1S72V

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s72V00
3CMAV 1K73W 1K9MW 5DM6V 1YITV 1Q81W 3CXCU 3CCJV 1YJNV 1M90W 3CC4V 1K8AW 1W2BU 3CC2V 1NJIW 1Q7YW 3CCEV 1VQ9V 3CD6V 1YHQV 3CCUV 4WCEV 3I56V 3CCSV 4WFBV 1VQ4V 1KQSU 1VQMV 3CMEV 3G71V 1YJWV 3CCMV 3I55V 1Q86W 1VQPV 1VQNV 1YI2V 1VQ6V 1QVGU 3CC7V 2D3OW 1KD1W 4WFAV 3CCRV 1VQ8V 1VQ7V 3G4SV 3G6EV 3CCQV 1YIJV 2OTJV 1M1KW 3CPWU 1S72V 1Q82W 1R73A 3CCVV 1YJ9V 1QVFU 3CCLV 4WF9V 1VQLV 1VQKV 1VQOV 1JJ2U 1VQ5V 3OW2U 2OTLV 1KC8W 2QA4V 2QEXV 1N8RW
chains in the Genus database with same CATH superfamily
2JK5C 1I5XA 5FPOA 1QBZA 5EZYB 4MS2A 1G4YB 4IT5A 1K7DA 2YIAA 4JYAO 4O2BA 4IGGA 4HZ3A 4K0KO 3RT3C 2AHYA 2EILB 2UXNA 2Q73A 3SYPA 2A9HA 4X20B 3B09A 1KKDA 3FYEB 1KMIZ 2XAGA 3EXAA 4J11A 3FYIB 3ETEA 3G71V 1N36B 4DR4B 3JAMN 1O9GA 3JATB 1NTZH 3RFRA 3CPWU 5CBGA 5J2UA 2XNDG 2DYRB 1VARA 1Y76B 3ETQA 1EZVH 3B8MA 4PI2A 1UPGA 4JYCA 2ZNIA 2Q4PA 3CHXA 2CGNA 3MHHC 2IU0A 3T1HB 2QTSA 1BCCH 1HNWO 5LOVA 2VQFO 3UM7A 3AK1A 5LXTA 1MG1A 2UXCO 4Q20A 1N33O 3OE7G 1TAEA 2OWOA 1WJZA 1E1RG 3ZHSA 5IY5C 4DR5B 1Y74A 1H2NA 1K73W 2EJRA 3ABTA 2FTKA 5C93A 3VQVA 4QIWF 3ZRSA 4JTAB 1MOFA 5LMUO 2RMKB 2WAMA 3T4DA 1OCZB 4XDKA 3BY6A 4DR2O 2UXDO 4IYHA 1H8HG 2JVDA 5LYJA 4JTCB 1F7YA 5KX5B 4FFBA 3JD3A 3RYCB 3APQA 3UKMA 3CJHA 1XI1A 1R6KA 4GCZA 2Y4TA 3UT5A 3WB0A 1XMOB 4FLTA 2P4VA 2GTSA 4H13B 4J9YB 3KZIZ 3KCYA 3ZMUA 1JCHA 4NXNB 4DYLA 2BOCC 4NYKA 4CH3A 1XNRO 4U3JA 4LF9O 3M8AA 1VF6C 3ZHQA 3ZHVA 2YUAA 1G6UA 3IGAC 3SYCA 1NH2B 1M57C 4PDLA 1NVPB 4LF6O 1VF5B 3AK2A 1H2GA 4DR6B 2HG5C 1PP9H 3N27A 1YVWA 1OJHA 3DTUB 1UJWB 4NVPA 3CXCU 2OCCC 3O9OA 1SZXA 3BEHA 3N2KA 4FZ1A 4LH6A 5H9CA 3BFRA 4DRXB 4FZ0A 1IBKO 1YSCA 4EFBA 1L0LH 3JASB 4MVQA 2DJVA 2ETNA 4DV4B 4NTYA 1ORQC 5IYBO 1M93A 5BXZA 1BL8A 4JGSA 5IYZA 1WAZA 4FK5C 1OCOC 5LA6B 4WFBV 2ZIMA 3KCXA 2ADPA 3E8GA 3CCMV 4X62B 1QLNA 1L0NH 1QR8A 1N32O 4DV7O 4R50A 3AG4C 5JH7A 4YHHO 1SA0A 3OEEG 1WB7A 3RBZA 4IIJB 5FLXN 3JARA 4LNUB 4O4IB 1NVPD 1SETA 2BSKB 1SC5B 4GYCB 3IC7A 1S0VA 4PDRA 3HKDB 3QVNA 4NB5A 1VQ8V 2NNUA 4MVZA 1WP7A 1D5NA 3MHSC 1W0JG 2HKOA 2ITCC 4OXSA 4NXMO 1SZTA 2IU3A 2ZE8A 2QA4V 3U10A 1GK9A 3T1YO 1XNQO 4JI2O 4UCUA 1QU7A 1VQ9V 2Q7GA 1AP5A 4TWKA 4QE7A 4DK1A 3TXQA 2F43G 1ZUQA 4LF5B 4PV1B 3KG2A 3CMEV 1MNGA 3ASOC 1FXKB 2YI9A 3OUFA 2CK3G 5CBFA 1B3QA 2A06H 4OX9O 5EIBC 2FL4A 3CS5A 1BHBA 4HNAB 4R6ZA 5BR8O 4O4HB 2R9IA 2VWKA 4JYYA 2JS5A 1HDJA 3FFQA 3SR2C 2UU9O 1P84F 4MVUA 3ZN1A 2FYUH 4FVMA 3J81N 5C8YA 1Q82W 2R9AA 5BMVB 2CTQA 4JI5B 4I50B 2Z0AA 1HR0B 3ZMTA 2EX3A 4JZ2A 1OCRB 3K0GA 1GTOA 2V1DA 3RN4A 2Q69A 3FB6C 1CEZA 3VQYA 1S77D 1K97A 3H9VA 3DSQA 4DR4O 2V7QG 1R3KC 3SJBC 4G28B 1VQ5V 3P32A 1HNXB 4G2KA 4O4LB 3G6BA 4FMTA 1FXKA 1P7BA 3T1HO 2ZDIC 3L71H 1IBMB 5AG2A 3BRCA 5CB4A 2D3OW 2OIGA 5D5QA 4ZI7B 2B9ZA 2QM8A 1E1QG 3N2GB 5DECA 3O65A 3VQWA 2YIBA 3C3SA 5JVDB 2JEUA 4AI8A 2PY5A 4BIZA 4CH4A 3CMAV 1DF5A 4MW3A 2DOSA 4DR5O 2DMXA 5EYPB 1OZ0A 5JJJB 1SF9A 1EBOA 2CAZC 4X88A 1XILA 3ZMSA 4D7TA 2BTOA 4I50A 3K03A 2QR4A 2YDEA 4EFEA 4BIOA 3ZJZA 3M99B 4TUYB 2WLIB 1GH6A 3J7AU 1U96A 2LFRA 4X1IA 1S5HC 3OAAG 1Q6IA 3SPCA 1W59A 3ASNC 2HEPA 2R72A 5E1AC 3HPLC 4FM1A 4RQFA 3STZC 2WLKA 1SERA 5KHIA 5LP6B 2OCHA 4CC5A 1B04A 1RM1B 1G1XB 2QDOA 4WFAV 3ZCCA 1XMOO 1CP9A 2PYLA 1GN3A 4PDMA 1XMQB 3RYIB 2H94A 5FPRA 2WA4A 1LNQA 2CUGA 1YTFB 5L3DA 2P06A 5CA0B 1I08A 4DR1B 1XEQA 1N34B 3CCRV 4MW8A 1WA8B 4J7JA 5EIBD 4DR6O 1QCEA 4K8XA 5LGUA 4JV5B 2LO1A 1JJOA 3FAVA 2QJ1A 3K9AA 4F6RB 3FB5C 2CH7B 4DR3B 4B3TB 1JVMA 1GRJA 3OTFA 1K4CC 3C3TA 1KP2A 3SJQC 3T4ZA 3CRMA 5IJ9B 1I94B 4O4JB 5B1BC 4EKWA 3J80N 1VQKV 5L3CA 4JF3A 4MTXA 1L1FA 4DV4O 4IHJB 4PJ0Z 1YXBA 3T1CA 1PNLA 1TA8A 5K1PA 4OPHA 5JWPA 4DV1B 3HKEB 4J9ZB 4LFCB 4PI0A 2F1MA 2F4VB 1NT2B 4X62O 2QKSA 1K5SA 4QGPA 4RUFA 2HFEC 4F6EA 1V9PA 3E22B 1YTFD 1S5LZ 1VQLV 1PL4A 3JD4A 4LWSB 1RPRA 4GZRB 4TV9B 3K57A 1NTMH 2PF4E 1IXMA 1GMGA 2UUCB 3U11A 4UVAA 1Q90D 3CRQA 3DC6A 4Z1MG 3RYHA 4F4LA 1YDXA 5JQGA 1VQMV 1JFFA 3E8FA 4JI3B 2UUBB 5BY1A 4QE9A 2JDIG 2XAJA 3UO3A 3SPHA 4JI0O 5CMUA 3CWBH 1BT8A 2FKXA 3E86A 1NJIW 1H2KA 1GN4A 4K3AA 1VEWA 3LNNA 4PD4F 4LF5O 2FB5A 2YXYA 1RP3B 2PGGA 2NN4A 3ABMC 4IHJA 4N21A 5B66Z 1BZKA 4NR1A 1I0HA 1WLEA 2IJJA 1M56C 2OTLV 1H2MA 1SQXH 3DXRB 1MZFA 1ZX3A 3F7VC 1ZTEA 4G27B 2PYJA 3OGCC 3SPJA 4TV9A 4PHZA 1DLBA 4P9PA 3JCZA 3OR6C 2JIZG 4JI5O 4I4TB 2WLLB 3IC9A 3ZS8C 1HR0O 2ZM6O 3JSNA 3S3XA 5KA6A 2W0XA 4YY3B 1KB9F 4YJ3B 2HLDG 1AJNA 4LCUC 4LFAB 3GVMA 4PA6A 4LFBB 4I5SA 1TVKA 1NTKH 3E8HA 2ZT9B 1KUQA 1ZSPA 2HVJC 1CPYA 1HNXO 3HKCB 1QLEC 1AJQA 3RW0A 2A7WA 4UUJC 2DW4A 3A2FA 1LUVA 3SYQA 4B08A 3ZMZA 1DTOA 5KMGB 2CTWA 4NTWA 4J10A 1K4DC 4EB6B 4DV3B 1PV0A 2YXHA 4IYIA 3QO7A 3A8TA 1AI6A 2EZOA 4UB8Z 5BZBA 1WNSA 3Q4HB 2DYSB 3SDLA 3X2QB 4DUZB 2KG7B 1NU1H 3JAWA 2IM9A 1NQTA 3AG3B 4JI4B 2C2AA 5B1AC 4MSWC 3OR7C 1A32A 4FLXA 1JPXA 1NS1A 1FXVA 2YEVB 2M7WA 5EZYA 2X7RB 2GHYA 5B3SC 4GX1A 3JD2A 1YITV 4FJCC 1TUBB 3ABLC 4RUEA 1AI7A 5DEDA 3ZX6A 1GO3F 2GSMB 3L70H 3LDCA 4X20A 1KBHA 2X0LA 1XQ8A 5EBMC 2QE7G 2F93B 5JCOC 3BA9A 1XMQO 2XASA 1JMKC 1KKCA 5LGTA 3S3WA 5KMGA 4UCOA 2AGAA 5J9PC 5IDJA 1GM9A 2Q0OC 3JATA 2ARHA 3P30A 4ZHQB 2O57A 4JZGA 3I55V 1Y76A 2P67A 1NKDA 1N34O 1FKAO 3CCLV 5H5NA 3CSXA 1MMMA 2Z3YA 2Y69C 3CCJV 4BW9A 4DR3O 4B3TO 5KUMA 1D5AA 2Q9LA 1HNZB 4I9QA 1R6TA 2Q6AA 3L9DA 2YSUB 2LGWA 4YIPA 4TV8B 2B5UA 2V4DA 2N05A 4HBNA 4WFHA 3E8BA 4UVCA 3F5TA 2DWEC 3ZRWB 2HJDA 1TUBA 3SYOA 3ABKC 1M5IA 2GUZB 2IJKA 2LW1A 2A0LA 5DN6G 2RJZA 3W7TA 3OFNG 1JOYA 4FLVA 4O2AB 3CCSV 4LP8A 3LUTB 4LFCO 1VQ6V 4W4KA 4LF8B 2F4VO 4CZZA 5LMNB 5KX5A 3OGIB 1QHTA 3G4SV 4A5UB 1M1KW 3RYCA 4J42A 4LF7B 4JI6B 1FXKC 1K9MW 4JAVA 3CB2A 4B7KA 4MVOA 4PA4A 2UUCO 4WFGA 4B3SB 5KHJA 3LSQA 3RVYA 3OM3B 4DV6B 2B1GA 3CC7V 2LP7A 1K92A 3K04A 4JI3O 1HP8A 4MVRA 4AQYB 2UUBO 5IT9N 4MVMA 5EK0A 2HJFC 2GDSA 4JI1O 4KL1A 1N0JA 4UV8A 1NR7A 1SQQH 2B1IA 3BAAA 2Y0IA 2P4KA 3TCUA 4I0XB 3MAQA 3AG1C 3ML0A 1VQ4V 3E83A 4K8ZA 4FM2A 1V54C 2YS8A 2M6YA 4UCTA 1JX9A 4LC1A 4QPJA 3K06A 4D6TH 1IVSA 4DRXA 2QEXV 4X1KB 1L8DA 1M57B 2CGOA 2WSSG 2XOKG 1FXHA 3JASA 2XT9A 4ZOLB 4KFMA 2VWJA 1YJWV 4B3RB 3JAKB 4DV2B 4GKKB 2JGDB 5L3BA 2OCCB 4MTFA 1JA8A 2EJ7A 4X66B 5LGNA 3THOA 2EINC 2H3OA 3IAYA 3OTOB 5LA6A 1DGSA 4LH7A 4D7SA 1RSOB 3W7UA 4CBCA 1BMFG 1YEWA 2H8PC 2XHBA 2ZQMA 3FB7C 3TK1A 1XL6A 3JALB 1VQNV 4LFAO 4LFBO 4IIJA 2P7TC 1NZ6A 4LNUA 4O4IA 4JASA 2QGNA 5IWAB 5ITZB 2BSKA 1OCOB 2DN9A 4UFZA 3ZIAG 2BCCH 1AI5A 3HKDA 2ADQB 3AG4B 4MTGA 3JSLA 1N36O 1G8MA 4DV3O 3MDSA 2BE3A 2UXBB 4GUNA 3NR7A 3D36A 1F23A 2P90A 2WPDG 2ZE7A 3ICXA 2EIMC 1FYJA 4DUZO 4K0KB 1PNKA 2CDYA 3F5WC 5FNVB 4CH6A 4JI4O 4HNAA 4KXRA 4ASUG 1P49A 3OUSA 4O4HA 1XL4A 3ZRXA 4WBNB 1RSOA 2WLJA 2ZKOA 2JJ1G 2WA3A 2EULA 1GKFA 4BW5A 1FFXB 1AVMA 3ASOB 2Y48A 4KUMA 3VBBA 4CS3A 5IJ0B 2RN9A 3CX5F 3I56V 1Y66A 2CTPA 3AG2C 4I7ZB 5HFLA 1Q43A 4H37A 1KQSU 5BMVA 1WPXA 2PI5A 4R7CA 3CYOA 3TJTA 1ROPA 4Z1VA 1OCCC 5LHIA 3WG7C 2KB1A 2UXCB 2X6BA 2ZD9A 3FD9A 5EBLC 1KD1W 2W6IG 3AEIA 4O4LA 4RQEA 2RQ6A 4MTOA 2GV9A 4NXNO 1NBMG 4H0LB 1PL0A 2EIKC 2BTQB 1PKXA 4AHCA 4DUYB 4BAYA 2ZINA 3JD1A 3RWRD 1W2BU 2ZXWC 4ZI7A 5LMUB 3OMNB 2L6LA 1ZAUA 3CCUV 3K3WA 4W4LA 4DV0B 3N2GA 1HNZO 1MABG 4YXWG 5JVDA 4N23A 2ZE6A 4DO2A 3FX7A 5EYPA 3WB1A 2Q5ZA 3SPGA 3H1HH 1EN5A 3RVZA 4P30A 4MVSA 5GTHZ 5IE9A 1KYOF 5CBHA 4TUYA 1SS3A 2WLIA 5EC1C 1BQ0A 4FLYA 2FMLA 1QVGU 1UFIA 3GWKC 2YC0A 2HHHB 2LQTA 5LMNO 4GKJB 3LDEA 1SQBH 1WN7A 1J5EB 1AILA 2IJIA 1VQOV 1P4RA 2IBZH 2Q7HA 4LF7O 4JI6O 1X59A 5LP6A 4TQFA 2N04A 1V55C 5IYCO 1BS3A 4B3SO 5E79Z 5GW7A 3VOUA 2EZPA 4ICGA 1FPOA 2PI4A 3RYIA 3ASNB 4DV6O 3RYFB 4JI8B 2NLJC 4FIPC 1X4TA 3CE2A 4AQYO 3OMIB 4FPPA 1KECA 2EIJC 5D5PA 4HYOA 1N8RW 2A3QA 4RO2A 1GM8A 4LR3A 3ZRVA 2UUAB 5CA0A 3QNEA 3UQ8A 5KHKA 5CA1B 2LW7A 3DC5A 3TGUH 1WA8A 2GTAA 1H38A 1I7FA 2JS3A 1Q5OA 3L75H 1VIBA 4UCVA 4EEQA 2OT5A 3AG7A 5B1OA 2QWQB 3LSSA 4F6RA 1ZL8B 2CH7A 4WF9V 2K1EA 1AJPA 2RNBA 1EZJA 5H6RA 1R3IC 5IJ9A 4U3FH 5H2FZ 2EILC 1S3JA 4O4JA 2MW2B 4JI7B 2W0FC 3A0RA 3SJCC 1H2LA 1N0NA 2WLNA 4B3RO 2ZR3A 1AR5A 3D8CA 1N32B 1LUWA 4DV7B 4GKKO 3L72H 5CA3A 4FFKA 1PD3A 4O2BB 4YHHB 1FAFA 3OMAB 4UCSA 1XREA 3HKEA 3OTOO 3STLC 3W7WA 5B1BB 1H8EG 1WPBA 4ZKIA 1YHQV 4FLUA 4KHPB 2DYRC 1URFA 3P3NA 3G80A 4KP4A 3E22A 3FB8C 3FKSG 3MD0A 4LWSA 5KAIZ 3EHBB 2DE0X 3ZBHA 3T2MA 3W7XA 5FL7G 4GX2A 1FJGB 4X1YB 3B4SA 5IWAO 4JPRA 1R1BA 4XBFA 5J2UB 4DV5B 1SRYA 4H44B 3CD6V 3OT7A 4P9OA 1R6NA 2F66C 3APOA 5J2TB 4IL6Z 2MK3A 4LBEC 2K9PA 2OIEA 5LOVB 4OX9B 3K5OA 5LXTB 1M4UA 2XAHA 2UXBO 2PZSA 5L3FA 1WP8A 1DF4A 3OEHG 4DW0A 1OCZC 2HR3A 4K35A 1TUEB 2Y4UA 5KHGA 4XDLA 2UU9B 1YF2A 4J7KA 4B3MB 1XBLA 1Y74B 5KAFZ 3ABUA 5LHGA 1K33A 1IBMO 3OD4A 3EFFK 1HWYA 3DXRA 2VQEB 4GX5A 5IYDO 3CRRA 1S5JA 4PELA 2ILMA 1AROP 1GAXA 2F95B 3ABMB 3K5LA 2AXTZ 5LYJB 2P5OA 4U7NA 4ZIBA 4FFBB 5KA5A 1M56B 4MT8A 4X1YA 1Q86W 3CJHB 4BR6A 4I4TA 2WLLA 2QM4A 1OV9A 4I9WA 4UV9A 2KKWA 4DK0A 1BQZA 3UT5B 2Q0AA 4DW1A 2ZCEA 3CRAA 4LF4B 4YJ3A 5J2TA 2N74A 1I5YA 1CXZB 2A79B 1SQPH 1VP7A 4U3JB 4WCEV 1FS0G 1RFYA 1BGYH 3HKCA 4J80A 3M7MX 3ZMVA 1Q8IA 3CRCA 3D3IA 1HW7A 5A2QN 3HKBB 3WB2A 2KQXA 2ZR2A 3HB3B 3HR0A 2E74B 5LL6Y 3B77A 2IJHA 2CE4A 4CS2A 4DUYO 2IH3C 2P6JA 4C7UA 2KSDA 4EB6A 2QKAA 2QM7A 4DV0O 3R65A 4UB6Z 3WU2Z 1IDSA 2AHZA 4JYBA 4QJFB 1QLEB 3IFXA 3N2KB 2DQ0A 2XTAA 2RDCA 4DR1O 3LDDA 2OTJV 3UCSC 2QKCA 1IX9A 3Q4HA 1EN6A 2KG7A 5K1XA 4E2LA 3K59A 4BIUA 1XHZA 3BVOA 3JD0A 4JV5O 2E76B 2XAFA 1AR4A 2VS0A 2UXXA 2YEVA 3PJSK 4X64B 4X8AA 1W0KG 5IYZB 1VQ7V 1O9HA 2HHHO 1I94O 4GKJO 2G38A 4B7EA 1XHXA 1J5EO 2YICA 4X65B 5B1AB 2NR5A 4H33A 1D2DA 3K5MA 5JH7B 1F51A 1WB8A 1SA0B 3HKBA 5L3EA 3R66A 4DV1O 1QR9A 3JARB 1QNMA 5B3SB 4PA3A 5IY5B 5L3GA 2XAQA 4JI8O 5F2VO 2QSAA 1ZLZA 3D36C 3ABLB 4ZBMA 4TOIA 1FFTB 4UXNA 3L74H 2YI8A 2Q67A 4ZHQA 4PDVA 2UUAO 1NR1A 3CXHF 2QTOA 3EVKA 2OYQA 2E5LB 4AILC 4UCRA 5LHHA 1AR1B 1PNMA 4GLXA 3LNMB 3OW2U 3E2EA 4YIOA 4JAAA 2E75B 2ITDC 3CC4V 3ZN0A 1MSWD 4TV8A 3K58A 1MZEA 1JR9A 4JI7O 4X9QA 3ZRWA 1E79G 1PPJH 3ETDA 2GUZA 3E35A 1OCRC 2Y69B 5A9GA 1AI4A 5H6QA 4RAIA 1JJ2U 1Y4MA 2HVKC 1NH2D 2LGQA 1K34A 4O2AA 2JJ2G 1BSMA 5C8YB 2YIDA 1SKVA 1XDCA 1LR1A 3A0HZ 4KHPO 1F4NA 4HAMA 3ABKB 3ETGA 2Q7EA 3SYAA 2YXLA 3ZHTA 3ZEDA 3QO5A 1IZ3A 4YJ2B 4TT3G 1FJGO 4JI0B 2EBOA 2DWDC 4I55B 5JCOA 2AW9A 2R9RB 1R3LC 3IJ4A 4QNHB 3H01A 4DV5O 4DXWA 3F7YC 1IBLB 4FLZA 4X89A 3K9SA 4YY3O 1THZA 1M9NA 1YI2V 1VQPV 2D2CB 3A0BZ 1XUQA 4GX0A 3LSUA 2ZNJA 4JTDB 4I0XA 5CB4B 4QPKA 3KKYA 1OHHG 1T5EA 2QWOB 1RPOA 1B6QA 4DR7B 1S76D 5KHHA 1IURA 3QF7A 1KU9A 2QWPB 4UVBA 1VF6A 2W6JG 4B3MO 3PN1A 4L87A 4X1KA 3CCQV 1S72V 3AG1B 2VQEO 1QVFU 5LP6C 4GT1A 2ZM6B 4ZOLA 1V54B 1RM1C 2QWNB 5DM6V 3JAKA 3WFVA 4X1IB 2JGDA 1MSDA 2JRIA 4JYAB 4YJ2A 1SESA 4PA9A 2F23A 1N4CA 2XUMA 4I55A 1GN6A 1U97A 3JYCA 2BOBC 4WFEA 3QTCA 4R8CA 5EC2C 1R3JC 4WFFA 1TGOA 4TSFG 3K5NA 4LF4O 3E89A 3JALA 3BPZA 2CTRA 2P22C 5B1NA 3NXSA 1Z5VA 2HP8A 2JEXA 2EINB 5ITZA 3L73H 1SQVH 2Z5UA 5GONB 4FM0A 3B2EE 2GBOA 4CC6A 2YIBD 5B5EZ 2RCVA 3ZHRA 5CN0A 4CH5A 1NI8A 1Z5WA 1PM9A 1HNWB 2VQFB 1F4MA 4J7ZA 1B06A 3C90A 3FAVB 1N33B 2LJ2A 2Q8VA 2ODMA 1JQ0A 3H1KH 1BE3H 3ZHUA 1Q6UA 1QQCA 5FNVA 1YJNV 1K8AW 4E4EA 4WBNA 4X64O 3H1JH 3K08A 1EFRG 1FFXA 1AP6A 4DR2B 2ZE5A 2EIMB 2UXDB 5JJEB 1K3EA 5IJ0A 4X65O 1Q3EA 3QO8A 3VQXA 3H1IH 5GONA 3TXSA 5GTIZ 2IH1C 1EN4A 1ZWIC 3K79A 4CS4A 4U7OA 2X6AA 3B40A 5EBWC 3DGEA 3W7SA 4OPAA 1COWG 3SJAC 4LF8O 2ZIOA 5JJNB 1SQFA 3RYHB 5JQGB 1XNRB 1JFFB 1J95A 1YCIA 3AG2B 2DQ3A 1AB3A 4LF9B 3UO2A 4FLWA 1KP3A 3P3PA 1Q81W 2QWRB 3CCEV 2E5LO 3CEIA 1OCCB 5KUKA 5LBQA 3BA8A 4LF6B 4JAUA 3WG7B 5TISZ 2BTQA 2JGUA 1H2SB 3CCVV 1YJ9V 1YZBA 1Y67A 4RWUA 1Q6HA 4P2ZA 1DK1A 4PA7A 2X6CA 2ATKC 3RGBA 2WLHA 1IBKB 1IXBA 2ZDIA 2EIKB 1VF7A 1P7GA 1US6A 3D3QA 2ZXWB 1GN2A 1Z2GA 3GB7C 3JCUZ 4XDJA 4Z2WA 3TETA 4ABMA 1Q7YW 2AZ2A 4NKGB 1SQGA 2WLMA 2VRZA 3BABA 4TQDA 2E3CA 3QG5A 3H1LH 4DV2O 3I5DA 5HFMA 1K5QA 2L35A 4JI1B 1XOUA 2LFSA 2R70A 4X66O 1TVKB 1Y6XA 1VMGA 3RYFA 3CC2V 3BHPA 1BHAA 1IBLO 1GM7A 3GWOA 2Y0PA 1MA1A 3SPIA 1V55B 2DYSC 3X2QC 4NTXA 4NXMB 3AG3C 2PUSA 5CA1A 3T1YB 1KC8W 1XNQB 3CP1A 3G67A 4JI2B 1ENVA 1EM1A 1M90W 3BCCH 1FD9A 3AK3A 3B8NA 4DR7O 4Q6GA 2PTMA 5KLVH 2Q68A 1ZL8A 2EIJB 4BWAA 4L8JA 3SGIA 2WWWA 3G6EV 3JAWB 1YIJV 2AZ0A 3U0ZA 3K0DA 1R73A 4OGQB 5BR8B 4J41A 2IW5A
chains in the Genus database with same CATH topology
2JK5C 1I5XA 4H33A 3ZIAG 1QBZA 3K9AA 4MS2A 1AI5A 3FB5C 1G4YB 1F51A 1JVMA 1K7DA 3AG4B 5L3EA 3T4ZA 1K4CC 3SJQC 1KP2A 1QR9A 4HZ3A 4MTGA 5B3SB 4PA3A 2AHYA 5IY5B 5L3GA 2XAQA 1G8MA 2EILB 2UXNA 5B1BC 4EKWA 3SYPA 3ABLB 2A9HA 4ZBMA 1VQKV 3D36A 5L3CA 1FFTB 4UXNA 1F23A 4JF3A 3FYEB 2P90A 2WPDG 1KKDA 4MTXA 2XAGA 1L1FA 2Q67A 4PDVA 2EIMC 3T1CA 1PNLA 1NR1A 2QTOA 3FYIB 1PNKA 4J9ZB 3ETEA 3F5WC 3G71V 5LHHA 4ASUG 1AR1B 2QKSA 3OUSA 1PNMA 1K5SA 1XL4A 3ZRXA 4RUFA 2WLJA 2HFEC 3CPWU 2JJ1G 5CBGA 1YTFD 3LNMB 2XNDG 1GKFA 1VQLV 2DYRB 4BW5A 3OW2U 3JD4A 3E2EA 1RPRA 3B8MA 3ASOB 4JYCA 2Y48A 4KUMA 3VBBA 2ITDC 1IXMA 3MHHC 1GMGA 3CC4V 2IU0A 3ZN0A 1MSWD 4UVAA 3UM7A 4Z1MG 3I56V 1Y66A 4F4LA 1MG1A 3AG2C 5HFLA 3ZRWA 4H37A 1E79G 1VQMV 1KQSU 1WPXA 3E8FA 3ETDA 3E35A 4Q20A 2PI5A 1OCRC 2Y69B 4R7CA 3CYOA 3OE7G 1ROPA 4QE9A 2JDIG 2XAJA 1AI4A 5H6QA 4RAIA 1JJ2U 1E1RG 1Y4MA 2HVKC 3SPHA 1NH2D 5IY5C 1K34A 1OCCC 2JJ2G 5LHIA 5CMUA 1K73W 3WG7C 2EJRA 3ABTA 2FTKA 5C93A 3E86A 4QIWF 1NJIW 3ZRSA 4JTAB 2KB1A 2X6BA 2ZD9A 1MOFA 1F4NA 2WAMA 4HAMA 3ABKB 3ETGA 3SYAA 3T4DA 1OCZB 5EBLC 4XDKA 1KD1W 3BY6A 2W6IG 3ABMC 3AEIA 4N21A 3QO5A 1WLEA 4RQEA 1H8HG 4TT3G 2IJJA 1M56C 2OTLV 4JTCB 4MTOA 2EBOA 2DWDC 1NBMG 1PL0A 2EIKC 1PKXA 3JD3A 2R9RB 4BAYA 3JD1A 1R3LC 3UKMA 1W2BU 2ZXWC 4QNHB 3H01A 3OMNB 4DXWA 3F7YC 3CCUV 3K3WA 1R6KA 4X89A 3F7VC 4GCZA 4G27B 1MABG 1M9NA 1THZA 1YI2V 1VQPV 4YXWG 3OGCC 3SPJA 4J9YB 4N23A 1DLBA 4GX0A 4JTDB 4P9PA 4DO2A 3ZMUA 3JCZA 1JCHA 3OR6C 2JIZG 2BOCC 4QPKA 2WLLB 3SPGA 1OHHG 1RPOA 3RVZA 1B6QA 4P30A 4MVSA 1S76D 5KA6A 5CBHA 2WLIA 2HLDG 5EC1C 4UVBA 1AJNA 3IGAC 3SYCA 4LCUC 1NH2B 2W6JG 4PA6A 1M57C 1QVGU 4PDLA 4I5SA 4L87A 1NVPB 3CCQV 3LDEA 1S72V 1H2GA 3AG1B 1QVFU 2HG5C 2IJIA 3E8HA 1VQOV 1P4RA 4GT1A 2HVJC 3DTUB 1CPYA 1V54B 1RM1C 1UJWB 1QLEC 5DM6V 1AJQA 3RW0A 3CXCU 2OCCC 3WFVA 1V55C 5IYCO 3BEHA 2DW4A 4UUJC 5H9CA 5GW7A 1SESA 4PA9A 2EZPA 3SYQA 3VOUA 3ZMZA 1DTOA 1YSCA 2PI4A 3ASNB 1K4DC 4MVQA 3JYCA 2NLJC 4FIPC 2BOBC 3QO7A 1AI6A 4WFEA 4R8CA 5EC2C 1R3JC 4WFFA 3OMIB 4FPPA 1KECA 2EZOA 2EIJC 4HYOA 1N8RW 4RO2A 4TSFG 1GM8A 1ORQC 3ZRVA 3E89A 5BZBA 3QNEA 5IYBO 1BL8A 4JGSA 2DYSB 3X2QB 5B1NA 3NXSA 4FK5C 3AG3B 1NQTA 1OCOC 4WFBV 2JEXA 2EINB 2C2AA 1H38A 5B1AC 3E8GA 4MSWC 3CCMV 2Z5UA 1QLNA 3OR7C 1QR8A 1JPXA 2OT5A 2YEVB 1FXVA 5B1OA 2M7WA 3LSSA 4R50A 3AG4C 2X7RB 4WF9V 2K1EA 1AJPA 2GHYA 3OEEG 5CN0A 5B3SC 1EZJA 5H6RA 3RBZA 4GX1A 1R3IC 3JD2A 2EILC 1YITV 1NVPD 1SETA 1S3JA 4FJCC 3ABLC 1F4MA 3IC7A 4RUEA 2W0FC 1AI7A 3A0RA 1S0VA 1GO3F 2GSMB 3LDCA 2WLNA 2ZR3A 4PDRA 1VQ8V 2NNUA 2X0LA 4MVZA 5CA3A 5EBMC 1PD3A 2QE7G 3MHSC 1W0JG 2HKOA 2ITCC 1JQ0A 3OMAB 4OXSA 1SZTA 2XASA 2IU3A 2QA4V 1GK9A 5LGTA 5J9PC 3STLC 3W7WA 1YJNV 5B1BB 1H8EG 1K8AW 5IDJA 1VQ9V 1GM9A 4ZKIA 4TWKA 4QE7A 1YHQV 2DYRC 4KP4A 2F43G 3FB8C 3P30A 3KG2A 3K08A 3CMEV 3I55V 3ASOC 3FKSG 2P67A 3MD0A 1FXKB 1EFRG 1NKDA 3EHBB 3OUFA 2EIMB 3T2MA 2CK3G 3W7XA 5FL7G 5CBFA 1K3EA 4GX2A 3CCLV 1BHBA 4R6ZA 4JPRA 2R9IA 3QO8A 2Z3YA 2Y69C 4XBFA 3CCJV 1SRYA 3CD6V 4P9OA 5KUMA 2IH1C 1R6NA 1ZWIC 3K79A 4MVUA 3ZN1A 2Q6AA 2X6AA 4U7OA 2YSUB 5EBWC 2MK3A 3DGEA 4LBEC 3W7SA 1COWG 2B5UA 4UVCA 4WFHA 3E8BA 1Q82W 2DWEC 2XAHA 3ZRWB 3SYOA 3ABKC 5L3FA 1J95A 3AG2B 1DF4A 3OEHG 2DQ3A 1OCZC 2IJKA 2HR3A 2A0LA 3ZMTA 1KP3A 5DN6G 1TUEB 1Q81W 1OCRB 4XDLA 3K0GA 1GTOA 3W7TA 3OFNG 3CCEV 2V1DA 2Q69A 1JOYA 3FB6C 1CEZA 3CCSV 1S77D 4LP8A 1K97A 3LUTB 3ABUA 5LHGA 1VQ6V 1OCCB 1K33A 5KUKA 5LBQA 2V7QG 1R3KC 3EFFK 4JAUA 3WG7B 4CZZA 3G4SV 1HWYA 1M1KW 4GX5A 3CCVV 1YJ9V 4G28B 5IYDO 1VQ5V 3P32A 4G2KA 1FXKC 4PELA 1AROP 4FMTA 1K9MW 1FXKA 4P2ZA 1P7BA 3ABMB 4JAVA 4PA7A 2X6CA 4U7NA 4MVOA 2ATKC 4PA4A 4WFGA 2WLHA 3LSQA 5KA5A 1M56B 2ZDIC 4MT8A 3RVYA 3OM3B 1Q86W 2B1GA 2ZDIA 3CC7V 2D3OW 2LP7A 2EIKB 2WLLA 2QM8A 1K92A 1E1QG 3K04A 4MVRA 4I9WA 2ZXWB 4UV9A 4MVMA 3GB7C 5EK0A 2HJFC 4XDJA 3TETA 2JEUA 4UV8A 1NR7A 4BIZA 3CMAV 1DF5A 4MW3A 1I5YA 2A79B 2B1IA 3TCUA 1OZ0A 1Q7YW 1EBOA 3AG1C 2WLMA 4X88A 3ZMSA 3ML0A 4WCEV 1VQ4V 3E83A 1V54C 1FS0G 3K03A 3ZJZA 3M99B 3ZMVA 1JX9A 4LC1A 2WLIB 3D3IA 4QPJA 5HFMA 1K5QA 3K06A 2LFRA 1S5HC 2LFSA 3OAAG 2ZR2A 3SPCA 3HB3B 2QEXV 3B77A 3ASNC 1M57B 2IJHA 2WSSG 2XOKG 5E1AC 3HPLC 2IH3C 2P6JA 1FXHA 4RQFA 3CC2V 2QM7A 3STZC 2WLKA 1BHAA 3R65A 1SERA 4KFMA 2AHZA 4JYBA 1YJWV 1GM7A 4QJFB 3GWOA 1RM1B 1QLEB 3IFXA 4WFAV 3ZCCA 2DQ0A 3LDDA 3SPIA 2OCCB 5L3BA 4MTFA 1V55B 2DYSC 3X2QC 1CP9A 2OTJV 4PDMA 3AG3C 5LGNA 2EINC 2H94A 1KC8W 4E2LA 3CP1A 4BIUA 1ENVA 3JD0A 1M90W 1LNQA 3W7UA 3B8NA 4CBCA 1BMFG 2H8PC 2XAFA 1YTFB 5L3DA 2UXXA 2YEVA 3PJSK 2ZQMA 3FB7C 3TK1A 1XL6A 2Q68A 2EIJB 1VQNV 4X8AA 1W0KG 3CCRV 1VQ7V 2WWWA 3G6EV 1YIJV 2P7TC 4MW8A 3K0DA 1R73A 4JASA 1QCEA 1OCOB 2IW5A 5B1AB 5LGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA V;  1K73 W;  1K9M W;  5DM6 V;  1YIT V;  1Q81 W;  3CXC U;  3CCJ V;  1YJN V;  1M90 W;  3CC4 V;  1K8A W;  1W2B U;  3CC2 V;  1NJI W;  1Q7Y W;  3CCE V;  1VQ9 V;  3CD6 V;  1YHQ V;  3CCU V;  4WCE V;  3I56 V;  3CCS V;  4WFB V;  1VQ4 V;  1KQS U;  1VQM V;  3CME V;  3G71 V;  1YJW V;  3CCM V;  3I55 V;  1Q86 W;  1VQP V;  1VQN V;  1YI2 V;  1VQ6 V;  1QVG U;  3CC7 V;  2D3O W;  1KD1 W;  4WFA V;  3CCR V;  1VQ8 V;  1VQ7 V;  3G4S V;  3G6E V;  3CCQ V;  1YIJ V;  2OTJ V;  1M1K W;  3CPW U;  1S72 V;  1Q82 W;  1R73 A;  3CCV V;  1YJ9 V;  1QVF U;  3CCL V;  4WF9 V;  1VQL V;  1VQK V;  1VQO V;  1JJ2 U;  1VQ5 V;  3OW2 U;  2OTL V;  1KC8 W;  2QA4 V;  2QEX V;  1N8R W; 
#chains in the Genus database with same CATH topology
 2JK5 C;  1I5X A;  5FPO A;  1QBZ A;  5EZY B;  4MS2 A;  1G4Y B;  4IT5 A;  1K7D A;  2YIA A;  4JYA O;  4O2B A;  4IGG A;  4HZ3 A;  4K0K O;  3RT3 C;  2AHY A;  2EIL B;  2UXN A;  2Q73 A;  3SYP A;  2A9H A;  4X20 B;  3B09 A;  1KKD A;  3FYE B;  1KMI Z;  2XAG A;  3EXA A;  4J11 A;  3FYI B;  3ETE A;  3G71 V;  1N36 B;  4DR4 B;  3JAM N;  1O9G A;  3JAT B;  1NTZ H;  3RFR A;  3CPW U;  5CBG A;  5J2U A;  2XND G;  2DYR B;  1VAR A;  1Y76 B;  3ETQ A;  1EZV H;  3B8M A;  4PI2 A;  1UPG A;  4JYC A;  2ZNI A;  2Q4P A;  3CHX A;  2CGN A;  3MHH C;  2IU0 A;  3T1H B;  2QTS A;  1BCC H;  1HNW O;  5LOV A;  2VQF O;  3UM7 A;  3AK1 A;  5LXT A;  1MG1 A;  2UXC O;  4Q20 A;  1N33 O;  3OE7 G;  1TAE A;  2OWO A;  1WJZ A;  1E1R G;  3ZHS A;  5IY5 C;  4DR5 B;  1Y74 A;  1H2N A;  1K73 W;  2EJR A;  3ABT A;  2FTK A;  5C93 A;  3VQV A;  4QIW F;  3ZRS A;  4JTA B;  1MOF A;  5LMU O;  2RMK B;  2WAM A;  3T4D A;  1OCZ B;  4XDK A;  3BY6 A;  4DR2 O;  2UXD O;  4IYH A;  1H8H G;  2JVD A;  5LYJ A;  4JTC B;  1F7Y A;  5KX5 B;  4FFB A;  3JD3 A;  3RYC B;  3APQ A;  3UKM A;  3CJH A;  1XI1 A;  1R6K A;  4GCZ A;  2Y4T A;  3UT5 A;  3WB0 A;  1XMO B;  4FLT A;  2P4V A;  2GTS A;  4H13 B;  4J9Y B;  3KZI Z;  3KCY A;  3ZMU A;  1JCH A;  4NXN B;  4DYL A;  2BOC C;  4NYK A;  4CH3 A;  1XNR O;  4U3J A;  4LF9 O;  3M8A A;  1VF6 C;  3ZHQ A;  3ZHV A;  2YUA A;  1G6U A;  3IGA C;  3SYC A;  1NH2 B;  1M57 C;  4PDL A;  1NVP B;  4LF6 O;  1VF5 B;  3AK2 A;  1H2G A;  4DR6 B;  2HG5 C;  1PP9 H;  3N27 A;  1YVW A;  1OJH A;  3DTU B;  1UJW B;  4NVP A;  3CXC U;  2OCC C;  3O9O A;  1SZX A;  3BEH A;  3N2K A;  4FZ1 A;  4LH6 A;  5H9C A;  3BFR A;  4DRX B;  4FZ0 A;  1IBK O;  1YSC A;  4EFB A;  1L0L H;  3JAS B;  4MVQ A;  2DJV A;  2ETN A;  4DV4 B;  4NTY A;  1ORQ C;  5IYB O;  1M93 A;  5BXZ A;  1BL8 A;  4JGS A;  5IYZ A;  1WAZ A;  4FK5 C;  1OCO C;  5LA6 B;  4WFB V;  2ZIM A;  3KCX A;  2ADP A;  3E8G A;  3CCM V;  4X62 B;  1QLN A;  1L0N H;  1QR8 A;  1N32 O;  4DV7 O;  4R50 A;  3AG4 C;  5JH7 A;  4YHH O;  1SA0 A;  3OEE G;  1WB7 A;  3RBZ A;  4IIJ B;  5FLX N;  3JAR A;  4LNU B;  4O4I B;  1NVP D;  1SET A;  2BSK B;  1SC5 B;  4GYC B;  3IC7 A;  1S0V A;  4PDR A;  3HKD B;  3QVN A;  4NB5 A;  1VQ8 V;  2NNU A;  4MVZ A;  1WP7 A;  1D5N A;  3MHS C;  1W0J G;  2HKO A;  2ITC C;  4OXS A;  4NXM O;  1SZT A;  2IU3 A;  2ZE8 A;  2QA4 V;  3U10 A;  1GK9 A;  3T1Y O;  1XNQ O;  4JI2 O;  4UCU A;  1QU7 A;  1VQ9 V;  2Q7G A;  1AP5 A;  4TWK A;  4QE7 A;  4DK1 A;  3TXQ A;  2F43 G;  1ZUQ A;  4LF5 B;  4PV1 B;  3KG2 A;  3CME V;  1MNG A;  3ASO C;  1FXK B;  2YI9 A;  3OUF A;  2CK3 G;  5CBF A;  1B3Q A;  2A06 H;  4OX9 O;  5EIB C;  2FL4 A;  3CS5 A;  1BHB A;  4HNA B;  4R6Z A;  5BR8 O;  4O4H B;  2R9I A;  2VWK A;  4JYY A;  2JS5 A;  1HDJ A;  3FFQ A;  3SR2 C;  2UU9 O;  1P84 F;  4MVU A;  3ZN1 A;  2FYU H;  4FVM A;  3J81 N;  5C8Y A;  1Q82 W;  2R9A A;  5BMV B;  2CTQ A;  4JI5 B;  4I50 B;  2Z0A A;  1HR0 B;  3ZMT A;  2EX3 A;  4JZ2 A;  1OCR B;  3K0G A;  1GTO A;  2V1D A;  3RN4 A;  2Q69 A;  3FB6 C;  1CEZ A;  3VQY A;  1S77 D;  1K97 A;  3H9V A;  3DSQ A;  4DR4 O;  2V7Q G;  1R3K C;  3SJB C;  4G28 B;  1VQ5 V;  3P32 A;  1HNX B;  4G2K A;  4O4L B;  3G6B A;  4FMT A;  1FXK A;  1P7B A;  3T1H O;  2ZDI C;  3L71 H;  1IBM B;  5AG2 A;  3BRC A;  5CB4 A;  2D3O W;  2OIG A;  5D5Q A;  4ZI7 B;  2B9Z A;  2QM8 A;  1E1Q G;  3N2G B;  5DEC A;  3O65 A;  3VQW A;  2YIB A;  3C3S A;  5JVD B;  2JEU A;  4AI8 A;  2PY5 A;  4BIZ A;  4CH4 A;  3CMA V;  1DF5 A;  4MW3 A;  2DOS A;  4DR5 O;  2DMX A;  5EYP B;  1OZ0 A;  5JJJ B;  1SF9 A;  1EBO A;  2CAZ C;  4X88 A;  1XIL A;  3ZMS A;  4D7T A;  2BTO A;  4I50 A;  3K03 A;  2QR4 A;  2YDE A;  4EFE A;  4BIO A;  3ZJZ A;  3M99 B;  4TUY B;  2WLI B;  1GH6 A;  3J7A U;  1U96 A;  2LFR A;  4X1I A;  1S5H C;  3OAA G;  1Q6I A;  3SPC A;  1W59 A;  3ASN C;  2HEP A;  2R72 A;  5E1A C;  3HPL C;  4FM1 A;  4RQF A;  3STZ C;  2WLK A;  1SER A;  5KHI A;  5LP6 B;  2OCH A;  4CC5 A;  1B04 A;  1RM1 B;  1G1X B;  2QDO A;  4WFA V;  3ZCC A;  1XMO O;  1CP9 A;  2PYL A;  1GN3 A;  4PDM A;  1XMQ B;  3RYI B;  2H94 A;  5FPR A;  2WA4 A;  1LNQ A;  2CUG A;  1YTF B;  5L3D A;  2P06 A;  5CA0 B;  1I08 A;  4DR1 B;  1XEQ A;  1N34 B;  3CCR V;  4MW8 A;  1WA8 B;  4J7J A;  5EIB D;  4DR6 O;  1QCE A;  4K8X A;  5LGU A;  4JV5 B;  2LO1 A;  1JJO A;  3FAV A;  2QJ1 A;  3K9A A;  4F6R B;  3FB5 C;  2CH7 B;  4DR3 B;  4B3T B;  1JVM A;  1GRJ A;  3OTF A;  1K4C C;  3C3T A;  1KP2 A;  3SJQ C;  3T4Z A;  3CRM A;  5IJ9 B;  1I94 B;  4O4J B;  5B1B C;  4EKW A;  3J80 N;  1VQK V;  5L3C A;  4JF3 A;  4MTX A;  1L1F A;  4DV4 O;  4IHJ B;  4PJ0 Z;  1YXB A;  3T1C A;  1PNL A;  1TA8 A;  5K1P A;  4OPH A;  5JWP A;  4DV1 B;  3HKE B;  4J9Z B;  4LFC B;  4PI0 A;  2F1M A;  2F4V B;  1NT2 B;  4X62 O;  2QKS A;  1K5S A;  4QGP A;  4RUF A;  2HFE C;  4F6E A;  1V9P A;  3E22 B;  1YTF D;  1S5L Z;  1VQL V;  1PL4 A;  3JD4 A;  4LWS B;  1RPR A;  4GZR B;  4TV9 B;  3K57 A;  1NTM H;  2PF4 E;  1IXM A;  1GMG A;  2UUC B;  3U11 A;  4UVA A;  1Q90 D;  3CRQ A;  3DC6 A;  4Z1M G;  3RYH A;  4F4L A;  1YDX A;  5JQG A;  1VQM V;  1JFF A;  3E8F A;  4JI3 B;  2UUB B;  5BY1 A;  4QE9 A;  2JDI G;  2XAJ A;  3UO3 A;  3SPH A;  4JI0 O;  5CMU A;  3CWB H;  1BT8 A;  2FKX A;  3E86 A;  1NJI W;  1H2K A;  1GN4 A;  4K3A A;  1VEW A;  3LNN A;  4PD4 F;  4LF5 O;  2FB5 A;  2YXY A;  1RP3 B;  2PGG A;  2NN4 A;  3ABM C;  4IHJ A;  4N21 A;  5B66 Z;  1BZK A;  4NR1 A;  1I0H A;  1WLE A;  2IJJ A;  1M56 C;  2OTL V;  1H2M A;  1SQX H;  3DXR B;  1MZF A;  1ZX3 A;  3F7V C;  1ZTE A;  4G27 B;  2PYJ A;  3OGC C;  3SPJ A;  4TV9 A;  4PHZ A;  1DLB A;  4P9P A;  3JCZ A;  3OR6 C;  2JIZ G;  4JI5 O;  4I4T B;  2WLL B;  3IC9 A;  3ZS8 C;  1HR0 O;  2ZM6 O;  3JSN A;  3S3X A;  5KA6 A;  2W0X A;  4YY3 B;  1KB9 F;  4YJ3 B;  2HLD G;  1AJN A;  4LCU C;  4LFA B;  3GVM A;  4PA6 A;  4LFB B;  4I5S A;  1TVK A;  1NTK H;  3E8H A;  2ZT9 B;  1KUQ A;  1ZSP A;  2HVJ C;  1CPY A;  1HNX O;  3HKC B;  1QLE C;  1AJQ A;  3RW0 A;  2A7W A;  4UUJ C;  2DW4 A;  3A2F A;  1LUV A;  3SYQ A;  4B08 A;  3ZMZ A;  1DTO A;  5KMG B;  2CTW A;  4NTW A;  4J10 A;  1K4D C;  4EB6 B;  4DV3 B;  1PV0 A;  2YXH A;  4IYI A;  3QO7 A;  3A8T A;  1AI6 A;  2EZO A;  4UB8 Z;  5BZB A;  1WNS A;  3Q4H B;  2DYS B;  3SDL A;  3X2Q B;  4DUZ B;  2KG7 B;  1NU1 H;  3JAW A;  2IM9 A;  1NQT A;  3AG3 B;  4JI4 B;  2C2A A;  5B1A C;  4MSW C;  3OR7 C;  1A32 A;  4FLX A;  1JPX A;  1NS1 A;  1FXV A;  2YEV B;  2M7W A;  5EZY A;  2X7R B;  2GHY A;  5B3S C;  4GX1 A;  3JD2 A;  1YIT V;  4FJC C;  1TUB B;  3ABL C;  4RUE A;  1AI7 A;  5DED A;  3ZX6 A;  1GO3 F;  2GSM B;  3L70 H;  3LDC A;  4X20 A;  1KBH A;  2X0L A;  1XQ8 A;  5EBM C;  2QE7 G;  2F93 B;  5JCO C;  3BA9 A;  1XMQ O;  2XAS A;  1JMK C;  1KKC A;  5LGT A;  3S3W A;  5KMG A;  4UCO A;  2AGA A;  5J9P C;  5IDJ A;  1GM9 A;  2Q0O C;  3JAT A;  2ARH A;  3P30 A;  4ZHQ B;  2O57 A;  4JZG A;  3I55 V;  1Y76 A;  2P67 A;  1NKD A;  1N34 O;  1FKA O;  3CCL V;  5H5N A;  3CSX A;  1MMM A;  2Z3Y A;  2Y69 C;  3CCJ V;  4BW9 A;  4DR3 O;  4B3T O;  5KUM A;  1D5A A;  2Q9L A;  1HNZ B;  4I9Q A;  1R6T A;  2Q6A A;  3L9D A;  2YSU B;  2LGW A;  4YIP A;  4TV8 B;  2B5U A;  2V4D A;  2N05 A;  4HBN A;  4WFH A;  3E8B A;  4UVC A;  3F5T A;  2DWE C;  3ZRW B;  2HJD A;  1TUB A;  3SYO A;  3ABK C;  1M5I A;  2GUZ B;  2IJK A;  2LW1 A;  2A0L A;  5DN6 G;  2RJZ A;  3W7T A;  3OFN G;  1JOY A;  4FLV A;  4O2A B;  3CCS V;  4LP8 A;  3LUT B;  4LFC O;  1VQ6 V;  4W4K A;  4LF8 B;  2F4V O;  4CZZ A;  5LMN B;  5KX5 A;  3OGI B;  1QHT A;  3G4S V;  4A5U B;  1M1K W;  3RYC A;  4J42 A;  4LF7 B;  4JI6 B;  1FXK C;  1K9M W;  4JAV A;  3CB2 A;  4B7K A;  4MVO A;  4PA4 A;  2UUC O;  4WFG A;  4B3S B;  5KHJ A;  3LSQ A;  3RVY A;  3OM3 B;  4DV6 B;  2B1G A;  3CC7 V;  2LP7 A;  1K92 A;  3K04 A;  4JI3 O;  1HP8 A;  4MVR A;  4AQY B;  2UUB O;  5IT9 N;  4MVM A;  5EK0 A;  2HJF C;  2GDS A;  4JI1 O;  4KL1 A;  1N0J A;  4UV8 A;  1NR7 A;  1SQQ H;  2B1I A;  3BAA A;  2Y0I A;  2P4K A;  3TCU A;  4I0X B;  3MAQ A;  3AG1 C;  3ML0 A;  1VQ4 V;  3E83 A;  4K8Z A;  4FM2 A;  1V54 C;  2YS8 A;  2M6Y A;  4UCT A;  1JX9 A;  4LC1 A;  4QPJ A;  3K06 A;  4D6T H;  1IVS A;  4DRX A;  2QEX V;  4X1K B;  1L8D A;  1M57 B;  2CGO A;  2WSS G;  2XOK G;  1FXH A;  3JAS A;  2XT9 A;  4ZOL B;  4KFM A;  2VWJ A;  1YJW V;  4B3R B;  3JAK B;  4DV2 B;  4GKK B;  2JGD B;  5L3B A;  2OCC B;  4MTF A;  1JA8 A;  2EJ7 A;  4X66 B;  5LGN A;  3THO A;  2EIN C;  2H3O A;  3IAY A;  3OTO B;  5LA6 A;  1DGS A;  4LH7 A;  4D7S A;  1RSO B;  3W7U A;  4CBC A;  1BMF G;  1YEW A;  2H8P C;  2XHB A;  2ZQM A;  3FB7 C;  3TK1 A;  1XL6 A;  3JAL B;  1VQN V;  4LFA O;  4LFB O;  4IIJ A;  2P7T C;  1NZ6 A;  4LNU A;  4O4I A;  4JAS A;  2QGN A;  5IWA B;  5ITZ B;  2BSK A;  1OCO B;  2DN9 A;  4UFZ A;  3ZIA G;  2BCC H;  1AI5 A;  3HKD A;  2ADQ B;  3AG4 B;  4MTG A;  3JSL A;  1N36 O;  1G8M A;  4DV3 O;  3MDS A;  2BE3 A;  2UXB B;  4GUN A;  3NR7 A;  3D36 A;  1F23 A;  2P90 A;  2WPD G;  2ZE7 A;  3ICX A;  2EIM C;  1FYJ A;  4DUZ O;  4K0K B;  1PNK A;  2CDY A;  3F5W C;  5FNV B;  4CH6 A;  4JI4 O;  4HNA A;  4KXR A;  4ASU G;  1P49 A;  3OUS A;  4O4H A;  1XL4 A;  3ZRX A;  4WBN B;  1RSO A;  2WLJ A;  2ZKO A;  2JJ1 G;  2WA3 A;  2EUL A;  1GKF A;  4BW5 A;  1FFX B;  1AVM A;  3ASO B;  2Y48 A;  4KUM A;  3VBB A;  4CS3 A;  5IJ0 B;  2RN9 A;  3CX5 F;  3I56 V;  1Y66 A;  2CTP A;  3AG2 C;  4I7Z B;  5HFL A;  1Q43 A;  4H37 A;  1KQS U;  5BMV A;  1WPX A;  2PI5 A;  4R7C A;  3CYO A;  3TJT A;  1ROP A;  4Z1V A;  1OCC C;  5LHI A;  3WG7 C;  2KB1 A;  2UXC B;  2X6B A;  2ZD9 A;  3FD9 A;  5EBL C;  1KD1 W;  2W6I G;  3AEI A;  4O4L A;  4RQE A;  2RQ6 A;  4MTO A;  2GV9 A;  4NXN O;  1NBM G;  4H0L B;  1PL0 A;  2EIK C;  2BTQ B;  1PKX A;  4AHC A;  4DUY B;  4BAY A;  2ZIN A;  3JD1 A;  3RWR D;  1W2B U;  2ZXW C;  4ZI7 A;  5LMU B;  3OMN B;  2L6L A;  1ZAU A;  3CCU V;  3K3W A;  4W4L A;  4DV0 B;  3N2G A;  1HNZ O;  1MAB G;  4YXW G;  5JVD A;  4N23 A;  2ZE6 A;  4DO2 A;  3FX7 A;  5EYP A;  3WB1 A;  2Q5Z A;  3SPG A;  3H1H H;  1EN5 A;  3RVZ A;  4P30 A;  4MVS A;  5GTH Z;  5IE9 A;  1KYO F;  5CBH A;  4TUY A;  1SS3 A;  2WLI A;  5EC1 C;  1BQ0 A;  4FLY A;  2FML A;  1QVG U;  1UFI A;  3GWK C;  2YC0 A;  2HHH B;  2LQT A;  5LMN O;  4GKJ B;  3LDE A;  1SQB H;  1WN7 A;  1J5E B;  1AIL A;  2IJI A;  1VQO V;  1P4R A;  2IBZ H;  2Q7H A;  4LF7 O;  4JI6 O;  1X59 A;  5LP6 A;  4TQF A;  2N04 A;  1V55 C;  5IYC O;  1BS3 A;  4B3S O;  5E79 Z;  5GW7 A;  3VOU A;  2EZP A;  4ICG A;  1FPO A;  2PI4 A;  3RYI A;  3ASN B;  4DV6 O;  3RYF B;  4JI8 B;  2NLJ C;  4FIP C;  1X4T A;  3CE2 A;  4AQY O;  3OMI B;  4FPP A;  1KEC A;  2EIJ C;  5D5P A;  4HYO A;  1N8R W;  2A3Q A;  4RO2 A;  1GM8 A;  4LR3 A;  3ZRV A;  2UUA B;  5CA0 A;  3QNE A;  3UQ8 A;  5KHK A;  5CA1 B;  2LW7 A;  3DC5 A;  3TGU H;  1WA8 A;  2GTA A;  1H38 A;  1I7F A;  2JS3 A;  1Q5O A;  3L75 H;  1VIB A;  4UCV A;  4EEQ A;  2OT5 A;  3AG7 A;  5B1O A;  2QWQ B;  3LSS A;  4F6R A;  1ZL8 B;  2CH7 A;  4WF9 V;  2K1E A;  1AJP A;  2RNB A;  1EZJ A;  5H6R A;  1R3I C;  5IJ9 A;  4U3F H;  5H2F Z;  2EIL C;  1S3J A;  4O4J A;  2MW2 B;  4JI7 B;  2W0F C;  3A0R A;  3SJC C;  1H2L A;  1N0N A;  2WLN A;  4B3R O;  2ZR3 A;  1AR5 A;  3D8C A;  1N32 B;  1LUW A;  4DV7 B;  4GKK O;  3L72 H;  5CA3 A;  4FFK A;  1PD3 A;  4O2B B;  4YHH B;  1FAF A;  3OMA B;  4UCS A;  1XRE A;  3HKE A;  3OTO O;  3STL C;  3W7W A;  5B1B B;  1H8E G;  1WPB A;  4ZKI A;  1YHQ V;  4FLU A;  4KHP B;  2DYR C;  1URF A;  3P3N A;  3G80 A;  4KP4 A;  3E22 A;  3FB8 C;  3FKS G;  3MD0 A;  4LWS A;  5KAI Z;  3EHB B;  2DE0 X;  3ZBH A;  3T2M A;  3W7X A;  5FL7 G;  4GX2 A;  1FJG B;  4X1Y B;  3B4S A;  5IWA O;  4JPR A;  1R1B A;  4XBF A;  5J2U B;  4DV5 B;  1SRY A;  4H44 B;  3CD6 V;  3OT7 A;  4P9O A;  1R6N A;  2F66 C;  3APO A;  5J2T B;  4IL6 Z;  2MK3 A;  4LBE C;  2K9P A;  2OIE A;  5LOV B;  4OX9 B;  3K5O A;  5LXT B;  1M4U A;  2XAH A;  2UXB O;  2PZS A;  5L3F A;  1WP8 A;  1DF4 A;  3OEH G;  4DW0 A;  1OCZ C;  2HR3 A;  4K35 A;  1TUE B;  2Y4U A;  5KHG A;  4XDL A;  2UU9 B;  1YF2 A;  4J7K A;  4B3M B;  1XBL A;  1Y74 B;  5KAF Z;  3ABU A;  5LHG A;  1K33 A;  1IBM O;  3OD4 A;  3EFF K;  1HWY A;  3DXR A;  2VQE B;  4GX5 A;  5IYD O;  3CRR A;  1S5J A;  4PEL A;  2ILM A;  1ARO P;  1GAX A;  2F95 B;  3ABM B;  3K5L A;  2AXT Z;  5LYJ B;  2P5O A;  4U7N A;  4ZIB A;  4FFB B;  5KA5 A;  1M56 B;  4MT8 A;  4X1Y A;  1Q86 W;  3CJH B;  4BR6 A;  4I4T A;  2WLL A;  2QM4 A;  1OV9 A;  4I9W A;  4UV9 A;  2KKW A;  4DK0 A;  1BQZ A;  3UT5 B;  2Q0A A;  4DW1 A;  2ZCE A;  3CRA A;  4LF4 B;  4YJ3 A;  5J2T A;  2N74 A;  1I5Y A;  1CXZ B;  2A79 B;  1SQP H;  1VP7 A;  4U3J B;  4WCE V;  1FS0 G;  1RFY A;  1BGY H;  3HKC A;  4J80 A;  3M7M X;  3ZMV A;  1Q8I A;  3CRC A;  3D3I A;  1HW7 A;  5A2Q N;  3HKB B;  3WB2 A;  2KQX A;  2ZR2 A;  3HB3 B;  3HR0 A;  2E74 B;  5LL6 Y;  3B77 A;  2IJH A;  2CE4 A;  4CS2 A;  4DUY O;  2IH3 C;  2P6J A;  4C7U A;  2KSD A;  4EB6 A;  2QKA A;  2QM7 A;  4DV0 O;  3R65 A;  4UB6 Z;  3WU2 Z;  1IDS A;  2AHZ A;  4JYB A;  4QJF B;  1QLE B;  3IFX A;  3N2K B;  2DQ0 A;  2XTA A;  2RDC A;  4DR1 O;  3LDD A;  2OTJ V;  3UCS C;  2QKC A;  1IX9 A;  3Q4H A;  1EN6 A;  2KG7 A;  5K1X A;  4E2L A;  3K59 A;  4BIU A;  1XHZ A;  3BVO A;  3JD0 A;  4JV5 O;  2E76 B;  2XAF A;  1AR4 A;  2VS0 A;  2UXX A;  2YEV A;  3PJS K;  4X64 B;  4X8A A;  1W0K G;  5IYZ B;  1VQ7 V;  1O9H A;  2HHH O;  1I94 O;  4GKJ O;  2G38 A;  4B7E A;  1XHX A;  1J5E O;  2YIC A;  4X65 B;  5B1A B;  2NR5 A;  4H33 A;  1D2D A;  3K5M A;  5JH7 B;  1F51 A;  1WB8 A;  1SA0 B;  3HKB A;  5L3E A;  3R66 A;  4DV1 O;  1QR9 A;  3JAR B;  1QNM A;  5B3S B;  4PA3 A;  5IY5 B;  5L3G A;  2XAQ A;  4JI8 O;  5F2V O;  2QSA A;  1ZLZ A;  3D36 C;  3ABL B;  4ZBM A;  4TOI A;  1FFT B;  4UXN A;  3L74 H;  2YI8 A;  2Q67 A;  4ZHQ A;  4PDV A;  2UUA O;  1NR1 A;  3CXH F;  2QTO A;  3EVK A;  2OYQ A;  2E5L B;  4AIL C;  4UCR A;  5LHH A;  1AR1 B;  1PNM A;  4GLX A;  3LNM B;  3OW2 U;  3E2E A;  4YIO A;  4JAA A;  2E75 B;  2ITD C;  3CC4 V;  3ZN0 A;  1MSW D;  4TV8 A;  3K58 A;  1MZE A;  1JR9 A;  4JI7 O;  4X9Q A;  3ZRW A;  1E79 G;  1PPJ H;  3ETD A;  2GUZ A;  3E35 A;  1OCR C;  2Y69 B;  5A9G A;  1AI4 A;  5H6Q A;  4RAI A;  1JJ2 U;  1Y4M A;  2HVK C;  1NH2 D;  2LGQ A;  1K34 A;  4O2A A;  2JJ2 G;  1BSM A;  5C8Y B;  2YID A;  1SKV A;  1XDC A;  1LR1 A;  3A0H Z;  4KHP O;  1F4N A;  4HAM A;  3ABK B;  3ETG A;  2Q7E A;  3SYA A;  2YXL A;  3ZHT A;  3ZED A;  3QO5 A;  1IZ3 A;  4YJ2 B;  4TT3 G;  1FJG O;  4JI0 B;  2EBO A;  2DWD C;  4I55 B;  5JCO A;  2AW9 A;  2R9R B;  1R3L C;  3IJ4 A;  4QNH B;  3H01 A;  4DV5 O;  4DXW A;  3F7Y C;  1IBL B;  4FLZ A;  4X89 A;  3K9S A;  4YY3 O;  1THZ A;  1M9N A;  1YI2 V;  1VQP V;  2D2C B;  3A0B Z;  1XUQ A;  4GX0 A;  3LSU A;  2ZNJ A;  4JTD B;  4I0X A;  5CB4 B;  4QPK A;  3KKY A;  1OHH G;  1T5E A;  2QWO B;  1RPO A;  1B6Q A;  4DR7 B;  1S76 D;  5KHH A;  1IUR A;  3QF7 A;  1KU9 A;  2QWP B;  4UVB A;  1VF6 A;  2W6J G;  4B3M O;  3PN1 A;  4L87 A;  4X1K A;  3CCQ V;  1S72 V;  3AG1 B;  2VQE O;  1QVF U;  5LP6 C;  4GT1 A;  2ZM6 B;  4ZOL A;  1V54 B;  1RM1 C;  2QWN B;  5DM6 V;  3JAK A;  3WFV A;  4X1I B;  2JGD A;  1MSD A;  2JRI A;  4JYA B;  4YJ2 A;  1SES A;  4PA9 A;  2F23 A;  1N4C A;  2XUM A;  4I55 A;  1GN6 A;  1U97 A;  3JYC A;  2BOB C;  4WFE A;  3QTC A;  4R8C A;  5EC2 C;  1R3J C;  4WFF A;  1TGO A;  4TSF G;  3K5N A;  4LF4 O;  3E89 A;  3JAL A;  3BPZ A;  2CTR A;  2P22 C;  5B1N A;  3NXS A;  1Z5V A;  2HP8 A;  2JEX A;  2EIN B;  5ITZ A;  3L73 H;  1SQV H;  2Z5U A;  5GON B;  4FM0 A;  3B2E E;  2GBO A;  4CC6 A;  2YIB D;  5B5E Z;  2RCV A;  3ZHR A;  5CN0 A;  4CH5 A;  1NI8 A;  1Z5W A;  1PM9 A;  1HNW B;  2VQF B;  1F4M A;  4J7Z A;  1B06 A;  3C90 A;  3FAV B;  1N33 B;  2LJ2 A;  2Q8V A;  2ODM A;  1JQ0 A;  3H1K H;  1BE3 H;  3ZHU A;  1Q6U A;  1QQC A;  5FNV A;  1YJN V;  1K8A W;  4E4E A;  4WBN A;  4X64 O;  3H1J H;  3K08 A;  1EFR G;  1FFX A;  1AP6 A;  4DR2 B;  2ZE5 A;  2EIM B;  2UXD B;  5JJE B;  1K3E A;  5IJ0 A;  4X65 O;  1Q3E A;  3QO8 A;  3VQX A;  3H1I H;  5GON A;  3TXS A;  5GTI Z;  2IH1 C;  1EN4 A;  1ZWI C;  3K79 A;  4CS4 A;  4U7O A;  2X6A A;  3B40 A;  5EBW C;  3DGE A;  3W7S A;  4OPA A;  1COW G;  3SJA C;  4LF8 O;  2ZIO A;  5JJN B;  1SQF A;  3RYH B;  5JQG B;  1XNR B;  1JFF B;  1J95 A;  1YCI A;  3AG2 B;  2DQ3 A;  1AB3 A;  4LF9 B;  3UO2 A;  4FLW A;  1KP3 A;  3P3P A;  1Q81 W;  2QWR B;  3CCE V;  2E5L O;  3CEI A;  1OCC B;  5KUK A;  5LBQ A;  3BA8 A;  4LF6 B;  4JAU A;  3WG7 B;  5TIS Z;  2BTQ A;  2JGU A;  1H2S B;  3CCV V;  1YJ9 V;  1YZB A;  1Y67 A;  4RWU A;  1Q6H A;  4P2Z A;  1DK1 A;  4PA7 A;  2X6C A;  2ATK C;  3RGB A;  2WLH A;  1IBK B;  1IXB A;  2ZDI A;  2EIK B;  1VF7 A;  1P7G A;  1US6 A;  3D3Q A;  2ZXW B;  1GN2 A;  1Z2G A;  3GB7 C;  3JCU Z;  4XDJ A;  4Z2W A;  3TET A;  4ABM A;  1Q7Y W;  2AZ2 A;  4NKG B;  1SQG A;  2WLM A;  2VRZ A;  3BAB A;  4TQD A;  2E3C A;  3QG5 A;  3H1L H;  4DV2 O;  3I5D A;  5HFM A;  1K5Q A;  2L35 A;  4JI1 B;  1XOU A;  2LFS A;  2R70 A;  4X66 O;  1TVK B;  1Y6X A;  1VMG A;  3RYF A;  3CC2 V;  3BHP A;  1BHA A;  1IBL O;  1GM7 A;  3GWO A;  2Y0P A;  1MA1 A;  3SPI A;  1V55 B;  2DYS C;  3X2Q C;  4NTX A;  4NXM B;  3AG3 C;  2PUS A;  5CA1 A;  3T1Y B;  1KC8 W;  1XNQ B;  3CP1 A;  3G67 A;  4JI2 B;  1ENV A;  1EM1 A;  1M90 W;  3BCC H;  1FD9 A;  3AK3 A;  3B8N A;  4DR7 O;  4Q6G A;  2PTM A;  5KLV H;  2Q68 A;  1ZL8 A;  2EIJ B;  4BWA A;  4L8J A;  3SGI A;  2WWW A;  3G6E V;  3JAW B;  1YIJ V;  2AZ0 A;  3U0Z A;  3K0D A;  1R73 A;  4OGQ B;  5BR8 B;  4J41 A;  2IW5 A; 
#chains in the Genus database with same CATH homology
 2JK5 C;  1I5X A;  4H33 A;  3ZIA G;  1QBZ A;  3K9A A;  4MS2 A;  1AI5 A;  3FB5 C;  1G4Y B;  1F51 A;  1JVM A;  1K7D A;  3AG4 B;  5L3E A;  3T4Z A;  1K4C C;  3SJQ C;  1KP2 A;  1QR9 A;  4HZ3 A;  4MTG A;  5B3S B;  4PA3 A;  2AHY A;  5IY5 B;  5L3G A;  2XAQ A;  1G8M A;  2EIL B;  2UXN A;  5B1B C;  4EKW A;  3SYP A;  3ABL B;  2A9H A;  4ZBM A;  1VQK V;  3D36 A;  5L3C A;  1FFT B;  4UXN A;  1F23 A;  4JF3 A;  3FYE B;  2P90 A;  2WPD G;  1KKD A;  4MTX A;  2XAG A;  1L1F A;  2Q67 A;  4PDV A;  2EIM C;  3T1C A;  1PNL A;  1NR1 A;  2QTO A;  3FYI B;  1PNK A;  4J9Z B;  3ETE A;  3F5W C;  3G71 V;  5LHH A;  4ASU G;  1AR1 B;  2QKS A;  3OUS A;  1PNM A;  1K5S A;  1XL4 A;  3ZRX A;  4RUF A;  2WLJ A;  2HFE C;  3CPW U;  2JJ1 G;  5CBG A;  1YTF D;  3LNM B;  2XND G;  1GKF A;  1VQL V;  2DYR B;  4BW5 A;  3OW2 U;  3JD4 A;  3E2E A;  1RPR A;  3B8M A;  3ASO B;  4JYC A;  2Y48 A;  4KUM A;  3VBB A;  2ITD C;  1IXM A;  3MHH C;  1GMG A;  3CC4 V;  2IU0 A;  3ZN0 A;  1MSW D;  4UVA A;  3UM7 A;  4Z1M G;  3I56 V;  1Y66 A;  4F4L A;  1MG1 A;  3AG2 C;  5HFL A;  3ZRW A;  4H37 A;  1E79 G;  1VQM V;  1KQS U;  1WPX A;  3E8F A;  3ETD A;  3E35 A;  4Q20 A;  2PI5 A;  1OCR C;  2Y69 B;  4R7C A;  3CYO A;  3OE7 G;  1ROP A;  4QE9 A;  2JDI G;  2XAJ A;  1AI4 A;  5H6Q A;  4RAI A;  1JJ2 U;  1E1R G;  1Y4M A;  2HVK C;  3SPH A;  1NH2 D;  5IY5 C;  1K34 A;  1OCC C;  2JJ2 G;  5LHI A;  5CMU A;  1K73 W;  3WG7 C;  2EJR A;  3ABT A;  2FTK A;  5C93 A;  3E86 A;  4QIW F;  1NJI W;  3ZRS A;  4JTA B;  2KB1 A;  2X6B A;  2ZD9 A;  1MOF A;  1F4N A;  2WAM A;  4HAM A;  3ABK B;  3ETG A;  3SYA A;  3T4D A;  1OCZ B;  5EBL C;  4XDK A;  1KD1 W;  3BY6 A;  2W6I G;  3ABM C;  3AEI A;  4N21 A;  3QO5 A;  1WLE A;  4RQE A;  1H8H G;  4TT3 G;  2IJJ A;  1M56 C;  2OTL V;  4JTC B;  4MTO A;  2EBO A;  2DWD C;  1NBM G;  1PL0 A;  2EIK C;  1PKX A;  3JD3 A;  2R9R B;  4BAY A;  3JD1 A;  1R3L C;  3UKM A;  1W2B U;  2ZXW C;  4QNH B;  3H01 A;  3OMN B;  4DXW A;  3F7Y C;  3CCU V;  3K3W A;  1R6K A;  4X89 A;  3F7V C;  4GCZ A;  4G27 B;  1MAB G;  1M9N A;  1THZ A;  1YI2 V;  1VQP V;  4YXW G;  3OGC C;  3SPJ A;  4J9Y B;  4N23 A;  1DLB A;  4GX0 A;  4JTD B;  4P9P A;  4DO2 A;  3ZMU A;  3JCZ A;  1JCH A;  3OR6 C;  2JIZ G;  2BOC C;  4QPK A;  2WLL B;  3SPG A;  1OHH G;  1RPO A;  3RVZ A;  1B6Q A;  4P30 A;  4MVS A;  1S76 D;  5KA6 A;  5CBH A;  2WLI A;  2HLD G;  5EC1 C;  4UVB A;  1AJN A;  3IGA C;  3SYC A;  4LCU C;  1NH2 B;  2W6J G;  4PA6 A;  1M57 C;  1QVG U;  4PDL A;  4I5S A;  4L87 A;  1NVP B;  3CCQ V;  3LDE A;  1S72 V;  1H2G A;  3AG1 B;  1QVF U;  2HG5 C;  2IJI A;  3E8H A;  1VQO V;  1P4R A;  4GT1 A;  2HVJ C;  3DTU B;  1CPY A;  1V54 B;  1RM1 C;  1UJW B;  1QLE C;  5DM6 V;  1AJQ A;  3RW0 A;  3CXC U;  2OCC C;  3WFV A;  1V55 C;  5IYC O;  3BEH A;  2DW4 A;  4UUJ C;  5H9C A;  5GW7 A;  1SES A;  4PA9 A;  2EZP A;  3SYQ A;  3VOU A;  3ZMZ A;  1DTO A;  1YSC A;  2PI4 A;  3ASN B;  1K4D C;  4MVQ A;  3JYC A;  2NLJ C;  4FIP C;  2BOB C;  3QO7 A;  1AI6 A;  4WFE A;  4R8C A;  5EC2 C;  1R3J C;  4WFF A;  3OMI B;  4FPP A;  1KEC A;  2EZO A;  2EIJ C;  4HYO A;  1N8R W;  4RO2 A;  4TSF G;  1GM8 A;  1ORQ C;  3ZRV A;  3E89 A;  5BZB A;  3QNE A;  5IYB O;  1BL8 A;  4JGS A;  2DYS B;  3X2Q B;  5B1N A;  3NXS A;  4FK5 C;  3AG3 B;  1NQT A;  1OCO C;  4WFB V;  2JEX A;  2EIN B;  2C2A A;  1H38 A;  5B1A C;  3E8G A;  4MSW C;  3CCM V;  2Z5U A;  1QLN A;  3OR7 C;  1QR8 A;  1JPX A;  2OT5 A;  2YEV B;  1FXV A;  5B1O A;  2M7W A;  3LSS A;  4R50 A;  3AG4 C;  2X7R B;  4WF9 V;  2K1E A;  1AJP A;  2GHY A;  3OEE G;  5CN0 A;  5B3S C;  1EZJ A;  5H6R A;  3RBZ A;  4GX1 A;  1R3I C;  3JD2 A;  2EIL C;  1YIT V;  1NVP D;  1SET A;  1S3J A;  4FJC C;  3ABL C;  1F4M A;  3IC7 A;  4RUE A;  2W0F C;  1AI7 A;  3A0R A;  1S0V A;  1GO3 F;  2GSM B;  3LDC A;  2WLN A;  2ZR3 A;  4PDR A;  1VQ8 V;  2NNU A;  2X0L A;  4MVZ A;  5CA3 A;  5EBM C;  1PD3 A;  2QE7 G;  3MHS C;  1W0J G;  2HKO A;  2ITC C;  1JQ0 A;  3OMA B;  4OXS A;  1SZT A;  2XAS A;  2IU3 A;  2QA4 V;  1GK9 A;  5LGT A;  5J9P C;  3STL C;  3W7W A;  1YJN V;  5B1B B;  1H8E G;  1K8A W;  5IDJ A;  1VQ9 V;  1GM9 A;  4ZKI A;  4TWK A;  4QE7 A;  1YHQ V;  2DYR C;  4KP4 A;  2F43 G;  3FB8 C;  3P30 A;  3KG2 A;  3K08 A;  3CME V;  3I55 V;  3ASO C;  3FKS G;  2P67 A;  3MD0 A;  1FXK B;  1EFR G;  1NKD A;  3EHB B;  3OUF A;  2EIM B;  3T2M A;  2CK3 G;  3W7X A;  5FL7 G;  5CBF A;  1K3E A;  4GX2 A;  3CCL V;  1BHB A;  4R6Z A;  4JPR A;  2R9I A;  3QO8 A;  2Z3Y A;  2Y69 C;  4XBF A;  3CCJ V;  1SRY A;  3CD6 V;  4P9O A;  5KUM A;  2IH1 C;  1R6N A;  1ZWI C;  3K79 A;  4MVU A;  3ZN1 A;  2Q6A A;  2X6A A;  4U7O A;  2YSU B;  5EBW C;  2MK3 A;  3DGE A;  4LBE C;  3W7S A;  1COW G;  2B5U A;  4UVC A;  4WFH A;  3E8B A;  1Q82 W;  2DWE C;  2XAH A;  3ZRW B;  3SYO A;  3ABK C;  5L3F A;  1J95 A;  3AG2 B;  1DF4 A;  3OEH G;  2DQ3 A;  1OCZ C;  2IJK A;  2HR3 A;  2A0L A;  3ZMT A;  1KP3 A;  5DN6 G;  1TUE B;  1Q81 W;  1OCR B;  4XDL A;  3K0G A;  1GTO A;  3W7T A;  3OFN G;  3CCE V;  2V1D A;  2Q69 A;  1JOY A;  3FB6 C;  1CEZ A;  3CCS V;  1S77 D;  4LP8 A;  1K97 A;  3LUT B;  3ABU A;  5LHG A;  1VQ6 V;  1OCC B;  1K33 A;  5KUK A;  5LBQ A;  2V7Q G;  1R3K C;  3EFF K;  4JAU A;  3WG7 B;  4CZZ A;  3G4S V;  1HWY A;  1M1K W;  4GX5 A;  3CCV V;  1YJ9 V;  4G28 B;  5IYD O;  1VQ5 V;  3P32 A;  4G2K A;  1FXK C;  4PEL A;  1ARO P;  4FMT A;  1K9M W;  1FXK A;  4P2Z A;  1P7B A;  3ABM B;  4JAV A;  4PA7 A;  2X6C A;  4U7N A;  4MVO A;  2ATK C;  4PA4 A;  4WFG A;  2WLH A;  3LSQ A;  5KA5 A;  1M56 B;  2ZDI C;  4MT8 A;  3RVY A;  3OM3 B;  1Q86 W;  2B1G A;  2ZDI A;  3CC7 V;  2D3O W;  2LP7 A;  2EIK B;  2WLL A;  2QM8 A;  1K92 A;  1E1Q G;  3K04 A;  4MVR A;  4I9W A;  2ZXW B;  4UV9 A;  4MVM A;  3GB7 C;  5EK0 A;  2HJF C;  4XDJ A;  3TET A;  2JEU A;  4UV8 A;  1NR7 A;  4BIZ A;  3CMA V;  1DF5 A;  4MW3 A;  1I5Y A;  2A79 B;  2B1I A;  3TCU A;  1OZ0 A;  1Q7Y W;  1EBO A;  3AG1 C;  2WLM A;  4X88 A;  3ZMS A;  3ML0 A;  4WCE V;  1VQ4 V;  3E83 A;  1V54 C;  1FS0 G;  3K03 A;  3ZJZ A;  3M99 B;  3ZMV A;  1JX9 A;  4LC1 A;  2WLI B;  3D3I A;  4QPJ A;  5HFM A;  1K5Q A;  3K06 A;  2LFR A;  1S5H C;  2LFS A;  3OAA G;  2ZR2 A;  3SPC A;  3HB3 B;  2QEX V;  3B77 A;  3ASN C;  1M57 B;  2IJH A;  2WSS G;  2XOK G;  5E1A C;  3HPL C;  2IH3 C;  2P6J A;  1FXH A;  4RQF A;  3CC2 V;  2QM7 A;  3STZ C;  2WLK A;  1BHA A;  3R65 A;  1SER A;  4KFM A;  2AHZ A;  4JYB A;  1YJW V;  1GM7 A;  4QJF B;  3GWO A;  1RM1 B;  1QLE B;  3IFX A;  4WFA V;  3ZCC A;  2DQ0 A;  3LDD A;  3SPI A;  2OCC B;  5L3B A;  4MTF A;  1V55 B;  2DYS C;  3X2Q C;  1CP9 A;  2OTJ V;  4PDM A;  3AG3 C;  5LGN A;  2EIN C;  2H94 A;  1KC8 W;  4E2L A;  3CP1 A;  4BIU A;  1ENV A;  3JD0 A;  1M90 W;  1LNQ A;  3W7U A;  3B8N A;  4CBC A;  1BMF G;  2H8P C;  2XAF A;  1YTF B;  5L3D A;  2UXX A;  2YEV A;  3PJS K;  2ZQM A;  3FB7 C;  3TK1 A;  1XL6 A;  2Q68 A;  2EIJ B;  1VQN V;  4X8A A;  1W0K G;  3CCR V;  1VQ7 V;  2WWW A;  3G6E V;  1YIJ V;  2P7T C;  4MW8 A;  3K0D A;  1R73 A;  4JAS A;  1QCE A;  1OCO B;  2IW5 A;  5B1A B;  5LGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...