1S72V

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s72V00
3CCUV 1JJ2U 3CCSV 1Q7YW 1YI2V 2OTLV 1QVFU 1K9MW 1K73W 1W2BU 3I56V 4WFAV 1KC8W 1YITV 3CPWU 3CCQV 1VQOV 1VQ7V 1Q82W 3CC7V 1N8RW 3CXCU 1VQ8V 3CC2V 2OTJV 2D3OW 3CD6V 4WFBV 3CCJV 1KQSU 1YJ9V 1VQ4V 1VQ6V 3CCRV 3CCLV 3CMEV 3CCVV 4WCEV 1QVGU 1M1KW 1VQ9V 1VQLV 1S72V 3CCMV 1VQMV 1YIJV 1VQPV 1M90W 3OW2U 5DM6V 3I55V 1YHQV 1YJNV 3CCEV 1Q81W 3G6EV 1R73A 3CMAV 1KD1W 1YJWV 2QEXV 1NJIW 3CC4V 3G71V 1Q86W 3G4SV 2QA4V 1K8AW 4WF9V 1VQKV 1VQNV 1VQ5V
chains in the Genus database with same CATH superfamily
3QO7A 2WLKA 3TCUA 4DXWA 4TQDA 2RMKB 5CBHA 5B1NA 1M93A 1IBKB 3CHXA 4QGPA 2UUBB 4MVUA 3ZHRA 1P4RA 5EYPB 5L3DA 1Q6IA 1AJNA 1JPXA 4WBNB 1BE3H 2ZDIA 1SQPH 2Z5UA 2VWKA 4QE7A 5KX5B 1XUQA 2EIJB 1NVPD 4X9QA 2F1MA 1FXKA 2ODMA 3OTOB 3WU2Z 2DQ0A 4WFFA 3CC4V 4IHJA 2GV9A 4I55B 3ZIAG 3N2KB 4CBCA 5JCOC 3T1YO 2EILC 4JAUA 2H8PC 1GM8A 1NBMG 4KHPB 4RQEA 4HNAB 3THOA 3CSXA 3L72H 1YJ9V 1WB8A 1PL4A 1M1KW 2CK3G 3JALB 4K0KB 5JWPA 2FL4A 4I9WA 1XHXA 1R6TA 4X1KB 3HKBB 4HBNA 2Q73A 5EBLC 1Q86W 3AK3A 2Q8VA 1GK9A 1Z2GA 1R3LC 2AXTZ 1N36B 3B2EE 3LSSA 2QE7G 1CEZA 5ITZA 3C3TA 4LWSA 2ZE6A 2CAZC 5GONA 1IURA 1NTZH 1V55B 1XREA 2JGUA 1W0JG 3EHBB 4LH7A 2X0LA 3ZN0A 1KYOF 4ABMA 2ZD9A 1ROPA 4O4JB 4JI7O 3APQA 4O4LA 3K5OA 2YXHA 1SC5B 2V4DA 1M56C 1HNZB 1OCRB 1OCCB 5BY1A 1WP8A 4PDMA 4ZKIA 2W6IG 3FAVA 1OHHG 4DV3B 2ZKOA 1ORQC 3ZS8C 4FLVA 1NTMH 4LH6A 3APOA 1EN4A 1XOUA 2WLNA 4GX2A 2D3OW 2Q4PA 5DN6G 5LYJA 4WBNA 5EC2C 4GUNA 1OCZB 1TUBB 5CA0A 4NXNB 3JSNA 4TUYA 2HJDA 4MVZA 4DR3B 1IZ3A 3BRCA 3FB6C 4FIPC 2UUAO 1SQVH 4CS4A 3OR6C 3DTUB 5K1XA 3Q4HB 5FPOA 1LUVA 1FFXB 3CXCU 4ZHQA 2P22C 5GTHZ 5DM6V 1I5XA 2P4KA 3UCSC 2YEVB 1R3JC 1GN6A 1AJQA 3HPLC 3P3NA 3L73H 2Q7HA 1L1FA 3G6BA 4HNAA 2KQXA 3O65A 1YEWA 3J81N 4JGSA 4N23A 4JI6O 2OWOA 1Q5OA 1TUEB 4LF8O 3JATB 1SZXA 1IBMO 1EM1A 4X1KA 2Y4UA 4D7TA 5IJ0A 5IWAB 3D3IA 3RW0A 1XNRO 1R73A 4H13B 4PDRA 3QNEA 2QWRB 5JJNB 2QKSA 4WFHA 1NVPB 2F4VB 3FB7C 2BTOA 3CC2V 3ETEA 1YTFB 4ZOLA 3H1JH 5B5EZ 3CCLV 3RYIA 5KAIZ 4J80A 2XAJA 1RPOA 5B1BB 1N33B 2Y48A 3QO5A 2IJJA 4NTWA 5CBFA 4UVBA 1VQ5V 1XEQA 4DV2B 2P06A 5J9PC 1EN5A 5EZYA 1HW7A 3VBBA 4DV7B 3AG3C 2JEUA 2XUMA 3O9OA 4JI6B 3CEIA 1VQ9V 4GKJO 4FM1A 3ZCCA 3K06A 1S72V 4DRXA 4DV5B 1YXBA 1AR1B 4NVPA 2WA4A 2CDYA 3OTOO 1XNRB 4YHHO 1G8MA 1J95A 2LW1A 2L6LA 2DMXA 1OCOB 1AI5A 2IU0A 1OCRC 1SESA 1ZTEA 4F4LA 1NS1A 4B3MO 3HKEA 1FXKB 2QGNA 3RGBA 2V1DA 3E89A 1NR1A 2EX3A 4KXRA 5FL7G 4LFCO 2ZT9B 1XMQB 2AHYA 1P49A 4NXMB 2RN9A 3IC7A 3VQVA 4I0XA 5KAFZ 2Q0OC 1MSWD 4NR1A 4BIUA 4X1IB 1SS3A 3RT3C 1OJHA 2F93B 1QR9A 3ETGA 1MA1A 1GTOA 4O4LB 3BABA 5IT9N 1Y67A 1Z5WA 2QWQB 3CWBH 1Y74B 4HAMA 1OZ0A 2IJKA 1XNQB 2VQEB 1SQBH 2RJZA 3TJTA 3U10A 4DV4B 1M57B 3L74H 3AEIA 3CXHF 3IJ4A 2W6JG 4GLXA 1HNZO 1Q6UA 1VQLV 2O57A 3JASB 1FAFA 3DXRB 4O2BB 2QTSA 3RN4A 1XMQO 4FLTA 2EILB 4FFBB 4G2KA 2VS0A 2F66C 1I94B 3BA9A 2WPDG 2FYUH 2Z0AA 2WAMA 5JJJB 3FD9A 3MDSA 3SPCA 4DR2O 3JAKB 2YDEA 4QIWF 3FX7A 1YJWV 2DWEC 4Q20A 4XBFA 4NXNO 5LL6Y 1NI8A 3CX5F 3VQXA 4LFBB 1P84F 1Y76A 3KCXA 3OR7C 4JYAO 5HFLA 5BMVB 4DV4O 2QDOA 2XT9A 2DYSC 4Q6GA 2WLJA 1IX9A 1VF6C 5CA0B 4F6EA 3S3XA 3JATA 4L87A 4F6RB 4U3JA 1QHTA 2UU9B 5IJ0B 1NZ6A 2YIBA 1K8AW 4YIPA 1E1RG 4FM2A 3HKDA 4UCSA 1I94O 2PYLA 2OCCB 2A3QA 2EIMC 3E35A 1SKVA 2HR3A 2QSAA 3GVMA 4GKKO 4B7KA 2ZNJA 4P9PA 1YJNV 1J5EB 3LDCA 3SYPA 2N05A 4EFBA 1DF5A 3FYEB 3AG2B 3GWOA 3ICXA 1O9HA 2XTAA 1JCHA 2Y4TA 3OTFA 2JS5A 2LGQA 4G27B 4PDVA 2GSMB 5D5PA 2A7WA 1KU9A 1P7BA 1DK1A 2PY5A 4O2AA 1XI1A 2F95B 1XBLA 4LNUA 1AJPA 2CH7B 5H2FZ 4YY3B 1VQKV 2HP8A 4DUYO 1IBKO 3TXSA 2V7QG 1KP3A 3E8FA 2JVDA 5KA6A 2WA3A 1WNSA 4DR5O 3Q4HA 4DV7O 3TETA 4MTXA 2UXCO 1J5EO 1DTOA 3J80N 3JARA 1E79G 2ZR2A 3PN1A 3BA8A 2JS3A 1WLEA 4FLYA 5LBQA 4X66O 4JYYA 2AW9A 1U96A 4I9QA 3RBZA 5EBMC 4OPHA 3E8GA 4HZ3A 4LFCB 3T2MA 3B09A 1V9PA 4U7OA 5KMGB 1Y74A 4NXMO 1N0JA 2YUAA 2PZSA 3QTCA 1RM1C 5BZBA 2QWOB 2A9HA 1NQTA 1I08A 4A5UB 2LP7A 3CD6V 1RM1B 2N74A 2QKAA 4D6TH 1FPOA 2ADPA 2Q67A 1VQPV 1XMOO 1H2GA 1RSOA 4UB8Z 2XNDG 4FM0A 5B3SB 2X7RB 3T1HO 1XNQO 2CGOA 1V54C 1XILA 3AG1C 2VQEO 5KHJA 1Q7YW 4B7EA 2JJ2G 4X20B 4J11A 4N21A 1RFYA 1ZL8B 2CTPA 5LOVB 3JD2A 3KG2A 4AQYB 1K34A 2EIKC 2GTAA 2KG7B 4MT8A 1H2MA 2GBOA 4WCEV 1G1XB 3H1HH 2LGWA 2YSUB 1FD9A 3WG7C 3CCMV 4I5SA 1E1QG 4H0LB 2M6YA 4LF4B 4CH4A 5FLXN 4I7ZB 4JTDB 1EBOA 3K9AA 2EIKB 1AI7A 5CN0A 5FNVB 4PHZA 1VQ7V 3CRQA 3X2QB 4DUZB 3HKEB 5KHIA 1BS3A 1AI4A 3D36C 4DV0B 2YICA 4U3JB 2WLMA 1GAXA 1DF4A 3RYFA 3OE7G 3MD0A 4JYAB 3SJBC 1QQCA 3WB1A 1S0VA 4GX1A 2UXDB 4PJ0Z 3E22A 4AQYO 1WJZA 4DR3O 2UUAB 2KSDA 4JV5O 4JAAA 4LC1A 3JSLA 1V55C 1JR9A 2XASA 2NR5A 5L3GA 4QJFB 5EK0A 5HFMA 3OMNB 2UUBO 1HNXO 3AK1A 2W0XA 1WB7A 3ZHSA 3H1KH 2BOCC 5KMGA 4UVAA 4P30A 3TXQA 2XHBA 2Y69C 3UKMA 1US6A 5KUMA 1G4YB 2IW5A 2DJVA 2IJHA 2ITDC 5H6RA 3W7UA 5JH7B 4RO2A 3AG1B 3UM7A 4LF8B 2YI8A 1K9MW 4KL1A 4TV8A 5L3EA 4QPJA 1VQOV 4X65O 3BVOA 3HKCA 3ZX6A 3MHSC 2LQTA 2Q0AA 3JCUZ 1U97A 4K35A 5KUKA 2IU3A 3T1YB 3E8BA 4XDJA 3DGEA 2F4VO 3IGAC 5IDJA 1Y4MA 4JV5B 3AG3B 4OGQB 1SQGA 1VP7A 4MW8A 1D2DA 2EIJC 3LDDA 4DUYB 2ZXWC 3KKYA 4WFGA 5IYZA 2YIAA 3CCJV 1N33O 2IM9A 2LFRA 4X62B 1R3KC 3LNNA 2ETNA 2ZXWB 4DV2O 1XL6A 4JI4O 5JVDA 2VQFO 5IY5B 4IYIA 4DK1A 5KX5A 4IGGA 5L3FA 4ICGA 3K04A 3P30A 4GKJB 5TISZ 1M57C 2OCCC 2Y0PA 3KZIZ 3STLC 4PD4F 3K58A 1VQ4V 4JI7B 3F7VC 1ZX3A 5CMUA 4IIJA 4JPRA 1GM9A 5J2TA 5AG2A 1Q6HA 4B3SB 1Q43A 4TV9B 4J7KA 4DW0A 4JI1O 1S5LZ 1YF2A 1AI6A 3ZMTA 1YSCA 4FZ0A 4WFEA 3H1LH 1R3IC 2CTRA 1IXBA 4LF7B 3MHHC 1M4UA 1L0LH 1YIJV 4FLZA 1DGSA 1COWG 2R70A 2DWDC 2VQFB 2Y69B 3W7XA 1VIBA 2HHHB 4FPPA 1W59A 1RSOB 4UXNA 1I5YA 3G80A 3SDLA 2B9ZA 3E86A 2DN9A 2XOKG 5JH7A 5LYJB 1FS0G 3OGCC 3K0GA 4LF4O 4XDKA 2XAQA 1VQNV 4X1YA 4DR4B 2RCVA 4MTFA 4JI1B 3IAYA 4WFAV 5LP6A 1SF9A 4TWKA 5IYBO 5EBWC 2QM8A 4JYBA 4FVMA 4LF7O 4B3RB 1M90W 1M9NA 4DUZO 3OM3B 3UO2A 4C7UA 3CJHB 2OT5A 2OIEA 4H44B 4W4LA 4MVMA 1JMKC 3A8TA 1MG1A 1TVKB 5BXZA 2CE4A 5IY5C 4DV0O 5FNVA 3SPGA 1H8HG 5EZYB 5IE9A 2ZR3A 1F51A 5GW7A 2DW4A 4JI3O 1NH2B 4JZ2A 2HVKC 2Q68A 1JA8A 5ITZB 1SQFA 2UXXA 2PI4A 2EINC 1WN7A 1NT2B 3MAQA 2UXBO 1GO3F 1JOYA 1AR5A 3OT7A 3FFQA 4K8XA 3T4DA 2LO1A 3KCYA 3RFRA 3I56V 1F4MA 1WPXA 2OCHA 4BW9A 3WG7B 1GM7A 1HNXB 1HR0B 1NKDA 3CCRV 4YXWG 5H5NA 1B06A 5FPRA 3W7SA 3OW2U 2KG7A 4LF9O 2OIGA 4I0XB 4DV1B 3RYIB 5B1AC 4YIOA 3H1IH 2IBZH 4X1IA 4BIOA 2YIDA 4NKGB 2Z3YA 4UVCA 1F7YA 3X2QC 4MW3A 3SGIA 5KLVH 1T5EA 3JD0A 4GKKB 2GDSA 1JFFB 3CYOA 3D8CA 3JAWA 4X65B 3VQYA 5IYCO 3SPIA 4DR6B 1D5NA 1IXMA 2GTSA 1H8EG 3W7TA 5B1BC 5LA6B 3G71V 1B6QA 2WWWA 4O4IA 3C3SA 4TV8B 4B3MB 4MS2A 3HKCB 4LFAB 1SETA 3ASNC 4MTGA 5LXTA 1FXKC 2QWPB 4CH5A 4UCTA 1K33A 2A06H 5B3SC 1QNMA 4X62O 4JI4B 3ABKB 4R6ZA 4BAYA 2QKCA 2QWNB 3BFRA 2CTQA 2XAHA 2ZE8A 2ZCEA 2UUCB 2JIZG 2P6JA 4AHCA 2AGAA 2X6BA 3CCVV 2EULA 2BTQA 3EVKA 5JVDB 4DR6O 3M7MX 2WSSG 2Q69A 1TAEA 3ZEDA 1H2LA 2EINB 1AROP 2Q9LA 3CRMA 2PTMA 2P67A 5LMUO 1UFIA 1WAZA 1R6NA 1KBHA 3ZRVA 4TSFG 1B04A 3M99B 4LFAO 5KA5A 1MZFA 4ZOLB 4OPAA 2B1IA 1R1BA 1FJGO 4QPKA 4E4EA 3DXRA 4O2BA 5J2UB 1JVMA 2K9PA 2VRZA 2MK3A 4X89A 3QO8A 3N2GB 1NR7A 1YCIA 4BWAA 4DR2B 2HFEC 4TT3G 4K8ZA 2UUCO 3T1HB 2E5LO 4BIZA 3ABLC 2FMLA 2PYJA 5B1OA 1PL0A 1K92A 1HNWO 1BZKA 4ZI7A 1N34B 2KKWA 1QLNA 1FYJA 3B8NA 3CCUV 4JI8B 3VQWA 2JJ1G 5JQGB 3OFNG 3P32A 3F5WC 4UV8A 4CS3A 1KQSU 2UU9O 1YVWA 1NU1H 4R7CA 1D5AA 5DECA 4JTCB 5EIBD 2JDIG 1IVSA 2ZE7A 4B3RO 4FFBA 1WA8A 4FLWA 3OGIB 2M7WA 4UFZA 4GX0A 1W0KG 4WF9V 3D36A 4B3TO 1FXHA 2OYQA 4UB6Z 1PPJH 3ZHVA 3ZRWB 4DV6O 1BHAA 1SA0B 4XDLA 1BMFG 4JI3B 1SRYA 3JAKA 1F23A 4FMTA 2DOSA 1VQMV 1L0NH 4IHJB 4DK0A 3RYHB 2E5LB 2Q6AA 1LR1A 4CH3A 4X64B 3G67A 1Q3EA 2DE0X 2UXBB 4LP8A 2HEPA 2UXDO 2FKXA 4NTYA 2BCCH 3JD4A 4G28B 2R9RB 1FKAO 2Q7GA 1HR0O 1X4TA 3ZRXA 2DYRC 5LMNO 4J7JA 3A0BZ 2G38A 3CRRA 5LHIA 4J9YB 2GHYA 4LF9B 4DV1O 2N04A 3BCCH 5EYPA 4DR1B 1OV9A 4TOIA 3AG2C 3DC6A 3IFXA 4O2AB 1HWYA 4O4IB 3ABTA 4X1YB 3STZC 5KHKA 3W7WA 2UXCB 3UO3A 4W4KA 5CB4B 2A79B 3N27A 4J7ZA 4J42A 1PD3A 3UT5B 3LDEA 3SJQC 4X66B 1UJWB 4P9OA 3CJHA 2R9AA 3A2FA 4JYCA 1Y76B 1YITV 1S5HC 2XAFA 1AB3A 4CZZA 4EFEA 4GYCB 2IH3C 4UCUA 3SJAC 4RAIA 4GX5A 3B8MA 3ZMZA 5LMNB 3G6EV 1N4CA 2BTQB 4PELA 2YXYA 4F6RA 4QNHB 5LP6C 3SYQA 1A32A 1KC8W 2JGDB 1VF6A 5EC1C 4LF5O 3ASNB 3CMEV 1EZJA 3F5TA 5DEDA 4UUJC 2L35A 4PA4A 1AILA 2X6CA 2PGGA 2A0LA 2ZQMA 4BR6A 1K4CC 4B08A 2LFSA 1KP2A 3OMAB 4FLUA 1BQ0A 1H2KA 1KUQA 4Z2WA 2MW2B 3SYCA 5CA1A 2QTOA 3H9VA 2FB5A 1OCOC 1XL4A 5LOVA 3NXSA 3HKBA 3JCZA 1EZVH 2JEXA 2ADQB 4DO2A 4H37A 3A0HZ 1N32O 1QU7A 4RWUA 4JI5O 2DYSB 4LNUB 1VEWA 1AP6A 1YTFD 4NTXA 4KUMA 3B4SA 3ML0A 4LF5B 2HLDG 3LNMB 1BCCH 2UXNA 1S3JA 5KHHA 1Z5VA 1S76D 1N34O 3OD4A 4TUYB 1QLEB 1BSMA 1K5SA 5F2VO 3R66A 2HJFC 3CCQV 5KHGA 2JK5C 2LJ2A 3UT5A 3WB0A 4D7SA 5LHHA 4O4HA 2EZPA 4JAVA 3JALA 4MVOA 1ENVA 1QLEC 4LF6O 1TGOA 4K3AA 4MVSA 2ITCC 1FFTB 2P7TC 4JI0B 2H3OA 1R6KA 4BW5A 4DV6B 3ZMUA 1VF7A 1KB9F 4DR7B 3AG4C 5K1PA 2JRIA 4CS2A 4JTAB 2AHZA 3K5NA 3I5DA 4TQFA 2ZINA 1QVFU 2EZOA 3ZRWA 4FLXA 4IT5A 3ZRSA 2RNBA 4ZIBA 3E22B 2E3CA 3ABLB 2YIBD 2ILMA 3UQ8A 1JJOA 1I7FA 4IIJB 2YS8A 3OEHG 2EBOA 3OUFA 4PV1B 1ZUQA 3RYCB 1AR4A 1SZTA 3DSQA 1W2BU 2AZ0A 1IDSA 2IH1C 3NR7A 2QR4A 1VQ6V 5JQGA 4FJCC 5CA3A 4KFMA 1Q8IA 1YDXA 1YZBA 2XAGA 1PNKA 5LGTA 2P4VA 4EEQA 1MOFA 2QJ1A 4FFKA 4MVRA 5IWAO 2K1EA 3F7YC 3K0DA 5CBGA 1TA8A 4I4TA 4QE9A 3K03A 3JASA 3CC7V 1KMIZ 2R72A 4P2ZA 2F23A 4B3SO 4UCVA 3SYAA 1SQXH 3I55V 1YHQV 1HDJA 2X6AA 2ZM6O 3G4SV 1BT8A 2WLHA 4K0KO 3CE2A 2LW7A 3CCSV 3HB3B 2Q7EA 1GH6A 5LGNA 4MSWC 1I0HA 1PKXA 3AK2A 3VOUA 2PUSA 4OX9B 3ETQA 4PA7A 2CUGA 2EJRA 1N36O 1GN3A 5CA1B 5JCOA 4I50B 1TVKA 3E83A 5L3BA 1KD1W 4YJ3A 2EJ7A 3C90A 2JGDA 2F43G 2BE3A 1XQ8A 2BOBC 2HHHO 4E2LA 2H94A 4J41A 5C8YB 3ABUA 2KB1A 4RQFA 1WPBA 5D5QA 5J2TB 3L9DA 1H2SB 2NLJC 5C93A 3ABKC 4X8AA 4LCUC 4DR4O 4TV9A 3AG4B 1THZA 1F4NA 1M5IA 3HKDB 1KKDA 4PA6A 3L71H 2WLIB 3K08A 4GT1A 5CB4A 4DV3O 2ZM6B 3EXAA 3J7AU 1K7DA 1P7GA 4PA9A 1G6UA 2YXLA 5B1AB 2BSKA 4YJ2B 4DYLA 2FTKA 4WFBV 1FJGB 3RVZA 4OX9O 2RQ6A 3OUSA 3OMIB 1O9GA 5IJ9A 3R65A 5EIBC 1FXVA 4NB5A 1OCZC 1UPGA 4RUEA 3FB8C 3EFFK 3E8HA 4O4HB 4FK5C 1GN4A 3HR0A 3FB5C 2C2AA 3JAMN 3OEEG 4NYKA 1Q90D 5BMVA 2HKOA 4EB6A 4PA3A 3BEHA 3E2EA 3RWRD 4JI8O 1CPYA 1GRJA 2E76B 5BR8O 1PP9H 1S77D 1JJ2U 3S3WA 1JQ0A 1OCCC 1ZSPA 4LF6B 2GUZB 3SJCC 1DLBA 1Y6XA 4JF3A 3ZMVA 5LGUA 1LNQA 3K59A 4JI0O 3K3WA 3CRAA 4UCOA 1AP5A 4DW1A 4B3TB 3ASOC 2B5UA 2QEXV 3N2KA 2CGNA 2WLLA 1IBMB 1WP7A 3AG7A 2ZIMA 1N0NA 4RUFA 4Z1MG 1IBLB 2ZE5A 3RYCA 2EIMB 3FYIB 2PI5A 1B3QA 3K5MA 3DC5A 1MSDA 3BPZA 4GCZA 3T4ZA 3ABMC 4KP4A 4LFBO 3WFVA 1BGYH 4EKWA 4PI2A 4CH6A 1K97A 4L8JA 3ABMB 2E74B 5A9GA 3CMAV 3H01A 3BAAA 3CB2A 3IC9A 1MABG 3OAAG 5C8YA 5BR8B 3K9SA 2VWJA 2IJIA 1K4DC 1VQ8V 3ZHTA 3ZBHA 2ZNIA 2Y0IA 5LP6B 1RP3B 3CRCA 4DR1O 3LSUA 1QVGU 1MZEA 3M8AA 3CCEV 2ZIOA 3SYOA 1NH2D 5LXTB 1H2NA 2D2CB 2NNUA 4HYOA 4OXSA 3K57A 1K5QA 3LSQA 3ZHUA 4DV5O 2AZ2A 2QM7A 1BL8A 4I55A 1PV0A 4J9ZB 4YHHB 1M56B 2CTWA 1QCEA 4U3FH 5A2QN 1XHZA 1KKCA 3BHPA 1VARA 3SPJA 1EFRG 2P5OA 1PM9A 4JASA 5LMUB 1RPRA 1GN2A 1MMMA 1X59A 1XDCA 3A0RA 4I50A 3JD1A 5IYDO 1K3EA 4JI2B 1BQZA 4KHPO 5B66Z 1BHBA 4ASUG 2YI9A 5LHGA 4EB6B 2E75B 4YY3O 3L75H 1EN6A 4LWSB 3B77A 4IYHA 2W0FC 4DR5B 3JYCA 3JARB 2NN4A 4J10A 2ATKC 1CP9A 3P3PA 2DYRB 4PI0A 3RYFB 4JZGA 1YI2V 2OTLV 4MVQA 5J2UA 1SA0A 3CP1A 1URFA 1JX9A 1Q82W 2OTJV 4X20A 5E79Z 1MNGA 1QBZA 3N2GA 1HNWB 3K5LA 2P90A 4H33A 1JFFA 3BY6A 4UCRA 4YJ3B 3TGUH 5GTIZ 3JAWB 2Q5ZA 3L70H 5LA6A 2PF4E 3SPHA 5L3CA 3TK1A 4ZBMA 3ZJZA 1SERA 2CH7A 4JI2O 3ZN1A 1SQQH 2RDCA 3ASOB 4I4TB 4X88A 1GKFA 1S5JA 1L8DA 1N32B 4IL6Z 4JI5B 4AI8A 1TUBA 3GWKC 4Z1VA 2QA4V 1WA8B 3QG5A 1XMOB 1K73W 4U7NA 1VF5B 1N8RW 3ZHQA 1PNLA 4X64O 4LBEC 2ZDIC 4R50A 3QF7A 4ZI7B 1FFXA 3U0ZA 4ZHQB 1LUWA 4GZRB 1QR8A 1ZWIC 5E1AC 2HG5C 5JJEB 2QM4A 1Y66A 2R9IA 4AILC 1VMGA 5IYZB 1AVMA 4MTOA 4DRXB 2YC0A 1H38A 3D3QA 5GONB 4CC6A 1CXZB 1ZAUA 1NJIW 3WB2A 1NTKH 3U11A 3ETDA 2GUZA 3JD3A 1KECA 5H9CA 3T1CA 4O4JA 3FKSG 3QVNA 3CS5A 3LUTB 5H6QA 4DR7O 1IBLO 2WLIA 3PJSK 3ZMSA 3B40A 3CPWU 2HVJC 3GB7C 4UV9A 1PNMA 1HP8A 2BSKB 4FZ1A 4YJ2A 2B1GA 3RYHA 1ZL8A 4PDLA 4CC5A 1GMGA 1ZLZA 2YEVA 2WLLB 2ARHA 3K79A 1Q81W 3FAVB 5IJ9B 4LR3A 2DQ3A 4R8CA 1V54B 3SR2C 3RVYA
chains in the Genus database with same CATH topology
1SZTA 3GWOA 3QO7A 2WLKA 2Z3YA 4UVCA 1W2BU 3TCUA 3X2QC 4DXWA 4MW3A 1JCHA 3JD0A 5CBHA 4G27B 2IH1C 3CYOA 4PDVA 2GSMB 1VQ6V 5B1NA 5IYCO 1P7BA 3SPIA 1IXMA 4MVUA 1H8EG 1P4RA 5L3DA 4FJCC 1AJNA 5CA3A 4KFMA 3W7TA 5B1BC 2XAGA 1PNKA 5LGTA 1JPXA 2ZDIA 3G71V 1B6QA 2WWWA 1MOFA 2Z5UA 1AJPA 1VQKV 4QE7A 4MVRA 2K1EA 3F7YC 3K0DA 4MS2A 5CBGA 2V7QG 1KP3A 3E8FA 4QE9A 5KA6A 2EIJB 3K03A 3CC7V 1NVPD 1SETA 3ASNC 4P2ZA 4MTGA 3TETA 1FXKC 1FXKA 3SYAA 1K33A 4MTXA 5B3SC 3I55V 1YHQV 2DQ0A 4WFFA 3CC4V 2X6AA 1DTOA 3G4SV 2WLHA 3ABKB 3ZIAG 4R6ZA 3CCSV 1E79G 2ZR2A 3HB3B 5LGNA 4CBCA 4MSWC 2EILC 1PKXA 4BAYA 1WLEA 2H8PC 1GM8A 4JAUA 1NBMG 5LBQA 3VOUA 2XAHA 4RQEA 2JIZG 3RBZA 5EBMC 2P6JA 4PA7A 1YJ9V 2X6BA 3E8GA 3CCVV 2EJRA 1M1KW 2CK3G 4HZ3A 3T2MA 4U7OA 4I9WA 2WSSG 2Q69A 3E83A 5L3BA 1KD1W 5EBLC 1Q86W 2EINB 1GK9A 1AROP 2F43G 1R3LC 1RM1C 2P67A 2BOBC 5BZBA 3LSSA 4E2LA 2H94A 2QE7G 1CEZA 1R6NA 2A9HA 1NQTA 2LP7A 3ZRVA 4TSFG 3CD6V 3ABUA 1RM1B 2KB1A 3M99B 4RQFA 5KA5A 1V55B 2NLJC 5C93A 1W0JG 3ABKC 2Q67A 3EHBB 4X8AA 1VQPV 2X0LA 4LCUC 1H2GA 3ZN0A 2B1IA 3AG4B 1THZA 2XNDG 4QPKA 1F4NA 2ZD9A 1ROPA 1KKDA 5B3SB 2X7RB 4PA6A 2WLIB 3K08A 4GT1A 3AG1C 1V54C 1JVMA 1Q7YW 1K7DA 2MK3A 4PA9A 4X89A 2JJ2G 3QO8A 1NR7A 5B1AB 4N21A 1M56C 2FTKA 3JD2A 1OCRB 3KG2A 2HFEC 1OCCB 1K34A 2EIKC 4TT3G 4WFBV 4MT8A 3RVZA 4PDMA 4ZKIA 2W6IG 4WCEV 3OUSA 3OMIB 2YSUB 1OHHG 3WG7C 3CCMV 3R65A 4BIZA 3ABLC 1E1QG 4I5SA 5B1OA 1PL0A 1FXVA 1OCZC 1K92A 4RUEA 1ORQC 1QLNA 3FB8C 3EFFK 3E8HA 3B8NA 3CCUV 4JTDB 1EBOA 3K9AA 4FK5C 2EIKB 1AI7A 5CN0A 2JJ1G 2WLNA 4GX2A 3FB5C 2C2AA 1VQ7V 3OFNG 3P32A 3OEEG 3F5WC 4UV8A 3X2QB 2D3OW 1KQSU 2HKOA 5DN6G 4R7CA 4JTCB 4PA3A 3BEHA 3E2EA 2JDIG 5EC2C 1OCZB 1AI4A 1CPYA 2M7WA 4MVZA 4GX0A 1W0KG 3FB6C 2WLMA 4FIPC 4WF9V 3D36A 1JJ2U 1S77D 1FXHA 1JQ0A 1DF4A 1OCCC 3OR6C 3DTUB 3OE7G 3MD0A 1DLBA 4JF3A 3ZRWB 3ZMVA 5LGUA 1BHAA 1LNQA 4XDLA 4GX1A 3CXCU 1S0VA 1BMFG 1SRYA 1F23A 4FMTA 3K3WA 1VQMV 5DM6V 1I5XA 3ASOC 2B5UA 2Q6AA 2QEXV 2YEVB 1R3JC 2WLLA 1AJQA 4LC1A 1V55C 4LP8A 3HPLC 2XASA 5L3GA 4RUFA 4Z1MG 4QJFB 5EK0A 1L1FA 2EIMB 5HFMA 3JD4A 3FYIB 3OMNB 4G28B 2PI5A 4JGSA 4N23A 4GCZA 3T4ZA 3ABMC 4KP4A 2R9RB 1TUEB 3WFVA 4EKWA 2BOCC 4UVAA 4P30A 3ZRXA 2DYRC 2Y69C 1K97A 3ABMB 5LHIA 3D3IA 4J9YB 3RW0A 1R73A 2GHYA 5KUMA 3UKMA 1G4YB 3H01A 2IW5A 3CMAV 4PDRA 2IJHA 2ITDC 5H6RA 3W7UA 3QNEA 3AG2C 1MABG 4RO2A 3AG1B 2QKSA 3UM7A 3IFXA 3OAAG 1HWYA 4WFHA 1K9MW 1NVPB 3ABTA 2IJIA 5L3EA 4QPJA 3FB7C 3STZC 1VQOV 1K4DC 1VQ8V 3CC2V 3ETEA 1YTFB 3MHSC 3W7WA 3CCLV 1QVGU 5KUKA 2XAJA 2IU3A 3CCEV 3E8BA 4XDJA 3SYOA 1NH2D 3DGEA 2A79B 1RPOA 5B1BB 2NNUA 3IGAC 2Y48A 1PD3A 3QO5A 5IDJA 3LDEA 2IJJA 3SJQC 5CBFA 1Y4MA 4HYOA 4P9OA 1UJWB 4OXSA 4UVBA 1K5QA 3AG3B 3LSQA 1VQ5V 2QM7A 1BL8A 4MW8A 2EIJC 4JYCA 3LDDA 5J9PC 1YITV 1S5HC 4J9ZB 2XAFA 1M56B 2ZXWC 3VBBA 4CZZA 4WFGA 1QCEA 3AG3C 2JEUA 3CCJV 2IH3C 1VQ9V 4RAIA 3ZCCA 3K06A 1S72V 4GX5A 3SPJA 3B8MA 1EFRG 3ZMZA 2LFRA 1AR1B 1R3KC 2ZXWB 4JASA 3G6EV 1RPRA 1XL6A 4PELA 3A0RA 1G8MA 1J95A 3JD1A 4QNHB 5IY5B 5IYDO 1OCOB 5L3FA 1K3EA 1AI5A 2IU0A 3SYQA 1OCRC 1SESA 3K04A 3P30A 1KC8W 4ASUG 1BHBA 4F4LA 5LHGA 1M57C 2OCCC 5EC1C 3STLC 1FXKB 2V1DA 3E89A 1NR1A 1VQ4V 3ASNB 3F7VC 5FL7G 3CMEV 1EZJA 5CMUA 3B77A 4JPRA 2AHYA 1GM9A 2W0FC 4UUJC 3JYCA 4PA4A 3IC7A 2X6CA 2A0LA 2ZQMA 1K4CC 2ATKC 1CP9A 2DYRB 1MSWD 4BIUA 1YI2V 2OTLV 1AI6A 1KP2A 2LFSA 3OMAB 4MVQA 3ZMTA 1QR9A 3ETGA 3CP1A 1YSCA 1GTOA 4WFEA 1JX9A 1R3IC 1Q82W 2OTJV 3SYCA 1QBZA 2QTOA 2P90A 1OCOC 1XL4A 3MHHC 4H33A 3NXSA 3BY6A 1YIJV 3JCZA 2JEXA 4HAMA 1OZ0A 1COWG 2IJKA 4DO2A 4H37A 2DWDC 3RVYA 3SPHA 5L3CA 3TK1A 4ZBMA 2DYSB 3ZJZA 1SERA 1YTFD 1M57B 3ZN1A 4KUMA 2Y69B 3W7XA 3ASOB 3AEIA 2W6JG 3ML0A 4X88A 1GKFA 4FPPA 4UXNA 1VQLV 1I5YA 2HLDG 3E86A 2XOKG 3LNMB 1FS0G 1S3JA 2UXNA 3OGCC 3K0GA 2EILB 4XDKA 1S76D 2QA4V 2XAQA 4G2KA 1VQNV 1QLEB 1K5SA 1K73W 4MTFA 4WFAV 4U7NA 2HJFC 3CCQV 4TWKA 1N8RW 2WPDG 1PNLA 4LBEC 2ZDIC 2JK5C 5IYBO 2WAMA 5EBWC 2QM8A 4JYBA 4R50A 1M90W 1M9NA 3SPCA 3OM3B 4QIWF 2OT5A 4MVMA 5LHHA 1YJWV 2EZPA 2DWEC 4JAVA 4Q20A 1QR8A 4XBFA 4MVOA 1MG1A 1ENVA 5IY5C 1QLEC 1ZWIC 5E1AC 3SPGA 2HG5C 3OR7C 1Y66A 1H8HG 2R9IA 4MVSA 5HFLA 2ITCC 2ZR3A 1F51A 1FFTB 2P7TC 5GW7A 2DW4A 2DYSC 1NH2B 1R6KA 4MTOA 4BW5A 2HVKC 2WLJA 3ZMUA 2Q68A 1H38A 2UXXA 2PI4A 2EINC 3AG4C 4L87A 1GO3F 4JTAB 1JOYA 1NJIW 2AHZA 3ETDA 1K8AW 3JD3A 1KECA 1E1RG 5H9CA 3T4DA 1QVFU 2EZOA 3T1CA 3ZRWA 3FKSG 3LUTB 5H6QA 3I56V 1F4MA 3ZRSA 2WLIA 1WPXA 3PJSK 3ZMSA 3CPWU 2HVJC 3GB7C 3ABLB 4UV9A 2OCCB 1PNMA 1GM7A 2EIMC 3WG7B 1NKDA 3E35A 3CCRV 2HR3A 2B1GA 4YXWG 4PDLA 3OEHG 1GMGA 2YEVA 3W7SA 2EBOA 2WLLB 3K79A 3OW2U 4P9PA 3OUFA 1YJNV 1Q81W 5B1AC 3LDCA 3SYPA 2DQ3A 4R8CA 1DF5A 1V54B 3FYEB 3AG2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU V;  1JJ2 U;  3CCS V;  1Q7Y W;  1YI2 V;  2OTL V;  1QVF U;  1K9M W;  1K73 W;  1W2B U;  3I56 V;  4WFA V;  1KC8 W;  1YIT V;  3CPW U;  3CCQ V;  1VQO V;  1VQ7 V;  1Q82 W;  3CC7 V;  1N8R W;  3CXC U;  1VQ8 V;  3CC2 V;  2OTJ V;  2D3O W;  3CD6 V;  4WFB V;  3CCJ V;  1KQS U;  1YJ9 V;  1VQ4 V;  1VQ6 V;  3CCR V;  3CCL V;  3CME V;  3CCV V;  4WCE V;  1QVG U;  1M1K W;  1VQ9 V;  1VQL V;  1S72 V;  3CCM V;  1VQM V;  1YIJ V;  1VQP V;  1M90 W;  3OW2 U;  5DM6 V;  3I55 V;  1YHQ V;  1YJN V;  3CCE V;  1Q81 W;  3G6E V;  1R73 A;  3CMA V;  1KD1 W;  1YJW V;  2QEX V;  1NJI W;  3CC4 V;  3G71 V;  1Q86 W;  3G4S V;  2QA4 V;  1K8A W;  4WF9 V;  1VQK V;  1VQN V;  1VQ5 V; 
#chains in the Genus database with same CATH topology
 3QO7 A;  2WLK A;  3TCU A;  4DXW A;  4TQD A;  2RMK B;  5CBH A;  5B1N A;  1M93 A;  1IBK B;  3CHX A;  4QGP A;  2UUB B;  4MVU A;  3ZHR A;  1P4R A;  5EYP B;  5L3D A;  1Q6I A;  1AJN A;  1JPX A;  4WBN B;  1BE3 H;  2ZDI A;  1SQP H;  2Z5U A;  2VWK A;  4QE7 A;  5KX5 B;  1XUQ A;  2EIJ B;  1NVP D;  4X9Q A;  2F1M A;  1FXK A;  2ODM A;  3OTO B;  3WU2 Z;  2DQ0 A;  4WFF A;  3CC4 V;  4IHJ A;  2GV9 A;  4I55 B;  3ZIA G;  3N2K B;  4CBC A;  5JCO C;  3T1Y O;  2EIL C;  4JAU A;  2H8P C;  1GM8 A;  1NBM G;  4KHP B;  4RQE A;  4HNA B;  3THO A;  3CSX A;  3L72 H;  1YJ9 V;  1WB8 A;  1PL4 A;  1M1K W;  2CK3 G;  3JAL B;  4K0K B;  5JWP A;  2FL4 A;  4I9W A;  1XHX A;  1R6T A;  4X1K B;  3HKB B;  4HBN A;  2Q73 A;  5EBL C;  1Q86 W;  3AK3 A;  2Q8V A;  1GK9 A;  1Z2G A;  1R3L C;  2AXT Z;  1N36 B;  3B2E E;  3LSS A;  2QE7 G;  1CEZ A;  5ITZ A;  3C3T A;  4LWS A;  2ZE6 A;  2CAZ C;  5GON A;  1IUR A;  1NTZ H;  1V55 B;  1XRE A;  2JGU A;  1W0J G;  3EHB B;  4LH7 A;  2X0L A;  3ZN0 A;  1KYO F;  4ABM A;  2ZD9 A;  1ROP A;  4O4J B;  4JI7 O;  3APQ A;  4O4L A;  3K5O A;  2YXH A;  1SC5 B;  2V4D A;  1M56 C;  1HNZ B;  1OCR B;  1OCC B;  5BY1 A;  1WP8 A;  4PDM A;  4ZKI A;  2W6I G;  3FAV A;  1OHH G;  4DV3 B;  2ZKO A;  1ORQ C;  3ZS8 C;  4FLV A;  1NTM H;  4LH6 A;  3APO A;  1EN4 A;  1XOU A;  2WLN A;  4GX2 A;  2D3O W;  2Q4P A;  5DN6 G;  5LYJ A;  4WBN A;  5EC2 C;  4GUN A;  1OCZ B;  1TUB B;  5CA0 A;  4NXN B;  3JSN A;  4TUY A;  2HJD A;  4MVZ A;  4DR3 B;  1IZ3 A;  3BRC A;  3FB6 C;  4FIP C;  2UUA O;  1SQV H;  4CS4 A;  3OR6 C;  3DTU B;  5K1X A;  3Q4H B;  5FPO A;  1LUV A;  1FFX B;  3CXC U;  4ZHQ A;  2P22 C;  5GTH Z;  5DM6 V;  1I5X A;  2P4K A;  3UCS C;  2YEV B;  1R3J C;  1GN6 A;  1AJQ A;  3HPL C;  3P3N A;  3L73 H;  2Q7H A;  1L1F A;  3G6B A;  4HNA A;  2KQX A;  3O65 A;  1YEW A;  3J81 N;  4JGS A;  4N23 A;  4JI6 O;  2OWO A;  1Q5O A;  1TUE B;  4LF8 O;  3JAT B;  1SZX A;  1IBM O;  1EM1 A;  4X1K A;  2Y4U A;  4D7T A;  5IJ0 A;  5IWA B;  3D3I A;  3RW0 A;  1XNR O;  1R73 A;  4H13 B;  4PDR A;  3QNE A;  2QWR B;  5JJN B;  2QKS A;  4WFH A;  1NVP B;  2F4V B;  3FB7 C;  2BTO A;  3CC2 V;  3ETE A;  1YTF B;  4ZOL A;  3H1J H;  5B5E Z;  3CCL V;  3RYI A;  5KAI Z;  4J80 A;  2XAJ A;  1RPO A;  5B1B B;  1N33 B;  2Y48 A;  3QO5 A;  2IJJ A;  4NTW A;  5CBF A;  4UVB A;  1VQ5 V;  1XEQ A;  4DV2 B;  2P06 A;  5J9P C;  1EN5 A;  5EZY A;  1HW7 A;  3VBB A;  4DV7 B;  3AG3 C;  2JEU A;  2XUM A;  3O9O A;  4JI6 B;  3CEI A;  1VQ9 V;  4GKJ O;  4FM1 A;  3ZCC A;  3K06 A;  1S72 V;  4DRX A;  4DV5 B;  1YXB A;  1AR1 B;  4NVP A;  2WA4 A;  2CDY A;  3OTO O;  1XNR B;  4YHH O;  1G8M A;  1J95 A;  2LW1 A;  2L6L A;  2DMX A;  1OCO B;  1AI5 A;  2IU0 A;  1OCR C;  1SES A;  1ZTE A;  4F4L A;  1NS1 A;  4B3M O;  3HKE A;  1FXK B;  2QGN A;  3RGB A;  2V1D A;  3E89 A;  1NR1 A;  2EX3 A;  4KXR A;  5FL7 G;  4LFC O;  2ZT9 B;  1XMQ B;  2AHY A;  1P49 A;  4NXM B;  2RN9 A;  3IC7 A;  3VQV A;  4I0X A;  5KAF Z;  2Q0O C;  1MSW D;  4NR1 A;  4BIU A;  4X1I B;  1SS3 A;  3RT3 C;  1OJH A;  2F93 B;  1QR9 A;  3ETG A;  1MA1 A;  1GTO A;  4O4L B;  3BAB A;  5IT9 N;  1Y67 A;  1Z5W A;  2QWQ B;  3CWB H;  1Y74 B;  4HAM A;  1OZ0 A;  2IJK A;  1XNQ B;  2VQE B;  1SQB H;  2RJZ A;  3TJT A;  3U10 A;  4DV4 B;  1M57 B;  3L74 H;  3AEI A;  3CXH F;  3IJ4 A;  2W6J G;  4GLX A;  1HNZ O;  1Q6U A;  1VQL V;  2O57 A;  3JAS B;  1FAF A;  3DXR B;  4O2B B;  2QTS A;  3RN4 A;  1XMQ O;  4FLT A;  2EIL B;  4FFB B;  4G2K A;  2VS0 A;  2F66 C;  1I94 B;  3BA9 A;  2WPD G;  2FYU H;  2Z0A A;  2WAM A;  5JJJ B;  3FD9 A;  3MDS A;  3SPC A;  4DR2 O;  3JAK B;  2YDE A;  4QIW F;  3FX7 A;  1YJW V;  2DWE C;  4Q20 A;  4XBF A;  4NXN O;  5LL6 Y;  1NI8 A;  3CX5 F;  3VQX A;  4LFB B;  1P84 F;  1Y76 A;  3KCX A;  3OR7 C;  4JYA O;  5HFL A;  5BMV B;  4DV4 O;  2QDO A;  2XT9 A;  2DYS C;  4Q6G A;  2WLJ A;  1IX9 A;  1VF6 C;  5CA0 B;  4F6E A;  3S3X A;  3JAT A;  4L87 A;  4F6R B;  4U3J A;  1QHT A;  2UU9 B;  5IJ0 B;  1NZ6 A;  2YIB A;  1K8A W;  4YIP A;  1E1R G;  4FM2 A;  3HKD A;  4UCS A;  1I94 O;  2PYL A;  2OCC B;  2A3Q A;  2EIM C;  3E35 A;  1SKV A;  2HR3 A;  2QSA A;  3GVM A;  4GKK O;  4B7K A;  2ZNJ A;  4P9P A;  1YJN V;  1J5E B;  3LDC A;  3SYP A;  2N05 A;  4EFB A;  1DF5 A;  3FYE B;  3AG2 B;  3GWO A;  3ICX A;  1O9H A;  2XTA A;  1JCH A;  2Y4T A;  3OTF A;  2JS5 A;  2LGQ A;  4G27 B;  4PDV A;  2GSM B;  5D5P A;  2A7W A;  1KU9 A;  1P7B A;  1DK1 A;  2PY5 A;  4O2A A;  1XI1 A;  2F95 B;  1XBL A;  4LNU A;  1AJP A;  2CH7 B;  5H2F Z;  4YY3 B;  1VQK V;  2HP8 A;  4DUY O;  1IBK O;  3TXS A;  2V7Q G;  1KP3 A;  3E8F A;  2JVD A;  5KA6 A;  2WA3 A;  1WNS A;  4DR5 O;  3Q4H A;  4DV7 O;  3TET A;  4MTX A;  2UXC O;  1J5E O;  1DTO A;  3J80 N;  3JAR A;  1E79 G;  2ZR2 A;  3PN1 A;  3BA8 A;  2JS3 A;  1WLE A;  4FLY A;  5LBQ A;  4X66 O;  4JYY A;  2AW9 A;  1U96 A;  4I9Q A;  3RBZ A;  5EBM C;  4OPH A;  3E8G A;  4HZ3 A;  4LFC B;  3T2M A;  3B09 A;  1V9P A;  4U7O A;  5KMG B;  1Y74 A;  4NXM O;  1N0J A;  2YUA A;  2PZS A;  3QTC A;  1RM1 C;  5BZB A;  2QWO B;  2A9H A;  1NQT A;  1I08 A;  4A5U B;  2LP7 A;  3CD6 V;  1RM1 B;  2N74 A;  2QKA A;  4D6T H;  1FPO A;  2ADP A;  2Q67 A;  1VQP V;  1XMO O;  1H2G A;  1RSO A;  4UB8 Z;  2XND G;  4FM0 A;  5B3S B;  2X7R B;  3T1H O;  1XNQ O;  2CGO A;  1V54 C;  1XIL A;  3AG1 C;  2VQE O;  5KHJ A;  1Q7Y W;  4B7E A;  2JJ2 G;  4X20 B;  4J11 A;  4N21 A;  1RFY A;  1ZL8 B;  2CTP A;  5LOV B;  3JD2 A;  3KG2 A;  4AQY B;  1K34 A;  2EIK C;  2GTA A;  2KG7 B;  4MT8 A;  1H2M A;  2GBO A;  4WCE V;  1G1X B;  3H1H H;  2LGW A;  2YSU B;  1FD9 A;  3WG7 C;  3CCM V;  4I5S A;  1E1Q G;  4H0L B;  2M6Y A;  4LF4 B;  4CH4 A;  5FLX N;  4I7Z B;  4JTD B;  1EBO A;  3K9A A;  2EIK B;  1AI7 A;  5CN0 A;  5FNV B;  4PHZ A;  1VQ7 V;  3CRQ A;  3X2Q B;  4DUZ B;  3HKE B;  5KHI A;  1BS3 A;  1AI4 A;  3D36 C;  4DV0 B;  2YIC A;  4U3J B;  2WLM A;  1GAX A;  1DF4 A;  3RYF A;  3OE7 G;  3MD0 A;  4JYA B;  3SJB C;  1QQC A;  3WB1 A;  1S0V A;  4GX1 A;  2UXD B;  4PJ0 Z;  3E22 A;  4AQY O;  1WJZ A;  4DR3 O;  2UUA B;  2KSD A;  4JV5 O;  4JAA A;  4LC1 A;  3JSL A;  1V55 C;  1JR9 A;  2XAS A;  2NR5 A;  5L3G A;  4QJF B;  5EK0 A;  5HFM A;  3OMN B;  2UUB O;  1HNX O;  3AK1 A;  2W0X A;  1WB7 A;  3ZHS A;  3H1K H;  2BOC C;  5KMG A;  4UVA A;  4P30 A;  3TXQ A;  2XHB A;  2Y69 C;  3UKM A;  1US6 A;  5KUM A;  1G4Y B;  2IW5 A;  2DJV A;  2IJH A;  2ITD C;  5H6R A;  3W7U A;  5JH7 B;  4RO2 A;  3AG1 B;  3UM7 A;  4LF8 B;  2YI8 A;  1K9M W;  4KL1 A;  4TV8 A;  5L3E A;  4QPJ A;  1VQO V;  4X65 O;  3BVO A;  3HKC A;  3ZX6 A;  3MHS C;  2LQT A;  2Q0A A;  3JCU Z;  1U97 A;  4K35 A;  5KUK A;  2IU3 A;  3T1Y B;  3E8B A;  4XDJ A;  3DGE A;  2F4V O;  3IGA C;  5IDJ A;  1Y4M A;  4JV5 B;  3AG3 B;  4OGQ B;  1SQG A;  1VP7 A;  4MW8 A;  1D2D A;  2EIJ C;  3LDD A;  4DUY B;  2ZXW C;  3KKY A;  4WFG A;  5IYZ A;  2YIA A;  3CCJ V;  1N33 O;  2IM9 A;  2LFR A;  4X62 B;  1R3K C;  3LNN A;  2ETN A;  2ZXW B;  4DV2 O;  1XL6 A;  4JI4 O;  5JVD A;  2VQF O;  5IY5 B;  4IYI A;  4DK1 A;  5KX5 A;  4IGG A;  5L3F A;  4ICG A;  3K04 A;  3P30 A;  4GKJ B;  5TIS Z;  1M57 C;  2OCC C;  2Y0P A;  3KZI Z;  3STL C;  4PD4 F;  3K58 A;  1VQ4 V;  4JI7 B;  3F7V C;  1ZX3 A;  5CMU A;  4IIJ A;  4JPR A;  1GM9 A;  5J2T A;  5AG2 A;  1Q6H A;  4B3S B;  1Q43 A;  4TV9 B;  4J7K A;  4DW0 A;  4JI1 O;  1S5L Z;  1YF2 A;  1AI6 A;  3ZMT A;  1YSC A;  4FZ0 A;  4WFE A;  3H1L H;  1R3I C;  2CTR A;  1IXB A;  4LF7 B;  3MHH C;  1M4U A;  1L0L H;  1YIJ V;  4FLZ A;  1DGS A;  1COW G;  2R70 A;  2DWD C;  2VQF B;  2Y69 B;  3W7X A;  1VIB A;  2HHH B;  4FPP A;  1W59 A;  1RSO B;  4UXN A;  1I5Y A;  3G80 A;  3SDL A;  2B9Z A;  3E86 A;  2DN9 A;  2XOK G;  5JH7 A;  5LYJ B;  1FS0 G;  3OGC C;  3K0G A;  4LF4 O;  4XDK A;  2XAQ A;  1VQN V;  4X1Y A;  4DR4 B;  2RCV A;  4MTF A;  4JI1 B;  3IAY A;  4WFA V;  5LP6 A;  1SF9 A;  4TWK A;  5IYB O;  5EBW C;  2QM8 A;  4JYB A;  4FVM A;  4LF7 O;  4B3R B;  1M90 W;  1M9N A;  4DUZ O;  3OM3 B;  3UO2 A;  4C7U A;  3CJH B;  2OT5 A;  2OIE A;  4H44 B;  4W4L A;  4MVM A;  1JMK C;  3A8T A;  1MG1 A;  1TVK B;  5BXZ A;  2CE4 A;  5IY5 C;  4DV0 O;  5FNV A;  3SPG A;  1H8H G;  5EZY B;  5IE9 A;  2ZR3 A;  1F51 A;  5GW7 A;  2DW4 A;  4JI3 O;  1NH2 B;  4JZ2 A;  2HVK C;  2Q68 A;  1JA8 A;  5ITZ B;  1SQF A;  2UXX A;  2PI4 A;  2EIN C;  1WN7 A;  1NT2 B;  3MAQ A;  2UXB O;  1GO3 F;  1JOY A;  1AR5 A;  3OT7 A;  3FFQ A;  4K8X A;  3T4D A;  2LO1 A;  3KCY A;  3RFR A;  3I56 V;  1F4M A;  1WPX A;  2OCH A;  4BW9 A;  3WG7 B;  1GM7 A;  1HNX B;  1HR0 B;  1NKD A;  3CCR V;  4YXW G;  5H5N A;  1B06 A;  5FPR A;  3W7S A;  3OW2 U;  2KG7 A;  4LF9 O;  2OIG A;  4I0X B;  4DV1 B;  3RYI B;  5B1A C;  4YIO A;  3H1I H;  2IBZ H;  4X1I A;  4BIO A;  2YID A;  4NKG B;  2Z3Y A;  4UVC A;  1F7Y A;  3X2Q C;  4MW3 A;  3SGI A;  5KLV H;  1T5E A;  3JD0 A;  4GKK B;  2GDS A;  1JFF B;  3CYO A;  3D8C A;  3JAW A;  4X65 B;  3VQY A;  5IYC O;  3SPI A;  4DR6 B;  1D5N A;  1IXM A;  2GTS A;  1H8E G;  3W7T A;  5B1B C;  5LA6 B;  3G71 V;  1B6Q A;  2WWW A;  4O4I A;  3C3S A;  4TV8 B;  4B3M B;  4MS2 A;  3HKC B;  4LFA B;  1SET A;  3ASN C;  4MTG A;  5LXT A;  1FXK C;  2QWP B;  4CH5 A;  4UCT A;  1K33 A;  2A06 H;  5B3S C;  1QNM A;  4X62 O;  4JI4 B;  3ABK B;  4R6Z A;  4BAY A;  2QKC A;  2QWN B;  3BFR A;  2CTQ A;  2XAH A;  2ZE8 A;  2ZCE A;  2UUC B;  2JIZ G;  2P6J A;  4AHC A;  2AGA A;  2X6B A;  3CCV V;  2EUL A;  2BTQ A;  3EVK A;  5JVD B;  4DR6 O;  3M7M X;  2WSS G;  2Q69 A;  1TAE A;  3ZED A;  1H2L A;  2EIN B;  1ARO P;  2Q9L A;  3CRM A;  2PTM A;  2P67 A;  5LMU O;  1UFI A;  1WAZ A;  1R6N A;  1KBH A;  3ZRV A;  4TSF G;  1B04 A;  3M99 B;  4LFA O;  5KA5 A;  1MZF A;  4ZOL B;  4OPA A;  2B1I A;  1R1B A;  1FJG O;  4QPK A;  4E4E A;  3DXR A;  4O2B A;  5J2U B;  1JVM A;  2K9P A;  2VRZ A;  2MK3 A;  4X89 A;  3QO8 A;  3N2G B;  1NR7 A;  1YCI A;  4BWA A;  4DR2 B;  2HFE C;  4TT3 G;  4K8Z A;  2UUC O;  3T1H B;  2E5L O;  4BIZ A;  3ABL C;  2FML A;  2PYJ A;  5B1O A;  1PL0 A;  1K92 A;  1HNW O;  1BZK A;  4ZI7 A;  1N34 B;  2KKW A;  1QLN A;  1FYJ A;  3B8N A;  3CCU V;  4JI8 B;  3VQW A;  2JJ1 G;  5JQG B;  3OFN G;  3P32 A;  3F5W C;  4UV8 A;  4CS3 A;  1KQS U;  2UU9 O;  1YVW A;  1NU1 H;  4R7C A;  1D5A A;  5DEC A;  4JTC B;  5EIB D;  2JDI G;  1IVS A;  2ZE7 A;  4B3R O;  4FFB A;  1WA8 A;  4FLW A;  3OGI B;  2M7W A;  4UFZ A;  4GX0 A;  1W0K G;  4WF9 V;  3D36 A;  4B3T O;  1FXH A;  2OYQ A;  4UB6 Z;  1PPJ H;  3ZHV A;  3ZRW B;  4DV6 O;  1BHA A;  1SA0 B;  4XDL A;  1BMF G;  4JI3 B;  1SRY A;  3JAK A;  1F23 A;  4FMT A;  2DOS A;  1VQM V;  1L0N H;  4IHJ B;  4DK0 A;  3RYH B;  2E5L B;  2Q6A A;  1LR1 A;  4CH3 A;  4X64 B;  3G67 A;  1Q3E A;  2DE0 X;  2UXB B;  4LP8 A;  2HEP A;  2UXD O;  2FKX A;  4NTY A;  2BCC H;  3JD4 A;  4G28 B;  2R9R B;  1FKA O;  2Q7G A;  1HR0 O;  1X4T A;  3ZRX A;  2DYR C;  5LMN O;  4J7J A;  3A0B Z;  2G38 A;  3CRR A;  5LHI A;  4J9Y B;  2GHY A;  4LF9 B;  4DV1 O;  2N04 A;  3BCC H;  5EYP A;  4DR1 B;  1OV9 A;  4TOI A;  3AG2 C;  3DC6 A;  3IFX A;  4O2A B;  1HWY A;  4O4I B;  3ABT A;  4X1Y B;  3STZ C;  5KHK A;  3W7W A;  2UXC B;  3UO3 A;  4W4K A;  5CB4 B;  2A79 B;  3N27 A;  4J7Z A;  4J42 A;  1PD3 A;  3UT5 B;  3LDE A;  3SJQ C;  4X66 B;  1UJW B;  4P9O A;  3CJH A;  2R9A A;  3A2F A;  4JYC A;  1Y76 B;  1YIT V;  1S5H C;  2XAF A;  1AB3 A;  4CZZ A;  4EFE A;  4GYC B;  2IH3 C;  4UCU A;  3SJA C;  4RAI A;  4GX5 A;  3B8M A;  3ZMZ A;  5LMN B;  3G6E V;  1N4C A;  2BTQ B;  4PEL A;  2YXY A;  4F6R A;  4QNH B;  5LP6 C;  3SYQ A;  1A32 A;  1KC8 W;  2JGD B;  1VF6 A;  5EC1 C;  4LF5 O;  3ASN B;  3CME V;  1EZJ A;  3F5T A;  5DED A;  4UUJ C;  2L35 A;  4PA4 A;  1AIL A;  2X6C A;  2PGG A;  2A0L A;  2ZQM A;  4BR6 A;  1K4C C;  4B08 A;  2LFS A;  1KP2 A;  3OMA B;  4FLU A;  1BQ0 A;  1H2K A;  1KUQ A;  4Z2W A;  2MW2 B;  3SYC A;  5CA1 A;  2QTO A;  3H9V A;  2FB5 A;  1OCO C;  1XL4 A;  5LOV A;  3NXS A;  3HKB A;  3JCZ A;  1EZV H;  2JEX A;  2ADQ B;  4DO2 A;  4H37 A;  3A0H Z;  1N32 O;  1QU7 A;  4RWU A;  4JI5 O;  2DYS B;  4LNU B;  1VEW A;  1AP6 A;  1YTF D;  4NTX A;  4KUM A;  3B4S A;  3ML0 A;  4LF5 B;  2HLD G;  3LNM B;  1BCC H;  2UXN A;  1S3J A;  5KHH A;  1Z5V A;  1S76 D;  1N34 O;  3OD4 A;  4TUY B;  1QLE B;  1BSM A;  1K5S A;  5F2V O;  3R66 A;  2HJF C;  3CCQ V;  5KHG A;  2JK5 C;  2LJ2 A;  3UT5 A;  3WB0 A;  4D7S A;  5LHH A;  4O4H A;  2EZP A;  4JAV A;  3JAL A;  4MVO A;  1ENV A;  1QLE C;  4LF6 O;  1TGO A;  4K3A A;  4MVS A;  2ITC C;  1FFT B;  2P7T C;  4JI0 B;  2H3O A;  1R6K A;  4BW5 A;  4DV6 B;  3ZMU A;  1VF7 A;  1KB9 F;  4DR7 B;  3AG4 C;  5K1P A;  2JRI A;  4CS2 A;  4JTA B;  2AHZ A;  3K5N A;  3I5D A;  4TQF A;  2ZIN A;  1QVF U;  2EZO A;  3ZRW A;  4FLX A;  4IT5 A;  3ZRS A;  2RNB A;  4ZIB A;  3E22 B;  2E3C A;  3ABL B;  2YIB D;  2ILM A;  3UQ8 A;  1JJO A;  1I7F A;  4IIJ B;  2YS8 A;  3OEH G;  2EBO A;  3OUF A;  4PV1 B;  1ZUQ A;  3RYC B;  1AR4 A;  1SZT A;  3DSQ A;  1W2B U;  2AZ0 A;  1IDS A;  2IH1 C;  3NR7 A;  2QR4 A;  1VQ6 V;  5JQG A;  4FJC C;  5CA3 A;  4KFM A;  1Q8I A;  1YDX A;  1YZB A;  2XAG A;  1PNK A;  5LGT A;  2P4V A;  4EEQ A;  1MOF A;  2QJ1 A;  4FFK A;  4MVR A;  5IWA O;  2K1E A;  3F7Y C;  3K0D A;  5CBG A;  1TA8 A;  4I4T A;  4QE9 A;  3K03 A;  3JAS A;  3CC7 V;  1KMI Z;  2R72 A;  4P2Z A;  2F23 A;  4B3S O;  4UCV A;  3SYA A;  1SQX H;  3I55 V;  1YHQ V;  1HDJ A;  2X6A A;  2ZM6 O;  3G4S V;  1BT8 A;  2WLH A;  4K0K O;  3CE2 A;  2LW7 A;  3CCS V;  3HB3 B;  2Q7E A;  1GH6 A;  5LGN A;  4MSW C;  1I0H A;  1PKX A;  3AK2 A;  3VOU A;  2PUS A;  4OX9 B;  3ETQ A;  4PA7 A;  2CUG A;  2EJR A;  1N36 O;  1GN3 A;  5CA1 B;  5JCO A;  4I50 B;  1TVK A;  3E83 A;  5L3B A;  1KD1 W;  4YJ3 A;  2EJ7 A;  3C90 A;  2JGD A;  2F43 G;  2BE3 A;  1XQ8 A;  2BOB C;  2HHH O;  4E2L A;  2H94 A;  4J41 A;  5C8Y B;  3ABU A;  2KB1 A;  4RQF A;  1WPB A;  5D5Q A;  5J2T B;  3L9D A;  1H2S B;  2NLJ C;  5C93 A;  3ABK C;  4X8A A;  4LCU C;  4DR4 O;  4TV9 A;  3AG4 B;  1THZ A;  1F4N A;  1M5I A;  3HKD B;  1KKD A;  4PA6 A;  3L71 H;  2WLI B;  3K08 A;  4GT1 A;  5CB4 A;  4DV3 O;  2ZM6 B;  3EXA A;  3J7A U;  1K7D A;  1P7G A;  4PA9 A;  1G6U A;  2YXL A;  5B1A B;  2BSK A;  4YJ2 B;  4DYL A;  2FTK A;  4WFB V;  1FJG B;  3RVZ A;  4OX9 O;  2RQ6 A;  3OUS A;  3OMI B;  1O9G A;  5IJ9 A;  3R65 A;  5EIB C;  1FXV A;  4NB5 A;  1OCZ C;  1UPG A;  4RUE A;  3FB8 C;  3EFF K;  3E8H A;  4O4H B;  4FK5 C;  1GN4 A;  3HR0 A;  3FB5 C;  2C2A A;  3JAM N;  3OEE G;  4NYK A;  1Q90 D;  5BMV A;  2HKO A;  4EB6 A;  4PA3 A;  3BEH A;  3E2E A;  3RWR D;  4JI8 O;  1CPY A;  1GRJ A;  2E76 B;  5BR8 O;  1PP9 H;  1S77 D;  1JJ2 U;  3S3W A;  1JQ0 A;  1OCC C;  1ZSP A;  4LF6 B;  2GUZ B;  3SJC C;  1DLB A;  1Y6X A;  4JF3 A;  3ZMV A;  5LGU A;  1LNQ A;  3K59 A;  4JI0 O;  3K3W A;  3CRA A;  4UCO A;  1AP5 A;  4DW1 A;  4B3T B;  3ASO C;  2B5U A;  2QEX V;  3N2K A;  2CGN A;  2WLL A;  1IBM B;  1WP7 A;  3AG7 A;  2ZIM A;  1N0N A;  4RUF A;  4Z1M G;  1IBL B;  2ZE5 A;  3RYC A;  2EIM B;  3FYI B;  2PI5 A;  1B3Q A;  3K5M A;  3DC5 A;  1MSD A;  3BPZ A;  4GCZ A;  3T4Z A;  3ABM C;  4KP4 A;  4LFB O;  3WFV A;  1BGY H;  4EKW A;  4PI2 A;  4CH6 A;  1K97 A;  4L8J A;  3ABM B;  2E74 B;  5A9G A;  3CMA V;  3H01 A;  3BAA A;  3CB2 A;  3IC9 A;  1MAB G;  3OAA G;  5C8Y A;  5BR8 B;  3K9S A;  2VWJ A;  2IJI A;  1K4D C;  1VQ8 V;  3ZHT A;  3ZBH A;  2ZNI A;  2Y0I A;  5LP6 B;  1RP3 B;  3CRC A;  4DR1 O;  3LSU A;  1QVG U;  1MZE A;  3M8A A;  3CCE V;  2ZIO A;  3SYO A;  1NH2 D;  5LXT B;  1H2N A;  2D2C B;  2NNU A;  4HYO A;  4OXS A;  3K57 A;  1K5Q A;  3LSQ A;  3ZHU A;  4DV5 O;  2AZ2 A;  2QM7 A;  1BL8 A;  4I55 A;  1PV0 A;  4J9Z B;  4YHH B;  1M56 B;  2CTW A;  1QCE A;  4U3F H;  5A2Q N;  1XHZ A;  1KKC A;  3BHP A;  1VAR A;  3SPJ A;  1EFR G;  2P5O A;  1PM9 A;  4JAS A;  5LMU B;  1RPR A;  1GN2 A;  1MMM A;  1X59 A;  1XDC A;  3A0R A;  4I50 A;  3JD1 A;  5IYD O;  1K3E A;  4JI2 B;  1BQZ A;  4KHP O;  5B66 Z;  1BHB A;  4ASU G;  2YI9 A;  5LHG A;  4EB6 B;  2E75 B;  4YY3 O;  3L75 H;  1EN6 A;  4LWS B;  3B77 A;  4IYH A;  2W0F C;  4DR5 B;  3JYC A;  3JAR B;  2NN4 A;  4J10 A;  2ATK C;  1CP9 A;  3P3P A;  2DYR B;  4PI0 A;  3RYF B;  4JZG A;  1YI2 V;  2OTL V;  4MVQ A;  5J2U A;  1SA0 A;  3CP1 A;  1URF A;  1JX9 A;  1Q82 W;  2OTJ V;  4X20 A;  5E79 Z;  1MNG A;  1QBZ A;  3N2G A;  1HNW B;  3K5L A;  2P90 A;  4H33 A;  1JFF A;  3BY6 A;  4UCR A;  4YJ3 B;  3TGU H;  5GTI Z;  3JAW B;  2Q5Z A;  3L70 H;  5LA6 A;  2PF4 E;  3SPH A;  5L3C A;  3TK1 A;  4ZBM A;  3ZJZ A;  1SER A;  2CH7 A;  4JI2 O;  3ZN1 A;  1SQQ H;  2RDC A;  3ASO B;  4I4T B;  4X88 A;  1GKF A;  1S5J A;  1L8D A;  1N32 B;  4IL6 Z;  4JI5 B;  4AI8 A;  1TUB A;  3GWK C;  4Z1V A;  2QA4 V;  1WA8 B;  3QG5 A;  1XMO B;  1K73 W;  4U7N A;  1VF5 B;  1N8R W;  3ZHQ A;  1PNL A;  4X64 O;  4LBE C;  2ZDI C;  4R50 A;  3QF7 A;  4ZI7 B;  1FFX A;  3U0Z A;  4ZHQ B;  1LUW A;  4GZR B;  1QR8 A;  1ZWI C;  5E1A C;  2HG5 C;  5JJE B;  2QM4 A;  1Y66 A;  2R9I A;  4AIL C;  1VMG A;  5IYZ B;  1AVM A;  4MTO A;  4DRX B;  2YC0 A;  1H38 A;  3D3Q A;  5GON B;  4CC6 A;  1CXZ B;  1ZAU A;  1NJI W;  3WB2 A;  1NTK H;  3U11 A;  3ETD A;  2GUZ A;  3JD3 A;  1KEC A;  5H9C A;  3T1C A;  4O4J A;  3FKS G;  3QVN A;  3CS5 A;  3LUT B;  5H6Q A;  4DR7 O;  1IBL O;  2WLI A;  3PJS K;  3ZMS A;  3B40 A;  3CPW U;  2HVJ C;  3GB7 C;  4UV9 A;  1PNM A;  1HP8 A;  2BSK B;  4FZ1 A;  4YJ2 A;  2B1G A;  3RYH A;  1ZL8 A;  4PDL A;  4CC5 A;  1GMG A;  1ZLZ A;  2YEV A;  2WLL B;  2ARH A;  3K79 A;  1Q81 W;  3FAV B;  5IJ9 B;  4LR3 A;  2DQ3 A;  4R8C A;  1V54 B;  3SR2 C;  3RVY A; 
#chains in the Genus database with same CATH homology
 1SZT A;  3GWO A;  3QO7 A;  2WLK A;  2Z3Y A;  4UVC A;  1W2B U;  3TCU A;  3X2Q C;  4DXW A;  4MW3 A;  1JCH A;  3JD0 A;  5CBH A;  4G27 B;  2IH1 C;  3CYO A;  4PDV A;  2GSM B;  1VQ6 V;  5B1N A;  5IYC O;  1P7B A;  3SPI A;  1IXM A;  4MVU A;  1H8E G;  1P4R A;  5L3D A;  4FJC C;  1AJN A;  5CA3 A;  4KFM A;  3W7T A;  5B1B C;  2XAG A;  1PNK A;  5LGT A;  1JPX A;  2ZDI A;  3G71 V;  1B6Q A;  2WWW A;  1MOF A;  2Z5U A;  1AJP A;  1VQK V;  4QE7 A;  4MVR A;  2K1E A;  3F7Y C;  3K0D A;  4MS2 A;  5CBG A;  2V7Q G;  1KP3 A;  3E8F A;  4QE9 A;  5KA6 A;  2EIJ B;  3K03 A;  3CC7 V;  1NVP D;  1SET A;  3ASN C;  4P2Z A;  4MTG A;  3TET A;  1FXK C;  1FXK A;  3SYA A;  1K33 A;  4MTX A;  5B3S C;  3I55 V;  1YHQ V;  2DQ0 A;  4WFF A;  3CC4 V;  2X6A A;  1DTO A;  3G4S V;  2WLH A;  3ABK B;  3ZIA G;  4R6Z A;  3CCS V;  1E79 G;  2ZR2 A;  3HB3 B;  5LGN A;  4CBC A;  4MSW C;  2EIL C;  1PKX A;  4BAY A;  1WLE A;  2H8P C;  1GM8 A;  4JAU A;  1NBM G;  5LBQ A;  3VOU A;  2XAH A;  4RQE A;  2JIZ G;  3RBZ A;  5EBM C;  2P6J A;  4PA7 A;  1YJ9 V;  2X6B A;  3E8G A;  3CCV V;  2EJR A;  1M1K W;  2CK3 G;  4HZ3 A;  3T2M A;  4U7O A;  4I9W A;  2WSS G;  2Q69 A;  3E83 A;  5L3B A;  1KD1 W;  5EBL C;  1Q86 W;  2EIN B;  1GK9 A;  1ARO P;  2F43 G;  1R3L C;  1RM1 C;  2P67 A;  2BOB C;  5BZB A;  3LSS A;  4E2L A;  2H94 A;  2QE7 G;  1CEZ A;  1R6N A;  2A9H A;  1NQT A;  2LP7 A;  3ZRV A;  4TSF G;  3CD6 V;  3ABU A;  1RM1 B;  2KB1 A;  3M99 B;  4RQF A;  5KA5 A;  1V55 B;  2NLJ C;  5C93 A;  1W0J G;  3ABK C;  2Q67 A;  3EHB B;  4X8A A;  1VQP V;  2X0L A;  4LCU C;  1H2G A;  3ZN0 A;  2B1I A;  3AG4 B;  1THZ A;  2XND G;  4QPK A;  1F4N A;  2ZD9 A;  1ROP A;  1KKD A;  5B3S B;  2X7R B;  4PA6 A;  2WLI B;  3K08 A;  4GT1 A;  3AG1 C;  1V54 C;  1JVM A;  1Q7Y W;  1K7D A;  2MK3 A;  4PA9 A;  4X89 A;  2JJ2 G;  3QO8 A;  1NR7 A;  5B1A B;  4N21 A;  1M56 C;  2FTK A;  3JD2 A;  1OCR B;  3KG2 A;  2HFE C;  1OCC B;  1K34 A;  2EIK C;  4TT3 G;  4WFB V;  4MT8 A;  3RVZ A;  4PDM A;  4ZKI A;  2W6I G;  4WCE V;  3OUS A;  3OMI B;  2YSU B;  1OHH G;  3WG7 C;  3CCM V;  3R65 A;  4BIZ A;  3ABL C;  1E1Q G;  4I5S A;  5B1O A;  1PL0 A;  1FXV A;  1OCZ C;  1K92 A;  4RUE A;  1ORQ C;  1QLN A;  3FB8 C;  3EFF K;  3E8H A;  3B8N A;  3CCU V;  4JTD B;  1EBO A;  3K9A A;  4FK5 C;  2EIK B;  1AI7 A;  5CN0 A;  2JJ1 G;  2WLN A;  4GX2 A;  3FB5 C;  2C2A A;  1VQ7 V;  3OFN G;  3P32 A;  3OEE G;  3F5W C;  4UV8 A;  3X2Q B;  2D3O W;  1KQS U;  2HKO A;  5DN6 G;  4R7C A;  4JTC B;  4PA3 A;  3BEH A;  3E2E A;  2JDI G;  5EC2 C;  1OCZ B;  1AI4 A;  1CPY A;  2M7W A;  4MVZ A;  4GX0 A;  1W0K G;  3FB6 C;  2WLM A;  4FIP C;  4WF9 V;  3D36 A;  1JJ2 U;  1S77 D;  1FXH A;  1JQ0 A;  1DF4 A;  1OCC C;  3OR6 C;  3DTU B;  3OE7 G;  3MD0 A;  1DLB A;  4JF3 A;  3ZRW B;  3ZMV A;  5LGU A;  1BHA A;  1LNQ A;  4XDL A;  4GX1 A;  3CXC U;  1S0V A;  1BMF G;  1SRY A;  1F23 A;  4FMT A;  3K3W A;  1VQM V;  5DM6 V;  1I5X A;  3ASO C;  2B5U A;  2Q6A A;  2QEX V;  2YEV B;  1R3J C;  2WLL A;  1AJQ A;  4LC1 A;  1V55 C;  4LP8 A;  3HPL C;  2XAS A;  5L3G A;  4RUF A;  4Z1M G;  4QJF B;  5EK0 A;  1L1F A;  2EIM B;  5HFM A;  3JD4 A;  3FYI B;  3OMN B;  4G28 B;  2PI5 A;  4JGS A;  4N23 A;  4GCZ A;  3T4Z A;  3ABM C;  4KP4 A;  2R9R B;  1TUE B;  3WFV A;  4EKW A;  2BOC C;  4UVA A;  4P30 A;  3ZRX A;  2DYR C;  2Y69 C;  1K97 A;  3ABM B;  5LHI A;  3D3I A;  4J9Y B;  3RW0 A;  1R73 A;  2GHY A;  5KUM A;  3UKM A;  1G4Y B;  3H01 A;  2IW5 A;  3CMA V;  4PDR A;  2IJH A;  2ITD C;  5H6R A;  3W7U A;  3QNE A;  3AG2 C;  1MAB G;  4RO2 A;  3AG1 B;  2QKS A;  3UM7 A;  3IFX A;  3OAA G;  1HWY A;  4WFH A;  1K9M W;  1NVP B;  3ABT A;  2IJI A;  5L3E A;  4QPJ A;  3FB7 C;  3STZ C;  1VQO V;  1K4D C;  1VQ8 V;  3CC2 V;  3ETE A;  1YTF B;  3MHS C;  3W7W A;  3CCL V;  1QVG U;  5KUK A;  2XAJ A;  2IU3 A;  3CCE V;  3E8B A;  4XDJ A;  3SYO A;  1NH2 D;  3DGE A;  2A79 B;  1RPO A;  5B1B B;  2NNU A;  3IGA C;  2Y48 A;  1PD3 A;  3QO5 A;  5IDJ A;  3LDE A;  2IJJ A;  3SJQ C;  5CBF A;  1Y4M A;  4HYO A;  4P9O A;  1UJW B;  4OXS A;  4UVB A;  1K5Q A;  3AG3 B;  3LSQ A;  1VQ5 V;  2QM7 A;  1BL8 A;  4MW8 A;  2EIJ C;  4JYC A;  3LDD A;  5J9P C;  1YIT V;  1S5H C;  4J9Z B;  2XAF A;  1M56 B;  2ZXW C;  3VBB A;  4CZZ A;  4WFG A;  1QCE A;  3AG3 C;  2JEU A;  3CCJ V;  2IH3 C;  1VQ9 V;  4RAI A;  3ZCC A;  3K06 A;  1S72 V;  4GX5 A;  3SPJ A;  3B8M A;  1EFR G;  3ZMZ A;  2LFR A;  1AR1 B;  1R3K C;  2ZXW B;  4JAS A;  3G6E V;  1RPR A;  1XL6 A;  4PEL A;  3A0R A;  1G8M A;  1J95 A;  3JD1 A;  4QNH B;  5IY5 B;  5IYD O;  1OCO B;  5L3F A;  1K3E A;  1AI5 A;  2IU0 A;  3SYQ A;  1OCR C;  1SES A;  3K04 A;  3P30 A;  1KC8 W;  4ASU G;  1BHB A;  4F4L A;  5LHG A;  1M57 C;  2OCC C;  5EC1 C;  3STL C;  1FXK B;  2V1D A;  3E89 A;  1NR1 A;  1VQ4 V;  3ASN B;  3F7V C;  5FL7 G;  3CME V;  1EZJ A;  5CMU A;  3B77 A;  4JPR A;  2AHY A;  1GM9 A;  2W0F C;  4UUJ C;  3JYC A;  4PA4 A;  3IC7 A;  2X6C A;  2A0L A;  2ZQM A;  1K4C C;  2ATK C;  1CP9 A;  2DYR B;  1MSW D;  4BIU A;  1YI2 V;  2OTL V;  1AI6 A;  1KP2 A;  2LFS A;  3OMA B;  4MVQ A;  3ZMT A;  1QR9 A;  3ETG A;  3CP1 A;  1YSC A;  1GTO A;  4WFE A;  1JX9 A;  1R3I C;  1Q82 W;  2OTJ V;  3SYC A;  1QBZ A;  2QTO A;  2P90 A;  1OCO C;  1XL4 A;  3MHH C;  4H33 A;  3NXS A;  3BY6 A;  1YIJ V;  3JCZ A;  2JEX A;  4HAM A;  1OZ0 A;  1COW G;  2IJK A;  4DO2 A;  4H37 A;  2DWD C;  3RVY A;  3SPH A;  5L3C A;  3TK1 A;  4ZBM A;  2DYS B;  3ZJZ A;  1SER A;  1YTF D;  1M57 B;  3ZN1 A;  4KUM A;  2Y69 B;  3W7X A;  3ASO B;  3AEI A;  2W6J G;  3ML0 A;  4X88 A;  1GKF A;  4FPP A;  4UXN A;  1VQL V;  1I5Y A;  2HLD G;  3E86 A;  2XOK G;  3LNM B;  1FS0 G;  1S3J A;  2UXN A;  3OGC C;  3K0G A;  2EIL B;  4XDK A;  1S76 D;  2QA4 V;  2XAQ A;  4G2K A;  1VQN V;  1QLE B;  1K5S A;  1K73 W;  4MTF A;  4WFA V;  4U7N A;  2HJF C;  3CCQ V;  4TWK A;  1N8R W;  2WPD G;  1PNL A;  4LBE C;  2ZDI C;  2JK5 C;  5IYB O;  2WAM A;  5EBW C;  2QM8 A;  4JYB A;  4R50 A;  1M90 W;  1M9N A;  3SPC A;  3OM3 B;  4QIW F;  2OT5 A;  4MVM A;  5LHH A;  1YJW V;  2EZP A;  2DWE C;  4JAV A;  4Q20 A;  1QR8 A;  4XBF A;  4MVO A;  1MG1 A;  1ENV A;  5IY5 C;  1QLE C;  1ZWI C;  5E1A C;  3SPG A;  2HG5 C;  3OR7 C;  1Y66 A;  1H8H G;  2R9I A;  4MVS A;  5HFL A;  2ITC C;  2ZR3 A;  1F51 A;  1FFT B;  2P7T C;  5GW7 A;  2DW4 A;  2DYS C;  1NH2 B;  1R6K A;  4MTO A;  4BW5 A;  2HVK C;  2WLJ A;  3ZMU A;  2Q68 A;  1H38 A;  2UXX A;  2PI4 A;  2EIN C;  3AG4 C;  4L87 A;  1GO3 F;  4JTA B;  1JOY A;  1NJI W;  2AHZ A;  3ETD A;  1K8A W;  3JD3 A;  1KEC A;  1E1R G;  5H9C A;  3T4D A;  1QVF U;  2EZO A;  3T1C A;  3ZRW A;  3FKS G;  3LUT B;  5H6Q A;  3I56 V;  1F4M A;  3ZRS A;  2WLI A;  1WPX A;  3PJS K;  3ZMS A;  3CPW U;  2HVJ C;  3GB7 C;  3ABL B;  4UV9 A;  2OCC B;  1PNM A;  1GM7 A;  2EIM C;  3WG7 B;  1NKD A;  3E35 A;  3CCR V;  2HR3 A;  2B1G A;  4YXW G;  4PDL A;  3OEH G;  1GMG A;  2YEV A;  3W7S A;  2EBO A;  2WLL B;  3K79 A;  3OW2 U;  4P9P A;  3OUF A;  1YJN V;  1Q81 W;  5B1A C;  3LDC A;  3SYP A;  2DQ3 A;  4R8C A;  1DF5 A;  1V54 B;  3FYE B;  3AG2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...