1S72V

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s72V00
1VQ7V 1Q86W 1JJ2U 2D3OW 1KD1W 1M90W 1KC8W 3CMAV 1Q81W 2QEXV 1YIJV 2QA4V 1M1KW 3OW2U 1Q82W 1K73W 1VQLV 1QVGU 1VQ9V 1NJIW 1VQ4V 3CCLV 2OTLV 1VQ6V 1VQ5V 3CCVV 4WFBV 3CCMV 3CCRV 1YHQV 1S72V 3G6EV 1R73A 5DM6V 4WF9V 3CPWU 3CCUV 3CC7V 1YITV 4WFAV 1K9MW 2OTJV 1VQ8V 1VQNV 1Q7YW 1YJNV 3G4SV 1VQMV 1K8AW 3CCEV 3CCJV 3CD6V 1W2BU 1VQPV 1KQSU 1YJ9V 1VQKV 3CCQV 1VQOV 1YI2V 3I55V 1YJWV 1QVFU 3CCSV 3CXCU 4WCEV 3CMEV 3G71V 3CC4V 3CC2V 3I56V 1N8RW
chains in the Genus database with same CATH superfamily
1RPOA 4EB6A 3B4SA 4MTFA 1DK1A 2GV9A 2UU9O 3AG3B 1VQ6V 4F6RA 4CH3A 5IYZB 4BW5A 3B09A 3CCUV 1IBLB 2F4VO 2Q7GA 2RNBA 5KMGB 4X66O 4IHJB 3STZC 3T1HB 1OCZB 2MW2B 1YXBA 4FFBA 4X65O 1E79G 4I4TA 3KCXA 3SYQA 5CA1B 5IWAB 4K8XA 2Q7HA 1R3KC 2WLNA 2QJ1A 3KCYA 1MSWD 3TXSA 4HBNA 2RJZA 1V55B 2QWNB 3W7TA 1JMKC 3G67A 1CPYA 1OJHA 1IBMO 1MA1A 3RN4A 1N8RW 1AROP 2GDSA 1QCEA 2Y48A 1JVMA 4F4LA 2CUGA 4NKGB 1I94B 1HNWB 3D36C 5EBMC 4DRXB 4JI5O 2YEVB 2X0LA 1P49A 2V4DA 4J7ZA 5EYPB 3DXRA 4KP4A 3U11A 2EJRA 5B1AB 3HKBB 4I9QA 4O4IB 2AGAA 3OEHG 5GONA 1FFXA 4I50A 3LUTB 1OCRC 1VQ9V 1LNQA 3ZIAG 4F6RB 1L0LH 1FKAO 1WLEA 4HYOA 2PI5A 3F5WC 3F7YC 2ZDIC 3SPGA 1SQXH 2GUZA 4LNUA 4K3AA 3SJBC 2IU3A 4TT3G 4X66B 4RQFA 3D8CA 3MHHC 4CH5A 4FFBB 4O4JB 4GKJO 2RCVA 4I4TB 2EZPA 1OCCB 4G28B 3MHSC 2ZCEA 1US6A 1TA8A 1XMOB 3ABMB 3JD1A 4TV9B 4QPJA 2QE7G 2PUSA 5EC2C 2WLLB 2AXTZ 5L3CA 1I7FA 2E74B 3OTOO 2Y69C 1PM9A 3JSNA 2ETNA 5BXZA 4JYAB 2L35A 1H8HG 1HDJA 1YF2A 4LF8O 2Q0OC 3G4SV 4NXNO 2A7WA 5L3BA 1XMQO 1SQBH 3ZX6A 1MZFA 3DXRB 1OCOB 3BCCH 2ITCC 2ZNIA 3DC5A 2VQFO 3ZEDA 4RWUA 2DJVA 5GONB 2YI9A 2IW5A 4J11A 3TGUH 3L70H 3DGEA 1M57B 1VF5B 3WG7B 5KUKA 3E8FA 2E5LO 1N0NA 4PA7A 2EX3A 2YICA 1OCZC 1Q3EA 1NTKH 4BR6A 5B1OA 1Q90D 3ZRWA 5KAIZ 3SYAA 3RW0A 1MG1A 1Y6XA 2QKAA 4ZKIA 2EBOA 1V55C 2OWOA 4TQFA 5B1BB 3QF7A 1K33A 1N34B 4H13B 1ZSPA 5JJJB 4N23A 4DV0B 4JI6O 1TVKA 2QWPB 2A3QA 1NH2B 4DUZO 3SJAC 3L72H 1NJIW 4FK5C 3J81N 1EM1A 3HKEA 2UXNA 3K9SA 1W0JG 4X1IA 3VBBA 1B3QA 5FL7G 4FFKA 4JI2O 4DR7O 1FS0G 1R6TA 4PJ0Z 3L71H 4OXSA 3OR6C 1GKFA 5JJEB 2JK5C 1CP9A 1GN3A 4GYCB 4JV5B 3B2EE 5GTHZ 4XBFA 3K58A 1WB8A 4P9OA 4YY3O 4J41A 4OPAA 1SQPH 2EINB 3HKDB 1VQPV 3WB2A 1H2LA 2H94A 2R9RB 4I55A 4JTAB 2CGNA 1GMGA 2JDIG 1H8EG 4DK1A 1KBHA 3SJCC 1JJOA 4K35A 4DR6B 3OGIB 2Q0AA 1YHQV 3ZRVA 2DYRB 3SPCA 3JAWA 1WP8A 1RFYA 3OUSA 3EXAA 2IJIA 5JVDA 3E35A 1V9PA 2E76B 2D3OW 2F93B 2LQTA 1K73W 3E89A 2NN4A 1XNRB 4TQDA 5KUMA 3HKEB 1GM9A 4A5UB 2Y0PA 5J2TB 1OCOC 2VS0A 4HNAA 3L74H 4X1IB 2OCHA 4JF3A 3CRCA 4UVBA 4CC5A 1JPXA 1M57C 3WG7C 2P4VA 2Y4TA 1KC8W 1A32A 1FPOA 2Z3YA 1NS1A 1SC5B 3CCVV 4X1YA 5KA6A 3EHBB 4X1KA 5CBHA 2A0LA 2LFSA 3ZJZA 3JARA 3K0DA 4D6TH 1D5AA 1VQKV 1J95A 1NBMG 3N2KA 4B3SB 5AG2A 1XQ8A 2P90A 3CC2V 1UFIA 1JX9A 2QGNA 5IY5B 2X6BA 5B1BC 3RYHA 4DV1O 2XAJA 5LA6B 2RDCA 1SQFA 1F51A 1VQ4V 3CJHB 4I0XA 4CZZA 3JAWB 4OPHA 4YJ3A 4DV3O 1XILA 2UXCB 1NQTA 4MW8A 3J7AU 4X89A 2LGQA 5JVDB 5LYJA 2ZKOA 4B08A 3RYCA 4DR1B 2AHZA 5DECA 1JA8A 3WU2Z 1R3LC 2JIZG 2YI8A 4DUYO 2UUBB 4LH6A 1SQVH 1XNQO 2XTAA 3RVZA 3FAVB 4DR4B 4TUYA 4LF7B 1BS3A 1FXKA 5KAFZ 1N32B 4JI1B 4R50A 1ZTEA 2R70A 4W4LA 2QEXV 4UCVA 5B3SC 1RSOA 3C3SA 1MABG 2WLHA 2Y0IA 4BIUA 4UCSA 2EINC 1F23A 4NYKA 4ZI7B 4CH6A 3DTUB 1GRJA 1V54C 2BTQA 3SYPA 1NVPB 3H1IH 1H2SB 5GW7A 2GTSA 1K8AW 2UUCO 3CD6V 1JCHA 1HR0B 2YDEA 3FD9A 4DV4O 1YJWV 1AJNA 5IJ0A 4L87A 3KZIZ 4QE7A 3UO2A 3ICXA 5EC1C 3RYHB 3VOUA 3LSUA 5LMUO 2XAQA 3M99B 1YTFB 3OFNG 4MTGA 3UM7A 5K1XA 4U3FH 4BWAA 4IYIA 1F4MA 4YIPA 5KLVH 4Z1MG 3IC7A 1EFRG 4RQEA 4DR5O 3ZMTA 5LYJB 2PYJA 3E8BA 3RYCB 1W0KG 1Y4MA 2FKXA 3HKCA 3T2MA 3CX5F 4WFHA 3KKYA 4FLWA 1QR9A 3OMAB 1N36O 5LGNA 2JEUA 2ZIOA 4LF5B 3AK2A 4LF9B 2Q68A 1S3JA 3FFQA 4TUYB 3RFRA 3WB1A 4IT5A 4J7KA 4FJCC 2W0FC 3JD3A 3THOA 4YIOA 4DV5O 4O2BB 3BVOA 3FB7C 4QE9A 1H2NA 4MW3A 2UXXA 5H9CA 4JZGA 1RSOB 2WLIB 4UCUA 2EILB 1IBLO 1XDCA 5IYZA 1ZL8B 4P9PA 5KA5A 3G6EV 2C2AA 3ABKC 2WSSG 4FZ1A 1H2GA 5FPOA 2EIJB 4YHHB 5KMGA 1IDSA 2JEXA 3CE2A 4O4HA 2YSUB 4ZIBA 3HR0A 4IHJA 2P22C 3OM3B 3W7SA 1Q86W 1VP7A 5IWAO 1ZX3A 2HG5C 1T5EA 1Q5OA 2EJ7A 5BR8B 1O9HA 1BE3H 1IBKB 4GCZA 1GN2A 1AR5A 3RVYA 2XASA 3T1YB 1EN6A 3X2QB 4E4EA 4ZBMA 1URFA 4GX1A 3W7XA 1S77D 4IGGA 1CXZB 4XDLA 5LHHA 3CWBH 2DQ0A 3FX7A 1SERA 1L0NH 4P2ZA 3WB0A 3K04A 4NB5A 4DR5B 1HNZO 1I94O 2QM7A 3G6BA 1HNWO 1YZBA 1IURA 1QVGU 3HKCB 2P6JA 2VWJA 3ZRSA 4B3TB 2NLJC 4IIJB 5CBGA 1H2KA 1K9MW 2AZ2A 3SDLA 1K4DC 3OMNB 3JALA 1P7GA 2UUAB 5L3GA 3S3WA 1SZTA 4B3MB 3HKBA 1X59A 3ASNC 4O4IA 5B66Z 1GN4A 4R8CA 4DV5B 3B8NA 2EIKB 4LFCB 2OTLV 3CCLV 3SPIA 2W6JG 4LFAO 1PD3A 1VF7A 2IBZH 3OT7A 3B8MA 4J80A 4KXRA 1R6KA 2W0XA 4Z2WA 1HNXB 4O4HB 2ODMA 2WPDG 2F66C 3E8HA 3P3PA 3ZN0A 5JJNB 4ZHQA 1BQ0A 4WFAV 5LOVB 2JJ2G 3ETEA 4LBEC 1M90W 4O4JA 1R3JC 1XMOO 1K5SA 3H9VA 4FLVA 3R65A 3C90A 4TV9A 4DW1A 4JI0B 3ZMSA 2WLLA 1QR8A 4UUJC 1FFTB 1ZAUA 1EBOA 4JPRA 4JYAO 3GWKC 1DGSA 5LMNB 2OIGA 1HNZB 1XUQA 1FXKC 4KHPB 4R7CA 4MVQA 3GWOA 2ZR3A 3ETQA 1GK9A 4LF4B 1N0JA 3JALB 3GVMA 2N74A 2Q5ZA 4FLZA 5A2QN 1Z5VA 1FD9A 5C8YB 1JOYA 4JI8B 1N33O 2EIJC 4KFMA 2PGGA 2ZXWB 5A9GA 4LFAB 1H2MA 2KSDA 4JYYA 1Y66A 2QDOA 4ZHQB 2P4KA 1PPJH 2KQXA 2VRZA 5EZYA 1XEQA 1R6NA 2E75B 2DW4A 4JI3B 1N34O 2WLMA 2ARHA 1PV0A 2BOCC 4DV0O 1TGOA 4X88A 2WLKA 4AHCA 2N04A 2IM9A 5LHGA 4GKKB 5TISZ 2B5UA 4UXNA 1Q7YW 3B40A 2R9IA 2ZQMA 4P30A 4W4KA 2M6YA 3CCMV 2YIBA 5E1AC 2F43G 4NTYA 2F95B 5LP6A 4NVPA 2LFRA 5HFLA 5DN6G 3AG2C 2MK3A 3I55V 1GH6A 3J80N 1XI1A 5D5QA 4R6ZA 4X8AA 4DR2O 3AG3C 2KKWA 3IFXA 3BEHA 3BABA 2Z0AA 1AR1B 1P7BA 5J2UB 4JV5O 3QO7A 2HHHB 5FLXN 4TV8B 1VQ8V 1Q43A 5KHGA 1N33B 1BT8A 1ORQC 3JASB 5F2VO 2ZE8A 1AI5A 2ADQB 3HKDA 5EIBC 4U7OA 1D2DA 4UCTA 3RT3C 3BY6A 1YI2V 1QLEB 4DR6O 3CMAV 4JZ2A 5EZYB 5IYBO 1GO3F 3I5DA 3T4ZA 1VQNV 3ZBHA 1WPXA 2YIDA 3TETA 3N2GA 4UB6Z 3K9AA 1ROPA 3DC6A 1RP3B 2R9AA 5C93A 1PKXA 3CCSV 3K5NA 4L8JA 2QR4A 2WAMA 2KB1A 5IYCO 2QA4V 1XNRO 4DV6B 2BSKB 1Y74B 2HJDA 3GB7C 1NR7A 2D2CB 1AP6A 4Q6GA 4QIWF 2ZM6B 4FLUA 3UKMA 5LP6B 5J2TA 5GTIZ 1VARA 4RUFA 5B1AC 4UFZA 2YC0A 2K1EA 1W2BU 1SKVA 2HVKC 4H37A 4JI4B 4DXWA 3F7VC 4LWSA 4CH4A 1CEZA 4KL1A 1RM1B 2X7RB 2OYQA 4DR2B 3FYIB 2A79B 2GBOA 1K4CC 4WF9V 4JTDB 4MVSA 1VQMV 4J10A 4B3SO 4ASUG 3C3TA 2A06H 4F6EA 3JCUZ 3JD2A 1OCCC 2CTPA 4MS2A 3N27A 2X6CA 3IC9A 3ABMC 1WA8B 1IX9A 4X20A 5LA6A 4GUNA 3BAAA 3CJHA 4RAIA 2UXCO 5JWPA 2UXDO 2HKOA 3AG4B 4BIOA 4TOIA 1RPRA 1PL4A 2ADPA 4JYBA 4PDVA 3N2GB 3OTFA 4OX9B 4DR1O 1QNMA 1ENVA 1H38A 4J42A 2ZIMA 3K3WA 2UUBO 5BY1A 3OW2U 4LF6B 1WB7A 2WA4A 1SF9A 5CA0B 3SJQC 4DR4O 5BZBA 4LF7O 5EBWC 3FAVA 1N32O 4JI1O 1M56B 2CH7B 3VQVA 3CCJV 1EZJA 1I0HA 1YCIA 3Q4HA 4MVZA 2R72A 4QNHB 4AILC 2ILMA 2GHYA 2IJKA 4LWSB 3SYOA 4BAYA 4LFBO 3KG2A 3ASOB 2Y4UA 1PP9H 1LR1A 2L6LA 4EKWA 1XREA 3UT5B 4ZI7A 1NZ6A 3CS5A 2Z5UA 1HR0O 2YXYA 1G1XB 2GTAA 2DOSA 1I5XA 3CP1A 3A8TA 2VWKA 1LUVA 1Q6IA 5KX5B 4X20B 3CSXA 2QTOA 4LR3A 1MMMA 1FXVA 4LCUC 2NNUA 3LSSA 1OHHG 2UXDB 2IJHA 1SETA 2XUMA 4UV9A 2RN9A 4PHZA 1VQ7V 1BZKA 3E22B 4JAAA 3JCZA 5LP6C 4LF5O 5L3FA 4LF9O 1FJGB 3LDCA 3P30A 5ITZA 2WA3A 2HFEC 2Q7EA 3E2EA 1AR4A 1GM8A 2GSMB 2XT9A 3Q4HB 1KP3A 1VMGA 2CDYA 1AI4A 4I5SA 4O2BA 5FPRA 3R66A 1KECA 5LL6Y 4J9YB 4WBNA 1AP5A 2WLIA 4H33A 3K79A 4WFBV 4YHHO 1ZL8A 2FL4A 2ZT9B 4LFBB 1D5NA 4AQYB 3K06A 4DV2O 4PI2A 1K5QA 2P67A 4MTOA 4EFBA 2Q73A 5IYDO 2YXHA 4X62B 3MDSA 1GM7A 4DK0A 2A9HA 5BR8O 2BOBC 4FZ0A 4MVUA 1IBKO 2DYRC 3AG4C 3M8AA 5CBFA 3T1YO 1G6UA 4LC1A 3SPJA 2ZR2A 3RBZA 4GX2A 1NI8A 2HP8A 1X4TA 2Q8VA 3QTCA 4N21A 5EK0A 2ZD9A 3ABLB 1AI6A 1XOUA 5BMVB 3PJSK 3CHXA 1TUEB 5LXTA 2W6IG 1Z2GA 4B3TO 4RO2A 2Q69A 1BGYH 1Y76A 2CTRA 3O65A 1M56C 1WNSA 2QWOB 4JASA 4IIJA 3A0BZ 5ITZB 4DYLA 2UUAO 1GAXA 1KKDA 1WJZA 3CCEV 4B3MO 5IDJA 3L73H 1COWG 2QM4A 5LBQA 3UO3A 3AK3A 1EN4A 3APQA 1UJWB 1UPGA 4QJFB 4LFCO 1DLBA 1IXBA 1I08A 3FB8C 1SQQH 2O57A 1BSMA 4WBNB 2QWQB 5KHIA 4GT1A 4B7EA 3CC7V 3OD4A 3JAKB 1HNXO 5JH7A 1KU9A 3IAYA 3ZHQA 4LP8A 4UVAA 4DV2B 2FMLA 4C7UA 5IY5C 5LOVA 3ZMVA 4PDLA 4DV7B 1W59A 4K8ZA 2ATKC 4PA3A 4JI0O 3JD4A 2P06A 2OTJV 4MTXA 4K0KB 1PNKA 1FYJA 5IJ9A 3K5OA 3L75H 2E3CA 3AG1B 5LMNO 1K34A 5CA3A 5LXTB 4MVOA 1Y76B 4KHPO 4PA4A 4LF4O 2VQEB 2QTSA 4B7KA 1GTOA 3LSQA 1SZXA 1QU7A 4X64B 4XDKA 3BA8A 1YJ9V 2FB5A 2ZNJA 3CCQV 2RMKB 5LGTA 2V1DA 3LNMB 4JI8O 1J5EB 3BHPA 4Z1VA 5C8YA 2UXBB 4IYHA 3RWRD 4X9QA 4CS3A 3ZCCA 3A0RA 1YDXA 2QWRB 5JH7B 3S3XA 1M5IA 4I7ZB 2EULA 4QGPA 2BE3A 3HPLC 1AVMA 3CMEV 3I56V 1B6QA 4JI3O 1Q82W 1AILA 1Z5WA 4U3JA 2P5OA 3PN1A 5IT9N 3ABLC 3QO8A 4GKKO 4PI0A 2RQ6A 4NXMB 2IH3C 5IJ9B 4NTWA 2LW7A 3ZHVA 1IVSA 1Q8IA 4ABMA 5KHKA 4WCEV 3LDEA 3UQ8A 2JS5A 5JQGA 4JI7B 4AI8A 3M7MX 1NVPD 2ZE7A 4JAVA 1ZUQA 1I5YA 4QPKA 2Q4PA 3WFVA 1HWYA 2K9PA 4FLXA 5LHIA 3JSLA 1PNMA 5IE9A 3JATA 1XHXA 2LGWA 2QSAA 3LDDA 1MSDA 2BTOA 1P84F 1YTFD 2HHHO 2EILC 4B3RB 1PNLA 2P7TC 1JFFB 4FM2A 4CC6A 5J2UA 1YSCA 3OEEG 2EZOA 4TV8A 4XDJA 4J9ZB 4O4LA 1F4NA 3JASA 2KG7B 4JGSA 2FYUH 1VF6A 1VQOV 1WN7A 4PDMA 2HLDG 3OAAG 3ETDA 3FB6C 2OT5A 2G38A 4EB6B 4MVRA 5CB4A 1WAZA 4PELA 2XOKG 3U10A 3X2QC 4PD4F 4U3JB 2UU9B 1S72V 1Q6HA 5L3DA 3EFFK 2LP7A 4J7JA 2F4VB 3AG1C 3AK1A 1SRYA 3D3QA 4PDRA 4D7TA 2FTKA 3ZHTA 3W7UA 4DW0A 4DV6O 5JQGB 4FLTA 2PF4E 2HVJC 1B06A 4ICGA 2BSKA 4X65B 3W7WA 2ZM6O 1Y74A 1VEWA 1JR9A 2QM8A 3MD0A 1B04A 1G4YB 3H1JH 3JATB 3K03A 4UVCA 4FM1A 4JI4O 1BCCH 1BHAA 2EIKC 3H1KH 1IBMB 1O9GA 4TSFG 3EVKA 3ZHRA 1VQLV 1OZ0A 4FMTA 2AZ0A 4E2LA 2IH1C 4O4LB 1NTZH 3SGIA 4U7NA 3SYCA 2LJ2A 1BMFG 1KKCA 4WFFA 1P4RA 4JI5B 5HFMA 1Y67A 1MOFA 3APOA 3TJTA 1HW7A 3IGAC 1FFXB 3G80A 4I50B 1G8MA 2CAZC 5CB4B 3IJ4A 1YVWA 4RUEA 1WA8A 1K7DA 2OCCB 4H44B 4OGQB 3BPZA 3O9OA 2CTWA 3K0GA 2GUZB 4LNUB 2PY5A 4OX9O 2YXLA 3CB2A 2PTMA 1QHTA 2XAGA 1R3IC 1THZA 4LF6O 4GX0A 1U96A 2JGDA 5J9PC 4CBCA 3BA9A 2QKSA 4GKJB 1EN5A 3E8GA 3P32A 5CA0A 1WP7A 4GLXA 3ZMUA 3JD0A 1IZ3A 1MZEA 5EIBD 2CH7A 1HP8A 3H1LH 2PYLA 1BQZA 3HB3B 3D3IA 3OTOB 4GX5A 4BW9A 4WFEA 2DYSB 4FIPC 2PZSA 2ZXWC 2XAHA 1PL0A 3CRAA 3STLC 3UT5A 3ZHSA 5FNVA 4Q20A 4WFGA 4LF8B 4NXNB 1XMQB 2Q67A 3AEIA 2DE0X 3QG5A 2HEPA 3FB5C 2B9ZA 2VQFB 5LGUA 2AW9A 2H3OA 5H6QA 1XBLA 5JCOA 3TCUA 3JAMN 5KX5A 3TXQA 3SPHA 5KHJA 1R73A 2NR5A 2XHBA 2IU0A 5B3SB 3JYCA 3K5MA 2DWEC 2E5LB 3ZN1A 4CS4A 4HAMA 1V54B 3CRRA 1K92A 1S5HC 1WPBA 2DWDC 1U97A 3ZRWB 4GZRB 3ZMZA 1KD1W 1M9NA 3E22A 1YIJV 2JGDB 1FJGO 1AI7A 2CK3G 1AB3A 1VIBA 2OIEA 2DQ3A 3OMIB 4PV1B 2DMXA 2DN9A 1TVKB 4FVMA 3SR2C 4D7SA 3OR7C 4JI6B 2AHYA 5B1NA 1BL8A 3OE7G 2IJJA 2ZE5A 4UB8Z 3CXHF 4DUZB 3E86A 2ZINA 4AQYO 5H6RA 2LW1A 1VF6C 4G27B 5FNVB 1N4CA 1DTOA 4X62O 1QLEC 4YJ2A 4JAUA 4H0LB 1DF5A 2OCCC 1YEWA 2CGOA 4JI2B 4DR7B 2JS3A 4ZOLA 4DR3O 2JGUA 2M7WA 1KUQA 2N05A 2CTQA 2EIMB 1TUBA 3NXSA 3ABKB 1L1FA 4YY3B 2CE4A 4FPPA 4NR1A 4I55B 5BMVA 2XAFA 4TWKA 4DO2A 1NTMH 1M93A 1E1QG 2X6AA 1EZVH 1QBZA 1XL4A 2Q9LA 3DSQA 1QQCA 1K97A 1ZWIC 1KQSU 3RYFA 2DYSC 3K08A 1NU1H 4JTCB 1LUWA 3F5TA 1RM1C 1QVFU 3ZS8C 5CMUA 1QLNA 5H2FZ 3ML0A 1SA0A 3H01A 1M4UA 4I9WA 1Q81W 1AJQA 1XHZA 3QVNA 5CN0A 1NKDA 5EBLC 3BFRA 4KUMA 2XNDG 2HJFC 3JAKA 5KHHA 4HNAB 1NH2D 3D36A 4YJ2B 3ETGA 1JQ0A 3LNNA 3K57A 4DV7O 1F7YA 3P3NA 5K1PA 2YIBD 3L9DA 1JJ2U 4EEQA 1KMIZ 3RYIA 4ZOLB 1Q6UA 3ASNB 4UV8A 4K0KO 4DR3B 4X1YB 1S0VA 1OV9A 1KB9F 1BHBA 4X1KB 3A0HZ 1YJNV 1AJPA 2WWWA 1TUBB 4YXWG 3VQXA 1TAEA 3JARB 4FLYA 2ZDIA 3N2KB 4BIZA 1S5JA 3TK1A 1GN6A 4LH7A 1M1KW 4UCOA 1DF4A 2VQEO 3VQWA 3ZRXA 3QNEA 4DV1B 4I0XB 4PA9A 5DM6V 3CPWU 4YJ3B 4X64O 1NT2B 4UCRA 1KYOF 3CRQA 4DV3B 3AG7A 3RYFB 5DEDA 1J5EO 4G2KA 3U0ZA 4MT8A 3ZHUA 2UXBO 3ASOC 1SA0B 2F23A 2Q6AA 3T4DA 3A2FA 4O2AA 3QO5A 3H1HH 2JRIA 3CCRV 2YS8A 4FM0A 4DUYB 3CYOA 1XNQB 1FXKB 2B1GA 3CEIA 2V7QG 3ABTA 4PA6A 3BRCA 2ITDC 2WLJA 4MVMA 5JCOC 2YIAA 1XL6A 1NR1A 4MSWC 1S5LZ 2JVDA 3MAQA 2EIMC 3RYIB 3FYEB 1VQ5V 3CRMA 4NXMO 1YITV 2HR3A 3E83A 1OCRB 2BTQB 1S76D 1KP2A 2QKCA 3T1HO 5L3EA 5E79Z 1IXMA 2UUCB 5IJ0B 4JI7O 2LO1A 2PI4A 3ABUA 4DV4B 2H8PC 1SQGA 1MNGA 5CA1A 3K59A 1R1BA 3NR7A 3B77A 1ZLZA 5LMUB 2ZE6A 4IL6Z 5D5PA 3T1CA 2JJ1G 2BCCH 3K5LA 3FKSG 4B3RO 3VQYA 3CXCU 3OUFA 3G71V 3CC4V 4CS2A 1JFFA 3UCSC 1FAFA 2Y69B 5B5EZ 4O2AB 1K3EA 4HZ3A 2YUAA 4DRXA 5H5NA 3RGBA 1N36B 1L8DA 2F1MA 4NTXA 2YEVA 2KG7A 3OGCC 5EYPA 1SS3A 1E1RG 4JYCA 4EFEA 1FXHA 1SESA 3AG2B 2B1IA
chains in the Genus database with same CATH topology
1RPOA 5EC1C 3K3WA 4MTFA 4TSFG 3AG3B 3OW2U 3VOUA 1VQLV 1VQ6V 1OZ0A 4FMTA 4E2LA 2IH1C 2XAQA 3SJQC 3M99B 4BW5A 1YTFB 3CCUV 3OFNG 4MTGA 5BZBA 3UM7A 5EBWC 4U7NA 3SYCA 1BMFG 1M56B 3CCJV 4WFFA 1F4MA 1EZJA 4Z1MG 1P4RA 3IC7A 4MVZA 1EFRG 5HFMA 3STZC 4QNHB 4RQEA 3ZMTA 1MOFA 2GHYA 1OCZB 2IJKA 3IGAC 3E8BA 3SYOA 4BAYA 1W0KG 1G8MA 1E79G 1Y4MA 3KG2A 4RUEA 3T2MA 1K7DA 3ASOB 3SYQA 4WFHA 2OCCB 1QR9A 3OMAB 5LGNA 2JEUA 4EKWA 1R3KC 2WLNA 1MSWD 3K0GA 2Q68A 2Z5UA 1V55B 1S3JA 3W7TA 1I5XA 1CPYA 4FJCC 3CP1A 2W0FC 3JD3A 3FB7C 4QE9A 2XAGA 1R3IC 1THZA 1N8RW 1AROP 4MW3A 2Y48A 1QCEA 4GX0A 2UXXA 1JVMA 4F4LA 5J9PC 5H9CA 4CBCA 2WLIB 2EILB 2QKSA 3E8GA 2QTOA 4QE7A 3P32A 4P9PA 5KA5A 5EBMC 3G6EV 2C2AA 3ABKC 2WSSG 1FXVA 3ZMUA 1H2GA 3JD0A 2EIJB 4LCUC 2NNUA 3LSSA 2YEVB 2X0LA 2JEXA 1OHHG 2IJHA 2YSUB 4KP4A 1SETA 2EJRA 5B1AB 3HB3B 3D3IA 4UV9A 4GX5A 3OM3B 4WFEA 2DYSB 4FIPC 3OEHG 3W7SA 1VQ7V 1Q86W 2ZXWC 3LUTB 2HG5C 1OCRC 2XAHA 3JCZA 1VQ9V 1PL0A 1LNQA 3ZIAG 4GCZA 5L3FA 1WLEA 4HYOA 3STLC 2PI5A 3F5WC 3LDCA 3RVYA 2XASA 3P30A 3F7YC 3X2QB 2ZDIC 4ZBMA 2HFEC 4GX1A 4Q20A 3SPGA 3W7XA 1S77D 3E2EA 4WFGA 1GM8A 2GSMB 4XDLA 5LHHA 1KP3A 2DQ0A 1AI4A 1SERA 4I5SA 2Q67A 3AEIA 4P2ZA 3K04A 2IU3A 4TT3G 4RQFA 3FB5C 3MHHC 5LGUA 2QM7A 5H6QA 3TCUA 1KECA 2EZPA 1OCCB 1QVGU 4G28B 4J9YB 2WLIA 4H33A 3SPHA 2P6JA 3MHSC 3K79A 3ZRSA 4WFBV 2NLJC 1R73A 3ABMB 2IU0A 5B3SB 3JD1A 5CBGA 1K9MW 4QPJA 3JYCA 2QE7G 1K4DC 3OMNB 3K06A 2DWEC 5EC2C 2WLLB 3ZN1A 1K5QA 5L3CA 5L3GA 2P67A 4MTOA 4HAMA 1V54B 1SZTA 5IYDO 2Y69C 1K92A 1S5HC 2DWDC 3ZRWB 3ASNC 1GM7A 2A9HA 3ZMZA 1KD1W 2BOBC 1M9NA 4MVUA 4R8CA 3B8NA 1YIJV 2DYRC 2EIKB 2OTLV 3AG4C 3CCLV 5CBFA 1AI7A 3SPIA 2CK3G 2W6JG 1H8HG 1PD3A 4LC1A 3SPJA 2ZR2A 3RBZA 2DQ3A 4GX2A 3B8MA 3OMIB 4N21A 5EK0A 3G4SV 2ZD9A 3ABLB 5L3BA 1R6KA 1AI6A 1OCOB 2WPDG 2ITCC 3PJSK 3E8HA 3OR7C 2AHYA 3ZN0A 5B1NA 1BL8A 1TUEB 3OE7G 4WFAV 2IJJA 2JJ2G 3ETEA 4LBEC 1M90W 2IW5A 2W6IG 4RO2A 2Q69A 1R3JC 3DGEA 1M57B 3WG7B 3E86A 1K5SA 5KUKA 3E8FA 5H6RA 1M56C 3R65A 4JASA 4PA7A 4G27B 3ZMSA 1KKDA 1DTOA 3CCEV 1OCZC 2WLLA 5IDJA 1COWG 1QLEC 1QR8A 4JAUA 4UUJC 5LBQA 1FFTB 5B1OA 1DF5A 1EBOA 2OCCC 1UJWB 3ZRWA 4QJFB 3SYAA 4JPRA 1DLBA 3FB8C 3RW0A 1MG1A 2M7WA 4ZKIA 2EBOA 1V55C 4GT1A 1FXKC 5B1BB 3CC7V 4R7CA 1K33A 2EIMB 4MVQA 3GWOA 2ZR3A 1GK9A 3NXSA 3ABKB 4N23A 1L1FA 4FPPA 4LP8A 4UVAA 5IY5C 2XAFA 4TWKA 4DO2A 1E1QG 1NH2B 2X6AA 3ZMVA 4PDLA 1JOYA 1QBZA 1XL4A 1NJIW 2EIJC 4FK5C 2ATKC 4KFMA 4PA3A 2ZXWB 3JD4A 2UXNA 2OTJV 4MTXA 1PNKA 1K97A 1ZWIC 1W0JG 3VBBA 1KQSU 2DYSC 3K08A 5FL7G 4JTCB 1RM1C 1Y66A 1QVFU 5CMUA 1QLNA 1FS0G 3AG1B 3ML0A 4OXSA 3H01A 1K34A 4I9WA 5CA3A 3OR6C 1GKFA 1Q81W 2JK5C 1AJQA 1CP9A 4MVOA 2DW4A 1R6NA 1NKDA 5CN0A 5EBLC 4PA4A 4KUMA 4XBFA 2WLMA 2XNDG 2BOCC 2HJFC 4P9OA 1GTOA 3LSQA 4X88A 1NH2D 2WLKA 3D36A 5LHGA 2EINB 4XDKA 1VQPV 1YJ9V 3CCQV 2B5UA 2H94A 2R9RB 3ETGA 1JQ0A 5LGTA 2V1DA 3LNMB 4JTAB 4UXNA 1GMGA 1Q7YW 2JDIG 1H8EG 2R9IA 1JJ2U 2ZQMA 4P30A 3ASNB 3ZCCA 4UV8A 3CCMV 1YHQV 1S0VA 5E1AC 2F43G 2DYRB 3SPCA 3ZRVA 3A0RA 1BHBA 1YJNV 1AJPA 2LFRA 2WWWA 5HFLA 4YXWG 5DN6G 3OUSA 3AG2C 2ZDIA 2IJIA 2MK3A 3I55V 3HPLC 4BIZA 3E35A 4R6ZA 4X8AA 3AG3C 3CMEV 3IFXA 3BEHA 3I56V 1B6QA 3TK1A 1AR1B 2D3OW 1P7BA 3QO7A 1M1KW 1Q82W 1K73W 1DF4A 3E89A 3ZRXA 3QNEA 3ABLC 3QO8A 1VQ8V 3CPWU 4PA9A 5KUMA 5DM6V 1GM9A 1ORQC 1OCOC 2IH3C 1AI5A 4JF3A 4U7OA 4G2KA 4UVBA 4MT8A 1JPXA 1M57C 3WG7C 4WCEV 3LDEA 3BY6A 3ASOC 1YI2V 1QLEB 2Q6AA 1KC8W 3CMAV 1NVPD 3T4DA 4JAVA 1I5YA 2Z3YA 3QO5A 5IYBO 1GO3F 4QPKA 3CCVV 3WFVA 3CCRV 1HWYA 5LHIA 5KA6A 3EHBB 3T4ZA 1VQNV 3CYOA 1PNMA 5CBHA 2A0LA 1WPXA 2LFSA 3ZJZA 1FXKB 3TETA 2B1GA 2V7QG 3ABTA 3K9AA 3LDDA 4PA6A 1ROPA 2ITDC 3K0DA 1VQKV 1J95A 5C93A 1NBMG 2WLJA 4MVMA 1PKXA 3CCSV 1XL6A 1NR1A 1YTFD 2P90A 2EILC 3CC2V 1JX9A 1PNLA 2P7TC 5IY5B 2WAMA 2X6BA 2KB1A 5B1BC 5IYCO 1YSCA 2XAJA 4MSWC 2QA4V 2EIMC 3OEEG 2EZOA 1F51A 3FYEB 1VQ4V 4XDJA 4J9ZB 3GB7C 1VQ5V 1NR7A 1F4NA 1YITV 2HR3A 3E83A 4QIWF 4CZZA 1OCRB 3UKMA 1S76D 4RUFA 1KP2A 5B1AC 4JGSA 2K1EA 1W2BU 1NQTA 5L3EA 1IXMA 4MW8A 1VQOV 2HVKC 4X89A 4H37A 4DXWA 3F7VC 4PDMA 2HLDG 3OAAG 2PI4A 3ABUA 3ETDA 3FB6C 1CEZA 2OT5A 2H8PC 1RM1B 4MVRA 2X7RB 4PELA 2AHZA 1R3LC 2XOKG 2JIZG 3FYIB 3X2QC 2A79B 1K4CC 3B77A 1S72V 4WF9V 5L3DA 3EFFK 4JTDB 4MVSA 2LP7A 3RVZA 1VQMV 3T1CA 2JJ1G 3AG1C 1FXKA 1SRYA 4ASUG 4PDRA 3FKSG 2FTKA 4R50A 3JD2A 3W7UA 3CXCU 1OCCC 3OUFA 3G71V 3CC4V 4MS2A 2X6CA 2HVJC 2QEXV 2Y69B 3ABMC 5B3SC 1MABG 2WLHA 3W7WA 1K3EA 4HZ3A 4BIUA 2QM8A 3MD0A 2EINC 1F23A 4RAIA 3DTUB 1G4YB 2HKOA 3AG4B 1V54C 3SYPA 1NVPB 2YEVA 1RPRA 5GW7A 3K03A 4UVCA 1K8AW 4JYBA 3OGCC 4PDVA 3CD6V 1JCHA 1E1RG 1YJWV 1BHAA 4JYCA 1AJNA 1FXHA 1SESA 1ENVA 2EIKC 4L87A 1H38A 3AG2B 2B1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 V;  1Q86 W;  1JJ2 U;  2D3O W;  1KD1 W;  1M90 W;  1KC8 W;  3CMA V;  1Q81 W;  2QEX V;  1YIJ V;  2QA4 V;  1M1K W;  3OW2 U;  1Q82 W;  1K73 W;  1VQL V;  1QVG U;  1VQ9 V;  1NJI W;  1VQ4 V;  3CCL V;  2OTL V;  1VQ6 V;  1VQ5 V;  3CCV V;  4WFB V;  3CCM V;  3CCR V;  1YHQ V;  1S72 V;  3G6E V;  1R73 A;  5DM6 V;  4WF9 V;  3CPW U;  3CCU V;  3CC7 V;  1YIT V;  4WFA V;  1K9M W;  2OTJ V;  1VQ8 V;  1VQN V;  1Q7Y W;  1YJN V;  3G4S V;  1VQM V;  1K8A W;  3CCE V;  3CCJ V;  3CD6 V;  1W2B U;  1VQP V;  1KQS U;  1YJ9 V;  1VQK V;  3CCQ V;  1VQO V;  1YI2 V;  3I55 V;  1YJW V;  1QVF U;  3CCS V;  3CXC U;  4WCE V;  3CME V;  3G71 V;  3CC4 V;  3CC2 V;  3I56 V;  1N8R W; 
#chains in the Genus database with same CATH topology
 1RPO A;  4EB6 A;  3B4S A;  4MTF A;  1DK1 A;  2GV9 A;  2UU9 O;  3AG3 B;  1VQ6 V;  4F6R A;  4CH3 A;  5IYZ B;  4BW5 A;  3B09 A;  3CCU V;  1IBL B;  2F4V O;  2Q7G A;  2RNB A;  5KMG B;  4X66 O;  4IHJ B;  3STZ C;  3T1H B;  1OCZ B;  2MW2 B;  1YXB A;  4FFB A;  4X65 O;  1E79 G;  4I4T A;  3KCX A;  3SYQ A;  5CA1 B;  5IWA B;  4K8X A;  2Q7H A;  1R3K C;  2WLN A;  2QJ1 A;  3KCY A;  1MSW D;  3TXS A;  4HBN A;  2RJZ A;  1V55 B;  2QWN B;  3W7T A;  1JMK C;  3G67 A;  1CPY A;  1OJH A;  1IBM O;  1MA1 A;  3RN4 A;  1N8R W;  1ARO P;  2GDS A;  1QCE A;  2Y48 A;  1JVM A;  4F4L A;  2CUG A;  4NKG B;  1I94 B;  1HNW B;  3D36 C;  5EBM C;  4DRX B;  4JI5 O;  2YEV B;  2X0L A;  1P49 A;  2V4D A;  4J7Z A;  5EYP B;  3DXR A;  4KP4 A;  3U11 A;  2EJR A;  5B1A B;  3HKB B;  4I9Q A;  4O4I B;  2AGA A;  3OEH G;  5GON A;  1FFX A;  4I50 A;  3LUT B;  1OCR C;  1VQ9 V;  1LNQ A;  3ZIA G;  4F6R B;  1L0L H;  1FKA O;  1WLE A;  4HYO A;  2PI5 A;  3F5W C;  3F7Y C;  2ZDI C;  3SPG A;  1SQX H;  2GUZ A;  4LNU A;  4K3A A;  3SJB C;  2IU3 A;  4TT3 G;  4X66 B;  4RQF A;  3D8C A;  3MHH C;  4CH5 A;  4FFB B;  4O4J B;  4GKJ O;  2RCV A;  4I4T B;  2EZP A;  1OCC B;  4G28 B;  3MHS C;  2ZCE A;  1US6 A;  1TA8 A;  1XMO B;  3ABM B;  3JD1 A;  4TV9 B;  4QPJ A;  2QE7 G;  2PUS A;  5EC2 C;  2WLL B;  2AXT Z;  5L3C A;  1I7F A;  2E74 B;  3OTO O;  2Y69 C;  1PM9 A;  3JSN A;  2ETN A;  5BXZ A;  4JYA B;  2L35 A;  1H8H G;  1HDJ A;  1YF2 A;  4LF8 O;  2Q0O C;  3G4S V;  4NXN O;  2A7W A;  5L3B A;  1XMQ O;  1SQB H;  3ZX6 A;  1MZF A;  3DXR B;  1OCO B;  3BCC H;  2ITC C;  2ZNI A;  3DC5 A;  2VQF O;  3ZED A;  4RWU A;  2DJV A;  5GON B;  2YI9 A;  2IW5 A;  4J11 A;  3TGU H;  3L70 H;  3DGE A;  1M57 B;  1VF5 B;  3WG7 B;  5KUK A;  3E8F A;  2E5L O;  1N0N A;  4PA7 A;  2EX3 A;  2YIC A;  1OCZ C;  1Q3E A;  1NTK H;  4BR6 A;  5B1O A;  1Q90 D;  3ZRW A;  5KAI Z;  3SYA A;  3RW0 A;  1MG1 A;  1Y6X A;  2QKA A;  4ZKI A;  2EBO A;  1V55 C;  2OWO A;  4TQF A;  5B1B B;  3QF7 A;  1K33 A;  1N34 B;  4H13 B;  1ZSP A;  5JJJ B;  4N23 A;  4DV0 B;  4JI6 O;  1TVK A;  2QWP B;  2A3Q A;  1NH2 B;  4DUZ O;  3SJA C;  3L72 H;  1NJI W;  4FK5 C;  3J81 N;  1EM1 A;  3HKE A;  2UXN A;  3K9S A;  1W0J G;  4X1I A;  3VBB A;  1B3Q A;  5FL7 G;  4FFK A;  4JI2 O;  4DR7 O;  1FS0 G;  1R6T A;  4PJ0 Z;  3L71 H;  4OXS A;  3OR6 C;  1GKF A;  5JJE B;  2JK5 C;  1CP9 A;  1GN3 A;  4GYC B;  4JV5 B;  3B2E E;  5GTH Z;  4XBF A;  3K58 A;  1WB8 A;  4P9O A;  4YY3 O;  4J41 A;  4OPA A;  1SQP H;  2EIN B;  3HKD B;  1VQP V;  3WB2 A;  1H2L A;  2H94 A;  2R9R B;  4I55 A;  4JTA B;  2CGN A;  1GMG A;  2JDI G;  1H8E G;  4DK1 A;  1KBH A;  3SJC C;  1JJO A;  4K35 A;  4DR6 B;  3OGI B;  2Q0A A;  1YHQ V;  3ZRV A;  2DYR B;  3SPC A;  3JAW A;  1WP8 A;  1RFY A;  3OUS A;  3EXA A;  2IJI A;  5JVD A;  3E35 A;  1V9P A;  2E76 B;  2D3O W;  2F93 B;  2LQT A;  1K73 W;  3E89 A;  2NN4 A;  1XNR B;  4TQD A;  5KUM A;  3HKE B;  1GM9 A;  4A5U B;  2Y0P A;  5J2T B;  1OCO C;  2VS0 A;  4HNA A;  3L74 H;  4X1I B;  2OCH A;  4JF3 A;  3CRC A;  4UVB A;  4CC5 A;  1JPX A;  1M57 C;  3WG7 C;  2P4V A;  2Y4T A;  1KC8 W;  1A32 A;  1FPO A;  2Z3Y A;  1NS1 A;  1SC5 B;  3CCV V;  4X1Y A;  5KA6 A;  3EHB B;  4X1K A;  5CBH A;  2A0L A;  2LFS A;  3ZJZ A;  3JAR A;  3K0D A;  4D6T H;  1D5A A;  1VQK V;  1J95 A;  1NBM G;  3N2K A;  4B3S B;  5AG2 A;  1XQ8 A;  2P90 A;  3CC2 V;  1UFI A;  1JX9 A;  2QGN A;  5IY5 B;  2X6B A;  5B1B C;  3RYH A;  4DV1 O;  2XAJ A;  5LA6 B;  2RDC A;  1SQF A;  1F51 A;  1VQ4 V;  3CJH B;  4I0X A;  4CZZ A;  3JAW B;  4OPH A;  4YJ3 A;  4DV3 O;  1XIL A;  2UXC B;  1NQT A;  4MW8 A;  3J7A U;  4X89 A;  2LGQ A;  5JVD B;  5LYJ A;  2ZKO A;  4B08 A;  3RYC A;  4DR1 B;  2AHZ A;  5DEC A;  1JA8 A;  3WU2 Z;  1R3L C;  2JIZ G;  2YI8 A;  4DUY O;  2UUB B;  4LH6 A;  1SQV H;  1XNQ O;  2XTA A;  3RVZ A;  3FAV B;  4DR4 B;  4TUY A;  4LF7 B;  1BS3 A;  1FXK A;  5KAF Z;  1N32 B;  4JI1 B;  4R50 A;  1ZTE A;  2R70 A;  4W4L A;  2QEX V;  4UCV A;  5B3S C;  1RSO A;  3C3S A;  1MAB G;  2WLH A;  2Y0I A;  4BIU A;  4UCS A;  2EIN C;  1F23 A;  4NYK A;  4ZI7 B;  4CH6 A;  3DTU B;  1GRJ A;  1V54 C;  2BTQ A;  3SYP A;  1NVP B;  3H1I H;  1H2S B;  5GW7 A;  2GTS A;  1K8A W;  2UUC O;  3CD6 V;  1JCH A;  1HR0 B;  2YDE A;  3FD9 A;  4DV4 O;  1YJW V;  1AJN A;  5IJ0 A;  4L87 A;  3KZI Z;  4QE7 A;  3UO2 A;  3ICX A;  5EC1 C;  3RYH B;  3VOU A;  3LSU A;  5LMU O;  2XAQ A;  3M99 B;  1YTF B;  3OFN G;  4MTG A;  3UM7 A;  5K1X A;  4U3F H;  4BWA A;  4IYI A;  1F4M A;  4YIP A;  5KLV H;  4Z1M G;  3IC7 A;  1EFR G;  4RQE A;  4DR5 O;  3ZMT A;  5LYJ B;  2PYJ A;  3E8B A;  3RYC B;  1W0K G;  1Y4M A;  2FKX A;  3HKC A;  3T2M A;  3CX5 F;  4WFH A;  3KKY A;  4FLW A;  1QR9 A;  3OMA B;  1N36 O;  5LGN A;  2JEU A;  2ZIO A;  4LF5 B;  3AK2 A;  4LF9 B;  2Q68 A;  1S3J A;  3FFQ A;  4TUY B;  3RFR A;  3WB1 A;  4IT5 A;  4J7K A;  4FJC C;  2W0F C;  3JD3 A;  3THO A;  4YIO A;  4DV5 O;  4O2B B;  3BVO A;  3FB7 C;  4QE9 A;  1H2N A;  4MW3 A;  2UXX A;  5H9C A;  4JZG A;  1RSO B;  2WLI B;  4UCU A;  2EIL B;  1IBL O;  1XDC A;  5IYZ A;  1ZL8 B;  4P9P A;  5KA5 A;  3G6E V;  2C2A A;  3ABK C;  2WSS G;  4FZ1 A;  1H2G A;  5FPO A;  2EIJ B;  4YHH B;  5KMG A;  1IDS A;  2JEX A;  3CE2 A;  4O4H A;  2YSU B;  4ZIB A;  3HR0 A;  4IHJ A;  2P22 C;  3OM3 B;  3W7S A;  1Q86 W;  1VP7 A;  5IWA O;  1ZX3 A;  2HG5 C;  1T5E A;  1Q5O A;  2EJ7 A;  5BR8 B;  1O9H A;  1BE3 H;  1IBK B;  4GCZ A;  1GN2 A;  1AR5 A;  3RVY A;  2XAS A;  3T1Y B;  1EN6 A;  3X2Q B;  4E4E A;  4ZBM A;  1URF A;  4GX1 A;  3W7X A;  1S77 D;  4IGG A;  1CXZ B;  4XDL A;  5LHH A;  3CWB H;  2DQ0 A;  3FX7 A;  1SER A;  1L0N H;  4P2Z A;  3WB0 A;  3K04 A;  4NB5 A;  4DR5 B;  1HNZ O;  1I94 O;  2QM7 A;  3G6B A;  1HNW O;  1YZB A;  1IUR A;  1QVG U;  3HKC B;  2P6J A;  2VWJ A;  3ZRS A;  4B3T B;  2NLJ C;  4IIJ B;  5CBG A;  1H2K A;  1K9M W;  2AZ2 A;  3SDL A;  1K4D C;  3OMN B;  3JAL A;  1P7G A;  2UUA B;  5L3G A;  3S3W A;  1SZT A;  4B3M B;  3HKB A;  1X59 A;  3ASN C;  4O4I A;  5B66 Z;  1GN4 A;  4R8C A;  4DV5 B;  3B8N A;  2EIK B;  4LFC B;  2OTL V;  3CCL V;  3SPI A;  2W6J G;  4LFA O;  1PD3 A;  1VF7 A;  2IBZ H;  3OT7 A;  3B8M A;  4J80 A;  4KXR A;  1R6K A;  2W0X A;  4Z2W A;  1HNX B;  4O4H B;  2ODM A;  2WPD G;  2F66 C;  3E8H A;  3P3P A;  3ZN0 A;  5JJN B;  4ZHQ A;  1BQ0 A;  4WFA V;  5LOV B;  2JJ2 G;  3ETE A;  4LBE C;  1M90 W;  4O4J A;  1R3J C;  1XMO O;  1K5S A;  3H9V A;  4FLV A;  3R65 A;  3C90 A;  4TV9 A;  4DW1 A;  4JI0 B;  3ZMS A;  2WLL A;  1QR8 A;  4UUJ C;  1FFT B;  1ZAU A;  1EBO A;  4JPR A;  4JYA O;  3GWK C;  1DGS A;  5LMN B;  2OIG A;  1HNZ B;  1XUQ A;  1FXK C;  4KHP B;  4R7C A;  4MVQ A;  3GWO A;  2ZR3 A;  3ETQ A;  1GK9 A;  4LF4 B;  1N0J A;  3JAL B;  3GVM A;  2N74 A;  2Q5Z A;  4FLZ A;  5A2Q N;  1Z5V A;  1FD9 A;  5C8Y B;  1JOY A;  4JI8 B;  1N33 O;  2EIJ C;  4KFM A;  2PGG A;  2ZXW B;  5A9G A;  4LFA B;  1H2M A;  2KSD A;  4JYY A;  1Y66 A;  2QDO A;  4ZHQ B;  2P4K A;  1PPJ H;  2KQX A;  2VRZ A;  5EZY A;  1XEQ A;  1R6N A;  2E75 B;  2DW4 A;  4JI3 B;  1N34 O;  2WLM A;  2ARH A;  1PV0 A;  2BOC C;  4DV0 O;  1TGO A;  4X88 A;  2WLK A;  4AHC A;  2N04 A;  2IM9 A;  5LHG A;  4GKK B;  5TIS Z;  2B5U A;  4UXN A;  1Q7Y W;  3B40 A;  2R9I A;  2ZQM A;  4P30 A;  4W4K A;  2M6Y A;  3CCM V;  2YIB A;  5E1A C;  2F43 G;  4NTY A;  2F95 B;  5LP6 A;  4NVP A;  2LFR A;  5HFL A;  5DN6 G;  3AG2 C;  2MK3 A;  3I55 V;  1GH6 A;  3J80 N;  1XI1 A;  5D5Q A;  4R6Z A;  4X8A A;  4DR2 O;  3AG3 C;  2KKW A;  3IFX A;  3BEH A;  3BAB A;  2Z0A A;  1AR1 B;  1P7B A;  5J2U B;  4JV5 O;  3QO7 A;  2HHH B;  5FLX N;  4TV8 B;  1VQ8 V;  1Q43 A;  5KHG A;  1N33 B;  1BT8 A;  1ORQ C;  3JAS B;  5F2V O;  2ZE8 A;  1AI5 A;  2ADQ B;  3HKD A;  5EIB C;  4U7O A;  1D2D A;  4UCT A;  3RT3 C;  3BY6 A;  1YI2 V;  1QLE B;  4DR6 O;  3CMA V;  4JZ2 A;  5EZY B;  5IYB O;  1GO3 F;  3I5D A;  3T4Z A;  1VQN V;  3ZBH A;  1WPX A;  2YID A;  3TET A;  3N2G A;  4UB6 Z;  3K9A A;  1ROP A;  3DC6 A;  1RP3 B;  2R9A A;  5C93 A;  1PKX A;  3CCS V;  3K5N A;  4L8J A;  2QR4 A;  2WAM A;  2KB1 A;  5IYC O;  2QA4 V;  1XNR O;  4DV6 B;  2BSK B;  1Y74 B;  2HJD A;  3GB7 C;  1NR7 A;  2D2C B;  1AP6 A;  4Q6G A;  4QIW F;  2ZM6 B;  4FLU A;  3UKM A;  5LP6 B;  5J2T A;  5GTI Z;  1VAR A;  4RUF A;  5B1A C;  4UFZ A;  2YC0 A;  2K1E A;  1W2B U;  1SKV A;  2HVK C;  4H37 A;  4JI4 B;  4DXW A;  3F7V C;  4LWS A;  4CH4 A;  1CEZ A;  4KL1 A;  1RM1 B;  2X7R B;  2OYQ A;  4DR2 B;  3FYI B;  2A79 B;  2GBO A;  1K4C C;  4WF9 V;  4JTD B;  4MVS A;  1VQM V;  4J10 A;  4B3S O;  4ASU G;  3C3T A;  2A06 H;  4F6E A;  3JCU Z;  3JD2 A;  1OCC C;  2CTP A;  4MS2 A;  3N27 A;  2X6C A;  3IC9 A;  3ABM C;  1WA8 B;  1IX9 A;  4X20 A;  5LA6 A;  4GUN A;  3BAA A;  3CJH A;  4RAI A;  2UXC O;  5JWP A;  2UXD O;  2HKO A;  3AG4 B;  4BIO A;  4TOI A;  1RPR A;  1PL4 A;  2ADP A;  4JYB A;  4PDV A;  3N2G B;  3OTF A;  4OX9 B;  4DR1 O;  1QNM A;  1ENV A;  1H38 A;  4J42 A;  2ZIM A;  3K3W A;  2UUB O;  5BY1 A;  3OW2 U;  4LF6 B;  1WB7 A;  2WA4 A;  1SF9 A;  5CA0 B;  3SJQ C;  4DR4 O;  5BZB A;  4LF7 O;  5EBW C;  3FAV A;  1N32 O;  4JI1 O;  1M56 B;  2CH7 B;  3VQV A;  3CCJ V;  1EZJ A;  1I0H A;  1YCI A;  3Q4H A;  4MVZ A;  2R72 A;  4QNH B;  4AIL C;  2ILM A;  2GHY A;  2IJK A;  4LWS B;  3SYO A;  4BAY A;  4LFB O;  3KG2 A;  3ASO B;  2Y4U A;  1PP9 H;  1LR1 A;  2L6L A;  4EKW A;  1XRE A;  3UT5 B;  4ZI7 A;  1NZ6 A;  3CS5 A;  2Z5U A;  1HR0 O;  2YXY A;  1G1X B;  2GTA A;  2DOS A;  1I5X A;  3CP1 A;  3A8T A;  2VWK A;  1LUV A;  1Q6I A;  5KX5 B;  4X20 B;  3CSX A;  2QTO A;  4LR3 A;  1MMM A;  1FXV A;  4LCU C;  2NNU A;  3LSS A;  1OHH G;  2UXD B;  2IJH A;  1SET A;  2XUM A;  4UV9 A;  2RN9 A;  4PHZ A;  1VQ7 V;  1BZK A;  3E22 B;  4JAA A;  3JCZ A;  5LP6 C;  4LF5 O;  5L3F A;  4LF9 O;  1FJG B;  3LDC A;  3P30 A;  5ITZ A;  2WA3 A;  2HFE C;  2Q7E A;  3E2E A;  1AR4 A;  1GM8 A;  2GSM B;  2XT9 A;  3Q4H B;  1KP3 A;  1VMG A;  2CDY A;  1AI4 A;  4I5S A;  4O2B A;  5FPR A;  3R66 A;  1KEC A;  5LL6 Y;  4J9Y B;  4WBN A;  1AP5 A;  2WLI A;  4H33 A;  3K79 A;  4WFB V;  4YHH O;  1ZL8 A;  2FL4 A;  2ZT9 B;  4LFB B;  1D5N A;  4AQY B;  3K06 A;  4DV2 O;  4PI2 A;  1K5Q A;  2P67 A;  4MTO A;  4EFB A;  2Q73 A;  5IYD O;  2YXH A;  4X62 B;  3MDS A;  1GM7 A;  4DK0 A;  2A9H A;  5BR8 O;  2BOB C;  4FZ0 A;  4MVU A;  1IBK O;  2DYR C;  3AG4 C;  3M8A A;  5CBF A;  3T1Y O;  1G6U A;  4LC1 A;  3SPJ A;  2ZR2 A;  3RBZ A;  4GX2 A;  1NI8 A;  2HP8 A;  1X4T A;  2Q8V A;  3QTC A;  4N21 A;  5EK0 A;  2ZD9 A;  3ABL B;  1AI6 A;  1XOU A;  5BMV B;  3PJS K;  3CHX A;  1TUE B;  5LXT A;  2W6I G;  1Z2G A;  4B3T O;  4RO2 A;  2Q69 A;  1BGY H;  1Y76 A;  2CTR A;  3O65 A;  1M56 C;  1WNS A;  2QWO B;  4JAS A;  4IIJ A;  3A0B Z;  5ITZ B;  4DYL A;  2UUA O;  1GAX A;  1KKD A;  1WJZ A;  3CCE V;  4B3M O;  5IDJ A;  3L73 H;  1COW G;  2QM4 A;  5LBQ A;  3UO3 A;  3AK3 A;  1EN4 A;  3APQ A;  1UJW B;  1UPG A;  4QJF B;  4LFC O;  1DLB A;  1IXB A;  1I08 A;  3FB8 C;  1SQQ H;  2O57 A;  1BSM A;  4WBN B;  2QWQ B;  5KHI A;  4GT1 A;  4B7E A;  3CC7 V;  3OD4 A;  3JAK B;  1HNX O;  5JH7 A;  1KU9 A;  3IAY A;  3ZHQ A;  4LP8 A;  4UVA A;  4DV2 B;  2FML A;  4C7U A;  5IY5 C;  5LOV A;  3ZMV A;  4PDL A;  4DV7 B;  1W59 A;  4K8Z A;  2ATK C;  4PA3 A;  4JI0 O;  3JD4 A;  2P06 A;  2OTJ V;  4MTX A;  4K0K B;  1PNK A;  1FYJ A;  5IJ9 A;  3K5O A;  3L75 H;  2E3C A;  3AG1 B;  5LMN O;  1K34 A;  5CA3 A;  5LXT B;  4MVO A;  1Y76 B;  4KHP O;  4PA4 A;  4LF4 O;  2VQE B;  2QTS A;  4B7K A;  1GTO A;  3LSQ A;  1SZX A;  1QU7 A;  4X64 B;  4XDK A;  3BA8 A;  1YJ9 V;  2FB5 A;  2ZNJ A;  3CCQ V;  2RMK B;  5LGT A;  2V1D A;  3LNM B;  4JI8 O;  1J5E B;  3BHP A;  4Z1V A;  5C8Y A;  2UXB B;  4IYH A;  3RWR D;  4X9Q A;  4CS3 A;  3ZCC A;  3A0R A;  1YDX A;  2QWR B;  5JH7 B;  3S3X A;  1M5I A;  4I7Z B;  2EUL A;  4QGP A;  2BE3 A;  3HPL C;  1AVM A;  3CME V;  3I56 V;  1B6Q A;  4JI3 O;  1Q82 W;  1AIL A;  1Z5W A;  4U3J A;  2P5O A;  3PN1 A;  5IT9 N;  3ABL C;  3QO8 A;  4GKK O;  4PI0 A;  2RQ6 A;  4NXM B;  2IH3 C;  5IJ9 B;  4NTW A;  2LW7 A;  3ZHV A;  1IVS A;  1Q8I A;  4ABM A;  5KHK A;  4WCE V;  3LDE A;  3UQ8 A;  2JS5 A;  5JQG A;  4JI7 B;  4AI8 A;  3M7M X;  1NVP D;  2ZE7 A;  4JAV A;  1ZUQ A;  1I5Y A;  4QPK A;  2Q4P A;  3WFV A;  1HWY A;  2K9P A;  4FLX A;  5LHI A;  3JSL A;  1PNM A;  5IE9 A;  3JAT A;  1XHX A;  2LGW A;  2QSA A;  3LDD A;  1MSD A;  2BTO A;  1P84 F;  1YTF D;  2HHH O;  2EIL C;  4B3R B;  1PNL A;  2P7T C;  1JFF B;  4FM2 A;  4CC6 A;  5J2U A;  1YSC A;  3OEE G;  2EZO A;  4TV8 A;  4XDJ A;  4J9Z B;  4O4L A;  1F4N A;  3JAS A;  2KG7 B;  4JGS A;  2FYU H;  1VF6 A;  1VQO V;  1WN7 A;  4PDM A;  2HLD G;  3OAA G;  3ETD A;  3FB6 C;  2OT5 A;  2G38 A;  4EB6 B;  4MVR A;  5CB4 A;  1WAZ A;  4PEL A;  2XOK G;  3U10 A;  3X2Q C;  4PD4 F;  4U3J B;  2UU9 B;  1S72 V;  1Q6H A;  5L3D A;  3EFF K;  2LP7 A;  4J7J A;  2F4V B;  3AG1 C;  3AK1 A;  1SRY A;  3D3Q A;  4PDR A;  4D7T A;  2FTK A;  3ZHT A;  3W7U A;  4DW0 A;  4DV6 O;  5JQG B;  4FLT A;  2PF4 E;  2HVJ C;  1B06 A;  4ICG A;  2BSK A;  4X65 B;  3W7W A;  2ZM6 O;  1Y74 A;  1VEW A;  1JR9 A;  2QM8 A;  3MD0 A;  1B04 A;  1G4Y B;  3H1J H;  3JAT B;  3K03 A;  4UVC A;  4FM1 A;  4JI4 O;  1BCC H;  1BHA A;  2EIK C;  3H1K H;  1IBM B;  1O9G A;  4TSF G;  3EVK A;  3ZHR A;  1VQL V;  1OZ0 A;  4FMT A;  2AZ0 A;  4E2L A;  2IH1 C;  4O4L B;  1NTZ H;  3SGI A;  4U7N A;  3SYC A;  2LJ2 A;  1BMF G;  1KKC A;  4WFF A;  1P4R A;  4JI5 B;  5HFM A;  1Y67 A;  1MOF A;  3APO A;  3TJT A;  1HW7 A;  3IGA C;  1FFX B;  3G80 A;  4I50 B;  1G8M A;  2CAZ C;  5CB4 B;  3IJ4 A;  1YVW A;  4RUE A;  1WA8 A;  1K7D A;  2OCC B;  4H44 B;  4OGQ B;  3BPZ A;  3O9O A;  2CTW A;  3K0G A;  2GUZ B;  4LNU B;  2PY5 A;  4OX9 O;  2YXL A;  3CB2 A;  2PTM A;  1QHT A;  2XAG A;  1R3I C;  1THZ A;  4LF6 O;  4GX0 A;  1U96 A;  2JGD A;  5J9P C;  4CBC A;  3BA9 A;  2QKS A;  4GKJ B;  1EN5 A;  3E8G A;  3P32 A;  5CA0 A;  1WP7 A;  4GLX A;  3ZMU A;  3JD0 A;  1IZ3 A;  1MZE A;  5EIB D;  2CH7 A;  1HP8 A;  3H1L H;  2PYL A;  1BQZ A;  3HB3 B;  3D3I A;  3OTO B;  4GX5 A;  4BW9 A;  4WFE A;  2DYS B;  4FIP C;  2PZS A;  2ZXW C;  2XAH A;  1PL0 A;  3CRA A;  3STL C;  3UT5 A;  3ZHS A;  5FNV A;  4Q20 A;  4WFG A;  4LF8 B;  4NXN B;  1XMQ B;  2Q67 A;  3AEI A;  2DE0 X;  3QG5 A;  2HEP A;  3FB5 C;  2B9Z A;  2VQF B;  5LGU A;  2AW9 A;  2H3O A;  5H6Q A;  1XBL A;  5JCO A;  3TCU A;  3JAM N;  5KX5 A;  3TXQ A;  3SPH A;  5KHJ A;  1R73 A;  2NR5 A;  2XHB A;  2IU0 A;  5B3S B;  3JYC A;  3K5M A;  2DWE C;  2E5L B;  3ZN1 A;  4CS4 A;  4HAM A;  1V54 B;  3CRR A;  1K92 A;  1S5H C;  1WPB A;  2DWD C;  1U97 A;  3ZRW B;  4GZR B;  3ZMZ A;  1KD1 W;  1M9N A;  3E22 A;  1YIJ V;  2JGD B;  1FJG O;  1AI7 A;  2CK3 G;  1AB3 A;  1VIB A;  2OIE A;  2DQ3 A;  3OMI B;  4PV1 B;  2DMX A;  2DN9 A;  1TVK B;  4FVM A;  3SR2 C;  4D7S A;  3OR7 C;  4JI6 B;  2AHY A;  5B1N A;  1BL8 A;  3OE7 G;  2IJJ A;  2ZE5 A;  4UB8 Z;  3CXH F;  4DUZ B;  3E86 A;  2ZIN A;  4AQY O;  5H6R A;  2LW1 A;  1VF6 C;  4G27 B;  5FNV B;  1N4C A;  1DTO A;  4X62 O;  1QLE C;  4YJ2 A;  4JAU A;  4H0L B;  1DF5 A;  2OCC C;  1YEW A;  2CGO A;  4JI2 B;  4DR7 B;  2JS3 A;  4ZOL A;  4DR3 O;  2JGU A;  2M7W A;  1KUQ A;  2N05 A;  2CTQ A;  2EIM B;  1TUB A;  3NXS A;  3ABK B;  1L1F A;  4YY3 B;  2CE4 A;  4FPP A;  4NR1 A;  4I55 B;  5BMV A;  2XAF A;  4TWK A;  4DO2 A;  1NTM H;  1M93 A;  1E1Q G;  2X6A A;  1EZV H;  1QBZ A;  1XL4 A;  2Q9L A;  3DSQ A;  1QQC A;  1K97 A;  1ZWI C;  1KQS U;  3RYF A;  2DYS C;  3K08 A;  1NU1 H;  4JTC B;  1LUW A;  3F5T A;  1RM1 C;  1QVF U;  3ZS8 C;  5CMU A;  1QLN A;  5H2F Z;  3ML0 A;  1SA0 A;  3H01 A;  1M4U A;  4I9W A;  1Q81 W;  1AJQ A;  1XHZ A;  3QVN A;  5CN0 A;  1NKD A;  5EBL C;  3BFR A;  4KUM A;  2XND G;  2HJF C;  3JAK A;  5KHH A;  4HNA B;  1NH2 D;  3D36 A;  4YJ2 B;  3ETG A;  1JQ0 A;  3LNN A;  3K57 A;  4DV7 O;  1F7Y A;  3P3N A;  5K1P A;  2YIB D;  3L9D A;  1JJ2 U;  4EEQ A;  1KMI Z;  3RYI A;  4ZOL B;  1Q6U A;  3ASN B;  4UV8 A;  4K0K O;  4DR3 B;  4X1Y B;  1S0V A;  1OV9 A;  1KB9 F;  1BHB A;  4X1K B;  3A0H Z;  1YJN V;  1AJP A;  2WWW A;  1TUB B;  4YXW G;  3VQX A;  1TAE A;  3JAR B;  4FLY A;  2ZDI A;  3N2K B;  4BIZ A;  1S5J A;  3TK1 A;  1GN6 A;  4LH7 A;  1M1K W;  4UCO A;  1DF4 A;  2VQE O;  3VQW A;  3ZRX A;  3QNE A;  4DV1 B;  4I0X B;  4PA9 A;  5DM6 V;  3CPW U;  4YJ3 B;  4X64 O;  1NT2 B;  4UCR A;  1KYO F;  3CRQ A;  4DV3 B;  3AG7 A;  3RYF B;  5DED A;  1J5E O;  4G2K A;  3U0Z A;  4MT8 A;  3ZHU A;  2UXB O;  3ASO C;  1SA0 B;  2F23 A;  2Q6A A;  3T4D A;  3A2F A;  4O2A A;  3QO5 A;  3H1H H;  2JRI A;  3CCR V;  2YS8 A;  4FM0 A;  4DUY B;  3CYO A;  1XNQ B;  1FXK B;  2B1G A;  3CEI A;  2V7Q G;  3ABT A;  4PA6 A;  3BRC A;  2ITD C;  2WLJ A;  4MVM A;  5JCO C;  2YIA A;  1XL6 A;  1NR1 A;  4MSW C;  1S5L Z;  2JVD A;  3MAQ A;  2EIM C;  3RYI B;  3FYE B;  1VQ5 V;  3CRM A;  4NXM O;  1YIT V;  2HR3 A;  3E83 A;  1OCR B;  2BTQ B;  1S76 D;  1KP2 A;  2QKC A;  3T1H O;  5L3E A;  5E79 Z;  1IXM A;  2UUC B;  5IJ0 B;  4JI7 O;  2LO1 A;  2PI4 A;  3ABU A;  4DV4 B;  2H8P C;  1SQG A;  1MNG A;  5CA1 A;  3K59 A;  1R1B A;  3NR7 A;  3B77 A;  1ZLZ A;  5LMU B;  2ZE6 A;  4IL6 Z;  5D5P A;  3T1C A;  2JJ1 G;  2BCC H;  3K5L A;  3FKS G;  4B3R O;  3VQY A;  3CXC U;  3OUF A;  3G71 V;  3CC4 V;  4CS2 A;  1JFF A;  3UCS C;  1FAF A;  2Y69 B;  5B5E Z;  4O2A B;  1K3E A;  4HZ3 A;  2YUA A;  4DRX A;  5H5N A;  3RGB A;  1N36 B;  1L8D A;  2F1M A;  4NTX A;  2YEV A;  2KG7 A;  3OGC C;  5EYP A;  1SS3 A;  1E1R G;  4JYC A;  4EFE A;  1FXH A;  1SES A;  3AG2 B;  2B1I A; 
#chains in the Genus database with same CATH homology
 1RPO A;  5EC1 C;  3K3W A;  4MTF A;  4TSF G;  3AG3 B;  3OW2 U;  3VOU A;  1VQL V;  1VQ6 V;  1OZ0 A;  4FMT A;  4E2L A;  2IH1 C;  2XAQ A;  3SJQ C;  3M99 B;  4BW5 A;  1YTF B;  3CCU V;  3OFN G;  4MTG A;  5BZB A;  3UM7 A;  5EBW C;  4U7N A;  3SYC A;  1BMF G;  1M56 B;  3CCJ V;  4WFF A;  1F4M A;  1EZJ A;  4Z1M G;  1P4R A;  3IC7 A;  4MVZ A;  1EFR G;  5HFM A;  3STZ C;  4QNH B;  4RQE A;  3ZMT A;  1MOF A;  2GHY A;  1OCZ B;  2IJK A;  3IGA C;  3E8B A;  3SYO A;  4BAY A;  1W0K G;  1G8M A;  1E79 G;  1Y4M A;  3KG2 A;  4RUE A;  3T2M A;  1K7D A;  3ASO B;  3SYQ A;  4WFH A;  2OCC B;  1QR9 A;  3OMA B;  5LGN A;  2JEU A;  4EKW A;  1R3K C;  2WLN A;  1MSW D;  3K0G A;  2Q68 A;  2Z5U A;  1V55 B;  1S3J A;  3W7T A;  1I5X A;  1CPY A;  4FJC C;  3CP1 A;  2W0F C;  3JD3 A;  3FB7 C;  4QE9 A;  2XAG A;  1R3I C;  1THZ A;  1N8R W;  1ARO P;  4MW3 A;  2Y48 A;  1QCE A;  4GX0 A;  2UXX A;  1JVM A;  4F4L A;  5J9P C;  5H9C A;  4CBC A;  2WLI B;  2EIL B;  2QKS A;  3E8G A;  2QTO A;  4QE7 A;  3P32 A;  4P9P A;  5KA5 A;  5EBM C;  3G6E V;  2C2A A;  3ABK C;  2WSS G;  1FXV A;  3ZMU A;  1H2G A;  3JD0 A;  2EIJ B;  4LCU C;  2NNU A;  3LSS A;  2YEV B;  2X0L A;  2JEX A;  1OHH G;  2IJH A;  2YSU B;  4KP4 A;  1SET A;  2EJR A;  5B1A B;  3HB3 B;  3D3I A;  4UV9 A;  4GX5 A;  3OM3 B;  4WFE A;  2DYS B;  4FIP C;  3OEH G;  3W7S A;  1VQ7 V;  1Q86 W;  2ZXW C;  3LUT B;  2HG5 C;  1OCR C;  2XAH A;  3JCZ A;  1VQ9 V;  1PL0 A;  1LNQ A;  3ZIA G;  4GCZ A;  5L3F A;  1WLE A;  4HYO A;  3STL C;  2PI5 A;  3F5W C;  3LDC A;  3RVY A;  2XAS A;  3P30 A;  3F7Y C;  3X2Q B;  2ZDI C;  4ZBM A;  2HFE C;  4GX1 A;  4Q20 A;  3SPG A;  3W7X A;  1S77 D;  3E2E A;  4WFG A;  1GM8 A;  2GSM B;  4XDL A;  5LHH A;  1KP3 A;  2DQ0 A;  1AI4 A;  1SER A;  4I5S A;  2Q67 A;  3AEI A;  4P2Z A;  3K04 A;  2IU3 A;  4TT3 G;  4RQF A;  3FB5 C;  3MHH C;  5LGU A;  2QM7 A;  5H6Q A;  3TCU A;  1KEC A;  2EZP A;  1OCC B;  1QVG U;  4G28 B;  4J9Y B;  2WLI A;  4H33 A;  3SPH A;  2P6J A;  3MHS C;  3K79 A;  3ZRS A;  4WFB V;  2NLJ C;  1R73 A;  3ABM B;  2IU0 A;  5B3S B;  3JD1 A;  5CBG A;  1K9M W;  4QPJ A;  3JYC A;  2QE7 G;  1K4D C;  3OMN B;  3K06 A;  2DWE C;  5EC2 C;  2WLL B;  3ZN1 A;  1K5Q A;  5L3C A;  5L3G A;  2P67 A;  4MTO A;  4HAM A;  1V54 B;  1SZT A;  5IYD O;  2Y69 C;  1K92 A;  1S5H C;  2DWD C;  3ZRW B;  3ASN C;  1GM7 A;  2A9H A;  3ZMZ A;  1KD1 W;  2BOB C;  1M9N A;  4MVU A;  4R8C A;  3B8N A;  1YIJ V;  2DYR C;  2EIK B;  2OTL V;  3AG4 C;  3CCL V;  5CBF A;  1AI7 A;  3SPI A;  2CK3 G;  2W6J G;  1H8H G;  1PD3 A;  4LC1 A;  3SPJ A;  2ZR2 A;  3RBZ A;  2DQ3 A;  4GX2 A;  3B8M A;  3OMI B;  4N21 A;  5EK0 A;  3G4S V;  2ZD9 A;  3ABL B;  5L3B A;  1R6K A;  1AI6 A;  1OCO B;  2WPD G;  2ITC C;  3PJS K;  3E8H A;  3OR7 C;  2AHY A;  3ZN0 A;  5B1N A;  1BL8 A;  1TUE B;  3OE7 G;  4WFA V;  2IJJ A;  2JJ2 G;  3ETE A;  4LBE C;  1M90 W;  2IW5 A;  2W6I G;  4RO2 A;  2Q69 A;  1R3J C;  3DGE A;  1M57 B;  3WG7 B;  3E86 A;  1K5S A;  5KUK A;  3E8F A;  5H6R A;  1M56 C;  3R65 A;  4JAS A;  4PA7 A;  4G27 B;  3ZMS A;  1KKD A;  1DTO A;  3CCE V;  1OCZ C;  2WLL A;  5IDJ A;  1COW G;  1QLE C;  1QR8 A;  4JAU A;  4UUJ C;  5LBQ A;  1FFT B;  5B1O A;  1DF5 A;  1EBO A;  2OCC C;  1UJW B;  3ZRW A;  4QJF B;  3SYA A;  4JPR A;  1DLB A;  3FB8 C;  3RW0 A;  1MG1 A;  2M7W A;  4ZKI A;  2EBO A;  1V55 C;  4GT1 A;  1FXK C;  5B1B B;  3CC7 V;  4R7C A;  1K33 A;  2EIM B;  4MVQ A;  3GWO A;  2ZR3 A;  1GK9 A;  3NXS A;  3ABK B;  4N23 A;  1L1F A;  4FPP A;  4LP8 A;  4UVA A;  5IY5 C;  2XAF A;  4TWK A;  4DO2 A;  1E1Q G;  1NH2 B;  2X6A A;  3ZMV A;  4PDL A;  1JOY A;  1QBZ A;  1XL4 A;  1NJI W;  2EIJ C;  4FK5 C;  2ATK C;  4KFM A;  4PA3 A;  2ZXW B;  3JD4 A;  2UXN A;  2OTJ V;  4MTX A;  1PNK A;  1K97 A;  1ZWI C;  1W0J G;  3VBB A;  1KQS U;  2DYS C;  3K08 A;  5FL7 G;  4JTC B;  1RM1 C;  1Y66 A;  1QVF U;  5CMU A;  1QLN A;  1FS0 G;  3AG1 B;  3ML0 A;  4OXS A;  3H01 A;  1K34 A;  4I9W A;  5CA3 A;  3OR6 C;  1GKF A;  1Q81 W;  2JK5 C;  1AJQ A;  1CP9 A;  4MVO A;  2DW4 A;  1R6N A;  1NKD A;  5CN0 A;  5EBL C;  4PA4 A;  4KUM A;  4XBF A;  2WLM A;  2XND G;  2BOC C;  2HJF C;  4P9O A;  1GTO A;  3LSQ A;  4X88 A;  1NH2 D;  2WLK A;  3D36 A;  5LHG A;  2EIN B;  4XDK A;  1VQP V;  1YJ9 V;  3CCQ V;  2B5U A;  2H94 A;  2R9R B;  3ETG A;  1JQ0 A;  5LGT A;  2V1D A;  3LNM B;  4JTA B;  4UXN A;  1GMG A;  1Q7Y W;  2JDI G;  1H8E G;  2R9I A;  1JJ2 U;  2ZQM A;  4P30 A;  3ASN B;  3ZCC A;  4UV8 A;  3CCM V;  1YHQ V;  1S0V A;  5E1A C;  2F43 G;  2DYR B;  3SPC A;  3ZRV A;  3A0R A;  1BHB A;  1YJN V;  1AJP A;  2LFR A;  2WWW A;  5HFL A;  4YXW G;  5DN6 G;  3OUS A;  3AG2 C;  2ZDI A;  2IJI A;  2MK3 A;  3I55 V;  3HPL C;  4BIZ A;  3E35 A;  4R6Z A;  4X8A A;  3AG3 C;  3CME V;  3IFX A;  3BEH A;  3I56 V;  1B6Q A;  3TK1 A;  1AR1 B;  2D3O W;  1P7B A;  3QO7 A;  1M1K W;  1Q82 W;  1K73 W;  1DF4 A;  3E89 A;  3ZRX A;  3QNE A;  3ABL C;  3QO8 A;  1VQ8 V;  3CPW U;  4PA9 A;  5KUM A;  5DM6 V;  1GM9 A;  1ORQ C;  1OCO C;  2IH3 C;  1AI5 A;  4JF3 A;  4U7O A;  4G2K A;  4UVB A;  4MT8 A;  1JPX A;  1M57 C;  3WG7 C;  4WCE V;  3LDE A;  3BY6 A;  3ASO C;  1YI2 V;  1QLE B;  2Q6A A;  1KC8 W;  3CMA V;  1NVP D;  3T4D A;  4JAV A;  1I5Y A;  2Z3Y A;  3QO5 A;  5IYB O;  1GO3 F;  4QPK A;  3CCV V;  3WFV A;  3CCR V;  1HWY A;  5LHI A;  5KA6 A;  3EHB B;  3T4Z A;  1VQN V;  3CYO A;  1PNM A;  5CBH A;  2A0L A;  1WPX A;  2LFS A;  3ZJZ A;  1FXK B;  3TET A;  2B1G A;  2V7Q G;  3ABT A;  3K9A A;  3LDD A;  4PA6 A;  1ROP A;  2ITD C;  3K0D A;  1VQK V;  1J95 A;  5C93 A;  1NBM G;  2WLJ A;  4MVM A;  1PKX A;  3CCS V;  1XL6 A;  1NR1 A;  1YTF D;  2P90 A;  2EIL C;  3CC2 V;  1JX9 A;  1PNL A;  2P7T C;  5IY5 B;  2WAM A;  2X6B A;  2KB1 A;  5B1B C;  5IYC O;  1YSC A;  2XAJ A;  4MSW C;  2QA4 V;  2EIM C;  3OEE G;  2EZO A;  1F51 A;  3FYE B;  1VQ4 V;  4XDJ A;  4J9Z B;  3GB7 C;  1VQ5 V;  1NR7 A;  1F4N A;  1YIT V;  2HR3 A;  3E83 A;  4QIW F;  4CZZ A;  1OCR B;  3UKM A;  1S76 D;  4RUF A;  1KP2 A;  5B1A C;  4JGS A;  2K1E A;  1W2B U;  1NQT A;  5L3E A;  1IXM A;  4MW8 A;  1VQO V;  2HVK C;  4X89 A;  4H37 A;  4DXW A;  3F7V C;  4PDM A;  2HLD G;  3OAA G;  2PI4 A;  3ABU A;  3ETD A;  3FB6 C;  1CEZ A;  2OT5 A;  2H8P C;  1RM1 B;  4MVR A;  2X7R B;  4PEL A;  2AHZ A;  1R3L C;  2XOK G;  2JIZ G;  3FYI B;  3X2Q C;  2A79 B;  1K4C C;  3B77 A;  1S72 V;  4WF9 V;  5L3D A;  3EFF K;  4JTD B;  4MVS A;  2LP7 A;  3RVZ A;  1VQM V;  3T1C A;  2JJ1 G;  3AG1 C;  1FXK A;  1SRY A;  4ASU G;  4PDR A;  3FKS G;  2FTK A;  4R50 A;  3JD2 A;  3W7U A;  3CXC U;  1OCC C;  3OUF A;  3G71 V;  3CC4 V;  4MS2 A;  2X6C A;  2HVJ C;  2QEX V;  2Y69 B;  3ABM C;  5B3S C;  1MAB G;  2WLH A;  3W7W A;  1K3E A;  4HZ3 A;  4BIU A;  2QM8 A;  3MD0 A;  2EIN C;  1F23 A;  4RAI A;  3DTU B;  1G4Y B;  2HKO A;  3AG4 B;  1V54 C;  3SYP A;  1NVP B;  2YEV A;  1RPR A;  5GW7 A;  3K03 A;  4UVC A;  1K8A W;  4JYB A;  3OGC C;  4PDV A;  3CD6 V;  1JCH A;  1E1R G;  1YJW V;  1BHA A;  4JYC A;  1AJN A;  1FXH A;  1SES A;  1ENV A;  2EIK C;  4L87 A;  1H38 A;  3AG2 B;  2B1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...