1KC8W

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kc8W00
1S72V 3CMAV 1VQPV 1W2BU 1N8RW 1YJNV 3CC4V 3G4SV 3G6EV 3CCLV 1YJWV 1KQSU 3CCRV 1QVFU 1YIJV 2OTJV 3CXCU 1VQOV 3CCJV 4WCEV 1VQNV 3OW2U 1R73A 1VQ7V 1VQ8V 3CCSV 3CC2V 3CCUV 1VQ6V 1K8AW 4WF9V 3G71V 1Q82W 1Q7YW 1VQMV 3CCVV 1K73W 1YITV 3CMEV 3I55V 1Q86W 1QVGU 1NJIW 1KC8W 3CCQV 3CD6V 1VQ5V 1KD1W 3CPWU 1M90W 1VQ9V 2OTLV 3CC7V 2QEXV 3CCMV 1JJ2U 1YI2V 1Q81W 1YJ9V 2QA4V 1YHQV 1VQLV 1VQ4V 2D3OW 5DM6V 4WFBV 3I56V 1VQKV 3CCEV 4WFAV 1M1KW 1K9MW
chains in the Genus database with same CATH superfamily
1SQXH 3ABUA 3H1KH 3THOA 2ADQB 2ADPA 4FM2A 1N34O 3UM7A 4G27B 1GO3F 5LP6C 2ILMA 4KP4A 4B3SO 1HNWO 3SPCA 5EBLC 2ZD9A 4ABMA 1AR4A 1QR9A 3OUSA 2Q68A 1Y76A 3AG4C 4GX0A 3GWOA 3BRCA 2JIZG 1NZ6A 4FJCC 4FLTA 2PF4E 3P32A 1SQFA 4DUYO 2BOBC 3T1HB 3HR0A 2OWOA 3L9DA 1U97A 5FL7G 1VQMV 4LBEC 3ABKB 1VMGA 5LHIA 2KB1A 1KC8W 4YIPA 1I94B 3A8TA 3CC7V 3K5LA 2OYQA 1M9NA 2XTAA 3H1HH 4JI8O 1E1RG 2QEXV 2UUCB 1GKFA 3CCRV 4LNUB 4JTAB 5C8YB 1PD3A 2IU0A 4U7OA 4DUZO 1D5NA 3RYIA 1XNQB 4MW3A 3AK2A 2AXTZ 1VIBA 5EIBD 1MOFA 1URFA 3S3WA 4D6TH 4LF6O 2YIAA 2OT5A 2WSSG 3CCLV 5B5EZ 1TVKB 3WB1A 1H2MA 4U3JA 5H5NA 3WG7B 2QWPB 2VRZA 3CCSV 4I7ZB 3FYIB 3QO8A 1H2SB 3ZRXA 2DN9A 2Q69A 2BTQB 4TV8B 1DTOA 4TT3G 2W0FC 1NS1A 4FLZA 1AJNA 3S3XA 5CA0B 1D2DA 3TCUA 1S5LZ 3W7WA 4OX9B 1QLNA 5IJ0B 5H6QA 4JI3O 4LF4B 1N33O 2EIKC 2Q0OC 1XQ8A 3J7AU 1QR8A 1RP3B 2DYRC 1NJIW 3JATA 3ASOC 4O2BA 4P30A 4X65O 4JI6B 1XL6A 3UO2A 1TUBB 2Q9LA 4TV9B 3FB8C 4FZ1A 1YVWA 2H3OA 3FB7C 1FS0G 4JAUA 4X9QA 2BOCC 2UUAB 2ZXWC 4JV5B 2GUZB 3HKBA 2QM4A 5HFMA 4TUYA 1ZUQA 3OTOB 4DR5B 4YHHO 5KHIA 1MZEA 3DTUB 3FAVB 1HR0O 5JH7B 2N04A 4F6RB 2Q4PA 4L87A 1FKAO 1V54C 3T4DA 1PKXA 3CB2A 2ATKC 1G4YB 3ZMZA 2UUBB 2WWWA 4XDLA 2YXHA 1Q6UA 4PI2A 3WB2A 1NVPB 2ZE8A 3SYCA 1H2KA 2RCVA 1JJOA 5LP6A 3FKSG 2LW7A 5B1OA 5CBFA 3JD0A 5LMUO 3CRQA 3RVZA 2IJJA 3F7YC 3G6EV 1YJWV 2YXYA 3RYHB 4W4LA 1UJWB 1NQTA 4GX5A 4EB6A 4FLVA 4E2LA 3CC2V 1K5SA 1K33A 2JVDA 2WPDG 2QWRB 1Q7YW 4W4KA 5FPRA 3ZRSA 3CMEV 5A2QN 1QQCA 4FM0A 3K3WA 1M90W 3ZHTA 1YHQV 3L71H 1OCOB 4ZBMA 3K59A 1Q90D 5HFLA 4LF5B 2KG7A 4QIWF 1J5EB 4LFAB 4MVZA 5IY5B 5KX5A 4UVCA 1DK1A 3CE2A 3E8BA 1PNMA 2EJ7A 1DLBA 2JK5C 4UB6Z 4CBCA 3TXQA 1L8DA 4DV3O 3EVKA 5F2VO 1YXBA 1LR1A 2Q7GA 2IJIA 4DR3B 5GW7A 2IW5A 3CRAA 4PA4A 2HHHB 3ZRWB 5DEDA 3WFVA 2PYLA 2DYSC 3AG2B 5FNVA 4HBNA 3H9VA 3JALB 5L3EA 1BMFG 4KXRA 1I94O 2CH7B 4FK5C 4J11A 2X0LA 1TAEA 4K0KB 2ZT9B 4DO2A 4ZOLA 4PELA 3HKDA 3QNEA 3K9SA 2CTQA 2ZE6A 3OMNB 3APQA 4MVOA 4JI7O 4CC6A 1KKCA 1Z2GA 3JAMN 4L8JA 4FIPC 3CCVV 3ETEA 2JJ1G 1QU7A 5LGTA 3CPWU 1R3IC 5L3CA 2A0LA 1XNQO 3OD4A 2F66C 2PYJA 4PHZA 2VQFB 1Q5OA 1R6TA 3HKCB 5L3GA 4JTDB 2ZINA 4IYHA 2WLMA 2EIMC 1VQ6V 1JA8A 2YS8A 4EKWA 1GM9A 1YITV 3UT5A 1W0JG 2PZSA 3JAWB 4JI0B 1YF2A 5TISZ 1OHHG 3JARA 4X20A 1NTZH 3OR7C 1M1KW 4DV7B 1Y67A 4MS2A 3BEHA 4OX9O 1B04A 5CA1A 5GONB 1RM1C 4LF4O 3O9OA 4NTYA 4YY3B 3ZBHA 1XMOB 1M5IA 4LF8O 2CAZC 3ABLC 3E8GA 2JRIA 5CA3A 2L6LA 1XBLA 1Y74B 4RWUA 4UVAA 3SPJA 4J80A 4JGSA 2F95B 4X1YA 3ZEDA 4DW0A 2LJ2A 2W6IG 3MAQA 4DR4B 3ML0A 4RQEA 4JV5O 3OT7A 1SQQH 3OTOO 2F4VB 5JQGA 3G6BA 3MHHC 5KHJA 1Q86W 3ZIAG 4K35A 4UCTA 2BE3A 3BAAA 1Q43A 1Q6IA 1JPXA 3OGIB 2YEVB 4PI0A 2QR4A 3T2MA 2E76B 3W7XA 4EEQA 2UUBO 4LF9B 2Q5ZA 2Q67A 4JI2B 1GN2A 4P2ZA 1M56C 3ZMTA 1Z5VA 4TSFG 4JASA 4RQFA 4LCUC 3VQXA 2EINC 1JR9A 1P49A 1MA1A 4AQYO 4FFKA 4JZGA 4IHJA 1RSOB 1E1QG 2EILB 2E5LB 2A7WA 4MVSA 1GN4A 1ZL8A 2R72A 3LDDA 2B1IA 2ZIMA 3OEHG 3LSUA 4YJ3A 4X8AA 3U0ZA 3B09A 4H37A 1NKDA 2EZPA 4MW8A 3UO3A 2A06H 3B77A 3VQWA 1HW7A 4X66B 1ZWIC 5KLVH 4LFAO 2A9HA 3RYIB 3AK1A 3B8NA 2P22C 3CCUV 2K1EA 3TJTA 2YIDA 2GTSA 4O2AB 3R65A 3LNNA 4I4TB 2HJFC 5B1BB 3JCZA 3J80N 5IYZB 4U3JB 1QLEC 2C2AA 4YJ2B 1OCZB 4DR3O 2BSKA 1D5AA 4MT8A 4G28B 3ZRVA 2HHHO 1NVPD 4NYKA 4O4JB 3F7VC 1E79G 4FVMA 2P6JA 3P3PA 2F43G 2QM7A 4K0KO 5LXTA 5IE9A 1FFXB 2FB5A 3OEEG 5EZYA 4WFFA 5B1NA 3SJAC 2A3QA 2B5UA 1HWYA 1TUEB 1HP8A 5LA6B 1RPRA 3JATB 2ETNA 2VQEB 3BFRA 2WLLA 3SYAA 1IBKB 3WU2Z 2KQXA 4DRXB 3K0GA 1NI8A 1VEWA 1AP6A 3ABMC 3NR7A 3CXHF 5IJ9A 2AHZA 5BXZA 1SKVA 3AG1C 1F23A 4OPAA 5BZBA 4TUYB 2VQFO 1K9MW 5BY1A 5ITZB 3CC4V 4DR2O 4UVBA 5D5QA 3BY6A 2YIBA 1FJGO 1XREA 1KP3A 1L0LH 3C90A 5LHGA 3E89A 2DQ3A 2QTSA 5B1AB 4DW1A 1O9HA 1S3JA 1EFRG 1PPJH 4JI0O 3RW0A 2BTOA 2WA3A 2CTWA 5IT9N 4ZI7A 2ARHA 2JGDA 3APOA 5BR8B 1KU9A 5DECA 2P90A 1VF7A 1CP9A 2CK3G 3C3SA 4YY3O 3ZMUA 1FXVA 4NXNB 2XT9A 1J95A 1BCCH 3RVYA 3JD1A 1Z5WA 5CBGA 4N23A 1IBLB 4DR4O 1PP9H 4BW9A 2QSAA 1NR1A 3ASNB 4FZ0A 1GAXA 2F4VO 3SYQA 2ZDIC 2P4KA 3K08A 1B06A 4X64B 2CGNA 3N2GA 2QWOB 2HJDA 2AZ0A 5CB4B 4WBNA 2H8PC 5KX5B 1BSMA 5J2UB 3FFQA 2O57A 1BZKA 1XL4A 2OTJV 2OCCC 4LH6A 2PI5A 2GV9A 4JI1O 1XMQO 2B9ZA 4JZ2A 5IWAB 2KKWA 3OE7G 5CN0A 1WN7A 2GDSA 4I0XA 2QKAA 3EXAA 3K57A 3JSNA 1AI6A 2UXCB 2Y4TA 1Q81W 4DR7O 1IURA 1XI1A 1VQKV 5B3SC 1W0KG 3LNMB 1W59A 2UXDO 2E5LO 5FNVB 2IJKA 2PTMA 2E74B 3VQYA 2QTOA 2P5OA 3X2QC 3MDSA 4ZOLB 4GKKB 2WAMA 3CCQV 4IT5A 2N05A 1N36B 1KBHA 2G38A 3HKEA 3K5OA 1XNRB 4DR6B 2DE0X 1K97A 2FL4A 4LWSA 1OCRB 1SQVH 4EFBA 4NKGB 4GUNA 2DYRB 1EZVH 1R6NA 4CC5A 5LOVA 4DV6O 4JAAA 3ZN0A 1X59A 3ABKC 4FLUA 4O4IA 1M4UA 3N2KA 3QO5A 3JASA 5EBMC 2XAHA 3E2EA 2OTLV 3K58A 2ZXWB 3O65A 1S72V 5EC1C 2ZNJA 2L35A 3LDEA 4FFBA 1JFFA 4X20B 1V54B 4CS3A 4DV2B 4JI5O 4BIUA 2LW1A 5CA1B 4UV9A 1BHBA 2HG5C 4LF7B 2R9RB 2DOSA 2F1MA 2VQEO 2F93B 1N4CA 3STZC 2ITDC 4DV4B 2YXLA 5LYJA 2NNUA 3GB7C 1R6KA 4X1YB 2JS3A 1DF4A 3OR6C 1UPGA 5KA5A 4PA6A 4A5UB 4RAIA 5KAIZ 1SF9A 1WP7A 1YJNV 4E4EA 1K34A 5A9GA 1M57C 4KFMA 4O4LB 2UU9B 3OGCC 3OW2U 3RYCA 4FM1A 3ETGA 3IJ4A 1SA0B 2YI8A 4CH4A 2ZDIA 3M7MX 4XBFA 4UCUA 4MVMA 1H38A 1NBMG 4FLWA 2HEPA 1BT8A 1S0VA 5BR8O 1IXBA 4LH7A 1XHZA 5CMUA 3A0RA 4F4LA 4NTWA 2Y48A 2LQTA 3Q4HB 4J7KA 1A32A 1I5YA 4NXNO 1XEQA 3L73H 3A2FA 4JYAB 4BIZA 2EJRA 3DXRB 1GN6A 5GTIZ 1IBLO 5JJEB 3L72H 1VQ9V 4IYIA 4YJ3B 1V55C 2FMLA 3SPIA 3JD3A 1NH2B 1H2LA 4PA7A 1I0HA 5BMVB 3UQ8A 1GN3A 2Y0PA 2WLIA 1JMKC 1YTFD 1BQ0A 3T1YB 4B3MB 5JVDA 1F7YA 1HNZB 1ZAUA 4D7TA 1VQPV 2JEUA 3JSLA 3CRRA 4HAMA 4X1KB 2Y69C 3T1HO 1FFTB 4ZHQB 1SETA 1JOYA 3W7UA 5IWAO 2B1GA 2Q7EA 3JAKB 2UXCO 3BA8A 3STLC 3EFFK 2LGWA 1EBOA 3DSQA 3KKYA 1N8RW 2UUCO 1OCOC 2CE4A 5LHHA 2EIMB 3RYFA 1VARA 5J9PC 3RBZA 4KHPB 2M7WA 5LXTB 4MTFA 2ZNIA 1I08A 3SDLA 4GKKO 5IY5C 4LNUA 2RMKB 3K03A 5C8YA 4OGQB 4B7KA 1XNRO 4DR6O 3IC7A 2AW9A 1L0NH 1AROP 4TWKA 3IAYA 3L75H 1VQOV 4ZIBA 3G71V 4FLXA 4Q6GA 3ABLB 1MSWD 1TVKA 3CSXA 3K04A 2ZE5A 3H1LH 2QM8A 2R9AA 4I55A 3OM3B 1ZSPA 3E8FA 4C7UA 1WPXA 5GTHZ 2BTQA 4TV8A 3KZIZ 2QDOA 3E83A 1QVFU 1Q8IA 5CA0A 1G6UA 2JGDB 1QVGU 2AGAA 2MW2B 4JI6O 1H8EG 1XDCA 4H0LB 1YJ9V 4RUEA 5E79Z 4LF7O 1WB7A 4Z2WA 1OZ0A 2HFEC 4TV9A 2UUAO 3ZHQA 2HKOA 2EINB 4MVRA 3RT3C 4UCOA 2YDEA 4LC1A 4DR5O 3JD4A 4CH5A 3TGUH 4MTOA 4QE7A 5H2FZ 2Y0IA 3FAVA 3L74H 1IDSA 4B08A 3T1CA 2NR5A 4MTGA 1M93A 3B4SA 4LFCB 1SZTA 1AJPA 2UU9O 4MVQA 4GLXA 1COWG 2FTKA 3N2GB 3PN1A 3IFXA 5LGUA 4B3SB 1K7DA 2GSMB 4WBNB 1Y76B 4PD4F 1EN6A 1IVSA 4P9OA 3BPZA 3TK1A 4UFZA 1HDJA 2XAQA 2OIEA 1QNMA 4DUYB 2XUMA 1NTMH 2RJZA 1GM7A 3P3NA 5EIBC 1U96A 1EM1A 3BCCH 4QNHB 4WCEV 1XHXA 1CPYA 4UCSA 4GKJB 3RYHA 2BCCH 2HP8A 2ZKOA 2FKXA 2N74A 4JI8B 1JCHA 1SS3A 3SPGA 5DM6V 4WFBV 5KHKA 2LO1A 4FMTA 3N27A 1JX9A 4LF5O 1MNGA 1FD9A 4J9ZB 1J5EO 3CXCU 1K92A 1OCCC 3HKEB 2UXBB 1YSCA 4UV8A 3LUTB 2XAFA 2YICA 2JGUA 2W6JG 4DUZB 4LWSB 3BABA 3SGIA 1MSDA 3FD9A 4B3MO 1SQBH 4BAYA 1YZBA 1NU1H 2IH1C 4J42A 3CCEV 4LF6B 1K4CC 1W2BU 2QGNA 3AG3C 2EULA 4J7JA 4O4IB 3N2KB 4DK1A 4X62B 4PJ0Z 1K5QA 1LUVA 3AG1B 1JJ2U 3CJHA 4IIJA 1FXKC 5B66Z 1SQGA 2IJHA 2A79B 1BQZA 1R3LC 4O2BB 1VQNV 3LSQA 1XILA 2P06A 4JI3B 4I50A 4EFEA 5L3BA 3EHBB 4OPHA 1AR5A 5FPOA 4NXMB 2ODMA 3RFRA 4RUFA 3A0BZ 1YTFB 4JPRA 5LGNA 5KUKA 3HKBB 4R6ZA 3ZMVA 1Q3EA 4X88A 1RPOA 4G2KA 1NH2D 2RNBA 3J81N 4DR1B 1PL4A 2FYUH 2PUSA 4WF9V 3ZHVA 4YHHB 2EZOA 3HKCA 1HR0B 5KHHA 4QE9A 2EX3A 2Q7HA 1K4DC 5J2TA 1IX9A 1AI5A 3JAWA 4DV7O 4AILC 1AI4A 1KQSU 1VQ7V 1K3EA 1R73A 5LP6B 4CZZA 2NN4A 4I9WA 1WAZA 3TETA 5KMGA 3RWRD 1XMOO 3BHPA 4GX1A 4FLYA 3AG4B 1YI2V 2XAGA 5JJJB 3I56V 2QKSA 2ZM6B 4EB6B 1WA8A 5KAFZ 1LUWA 2EIJC 3E22A 1O9GA 3SYOA 4DXWA 4NTXA 1YCIA 1P7BA 4JTCB 5FLXN 2H94A 3H01A 1P7GA 3E86A 3QVNA 2KG7B 2UXXA 2DMXA 4B3RB 4LFCO 1RFYA 1L1FA 2QWNB 2WLIB 3ZHUA 2YEVA 2JDIG 4LF9O 4LR3A 4JI2O 3ZMSA 1IZ3A 2XASA 1ENVA 3X2QB 3W7SA 4QPKA 5JVDB 3AEIA 2VWKA 3KCXA 3P30A 3K0DA 4QJFB 4J41A 1OJHA 2YIBD 4DV3B 4GYCB 2E75B 1LNQA 2WLHA 4PDRA 5IYCO 1AR1B 5EK0A 1MMMA 3FYEB 2LFSA 1RSOA 3CRMA 4GKJO 1GM8A 1T5EA 3ASNC 1FPOA 4P9PA 3HKDB 1I7FA 1VQ5V 1MG1A 4WFEA 1BL8A 3A0HZ 3RYFB 4JYCA 5EYPA 2MK3A 2CGOA 1SQPH 2DJVA 1KKDA 2XNDG 1KECA 3F5TA 5LL6Y 4X66O 1FXKA 4JI7B 1ZX3A 4GCZA 2K9PA 2UXBO 1PNLA 2EIKB 4XDJA 3SJQC 5IYDO 3OAAG 3ASOB 1G8MA 2Z3YA 1AI7A 1R3KC 1S5HC 1VQ4V 4HYOA 2Z0AA 3QTCA 4O2AA 1WJZA 4I4TA 3KG2A 3BVOA 3CEIA 5IYBO 5IYZA 2AZ2A 2DWDC 3UT5B 4YJ2A 4WFGA 3K79A 4I55B 4F6EA 4X62O 2ZQMA 4PDVA 1R1BA 3E35A 3MD0A 3JARB 3CD6V 3G80A 4O4JA 2X7RB 2LP7A 2RDCA 1GRJA 4NB5A 2P4VA 4HNAA 2IBZH 1M57B 3DC5A 1CEZA 1BHAA 1AVMA 4LFBB 3RGBA 1OCRC 1FFXA 1WNSA 5EC2C 5KUMA 3LDCA 2GBOA 2ZR2A 5LA6A 3WG7C 1K73W 4NXMO 4B3TB 1IBKO 4LF8B 2GTAA 1ZLZA 3CCMV 4MSWC 5L3DA 2PGGA 2Z5UA 2KSDA 4DRXA 2VS0A 4GZRB 1NTKH 4DV5B 5D5PA 5JQGB 1IXMA 1SERA 4J7ZA 1R3JC 2CDYA 4DR1O 5ITZA 4DV0B 2W0XA 4H33A 3L70H 4UXNA 2IU3A 2RN9A 2V7QG 4D7SA 1PL0A 3PJSK 3AG7A 5C93A 3CP1A 2D3OW 1KMIZ 1V55B 3K9AA 4DV1B 4KUMA 4PDLA 4DYLA 2ZR3A 5K1PA 4X1IA 1KUQA 4TOIA 3OUFA 2HR3A 2Q0AA 3E8HA 3OMIB 1PM9A 1Y66A 4IL6Z 1SRYA 4R8CA 3M99B 3GWKC 1X4TA 1FYJA 2CTPA 4IHJB 1B6QA 1GH6A 1GMGA 2JEXA 5H9CA 1Y6XA 4PA9A 4ZKIA 4AQYB 1ZL8B 2ZM6O 4PV1B 2Y69B 1HNXB 1H2GA 4O4HA 4PDMA 4ASUG 2Q8VA 1GK9A 1KYOF 2DYSB 2V4DA 5DN6G 2HVKC 2IM9A 2E3CA 1K8AW 4UCVA 3QO7A 3CWBH 5CBHA 3K5MA 1THZA 3DC6A 2Q6AA 4I9QA 1BS3A 4X64O 2AHYA 1EN4A 3UKMA 2QA4V 1MABG 4B3RO 2IH3C 5CB4A 3F5WC 2P7TC 1KP2A 5J2UA 3T4ZA 1VF6C 3G67A 5LBQA 1VF5B 2OCHA 2BSKB 4MTXA 2XHBA 3K06A 3W7TA 3D8CA 4WFHA 2WLKA 1FAFA 3SPHA 3CMAV 3IC9A 3VOUA 5E1AC 1DGSA 4K8ZA 4ICGA 4UCRA 3U11A 1OV9A 2QE7G 2DW4A 1EZJA 2ZCEA 5LMNB 1IBMB 1AP5A 3CJHB 1QHTA 4IIJB 2X6AA 4HZ3A 1V9PA 2QJ1A 5EZYB 1N36O 2XAJA 3K5NA 4Z1MG 4R50A 4CH3A 1QCEA 4I50B 2WLLB 3HB3B 3ZHRA 2GHYA 4BR6A 3VBBA 3SJCC 4DK0A 3ZN1A 1RM1B 3B8MA 3JYCA 4CS2A 1I5XA 1Q6HA 1MZFA 5IJ9B 2R9IA 4J9YB 4MVUA 3AG2C 2YSUB 1AILA 1PV0A 2X6CA 3HPLC 2X6BA 3I5DA 1EN5A 1S76D 4JI4B 1WLEA 4QGPA 4DR2B 3LSSA 3AK3A 1YIJV 5JJNB 1FJGB 3U10A 3FX7A 4YXWG 5J2TB 5JCOC 2M6YA 4XDKA 1CXZB 4ZI7B 4IGGA 1WP8A 1DF5A 4DV2O 5IJ0A 3H1JH 5AG2A 1N32B 3QF7A 2V1DA 4RO2A 3DGEA 2WA4A 4N21A 5KMGB 4LFBO 1M56B 2RQ6A 1TUBA 1YEWA 4J10A 3SYPA 5IDJA 4GT1A 4DV4O 2WLJA 3OTFA 1WB8A 5KA6A 4B3TO 4Z1VA 3IGAC 3BA9A 5JWPA 2DQ0A 1WA8B 2GUZA 3H1IH 3ABTA 3CHXA 3E22B 3SJBC 1SZXA 1VQLV 4WFAV 2R70A 5JH7A 5H6RA 4DV5O 4F6RA 4TQDA 2OIGA 3FB5C 4DV0O 1N34B 3M8AA 4R7CA 1YDXA 4NVPA 3ETQA 3ZX6A 4O4LA 3D36C 1KD1W 2NLJC 1HNWB 1H2NA 3C3TA 3CS5A 3UCSC 1SESA 3QG5A 1SA0A 4DV1O 3B40A 2PI4A 1OCCB 2ZIOA 5EBWC 3ZCCA 1S77D 4I0XB 4CS4A 4BW5A 3VQVA 4JI1B 1XMQB 4CH6A 3GVMA 3I55V 1JQ0A 4YIOA 3TXSA 4JYAO 1VF6A 3R66A 1H8HG 3D3IA 3Q4HA 1QLEB 3RN4A 4DR7B 3OMAB 2JJ2G 3AG3B 2UXDB 1VP7A 4H44B 2ZE7A 3ICXA 3CRCA 1HNXO 4JF3A 1Y4MA 2WLNA 3DXRA 1GTOA 1VQ8V 1ZTEA 5EYPB 4BIOA 5BMVA 4BWAA 3T1YO 1FXKB 2JS5A 4Q20A 3CX5F 4AI8A 1P84F 1B3QA 1HNZO 2PY5A 4H13B 1US6A 5L3FA 5LOVB 1NT2B 2EILC 4UUJC 2YUAA 1TGOA 5K1XA 3ZJZA 2Q73A 3JASB 2EBOA 4X1KA 4DV6B 3ABMB 1P4RA 2QWQB 2HVJC 1PNKA 4ZHQA 3ZRWA 3MHSC 4K3AA 1ORQC 2P67A 2VWJA 1ROPA 1AJQA 3JALA 3JAKA 4FFBB 1JFFB 2CH7A 4U3FH 4AHCA 2CUGA 1F4MA 5LMNO 1IBMO 4NR1A 4KHPO 2LFRA 1N33B 4HNAB 4OXSA 5JCOA 2F23A 4JI5B 4X65B 4JYYA 3NXSA 3D3QA 4LP8A 1BE3H 5B1BC 1WPBA 1S5JA 4FPPA 3CYOA 5LYJB 1OCZC 1NR7A 1XUQA 4I5SA 2QKCA 4UB8Z 4PA3A 1F51A 1SC5B 3ZS8C 4TQFA 1FXHA 3JCUZ 2D2CB 2CTRA 2HLDG 2YC0A 1KB9F 2EIJB 4JI4O 3RYCB 4B7EA 1JVMA 4GX2A 1F4NA 1BGYH 1UFIA 4JAVA 1Q82W 2UXNA 1G1XB 3FB6C 2LGQA 3D36A 4KL1A 4X1IB 5GONA 1N32O 2Y4UA 4U7NA 3SR2C 3WB0A 1TA8A 5LMUB 1QBZA 3G4SV 2OCCB 1N0JA 1Y74A 2DWEC 2ITCC 3CCJV 4QPJA 1XOUA 4X89A 2YI9A 3OFNG 1N0NA 3ZHSA 3ETDA 4JYBA 5B1AC 3B2EE 4K8XA 4O4HB 5B3SB 5KHGA 3KCYA 3JD2A 1AB3A 2XOKG
chains in the Genus database with same CATH topology
3ABUA 1IXMA 1AROP 1ZWIC 1SERA 4TWKA 1R3JC 1VQOV 2A9HA 3B8NA 3UM7A 3CCUV 3G71V 2K1EA 4G27B 1GO3F 4H33A 3ABLB 4KP4A 1MSWD 3K04A 4UXNA 2IU3A 3R65A 3SPCA 2QM8A 2V7QG 5EBLC 2HJFC 3OM3B 1PL0A 2ZD9A 3PJSK 5B1BB 3JCZA 1QR9A 5C93A 3E8FA 3CP1A 2D3OW 3OUSA 2Q68A 1QLEC 1V55B 1WPXA 1OCZB 2C2AA 3AG4C 3K9AA 4GX0A 4KUMA 4PDLA 3GWOA 2JIZG 2ZR3A 4FJCC 3P32A 3E83A 2BOBC 4MT8A 1QVFU 4G28B 3OUFA 2HR3A 3E8HA 3ZRVA 3OMIB 1Y66A 1NVPD 3F7VC 1E79G 1SRYA 4R8CA 2P6JA 3M99B 5FL7G 4LBEC 1VQMV 3ABKB 5LHIA 2KB1A 1QVGU 1KC8W 2F43G 1B6QA 1GMGA 2QM7A 2JEXA 3CC7V 5H9CA 4PA9A 4ZKIA 1H8EG 1M9NA 1E1RG 2QEXV 1YJ9V 4RUEA 3OEEG 2Y69B 4WFFA 5B1NA 2B5UA 1HWYA 1GKFA 1TUEB 3CCRV 1H2GA 4PDMA 1OZ0A 1RPRA 2HFEC 4ASUG 1GK9A 2DYSB 2HKOA 5DN6G 2EINB 2HVKC 2WLLA 4JTAB 4MVRA 1K8AW 3QO7A 1PD3A 5CBHA 4LC1A 2IU0A 4U7OA 3SYAA 1THZA 2Q6AA 3K0GA 3JD4A 2AHYA 3ABMC 4MW3A 4MTOA 4QE7A 3UKMA 2QA4V 2AHZA 3AG1C 1MOFA 1F23A 1MABG 3T1CA 4MTGA 5BZBA 1K9MW 2IH3C 3CC4V 2OT5A 2WSSG 3CCLV 1SZTA 1AJPA 4UVBA 3BY6A 3WG7B 3F5WC 2P7TC 4MVQA 1KP3A 3CCSV 1COWG 2FTKA 5LHGA 3E89A 3IFXA 2DQ3A 1KP2A 5B1AB 3FYIB 3T4ZA 3QO8A 5LGUA 1K7DA 1S3JA 2GSMB 5LBQA 3ZRXA 1EFRG 2Q69A 4P9OA 3RW0A 3TK1A 4MTXA 1DTOA 4TT3G 3K06A 3W7TA 4WFHA 2W0FC 2WLKA 2XAQA 1AJNA 3SPHA 3CMAV 3VOUA 5E1AC 2P90A 3TCUA 1GM7A 3W7WA 2QE7G 2DW4A 1EZJA 4QNHB 4WCEV 1CP9A 2CK3G 1QLNA 5H6QA 1CPYA 2EIKC 1FXVA 2X6AA 3ZMUA 1QR8A 2DYRC 4HZ3A 1NJIW 3ASOC 1J95A 4P30A 1XL6A 2XAJA 3RVYA 4Z1MG 4R50A 1JCHA 3JD1A 3FB8C 1QCEA 3SPGA 5DM6V 5CBGA 4WFBV 4N23A 3FB7C 1FS0G 2WLLB 4FMTA 1JX9A 3HB3B 4JAUA 2BOCC 2GHYA 4J9ZB 2ZXWC 3VBBA 3ZN1A 1RM1B 3CXCU 1NR1A 3B8MA 1K92A 1OCCC 3JYCA 3ASNB 1I5XA 5HFMA 1YSCA 4UV8A 3LUTB 2XAFA 3DTUB 2ZDIC 3SYQA 2R9IA 2W6JG 3K08A 4J9YB 4MVUA 3AG2C 2YSUB 4BAYA 2X6CA 4L87A 3HPLC 1V54C 2IH1C 2X6BA 3T4DA 1PKXA 1S76D 3CCEV 2H8PC 1WLEA 1K4CC 1W2BU 3LSSA 2ATKC 3AG3C 1G4YB 3ZMZA 1YIJV 1XL4A 2WWWA 2OTJV 2OCCC 4XDLA 2PI5A 4YXWG 1NVPB 1K5QA 3SYCA 4XDKA 3OE7G 5CN0A 1DF5A 3FKSG 3AG1B 1AI6A 1JJ2U 5B1OA 5CBFA 1Q81W 3JD0A 2V1DA 4RO2A 1VQKV 5B3SC 3DGEA 1W0KG 3LNMB 4N21A 1FXKC 3RVZA 1M56B 2IJJA 3F7YC 3G6EV 1YJWV 2IJKA 1UJWB 1NQTA 2IJHA 3SYPA 2A79B 4GX5A 5IDJA 1R3LC 4GT1A 1VQNV 4E2LA 3CC2V 1K5SA 3LSQA 1K33A 2WLJA 2WPDG 5L3BA 2QTOA 3X2QC 1Q7YW 3EHBB 5KA6A 3ZRSA 3CMEV 3IGAC 2WAMA 3CCQV 2DQ0A 3K3WA 1M90W 4RUFA 3ABTA 1YTFB 4JPRA 1YHQV 1VQLV 5LGNA 5KUKA 1OCOB 4ZBMA 4R6ZA 3ZMVA 4WFAV 1K97A 5HFLA 1OCRB 5H6RA 4X88A 1RPOA 4G2KA 4QIWF 1NH2D 3FB5C 2DYRB 4R7CA 4WF9V 4MVZA 5IY5B 1R6NA 4UVCA 2EZOA 3ZN0A 3E8BA 1PNMA 4QE9A 1KD1W 1DLBA 2JK5C 2NLJC 3ABKC 4CBCA 3QO5A 1K4DC 1SESA 5EBMC 2XAHA 3E2EA 1AI5A 2OTLV 2ZXWB 1S72V 5EC1C 2IJIA 5GW7A 2PI4A 1OCCB 1AI4A 1KQSU 2IW5A 5EBWC 3ZCCA 1S77D 3LDEA 4PA4A 1VQ7V 1K3EA 1R73A 4BW5A 3ZRWB 4CZZA 4I9WA 3WFVA 3TETA 2DYSC 3AG2B 3I55V 5L3EA 1BMFG 1JQ0A 1V54B 4GX1A 4FK5C 1H8HG 2X0LA 3D3IA 1QLEB 3AG4B 1YI2V 2XAGA 3OMAB 4DO2A 4BIUA 3I56V 4PELA 2QKSA 2JJ2G 3AG3B 3QNEA 4UV9A 1BHBA 4JF3A 2HG5C 2EIJC 3OMNB 2R9RB 4MVOA 1Y4MA 2WLNA 1GTOA 3STZC 3SYOA 2ITDC 1VQ8V 4DXWA 4FIPC 1P7BA 3CCVV 2NNUA 3GB7C 4JTCB 1R6KA 3ETEA 2JJ1G 2H94A 1DF4A 5LGTA 3OR6C 3CPWU 5KA5A 1R3IC 3H01A 2A0LA 5L3CA 4PA6A 3E86A 4RAIA 1FXKB 4Q20A 2UXXA 1YJNV 1L1FA 1K34A 2WLIB 5L3FA 1M57C 2JDIG 2YEVA 4KFMA 4JTDB 5L3GA 3ZMSA 2EILC 2XASA 1ENVA 4UUJC 3X2QB 4QPKA 3OGCC 3W7SA 2WLMA 2EIMC 3OW2U 1VQ6V 3ZJZA 3AEIA 3ETGA 2EBOA 1YITV 4EKWA 1GM9A 3ABMB 3P30A 1W0JG 1P4RA 2ZDIA 3K0DA 4XBFA 4QJFB 2HVJC 1PNKA 3ZRWA 3MHSC 4MVMA 1H38A 1NBMG 1ORQC 2P67A 1ROPA 1OHHG 1S0VA 1AJQA 3OR7C 1LNQA 1M1KW 2WLHA 4PDRA 5IYCO 1AR1B 5EK0A 4MS2A 3BEHA 3FYEB 2LFSA 3A0RA 5CMUA 1F4MA 4F4LA 2Y48A 1RM1C 2LFRA 1GM8A 3ASNC 1I5YA 4OXSA 4P9PA 1VQ5V 1MG1A 4WFEA 4BIZA 3ABLC 3E8GA 3NXSA 1BL8A 5CA3A 2EJRA 4JYCA 3SPJA 4UVAA 2MK3A 4LP8A 1VQ9V 4JGSA 5B1BC 4FPPA 2W6IG 1KKDA 2XNDG 3CYOA 1V55C 1KECA 1OCZC 3ML0A 4RQEA 1NR7A 1FXKA 3SPIA 4I5SA 3JD3A 4GCZA 1NH2B 4PA7A 4PA3A 1PNLA 2EIKB 4XDJA 1F51A 3SJQC 5IYDO 3OAAG 3MHHC 3ASOB 2WLIA 1FXHA 1G8MA 2Z3YA 1Q86W 1AI7A 3ZIAG 1R3KC 1YTFD 1S5HC 2HLDG 1JPXA 2YEVB 1VQ4V 4HYOA 3T2MA 2EIJB 3W7XA 1VQPV 2JEUA 1JVMA 3KG2A 4GX2A 1F4NA 4HAMA 5IYBO 2Q67A 2Y69C 2DWDC 4P2ZA 1M56C 4WFGA 1FFTB 3K79A 3ZMTA 1SETA 2ZQMA 4JAVA 1Q82W 1JOYA 4TSFG 4PDVA 4JASA 3W7UA 2UXNA 4RQFA 3E35A 3MD0A 4LCUC 2B1GA 2EINC 3CD6V 3FB6C 3D36A 2X7RB 2LP7A 4U7NA 3STLC 3EFFK 1EBOA 1M57B 1CEZA 1BHAA 1E1QG 1QBZA 1N8RW 2EILB 3G4SV 1OCOC 2OCCB 5LHHA 2EIMB 4MVSA 1OCRC 3LDDA 2DWEC 2ITCC 2B1IA 5J9PC 3CCJV 4QPJA 4X89A 5EC2C 3RBZA 3OEHG 5KUMA 3OFNG 3LDCA 2M7WA 3ETDA 2ZR2A 4MTFA 4X8AA 3WG7C 1K73W 4JYBA 4H37A 5IY5C 1NKDA 5B1AC 3K03A 3CCMV 2EZPA 4MSWC 5B3SB 4MW8A 5L3DA 3JD2A 2Z5UA 2XOKG 3IC7A 3B77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 V;  3CMA V;  1VQP V;  1W2B U;  1N8R W;  1YJN V;  3CC4 V;  3G4S V;  3G6E V;  3CCL V;  1YJW V;  1KQS U;  3CCR V;  1QVF U;  1YIJ V;  2OTJ V;  3CXC U;  1VQO V;  3CCJ V;  4WCE V;  1VQN V;  3OW2 U;  1R73 A;  1VQ7 V;  1VQ8 V;  3CCS V;  3CC2 V;  3CCU V;  1VQ6 V;  1K8A W;  4WF9 V;  3G71 V;  1Q82 W;  1Q7Y W;  1VQM V;  3CCV V;  1K73 W;  1YIT V;  3CME V;  3I55 V;  1Q86 W;  1QVG U;  1NJI W;  1KC8 W;  3CCQ V;  3CD6 V;  1VQ5 V;  1KD1 W;  3CPW U;  1M90 W;  1VQ9 V;  2OTL V;  3CC7 V;  2QEX V;  3CCM V;  1JJ2 U;  1YI2 V;  1Q81 W;  1YJ9 V;  2QA4 V;  1YHQ V;  1VQL V;  1VQ4 V;  2D3O W;  5DM6 V;  4WFB V;  3I56 V;  1VQK V;  3CCE V;  4WFA V;  1M1K W;  1K9M W; 
#chains in the Genus database with same CATH topology
 1SQX H;  3ABU A;  3H1K H;  3THO A;  2ADQ B;  2ADP A;  4FM2 A;  1N34 O;  3UM7 A;  4G27 B;  1GO3 F;  5LP6 C;  2ILM A;  4KP4 A;  4B3S O;  1HNW O;  3SPC A;  5EBL C;  2ZD9 A;  4ABM A;  1AR4 A;  1QR9 A;  3OUS A;  2Q68 A;  1Y76 A;  3AG4 C;  4GX0 A;  3GWO A;  3BRC A;  2JIZ G;  1NZ6 A;  4FJC C;  4FLT A;  2PF4 E;  3P32 A;  1SQF A;  4DUY O;  2BOB C;  3T1H B;  3HR0 A;  2OWO A;  3L9D A;  1U97 A;  5FL7 G;  1VQM V;  4LBE C;  3ABK B;  1VMG A;  5LHI A;  2KB1 A;  1KC8 W;  4YIP A;  1I94 B;  3A8T A;  3CC7 V;  3K5L A;  2OYQ A;  1M9N A;  2XTA A;  3H1H H;  4JI8 O;  1E1R G;  2QEX V;  2UUC B;  1GKF A;  3CCR V;  4LNU B;  4JTA B;  5C8Y B;  1PD3 A;  2IU0 A;  4U7O A;  4DUZ O;  1D5N A;  3RYI A;  1XNQ B;  4MW3 A;  3AK2 A;  2AXT Z;  1VIB A;  5EIB D;  1MOF A;  1URF A;  3S3W A;  4D6T H;  4LF6 O;  2YIA A;  2OT5 A;  2WSS G;  3CCL V;  5B5E Z;  1TVK B;  3WB1 A;  1H2M A;  4U3J A;  5H5N A;  3WG7 B;  2QWP B;  2VRZ A;  3CCS V;  4I7Z B;  3FYI B;  3QO8 A;  1H2S B;  3ZRX A;  2DN9 A;  2Q69 A;  2BTQ B;  4TV8 B;  1DTO A;  4TT3 G;  2W0F C;  1NS1 A;  4FLZ A;  1AJN A;  3S3X A;  5CA0 B;  1D2D A;  3TCU A;  1S5L Z;  3W7W A;  4OX9 B;  1QLN A;  5IJ0 B;  5H6Q A;  4JI3 O;  4LF4 B;  1N33 O;  2EIK C;  2Q0O C;  1XQ8 A;  3J7A U;  1QR8 A;  1RP3 B;  2DYR C;  1NJI W;  3JAT A;  3ASO C;  4O2B A;  4P30 A;  4X65 O;  4JI6 B;  1XL6 A;  3UO2 A;  1TUB B;  2Q9L A;  4TV9 B;  3FB8 C;  4FZ1 A;  1YVW A;  2H3O A;  3FB7 C;  1FS0 G;  4JAU A;  4X9Q A;  2BOC C;  2UUA B;  2ZXW C;  4JV5 B;  2GUZ B;  3HKB A;  2QM4 A;  5HFM A;  4TUY A;  1ZUQ A;  3OTO B;  4DR5 B;  4YHH O;  5KHI A;  1MZE A;  3DTU B;  3FAV B;  1HR0 O;  5JH7 B;  2N04 A;  4F6R B;  2Q4P A;  4L87 A;  1FKA O;  1V54 C;  3T4D A;  1PKX A;  3CB2 A;  2ATK C;  1G4Y B;  3ZMZ A;  2UUB B;  2WWW A;  4XDL A;  2YXH A;  1Q6U A;  4PI2 A;  3WB2 A;  1NVP B;  2ZE8 A;  3SYC A;  1H2K A;  2RCV A;  1JJO A;  5LP6 A;  3FKS G;  2LW7 A;  5B1O A;  5CBF A;  3JD0 A;  5LMU O;  3CRQ A;  3RVZ A;  2IJJ A;  3F7Y C;  3G6E V;  1YJW V;  2YXY A;  3RYH B;  4W4L A;  1UJW B;  1NQT A;  4GX5 A;  4EB6 A;  4FLV A;  4E2L A;  3CC2 V;  1K5S A;  1K33 A;  2JVD A;  2WPD G;  2QWR B;  1Q7Y W;  4W4K A;  5FPR A;  3ZRS A;  3CME V;  5A2Q N;  1QQC A;  4FM0 A;  3K3W A;  1M90 W;  3ZHT A;  1YHQ V;  3L71 H;  1OCO B;  4ZBM A;  3K59 A;  1Q90 D;  5HFL A;  4LF5 B;  2KG7 A;  4QIW F;  1J5E B;  4LFA B;  4MVZ A;  5IY5 B;  5KX5 A;  4UVC A;  1DK1 A;  3CE2 A;  3E8B A;  1PNM A;  2EJ7 A;  1DLB A;  2JK5 C;  4UB6 Z;  4CBC A;  3TXQ A;  1L8D A;  4DV3 O;  3EVK A;  5F2V O;  1YXB A;  1LR1 A;  2Q7G A;  2IJI A;  4DR3 B;  5GW7 A;  2IW5 A;  3CRA A;  4PA4 A;  2HHH B;  3ZRW B;  5DED A;  3WFV A;  2PYL A;  2DYS C;  3AG2 B;  5FNV A;  4HBN A;  3H9V A;  3JAL B;  5L3E A;  1BMF G;  4KXR A;  1I94 O;  2CH7 B;  4FK5 C;  4J11 A;  2X0L A;  1TAE A;  4K0K B;  2ZT9 B;  4DO2 A;  4ZOL A;  4PEL A;  3HKD A;  3QNE A;  3K9S A;  2CTQ A;  2ZE6 A;  3OMN B;  3APQ A;  4MVO A;  4JI7 O;  4CC6 A;  1KKC A;  1Z2G A;  3JAM N;  4L8J A;  4FIP C;  3CCV V;  3ETE A;  2JJ1 G;  1QU7 A;  5LGT A;  3CPW U;  1R3I C;  5L3C A;  2A0L A;  1XNQ O;  3OD4 A;  2F66 C;  2PYJ A;  4PHZ A;  2VQF B;  1Q5O A;  1R6T A;  3HKC B;  5L3G A;  4JTD B;  2ZIN A;  4IYH A;  2WLM A;  2EIM C;  1VQ6 V;  1JA8 A;  2YS8 A;  4EKW A;  1GM9 A;  1YIT V;  3UT5 A;  1W0J G;  2PZS A;  3JAW B;  4JI0 B;  1YF2 A;  5TIS Z;  1OHH G;  3JAR A;  4X20 A;  1NTZ H;  3OR7 C;  1M1K W;  4DV7 B;  1Y67 A;  4MS2 A;  3BEH A;  4OX9 O;  1B04 A;  5CA1 A;  5GON B;  1RM1 C;  4LF4 O;  3O9O A;  4NTY A;  4YY3 B;  3ZBH A;  1XMO B;  1M5I A;  4LF8 O;  2CAZ C;  3ABL C;  3E8G A;  2JRI A;  5CA3 A;  2L6L A;  1XBL A;  1Y74 B;  4RWU A;  4UVA A;  3SPJ A;  4J80 A;  4JGS A;  2F95 B;  4X1Y A;  3ZED A;  4DW0 A;  2LJ2 A;  2W6I G;  3MAQ A;  4DR4 B;  3ML0 A;  4RQE A;  4JV5 O;  3OT7 A;  1SQQ H;  3OTO O;  2F4V B;  5JQG A;  3G6B A;  3MHH C;  5KHJ A;  1Q86 W;  3ZIA G;  4K35 A;  4UCT A;  2BE3 A;  3BAA A;  1Q43 A;  1Q6I A;  1JPX A;  3OGI B;  2YEV B;  4PI0 A;  2QR4 A;  3T2M A;  2E76 B;  3W7X A;  4EEQ A;  2UUB O;  4LF9 B;  2Q5Z A;  2Q67 A;  4JI2 B;  1GN2 A;  4P2Z A;  1M56 C;  3ZMT A;  1Z5V A;  4TSF G;  4JAS A;  4RQF A;  4LCU C;  3VQX A;  2EIN C;  1JR9 A;  1P49 A;  1MA1 A;  4AQY O;  4FFK A;  4JZG A;  4IHJ A;  1RSO B;  1E1Q G;  2EIL B;  2E5L B;  2A7W A;  4MVS A;  1GN4 A;  1ZL8 A;  2R72 A;  3LDD A;  2B1I A;  2ZIM A;  3OEH G;  3LSU A;  4YJ3 A;  4X8A A;  3U0Z A;  3B09 A;  4H37 A;  1NKD A;  2EZP A;  4MW8 A;  3UO3 A;  2A06 H;  3B77 A;  3VQW A;  1HW7 A;  4X66 B;  1ZWI C;  5KLV H;  4LFA O;  2A9H A;  3RYI B;  3AK1 A;  3B8N A;  2P22 C;  3CCU V;  2K1E A;  3TJT A;  2YID A;  2GTS A;  4O2A B;  3R65 A;  3LNN A;  4I4T B;  2HJF C;  5B1B B;  3JCZ A;  3J80 N;  5IYZ B;  4U3J B;  1QLE C;  2C2A A;  4YJ2 B;  1OCZ B;  4DR3 O;  2BSK A;  1D5A A;  4MT8 A;  4G28 B;  3ZRV A;  2HHH O;  1NVP D;  4NYK A;  4O4J B;  3F7V C;  1E79 G;  4FVM A;  2P6J A;  3P3P A;  2F43 G;  2QM7 A;  4K0K O;  5LXT A;  5IE9 A;  1FFX B;  2FB5 A;  3OEE G;  5EZY A;  4WFF A;  5B1N A;  3SJA C;  2A3Q A;  2B5U A;  1HWY A;  1TUE B;  1HP8 A;  5LA6 B;  1RPR A;  3JAT B;  2ETN A;  2VQE B;  3BFR A;  2WLL A;  3SYA A;  1IBK B;  3WU2 Z;  2KQX A;  4DRX B;  3K0G A;  1NI8 A;  1VEW A;  1AP6 A;  3ABM C;  3NR7 A;  3CXH F;  5IJ9 A;  2AHZ A;  5BXZ A;  1SKV A;  3AG1 C;  1F23 A;  4OPA A;  5BZB A;  4TUY B;  2VQF O;  1K9M W;  5BY1 A;  5ITZ B;  3CC4 V;  4DR2 O;  4UVB A;  5D5Q A;  3BY6 A;  2YIB A;  1FJG O;  1XRE A;  1KP3 A;  1L0L H;  3C90 A;  5LHG A;  3E89 A;  2DQ3 A;  2QTS A;  5B1A B;  4DW1 A;  1O9H A;  1S3J A;  1EFR G;  1PPJ H;  4JI0 O;  3RW0 A;  2BTO A;  2WA3 A;  2CTW A;  5IT9 N;  4ZI7 A;  2ARH A;  2JGD A;  3APO A;  5BR8 B;  1KU9 A;  5DEC A;  2P90 A;  1VF7 A;  1CP9 A;  2CK3 G;  3C3S A;  4YY3 O;  3ZMU A;  1FXV A;  4NXN B;  2XT9 A;  1J95 A;  1BCC H;  3RVY A;  3JD1 A;  1Z5W A;  5CBG A;  4N23 A;  1IBL B;  4DR4 O;  1PP9 H;  4BW9 A;  2QSA A;  1NR1 A;  3ASN B;  4FZ0 A;  1GAX A;  2F4V O;  3SYQ A;  2ZDI C;  2P4K A;  3K08 A;  1B06 A;  4X64 B;  2CGN A;  3N2G A;  2QWO B;  2HJD A;  2AZ0 A;  5CB4 B;  4WBN A;  2H8P C;  5KX5 B;  1BSM A;  5J2U B;  3FFQ A;  2O57 A;  1BZK A;  1XL4 A;  2OTJ V;  2OCC C;  4LH6 A;  2PI5 A;  2GV9 A;  4JI1 O;  1XMQ O;  2B9Z A;  4JZ2 A;  5IWA B;  2KKW A;  3OE7 G;  5CN0 A;  1WN7 A;  2GDS A;  4I0X A;  2QKA A;  3EXA A;  3K57 A;  3JSN A;  1AI6 A;  2UXC B;  2Y4T A;  1Q81 W;  4DR7 O;  1IUR A;  1XI1 A;  1VQK V;  5B3S C;  1W0K G;  3LNM B;  1W59 A;  2UXD O;  2E5L O;  5FNV B;  2IJK A;  2PTM A;  2E74 B;  3VQY A;  2QTO A;  2P5O A;  3X2Q C;  3MDS A;  4ZOL B;  4GKK B;  2WAM A;  3CCQ V;  4IT5 A;  2N05 A;  1N36 B;  1KBH A;  2G38 A;  3HKE A;  3K5O A;  1XNR B;  4DR6 B;  2DE0 X;  1K97 A;  2FL4 A;  4LWS A;  1OCR B;  1SQV H;  4EFB A;  4NKG B;  4GUN A;  2DYR B;  1EZV H;  1R6N A;  4CC5 A;  5LOV A;  4DV6 O;  4JAA A;  3ZN0 A;  1X59 A;  3ABK C;  4FLU A;  4O4I A;  1M4U A;  3N2K A;  3QO5 A;  3JAS A;  5EBM C;  2XAH A;  3E2E A;  2OTL V;  3K58 A;  2ZXW B;  3O65 A;  1S72 V;  5EC1 C;  2ZNJ A;  2L35 A;  3LDE A;  4FFB A;  1JFF A;  4X20 B;  1V54 B;  4CS3 A;  4DV2 B;  4JI5 O;  4BIU A;  2LW1 A;  5CA1 B;  4UV9 A;  1BHB A;  2HG5 C;  4LF7 B;  2R9R B;  2DOS A;  2F1M A;  2VQE O;  2F93 B;  1N4C A;  3STZ C;  2ITD C;  4DV4 B;  2YXL A;  5LYJ A;  2NNU A;  3GB7 C;  1R6K A;  4X1Y B;  2JS3 A;  1DF4 A;  3OR6 C;  1UPG A;  5KA5 A;  4PA6 A;  4A5U B;  4RAI A;  5KAI Z;  1SF9 A;  1WP7 A;  1YJN V;  4E4E A;  1K34 A;  5A9G A;  1M57 C;  4KFM A;  4O4L B;  2UU9 B;  3OGC C;  3OW2 U;  3RYC A;  4FM1 A;  3ETG A;  3IJ4 A;  1SA0 B;  2YI8 A;  4CH4 A;  2ZDI A;  3M7M X;  4XBF A;  4UCU A;  4MVM A;  1H38 A;  1NBM G;  4FLW A;  2HEP A;  1BT8 A;  1S0V A;  5BR8 O;  1IXB A;  4LH7 A;  1XHZ A;  5CMU A;  3A0R A;  4F4L A;  4NTW A;  2Y48 A;  2LQT A;  3Q4H B;  4J7K A;  1A32 A;  1I5Y A;  4NXN O;  1XEQ A;  3L73 H;  3A2F A;  4JYA B;  4BIZ A;  2EJR A;  3DXR B;  1GN6 A;  5GTI Z;  1IBL O;  5JJE B;  3L72 H;  1VQ9 V;  4IYI A;  4YJ3 B;  1V55 C;  2FML A;  3SPI A;  3JD3 A;  1NH2 B;  1H2L A;  4PA7 A;  1I0H A;  5BMV B;  3UQ8 A;  1GN3 A;  2Y0P A;  2WLI A;  1JMK C;  1YTF D;  1BQ0 A;  3T1Y B;  4B3M B;  5JVD A;  1F7Y A;  1HNZ B;  1ZAU A;  4D7T A;  1VQP V;  2JEU A;  3JSL A;  3CRR A;  4HAM A;  4X1K B;  2Y69 C;  3T1H O;  1FFT B;  4ZHQ B;  1SET A;  1JOY A;  3W7U A;  5IWA O;  2B1G A;  2Q7E A;  3JAK B;  2UXC O;  3BA8 A;  3STL C;  3EFF K;  2LGW A;  1EBO A;  3DSQ A;  3KKY A;  1N8R W;  2UUC O;  1OCO C;  2CE4 A;  5LHH A;  2EIM B;  3RYF A;  1VAR A;  5J9P C;  3RBZ A;  4KHP B;  2M7W A;  5LXT B;  4MTF A;  2ZNI A;  1I08 A;  3SDL A;  4GKK O;  5IY5 C;  4LNU A;  2RMK B;  3K03 A;  5C8Y A;  4OGQ B;  4B7K A;  1XNR O;  4DR6 O;  3IC7 A;  2AW9 A;  1L0N H;  1ARO P;  4TWK A;  3IAY A;  3L75 H;  1VQO V;  4ZIB A;  3G71 V;  4FLX A;  4Q6G A;  3ABL B;  1MSW D;  1TVK A;  3CSX A;  3K04 A;  2ZE5 A;  3H1L H;  2QM8 A;  2R9A A;  4I55 A;  3OM3 B;  1ZSP A;  3E8F A;  4C7U A;  1WPX A;  5GTH Z;  2BTQ A;  4TV8 A;  3KZI Z;  2QDO A;  3E83 A;  1QVF U;  1Q8I A;  5CA0 A;  1G6U A;  2JGD B;  1QVG U;  2AGA A;  2MW2 B;  4JI6 O;  1H8E G;  1XDC A;  4H0L B;  1YJ9 V;  4RUE A;  5E79 Z;  4LF7 O;  1WB7 A;  4Z2W A;  1OZ0 A;  2HFE C;  4TV9 A;  2UUA O;  3ZHQ A;  2HKO A;  2EIN B;  4MVR A;  3RT3 C;  4UCO A;  2YDE A;  4LC1 A;  4DR5 O;  3JD4 A;  4CH5 A;  3TGU H;  4MTO A;  4QE7 A;  5H2F Z;  2Y0I A;  3FAV A;  3L74 H;  1IDS A;  4B08 A;  3T1C A;  2NR5 A;  4MTG A;  1M93 A;  3B4S A;  4LFC B;  1SZT A;  1AJP A;  2UU9 O;  4MVQ A;  4GLX A;  1COW G;  2FTK A;  3N2G B;  3PN1 A;  3IFX A;  5LGU A;  4B3S B;  1K7D A;  2GSM B;  4WBN B;  1Y76 B;  4PD4 F;  1EN6 A;  1IVS A;  4P9O A;  3BPZ A;  3TK1 A;  4UFZ A;  1HDJ A;  2XAQ A;  2OIE A;  1QNM A;  4DUY B;  2XUM A;  1NTM H;  2RJZ A;  1GM7 A;  3P3N A;  5EIB C;  1U96 A;  1EM1 A;  3BCC H;  4QNH B;  4WCE V;  1XHX A;  1CPY A;  4UCS A;  4GKJ B;  3RYH A;  2BCC H;  2HP8 A;  2ZKO A;  2FKX A;  2N74 A;  4JI8 B;  1JCH A;  1SS3 A;  3SPG A;  5DM6 V;  4WFB V;  5KHK A;  2LO1 A;  4FMT A;  3N27 A;  1JX9 A;  4LF5 O;  1MNG A;  1FD9 A;  4J9Z B;  1J5E O;  3CXC U;  1K92 A;  1OCC C;  3HKE B;  2UXB B;  1YSC A;  4UV8 A;  3LUT B;  2XAF A;  2YIC A;  2JGU A;  2W6J G;  4DUZ B;  4LWS B;  3BAB A;  3SGI A;  1MSD A;  3FD9 A;  4B3M O;  1SQB H;  4BAY A;  1YZB A;  1NU1 H;  2IH1 C;  4J42 A;  3CCE V;  4LF6 B;  1K4C C;  1W2B U;  2QGN A;  3AG3 C;  2EUL A;  4J7J A;  4O4I B;  3N2K B;  4DK1 A;  4X62 B;  4PJ0 Z;  1K5Q A;  1LUV A;  3AG1 B;  1JJ2 U;  3CJH A;  4IIJ A;  1FXK C;  5B66 Z;  1SQG A;  2IJH A;  2A79 B;  1BQZ A;  1R3L C;  4O2B B;  1VQN V;  3LSQ A;  1XIL A;  2P06 A;  4JI3 B;  4I50 A;  4EFE A;  5L3B A;  3EHB B;  4OPH A;  1AR5 A;  5FPO A;  4NXM B;  2ODM A;  3RFR A;  4RUF A;  3A0B Z;  1YTF B;  4JPR A;  5LGN A;  5KUK A;  3HKB B;  4R6Z A;  3ZMV A;  1Q3E A;  4X88 A;  1RPO A;  4G2K A;  1NH2 D;  2RNB A;  3J81 N;  4DR1 B;  1PL4 A;  2FYU H;  2PUS A;  4WF9 V;  3ZHV A;  4YHH B;  2EZO A;  3HKC A;  1HR0 B;  5KHH A;  4QE9 A;  2EX3 A;  2Q7H A;  1K4D C;  5J2T A;  1IX9 A;  1AI5 A;  3JAW A;  4DV7 O;  4AIL C;  1AI4 A;  1KQS U;  1VQ7 V;  1K3E A;  1R73 A;  5LP6 B;  4CZZ A;  2NN4 A;  4I9W A;  1WAZ A;  3TET A;  5KMG A;  3RWR D;  1XMO O;  3BHP A;  4GX1 A;  4FLY A;  3AG4 B;  1YI2 V;  2XAG A;  5JJJ B;  3I56 V;  2QKS A;  2ZM6 B;  4EB6 B;  1WA8 A;  5KAF Z;  1LUW A;  2EIJ C;  3E22 A;  1O9G A;  3SYO A;  4DXW A;  4NTX A;  1YCI A;  1P7B A;  4JTC B;  5FLX N;  2H94 A;  3H01 A;  1P7G A;  3E86 A;  3QVN A;  2KG7 B;  2UXX A;  2DMX A;  4B3R B;  4LFC O;  1RFY A;  1L1F A;  2QWN B;  2WLI B;  3ZHU A;  2YEV A;  2JDI G;  4LF9 O;  4LR3 A;  4JI2 O;  3ZMS A;  1IZ3 A;  2XAS A;  1ENV A;  3X2Q B;  3W7S A;  4QPK A;  5JVD B;  3AEI A;  2VWK A;  3KCX A;  3P30 A;  3K0D A;  4QJF B;  4J41 A;  1OJH A;  2YIB D;  4DV3 B;  4GYC B;  2E75 B;  1LNQ A;  2WLH A;  4PDR A;  5IYC O;  1AR1 B;  5EK0 A;  1MMM A;  3FYE B;  2LFS A;  1RSO A;  3CRM A;  4GKJ O;  1GM8 A;  1T5E A;  3ASN C;  1FPO A;  4P9P A;  3HKD B;  1I7F A;  1VQ5 V;  1MG1 A;  4WFE A;  1BL8 A;  3A0H Z;  3RYF B;  4JYC A;  5EYP A;  2MK3 A;  2CGO A;  1SQP H;  2DJV A;  1KKD A;  2XND G;  1KEC A;  3F5T A;  5LL6 Y;  4X66 O;  1FXK A;  4JI7 B;  1ZX3 A;  4GCZ A;  2K9P A;  2UXB O;  1PNL A;  2EIK B;  4XDJ A;  3SJQ C;  5IYD O;  3OAA G;  3ASO B;  1G8M A;  2Z3Y A;  1AI7 A;  1R3K C;  1S5H C;  1VQ4 V;  4HYO A;  2Z0A A;  3QTC A;  4O2A A;  1WJZ A;  4I4T A;  3KG2 A;  3BVO A;  3CEI A;  5IYB O;  5IYZ A;  2AZ2 A;  2DWD C;  3UT5 B;  4YJ2 A;  4WFG A;  3K79 A;  4I55 B;  4F6E A;  4X62 O;  2ZQM A;  4PDV A;  1R1B A;  3E35 A;  3MD0 A;  3JAR B;  3CD6 V;  3G80 A;  4O4J A;  2X7R B;  2LP7 A;  2RDC A;  1GRJ A;  4NB5 A;  2P4V A;  4HNA A;  2IBZ H;  1M57 B;  3DC5 A;  1CEZ A;  1BHA A;  1AVM A;  4LFB B;  3RGB A;  1OCR C;  1FFX A;  1WNS A;  5EC2 C;  5KUM A;  3LDC A;  2GBO A;  2ZR2 A;  5LA6 A;  3WG7 C;  1K73 W;  4NXM O;  4B3T B;  1IBK O;  4LF8 B;  2GTA A;  1ZLZ A;  3CCM V;  4MSW C;  5L3D A;  2PGG A;  2Z5U A;  2KSD A;  4DRX A;  2VS0 A;  4GZR B;  1NTK H;  4DV5 B;  5D5P A;  5JQG B;  1IXM A;  1SER A;  4J7Z A;  1R3J C;  2CDY A;  4DR1 O;  5ITZ A;  4DV0 B;  2W0X A;  4H33 A;  3L70 H;  4UXN A;  2IU3 A;  2RN9 A;  2V7Q G;  4D7S A;  1PL0 A;  3PJS K;  3AG7 A;  5C93 A;  3CP1 A;  2D3O W;  1KMI Z;  1V55 B;  3K9A A;  4DV1 B;  4KUM A;  4PDL A;  4DYL A;  2ZR3 A;  5K1P A;  4X1I A;  1KUQ A;  4TOI A;  3OUF A;  2HR3 A;  2Q0A A;  3E8H A;  3OMI B;  1PM9 A;  1Y66 A;  4IL6 Z;  1SRY A;  4R8C A;  3M99 B;  3GWK C;  1X4T A;  1FYJ A;  2CTP A;  4IHJ B;  1B6Q A;  1GH6 A;  1GMG A;  2JEX A;  5H9C A;  1Y6X A;  4PA9 A;  4ZKI A;  4AQY B;  1ZL8 B;  2ZM6 O;  4PV1 B;  2Y69 B;  1HNX B;  1H2G A;  4O4H A;  4PDM A;  4ASU G;  2Q8V A;  1GK9 A;  1KYO F;  2DYS B;  2V4D A;  5DN6 G;  2HVK C;  2IM9 A;  2E3C A;  1K8A W;  4UCV A;  3QO7 A;  3CWB H;  5CBH A;  3K5M A;  1THZ A;  3DC6 A;  2Q6A A;  4I9Q A;  1BS3 A;  4X64 O;  2AHY A;  1EN4 A;  3UKM A;  2QA4 V;  1MAB G;  4B3R O;  2IH3 C;  5CB4 A;  3F5W C;  2P7T C;  1KP2 A;  5J2U A;  3T4Z A;  1VF6 C;  3G67 A;  5LBQ A;  1VF5 B;  2OCH A;  2BSK B;  4MTX A;  2XHB A;  3K06 A;  3W7T A;  3D8C A;  4WFH A;  2WLK A;  1FAF A;  3SPH A;  3CMA V;  3IC9 A;  3VOU A;  5E1A C;  1DGS A;  4K8Z A;  4ICG A;  4UCR A;  3U11 A;  1OV9 A;  2QE7 G;  2DW4 A;  1EZJ A;  2ZCE A;  5LMN B;  1IBM B;  1AP5 A;  3CJH B;  1QHT A;  4IIJ B;  2X6A A;  4HZ3 A;  1V9P A;  2QJ1 A;  5EZY B;  1N36 O;  2XAJ A;  3K5N A;  4Z1M G;  4R50 A;  4CH3 A;  1QCE A;  4I50 B;  2WLL B;  3HB3 B;  3ZHR A;  2GHY A;  4BR6 A;  3VBB A;  3SJC C;  4DK0 A;  3ZN1 A;  1RM1 B;  3B8M A;  3JYC A;  4CS2 A;  1I5X A;  1Q6H A;  1MZF A;  5IJ9 B;  2R9I A;  4J9Y B;  4MVU A;  3AG2 C;  2YSU B;  1AIL A;  1PV0 A;  2X6C A;  3HPL C;  2X6B A;  3I5D A;  1EN5 A;  1S76 D;  4JI4 B;  1WLE A;  4QGP A;  4DR2 B;  3LSS A;  3AK3 A;  1YIJ V;  5JJN B;  1FJG B;  3U10 A;  3FX7 A;  4YXW G;  5J2T B;  5JCO C;  2M6Y A;  4XDK A;  1CXZ B;  4ZI7 B;  4IGG A;  1WP8 A;  1DF5 A;  4DV2 O;  5IJ0 A;  3H1J H;  5AG2 A;  1N32 B;  3QF7 A;  2V1D A;  4RO2 A;  3DGE A;  2WA4 A;  4N21 A;  5KMG B;  4LFB O;  1M56 B;  2RQ6 A;  1TUB A;  1YEW A;  4J10 A;  3SYP A;  5IDJ A;  4GT1 A;  4DV4 O;  2WLJ A;  3OTF A;  1WB8 A;  5KA6 A;  4B3T O;  4Z1V A;  3IGA C;  3BA9 A;  5JWP A;  2DQ0 A;  1WA8 B;  2GUZ A;  3H1I H;  3ABT A;  3CHX A;  3E22 B;  3SJB C;  1SZX A;  1VQL V;  4WFA V;  2R70 A;  5JH7 A;  5H6R A;  4DV5 O;  4F6R A;  4TQD A;  2OIG A;  3FB5 C;  4DV0 O;  1N34 B;  3M8A A;  4R7C A;  1YDX A;  4NVP A;  3ETQ A;  3ZX6 A;  4O4L A;  3D36 C;  1KD1 W;  2NLJ C;  1HNW B;  1H2N A;  3C3T A;  3CS5 A;  3UCS C;  1SES A;  3QG5 A;  1SA0 A;  4DV1 O;  3B40 A;  2PI4 A;  1OCC B;  2ZIO A;  5EBW C;  3ZCC A;  1S77 D;  4I0X B;  4CS4 A;  4BW5 A;  3VQV A;  4JI1 B;  1XMQ B;  4CH6 A;  3GVM A;  3I55 V;  1JQ0 A;  4YIO A;  3TXS A;  4JYA O;  1VF6 A;  3R66 A;  1H8H G;  3D3I A;  3Q4H A;  1QLE B;  3RN4 A;  4DR7 B;  3OMA B;  2JJ2 G;  3AG3 B;  2UXD B;  1VP7 A;  4H44 B;  2ZE7 A;  3ICX A;  3CRC A;  1HNX O;  4JF3 A;  1Y4M A;  2WLN A;  3DXR A;  1GTO A;  1VQ8 V;  1ZTE A;  5EYP B;  4BIO A;  5BMV A;  4BWA A;  3T1Y O;  1FXK B;  2JS5 A;  4Q20 A;  3CX5 F;  4AI8 A;  1P84 F;  1B3Q A;  1HNZ O;  2PY5 A;  4H13 B;  1US6 A;  5L3F A;  5LOV B;  1NT2 B;  2EIL C;  4UUJ C;  2YUA A;  1TGO A;  5K1X A;  3ZJZ A;  2Q73 A;  3JAS B;  2EBO A;  4X1K A;  4DV6 B;  3ABM B;  1P4R A;  2QWQ B;  2HVJ C;  1PNK A;  4ZHQ A;  3ZRW A;  3MHS C;  4K3A A;  1ORQ C;  2P67 A;  2VWJ A;  1ROP A;  1AJQ A;  3JAL A;  3JAK A;  4FFB B;  1JFF B;  2CH7 A;  4U3F H;  4AHC A;  2CUG A;  1F4M A;  5LMN O;  1IBM O;  4NR1 A;  4KHP O;  2LFR A;  1N33 B;  4HNA B;  4OXS A;  5JCO A;  2F23 A;  4JI5 B;  4X65 B;  4JYY A;  3NXS A;  3D3Q A;  4LP8 A;  1BE3 H;  5B1B C;  1WPB A;  1S5J A;  4FPP A;  3CYO A;  5LYJ B;  1OCZ C;  1NR7 A;  1XUQ A;  4I5S A;  2QKC A;  4UB8 Z;  4PA3 A;  1F51 A;  1SC5 B;  3ZS8 C;  4TQF A;  1FXH A;  3JCU Z;  2D2C B;  2CTR A;  2HLD G;  2YC0 A;  1KB9 F;  2EIJ B;  4JI4 O;  3RYC B;  4B7E A;  1JVM A;  4GX2 A;  1F4N A;  1BGY H;  1UFI A;  4JAV A;  1Q82 W;  2UXN A;  1G1X B;  3FB6 C;  2LGQ A;  3D36 A;  4KL1 A;  4X1I B;  5GON A;  1N32 O;  2Y4U A;  4U7N A;  3SR2 C;  3WB0 A;  1TA8 A;  5LMU B;  1QBZ A;  3G4S V;  2OCC B;  1N0J A;  1Y74 A;  2DWE C;  2ITC C;  3CCJ V;  4QPJ A;  1XOU A;  4X89 A;  2YI9 A;  3OFN G;  1N0N A;  3ZHS A;  3ETD A;  4JYB A;  5B1A C;  3B2E E;  4K8X A;  4O4H B;  5B3S B;  5KHG A;  3KCY A;  3JD2 A;  1AB3 A;  2XOK G; 
#chains in the Genus database with same CATH homology
 3ABU A;  1IXM A;  1ARO P;  1ZWI C;  1SER A;  4TWK A;  1R3J C;  1VQO V;  2A9H A;  3B8N A;  3UM7 A;  3CCU V;  3G71 V;  2K1E A;  4G27 B;  1GO3 F;  4H33 A;  3ABL B;  4KP4 A;  1MSW D;  3K04 A;  4UXN A;  2IU3 A;  3R65 A;  3SPC A;  2QM8 A;  2V7Q G;  5EBL C;  2HJF C;  3OM3 B;  1PL0 A;  2ZD9 A;  3PJS K;  5B1B B;  3JCZ A;  1QR9 A;  5C93 A;  3E8F A;  3CP1 A;  2D3O W;  3OUS A;  2Q68 A;  1QLE C;  1V55 B;  1WPX A;  1OCZ B;  2C2A A;  3AG4 C;  3K9A A;  4GX0 A;  4KUM A;  4PDL A;  3GWO A;  2JIZ G;  2ZR3 A;  4FJC C;  3P32 A;  3E83 A;  2BOB C;  4MT8 A;  1QVF U;  4G28 B;  3OUF A;  2HR3 A;  3E8H A;  3ZRV A;  3OMI B;  1Y66 A;  1NVP D;  3F7V C;  1E79 G;  1SRY A;  4R8C A;  2P6J A;  3M99 B;  5FL7 G;  4LBE C;  1VQM V;  3ABK B;  5LHI A;  2KB1 A;  1QVG U;  1KC8 W;  2F43 G;  1B6Q A;  1GMG A;  2QM7 A;  2JEX A;  3CC7 V;  5H9C A;  4PA9 A;  4ZKI A;  1H8E G;  1M9N A;  1E1R G;  2QEX V;  1YJ9 V;  4RUE A;  3OEE G;  2Y69 B;  4WFF A;  5B1N A;  2B5U A;  1HWY A;  1GKF A;  1TUE B;  3CCR V;  1H2G A;  4PDM A;  1OZ0 A;  1RPR A;  2HFE C;  4ASU G;  1GK9 A;  2DYS B;  2HKO A;  5DN6 G;  2EIN B;  2HVK C;  2WLL A;  4JTA B;  4MVR A;  1K8A W;  3QO7 A;  1PD3 A;  5CBH A;  4LC1 A;  2IU0 A;  4U7O A;  3SYA A;  1THZ A;  2Q6A A;  3K0G A;  3JD4 A;  2AHY A;  3ABM C;  4MW3 A;  4MTO A;  4QE7 A;  3UKM A;  2QA4 V;  2AHZ A;  3AG1 C;  1MOF A;  1F23 A;  1MAB G;  3T1C A;  4MTG A;  5BZB A;  1K9M W;  2IH3 C;  3CC4 V;  2OT5 A;  2WSS G;  3CCL V;  1SZT A;  1AJP A;  4UVB A;  3BY6 A;  3WG7 B;  3F5W C;  2P7T C;  4MVQ A;  1KP3 A;  3CCS V;  1COW G;  2FTK A;  5LHG A;  3E89 A;  3IFX A;  2DQ3 A;  1KP2 A;  5B1A B;  3FYI B;  3T4Z A;  3QO8 A;  5LGU A;  1K7D A;  1S3J A;  2GSM B;  5LBQ A;  3ZRX A;  1EFR G;  2Q69 A;  4P9O A;  3RW0 A;  3TK1 A;  4MTX A;  1DTO A;  4TT3 G;  3K06 A;  3W7T A;  4WFH A;  2W0F C;  2WLK A;  2XAQ A;  1AJN A;  3SPH A;  3CMA V;  3VOU A;  5E1A C;  2P90 A;  3TCU A;  1GM7 A;  3W7W A;  2QE7 G;  2DW4 A;  1EZJ A;  4QNH B;  4WCE V;  1CP9 A;  2CK3 G;  1QLN A;  5H6Q A;  1CPY A;  2EIK C;  1FXV A;  2X6A A;  3ZMU A;  1QR8 A;  2DYR C;  4HZ3 A;  1NJI W;  3ASO C;  1J95 A;  4P30 A;  1XL6 A;  2XAJ A;  3RVY A;  4Z1M G;  4R50 A;  1JCH A;  3JD1 A;  3FB8 C;  1QCE A;  3SPG A;  5DM6 V;  5CBG A;  4WFB V;  4N23 A;  3FB7 C;  1FS0 G;  2WLL B;  4FMT A;  1JX9 A;  3HB3 B;  4JAU A;  2BOC C;  2GHY A;  4J9Z B;  2ZXW C;  3VBB A;  3ZN1 A;  1RM1 B;  3CXC U;  1NR1 A;  3B8M A;  1K92 A;  1OCC C;  3JYC A;  3ASN B;  1I5X A;  5HFM A;  1YSC A;  4UV8 A;  3LUT B;  2XAF A;  3DTU B;  2ZDI C;  3SYQ A;  2R9I A;  2W6J G;  3K08 A;  4J9Y B;  4MVU A;  3AG2 C;  2YSU B;  4BAY A;  2X6C A;  4L87 A;  3HPL C;  1V54 C;  2IH1 C;  2X6B A;  3T4D A;  1PKX A;  1S76 D;  3CCE V;  2H8P C;  1WLE A;  1K4C C;  1W2B U;  3LSS A;  2ATK C;  3AG3 C;  1G4Y B;  3ZMZ A;  1YIJ V;  1XL4 A;  2WWW A;  2OTJ V;  2OCC C;  4XDL A;  2PI5 A;  4YXW G;  1NVP B;  1K5Q A;  3SYC A;  4XDK A;  3OE7 G;  5CN0 A;  1DF5 A;  3FKS G;  3AG1 B;  1AI6 A;  1JJ2 U;  5B1O A;  5CBF A;  1Q81 W;  3JD0 A;  2V1D A;  4RO2 A;  1VQK V;  5B3S C;  3DGE A;  1W0K G;  3LNM B;  4N21 A;  1FXK C;  3RVZ A;  1M56 B;  2IJJ A;  3F7Y C;  3G6E V;  1YJW V;  2IJK A;  1UJW B;  1NQT A;  2IJH A;  3SYP A;  2A79 B;  4GX5 A;  5IDJ A;  1R3L C;  4GT1 A;  1VQN V;  4E2L A;  3CC2 V;  1K5S A;  3LSQ A;  1K33 A;  2WLJ A;  2WPD G;  5L3B A;  2QTO A;  3X2Q C;  1Q7Y W;  3EHB B;  5KA6 A;  3ZRS A;  3CME V;  3IGA C;  2WAM A;  3CCQ V;  2DQ0 A;  3K3W A;  1M90 W;  4RUF A;  3ABT A;  1YTF B;  4JPR A;  1YHQ V;  1VQL V;  5LGN A;  5KUK A;  1OCO B;  4ZBM A;  4R6Z A;  3ZMV A;  4WFA V;  1K97 A;  5HFL A;  1OCR B;  5H6R A;  4X88 A;  1RPO A;  4G2K A;  4QIW F;  1NH2 D;  3FB5 C;  2DYR B;  4R7C A;  4WF9 V;  4MVZ A;  5IY5 B;  1R6N A;  4UVC A;  2EZO A;  3ZN0 A;  3E8B A;  1PNM A;  4QE9 A;  1KD1 W;  1DLB A;  2JK5 C;  2NLJ C;  3ABK C;  4CBC A;  3QO5 A;  1K4D C;  1SES A;  5EBM C;  2XAH A;  3E2E A;  1AI5 A;  2OTL V;  2ZXW B;  1S72 V;  5EC1 C;  2IJI A;  5GW7 A;  2PI4 A;  1OCC B;  1AI4 A;  1KQS U;  2IW5 A;  5EBW C;  3ZCC A;  1S77 D;  3LDE A;  4PA4 A;  1VQ7 V;  1K3E A;  1R73 A;  4BW5 A;  3ZRW B;  4CZZ A;  4I9W A;  3WFV A;  3TET A;  2DYS C;  3AG2 B;  3I55 V;  5L3E A;  1BMF G;  1JQ0 A;  1V54 B;  4GX1 A;  4FK5 C;  1H8H G;  2X0L A;  3D3I A;  1QLE B;  3AG4 B;  1YI2 V;  2XAG A;  3OMA B;  4DO2 A;  4BIU A;  3I56 V;  4PEL A;  2QKS A;  2JJ2 G;  3AG3 B;  3QNE A;  4UV9 A;  1BHB A;  4JF3 A;  2HG5 C;  2EIJ C;  3OMN B;  2R9R B;  4MVO A;  1Y4M A;  2WLN A;  1GTO A;  3STZ C;  3SYO A;  2ITD C;  1VQ8 V;  4DXW A;  4FIP C;  1P7B A;  3CCV V;  2NNU A;  3GB7 C;  4JTC B;  1R6K A;  3ETE A;  2JJ1 G;  2H94 A;  1DF4 A;  5LGT A;  3OR6 C;  3CPW U;  5KA5 A;  1R3I C;  3H01 A;  2A0L A;  5L3C A;  4PA6 A;  3E86 A;  4RAI A;  1FXK B;  4Q20 A;  2UXX A;  1YJN V;  1L1F A;  1K34 A;  2WLI B;  5L3F A;  1M57 C;  2JDI G;  2YEV A;  4KFM A;  4JTD B;  5L3G A;  3ZMS A;  2EIL C;  2XAS A;  1ENV A;  4UUJ C;  3X2Q B;  4QPK A;  3OGC C;  3W7S A;  2WLM A;  2EIM C;  3OW2 U;  1VQ6 V;  3ZJZ A;  3AEI A;  3ETG A;  2EBO A;  1YIT V;  4EKW A;  1GM9 A;  3ABM B;  3P30 A;  1W0J G;  1P4R A;  2ZDI A;  3K0D A;  4XBF A;  4QJF B;  2HVJ C;  1PNK A;  3ZRW A;  3MHS C;  4MVM A;  1H38 A;  1NBM G;  1ORQ C;  2P67 A;  1ROP A;  1OHH G;  1S0V A;  1AJQ A;  3OR7 C;  1LNQ A;  1M1K W;  2WLH A;  4PDR A;  5IYC O;  1AR1 B;  5EK0 A;  4MS2 A;  3BEH A;  3FYE B;  2LFS A;  3A0R A;  5CMU A;  1F4M A;  4F4L A;  2Y48 A;  1RM1 C;  2LFR A;  1GM8 A;  3ASN C;  1I5Y A;  4OXS A;  4P9P A;  1VQ5 V;  1MG1 A;  4WFE A;  4BIZ A;  3ABL C;  3E8G A;  3NXS A;  1BL8 A;  5CA3 A;  2EJR A;  4JYC A;  3SPJ A;  4UVA A;  2MK3 A;  4LP8 A;  1VQ9 V;  4JGS A;  5B1B C;  4FPP A;  2W6I G;  1KKD A;  2XND G;  3CYO A;  1V55 C;  1KEC A;  1OCZ C;  3ML0 A;  4RQE A;  1NR7 A;  1FXK A;  3SPI A;  4I5S A;  3JD3 A;  4GCZ A;  1NH2 B;  4PA7 A;  4PA3 A;  1PNL A;  2EIK B;  4XDJ A;  1F51 A;  3SJQ C;  5IYD O;  3OAA G;  3MHH C;  3ASO B;  2WLI A;  1FXH A;  1G8M A;  2Z3Y A;  1Q86 W;  1AI7 A;  3ZIA G;  1R3K C;  1YTF D;  1S5H C;  2HLD G;  1JPX A;  2YEV B;  1VQ4 V;  4HYO A;  3T2M A;  2EIJ B;  3W7X A;  1VQP V;  2JEU A;  1JVM A;  3KG2 A;  4GX2 A;  1F4N A;  4HAM A;  5IYB O;  2Q67 A;  2Y69 C;  2DWD C;  4P2Z A;  1M56 C;  4WFG A;  1FFT B;  3K79 A;  3ZMT A;  1SET A;  2ZQM A;  4JAV A;  1Q82 W;  1JOY A;  4TSF G;  4PDV A;  4JAS A;  3W7U A;  2UXN A;  4RQF A;  3E35 A;  3MD0 A;  4LCU C;  2B1G A;  2EIN C;  3CD6 V;  3FB6 C;  3D36 A;  2X7R B;  2LP7 A;  4U7N A;  3STL C;  3EFF K;  1EBO A;  1M57 B;  1CEZ A;  1BHA A;  1E1Q G;  1QBZ A;  1N8R W;  2EIL B;  3G4S V;  1OCO C;  2OCC B;  5LHH A;  2EIM B;  4MVS A;  1OCR C;  3LDD A;  2DWE C;  2ITC C;  2B1I A;  5J9P C;  3CCJ V;  4QPJ A;  4X89 A;  5EC2 C;  3RBZ A;  3OEH G;  5KUM A;  3OFN G;  3LDC A;  2M7W A;  3ETD A;  2ZR2 A;  4MTF A;  4X8A A;  3WG7 C;  1K73 W;  4JYB A;  4H37 A;  5IY5 C;  1NKD A;  5B1A C;  3K03 A;  3CCM V;  2EZP A;  4MSW C;  5B3S B;  4MW8 A;  5L3D A;  3JD2 A;  2Z5U A;  2XOK G;  3IC7 A;  3B77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...