1KC8W

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kc8W00
3CMEV 3CXCU 1VQMV 3CCRV 1VQOV 2D3OW 1K73W 1M1KW 1JJ2U 1VQ5V 1VQ9V 1YITV 3I56V 3CPWU 3CMAV 2QA4V 4WFAV 1KQSU 1Q81W 1R73A 1VQ4V 1YJ9V 1VQ8V 2QEXV 1YIJV 1QVGU 3CCMV 1S72V 1QVFU 1VQNV 3G4SV 3CC7V 1N8RW 1YJWV 3CCEV 3CC2V 1NJIW 1VQLV 1VQ6V 1KD1W 1YJNV 3G6EV 3CCJV 3CCSV 3CCUV 2OTJV 3CCVV 1VQ7V 3CCLV 3CC4V 3CCQV 1VQPV 1K9MW 2OTLV 4WF9V 3I55V 1YHQV 3OW2U 1KC8W 1YI2V 1K8AW 4WFBV 1Q7YW 1Q82W 5DM6V 1W2BU 1VQKV 3CD6V 1M90W 3G71V 1Q86W 4WCEV
chains in the Genus database with same CATH superfamily
1EM1A 3AG3C 3JSNA 1JPXA 1WB8A 2HR3A 2EIJB 3OR6C 4LH6A 4DV4O 1FKAO 1Y67A 2XAJA 3ZBHA 3QG5A 1L0LH 4DXWA 4FLVA 2L35A 4ZOLB 2W0XA 3OMAB 4LF4B 5GW7A 2EX3A 3RYCA 1HW7A 4JI0O 1RFYA 5FNVA 1P7BA 1OJHA 2P67A 3HKDA 3ETGA 4O2BA 5B5EZ 2NLJC 5EK0A 1Z2GA 1V9PA 2ZR3A 5ITZA 2XUMA 4YJ3A 4FM2A 4C7UA 1K7DA 3CXHF 1YEWA 3ICXA 3CB2A 3A0BZ 1WNSA 3UKMA 5LGNA 1GN6A 3J7AU 3D8CA 4F6EA 1P7GA 1W0KG 5EIBD 3JATB 5LHHA 1VQ7V 1VQPV 3JAKB 4J80A 2BSKA 4P2ZA 4JAVA 1KKCA 1G8MA 4ABMA 3SYPA 5IJ0A 1HR0B 1K73W 5JCOA 4G28B 3T1CA 4JTDB 4PDMA 1GM7A 4K0KO 1WLEA 3ASOC 3QO7A 4JI2O 3TCUA 4JI4O 1OCOC 4KHPO 4X62O 5HFLA 3DC6A 4UXNA 1XBLA 3W7UA 4L8JA 1Z5WA 2ITCC 4O4HB 2XT9A 4X66B 4PV1B 4PA9A 1UFIA 4QPKA 3TGUH 1KKDA 3H1HH 3CRAA 3F5TA 4LF4O 5JCOC 1VQNV 2ZCEA 1ZSPA 1Q5OA 1FXVA 5H6RA 3JD3A 1YJNV 3CCLV 1X59A 5BMVB 3LNMB 4AI8A 4LWSB 2JRIA 4WFBV 5IYZB 1HNWO 2MK3A 1KP2A 1NTMH 1R3KC 3IC7A 3BCCH 3RYFA 5TISZ 1F4MA 5JVDB 4OPHA 1ZL8A 2E3CA 3ZHQA 1IURA 3VOUA 2FKXA 3B8MA 4ZI7B 5KAFZ 3FB6C 1N0NA 3RT3C 1WPXA 3BA8A 5J2UA 4FK5C 1GM9A 3L73H 3Q4HB 1GN2A 1N4CA 4DV4B 3HR0A 3WB2A 1S77D 1ZUQA 1FXKC 1L1FA 2DYSC 5KMGB 4DUZB 5D5PA 1ZLZA 3G67A 2LP7A 3B4SA 3O9OA 4DV5B 5EC1C 4DR6O 1OCCC 4NTWA 2F95B 4U7OA 1KD1W 1Y66A 3CCSV 1TA8A 5JQGB 5CA1B 1N33B 2HP8A 2JS3A 1WA8B 3CCRV 5K1PA 5H9CA 2QA4V 3ETQA 4UCVA 1SESA 2VS0A 3MHSC 3OGCC 1DLBA 5KHHA 3SDLA 1VIBA 1NU1H 2YS8A 5JH7B 3ZCCA 1YI2V 2Q0OC 4WBNA 5LMUO 1Y4MA 2P22C 3IAYA 5KAIZ 3RN4A 1XMOO 3QO8A 1VQ8V 2DWEC 1BQZA 1MABG 4ZKIA 1EZJA 2ZM6B 2JDIG 4PI0A 1XEQA 2N74A 5KX5A 1F51A 5GTHZ 4ZHQB 2UXCO 2Z3YA 3C3SA 3A0RA 4DO2A 1QR9A 4GYCB 4EKWA 5LBQA 2BSKB 4WFHA 3APOA 3N2GB 5LHIA 4W4LA 4O4JB 4NKGB 3I55V 4JI5B 3W7TA 2UXBB 2JS5A 3DC5A 4LC1A 5LA6A 2D3OW 2R72A 4K35A 1GTOA 1YSCA 2PF4E 2QWPB 3CRRA 1OCOB 4DR5B 1XNQO 4DR1B 5IYCO 4U7NA 3N2KB 2BTOA 2ZIMA 1KBHA 2CH7B 4H37A 3W7XA 3STLC 3E83A 4UCUA 2X0LA 1GM8A 1SQFA 3VQWA 1ORQC 3ZN1A 4TQDA 3DTUB 1IXBA 4DK1A 5L3BA 3E22B 4JYAO 4UCTA 1NH2B 4X62B 3ZMVA 2M6YA 4JYAB 4X66O 3LDCA 4ASUG 3B77A 3ZIAG 2QWOB 2X6BA 3VQXA 4FM0A 1H8EG 3ABLC 4UUJC 4KHPB 4BIUA 2JJ2G 3CRMA 1H2GA 1I0HA 3RFRA 5IJ9B 4DR7O 2G38A 4ZIBA 1XOUA 1KP3A 2ZNJA 4IT5A 4FVMA 2RQ6A 4GKJB 1E1QG 1P84F 5B1BC 3VQVA 1A32A 2QKSA 1K33A 3ZJZA 1IBMO 4GKJO 4I55B 3AG3B 2QM8A 4DV1B 1N0JA 1TAEA 2B1IA 4J41A 1BQ0A 1YITV 5GONB 2Q7GA 2GSMB 2QWRB 4JPRA 5B3SC 4JI1B 5FPRA 3NXSA 4X1KB 1R6KA 3H01A 2K1EA 3RBZA 1R3LC 1SQGA 4FLUA 1ZL8B 3QVNA 4N21A 3SYOA 5A2QN 2IW5A 5H5NA 1JJOA 2QGNA 4LWSA 1NTZH 1PL0A 4CH3A 1NR1A 3TXQA 2ODMA 1QVGU 4LFAB 2QR4A 4O4IA 2PZSA 4LR3A 3LSSA 4O4LA 2RCVA 3ABLB 4LCUC 3ZMTA 1M9NA 3PN1A 4B08A 4DYLA 1AVMA 2A7WA 5B1NA 2P6JA 1M4UA 4MW3A 2MW2B 5L3CA 1WJZA 3RVYA 1GN4A 1DTOA 5CN0A 2BCCH 3HKBB 3K59A 4EEQA 1EN4A 3T1HB 3K5OA 3J81N 1F7YA 1SRYA 2GHYA 2HKOA 5H2FZ 2QWQB 3L74H 2GBOA 1B6QA 3AG4B 1MOFA 5IY5B 3H1IH 3SJQC 2AZ0A 4X1YB 4JV5O 2EIJC 1K97A 2W6JG 1OZ0A 3BY6A 3OMIB 4HNAA 3CMAV 3OTOO 1XNRB 1GKFA 5LHGA 1WN7A 3FAVA 5IJ9A 2DMXA 4DV5O 3JSLA 4Z1MG 3G80A 3L75H 4YJ3B 4JZGA 3K3WA 2IM9A 3JD2A 1FJGO 4EB6B 4TUYB 1XNQB 1K5QA 1P49A 3ZX6A 3ZEDA 4OX9B 2IJIA 4LFAO 1I5XA 1I08A 1JJ2U 3IGAC 1FJGB 4FZ1A 4UVCA 4Z2WA 3HKCA 1BE3H 4BAYA 4BR6A 3KG2A 2P5OA 1AI5A 5IWAB 3UCSC 3HKDB 4DV6B 1DF5A 3MDSA 3K58A 3N2KA 3CJHB 1M5IA 5B66Z 4J9ZB 4QGPA 1DF4A 1VQOV 4MW8A 2YEVA 4QNHB 4RQFA 5LOVA 1W0JG 1XHXA 1VQ4V 4CH5A 4O4HA 4UV8A 2ZE6A 4F6RA 3K0GA 4PI2A 1UJWB 4IL6Z 1XMOB 1TUBB 4ZBMA 4P30A 3ETEA 4FLWA 1FXHA 4OX9O 1U97A 3NR7A 5DM6V 2E76B 1W2BU 2ZE5A 1IXMA 3TETA 4FLXA 1AJQA 3BFRA 4X1IB 1QCEA 4FZ0A 3K08A 2YIDA 2NNUA 1Y74A 3UQ8A 3D36A 3E8FA 4LF5O 4F6RB 1KYOF 3ZHRA 1NH2D 5LYJB 1KB9F 1VARA 1RSOB 1NT2B 1FD9A 2P06A 3CJHA 3K57A 1M57B 2AZ2A 1BHAA 3ZHVA 2WLNA 4JI6O 4WBNB 3HKEA 1ENVA 3ZRSA 4MTOA 1VF5B 1ZTEA 2XOKG 1QLEB 2UUBO 5EBWC 3VBBA 1NZ6A 1P4RA 1FXKA 5LGTA 2OYQA 3EXAA 2ZNIA 1AROP 1D2DA 4FLYA 1AB3A 2IJHA 5LMNO 3KCYA 2UUAB 4GKKO 1S72V 3WG7C 1L0NH 4J42A 4LF6B 2WA4A 4L87A 5KLVH 1NTKH 3ZRWA 4U3JB 2E5LO 5DN6G 4X1IA 3ZN0A 4RQEA 1KMIZ 4U3JA 4RUEA 4X64B 2ZKOA 2UXXA 4LP8A 4J7KA 4DK0A 1F4NA 1YXBA 4J7ZA 3WU2Z 3AG4C 2Y4TA 3CCUV 1GRJA 2H94A 1AR1B 4FFBB 1LR1A 5D5QA 1CXZB 1NQTA 4MTGA 1NI8A 3G71V 1PD3A 1YTFB 1RPOA 2WLHA 3RYFB 2ZXWB 2XAQA 2ZD9A 3P3PA 3ABUA 3A2FA 2VQEO 4PHZA 2JEUA 1NBMG 2C2AA 4QE7A 1XILA 1K34A 5IY5C 2YIAA 2UUCB 1AR4A 1TUEB 3JAWA 1RSOA 3FB8C 3E2EA 1TVKA 1J5EO 4IHJB 4TV9B 2Y0PA 1MNGA 5B1AC 1PV0A 3JCZA 2LGQA 3W7WA 4JYCA 4IGGA 2QDOA 4DUYO 1S0VA 4D6TH 4LF9O 4NXMO 1US6A 4DR2B 2WLMA 4I55A 4W4KA 3RWRD 5CBFA 4PD4F 1JMKC 2H8PC 2LW1A 4DV3O 4MVSA 2KB1A 3CC2V 2B1GA 1NJIW 1GAXA 1FFTB 2CAZC 4PA4A 4F4LA 3SPIA 3K03A 2JIZG 5KMGA 2V7QG 3JASB 4AHCA 5LMUB 1H2LA 5IWAO 1WP7A 1QLNA 4DR3B 1XUQA 5EBMC 1Y76B 4DW1A 2HG5C 1Q3EA 1QVFU 4MSWC 4TV8A 5B1BB 4D7SA 3M99B 1SZXA 4O2BB 2W6IG 4FPPA 3RW0A 1SF9A 2ETNA 3G6BA 1HDJA 1XREA 2EILC 2OWOA 2IU0A 2DW4A 3DXRA 2CGNA 1MZFA 4MVZA 4PDLA 1IBKO 3LSUA 2EINB 4XDKA 4EB6A 4TV8B 3K9SA 4HAMA 4WFFA 5JJEB 4PA7A 2OCCC 4KXRA 2E5LB 3CRQA 1R6TA 1R1BA 2ADQB 3C90A 1OCZB 5KHGA 1THZA 1XHZA 5L3FA 2AHYA 1KQSU 5IE9A 4BW9A 4O4JA 3CS5A 1HNZB 1M56C 4KUMA 3E8HA 1TUBA 1MZEA 3OW2U 4I50B 2YSUB 4IIJB 2FYUH 3CXCU 4I9QA 4TT3G 2UXDO 2ADPA 1AI4A 2Q6AA 4NXNB 3CEIA 2F4VO 2K9PA 4MVUA 2DE0X 3FYIB 4UB8Z 4FJCC 3K04A 3RYIA 5BY1A 4I5SA 1OCRB 4IHJA 2DYRB 3ETDA 3SPCA 2AW9A 2XHBA 3ZRXA 5F2VO 2EILB 4X9QA 3ABMB 1SZTA 4GLXA 3WB1A 2EZOA 4G27B 4JI7B 3KZIZ 5BR8B 2Z0AA 2ZT9B 4JI8O 3AK1A 4DV1O 4DV0O 3ASNB 1GMGA 1IBMB 2DYRC 4GT1A 1QNMA 3TXSA 2UXCB 5GONA 5H6QA 4EFEA 2Q8VA 3D3QA 2F4VB 3L72H 1SQVH 3OEHG 1O9HA 3H1JH 2PYLA 2YICA 2F66C 3D36C 4B3SO 4DR7B 3OUSA 4K8ZA 4DV7O 3CC4V 4JF3A 3OMNB 2LW7A 4DRXB 5J2UB 4KP4A 3Q4HA 4Q20A 4PDRA 2RNBA 1QR8A 1RPRA 3T4DA 2HHHO 4WFGA 3UO2A 1AI6A 2OIGA 3OFNG 2P90A 1MSDA 3FB7C 2QJ1A 3IFXA 3SR2C 1VQ6V 5CA3A 4I4TB 4TV9A 2D2CB 1VQ9V 3THOA 2L6LA 2HJFC 1VMGA 2QEXV 1QBZA 3VQYA 3RYCB 3BRCA 1QU7A 2BE3A 5JH7A 4YY3B 1GK9A 2A06H 3ZRVA 3OAAG 3MAQA 2OTLV 3DSQA 1V54C 2WAMA 3K9AA 4I4TA 1I7FA 1WPBA 2PTMA 3CD6V 4JAAA 3CRCA 4DV6O 2Q5ZA 4X89A 3AG2B 3SJCC 1JFFB 3CHXA 1YJ9V 5EBLC 1YIJV 1MG1A 4H44B 4FLTA 2LO1A 5CA1A 5IJ0B 3CX5F 4LH7A 3T1YB 2ZM6O 5EZYA 3N27A 4PDVA 3JAKA 1YTFD 2V1DA 3AG1B 3AEIA 1S76D 4BIZA 1YVWA 4WFAV 1KU9A 3OUFA 1IBKB 1B04A 2BTQA 2WLIA 4LFBB 1CP9A 3ZHSA 5KHKA 1JX9A 5B1AB 2VQFO 1OCRC 2IH3C 4DUZO 4DR3O 2R9AA 3EFFK 3UO3A 2ZIOA 4R6ZA 3E89A 3A8TA 3JYCA 1SQXH 4J11A 3R66A 2BOCC 2DOSA 1D5NA 4JZ2A 1ZWIC 3BHPA 1VP7A 4JAUA 4CBCA 3JAWB 3CCQV 2IU3A 4MT8A 3OE7G 4X8AA 4LF9B 1AJNA 1Y76A 3RYIB 3P3NA 4MVMA 4UVBA 1JA8A 4TUYA 2V4DA 4GX2A 4HNAB 5K1XA 4NR1A 2LJ2A 2Q73A 1H2SB 5BXZA 2CTQA 4LNUA 2XASA 3J80N 2LQTA 2DN9A 2YI9A 4JI4B 2HHHB 1JVMA 3SPHA 1B3QA 4CC6A 2UUCO 1Q86W 1H38A 1M1KW 1B06A 3C3TA 4IIJA 2ZE7A 3ZMSA 5KA5A 4RO2A 2ZDIC 4D7TA 3MHHC 4RUFA 2A0LA 4O2AB 5DEDA 2Q0AA 2Q7HA 4MTFA 1V54B 2GV9A 2R9RB 2DWDC 2YXHA 2YI8A 3OR7C 4OXSA 3U0ZA 3K5NA 3H9VA 1N34B 2HVJC 1HR0O 3RYHB 5KX5B 2XTAA 1NKDA 4B3SB 4MVOA 1FFXA 2QM4A 1Q6HA 3E86A 3T2MA 2QTSA 3LSQA 4KFMA 2CTPA 1PPJH 2WSSG 3CCEV 1LUVA 3CWBH 3DXRB 4I7ZB 2KG7A 4QIWF 1WAZA 4UCSA 4I9WA 4J10A 3FYEB 3E35A 1URFA 1MSWD 4HYOA 4JI7O 5CMUA 2ILMA 5EC2C 5EYPB 4LF7O 3BAAA 1Y6XA 4YIOA 1HNWB 2EIKB 1E79G 2H3OA 3H1LH 1IZ3A 1JQ0A 1RP3B 2Y48A 3FAVB 4YHHO 1M90W 5A9GA 2UXDB 1LNQA 4K8XA 2WLKA 2ATKC 1M93A 2EJRA 4X1YA 4JTCB 3AG1C 4MTXA 5IYDO 4GUNA 4CS4A 5JJNB 1S5HC 4LFBO 2QWNB 3WFVA 4UV9A 4LF8B 4UB6Z 1N32O 1M56B 2JK5C 1KECA 3OTFA 4R8CA 4NTYA 4YIPA 1VF7A 3FFQA 2F43G 4ZHQA 1GH6A 3M8AA 1TVKB 3EVKA 3AG2C 5JVDA 3AK2A 2AHZA 2N05A 1L8DA 4CC5A 3IC9A 4MVQA 3OT7A 4PJ0Z 2IBZH 1SA0A 1K8AW 1BZKA 1Q6UA 2PI4A 4Z1VA 5KA6A 5CBHA 2WA3A 1KUQA 3EHBB 3GVMA 5EIBC 3F7VC 2B5UA 1PNKA 4FLZA 1R73A 1SKVA 2CK3G 4LFCO 3CCMV 2ZR2A 1Z5VA 2EINC 1XMQO 5JJJB 4FM1A 1K3EA 2JVDA 4I50A 4WFEA 4FMTA 4IYHA 2HVKC 1Y74B 2F93B 2QE7G 4TWKA 1VEWA 1AI7A 1OV9A 1NS1A 3ML0A 4J7JA 4TQFA 5JWPA 4BWAA 1RM1B 3MD0A 3ZMUA 3ZRWB 3JATA 1WB7A 2VWJA 2YIBD 3OEEG 2HJDA 1YDXA 1IDSA 2KQXA 2R9IA 2WLLB 3K5MA 4DR2O 2PGGA 2EBOA 4JI1O 3CE2A 2LFRA 4YXWG 4CS2A 4DUYB 4J9YB 2AXTZ 5L3DA 1BSMA 2Q67A 5LGUA 3K06A 1SERA 2JEXA 1XL4A 1MMMA 1SA0B 5EYPA 4LFCB 3B09A 1YHQV 1J5EB 1S5LZ 1SQBH 1Q90D 2Q4PA 1AP6A 1G6UA 2LFSA 5ITZB 4GZRB 3HKEB 2GDSA 2WLJA 2KG7B 1BCCH 1OCCB 2FB5A 4JI8B 1FYJA 2OIEA 1EN5A 2RMKB 3G6EV 4MVRA 3ABKB 5LP6C 1PNLA 1XL6A 4NVPA 3GWOA 1Q82W 1N36B 1AP5A 1PL4A 2BTQB 5LMNB 3GWKC 2YUAA 2WLLA 3AK3A 4UVAA 2UXNA 3K79A 3LUTB 4ZOLA 3IJ4A 5EZYB 2JGDB 2DQ0A 3SPJA 5C8YB 4YY3O 1RM1C 1O9GA 4JYYA 3B2EE 4B3TB 1SQQH 1SETA 3JALA 3CP1A 2VWKA 2Q68A 4YJ2B 2PYJA 4LBEC 4FIPC 4XDLA 4QPJA 1Q8IA 3E8GA 1CEZA 2EIMC 1JFFA 2KSDA 1BT8A 2FTKA 1I94B 2XAHA 1V55C 4X88A 2LGWA 5C93A 3KCXA 1YJWV 3ZHUA 1VQLV 1K4DC 3QO5A 1LUWA 1I94O 4GKKB 2DJVA 2QTOA 3B8NA 3K0DA 2CGOA 4I0XB 4K3AA 5LOVB 4X65B 5DECA 3CMEV 3QF7A 1G4YB 4PA3A 4UFZA 3SYCA 5BMVA 5KHIA 1N32B 4P9OA 1WP8A 3K5LA 4B3RB 1N8RW 4TSFG 5LXTA 3RVZA 1H8HG 2YIBA 4AILC 2YDEA 4CS3A 1PM9A 2CE4A 1IVSA 5LP6B 2EULA 2YXYA 4U3FH 1IBLB 1JOYA 3U11A 3JD1A 3CPWU 5CB4A 4X20B 4NTXA 4X64O 4QJFB 1M57C 3A0HZ 1AILA 2HLDG 5JQGA 2E74B 4JI3B 4UCRA 4DV0B 1HNZO 5J2TB 4DR4B 1FS0G 2WWWA 2EJ7A 2E75B 5FL7G 3QTCA 2BOBC 2GUZB 2YC0A 3LDEA 4NB5A 1ZX3A 2CDYA 1EN6A 1GO3F 3L70H 5J2TA 4Q6GA 2GUZA 4NXNO 4E4EA 4X20A 5CB4B 1H2MA 3E8BA 3UT5A 3WG7B 1EFRG 2RN9A 3QNEA 3H1KH 5AG2A 4ZI7A 1TGOA 2FMLA 2EIKC 1W59A 3BEHA 5LP6A 3OM3B 4CH4A 1D5AA 1X4TA 2UXBO 2RDCA 4HBNA 1XNRO 3FKSG 1QQCA 2QM7A 1FXKB 4DR1O 1SS3A 2KKWA 4B3MO 4IYIA 4O4IB 5CA0A 5LL6Y 5FNVB 3HB3B 3ABTA 3TK1A 3JD4A 1DK1A 1K92A 1XQ8A 3OD4A 4XDJA 3X2QC 2EIMB 4X1KA 1ZAUA 5IDJA 1FFXB 1Q6IA 2F1MA 2Z5UA 2EZPA 1CPYA 5KUMA 5B3SB 3CC7V 2Q69A 3BVOA 4R50A 3ASNC 3BA9A 4OPAA 1JCHA 4JYBA 2OTJV 2P4VA 4R7CA 3JALB 2ZINA 3TJTA 4DV3B 1XMQB 4G2KA 5IYBO 1IBLO 4YJ2A 2DYSB 3S3WA 5GTIZ 4OGQB 1EZVH 4JV5B 2Y0IA 3HPLC 4JASA 3T1YO 5C8YA 3G4SV 2YEVB 3O65A 3SYAA 3ZMZA 1BS3A 3W7SA 1SQPH 4BIOA 1YF2A 2RJZA 2ZQMA 3T1HO 3DGEA 2M7WA 1Q7YW 1HWYA 4B3MB 2Y69C 5FPOA 4PELA 4K0KB 1E1RG 3M7MX 3HKCB 2VQEB 3F5WC 3AG7A 4NXMB 4H13B 4GCZA 1QHTA 2CTRA 3GB7C 1G1XB 4LF8O 3CCVV 3BPZA 4RWUA 4B3RO 3OGIB 2DQ3A 2IH1C 2P4KA 4AQYO 1XI1A 3S3XA 4B3TO 4B7KA 2ARHA 1WA8A 5BR8O 1SC5B 3T4ZA 2X6CA 4I0XA 2O57A 1V55B 2NN4A 1GN3A 3ABKC 3JASA 3R65A 4JI6B 3UT5B 5BZBA 1UPGA 2UU9B 4YHHB 2CTWA 4LF7B 4GX0A 4X65O 3SPGA 4WCEV 1H2KA 2ZXWC 2GTSA 4A5UB 3P30A 4HZ3A 3KKYA 3HKBA 3N2GA 2JGUA 3JCUZ 1HP8A 1IX9A 4FFKA 3L9DA 1NVPD 2A9HA 2Y4UA 1BHBA 2XNDG 4JTAB 1K4CC 2PI5A 4QE9A 4AQYB 4TOIA 4BW5A 3X2QB 1VQMV 5HFMA 4RAIA 4JI5O 1FPOA 2ZE8A 3ZHTA 2X6AA 2FL4A 1YCIA 2P7TC 5CA0B 3LDDA 5FLXN 1HNXB 5L3EA 2QKCA 1N34O 1VF6C 4JI3O 1F23A 4DW0A 1N36O 1AJPA 1S3JA 2ITDC 2Q9LA 1VF6A 2UUAO 4DV2B 1HNXO 4ICGA 4JI2B 4JI0B 1R3JC 3B40A 3P32A 1XDCA 3SJAC 4LF6O 3CCJV 2VQFB 4N23A 5IT9N 1K5SA 1PP9H 4EFBA 4PA6A 5KHJA 4GX5A 2HFEC 2WLIB 1VQ5V 2ZDIA 1BMFG 4FFBA 3CSXA 3ABMC 2X7RB 2R70A 4DR5O 1R3IC 1H2NA 2XAGA 3FB5C 2XAFA 4XBFA 4CH6A 2N04A 2QKAA 2UUBB 3WB0A 2AGAA 5CBGA 2JGDA 4GX1A 1K9MW 2GTAA 1KC8W 2PUSA 1NVPB 2HEPA 1DGSA 4NYKA 3I56V 2Y69B 2YXLA 3ASOB 3E22A 2WPDG 3D3IA 4UCOA 3FX7A 3PJSK 2UU9O 5J9PC 4KL1A 2F23A 3SYQA 1AR5A 4B7EA 2OT5A 3JARA 3RGBA 3JAMN 1PNMA 2W0FC 4LF5B 1OHHG 3I5DA 2JJ1G 4MS2A 5LXTB 4E2LA 1U96A 2CH7A 2CUGA 2A3QA 4H33A 2VRZA 5IYZA 4P9PA 1Q81W 2PY5A 4O4LB 3JD0A 3APQA 2B9ZA 5LA6B 3SJBC 3CYOA 4DR6B 3RYHA 5LYJA 3L71H 1COWG 5KUKA 3OTOB 3STZC 4H0LB 1PKXA 1J95A 3UM7A 1R6NA 5E1AC 1YZBA 2IJJA 1VQKV 2OCCB 4DR4O 2IJKA 3LNNA 1JR9A 2OCHA 5L3GA 1OCZC 4DV2O 3ZS8C 5E79Z 1N33O 1MA1A 1BGYH 2NR5A 1I5YA 2Q7EA 3JARB 1S5JA 3U10A 4DRXA 1QLEC 3BABA 2A79B 4O2AA 4JGSA 5B1OA 1T5EA 1FAFA 4DV7B 1Q43A 2QSAA 1BL8A 3F7YC 4WF9V 3FD9A 4LNUB 1EBOA 3SGIA 1NR7A 4CZZA 1ROPA
chains in the Genus database with same CATH topology
3AG3C 4LBEC 1JPXA 2EIJC 1K97A 4FIPC 4KP4A 2HR3A 4XDLA 2EIJB 3OR6C 2W6JG 4PDRA 4Q20A 1OZ0A 3BY6A 3E8GA 3OMIB 4QPJA 3CMAV 2EIMC 1CEZA 1QR8A 1GKFA 5LHGA 1RPRA 3T4DA 2XAJA 4WFGA 1AI6A 2FTKA 4DXWA 2XAHA 4Z1MG 1V55C 4X88A 3OFNG 5C93A 2P90A 1YJWV 3FB7C 3K3WA 1K4DC 1VQLV 3IFXA 3JD2A 1VQ6V 3QO5A 5CA3A 3OMAB 1K5QA 5GW7A 2IJIA 2QTOA 3B8NA 3K0DA 1I5XA 3CMEV 1VQ9V 1JJ2U 3IGAC 1G4YB 4PA3A 4UVCA 3SYCA 1P7BA 2HJFC 4BAYA 2P67A 2QEXV 1QBZA 3ETGA 4P9OA 3KG2A 1N8RW 2NLJC 5EK0A 1AI5A 4TSFG 3RVZA 1H8HG 1NR7A 1GK9A 1DF5A 3ZRVA 2ZR3A 3OAAG 2OTLV 1V54C 2WAMA 3K9AA 1K7DA 3CD6V 4J9ZB 1VQOV 1DF4A 1JOYA 4MW8A 2YEVA 4QNHB 4RQFA 3JD1A 3CPWU 3UKMA 5LGNA 1W0JG 4X89A 3AG2B 4QJFB 1VQ4V 1M57C 1YJ9V 5EBLC 2HLDG 1YIJV 1MG1A 4UV8A 3K0GA 1W0KG 1UJWB 5LHHA 1VQ7V 1VQPV 1FS0G 2WWWA 3ETEA 4P30A 1FXHA 4ZBMA 5FL7G 4P2ZA 2BOBC 4JAVA 1G8MA 5DM6V 3SYPA 3LDEA 1W2BU 1IXMA 1K73W 4PDVA 3TETA 1AJQA 1GO3F 4G28B 3T1CA 4JTDB 4PDMA 1GM7A 2V1DA 3AG1B 3AEIA 1YTFD 1S76D 4BIZA 4WFAV 1WLEA 3OUFA 3ASOC 1QCEA 3QO7A 3TCUA 1OCOC 3E8BA 3K08A 5HFLA 2NNUA 2WLIA 1CP9A 3D36A 3WG7B 4UXNA 1EFRG 3QNEA 3E8FA 3W7UA 1JX9A 2EIKC 5B1AB 2ITCC 3BEHA 1OCRC 2IH3C 3OM3B 1NH2D 3EFFK 4R6ZA 4PA9A 3E89A 4QPKA 1M57B 3FKSG 1BHAA 2WLNA 1KKDA 2QM7A 1FXKB 3JYCA 1VQNV 1ENVA 3ZRSA 1FXVA 2BOCC 4MTOA 5H6RA 3JD3A 2XOKG 1QLEB 5EBWC 1ZWIC 1YJNV 3VBBA 4JAUA 4CBCA 1P4RA 3CCLV 3CCQV 2IU3A 4MT8A 3LNMB 1FXKA 3OE7G 3HB3B 5LGTA 4WFBV 3ABTA 4X8AA 3TK1A 2MK3A 3JD4A 1K92A 1AROP 4XDJA 3X2QC 1AJNA 2EIMB 5IDJA 1KP2A 4MVMA 2IJHA 1R3KC 3IC7A 1F4MA 4UVBA 2Z5UA 2EZPA 1CPYA 4GX2A 5KUMA 1S72V 5B3SB 3WG7C 3CC7V 2Q69A 4R50A 3VOUA 3ASNC 3B8MA 1JCHA 4L87A 3FB6C 4JYBA 2OTJV 4R7CA 2XASA 3ZRWA 1WPXA 4G2KA 1JVMA 3SPHA 5IYBO 5DN6G 4FK5C 1Q86W 1GM9A 1H38A 2DYSB 1M1KW 3ZN0A 4RQEA 1S77D 1FXKC 1L1FA 2DYSC 3ZMSA 3HPLC 5KA5A 4JASA 2LP7A 4RUEA 4RO2A 2ZDIC 2UXXA 4LP8A 5EC1C 3MHHC 2YEVB 3G4SV 4RUFA 2A0LA 1F4NA 1OCCC 3SYAA 3W7SA 3ZMZA 4U7OA 1KD1W 1Y66A 3AG4C 3CCSV 3CCUV 2H94A 4MTFA 1V54B 2R9RB 2DWDC 4OXSA 3OR7C 2ZQMA 1AR1B 3DGEA 1NQTA 2HVJC 2M7WA 1Q7YW 1HWYA 4MTGA 3G71V 1PD3A 2Y69C 3CCRV 1YTFB 1RPOA 1NKDA 2WLHA 2ZXWB 4MVOA 5H9CA 2QA4V 4PELA 1E1RG 2XAQA 2ZD9A 3E86A 1SESA 3MHSC 3T2MA 3ABUA 3F5WC 3OGCC 3LSQA 1DLBA 4GCZA 4KFMA 2WSSG 3CCEV 2JEUA 3GB7C 1NBMG 2C2AA 4QE7A 1K34A 3CCVV 3ZCCA 4QIWF 1YI2V 1Y4MA 4I9WA 5IY5C 2DQ3A 2IH1C 3FYEB 3E35A 1TUEB 1MSWD 4HYOA 3FB8C 3QO8A 5CMUA 1VQ8V 3E2EA 3T4ZA 2DWEC 2X6CA 5EC2C 1V55B 2EIKB 1MABG 5B1AC 1E79G 4ZKIA 3JCZA 3ABKC 1EZJA 3R65A 3W7WA 5BZBA 2JDIG 1JQ0A 2Y48A 4JYCA 1S0VA 4GX0A 1M90W 3SPGA 1F51A 4WCEV 1LNQA 2Z3YA 2WLMA 2ZXWC 3P30A 4HZ3A 3A0RA 4DO2A 2WLKA 5CBFA 2ATKC 2EJRA 5IYDO 4JTCB 3AG1C 1QR9A 4MTXA 2H8PC 1S5HC 4EKWA 5LBQA 1NVPD 4MVSA 2A9HA 4WFHA 3WFVA 2KB1A 3CC2V 2B1GA 2XNDG 1NJIW 4JTAB 4UV9A 1BHBA 1FFTB 1K4CC 4PA4A 5LHIA 4F4LA 2PI5A 4QE9A 3SPIA 3K03A 2JIZG 1M56B 2JK5C 1KECA 3I55V 2V7QG 4R8CA 4BW5A 3W7TA 3X2QB 1VQMV 4LC1A 2D3OW 5HFMA 2F43G 1GTOA 1YSCA 4RAIA 1QLNA 5EBMC 1OCOB 3AG2C 2HG5C 1QVFU 4MSWC 5IYCO 4U7NA 5B1BB 2AHZA 4H37A 3W7XA 3STLC 3M99B 2X6AA 2P7TC 3E83A 3LDDA 2W6IG 4FPPA 4MVQA 5L3EA 1K8AW 2X0LA 3RW0A 1GM8A 2PI4A 1F23A 1ORQC 5KA6A 5CBHA 3ZN1A 3EHBB 1AJPA 3F7VC 1S3JA 2B5UA 2ITDC 3DTUB 1PNKA 2EILC 2IU0A 2DW4A 1R73A 5L3BA 2CK3G 3CCMV 4MVZA 4PDLA 2ZR2A 1NH2B 2EINC 3ZMVA 3LDCA 2EINB 4XDKA 1R3JC 4ASUG 3P32A 3B77A 3ZIAG 1K3EA 4HAMA 4WFEA 4WFFA 2X6BA 3CCJV 4FMTA 1H8EG 3ABLC 2HVKC 4N23A 4UUJC 4PA7A 1K5SA 4BIUA 2JJ2G 1H2GA 2OCCC 4PA6A 4GX5A 2HFEC 2QE7G 2WLIB 4TWKA 1VQ5V 2ZDIA 1BMFG 1KP3A 1OCZB 1THZA 1AI7A 5L3FA 2AHYA 3ABMC 1KQSU 2X7RB 3ML0A 1E1QG 5B1BC 1R3IC 2QKSA 2XAGA 3FB5C 2XAFA 4XBFA 1RM1B 3MD0A 3ZMUA 1K33A 3ZRWB 1M56C 4KUMA 5CBGA 3ZJZA 4GX1A 3E8HA 1K9MW 1KC8W 3OW2U 1NVPB 3AG3B 2QM8A 3OEEG 2YSUB 3CXCU 2B1IA 2R9IA 4TT3G 2WLLB 1YITV 3I56V 2EBOA 2Y69B 1AI4A 2GSMB 2Q6AA 3ASOB 2WPDG 3D3IA 3PJSK 4JPRA 4MVUA 2LFRA 3FYIB 4YXWG 5B3SC 5J9PC 4FJCC 4J9YB 3SYQA 3NXSA 2OT5A 3K04A 5L3DA 1R6KA 3H01A 1PNMA 2Q67A 5LGUA 2K1EA 3K06A 2W0FC 3RBZA 1OHHG 1OCRB 4I5SA 1SERA 1R3LC 2JEXA 1XL4A 2JJ1G 2DYRB 3ETDA 4N21A 3SPCA 3SYOA 1YHQV 2IW5A 3ZRXA 4MS2A 4E2LA 2EILB 4H33A 2LFSA 3ABMB 1PL0A 1SZTA 4P9PA 1Q81W 1NR1A 2EZOA 2WLJA 4G27B 3JD0A 1QVGU 1OCCB 3CYOA 1COWG 3ASNB 3LSSA 5KUKA 1GMGA 4MVRA 3G6EV 3ABLB 3ABKB 4LCUC 3STZC 3ZMTA 1M9NA 1PNLA 1XL6A 1PKXA 1J95A 5B1NA 2DYRC 2P6JA 3UM7A 3GWOA 1Q82W 1R6NA 5E1AC 4GT1A 4MW3A 2IJJA 5H6QA 5L3CA 1VQKV 2OCCB 2IJKA 3RVYA 1DTOA 2WLLA 3OEHG 5CN0A 5L3GA 4UVAA 1OCZC 2UXNA 3K79A 3LUTB 2DQ0A 3SPJA 1I5YA 1SRYA 2GHYA 1QLEC 3OUSA 2A79B 2HKOA 1RM1C 4JGSA 5B1OA 3CC4V 1BL8A 1B6QA 3AG4B 3F7YC 4WF9V 1SETA 4JF3A 1MOFA 3OMNB 1EBOA 5IY5B 3CP1A 2Q68A 4CZZA 3SJQC 1ROPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME V;  3CXC U;  1VQM V;  3CCR V;  1VQO V;  2D3O W;  1K73 W;  1M1K W;  1JJ2 U;  1VQ5 V;  1VQ9 V;  1YIT V;  3I56 V;  3CPW U;  3CMA V;  2QA4 V;  4WFA V;  1KQS U;  1Q81 W;  1R73 A;  1VQ4 V;  1YJ9 V;  1VQ8 V;  2QEX V;  1YIJ V;  1QVG U;  3CCM V;  1S72 V;  1QVF U;  1VQN V;  3G4S V;  3CC7 V;  1N8R W;  1YJW V;  3CCE V;  3CC2 V;  1NJI W;  1VQL V;  1VQ6 V;  1KD1 W;  1YJN V;  3G6E V;  3CCJ V;  3CCS V;  3CCU V;  2OTJ V;  3CCV V;  1VQ7 V;  3CCL V;  3CC4 V;  3CCQ V;  1VQP V;  1K9M W;  2OTL V;  4WF9 V;  3I55 V;  1YHQ V;  3OW2 U;  1KC8 W;  1YI2 V;  1K8A W;  4WFB V;  1Q7Y W;  1Q82 W;  5DM6 V;  1W2B U;  1VQK V;  3CD6 V;  1M90 W;  3G71 V;  1Q86 W;  4WCE V; 
#chains in the Genus database with same CATH topology
 1EM1 A;  3AG3 C;  3JSN A;  1JPX A;  1WB8 A;  2HR3 A;  2EIJ B;  3OR6 C;  4LH6 A;  4DV4 O;  1FKA O;  1Y67 A;  2XAJ A;  3ZBH A;  3QG5 A;  1L0L H;  4DXW A;  4FLV A;  2L35 A;  4ZOL B;  2W0X A;  3OMA B;  4LF4 B;  5GW7 A;  2EX3 A;  3RYC A;  1HW7 A;  4JI0 O;  1RFY A;  5FNV A;  1P7B A;  1OJH A;  2P67 A;  3HKD A;  3ETG A;  4O2B A;  5B5E Z;  2NLJ C;  5EK0 A;  1Z2G A;  1V9P A;  2ZR3 A;  5ITZ A;  2XUM A;  4YJ3 A;  4FM2 A;  4C7U A;  1K7D A;  3CXH F;  1YEW A;  3ICX A;  3CB2 A;  3A0B Z;  1WNS A;  3UKM A;  5LGN A;  1GN6 A;  3J7A U;  3D8C A;  4F6E A;  1P7G A;  1W0K G;  5EIB D;  3JAT B;  5LHH A;  1VQ7 V;  1VQP V;  3JAK B;  4J80 A;  2BSK A;  4P2Z A;  4JAV A;  1KKC A;  1G8M A;  4ABM A;  3SYP A;  5IJ0 A;  1HR0 B;  1K73 W;  5JCO A;  4G28 B;  3T1C A;  4JTD B;  4PDM A;  1GM7 A;  4K0K O;  1WLE A;  3ASO C;  3QO7 A;  4JI2 O;  3TCU A;  4JI4 O;  1OCO C;  4KHP O;  4X62 O;  5HFL A;  3DC6 A;  4UXN A;  1XBL A;  3W7U A;  4L8J A;  1Z5W A;  2ITC C;  4O4H B;  2XT9 A;  4X66 B;  4PV1 B;  4PA9 A;  1UFI A;  4QPK A;  3TGU H;  1KKD A;  3H1H H;  3CRA A;  3F5T A;  4LF4 O;  5JCO C;  1VQN V;  2ZCE A;  1ZSP A;  1Q5O A;  1FXV A;  5H6R A;  3JD3 A;  1YJN V;  3CCL V;  1X59 A;  5BMV B;  3LNM B;  4AI8 A;  4LWS B;  2JRI A;  4WFB V;  5IYZ B;  1HNW O;  2MK3 A;  1KP2 A;  1NTM H;  1R3K C;  3IC7 A;  3BCC H;  3RYF A;  5TIS Z;  1F4M A;  5JVD B;  4OPH A;  1ZL8 A;  2E3C A;  3ZHQ A;  1IUR A;  3VOU A;  2FKX A;  3B8M A;  4ZI7 B;  5KAF Z;  3FB6 C;  1N0N A;  3RT3 C;  1WPX A;  3BA8 A;  5J2U A;  4FK5 C;  1GM9 A;  3L73 H;  3Q4H B;  1GN2 A;  1N4C A;  4DV4 B;  3HR0 A;  3WB2 A;  1S77 D;  1ZUQ A;  1FXK C;  1L1F A;  2DYS C;  5KMG B;  4DUZ B;  5D5P A;  1ZLZ A;  3G67 A;  2LP7 A;  3B4S A;  3O9O A;  4DV5 B;  5EC1 C;  4DR6 O;  1OCC C;  4NTW A;  2F95 B;  4U7O A;  1KD1 W;  1Y66 A;  3CCS V;  1TA8 A;  5JQG B;  5CA1 B;  1N33 B;  2HP8 A;  2JS3 A;  1WA8 B;  3CCR V;  5K1P A;  5H9C A;  2QA4 V;  3ETQ A;  4UCV A;  1SES A;  2VS0 A;  3MHS C;  3OGC C;  1DLB A;  5KHH A;  3SDL A;  1VIB A;  1NU1 H;  2YS8 A;  5JH7 B;  3ZCC A;  1YI2 V;  2Q0O C;  4WBN A;  5LMU O;  1Y4M A;  2P22 C;  3IAY A;  5KAI Z;  3RN4 A;  1XMO O;  3QO8 A;  1VQ8 V;  2DWE C;  1BQZ A;  1MAB G;  4ZKI A;  1EZJ A;  2ZM6 B;  2JDI G;  4PI0 A;  1XEQ A;  2N74 A;  5KX5 A;  1F51 A;  5GTH Z;  4ZHQ B;  2UXC O;  2Z3Y A;  3C3S A;  3A0R A;  4DO2 A;  1QR9 A;  4GYC B;  4EKW A;  5LBQ A;  2BSK B;  4WFH A;  3APO A;  3N2G B;  5LHI A;  4W4L A;  4O4J B;  4NKG B;  3I55 V;  4JI5 B;  3W7T A;  2UXB B;  2JS5 A;  3DC5 A;  4LC1 A;  5LA6 A;  2D3O W;  2R72 A;  4K35 A;  1GTO A;  1YSC A;  2PF4 E;  2QWP B;  3CRR A;  1OCO B;  4DR5 B;  1XNQ O;  4DR1 B;  5IYC O;  4U7N A;  3N2K B;  2BTO A;  2ZIM A;  1KBH A;  2CH7 B;  4H37 A;  3W7X A;  3STL C;  3E83 A;  4UCU A;  2X0L A;  1GM8 A;  1SQF A;  3VQW A;  1ORQ C;  3ZN1 A;  4TQD A;  3DTU B;  1IXB A;  4DK1 A;  5L3B A;  3E22 B;  4JYA O;  4UCT A;  1NH2 B;  4X62 B;  3ZMV A;  2M6Y A;  4JYA B;  4X66 O;  3LDC A;  4ASU G;  3B77 A;  3ZIA G;  2QWO B;  2X6B A;  3VQX A;  4FM0 A;  1H8E G;  3ABL C;  4UUJ C;  4KHP B;  4BIU A;  2JJ2 G;  3CRM A;  1H2G A;  1I0H A;  3RFR A;  5IJ9 B;  4DR7 O;  2G38 A;  4ZIB A;  1XOU A;  1KP3 A;  2ZNJ A;  4IT5 A;  4FVM A;  2RQ6 A;  4GKJ B;  1E1Q G;  1P84 F;  5B1B C;  3VQV A;  1A32 A;  2QKS A;  1K33 A;  3ZJZ A;  1IBM O;  4GKJ O;  4I55 B;  3AG3 B;  2QM8 A;  4DV1 B;  1N0J A;  1TAE A;  2B1I A;  4J41 A;  1BQ0 A;  1YIT V;  5GON B;  2Q7G A;  2GSM B;  2QWR B;  4JPR A;  5B3S C;  4JI1 B;  5FPR A;  3NXS A;  4X1K B;  1R6K A;  3H01 A;  2K1E A;  3RBZ A;  1R3L C;  1SQG A;  4FLU A;  1ZL8 B;  3QVN A;  4N21 A;  3SYO A;  5A2Q N;  2IW5 A;  5H5N A;  1JJO A;  2QGN A;  4LWS A;  1NTZ H;  1PL0 A;  4CH3 A;  1NR1 A;  3TXQ A;  2ODM A;  1QVG U;  4LFA B;  2QR4 A;  4O4I A;  2PZS A;  4LR3 A;  3LSS A;  4O4L A;  2RCV A;  3ABL B;  4LCU C;  3ZMT A;  1M9N A;  3PN1 A;  4B08 A;  4DYL A;  1AVM A;  2A7W A;  5B1N A;  2P6J A;  1M4U A;  4MW3 A;  2MW2 B;  5L3C A;  1WJZ A;  3RVY A;  1GN4 A;  1DTO A;  5CN0 A;  2BCC H;  3HKB B;  3K59 A;  4EEQ A;  1EN4 A;  3T1H B;  3K5O A;  3J81 N;  1F7Y A;  1SRY A;  2GHY A;  2HKO A;  5H2F Z;  2QWQ B;  3L74 H;  2GBO A;  1B6Q A;  3AG4 B;  1MOF A;  5IY5 B;  3H1I H;  3SJQ C;  2AZ0 A;  4X1Y B;  4JV5 O;  2EIJ C;  1K97 A;  2W6J G;  1OZ0 A;  3BY6 A;  3OMI B;  4HNA A;  3CMA V;  3OTO O;  1XNR B;  1GKF A;  5LHG A;  1WN7 A;  3FAV A;  5IJ9 A;  2DMX A;  4DV5 O;  3JSL A;  4Z1M G;  3G80 A;  3L75 H;  4YJ3 B;  4JZG A;  3K3W A;  2IM9 A;  3JD2 A;  1FJG O;  4EB6 B;  4TUY B;  1XNQ B;  1K5Q A;  1P49 A;  3ZX6 A;  3ZED A;  4OX9 B;  2IJI A;  4LFA O;  1I5X A;  1I08 A;  1JJ2 U;  3IGA C;  1FJG B;  4FZ1 A;  4UVC A;  4Z2W A;  3HKC A;  1BE3 H;  4BAY A;  4BR6 A;  3KG2 A;  2P5O A;  1AI5 A;  5IWA B;  3UCS C;  3HKD B;  4DV6 B;  1DF5 A;  3MDS A;  3K58 A;  3N2K A;  3CJH B;  1M5I A;  5B66 Z;  4J9Z B;  4QGP A;  1DF4 A;  1VQO V;  4MW8 A;  2YEV A;  4QNH B;  4RQF A;  5LOV A;  1W0J G;  1XHX A;  1VQ4 V;  4CH5 A;  4O4H A;  4UV8 A;  2ZE6 A;  4F6R A;  3K0G A;  4PI2 A;  1UJW B;  4IL6 Z;  1XMO B;  1TUB B;  4ZBM A;  4P30 A;  3ETE A;  4FLW A;  1FXH A;  4OX9 O;  1U97 A;  3NR7 A;  5DM6 V;  2E76 B;  1W2B U;  2ZE5 A;  1IXM A;  3TET A;  4FLX A;  1AJQ A;  3BFR A;  4X1I B;  1QCE A;  4FZ0 A;  3K08 A;  2YID A;  2NNU A;  1Y74 A;  3UQ8 A;  3D36 A;  3E8F A;  4LF5 O;  4F6R B;  1KYO F;  3ZHR A;  1NH2 D;  5LYJ B;  1KB9 F;  1VAR A;  1RSO B;  1NT2 B;  1FD9 A;  2P06 A;  3CJH A;  3K57 A;  1M57 B;  2AZ2 A;  1BHA A;  3ZHV A;  2WLN A;  4JI6 O;  4WBN B;  3HKE A;  1ENV A;  3ZRS A;  4MTO A;  1VF5 B;  1ZTE A;  2XOK G;  1QLE B;  2UUB O;  5EBW C;  3VBB A;  1NZ6 A;  1P4R A;  1FXK A;  5LGT A;  2OYQ A;  3EXA A;  2ZNI A;  1ARO P;  1D2D A;  4FLY A;  1AB3 A;  2IJH A;  5LMN O;  3KCY A;  2UUA B;  4GKK O;  1S72 V;  3WG7 C;  1L0N H;  4J42 A;  4LF6 B;  2WA4 A;  4L87 A;  5KLV H;  1NTK H;  3ZRW A;  4U3J B;  2E5L O;  5DN6 G;  4X1I A;  3ZN0 A;  4RQE A;  1KMI Z;  4U3J A;  4RUE A;  4X64 B;  2ZKO A;  2UXX A;  4LP8 A;  4J7K A;  4DK0 A;  1F4N A;  1YXB A;  4J7Z A;  3WU2 Z;  3AG4 C;  2Y4T A;  3CCU V;  1GRJ A;  2H94 A;  1AR1 B;  4FFB B;  1LR1 A;  5D5Q A;  1CXZ B;  1NQT A;  4MTG A;  1NI8 A;  3G71 V;  1PD3 A;  1YTF B;  1RPO A;  2WLH A;  3RYF B;  2ZXW B;  2XAQ A;  2ZD9 A;  3P3P A;  3ABU A;  3A2F A;  2VQE O;  4PHZ A;  2JEU A;  1NBM G;  2C2A A;  4QE7 A;  1XIL A;  1K34 A;  5IY5 C;  2YIA A;  2UUC B;  1AR4 A;  1TUE B;  3JAW A;  1RSO A;  3FB8 C;  3E2E A;  1TVK A;  1J5E O;  4IHJ B;  4TV9 B;  2Y0P A;  1MNG A;  5B1A C;  1PV0 A;  3JCZ A;  2LGQ A;  3W7W A;  4JYC A;  4IGG A;  2QDO A;  4DUY O;  1S0V A;  4D6T H;  4LF9 O;  4NXM O;  1US6 A;  4DR2 B;  2WLM A;  4I55 A;  4W4K A;  3RWR D;  5CBF A;  4PD4 F;  1JMK C;  2H8P C;  2LW1 A;  4DV3 O;  4MVS A;  2KB1 A;  3CC2 V;  2B1G A;  1NJI W;  1GAX A;  1FFT B;  2CAZ C;  4PA4 A;  4F4L A;  3SPI A;  3K03 A;  2JIZ G;  5KMG A;  2V7Q G;  3JAS B;  4AHC A;  5LMU B;  1H2L A;  5IWA O;  1WP7 A;  1QLN A;  4DR3 B;  1XUQ A;  5EBM C;  1Y76 B;  4DW1 A;  2HG5 C;  1Q3E A;  1QVF U;  4MSW C;  4TV8 A;  5B1B B;  4D7S A;  3M99 B;  1SZX A;  4O2B B;  2W6I G;  4FPP A;  3RW0 A;  1SF9 A;  2ETN A;  3G6B A;  1HDJ A;  1XRE A;  2EIL C;  2OWO A;  2IU0 A;  2DW4 A;  3DXR A;  2CGN A;  1MZF A;  4MVZ A;  4PDL A;  1IBK O;  3LSU A;  2EIN B;  4XDK A;  4EB6 A;  4TV8 B;  3K9S A;  4HAM A;  4WFF A;  5JJE B;  4PA7 A;  2OCC C;  4KXR A;  2E5L B;  3CRQ A;  1R6T A;  1R1B A;  2ADQ B;  3C90 A;  1OCZ B;  5KHG A;  1THZ A;  1XHZ A;  5L3F A;  2AHY A;  1KQS U;  5IE9 A;  4BW9 A;  4O4J A;  3CS5 A;  1HNZ B;  1M56 C;  4KUM A;  3E8H A;  1TUB A;  1MZE A;  3OW2 U;  4I50 B;  2YSU B;  4IIJ B;  2FYU H;  3CXC U;  4I9Q A;  4TT3 G;  2UXD O;  2ADP A;  1AI4 A;  2Q6A A;  4NXN B;  3CEI A;  2F4V O;  2K9P A;  4MVU A;  2DE0 X;  3FYI B;  4UB8 Z;  4FJC C;  3K04 A;  3RYI A;  5BY1 A;  4I5S A;  1OCR B;  4IHJ A;  2DYR B;  3ETD A;  3SPC A;  2AW9 A;  2XHB A;  3ZRX A;  5F2V O;  2EIL B;  4X9Q A;  3ABM B;  1SZT A;  4GLX A;  3WB1 A;  2EZO A;  4G27 B;  4JI7 B;  3KZI Z;  5BR8 B;  2Z0A A;  2ZT9 B;  4JI8 O;  3AK1 A;  4DV1 O;  4DV0 O;  3ASN B;  1GMG A;  1IBM B;  2DYR C;  4GT1 A;  1QNM A;  3TXS A;  2UXC B;  5GON A;  5H6Q A;  4EFE A;  2Q8V A;  3D3Q A;  2F4V B;  3L72 H;  1SQV H;  3OEH G;  1O9H A;  3H1J H;  2PYL A;  2YIC A;  2F66 C;  3D36 C;  4B3S O;  4DR7 B;  3OUS A;  4K8Z A;  4DV7 O;  3CC4 V;  4JF3 A;  3OMN B;  2LW7 A;  4DRX B;  5J2U B;  4KP4 A;  3Q4H A;  4Q20 A;  4PDR A;  2RNB A;  1QR8 A;  1RPR A;  3T4D A;  2HHH O;  4WFG A;  3UO2 A;  1AI6 A;  2OIG A;  3OFN G;  2P90 A;  1MSD A;  3FB7 C;  2QJ1 A;  3IFX A;  3SR2 C;  1VQ6 V;  5CA3 A;  4I4T B;  4TV9 A;  2D2C B;  1VQ9 V;  3THO A;  2L6L A;  2HJF C;  1VMG A;  2QEX V;  1QBZ A;  3VQY A;  3RYC B;  3BRC A;  1QU7 A;  2BE3 A;  5JH7 A;  4YY3 B;  1GK9 A;  2A06 H;  3ZRV A;  3OAA G;  3MAQ A;  2OTL V;  3DSQ A;  1V54 C;  2WAM A;  3K9A A;  4I4T A;  1I7F A;  1WPB A;  2PTM A;  3CD6 V;  4JAA A;  3CRC A;  4DV6 O;  2Q5Z A;  4X89 A;  3AG2 B;  3SJC C;  1JFF B;  3CHX A;  1YJ9 V;  5EBL C;  1YIJ V;  1MG1 A;  4H44 B;  4FLT A;  2LO1 A;  5CA1 A;  5IJ0 B;  3CX5 F;  4LH7 A;  3T1Y B;  2ZM6 O;  5EZY A;  3N27 A;  4PDV A;  3JAK A;  1YTF D;  2V1D A;  3AG1 B;  3AEI A;  1S76 D;  4BIZ A;  1YVW A;  4WFA V;  1KU9 A;  3OUF A;  1IBK B;  1B04 A;  2BTQ A;  2WLI A;  4LFB B;  1CP9 A;  3ZHS A;  5KHK A;  1JX9 A;  5B1A B;  2VQF O;  1OCR C;  2IH3 C;  4DUZ O;  4DR3 O;  2R9A A;  3EFF K;  3UO3 A;  2ZIO A;  4R6Z A;  3E89 A;  3A8T A;  3JYC A;  1SQX H;  4J11 A;  3R66 A;  2BOC C;  2DOS A;  1D5N A;  4JZ2 A;  1ZWI C;  3BHP A;  1VP7 A;  4JAU A;  4CBC A;  3JAW B;  3CCQ V;  2IU3 A;  4MT8 A;  3OE7 G;  4X8A A;  4LF9 B;  1AJN A;  1Y76 A;  3RYI B;  3P3N A;  4MVM A;  4UVB A;  1JA8 A;  4TUY A;  2V4D A;  4GX2 A;  4HNA B;  5K1X A;  4NR1 A;  2LJ2 A;  2Q73 A;  1H2S B;  5BXZ A;  2CTQ A;  4LNU A;  2XAS A;  3J80 N;  2LQT A;  2DN9 A;  2YI9 A;  4JI4 B;  2HHH B;  1JVM A;  3SPH A;  1B3Q A;  4CC6 A;  2UUC O;  1Q86 W;  1H38 A;  1M1K W;  1B06 A;  3C3T A;  4IIJ A;  2ZE7 A;  3ZMS A;  5KA5 A;  4RO2 A;  2ZDI C;  4D7T A;  3MHH C;  4RUF A;  2A0L A;  4O2A B;  5DED A;  2Q0A A;  2Q7H A;  4MTF A;  1V54 B;  2GV9 A;  2R9R B;  2DWD C;  2YXH A;  2YI8 A;  3OR7 C;  4OXS A;  3U0Z A;  3K5N A;  3H9V A;  1N34 B;  2HVJ C;  1HR0 O;  3RYH B;  5KX5 B;  2XTA A;  1NKD A;  4B3S B;  4MVO A;  1FFX A;  2QM4 A;  1Q6H A;  3E86 A;  3T2M A;  2QTS A;  3LSQ A;  4KFM A;  2CTP A;  1PPJ H;  2WSS G;  3CCE V;  1LUV A;  3CWB H;  3DXR B;  4I7Z B;  2KG7 A;  4QIW F;  1WAZ A;  4UCS A;  4I9W A;  4J10 A;  3FYE B;  3E35 A;  1URF A;  1MSW D;  4HYO A;  4JI7 O;  5CMU A;  2ILM A;  5EC2 C;  5EYP B;  4LF7 O;  3BAA A;  1Y6X A;  4YIO A;  1HNW B;  2EIK B;  1E79 G;  2H3O A;  3H1L H;  1IZ3 A;  1JQ0 A;  1RP3 B;  2Y48 A;  3FAV B;  4YHH O;  1M90 W;  5A9G A;  2UXD B;  1LNQ A;  4K8X A;  2WLK A;  2ATK C;  1M93 A;  2EJR A;  4X1Y A;  4JTC B;  3AG1 C;  4MTX A;  5IYD O;  4GUN A;  4CS4 A;  5JJN B;  1S5H C;  4LFB O;  2QWN B;  3WFV A;  4UV9 A;  4LF8 B;  4UB6 Z;  1N32 O;  1M56 B;  2JK5 C;  1KEC A;  3OTF A;  4R8C A;  4NTY A;  4YIP A;  1VF7 A;  3FFQ A;  2F43 G;  4ZHQ A;  1GH6 A;  3M8A A;  1TVK B;  3EVK A;  3AG2 C;  5JVD A;  3AK2 A;  2AHZ A;  2N05 A;  1L8D A;  4CC5 A;  3IC9 A;  4MVQ A;  3OT7 A;  4PJ0 Z;  2IBZ H;  1SA0 A;  1K8A W;  1BZK A;  1Q6U A;  2PI4 A;  4Z1V A;  5KA6 A;  5CBH A;  2WA3 A;  1KUQ A;  3EHB B;  3GVM A;  5EIB C;  3F7V C;  2B5U A;  1PNK A;  4FLZ A;  1R73 A;  1SKV A;  2CK3 G;  4LFC O;  3CCM V;  2ZR2 A;  1Z5V A;  2EIN C;  1XMQ O;  5JJJ B;  4FM1 A;  1K3E A;  2JVD A;  4I50 A;  4WFE A;  4FMT A;  4IYH A;  2HVK C;  1Y74 B;  2F93 B;  2QE7 G;  4TWK A;  1VEW A;  1AI7 A;  1OV9 A;  1NS1 A;  3ML0 A;  4J7J A;  4TQF A;  5JWP A;  4BWA A;  1RM1 B;  3MD0 A;  3ZMU A;  3ZRW B;  3JAT A;  1WB7 A;  2VWJ A;  2YIB D;  3OEE G;  2HJD A;  1YDX A;  1IDS A;  2KQX A;  2R9I A;  2WLL B;  3K5M A;  4DR2 O;  2PGG A;  2EBO A;  4JI1 O;  3CE2 A;  2LFR A;  4YXW G;  4CS2 A;  4DUY B;  4J9Y B;  2AXT Z;  5L3D A;  1BSM A;  2Q67 A;  5LGU A;  3K06 A;  1SER A;  2JEX A;  1XL4 A;  1MMM A;  1SA0 B;  5EYP A;  4LFC B;  3B09 A;  1YHQ V;  1J5E B;  1S5L Z;  1SQB H;  1Q90 D;  2Q4P A;  1AP6 A;  1G6U A;  2LFS A;  5ITZ B;  4GZR B;  3HKE B;  2GDS A;  2WLJ A;  2KG7 B;  1BCC H;  1OCC B;  2FB5 A;  4JI8 B;  1FYJ A;  2OIE A;  1EN5 A;  2RMK B;  3G6E V;  4MVR A;  3ABK B;  5LP6 C;  1PNL A;  1XL6 A;  4NVP A;  3GWO A;  1Q82 W;  1N36 B;  1AP5 A;  1PL4 A;  2BTQ B;  5LMN B;  3GWK C;  2YUA A;  2WLL A;  3AK3 A;  4UVA A;  2UXN A;  3K79 A;  3LUT B;  4ZOL A;  3IJ4 A;  5EZY B;  2JGD B;  2DQ0 A;  3SPJ A;  5C8Y B;  4YY3 O;  1RM1 C;  1O9G A;  4JYY A;  3B2E E;  4B3T B;  1SQQ H;  1SET A;  3JAL A;  3CP1 A;  2VWK A;  2Q68 A;  4YJ2 B;  2PYJ A;  4LBE C;  4FIP C;  4XDL A;  4QPJ A;  1Q8I A;  3E8G A;  1CEZ A;  2EIM C;  1JFF A;  2KSD A;  1BT8 A;  2FTK A;  1I94 B;  2XAH A;  1V55 C;  4X88 A;  2LGW A;  5C93 A;  3KCX A;  1YJW V;  3ZHU A;  1VQL V;  1K4D C;  3QO5 A;  1LUW A;  1I94 O;  4GKK B;  2DJV A;  2QTO A;  3B8N A;  3K0D A;  2CGO A;  4I0X B;  4K3A A;  5LOV B;  4X65 B;  5DEC A;  3CME V;  3QF7 A;  1G4Y B;  4PA3 A;  4UFZ A;  3SYC A;  5BMV A;  5KHI A;  1N32 B;  4P9O A;  1WP8 A;  3K5L A;  4B3R B;  1N8R W;  4TSF G;  5LXT A;  3RVZ A;  1H8H G;  2YIB A;  4AIL C;  2YDE A;  4CS3 A;  1PM9 A;  2CE4 A;  1IVS A;  5LP6 B;  2EUL A;  2YXY A;  4U3F H;  1IBL B;  1JOY A;  3U11 A;  3JD1 A;  3CPW U;  5CB4 A;  4X20 B;  4NTX A;  4X64 O;  4QJF B;  1M57 C;  3A0H Z;  1AIL A;  2HLD G;  5JQG A;  2E74 B;  4JI3 B;  4UCR A;  4DV0 B;  1HNZ O;  5J2T B;  4DR4 B;  1FS0 G;  2WWW A;  2EJ7 A;  2E75 B;  5FL7 G;  3QTC A;  2BOB C;  2GUZ B;  2YC0 A;  3LDE A;  4NB5 A;  1ZX3 A;  2CDY A;  1EN6 A;  1GO3 F;  3L70 H;  5J2T A;  4Q6G A;  2GUZ A;  4NXN O;  4E4E A;  4X20 A;  5CB4 B;  1H2M A;  3E8B A;  3UT5 A;  3WG7 B;  1EFR G;  2RN9 A;  3QNE A;  3H1K H;  5AG2 A;  4ZI7 A;  1TGO A;  2FML A;  2EIK C;  1W59 A;  3BEH A;  5LP6 A;  3OM3 B;  4CH4 A;  1D5A A;  1X4T A;  2UXB O;  2RDC A;  4HBN A;  1XNR O;  3FKS G;  1QQC A;  2QM7 A;  1FXK B;  4DR1 O;  1SS3 A;  2KKW A;  4B3M O;  4IYI A;  4O4I B;  5CA0 A;  5LL6 Y;  5FNV B;  3HB3 B;  3ABT A;  3TK1 A;  3JD4 A;  1DK1 A;  1K92 A;  1XQ8 A;  3OD4 A;  4XDJ A;  3X2Q C;  2EIM B;  4X1K A;  1ZAU A;  5IDJ A;  1FFX B;  1Q6I A;  2F1M A;  2Z5U A;  2EZP A;  1CPY A;  5KUM A;  5B3S B;  3CC7 V;  2Q69 A;  3BVO A;  4R50 A;  3ASN C;  3BA9 A;  4OPA A;  1JCH A;  4JYB A;  2OTJ V;  2P4V A;  4R7C A;  3JAL B;  2ZIN A;  3TJT A;  4DV3 B;  1XMQ B;  4G2K A;  5IYB O;  1IBL O;  4YJ2 A;  2DYS B;  3S3W A;  5GTI Z;  4OGQ B;  1EZV H;  4JV5 B;  2Y0I A;  3HPL C;  4JAS A;  3T1Y O;  5C8Y A;  3G4S V;  2YEV B;  3O65 A;  3SYA A;  3ZMZ A;  1BS3 A;  3W7S A;  1SQP H;  4BIO A;  1YF2 A;  2RJZ A;  2ZQM A;  3T1H O;  3DGE A;  2M7W A;  1Q7Y W;  1HWY A;  4B3M B;  2Y69 C;  5FPO A;  4PEL A;  4K0K B;  1E1R G;  3M7M X;  3HKC B;  2VQE B;  3F5W C;  3AG7 A;  4NXM B;  4H13 B;  4GCZ A;  1QHT A;  2CTR A;  3GB7 C;  1G1X B;  4LF8 O;  3CCV V;  3BPZ A;  4RWU A;  4B3R O;  3OGI B;  2DQ3 A;  2IH1 C;  2P4K A;  4AQY O;  1XI1 A;  3S3X A;  4B3T O;  4B7K A;  2ARH A;  1WA8 A;  5BR8 O;  1SC5 B;  3T4Z A;  2X6C A;  4I0X A;  2O57 A;  1V55 B;  2NN4 A;  1GN3 A;  3ABK C;  3JAS A;  3R65 A;  4JI6 B;  3UT5 B;  5BZB A;  1UPG A;  2UU9 B;  4YHH B;  2CTW A;  4LF7 B;  4GX0 A;  4X65 O;  3SPG A;  4WCE V;  1H2K A;  2ZXW C;  2GTS A;  4A5U B;  3P30 A;  4HZ3 A;  3KKY A;  3HKB A;  3N2G A;  2JGU A;  3JCU Z;  1HP8 A;  1IX9 A;  4FFK A;  3L9D A;  1NVP D;  2A9H A;  2Y4U A;  1BHB A;  2XND G;  4JTA B;  1K4C C;  2PI5 A;  4QE9 A;  4AQY B;  4TOI A;  4BW5 A;  3X2Q B;  1VQM V;  5HFM A;  4RAI A;  4JI5 O;  1FPO A;  2ZE8 A;  3ZHT A;  2X6A A;  2FL4 A;  1YCI A;  2P7T C;  5CA0 B;  3LDD A;  5FLX N;  1HNX B;  5L3E A;  2QKC A;  1N34 O;  1VF6 C;  4JI3 O;  1F23 A;  4DW0 A;  1N36 O;  1AJP A;  1S3J A;  2ITD C;  2Q9L A;  1VF6 A;  2UUA O;  4DV2 B;  1HNX O;  4ICG A;  4JI2 B;  4JI0 B;  1R3J C;  3B40 A;  3P32 A;  1XDC A;  3SJA C;  4LF6 O;  3CCJ V;  2VQF B;  4N23 A;  5IT9 N;  1K5S A;  1PP9 H;  4EFB A;  4PA6 A;  5KHJ A;  4GX5 A;  2HFE C;  2WLI B;  1VQ5 V;  2ZDI A;  1BMF G;  4FFB A;  3CSX A;  3ABM C;  2X7R B;  2R70 A;  4DR5 O;  1R3I C;  1H2N A;  2XAG A;  3FB5 C;  2XAF A;  4XBF A;  4CH6 A;  2N04 A;  2QKA A;  2UUB B;  3WB0 A;  2AGA A;  5CBG A;  2JGD A;  4GX1 A;  1K9M W;  2GTA A;  1KC8 W;  2PUS A;  1NVP B;  2HEP A;  1DGS A;  4NYK A;  3I56 V;  2Y69 B;  2YXL A;  3ASO B;  3E22 A;  2WPD G;  3D3I A;  4UCO A;  3FX7 A;  3PJS K;  2UU9 O;  5J9P C;  4KL1 A;  2F23 A;  3SYQ A;  1AR5 A;  4B7E A;  2OT5 A;  3JAR A;  3RGB A;  3JAM N;  1PNM A;  2W0F C;  4LF5 B;  1OHH G;  3I5D A;  2JJ1 G;  4MS2 A;  5LXT B;  4E2L A;  1U96 A;  2CH7 A;  2CUG A;  2A3Q A;  4H33 A;  2VRZ A;  5IYZ A;  4P9P A;  1Q81 W;  2PY5 A;  4O4L B;  3JD0 A;  3APQ A;  2B9Z A;  5LA6 B;  3SJB C;  3CYO A;  4DR6 B;  3RYH A;  5LYJ A;  3L71 H;  1COW G;  5KUK A;  3OTO B;  3STZ C;  4H0L B;  1PKX A;  1J95 A;  3UM7 A;  1R6N A;  5E1A C;  1YZB A;  2IJJ A;  1VQK V;  2OCC B;  4DR4 O;  2IJK A;  3LNN A;  1JR9 A;  2OCH A;  5L3G A;  1OCZ C;  4DV2 O;  3ZS8 C;  5E79 Z;  1N33 O;  1MA1 A;  1BGY H;  2NR5 A;  1I5Y A;  2Q7E A;  3JAR B;  1S5J A;  3U10 A;  4DRX A;  1QLE C;  3BAB A;  2A79 B;  4O2A A;  4JGS A;  5B1O A;  1T5E A;  1FAF A;  4DV7 B;  1Q43 A;  2QSA A;  1BL8 A;  3F7Y C;  4WF9 V;  3FD9 A;  4LNU B;  1EBO A;  3SGI A;  1NR7 A;  4CZZ A;  1ROP A; 
#chains in the Genus database with same CATH homology
 3AG3 C;  4LBE C;  1JPX A;  2EIJ C;  1K97 A;  4FIP C;  4KP4 A;  2HR3 A;  4XDL A;  2EIJ B;  3OR6 C;  2W6J G;  4PDR A;  4Q20 A;  1OZ0 A;  3BY6 A;  3E8G A;  3OMI B;  4QPJ A;  3CMA V;  2EIM C;  1CEZ A;  1QR8 A;  1GKF A;  5LHG A;  1RPR A;  3T4D A;  2XAJ A;  4WFG A;  1AI6 A;  2FTK A;  4DXW A;  2XAH A;  4Z1M G;  1V55 C;  4X88 A;  3OFN G;  5C93 A;  2P90 A;  1YJW V;  3FB7 C;  3K3W A;  1K4D C;  1VQL V;  3IFX A;  3JD2 A;  1VQ6 V;  3QO5 A;  5CA3 A;  3OMA B;  1K5Q A;  5GW7 A;  2IJI A;  2QTO A;  3B8N A;  3K0D A;  1I5X A;  3CME V;  1VQ9 V;  1JJ2 U;  3IGA C;  1G4Y B;  4PA3 A;  4UVC A;  3SYC A;  1P7B A;  2HJF C;  4BAY A;  2P67 A;  2QEX V;  1QBZ A;  3ETG A;  4P9O A;  3KG2 A;  1N8R W;  2NLJ C;  5EK0 A;  1AI5 A;  4TSF G;  3RVZ A;  1H8H G;  1NR7 A;  1GK9 A;  1DF5 A;  3ZRV A;  2ZR3 A;  3OAA G;  2OTL V;  1V54 C;  2WAM A;  3K9A A;  1K7D A;  3CD6 V;  4J9Z B;  1VQO V;  1DF4 A;  1JOY A;  4MW8 A;  2YEV A;  4QNH B;  4RQF A;  3JD1 A;  3CPW U;  3UKM A;  5LGN A;  1W0J G;  4X89 A;  3AG2 B;  4QJF B;  1VQ4 V;  1M57 C;  1YJ9 V;  5EBL C;  2HLD G;  1YIJ V;  1MG1 A;  4UV8 A;  3K0G A;  1W0K G;  1UJW B;  5LHH A;  1VQ7 V;  1VQP V;  1FS0 G;  2WWW A;  3ETE A;  4P30 A;  1FXH A;  4ZBM A;  5FL7 G;  4P2Z A;  2BOB C;  4JAV A;  1G8M A;  5DM6 V;  3SYP A;  3LDE A;  1W2B U;  1IXM A;  1K73 W;  4PDV A;  3TET A;  1AJQ A;  1GO3 F;  4G28 B;  3T1C A;  4JTD B;  4PDM A;  1GM7 A;  2V1D A;  3AG1 B;  3AEI A;  1YTF D;  1S76 D;  4BIZ A;  4WFA V;  1WLE A;  3OUF A;  3ASO C;  1QCE A;  3QO7 A;  3TCU A;  1OCO C;  3E8B A;  3K08 A;  5HFL A;  2NNU A;  2WLI A;  1CP9 A;  3D36 A;  3WG7 B;  4UXN A;  1EFR G;  3QNE A;  3E8F A;  3W7U A;  1JX9 A;  2EIK C;  5B1A B;  2ITC C;  3BEH A;  1OCR C;  2IH3 C;  3OM3 B;  1NH2 D;  3EFF K;  4R6Z A;  4PA9 A;  3E89 A;  4QPK A;  1M57 B;  3FKS G;  1BHA A;  2WLN A;  1KKD A;  2QM7 A;  1FXK B;  3JYC A;  1VQN V;  1ENV A;  3ZRS A;  1FXV A;  2BOC C;  4MTO A;  5H6R A;  3JD3 A;  2XOK G;  1QLE B;  5EBW C;  1ZWI C;  1YJN V;  3VBB A;  4JAU A;  4CBC A;  1P4R A;  3CCL V;  3CCQ V;  2IU3 A;  4MT8 A;  3LNM B;  1FXK A;  3OE7 G;  3HB3 B;  5LGT A;  4WFB V;  3ABT A;  4X8A A;  3TK1 A;  2MK3 A;  3JD4 A;  1K92 A;  1ARO P;  4XDJ A;  3X2Q C;  1AJN A;  2EIM B;  5IDJ A;  1KP2 A;  4MVM A;  2IJH A;  1R3K C;  3IC7 A;  1F4M A;  4UVB A;  2Z5U A;  2EZP A;  1CPY A;  4GX2 A;  5KUM A;  1S72 V;  5B3S B;  3WG7 C;  3CC7 V;  2Q69 A;  4R50 A;  3VOU A;  3ASN C;  3B8M A;  1JCH A;  4L87 A;  3FB6 C;  4JYB A;  2OTJ V;  4R7C A;  2XAS A;  3ZRW A;  1WPX A;  4G2K A;  1JVM A;  3SPH A;  5IYB O;  5DN6 G;  4FK5 C;  1Q86 W;  1GM9 A;  1H38 A;  2DYS B;  1M1K W;  3ZN0 A;  4RQE A;  1S77 D;  1FXK C;  1L1F A;  2DYS C;  3ZMS A;  3HPL C;  5KA5 A;  4JAS A;  2LP7 A;  4RUE A;  4RO2 A;  2ZDI C;  2UXX A;  4LP8 A;  5EC1 C;  3MHH C;  2YEV B;  3G4S V;  4RUF A;  2A0L A;  1F4N A;  1OCC C;  3SYA A;  3W7S A;  3ZMZ A;  4U7O A;  1KD1 W;  1Y66 A;  3AG4 C;  3CCS V;  3CCU V;  2H94 A;  4MTF A;  1V54 B;  2R9R B;  2DWD C;  4OXS A;  3OR7 C;  2ZQM A;  1AR1 B;  3DGE A;  1NQT A;  2HVJ C;  2M7W A;  1Q7Y W;  1HWY A;  4MTG A;  3G71 V;  1PD3 A;  2Y69 C;  3CCR V;  1YTF B;  1RPO A;  1NKD A;  2WLH A;  2ZXW B;  4MVO A;  5H9C A;  2QA4 V;  4PEL A;  1E1R G;  2XAQ A;  2ZD9 A;  3E86 A;  1SES A;  3MHS C;  3T2M A;  3ABU A;  3F5W C;  3OGC C;  3LSQ A;  1DLB A;  4GCZ A;  4KFM A;  2WSS G;  3CCE V;  2JEU A;  3GB7 C;  1NBM G;  2C2A A;  4QE7 A;  1K34 A;  3CCV V;  3ZCC A;  4QIW F;  1YI2 V;  1Y4M A;  4I9W A;  5IY5 C;  2DQ3 A;  2IH1 C;  3FYE B;  3E35 A;  1TUE B;  1MSW D;  4HYO A;  3FB8 C;  3QO8 A;  5CMU A;  1VQ8 V;  3E2E A;  3T4Z A;  2DWE C;  2X6C A;  5EC2 C;  1V55 B;  2EIK B;  1MAB G;  5B1A C;  1E79 G;  4ZKI A;  3JCZ A;  3ABK C;  1EZJ A;  3R65 A;  3W7W A;  5BZB A;  2JDI G;  1JQ0 A;  2Y48 A;  4JYC A;  1S0V A;  4GX0 A;  1M90 W;  3SPG A;  1F51 A;  4WCE V;  1LNQ A;  2Z3Y A;  2WLM A;  2ZXW C;  3P30 A;  4HZ3 A;  3A0R A;  4DO2 A;  2WLK A;  5CBF A;  2ATK C;  2EJR A;  5IYD O;  4JTC B;  3AG1 C;  1QR9 A;  4MTX A;  2H8P C;  1S5H C;  4EKW A;  5LBQ A;  1NVP D;  4MVS A;  2A9H A;  4WFH A;  3WFV A;  2KB1 A;  3CC2 V;  2B1G A;  2XND G;  1NJI W;  4JTA B;  4UV9 A;  1BHB A;  1FFT B;  1K4C C;  4PA4 A;  5LHI A;  4F4L A;  2PI5 A;  4QE9 A;  3SPI A;  3K03 A;  2JIZ G;  1M56 B;  2JK5 C;  1KEC A;  3I55 V;  2V7Q G;  4R8C A;  4BW5 A;  3W7T A;  3X2Q B;  1VQM V;  4LC1 A;  2D3O W;  5HFM A;  2F43 G;  1GTO A;  1YSC A;  4RAI A;  1QLN A;  5EBM C;  1OCO B;  3AG2 C;  2HG5 C;  1QVF U;  4MSW C;  5IYC O;  4U7N A;  5B1B B;  2AHZ A;  4H37 A;  3W7X A;  3STL C;  3M99 B;  2X6A A;  2P7T C;  3E83 A;  3LDD A;  2W6I G;  4FPP A;  4MVQ A;  5L3E A;  1K8A W;  2X0L A;  3RW0 A;  1GM8 A;  2PI4 A;  1F23 A;  1ORQ C;  5KA6 A;  5CBH A;  3ZN1 A;  3EHB B;  1AJP A;  3F7V C;  1S3J A;  2B5U A;  2ITD C;  3DTU B;  1PNK A;  2EIL C;  2IU0 A;  2DW4 A;  1R73 A;  5L3B A;  2CK3 G;  3CCM V;  4MVZ A;  4PDL A;  2ZR2 A;  1NH2 B;  2EIN C;  3ZMV A;  3LDC A;  2EIN B;  4XDK A;  1R3J C;  4ASU G;  3P32 A;  3B77 A;  3ZIA G;  1K3E A;  4HAM A;  4WFE A;  4WFF A;  2X6B A;  3CCJ V;  4FMT A;  1H8E G;  3ABL C;  2HVK C;  4N23 A;  4UUJ C;  4PA7 A;  1K5S A;  4BIU A;  2JJ2 G;  1H2G A;  2OCC C;  4PA6 A;  4GX5 A;  2HFE C;  2QE7 G;  2WLI B;  4TWK A;  1VQ5 V;  2ZDI A;  1BMF G;  1KP3 A;  1OCZ B;  1THZ A;  1AI7 A;  5L3F A;  2AHY A;  3ABM C;  1KQS U;  2X7R B;  3ML0 A;  1E1Q G;  5B1B C;  1R3I C;  2QKS A;  2XAG A;  3FB5 C;  2XAF A;  4XBF A;  1RM1 B;  3MD0 A;  3ZMU A;  1K33 A;  3ZRW B;  1M56 C;  4KUM A;  5CBG A;  3ZJZ A;  4GX1 A;  3E8H A;  1K9M W;  1KC8 W;  3OW2 U;  1NVP B;  3AG3 B;  2QM8 A;  3OEE G;  2YSU B;  3CXC U;  2B1I A;  2R9I A;  4TT3 G;  2WLL B;  1YIT V;  3I56 V;  2EBO A;  2Y69 B;  1AI4 A;  2GSM B;  2Q6A A;  3ASO B;  2WPD G;  3D3I A;  3PJS K;  4JPR A;  4MVU A;  2LFR A;  3FYI B;  4YXW G;  5B3S C;  5J9P C;  4FJC C;  4J9Y B;  3SYQ A;  3NXS A;  2OT5 A;  3K04 A;  5L3D A;  1R6K A;  3H01 A;  1PNM A;  2Q67 A;  5LGU A;  2K1E A;  3K06 A;  2W0F C;  3RBZ A;  1OHH G;  1OCR B;  4I5S A;  1SER A;  1R3L C;  2JEX A;  1XL4 A;  2JJ1 G;  2DYR B;  3ETD A;  4N21 A;  3SPC A;  3SYO A;  1YHQ V;  2IW5 A;  3ZRX A;  4MS2 A;  4E2L A;  2EIL B;  4H33 A;  2LFS A;  3ABM B;  1PL0 A;  1SZT A;  4P9P A;  1Q81 W;  1NR1 A;  2EZO A;  2WLJ A;  4G27 B;  3JD0 A;  1QVG U;  1OCC B;  3CYO A;  1COW G;  3ASN B;  3LSS A;  5KUK A;  1GMG A;  4MVR A;  3G6E V;  3ABL B;  3ABK B;  4LCU C;  3STZ C;  3ZMT A;  1M9N A;  1PNL A;  1XL6 A;  1PKX A;  1J95 A;  5B1N A;  2DYR C;  2P6J A;  3UM7 A;  3GWO A;  1Q82 W;  1R6N A;  5E1A C;  4GT1 A;  4MW3 A;  2IJJ A;  5H6Q A;  5L3C A;  1VQK V;  2OCC B;  2IJK A;  3RVY A;  1DTO A;  2WLL A;  3OEH G;  5CN0 A;  5L3G A;  4UVA A;  1OCZ C;  2UXN A;  3K79 A;  3LUT B;  2DQ0 A;  3SPJ A;  1I5Y A;  1SRY A;  2GHY A;  1QLE C;  3OUS A;  2A79 B;  2HKO A;  1RM1 C;  4JGS A;  5B1O A;  3CC4 V;  1BL8 A;  1B6Q A;  3AG4 B;  3F7Y C;  4WF9 V;  1SET A;  4JF3 A;  1MOF A;  3OMN B;  1EBO A;  5IY5 B;  3CP1 A;  2Q68 A;  4CZZ A;  3SJQ C;  1ROP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...