FB7C 3SPHA 1W0JG 4U7NA 4X89A 1K3EA 3ABMC 4MVZA 4U7OA 2XAJA 3K0GA 2P6JA 1K4CC 1GKFA 3A0RA 3OEHG 4QE9A 2W6JG 1KQSU 2IJKA 2WLLA 1S76D 3ZMTA 3CCJV 3BY6A 2AHZA 2HVJC 4PDLA 3OFNG 3ABTA 4QPKA 3QNEA 4UVCA 3ABLC 2Z5UA 1ROPA 1CEZA 2X6CA 4MW3A 3ZCCA 3HB3B 1V54C 2ITDC 3E83A 4QIWF 2IJIA 4FJCC 1PL0A 3ZRXA 1DF5A 2Z3YA 3AG2C 1FXKC 2QTOA 2ZXWC 3AG1B 4LCUC 2WAMA 3OUSA 1KP2A 2JDIG 2WLLB 1RPRA 4PA4A 3SPJA 3B77A 2X0LA 4JAUA 1M57B 1SRYA 3VBBA 4PA9A 5L3CA 2EJRA 4E2LA 5CBFA 4MTOA 1W0KG 3BEHA 3OEEG 2HG5C 5L3BA 1H2GA 2JJ1G 4WFAV 1QVGU 3SYPA 3R65A 2B1GA 3JD1A 1OCZC 5IY5B 3FB5C 1V55C 3AG3B 1QBZA 4P9PA 1K97A 1BMFG 4MVRA 5B1AC 1MG1A 4JYBA 3K79A 2DQ3A 5H9CA 3JCZA 1GM9A 1VQOV 1OCRB 2QM7A 2DWEC 1S77D 1AI4A 1NQTA 3ETGA 5HFMA 3EHBB 1BL8A 2C2AA 1E1QG 3E8FA 4GCZA 1NKDA 5C93A 1VQKV 1QLNA 2EIKC 1R3KC 4FMTA 1ENVA 2Q67A 1K33A 1PNKA 1NR7A 1OZ0A 2D3OW 1DTOA 3OM3B 3CXCU 1H8HG 3QO7A 2DYRC 1S5HC 2WLMA 3AG4C 1JVMA 2F43G 1F4NA 2W0FC 3SYQA 4JF3A 3W7UA 4JPRA 1K92A 5CN0A 5LBQA 4G2KA 3TCUA 3GB7C 3RVZA 1G8MA 1OCOC 3GWOA 2LFSA 4XDLA 3TETA 1VQ5V 2V1DA 5CMUA 3ABKB 5J9PC 3ML0A 4GX0A 5KUKA 4N23A 1K73W 3X2QC 1NVPD 2EINC 4JTAB 3VOUA 4MSWC 2A9HA 1NJIW 2WLHA 1UJWB 2R9IA 5B1BC 2EZOA 2EIMB 2JJ2G 5EBWC 1M9NA 1VQPV 3WFVA 4FIPC 2OCCC 4JTCB 1VQ4V 3IFXA 4HAMA 1N8RW 5IDJA 1YITV 2UXNA 1AJNA 1J95A 3QO8A 4H33A 4MTGA 4MVOA 1PNMA 1NH2D 1K4DC 3AEIA 1VQ7V 1VQLV 4UV9A 1L1FA 4WFFA 3RBZA 4XDKA 2EBOA 2LP7A 1OHHG 5LGNA 1VQNV 3SPIA 4QNHB 3WG7B 4QE7A 3K03A 1TUEB 1P7BA 1EZJA 1JQ0A 1YSCA 1YJ9V 5IYDO 1YHQV 1RPOA 4N21A 2Y69C 1GTOA 3OMNB 4ASUG 2IW5A 2Q68A 3ZN1A 2DQ0A 2R9RB 4MT8A 1QLEB 5B3SC 2ZR3A 4FK5C 1K8AW 4R8CA 4KFMA 1E1RG 2IH1C 4GX2A 4UV8A 4XBFA 3ZMUA 5DN6G 1M56B 3FB8C 1F23A 2XAHA 3AG2B 4LBEC 2ZXWB 1R6NA 4LC1A 1GM8A 4MTXA 3STLC 4EKWA 1EFRG 3LSSA 2XOKG 3ZMSA 3IGAC 3E89A 3SPCA 1CP9A 3FKSG 2EILB 3G71V 3LNMB 3PJSK 2ZD9A 4WFHA 3CYOA 1MSWD 3LUTB 1WPXA 1FFTB 3OUFA 4OXSA 1H8EG 2UXXA 3ETDA 5L3FA 2PI4A 5EBLC 3CCMV 2H94A 3STZC 3ZJZA 5LHHA 4KP4A 5EC1C 4HZ3A 4TWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM V;  1YIJ V;  3CCV V;  3CME V;  1YJN V;  1VQN V;  1VQ9 V;  1KC8 W;  1YJW V;  4WFB V;  3CCR V;  2D3O W;  1Q7Y W;  1NJI W;  4WF9 V;  3CC7 V;  3CXC U;  3G4S V;  1KQS U;  1R73 A;  2OTJ V;  3CC2 V;  1KD1 W;  4WCE V;  3I56 V;  1S72 V;  1YJ9 V;  3G71 V;  1VQP V;  3CPW U;  2OTL V;  3CCJ V;  3CCL V;  1YHQ V;  3CCE V;  3CCS V;  3OW2 U;  1Q81 W;  1VQ8 V;  1VQ4 V;  3CC4 V;  1QVF U;  1N8R W;  1VQO V;  1VQ6 V;  1VQK V;  1YIT V;  3CCQ V;  2QEX V;  1K9M W;  3CD6 V;  3CMA V;  3CCM V;  1W2B U;  1M1K W;  1K8A W;  1VQ5 V;  1QVG U;  4WFA V;  1YI2 V;  1Q82 W;  1Q86 W;  1VQL V;  1VQ7 V;  3I55 V;  1M90 W;  1JJ2 U;  3CCU V;  3G6E V;  2QA4 V;  5DM6 V;  1K73 W; 
#chains in the Genus database with same CATH topology
 4EFB A;  3FAV B;  2F93 B;  2YXH A;  2Q69 A;  1BQZ A;  4B3M O;  3T2M A;  4NXM O;  2JEU A;  4DK1 A;  2YEV A;  3CCS V;  1B04 A;  3K06 A;  4X1K A;  4GKK B;  1OCC B;  4X1I B;  3SJB C;  2ZM6 O;  4J11 A;  4PHZ A;  2CTP A;  5B5E Z;  2ADP A;  1MA1 A;  4O4L B;  3VQY A;  3JAS A;  5KMG A;  1RFY A;  5KAF Z;  1MZE A;  1BE3 H;  4W4K A;  1K5Q A;  4DXW A;  3A0B Z;  5JQG A;  1SER A;  5L3G A;  1KMI Z;  4JGS A;  1YZB A;  5EBM C;  4PV1 B;  1HNW O;  2VRZ A;  2JS3 A;  1SET A;  4CH3 A;  1M5I A;  2XT9 A;  1PP9 H;  4Z1M G;  3ZMV A;  3ZHT A;  5CBH A;  4U3J A;  3RN4 A;  2FB5 A;  1WA8 A;  4JI7 O;  1SES A;  4J9Z B;  1N4C A;  4WCE V;  1Y4M A;  3ASO B;  4B7E A;  3D3Q A;  4AIL C;  4FFB B;  3CC4 V;  4CH5 A;  1B6Q A;  3SJC C;  1IXB A;  1WAZ A;  5IYZ A;  3SGI A;  4PDV A;  2EIJ C;  2CH7 A;  2IH3 C;  2W6I G;  3BA9 A;  4MS2 A;  1TVK A;  1Z5W A;  1FXK A;  3Q4H B;  1QR8 A;  5IYB O;  4X9Q A;  3AK3 A;  1AP6 A;  1OJH A;  1R73 A;  4DV5 O;  2QJ1 A;  1B06 A;  1F51 A;  2UXB O;  1G6U A;  3JSL A;  5CB4 A;  3ZX6 A;  4YY3 O;  3OMI B;  5IJ9 B;  5FNV B;  1JJ2 U;  1KEC A;  5KHJ A;  1VMG A;  1IVS A;  3MD0 A;  4X8A A;  5GON A;  1I94 O;  3UT5 B;  1XMO O;  2QKS A;  4TQF A;  2CGN A;  4P9O A;  3HKE B;  2ZT9 B;  3GWK C;  2CK3 G;  4IYH A;  1IXM A;  4PD4 F;  3F7V C;  3ZHQ A;  2KG7 A;  2P67 A;  1M1K W;  3FB6 C;  1IBL O;  2N05 A;  2CGO A;  3CJH A;  4BIO A;  2ZKO A;  3T1Y B;  1JFF A;  1Q82 W;  3S3W A;  3P3P A;  3CCV V;  1YJN V;  1VQ9 V;  2P22 C;  4J41 A;  3LSQ A;  5EZY B;  1JX9 A;  5J2T B;  1GN6 A;  4QJF B;  4KUM A;  1XQ8 A;  3L75 H;  5CA1 A;  2XAS A;  2RN9 A;  4O2B B;  5JJN B;  5FL7 G;  3L9D A;  3ZRV A;  3LDE A;  5GTH Z;  2QR4 A;  4NKG B;  4IIJ B;  2NN4 A;  4A5U B;  2QA4 V;  1AJQ A;  4H0L B;  1BHB A;  4O4J B;  3MAQ A;  1V9P A;  1S72 V;  4IYI A;  4K3A A;  4DW0 A;  4K8X A;  3ZMZ A;  1WPB A;  3G80 A;  3EVK A;  3EFF K;  4X1K B;  4DV6 O;  1Q3E A;  4JV5 B;  1P4R A;  1US6 A;  2WA4 A;  1D5N A;  1F4M A;  5EIB C;  4J42 A;  5DM6 V;  2UXD B;  2MK3 A;  1TAE A;  2PI5 A;  3B40 A;  4YJ3 A;  4PA3 A;  2QKC A;  3O65 A;  2OTL V;  3RYF B;  1AJP A;  1TUB B;  2Y0I A;  3JAM N;  1KB9 F;  4JAS A;  2HLD G;  4UCR A;  4LWS A;  4YIO A;  2X6A A;  3SYO A;  5J2U A;  3GVM A;  1Z2G A;  1N36 B;  4LH7 A;  4O2A A;  3BRC A;  4QGP A;  3ZRW B;  3RYI B;  3CC7 V;  1R3J C;  1L8D A;  4AQY O;  2ZDI C;  3WU2 Z;  3TK1 A;  1F7Y A;  1K7D A;  2Y69 B;  4CC5 A;  5DEC A;  4CZZ A;  3K5M A;  3F5T A;  2PTM A;  1K9M W;  2AGA A;  5KLV H;  4ZKI A;  3FB7 C;  4JI1 O;  4U7N A;  3JAW B;  3KKY A;  5IJ0 A;  3HKB A;  3K0G A;  4YHH B;  1K4C C;  5LYJ A;  1KQS U;  1WP7 A;  3CHX A;  2VQF B;  5JCO A;  3T1H O;  1AB3 A;  4QPK A;  5KHH A;  3OTO B;  1CEZ A;  2DN9 A;  2X6C A;  2UXC B;  4MW3 A;  3ZCC A;  4NVP A;  3HB3 B;  1V54 C;  1VP7 A;  2YDE A;  1VIB A;  3ZRX A;  2Z3Y A;  2QTO A;  4LCU C;  2LGW A;  2WAM A;  4JI4 O;  1Q6H A;  2WLL B;  3VBB A;  2X0L A;  4YIP A;  5E79 Z;  4X64 B;  1SS3 A;  5CBF A;  4MTO A;  1CXZ B;  3BCC H;  4DV2 O;  1QVG U;  4WFA V;  4B3R B;  4YJ2 A;  3R65 A;  2ZCE A;  2B1G A;  2XTA A;  4UB6 Z;  2YC0 A;  2UUB O;  3FFQ A;  1Y67 A;  2BTQ B;  3K79 A;  1LUV A;  4DR5 B;  4PI0 A;  3K5O A;  2DWE C;  1HNZ B;  1S77 D;  1Z5V A;  3ETG A;  1N33 B;  1R1B A;  2C2A A;  1E1Q G;  4X62 B;  1QLN A;  1NS1 A;  1R3K C;  4FMT A;  1ENV A;  4X62 O;  1PNK A;  4Z2W A;  5LMU B;  1IDS A;  2HEP A;  5BY1 A;  3QO7 A;  2LW1 A;  2W0F C;  3A8T A;  2GTA A;  3W7U A;  4GKK O;  3D36 C;  4G2K A;  4L8J A;  3TCU A;  2LFS A;  2V1D A;  2EJ7 A;  5CMU A;  4GX0 A;  5KUK A;  1K73 W;  1NVP D;  1WP8 A;  2Y4U A;  2VWK A;  3VOU A;  5B1B C;  3CRM A;  1M9N A;  1VF7 A;  1VQ4 V;  3IFX A;  1YIT V;  5EIB D;  1J95 A;  5K1X A;  5LOV B;  2HJD A;  4X1Y B;  2LP7 A;  1OHH G;  4I0X B;  1ZX3 A;  4NYK A;  4QE7 A;  1XDC A;  1H2L A;  1TUE B;  1JQ0 A;  5BMV B;  1YSC A;  1YJ9 V;  3TJT A;  5IYD O;  4JAA A;  4N21 A;  1GTO A;  3L70 H;  2ZIM A;  1BGY H;  2ZR3 A;  4FK5 C;  4HBN A;  4R8C A;  1E1R G;  2DMX A;  1P84 F;  2ZXW B;  4LC1 A;  3O9O A;  3FAV A;  3KCX A;  1EFR G;  5K1P A;  2Q4P A;  1JMK C;  3SPC A;  1AP5 A;  2KKW A;  3G71 V;  3PJS K;  1MSW D;  3CYO A;  1YCI A;  3LUT B;  2GUZ B;  1FFX B;  4JZG A;  3OUF A;  2UXX A;  4X1I A;  3CCM V;  3ZJZ A;  2A7W A;  2ARH A;  4O4L A;  4HZ3 A;  3B2E E;  1OCZ B;  1NVP B;  4LFB B;  3LDC A;  5B1A B;  5CA3 A;  4GLX A;  4BIZ A;  4DO2 A;  3DTU B;  2LJ2 A;  2YS8 A;  1YXB A;  3CPW U;  1XNQ O;  1BS3 A;  2O57 A;  1GMG A;  3E8G A;  1GN2 A;  2N04 A;  1M57 C;  3AG7 A;  2EIK B;  4DRX B;  2FL4 A;  3FYE B;  3T1Y O;  2PYJ A;  5BZB A;  3K0D A;  1RSO B;  4DR2 B;  4CBC A;  1K34 A;  2V7Q G;  3AG3 C;  3G67 A;  3AK2 A;  3ZN0 A;  4FFB A;  2E5L B;  3CRA A;  1GK9 A;  2X6B A;  3CXH F;  1OCR C;  1IZ3 A;  3T4D A;  3W7S A;  1PL4 A;  3QO5 A;  4BR6 A;  1FYJ A;  3ZIA G;  1SQQ H;  1QR9 A;  2Q6A A;  5B66 Z;  3Q4H A;  5KX5 A;  1TA8 A;  4GX1 A;  3BA8 A;  1WB7 A;  4LF4 B;  1VQ8 V;  2WLJ A;  2Q0O C;  1IBM B;  1JJO A;  4JV5 O;  1H2S B;  4LFC B;  4E4E A;  4X20 B;  5IJ9 A;  5FNV A;  5L3E A;  4DV3 B;  3ABK C;  2UXD O;  5JVD B;  4UCS A;  4GX5 A;  4DR7 B;  3CCR V;  1JCH A;  3UT5 A;  1X4T A;  1AR5 A;  3ETQ A;  2ZQM A;  3CRQ A;  3UKM A;  3HKE A;  1LUW A;  1I0H A;  2K1E A;  3TXS A;  3SYC A;  2XUM A;  1R6T A;  2DOS A;  3B4S A;  1HR0 B;  4FM2 A;  4I50 B;  1V54 B;  1M90 W;  2ZIO A;  3LNN A;  1N36 O;  2Q7H A;  3P32 A;  5EZY A;  2A79 B;  3WG7 C;  5J2T A;  5JJJ B;  3I56 V;  2HJF C;  5LMN B;  3H1K H;  2Y48 A;  4WFE A;  3ABU A;  1PD3 A;  3P30 A;  4MVS A;  4D7S A;  4O2B A;  2VQE B;  3BFR A;  1NI8 A;  3CEI A;  3ZHU A;  3KZI Z;  3K08 A;  1HNX B;  1ZWI C;  2IU3 A;  4IIJ A;  1QLE C;  3CCU V;  5H2F Z;  2M7W A;  1GO3 F;  1QQC A;  3E8H A;  3CP1 A;  4YHH O;  2AZ2 A;  4O4J A;  3DSQ A;  3JD0 A;  2QWQ B;  1H2M A;  2VQF O;  2WLI B;  2EIL C;  1BSM A;  1GM7 A;  4MW8 A;  4DR1 O;  4HYO A;  2DWD C;  1ZL8 B;  1QCE A;  2P4K A;  4X88 A;  3H1I H;  4NTW A;  3OTO O;  2UXC O;  4I55 B;  2KB1 A;  2JGU A;  1AI6 A;  3E35 A;  4TT3 G;  2ZE5 A;  3B8M A;  3QTC A;  1P7G A;  3T1C A;  2WPD G;  4PA7 A;  3RYF A;  1TUB A;  2F1M A;  3T4Z A;  3W7X A;  4JYA B;  3E8B A;  3L73 H;  1TGO A;  4X64 O;  2PY5 A;  2MW2 B;  2F23 A;  5KUM A;  2CE4 A;  2AHY A;  3G6B A;  3I55 V;  4B3R O;  1WNS A;  1Y76 B;  1MZF A;  5B1B B;  2QWP B;  3ZRW A;  3RYI A;  4BIU A;  2BTO A;  1BT8 A;  2A0L A;  1Q5O A;  3L74 H;  2OTJ V;  2P4V A;  3CB2 A;  3N27 A;  4KHP B;  3E86 A;  4TV8 B;  3ZHV A;  4FPP A;  3AK1 A;  1SZT A;  1JPX A;  3SR2 C;  4DR5 O;  2RNB A;  2GSM B;  1AR1 B;  1HNZ O;  3DGE A;  3E2E A;  2P90 A;  4WBN B;  1W2B U;  1N33 O;  5LHG A;  3C90 A;  3JAW A;  3K9A A;  2RCV A;  4DR4 B;  4O4I B;  3JD4 A;  1ARO P;  1E79 G;  4JI5 B;  4WFB V;  4RQF A;  4DK0 A;  3WB0 A;  5LMU O;  5KX5 B;  4ICG A;  5EK0 A;  3MHS C;  1ZAU A;  2F66 C;  1R3L C;  4UVA A;  2DYS B;  5HFL A;  1PKX A;  2RQ6 A;  2HFE C;  1S3J A;  2LO1 A;  1K3E A;  3ABM C;  2E3C A;  2R70 A;  3C3S A;  3WB2 A;  3OEH G;  2ODM A;  4QE9 A;  4U3F H;  1HDJ A;  2IJK A;  5F2V O;  2WLL A;  4Q6G A;  1XNQ B;  3CCJ V;  3BY6 A;  2AHZ A;  1MMM A;  4PDL A;  2YXY A;  3ABL C;  3U10 A;  2YI9 A;  4QIW F;  2OYQ A;  2VWJ A;  4EEQ A;  4J7K A;  1Y74 B;  2QWR B;  2ZXW C;  1YEW A;  3OUS A;  4DV0 B;  1KP2 A;  2JS5 A;  3SPJ A;  5FPR A;  4ZHQ B;  1M57 B;  3ZHS A;  2BTQ A;  2K9P A;  4H44 B;  1W0K G;  1H2G A;  3HR0 A;  4H13 B;  2PYL A;  1PM9 A;  1OCZ C;  2NR5 A;  1V55 C;  1Q6U A;  4OPH A;  3AG3 B;  1SQP H;  4P9P A;  1M93 A;  5B1A C;  1AR4 A;  4JYB A;  1VAR A;  1OV9 A;  5H9C A;  5GTI Z;  3RFR A;  2IM9 A;  1OCR B;  2Q73 A;  2OIE A;  3L71 H;  1NQT A;  1MNG A;  3E8F A;  1NKD A;  5C93 A;  1VQK V;  2EIK C;  2Q67 A;  1NR7 A;  1OZ0 A;  3M7M X;  2D3O W;  2WA3 A;  4LFB O;  1YDX A;  1EN5 A;  4K8Z A;  3U11 A;  4NXN B;  2QKA A;  1JVM A;  3SYQ A;  3I5D A;  3RT3 C;  4AHC A;  1K92 A;  4UCT A;  2R9A A;  3GB7 C;  1G8M A;  1OCO C;  1VQ5 V;  4GYC B;  3ABK B;  5J9P C;  5LOV A;  3HKD B;  4RWU A;  4X1Y A;  3C3T A;  1XBL A;  5CA0 B;  4I0X A;  4ZI7 A;  2YIB A;  4TQD A;  3HKC B;  1NJI W;  1D2D A;  2EZO A;  2EIM B;  2JJ2 G;  4DR2 O;  5BMV A;  4FM1 A;  1VQP V;  4FIP C;  4JTC B;  2OCH A;  2GBO A;  3ZED A;  4HAM A;  5IDJ A;  2E5L O;  4LFA B;  3QO8 A;  4MTG A;  1NH2 D;  2GDS A;  4FFK A;  3K5L A;  4UV9 A;  4WFF A;  4XDK A;  2EBO A;  3SPI A;  3WG7 B;  4O4H B;  2FKX A;  3K03 A;  4ABM A;  1A32 A;  4DUZ B;  2QDO A;  1FD9 A;  1YHQ V;  2GUZ A;  4LF4 O;  1FFX A;  4ASU G;  4BW9 A;  4DR1 B;  2Q5Z A;  2PZS A;  3ZN1 A;  1IBM O;  3ZS8 C;  1QLE B;  3B09 A;  5B3S C;  4LFC O;  1SA0 B;  3JSN A;  4KFM A;  2IH1 C;  4GX2 A;  4ZOL B;  4DV3 O;  1GM8 A;  2ADQ B;  4DR7 O;  1XUQ A;  3JAR B;  4JI6 B;  2XOK G;  2YIA A;  3E89 A;  2EIL B;  1O9H A;  3LNM B;  2ZD9 A;  1GRJ A;  2ZNJ A;  4I4T B;  5EYP B;  1XIL A;  4B7K A;  5L3F A;  1HR0 O;  4LF7 B;  4KP4 A;  2ZE8 A;  3N2K B;  4DRX A;  4JAV A;  2JIZ G;  2YIB D;  4MTF A;  3MDS A;  3OT7 A;  1RSO A;  2OT5 A;  2ATK C;  1PNL A;  1Y66 A;  5LMN O;  1LR1 A;  2M6Y A;  1N34 B;  4WFG A;  4X65 B;  2VQE O;  2LW7 A;  3BAB A;  1HNX O;  2HR3 A;  1NH2 B;  3M99 B;  1YIJ V;  3CSX A;  3ICX A;  1KC8 W;  3AG4 B;  3E22 B;  2NLJ C;  2ZDI A;  4MVM A;  5IY5 C;  3CC2 V;  4FLV A;  2UUC B;  2DW4 A;  2F4V B;  4LF9 B;  4I9W A;  1KP3 A;  3UO3 A;  4QPJ A;  5IYC O;  3FX7 A;  3BHP A;  4MVQ A;  2XAG A;  2EIN B;  4X20 A;  3IC7 A;  4LF6 B;  3W7W A;  5JVD A;  1GN3 A;  1K5S A;  2RDC A;  3JD2 A;  1NT2 B;  4DV1 B;  2PF4 E;  5KAI Z;  2FML A;  2JEX A;  3SJA C;  2ZR2 A;  3OW2 U;  3KCY A;  4JYA O;  4UUJ C;  5IWA B;  1SZX A;  1Y6X A;  2H8P C;  4I50 A;  1DK1 A;  3ABM B;  5EC2 C;  1GAX A;  5FPO A;  2QM4 A;  4ZI7 B;  2B5U A;  1S5J A;  3OMA B;  3ZBH A;  1CPY A;  5KHI A;  2IU0 A;  3RYH B;  1I7F A;  1WB8 A;  3JD3 A;  5TIS Z;  4KHP O;  4I5S A;  2IBZ H;  3J7A U;  2QE7 G;  1KKC A;  3ABL B;  3TXQ A;  2DYS C;  1KU9 A;  4F4L A;  4TUY B;  3JAL B;  4LNU A;  4DR4 O;  4JZ2 A;  4JI5 O;  3RW0 A;  4GT1 A;  1QHT A;  2G38 A;  3SPG A;  4CS3 A;  1JOY A;  3CCE V;  2WLI A;  5KA5 A;  1MSD A;  3RVY A;  1EZV H;  1ORQ C;  1Q90 D;  1ZL8 A;  4JYY A;  3HPL C;  5LA6 B;  5LP6 C;  3CWB H;  4K35 A;  4I55 A;  4PDR A;  5KA6 A;  2LFR A;  4B3S B;  5GW7 A;  1YJW V;  1V55 B;  3H01 A;  1FKA O;  4DR3 B;  1THZ A;  1H2K A;  2FTK A;  1KD1 W;  1YTF D;  4RQE A;  1S5L Z;  2BSK B;  4NR1 A;  1VQ6 V;  3D36 A;  2N74 A;  2FYU H;  3CX5 F;  4LF5 B;  4FLT A;  2JGD B;  3LSU A;  1SQG A;  3K3W A;  1Y76 A;  5DED A;  4WF9 V;  1BHA A;  4UVB A;  3UM7 A;  1VF6 C;  4DV0 O;  2LQT A;  5FLX N;  1H38 A;  4TV8 A;  5B1N A;  2AXT Z;  2HKO A;  2H3O A;  5E1A C;  1OCO B;  2BCC H;  5LHI A;  2Z0A A;  2WLN A;  2QEX V;  4JI3 B;  4BAY A;  4H37 A;  1NR1 A;  4WBN A;  5A9G A;  3VQW A;  4CS2 A;  4CS4 A;  4P2Z A;  2ZNI A;  3D3I A;  4O4I A;  4LP8 A;  1MOF A;  5JH7 B;  3RWR D;  2RMK B;  3ASN B;  1SQX H;  4UFZ A;  2IJJ A;  4YXW G;  1BCC H;  4FLU A;  1EBO A;  1I5X A;  4UCV A;  1ZUQ A;  4AI8 A;  3CMA V;  4R7C A;  1B3Q A;  3UCS C;  3SYA A;  3OAA G;  4MVU A;  4KL1 A;  3OE7 G;  2XAQ A;  3OGC C;  2NNU A;  4RUF A;  3JAT B;  3W7T A;  1SKV A;  2QSA A;  4GKJ B;  2EIM C;  4NXN O;  4TV9 B;  1YTF B;  4XDJ A;  2HP8 A;  4UXN A;  3K9S A;  2HVK C;  5B3S B;  1GH6 A;  3QG5 A;  3SPH A;  5LXT B;  4X89 A;  5IT9 N;  2ZIN A;  4MVZ A;  2UUA B;  5BR8 B;  1XNR B;  2YXL A;  2P6J A;  1AVM A;  1Y74 A;  3A0R A;  1NZ6 A;  2W6J G;  3VQV A;  1U97 A;  3RYC B;  2QTS A;  1S76 D;  4J10 A;  3DXR B;  4ZHQ A;  3BAA A;  3ABT A;  4OX9 B;  3QNE A;  2Z5U A;  4FM0 A;  4LFA O;  4D7T A;  4IHJ B;  3JAK B;  2ITD C;  2UU9 B;  4FJC C;  4LNU B;  1DF5 A;  3CE2 A;  1FXK C;  1J5E B;  2JDI G;  1ZLZ A;  1RPR A;  4I9Q A;  3B77 A;  1SRY A;  4DUZ O;  1ZTE A;  4E2L A;  5C8Y B;  3BEH A;  3OEE G;  4NB5 A;  2E75 B;  4HNA B;  3SYP A;  1X59 A;  3APQ A;  5IY5 B;  3FD9 A;  4JI6 O;  3DC6 A;  1BMF G;  4MVR A;  2YIC A;  1SF9 A;  1QU7 A;  1DGS A;  2DQ3 A;  2QM7 A;  1AI4 A;  1IX9 A;  1YVW A;  1BL8 A;  4LF7 O;  3HKD A;  3CRC A;  1K33 A;  5CA0 A;  1NTM H;  1AIL A;  3HKC A;  1H8H G;  5ITZ B;  3AG4 C;  3SDL A;  4K0K B;  1F4N A;  4FLY A;  3PN1 A;  3R66 A;  4NTX A;  5AG2 A;  4JF3 A;  4JPR A;  1N34 O;  5CN0 A;  4X66 B;  4X65 O;  1FJG B;  3K59 A;  4XDL A;  3TET A;  4JI0 B;  5IE9 A;  3ML0 A;  1JR9 A;  3X2Q C;  2EIN C;  4MSW C;  2WLH A;  1GN4 A;  2R9I A;  4O4H A;  4PJ0 Z;  5EBW C;  4J7J A;  4UB8 Z;  3QVN A;  3WFV A;  1O9G A;  2OCC C;  2UUC O;  4CC6 A;  1N8R W;  2F4V O;  4LF9 O;  2YUA A;  4FLX A;  4H33 A;  1PNM A;  1VQ7 V;  1SA0 A;  4LF6 O;  1L1F A;  4ZOL A;  5LGN A;  1VQN V;  3A2F A;  3K57 A;  4IT5 A;  1N32 B;  3JAR A;  3L72 H;  1P7B A;  4DV1 O;  3UQ8 A;  2CTR A;  3EXA A;  4I4T A;  3OMN B;  5EYP A;  2Q68 A;  3CRR A;  5IWA O;  4MT8 A;  2DJV A;  5LP6 B;  4UV8 A;  5DN6 G;  3ZMU A;  3FB8 C;  1F23 A;  3N2K A;  3AG2 B;  3N2G B;  4EKW A;  1XOU A;  3LSS A;  3ZMS A;  4FLZ A;  4WFH A;  4JI8 B;  1WPX A;  1I08 A;  4OXS A;  1H8E G;  2PI4 A;  4LF8 O;  4NTY A;  3STZ C;  3UO2 A;  4I7Z B;  2EUL A;  2CTW A;  2IJH A;  2WSS G;  1FXV A;  4R6Z A;  3E22 A;  3AG1 C;  3RGB A;  4DW1 A;  1HWY A;  2JVD A;  3BPZ A;  5JCO C;  1KBH A;  3SJQ C;  3CS5 A;  2L6L A;  1FS0 G;  3F7Y C;  4DV7 B;  4B3T B;  4DUY B;  1YI2 V;  4JI2 B;  5JJE B;  2HHH B;  3G6E V;  5B1O A;  2JK5 C;  1L0N H;  3U0Z A;  3KG2 A;  2DYR B;  1XMQ B;  4B3S O;  4DR3 O;  2E76 B;  1XRE A;  4IL6 Z;  2YEV B;  2B1I A;  5D5Q A;  1VEW A;  4TOI A;  4F6R A;  3CCL V;  2D2C B;  1Q81 W;  4BW5 A;  3CCQ V;  4J80 A;  5KHG A;  2YSU B;  4LF5 O;  3JAS B;  5KMG B;  2EX3 A;  4J9Y B;  1Q7Y W;  2GTS A;  5JQG B;  5A2Q N;  2A06 H;  5KHK A;  5LGT A;  3ASN C;  1KYO F;  2CUG A;  3RYH A;  1FXH A;  3CD6 V;  2ZE6 A;  4JI3 O;  4G27 B;  2ITC C;  1G1X B;  4TUY A;  4U3J B;  1WA8 B;  2Q0A A;  3JAL A;  1XHZ A;  3CME V;  4KXR A;  4DV4 B;  2Q8V A;  3H1H H;  2QGN A;  3NR7 A;  3F5W C;  1COW G;  4G28 B;  2VS0 A;  1IBK B;  3IAY A;  2P5O A;  2WLK A;  1R3I C;  2YID A;  1L0L H;  4DR6 B;  2Q7E A;  1EN4 A;  4UCU A;  1S0V A;  1KKD A;  3ZHR A;  5IYZ B;  1MAB G;  5LA6 A;  2CH7 B;  2BOC C;  4CH6 A;  1TVK B;  4RAI A;  3J80 N;  1FXK B;  3APO A;  4B3M B;  4NXM B;  1HP8 A;  4ZBM A;  1QNM A;  3B8N A;  1XL6 A;  1SQV H;  3K04 A;  4GKJ O;  4EFE A;  5CB4 B;  2X7R B;  2BSK A;  2ZM6 B;  4P30 A;  1AI7 A;  1HW7 A;  3FYI B;  3OR7 C;  4R50 A;  2P7T C;  2L35 A;  1I5Y A;  3ZRS A;  2JGD A;  4PEL A;  5GON B;  1RM1 C;  1XNR O;  2UUA O;  5BR8 O;  1LNQ A;  1M56 C;  1XL4 A;  4FZ0 A;  1WN7 A;  4UCO A;  2DE0 X;  4FVM A;  2PUS A;  1SQB H;  3IJ4 A;  4F6E A;  2QWN B;  2GHY A;  1HNW B;  1WLE A;  2ETN A;  3NXS A;  2OWO A;  1PPJ H;  1AI5 A;  4OX9 O;  2KG7 B;  2ILM A;  3CJH B;  1JFF B;  4PDM A;  5H6Q A;  4JI7 B;  2UU9 O;  5JH7 A;  1BQ0 A;  5H6R A;  1H2N A;  2F95 B;  5CA1 B;  1J5E O;  2PGG A;  1N0N A;  4JYC A;  2QWO B;  2EZP A;  1UFI A;  1Q43 A;  2QM8 A;  4Q20 A;  1OCC C;  1R6K A;  2A3Q A;  3X2Q B;  1Q86 W;  3H1L H;  2KQX A;  2WWW A;  2XND G;  3TGU H;  4DV5 B;  3JAT A;  2ZE7 A;  2OCC B;  4JTD B;  4RO2 A;  2UXB B;  3S3X A;  4F6R B;  4TV9 A;  4EB6 A;  2XAF A;  1DF4 A;  4YY3 B;  3MHH C;  1DLB A;  2YI8 A;  5LGU A;  5L3D A;  2EIJ B;  3JYC A;  4L87 A;  4FLW A;  5CBG A;  1EN6 A;  2BOB C;  4ZIB A;  5LXT A;  2GV9 A;  1SC5 B;  4PA6 A;  4C7U A;  1VQM V;  4OPA A;  2CDY A;  3OR6 C;  1I94 B;  4TSF G;  1XMO B;  4YJ3 B;  3ETE A;  4RUE A;  5JWP A;  1JA8 A;  4GZR B;  3G4S V;  1G4Y B;  2CTQ A;  4CH4 A;  3RYC A;  2E74 B;  3ASO C;  3LDD A;  4K0K O;  3DXR A;  1QVF U;  4GUN A;  1Q8I A;  1FPO A;  3OTF A;  4LF8 B;  4X66 O;  1IBL B;  1FJG O;  1NBM G;  1SQF A;  1W0J G;  4LWS B;  4W4L A;  5J2U B;  4IHJ A;  4JI0 O;  4O2A B;  4U7O A;  5LL6 Y;  3JAK A;  2B9Z A;  2XAJ A;  1GKF A;  1NTK H;  2Q7G A;  1PV0 A;  3ZMT A;  2HVJ C;  3OFN G;  5C8Y A;  5BXZ A;  4UVC A;  2XHB A;  1ROP A;  2Q9L A;  4HNA A;  3E83 A;  5IJ0 B;  3HKB B;  2IJI A;  4LR3 A;  2V4D A;  3DC5 A;  1PL0 A;  3D8C A;  3AG2 C;  5LYJ B;  3AG1 B;  3M8A A;  1URF A;  3JCU Z;  1N32 O;  4OGQ B;  1P49 A;  2AW9 A;  4PA4 A;  3OD4 A;  1BZK A;  4JAU A;  4PA9 A;  5L3C A;  2EJR A;  4DV6 B;  4FZ1 A;  2HG5 C;  2BE3 A;  1XI1 A;  5L3B A;  1YF2 A;  2JJ1 G;  3K5N A;  4DYL A;  4LH6 A;  4BWA A;  3OGI B;  5D5P A;  3JD1 A;  3FB5 C;  1QBZ A;  1K97 A;  4Z1V A;  5ITZ A;  1MG1 A;  4JI8 O;  3JCZ A;  1GM9 A;  1ZSP A;  1VQO V;  5HFM A;  3EHB B;  4GCZ A;  2W0X A;  4YJ2 B;  2CAZ C;  2R72 A;  1DTO A;  3OM3 B;  3CXC U;  1U96 A;  1WJZ A;  2DYR C;  4AQY B;  1S5H C;  2WLM A;  1RP3 B;  2P06 A;  2F43 G;  3H1J H;  5LBQ A;  3RVZ A;  1NU1 H;  3GWO A;  4JI1 B;  4PI2 A;  4DV7 O;  4B3T O;  4DUY O;  5H5N A;  4JI2 O;  2HHH O;  4N23 A;  2JRI A;  1UPG A;  1NTZ H;  4JTA B;  4B08 A;  2A9H A;  1XMQ O;  1UJW B;  3WB1 A;  1M4U A;  3VQX A;  3IC9 A;  3T1H B;  2Y0P A;  4EB6 B;  2Y4T A;  1Q6I A;  2UXN A;  1AJN A;  4MVO A;  2OIG A;  1K4D C;  3AEI A;  5LP6 A;  1VQL V;  2RJZ A;  1FAF A;  3RBZ A;  3P3N A;  3K58 A;  4J7Z A;  4QNH B;  1N0J A;  3N2G A;  1XEQ A;  4JI4 B;  4IGG A;  1EZJ A;  3A0H Z;  1RPO A;  2Y69 C;  1XHX A;  3QF7 A;  2IW5 A;  2DQ0 A;  2AZ0 A;  4DV2 B;  2R9R B;  1K8A W;  1RM1 B;  4XBF A;  1M56 B;  2XAH A;  4LBE C;  1R6N A;  1IUR A;  1KUQ A;  4MTX A;  3STL C;  2UUB B;  1VF6 A;  4DV4 O;  1VF5 B;  1D5A A;  3IGA C;  1CP9 A;  3FKS G;  1IBK O;  3BVO A;  3THO A;  3H9V A;  1FFT B;  2KSD A;  1T5E A;  3ETD A;  4DR6 O;  5EBL C;  4D6T H;  1EM1 A;  2H94 A;  3J81 N;  5LHH A;  1W59 A;  5EC1 C;  2LGQ A;  4TWK A; 
#chains in the Genus database with same CATH homology
 1OCZ B;  2IJH A;  4JAV A;  2JIZ G;  2WSS G;  1NVP B;  4MTF A;  1FXV A;  2Q69 A;  4R6Z A;  3T2M A;  3LDC A;  5B1A B;  5CA3 A;  4BIZ A;  3AG1 C;  2JEU A;  4DO2 A;  2OT5 A;  3DTU B;  2ATK C;  3CPW U;  1PNL A;  1HWY A;  1Y66 A;  1GMG A;  2YEV A;  3CCS V;  3E8G A;  3K06 A;  1M57 C;  4WFG A;  3SJQ C;  1OCC B;  1FS0 G;  2EIK B;  3F7Y C;  1YI2 V;  3FYE B;  2HR3 A;  3G6E V;  5B1O A;  2JK5 C;  1NH2 B;  3M99 B;  1YIJ V;  3KG2 A;  2DYR B;  5BZB A;  1K5Q A;  1KC8 W;  4DXW A;  3AG4 B;  3K0D A;  2NLJ C;  2ZDI A;  4MVM A;  5IY5 C;  1SER A;  4CBC A;  3CC2 V;  1K34 A;  2V7Q G;  5L3G A;  3AG3 C;  4JGS A;  2YEV B;  2B1I A;  3ZN0 A;  5EBM C;  3CCL V;  2DW4 A;  1Q81 W;  4I9W A;  1KP3 A;  4BW5 A;  1GK9 A;  1SET A;  2X6B A;  4QPJ A;  3CCQ V;  5IYC O;  1OCR C;  3T4D A;  4Z1M G;  3ZMV A;  4MVQ A;  3QO5 A;  2XAG A;  2EIN B;  3W7S A;  3IC7 A;  2YSU B;  5CBH A;  3ZIA G;  3W7W A;  1QR9 A;  2Q6A A;  4J9Y B;  1Q7Y W;  1K5S A;  1SES A;  3JD2 A;  4J9Z B;  4GX1 A;  5LGT A;  4WCE V;  1Y4M A;  3ASN C;  3ASO B;  2JEX A;  2ZR2 A;  1VQ8 V;  3OW2 U;  3CC4 V;  1FXH A;  2WLJ A;  1B6Q A;  3CD6 V;  4UUJ C;  2H8P C;  4G27 B;  3ABM B;  2ITC C;  5EC2 C;  4PDV A;  2EIJ C;  5L3E A;  2IH3 C;  2W6I G;  3ABK C;  4MS2 A;  3CME V;  4GX5 A;  1FXK A;  5IYB O;  1QR8 A;  3CCR V;  1JCH A;  2B5U A;  2ZQM A;  3OMA B;  1R73 A;  3F5W C;  1COW G;  1CPY A;  4G28 B;  3UKM A;  2IU0 A;  1F51 A;  2K1E A;  3JD3 A;  3SYC A;  4I5S A;  2WLK A;  1R3I C;  2QE7 G;  3ABL B;  2DYS C;  3OMI B;  4F4L A;  1S0V A;  1V54 B;  1JJ2 U;  1KEC A;  1KKD A;  1M90 W;  1MAB G;  2BOC C;  3MD0 A;  4X8A A;  4RAI A;  1FXK B;  3P32 A;  2QKS A;  3RW0 A;  4GT1 A;  2A79 B;  4ZBM A;  3WG7 C;  3SPG A;  4P9O A;  3B8N A;  1XL6 A;  3I56 V;  3K04 A;  2HJF C;  2CK3 G;  1IXM A;  1JOY A;  2Y48 A;  4WFE A;  3ABU A;  2WLI A;  1PD3 A;  5KA5 A;  3P30 A;  4MVS A;  3CCE V;  2X7R B;  3RVY A;  4P30 A;  1AI7 A;  1ORQ C;  3F7V C;  3K08 A;  2P67 A;  1M1K W;  1ZWI C;  3FB6 C;  3FYI B;  3HPL C;  3OR7 C;  2IU3 A;  4R50 A;  1QLE C;  3CCU V;  2P7T C;  1Q82 W;  3ZRS A;  1I5Y A;  2M7W A;  4PEL A;  1RM1 C;  4PDR A;  1GO3 F;  5KA6 A;  1LNQ A;  1M56 C;  3CCV V;  1XL4 A;  2LFR A;  3E8H A;  1YJN V;  3CP1 A;  3LSQ A;  1V55 B;  5GW7 A;  1YJW V;  1VQ9 V;  3H01 A;  1JX9 A;  1THZ A;  4QJF B;  4KUM A;  2FTK A;  1KD1 W;  1YTF D;  3JD0 A;  4RQE A;  2XAS A;  2GHY A;  2WLI B;  2EIL C;  1VQ6 V;  1WLE A;  1GM7 A;  3D36 A;  4MW8 A;  4HYO A;  3NXS A;  2DWD C;  5FL7 G;  1QCE A;  3ZRV A;  1AI5 A;  3LDE A;  4X88 A;  4PDM A;  2QA4 V;  5H6Q A;  1AJQ A;  3K3W A;  2KB1 A;  1BHB A;  1AI6 A;  4WF9 V;  1BHA A;  4UVB A;  3E35 A;  4TT3 G;  5H6R A;  3UM7 A;  3B8M A;  3T1C A;  1S72 V;  2WPD G;  4PA7 A;  3ZMZ A;  1H38 A;  3T4Z A;  3W7X A;  4JYC A;  3E8B A;  2HKO A;  5B1N A;  3EFF K;  2EZP A;  5E1A C;  1OCO B;  2QEX V;  5LHI A;  2WLN A;  1P4R A;  2QM8 A;  1F4M A;  4Q20 A;  5KUM A;  4BAY A;  1OCC C;  1R6K A;  4H37 A;  1NR1 A;  3X2Q B;  1Q86 W;  2AHY A;  3I55 V;  5DM6 V;  4P2Z A;  3D3I A;  2MK3 A;  2PI5 A;  4LP8 A;  1MOF A;  5B1B B;  3ZRW A;  2WWW A;  3ASN B;  4PA3 A;  4BIU A;  2XND G;  2A0L A;  2OTJ V;  2OCC B;  4JTD B;  4RO2 A;  2OTL V;  2IJJ A;  1AJP A;  3E86 A;  4FPP A;  4YXW G;  1JPX A;  1SZT A;  2XAF A;  1DF4 A;  1EBO A;  1I5X A;  3MHH C;  1DLB A;  3CMA V;  4JAS A;  2GSM B;  4R7C A;  5LGU A;  1AR1 B;  3E2E A;  2HLD G;  2EIJ B;  3DGE A;  2P90 A;  3JYC A;  4L87 A;  5L3D A;  5CBG A;  2BOB C;  5LHG A;  1W2B U;  2X6A A;  3SYA A;  3OAA G;  3SYO A;  4MVU A;  4PA6 A;  3K9A A;  1VQM V;  3OR6 C;  3JD4 A;  1ARO P;  4TSF G;  3OE7 G;  2XAQ A;  1E79 G;  2NNU A;  3OGC C;  4RUF A;  4WFB V;  3ETE A;  3ZRW B;  4RQF A;  4RUE A;  3CC7 V;  3G4S V;  3W7T A;  1G4Y B;  1R3J C;  2ZDI C;  5EK0 A;  3MHS C;  3TK1 A;  1K7D A;  1R3L C;  2Y69 B;  2EIM C;  4UVA A;  1YTF B;  2DYS B;  3ASO C;  4XDJ A;  3LDD A;  4CZZ A;  1RM1 B;  5HFL A;  1QVF U;  1PKX A;  4UXN A;  2HVK C;  5B3S B;  2HFE C;  1K9M W;  1S3J A;  4ZKI A;  1NBM G;  3FB7 C;  3SPH A;  1W0J G;  4U7N A;  4X89 A;  1K3E A;  3ABM C;  4MVZ A;  4U7O A;  2XAJ A;  3K0G A;  2P6J A;  1K4C C;  1GKF A;  3A0R A;  3OEH G;  4QE9 A;  2W6J G;  1KQS U;  2IJK A;  2WLL A;  1S76 D;  3ZMT A;  3CCJ V;  3BY6 A;  2AHZ A;  2HVJ C;  4PDL A;  3OFN G;  3ABT A;  4QPK A;  3QNE A;  4UVC A;  3ABL C;  2Z5U A;  1ROP A;  1CEZ A;  2X6C A;  4MW3 A;  3ZCC A;  3HB3 B;  1V54 C;  2ITD C;  3E83 A;  4QIW F;  2IJI A;  4FJC C;  1PL0 A;  3ZRX A;  1DF5 A;  2Z3Y A;  3AG2 C;  1FXK C;  2QTO A;  2ZXW C;  3AG1 B;  4LCU C;  2WAM A;  3OUS A;  1KP2 A;  2JDI G;  2WLL B;  1RPR A;  4PA4 A;  3SPJ A;  3B77 A;  2X0L A;  4JAU A;  1M57 B;  1SRY A;  3VBB A;  4PA9 A;  5L3C A;  2EJR A;  4E2L A;  5CBF A;  4MTO A;  1W0K G;  3BEH A;  3OEE G;  2HG5 C;  5L3B A;  1H2G A;  2JJ1 G;  4WFA V;  1QVG U;  3SYP A;  3R65 A;  2B1G A;  3JD1 A;  1OCZ C;  5IY5 B;  3FB5 C;  1V55 C;  3AG3 B;  1QBZ A;  4P9P A;  1K97 A;  1BMF G;  4MVR A;  5B1A C;  1MG1 A;  4JYB A;  3K79 A;  2DQ3 A;  5H9C A;  3JCZ A;  1GM9 A;  1VQO V;  1OCR B;  2QM7 A;  2DWE C;  1S77 D;  1AI4 A;  1NQT A;  3ETG A;  5HFM A;  3EHB B;  1BL8 A;  2C2A A;  1E1Q G;  3E8F A;  4GCZ A;  1NKD A;  5C93 A;  1VQK V;  1QLN A;  2EIK C;  1R3K C;  4FMT A;  1ENV A;  2Q67 A;  1K33 A;  1PNK A;  1NR7 A;  1OZ0 A;  2D3O W;  1DTO A;  3OM3 B;  3CXC U;  1H8H G;  3QO7 A;  2DYR C;  1S5H C;  2WLM A;  3AG4 C;  1JVM A;  2F43 G;  1F4N A;  2W0F C;  3SYQ A;  4JF3 A;  3W7U A;  4JPR A;  1K92 A;  5CN0 A;  5LBQ A;  4G2K A;  3TCU A;  3GB7 C;  3RVZ A;  1G8M A;  1OCO C;  3GWO A;  2LFS A;  4XDL A;  3TET A;  1VQ5 V;  2V1D A;  5CMU A;  3ABK B;  5J9P C;  3ML0 A;  4GX0 A;  5KUK A;  4N23 A;  1K73 W;  3X2Q C;  1NVP D;  2EIN C;  4JTA B;  3VOU A;  4MSW C;  2A9H A;  1NJI W;  2WLH A;  1UJW B;  2R9I A;  5B1B C;  2EZO A;  2EIM B;  2JJ2 G;  5EBW C;  1M9N A;  1VQP V;  3WFV A;  4FIP C;  2OCC C;  4JTC B;  1VQ4 V;  3IFX A;  4HAM A;  1N8R W;  5IDJ A;  1YIT V;  2UXN A;  1AJN A;  1J95 A;  3QO8 A;  4H33 A;  4MTG A;  4MVO A;  1PNM A;  1NH2 D;  1K4D C;  3AEI A;  1VQ7 V;  1VQL V;  4UV9 A;  1L1F A;  4WFF A;  3RBZ A;  4XDK A;  2EBO A;  2LP7 A;  1OHH G;  5LGN A;  1VQN V;  3SPI A;  4QNH B;  3WG7 B;  4QE7 A;  3K03 A;  1TUE B;  1P7B A;  1EZJ A;  1JQ0 A;  1YSC A;  1YJ9 V;  5IYD O;  1YHQ V;  1RPO A;  4N21 A;  2Y69 C;  1GTO A;  3OMN B;  4ASU G;  2IW5 A;  2Q68 A;  3ZN1 A;  2DQ0 A;  2R9R B;  4MT8 A;  1QLE B;  5B3S C;  2ZR3 A;  4FK5 C;  1K8A W;  4R8C A;  4KFM A;  1E1R G;  2IH1 C;  4GX2 A;  4UV8 A;  4XBF A;  3ZMU A;  5DN6 G;  1M56 B;  3FB8 C;  1F23 A;  2XAH A;  3AG2 B;  4LBE C;  2ZXW B;  1R6N A;  4LC1 A;  1GM8 A;  4MTX A;  3STL C;  4EKW A;  1EFR G;  3LSS A;  2XOK G;  3ZMS A;  3IGA C;  3E89 A;  3SPC A;  1CP9 A;  3FKS G;  2EIL B;  3G71 V;  3LNM B;  3PJS K;  2ZD9 A;  4WFH A;  3CYO A;  1MSW D;  3LUT B;  1WPX A;  1FFT B;  3OUF A;  4OXS A;  1H8E G;  2UXX A;  3ETD A;  5L3F A;  2PI4 A;  5EBL C;  3CCM V;  2H94 A;  3STZ C;  3ZJZ A;  5LHH A;  4KP4 A;  5EC1 C;  4HZ3 A;  4TWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...