1S72V

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s72V00
1YJ9V 1QVFU 1KD1W 1Q82W 2QA4V 2OTLV 1K9MW 1VQ9V 3OW2U 1N8RW 3CCVV 1K73W 1YJNV 1KQSU 1YI2V 1YJWV 3G71V 3I56V 3CXCU 1YHQV 1YITV 3CC4V 1W2BU 1QVGU 4WCEV 3CCMV 1VQ7V 1Q81W 3CCQV 1NJIW 3G4SV 1JJ2U 4WF9V 1Q7YW 3G6EV 2QEXV 2OTJV 3CCRV 3CC2V 1VQNV 1S72V 3CCJV 1Q86W 3CCEV 4WFBV 4WFAV 1VQOV 1VQMV 3CC7V 1KC8W 1K8AW 3CMEV 3CMAV 1R73A 1YIJV 1VQPV 1M1KW 3I55V 3CCLV 2D3OW 1M90W 1VQ5V 5DM6V 3CD6V 3CCSV 3CCUV 1VQ8V 3CPWU 1VQKV 1VQ6V 1VQ4V 1VQLV
chains in the Genus database with same CATH superfamily
5H6RA 3WFVA 3CCVV 4MVQA 2VQEO 1NR1A 1PP9H 3SJCC 4RQEA 2ADPA 4NTXA 3CWBH 1YZBA 1AR4A 1BL8A 4D7TA 2PYLA 1VMGA 3OR6C 2ZQMA 1PNMA 2Q0OC 1J5EO 4JI1B 3ZCCA 3BABA 1WN7A 4LH6A 1H2GA 2P67A 4UCVA 4FLTA 4PDVA 4MTFA 3N2KB 5LBQA 4UCSA 2UXCB 2CGNA 1THZA 1SS3A 1AJPA 1VQ7V 4QPJA 4IIJB 4OX9O 1D5NA 4CS4A 4DRXB 3K3WA 4JI3O 2IJIA 3SYAA 3NR7A 3SPIA 4L8JA 4AQYO 1S5JA 4JASA 4MVZA 3ZJZA 3K03A 4UCOA 1KKDA 1NTKH 4XDLA 5KUMA 3FYIB 1M9NA 2A3QA 1PPJH 1WP7A 2KG7A 3L75H 1EFRG 2HEPA 1HNWO 4GX5A 3ABKB 1WPBA 4IIJA 2DE0X 4DRXA 4FLVA 3R66A 1IBLO 2LGQA 5JJNB 5L3BA 5JVDB 1HDJA 4W4KA 4DV2O 1XMOB 2EZPA 4JF3A 1FFXB 2HJFC 3AG2B 1F7YA 4L87A 2VRZA 5IJ9B 4ABMA 2QWRB 4I55B 3K0GA 4D7SA 2EIKB 1UJWB 4HZ3A 2LW7A 4IT5A 3OEHG 1EZVH 3FAVB 4UXNA 5B1BB 2OTLV 2EZOA 2QA4V 2QE7G 4DV6B 1M56B 1U97A 2YICA 3H01A 2KSDA 3G6EV 4EB6B 1FJGB 3RGBA 3D8CA 1PD3A 5B1NA 4IYHA 4PI2A 1HR0B 1NT2B 5JVDA 1V55B 2XAFA 2EINB 3U10A 1GH6A 1K33A 1FFXA 3FB6C 2DN9A 5LMUO 5IJ9A 1Z5VA 4K8ZA 1AROP 3C3SA 2ZKOA 1ZAUA 2ZR2A 3CCEV 4LFAB 5FPOA 1R3JC 3B8MA 1M5IA 1JOYA 2YS8A 2P90A 2Q6AA 2LP7A 2XT9A 1SZXA 1BS3A 3ETQA 1QLEB 1KQSU 4DR7O 5KHGA 1Q3EA 2AGAA 1FYJA 2WLMA 3T1HO 4NKGB 1XNQB 4UB8Z 1R3LC 1MSDA 5LA6B 3B09A 5LHHA 4NXNO 1XHZA 4WFHA 1VQOV 3CMAV 3L73H 1TVKB 4MVMA 1KMIZ 2QKAA 4BAYA 2LW1A 4ICGA 5J9PC 3RYFB 1BMFG 4IGGA 1MZFA 1XILA 1MSWD 2MW2B 5CB4B 4JI6O 4FLWA 2R70A 3FFQA 4RWUA 4CH3A 2JIZG 3EVKA 3OTOB 2WA4A 1AI6A 3JYCA 4DR4B 2ZIMA 3H1HH 4P30A 2IU3A 4MVUA 3O9OA 3CD6V 3PJSK 1HNZB 4AI8A 5LYJB 1XNRO 4XBFA 4DR3O 1KB9F 5LA6A 3SPCA 1GK9A 5A2QN 2CTPA 1US6A 2VQEB 1TVKA 1EN6A 2IM9A 3H1JH 2BOBC 1Y76B 2BTQB 2YIBA 4PA9A 1O9HA 2EIJC 3RYFA 1WJZA 1UPGA 2BCCH 3ZEDA 4LF5O 1J5EB 1JFFA 2P5OA 1NI8A 3OUFA 2O57A 3FYEB 1Q8IA 1ZL8A 4TV9B 4TWKA 4D6TH 3W7TA 4JI3B 4PI0A 5KX5B 3ZRVA 2AXTZ 1S5LZ 3W7UA 3D36A 4AQYB 3OW2U 1K5QA 4BIOA 1H8EG 1RSOB 1Y76A 2BTQA 5F2VO 4N21A 1BGYH 3ABMC 3F7YC 4PV1B 3J81N 2A79B 3X2QC 2F43G 5DM6V 4RUFA 2XTAA 3APQA 4YY3O 2L35A 1PM9A 3BHPA 2Z0AA 1HNWB 3VQYA 4QE9A 4TV9A 1IBKO 4U3JB 1F4MA 1ROPA 1IBLB 3ZHQA 5KX5A 1KBHA 2Q67A 4WBNB 4EFEA 4LFBO 1VQMV 1ORQC 3CC7V 3K5MA 4DV0O 2Q7GA 2JGDB 2WLKA 1RSOA 5L3FA 2X7RB 2WA3A 4P2ZA 3VOUA 2PI5A 1XI1A 3CE2A 3H1KH 4K0KO 1H2MA 4UB6Z 2YUAA 1S77D 4YJ3A 2LJ2A 4X65O 2PGGA 4PDLA 1YIJV 3FB8C 1EBOA 2RMKB 2AZ0A 3B4SA 3AG1B 4Q20A 4U3JA 3APOA 1JPXA 4CH5A 1K73W 2LO1A 3E8HA 5BZBA 3G6BA 4TQFA 5J2UA 1SC5B 5LHIA 2JGDA 4GX1A 3AK3A 5LMUB 3T1YO 3CB2A 5CN0A 2QDOA 4LF7O 1NVPD 3OGIB 3HKCB 3E8FA 2Q7EA 3STLC 3OT7A 2EIMB 1PKXA 4FZ1A 5JQGA 5KMGB 3ZHUA 1OHHG 3FB5C 3E8GA 5L3EA 3WB1A 4H44B 1VF5B 3CCMV 4UV9A 4GX0A 4P9PA 4DR7B 4K8XA 4UCUA 1IXBA 3T1HB 1AJQA 3UKMA 5IE9A 2UXBO 4NXNB 4EEQA 5IDJA 2CAZC 3LSUA 5LGTA 3ZHSA 1S3JA 4JV5O 3GVMA 3CXCU 1R6NA 2ZCEA 4HAMA 1SQPH 4JI6B 1K4CC 3HKCA 3A0BZ 4RUEA 2E5LO 3TCUA 3K59A 3T4ZA 5KMGA 1NVPB 4LBEC 5B5EZ 3IFXA 4QJFB 5EYPA 1FXKA 1WLEA 5KHHA 1MABG 2IBZH 4MSWC 4DR1O 1ZWIC 2HFEC 1NZ6A 1SERA 3AG7A 3LDEA 1XNRB 4O2BB 3G71V 2PZSA 3JD1A 4BIZA 4DR3B 1EM1A 3SPJA 3SPGA 4U7OA 1YTFD 2Q4PA 3PN1A 4LR3A 3OD4A 3CCLV 1VF6A 5IY5B 1IX9A 1BQ0A 3ASNC 4ZOLB 1DGSA 3P3NA 2QGNA 4PJ0Z 1GRJA 4LF5B 4DK1A 4B3RO 4Q6GA 3JSNA 1I94B 5JH7B 1X59A 2M6YA 2DYRC 3A0RA 4B3SO 1WB8A 1HR0O 2KKWA 2YSUB 2HVKC 4O2BA 2LGWA 2A9HA 1CP9A 1YVWA 1QHTA 1WA8B 5ITZB 2WLHA 3BEHA 2C2AA 1XL6A 1OCOB 3KKYA 1GKFA 4NR1A 2AHZA 5LGUA 1FD9A 3CX5F 5FLXN 5KAIZ 1FXVA 1IDSA 3O65A 5B1AC 4MVRA 1WB7A 2F4VO 1RP3B 3MHHC 3QO8A 3ZBHA 2UUBO 3VQXA 5JH7A 4X66O 3VQWA 4PA7A 4YY3B 4CH4A 4JZ2A 5LP6C 5FNVA 2QM7A 2ZINA 4FZ0A 4MVSA 4UVAA 1K5SA 1IBKB 1QR9A 2GTAA 5KHJA 1NBMG 1WA8A 2A06H 3ETDA 5ITZA 2QJ1A 5LHGA 4LFBB 2ZE5A 4FLZA 1S5HC 1QVFU 4DV0B 3CP1A 1KP2A 5EBWC 2K9PA 1BZKA 1W0JG 2EBOA 3BA9A 5B3SB 3ICXA 1QVGU 4EKWA 3A0HZ 1MZEA 2YEVB 2E76B 4LF4B 4K0KB 5KHIA 1NTZH 1Q86W 1GTOA 3B8NA 5CBHA 3KCXA 4X65B 2ZE6A 2JEXA 4ZHQA 1Q5OA 3BFRA 1RM1C 4JAUA 4JTCB 3W7SA 4DV1B 3K5OA 4DV3O 3WB0A 2F93B 4PHZA 3G4SV 1AI5A 4UCRA 3T1YB 5EC1C 5IYBO 2XASA 4UUJC 2Q69A 4LF7B 3RYIB 2YEVA 3JD0A 4R7CA 2KG7B 4U3FH 2NR5A 1IVSA 3LUTB 4DUZO 4MTXA 3T2MA 2PUSA 1AB3A 1V54B 2EULA 1IBMO 4B3MO 2UXBB 1NQTA 3MD0A 1R6KA 1TGOA 5H5NA 5EBMC 4JV5B 1SQQH 3SJQC 3E83A 1AJNA 1HNXO 1K92A 3ABLC 1Q6IA 4J7ZA 3RYIA 3ASOB 3RYHB 1MG1A 3H1LH 4LH7A 2UU9O 1G8MA 3ML0A 4LWSB 2E5LB 1AI7A 2Q68A 2QWNB 4JYBA 4J7KA 1DF4A 1SZTA 2OT5A 3RN4A 3AG4B 3JD3A 4DR1B 1MA1A 1TA8A 5L3DA 1B04A 4JI4O 2ZDIA 2X6BA 1KUQA 2DQ0A 5FPRA 3HKEA 3L72H 5FL7G 5LMNO 1NH2D 5JJJB 2ITCC 1FAFA 2Q0AA 2HLDG 3RBZA 3RYHA 1SQVH 2IW5A 3BRCA 2LQTA 1W2BU 4WCEV 1WP8A 4FFKA 4H13B 4LWSA 3J80N 1DTOA 1VF7A 1LUVA 4K35A 4B3RB 2GHYA 4CS3A 4OPAA 4J11A 1BCCH 1VQ5V 2WSSG 2DWEC 5JJEB 5JCOA 4B3SB 2CGOA 1I5XA 4KHPO 2CTRA 4LC1A 1SQFA 1CXZB 1Z2GA 4CH6A 3D3IA 5C8YA 1N33O 2UXNA 1BE3H 3T4DA 5DECA 1SQGA 1SKVA 1NH2B 1B6QA 2JK5C 2R9IA 2NN4A 2RCVA 1TAEA 4DV4O 2F4VB 2P06A 3A2FA 1H8HG 4RAIA 2UUBB 1E1RG 2BSKB 2XAGA 2WLIB 1B3QA 4X66B 3UT5A 4LP8A 4WFFA 2IJHA 2EILC 4NXMO 2HG5C 4TSFG 3RT3C 3ZRXA 5JWPA 2UUAB 4JGSA 3JD4A 1YCIA 4I9WA 1VQ8V 3OUSA 1VQKV 3ZX6A 3FB7C 5K1XA 5EC2C 4I7ZB 1N0NA 2XAQA 3UO3A 1JJ2U 3ABTA 4I9QA 1JFFB 3TETA 1W0KG 2QWOB 4DV5O 2BSKA 3K9AA 2WLIA 3HR0A 3E22A 4J7JA 3ABKC 4FFBB 1ZL8B 4QNHB 3LSQA 5E79Z 1YI2V 3E89A 1SF9A 1TUEB 2EJRA 2OCHA 3VQVA 4DV3B 1ZUQA 1GO3F 4O4HB 4NVPA 2FB5A 2EIKC 4F6RA 4H0LB 2DOSA 1VQ4V 1OCCB 4N23A 5B1BC 1GAXA 5EK0A 2DW4A 1I94O 2JS3A 3HKDB 1M56C 2P4VA 5CA1B 4FFBA 4DYLA 3SYOA 3T1CA 4DUZB 2CTWA 2RNBA 3CCUV 2N74A 1V55C 2EINC 1FPOA 3C90A 4QPKA 4JPRA 1GM8A 4YHHO 1IZ3A 5BMVA 2W0XA 1IBMB 4O4HA 4DW0A 4B3MB 1K3EA 5J2TA 3CS5A 3JCZA 1SETA 2W6IG 2K1EA 1HNXB 2H94A 4WFGA 3CJHB 3HKDA 4YJ3B 1VQLV 2PYJA 4UFZA 1M57B 2JS5A 2ZM6O 3HKBA 2UU9B 4KFMA 5B1OA 5CA1A 1QLEC 3VBBA 2X6AA 3S3WA 4R6ZA 4MW3A 5LOVB 1QQCA 2L6LA 1Q6UA 4DR2O 4MT8A 1P4RA 2GUZB 4E2LA 1AP5A 2HHHO 4JYYA 4JI4B 5J2UB 2LFRA 3L74H 4GUNA 3G80A 2Q9LA 5CBFA 5LMNB 1NKDA 2ZXWB 1N4CA 5IWAO 4LF4O 3OAAG 3ZHTA 3IGAC 2F95B 1SQXH 5BR8O 1F4NA 4DXWA 3CJHA 1FXHA 1BHAA 5JQGB 4KXRA 1EN4A 2DWDC 3OR7C 1N34O 3P30A 5LOVA 3B2EE 1GN2A 4DV1O 5KUKA 4G28B 1BSMA 3E86A 5EZYA 4J41A 2GUZA 3BVOA 1XMQO 2GSMB 5CA3A 4KHPB 2CUGA 4FJCC 4I0XB 1ZSPA 1FFTB 1XUQA 2WPDG 3D36C 1VP7A 3CRCA 2M7WA 3WU2Z 3DXRB 1N33B 5CA0B 1LNQA 4DK0A 1L1FA 3WB2A 3MHSC 4C7UA 3K79A 1XHXA 1YEWA 2A7WA 4DV4B 3BCCH 4YJ2B 4B3TO 2H3OA 5EYPB 1FXKB 2XOKG 4RO2A 3IAYA 1H2NA 3NXSA 4PDRA 2A0LA 4LFCO 4X8AA 4NXMB 4I0XA 2KB1A 3DXRA 5CA0A 1QCEA 4KL1A 2QWPB 1QBZA 3N27A 1VEWA 2FL4A 3IC7A 4X62O 5BXZA 4CS2A 1JA8A 1YXBA 3CCJV 3CMEV 4DR5O 2Q73A 2JEUA 2XAHA 2Y69B 4YJ2A 1E1QG 1F51A 2QR4A 4JYAO 3OMIB 4WFEA 2VQFO 2YXLA 4DV5B 1KKCA 1XDCA 1OCZB 4B7KA 2EJ7A 4HYOA 1Y4MA 4FMTA 4JI0O 5KA5A 2HP8A 3SR2C 1OCRB 3E2EA 1PV0A 4K3AA 2Q7HA 2DQ3A 4R8CA 4DUYO 3B40A 3TJTA 4FLUA 5CBGA 4BWAA 3EHBB 1H2LA 4U7NA 5CMUA 3N2GB 4ZKIA 3TK1A 2QTSA 3FKSG 1X4TA 2B1IA 2D2CB 2W6JG 4IL6Z 1P7BA 3MAQA 4WF9V 4FIPC 3OFNG 4HNAB 2JGUA 1K8AW 4QE7A 3U11A 2BE3A 3RFRA 4PA4A 5FNVB 1RPRA 1Z5WA 4NB5A 2CTQA 3BAAA 4YIPA 3LNMB 3AG1C 1DLBA 4UV8A 4Z1VA 2ETNA 3K9SA 3JARB 1YHQV 1G1XB 4YHHB 4H37A 1YTFB 2ARHA 3N2GA 4CC5A 1AILA 3ZIAG 4GKJB 4YIOA 4MS2A 3JD2A 1QNMA 3CSXA 4KP4A 1M93A 2EIMC 3P32A 5IJ0B 4HNAA 2ZM6B 5KAFZ 3CRAA 3F5WC 4ZHQB 3BPZA 1ZLZA 2OTJV 5DN6G 2UUAO 1F23A 3K5LA 5IYZA 2AHYA 4DR2B 5L3GA 1M90W 5E1AC 3JARA 1MMMA 2HHHB 5GW7A 3OMNB 3F7VC 3QNEA 1JR9A 1YJWV 1VF6C 3MDSA 1DK1A 4W4LA 4GKKO 1N32O 2DYSC 2ZE7A 5IWAB 4R50A 3R65A 2R9RB 1LUWA 4X9QA 2JRIA 4TOIA 5BR8B 3I55V 5IJ0A 2UXDO 4J9YB 4Z2WA 4RQFA 1N34B 4OGQB 4LCUC 2RQ6A 2ZIOA 5EIBC 4FM0A 4BW9A 4UVBA 4LNUB 2Y48A 4TV8A 1OZ0A 1K7DA 1XMQB 1G6UA 3ZN0A 4WFAV 5TISZ 3H9VA 3CHXA 4JAAA 2ZT9B 3AEIA 4X89A 1H2KA 1Y66A 2YIAA 5IY5C 2QKSA 5EBLC 4LF6O 1AVMA 3CRQA 5LGNA 4FVMA 5H6QA 4I4TA 2IJKA 3OGCC 2BOCC 5GTHZ 1TUBB 4B3TB 5KLVH 1A32A 3ZMUA 3RWRD 5BY1A 4LNUA 2X0LA 2GDSA 4JI7O 1VQ9V 3UCSC 3HKEB 4LFCB 5C93A 1K4DC 2YI8A 2F66C 1OCOC 1YITV 4FLYA 1Q7YW 2XUMA 1R3IC 3SYPA 3WG7C 1JJOA 1E79G 2EILB 1KP3A 3EXAA 4O4LB 4DO2A 4X62B 4UVCA 5GTIZ 4OPHA 2HKOA 3HB3B 1YJ9V 2E3CA 3SDLA 2Z5UA 2B1GA 4DR5B 4J10A 1R3KC 1TUBA 1P7GA 1JX9A 4GT1A 4JYAB 2OCCC 2VQFB 3K0DA 1GN6A 4JI0B 4PA3A 1H2SB 1VQNV 3BY6A 3D3QA 5HFLA 2BTOA 3ABUA 4DUYB 3N2KA 1NS1A 4JTDB 5C8YB 3G67A 4XDKA 3AG3C 5HFMA 2OIEA 4O4LA 1HP8A 5B3SC 1QR8A 3DTUB 4GLXA 2Y0IA 1YDXA 4Z1MG 2EIJB 5DEDA 1WPXA 4FM2A 1I08A 2P4KA 3M99B 3UT5B 5AG2A 4GYCB 4I50B 3SJAC 3UQ8A 4JZGA 4CBCA 1U96A 3B77A 4BIUA 2RDCA 3K04A 2AW9A 4LF8O 4CZZA 1AI4A 2B9ZA 3OEEG 1VARA 3RVYA 2QM8A 3KG2A 1GN4A 1HWYA 1M4UA 2XHBA 2F23A 3ETEA 2V7QG 2Y4UA 1URFA 2YIBD 2JJ1G 1SRYA 4I55A 3OM3B 1W59A 2FMLA 3E22B 4X1YB 4XDJA 2OWOA 2DMXA 4X88A 3FAVA 3ABMB 3JAKB 1OJHA 3UM7A 3SYCA 1Q6HA 4I50A 1P49A 1M1KW 1R73A 3X2QB 1V54C 3CPWU 2GBOA 2ZDIC 2MK3A 4EB6A 1NTMH 1DF5A 3ZHRA 3I56V 3GWKC 4F6RB 2OYQA 4F4LA 2QTOA 2QKCA 3ZRSA 2RN9A 3AK1A 4NTYA 3JALB 3ASOC 2HR3A 4GKKB 2ADQB 1K97A 2V1DA 1N32B 1FS0G 2CK3G 4DW1A 1YF2A 1PNKA 4DV7O 2PI4A 2PY5A 2GV9A 4HBNA 1NU1H 4X1YA 4E4EA 2VS0A 2UXDB 1Y67A 1SESA 1SA0B 3JAKA 2LFSA 4PELA 5JCOC 3AG4C 2RJZA 3JATB 4PA6A 2YC0A 1AR1B 5LL6Y 2Y4TA 5BMVB 3AG2C 3M8AA 4X1KB 4ASUG 1COWG 2Y0PA 2D3OW 2CDYA 4X1IB 5J2TB 1KYOF 2PTMA 4PDMA 5H2FZ 2KQXA 1Y6XA 3JALA 1XBLA 3FX7A 4O4IB 2H8PC 3CC4V 3CRMA 2HJDA 2QWQB 1IURA 4LF6B 4AHCA 3HKBB 1OV9A 4ZIBA 5B66Z 1O9GA 2DJVA 3QO7A 4QGPA 1L8DA 1SA0A 2UXXA 5CB4A 3QG5A 4IYIA 3K5NA 3JATA 2UUCO 2Z3YA 4JI2O 2FYUH 1Q82W 1YSCA 2WWWA 2AZ2A 2ILMA 4X1KA 4B7EA 4JI7B 4JYCA 4JI8O 4X1IA 5LYJA 2E74B 4GKJO 3BA8A 3QO5A 1N36O 1ZX3A 1SQBH 4WFBV 4B08A 4OX9B 4J42A 3CC2V 3JASB 4X64O 1GN3A 3K57A 3DSQA 3CCSV 3QTCA 4O4IA 4QIWF 3QF7A 4GX2A 3STZC 3GWOA 1VIBA 4FK5C 4O4JB 4GZRB 3ETGA 5KA6A 1XQ8A 3K08A 3E35A 3JAMN 2WAMA 3OE7G 4NYKA 2IH1C 2VWJA 2ZR3A 3TXSA 5LXTB 1H38A 2CH7B 5IYDO 1S76D 1S72V 1KU9A 5EZYB 3DGEA 3J7AU 1MNGA 1VQPV 3SJBC 2YIDA 3RVZA 2QSAA 4JI5O 3DC5A 2QM4A 4IHJB 1L0LH 2EX3A 3EFFK 3SGIA 3K58A 1KD1W 4BR6A 2OIGA 1LR1A 1WAZA 4P9OA 3F5TA 2IH3C 2VWKA 2ITDC 2R9AA 4EFBA 4LF9O 3JASA 3OTFA 1AR5A 1D5AA 4MW8A 4NTWA 1QLNA 4DV2B 3M7MX 1NR7A 1BT8A 4O4JA 4ZBMA 1KC8W 4J80A 1I5YA 4DR6O 4J9ZB 2YI9A 3ASNB 2P7TC 2X6CA 3Q4HB 1I0HA 1PL0A 5LXTA 2CH7A 1XEQA 2V4DA 1FKAO 2N04A 3L71H 5IYCO 3LNNA 4IHJA 1RFYA 2DYRB 4LF8B 2WLNA 1L0NH 1HW7A 2WLLB 2YXHA 2Q5ZA 3RYCB 5K1PA 1OCCC 2NNUA 4WBNA 2W0FC 1JCHA 1XOUA 3L9DA 1GM7A 1NJIW 3GB7C 3FD9A 4I5SA 2JJ2G 3Q4HA 3LDCA 4JI1O 5B1AB 5GONB 1QU7A 3C3TA 3LSSA 3TGUH 2CE4A 1S0VA 4FLXA 3ZS8C 3IJ4A 2B5UA 2UXCO 1MOFA 5EIBD 4MTOA 3CXHF 1I7FA 3U0ZA 1G4YB 3LDDA 1XL4A 2JDIG 2P6JA 5LP6B 5H9CA 2WLLA 2GTSA 3HPLC 5KHKA 1V9PA 2QEXV 3JCUZ 3K06A 4OXSA 4TQDA 3RYCA 1D2DA 1EN5A 1JQ0A 5D5QA 3S3XA 3IC9A 4FPPA 3QVNA 1M57C 4DV7B 1K9MW 1GM9A 3OMAB 2YXYA 4AILC 5GONA 3ZMSA 1ZTEA 5L3CA 1Q81W 1ENVA 2DYSB 3CCQV 3P3PA 1XREA 4PD4F 3THOA 4F6EA 4FM1A 4O2AB 3W7WA 4A5UB 3SPHA 1PL4A 1EZJA 4UCTA 4H33A 5LP6A 3ZHVA 1R1BA 5D5PA 3ZMTA 1AP6A 1RM1B 3CRRA 4TT3G 2ZXWC 1XMOO 2P22C 3ZMVA 1PNLA 1R6TA 2IJJA 2R72A 3KCYA 1N0JA 3CEIA 3CCRV 3L70H 3JSLA 1IXMA 3SYQA 2ZNJA 3UO2A 5IT9N 2F1MA 1VQ6V 3TXQA 3E8BA 4G2KA 1RPOA 2JVDA 4DV6O 4G27B 4BW5A 5IYZB 1P84F 2XNDG 2UUCB 4O2AA 1FJGO 4JI2B 1JVMA 1UFIA 2ZD9A 1B06A 3ZN1A 4MVOA 4JI8B 1Q43A 1T5EA 1N36B 2ZNIA 2E75B 4X64B 3ZRWB 3A8TA 4JTAB 4X20B 4LFAO 3DC6A 4ZI7B 2XAJA 2G38A 1FXKC 3CYOA 3WG7B 1GMGA 3ABLB 1BQZA 4ZOLA 3ZMZA 1Y74B 2PF4E 4TV8B 4TUYB 4JI5B 3JAWB 1XNQO 1KECA 2IU0A 2OCCB 3AK2A 4CC6A 4LF9B 3ZRWA 2NLJC 4YXWG 4JAVA 3H1IH 4I4TB 3KZIZ 2Y69C 4X20A 4MTGA 4ZI7A 2WLJA 1Q90D 1WNSA 3AG3B 2ATKC 1JMKC 4DR6B 1N8RW 1BHBA 2ZE8A 1OCZC 5A9GA 3RW0A 1YJNV 3OTOO 1CPYA 1Y74A 2ODMA 2FTKA 4DR4O 1OCRC 3I5DA 4GCZA 2HVJC 3W7XA 2FKXA 4TUYA 1HNZO 3JAWA 1J95A 2Q8VA 4KUMA 2N05A 2YDEA 1K34A 1CEZA
chains in the Genus database with same CATH topology
1WLEA 1M57B 5H6RA 1MABG 4KFMA 4MSWC 5B1OA 1ZWIC 2HFEC 3WFVA 3CCVV 1SERA 1QLEC 2JJ1G 1NR1A 3LDEA 1SRYA 4MVQA 3G71V 3OM3B 3VBBA 4RQEA 2X6AA 3JD1A 4BIZA 4R6ZA 4MW3A 4XDJA 3SPJA 3SPGA 4U7OA 1YTFD 1BL8A 4MT8A 4X88A 3ABMB 1P4RA 3UM7A 4E2LA 3SYCA 1M1KW 1R73A 3OR6C 2ZQMA 1PNMA 3CCLV 3X2QB 1V54C 2LFRA 5IY5B 3CPWU 3ZCCA 2ZDIC 3ASNC 2MK3A 5CBFA 1H2GA 1NKDA 2P67A 2ZXWB 4PDVA 4MTFA 5LBQA 1DF5A 3I56V 1THZA 3OAAG 1AJPA 1VQ7V 3IGAC 4QPJA 4F4LA 2QTOA 1F4NA 4DXWA 3ZRSA 1FXHA 1BHAA 2DYRC 3A0RA 2HR3A 3ASOC 3K3WA 1K97A 2V1DA 2IJIA 3SYAA 1FS0G 2CK3G 2DWDC 3OR7C 3SPIA 2YSUB 2HVKC 2PI4A 1PNKA 3P30A 2A9HA 1CP9A 4JASA 4MVZA 3ZJZA 5KUKA 4G28B 1SESA 3E86A 3K03A 2LFSA 4PELA 2WLHA 3BEHA 1KKDA 2GSMB 5CA3A 2C2AA 1XL6A 1OCOB 3AG4C 1GKFA 4FJCC 4PA6A 2AHZA 1AR1B 5LGUA 1FFTB 2WPDG 5KUMA 4XDLA 3FYIB 2M7WA 1M9NA 3AG2C 1FXVA 5B1AC 4MVRA 4ASUG 1COWG 1LNQA 2D3OW 3MHHC 1EFRG 4PDMA 4GX5A 3QO8A 1L1FA 3ABKB 3MHSC 4PA7A 3K79A 5L3BA 2H8PC 3CC4V 1FXKB 2QM7A 2EZPA 2XOKG 4RO2A 4JF3A 4MVSA 4UVAA 2HJFC 1K5SA 3AG2B 1QR9A 3QO7A 4L87A 1NBMG 3K0GA 2EIKB 2UXXA 3ETDA 3NXSA 1UJWB 4HZ3A 5LHGA 4PDRA 2A0LA 1S5HC 3OEHG 4X8AA 2Z3YA 1QVFU 5B1BB 4UXNA 3CP1A 1KP2A 2EZOA 2QA4V 1YSCA 5EBWC 2KB1A 1Q82W 2WWWA 2OTLV 1W0JG 2EBOA 1QCEA 2QE7G 5B3SB 1QVGU 1M56B 1QBZA 4EKWA 4JYCA 3IC7A 3H01A 2YEVB 3G6EV 3QO5A 3CCJV 1PD3A 1GTOA 5B1NA 1Q86W 4WFBV 3B8NA 5CBHA 3CMEV 3CC2V 2JEXA 2JEUA 2XAHA 3CCSV 2Y69B 4QIWF 1E1QG 1V55B 2XAFA 4GX2A 2EINB 1F51A 3GWOA 3STZC 1RM1C 4FK5C 3OMIB 4WFEA 1K33A 3ETGA 1OCZB 3FB6C 5KA6A 4HYOA 1Y4MA 4JAUA 4FMTA 3K08A 3E35A 4JTCB 5KA5A 3W7SA 2WAMA 3OE7G 1OCRB 3E2EA 2IH1C 2ZR3A 1AROP 3G4SV 2DQ3A 1AI5A 4R8CA 1H38A 5IYDO 1S76D 1S72V 2ZR2A 3CCEV 3DGEA 5CBGA 1VQPV 1R3JC 3B8MA 5EC1C 3RVZA 3EHBB 2XASA 5IYBO 1JOYA 4UUJC 2Q69A 2P90A 2Q6AA 4U7NA 2LP7A 5CMUA 3EFFK 4ZKIA 1KD1W 2YEVA 3TK1A 3JD0A 4R7CA 1QLEB 4P9OA 1KQSU 2IH3C 3FKSG 2B1IA 2WLMA 2W6JG 2ITDC 1P7BA 1R3LC 4MW8A 4WF9V 3LUTB 4FIPC 3OFNG 5LHHA 1QLNA 1NR7A 4WFHA 1VQOV 4MTXA 4ZBMA 3T2MA 1KC8W 1K8AW 3CMAV 4QE7A 1V54B 4PA4A 1I5YA 1RPRA 4J9ZB 4MVMA 3ASNB 3LNMB 3AG1C 2P7TC 2X6CA 4BAYA 1PL0A 1DLBA 1NQTA 3MD0A 1R6KA 4UV8A 5J9PC 1BMFG 5EBMC 1MSWD 1YHQV 3SJQC 2JIZG 3E83A 1AJNA 4H37A 5IYCO 1AI6A 1K92A 3ABLC 1YTFB 3JYCA 2DYRB 3ASOB 1MG1A 2WLNA 3ZIAG 4P30A 2IU3A 4MVUA 2WLLB 1G8MA 3ML0A 3CD6V 1AI7A 2Q68A 3PJSK 4MS2A 3JD2A 4JYBA 4KP4A 1OCCC 2NNUA 2EIMC 4XBFA 3P32A 1DF4A 1SZTA 3SPCA 1GK9A 2OT5A 2W0FC 1JCHA 3AG4B 3F5WC 3JD3A 1GM7A 1NJIW 3GB7C 5L3DA 2OTJV 5DN6G 2ZDIA 2X6BA 4I5SA 1F23A 2JJ2G 3LDCA 2BOBC 2DQ0A 5B1AB 4PA9A 2EIJC 5FL7G 3LSSA 2AHYA 1NH2D 5L3GA 1M90W 5E1AC 1S0VA 2ITCC 5GW7A 2HLDG 3OMNB 2B5UA 3RBZA 1MOFA 3F7VC 4MTOA 3QNEA 1G4YB 2IW5A 3LDDA 1YJWV 1XL4A 2JDIG 2P6JA 1W2BU 3OUFA 4WCEV 5H9CA 2WLLA 3HPLC 1DTOA 2DYSC 2QEXV 3FYEB 3K06A 4OXSA 4R50A 2GHYA 3R65A 2R9RB 4TWKA 1CEZA 1JQ0A 3I55V 1VQ5V 2WSSG 2DWEC 3W7TA 4FPPA 4J9YB 3ZRVA 1I5XA 4RQFA 1M57C 3W7UA 4LCUC 3D36A 1K9MW 3OW2U 1K5QA 4LC1A 1GM9A 1H8EG 3OMAB 4UVBA 3ZMSA 2Y48A 1OZ0A 5L3CA 3D3IA 1Q81W 1ENVA 2DYSB 3CCQV 2UXNA 4N21A 1K7DA 3T4DA 3ZN0A 3ABMC 3F7YC 3W7WA 4WFAV 1NH2B 1B6QA 3AEIA 2A79B 1Y66A 2JK5C 2R9IA 4X89A 2F43G 3SPHA 3X2QC 4RUFA 5DM6V 1EZJA 5IY5C 4H33A 2QKSA 3ZMTA 5EBLC 1RM1B 4TT3G 2ZXWC 3ZMVA 1PNLA 1H8HG 4QE9A 4RAIA 5LGNA 1E1RG 2IJJA 5H6QA 2XAGA 2WLIB 2IJKA 3OGCC 1F4MA 1ROPA 4LP8A 3CCRV 2BOCC 4WFFA 2IJHA 1IXMA 2Q67A 2EILC 3SYQA 1VQMV 2HG5C 1ORQC 4TSFG 3ZRXA 3CC7V 4JGSA 3ZMUA 3JD4A 2WLKA 4I9WA 1VQ8V 3OUSA 1VQKV 1VQ6V 3FB7C 3E8BA 4G2KA 5L3FA 1RPOA 2X7RB 5EC2C 4P2ZA 2X0LA 1VQ9V 4G27B 4BW5A 3VOUA 2PI5A 2XNDG 5C93A 1K4DC 1OCOC 1YITV 2XAQA 1JVMA 1S77D 1JJ2U 2ZD9A 1Q7YW 3WG7C 1R3IC 3SYPA 3ABTA 3ZN1A 1E79G 2EILB 4PDLA 1KP3A 4MVOA 4DO2A 3TETA 1YIJV 4UVCA 1W0KG 3FB8C 1EBOA 2HKOA 3K9AA 2WLIA 3HB3B 1YJ9V 3AG1B 4Q20A 2Z5UA 2B1GA 3ABKC 1JPXA 3ZRWB 1K73W 4QNHB 3E8HA 5BZBA 3LSQA 1R3KC 1YI2V 3E89A 1JX9A 4GT1A 4JTAB 2OCCC 3K0DA 5LHIA 2XAJA 3CYOA 1FXKC 4GX1A 1TUEB 3WG7B 1GMGA 4PA3A 3ABLB 2EJRA 3ZMZA 1VQNV 3BY6A 5CN0A 5HFLA 1GO3F 3ABUA 1NVPD 2EIKC 4JTDB 3E8FA 1VQ4V 3STLC 1OCCB 4N23A 2EIMB 5B1BC 1PKXA 4XDKA 3AG3C 5HFMA 1KECA 5EK0A 2IU0A 1OHHG 2DW4A 3FB5C 2OCCB 3E8GA 5L3EA 5B3SC 1M56C 3CCMV 4UV9A 4GX0A 1QR8A 4P9PA 3DTUB 1AJQA 3UKMA 4Z1MG 3ZRWA 2EIJB 2NLJC 3SYOA 4YXWG 1WPXA 3T1CA 4JAVA 5IDJA 3CCUV 2Y69C 3M99B 5LGTA 1V55C 1S3JA 2EINC 4MTGA 2WLJA 4QPKA 3AG3B 2ATKC 4JPRA 1GM8A 1N8RW 1BHBA 1OCZC 3RW0A 1YJNV 1CPYA 4CBCA 3B77A 3CXCU 1R6NA 4BIUA 2FTKA 1K3EA 3K04A 1OCRC 4HAMA 4CZZA 1AI4A 3OEEG 3JCZA 1K4CC 4GCZA 1SETA 4RUEA 2HVJC 3W7XA 3RVYA 2W6IG 2K1EA 2QM8A 3KG2A 1HWYA 3TCUA 1J95A 3T4ZA 1NVPB 2H94A 4KUMA 4LBEC 3IFXA 4WFGA 1K34A 3ETEA 4QJFB 1VQLV 2V7QG 1FXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 V;  1QVF U;  1KD1 W;  1Q82 W;  2QA4 V;  2OTL V;  1K9M W;  1VQ9 V;  3OW2 U;  1N8R W;  3CCV V;  1K73 W;  1YJN V;  1KQS U;  1YI2 V;  1YJW V;  3G71 V;  3I56 V;  3CXC U;  1YHQ V;  1YIT V;  3CC4 V;  1W2B U;  1QVG U;  4WCE V;  3CCM V;  1VQ7 V;  1Q81 W;  3CCQ V;  1NJI W;  3G4S V;  1JJ2 U;  4WF9 V;  1Q7Y W;  3G6E V;  2QEX V;  2OTJ V;  3CCR V;  3CC2 V;  1VQN V;  1S72 V;  3CCJ V;  1Q86 W;  3CCE V;  4WFB V;  4WFA V;  1VQO V;  1VQM V;  3CC7 V;  1KC8 W;  1K8A W;  3CME V;  3CMA V;  1R73 A;  1YIJ V;  1VQP V;  1M1K W;  3I55 V;  3CCL V;  2D3O W;  1M90 W;  1VQ5 V;  5DM6 V;  3CD6 V;  3CCS V;  3CCU V;  1VQ8 V;  3CPW U;  1VQK V;  1VQ6 V;  1VQ4 V;  1VQL V; 
#chains in the Genus database with same CATH topology
 5H6R A;  3WFV A;  3CCV V;  4MVQ A;  2VQE O;  1NR1 A;  1PP9 H;  3SJC C;  4RQE A;  2ADP A;  4NTX A;  3CWB H;  1YZB A;  1AR4 A;  1BL8 A;  4D7T A;  2PYL A;  1VMG A;  3OR6 C;  2ZQM A;  1PNM A;  2Q0O C;  1J5E O;  4JI1 B;  3ZCC A;  3BAB A;  1WN7 A;  4LH6 A;  1H2G A;  2P67 A;  4UCV A;  4FLT A;  4PDV A;  4MTF A;  3N2K B;  5LBQ A;  4UCS A;  2UXC B;  2CGN A;  1THZ A;  1SS3 A;  1AJP A;  1VQ7 V;  4QPJ A;  4IIJ B;  4OX9 O;  1D5N A;  4CS4 A;  4DRX B;  3K3W A;  4JI3 O;  2IJI A;  3SYA A;  3NR7 A;  3SPI A;  4L8J A;  4AQY O;  1S5J A;  4JAS A;  4MVZ A;  3ZJZ A;  3K03 A;  4UCO A;  1KKD A;  1NTK H;  4XDL A;  5KUM A;  3FYI B;  1M9N A;  2A3Q A;  1PPJ H;  1WP7 A;  2KG7 A;  3L75 H;  1EFR G;  2HEP A;  1HNW O;  4GX5 A;  3ABK B;  1WPB A;  4IIJ A;  2DE0 X;  4DRX A;  4FLV A;  3R66 A;  1IBL O;  2LGQ A;  5JJN B;  5L3B A;  5JVD B;  1HDJ A;  4W4K A;  4DV2 O;  1XMO B;  2EZP A;  4JF3 A;  1FFX B;  2HJF C;  3AG2 B;  1F7Y A;  4L87 A;  2VRZ A;  5IJ9 B;  4ABM A;  2QWR B;  4I55 B;  3K0G A;  4D7S A;  2EIK B;  1UJW B;  4HZ3 A;  2LW7 A;  4IT5 A;  3OEH G;  1EZV H;  3FAV B;  4UXN A;  5B1B B;  2OTL V;  2EZO A;  2QA4 V;  2QE7 G;  4DV6 B;  1M56 B;  1U97 A;  2YIC A;  3H01 A;  2KSD A;  3G6E V;  4EB6 B;  1FJG B;  3RGB A;  3D8C A;  1PD3 A;  5B1N A;  4IYH A;  4PI2 A;  1HR0 B;  1NT2 B;  5JVD A;  1V55 B;  2XAF A;  2EIN B;  3U10 A;  1GH6 A;  1K33 A;  1FFX A;  3FB6 C;  2DN9 A;  5LMU O;  5IJ9 A;  1Z5V A;  4K8Z A;  1ARO P;  3C3S A;  2ZKO A;  1ZAU A;  2ZR2 A;  3CCE V;  4LFA B;  5FPO A;  1R3J C;  3B8M A;  1M5I A;  1JOY A;  2YS8 A;  2P90 A;  2Q6A A;  2LP7 A;  2XT9 A;  1SZX A;  1BS3 A;  3ETQ A;  1QLE B;  1KQS U;  4DR7 O;  5KHG A;  1Q3E A;  2AGA A;  1FYJ A;  2WLM A;  3T1H O;  4NKG B;  1XNQ B;  4UB8 Z;  1R3L C;  1MSD A;  5LA6 B;  3B09 A;  5LHH A;  4NXN O;  1XHZ A;  4WFH A;  1VQO V;  3CMA V;  3L73 H;  1TVK B;  4MVM A;  1KMI Z;  2QKA A;  4BAY A;  2LW1 A;  4ICG A;  5J9P C;  3RYF B;  1BMF G;  4IGG A;  1MZF A;  1XIL A;  1MSW D;  2MW2 B;  5CB4 B;  4JI6 O;  4FLW A;  2R70 A;  3FFQ A;  4RWU A;  4CH3 A;  2JIZ G;  3EVK A;  3OTO B;  2WA4 A;  1AI6 A;  3JYC A;  4DR4 B;  2ZIM A;  3H1H H;  4P30 A;  2IU3 A;  4MVU A;  3O9O A;  3CD6 V;  3PJS K;  1HNZ B;  4AI8 A;  5LYJ B;  1XNR O;  4XBF A;  4DR3 O;  1KB9 F;  5LA6 A;  3SPC A;  1GK9 A;  5A2Q N;  2CTP A;  1US6 A;  2VQE B;  1TVK A;  1EN6 A;  2IM9 A;  3H1J H;  2BOB C;  1Y76 B;  2BTQ B;  2YIB A;  4PA9 A;  1O9H A;  2EIJ C;  3RYF A;  1WJZ A;  1UPG A;  2BCC H;  3ZED A;  4LF5 O;  1J5E B;  1JFF A;  2P5O A;  1NI8 A;  3OUF A;  2O57 A;  3FYE B;  1Q8I A;  1ZL8 A;  4TV9 B;  4TWK A;  4D6T H;  3W7T A;  4JI3 B;  4PI0 A;  5KX5 B;  3ZRV A;  2AXT Z;  1S5L Z;  3W7U A;  3D36 A;  4AQY B;  3OW2 U;  1K5Q A;  4BIO A;  1H8E G;  1RSO B;  1Y76 A;  2BTQ A;  5F2V O;  4N21 A;  1BGY H;  3ABM C;  3F7Y C;  4PV1 B;  3J81 N;  2A79 B;  3X2Q C;  2F43 G;  5DM6 V;  4RUF A;  2XTA A;  3APQ A;  4YY3 O;  2L35 A;  1PM9 A;  3BHP A;  2Z0A A;  1HNW B;  3VQY A;  4QE9 A;  4TV9 A;  1IBK O;  4U3J B;  1F4M A;  1ROP A;  1IBL B;  3ZHQ A;  5KX5 A;  1KBH A;  2Q67 A;  4WBN B;  4EFE A;  4LFB O;  1VQM V;  1ORQ C;  3CC7 V;  3K5M A;  4DV0 O;  2Q7G A;  2JGD B;  2WLK A;  1RSO A;  5L3F A;  2X7R B;  2WA3 A;  4P2Z A;  3VOU A;  2PI5 A;  1XI1 A;  3CE2 A;  3H1K H;  4K0K O;  1H2M A;  4UB6 Z;  2YUA A;  1S77 D;  4YJ3 A;  2LJ2 A;  4X65 O;  2PGG A;  4PDL A;  1YIJ V;  3FB8 C;  1EBO A;  2RMK B;  2AZ0 A;  3B4S A;  3AG1 B;  4Q20 A;  4U3J A;  3APO A;  1JPX A;  4CH5 A;  1K73 W;  2LO1 A;  3E8H A;  5BZB A;  3G6B A;  4TQF A;  5J2U A;  1SC5 B;  5LHI A;  2JGD A;  4GX1 A;  3AK3 A;  5LMU B;  3T1Y O;  3CB2 A;  5CN0 A;  2QDO A;  4LF7 O;  1NVP D;  3OGI B;  3HKC B;  3E8F A;  2Q7E A;  3STL C;  3OT7 A;  2EIM B;  1PKX A;  4FZ1 A;  5JQG A;  5KMG B;  3ZHU A;  1OHH G;  3FB5 C;  3E8G A;  5L3E A;  3WB1 A;  4H44 B;  1VF5 B;  3CCM V;  4UV9 A;  4GX0 A;  4P9P A;  4DR7 B;  4K8X A;  4UCU A;  1IXB A;  3T1H B;  1AJQ A;  3UKM A;  5IE9 A;  2UXB O;  4NXN B;  4EEQ A;  5IDJ A;  2CAZ C;  3LSU A;  5LGT A;  3ZHS A;  1S3J A;  4JV5 O;  3GVM A;  3CXC U;  1R6N A;  2ZCE A;  4HAM A;  1SQP H;  4JI6 B;  1K4C C;  3HKC A;  3A0B Z;  4RUE A;  2E5L O;  3TCU A;  3K59 A;  3T4Z A;  5KMG A;  1NVP B;  4LBE C;  5B5E Z;  3IFX A;  4QJF B;  5EYP A;  1FXK A;  1WLE A;  5KHH A;  1MAB G;  2IBZ H;  4MSW C;  4DR1 O;  1ZWI C;  2HFE C;  1NZ6 A;  1SER A;  3AG7 A;  3LDE A;  1XNR B;  4O2B B;  3G71 V;  2PZS A;  3JD1 A;  4BIZ A;  4DR3 B;  1EM1 A;  3SPJ A;  3SPG A;  4U7O A;  1YTF D;  2Q4P A;  3PN1 A;  4LR3 A;  3OD4 A;  3CCL V;  1VF6 A;  5IY5 B;  1IX9 A;  1BQ0 A;  3ASN C;  4ZOL B;  1DGS A;  3P3N A;  2QGN A;  4PJ0 Z;  1GRJ A;  4LF5 B;  4DK1 A;  4B3R O;  4Q6G A;  3JSN A;  1I94 B;  5JH7 B;  1X59 A;  2M6Y A;  2DYR C;  3A0R A;  4B3S O;  1WB8 A;  1HR0 O;  2KKW A;  2YSU B;  2HVK C;  4O2B A;  2LGW A;  2A9H A;  1CP9 A;  1YVW A;  1QHT A;  1WA8 B;  5ITZ B;  2WLH A;  3BEH A;  2C2A A;  1XL6 A;  1OCO B;  3KKY A;  1GKF A;  4NR1 A;  2AHZ A;  5LGU A;  1FD9 A;  3CX5 F;  5FLX N;  5KAI Z;  1FXV A;  1IDS A;  3O65 A;  5B1A C;  4MVR A;  1WB7 A;  2F4V O;  1RP3 B;  3MHH C;  3QO8 A;  3ZBH A;  2UUB O;  3VQX A;  5JH7 A;  4X66 O;  3VQW A;  4PA7 A;  4YY3 B;  4CH4 A;  4JZ2 A;  5LP6 C;  5FNV A;  2QM7 A;  2ZIN A;  4FZ0 A;  4MVS A;  4UVA A;  1K5S A;  1IBK B;  1QR9 A;  2GTA A;  5KHJ A;  1NBM G;  1WA8 A;  2A06 H;  3ETD A;  5ITZ A;  2QJ1 A;  5LHG A;  4LFB B;  2ZE5 A;  4FLZ A;  1S5H C;  1QVF U;  4DV0 B;  3CP1 A;  1KP2 A;  5EBW C;  2K9P A;  1BZK A;  1W0J G;  2EBO A;  3BA9 A;  5B3S B;  3ICX A;  1QVG U;  4EKW A;  3A0H Z;  1MZE A;  2YEV B;  2E76 B;  4LF4 B;  4K0K B;  5KHI A;  1NTZ H;  1Q86 W;  1GTO A;  3B8N A;  5CBH A;  3KCX A;  4X65 B;  2ZE6 A;  2JEX A;  4ZHQ A;  1Q5O A;  3BFR A;  1RM1 C;  4JAU A;  4JTC B;  3W7S A;  4DV1 B;  3K5O A;  4DV3 O;  3WB0 A;  2F93 B;  4PHZ A;  3G4S V;  1AI5 A;  4UCR A;  3T1Y B;  5EC1 C;  5IYB O;  2XAS A;  4UUJ C;  2Q69 A;  4LF7 B;  3RYI B;  2YEV A;  3JD0 A;  4R7C A;  2KG7 B;  4U3F H;  2NR5 A;  1IVS A;  3LUT B;  4DUZ O;  4MTX A;  3T2M A;  2PUS A;  1AB3 A;  1V54 B;  2EUL A;  1IBM O;  4B3M O;  2UXB B;  1NQT A;  3MD0 A;  1R6K A;  1TGO A;  5H5N A;  5EBM C;  4JV5 B;  1SQQ H;  3SJQ C;  3E83 A;  1AJN A;  1HNX O;  1K92 A;  3ABL C;  1Q6I A;  4J7Z A;  3RYI A;  3ASO B;  3RYH B;  1MG1 A;  3H1L H;  4LH7 A;  2UU9 O;  1G8M A;  3ML0 A;  4LWS B;  2E5L B;  1AI7 A;  2Q68 A;  2QWN B;  4JYB A;  4J7K A;  1DF4 A;  1SZT A;  2OT5 A;  3RN4 A;  3AG4 B;  3JD3 A;  4DR1 B;  1MA1 A;  1TA8 A;  5L3D A;  1B04 A;  4JI4 O;  2ZDI A;  2X6B A;  1KUQ A;  2DQ0 A;  5FPR A;  3HKE A;  3L72 H;  5FL7 G;  5LMN O;  1NH2 D;  5JJJ B;  2ITC C;  1FAF A;  2Q0A A;  2HLD G;  3RBZ A;  3RYH A;  1SQV H;  2IW5 A;  3BRC A;  2LQT A;  1W2B U;  4WCE V;  1WP8 A;  4FFK A;  4H13 B;  4LWS A;  3J80 N;  1DTO A;  1VF7 A;  1LUV A;  4K35 A;  4B3R B;  2GHY A;  4CS3 A;  4OPA A;  4J11 A;  1BCC H;  1VQ5 V;  2WSS G;  2DWE C;  5JJE B;  5JCO A;  4B3S B;  2CGO A;  1I5X A;  4KHP O;  2CTR A;  4LC1 A;  1SQF A;  1CXZ B;  1Z2G A;  4CH6 A;  3D3I A;  5C8Y A;  1N33 O;  2UXN A;  1BE3 H;  3T4D A;  5DEC A;  1SQG A;  1SKV A;  1NH2 B;  1B6Q A;  2JK5 C;  2R9I A;  2NN4 A;  2RCV A;  1TAE A;  4DV4 O;  2F4V B;  2P06 A;  3A2F A;  1H8H G;  4RAI A;  2UUB B;  1E1R G;  2BSK B;  2XAG A;  2WLI B;  1B3Q A;  4X66 B;  3UT5 A;  4LP8 A;  4WFF A;  2IJH A;  2EIL C;  4NXM O;  2HG5 C;  4TSF G;  3RT3 C;  3ZRX A;  5JWP A;  2UUA B;  4JGS A;  3JD4 A;  1YCI A;  4I9W A;  1VQ8 V;  3OUS A;  1VQK V;  3ZX6 A;  3FB7 C;  5K1X A;  5EC2 C;  4I7Z B;  1N0N A;  2XAQ A;  3UO3 A;  1JJ2 U;  3ABT A;  4I9Q A;  1JFF B;  3TET A;  1W0K G;  2QWO B;  4DV5 O;  2BSK A;  3K9A A;  2WLI A;  3HR0 A;  3E22 A;  4J7J A;  3ABK C;  4FFB B;  1ZL8 B;  4QNH B;  3LSQ A;  5E79 Z;  1YI2 V;  3E89 A;  1SF9 A;  1TUE B;  2EJR A;  2OCH A;  3VQV A;  4DV3 B;  1ZUQ A;  1GO3 F;  4O4H B;  4NVP A;  2FB5 A;  2EIK C;  4F6R A;  4H0L B;  2DOS A;  1VQ4 V;  1OCC B;  4N23 A;  5B1B C;  1GAX A;  5EK0 A;  2DW4 A;  1I94 O;  2JS3 A;  3HKD B;  1M56 C;  2P4V A;  5CA1 B;  4FFB A;  4DYL A;  3SYO A;  3T1C A;  4DUZ B;  2CTW A;  2RNB A;  3CCU V;  2N74 A;  1V55 C;  2EIN C;  1FPO A;  3C90 A;  4QPK A;  4JPR A;  1GM8 A;  4YHH O;  1IZ3 A;  5BMV A;  2W0X A;  1IBM B;  4O4H A;  4DW0 A;  4B3M B;  1K3E A;  5J2T A;  3CS5 A;  3JCZ A;  1SET A;  2W6I G;  2K1E A;  1HNX B;  2H94 A;  4WFG A;  3CJH B;  3HKD A;  4YJ3 B;  1VQL V;  2PYJ A;  4UFZ A;  1M57 B;  2JS5 A;  2ZM6 O;  3HKB A;  2UU9 B;  4KFM A;  5B1O A;  5CA1 A;  1QLE C;  3VBB A;  2X6A A;  3S3W A;  4R6Z A;  4MW3 A;  5LOV B;  1QQC A;  2L6L A;  1Q6U A;  4DR2 O;  4MT8 A;  1P4R A;  2GUZ B;  4E2L A;  1AP5 A;  2HHH O;  4JYY A;  4JI4 B;  5J2U B;  2LFR A;  3L74 H;  4GUN A;  3G80 A;  2Q9L A;  5CBF A;  5LMN B;  1NKD A;  2ZXW B;  1N4C A;  5IWA O;  4LF4 O;  3OAA G;  3ZHT A;  3IGA C;  2F95 B;  1SQX H;  5BR8 O;  1F4N A;  4DXW A;  3CJH A;  1FXH A;  1BHA A;  5JQG B;  4KXR A;  1EN4 A;  2DWD C;  3OR7 C;  1N34 O;  3P30 A;  5LOV A;  3B2E E;  1GN2 A;  4DV1 O;  5KUK A;  4G28 B;  1BSM A;  3E86 A;  5EZY A;  4J41 A;  2GUZ A;  3BVO A;  1XMQ O;  2GSM B;  5CA3 A;  4KHP B;  2CUG A;  4FJC C;  4I0X B;  1ZSP A;  1FFT B;  1XUQ A;  2WPD G;  3D36 C;  1VP7 A;  3CRC A;  2M7W A;  3WU2 Z;  3DXR B;  1N33 B;  5CA0 B;  1LNQ A;  4DK0 A;  1L1F A;  3WB2 A;  3MHS C;  4C7U A;  3K79 A;  1XHX A;  1YEW A;  2A7W A;  4DV4 B;  3BCC H;  4YJ2 B;  4B3T O;  2H3O A;  5EYP B;  1FXK B;  2XOK G;  4RO2 A;  3IAY A;  1H2N A;  3NXS A;  4PDR A;  2A0L A;  4LFC O;  4X8A A;  4NXM B;  4I0X A;  2KB1 A;  3DXR A;  5CA0 A;  1QCE A;  4KL1 A;  2QWP B;  1QBZ A;  3N27 A;  1VEW A;  2FL4 A;  3IC7 A;  4X62 O;  5BXZ A;  4CS2 A;  1JA8 A;  1YXB A;  3CCJ V;  3CME V;  4DR5 O;  2Q73 A;  2JEU A;  2XAH A;  2Y69 B;  4YJ2 A;  1E1Q G;  1F51 A;  2QR4 A;  4JYA O;  3OMI B;  4WFE A;  2VQF O;  2YXL A;  4DV5 B;  1KKC A;  1XDC A;  1OCZ B;  4B7K A;  2EJ7 A;  4HYO A;  1Y4M A;  4FMT A;  4JI0 O;  5KA5 A;  2HP8 A;  3SR2 C;  1OCR B;  3E2E A;  1PV0 A;  4K3A A;  2Q7H A;  2DQ3 A;  4R8C A;  4DUY O;  3B40 A;  3TJT A;  4FLU A;  5CBG A;  4BWA A;  3EHB B;  1H2L A;  4U7N A;  5CMU A;  3N2G B;  4ZKI A;  3TK1 A;  2QTS A;  3FKS G;  1X4T A;  2B1I A;  2D2C B;  2W6J G;  4IL6 Z;  1P7B A;  3MAQ A;  4WF9 V;  4FIP C;  3OFN G;  4HNA B;  2JGU A;  1K8A W;  4QE7 A;  3U11 A;  2BE3 A;  3RFR A;  4PA4 A;  5FNV B;  1RPR A;  1Z5W A;  4NB5 A;  2CTQ A;  3BAA A;  4YIP A;  3LNM B;  3AG1 C;  1DLB A;  4UV8 A;  4Z1V A;  2ETN A;  3K9S A;  3JAR B;  1YHQ V;  1G1X B;  4YHH B;  4H37 A;  1YTF B;  2ARH A;  3N2G A;  4CC5 A;  1AIL A;  3ZIA G;  4GKJ B;  4YIO A;  4MS2 A;  3JD2 A;  1QNM A;  3CSX A;  4KP4 A;  1M93 A;  2EIM C;  3P32 A;  5IJ0 B;  4HNA A;  2ZM6 B;  5KAF Z;  3CRA A;  3F5W C;  4ZHQ B;  3BPZ A;  1ZLZ A;  2OTJ V;  5DN6 G;  2UUA O;  1F23 A;  3K5L A;  5IYZ A;  2AHY A;  4DR2 B;  5L3G A;  1M90 W;  5E1A C;  3JAR A;  1MMM A;  2HHH B;  5GW7 A;  3OMN B;  3F7V C;  3QNE A;  1JR9 A;  1YJW V;  1VF6 C;  3MDS A;  1DK1 A;  4W4L A;  4GKK O;  1N32 O;  2DYS C;  2ZE7 A;  5IWA B;  4R50 A;  3R65 A;  2R9R B;  1LUW A;  4X9Q A;  2JRI A;  4TOI A;  5BR8 B;  3I55 V;  5IJ0 A;  2UXD O;  4J9Y B;  4Z2W A;  4RQF A;  1N34 B;  4OGQ B;  4LCU C;  2RQ6 A;  2ZIO A;  5EIB C;  4FM0 A;  4BW9 A;  4UVB A;  4LNU B;  2Y48 A;  4TV8 A;  1OZ0 A;  1K7D A;  1XMQ B;  1G6U A;  3ZN0 A;  4WFA V;  5TIS Z;  3H9V A;  3CHX A;  4JAA A;  2ZT9 B;  3AEI A;  4X89 A;  1H2K A;  1Y66 A;  2YIA A;  5IY5 C;  2QKS A;  5EBL C;  4LF6 O;  1AVM A;  3CRQ A;  5LGN A;  4FVM A;  5H6Q A;  4I4T A;  2IJK A;  3OGC C;  2BOC C;  5GTH Z;  1TUB B;  4B3T B;  5KLV H;  1A32 A;  3ZMU A;  3RWR D;  5BY1 A;  4LNU A;  2X0L A;  2GDS A;  4JI7 O;  1VQ9 V;  3UCS C;  3HKE B;  4LFC B;  5C93 A;  1K4D C;  2YI8 A;  2F66 C;  1OCO C;  1YIT V;  4FLY A;  1Q7Y W;  2XUM A;  1R3I C;  3SYP A;  3WG7 C;  1JJO A;  1E79 G;  2EIL B;  1KP3 A;  3EXA A;  4O4L B;  4DO2 A;  4X62 B;  4UVC A;  5GTI Z;  4OPH A;  2HKO A;  3HB3 B;  1YJ9 V;  2E3C A;  3SDL A;  2Z5U A;  2B1G A;  4DR5 B;  4J10 A;  1R3K C;  1TUB A;  1P7G A;  1JX9 A;  4GT1 A;  4JYA B;  2OCC C;  2VQF B;  3K0D A;  1GN6 A;  4JI0 B;  4PA3 A;  1H2S B;  1VQN V;  3BY6 A;  3D3Q A;  5HFL A;  2BTO A;  3ABU A;  4DUY B;  3N2K A;  1NS1 A;  4JTD B;  5C8Y B;  3G67 A;  4XDK A;  3AG3 C;  5HFM A;  2OIE A;  4O4L A;  1HP8 A;  5B3S C;  1QR8 A;  3DTU B;  4GLX A;  2Y0I A;  1YDX A;  4Z1M G;  2EIJ B;  5DED A;  1WPX A;  4FM2 A;  1I08 A;  2P4K A;  3M99 B;  3UT5 B;  5AG2 A;  4GYC B;  4I50 B;  3SJA C;  3UQ8 A;  4JZG A;  4CBC A;  1U96 A;  3B77 A;  4BIU A;  2RDC A;  3K04 A;  2AW9 A;  4LF8 O;  4CZZ A;  1AI4 A;  2B9Z A;  3OEE G;  1VAR A;  3RVY A;  2QM8 A;  3KG2 A;  1GN4 A;  1HWY A;  1M4U A;  2XHB A;  2F23 A;  3ETE A;  2V7Q G;  2Y4U A;  1URF A;  2YIB D;  2JJ1 G;  1SRY A;  4I55 A;  3OM3 B;  1W59 A;  2FML A;  3E22 B;  4X1Y B;  4XDJ A;  2OWO A;  2DMX A;  4X88 A;  3FAV A;  3ABM B;  3JAK B;  1OJH A;  3UM7 A;  3SYC A;  1Q6H A;  4I50 A;  1P49 A;  1M1K W;  1R73 A;  3X2Q B;  1V54 C;  3CPW U;  2GBO A;  2ZDI C;  2MK3 A;  4EB6 A;  1NTM H;  1DF5 A;  3ZHR A;  3I56 V;  3GWK C;  4F6R B;  2OYQ A;  4F4L A;  2QTO A;  2QKC A;  3ZRS A;  2RN9 A;  3AK1 A;  4NTY A;  3JAL B;  3ASO C;  2HR3 A;  4GKK B;  2ADQ B;  1K97 A;  2V1D A;  1N32 B;  1FS0 G;  2CK3 G;  4DW1 A;  1YF2 A;  1PNK A;  4DV7 O;  2PI4 A;  2PY5 A;  2GV9 A;  4HBN A;  1NU1 H;  4X1Y A;  4E4E A;  2VS0 A;  2UXD B;  1Y67 A;  1SES A;  1SA0 B;  3JAK A;  2LFS A;  4PEL A;  5JCO C;  3AG4 C;  2RJZ A;  3JAT B;  4PA6 A;  2YC0 A;  1AR1 B;  5LL6 Y;  2Y4T A;  5BMV B;  3AG2 C;  3M8A A;  4X1K B;  4ASU G;  1COW G;  2Y0P A;  2D3O W;  2CDY A;  4X1I B;  5J2T B;  1KYO F;  2PTM A;  4PDM A;  5H2F Z;  2KQX A;  1Y6X A;  3JAL A;  1XBL A;  3FX7 A;  4O4I B;  2H8P C;  3CC4 V;  3CRM A;  2HJD A;  2QWQ B;  1IUR A;  4LF6 B;  4AHC A;  3HKB B;  1OV9 A;  4ZIB A;  5B66 Z;  1O9G A;  2DJV A;  3QO7 A;  4QGP A;  1L8D A;  1SA0 A;  2UXX A;  5CB4 A;  3QG5 A;  4IYI A;  3K5N A;  3JAT A;  2UUC O;  2Z3Y A;  4JI2 O;  2FYU H;  1Q82 W;  1YSC A;  2WWW A;  2AZ2 A;  2ILM A;  4X1K A;  4B7E A;  4JI7 B;  4JYC A;  4JI8 O;  4X1I A;  5LYJ A;  2E74 B;  4GKJ O;  3BA8 A;  3QO5 A;  1N36 O;  1ZX3 A;  1SQB H;  4WFB V;  4B08 A;  4OX9 B;  4J42 A;  3CC2 V;  3JAS B;  4X64 O;  1GN3 A;  3K57 A;  3DSQ A;  3CCS V;  3QTC A;  4O4I A;  4QIW F;  3QF7 A;  4GX2 A;  3STZ C;  3GWO A;  1VIB A;  4FK5 C;  4O4J B;  4GZR B;  3ETG A;  5KA6 A;  1XQ8 A;  3K08 A;  3E35 A;  3JAM N;  2WAM A;  3OE7 G;  4NYK A;  2IH1 C;  2VWJ A;  2ZR3 A;  3TXS A;  5LXT B;  1H38 A;  2CH7 B;  5IYD O;  1S76 D;  1S72 V;  1KU9 A;  5EZY B;  3DGE A;  3J7A U;  1MNG A;  1VQP V;  3SJB C;  2YID A;  3RVZ A;  2QSA A;  4JI5 O;  3DC5 A;  2QM4 A;  4IHJ B;  1L0L H;  2EX3 A;  3EFF K;  3SGI A;  3K58 A;  1KD1 W;  4BR6 A;  2OIG A;  1LR1 A;  1WAZ A;  4P9O A;  3F5T A;  2IH3 C;  2VWK A;  2ITD C;  2R9A A;  4EFB A;  4LF9 O;  3JAS A;  3OTF A;  1AR5 A;  1D5A A;  4MW8 A;  4NTW A;  1QLN A;  4DV2 B;  3M7M X;  1NR7 A;  1BT8 A;  4O4J A;  4ZBM A;  1KC8 W;  4J80 A;  1I5Y A;  4DR6 O;  4J9Z B;  2YI9 A;  3ASN B;  2P7T C;  2X6C A;  3Q4H B;  1I0H A;  1PL0 A;  5LXT A;  2CH7 A;  1XEQ A;  2V4D A;  1FKA O;  2N04 A;  3L71 H;  5IYC O;  3LNN A;  4IHJ A;  1RFY A;  2DYR B;  4LF8 B;  2WLN A;  1L0N H;  1HW7 A;  2WLL B;  2YXH A;  2Q5Z A;  3RYC B;  5K1P A;  1OCC C;  2NNU A;  4WBN A;  2W0F C;  1JCH A;  1XOU A;  3L9D A;  1GM7 A;  1NJI W;  3GB7 C;  3FD9 A;  4I5S A;  2JJ2 G;  3Q4H A;  3LDC A;  4JI1 O;  5B1A B;  5GON B;  1QU7 A;  3C3T A;  3LSS A;  3TGU H;  2CE4 A;  1S0V A;  4FLX A;  3ZS8 C;  3IJ4 A;  2B5U A;  2UXC O;  1MOF A;  5EIB D;  4MTO A;  3CXH F;  1I7F A;  3U0Z A;  1G4Y B;  3LDD A;  1XL4 A;  2JDI G;  2P6J A;  5LP6 B;  5H9C A;  2WLL A;  2GTS A;  3HPL C;  5KHK A;  1V9P A;  2QEX V;  3JCU Z;  3K06 A;  4OXS A;  4TQD A;  3RYC A;  1D2D A;  1EN5 A;  1JQ0 A;  5D5Q A;  3S3X A;  3IC9 A;  4FPP A;  3QVN A;  1M57 C;  4DV7 B;  1K9M W;  1GM9 A;  3OMA B;  2YXY A;  4AIL C;  5GON A;  3ZMS A;  1ZTE A;  5L3C A;  1Q81 W;  1ENV A;  2DYS B;  3CCQ V;  3P3P A;  1XRE A;  4PD4 F;  3THO A;  4F6E A;  4FM1 A;  4O2A B;  3W7W A;  4A5U B;  3SPH A;  1PL4 A;  1EZJ A;  4UCT A;  4H33 A;  5LP6 A;  3ZHV A;  1R1B A;  5D5P A;  3ZMT A;  1AP6 A;  1RM1 B;  3CRR A;  4TT3 G;  2ZXW C;  1XMO O;  2P22 C;  3ZMV A;  1PNL A;  1R6T A;  2IJJ A;  2R72 A;  3KCY A;  1N0J A;  3CEI A;  3CCR V;  3L70 H;  3JSL A;  1IXM A;  3SYQ A;  2ZNJ A;  3UO2 A;  5IT9 N;  2F1M A;  1VQ6 V;  3TXQ A;  3E8B A;  4G2K A;  1RPO A;  2JVD A;  4DV6 O;  4G27 B;  4BW5 A;  5IYZ B;  1P84 F;  2XND G;  2UUC B;  4O2A A;  1FJG O;  4JI2 B;  1JVM A;  1UFI A;  2ZD9 A;  1B06 A;  3ZN1 A;  4MVO A;  4JI8 B;  1Q43 A;  1T5E A;  1N36 B;  2ZNI A;  2E75 B;  4X64 B;  3ZRW B;  3A8T A;  4JTA B;  4X20 B;  4LFA O;  3DC6 A;  4ZI7 B;  2XAJ A;  2G38 A;  1FXK C;  3CYO A;  3WG7 B;  1GMG A;  3ABL B;  1BQZ A;  4ZOL A;  3ZMZ A;  1Y74 B;  2PF4 E;  4TV8 B;  4TUY B;  4JI5 B;  3JAW B;  1XNQ O;  1KEC A;  2IU0 A;  2OCC B;  3AK2 A;  4CC6 A;  4LF9 B;  3ZRW A;  2NLJ C;  4YXW G;  4JAV A;  3H1I H;  4I4T B;  3KZI Z;  2Y69 C;  4X20 A;  4MTG A;  4ZI7 A;  2WLJ A;  1Q90 D;  1WNS A;  3AG3 B;  2ATK C;  1JMK C;  4DR6 B;  1N8R W;  1BHB A;  2ZE8 A;  1OCZ C;  5A9G A;  3RW0 A;  1YJN V;  3OTO O;  1CPY A;  1Y74 A;  2ODM A;  2FTK A;  4DR4 O;  1OCR C;  3I5D A;  4GCZ A;  2HVJ C;  3W7X A;  2FKX A;  4TUY A;  1HNZ O;  3JAW A;  1J95 A;  2Q8V A;  4KUM A;  2N05 A;  2YDE A;  1K34 A;  1CEZ A; 
#chains in the Genus database with same CATH homology
 1WLE A;  1M57 B;  5H6R A;  1MAB G;  4KFM A;  4MSW C;  5B1O A;  1ZWI C;  2HFE C;  3WFV A;  3CCV V;  1SER A;  1QLE C;  2JJ1 G;  1NR1 A;  3LDE A;  1SRY A;  4MVQ A;  3G71 V;  3OM3 B;  3VBB A;  4RQE A;  2X6A A;  3JD1 A;  4BIZ A;  4R6Z A;  4MW3 A;  4XDJ A;  3SPJ A;  3SPG A;  4U7O A;  1YTF D;  1BL8 A;  4MT8 A;  4X88 A;  3ABM B;  1P4R A;  3UM7 A;  4E2L A;  3SYC A;  1M1K W;  1R73 A;  3OR6 C;  2ZQM A;  1PNM A;  3CCL V;  3X2Q B;  1V54 C;  2LFR A;  5IY5 B;  3CPW U;  3ZCC A;  2ZDI C;  3ASN C;  2MK3 A;  5CBF A;  1H2G A;  1NKD A;  2P67 A;  2ZXW B;  4PDV A;  4MTF A;  5LBQ A;  1DF5 A;  3I56 V;  1THZ A;  3OAA G;  1AJP A;  1VQ7 V;  3IGA C;  4QPJ A;  4F4L A;  2QTO A;  1F4N A;  4DXW A;  3ZRS A;  1FXH A;  1BHA A;  2DYR C;  3A0R A;  2HR3 A;  3ASO C;  3K3W A;  1K97 A;  2V1D A;  2IJI A;  3SYA A;  1FS0 G;  2CK3 G;  2DWD C;  3OR7 C;  3SPI A;  2YSU B;  2HVK C;  2PI4 A;  1PNK A;  3P30 A;  2A9H A;  1CP9 A;  4JAS A;  4MVZ A;  3ZJZ A;  5KUK A;  4G28 B;  1SES A;  3E86 A;  3K03 A;  2LFS A;  4PEL A;  2WLH A;  3BEH A;  1KKD A;  2GSM B;  5CA3 A;  2C2A A;  1XL6 A;  1OCO B;  3AG4 C;  1GKF A;  4FJC C;  4PA6 A;  2AHZ A;  1AR1 B;  5LGU A;  1FFT B;  2WPD G;  5KUM A;  4XDL A;  3FYI B;  2M7W A;  1M9N A;  3AG2 C;  1FXV A;  5B1A C;  4MVR A;  4ASU G;  1COW G;  1LNQ A;  2D3O W;  3MHH C;  1EFR G;  4PDM A;  4GX5 A;  3QO8 A;  1L1F A;  3ABK B;  3MHS C;  4PA7 A;  3K79 A;  5L3B A;  2H8P C;  3CC4 V;  1FXK B;  2QM7 A;  2EZP A;  2XOK G;  4RO2 A;  4JF3 A;  4MVS A;  4UVA A;  2HJF C;  1K5S A;  3AG2 B;  1QR9 A;  3QO7 A;  4L87 A;  1NBM G;  3K0G A;  2EIK B;  2UXX A;  3ETD A;  3NXS A;  1UJW B;  4HZ3 A;  5LHG A;  4PDR A;  2A0L A;  1S5H C;  3OEH G;  4X8A A;  2Z3Y A;  1QVF U;  5B1B B;  4UXN A;  3CP1 A;  1KP2 A;  2EZO A;  2QA4 V;  1YSC A;  5EBW C;  2KB1 A;  1Q82 W;  2WWW A;  2OTL V;  1W0J G;  2EBO A;  1QCE A;  2QE7 G;  5B3S B;  1QVG U;  1M56 B;  1QBZ A;  4EKW A;  4JYC A;  3IC7 A;  3H01 A;  2YEV B;  3G6E V;  3QO5 A;  3CCJ V;  1PD3 A;  1GTO A;  5B1N A;  1Q86 W;  4WFB V;  3B8N A;  5CBH A;  3CME V;  3CC2 V;  2JEX A;  2JEU A;  2XAH A;  3CCS V;  2Y69 B;  4QIW F;  1E1Q G;  1V55 B;  2XAF A;  4GX2 A;  2EIN B;  1F51 A;  3GWO A;  3STZ C;  1RM1 C;  4FK5 C;  3OMI B;  4WFE A;  1K33 A;  3ETG A;  1OCZ B;  3FB6 C;  5KA6 A;  4HYO A;  1Y4M A;  4JAU A;  4FMT A;  3K08 A;  3E35 A;  4JTC B;  5KA5 A;  3W7S A;  2WAM A;  3OE7 G;  1OCR B;  3E2E A;  2IH1 C;  2ZR3 A;  1ARO P;  3G4S V;  2DQ3 A;  1AI5 A;  4R8C A;  1H38 A;  5IYD O;  1S76 D;  1S72 V;  2ZR2 A;  3CCE V;  3DGE A;  5CBG A;  1VQP V;  1R3J C;  3B8M A;  5EC1 C;  3RVZ A;  3EHB B;  2XAS A;  5IYB O;  1JOY A;  4UUJ C;  2Q69 A;  2P90 A;  2Q6A A;  4U7N A;  2LP7 A;  5CMU A;  3EFF K;  4ZKI A;  1KD1 W;  2YEV A;  3TK1 A;  3JD0 A;  4R7C A;  1QLE B;  4P9O A;  1KQS U;  2IH3 C;  3FKS G;  2B1I A;  2WLM A;  2W6J G;  2ITD C;  1P7B A;  1R3L C;  4MW8 A;  4WF9 V;  3LUT B;  4FIP C;  3OFN G;  5LHH A;  1QLN A;  1NR7 A;  4WFH A;  1VQO V;  4MTX A;  4ZBM A;  3T2M A;  1KC8 W;  1K8A W;  3CMA V;  4QE7 A;  1V54 B;  4PA4 A;  1I5Y A;  1RPR A;  4J9Z B;  4MVM A;  3ASN B;  3LNM B;  3AG1 C;  2P7T C;  2X6C A;  4BAY A;  1PL0 A;  1DLB A;  1NQT A;  3MD0 A;  1R6K A;  4UV8 A;  5J9P C;  1BMF G;  5EBM C;  1MSW D;  1YHQ V;  3SJQ C;  2JIZ G;  3E83 A;  1AJN A;  4H37 A;  5IYC O;  1AI6 A;  1K92 A;  3ABL C;  1YTF B;  3JYC A;  2DYR B;  3ASO B;  1MG1 A;  2WLN A;  3ZIA G;  4P30 A;  2IU3 A;  4MVU A;  2WLL B;  1G8M A;  3ML0 A;  3CD6 V;  1AI7 A;  2Q68 A;  3PJS K;  4MS2 A;  3JD2 A;  4JYB A;  4KP4 A;  1OCC C;  2NNU A;  2EIM C;  4XBF A;  3P32 A;  1DF4 A;  1SZT A;  3SPC A;  1GK9 A;  2OT5 A;  2W0F C;  1JCH A;  3AG4 B;  3F5W C;  3JD3 A;  1GM7 A;  1NJI W;  3GB7 C;  5L3D A;  2OTJ V;  5DN6 G;  2ZDI A;  2X6B A;  4I5S A;  1F23 A;  2JJ2 G;  3LDC A;  2BOB C;  2DQ0 A;  5B1A B;  4PA9 A;  2EIJ C;  5FL7 G;  3LSS A;  2AHY A;  1NH2 D;  5L3G A;  1M90 W;  5E1A C;  1S0V A;  2ITC C;  5GW7 A;  2HLD G;  3OMN B;  2B5U A;  3RBZ A;  1MOF A;  3F7V C;  4MTO A;  3QNE A;  1G4Y B;  2IW5 A;  3LDD A;  1YJW V;  1XL4 A;  2JDI G;  2P6J A;  1W2B U;  3OUF A;  4WCE V;  5H9C A;  2WLL A;  3HPL C;  1DTO A;  2DYS C;  2QEX V;  3FYE B;  3K06 A;  4OXS A;  4R50 A;  2GHY A;  3R65 A;  2R9R B;  4TWK A;  1CEZ A;  1JQ0 A;  3I55 V;  1VQ5 V;  2WSS G;  2DWE C;  3W7T A;  4FPP A;  4J9Y B;  3ZRV A;  1I5X A;  4RQF A;  1M57 C;  3W7U A;  4LCU C;  3D36 A;  1K9M W;  3OW2 U;  1K5Q A;  4LC1 A;  1GM9 A;  1H8E G;  3OMA B;  4UVB A;  3ZMS A;  2Y48 A;  1OZ0 A;  5L3C A;  3D3I A;  1Q81 W;  1ENV A;  2DYS B;  3CCQ V;  2UXN A;  4N21 A;  1K7D A;  3T4D A;  3ZN0 A;  3ABM C;  3F7Y C;  3W7W A;  4WFA V;  1NH2 B;  1B6Q A;  3AEI A;  2A79 B;  1Y66 A;  2JK5 C;  2R9I A;  4X89 A;  2F43 G;  3SPH A;  3X2Q C;  4RUF A;  5DM6 V;  1EZJ A;  5IY5 C;  4H33 A;  2QKS A;  3ZMT A;  5EBL C;  1RM1 B;  4TT3 G;  2ZXW C;  3ZMV A;  1PNL A;  1H8H G;  4QE9 A;  4RAI A;  5LGN A;  1E1R G;  2IJJ A;  5H6Q A;  2XAG A;  2WLI B;  2IJK A;  3OGC C;  1F4M A;  1ROP A;  4LP8 A;  3CCR V;  2BOC C;  4WFF A;  2IJH A;  1IXM A;  2Q67 A;  2EIL C;  3SYQ A;  1VQM V;  2HG5 C;  1ORQ C;  4TSF G;  3ZRX A;  3CC7 V;  4JGS A;  3ZMU A;  3JD4 A;  2WLK A;  4I9W A;  1VQ8 V;  3OUS A;  1VQK V;  1VQ6 V;  3FB7 C;  3E8B A;  4G2K A;  5L3F A;  1RPO A;  2X7R B;  5EC2 C;  4P2Z A;  2X0L A;  1VQ9 V;  4G27 B;  4BW5 A;  3VOU A;  2PI5 A;  2XND G;  5C93 A;  1K4D C;  1OCO C;  1YIT V;  2XAQ A;  1JVM A;  1S77 D;  1JJ2 U;  2ZD9 A;  1Q7Y W;  3WG7 C;  1R3I C;  3SYP A;  3ABT A;  3ZN1 A;  1E79 G;  2EIL B;  4PDL A;  1KP3 A;  4MVO A;  4DO2 A;  3TET A;  1YIJ V;  4UVC A;  1W0K G;  3FB8 C;  1EBO A;  2HKO A;  3K9A A;  2WLI A;  3HB3 B;  1YJ9 V;  3AG1 B;  4Q20 A;  2Z5U A;  2B1G A;  3ABK C;  1JPX A;  3ZRW B;  1K73 W;  4QNH B;  3E8H A;  5BZB A;  3LSQ A;  1R3K C;  1YI2 V;  3E89 A;  1JX9 A;  4GT1 A;  4JTA B;  2OCC C;  3K0D A;  5LHI A;  2XAJ A;  3CYO A;  1FXK C;  4GX1 A;  1TUE B;  3WG7 B;  1GMG A;  4PA3 A;  3ABL B;  2EJR A;  3ZMZ A;  1VQN V;  3BY6 A;  5CN0 A;  5HFL A;  1GO3 F;  3ABU A;  1NVP D;  2EIK C;  4JTD B;  3E8F A;  1VQ4 V;  3STL C;  1OCC B;  4N23 A;  2EIM B;  5B1B C;  1PKX A;  4XDK A;  3AG3 C;  5HFM A;  1KEC A;  5EK0 A;  2IU0 A;  1OHH G;  2DW4 A;  3FB5 C;  2OCC B;  3E8G A;  5L3E A;  5B3S C;  1M56 C;  3CCM V;  4UV9 A;  4GX0 A;  1QR8 A;  4P9P A;  3DTU B;  1AJQ A;  3UKM A;  4Z1M G;  3ZRW A;  2EIJ B;  2NLJ C;  3SYO A;  4YXW G;  1WPX A;  3T1C A;  4JAV A;  5IDJ A;  3CCU V;  2Y69 C;  3M99 B;  5LGT A;  1V55 C;  1S3J A;  2EIN C;  4MTG A;  2WLJ A;  4QPK A;  3AG3 B;  2ATK C;  4JPR A;  1GM8 A;  1N8R W;  1BHB A;  1OCZ C;  3RW0 A;  1YJN V;  1CPY A;  4CBC A;  3B77 A;  3CXC U;  1R6N A;  4BIU A;  2FTK A;  1K3E A;  3K04 A;  1OCR C;  4HAM A;  4CZZ A;  1AI4 A;  3OEE G;  3JCZ A;  1K4C C;  4GCZ A;  1SET A;  4RUE A;  2HVJ C;  3W7X A;  3RVY A;  2W6I G;  2K1E A;  2QM8 A;  3KG2 A;  1HWY A;  3TCU A;  1J95 A;  3T4Z A;  1NVP B;  2H94 A;  4KUM A;  4LBE C;  3IFX A;  4WFG A;  1K34 A;  3ETE A;  4QJF B;  1VQL V;  2V7Q G;  1FXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...