1M90W

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m90W00
1K73W 1KQSU 3CXCU 1KC8W 3CMAV 1K9MW 1W2BU 1M90W 3CPWU 1VQ9V 1Q81W 3CCLV 1VQ5V 1VQLV 2OTLV 3CCRV 4WFBV 1Q82W 1VQ7V 1YJNV 1QVGU 3G4SV 1Q86W 2D3OW 3I56V 3CD6V 3CCVV 1YJWV 1Q7YW 3CC7V 1YITV 1VQNV 3CCEV 3CMEV 3CCSV 3G6EV 1YHQV 1N8RW 1KD1W 3CC4V 4WCEV 2QA4V 1VQ4V 1JJ2U 1M1KW 4WF9V 1VQOV 2QEXV 1VQKV 1S72V 1VQPV 3CC2V 3CCMV 1VQ6V 1VQMV 1VQ8V 3CCQV 1YI2V 3CCJV 1YIJV 1K8AW 3OW2U 1NJIW 1YJ9V 1QVFU 3I55V 3G71V 4WFAV 1R73A 2OTJV 3CCUV 5DM6V
chains in the Genus database with same CATH superfamily
1KQSU 4Z1VA 4X20A 3H1JH 5CB4B 2JGUA 3M99B 3JAMN 1VF5B 1L1FA 2IJKA 4X64O 1NR7A 2QKAA 4NYKA 2F1MA 4P9PA 2Z3YA 3T2MA 1I0HA 5CA0A 1JX9A 1WB8A 3KZIZ 4GKKB 2DYRB 1AI7A 1XOUA 4DYLA 4CH5A 3ZHTA 2WSSG 2W6IG 1AILA 2DMXA 1V9PA 2VS0A 3RVZA 4AQYO 2BE3A 3ZRXA 2Z0AA 2GUZB 3MDSA 2UXBB 3LDDA 1NR1A 3GB7C 1KKCA 1GN6A 4JI3B 3UT5A 3T1HO 3K57A 2WLLA 2HHHO 2MW2B 5KHKA 3AG2C 4PA9A 4YHHO 5L3FA 1Q6UA 3C90A 4LF4O 1B04A 3IAYA 3ZHRA 4NXMO 2EX3A 2WLHA 4MW8A 3ABKB 3ZN1A 2IU3A 1Q7YW 2R72A 1RFYA 3OTFA 3QO8A 2BTQA 4ZHQB 2P4KA 4KUMA 2JK5C 2GTSA 3K03A 3SDLA 1KB9F 3ZN0A 1VQKV 4B3MB 3ABMC 3AK1A 5LMNO 1N32B 2A7WA 2CTPA 1IDSA 3FB7C 3RYCA 1Y76B 2KB1A 5KMGA 3RYFB 1GKFA 2PTMA 5IWAO 4J11A 1F7YA 4P2ZA 2W0XA 4DUYO 1IZ3A 1ZUQA 3JAKB 5FNVB 3ZEDA 2BOCC 4E2LA 5GTIZ 2Q67A 4U7OA 2YDEA 4LH6A 2IH3C 2EIKB 4DUZB 4G2KA 4O4IB 1GM8A 4PELA 3L72H 2WPDG 2EILB 2IU0A 5JJNB 2UXXA 4MTGA 5JJJB 3DXRA 4CH3A 5LA6B 1LNQA 2QJ1A 2UUAO 5KX5A 4DR7O 5KA5A 1IBKB 1AP5A 1H2GA 1YDXA 2Q68A 3C3TA 2Q5ZA 1K5QA 5E79Z 4UVCA 4DR1B 3WB2A 2P90A 2RMKB 3OUFA 4FFKA 2WA4A 3AG1B 4MW3A 2R9AA 5GTHZ 4MVUA 5DM6V 4QPJA 5CN0A 1HNZB 1XBLA 3K04A 5B3SB 2DQ0A 1GRJA 4JYCA 3RYHA 5BZBA 5BXZA 4GX5A 4AHCA 5KAFZ 1FJGB 3W7WA 3HB3B 3ZHUA 1M1KW 4DR5B 2ETNA 1SQPH 1S72V 3N2KB 5KUKA 2WLKA 3NR7A 3TK1A 3GWOA 2L6LA 4TQFA 3CRAA 1GM7A 2DWDC 2IW5A 3TCUA 2N74A 2JIZG 1K7DA 5EBWC 4BIUA 3ML0A 2QSAA 4NTYA 4JAAA 2OYQA 4K0KB 3HKEB 1BHAA 4N23A 1FFTB 2E76B 2BTOA 2UUBO 3E35A 2FL4A 3P30A 1VF6C 3K9SA 4I4TA 1F23A 3TETA 4KHPB 1SKVA 5B66Z 1HNWB 3U10A 5FL7G 2YS8A 2YSUB 3CEIA 2E5LB 1BS3A 2AHYA 1IBMB 2QKSA 1XNQB 1I94B 5LMUO 3OD4A 1O9GA 3VQXA 1AVMA 2OIEA 1JFFA 1EN4A 1EN6A 4NXNB 1OCZB 1WB7A 5A9GA 1NH2B 1YIJV 3OW2U 4G27B 3J7AU 1CP9A 1QR8A 1K73W 2F43G 5GW7A 1SESA 2ZR2A 1GK9A 5JCOA 5DN6G 1ZX3A 5C93A 1YJWV 1LR1A 3CS5A 3CMEV 4J42A 1AI4A 1HR0O 2KG7B 3AEIA 2ZDIC 2A3QA 3K5OA 2WLIB 3JASB 4DK0A 1YEWA 4IHJA 1YXBA 3APQA 1M90W 4D6TH 2CAZC 3SPJA 2DYRC 4FZ1A 1FXKA 1Q8IA 5EK0A 2LFRA 4N21A 1GMGA 1NVPD 2QM8A 4C7UA 5JQGA 2DQ3A 2RDCA 4YY3O 4XDJA 4WBNB 3BCCH 3OTOB 2M7WA 4YIPA 4EB6A 3H9VA 2ZXWB 2YC0A 2XAQA 4Z2WA 1L0NH 2F95B 5KHJA 1MABG 1VQ9V 1GTOA 1W0JG 2Q0AA 5LBQA 3TXQA 1SF9A 4BR6A 4QPKA 2Y48A 1GM9A 1YHQV 4WCEV 5BR8O 4JTDB 5LYJA 2EINB 2LGWA 2PZSA 3ABKC 3ASNB 3HKCB 1NTZH 2UXCO 3HKDB 2UU9B 2Q7EA 4JV5O 1IBLO 2OIGA 1HW7A 1MA1A 4UXNA 3RT3C 5LGTA 3E8GA 4LFAB 2LQTA 3F5TA 4ABMA 1DLBA 1QCEA 4A5UB 3CCMV 1R3LC 1J5EB 4Q6GA 3CYOA 1TUEB 4UV8A 3CCQV 3JALA 1XMQB 1SA0B 3OT7A 1W0KG 4LNUB 5GONB 4UV9A 2VQEO 1ORQC 3FB8C 2OWOA 3QG5A 1JR9A 2D3OW 1BCCH 3FYIB 2F93B 4BIOA 3B77A 4PJ0Z 3FFQA 1RP3B 2EIKC 2NNUA 2QWNB 3BFRA 3CXHF 2XNDG 2N05A 2JS3A 5AG2A 4FLXA 3JARA 2EILC 4I50A 2Q7HA 4K8ZA 2ARHA 4IT5A 3UKMA 1TVKA 2CE4A 4UVAA 3T1CA 4ZI7B 1Q86W 4DV6B 2DN9A 2ZINA 3EVKA 1SZTA 3RN4A 1GO3F 2QA4V 2LFSA 3D36C 2BCCH 4CC5A 4R7CA 3T4DA 4JI5O 3B40A 2HKOA 2WWWA 2PI5A 4J7ZA 1AB3A 1ZSPA 3CXCU 1UFIA 5L3GA 1TGOA 3CWBH 3JSNA 3J81N 1GAXA 3AG1C 4X20B 4B7EA 1N33B 3U0ZA 3JD1A 3UM7A 1QHTA 4ZIBA 5B3SC 3E8FA 3CC2V 1WA8A 4JI1B 1KUQA 4BIZA 1K5SA 2FKXA 3JD2A 2H3OA 2EJRA 3K06A 3G80A 5B1AB 2GBOA 1JVMA 2LO1A 3JCUZ 2V4DA 1T5EA 3A0RA 3BA9A 3RVYA 1FKAO 2KQXA 5JH7A 1JA8A 1PM9A 4LF9O 2YEVA 1B06A 3KKYA 4MVMA 5KAIZ 4GKKO 2BSKB 3IC7A 1XUQA 3T1YO 4PA3A 3UT5B 4JF3A 4UVBA 4DV1B 2XAJA 2QWRB 1NTKH 3EFFK 5IYDO 1AROP 4GT1A 3ZMVA 1YTFB 3H1HH 5EC2C 3ZIAG 4JI3O 1QR9A 5CA3A 5FLXN 1OJHA 2JDIG 4LWSA 4FLVA 1MSWD 1DF5A 3QO7A 1HWYA 3E22A 1I7FA 1R3IC 1OCZC 4UCTA 4LFBO 2ODMA 4DR6O 4JI6B 3RYCB 3ZRSA 4MT8A 3ZCCA 5EIBD 4FLWA 4CH6A 2ADQB 1AI6A 2ZE8A 2VQFO 1KD1W 5KMGB 4O2AA 2GSMB 2CGOA 2Y4UA 4J7JA 5IYZA 1LUVA 1N32O 5LXTB 3PN1A 4X1IA 1YJNV 5H2FZ 3FB6C 1W2BU 2Y69C 1W59A 3OR6C 1D2DA 2PGGA 4XDKA 3CCVV 1GN4A 1NS1A 4LF7B 5B1BB 1N8RW 1PNMA 4RWUA 2EIJB 2QTOA 3FB5C 4DK1A 4DR2B 1XNRB 4O4HB 3LSUA 2HJDA 3I5DA 1G4YB 2GTAA 3BA8A 3W7SA 1URFA 4B08A 3FX7A 3DXRB 2YIDA 2PYLA 1SS3A 4I55A 1IXMA 2ZXWC 1K97A 3ZHQA 5F2VO 3AG7A 5KX5B 1OCOB 1ZL8A 1PPJH 4X88A 2WLNA 4J7KA 4GYCB 4FIPC 3UO2A 4I0XA 5CBGA 2XHBA 1QNMA 4DR3B 4JTAB 1WAZA 2VWJA 4LC1A 1HNXB 2EINC 3JSLA 1S77D 3OMAB 1L0LH 1RM1B 3ASNC 4ZOLA 4MTFA 4JYAB 2DYSB 2R9RB 4TV8A 3ZMUA 2UUCB 1AJNA 3CC4V 3RYHB 2NN4A 1VQPV 1NZ6A 3N27A 5B1OA 1CEZA 1XI1A 1HNZO 1EBOA 1SQVH 3PJSK 1KU9A 3B09A 2XT9A 3UCSC 2AGAA 4FLZA 3OFNG 4L87A 3IC9A 4X66O 3FAVA 1MSDA 2LW1A 4GX1A 1OCRC 2EJ7A 1YVWA 3K9AA 1VARA 4EFBA 1WP7A 2RNBA 2WA3A 1I08A 5B5EZ 3CMAV 4I4TB 1S5LZ 4UUJC 2DOSA 3SJCC 1TUBA 2YIBD 1KECA 3H01A 2ZT9B 4X65O 3OE7G 4PA7A 4DV2B 1IVSA 3OGIB 4X8AA 4PD4F 1JFFB 3IJ4A 3P3NA 3L74H 1Y67A 1N34B 3JYCA 2YICA 4WFAV 4DV4B 4JI0B 3F7VC 2RCVA 3SYCA 1N36O 1XNQO 2YXYA 4GKJB 3VQVA 2XOKG 2RQ6A 3D3IA 4NXNO 4EFEA 1K34A 1F4MA 2YXLA 4B3RB 4YJ3A 4K3AA 4BAYA 1OHHG 4X89A 4IHJB 4LF5B 2N04A 2EZOA 4FK5C 2VRZA 2HVJC 5B1AC 1YSCA 5K1XA 3CCEV 2D2CB 2CTRA 2ZNJA 1S5JA 1WPBA 4DV7O 1FXKB 1SQQH 4QIWF 4FLYA 3P3PA 2QE7G 2C2AA 5JQGB 1FD9A 2PI4A 4IIJB 1E79G 1E1RG 5CMUA 5IY5B 5FPOA 2HJFC 3CCUV 4EB6B 5IJ9B 3A8TA 3X2QB 1SZXA 3F7YC 3OTOO 2A9HA 1RPRA 1Z5VA 2XTAA 5IJ0A 5LYJB 1PNLA 5EBMC 2CGNA 4LF8B 2AHZA 4JASA 1Y74A 3WB0A 5KHHA 1SERA 2LGQA 3CCSV 4X64B 1X4TA 4OPHA 2QR4A 3ABTA 2ITCC 4KFMA 1ENVA 2UU9O 1QVFU 4K35A 1L8DA 1Q90D 4LFCB 3JALB 1NVPB 4H37A 3K5MA 4GLXA 1M56B 3G4SV 3RYIA 1EM1A 4TV9A 3RWRD 3WFVA 2FTKA 1M4UA 5J2UB 1R3KC 3STZC 2DW4A 3R66A 1J5EO 3MHHC 1EZJA 1K3EA 3T1HB 4PDLA 4B3SO 4J9ZB 4FM0A 2HHHB 5B1BC 1S3JA 2F23A 2EIJC 4ASUG 4LF4B 3OM3B 2GUZA 2JGDB 2WAMA 3K0DA 3ICXA 4CS4A 3JARB 2QKCA 4DRXA 4NXMB 2Q8VA 4I50B 4OX9O 1TVKB 4L8JA 5DEDA 1ROPA 4O2BA 4O4LA 4DV5O 3ZMZA 4FM2A 3BEHA 4MVZA 4WFFA 4UCRA 3T4ZA 1OCOC 5LMNB 4FJCC 4U3JA 1G6UA 2ADPA 5LGNA 3WU2Z 1VQ5V 3L70H 4FFBA 3HR0A 1PD3A 4DV6O 3QNEA 3CRQA 1GN3A 5JVDA 1SQXH 2XUMA 3TGUH 4DUYB 1RM1C 4JI2O 2ZD9A 4UB8Z 5HFMA 3ETEA 2DYSC 2Y69B 4HNAA 1WA8B 4LH7A 2OT5A 1WLEA 3W7TA 2HLDG 1G8MA 3WB1A 2H94A 1J95A 2ZE6A 1H2LA 2QWOB 2FYUH 4WFHA 2OCHA 1R3JC 2JVDA 1VMGA 4NTWA 3SJQC 4JI1O 4WF9V 4DV3O 3RBZA 4B7KA 4YIOA 5JH7B 2Q69A 1OZ0A 2YEVB 4HAMA 1FFXA 1AI5A 4FM1A 4MTOA 1VQ7V 4DR7B 3QTCA 1XREA 1VQNV 1NTMH 2ZM6B 1H2KA 5KA6A 4G28B 1VIBA 3LNNA 3E8HA 1K4DC 4X1KA 1VQ8V 4DV1O 2EIMB 3SYAA 2NLJC 4UCSA 4LWSB 1XHXA 1WNSA 3CSXA 5CBHA 3E22B 1XEQA 4O4JA 1QU7A 2IH1C 3CX5F 2NR5A 5LHGA 2BOBC 3CD6V 3G6EV 3JD0A 1CXZB 4BW9A 4U7NA 1GH6A 1VQMV 4O2AB 3K5NA 5IYZB 3JATA 4B3TO 5JCOC 1WN7A 3G71V 5DECA 1YCIA 2ZE5A 1NH2D 3OMNB 3GVMA 1TA8A 4X1IB 3L9DA 3OEEG 3EXAA 3ZRWB 3LUTB 1OCRB 2A0LA 2EBOA 1Y6XA 2ZNIA 3KCXA 1PNKA 3EHBB 3K0GA 5IT9N 2UXNA 2F4VO 5K1PA 3CB2A 1P84F 1XL4A 1NBMG 2Q7GA 2Q9LA 3K08A 1FXKC 2P06A 1KBHA 4U3FH 1H38A 3U11A 4FZ0A 2UXDO 3OUSA 1OCCB 4LF7O 1KP3A 5LMUB 5IY5C 4RUFA 4JI7O 1KP2A 1H8EG 2QWPB 3RGBA 3FYEB 4I55B 4DW0A 5LP6A 2A06H 1ZL8B 1MNGA 4QNHB 1S76D 3X2QC 1YI2V 2XASA 4I0XB 5KHGA 3VOUA 3LSSA 1Q81W 5EZYA 1V54C 1COWG 3IGAC 5KUMA 5HFLA 1ZWIC 4NR1A 3WG7B 4ZOLB 4TV8B 3SPIA 1HR0B 1VQ6V 3NXSA 1WJZA 4NB5A 5B1NA 4DR3O 4JI8B 1NJIW 4PA4A 4DV0B 3OMIB 5CA0B 3G67A 4TUYA 1R6TA 4JYAO 3ZBHA 2QM7A 2KG7A 1QLNA 2E74B 1VQ4V 4XBFA 1LUWA 4YY3B 1WPXA 1M56C 5EC1C 1JCHA 4NTXA 1VEWA 2WLLB 2V1DA 1K9MW 3ZJZA 3CPWU 2DJVA 4PA6A 4PDRA 5EYPA 2FMLA 2UXBO 3ZHVA 1TUBB 4QJFB 2AZ2A 5BY1A 5BR8B 1M9NA 1U96A 3O65A 4DR4B 2B5UA 1IXBA 3C3SA 2BTQB 1CPYA 1BL8A 3ZX6A 4MVOA 4J10A 1FYJA 2P22C 2UXCB 1YF2A 4JI4B 4OPAA 2ZIOA 4CS2A 3UO3A 1IBLB 4MVQA 1QLEB 2IJJA 2K1EA 1EN5A 1H2SB 5LGUA 1BMFG 1N4CA 4EEQA 4H13B 2IJHA 1N34O 4B3MO 1B6QA 2CTQA 4JI0O 4J9YB 4YJ3B 2EULA 2CH7A 2W6JG 2ZKOA 2PYJA 5E1AC 2VQEB 2ZCEA 1H8HG 4JZ2A 3LNMB 3AK3A 4CC6A 1UPGA 1Y4MA 3HKBA 4B3RO 4LNUA 5KLVH 3JAWA 2CDYA 1FS0G 1MOFA 4PHZA 2HP8A 3N2GA 5J2TA 3CP1A 4LF5O 3Q4HA 4DUZO 3BHPA 3VQWA 5ITZA 4DW1A 1Q5OA 1KMIZ 4I9WA 4BW5A 4LBEC 4X1YA 1KYOF 3SYQA 1A32A 5L3EA 4F6RA 5IJ0B 1YJ9V 4PI2A 2P7TC 4R50A 1KC8W 4X9QA 1XMOB 2EIMC 2QTSA 1IBKO 1I5XA 3SYOA 3A2FA 4GCZA 5JJEB 1Y74B 1WP8A 4KL1A 1NQTA 3AG4B 4F4LA 4DR1O 3SYPA 4PDMA 1S0VA 3VQYA 4R8CA 4KXRA 4LF8O 2QGNA 3CE2A 2Q73A 3ZS8C 4H0LB 1FJGO 1NU1H 2K9PA 4GZRB 2B9ZA 4YJ2A 4QE9A 4WFEA 5C8YA 1Q43A 4DR5O 3RYIB 4TV9B 4RAIA 2LW7A 4KP4A 1K92A 4LF9B 3ABUA 4NKGB 1P4RA 3S3WA 3CJHA 3T1YB 1DF4A 4LFCO 3ZMSA 5BMVA 1O9HA 4FPPA 1H2MA 3JD4A 1K4CC 2QM4A 4BWAA 1SQFA 4WFBV 4UFZA 1R6KA 4K0KO 3CRCA 4D7TA 2IBZH 2BSKA 5IYBO 4DRXB 1U97A 5LOVA 3K5LA 4HZ3A 1OCCC 4O2BB 4KHPO 4AILC 1AP6A 4TT3G 4X62B 1HNWO 4O4LB 2E5LO 4MSWC 2AZ0A 4Z1MG 4UCUA 2R9IA 1IBMO 2YUAA 2EZPA 1I94O 3CRMA 4LFBB 4U3JB 4DR6B 1ZTEA 5LHHA 4FFBB 5EIBC 2CUGA 2VQFB 3MAQA 3K59A 4RQFA 3JCZA 3DTUB 2JEUA 3W7XA 1VQOV 3E86A 5JVDB 4I9QA 4UCOA 3CCJV 3WG7C 3I55V 3UQ8A 3CHXA 2G38A 1SETA 4HNAB 4J80A 4K8XA 3KG2A 4IL6Z 1MG1A 3K3WA 4R6ZA 5LXTA 2YIBA 4CBCA 5CA1A 3CRRA 2OCCB 4MVRA 1PL0A 4LF6B 2HEPA 1JPXA 1BZKA 5LHIA 1VF6A 5H6RA 2Q6AA 1N0JA 1ZAUA 2KKWA 4CS3A 3SPHA 5IDJA 1FFXB 2AW9A 4O4HA 1M57C 1DK1A 2A79B 3D8CA 1V54B 4X1KB 3D3QA 1AJQA 4PV1B 2H8PC 4YXWG 1RSOA 1Q82W 4HYOA 2ZM6O 4O4JB 3OGCC 1BGYH 1QLEC 4XDLA 5FPRA 1IURA 4FLTA 5LL6Y 4DXWA 2FB5A 2Y0IA 2ZR3A 3AG3B 5CB4A 5JWPA 5KHIA 2ZDIA 3JATB 3K58A 4JAUA 3CCLV 2ZIMA 1DGSA 2ATKC 2QDOA 4LP8A 1PKXA 1QVGU 3I56V 4AQYB 4LFAO 4MS2A 4QGPA 3FKSG 3HPLC 1AR1B 4X66B 3QVNA 2GHYA 1BQZA 2IJIA 1RPOA 3F5WC 1XMQO 2R70A 5L3DA 4LR3A 3ZMTA 4YHHB 1Q6IA 2ZQMA 3H1LH 3KCYA 1R6NA 1D5NA 1JQ0A 2YXHA 2HR3A 4H44B 2QWQB 4X65B 4FVMA 1XDCA 4WFGA 4UCVA 1SC5B 1JOYA 5D5QA 5CBFA 3O9OA 3SPCA 5LP6B 2X7RB 1AR5A 3M8AA 4JAVA 4MVSA 4GX2A 4RO2A 4H33A 3DGEA 4D7SA 3ETQA 1N36B 3L71H 3TJTA 1GN2A 4I7ZB 4JZGA 4ZHQA 1BSMA 5EZYB 5H6QA 5IWAB 1Y66A 1FXVA 2YI8A 3STLC 1V55B 2DE0X 1F4NA 1BE3H 1Y76A 1UJWB 2CK3G 1R1BA 4RQEA 3AG4C 3RYFA 3ABLC 2MK3A 2VWKA 1KKDA 1EZVH 3RFRA 1XHZA 5EBLC 3FD9A 4DO2A 1N33O 2WLMA 4TUYB 1YITV 1FPOA 3JAKA 5FNVA 3E2EA 3MD0A 4DV7B 2AXTZ 4JI8O 1XL6A 2LJ2A 4DV0O 2L35A 1K8AW 3ETDA 2M6YA 2P5OA 1R73A 4FMTA 4O4IA 5L3BA 2WLJA 2UUAB 3CCRV 1THZA 1H2NA 4IIJA 5EYPB 3E8BA 1VP7A 4TWKA 5LA6A 4P9OA 2PY5A 4IYIA 3BPZA 4QE7A 2GV9A 3D36A 1FXHA 2B1IA 2Q0OC 4W4KA 5IJ9A 3OR7C 4GUNA 2OTLV 1YZBA 4MTXA 3JD3A 2X6AA 3ASOB 3BVOA 3LDCA 4DR4O 3BAAA 3BRCA 3ETGA 2HG5C 4OXSA 4AI8A 4JI4O 3DSQA 5J9PC 3M7MX 3SPGA 2B1GA 4JI6O 2CH7B 4E4EA 1JMKC 2P6JA 3GWKC 2GDSA 3N2KA 5TISZ 2Y4TA 4LCUC 4CZZA 2E3CA 4JYBA 3HKBB 1G1XB 2CTWA 2UUBB 4B3SB 1PP9H 1SQBH 1BQ0A 3JAWB 4EKWA 1TAEA 5J2UA 3HKEA 1N0NA 4TSFG 2OCCC 3N2GB 5J2TB 1D5AA 3AK2A 1P7GA 3AG2B 3Q4HB 1HDJA 3L73H 1X59A 3MHSC 5ITZB 4OX9B 4PI0A 2DWEC 3VBBA 4DR2O 1XQ8A 1XNRO 4X1YB 2X0LA 4IGGA 4DV5B 4JPRA 2JGDA 1US6A 3DC6A 3QF7A 3S3XA 4TOIA 3OEHG 3B2EE 1BHBA 4F6RB 4JTCB 4OGQB 2KSDA 4ZKIA 2E75B 3B8MA 4Q20A 3K79A 3J80N 3ABMB 1NKDA 1OV9A 1Q6HA 3SR2C 2W0FC 4JI2B 3ZRVA 4TQDA 2OTJV 4HBNA 1HNXO 1QBZA 3G6BA 5L3CA 1XMOO 3DC5A 1E1QG 3TXSA 4F6EA 3RW0A 5A2QN 1AJPA 3OAAG 3LSQA 2UUCO 1EFRG 3QO5A 3AG3C 2LP7A 2F66C 4IYHA 3R65A 2Q4PA 4UB6Z 1M93A 2XAHA 4PDVA 2WLIA 4W4LA 4YJ2B 4DV3B 5C8YB 2XAGA 2JJ2G 3JASA 3FAVB 1AR4A 1XILA 2P4VA 3CJHB 4JYYA 1M57B 2PUSA 5BMVB 4JGSA 2JRIA 4WBNA 4I5SA 1M5IA 4GX0A 1JJ2U 2ZE7A 2YIAA 2ITDC 1P7BA 5LOVB 4RUEA 1NT2B 4FLUA 2XAFA 1SRYA 2V7QG 2Y0PA 5LP6C 4JV5B 4DV2O 1S5HC 2RJZA 3BABA 3HKCA 1DTOA 3SJAC 5D5PA 2JJ1G 2X6CA 4X62O 1JJOA 1SQGA 3A0HZ 3HKDA 3P32A 4DV4O 5H5NA 4B3TB 1V55C 4GKJO 1MZEA 1PL4A 2Z5UA 3H1KH 3THOA 1K33A 5IE9A 4NVPA 2X6BA 2HVKC 2YI9A 1SA0A 2QEXV 5H9CA 3E83A 3ZHSA 2RN9A 2HFEC 3B8NA 5GONA 1BT8A 2F4VB 2ILMA 3ZRWA 1P49A 5CA1B 2JS5A 1HP8A 1VF7A 3B4SA 1VQLV 2UXDB 1QQCA 3E89A 3W7UA 1Z5WA 3H1IH 4JI7B 1I5YA 2PF4E 3APOA 3BY6A 3L75H 1F51A 4LF6O 1B3QA 4JI5B 1Z2GA 1NI8A 4ZI7A 1Q3EA 3IFXA 2IM9A 1FAFA 3A0BZ 4ZBMA 4P30A 3SGIA 5IYCO 1MMMA 3CC7V 1RSOB 3SJBC 4J41A 1PV0A 3LDEA 2O57A 1MZFA 1IX9A 2JEXA 3ABLB 1ZLZA 1YTFD 4ICGA 4CH4A 2P67A 3ASOC
chains in the Genus database with same CATH topology
1KQSU 1AJQA 1JVMA 4HAMA 2H8PC 4YXWG 1AI5A 1Q82W 4MTOA 1VQ7V 3M99B 4HYOA 3A0RA 1L1FA 2IJKA 1VQNV 3OGCC 3RVYA 5KA6A 4G28B 1NR7A 2YEVA 3E8HA 4MVMA 1K4DC 1QLEC 4XDLA 3IC7A 4P9PA 2Z3YA 3T2MA 1VQ8V 2EIMB 1JX9A 4PA3A 2DYRB 1AI7A 2NLJC 4JF3A 4UVBA 3SYAA 4DXWA 2XAJA 2ZR3A 3AG3B 2WSSG 2W6IG 2ZDIA 5CBHA 3EFFK 4JAUA 3CCLV 3RVZA 2IH1C 5IYDO 4LP8A 2ATKC 1AROP 5LHGA 1PKXA 1QVGU 3ZRXA 3I56V 2BOBC 4GT1A 3CD6V 3LDDA 3ZMVA 1YTFB 1NR1A 4MS2A 3GB7C 3JD0A 5EC2C 3ZIAG 3G6EV 3FKSG 3HPLC 1AR1B 4U7NA 1QR9A 5CA3A 2GHYA 2WLLA 1MSWD 2JDIG 1DF5A 3QO7A 1VQMV 2IJIA 1RPOA 3F5WC 3AG2C 4PA9A 5L3FA 5L3DA 1HWYA 3ZMTA 3G71V 1NH2D 1R3IC 1OCZC 3OMNB 2ZQMA 2WLHA 4MW8A 3OEEG 1R6NA 3ZRWB 3ABKB 1JQ0A 3ZN1A 2IU3A 2HR3A 3ZRSA 4MT8A 3LUTB 3ZCCA 1OCRB 1Q7YW 1AI6A 3QO8A 1KD1W 4WFGA 2A0LA 2EBOA 2GSMB 4KUMA 2JK5C 1PNKA 3EHBB 3K0GA 3K03A 1VQKV 1JOYA 3ZN0A 2UXNA 5CBFA 3SPCA 1XL4A 3ABMC 1NBMG 2X7RB 4JAVA 4MVSA 3K08A 1FXKC 1YJNV 4GX2A 4RO2A 4H33A 3DGEA 3FB6C 3FB7C 1H38A 1W2BU 2Y69C 3OUSA 1OCCB 2KB1A 3OR6C 1KP3A 1GKFA 5IY5C 4RUFA 4XDKA 1KP2A 3CCVV 1H8EG 5B1BB 4P2ZA 1N8RW 1PNMA 3FYEB 5H6QA 1Y66A 1FXVA 2EIJB 3STLC 1V55B 2QTOA 3FB5C 1F4NA 4QNHB 2BOCC 4E2LA 1S76D 3X2QC 1YI2V 1G4YB 2Q67A 2XASA 3W7SA 4U7OA 1UJWB 2CK3G 4RQEA 3AG4C 3ABLC 3VOUA 2MK3A 3LSSA 1Q81W 2IH3C 1COWG 1V54C 1KKDA 2EIKB 3IGAC 5EBLC 4G2KA 1IXMA 2ZXWC 1K97A 4DO2A 5KUMA 2WLMA 1GM8A 1OCOB 5HFLA 1ZWIC 1YITV 4PELA 4X88A 3WG7B 2WLNA 3E2EA 3MD0A 2WPDG 2EILB 4FIPC 2IU0A 3SPIA 2UXXA 1VQ6V 3NXSA 4MTGA 1XL6A 5CBGA 5B1NA 1K8AW 3ETDA 1NJIW 1LNQA 1R73A 4JTAB 4PA4A 4LC1A 2EINC 4FMTA 3OMIB 1S77D 3OMAB 5L3BA 2WLJA 1RM1B 3CCRV 5KA5A 3ASNC 4MTFA 2DYSB 1THZA 2R9RB 3ZMUA 2QM7A 1H2GA 1AJNA 1QLNA 2Q68A 3CC4V 1VQ4V 3E8BA 4XBFA 1K5QA 4UVCA 1WPXA 4TWKA 1M56C 5EC1C 1VQPV 4P9OA 1JCHA 2P90A 5B1OA 1CEZA 3OUFA 4QE7A 3AG1B 4MW3A 2WLLB 3D36A 4MVUA 1EBOA 1FXHA 2B1IA 2V1DA 4QPJA 5DM6V 3PJSK 3OR7C 5CN0A 1K9MW 3ZJZA 3CPWU 2OTLV 3K04A 5B3SB 2DQ0A 4JYCA 4PA6A 4PDRA 5BZBA 4MTXA 3JD3A 4GX5A 2X6AA 4QJFB 3W7WA 3OFNG 4L87A 3ASOB 3HB3B 3LDCA 1M1KW 1M9NA 1S72V 4GX1A 5KUKA 1OCRC 2WLKA 2B5UA 3ETGA 3K9AA 3TK1A 3GWOA 1CPYA 2HG5C 4OXSA 1BL8A 1GM7A 2DWDC 2IW5A 3TCUA 4MVOA 5J9PC 3SPGA 3CMAV 2JIZG 4UUJC 1K7DA 5EBWC 4BIUA 2B1GA 3ML0A 1KECA 4MVQA 3H01A 1QLEB 2IJJA 2P6JA 3OE7G 2K1EA 4PA7A 1BHAA 4N23A 1FFTB 5LGUA 1BMFG 4LCUC 4CZZA 4X8AA 3E35A 2IJHA 4JYBA 3P30A 1B6QA 3JYCA 1F23A 3TETA 4J9YB 5FL7G 4WFAV 3F7VC 4EKWA 2W6JG 2YSUB 3SYCA 5E1AC 2AHYA 2QKSA 1H8HG 4TSFG 3LNMB 2XOKG 2OCCC 3AG2B 3MHSC 1Y4MA 3D3IA 2DWEC 3VBBA 1K34A 1F4MA 1OCZB 2X0LA 1NH2B 4JPRA 1FS0G 1YIJV 1MOFA 3OW2U 3OEHG 4G27B 1CP9A 1QR8A 1K73W 2F43G 5GW7A 3CP1A 1BHBA 1SESA 4JTCB 2ZR2A 4BAYA 1OHHG 4ZKIA 1GK9A 4X89A 5DN6G 3B8MA 2EZOA 4FK5C 4I9WA 3K79A 4Q20A 5C93A 2HVJC 3ABMB 4BW5A 1NKDA 5B1AC 1YJWV 1YSCA 3CCEV 3CMEV 4LBEC 1FXKB 1AI4A 4QIWF 3SYQA 2QE7G 1VQOV 2C2AA 3AEIA 2ZDIC 2W0FC 3ZRVA 2PI4A 1E79G 2WLIB 1E1RG 5CMUA 5L3EA 5IY5B 1YJ9V 2OTJV 1QBZA 2HJFC 5L3CA 2P7TC 3CCUV 4R50A 1KC8W 1E1QG 1M90W 3RW0A 1AJPA 3SPJA 2EIMC 3OAAG 3LSQA 2DYRC 1FXKA 1I5XA 5EK0A 2LFRA 1EFRG 3QO5A 3AG3C 2LP7A 1GMGA 4GCZA 4N21A 3R65A 3SYOA 2QM8A 3X2QB 1NVPD 2DQ3A 2XAHA 3F7YC 4PDVA 2WLIA 4XDJA 2A9HA 1RPRA 1NQTA 3AG4B 4F4LA 2XAGA 2JJ2G 2M7WA 3SYPA 4PDMA 1S0VA 2ZXWB 1PNLA 4R8CA 2XAQA 5EBMC 1M57B 1MABG 1VQ9V 1GTOA 2AHZA 1W0JG 5LBQA 4JGSA 4JASA 4QPKA 1SERA 2Y48A 1GM9A 4QE9A 4WFEA 4I5SA 3CCSV 1YHQV 4GX0A 4WCEV 1JJ2U 4JTDB 2ITDC 4RAIA 4KP4A 1K92A 2EINB 1P7BA 3ABKC 3ABTA 3ABUA 2ITCC 1P4RA 4KFMA 4RUEA 1ENVA 3ASNB 1DF4A 1QVFU 3ZMSA 4FPPA 3JD4A 1NVPB 4H37A 1K4CC 2XAFA 1SRYA 2V7QG 4WFBV 1M56B 4UXNA 3G4SV 1R6KA 1S5HC 3WFVA 2FTKA 3E8GA 5IYBO 5LGTA 1R3KC 3STZC 2DW4A 4HZ3A 1OCCC 3MHHC 1DTOA 1DLBA 1EZJA 1K3EA 1QCEA 2JJ1G 1R3LC 2X6CA 4PDLA 3CCMV 3CYOA 1TUEB 4J9ZB 4UV8A 3CCQV 3P32A 4TT3G 5B1BC 1S3JA 1W0KG 2EIJC 4ASUG 1V55C 4MSWC 4UV9A 4Z1MG 3OM3B 2R9IA 1ORQC 2WAMA 2Z5UA 3FB8C 2EZPA 3K0DA 1K33A 5LHHA 2D3OW 2X6BA 2HVKC 3FYIB 3B77A 1ROPA 4RQFA 3JCZA 3DTUB 2JEUA 3W7XA 2EIKC 2NNUA 3E86A 5H9CA 3ZMZA 3E83A 3BEHA 4MVZA 4WFFA 2QEXV 2HFEC 3B8NA 2XNDG 3T4ZA 1OCOC 3CCJV 3WG7C 3I55V 3ZRWA 4FJCC 2EILC 1SETA 5LGNA 1VQ5V 1VQLV 3KG2A 3UKMA 4UVAA 1PD3A 3T1CA 1MG1A 1Q86W 3K3WA 3QNEA 3E89A 3W7UA 1I5YA 1SZTA 4R6ZA 1GO3F 2QA4V 2LFSA 1RM1C 2ZD9A 3BY6A 4R7CA 3T4DA 5HFMA 3ETEA 2DYSC 2Y69B 4CBCA 1F51A 2HKOA 2OCCB 2WWWA 4MVRA 1PL0A 1WLEA 2OT5A 3W7TA 1JPXA 2PI5A 2HLDG 3CXCU 5LHIA 1G8MA 2Q6AA 5H6RA 5L3GA 3IFXA 2H94A 3SPHA 3AG1C 1J95A 5IDJA 4ZBMA 4P30A 4WFHA 5IYCO 3CC7V 1M57C 1R3JC 3JD1A 3SJQC 3UM7A 4WF9V 3LDEA 5B3SC 3E8FA 3RBZA 3CC2V 2JEXA 3ABLB 2Q69A 2A79B 1YTFD 4BIZA 1K5SA 1V54B 1OZ0A 2YEVB 3JD2A 2P67A 2EJRA 3K06A 3ASOC 5B1AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 W;  1KQS U;  3CXC U;  1KC8 W;  3CMA V;  1K9M W;  1W2B U;  1M90 W;  3CPW U;  1VQ9 V;  1Q81 W;  3CCL V;  1VQ5 V;  1VQL V;  2OTL V;  3CCR V;  4WFB V;  1Q82 W;  1VQ7 V;  1YJN V;  1QVG U;  3G4S V;  1Q86 W;  2D3O W;  3I56 V;  3CD6 V;  3CCV V;  1YJW V;  1Q7Y W;  3CC7 V;  1YIT V;  1VQN V;  3CCE V;  3CME V;  3CCS V;  3G6E V;  1YHQ V;  1N8R W;  1KD1 W;  3CC4 V;  4WCE V;  2QA4 V;  1VQ4 V;  1JJ2 U;  1M1K W;  4WF9 V;  1VQO V;  2QEX V;  1VQK V;  1S72 V;  1VQP V;  3CC2 V;  3CCM V;  1VQ6 V;  1VQM V;  1VQ8 V;  3CCQ V;  1YI2 V;  3CCJ V;  1YIJ V;  1K8A W;  3OW2 U;  1NJI W;  1YJ9 V;  1QVF U;  3I55 V;  3G71 V;  4WFA V;  1R73 A;  2OTJ V;  3CCU V;  5DM6 V; 
#chains in the Genus database with same CATH topology
 1KQS U;  4Z1V A;  4X20 A;  3H1J H;  5CB4 B;  2JGU A;  3M99 B;  3JAM N;  1VF5 B;  1L1F A;  2IJK A;  4X64 O;  1NR7 A;  2QKA A;  4NYK A;  2F1M A;  4P9P A;  2Z3Y A;  3T2M A;  1I0H A;  5CA0 A;  1JX9 A;  1WB8 A;  3KZI Z;  4GKK B;  2DYR B;  1AI7 A;  1XOU A;  4DYL A;  4CH5 A;  3ZHT A;  2WSS G;  2W6I G;  1AIL A;  2DMX A;  1V9P A;  2VS0 A;  3RVZ A;  4AQY O;  2BE3 A;  3ZRX A;  2Z0A A;  2GUZ B;  3MDS A;  2UXB B;  3LDD A;  1NR1 A;  3GB7 C;  1KKC A;  1GN6 A;  4JI3 B;  3UT5 A;  3T1H O;  3K57 A;  2WLL A;  2HHH O;  2MW2 B;  5KHK A;  3AG2 C;  4PA9 A;  4YHH O;  5L3F A;  1Q6U A;  3C90 A;  4LF4 O;  1B04 A;  3IAY A;  3ZHR A;  4NXM O;  2EX3 A;  2WLH A;  4MW8 A;  3ABK B;  3ZN1 A;  2IU3 A;  1Q7Y W;  2R72 A;  1RFY A;  3OTF A;  3QO8 A;  2BTQ A;  4ZHQ B;  2P4K A;  4KUM A;  2JK5 C;  2GTS A;  3K03 A;  3SDL A;  1KB9 F;  3ZN0 A;  1VQK V;  4B3M B;  3ABM C;  3AK1 A;  5LMN O;  1N32 B;  2A7W A;  2CTP A;  1IDS A;  3FB7 C;  3RYC A;  1Y76 B;  2KB1 A;  5KMG A;  3RYF B;  1GKF A;  2PTM A;  5IWA O;  4J11 A;  1F7Y A;  4P2Z A;  2W0X A;  4DUY O;  1IZ3 A;  1ZUQ A;  3JAK B;  5FNV B;  3ZED A;  2BOC C;  4E2L A;  5GTI Z;  2Q67 A;  4U7O A;  2YDE A;  4LH6 A;  2IH3 C;  2EIK B;  4DUZ B;  4G2K A;  4O4I B;  1GM8 A;  4PEL A;  3L72 H;  2WPD G;  2EIL B;  2IU0 A;  5JJN B;  2UXX A;  4MTG A;  5JJJ B;  3DXR A;  4CH3 A;  5LA6 B;  1LNQ A;  2QJ1 A;  2UUA O;  5KX5 A;  4DR7 O;  5KA5 A;  1IBK B;  1AP5 A;  1H2G A;  1YDX A;  2Q68 A;  3C3T A;  2Q5Z A;  1K5Q A;  5E79 Z;  4UVC A;  4DR1 B;  3WB2 A;  2P90 A;  2RMK B;  3OUF A;  4FFK A;  2WA4 A;  3AG1 B;  4MW3 A;  2R9A A;  5GTH Z;  4MVU A;  5DM6 V;  4QPJ A;  5CN0 A;  1HNZ B;  1XBL A;  3K04 A;  5B3S B;  2DQ0 A;  1GRJ A;  4JYC A;  3RYH A;  5BZB A;  5BXZ A;  4GX5 A;  4AHC A;  5KAF Z;  1FJG B;  3W7W A;  3HB3 B;  3ZHU A;  1M1K W;  4DR5 B;  2ETN A;  1SQP H;  1S72 V;  3N2K B;  5KUK A;  2WLK A;  3NR7 A;  3TK1 A;  3GWO A;  2L6L A;  4TQF A;  3CRA A;  1GM7 A;  2DWD C;  2IW5 A;  3TCU A;  2N74 A;  2JIZ G;  1K7D A;  5EBW C;  4BIU A;  3ML0 A;  2QSA A;  4NTY A;  4JAA A;  2OYQ A;  4K0K B;  3HKE B;  1BHA A;  4N23 A;  1FFT B;  2E76 B;  2BTO A;  2UUB O;  3E35 A;  2FL4 A;  3P30 A;  1VF6 C;  3K9S A;  4I4T A;  1F23 A;  3TET A;  4KHP B;  1SKV A;  5B66 Z;  1HNW B;  3U10 A;  5FL7 G;  2YS8 A;  2YSU B;  3CEI A;  2E5L B;  1BS3 A;  2AHY A;  1IBM B;  2QKS A;  1XNQ B;  1I94 B;  5LMU O;  3OD4 A;  1O9G A;  3VQX A;  1AVM A;  2OIE A;  1JFF A;  1EN4 A;  1EN6 A;  4NXN B;  1OCZ B;  1WB7 A;  5A9G A;  1NH2 B;  1YIJ V;  3OW2 U;  4G27 B;  3J7A U;  1CP9 A;  1QR8 A;  1K73 W;  2F43 G;  5GW7 A;  1SES A;  2ZR2 A;  1GK9 A;  5JCO A;  5DN6 G;  1ZX3 A;  5C93 A;  1YJW V;  1LR1 A;  3CS5 A;  3CME V;  4J42 A;  1AI4 A;  1HR0 O;  2KG7 B;  3AEI A;  2ZDI C;  2A3Q A;  3K5O A;  2WLI B;  3JAS B;  4DK0 A;  1YEW A;  4IHJ A;  1YXB A;  3APQ A;  1M90 W;  4D6T H;  2CAZ C;  3SPJ A;  2DYR C;  4FZ1 A;  1FXK A;  1Q8I A;  5EK0 A;  2LFR A;  4N21 A;  1GMG A;  1NVP D;  2QM8 A;  4C7U A;  5JQG A;  2DQ3 A;  2RDC A;  4YY3 O;  4XDJ A;  4WBN B;  3BCC H;  3OTO B;  2M7W A;  4YIP A;  4EB6 A;  3H9V A;  2ZXW B;  2YC0 A;  2XAQ A;  4Z2W A;  1L0N H;  2F95 B;  5KHJ A;  1MAB G;  1VQ9 V;  1GTO A;  1W0J G;  2Q0A A;  5LBQ A;  3TXQ A;  1SF9 A;  4BR6 A;  4QPK A;  2Y48 A;  1GM9 A;  1YHQ V;  4WCE V;  5BR8 O;  4JTD B;  5LYJ A;  2EIN B;  2LGW A;  2PZS A;  3ABK C;  3ASN B;  3HKC B;  1NTZ H;  2UXC O;  3HKD B;  2UU9 B;  2Q7E A;  4JV5 O;  1IBL O;  2OIG A;  1HW7 A;  1MA1 A;  4UXN A;  3RT3 C;  5LGT A;  3E8G A;  4LFA B;  2LQT A;  3F5T A;  4ABM A;  1DLB A;  1QCE A;  4A5U B;  3CCM V;  1R3L C;  1J5E B;  4Q6G A;  3CYO A;  1TUE B;  4UV8 A;  3CCQ V;  3JAL A;  1XMQ B;  1SA0 B;  3OT7 A;  1W0K G;  4LNU B;  5GON B;  4UV9 A;  2VQE O;  1ORQ C;  3FB8 C;  2OWO A;  3QG5 A;  1JR9 A;  2D3O W;  1BCC H;  3FYI B;  2F93 B;  4BIO A;  3B77 A;  4PJ0 Z;  3FFQ A;  1RP3 B;  2EIK C;  2NNU A;  2QWN B;  3BFR A;  3CXH F;  2XND G;  2N05 A;  2JS3 A;  5AG2 A;  4FLX A;  3JAR A;  2EIL C;  4I50 A;  2Q7H A;  4K8Z A;  2ARH A;  4IT5 A;  3UKM A;  1TVK A;  2CE4 A;  4UVA A;  3T1C A;  4ZI7 B;  1Q86 W;  4DV6 B;  2DN9 A;  2ZIN A;  3EVK A;  1SZT A;  3RN4 A;  1GO3 F;  2QA4 V;  2LFS A;  3D36 C;  2BCC H;  4CC5 A;  4R7C A;  3T4D A;  4JI5 O;  3B40 A;  2HKO A;  2WWW A;  2PI5 A;  4J7Z A;  1AB3 A;  1ZSP A;  3CXC U;  1UFI A;  5L3G A;  1TGO A;  3CWB H;  3JSN A;  3J81 N;  1GAX A;  3AG1 C;  4X20 B;  4B7E A;  1N33 B;  3U0Z A;  3JD1 A;  3UM7 A;  1QHT A;  4ZIB A;  5B3S C;  3E8F A;  3CC2 V;  1WA8 A;  4JI1 B;  1KUQ A;  4BIZ A;  1K5S A;  2FKX A;  3JD2 A;  2H3O A;  2EJR A;  3K06 A;  3G80 A;  5B1A B;  2GBO A;  1JVM A;  2LO1 A;  3JCU Z;  2V4D A;  1T5E A;  3A0R A;  3BA9 A;  3RVY A;  1FKA O;  2KQX A;  5JH7 A;  1JA8 A;  1PM9 A;  4LF9 O;  2YEV A;  1B06 A;  3KKY A;  4MVM A;  5KAI Z;  4GKK O;  2BSK B;  3IC7 A;  1XUQ A;  3T1Y O;  4PA3 A;  3UT5 B;  4JF3 A;  4UVB A;  4DV1 B;  2XAJ A;  2QWR B;  1NTK H;  3EFF K;  5IYD O;  1ARO P;  4GT1 A;  3ZMV A;  1YTF B;  3H1H H;  5EC2 C;  3ZIA G;  4JI3 O;  1QR9 A;  5CA3 A;  5FLX N;  1OJH A;  2JDI G;  4LWS A;  4FLV A;  1MSW D;  1DF5 A;  3QO7 A;  1HWY A;  3E22 A;  1I7F A;  1R3I C;  1OCZ C;  4UCT A;  4LFB O;  2ODM A;  4DR6 O;  4JI6 B;  3RYC B;  3ZRS A;  4MT8 A;  3ZCC A;  5EIB D;  4FLW A;  4CH6 A;  2ADQ B;  1AI6 A;  2ZE8 A;  2VQF O;  1KD1 W;  5KMG B;  4O2A A;  2GSM B;  2CGO A;  2Y4U A;  4J7J A;  5IYZ A;  1LUV A;  1N32 O;  5LXT B;  3PN1 A;  4X1I A;  1YJN V;  5H2F Z;  3FB6 C;  1W2B U;  2Y69 C;  1W59 A;  3OR6 C;  1D2D A;  2PGG A;  4XDK A;  3CCV V;  1GN4 A;  1NS1 A;  4LF7 B;  5B1B B;  1N8R W;  1PNM A;  4RWU A;  2EIJ B;  2QTO A;  3FB5 C;  4DK1 A;  4DR2 B;  1XNR B;  4O4H B;  3LSU A;  2HJD A;  3I5D A;  1G4Y B;  2GTA A;  3BA8 A;  3W7S A;  1URF A;  4B08 A;  3FX7 A;  3DXR B;  2YID A;  2PYL A;  1SS3 A;  4I55 A;  1IXM A;  2ZXW C;  1K97 A;  3ZHQ A;  5F2V O;  3AG7 A;  5KX5 B;  1OCO B;  1ZL8 A;  1PPJ H;  4X88 A;  2WLN A;  4J7K A;  4GYC B;  4FIP C;  3UO2 A;  4I0X A;  5CBG A;  2XHB A;  1QNM A;  4DR3 B;  4JTA B;  1WAZ A;  2VWJ A;  4LC1 A;  1HNX B;  2EIN C;  3JSL A;  1S77 D;  3OMA B;  1L0L H;  1RM1 B;  3ASN C;  4ZOL A;  4MTF A;  4JYA B;  2DYS B;  2R9R B;  4TV8 A;  3ZMU A;  2UUC B;  1AJN A;  3CC4 V;  3RYH B;  2NN4 A;  1VQP V;  1NZ6 A;  3N27 A;  5B1O A;  1CEZ A;  1XI1 A;  1HNZ O;  1EBO A;  1SQV H;  3PJS K;  1KU9 A;  3B09 A;  2XT9 A;  3UCS C;  2AGA A;  4FLZ A;  3OFN G;  4L87 A;  3IC9 A;  4X66 O;  3FAV A;  1MSD A;  2LW1 A;  4GX1 A;  1OCR C;  2EJ7 A;  1YVW A;  3K9A A;  1VAR A;  4EFB A;  1WP7 A;  2RNB A;  2WA3 A;  1I08 A;  5B5E Z;  3CMA V;  4I4T B;  1S5L Z;  4UUJ C;  2DOS A;  3SJC C;  1TUB A;  2YIB D;  1KEC A;  3H01 A;  2ZT9 B;  4X65 O;  3OE7 G;  4PA7 A;  4DV2 B;  1IVS A;  3OGI B;  4X8A A;  4PD4 F;  1JFF B;  3IJ4 A;  3P3N A;  3L74 H;  1Y67 A;  1N34 B;  3JYC A;  2YIC A;  4WFA V;  4DV4 B;  4JI0 B;  3F7V C;  2RCV A;  3SYC A;  1N36 O;  1XNQ O;  2YXY A;  4GKJ B;  3VQV A;  2XOK G;  2RQ6 A;  3D3I A;  4NXN O;  4EFE A;  1K34 A;  1F4M A;  2YXL A;  4B3R B;  4YJ3 A;  4K3A A;  4BAY A;  1OHH G;  4X89 A;  4IHJ B;  4LF5 B;  2N04 A;  2EZO A;  4FK5 C;  2VRZ A;  2HVJ C;  5B1A C;  1YSC A;  5K1X A;  3CCE V;  2D2C B;  2CTR A;  2ZNJ A;  1S5J A;  1WPB A;  4DV7 O;  1FXK B;  1SQQ H;  4QIW F;  4FLY A;  3P3P A;  2QE7 G;  2C2A A;  5JQG B;  1FD9 A;  2PI4 A;  4IIJ B;  1E79 G;  1E1R G;  5CMU A;  5IY5 B;  5FPO A;  2HJF C;  3CCU V;  4EB6 B;  5IJ9 B;  3A8T A;  3X2Q B;  1SZX A;  3F7Y C;  3OTO O;  2A9H A;  1RPR A;  1Z5V A;  2XTA A;  5IJ0 A;  5LYJ B;  1PNL A;  5EBM C;  2CGN A;  4LF8 B;  2AHZ A;  4JAS A;  1Y74 A;  3WB0 A;  5KHH A;  1SER A;  2LGQ A;  3CCS V;  4X64 B;  1X4T A;  4OPH A;  2QR4 A;  3ABT A;  2ITC C;  4KFM A;  1ENV A;  2UU9 O;  1QVF U;  4K35 A;  1L8D A;  1Q90 D;  4LFC B;  3JAL B;  1NVP B;  4H37 A;  3K5M A;  4GLX A;  1M56 B;  3G4S V;  3RYI A;  1EM1 A;  4TV9 A;  3RWR D;  3WFV A;  2FTK A;  1M4U A;  5J2U B;  1R3K C;  3STZ C;  2DW4 A;  3R66 A;  1J5E O;  3MHH C;  1EZJ A;  1K3E A;  3T1H B;  4PDL A;  4B3S O;  4J9Z B;  4FM0 A;  2HHH B;  5B1B C;  1S3J A;  2F23 A;  2EIJ C;  4ASU G;  4LF4 B;  3OM3 B;  2GUZ A;  2JGD B;  2WAM A;  3K0D A;  3ICX A;  4CS4 A;  3JAR B;  2QKC A;  4DRX A;  4NXM B;  2Q8V A;  4I50 B;  4OX9 O;  1TVK B;  4L8J A;  5DED A;  1ROP A;  4O2B A;  4O4L A;  4DV5 O;  3ZMZ A;  4FM2 A;  3BEH A;  4MVZ A;  4WFF A;  4UCR A;  3T4Z A;  1OCO C;  5LMN B;  4FJC C;  4U3J A;  1G6U A;  2ADP A;  5LGN A;  3WU2 Z;  1VQ5 V;  3L70 H;  4FFB A;  3HR0 A;  1PD3 A;  4DV6 O;  3QNE A;  3CRQ A;  1GN3 A;  5JVD A;  1SQX H;  2XUM A;  3TGU H;  4DUY B;  1RM1 C;  4JI2 O;  2ZD9 A;  4UB8 Z;  5HFM A;  3ETE A;  2DYS C;  2Y69 B;  4HNA A;  1WA8 B;  4LH7 A;  2OT5 A;  1WLE A;  3W7T A;  2HLD G;  1G8M A;  3WB1 A;  2H94 A;  1J95 A;  2ZE6 A;  1H2L A;  2QWO B;  2FYU H;  4WFH A;  2OCH A;  1R3J C;  2JVD A;  1VMG A;  4NTW A;  3SJQ C;  4JI1 O;  4WF9 V;  4DV3 O;  3RBZ A;  4B7K A;  4YIO A;  5JH7 B;  2Q69 A;  1OZ0 A;  2YEV B;  4HAM A;  1FFX A;  1AI5 A;  4FM1 A;  4MTO A;  1VQ7 V;  4DR7 B;  3QTC A;  1XRE A;  1VQN V;  1NTM H;  2ZM6 B;  1H2K A;  5KA6 A;  4G28 B;  1VIB A;  3LNN A;  3E8H A;  1K4D C;  4X1K A;  1VQ8 V;  4DV1 O;  2EIM B;  3SYA A;  2NLJ C;  4UCS A;  4LWS B;  1XHX A;  1WNS A;  3CSX A;  5CBH A;  3E22 B;  1XEQ A;  4O4J A;  1QU7 A;  2IH1 C;  3CX5 F;  2NR5 A;  5LHG A;  2BOB C;  3CD6 V;  3G6E V;  3JD0 A;  1CXZ B;  4BW9 A;  4U7N A;  1GH6 A;  1VQM V;  4O2A B;  3K5N A;  5IYZ B;  3JAT A;  4B3T O;  5JCO C;  1WN7 A;  3G71 V;  5DEC A;  1YCI A;  2ZE5 A;  1NH2 D;  3OMN B;  3GVM A;  1TA8 A;  4X1I B;  3L9D A;  3OEE G;  3EXA A;  3ZRW B;  3LUT B;  1OCR B;  2A0L A;  2EBO A;  1Y6X A;  2ZNI A;  3KCX A;  1PNK A;  3EHB B;  3K0G A;  5IT9 N;  2UXN A;  2F4V O;  5K1P A;  3CB2 A;  1P84 F;  1XL4 A;  1NBM G;  2Q7G A;  2Q9L A;  3K08 A;  1FXK C;  2P06 A;  1KBH A;  4U3F H;  1H38 A;  3U11 A;  4FZ0 A;  2UXD O;  3OUS A;  1OCC B;  4LF7 O;  1KP3 A;  5LMU B;  5IY5 C;  4RUF A;  4JI7 O;  1KP2 A;  1H8E G;  2QWP B;  3RGB A;  3FYE B;  4I55 B;  4DW0 A;  5LP6 A;  2A06 H;  1ZL8 B;  1MNG A;  4QNH B;  1S76 D;  3X2Q C;  1YI2 V;  2XAS A;  4I0X B;  5KHG A;  3VOU A;  3LSS A;  1Q81 W;  5EZY A;  1V54 C;  1COW G;  3IGA C;  5KUM A;  5HFL A;  1ZWI C;  4NR1 A;  3WG7 B;  4ZOL B;  4TV8 B;  3SPI A;  1HR0 B;  1VQ6 V;  3NXS A;  1WJZ A;  4NB5 A;  5B1N A;  4DR3 O;  4JI8 B;  1NJI W;  4PA4 A;  4DV0 B;  3OMI B;  5CA0 B;  3G67 A;  4TUY A;  1R6T A;  4JYA O;  3ZBH A;  2QM7 A;  2KG7 A;  1QLN A;  2E74 B;  1VQ4 V;  4XBF A;  1LUW A;  4YY3 B;  1WPX A;  1M56 C;  5EC1 C;  1JCH A;  4NTX A;  1VEW A;  2WLL B;  2V1D A;  1K9M W;  3ZJZ A;  3CPW U;  2DJV A;  4PA6 A;  4PDR A;  5EYP A;  2FML A;  2UXB O;  3ZHV A;  1TUB B;  4QJF B;  2AZ2 A;  5BY1 A;  5BR8 B;  1M9N A;  1U96 A;  3O65 A;  4DR4 B;  2B5U A;  1IXB A;  3C3S A;  2BTQ B;  1CPY A;  1BL8 A;  3ZX6 A;  4MVO A;  4J10 A;  1FYJ A;  2P22 C;  2UXC B;  1YF2 A;  4JI4 B;  4OPA A;  2ZIO A;  4CS2 A;  3UO3 A;  1IBL B;  4MVQ A;  1QLE B;  2IJJ A;  2K1E A;  1EN5 A;  1H2S B;  5LGU A;  1BMF G;  1N4C A;  4EEQ A;  4H13 B;  2IJH A;  1N34 O;  4B3M O;  1B6Q A;  2CTQ A;  4JI0 O;  4J9Y B;  4YJ3 B;  2EUL A;  2CH7 A;  2W6J G;  2ZKO A;  2PYJ A;  5E1A C;  2VQE B;  2ZCE A;  1H8H G;  4JZ2 A;  3LNM B;  3AK3 A;  4CC6 A;  1UPG A;  1Y4M A;  3HKB A;  4B3R O;  4LNU A;  5KLV H;  3JAW A;  2CDY A;  1FS0 G;  1MOF A;  4PHZ A;  2HP8 A;  3N2G A;  5J2T A;  3CP1 A;  4LF5 O;  3Q4H A;  4DUZ O;  3BHP A;  3VQW A;  5ITZ A;  4DW1 A;  1Q5O A;  1KMI Z;  4I9W A;  4BW5 A;  4LBE C;  4X1Y A;  1KYO F;  3SYQ A;  1A32 A;  5L3E A;  4F6R A;  5IJ0 B;  1YJ9 V;  4PI2 A;  2P7T C;  4R50 A;  1KC8 W;  4X9Q A;  1XMO B;  2EIM C;  2QTS A;  1IBK O;  1I5X A;  3SYO A;  3A2F A;  4GCZ A;  5JJE B;  1Y74 B;  1WP8 A;  4KL1 A;  1NQT A;  3AG4 B;  4F4L A;  4DR1 O;  3SYP A;  4PDM A;  1S0V A;  3VQY A;  4R8C A;  4KXR A;  4LF8 O;  2QGN A;  3CE2 A;  2Q73 A;  3ZS8 C;  4H0L B;  1FJG O;  1NU1 H;  2K9P A;  4GZR B;  2B9Z A;  4YJ2 A;  4QE9 A;  4WFE A;  5C8Y A;  1Q43 A;  4DR5 O;  3RYI B;  4TV9 B;  4RAI A;  2LW7 A;  4KP4 A;  1K92 A;  4LF9 B;  3ABU A;  4NKG B;  1P4R A;  3S3W A;  3CJH A;  3T1Y B;  1DF4 A;  4LFC O;  3ZMS A;  5BMV A;  1O9H A;  4FPP A;  1H2M A;  3JD4 A;  1K4C C;  2QM4 A;  4BWA A;  1SQF A;  4WFB V;  4UFZ A;  1R6K A;  4K0K O;  3CRC A;  4D7T A;  2IBZ H;  2BSK A;  5IYB O;  4DRX B;  1U97 A;  5LOV A;  3K5L A;  4HZ3 A;  1OCC C;  4O2B B;  4KHP O;  4AIL C;  1AP6 A;  4TT3 G;  4X62 B;  1HNW O;  4O4L B;  2E5L O;  4MSW C;  2AZ0 A;  4Z1M G;  4UCU A;  2R9I A;  1IBM O;  2YUA A;  2EZP A;  1I94 O;  3CRM A;  4LFB B;  4U3J B;  4DR6 B;  1ZTE A;  5LHH A;  4FFB B;  5EIB C;  2CUG A;  2VQF B;  3MAQ A;  3K59 A;  4RQF A;  3JCZ A;  3DTU B;  2JEU A;  3W7X A;  1VQO V;  3E86 A;  5JVD B;  4I9Q A;  4UCO A;  3CCJ V;  3WG7 C;  3I55 V;  3UQ8 A;  3CHX A;  2G38 A;  1SET A;  4HNA B;  4J80 A;  4K8X A;  3KG2 A;  4IL6 Z;  1MG1 A;  3K3W A;  4R6Z A;  5LXT A;  2YIB A;  4CBC A;  5CA1 A;  3CRR A;  2OCC B;  4MVR A;  1PL0 A;  4LF6 B;  2HEP A;  1JPX A;  1BZK A;  5LHI A;  1VF6 A;  5H6R A;  2Q6A A;  1N0J A;  1ZAU A;  2KKW A;  4CS3 A;  3SPH A;  5IDJ A;  1FFX B;  2AW9 A;  4O4H A;  1M57 C;  1DK1 A;  2A79 B;  3D8C A;  1V54 B;  4X1K B;  3D3Q A;  1AJQ A;  4PV1 B;  2H8P C;  4YXW G;  1RSO A;  1Q82 W;  4HYO A;  2ZM6 O;  4O4J B;  3OGC C;  1BGY H;  1QLE C;  4XDL A;  5FPR A;  1IUR A;  4FLT A;  5LL6 Y;  4DXW A;  2FB5 A;  2Y0I A;  2ZR3 A;  3AG3 B;  5CB4 A;  5JWP A;  5KHI A;  2ZDI A;  3JAT B;  3K58 A;  4JAU A;  3CCL V;  2ZIM A;  1DGS A;  2ATK C;  2QDO A;  4LP8 A;  1PKX A;  1QVG U;  3I56 V;  4AQY B;  4LFA O;  4MS2 A;  4QGP A;  3FKS G;  3HPL C;  1AR1 B;  4X66 B;  3QVN A;  2GHY A;  1BQZ A;  2IJI A;  1RPO A;  3F5W C;  1XMQ O;  2R70 A;  5L3D A;  4LR3 A;  3ZMT A;  4YHH B;  1Q6I A;  2ZQM A;  3H1L H;  3KCY A;  1R6N A;  1D5N A;  1JQ0 A;  2YXH A;  2HR3 A;  4H44 B;  2QWQ B;  4X65 B;  4FVM A;  1XDC A;  4WFG A;  4UCV A;  1SC5 B;  1JOY A;  5D5Q A;  5CBF A;  3O9O A;  3SPC A;  5LP6 B;  2X7R B;  1AR5 A;  3M8A A;  4JAV A;  4MVS A;  4GX2 A;  4RO2 A;  4H33 A;  3DGE A;  4D7S A;  3ETQ A;  1N36 B;  3L71 H;  3TJT A;  1GN2 A;  4I7Z B;  4JZG A;  4ZHQ A;  1BSM A;  5EZY B;  5H6Q A;  5IWA B;  1Y66 A;  1FXV A;  2YI8 A;  3STL C;  1V55 B;  2DE0 X;  1F4N A;  1BE3 H;  1Y76 A;  1UJW B;  2CK3 G;  1R1B A;  4RQE A;  3AG4 C;  3RYF A;  3ABL C;  2MK3 A;  2VWK A;  1KKD A;  1EZV H;  3RFR A;  1XHZ A;  5EBL C;  3FD9 A;  4DO2 A;  1N33 O;  2WLM A;  4TUY B;  1YIT V;  1FPO A;  3JAK A;  5FNV A;  3E2E A;  3MD0 A;  4DV7 B;  2AXT Z;  4JI8 O;  1XL6 A;  2LJ2 A;  4DV0 O;  2L35 A;  1K8A W;  3ETD A;  2M6Y A;  2P5O A;  1R73 A;  4FMT A;  4O4I A;  5L3B A;  2WLJ A;  2UUA B;  3CCR V;  1THZ A;  1H2N A;  4IIJ A;  5EYP B;  3E8B A;  1VP7 A;  4TWK A;  5LA6 A;  4P9O A;  2PY5 A;  4IYI A;  3BPZ A;  4QE7 A;  2GV9 A;  3D36 A;  1FXH A;  2B1I A;  2Q0O C;  4W4K A;  5IJ9 A;  3OR7 C;  4GUN A;  2OTL V;  1YZB A;  4MTX A;  3JD3 A;  2X6A A;  3ASO B;  3BVO A;  3LDC A;  4DR4 O;  3BAA A;  3BRC A;  3ETG A;  2HG5 C;  4OXS A;  4AI8 A;  4JI4 O;  3DSQ A;  5J9P C;  3M7M X;  3SPG A;  2B1G A;  4JI6 O;  2CH7 B;  4E4E A;  1JMK C;  2P6J A;  3GWK C;  2GDS A;  3N2K A;  5TIS Z;  2Y4T A;  4LCU C;  4CZZ A;  2E3C A;  4JYB A;  3HKB B;  1G1X B;  2CTW A;  2UUB B;  4B3S B;  1PP9 H;  1SQB H;  1BQ0 A;  3JAW B;  4EKW A;  1TAE A;  5J2U A;  3HKE A;  1N0N A;  4TSF G;  2OCC C;  3N2G B;  5J2T B;  1D5A A;  3AK2 A;  1P7G A;  3AG2 B;  3Q4H B;  1HDJ A;  3L73 H;  1X59 A;  3MHS C;  5ITZ B;  4OX9 B;  4PI0 A;  2DWE C;  3VBB A;  4DR2 O;  1XQ8 A;  1XNR O;  4X1Y B;  2X0L A;  4IGG A;  4DV5 B;  4JPR A;  2JGD A;  1US6 A;  3DC6 A;  3QF7 A;  3S3X A;  4TOI A;  3OEH G;  3B2E E;  1BHB A;  4F6R B;  4JTC B;  4OGQ B;  2KSD A;  4ZKI A;  2E75 B;  3B8M A;  4Q20 A;  3K79 A;  3J80 N;  3ABM B;  1NKD A;  1OV9 A;  1Q6H A;  3SR2 C;  2W0F C;  4JI2 B;  3ZRV A;  4TQD A;  2OTJ V;  4HBN A;  1HNX O;  1QBZ A;  3G6B A;  5L3C A;  1XMO O;  3DC5 A;  1E1Q G;  3TXS A;  4F6E A;  3RW0 A;  5A2Q N;  1AJP A;  3OAA G;  3LSQ A;  2UUC O;  1EFR G;  3QO5 A;  3AG3 C;  2LP7 A;  2F66 C;  4IYH A;  3R65 A;  2Q4P A;  4UB6 Z;  1M93 A;  2XAH A;  4PDV A;  2WLI A;  4W4L A;  4YJ2 B;  4DV3 B;  5C8Y B;  2XAG A;  2JJ2 G;  3JAS A;  3FAV B;  1AR4 A;  1XIL A;  2P4V A;  3CJH B;  4JYY A;  1M57 B;  2PUS A;  5BMV B;  4JGS A;  2JRI A;  4WBN A;  4I5S A;  1M5I A;  4GX0 A;  1JJ2 U;  2ZE7 A;  2YIA A;  2ITD C;  1P7B A;  5LOV B;  4RUE A;  1NT2 B;  4FLU A;  2XAF A;  1SRY A;  2V7Q G;  2Y0P A;  5LP6 C;  4JV5 B;  4DV2 O;  1S5H C;  2RJZ A;  3BAB A;  3HKC A;  1DTO A;  3SJA C;  5D5P A;  2JJ1 G;  2X6C A;  4X62 O;  1JJO A;  1SQG A;  3A0H Z;  3HKD A;  3P32 A;  4DV4 O;  5H5N A;  4B3T B;  1V55 C;  4GKJ O;  1MZE A;  1PL4 A;  2Z5U A;  3H1K H;  3THO A;  1K33 A;  5IE9 A;  4NVP A;  2X6B A;  2HVK C;  2YI9 A;  1SA0 A;  2QEX V;  5H9C A;  3E83 A;  3ZHS A;  2RN9 A;  2HFE C;  3B8N A;  5GON A;  1BT8 A;  2F4V B;  2ILM A;  3ZRW A;  1P49 A;  5CA1 B;  2JS5 A;  1HP8 A;  1VF7 A;  3B4S A;  1VQL V;  2UXD B;  1QQC A;  3E89 A;  3W7U A;  1Z5W A;  3H1I H;  4JI7 B;  1I5Y A;  2PF4 E;  3APO A;  3BY6 A;  3L75 H;  1F51 A;  4LF6 O;  1B3Q A;  4JI5 B;  1Z2G A;  1NI8 A;  4ZI7 A;  1Q3E A;  3IFX A;  2IM9 A;  1FAF A;  3A0B Z;  4ZBM A;  4P30 A;  3SGI A;  5IYC O;  1MMM A;  3CC7 V;  1RSO B;  3SJB C;  4J41 A;  1PV0 A;  3LDE A;  2O57 A;  1MZF A;  1IX9 A;  2JEX A;  3ABL B;  1ZLZ A;  1YTF D;  4ICG A;  4CH4 A;  2P67 A;  3ASO C; 
#chains in the Genus database with same CATH homology
 1KQS U;  1AJQ A;  1JVM A;  4HAM A;  2H8P C;  4YXW G;  1AI5 A;  1Q82 W;  4MTO A;  1VQ7 V;  3M99 B;  4HYO A;  3A0R A;  1L1F A;  2IJK A;  1VQN V;  3OGC C;  3RVY A;  5KA6 A;  4G28 B;  1NR7 A;  2YEV A;  3E8H A;  4MVM A;  1K4D C;  1QLE C;  4XDL A;  3IC7 A;  4P9P A;  2Z3Y A;  3T2M A;  1VQ8 V;  2EIM B;  1JX9 A;  4PA3 A;  2DYR B;  1AI7 A;  2NLJ C;  4JF3 A;  4UVB A;  3SYA A;  4DXW A;  2XAJ A;  2ZR3 A;  3AG3 B;  2WSS G;  2W6I G;  2ZDI A;  5CBH A;  3EFF K;  4JAU A;  3CCL V;  3RVZ A;  2IH1 C;  5IYD O;  4LP8 A;  2ATK C;  1ARO P;  5LHG A;  1PKX A;  1QVG U;  3ZRX A;  3I56 V;  2BOB C;  4GT1 A;  3CD6 V;  3LDD A;  3ZMV A;  1YTF B;  1NR1 A;  4MS2 A;  3GB7 C;  3JD0 A;  5EC2 C;  3ZIA G;  3G6E V;  3FKS G;  3HPL C;  1AR1 B;  4U7N A;  1QR9 A;  5CA3 A;  2GHY A;  2WLL A;  1MSW D;  2JDI G;  1DF5 A;  3QO7 A;  1VQM V;  2IJI A;  1RPO A;  3F5W C;  3AG2 C;  4PA9 A;  5L3F A;  5L3D A;  1HWY A;  3ZMT A;  3G71 V;  1NH2 D;  1R3I C;  1OCZ C;  3OMN B;  2ZQM A;  2WLH A;  4MW8 A;  3OEE G;  1R6N A;  3ZRW B;  3ABK B;  1JQ0 A;  3ZN1 A;  2IU3 A;  2HR3 A;  3ZRS A;  4MT8 A;  3LUT B;  3ZCC A;  1OCR B;  1Q7Y W;  1AI6 A;  3QO8 A;  1KD1 W;  4WFG A;  2A0L A;  2EBO A;  2GSM B;  4KUM A;  2JK5 C;  1PNK A;  3EHB B;  3K0G A;  3K03 A;  1VQK V;  1JOY A;  3ZN0 A;  2UXN A;  5CBF A;  3SPC A;  1XL4 A;  3ABM C;  1NBM G;  2X7R B;  4JAV A;  4MVS A;  3K08 A;  1FXK C;  1YJN V;  4GX2 A;  4RO2 A;  4H33 A;  3DGE A;  3FB6 C;  3FB7 C;  1H38 A;  1W2B U;  2Y69 C;  3OUS A;  1OCC B;  2KB1 A;  3OR6 C;  1KP3 A;  1GKF A;  5IY5 C;  4RUF A;  4XDK A;  1KP2 A;  3CCV V;  1H8E G;  5B1B B;  4P2Z A;  1N8R W;  1PNM A;  3FYE B;  5H6Q A;  1Y66 A;  1FXV A;  2EIJ B;  3STL C;  1V55 B;  2QTO A;  3FB5 C;  1F4N A;  4QNH B;  2BOC C;  4E2L A;  1S76 D;  3X2Q C;  1YI2 V;  1G4Y B;  2Q67 A;  2XAS A;  3W7S A;  4U7O A;  1UJW B;  2CK3 G;  4RQE A;  3AG4 C;  3ABL C;  3VOU A;  2MK3 A;  3LSS A;  1Q81 W;  2IH3 C;  1COW G;  1V54 C;  1KKD A;  2EIK B;  3IGA C;  5EBL C;  4G2K A;  1IXM A;  2ZXW C;  1K97 A;  4DO2 A;  5KUM A;  2WLM A;  1GM8 A;  1OCO B;  5HFL A;  1ZWI C;  1YIT V;  4PEL A;  4X88 A;  3WG7 B;  2WLN A;  3E2E A;  3MD0 A;  2WPD G;  2EIL B;  4FIP C;  2IU0 A;  3SPI A;  2UXX A;  1VQ6 V;  3NXS A;  4MTG A;  1XL6 A;  5CBG A;  5B1N A;  1K8A W;  3ETD A;  1NJI W;  1LNQ A;  1R73 A;  4JTA B;  4PA4 A;  4LC1 A;  2EIN C;  4FMT A;  3OMI B;  1S77 D;  3OMA B;  5L3B A;  2WLJ A;  1RM1 B;  3CCR V;  5KA5 A;  3ASN C;  4MTF A;  2DYS B;  1THZ A;  2R9R B;  3ZMU A;  2QM7 A;  1H2G A;  1AJN A;  1QLN A;  2Q68 A;  3CC4 V;  1VQ4 V;  3E8B A;  4XBF A;  1K5Q A;  4UVC A;  1WPX A;  4TWK A;  1M56 C;  5EC1 C;  1VQP V;  4P9O A;  1JCH A;  2P90 A;  5B1O A;  1CEZ A;  3OUF A;  4QE7 A;  3AG1 B;  4MW3 A;  2WLL B;  3D36 A;  4MVU A;  1EBO A;  1FXH A;  2B1I A;  2V1D A;  4QPJ A;  5DM6 V;  3PJS K;  3OR7 C;  5CN0 A;  1K9M W;  3ZJZ A;  3CPW U;  2OTL V;  3K04 A;  5B3S B;  2DQ0 A;  4JYC A;  4PA6 A;  4PDR A;  5BZB A;  4MTX A;  3JD3 A;  4GX5 A;  2X6A A;  4QJF B;  3W7W A;  3OFN G;  4L87 A;  3ASO B;  3HB3 B;  3LDC A;  1M1K W;  1M9N A;  1S72 V;  4GX1 A;  5KUK A;  1OCR C;  2WLK A;  2B5U A;  3ETG A;  3K9A A;  3TK1 A;  3GWO A;  1CPY A;  2HG5 C;  4OXS A;  1BL8 A;  1GM7 A;  2DWD C;  2IW5 A;  3TCU A;  4MVO A;  5J9P C;  3SPG A;  3CMA V;  2JIZ G;  4UUJ C;  1K7D A;  5EBW C;  4BIU A;  2B1G A;  3ML0 A;  1KEC A;  4MVQ A;  3H01 A;  1QLE B;  2IJJ A;  2P6J A;  3OE7 G;  2K1E A;  4PA7 A;  1BHA A;  4N23 A;  1FFT B;  5LGU A;  1BMF G;  4LCU C;  4CZZ A;  4X8A A;  3E35 A;  2IJH A;  4JYB A;  3P30 A;  1B6Q A;  3JYC A;  1F23 A;  3TET A;  4J9Y B;  5FL7 G;  4WFA V;  3F7V C;  4EKW A;  2W6J G;  2YSU B;  3SYC A;  5E1A C;  2AHY A;  2QKS A;  1H8H G;  4TSF G;  3LNM B;  2XOK G;  2OCC C;  3AG2 B;  3MHS C;  1Y4M A;  3D3I A;  2DWE C;  3VBB A;  1K34 A;  1F4M A;  1OCZ B;  2X0L A;  1NH2 B;  4JPR A;  1FS0 G;  1YIJ V;  1MOF A;  3OW2 U;  3OEH G;  4G27 B;  1CP9 A;  1QR8 A;  1K73 W;  2F43 G;  5GW7 A;  3CP1 A;  1BHB A;  1SES A;  4JTC B;  2ZR2 A;  4BAY A;  1OHH G;  4ZKI A;  1GK9 A;  4X89 A;  5DN6 G;  3B8M A;  2EZO A;  4FK5 C;  4I9W A;  3K79 A;  4Q20 A;  5C93 A;  2HVJ C;  3ABM B;  4BW5 A;  1NKD A;  5B1A C;  1YJW V;  1YSC A;  3CCE V;  3CME V;  4LBE C;  1FXK B;  1AI4 A;  4QIW F;  3SYQ A;  2QE7 G;  1VQO V;  2C2A A;  3AEI A;  2ZDI C;  2W0F C;  3ZRV A;  2PI4 A;  1E79 G;  2WLI B;  1E1R G;  5CMU A;  5L3E A;  5IY5 B;  1YJ9 V;  2OTJ V;  1QBZ A;  2HJF C;  5L3C A;  2P7T C;  3CCU V;  4R50 A;  1KC8 W;  1E1Q G;  1M90 W;  3RW0 A;  1AJP A;  3SPJ A;  2EIM C;  3OAA G;  3LSQ A;  2DYR C;  1FXK A;  1I5X A;  5EK0 A;  2LFR A;  1EFR G;  3QO5 A;  3AG3 C;  2LP7 A;  1GMG A;  4GCZ A;  4N21 A;  3R65 A;  3SYO A;  2QM8 A;  3X2Q B;  1NVP D;  2DQ3 A;  2XAH A;  3F7Y C;  4PDV A;  2WLI A;  4XDJ A;  2A9H A;  1RPR A;  1NQT A;  3AG4 B;  4F4L A;  2XAG A;  2JJ2 G;  2M7W A;  3SYP A;  4PDM A;  1S0V A;  2ZXW B;  1PNL A;  4R8C A;  2XAQ A;  5EBM C;  1M57 B;  1MAB G;  1VQ9 V;  1GTO A;  2AHZ A;  1W0J G;  5LBQ A;  4JGS A;  4JAS A;  4QPK A;  1SER A;  2Y48 A;  1GM9 A;  4QE9 A;  4WFE A;  4I5S A;  3CCS V;  1YHQ V;  4GX0 A;  4WCE V;  1JJ2 U;  4JTD B;  2ITD C;  4RAI A;  4KP4 A;  1K92 A;  2EIN B;  1P7B A;  3ABK C;  3ABT A;  3ABU A;  2ITC C;  1P4R A;  4KFM A;  4RUE A;  1ENV A;  3ASN B;  1DF4 A;  1QVF U;  3ZMS A;  4FPP A;  3JD4 A;  1NVP B;  4H37 A;  1K4C C;  2XAF A;  1SRY A;  2V7Q G;  4WFB V;  1M56 B;  4UXN A;  3G4S V;  1R6K A;  1S5H C;  3WFV A;  2FTK A;  3E8G A;  5IYB O;  5LGT A;  1R3K C;  3STZ C;  2DW4 A;  4HZ3 A;  1OCC C;  3MHH C;  1DTO A;  1DLB A;  1EZJ A;  1K3E A;  1QCE A;  2JJ1 G;  1R3L C;  2X6C A;  4PDL A;  3CCM V;  3CYO A;  1TUE B;  4J9Z B;  4UV8 A;  3CCQ V;  3P32 A;  4TT3 G;  5B1B C;  1S3J A;  1W0K G;  2EIJ C;  4ASU G;  1V55 C;  4MSW C;  4UV9 A;  4Z1M G;  3OM3 B;  2R9I A;  1ORQ C;  2WAM A;  2Z5U A;  3FB8 C;  2EZP A;  3K0D A;  1K33 A;  5LHH A;  2D3O W;  2X6B A;  2HVK C;  3FYI B;  3B77 A;  1ROP A;  4RQF A;  3JCZ A;  3DTU B;  2JEU A;  3W7X A;  2EIK C;  2NNU A;  3E86 A;  5H9C A;  3ZMZ A;  3E83 A;  3BEH A;  4MVZ A;  4WFF A;  2QEX V;  2HFE C;  3B8N A;  2XND G;  3T4Z A;  1OCO C;  3CCJ V;  3WG7 C;  3I55 V;  3ZRW A;  4FJC C;  2EIL C;  1SET A;  5LGN A;  1VQ5 V;  1VQL V;  3KG2 A;  3UKM A;  4UVA A;  1PD3 A;  3T1C A;  1MG1 A;  1Q86 W;  3K3W A;  3QNE A;  3E89 A;  3W7U A;  1I5Y A;  1SZT A;  4R6Z A;  1GO3 F;  2QA4 V;  2LFS A;  1RM1 C;  2ZD9 A;  3BY6 A;  4R7C A;  3T4D A;  5HFM A;  3ETE A;  2DYS C;  2Y69 B;  4CBC A;  1F51 A;  2HKO A;  2OCC B;  2WWW A;  4MVR A;  1PL0 A;  1WLE A;  2OT5 A;  3W7T A;  1JPX A;  2PI5 A;  2HLD G;  3CXC U;  5LHI A;  1G8M A;  2Q6A A;  5H6R A;  5L3G A;  3IFX A;  2H94 A;  3SPH A;  3AG1 C;  1J95 A;  5IDJ A;  4ZBM A;  4P30 A;  4WFH A;  5IYC O;  3CC7 V;  1M57 C;  1R3J C;  3JD1 A;  3SJQ C;  3UM7 A;  4WF9 V;  3LDE A;  5B3S C;  3E8F A;  3RBZ A;  3CC2 V;  2JEX A;  3ABL B;  2Q69 A;  2A79 B;  1YTF D;  4BIZ A;  1K5S A;  1V54 B;  1OZ0 A;  2YEV B;  3JD2 A;  2P67 A;  2EJR A;  3K06 A;  3ASO C;  5B1A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...