1S72V

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s72V00
1R73A 1KC8W 1Q81W 1M90W 1K73W 3CMAV 1VQOV 3G4SV 1VQ9V 3CC7V 2OTJV 1W2BU 1YI2V 1KQSU 1S72V 1YITV 3CC2V 3CCRV 3G6EV 1QVFU 3CCEV 1VQPV 1JJ2U 1VQ4V 3CCVV 3G71V 2OTLV 1VQ8V 1NJIW 1VQMV 2QEXV 1QVGU 2D3OW 1M1KW 3CCMV 1VQLV 1YIJV 4WFAV 5DM6V 4WF9V 3OW2U 3CCSV 1VQKV 1K8AW 1YJ9V 1VQNV 3CCQV 1K9MW 3CC4V 1KD1W 3I55V 4WCEV 3CCJV 3CCUV 1Q82W 3CD6V 3CCLV 4WFBV 1VQ7V 1VQ6V 1YHQV 1VQ5V 1N8RW 3CXCU 3CMEV 2QA4V 3I56V 1YJWV 1Q7YW 1YJNV 1Q86W 3CPWU
chains in the Genus database with same CATH superfamily
4EB6A 5IYZA 1SS3A 3CRQA 3RGBA 4DR3B 1KECA 5EBWC 5FNVA 3K79A 3K0DA 1OJHA 4LFCO 2KQXA 4NVPA 5CA0A 2B5UA 1ZL8A 4KHPO 2CAZC 4DUYB 3JATA 5B1OA 3CD6V 4DV1B 4J42A 2JEXA 3L73H 2UU9O 2E75B 3SPGA 2P7TC 4AQYB 2A79B 1MNGA 4ZOLA 4JZ2A 3CJHA 3O9OA 4LFBO 1YTFB 4LF4O 2ZM6B 2ZIOA 4JI5O 2LGWA 4UUJC 3OMIB 3CYOA 3CCSV 2W0FC 5J2UB 3TETA 1MABG 1BE3H 5LGTA 4I50A 3D36C 1FJGO 1H2KA 5CMUA 1EN4A 1RSOB 2UUBB 3G4SV 3VQXA 4X1KA 2X6BA 5CBHA 4OGQB 2Y69C 1XUQA 4FLTA 3CCVV 1SZTA 4ASUG 1BZKA 1UFIA 3CP1A 5KUKA 4K0KB 3O65A 1BQ0A 3ZIAG 4DR4O 4UB8Z 3C90A 2QWRB 2UUAO 2JVDA 3ZHSA 1H2LA 3K5MA 2DW4A 4CC5A 2FTKA 2R9IA 5BMVB 4UV8A 2QGNA 2WLJA 3K06A 3AG4C 1QU7A 3ZMSA 2QEXV 4YJ2B 2WWWA 4YIOA 2DWDC 4E2LA 1IDSA 3I56V 3CRRA 4DV7B 5KAIZ 4FPPA 4X1IB 3OEEG 2V4DA 3ZRXA 2IM9A 1EZVH 4FMTA 1XNQO 1IZ3A 3F7YC 4MTXA 3RFRA 5FPOA 3TJTA 3JARA 5J2UA 4JI2O 2QKCA 4B3TO 1GH6A 2M7WA 1RSOA 4JI3O 4N21A 5J9PC 1D5NA 2JRIA 2ZR3A 3VQWA 2WLKA 3IC7A 2DYSB 4P9OA 1L0NH 1PKXA 2DE0X 3AK2A 1ORQC 3FB7C 3E89A 4L8JA 5B1AB 3RYIB 5LBQA 4MSWC 3HKEB 5GW7A 2LGQA 4MVMA 5BXZA 4J9ZB 4AHCA 2P6JA 4RUFA 1LR1A 2QWNB 3B2EE 2DN9A 2B9ZA 1N34B 1D5AA 1VF6A 4PDVA 2HP8A 1FS0G 4JF3A 5BMVA 2VQFO 3B40A 1FXKA 1OCOC 2DQ3A 2ATKC 4YJ2A 2F95B 4DW0A 2UU9B 4PV1B 3SPHA 5LP6C 4H0LB 3ZN0A 4LFBB 2Q67A 4LF4B 4X64O 1V54C 4QIWF 1THZA 4E4EA 5BY1A 1WP7A 3TCUA 2ZE7A 2G38A 2RQ6A 1H2NA 2ZNJA 3WB1A 1NTKH 4PI0A 1P4RA 3A0HZ 4H33A 1WN7A 3RYFB 1O9HA 3OE7G 2CTPA 3RYIA 4JYAB 3HKEA 2GTAA 1AB3A 4LF8O 1F51A 4FLVA 4K8ZA 4B3RO 3ABLC 1Y6XA 4LH7A 1LUVA 3JALA 3H9VA 4WCEV 1R6NA 1FYJA 4RQEA 2PYJA 5JH7A 4DV5O 5HFMA 3ABMC 2VQEB 3APQA 3P32A 2JK5C 3P30A 2QKAA 1S0VA 3OUSA 4X20B 5ITZB 2UUCB 3G71V 3RT3C 3MAQA 4JV5O 4DR1O 2ZCEA 1VQLV 1VQKV 1FXHA 4H37A 2X6AA 2F4VO 1K7DA 3N2GB 1XNQB 3JASB 1AR4A 1OCZB 4UFZA 5GONB 1RFYA 2R9RB 2IU3A 3AG3B 4FIPC 5JCOC 2DYRB 3B8MA 2HKOA 4B3TB 3R66A 3K59A 3ZMTA 4QPKA 4JI3B 4DUZO 3AG2C 5CA1B 1QQCA 2BTOA 5DEDA 2BOCC 5FL7G 1UJWB 3NXSA 3RYFA 3CCMV 3DXRA 4I4TA 5CN0A 4RUEA 1OCRC 2ZE5A 3K04A 3ZHQA 1ROPA 3HKDA 3A0BZ 4JTDB 2JGDB 2GTSA 2HEPA 1NR7A 3VOUA 3DTUB 3HPLC 2VQFB 5LMNB 2DWEC 5LOVB 4A5UB 1G1XB 4HAMA 2QE7G 4CH3A 4ZBMA 4YIPA 1HNXO 4L87A 1OCCC 1R73A 4X20A 1FXVA 1S77D 5ITZA 3LSQA 1IURA 4X64B 3G6EV 4HYOA 5K1XA 4NTXA 3N2GA 2LQTA 2D3OW 1SESA 1XDCA 3S3XA 1JPXA 4PA7A 5GONA 1ZSPA 3T4DA 4MTGA 4GX5A 1XOUA 2B1GA 4Z2WA 5E79Z 3K9AA 2RDCA 3FD9A 1BS3A 2EINB 5D5QA 3IAYA 4JI8O 5CA1A 3CWBH 4TSFG 1I94O 4JTCB 2YDEA 3N27A 1ZTEA 3B4SA 2EJRA 4HZ3A 5JJNB 3JD1A 1AROP 1CP9A 1K34A 3L71H 4LF8B 4ZKIA 3AEIA 1WA8B 4B3SO 4DRXB 2NN4A 2YIBD 1OZ0A 2JGDA 1S5HC 2YIDA 2Q69A 4JAUA 1JCHA 5KA6A 4AI8A 4DV5B 1H8EG 1M57C 3KG2A 4PA9A 1US6A 4JI4O 1W0JG 2ARHA 2XUMA 2EIKB 3FB8C 3ASNC 3FX7A 2HVJC 3ZEDA 4JV5B 2UXXA 4O2AB 4DR1B 3SPJA 4J11A 4R7CA 1PNMA 2F4VB 5EYPB 2JS5A 4NTYA 4K3AA 1WB7A 2F66C 4IL6Z 1NU1H 3SJQC 2FL4A 5DM6V 4CS3A 3D3IA 3ZN1A 4DV0O 1PPJH 5LHGA 4DUZB 2WLLB 3W7WA 2N04A 3DGEA 3BFRA 4FLUA 2H8PC 3VQYA 2YXYA 4D7SA 2GUZB 1L1FA 4HNAA 2OCCC 4G28B 4G2KA 2Q6AA 2ZT9B 1JJ2U 1J5EB 4DV1O 1WA8A 2YSUB 2YS8A 2A0LA 3WG7C 3MD0A 4PHZA 2CE4A 3ZHTA 1SKVA 4CBCA 4LP8A 1VIBA 3BAAA 3G80A 2ZM6O 2MK3A 2XHBA 2EIMC 2ZXWB 1QCEA 3P3NA 1K3EA 1UPGA 4Z1MG 4KFMA 1R6KA 1KU9A 2CUGA 2P5OA 1GAXA 2QWPB 3X2QB 2WPDG 3OW2U 4O2AA 4GCZA 3T1YO 2UUBO 3CCJV 4I0XA 5A2QN 4OX9O 5LHIA 4GX2A 1B04A 3LDDA 5KX5A 3ABKB 1WLEA 3AK1A 1FFXB 4DV4B 4JI8B 4CS4A 4K0KO 2Y0IA 2ZNIA 3R65A 4DK0A 2PY5A 3JCUZ 3U11A 1N33O 2NLJC 2RCVA 2ODMA 3FFQA 3BA8A 2GUZA 4DV6O 1KKCA 1JR9A 5B66Z 1GO3F 5KHKA 4ABMA 5BR8B 1B3QA 2XOKG 1MOFA 4F6EA 3C3TA 3RYHB 4X89A 3FB5C 2UXCB 2GBOA 4DV7O 1Y66A 3FKSG 1K97A 1XMOB 4BAYA 3CCUV 4U3FH 3CEIA 4JI4B 1TVKA 1Z5WA 5KHGA 4J9YB 4EEQA 3K58A 1XL6A 4BIZA 2KG7A 4WBNB 1AI4A 2IU0A 4O2BB 4LWSB 4DO2A 1HWYA 3T2MA 3UKMA 2P67A 1FFXA 4MVRA 3P3PA 4TWKA 4DV0B 2R9AA 1KKDA 1KQSU 1PNLA 3WB0A 3LDEA 1EN5A 1E1QG 1N34O 3I5DA 5EC2C 3GB7C 3ABUA 1M1KW 3U0ZA 3CCQV 5L3EA 2HG5C 4MW8A 4UV9A 4FLWA 3ASOC 5LYJA 1AJPA 3FAVA 4YXWG 4J7JA 1K5QA 5H5NA 1DK1A 1YITV 3HR0A 3RYHA 1E1RG 3ETEA 4P9PA 4LF9O 1IBLB 4TQDA 1FKAO 2Q7GA 5B1BC 1MZEA 4FFKA 2XAHA 1AR1B 3E22B 3W7XA 1MSWD 1M56C 4UCRA 1GN2A 2JIZG 1PNKA 2CGNA 2CTQA 3GWKC 5H6QA 4PA3A 1TAEA 3BVOA 4WBNA 1NR1A 2O57A 3T1YB 3BCCH 4O4IB 3D8CA 2AZ2A 2P22C 1P7GA 4OX9B 4JYYA 4O2BA 2L35A 2EILC 2P4VA 1OV9A 4WFHA 1Q8IA 4FM2A 4JYAO 2XT9A 1WPBA 1NQTA 1NT2B 1N33B 1GN6A 3DC6A 3SJCC 4J7ZA 1K73W 1GM7A 2LFSA 2RN9A 4DV6B 4BWAA 2UXDO 2A06H 4GLXA 5LGUA 3STZC 2VQEO 1SQGA 4W4KA 1K9MW 3A8TA 2OYQA 5B1NA 2Y4TA 3OMNB 1WAZA 3K0GA 3SYPA 3L74H 2UUCO 1HDJA 1VP7A 2HVKC 3VBBA 3SYAA 3E22A 2CTWA 1L8DA 4KUMA 1FD9A 3ZHVA 4QE7A 2H3OA 2QSAA 1WJZA 4NXMO 1W0KG 1K92A 3KCYA 2ZIMA 4O4IA 1AI7A 5LGNA 3OFNG 3W7TA 2F1MA 4AILC 1N0NA 1Q43A 1EBOA 4GT1A 1XEQA 3ZHRA 1Q3EA 1MG1A 3I55V 3TXSA 2F43G 2R70A 1Q82W 2L6LA 5EZYB 5KMGB 2WAMA 4QJFB 1V55B 4IYIA 4MVUA 5LMNO 1JX9A 3KKYA 1R3KC 5JJJB 4TQFA 1FXKC 5AG2A 1M93A 1YSCA 3GWOA 3UQ8A 4GX0A 3H1KH 4U7NA 4LF9B 4XDKA 3SPCA 4LF6O 4X1IA 3IC9A 1BSMA 1B6QA 2IBZH 4UCVA 4DR2O 2ITCC 5JJEB 1SQFA 1FAFA 1H8HG 5K1PA 4DV3O 2Q68A 4R6ZA 2JS3A 1Y76B 1XNRB 3JCZA 4UB6Z 3CB2A 2IH1C 2EULA 5IJ0B 1M90W 3CMAV 1BHBA 2RJZA 4J41A 3JD4A 4U7OA 5B1AC 1E79G 3AG2B 2PI5A 2IJHA 1U97A 1PD3A 1HR0B 1M5IA 4NB5A 1K4CC 1SQBH 3L75H 5KMGA 5D5PA 4LNUB 3OD4A 5L3DA 2LW1A 2BCCH 2JEUA 1SA0B 2UXDB 1I08A 3OMAB 4ZIBA 4QNHB 2D2CB 2QWQB 4CS2A 3FYIB 3H1JH 1N32O 5KHJA 3KZIZ 1T5EA 1IBMB 2PZSA 5KLVH 1JJOA 2ADQB 3K9SA 1XI1A 1WPXA 2XTAA 1R3IC 5B5EZ 3SR2C 4UVBA 3JD0A 1OCCB 3AG1B 4NXMB 4LBEC 3U10A 3ZMUA 2W6IG 1Y76A 4JI7O 4XBFA 2WA4A 1SQVH 5E1AC 5B3SC 5IY5C 1XL4A 3LSUA 3HB3B 1NVPD 1VQ7V 5IJ0A 3B77A 5GTHZ 1O9GA 1QNMA 1J5EO 1DF4A 3E8FA 3L70H 2X7RB 5BZBA 4FLZA 2CH7B 3SYQA 2UXNA 2ETNA 5LA6B 1KUQA 2ZINA 2BSKB 3OM3B 3H1HH 3LUTB 1SA0A 2QM7A 1SQPH 1RM1B 1K33A 3FYEB 4LC1A 1GMGA 3CXCU 5H6RA 5IDJA 5CBFA 4UVCA 1I7FA 2QWOB 2QR4A 4LF6B 2E74B 1M57B 2EIJB 4FLYA 2Q0AA 3JASA 4DR2B 1YJ9V 2KKWA 1Q90D 2Y4UA 4DV3B 4DV4O 4GYCB 1ZAUA 4BR6A 2PI4A 3AG3C 1KP2A 2ITDC 2YUAA 3MHHC 1Q81W 2EJ7A 5IJ9B 4N23A 5KUMA 4R50A 3APOA 1GK9A 2Y0PA 1QVGU 4O4LB 4LF7B 1XHXA 1YIJV 1NKDA 1EFRG 3CS5A 1BL8A 2YIAA 4X65B 1AP6A 3OAAG 1VQ5V 5J2TB 1J95A 4QPJA 5BR8O 3JSLA 2JJ1G 1YEWA 2CH7A 3CPWU 1SF9A 4JI6O 3WB2A 3J80N 2UXCO 2OTJV 3ZS8C 2OCCB 1XMOO 1DTOA 2PUSA 3OGIB 4MVQA 1VQPV 5LOVA 3E8BA 2YXHA 3EXAA 4PDLA 5L3FA 1N32B 3ETDA 1G8MA 4GZRB 4MT8A 2A3QA 1R1BA 1YJNV 4LFAB 1SRYA 2CTRA 2EIMB 2YI8A 5DECA 4EFEA 2E5LB 1Q6IA 3L72H 3CCRV 4JGSA 1EN6A 2GSMB 4FJCC 3A2FA 3OR7C 2K1EA 4MW3A 3TGUH 1GM9A 3M8AA 4DXWA 2K9PA 5JVDB 1FPOA 1QLEB 2AZ0A 3BRCA 4JI7B 5TISZ 1EZJA 4TV9B 4LR3A 1QBZA 1U96A 3BPZA 1VQ9V 2WLNA 5FLXN 4O4LA 4F6RB 4X62B 4P30A 2N74A 2DJVA 5J2TA 4DRXA 4I5SA 3CHXA 1ZWIC 1BCCH 1KBHA 1NTMH 1XQ8A 3K5LA 1IBLO 3AK3A 4JAVA 4TUYB 4I55B 2YIBA 2WA3A 3IJ4A 2OWOA 3K3WA 3CCEV 1N36O 4MVOA 4X8AA 2Q73A 2EIKC 1Q5OA 5H2FZ 5LXTB 2XAGA 5EYPA 2ZKOA 4ZI7B 3K08A 1MSDA 3T4ZA 1QVFU 5FPRA 1NH2D 3M99B 1FFTB 1IX9A 4MS2A 4DYLA 2WLLA 4W4LA 5H9CA 1GN3A 5IYDO 2W6JG 5LL6Y 3RYCB 2DOSA 1KD1W 4TV9A 1A32A 1ZUQA 3SPIA 2EX3A 1AILA 1HNZB 1M4UA 5IYCO 1Q86W 1WP8A 1SERA 1VQOV 4RAIA 2PYLA 4EB6B 2MW2B 3OT7A 1NJIW 3CE2A 4O4JB 4JI6B 5FNVB 4YY3O 3F5WC 5CA0B 1SETA 4EFBA 2HJFC 3ASOB 5HFLA 4BW9A 2ZXWC 2ZDIA 3B8NA 1YVWA 1IXMA 3BY6A 2OTLV 1QR8A 1HNWO 1JQ0A 4Q20A 1AP5A 1HW7A 2HJDA 4WF9V 1AI5A 5LXTA 3CC4V 2OT5A 4PDRA 2QKSA 5EBMC 4ZI7A 4U3JB 4I50B 3E2EA 3ABKC 5C93A 3J7AU 2ZD9A 2Y69B 4PJ0Z 4X1KB 2Q7HA 4MTFA 5EK0A 2IJIA 3RVZA 3RYCA 4X1YB 3N2KB 5IYBO 4DV2B 2XASA 1MZFA 3DSQA 2JDIG 2CK3G 1QHTA 1RPRA 1VF5B 3SYCA 1BHAA 3Q4HB 1KC8W 4O4JA 4DR6B 5CBGA 3AG4B 4WFFA 2W0XA 3UO2A 3OTOB 3T1HO 2VWKA 1VARA 4X66B 1R3JC 1YTFD 3THOA 1N36B 2FMLA 3D3QA 4CH6A 2BTQB 1YI2V 3K57A 3G67A 3RW0A 1XNRO 1AJNA 1R3LC 1F4MA 4IYHA 4LWSA 2KSDA 4FK5C 4IIJB 2XAQA 4JI0O 4QGPA 3JARB 4U3JA 3D36A 3E83A 2VS0A 1D2DA 2Q5ZA 2CGOA 4PDMA 4WFEA 1EM1A 2LFRA 1CXZB 1HR0O 4PA4A 2YI9A 2WLIB 1DLBA 3JD2A 4X1YA 3N2KA 2VWJA 4Q6GA 3ZMVA 4FFBB 4WFGA 3ZJZA 5KHHA 2H94A 2HFEC 1QLNA 3JAMN 3ZX6A 2ZR2A 2ILMA 3Q4HA 1VQ6V 5A9GA 1F7YA 2R72A 1LUWA 3ICXA 1IBMO 4YY3B 5GTIZ 2BOBC 4GUNA 4PA6A 5CB4B 1OCOB 4NTWA 4R8CA 2UXBB 4B08A 3HKBB 1FXKB 2F93B 5L3BA 1L0LH 4JASA 1XREA 1V9PA 4PD4F 1F23A 1MA1A 2JGUA 2VRZA 5LP6B 1CPYA 4G27B 1MMMA 4CH5A 3CRMA 2BTQA 4NXNB 1HNWB 1IVSA 1V54B 3PN1A 2A7WA 3HKCB 1RPOA 3JAKB 1GN4A 5EIBD 4IIJA 3QG5A 1ENVA 4RWUA 4UCSA 5JWPA 5IWAB 2WLIA 2HR3A 2QDOA 1YJWV 1NI8A 2GDSA 1PP9H 2P90A 5KHIA 3CX5F 1VF6C 1B06A 2NNUA 4FFBA 1P49A 4JI1O 4IGGA 2QJ1A 4JYCA 2HLDG 1VQ4V 4OPHA 3K5NA 3ABLB 4J80A 3EVKA 4WFBV 1H38A 3JALB 1S76D 5CB4A 2GHYA 1XMQO 1S5JA 2ZE6A 4LFCB 3T1HB 1CEZA 3ABMB 3HKBA 3STLC 4KHPB 1K4DC 3OTFA 3UO3A 2RNBA 5JH7B 4B7KA 4YHHO 1Z2GA 1VF7A 5EBLC 4TT3G 2AXTZ 1WB8A 5LP6A 4JYBA 1COWG 3QNEA 4LCUC 2YEVB 3HKCA 5EIBC 3JAKA 4JI5B 4F4LA 3JSNA 1VEWA 2DYSC 1I5YA 4JI0B 2FKXA 3H1LH 3ZRSA 4TV8B 4LF7O 5JQGB 2HHHO 4B3MO 2M6YA 4O4HB 4X65O 1FJGB 1KP3A 1S5LZ 4PI2A 1K8AW 3TXQA 2KB1A 5EZYA 1X4TA 2DMXA 4OXSA 5B3SB 5IY5B 3E8GA 1OCRB 3JAWB 3DXRB 1VMGA 4I4TB 4NR1A 2YICA 1V55C 2QA4V 3CXHF 1TUBB 3HKDB 4MVSA 2WLMA 3BHPA 1S72V 4DR4B 4ICGA 2IJKA 2UUAB 1ZX3A 4J10A 4X88A 3UCSC 3QO7A 1TGOA 3F5TA 4LFAO 5KAFZ 2A9HA 1AJQA 2ZQMA 1Q6HA 2E5LO 5L3CA 1YZBA 3LNNA 1JFFB 3LDCA 3JYCA 2BE3A 3CC7V 2Q9LA 3OGCC 1I0HA 4XDLA 5F2VO 5EC1C 2YEVA 1IBKO 3E8HA 3G6BA 2Z5UA 1AR5A 5JCOA 1P7BA 4FVMA 4TV8A 3AG7A 2OCHA 5JQGA 3ML0A 4JI2B 4X62O 4O4HA 3QF7A 3BA9A 4LH6A 2QM8A 2V1DA 1H2GA 1NVPB 4UCTA 4QE9A 4CH4A 3ZCCA 3JAWA 4LNUA 4X9QA 4JI1B 2Q7EA 2N05A 1GTOA 1TUBA 1BT8A 2F23A 2RMKB 3CMEV 3A0RA 4JTAB 1JA8A 4GKKO 3T1CA 4GKJO 2WSSG 4B7EA 5C8YB 4UXNA 1R6TA 1XMQB 2LJ2A 1H2MA 3QO5A 4D7TA 4CC6A 4CZZA 3ABTA 4YHHB 4DR7O 3MDSA 1SZXA 1PV0A 1Y74B 3GVMA 3W7UA 3ASNB 1JFFA 1OCZC 2XAFA 3EFFK 3AG1C 3K5OA 3H01A 1P84F 2DYRC 1Q6UA 3WFVA 3LSSA 3E86A 3H1IH 5IT9N 4P2ZA 1NTZH 2IJJA 3RBZA 1W59A 1GKFA 2P06A 4WFAV 4I7ZB 1HNZO 2HHHB 1BMFG 1KMIZ 4FM1A 3B09A 1NZ6A 4B3MB 3EHBB 5LMUO 3ZRWB 4LF5O 1YDXA 1Y67A 3ZHUA 4UCOA 2X0LA 1WNSA 2E3CA 5LA6A 3BEHA 5CA3A 2YXLA 4FZ0A 2FB5A 2BSKA 3CRAA 1NBMG 1VQMV 4HNAB 2GV9A 1RM1C 3E35A 4K8XA 1DF5A 1Z5VA 3WG7B 4B3RB 4K35A 3ZRVA 3WU2Z 3QTCA 3SGIA 5C8YA 3RN4A 4IHJB 3KCXA 1BGYH 4KL1A 3VQVA 3ETQA 2NR5A 4Z1VA 1OHHG 2B1IA 1Y4MA 2LW7A 4UVAA 2X6CA 1Y74A 2EIJC 3RVYA 2ADPA 2ZE8A 1HP8A 1G4YB 1RP3B 3BABA 4D6TH 4BIOA 4J7KA 3QVNA 2QTSA 1XILA 2EINC 3C3SA 5IJ9A 4DR5O 1Q7YW 2QM4A 4C7UA 2YC0A 4I0XB 2V7QG 3SJBC 3ZBHA 4NKGB 3NR7A 1IBKB 1K5SA 2AHZA 2C2AA 1PL4A 4DV2O 5KX5B 4JPRA 3RWRD 1GRJA 4RQFA 1VQ8V 2CDYA 4OPAA 2Q8VA 3ZRWA 4ZHQB 3CRCA 2Q4PA 3F7VC 4DR3O 1YXBA 3CCLV 3DC5A 1AVMA 1PL0A 4DK1A 3OUFA 4DR6O 1M9NA 3QO8A 3ZMZA 4EKWA 4BIUA 2IH3C 1G6UA 1F4NA 4MTOA 1TUEB 3OTOO 1LNQA 2Z0AA 3CC2V 4DUYO 4X66O 2LP7A 3IFXA 4I9WA 4BW5A 2OIGA 4H44B 4GKKB 2P4KA 4I9QA 4GKJB 4AQYO 2XNDG 1KB9F 4GX1A 4KP4A 1X59A 3K03A 4JAAA 4TOIA 4IHJA 1JOYA 3CSXA 3M7MX 2Q0OC 3UM7A 4DR7B 3OEHG 1TVKB 2AGAA 1I5XA 3PJSK 3S3WA 1SC5B 2AW9A 1HNXB 3LNMB 1XHZA 3SYOA 3UT5B 3SJAC 5JVDA 2KG7B 2Z3YA 4YJ3B 1XBLA 1IXBA 1QLEC 3JD3A 1VQNV 1URFA 5IE9A 5L3GA 1S3JA 2E76B 3MHSC 4FZ1A 4RO2A 1NH2B 4IT5A 2PF4E 2EZOA 3TK1A 3W7SA 4F6RA 5LMUB 2PGGA 3IGAC 2EZPA 4ZHQA 4LF5B 5IYZB 2PTMA 1I94B 4PELA 3J81N 1YCIA 1YF2A 2OIEA 1PM9A 1ZLZA 4TUYA 4I55A 4DW1A 4UCUA 2UXBO 1ZL8B 1BQZA 3JATB 2QTOA 1JVMA 3L9DA 1W2BU 4B3SB 5LYJB 2IW5A 3FAVB 3SDLA 2ZDIC 4ZOLB 1N4CA 5DN6G 4XDJA 1N0JA 1GM8A 3CJHB 3X2QC 5B1BB 5KA5A 4NXNO 2DQ0A 1M56B 1KYOF 2LO1A 3FB6C 4MVZA 3ETGA 4H13B 2EBOA 2Y48A 1DGSA 1NS1A 1JMKC 1H2SB 4JZGA 4NYKA 3UT5A 2FYUH 5LHHA 4FLXA 4YJ3A 1QR9A 3OR6C 4KXRA 4DR5B 2WLHA 5IWAO 2EILB 1SQXH 4FM0A 2AHYA 2XAJA 1TA8A 2JJ2G 1SQQH 1YHQV 1N8RW 1AI6A 4HBNA
chains in the Genus database with same CATH topology
2NNUA 3E8FA 2X7RB 1L1FA 1KECA 5EBWC 2OCCC 4G28B 4G2KA 5BZBA 3SYQA 3K79A 2Q6AA 2UXNA 4JYCA 2HLDG 1JJ2U 1VQ4V 2YSUB 3OM3B 3ABLB 3LUTB 1RM1B 2QM7A 3K0DA 2A0LA 2B5UA 3WG7C 1K33A 3FYEB 3MD0A 4LC1A 5B1OA 3CD6V 1GMGA 4WFBV 1H38A 1S76D 2JEXA 4CBCA 2GHYA 4LP8A 3CXCU 5H6RA 5IDJA 1CEZA 5CBFA 3ABMB 2MK3A 2P7TC 3SPGA 3STLC 2A79B 1K4DC 2EIMC 1QCEA 2ZXWB 4UVCA 1K3EA 4Z1MG 4KFMA 5EBLC 4TT3G 1R6KA 1YTFB 4JYBA 1COWG 1M57B 2EIJB 3X2QB 2WPDG 4UUJC 3OW2U 3OMIB 3CYOA 3CCSV 3QNEA 1YJ9V 2W0FC 4LCUC 3TETA 1MABG 4GCZA 5LGTA 2YEVB 3CCJV 4F4LA 2PI4A 3AG3C 1KP2A 5CMUA 5LHIA 4GX2A 2DYSC 3LDDA 1I5YA 2ITDC 3MHHC 1Q81W 3ABKB 3ZRSA 1WLEA 3G4SV 2X6BA 5CBHA 4N23A 2Y69C 5KUMA 4R50A 1KP3A 3CCVV 1GK9A 1SZTA 3R65A 4ASUG 1QVGU 1YIJV 1NKDA 2NLJC 3CP1A 1K8AW 5KUKA 1EFRG 2KB1A 1BL8A 4OXSA 5B3SB 5IY5B 3E8GA 1OCRB 3ZIAG 3OAAG 1VQ5V 1J95A 4QPJA 1V55C 2QA4V 2JJ1G 3CPWU 4MVSA 1GO3F 2WLMA 2OTJV 2DW4A 1S72V 2OCCB 2FTKA 2R9IA 1DTOA 4MVQA 1VQPV 2XOKG 1MOFA 2IJKA 4UV8A 2WLJA 3K06A 3AG4C 3ZMSA 4X88A 2QEXV 3E8BA 3QO7A 4X89A 3FB5C 2WWWA 1Y66A 3FKSG 4PDLA 5L3FA 1K97A 3ETDA 4BAYA 2DWDC 1G8MA 2A9HA 3CCUV 1AJQA 2ZQMA 4E2LA 4MT8A 3I56V 1YJNV 5L3CA 1SRYA 2EIMB 4FPPA 3LDCA 4J9YB 3OEEG 3JYCA 3ZRXA 3CC7V 1XL6A 4BIZA 4FMTA 3CCRV 4MTXA 3F7YC 4JGSA 4FJCC 2GSMB 3OGCC 1AI4A 3OR7C 2K1EA 4MW3A 4XDLA 5EC1C 2YEVA 1GM9A 4DXWA 2IU0A 1QLEB 3E8HA 2M7WA 2Z5UA 1HWYA 4DO2A 3T2MA 1P7BA 3UKMA 2P67A 4N21A 5J9PC 2ZR3A 3ML0A 2WLKA 1EZJA 3IC7A 2DYSB 4MVRA 4P9OA 4TWKA 1PKXA 1QBZA 2QM8A 1ORQC 1VQ9V 3FB7C 2WLNA 2V1DA 1KKDA 3E89A 1H2GA 1KQSU 1PNLA 5B1AB 3LDEA 1NVPB 1E1QG 5LBQA 4MSWC 4QE9A 5GW7A 3ZCCA 4MVMA 4P30A 5EC2C 3GB7C 3ABUA 1M1KW 4J9ZB 2P6JA 4RUFA 3CCQV 4I5SA 1GTOA 5L3EA 4PDVA 2HG5C 1ZWIC 4MW8A 3CMEV 4UV9A 3A0RA 1FS0G 3ASOC 4JTAB 4JAVA 4JF3A 1AJPA 4YXWG 3T1CA 1FXKA 1K5QA 1OCOC 2DQ3A 2ATKC 2WSSG 1YITV 4UXNA 1E1RG 3ETEA 3K3WA 4P9PA 3CCEV 3QO5A 4CZZA 3ABTA 5B1BC 2XAHA 4MVOA 1AR1B 4X8AA 3W7XA 3SPHA 1MSWD 1M56C 2EIKC 3ZN0A 2Q67A 2JIZG 3W7UA 3ASNB 1PNKA 1OCZC 5H6QA 1V54C 2XAFA 4QIWF 4PA3A 3EFFK 2XAGA 3AG1C 1THZA 3H01A 2DYRC 1NR1A 3WFVA 3K08A 3T4ZA 3TCUA 3LSSA 3E86A 1QVFU 1NH2D 3M99B 1FFTB 4P2ZA 4MS2A 2EILC 2IJJA 3RBZA 2WLLA 4WFHA 1GKFA 5H9CA 4WFAV 1BMFG 5IYDO 2W6JG 1NQTA 3EHBB 1KD1W 1P4RA 4H33A 3ZRWB 3OE7G 3SPIA 5IYCO 1Q86W 1SERA 2X0LA 1K73W 1VQOV 1GM7A 3BEHA 5CA3A 1F51A 2LFSA 4RAIA 1NBMG 1NJIW 1VQMV 3ABLC 1RM1C 3E35A 5LGUA 3STZC 1K9MW 1DF5A 3WG7B 4WCEV 1R6NA 3ZRVA 3F5WC 5B1NA 3OMNB 4RQEA 3K0GA 3SYPA 1SETA 2HJFC 5HFMA 3ABMC 3ASOB 5HFLA 2ZXWC 2HVKC 2ZDIA 3VBBA 3P32A 3SYAA 2JK5C 3P30A 3B8NA 1S0VA 3OUSA 1IXMA 3BY6A 1OHHG 2B1IA 1Y4MA 4UVAA 3G71V 2X6CA 2OTLV 1QR8A 2EIJC 4KUMA 1JQ0A 4QE7A 3RVYA 4Q20A 1VQLV 4WF9V 1VQKV 1AI5A 1FXHA 1G4YB 2X6AA 1W0KG 1K92A 4H37A 3CC4V 1K7DA 2OT5A 4PDRA 2QKSA 1OCZB 2EINC 5EBMC 1Q7YW 2R9RB 1AI7A 2IU3A 3AG3B 4FIPC 5LGNA 3OFNG 2V7QG 2DYRB 3ABKC 2HKOA 3B8MA 3W7TA 5C93A 3E2EA 1K5SA 2AHZA 2C2AA 2ZD9A 4QPKA 3ZMTA 2Y69B 4JPRA 1EBOA 3AG2C 4GT1A 4RQFA 2BOCC 4MTFA 5EK0A 5FL7G 2IJIA 3RVZA 1VQ8V 1UJWB 3NXSA 3ZRWA 3CCMV 5IYBO 5CN0A 4RUEA 1MG1A 2XASA 3F7VC 1OCRC 3I55V 2F43G 2JDIG 3K04A 3CCLV 1PL0A 2CK3G 1ROPA 1Q82W 3OUFA 1RPRA 2WAMA 1M9NA 3QO8A 3ZMZA 4JTDB 4QJFB 3SYCA 1V55B 4EKWA 1BHAA 4BIUA 1KC8W 2IH3C 4MVUA 1F4NA 4MTOA 1TUEB 1JX9A 1LNQA 3CC2V 1R3KC 1FXKC 1NR7A 3VOUA 5CBGA 2LP7A 3IFXA 3DTUB 4I9WA 4BW5A 1YSCA 3AG4B 3GWOA 3HPLC 4WFFA 2DWEC 2XNDG 4GX1A 4GX0A 4HAMA 1R3JC 3K03A 4KP4A 2QE7G 4U7NA 4XDKA 3SPCA 1JOYA 1YTFD 4ZBMA 4L87A 3UM7A 1OCCC 1R73A 1FXVA 3OEHG 1B6QA 1S77D 3LSQA 1I5XA 2ITCC 3PJSK 1YI2V 3LNMB 3G6EV 1H8HG 3RW0A 2Q68A 1AJNA 4HYOA 3SYOA 1R3LC 1F4MA 4R6ZA 2D3OW 2Z3YA 1SESA 4FK5C 1JPXA 2XAQA 4PA7A 3T4DA 4MTGA 1QLEC 3JD3A 4GX5A 3D36A 3E83A 1VQNV 2B1GA 5L3GA 1S3JA 3K9AA 3MHSC 4RO2A 2EINB 3JCZA 1NH2B 4WFEA 4PDMA 2LFRA 2EZOA 2IH1C 3TK1A 4PA4A 3W7SA 1M90W 3CMAV 1BHBA 4TSFG 2WLIB 3JD4A 4U7OA 1DLBA 5B1AC 3IGAC 2EZPA 3JD2A 4JTCB 1E79G 2EJRA 3AG2B 2PI5A 4HZ3A 3ZMVA 2IJHA 1PD3A 4WFGA 3JD1A 1AROP 3ZJZA 1CP9A 1K34A 2H94A 2HFEC 4PELA 1K4CC 1QLNA 4ZKIA 3AEIA 2ZR2A 5L3DA 2JEUA 1VQ6V 1OZ0A 3OMAB 4QNHB 1S5HC 2QTOA 1JVMA 3FYIB 2Q69A 2BOBC 4PA6A 1W2BU 4JAUA 1OCOB 1JCHA 2IW5A 5KA6A 4R8CA 1FXKB 2ZDIC 5L3BA 1H8EG 5DN6G 4XDJA 1M57C 3KG2A 4JASA 4PA9A 1GM8A 1W0JG 1F23A 3X2QC 5B1BB 5KA5A 2DQ0A 1WPXA 1M56B 2EIKB 3FB8C 1CPYA 3ASNC 3FB6C 4G27B 1R3IC 3ETGA 4MVZA 2HVJC 2EBOA 2Y48A 2UXXA 4UVBA 3JD0A 1V54B 3SPJA 1OCCB 3AG1B 4R7CA 1PNMA 1RPOA 4LBEC 5LHHA 3ZMUA 1QR9A 3OR6C 2W6IG 1ENVA 2WLHA 2EILB 3SJQC 5DM6V 4XBFA 3D3IA 3ZN1A 2AHYA 2XAJA 5E1AC 5B3SC 5IY5C 5LHGA 1XL4A 2JJ2G 2WLLB 3HB3B 3W7WA 1NVPD 3DGEA 1VQ7V 1YHQV 3B77A 2WLIA 1N8RW 2HR3A 1YJWV 2P90A 1AI6A 2H8PC 1DF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R73 A;  1KC8 W;  1Q81 W;  1M90 W;  1K73 W;  3CMA V;  1VQO V;  3G4S V;  1VQ9 V;  3CC7 V;  2OTJ V;  1W2B U;  1YI2 V;  1KQS U;  1S72 V;  1YIT V;  3CC2 V;  3CCR V;  3G6E V;  1QVF U;  3CCE V;  1VQP V;  1JJ2 U;  1VQ4 V;  3CCV V;  3G71 V;  2OTL V;  1VQ8 V;  1NJI W;  1VQM V;  2QEX V;  1QVG U;  2D3O W;  1M1K W;  3CCM V;  1VQL V;  1YIJ V;  4WFA V;  5DM6 V;  4WF9 V;  3OW2 U;  3CCS V;  1VQK V;  1K8A W;  1YJ9 V;  1VQN V;  3CCQ V;  1K9M W;  3CC4 V;  1KD1 W;  3I55 V;  4WCE V;  3CCJ V;  3CCU V;  1Q82 W;  3CD6 V;  3CCL V;  4WFB V;  1VQ7 V;  1VQ6 V;  1YHQ V;  1VQ5 V;  1N8R W;  3CXC U;  3CME V;  2QA4 V;  3I56 V;  1YJW V;  1Q7Y W;  1YJN V;  1Q86 W;  3CPW U; 
#chains in the Genus database with same CATH topology
 4EB6 A;  5IYZ A;  1SS3 A;  3CRQ A;  3RGB A;  4DR3 B;  1KEC A;  5EBW C;  5FNV A;  3K79 A;  3K0D A;  1OJH A;  4LFC O;  2KQX A;  4NVP A;  5CA0 A;  2B5U A;  1ZL8 A;  4KHP O;  2CAZ C;  4DUY B;  3JAT A;  5B1O A;  3CD6 V;  4DV1 B;  4J42 A;  2JEX A;  3L73 H;  2UU9 O;  2E75 B;  3SPG A;  2P7T C;  4AQY B;  2A79 B;  1MNG A;  4ZOL A;  4JZ2 A;  3CJH A;  3O9O A;  4LFB O;  1YTF B;  4LF4 O;  2ZM6 B;  2ZIO A;  4JI5 O;  2LGW A;  4UUJ C;  3OMI B;  3CYO A;  3CCS V;  2W0F C;  5J2U B;  3TET A;  1MAB G;  1BE3 H;  5LGT A;  4I50 A;  3D36 C;  1FJG O;  1H2K A;  5CMU A;  1EN4 A;  1RSO B;  2UUB B;  3G4S V;  3VQX A;  4X1K A;  2X6B A;  5CBH A;  4OGQ B;  2Y69 C;  1XUQ A;  4FLT A;  3CCV V;  1SZT A;  4ASU G;  1BZK A;  1UFI A;  3CP1 A;  5KUK A;  4K0K B;  3O65 A;  1BQ0 A;  3ZIA G;  4DR4 O;  4UB8 Z;  3C90 A;  2QWR B;  2UUA O;  2JVD A;  3ZHS A;  1H2L A;  3K5M A;  2DW4 A;  4CC5 A;  2FTK A;  2R9I A;  5BMV B;  4UV8 A;  2QGN A;  2WLJ A;  3K06 A;  3AG4 C;  1QU7 A;  3ZMS A;  2QEX V;  4YJ2 B;  2WWW A;  4YIO A;  2DWD C;  4E2L A;  1IDS A;  3I56 V;  3CRR A;  4DV7 B;  5KAI Z;  4FPP A;  4X1I B;  3OEE G;  2V4D A;  3ZRX A;  2IM9 A;  1EZV H;  4FMT A;  1XNQ O;  1IZ3 A;  3F7Y C;  4MTX A;  3RFR A;  5FPO A;  3TJT A;  3JAR A;  5J2U A;  4JI2 O;  2QKC A;  4B3T O;  1GH6 A;  2M7W A;  1RSO A;  4JI3 O;  4N21 A;  5J9P C;  1D5N A;  2JRI A;  2ZR3 A;  3VQW A;  2WLK A;  3IC7 A;  2DYS B;  4P9O A;  1L0N H;  1PKX A;  2DE0 X;  3AK2 A;  1ORQ C;  3FB7 C;  3E89 A;  4L8J A;  5B1A B;  3RYI B;  5LBQ A;  4MSW C;  3HKE B;  5GW7 A;  2LGQ A;  4MVM A;  5BXZ A;  4J9Z B;  4AHC A;  2P6J A;  4RUF A;  1LR1 A;  2QWN B;  3B2E E;  2DN9 A;  2B9Z A;  1N34 B;  1D5A A;  1VF6 A;  4PDV A;  2HP8 A;  1FS0 G;  4JF3 A;  5BMV A;  2VQF O;  3B40 A;  1FXK A;  1OCO C;  2DQ3 A;  2ATK C;  4YJ2 A;  2F95 B;  4DW0 A;  2UU9 B;  4PV1 B;  3SPH A;  5LP6 C;  4H0L B;  3ZN0 A;  4LFB B;  2Q67 A;  4LF4 B;  4X64 O;  1V54 C;  4QIW F;  1THZ A;  4E4E A;  5BY1 A;  1WP7 A;  3TCU A;  2ZE7 A;  2G38 A;  2RQ6 A;  1H2N A;  2ZNJ A;  3WB1 A;  1NTK H;  4PI0 A;  1P4R A;  3A0H Z;  4H33 A;  1WN7 A;  3RYF B;  1O9H A;  3OE7 G;  2CTP A;  3RYI A;  4JYA B;  3HKE A;  2GTA A;  1AB3 A;  4LF8 O;  1F51 A;  4FLV A;  4K8Z A;  4B3R O;  3ABL C;  1Y6X A;  4LH7 A;  1LUV A;  3JAL A;  3H9V A;  4WCE V;  1R6N A;  1FYJ A;  4RQE A;  2PYJ A;  5JH7 A;  4DV5 O;  5HFM A;  3ABM C;  2VQE B;  3APQ A;  3P32 A;  2JK5 C;  3P30 A;  2QKA A;  1S0V A;  3OUS A;  4X20 B;  5ITZ B;  2UUC B;  3G71 V;  3RT3 C;  3MAQ A;  4JV5 O;  4DR1 O;  2ZCE A;  1VQL V;  1VQK V;  1FXH A;  4H37 A;  2X6A A;  2F4V O;  1K7D A;  3N2G B;  1XNQ B;  3JAS B;  1AR4 A;  1OCZ B;  4UFZ A;  5GON B;  1RFY A;  2R9R B;  2IU3 A;  3AG3 B;  4FIP C;  5JCO C;  2DYR B;  3B8M A;  2HKO A;  4B3T B;  3R66 A;  3K59 A;  3ZMT A;  4QPK A;  4JI3 B;  4DUZ O;  3AG2 C;  5CA1 B;  1QQC A;  2BTO A;  5DED A;  2BOC C;  5FL7 G;  1UJW B;  3NXS A;  3RYF A;  3CCM V;  3DXR A;  4I4T A;  5CN0 A;  4RUE A;  1OCR C;  2ZE5 A;  3K04 A;  3ZHQ A;  1ROP A;  3HKD A;  3A0B Z;  4JTD B;  2JGD B;  2GTS A;  2HEP A;  1NR7 A;  3VOU A;  3DTU B;  3HPL C;  2VQF B;  5LMN B;  2DWE C;  5LOV B;  4A5U B;  1G1X B;  4HAM A;  2QE7 G;  4CH3 A;  4ZBM A;  4YIP A;  1HNX O;  4L87 A;  1OCC C;  1R73 A;  4X20 A;  1FXV A;  1S77 D;  5ITZ A;  3LSQ A;  1IUR A;  4X64 B;  3G6E V;  4HYO A;  5K1X A;  4NTX A;  3N2G A;  2LQT A;  2D3O W;  1SES A;  1XDC A;  3S3X A;  1JPX A;  4PA7 A;  5GON A;  1ZSP A;  3T4D A;  4MTG A;  4GX5 A;  1XOU A;  2B1G A;  4Z2W A;  5E79 Z;  3K9A A;  2RDC A;  3FD9 A;  1BS3 A;  2EIN B;  5D5Q A;  3IAY A;  4JI8 O;  5CA1 A;  3CWB H;  4TSF G;  1I94 O;  4JTC B;  2YDE A;  3N27 A;  1ZTE A;  3B4S A;  2EJR A;  4HZ3 A;  5JJN B;  3JD1 A;  1ARO P;  1CP9 A;  1K34 A;  3L71 H;  4LF8 B;  4ZKI A;  3AEI A;  1WA8 B;  4B3S O;  4DRX B;  2NN4 A;  2YIB D;  1OZ0 A;  2JGD A;  1S5H C;  2YID A;  2Q69 A;  4JAU A;  1JCH A;  5KA6 A;  4AI8 A;  4DV5 B;  1H8E G;  1M57 C;  3KG2 A;  4PA9 A;  1US6 A;  4JI4 O;  1W0J G;  2ARH A;  2XUM A;  2EIK B;  3FB8 C;  3ASN C;  3FX7 A;  2HVJ C;  3ZED A;  4JV5 B;  2UXX A;  4O2A B;  4DR1 B;  3SPJ A;  4J11 A;  4R7C A;  1PNM A;  2F4V B;  5EYP B;  2JS5 A;  4NTY A;  4K3A A;  1WB7 A;  2F66 C;  4IL6 Z;  1NU1 H;  3SJQ C;  2FL4 A;  5DM6 V;  4CS3 A;  3D3I A;  3ZN1 A;  4DV0 O;  1PPJ H;  5LHG A;  4DUZ B;  2WLL B;  3W7W A;  2N04 A;  3DGE A;  3BFR A;  4FLU A;  2H8P C;  3VQY A;  2YXY A;  4D7S A;  2GUZ B;  1L1F A;  4HNA A;  2OCC C;  4G28 B;  4G2K A;  2Q6A A;  2ZT9 B;  1JJ2 U;  1J5E B;  4DV1 O;  1WA8 A;  2YSU B;  2YS8 A;  2A0L A;  3WG7 C;  3MD0 A;  4PHZ A;  2CE4 A;  3ZHT A;  1SKV A;  4CBC A;  4LP8 A;  1VIB A;  3BAA A;  3G80 A;  2ZM6 O;  2MK3 A;  2XHB A;  2EIM C;  2ZXW B;  1QCE A;  3P3N A;  1K3E A;  1UPG A;  4Z1M G;  4KFM A;  1R6K A;  1KU9 A;  2CUG A;  2P5O A;  1GAX A;  2QWP B;  3X2Q B;  2WPD G;  3OW2 U;  4O2A A;  4GCZ A;  3T1Y O;  2UUB O;  3CCJ V;  4I0X A;  5A2Q N;  4OX9 O;  5LHI A;  4GX2 A;  1B04 A;  3LDD A;  5KX5 A;  3ABK B;  1WLE A;  3AK1 A;  1FFX B;  4DV4 B;  4JI8 B;  4CS4 A;  4K0K O;  2Y0I A;  2ZNI A;  3R65 A;  4DK0 A;  2PY5 A;  3JCU Z;  3U11 A;  1N33 O;  2NLJ C;  2RCV A;  2ODM A;  3FFQ A;  3BA8 A;  2GUZ A;  4DV6 O;  1KKC A;  1JR9 A;  5B66 Z;  1GO3 F;  5KHK A;  4ABM A;  5BR8 B;  1B3Q A;  2XOK G;  1MOF A;  4F6E A;  3C3T A;  3RYH B;  4X89 A;  3FB5 C;  2UXC B;  2GBO A;  4DV7 O;  1Y66 A;  3FKS G;  1K97 A;  1XMO B;  4BAY A;  3CCU V;  4U3F H;  3CEI A;  4JI4 B;  1TVK A;  1Z5W A;  5KHG A;  4J9Y B;  4EEQ A;  3K58 A;  1XL6 A;  4BIZ A;  2KG7 A;  4WBN B;  1AI4 A;  2IU0 A;  4O2B B;  4LWS B;  4DO2 A;  1HWY A;  3T2M A;  3UKM A;  2P67 A;  1FFX A;  4MVR A;  3P3P A;  4TWK A;  4DV0 B;  2R9A A;  1KKD A;  1KQS U;  1PNL A;  3WB0 A;  3LDE A;  1EN5 A;  1E1Q G;  1N34 O;  3I5D A;  5EC2 C;  3GB7 C;  3ABU A;  1M1K W;  3U0Z A;  3CCQ V;  5L3E A;  2HG5 C;  4MW8 A;  4UV9 A;  4FLW A;  3ASO C;  5LYJ A;  1AJP A;  3FAV A;  4YXW G;  4J7J A;  1K5Q A;  5H5N A;  1DK1 A;  1YIT V;  3HR0 A;  3RYH A;  1E1R G;  3ETE A;  4P9P A;  4LF9 O;  1IBL B;  4TQD A;  1FKA O;  2Q7G A;  5B1B C;  1MZE A;  4FFK A;  2XAH A;  1AR1 B;  3E22 B;  3W7X A;  1MSW D;  1M56 C;  4UCR A;  1GN2 A;  2JIZ G;  1PNK A;  2CGN A;  2CTQ A;  3GWK C;  5H6Q A;  4PA3 A;  1TAE A;  3BVO A;  4WBN A;  1NR1 A;  2O57 A;  3T1Y B;  3BCC H;  4O4I B;  3D8C A;  2AZ2 A;  2P22 C;  1P7G A;  4OX9 B;  4JYY A;  4O2B A;  2L35 A;  2EIL C;  2P4V A;  1OV9 A;  4WFH A;  1Q8I A;  4FM2 A;  4JYA O;  2XT9 A;  1WPB A;  1NQT A;  1NT2 B;  1N33 B;  1GN6 A;  3DC6 A;  3SJC C;  4J7Z A;  1K73 W;  1GM7 A;  2LFS A;  2RN9 A;  4DV6 B;  4BWA A;  2UXD O;  2A06 H;  4GLX A;  5LGU A;  3STZ C;  2VQE O;  1SQG A;  4W4K A;  1K9M W;  3A8T A;  2OYQ A;  5B1N A;  2Y4T A;  3OMN B;  1WAZ A;  3K0G A;  3SYP A;  3L74 H;  2UUC O;  1HDJ A;  1VP7 A;  2HVK C;  3VBB A;  3SYA A;  3E22 A;  2CTW A;  1L8D A;  4KUM A;  1FD9 A;  3ZHV A;  4QE7 A;  2H3O A;  2QSA A;  1WJZ A;  4NXM O;  1W0K G;  1K92 A;  3KCY A;  2ZIM A;  4O4I A;  1AI7 A;  5LGN A;  3OFN G;  3W7T A;  2F1M A;  4AIL C;  1N0N A;  1Q43 A;  1EBO A;  4GT1 A;  1XEQ A;  3ZHR A;  1Q3E A;  1MG1 A;  3I55 V;  3TXS A;  2F43 G;  2R70 A;  1Q82 W;  2L6L A;  5EZY B;  5KMG B;  2WAM A;  4QJF B;  1V55 B;  4IYI A;  4MVU A;  5LMN O;  1JX9 A;  3KKY A;  1R3K C;  5JJJ B;  4TQF A;  1FXK C;  5AG2 A;  1M93 A;  1YSC A;  3GWO A;  3UQ8 A;  4GX0 A;  3H1K H;  4U7N A;  4LF9 B;  4XDK A;  3SPC A;  4LF6 O;  4X1I A;  3IC9 A;  1BSM A;  1B6Q A;  2IBZ H;  4UCV A;  4DR2 O;  2ITC C;  5JJE B;  1SQF A;  1FAF A;  1H8H G;  5K1P A;  4DV3 O;  2Q68 A;  4R6Z A;  2JS3 A;  1Y76 B;  1XNR B;  3JCZ A;  4UB6 Z;  3CB2 A;  2IH1 C;  2EUL A;  5IJ0 B;  1M90 W;  3CMA V;  1BHB A;  2RJZ A;  4J41 A;  3JD4 A;  4U7O A;  5B1A C;  1E79 G;  3AG2 B;  2PI5 A;  2IJH A;  1U97 A;  1PD3 A;  1HR0 B;  1M5I A;  4NB5 A;  1K4C C;  1SQB H;  3L75 H;  5KMG A;  5D5P A;  4LNU B;  3OD4 A;  5L3D A;  2LW1 A;  2BCC H;  2JEU A;  1SA0 B;  2UXD B;  1I08 A;  3OMA B;  4ZIB A;  4QNH B;  2D2C B;  2QWQ B;  4CS2 A;  3FYI B;  3H1J H;  1N32 O;  5KHJ A;  3KZI Z;  1T5E A;  1IBM B;  2PZS A;  5KLV H;  1JJO A;  2ADQ B;  3K9S A;  1XI1 A;  1WPX A;  2XTA A;  1R3I C;  5B5E Z;  3SR2 C;  4UVB A;  3JD0 A;  1OCC B;  3AG1 B;  4NXM B;  4LBE C;  3U10 A;  3ZMU A;  2W6I G;  1Y76 A;  4JI7 O;  4XBF A;  2WA4 A;  1SQV H;  5E1A C;  5B3S C;  5IY5 C;  1XL4 A;  3LSU A;  3HB3 B;  1NVP D;  1VQ7 V;  5IJ0 A;  3B77 A;  5GTH Z;  1O9G A;  1QNM A;  1J5E O;  1DF4 A;  3E8F A;  3L70 H;  2X7R B;  5BZB A;  4FLZ A;  2CH7 B;  3SYQ A;  2UXN A;  2ETN A;  5LA6 B;  1KUQ A;  2ZIN A;  2BSK B;  3OM3 B;  3H1H H;  3LUT B;  1SA0 A;  2QM7 A;  1SQP H;  1RM1 B;  1K33 A;  3FYE B;  4LC1 A;  1GMG A;  3CXC U;  5H6R A;  5IDJ A;  5CBF A;  4UVC A;  1I7F A;  2QWO B;  2QR4 A;  4LF6 B;  2E74 B;  1M57 B;  2EIJ B;  4FLY A;  2Q0A A;  3JAS A;  4DR2 B;  1YJ9 V;  2KKW A;  1Q90 D;  2Y4U A;  4DV3 B;  4DV4 O;  4GYC B;  1ZAU A;  4BR6 A;  2PI4 A;  3AG3 C;  1KP2 A;  2ITD C;  2YUA A;  3MHH C;  1Q81 W;  2EJ7 A;  5IJ9 B;  4N23 A;  5KUM A;  4R50 A;  3APO A;  1GK9 A;  2Y0P A;  1QVG U;  4O4L B;  4LF7 B;  1XHX A;  1YIJ V;  1NKD A;  1EFR G;  3CS5 A;  1BL8 A;  2YIA A;  4X65 B;  1AP6 A;  3OAA G;  1VQ5 V;  5J2T B;  1J95 A;  4QPJ A;  5BR8 O;  3JSL A;  2JJ1 G;  1YEW A;  2CH7 A;  3CPW U;  1SF9 A;  4JI6 O;  3WB2 A;  3J80 N;  2UXC O;  2OTJ V;  3ZS8 C;  2OCC B;  1XMO O;  1DTO A;  2PUS A;  3OGI B;  4MVQ A;  1VQP V;  5LOV A;  3E8B A;  2YXH A;  3EXA A;  4PDL A;  5L3F A;  1N32 B;  3ETD A;  1G8M A;  4GZR B;  4MT8 A;  2A3Q A;  1R1B A;  1YJN V;  4LFA B;  1SRY A;  2CTR A;  2EIM B;  2YI8 A;  5DEC A;  4EFE A;  2E5L B;  1Q6I A;  3L72 H;  3CCR V;  4JGS A;  1EN6 A;  2GSM B;  4FJC C;  3A2F A;  3OR7 C;  2K1E A;  4MW3 A;  3TGU H;  1GM9 A;  3M8A A;  4DXW A;  2K9P A;  5JVD B;  1FPO A;  1QLE B;  2AZ0 A;  3BRC A;  4JI7 B;  5TIS Z;  1EZJ A;  4TV9 B;  4LR3 A;  1QBZ A;  1U96 A;  3BPZ A;  1VQ9 V;  2WLN A;  5FLX N;  4O4L A;  4F6R B;  4X62 B;  4P30 A;  2N74 A;  2DJV A;  5J2T A;  4DRX A;  4I5S A;  3CHX A;  1ZWI C;  1BCC H;  1KBH A;  1NTM H;  1XQ8 A;  3K5L A;  1IBL O;  3AK3 A;  4JAV A;  4TUY B;  4I55 B;  2YIB A;  2WA3 A;  3IJ4 A;  2OWO A;  3K3W A;  3CCE V;  1N36 O;  4MVO A;  4X8A A;  2Q73 A;  2EIK C;  1Q5O A;  5H2F Z;  5LXT B;  2XAG A;  5EYP A;  2ZKO A;  4ZI7 B;  3K08 A;  1MSD A;  3T4Z A;  1QVF U;  5FPR A;  1NH2 D;  3M99 B;  1FFT B;  1IX9 A;  4MS2 A;  4DYL A;  2WLL A;  4W4L A;  5H9C A;  1GN3 A;  5IYD O;  2W6J G;  5LL6 Y;  3RYC B;  2DOS A;  1KD1 W;  4TV9 A;  1A32 A;  1ZUQ A;  3SPI A;  2EX3 A;  1AIL A;  1HNZ B;  1M4U A;  5IYC O;  1Q86 W;  1WP8 A;  1SER A;  1VQO V;  4RAI A;  2PYL A;  4EB6 B;  2MW2 B;  3OT7 A;  1NJI W;  3CE2 A;  4O4J B;  4JI6 B;  5FNV B;  4YY3 O;  3F5W C;  5CA0 B;  1SET A;  4EFB A;  2HJF C;  3ASO B;  5HFL A;  4BW9 A;  2ZXW C;  2ZDI A;  3B8N A;  1YVW A;  1IXM A;  3BY6 A;  2OTL V;  1QR8 A;  1HNW O;  1JQ0 A;  4Q20 A;  1AP5 A;  1HW7 A;  2HJD A;  4WF9 V;  1AI5 A;  5LXT A;  3CC4 V;  2OT5 A;  4PDR A;  2QKS A;  5EBM C;  4ZI7 A;  4U3J B;  4I50 B;  3E2E A;  3ABK C;  5C93 A;  3J7A U;  2ZD9 A;  2Y69 B;  4PJ0 Z;  4X1K B;  2Q7H A;  4MTF A;  5EK0 A;  2IJI A;  3RVZ A;  3RYC A;  4X1Y B;  3N2K B;  5IYB O;  4DV2 B;  2XAS A;  1MZF A;  3DSQ A;  2JDI G;  2CK3 G;  1QHT A;  1RPR A;  1VF5 B;  3SYC A;  1BHA A;  3Q4H B;  1KC8 W;  4O4J A;  4DR6 B;  5CBG A;  3AG4 B;  4WFF A;  2W0X A;  3UO2 A;  3OTO B;  3T1H O;  2VWK A;  1VAR A;  4X66 B;  1R3J C;  1YTF D;  3THO A;  1N36 B;  2FML A;  3D3Q A;  4CH6 A;  2BTQ B;  1YI2 V;  3K57 A;  3G67 A;  3RW0 A;  1XNR O;  1AJN A;  1R3L C;  1F4M A;  4IYH A;  4LWS A;  2KSD A;  4FK5 C;  4IIJ B;  2XAQ A;  4JI0 O;  4QGP A;  3JAR B;  4U3J A;  3D36 A;  3E83 A;  2VS0 A;  1D2D A;  2Q5Z A;  2CGO A;  4PDM A;  4WFE A;  1EM1 A;  2LFR A;  1CXZ B;  1HR0 O;  4PA4 A;  2YI9 A;  2WLI B;  1DLB A;  3JD2 A;  4X1Y A;  3N2K A;  2VWJ A;  4Q6G A;  3ZMV A;  4FFB B;  4WFG A;  3ZJZ A;  5KHH A;  2H94 A;  2HFE C;  1QLN A;  3JAM N;  3ZX6 A;  2ZR2 A;  2ILM A;  3Q4H A;  1VQ6 V;  5A9G A;  1F7Y A;  2R72 A;  1LUW A;  3ICX A;  1IBM O;  4YY3 B;  5GTI Z;  2BOB C;  4GUN A;  4PA6 A;  5CB4 B;  1OCO B;  4NTW A;  4R8C A;  2UXB B;  4B08 A;  3HKB B;  1FXK B;  2F93 B;  5L3B A;  1L0L H;  4JAS A;  1XRE A;  1V9P A;  4PD4 F;  1F23 A;  1MA1 A;  2JGU A;  2VRZ A;  5LP6 B;  1CPY A;  4G27 B;  1MMM A;  4CH5 A;  3CRM A;  2BTQ A;  4NXN B;  1HNW B;  1IVS A;  1V54 B;  3PN1 A;  2A7W A;  3HKC B;  1RPO A;  3JAK B;  1GN4 A;  5EIB D;  4IIJ A;  3QG5 A;  1ENV A;  4RWU A;  4UCS A;  5JWP A;  5IWA B;  2WLI A;  2HR3 A;  2QDO A;  1YJW V;  1NI8 A;  2GDS A;  1PP9 H;  2P90 A;  5KHI A;  3CX5 F;  1VF6 C;  1B06 A;  2NNU A;  4FFB A;  1P49 A;  4JI1 O;  4IGG A;  2QJ1 A;  4JYC A;  2HLD G;  1VQ4 V;  4OPH A;  3K5N A;  3ABL B;  4J80 A;  3EVK A;  4WFB V;  1H38 A;  3JAL B;  1S76 D;  5CB4 A;  2GHY A;  1XMQ O;  1S5J A;  2ZE6 A;  4LFC B;  3T1H B;  1CEZ A;  3ABM B;  3HKB A;  3STL C;  4KHP B;  1K4D C;  3OTF A;  3UO3 A;  2RNB A;  5JH7 B;  4B7K A;  4YHH O;  1Z2G A;  1VF7 A;  5EBL C;  4TT3 G;  2AXT Z;  1WB8 A;  5LP6 A;  4JYB A;  1COW G;  3QNE A;  4LCU C;  2YEV B;  3HKC A;  5EIB C;  3JAK A;  4JI5 B;  4F4L A;  3JSN A;  1VEW A;  2DYS C;  1I5Y A;  4JI0 B;  2FKX A;  3H1L H;  3ZRS A;  4TV8 B;  4LF7 O;  5JQG B;  2HHH O;  4B3M O;  2M6Y A;  4O4H B;  4X65 O;  1FJG B;  1KP3 A;  1S5L Z;  4PI2 A;  1K8A W;  3TXQ A;  2KB1 A;  5EZY A;  1X4T A;  2DMX A;  4OXS A;  5B3S B;  5IY5 B;  3E8G A;  1OCR B;  3JAW B;  3DXR B;  1VMG A;  4I4T B;  4NR1 A;  2YIC A;  1V55 C;  2QA4 V;  3CXH F;  1TUB B;  3HKD B;  4MVS A;  2WLM A;  3BHP A;  1S72 V;  4DR4 B;  4ICG A;  2IJK A;  2UUA B;  1ZX3 A;  4J10 A;  4X88 A;  3UCS C;  3QO7 A;  1TGO A;  3F5T A;  4LFA O;  5KAF Z;  2A9H A;  1AJQ A;  2ZQM A;  1Q6H A;  2E5L O;  5L3C A;  1YZB A;  3LNN A;  1JFF B;  3LDC A;  3JYC A;  2BE3 A;  3CC7 V;  2Q9L A;  3OGC C;  1I0H A;  4XDL A;  5F2V O;  5EC1 C;  2YEV A;  1IBK O;  3E8H A;  3G6B A;  2Z5U A;  1AR5 A;  5JCO A;  1P7B A;  4FVM A;  4TV8 A;  3AG7 A;  2OCH A;  5JQG A;  3ML0 A;  4JI2 B;  4X62 O;  4O4H A;  3QF7 A;  3BA9 A;  4LH6 A;  2QM8 A;  2V1D A;  1H2G A;  1NVP B;  4UCT A;  4QE9 A;  4CH4 A;  3ZCC A;  3JAW A;  4LNU A;  4X9Q A;  4JI1 B;  2Q7E A;  2N05 A;  1GTO A;  1TUB A;  1BT8 A;  2F23 A;  2RMK B;  3CME V;  3A0R A;  4JTA B;  1JA8 A;  4GKK O;  3T1C A;  4GKJ O;  2WSS G;  4B7E A;  5C8Y B;  4UXN A;  1R6T A;  1XMQ B;  2LJ2 A;  1H2M A;  3QO5 A;  4D7T A;  4CC6 A;  4CZZ A;  3ABT A;  4YHH B;  4DR7 O;  3MDS A;  1SZX A;  1PV0 A;  1Y74 B;  3GVM A;  3W7U A;  3ASN B;  1JFF A;  1OCZ C;  2XAF A;  3EFF K;  3AG1 C;  3K5O A;  3H01 A;  1P84 F;  2DYR C;  1Q6U A;  3WFV A;  3LSS A;  3E86 A;  3H1I H;  5IT9 N;  4P2Z A;  1NTZ H;  2IJJ A;  3RBZ A;  1W59 A;  1GKF A;  2P06 A;  4WFA V;  4I7Z B;  1HNZ O;  2HHH B;  1BMF G;  1KMI Z;  4FM1 A;  3B09 A;  1NZ6 A;  4B3M B;  3EHB B;  5LMU O;  3ZRW B;  4LF5 O;  1YDX A;  1Y67 A;  3ZHU A;  4UCO A;  2X0L A;  1WNS A;  2E3C A;  5LA6 A;  3BEH A;  5CA3 A;  2YXL A;  4FZ0 A;  2FB5 A;  2BSK A;  3CRA A;  1NBM G;  1VQM V;  4HNA B;  2GV9 A;  1RM1 C;  3E35 A;  4K8X A;  1DF5 A;  1Z5V A;  3WG7 B;  4B3R B;  4K35 A;  3ZRV A;  3WU2 Z;  3QTC A;  3SGI A;  5C8Y A;  3RN4 A;  4IHJ B;  3KCX A;  1BGY H;  4KL1 A;  3VQV A;  3ETQ A;  2NR5 A;  4Z1V A;  1OHH G;  2B1I A;  1Y4M A;  2LW7 A;  4UVA A;  2X6C A;  1Y74 A;  2EIJ C;  3RVY A;  2ADP A;  2ZE8 A;  1HP8 A;  1G4Y B;  1RP3 B;  3BAB A;  4D6T H;  4BIO A;  4J7K A;  3QVN A;  2QTS A;  1XIL A;  2EIN C;  3C3S A;  5IJ9 A;  4DR5 O;  1Q7Y W;  2QM4 A;  4C7U A;  2YC0 A;  4I0X B;  2V7Q G;  3SJB C;  3ZBH A;  4NKG B;  3NR7 A;  1IBK B;  1K5S A;  2AHZ A;  2C2A A;  1PL4 A;  4DV2 O;  5KX5 B;  4JPR A;  3RWR D;  1GRJ A;  4RQF A;  1VQ8 V;  2CDY A;  4OPA A;  2Q8V A;  3ZRW A;  4ZHQ B;  3CRC A;  2Q4P A;  3F7V C;  4DR3 O;  1YXB A;  3CCL V;  3DC5 A;  1AVM A;  1PL0 A;  4DK1 A;  3OUF A;  4DR6 O;  1M9N A;  3QO8 A;  3ZMZ A;  4EKW A;  4BIU A;  2IH3 C;  1G6U A;  1F4N A;  4MTO A;  1TUE B;  3OTO O;  1LNQ A;  2Z0A A;  3CC2 V;  4DUY O;  4X66 O;  2LP7 A;  3IFX A;  4I9W A;  4BW5 A;  2OIG A;  4H44 B;  4GKK B;  2P4K A;  4I9Q A;  4GKJ B;  4AQY O;  2XND G;  1KB9 F;  4GX1 A;  4KP4 A;  1X59 A;  3K03 A;  4JAA A;  4TOI A;  4IHJ A;  1JOY A;  3CSX A;  3M7M X;  2Q0O C;  3UM7 A;  4DR7 B;  3OEH G;  1TVK B;  2AGA A;  1I5X A;  3PJS K;  3S3W A;  1SC5 B;  2AW9 A;  1HNX B;  3LNM B;  1XHZ A;  3SYO A;  3UT5 B;  3SJA C;  5JVD A;  2KG7 B;  2Z3Y A;  4YJ3 B;  1XBL A;  1IXB A;  1QLE C;  3JD3 A;  1VQN V;  1URF A;  5IE9 A;  5L3G A;  1S3J A;  2E76 B;  3MHS C;  4FZ1 A;  4RO2 A;  1NH2 B;  4IT5 A;  2PF4 E;  2EZO A;  3TK1 A;  3W7S A;  4F6R A;  5LMU B;  2PGG A;  3IGA C;  2EZP A;  4ZHQ A;  4LF5 B;  5IYZ B;  2PTM A;  1I94 B;  4PEL A;  3J81 N;  1YCI A;  1YF2 A;  2OIE A;  1PM9 A;  1ZLZ A;  4TUY A;  4I55 A;  4DW1 A;  4UCU A;  2UXB O;  1ZL8 B;  1BQZ A;  3JAT B;  2QTO A;  1JVM A;  3L9D A;  1W2B U;  4B3S B;  5LYJ B;  2IW5 A;  3FAV B;  3SDL A;  2ZDI C;  4ZOL B;  1N4C A;  5DN6 G;  4XDJ A;  1N0J A;  1GM8 A;  3CJH B;  3X2Q C;  5B1B B;  5KA5 A;  4NXN O;  2DQ0 A;  1M56 B;  1KYO F;  2LO1 A;  3FB6 C;  4MVZ A;  3ETG A;  4H13 B;  2EBO A;  2Y48 A;  1DGS A;  1NS1 A;  1JMK C;  1H2S B;  4JZG A;  4NYK A;  3UT5 A;  2FYU H;  5LHH A;  4FLX A;  4YJ3 A;  1QR9 A;  3OR6 C;  4KXR A;  4DR5 B;  2WLH A;  5IWA O;  2EIL B;  1SQX H;  4FM0 A;  2AHY A;  2XAJ A;  1TA8 A;  2JJ2 G;  1SQQ H;  1YHQ V;  1N8R W;  1AI6 A;  4HBN A; 
#chains in the Genus database with same CATH homology
 2NNU A;  3E8F A;  2X7R B;  1L1F A;  1KEC A;  5EBW C;  2OCC C;  4G28 B;  4G2K A;  5BZB A;  3SYQ A;  3K79 A;  2Q6A A;  2UXN A;  4JYC A;  2HLD G;  1JJ2 U;  1VQ4 V;  2YSU B;  3OM3 B;  3ABL B;  3LUT B;  1RM1 B;  2QM7 A;  3K0D A;  2A0L A;  2B5U A;  3WG7 C;  1K33 A;  3FYE B;  3MD0 A;  4LC1 A;  5B1O A;  3CD6 V;  1GMG A;  4WFB V;  1H38 A;  1S76 D;  2JEX A;  4CBC A;  2GHY A;  4LP8 A;  3CXC U;  5H6R A;  5IDJ A;  1CEZ A;  5CBF A;  3ABM B;  2MK3 A;  2P7T C;  3SPG A;  3STL C;  2A79 B;  1K4D C;  2EIM C;  1QCE A;  2ZXW B;  4UVC A;  1K3E A;  4Z1M G;  4KFM A;  5EBL C;  4TT3 G;  1R6K A;  1YTF B;  4JYB A;  1COW G;  1M57 B;  2EIJ B;  3X2Q B;  2WPD G;  4UUJ C;  3OW2 U;  3OMI B;  3CYO A;  3CCS V;  3QNE A;  1YJ9 V;  2W0F C;  4LCU C;  3TET A;  1MAB G;  4GCZ A;  5LGT A;  2YEV B;  3CCJ V;  4F4L A;  2PI4 A;  3AG3 C;  1KP2 A;  5CMU A;  5LHI A;  4GX2 A;  2DYS C;  3LDD A;  1I5Y A;  2ITD C;  3MHH C;  1Q81 W;  3ABK B;  3ZRS A;  1WLE A;  3G4S V;  2X6B A;  5CBH A;  4N23 A;  2Y69 C;  5KUM A;  4R50 A;  1KP3 A;  3CCV V;  1GK9 A;  1SZT A;  3R65 A;  4ASU G;  1QVG U;  1YIJ V;  1NKD A;  2NLJ C;  3CP1 A;  1K8A W;  5KUK A;  1EFR G;  2KB1 A;  1BL8 A;  4OXS A;  5B3S B;  5IY5 B;  3E8G A;  1OCR B;  3ZIA G;  3OAA G;  1VQ5 V;  1J95 A;  4QPJ A;  1V55 C;  2QA4 V;  2JJ1 G;  3CPW U;  4MVS A;  1GO3 F;  2WLM A;  2OTJ V;  2DW4 A;  1S72 V;  2OCC B;  2FTK A;  2R9I A;  1DTO A;  4MVQ A;  1VQP V;  2XOK G;  1MOF A;  2IJK A;  4UV8 A;  2WLJ A;  3K06 A;  3AG4 C;  3ZMS A;  4X88 A;  2QEX V;  3E8B A;  3QO7 A;  4X89 A;  3FB5 C;  2WWW A;  1Y66 A;  3FKS G;  4PDL A;  5L3F A;  1K97 A;  3ETD A;  4BAY A;  2DWD C;  1G8M A;  2A9H A;  3CCU V;  1AJQ A;  2ZQM A;  4E2L A;  4MT8 A;  3I56 V;  1YJN V;  5L3C A;  1SRY A;  2EIM B;  4FPP A;  3LDC A;  4J9Y B;  3OEE G;  3JYC A;  3ZRX A;  3CC7 V;  1XL6 A;  4BIZ A;  4FMT A;  3CCR V;  4MTX A;  3F7Y C;  4JGS A;  4FJC C;  2GSM B;  3OGC C;  1AI4 A;  3OR7 C;  2K1E A;  4MW3 A;  4XDL A;  5EC1 C;  2YEV A;  1GM9 A;  4DXW A;  2IU0 A;  1QLE B;  3E8H A;  2M7W A;  2Z5U A;  1HWY A;  4DO2 A;  3T2M A;  1P7B A;  3UKM A;  2P67 A;  4N21 A;  5J9P C;  2ZR3 A;  3ML0 A;  2WLK A;  1EZJ A;  3IC7 A;  2DYS B;  4MVR A;  4P9O A;  4TWK A;  1PKX A;  1QBZ A;  2QM8 A;  1ORQ C;  1VQ9 V;  3FB7 C;  2WLN A;  2V1D A;  1KKD A;  3E89 A;  1H2G A;  1KQS U;  1PNL A;  5B1A B;  3LDE A;  1NVP B;  1E1Q G;  5LBQ A;  4MSW C;  4QE9 A;  5GW7 A;  3ZCC A;  4MVM A;  4P30 A;  5EC2 C;  3GB7 C;  3ABU A;  1M1K W;  4J9Z B;  2P6J A;  4RUF A;  3CCQ V;  4I5S A;  1GTO A;  5L3E A;  4PDV A;  2HG5 C;  1ZWI C;  4MW8 A;  3CME V;  4UV9 A;  3A0R A;  1FS0 G;  3ASO C;  4JTA B;  4JAV A;  4JF3 A;  1AJP A;  4YXW G;  3T1C A;  1FXK A;  1K5Q A;  1OCO C;  2DQ3 A;  2ATK C;  2WSS G;  1YIT V;  4UXN A;  1E1R G;  3ETE A;  3K3W A;  4P9P A;  3CCE V;  3QO5 A;  4CZZ A;  3ABT A;  5B1B C;  2XAH A;  4MVO A;  1AR1 B;  4X8A A;  3W7X A;  3SPH A;  1MSW D;  1M56 C;  2EIK C;  3ZN0 A;  2Q67 A;  2JIZ G;  3W7U A;  3ASN B;  1PNK A;  1OCZ C;  5H6Q A;  1V54 C;  2XAF A;  4QIW F;  4PA3 A;  3EFF K;  2XAG A;  3AG1 C;  1THZ A;  3H01 A;  2DYR C;  1NR1 A;  3WFV A;  3K08 A;  3T4Z A;  3TCU A;  3LSS A;  3E86 A;  1QVF U;  1NH2 D;  3M99 B;  1FFT B;  4P2Z A;  4MS2 A;  2EIL C;  2IJJ A;  3RBZ A;  2WLL A;  4WFH A;  1GKF A;  5H9C A;  4WFA V;  1BMF G;  5IYD O;  2W6J G;  1NQT A;  3EHB B;  1KD1 W;  1P4R A;  4H33 A;  3ZRW B;  3OE7 G;  3SPI A;  5IYC O;  1Q86 W;  1SER A;  2X0L A;  1K73 W;  1VQO V;  1GM7 A;  3BEH A;  5CA3 A;  1F51 A;  2LFS A;  4RAI A;  1NBM G;  1NJI W;  1VQM V;  3ABL C;  1RM1 C;  3E35 A;  5LGU A;  3STZ C;  1K9M W;  1DF5 A;  3WG7 B;  4WCE V;  1R6N A;  3ZRV A;  3F5W C;  5B1N A;  3OMN B;  4RQE A;  3K0G A;  3SYP A;  1SET A;  2HJF C;  5HFM A;  3ABM C;  3ASO B;  5HFL A;  2ZXW C;  2HVK C;  2ZDI A;  3VBB A;  3P32 A;  3SYA A;  2JK5 C;  3P30 A;  3B8N A;  1S0V A;  3OUS A;  1IXM A;  3BY6 A;  1OHH G;  2B1I A;  1Y4M A;  4UVA A;  3G71 V;  2X6C A;  2OTL V;  1QR8 A;  2EIJ C;  4KUM A;  1JQ0 A;  4QE7 A;  3RVY A;  4Q20 A;  1VQL V;  4WF9 V;  1VQK V;  1AI5 A;  1FXH A;  1G4Y B;  2X6A A;  1W0K G;  1K92 A;  4H37 A;  3CC4 V;  1K7D A;  2OT5 A;  4PDR A;  2QKS A;  1OCZ B;  2EIN C;  5EBM C;  1Q7Y W;  2R9R B;  1AI7 A;  2IU3 A;  3AG3 B;  4FIP C;  5LGN A;  3OFN G;  2V7Q G;  2DYR B;  3ABK C;  2HKO A;  3B8M A;  3W7T A;  5C93 A;  3E2E A;  1K5S A;  2AHZ A;  2C2A A;  2ZD9 A;  4QPK A;  3ZMT A;  2Y69 B;  4JPR A;  1EBO A;  3AG2 C;  4GT1 A;  4RQF A;  2BOC C;  4MTF A;  5EK0 A;  5FL7 G;  2IJI A;  3RVZ A;  1VQ8 V;  1UJW B;  3NXS A;  3ZRW A;  3CCM V;  5IYB O;  5CN0 A;  4RUE A;  1MG1 A;  2XAS A;  3F7V C;  1OCR C;  3I55 V;  2F43 G;  2JDI G;  3K04 A;  3CCL V;  1PL0 A;  2CK3 G;  1ROP A;  1Q82 W;  3OUF A;  1RPR A;  2WAM A;  1M9N A;  3QO8 A;  3ZMZ A;  4JTD B;  4QJF B;  3SYC A;  1V55 B;  4EKW A;  1BHA A;  4BIU A;  1KC8 W;  2IH3 C;  4MVU A;  1F4N A;  4MTO A;  1TUE B;  1JX9 A;  1LNQ A;  3CC2 V;  1R3K C;  1FXK C;  1NR7 A;  3VOU A;  5CBG A;  2LP7 A;  3IFX A;  3DTU B;  4I9W A;  4BW5 A;  1YSC A;  3AG4 B;  3GWO A;  3HPL C;  4WFF A;  2DWE C;  2XND G;  4GX1 A;  4GX0 A;  4HAM A;  1R3J C;  3K03 A;  4KP4 A;  2QE7 G;  4U7N A;  4XDK A;  3SPC A;  1JOY A;  1YTF D;  4ZBM A;  4L87 A;  3UM7 A;  1OCC C;  1R73 A;  1FXV A;  3OEH G;  1B6Q A;  1S77 D;  3LSQ A;  1I5X A;  2ITC C;  3PJS K;  1YI2 V;  3LNM B;  3G6E V;  1H8H G;  3RW0 A;  2Q68 A;  1AJN A;  4HYO A;  3SYO A;  1R3L C;  1F4M A;  4R6Z A;  2D3O W;  2Z3Y A;  1SES A;  4FK5 C;  1JPX A;  2XAQ A;  4PA7 A;  3T4D A;  4MTG A;  1QLE C;  3JD3 A;  4GX5 A;  3D36 A;  3E83 A;  1VQN V;  2B1G A;  5L3G A;  1S3J A;  3K9A A;  3MHS C;  4RO2 A;  2EIN B;  3JCZ A;  1NH2 B;  4WFE A;  4PDM A;  2LFR A;  2EZO A;  2IH1 C;  3TK1 A;  4PA4 A;  3W7S A;  1M90 W;  3CMA V;  1BHB A;  4TSF G;  2WLI B;  3JD4 A;  4U7O A;  1DLB A;  5B1A C;  3IGA C;  2EZP A;  3JD2 A;  4JTC B;  1E79 G;  2EJR A;  3AG2 B;  2PI5 A;  4HZ3 A;  3ZMV A;  2IJH A;  1PD3 A;  4WFG A;  3JD1 A;  1ARO P;  3ZJZ A;  1CP9 A;  1K34 A;  2H94 A;  2HFE C;  4PEL A;  1K4C C;  1QLN A;  4ZKI A;  3AEI A;  2ZR2 A;  5L3D A;  2JEU A;  1VQ6 V;  1OZ0 A;  3OMA B;  4QNH B;  1S5H C;  2QTO A;  1JVM A;  3FYI B;  2Q69 A;  2BOB C;  4PA6 A;  1W2B U;  4JAU A;  1OCO B;  1JCH A;  2IW5 A;  5KA6 A;  4R8C A;  1FXK B;  2ZDI C;  5L3B A;  1H8E G;  5DN6 G;  4XDJ A;  1M57 C;  3KG2 A;  4JAS A;  4PA9 A;  1GM8 A;  1W0J G;  1F23 A;  3X2Q C;  5B1B B;  5KA5 A;  2DQ0 A;  1WPX A;  1M56 B;  2EIK B;  3FB8 C;  1CPY A;  3ASN C;  3FB6 C;  4G27 B;  1R3I C;  3ETG A;  4MVZ A;  2HVJ C;  2EBO A;  2Y48 A;  2UXX A;  4UVB A;  3JD0 A;  1V54 B;  3SPJ A;  1OCC B;  3AG1 B;  4R7C A;  1PNM A;  1RPO A;  4LBE C;  5LHH A;  3ZMU A;  1QR9 A;  3OR6 C;  2W6I G;  1ENV A;  2WLH A;  2EIL B;  3SJQ C;  5DM6 V;  4XBF A;  3D3I A;  3ZN1 A;  2AHY A;  2XAJ A;  5E1A C;  5B3S C;  5IY5 C;  5LHG A;  1XL4 A;  2JJ2 G;  2WLL B;  3HB3 B;  3W7W A;  1NVP D;  3DGE A;  1VQ7 V;  1YHQ V;  3B77 A;  2WLI A;  1N8R W;  2HR3 A;  1YJW V;  2P90 A;  1AI6 A;  2H8P C;  1DF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...