1KC8W

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kc8W00
1VQ8V 1W2BU 1VQOV 1VQ7V 1S72V 1YI2V 1YJ9V 1YIJV 1KC8W 1KD1W 4WFBV 1VQLV 1Q7YW 3CCJV 1VQ5V 1VQ9V 4WFAV 3CMAV 3G6EV 3OW2U 3CCUV 2OTLV 3CXCU 1NJIW 1YHQV 3CCRV 3CCMV 1K73W 3I55V 2D3OW 1Q86W 1N8RW 3CCSV 1QVFU 3CCVV 3CMEV 1VQNV 3CC7V 1M90W 3CCQV 1VQMV 1VQKV 1KQSU 3CCLV 3G71V 1VQ6V 4WF9V 3I56V 1YJWV 1M1KW 2QA4V 1QVGU 1K9MW 1VQ4V 1JJ2U 4WCEV 3G4SV 2QEXV 1Q81W 1YITV 3CPWU 3CCEV 1Q82W 1VQPV 3CD6V 2OTJV 3CC2V 1R73A 5DM6V 1YJNV 3CC4V 1K8AW
chains in the Genus database with same CATH superfamily
4BIUA 3ZRWA 3JCUZ 1YJ9V 5CN0A 5B1BB 4MTGA 2HJDA 4YJ3A 1XI1A 3LDCA 3CRCA 3H1KH 1H2SB 4UFZA 3JD2A 1PNMA 4IGGA 2AHYA 3Q4HA 3ABTA 2RDCA 3B8MA 1I94O 3JASB 1L0NH 2JEXA 1E79G 2KG7B 4MT8A 2IW5A 2P7TC 4QPJA 3RN4A 3UT5B 1XNQB 5AG2A 4GCZA 4P30A 4JI4B 2JGUA 4F6RB 2GBOA 4YY3B 4I5SA 4B3TO 3CCLV 4AI8A 5JJJB 1M4UA 3A0RA 1FXHA 4DUZO 1I08A 2QWQB 1NS1A 3T1YO 1I0HA 4TUYA 2EULA 1KP2A 2QJ1A 2P90A 3ABKC 4RAIA 2QKAA 3LNMB 1CP9A 3M8AA 1D5AA 4JI5B 2EZPA 4FVMA 4TOIA 4YIOA 3A0HZ 4PJ0Z 2GDSA 5C8YB 4KFMA 4LH7A 3CSXA 4PDMA 1DF5A 1KUQA 4H37A 2VQFO 3CCUV 2O57A 2IU0A 2PGGA 3A2FA 3T4ZA 5GONB 3K5OA 1R3KC 1NH2D 1M5IA 1NR7A 2XAJA 4JV5B 3VBBA 4X9QA 2IJHA 3OT7A 3OGIB 2DQ3A 4JTAB 2DJVA 4I9QA 3QNEA 4WFHA 1YI2V 3M7MX 3AK2A 3K03A 1K5SA 3HKEB 4RO2A 2FMLA 1QVFU 4WFFA 5D5QA 2X0LA 3G80A 3FYIB 2DYSB 3F7VC 4JAAA 1NI8A 3LSQA 4O4HA 4JGSA 3QO5A 3RYFA 1S77D 1Y74B 1FXKA 3AG3C 5CA1A 2V4DA 4WBNB 3HB3B 5FLXN 4O2AB 1NTKH 2IH1C 4LWSA 2A0LA 4I0XA 1YTFB 5BMVA 5B1NA 3DXRA 2H8PC 3SPHA 3ZEDA 1VARA 4UVCA 2P6JA 2RMKB 5IJ9A 1HNWO 1FXKC 1GK9A 3CB2A 3A8TA 1QU7A 5B5EZ 3ASNB 3ML0A 4KUMA 4MW8A 2YDEA 1AI5A 4BW5A 4CBCA 2FKXA 2KSDA 2LQTA 4X1KB 1GTOA 3CCEV 1N36B 2F4VB 1IDSA 5IDJA 1KBHA 4B7KA 4DR5O 2YXLA 3B8NA 4YHHB 4LF6O 2YEVB 1B04A 4DV5O 3ZHTA 3KCYA 2W6IG 1XHZA 2VQEO 2QTSA 2X6BA 4H33A 1FD9A 5LMNO 4R50A 4FM0A 4CS4A 2XT9A 2XAHA 2ZE7A 1N33O 1NZ6A 5H5NA 1F23A 5KA6A 5IWAO 1WN7A 1V9PA 3IGAC 5JJEB 1I94B 4MVUA 4MW3A 4X65O 3ETGA 3SPGA 1Y67A 2ZKOA 1R6KA 4OX9O 4DUYO 1K7DA 5LOVA 1PV0A 2IBZH 1AVMA 3BA9A 3B77A 2EIJB 2JVDA 4I55A 1LUVA 1X4TA 3OEHG 4DV7B 1O9HA 4CS2A 3E8GA 5EZYB 3RVZA 3TK1A 2EIMB 3W7XA 1AI7A 4UCTA 4GLXA 4H13B 2WPDG 4DUZB 4NKGB 4P2ZA 2WWWA 3UCSC 2EZOA 3CJHA 4LF7O 4GKKO 1OCZB 4BW9A 4LP8A 4FLTA 2F95B 1YJNV 5KHGA 4X66O 2P4KA 4W4KA 3U11A 3ZRVA 3AG1C 1FFTB 1OCCC 5KUMA 1SQXH 1RP3B 2ZR2A 2YSUB 4RUEA 1CEZA 1Y66A 1IBMO 2OTLV 2NR5A 3T1HO 2WLLA 1GRJA 4J9YB 2QWOB 2VQFB 1TUBA 2YIAA 3E2EA 4JTCB 5FL7G 3JSNA 1E1RG 3ETDA 1W2BU 2ZM6B 1N34B 1WPXA 2UXCO 3BA8A 2V7QG 4UCRA 1SQFA 1Y6XA 2CH7A 2KB1A 2L35A 1Y76A 1K4CC 1Q6IA 2JEUA 4JI2B 2ZDIC 5LYJB 1T5EA 1DTOA 4LFCO 3J7AU 2Q7EA 1TA8A 1KKDA 1MMMA 1SQQH 1YTFD 5J2TA 1CPYA 4X1YA 2WA3A 4PDLA 4QPKA 5JWPA 2P67A 4ZOLA 1B6QA 1V54C 4IL6Z 1FYJA 2PTMA 4U3FH 2W0FC 2ZQMA 1AR5A 3ZS8C 2QE7G 4EB6B 5KMGB 3SGIA 5GTIZ 4XBFA 1KD1W 3LSUA 3AEIA 3RGBA 5K1PA 2V1DA 3ZCCA 2Y48A 3K9AA 2VRZA 3ABUA 2EINC 3UO3A 5CBFA 2RN9A 3OM3B 3FFQA 1SRYA 4TV9B 1YCIA 2YXYA 5FPRA 1MABG 1EN6A 2DWEC 2BTQA 2N04A 3AG2B 4K3AA 3UKMA 4DRXB 3C3SA 1H2MA 4ZI7B 1HWYA 1M93A 3CXCU 4YJ2B 2CK3G 2PI5A 1XMQB 1M57C 4FMTA 4MVRA 2CTRA 2KQXA 1HDJA 2FB5A 4J7ZA 4DV1B 1YZBA 3N2GA 5TISZ 1SC5B 5H6RA 1VQPV 1OCRB 1R73A 5JCOA 3TGUH 3CC2V 1XNQO 5A9GA 1O9GA 5KHKA 1AR1B 5LBQA 3F5TA 1YF2A 4YY3O 1EN4A 1NKDA 1RSOB 2CTWA 2JRIA 4NB5A 2N74A 1NBMG 2CDYA 1D5NA 2GV9A 5H6QA 2XUMA 2BOBC 2Q4PA 5LA6A 4X65B 3R65A 5JVDB 4DUYB 1S5LZ 3LSSA 3OTOB 1K8AW 3CRRA 1VQ8V 3RYIB 2CTQA 2HG5C 4N21A 5JCOC 1Q7YW 1YSCA 2QM7A 4IIJA 2E5LO 3AK3A 1FS0G 4JI5O 2RJZA 4TQDA 3WU2Z 4LFBB 1I5XA 1EM1A 4MVQA 2Z3YA 4LF4B 4UV8A 5KLVH 3KCXA 4IYIA 5EBMC 5KHIA 1XHXA 1F4NA 1GMGA 4X62O 3UO2A 3FB6C 1GM8A 5A2QN 3W7WA 4O4JA 4DR6B 3T1CA 3ABLB 2UUCO 1MSWD 1UFIA 3CYOA 3ZRSA 1NT2B 4LH6A 1KMIZ 3I5DA 1OV9A 1Y4MA 3EFFK 3OUSA 4ZIBA 4R6ZA 4BWAA 3HKCB 4O2BA 3SR2C 1MZEA 3W7TA 1AILA 1SZTA 4X20B 4I4TB 3THOA 2HVJC 1W0JG 3TJTA 4PD4F 3OMAB 4D7SA 5BR8O 4BIOA 5D5PA 3GWOA 1BSMA 4ZHQA 3RYCB 1Q3EA 3H1JH 4EFEA 4XDKA 1UJWB 1PNKA 2A9HA 5BZBA 3GWKC 2GUZB 5GTHZ 1WP7A 3L75H 4AQYO 4LFCB 1JMKC 3WG7B 3JALA 2CGOA 2F66C 1QR8A 3HKBB 2WLHA 4PA7A 4HYOA 1P49A 1MZFA 5IYZA 1N32O 3H1HH 3SYAA 2R9AA 5B1BC 1FFXB 2GTAA 1OJHA 1WP8A 1AJPA 3FAVA 4A5UB 1N4CA 3HR0A 5LL6Y 2XTAA 3B4SA 2F4VO 1ENVA 4I50A 3G71V 4KXRA 3NXSA 2DE0X 5LP6B 1RM1B 4YHHO 1YXBA 2DYRB 4PHZA 2M6YA 3H1LH 5ITZA 1VQOV 1Z5VA 5C93A 2HKOA 3SJCC 1DK1A 1AB3A 2LW7A 2A79B 1XDCA 2YI9A 4FLZA 1QQCA 2Q8VA 1P7BA 2E3CA 4D7TA 1F7YA 3CMEV 4E2LA 3ZRXA 4J9ZB 1SETA 1TGOA 3IC7A 5B3SB 5K1XA 4DR4O 1W0KG 3FB7C 3JATB 4GX1A 5FNVB 1KC8W 3JD1A 3E83A 2GHYA 3K0DA 3G6EV 2QKCA 1ZTEA 4JI6B 1HP8A 2LGQA 4UCVA 5L3EA 2P4VA 4MVOA 2QA4V 4BIZA 4DV7O 2CTPA 1FJGB 5KX5A 2IH3C 2JGDB 3ASOB 3RWRD 1WB7A 4I7ZB 4JZGA 3W7SA 2ZE8A 4NTYA 3ZMVA 4CH5A 2ZIMA 4TWKA 3RYHA 1M56B 4X1IA 1VF5B 1NR1A 2E5LB 5FPOA 5EYPA 3STLC 2BSKB 1AP5A 4N23A 3K59A 1TAEA 4J10A 4O4LB 5J2UB 4X89A 2K9PA 2QWPB 4JAVA 2ZXWB 2OCHA 1LNQA 4PV1B 5CA3A 4QJFB 1AI4A 3ZRWB 2DYSC 4YJ3B 1K92A 4X62B 1V55B 2B1GA 3BFRA 1COWG 2EILB 2XAFA 1YJWV 4OPAA 4ZKIA 2ZM6O 1N34O 4JI8O 2UUCB 3Q4HB 5J9PC 4RWUA 2YS8A 4J41A 2IJIA 3D8CA 4NR1A 4G2KA 4JYBA 2F43G 3CMAV 3JCZA 1S3JA 1Q86W 3OMIB 2VS0A 3ABKB 4JI2O 1BHAA 3OD4A 3FB5C 4I9WA 5KAFZ 4JI3B 3MAQA 4MTFA 2F23A 4JTDB 5BR8B 5EBWC 3HKDA 4U3JA 3ASNC 2OYQA 4F4LA 3MD0A 3BHPA 2WSSG 1IXMA 4TUYB 1FKAO 3ZMUA 2B9ZA 5E79Z 1QLNA 4AQYB 3MDSA 1JPXA 4LF5B 5KUKA 2QDOA 2E74B 3S3WA 1N32B 4QNHB 1WA8A 5F2VO 3IFXA 3K57A 1SZXA 3J81N 3STZC 3ZMSA 3W7UA 4GX5A 2WLMA 4UB8Z 3X2QB 4Q20A 1WPBA 2IJKA 3PN1A 2MK3A 1G6UA 1ZLZA 3K0GA 1IX9A 3CP1A 3TETA 3ABMB 1XMQO 2IJJA 2GSMB 2JDIG 3OW2U 2EIJC 4DV1O 1XEQA 4QIWF 2HEPA 4DYLA 5LGTA 2LW1A 5E1AC 1U97A 2BTOA 1VP7A 2QEXV 2PF4E 4LNUA 2YUAA 4LC1A 4TT3G 1ORQC 2DWDC 3LUTB 2EIMC 3OUFA 2Q9LA 1VMGA 4DV6B 1B3QA 1PKXA 1PPJH 3ZHRA 1KB9F 4O4HB 4DR4B 3RYFB 4W4LA 1U96A 2Y4UA 3ZJZA 1FXKB 4DW1A 2FTKA 3OTOO 2RNBA 1VF6C 3KKYA 5CA1B 3EXAA 2Q69A 3R66A 4DK0A 3DTUB 5DM6V 5JQGA 3ZHVA 4JAUA 2BE3A 1HNZO 4LWSB 4LCUC 4I0XB 5EK0A 3CRMA 5BMVB 3G6BA 3DXRB 4LFBO 1I7FA 2QWNB 3OGCC 4JI1O 4LF4O 3F5WC 3CCVV 5IJ9B 3ZIAG 5L3FA 5LXTA 3E22A 4CZZA 3CPWU 4B08A 2EJ7A 2K1EA 1RPOA 5IJ0A 3N2KA 4PA3A 4DR6O 2HLDG 2AZ0A 3CRAA 5DN6G 1K33A 5KHHA 3JAKA 2XHBA 4X8AA 2BCCH 3B40A 4DR2O 4DK1A 1TVKA 1K5QA 1XOUA 5LGNA 2ZDIA 2OTJV 2G38A 3NR7A 1NVPB 1M9NA 1NTMH 5CB4A 2R9RB 2ADPA 1S72V 4JI8B 3SYCA 1FXVA 1H2NA 2X7RB 3CCRV 2LGWA 1LR1A 4FZ0A 2Q5ZA 1QBZA 2Y69B 1JJOA 2B5UA 2YIBD 1Q81W 1XNRB 5LOVB 2OCCB 4MSWC 1NU1H 2PYJA 2A7WA 2AHZA 5LHIA 4I55B 5JH7A 1QLEB 3AG1B 2M7WA 5DEDA 2VWJA 2W0XA 4DR1B 3K04A 2DQ0A 3AG2C 1R3IC 2JJ1G 1PL0A 1RFYA 1QNMA 3E8FA 3FKSG 4NTWA 3CJHB 1KYOF 2P5OA 1VQ5V 2JS3A 1DLBA 4FPPA 1RPRA 3G67A 1FAFA 2UUBO 3DSQA 2HVKC 3K79A 4NTXA 2EX3A 3HPLC 1OCRC 2ZD9A 4CC6A 2Z5UA 1JFFA 1K9MW 1OCOB 2WLLB 1IVSA 3TXQA 1GH6A 2AW9A 1TUBB 2W6JG 4FFBA 4HNAA 3UM7A 3ZMTA 2UU9O 3L70H 2WLKA 4AHCA 3D3IA 1K73W 2EJRA 3CXHF 4EFBA 2JK5C 5CA0A 5IY5B 2CH7B 3QO8A 1V54B 1Q82W 4FIPC 2BOCC 2EIKC 4TV8A 1S5HC 1Y76B 3L71H 4JI6O 1XQ8A 4EKWA 3MHSC 4WFAV 4B3RB 1IBKB 1Q43A 2OIGA 4JF3A 1JCHA 4JPRA 1GAXA 1ZX3A 1VQNV 2LJ2A 1G4YB 4QE9A 2QWRB 1FJGO 2ILMA 5J2TB 4X1YB 1F51A 4JYAB 4FLYA 4ZOLB 2F1MA 1AI6A 2WLIA 4YIPA 4DW0A 4JYYA 4UXNA 3ZBHA 2UUAB 2YI8A 1G8MA 3ZX6A 2HHHB 3EHBB 2C2AA 1K3EA 2OIEA 3CCJV 5L3DA 3ABLC 2ZNJA 1YVWA 2PY5A 4D6TH 3P3NA 4IHJA 1HNZB 2YXHA 1EFRG 2Q7GA 3JAWA 1SA0A 4GX0A 1R6NA 4JI1B 1PM9A 3JARA 3BY6A 3LDDA 1G1XB 1D2DA 2ZNIA 4FM1A 3BEHA 1H8HG 3ICXA 2BTQB 3J80N 1H8EG 3P32A 4NVPA 4TSFG 3ZN1A 2HR3A 5LHGA 1J5EB 3APOA 3B09A 4J7KA 2LFRA 2A3QA 3AG4B 4K0KO 5KA5A 1GM9A 2PI4A 3DC5A 3H9VA 4DR2B 1K4DC 1SQPH 5CA0B 4TQFA 1ZL8A 1XREA 4OPHA 2ZIOA 3N2GB 3KZIZ 4OXSA 1AJQA 3WG7C 1S0VA 2OT5A 3BRCA 4CH6A 4JI3O 1H2LA 4P9OA 1URFA 1P4RA 4ABMA 1Q6UA 3G4SV 4PI0A 3T2MA 3K08A 5LA6B 1NH2B 1VQ6V 4XDLA 3L74H 2Q6AA 5LHHA 3OAAG 3JASA 3QG5A 1P84F 3E89A 2E76B 3JD0A 1IURA 3GVMA 5LP6C 3RFRA 4IIJB 4ICGA 4LF5O 3RW0A 1FPOA 2KG7A 4B3MO 1BHBA 1R3LC 4WCEV 3SJQC 1BT8A 1BS3A 3UT5A 3BCCH 1MSDA 4FM2A 4F6RA 1XBLA 2WA4A 1J95A 2IM9A 3P30A 4QE7A 3UQ8A 4RQFA 3CCQV 2UUBB 3C3TA 3E8HA 4O4JB 4DR7O 2DW4A 2Q7HA 1PNLA 1NTZH 5H9CA 1ZUQA 3LDEA 2ZT9B 2Q73A 5LGUA 3BAAA 4MVMA 4G27B 4O2BB 3VOUA 3VQWA 5C8YA 2LFSA 5LMUB 2UU9B 4DV6O 3K5MA 3ASOC 4X88A 3FD9A 2CE4A 1JOYA 1W59A 1VQ7V 2YICA 2DN9A 4PA6A 4GX2A 5GONA 1HR0O 3QO7A 1M56C 4UCSA 4MTXA 1B06A 1XILA 3L72H 4ZHQB 1S76D 4HZ3A 1N8RW 1K34A 2UXXA 2WLJA 3OFNG 4K8XA 2A06H 3ZN0A 1VQMV 4J80A 1JA8A 2ITCC 4KP4A 1GN2A 3CD6V 4PA4A 2B1IA 4KHPB 1JX9A 2JIZG 2ZXWC 3HKEA 5B1AB 3JALB 1BQ0A 4GT1A 5IYZB 2QGNA 4H0LB 5CBHA 2RQ6A 1V55C 4LFAB 2EILC 3SDLA 5EIBD 1BE3H 1Q8IA 1Y74A 4UCUA 3TCUA 3WB0A 2YIBA 3FAVB 4JI0B 1Z5WA 1R6TA 4I50B 4WBNA 2L6LA 4JYCA 1CXZB 1QHTA 4O2AA 2CUGA 5ITZB 3VQXA 2ODMA 4B3SB 4FK5C 1ROPA 1EN5A 1YDXA 4ASUG 4FZ1A 4GYCB 1Q6HA 3OE7G 4RQEA 1IXBA 3QVNA 3CC4V 1SESA 4DV4B 4UVAA 2UXDB 1UPGA 4H44B 2DMXA 1GN3A 4DV2B 4BAYA 5KHJA 4EEQA 4K0KB 1R1BA 3CE2A 4HAMA 4LF8B 4X1KA 2FL4A 4FLVA 4PDRA 3P3PA 3CEIA 1XNRO 3OTFA 4DV3B 4DXWA 1IBLB 2D2CB 4BR6A 4JI7O 2YC0A 3FX7A 2YEVA 2ITDC 1GN6A 3O9OA 4DR1O 2PUSA 5HFLA 5HFMA 3DGEA 2AXTZ 1OZ0A 3X2QC 1JVMA 5KX5B 4FLUA 4NXNO 2VWKA 2KKWA 3L73H 1MG1A 1QVGU 3RYHB 4UV9A 4OGQB 1F4MA 4X1IB 1BQZA 3ABMC 3TXSA 4CS3A 3M99B 1L0LH 3N27A 1XUQA 4B3MB 5EC2C 4PI2A 5L3GA 3K5NA 1K97A 5EYPB 4PA9A 5CBGA 3JYCA 4YXWG 3WB2A 2UXBB 3O65A 4LF9B 4U7OA 1XL6A 1VIBA 1GKFA 5BY1A 5IYDO 5EZYA 1XL4A 2LO1A 5H2FZ 2WLNA 1XMOO 4DR7B 4MS2A 5IE9A 1IZ3A 2HP8A 4UUJC 3AG3B 3CCMV 1I5YA 1VF6A 1HNXB 3CWBH 1EBOA 1ZWIC 3AG7A 4FLWA 1VQ4V 1BGYH 2H94A 4B3RO 4NXMB 2PZSA 4DV0B 2R9IA 4GKJB 1SQBH 1IBKO 3K06A 1YIJV 1PD3A 2NNUA 3C90A 2ZE5A 1N0JA 1NJIW 4G28B 4JYAO 3T4DA 2HFEC 1HR0B 1OCZC 4NYKA 3HKDB 3JD3A 4U3JB 2OWOA 1KQSU 4JASA 2UUAO 3ZHUA 2HHHO 3SYPA 3MHHC 1WB8A 3ZMZA 4B7EA 1R3JC 1LUWA 2ATKC 3BPZA 1MNGA 4KL1A 4MVSA 3ETQA 1VQLV 5IYBO 1SQVH 1S5JA 5EBLC 1SS3A 4K35A 4J11A 1YEWA 1WA8B 1GM7A 5LYJA 2UXNA 4L87A 1H38A 1WNSA 1SF9A 4P9PA 1BZKA 4UB6Z 4B3TB 3F7YC 1L1FA 3FYEB 3SPCA 1BMFG 1Z2GA 2ZE6A 2AGAA 3JAMN 1J5EO 1YHQV 5IT9N 2Y69C 4EB6A 3E8BA 3T1YB 1Q5OA 2Z0AA 5KMGA 2OCCC 2Q67A 3GB7C 3A0BZ 3IJ4A 3OR7C 3RVYA 3WFVA 4AILC 1QLEC 3L9DA 4LNUB 4LBEC 4TV9A 1BL8A 4MVZA 1H2GA 3I55V 4J7JA 4ZBMA 2QM8A 3EVKA 4GZRB 2HJFC 3SJAC 4R8CA 1A32A 4DRXA 3IC9A 1THZA 2ZINA 4DR3O 4ZI7A 5IYCO 3VQVA 4YJ2A 2DOSA 5B1OA 3SJBC 3WB1A 4JI7B 2ZR3A 1OCCB 2H3OA 5JQGB 3SPIA 2XOKG 2CGNA 1NQTA 3B2EE 1OCOC 5L3CA 2CAZC 4Z1VA 1M1KW 4FLXA 1JR9A 1OHHG 1KECA 2Q0AA 4NXNB 3U10A 1RSOA 5LXTB 3E22B 2Q68A 1MA1A 3CRQA 2R72A 1VF7A 4PDVA 4X64O 5IJ0B 3N2KB 3RT3C 5JVDA 3OR6C 5IY5C 4IYHA 3CC7V 5DECA 3RYIA 1ZSPA 1Q90D 1JJ2U 3JAKB 2Q0OC 3D36A 3SYQA 2PYLA 1MOFA 1BCCH 2ARHA 1VQ9V 5GW7A 1AJNA 1TVKB 2Y4TA 1ZAUA 1PP9H 5LMUO 2R70A 5CB4B 1HW7A 1XMOB 1HNWB 4UVBA 1M90W 1VQKV 2AZ2A 1WLEA 2ADQB 3JSLA 1GO3F 4O4IA 5BXZA 3K5LA 4RUFA 3H01A 4R7CA 5KAIZ 3D36C 2X6CA 2XNDG 1SKVA 1PL4A 4Q6GA 5CMUA 4MTOA 4DR5B 3CCSV 4LF6B 3ZHSA 3HKCA 5JH7B 3AK1A 3CHXA 4KHPO 5EIBC 4WF9V 2EINB 3QF7A 4DV5B 2QR4A 1YITV 3FB8C 4Z1MG 4X20A 4I4TA 2VQEB 2QKSA 5LMNB 4JI4O 1QCEA 4LFAO 1SERA 4DO2A 1N33B 1N0NA 2JS5A 5IWAB 5JJNB 4JI0O 3KG2A 3E86A 1WJZA 3AG4C 3RYCA 4WFGA 4OX9B 1M57B 1JQ0A 3U0ZA 4FFKA 3SYOA 1KKCA 2GUZA 1KU9A 2WAMA 2EIKB 1JFFB 2GTSA 4C7UA 1EZVH 1AROP 2ETNA 1H2KA 4B3SO 3HKBA 1AR4A 2P22C 3ZHQA 4FFBB 1FFXA 3CX5F 4HNAB 4UCOA 5EC1C 1NVPD 2QSAA 4DV4O 1L8DA 2UXDO 1KP3A 2ZCEA 3QTCA 5L3BA 4WFEA 3K3WA 4DV2O 4HBNA 1VEWA 4LF7B 4GKKB 4LF8O 4Z2WA 1US6A 3RBZA 2JJ2G 3BVOA 4O4IB 4LR3A 4X66B 4DV3O 2Y0IA 4TV8B 3PJSK 2EBOA 2RCVA 3K58A 2IU3A 5LP6A 4JV5O 1IBLO 2D3OW 1X59A 2YIDA 2NN4A 4IT5A 1IBMB 3I56V 3T1HB 4CH3A 2X6AA 4GUNA 1AP6A 1DF4A 3VQYA 4DR3B 2WLIB 3K9SA 3LNNA 2UXCB 1DGSA 2FYUH 1RM1C 3JATA 5FNVA 1TUEB 1E1QG 1WAZA 4FJCC 2DYRC 2P06A 4IHJB 3H1IH 3S3XA 2XASA 3JAWB 3OMNB 1SA0B 3CS5A 2F93B 1SQGA 2UXBO 4F6EA 4LF9O 3IAYA 2MW2B 3ETEA 3JARB 4CH4A 3BABA 4L8JA 4XDJA 1QR9A 2N05A 2E75B 1EZJA 4CC5A 3OEEG 4U7NA 4X64B 4PELA 5B3SC 1P7GA 4JZ2A 2JGDA 3DC6A 3JD4A 2QM4A 3E35A 5B66Z 4WFBV 1HNXO 3SPJA 1GN4A 1N36O 2BSKA 1ZL8B 4NXMO 2Y0PA 4DV0O 2QTOA 2LP7A 4GKJO 4O4LA 5B1AC 5J2UA 2XAGA 3D3QA 2XAQA 4QGPA 4K8ZA 3APQA 4J42A 4E4EA 2NLJC
chains in the Genus database with same CATH topology
4BIUA 2R9RB 1VQ8V 1S72V 3ZRWA 4N21A 2HG5C 3SYCA 5CN0A 5B1BB 4MTGA 5EC2C 1YJ9V 1Q7YW 1FXVA 5L3GA 3LDCA 1K97A 1YSCA 2QM7A 4PA9A 5CBGA 3JYCA 3JD2A 4YXWG 1FS0G 1PNMA 2X7RB 3CCRV 4U7OA 1XL6A 2AHYA 1GKFA 1QBZA 1I5XA 3ABTA 4MVQA 2Y69B 2Z3YA 3B8MA 2B5UA 4UV8A 1Q81W 5IYDO 1XL4A 2OCCB 4MSWC 5EBMC 2WLNA 2JEXA 1E79G 4MT8A 1F4NA 2AHZA 5LHIA 1GMGA 2IW5A 2P7TC 4MS2A 4QPJA 1QLEB 3AG1B 2M7WA 3FB6C 1GM8A 4UUJC 4GCZA 4P30A 3W7WA 3AG3B 3K04A 3T1CA 3ABLB 3CCMV 1I5YA 1MSWD 4I5SA 3CYOA 1EBOA 3ZRSA 2DQ0A 3AG2C 3CCLV 1R3IC 1ZWIC 1VQ4V 2JJ1G 1Y4MA 2H94A 3EFFK 1PL0A 3OUSA 3A0RA 1FXHA 4R6ZA 3E8FA 2R9IA 3FKSG 3W7TA 3K06A 1YIJV 1VQ5V 1PD3A 2NNUA 1DLBA 4FPPA 1RPRA 1SZTA 2HVKC 1KP2A 3K79A 1NJIW 2P90A 3ABKC 2HVJC 4G28B 1W0JG 4RAIA 3LNMB 3T4DA 2HFEC 1CP9A 1OCZC 3JD3A 3HPLC 1KQSU 1OCRC 2ZD9A 4JASA 2Z5UA 3OMAB 2EZPA 1K9MW 3SYPA 1OCOB 2WLLB 3MHHC 3ZMZA 1R3JC 2ATKC 3GWOA 4KFMA 4MVSA 4XDKA 1UJWB 1PNKA 2A9HA 4PDMA 5BZBA 2W6JG 3UM7A 5IYBO 3ZMTA 1VQLV 1DF5A 4H37A 3CCUV 2WLKA 2IU0A 3T4ZA 5EBLC 3D3IA 1K73W 2EJRA 1R3KC 3WG7B 1GM7A 2JK5C 2UXNA 1QR8A 1NH2D 5IY5B 2WLHA 4PA7A 4L87A 4HYOA 1H38A 1NR7A 3QO8A 1V54B 2XAJA 3SYAA 4P9PA 3VBBA 4FIPC 2BOCC 5B1BC 2EIKC 1Q82W 2IJHA 1S5HC 3F7YC 1L1FA 2DQ3A 3FYEB 4JTAB 3QNEA 4WFHA 3SPCA 1YI2V 1AJPA 1BMFG 4EKWA 3MHSC 4WFAV 3K03A 1K5SA 1YHQV 4RO2A 4JF3A 1JCHA 2Y69C 4JPRA 1QVFU 3E8BA 1VQNV 1ENVA 1G4YB 4QE9A 4WFFA 2OCCC 2X0LA 3G71V 3NXSA 2Q67A 3FYIB 2DYSB 1F51A 3F7VC 3GB7C 1RM1B 3OR7C 1AI6A 2DYRB 3LSQA 2WLIA 3RVYA 3WFVA 4JGSA 1QLEC 3QO5A 4UXNA 1S77D 1G8MA 1VQOV 1FXKA 2C2AA 1K3EA 3EHBB 5C93A 2HKOA 3CCJV 3AG3C 5L3DA 3ABLC 4LBEC 1BL8A 2A79B 4MVZA 3M99B 1H2GA 1EFRG 3HB3B 3I55V 1P7BA 3CMEV 4GX0A 4E2LA 3ZRXA 4ZBMA 2QM8A 1R6NA 2IH1C 2HJFC 4R8CA 2A0LA 1YTFB 4J9ZB 1SETA 3BY6A 1THZA 3LDDA 5B1NA 3IC7A 2H8PC 3SPHA 5B3SB 5IYCO 1W0KG 3FB7C 4GX1A 5B1OA 4UVCA 2P6JA 1KC8W 3JD1A 3E83A 3BEHA 1H8HG 2GHYA 1FXKC 1GK9A 2ZR3A 3K0DA 1OCCB 3G6EV 1H8EG 3P32A 4TSFG 3SPIA 2XOKG 1NQTA 3ZN1A 2HR3A 3ASNB 3ML0A 1OCOC 4KUMA 4MW8A 5L3CA 5L3EA 1AI5A 4BW5A 4CBCA 5LHGA 1M1KW 4MVOA 2QA4V 4BIZA 1GTOA 1OHHG 3CCEV 2LFRA 1KECA 3AG4B 5KA5A 1GM9A 2PI4A 1K4DC 2Q68A 5IDJA 2IH3C 3ASOB 3B8NA 3W7SA 3ZMVA 4OXSA 4PDVA 1AJQA 2YEVB 3WG7C 1S0VA 4TWKA 2OT5A 3OR6C 5IY5C 1M56B 2W6IG 3CC7V 1NR1A 4P9OA 2X6BA 4H33A 1P4RA 4R50A 1JJ2U 3G4SV 3STLC 2XAHA 3D36A 4N23A 3SYQA 1MOFA 3K08A 3T2MA 1F23A 5KA6A 1NH2B 1VQ9V 1VQ6V 1AJNA 5GW7A 3IGAC 4X89A 4MVUA 4JAVA 2ZXWB 4XDLA 4MW3A 2Q6AA 1LNQA 5LHHA 3ETGA 3OAAG 3SPGA 5CA3A 1R6KA 4QJFB 1AI4A 3ZRWB 1K7DA 2DYSC 3E89A 3JD0A 3W7XA 1K92A 4UVBA 1M90W 1V55B 2B1GA 1VQKV 3B77A 1WLEA 3RW0A 1COWG 2EIJB 2EILB 2XAFA 1YJWV 4ZKIA 1BHBA 1R3LC 1GO3F 4WCEV 3SJQC 4RUFA 3H01A 4R7CA 3OEHG 5J9PC 1J95A 2IJIA 3E8GA 3P30A 4G2KA 3RVZA 2X6CA 2EIMB 2F43G 1AI7A 2XNDG 4JYBA 4QE7A 3TK1A 3CMAV 2WPDG 3JCZA 1S3JA 5CMUA 4MTOA 1Q86W 3OMIB 3CCSV 4P2ZA 4RQFA 2WWWA 3CCQV 3ABKB 2EZOA 4WF9V 1BHAA 2EINB 3E8HA 3FB5C 4I9WA 1OCZB 1YITV 2DW4A 4LP8A 1PNLA 3FB8C 4Z1MG 5H9CA 1YJNV 3ZRVA 5LGUA 3LDEA 2QKSA 3AG1C 1FFTB 1OCCC 1QCEA 4MTFA 5KUMA 4JTDB 1SERA 2ZR2A 5EBWC 2YSUB 3ASNC 4MVMA 4DO2A 4RUEA 1CEZA 4G27B 1Y66A 2OTLV 3VOUA 2WLLA 4F4LA 3KG2A 2LFSA 3E86A 3MD0A 2WSSG 1IXMA 3AG4C 4J9YB 3ZMUA 4WFGA 1QLNA 1M57B 1JQ0A 3E2EA 4JTCB 5FL7G 3ASOC 3SYOA 4X88A 1JPXA 1E1RG 3ETDA 1JOYA 5KUKA 1W2BU 2WAMA 1VQ7V 2EIKB 4PA6A 1WPXA 4GX2A 2V7QG 4QNHB 3QO7A 1AROP 1M56C 4MTXA 3IFXA 3STZC 1S76D 2KB1A 4HZ3A 3ZMSA 3W7UA 4GX5A 2WLMA 1K34A 2UXXA 2WLJA 3OFNG 1N8RW 3ZN0A 1VQMV 5EC1C 3X2QB 1NVPD 4Q20A 2ITCC 1KP3A 5L3BA 2IJKA 4WFEA 3K3WA 1K4CC 4KP4A 3CD6V 2JEUA 4PA4A 2B1IA 2MK3A 1JX9A 2JIZG 2ZXWC 2ZDIC 5B1AB 3K0GA 1DTOA 3CP1A 4GT1A 3TETA 3RBZA 3ABMB 2JJ2G 2IJJA 1KKDA 2GSMB 5CBHA 1YTFD 1V55C 1CPYA 2JDIG 3PJSK 3OW2U 2EBOA 2EIJC 2EILC 2IU3A 4PDLA 4QPKA 2D3OW 2P67A 1B6QA 1V54C 4QIWF 5LGTA 2W0FC 5E1AC 3I56V 3TCUA 2ZQMA 2QEXV 4LC1A 2QE7G 2X6AA 4TT3G 1ORQC 2DWDC 3LUTB 2EIMC 3OUFA 4XBFA 1KD1W 1PKXA 1DF4A 4JYCA 3AEIA 2WLIB 2V1DA 3ZCCA 2Y48A 3K9AA 3ABUA 2EINC 3ZJZA 5CBFA 1FXKB 2FTKA 3OM3B 1SRYA 1RM1C 1TUEB 4FK5C 1ROPA 4ASUG 1E1QG 2DYRC 4FJCC 3OE7G 1MABG 4RQEA 2Q69A 2DWEC 3DTUB 2XASA 3AG2B 5DM6V 3OMNB 3CC4V 1SESA 4JAUA 3UKMA 4UVAA 4LCUC 5EK0A 3ETEA 4BAYA 1HWYA 4XDJA 1QR9A 3OGCC 3CXCU 4HAMA 2CK3G 2PI5A 1EZJA 4PDRA 1M57C 4FMTA 3F5WC 3CCVV 3OEEG 4MVRA 3ZIAG 5L3FA 4U7NA 4PELA 5B3SC 4CZZA 4DXWA 3CPWU 1VQPV 2K1EA 5H6RA 1OCRB 1R73A 3CC2V 1RPOA 2YEVA 2ITDC 3JD4A 4PA3A 1AR1B 3E35A 5LBQA 5HFLA 4WFBV 5HFMA 3DGEA 2HLDG 5DN6G 1NKDA 1OZ0A 3SPJA 3X2QC 1JVMA 1K33A 4X8AA 1NBMG 5H6QA 2BOBC 2QTOA 2LP7A 3R65A 1MG1A 5B1AC 1QVGU 2XAGA 4UV9A 1K5QA 2XAQA 5LGNA 2ZDIA 1F4MA 3LSSA 2OTJV 3ABMC 1K8AW 1NVPB 1M9NA 2NLJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 V;  1W2B U;  1VQO V;  1VQ7 V;  1S72 V;  1YI2 V;  1YJ9 V;  1YIJ V;  1KC8 W;  1KD1 W;  4WFB V;  1VQL V;  1Q7Y W;  3CCJ V;  1VQ5 V;  1VQ9 V;  4WFA V;  3CMA V;  3G6E V;  3OW2 U;  3CCU V;  2OTL V;  3CXC U;  1NJI W;  1YHQ V;  3CCR V;  3CCM V;  1K73 W;  3I55 V;  2D3O W;  1Q86 W;  1N8R W;  3CCS V;  1QVF U;  3CCV V;  3CME V;  1VQN V;  3CC7 V;  1M90 W;  3CCQ V;  1VQM V;  1VQK V;  1KQS U;  3CCL V;  3G71 V;  1VQ6 V;  4WF9 V;  3I56 V;  1YJW V;  1M1K W;  2QA4 V;  1QVG U;  1K9M W;  1VQ4 V;  1JJ2 U;  4WCE V;  3G4S V;  2QEX V;  1Q81 W;  1YIT V;  3CPW U;  3CCE V;  1Q82 W;  1VQP V;  3CD6 V;  2OTJ V;  3CC2 V;  1R73 A;  5DM6 V;  1YJN V;  3CC4 V;  1K8A W; 
#chains in the Genus database with same CATH topology
 4BIU A;  3ZRW A;  3JCU Z;  1YJ9 V;  5CN0 A;  5B1B B;  4MTG A;  2HJD A;  4YJ3 A;  1XI1 A;  3LDC A;  3CRC A;  3H1K H;  1H2S B;  4UFZ A;  3JD2 A;  1PNM A;  4IGG A;  2AHY A;  3Q4H A;  3ABT A;  2RDC A;  3B8M A;  1I94 O;  3JAS B;  1L0N H;  2JEX A;  1E79 G;  2KG7 B;  4MT8 A;  2IW5 A;  2P7T C;  4QPJ A;  3RN4 A;  3UT5 B;  1XNQ B;  5AG2 A;  4GCZ A;  4P30 A;  4JI4 B;  2JGU A;  4F6R B;  2GBO A;  4YY3 B;  4I5S A;  4B3T O;  3CCL V;  4AI8 A;  5JJJ B;  1M4U A;  3A0R A;  1FXH A;  4DUZ O;  1I08 A;  2QWQ B;  1NS1 A;  3T1Y O;  1I0H A;  4TUY A;  2EUL A;  1KP2 A;  2QJ1 A;  2P90 A;  3ABK C;  4RAI A;  2QKA A;  3LNM B;  1CP9 A;  3M8A A;  1D5A A;  4JI5 B;  2EZP A;  4FVM A;  4TOI A;  4YIO A;  3A0H Z;  4PJ0 Z;  2GDS A;  5C8Y B;  4KFM A;  4LH7 A;  3CSX A;  4PDM A;  1DF5 A;  1KUQ A;  4H37 A;  2VQF O;  3CCU V;  2O57 A;  2IU0 A;  2PGG A;  3A2F A;  3T4Z A;  5GON B;  3K5O A;  1R3K C;  1NH2 D;  1M5I A;  1NR7 A;  2XAJ A;  4JV5 B;  3VBB A;  4X9Q A;  2IJH A;  3OT7 A;  3OGI B;  2DQ3 A;  4JTA B;  2DJV A;  4I9Q A;  3QNE A;  4WFH A;  1YI2 V;  3M7M X;  3AK2 A;  3K03 A;  1K5S A;  3HKE B;  4RO2 A;  2FML A;  1QVF U;  4WFF A;  5D5Q A;  2X0L A;  3G80 A;  3FYI B;  2DYS B;  3F7V C;  4JAA A;  1NI8 A;  3LSQ A;  4O4H A;  4JGS A;  3QO5 A;  3RYF A;  1S77 D;  1Y74 B;  1FXK A;  3AG3 C;  5CA1 A;  2V4D A;  4WBN B;  3HB3 B;  5FLX N;  4O2A B;  1NTK H;  2IH1 C;  4LWS A;  2A0L A;  4I0X A;  1YTF B;  5BMV A;  5B1N A;  3DXR A;  2H8P C;  3SPH A;  3ZED A;  1VAR A;  4UVC A;  2P6J A;  2RMK B;  5IJ9 A;  1HNW O;  1FXK C;  1GK9 A;  3CB2 A;  3A8T A;  1QU7 A;  5B5E Z;  3ASN B;  3ML0 A;  4KUM A;  4MW8 A;  2YDE A;  1AI5 A;  4BW5 A;  4CBC A;  2FKX A;  2KSD A;  2LQT A;  4X1K B;  1GTO A;  3CCE V;  1N36 B;  2F4V B;  1IDS A;  5IDJ A;  1KBH A;  4B7K A;  4DR5 O;  2YXL A;  3B8N A;  4YHH B;  4LF6 O;  2YEV B;  1B04 A;  4DV5 O;  3ZHT A;  3KCY A;  2W6I G;  1XHZ A;  2VQE O;  2QTS A;  2X6B A;  4H33 A;  1FD9 A;  5LMN O;  4R50 A;  4FM0 A;  4CS4 A;  2XT9 A;  2XAH A;  2ZE7 A;  1N33 O;  1NZ6 A;  5H5N A;  1F23 A;  5KA6 A;  5IWA O;  1WN7 A;  1V9P A;  3IGA C;  5JJE B;  1I94 B;  4MVU A;  4MW3 A;  4X65 O;  3ETG A;  3SPG A;  1Y67 A;  2ZKO A;  1R6K A;  4OX9 O;  4DUY O;  1K7D A;  5LOV A;  1PV0 A;  2IBZ H;  1AVM A;  3BA9 A;  3B77 A;  2EIJ B;  2JVD A;  4I55 A;  1LUV A;  1X4T A;  3OEH G;  4DV7 B;  1O9H A;  4CS2 A;  3E8G A;  5EZY B;  3RVZ A;  3TK1 A;  2EIM B;  3W7X A;  1AI7 A;  4UCT A;  4GLX A;  4H13 B;  2WPD G;  4DUZ B;  4NKG B;  4P2Z A;  2WWW A;  3UCS C;  2EZO A;  3CJH A;  4LF7 O;  4GKK O;  1OCZ B;  4BW9 A;  4LP8 A;  4FLT A;  2F95 B;  1YJN V;  5KHG A;  4X66 O;  2P4K A;  4W4K A;  3U11 A;  3ZRV A;  3AG1 C;  1FFT B;  1OCC C;  5KUM A;  1SQX H;  1RP3 B;  2ZR2 A;  2YSU B;  4RUE A;  1CEZ A;  1Y66 A;  1IBM O;  2OTL V;  2NR5 A;  3T1H O;  2WLL A;  1GRJ A;  4J9Y B;  2QWO B;  2VQF B;  1TUB A;  2YIA A;  3E2E A;  4JTC B;  5FL7 G;  3JSN A;  1E1R G;  3ETD A;  1W2B U;  2ZM6 B;  1N34 B;  1WPX A;  2UXC O;  3BA8 A;  2V7Q G;  4UCR A;  1SQF A;  1Y6X A;  2CH7 A;  2KB1 A;  2L35 A;  1Y76 A;  1K4C C;  1Q6I A;  2JEU A;  4JI2 B;  2ZDI C;  5LYJ B;  1T5E A;  1DTO A;  4LFC O;  3J7A U;  2Q7E A;  1TA8 A;  1KKD A;  1MMM A;  1SQQ H;  1YTF D;  5J2T A;  1CPY A;  4X1Y A;  2WA3 A;  4PDL A;  4QPK A;  5JWP A;  2P67 A;  4ZOL A;  1B6Q A;  1V54 C;  4IL6 Z;  1FYJ A;  2PTM A;  4U3F H;  2W0F C;  2ZQM A;  1AR5 A;  3ZS8 C;  2QE7 G;  4EB6 B;  5KMG B;  3SGI A;  5GTI Z;  4XBF A;  1KD1 W;  3LSU A;  3AEI A;  3RGB A;  5K1P A;  2V1D A;  3ZCC A;  2Y48 A;  3K9A A;  2VRZ A;  3ABU A;  2EIN C;  3UO3 A;  5CBF A;  2RN9 A;  3OM3 B;  3FFQ A;  1SRY A;  4TV9 B;  1YCI A;  2YXY A;  5FPR A;  1MAB G;  1EN6 A;  2DWE C;  2BTQ A;  2N04 A;  3AG2 B;  4K3A A;  3UKM A;  4DRX B;  3C3S A;  1H2M A;  4ZI7 B;  1HWY A;  1M93 A;  3CXC U;  4YJ2 B;  2CK3 G;  2PI5 A;  1XMQ B;  1M57 C;  4FMT A;  4MVR A;  2CTR A;  2KQX A;  1HDJ A;  2FB5 A;  4J7Z A;  4DV1 B;  1YZB A;  3N2G A;  5TIS Z;  1SC5 B;  5H6R A;  1VQP V;  1OCR B;  1R73 A;  5JCO A;  3TGU H;  3CC2 V;  1XNQ O;  5A9G A;  1O9G A;  5KHK A;  1AR1 B;  5LBQ A;  3F5T A;  1YF2 A;  4YY3 O;  1EN4 A;  1NKD A;  1RSO B;  2CTW A;  2JRI A;  4NB5 A;  2N74 A;  1NBM G;  2CDY A;  1D5N A;  2GV9 A;  5H6Q A;  2XUM A;  2BOB C;  2Q4P A;  5LA6 A;  4X65 B;  3R65 A;  5JVD B;  4DUY B;  1S5L Z;  3LSS A;  3OTO B;  1K8A W;  3CRR A;  1VQ8 V;  3RYI B;  2CTQ A;  2HG5 C;  4N21 A;  5JCO C;  1Q7Y W;  1YSC A;  2QM7 A;  4IIJ A;  2E5L O;  3AK3 A;  1FS0 G;  4JI5 O;  2RJZ A;  4TQD A;  3WU2 Z;  4LFB B;  1I5X A;  1EM1 A;  4MVQ A;  2Z3Y A;  4LF4 B;  4UV8 A;  5KLV H;  3KCX A;  4IYI A;  5EBM C;  5KHI A;  1XHX A;  1F4N A;  1GMG A;  4X62 O;  3UO2 A;  3FB6 C;  1GM8 A;  5A2Q N;  3W7W A;  4O4J A;  4DR6 B;  3T1C A;  3ABL B;  2UUC O;  1MSW D;  1UFI A;  3CYO A;  3ZRS A;  1NT2 B;  4LH6 A;  1KMI Z;  3I5D A;  1OV9 A;  1Y4M A;  3EFF K;  3OUS A;  4ZIB A;  4R6Z A;  4BWA A;  3HKC B;  4O2B A;  3SR2 C;  1MZE A;  3W7T A;  1AIL A;  1SZT A;  4X20 B;  4I4T B;  3THO A;  2HVJ C;  1W0J G;  3TJT A;  4PD4 F;  3OMA B;  4D7S A;  5BR8 O;  4BIO A;  5D5P A;  3GWO A;  1BSM A;  4ZHQ A;  3RYC B;  1Q3E A;  3H1J H;  4EFE A;  4XDK A;  1UJW B;  1PNK A;  2A9H A;  5BZB A;  3GWK C;  2GUZ B;  5GTH Z;  1WP7 A;  3L75 H;  4AQY O;  4LFC B;  1JMK C;  3WG7 B;  3JAL A;  2CGO A;  2F66 C;  1QR8 A;  3HKB B;  2WLH A;  4PA7 A;  4HYO A;  1P49 A;  1MZF A;  5IYZ A;  1N32 O;  3H1H H;  3SYA A;  2R9A A;  5B1B C;  1FFX B;  2GTA A;  1OJH A;  1WP8 A;  1AJP A;  3FAV A;  4A5U B;  1N4C A;  3HR0 A;  5LL6 Y;  2XTA A;  3B4S A;  2F4V O;  1ENV A;  4I50 A;  3G71 V;  4KXR A;  3NXS A;  2DE0 X;  5LP6 B;  1RM1 B;  4YHH O;  1YXB A;  2DYR B;  4PHZ A;  2M6Y A;  3H1L H;  5ITZ A;  1VQO V;  1Z5V A;  5C93 A;  2HKO A;  3SJC C;  1DK1 A;  1AB3 A;  2LW7 A;  2A79 B;  1XDC A;  2YI9 A;  4FLZ A;  1QQC A;  2Q8V A;  1P7B A;  2E3C A;  4D7T A;  1F7Y A;  3CME V;  4E2L A;  3ZRX A;  4J9Z B;  1SET A;  1TGO A;  3IC7 A;  5B3S B;  5K1X A;  4DR4 O;  1W0K G;  3FB7 C;  3JAT B;  4GX1 A;  5FNV B;  1KC8 W;  3JD1 A;  3E83 A;  2GHY A;  3K0D A;  3G6E V;  2QKC A;  1ZTE A;  4JI6 B;  1HP8 A;  2LGQ A;  4UCV A;  5L3E A;  2P4V A;  4MVO A;  2QA4 V;  4BIZ A;  4DV7 O;  2CTP A;  1FJG B;  5KX5 A;  2IH3 C;  2JGD B;  3ASO B;  3RWR D;  1WB7 A;  4I7Z B;  4JZG A;  3W7S A;  2ZE8 A;  4NTY A;  3ZMV A;  4CH5 A;  2ZIM A;  4TWK A;  3RYH A;  1M56 B;  4X1I A;  1VF5 B;  1NR1 A;  2E5L B;  5FPO A;  5EYP A;  3STL C;  2BSK B;  1AP5 A;  4N23 A;  3K59 A;  1TAE A;  4J10 A;  4O4L B;  5J2U B;  4X89 A;  2K9P A;  2QWP B;  4JAV A;  2ZXW B;  2OCH A;  1LNQ A;  4PV1 B;  5CA3 A;  4QJF B;  1AI4 A;  3ZRW B;  2DYS C;  4YJ3 B;  1K92 A;  4X62 B;  1V55 B;  2B1G A;  3BFR A;  1COW G;  2EIL B;  2XAF A;  1YJW V;  4OPA A;  4ZKI A;  2ZM6 O;  1N34 O;  4JI8 O;  2UUC B;  3Q4H B;  5J9P C;  4RWU A;  2YS8 A;  4J41 A;  2IJI A;  3D8C A;  4NR1 A;  4G2K A;  4JYB A;  2F43 G;  3CMA V;  3JCZ A;  1S3J A;  1Q86 W;  3OMI B;  2VS0 A;  3ABK B;  4JI2 O;  1BHA A;  3OD4 A;  3FB5 C;  4I9W A;  5KAF Z;  4JI3 B;  3MAQ A;  4MTF A;  2F23 A;  4JTD B;  5BR8 B;  5EBW C;  3HKD A;  4U3J A;  3ASN C;  2OYQ A;  4F4L A;  3MD0 A;  3BHP A;  2WSS G;  1IXM A;  4TUY B;  1FKA O;  3ZMU A;  2B9Z A;  5E79 Z;  1QLN A;  4AQY B;  3MDS A;  1JPX A;  4LF5 B;  5KUK A;  2QDO A;  2E74 B;  3S3W A;  1N32 B;  4QNH B;  1WA8 A;  5F2V O;  3IFX A;  3K57 A;  1SZX A;  3J81 N;  3STZ C;  3ZMS A;  3W7U A;  4GX5 A;  2WLM A;  4UB8 Z;  3X2Q B;  4Q20 A;  1WPB A;  2IJK A;  3PN1 A;  2MK3 A;  1G6U A;  1ZLZ A;  3K0G A;  1IX9 A;  3CP1 A;  3TET A;  3ABM B;  1XMQ O;  2IJJ A;  2GSM B;  2JDI G;  3OW2 U;  2EIJ C;  4DV1 O;  1XEQ A;  4QIW F;  2HEP A;  4DYL A;  5LGT A;  2LW1 A;  5E1A C;  1U97 A;  2BTO A;  1VP7 A;  2QEX V;  2PF4 E;  4LNU A;  2YUA A;  4LC1 A;  4TT3 G;  1ORQ C;  2DWD C;  3LUT B;  2EIM C;  3OUF A;  2Q9L A;  1VMG A;  4DV6 B;  1B3Q A;  1PKX A;  1PPJ H;  3ZHR A;  1KB9 F;  4O4H B;  4DR4 B;  3RYF B;  4W4L A;  1U96 A;  2Y4U A;  3ZJZ A;  1FXK B;  4DW1 A;  2FTK A;  3OTO O;  2RNB A;  1VF6 C;  3KKY A;  5CA1 B;  3EXA A;  2Q69 A;  3R66 A;  4DK0 A;  3DTU B;  5DM6 V;  5JQG A;  3ZHV A;  4JAU A;  2BE3 A;  1HNZ O;  4LWS B;  4LCU C;  4I0X B;  5EK0 A;  3CRM A;  5BMV B;  3G6B A;  3DXR B;  4LFB O;  1I7F A;  2QWN B;  3OGC C;  4JI1 O;  4LF4 O;  3F5W C;  3CCV V;  5IJ9 B;  3ZIA G;  5L3F A;  5LXT A;  3E22 A;  4CZZ A;  3CPW U;  4B08 A;  2EJ7 A;  2K1E A;  1RPO A;  5IJ0 A;  3N2K A;  4PA3 A;  4DR6 O;  2HLD G;  2AZ0 A;  3CRA A;  5DN6 G;  1K33 A;  5KHH A;  3JAK A;  2XHB A;  4X8A A;  2BCC H;  3B40 A;  4DR2 O;  4DK1 A;  1TVK A;  1K5Q A;  1XOU A;  5LGN A;  2ZDI A;  2OTJ V;  2G38 A;  3NR7 A;  1NVP B;  1M9N A;  1NTM H;  5CB4 A;  2R9R B;  2ADP A;  1S72 V;  4JI8 B;  3SYC A;  1FXV A;  1H2N A;  2X7R B;  3CCR V;  2LGW A;  1LR1 A;  4FZ0 A;  2Q5Z A;  1QBZ A;  2Y69 B;  1JJO A;  2B5U A;  2YIB D;  1Q81 W;  1XNR B;  5LOV B;  2OCC B;  4MSW C;  1NU1 H;  2PYJ A;  2A7W A;  2AHZ A;  5LHI A;  4I55 B;  5JH7 A;  1QLE B;  3AG1 B;  2M7W A;  5DED A;  2VWJ A;  2W0X A;  4DR1 B;  3K04 A;  2DQ0 A;  3AG2 C;  1R3I C;  2JJ1 G;  1PL0 A;  1RFY A;  1QNM A;  3E8F A;  3FKS G;  4NTW A;  3CJH B;  1KYO F;  2P5O A;  1VQ5 V;  2JS3 A;  1DLB A;  4FPP A;  1RPR A;  3G67 A;  1FAF A;  2UUB O;  3DSQ A;  2HVK C;  3K79 A;  4NTX A;  2EX3 A;  3HPL C;  1OCR C;  2ZD9 A;  4CC6 A;  2Z5U A;  1JFF A;  1K9M W;  1OCO B;  2WLL B;  1IVS A;  3TXQ A;  1GH6 A;  2AW9 A;  1TUB B;  2W6J G;  4FFB A;  4HNA A;  3UM7 A;  3ZMT A;  2UU9 O;  3L70 H;  2WLK A;  4AHC A;  3D3I A;  1K73 W;  2EJR A;  3CXH F;  4EFB A;  2JK5 C;  5CA0 A;  5IY5 B;  2CH7 B;  3QO8 A;  1V54 B;  1Q82 W;  4FIP C;  2BOC C;  2EIK C;  4TV8 A;  1S5H C;  1Y76 B;  3L71 H;  4JI6 O;  1XQ8 A;  4EKW A;  3MHS C;  4WFA V;  4B3R B;  1IBK B;  1Q43 A;  2OIG A;  4JF3 A;  1JCH A;  4JPR A;  1GAX A;  1ZX3 A;  1VQN V;  2LJ2 A;  1G4Y B;  4QE9 A;  2QWR B;  1FJG O;  2ILM A;  5J2T B;  4X1Y B;  1F51 A;  4JYA B;  4FLY A;  4ZOL B;  2F1M A;  1AI6 A;  2WLI A;  4YIP A;  4DW0 A;  4JYY A;  4UXN A;  3ZBH A;  2UUA B;  2YI8 A;  1G8M A;  3ZX6 A;  2HHH B;  3EHB B;  2C2A A;  1K3E A;  2OIE A;  3CCJ V;  5L3D A;  3ABL C;  2ZNJ A;  1YVW A;  2PY5 A;  4D6T H;  3P3N A;  4IHJ A;  1HNZ B;  2YXH A;  1EFR G;  2Q7G A;  3JAW A;  1SA0 A;  4GX0 A;  1R6N A;  4JI1 B;  1PM9 A;  3JAR A;  3BY6 A;  3LDD A;  1G1X B;  1D2D A;  2ZNI A;  4FM1 A;  3BEH A;  1H8H G;  3ICX A;  2BTQ B;  3J80 N;  1H8E G;  3P32 A;  4NVP A;  4TSF G;  3ZN1 A;  2HR3 A;  5LHG A;  1J5E B;  3APO A;  3B09 A;  4J7K A;  2LFR A;  2A3Q A;  3AG4 B;  4K0K O;  5KA5 A;  1GM9 A;  2PI4 A;  3DC5 A;  3H9V A;  4DR2 B;  1K4D C;  1SQP H;  5CA0 B;  4TQF A;  1ZL8 A;  1XRE A;  4OPH A;  2ZIO A;  3N2G B;  3KZI Z;  4OXS A;  1AJQ A;  3WG7 C;  1S0V A;  2OT5 A;  3BRC A;  4CH6 A;  4JI3 O;  1H2L A;  4P9O A;  1URF A;  1P4R A;  4ABM A;  1Q6U A;  3G4S V;  4PI0 A;  3T2M A;  3K08 A;  5LA6 B;  1NH2 B;  1VQ6 V;  4XDL A;  3L74 H;  2Q6A A;  5LHH A;  3OAA G;  3JAS A;  3QG5 A;  1P84 F;  3E89 A;  2E76 B;  3JD0 A;  1IUR A;  3GVM A;  5LP6 C;  3RFR A;  4IIJ B;  4ICG A;  4LF5 O;  3RW0 A;  1FPO A;  2KG7 A;  4B3M O;  1BHB A;  1R3L C;  4WCE V;  3SJQ C;  1BT8 A;  1BS3 A;  3UT5 A;  3BCC H;  1MSD A;  4FM2 A;  4F6R A;  1XBL A;  2WA4 A;  1J95 A;  2IM9 A;  3P30 A;  4QE7 A;  3UQ8 A;  4RQF A;  3CCQ V;  2UUB B;  3C3T A;  3E8H A;  4O4J B;  4DR7 O;  2DW4 A;  2Q7H A;  1PNL A;  1NTZ H;  5H9C A;  1ZUQ A;  3LDE A;  2ZT9 B;  2Q73 A;  5LGU A;  3BAA A;  4MVM A;  4G27 B;  4O2B B;  3VOU A;  3VQW A;  5C8Y A;  2LFS A;  5LMU B;  2UU9 B;  4DV6 O;  3K5M A;  3ASO C;  4X88 A;  3FD9 A;  2CE4 A;  1JOY A;  1W59 A;  1VQ7 V;  2YIC A;  2DN9 A;  4PA6 A;  4GX2 A;  5GON A;  1HR0 O;  3QO7 A;  1M56 C;  4UCS A;  4MTX A;  1B06 A;  1XIL A;  3L72 H;  4ZHQ B;  1S76 D;  4HZ3 A;  1N8R W;  1K34 A;  2UXX A;  2WLJ A;  3OFN G;  4K8X A;  2A06 H;  3ZN0 A;  1VQM V;  4J80 A;  1JA8 A;  2ITC C;  4KP4 A;  1GN2 A;  3CD6 V;  4PA4 A;  2B1I A;  4KHP B;  1JX9 A;  2JIZ G;  2ZXW C;  3HKE A;  5B1A B;  3JAL B;  1BQ0 A;  4GT1 A;  5IYZ B;  2QGN A;  4H0L B;  5CBH A;  2RQ6 A;  1V55 C;  4LFA B;  2EIL C;  3SDL A;  5EIB D;  1BE3 H;  1Q8I A;  1Y74 A;  4UCU A;  3TCU A;  3WB0 A;  2YIB A;  3FAV B;  4JI0 B;  1Z5W A;  1R6T A;  4I50 B;  4WBN A;  2L6L A;  4JYC A;  1CXZ B;  1QHT A;  4O2A A;  2CUG A;  5ITZ B;  3VQX A;  2ODM A;  4B3S B;  4FK5 C;  1ROP A;  1EN5 A;  1YDX A;  4ASU G;  4FZ1 A;  4GYC B;  1Q6H A;  3OE7 G;  4RQE A;  1IXB A;  3QVN A;  3CC4 V;  1SES A;  4DV4 B;  4UVA A;  2UXD B;  1UPG A;  4H44 B;  2DMX A;  1GN3 A;  4DV2 B;  4BAY A;  5KHJ A;  4EEQ A;  4K0K B;  1R1B A;  3CE2 A;  4HAM A;  4LF8 B;  4X1K A;  2FL4 A;  4FLV A;  4PDR A;  3P3P A;  3CEI A;  1XNR O;  3OTF A;  4DV3 B;  4DXW A;  1IBL B;  2D2C B;  4BR6 A;  4JI7 O;  2YC0 A;  3FX7 A;  2YEV A;  2ITD C;  1GN6 A;  3O9O A;  4DR1 O;  2PUS A;  5HFL A;  5HFM A;  3DGE A;  2AXT Z;  1OZ0 A;  3X2Q C;  1JVM A;  5KX5 B;  4FLU A;  4NXN O;  2VWK A;  2KKW A;  3L73 H;  1MG1 A;  1QVG U;  3RYH B;  4UV9 A;  4OGQ B;  1F4M A;  4X1I B;  1BQZ A;  3ABM C;  3TXS A;  4CS3 A;  3M99 B;  1L0L H;  3N27 A;  1XUQ A;  4B3M B;  5EC2 C;  4PI2 A;  5L3G A;  3K5N A;  1K97 A;  5EYP B;  4PA9 A;  5CBG A;  3JYC A;  4YXW G;  3WB2 A;  2UXB B;  3O65 A;  4LF9 B;  4U7O A;  1XL6 A;  1VIB A;  1GKF A;  5BY1 A;  5IYD O;  5EZY A;  1XL4 A;  2LO1 A;  5H2F Z;  2WLN A;  1XMO O;  4DR7 B;  4MS2 A;  5IE9 A;  1IZ3 A;  2HP8 A;  4UUJ C;  3AG3 B;  3CCM V;  1I5Y A;  1VF6 A;  1HNX B;  3CWB H;  1EBO A;  1ZWI C;  3AG7 A;  4FLW A;  1VQ4 V;  1BGY H;  2H94 A;  4B3R O;  4NXM B;  2PZS A;  4DV0 B;  2R9I A;  4GKJ B;  1SQB H;  1IBK O;  3K06 A;  1YIJ V;  1PD3 A;  2NNU A;  3C90 A;  2ZE5 A;  1N0J A;  1NJI W;  4G28 B;  4JYA O;  3T4D A;  2HFE C;  1HR0 B;  1OCZ C;  4NYK A;  3HKD B;  3JD3 A;  4U3J B;  2OWO A;  1KQS U;  4JAS A;  2UUA O;  3ZHU A;  2HHH O;  3SYP A;  3MHH C;  1WB8 A;  3ZMZ A;  4B7E A;  1R3J C;  1LUW A;  2ATK C;  3BPZ A;  1MNG A;  4KL1 A;  4MVS A;  3ETQ A;  1VQL V;  5IYB O;  1SQV H;  1S5J A;  5EBL C;  1SS3 A;  4K35 A;  4J11 A;  1YEW A;  1WA8 B;  1GM7 A;  5LYJ A;  2UXN A;  4L87 A;  1H38 A;  1WNS A;  1SF9 A;  4P9P A;  1BZK A;  4UB6 Z;  4B3T B;  3F7Y C;  1L1F A;  3FYE B;  3SPC A;  1BMF G;  1Z2G A;  2ZE6 A;  2AGA A;  3JAM N;  1J5E O;  1YHQ V;  5IT9 N;  2Y69 C;  4EB6 A;  3E8B A;  3T1Y B;  1Q5O A;  2Z0A A;  5KMG A;  2OCC C;  2Q67 A;  3GB7 C;  3A0B Z;  3IJ4 A;  3OR7 C;  3RVY A;  3WFV A;  4AIL C;  1QLE C;  3L9D A;  4LNU B;  4LBE C;  4TV9 A;  1BL8 A;  4MVZ A;  1H2G A;  3I55 V;  4J7J A;  4ZBM A;  2QM8 A;  3EVK A;  4GZR B;  2HJF C;  3SJA C;  4R8C A;  1A32 A;  4DRX A;  3IC9 A;  1THZ A;  2ZIN A;  4DR3 O;  4ZI7 A;  5IYC O;  3VQV A;  4YJ2 A;  2DOS A;  5B1O A;  3SJB C;  3WB1 A;  4JI7 B;  2ZR3 A;  1OCC B;  2H3O A;  5JQG B;  3SPI A;  2XOK G;  2CGN A;  1NQT A;  3B2E E;  1OCO C;  5L3C A;  2CAZ C;  4Z1V A;  1M1K W;  4FLX A;  1JR9 A;  1OHH G;  1KEC A;  2Q0A A;  4NXN B;  3U10 A;  1RSO A;  5LXT B;  3E22 B;  2Q68 A;  1MA1 A;  3CRQ A;  2R72 A;  1VF7 A;  4PDV A;  4X64 O;  5IJ0 B;  3N2K B;  3RT3 C;  5JVD A;  3OR6 C;  5IY5 C;  4IYH A;  3CC7 V;  5DEC A;  3RYI A;  1ZSP A;  1Q90 D;  1JJ2 U;  3JAK B;  2Q0O C;  3D36 A;  3SYQ A;  2PYL A;  1MOF A;  1BCC H;  2ARH A;  1VQ9 V;  5GW7 A;  1AJN A;  1TVK B;  2Y4T A;  1ZAU A;  1PP9 H;  5LMU O;  2R70 A;  5CB4 B;  1HW7 A;  1XMO B;  1HNW B;  4UVB A;  1M90 W;  1VQK V;  2AZ2 A;  1WLE A;  2ADQ B;  3JSL A;  1GO3 F;  4O4I A;  5BXZ A;  3K5L A;  4RUF A;  3H01 A;  4R7C A;  5KAI Z;  3D36 C;  2X6C A;  2XND G;  1SKV A;  1PL4 A;  4Q6G A;  5CMU A;  4MTO A;  4DR5 B;  3CCS V;  4LF6 B;  3ZHS A;  3HKC A;  5JH7 B;  3AK1 A;  3CHX A;  4KHP O;  5EIB C;  4WF9 V;  2EIN B;  3QF7 A;  4DV5 B;  2QR4 A;  1YIT V;  3FB8 C;  4Z1M G;  4X20 A;  4I4T A;  2VQE B;  2QKS A;  5LMN B;  4JI4 O;  1QCE A;  4LFA O;  1SER A;  4DO2 A;  1N33 B;  1N0N A;  2JS5 A;  5IWA B;  5JJN B;  4JI0 O;  3KG2 A;  3E86 A;  1WJZ A;  3AG4 C;  3RYC A;  4WFG A;  4OX9 B;  1M57 B;  1JQ0 A;  3U0Z A;  4FFK A;  3SYO A;  1KKC A;  2GUZ A;  1KU9 A;  2WAM A;  2EIK B;  1JFF B;  2GTS A;  4C7U A;  1EZV H;  1ARO P;  2ETN A;  1H2K A;  4B3S O;  3HKB A;  1AR4 A;  2P22 C;  3ZHQ A;  4FFB B;  1FFX A;  3CX5 F;  4HNA B;  4UCO A;  5EC1 C;  1NVP D;  2QSA A;  4DV4 O;  1L8D A;  2UXD O;  1KP3 A;  2ZCE A;  3QTC A;  5L3B A;  4WFE A;  3K3W A;  4DV2 O;  4HBN A;  1VEW A;  4LF7 B;  4GKK B;  4LF8 O;  4Z2W A;  1US6 A;  3RBZ A;  2JJ2 G;  3BVO A;  4O4I B;  4LR3 A;  4X66 B;  4DV3 O;  2Y0I A;  4TV8 B;  3PJS K;  2EBO A;  2RCV A;  3K58 A;  2IU3 A;  5LP6 A;  4JV5 O;  1IBL O;  2D3O W;  1X59 A;  2YID A;  2NN4 A;  4IT5 A;  1IBM B;  3I56 V;  3T1H B;  4CH3 A;  2X6A A;  4GUN A;  1AP6 A;  1DF4 A;  3VQY A;  4DR3 B;  2WLI B;  3K9S A;  3LNN A;  2UXC B;  1DGS A;  2FYU H;  1RM1 C;  3JAT A;  5FNV A;  1TUE B;  1E1Q G;  1WAZ A;  4FJC C;  2DYR C;  2P06 A;  4IHJ B;  3H1I H;  3S3X A;  2XAS A;  3JAW B;  3OMN B;  1SA0 B;  3CS5 A;  2F93 B;  1SQG A;  2UXB O;  4F6E A;  4LF9 O;  3IAY A;  2MW2 B;  3ETE A;  3JAR B;  4CH4 A;  3BAB A;  4L8J A;  4XDJ A;  1QR9 A;  2N05 A;  2E75 B;  1EZJ A;  4CC5 A;  3OEE G;  4U7N A;  4X64 B;  4PEL A;  5B3S C;  1P7G A;  4JZ2 A;  2JGD A;  3DC6 A;  3JD4 A;  2QM4 A;  3E35 A;  5B66 Z;  4WFB V;  1HNX O;  3SPJ A;  1GN4 A;  1N36 O;  2BSK A;  1ZL8 B;  4NXM O;  2Y0P A;  4DV0 O;  2QTO A;  2LP7 A;  4GKJ O;  4O4L A;  5B1A C;  5J2U A;  2XAG A;  3D3Q A;  2XAQ A;  4QGP A;  4K8Z A;  3APQ A;  4J42 A;  4E4E A;  2NLJ C; 
#chains in the Genus database with same CATH homology
 4BIU A;  2R9R B;  1VQ8 V;  1S72 V;  3ZRW A;  4N21 A;  2HG5 C;  3SYC A;  5CN0 A;  5B1B B;  4MTG A;  5EC2 C;  1YJ9 V;  1Q7Y W;  1FXV A;  5L3G A;  3LDC A;  1K97 A;  1YSC A;  2QM7 A;  4PA9 A;  5CBG A;  3JYC A;  3JD2 A;  4YXW G;  1FS0 G;  1PNM A;  2X7R B;  3CCR V;  4U7O A;  1XL6 A;  2AHY A;  1GKF A;  1QBZ A;  1I5X A;  3ABT A;  4MVQ A;  2Y69 B;  2Z3Y A;  3B8M A;  2B5U A;  4UV8 A;  1Q81 W;  5IYD O;  1XL4 A;  2OCC B;  4MSW C;  5EBM C;  2WLN A;  2JEX A;  1E79 G;  4MT8 A;  1F4N A;  2AHZ A;  5LHI A;  1GMG A;  2IW5 A;  2P7T C;  4MS2 A;  4QPJ A;  1QLE B;  3AG1 B;  2M7W A;  3FB6 C;  1GM8 A;  4UUJ C;  4GCZ A;  4P30 A;  3W7W A;  3AG3 B;  3K04 A;  3T1C A;  3ABL B;  3CCM V;  1I5Y A;  1MSW D;  4I5S A;  3CYO A;  1EBO A;  3ZRS A;  2DQ0 A;  3AG2 C;  3CCL V;  1R3I C;  1ZWI C;  1VQ4 V;  2JJ1 G;  1Y4M A;  2H94 A;  3EFF K;  1PL0 A;  3OUS A;  3A0R A;  1FXH A;  4R6Z A;  3E8F A;  2R9I A;  3FKS G;  3W7T A;  3K06 A;  1YIJ V;  1VQ5 V;  1PD3 A;  2NNU A;  1DLB A;  4FPP A;  1RPR A;  1SZT A;  2HVK C;  1KP2 A;  3K79 A;  1NJI W;  2P90 A;  3ABK C;  2HVJ C;  4G28 B;  1W0J G;  4RAI A;  3LNM B;  3T4D A;  2HFE C;  1CP9 A;  1OCZ C;  3JD3 A;  3HPL C;  1KQS U;  1OCR C;  2ZD9 A;  4JAS A;  2Z5U A;  3OMA B;  2EZP A;  1K9M W;  3SYP A;  1OCO B;  2WLL B;  3MHH C;  3ZMZ A;  1R3J C;  2ATK C;  3GWO A;  4KFM A;  4MVS A;  4XDK A;  1UJW B;  1PNK A;  2A9H A;  4PDM A;  5BZB A;  2W6J G;  3UM7 A;  5IYB O;  3ZMT A;  1VQL V;  1DF5 A;  4H37 A;  3CCU V;  2WLK A;  2IU0 A;  3T4Z A;  5EBL C;  3D3I A;  1K73 W;  2EJR A;  1R3K C;  3WG7 B;  1GM7 A;  2JK5 C;  2UXN A;  1QR8 A;  1NH2 D;  5IY5 B;  2WLH A;  4PA7 A;  4L87 A;  4HYO A;  1H38 A;  1NR7 A;  3QO8 A;  1V54 B;  2XAJ A;  3SYA A;  4P9P A;  3VBB A;  4FIP C;  2BOC C;  5B1B C;  2EIK C;  1Q82 W;  2IJH A;  1S5H C;  3F7Y C;  1L1F A;  2DQ3 A;  3FYE B;  4JTA B;  3QNE A;  4WFH A;  3SPC A;  1YI2 V;  1AJP A;  1BMF G;  4EKW A;  3MHS C;  4WFA V;  3K03 A;  1K5S A;  1YHQ V;  4RO2 A;  4JF3 A;  1JCH A;  2Y69 C;  4JPR A;  1QVF U;  3E8B A;  1VQN V;  1ENV A;  1G4Y B;  4QE9 A;  4WFF A;  2OCC C;  2X0L A;  3G71 V;  3NXS A;  2Q67 A;  3FYI B;  2DYS B;  1F51 A;  3F7V C;  3GB7 C;  1RM1 B;  3OR7 C;  1AI6 A;  2DYR B;  3LSQ A;  2WLI A;  3RVY A;  3WFV A;  4JGS A;  1QLE C;  3QO5 A;  4UXN A;  1S77 D;  1G8M A;  1VQO V;  1FXK A;  2C2A A;  1K3E A;  3EHB B;  5C93 A;  2HKO A;  3CCJ V;  3AG3 C;  5L3D A;  3ABL C;  4LBE C;  1BL8 A;  2A79 B;  4MVZ A;  3M99 B;  1H2G A;  1EFR G;  3HB3 B;  3I55 V;  1P7B A;  3CME V;  4GX0 A;  4E2L A;  3ZRX A;  4ZBM A;  2QM8 A;  1R6N A;  2IH1 C;  2HJF C;  4R8C A;  2A0L A;  1YTF B;  4J9Z B;  1SET A;  3BY6 A;  1THZ A;  3LDD A;  5B1N A;  3IC7 A;  2H8P C;  3SPH A;  5B3S B;  5IYC O;  1W0K G;  3FB7 C;  4GX1 A;  5B1O A;  4UVC A;  2P6J A;  1KC8 W;  3JD1 A;  3E83 A;  3BEH A;  1H8H G;  2GHY A;  1FXK C;  1GK9 A;  2ZR3 A;  3K0D A;  1OCC B;  3G6E V;  1H8E G;  3P32 A;  4TSF G;  3SPI A;  2XOK G;  1NQT A;  3ZN1 A;  2HR3 A;  3ASN B;  3ML0 A;  1OCO C;  4KUM A;  4MW8 A;  5L3C A;  5L3E A;  1AI5 A;  4BW5 A;  4CBC A;  5LHG A;  1M1K W;  4MVO A;  2QA4 V;  4BIZ A;  1GTO A;  1OHH G;  3CCE V;  2LFR A;  1KEC A;  3AG4 B;  5KA5 A;  1GM9 A;  2PI4 A;  1K4D C;  2Q68 A;  5IDJ A;  2IH3 C;  3ASO B;  3B8N A;  3W7S A;  3ZMV A;  4OXS A;  4PDV A;  1AJQ A;  2YEV B;  3WG7 C;  1S0V A;  4TWK A;  2OT5 A;  3OR6 C;  5IY5 C;  1M56 B;  2W6I G;  3CC7 V;  1NR1 A;  4P9O A;  2X6B A;  4H33 A;  1P4R A;  4R50 A;  1JJ2 U;  3G4S V;  3STL C;  2XAH A;  3D36 A;  4N23 A;  3SYQ A;  1MOF A;  3K08 A;  3T2M A;  1F23 A;  5KA6 A;  1NH2 B;  1VQ9 V;  1VQ6 V;  1AJN A;  5GW7 A;  3IGA C;  4X89 A;  4MVU A;  4JAV A;  2ZXW B;  4XDL A;  4MW3 A;  2Q6A A;  1LNQ A;  5LHH A;  3ETG A;  3OAA G;  3SPG A;  5CA3 A;  1R6K A;  4QJF B;  1AI4 A;  3ZRW B;  1K7D A;  2DYS C;  3E89 A;  3JD0 A;  3W7X A;  1K92 A;  4UVB A;  1M90 W;  1V55 B;  2B1G A;  1VQK V;  3B77 A;  1WLE A;  3RW0 A;  1COW G;  2EIJ B;  2EIL B;  2XAF A;  1YJW V;  4ZKI A;  1BHB A;  1R3L C;  1GO3 F;  4WCE V;  3SJQ C;  4RUF A;  3H01 A;  4R7C A;  3OEH G;  5J9P C;  1J95 A;  2IJI A;  3E8G A;  3P30 A;  4G2K A;  3RVZ A;  2X6C A;  2EIM B;  2F43 G;  1AI7 A;  2XND G;  4JYB A;  4QE7 A;  3TK1 A;  3CMA V;  2WPD G;  3JCZ A;  1S3J A;  5CMU A;  4MTO A;  1Q86 W;  3OMI B;  3CCS V;  4P2Z A;  4RQF A;  2WWW A;  3CCQ V;  3ABK B;  2EZO A;  4WF9 V;  1BHA A;  2EIN B;  3E8H A;  3FB5 C;  4I9W A;  1OCZ B;  1YIT V;  2DW4 A;  4LP8 A;  1PNL A;  3FB8 C;  4Z1M G;  5H9C A;  1YJN V;  3ZRV A;  5LGU A;  3LDE A;  2QKS A;  3AG1 C;  1FFT B;  1OCC C;  1QCE A;  4MTF A;  5KUM A;  4JTD B;  1SER A;  2ZR2 A;  5EBW C;  2YSU B;  3ASN C;  4MVM A;  4DO2 A;  4RUE A;  1CEZ A;  4G27 B;  1Y66 A;  2OTL V;  3VOU A;  2WLL A;  4F4L A;  3KG2 A;  2LFS A;  3E86 A;  3MD0 A;  2WSS G;  1IXM A;  3AG4 C;  4J9Y B;  3ZMU A;  4WFG A;  1QLN A;  1M57 B;  1JQ0 A;  3E2E A;  4JTC B;  5FL7 G;  3ASO C;  3SYO A;  4X88 A;  1JPX A;  1E1R G;  3ETD A;  1JOY A;  5KUK A;  1W2B U;  2WAM A;  1VQ7 V;  2EIK B;  4PA6 A;  1WPX A;  4GX2 A;  2V7Q G;  4QNH B;  3QO7 A;  1ARO P;  1M56 C;  4MTX A;  3IFX A;  3STZ C;  1S76 D;  2KB1 A;  4HZ3 A;  3ZMS A;  3W7U A;  4GX5 A;  2WLM A;  1K34 A;  2UXX A;  2WLJ A;  3OFN G;  1N8R W;  3ZN0 A;  1VQM V;  5EC1 C;  3X2Q B;  1NVP D;  4Q20 A;  2ITC C;  1KP3 A;  5L3B A;  2IJK A;  4WFE A;  3K3W A;  1K4C C;  4KP4 A;  3CD6 V;  2JEU A;  4PA4 A;  2B1I A;  2MK3 A;  1JX9 A;  2JIZ G;  2ZXW C;  2ZDI C;  5B1A B;  3K0G A;  1DTO A;  3CP1 A;  4GT1 A;  3TET A;  3RBZ A;  3ABM B;  2JJ2 G;  2IJJ A;  1KKD A;  2GSM B;  5CBH A;  1YTF D;  1V55 C;  1CPY A;  2JDI G;  3PJS K;  3OW2 U;  2EBO A;  2EIJ C;  2EIL C;  2IU3 A;  4PDL A;  4QPK A;  2D3O W;  2P67 A;  1B6Q A;  1V54 C;  4QIW F;  5LGT A;  2W0F C;  5E1A C;  3I56 V;  3TCU A;  2ZQM A;  2QEX V;  4LC1 A;  2QE7 G;  2X6A A;  4TT3 G;  1ORQ C;  2DWD C;  3LUT B;  2EIM C;  3OUF A;  4XBF A;  1KD1 W;  1PKX A;  1DF4 A;  4JYC A;  3AEI A;  2WLI B;  2V1D A;  3ZCC A;  2Y48 A;  3K9A A;  3ABU A;  2EIN C;  3ZJZ A;  5CBF A;  1FXK B;  2FTK A;  3OM3 B;  1SRY A;  1RM1 C;  1TUE B;  4FK5 C;  1ROP A;  4ASU G;  1E1Q G;  2DYR C;  4FJC C;  3OE7 G;  1MAB G;  4RQE A;  2Q69 A;  2DWE C;  3DTU B;  2XAS A;  3AG2 B;  5DM6 V;  3OMN B;  3CC4 V;  1SES A;  4JAU A;  3UKM A;  4UVA A;  4LCU C;  5EK0 A;  3ETE A;  4BAY A;  1HWY A;  4XDJ A;  1QR9 A;  3OGC C;  3CXC U;  4HAM A;  2CK3 G;  2PI5 A;  1EZJ A;  4PDR A;  1M57 C;  4FMT A;  3F5W C;  3CCV V;  3OEE G;  4MVR A;  3ZIA G;  5L3F A;  4U7N A;  4PEL A;  5B3S C;  4CZZ A;  4DXW A;  3CPW U;  1VQP V;  2K1E A;  5H6R A;  1OCR B;  1R73 A;  3CC2 V;  1RPO A;  2YEV A;  2ITD C;  3JD4 A;  4PA3 A;  1AR1 B;  3E35 A;  5LBQ A;  5HFL A;  4WFB V;  5HFM A;  3DGE A;  2HLD G;  5DN6 G;  1NKD A;  1OZ0 A;  3SPJ A;  3X2Q C;  1JVM A;  1K33 A;  4X8A A;  1NBM G;  5H6Q A;  2BOB C;  2QTO A;  2LP7 A;  3R65 A;  1MG1 A;  5B1A C;  1QVG U;  2XAG A;  4UV9 A;  1K5Q A;  2XAQ A;  5LGN A;  2ZDI A;  1F4M A;  3LSS A;  2OTJ V;  3ABM C;  1K8A W;  1NVP B;  1M9N A;  2NLJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...