1KC8W

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kc8W00
3CC2V 1VQ6V 1W2BU 1VQ4V 1M1KW 1VQ9V 1VQNV 1JJ2U 3CPWU 2D3OW 1Q86W 1KQSU 3OW2U 3G4SV 1S72V 3CCLV 1YIJV 1YHQV 1K73W 1K9MW 1VQ8V 2OTLV 3CCSV 1VQ5V 1Q82W 1VQMV 3CCVV 1VQLV 3CC7V 1K8AW 1VQOV 1YI2V 3CCQV 1YITV 1M90W 4WFAV 1YJNV 1VQPV 3CC4V 1QVFU 2OTJV 3CCMV 3CCEV 3CMAV 1Q7YW 1NJIW 1KC8W 1YJWV 3CCRV 1N8RW 1VQKV 1KD1W 3CCJV 3I56V 1VQ7V 2QA4V 3G6EV 1Q81W 4WF9V 2QEXV 3CCUV 3I55V 4WFBV 1R73A 5DM6V 3G71V 4WCEV 3CXCU 1YJ9V 3CD6V 3CMEV 1QVGU
chains in the Genus database with same CATH superfamily
3K03A 1Y74B 1AB3A 4MTGA 1KP3A 4DR1O 3SJQC 4DW1A 4DV5B 4A5UB 4JZGA 4B3MB 3RN4A 3JAKA 2Z0AA 4R8CA 4F4LA 2G38A 3BFRA 3SJBC 1L0NH 3SPCA 2JS5A 2CTQA 3OEHG 4CH3A 5KA5A 1P84F 3EVKA 1H2GA 1WN7A 2L6LA 3WFVA 4R7CA 4LFCB 2UUAO 1TUBB 5KUMA 2A06H 2ARHA 4UCUA 1IURA 3AG2B 4I50A 4EKWA 1GM8A 2E76B 4MW3A 4CS4A 3PN1A 4TV9A 1AR1B 3W7WA 3G80A 4Q20A 3RGBA 4JASA 5IYZA 2B1IA 1YTFB 2WLJA 2ZNIA 2VQEB 3I5DA 4U3FH 2M6YA 2VRZA 4UVAA 4NXNB 3RYCA 3OMIB 5EYPA 1N8RW 5B5EZ 1G1XB 3DXRA 4JI7B 1CP9A 3T1CA 4ZHQA 4DV5O 5EZYB 2QSAA 5CA0B 5LHIA 1Z2GA 5IWAO 3ABKC 4U3JA 4CH6A 1TGOA 3B40A 3SJAC 4X20A 1NI8A 1AR5A 2ZE7A 3CCMV 4FFBB 4F6RB 1Z5VA 5CB4A 2Q8VA 3APQA 2IJHA 3OTOB 2R9IA 4QE7A 4LF4B 3ETDA 4LFCO 2F43G 3OTFA 4KFMA 3ZHQA 4DXWA 4MVOA 4ZI7A 1NH2D 4L87A 5LMNB 4O2AA 5KHGA 1WLEA 3CXHF 4NYKA 1N33B 4H44B 4PDLA 1S3JA 4MVUA 1G4YB 1T5EA 2YEVA 1ZAUA 1XMOB 1KECA 4Z1VA 1JOYA 1GM7A 2VQEO 4X65B 3HKEB 3U0ZA 1O9HA 5H6RA 1PP9H 5L3GA 2QTSA 3GB7C 3F5WC 4U7OA 4DV1O 3LNMB 4UV8A 4TV8A 4DK0A 1XNRB 3CCJV 1QCEA 3CCUV 3HPLC 3ML0A 1DF4A 4QPJA 1RSOB 2EJRA 1XDCA 3MD0A 5J2TA 4BW9A 5IE9A 4WFFA 5BR8B 4LH6A 2KG7A 3CPWU 2VQFO 5FPOA 3E83A 1F4NA 4EB6A 3OTOO 3L71H 1SQGA 4LF4O 3D3IA 1SQPH 2LW1A 1MA1A 1HR0B 1NKDA 5LMNO 2ITDC 4CZZA 2PYLA 3AG4C 3ZN0A 4LWSA 2IM9A 3LSSA 4CC5A 3Q4HA 4ZBMA 2CK3G 4DUYB 5C8YA 5CA1B 4DR2B 2JEXA 3FB7C 4J9YB 3CE2A 4MT8A 2JS3A 4O4LB 2ADPA 3JASA 3OE7G 3W7TA 3RVYA 4G2KA 1KP2A 2DWDC 5E1AC 1GRJA 3GVMA 2GTSA 2ZD9A 2DYRC 3F7VC 1Q3EA 3TCUA 2PI5A 4LF5B 1XNRO 4BIZA 3UO3A 1QR9A 2EILC 4DR3B 2Z3YA 2P5OA 1AVMA 1NJIW 2ZIOA 1R3JC 1LUVA 5BR8O 4JYYA 4P2ZA 3HKBB 4CS2A 3ABKB 5LYJA 3SYPA 2UXXA 1FD9A 5CBGA 4X66B 4YJ3A 3L73H 1SZXA 1M93A 1HR0O 5KLVH 2R70A 2JDIG 3UO2A 3CCVV 3ZBHA 3TK1A 2O57A 3CC4V 3JAWA 1VQPV 2UXNA 3WB2A 1KC8W 1AJNA 1DTOA 3CHXA 5LGNA 3L70H 2Q9LA 3SYCA 2KB1A 3BCCH 4DV3B 4XDKA 1BZKA 4FZ1A 4XBFA 3ZHVA 1N32B 4LH7A 4YJ2B 4MW8A 4ZOLB 2CDYA 3ZHTA 4EFEA 4LF6O 5BXZA 2Q7GA 1IZ3A 3E8GA 1AR4A 3WB0A 2P22C 1I5XA 4ZIBA 4LF5O 2GDSA 2YIBD 1M5IA 2IU3A 1OZ0A 1QVGU 4O4HA 4DR3O 1XILA 1OCRC 4LF8B 5JH7B 1I94B 1FXHA 1VF5B 3JATB 2P90A 3CCLV 1N36B 3SPGA 4MSWC 4AI8A 1BHBA 2Z5UA 3ASNC 4OPHA 3CCQV 4X66O 3TXQA 5LA6B 5L3CA 2OYQA 2QWQB 1H2SB 1OCZC 4UB6Z 3T1YB 4FLVA 4BWAA 1I08A 4TUYA 3BAAA 2WA3A 3ICXA 4H37A 1AI6A 1VQ4V 2P4VA 4UVBA 1DK1A 1Y76B 4B7EA 1RM1C 1QLNA 1KQSU 4MTOA 4KXRA 4NTWA 3HKCB 2ZINA 1ZL8A 4PI0A 1GN2A 4QNHB 4DO2A 4DV3O 1PM9A 2BSKB 3AG4B 1F4MA 3DSQA 4LCUC 2ZM6B 3EHBB 3E8BA 1N32O 1FKAO 1K3EA 1K5QA 4PI2A 4L8JA 5DECA 4I55A 2HJDA 1MSDA 5J2UB 2UU9O 2KKWA 3RYIB 3VQWA 2NNUA 3IGAC 4TT3G 4X1KB 4JI8B 2LGQA 2F4VB 4LF8O 4FM1A 3HB3B 2DYRB 4H13B 1NTMH 1PNMA 1WPXA 1B3QA 1I94O 4DV6O 1VARA 1NZ6A 5FPRA 1WPBA 3ZEDA 2W0XA 2EILB 3H1JH 2GTAA 3G67A 3NXSA 3ZJZA 3B09A 1L8DA 2UUBB 1OV9A 2GUZA 2ZR2A 3CRRA 3FD9A 3JD3A 4B08A 1BL8A 2YXHA 2NN4A 3D36A 5IJ0A 1R6NA 4FPPA 3W7XA 3IC7A 4I9WA 1PL4A 4J41A 4MVSA 2ZKOA 1IBMB 1SERA 5GTIZ 1FFTB 3UT5B 4BIOA 4NTYA 1VQNV 4GKJB 2Q0AA 1Q86W 2GBOA 2ZM6O 2RJZA 1P49A 2E74B 2OTJV 2V1DA 2ZIMA 2P4KA 1XUQA 3N2GB 5DN6G 3J7AU 1VQKV 3H1HH 4FM2A 1OJHA 4I9QA 5HFMA 2XASA 1Q8IA 1R6KA 1SESA 2HVJC 1W2BU 2B1GA 1YCIA 4JI8O 2F4VO 2AZ0A 4HYOA 1R3KC 1GTOA 2CTWA 3M99B 4PD4F 3F7YC 2N05A 3JAKB 1OCRB 3KKYA 2FYUH 2AZ2A 2CUGA 3KG2A 2QA4V 4DW0A 4O4IA 2GSMB 3ASNB 1HNZB 5EBWC 4X88A 4RUFA 4P9OA 3T1HB 1OCZB 3GWKC 1PD3A 2XT9A 2CAZC 5JCOA 3ZN1A 1IBMO 1QVFU 4MS2A 1FXVA 1PNKA 2ZT9B 4GKJO 1N0JA 5BY1A 4YHHB 1RM1B 1YZBA 4I50B 1OCCC 4DR4O 1GK9A 4TV9B 5IYZB 3OW2U 3ASOC 1HP8A 2F66C 3CRCA 1K4CC 5LGTA 2EIKC 2W0FC 1GN6A 1LNQA 1JPXA 1K5SA 4YIOA 3RYCB 5EYPB 3AK1A 3DXRB 1BT8A 3OAAG 3G6EV 2R9RB 4ZHQB 5LP6A 2XAJA 3IFXA 1UJWB 1O9GA 1H2KA 2LP7A 1WP8A 2F1MA 4U3JB 4X20B 3SPIA 3BA8A 1EN6A 3E8HA 5CB4B 1HNZO 1COWG 3T1HO 2Y4TA 2UUAB 3KCXA 1EZJA 5KUKA 4FM0A 3K06A 4ZI7B 2QKAA 2B9ZA 4O2AB 5LBQA 3K9AA 1J95A 4YHHO 3K3WA 1ZTEA 4WBNA 3L75H 4CBCA 2FB5A 2YIDA 4CH4A 4JAUA 2WSSG 5KA6A 3OR7C 5EC2C 1YJ9V 1AI5A 2YEVB 4DV7B 4DR6O 1GKFA 1YTFD 1TAEA 3ZRWA 1FJGO 1J5EB 3B77A 1MZFA 1E79G 4NB5A 3D8CA 2XAHA 4TV8B 4B3TO 3DGEA 5IWAB 1D2DA 3KZIZ 3R66A 5GTHZ 3T4ZA 3JARA 1WA8A 2P06A 2QM7A 2LQTA 5H9CA 5J2TB 1K4DC 2E75B 4PA3A 1A32A 2KG7B 2QJ1A 4EB6B 2QM8A 1S72V 4OX9O 4I7ZB 1Y66A 2ZE6A 1CEZA 1RP3B 3THOA 1JR9A 5K1XA 2Y48A 2ZDIA 3P3NA 3ABMC 4JAVA 1BMFG 2QGNA 4LFBB 1SC5B 4IGGA 4LWSB 1AP6A 2PUSA 3Q4HB 2P6JA 5JWPA 3ZRXA 4X1YA 5C8YB 2PYJA 1Z5WA 1YIJV 4H33A 3OGIB 4LR3A 1MSWD 4RQEA 4JYAB 4DV7O 1OCCB 3JASB 2BOBC 1Q6IA 1VF7A 5HFLA 2BTQA 5FNVA 3ASOB 3K04A 1J5EO 1AILA 2RNBA 2EIKB 3AK3A 3ZMTA 4HBNA 4DV1B 3BY6A 4GCZA 3KCYA 3IJ4A 4JI3B 4DR7O 1R1BA 2K9PA 5IY5C 4X1IA 3OM3B 2CE4A 3S3XA 1DLBA 5J9PC 1MG1A 2VQFB 3RFRA 3TJTA 1Q6UA 3OGCC 5LYJB 1MMMA 3C90A 2E3CA 2EIJB 3D36C 4YJ3B 2EZPA 1BQ0A 3SJCC 4BIUA 1EBOA 3ZHSA 1IXMA 1DF5A 2NLJC 4LFBO 1BHAA 3LSQA 2KQXA 3ABUA 2HP8A 3WG7C 1YVWA 3JAWB 2DYSC 3VOUA 3RYHA 3BA9A 5LMUB 3CJHA 4E2LA 1MZEA 1SKVA 2WLLB 3K0DA 2OT5A 2DE0X 1S77D 2RDCA 4N21A 4PV1B 4JYAO 2FTKA 3K5MA 5L3BA 2XHBA 2ILMA 2XTAA 1UPGA 1R6TA 1TUEB 3VQYA 3LUTB 5GONB 1PPJH 2UXCB 1FXKA 1IDSA 5KX5A 4JI3O 5B1NA 4WCEV 4O4HB 1N34B 3O9OA 5AG2A 1JJ2U 1KKCA 3OUFA 3L72H 1ZX3A 1BE3H 1EZVH 2Q7EA 2CTRA 1QR8A 3LDDA 1Q82W 3DTUB 4JTDB 5JJNB 1YITV 2YI8A 3OMAB 1YJWV 3JD1A 1F51A 4ABMA 3CP1A 1X59A 4CH5A 5JCOC 1R73A 4TUYB 1U96A 3E35A 5EIBC 1HNWO 2YXYA 4PELA 2JK5C 5LMUO 3ABMB 1I0HA 2AHZA 4OGQB 3AK2A 2Q69A 1QLEC 1ZL8B 1AROP 4CS3A 2EINC 4TOIA 3QG5A 5LXTA 2RN9A 5EBMC 4QPKA 2QR4A 3J81N 4PDVA 4ZKIA 2A9HA 2LO1A 4OPAA 5BMVA 1OHHG 5KHIA 4LF6B 4KHPB 4I55B 1XNQO 2IJKA 1M57C 5LP6C 3D3QA 4JTAB 2UXCO 2KSDA 2FMLA 1N34O 1PV0A 1FS0G 3ZMZA 4WF9V 4PHZA 3E2EA 3NR7A 2A7WA 2CH7A 5IY5B 2F95B 2HG5C 1NVPB 4O4JA 2EULA 1XMQO 2GUZB 3DC5A 4KUMA 2OCCC 4FLYA 1K97A 5A2QN 3A0BZ 1YJNV 3RW0A 3CRMA 4GX0A 5IJ0B 1BGYH 1QNMA 2LFSA 1M9NA 2WLLA 3RYFA 1SQQH 2DQ3A 2IH3C 1PKXA 2QEXV 3JCZA 3WG7B 2EIMC 2DYSB 3K9SA 3K0GA 1KB9F 5LHGA 2JGDA 4Z1MG 1IBKB 4QJFB 1Y67A 4KHPO 1FAFA 2YDEA 5GONA 3X2QC 2QE7G 2DWEC 2ZQMA 2UU9B 4GLXA 4P9PA 1KKDA 5H2FZ 1JQ0A 5JVDA 4RAIA 1W0KG 1SQVH 2YXLA 4DV6B 1KYOF 2JGUA 1VQ8V 2DMXA 3N27A 3HKDA 2EBOA 4B3SB 5JQGA 3CCRV 1JFFA 3ETGA 3MAQA 4O4IB 4DUZB 3K08A 3GWOA 2ZDIC 4UCOA 1KU9A 3OR6C 1BQZA 1RPRA 3BRCA 4TWKA 2OIEA 4JV5B 3G4SV 5C93A 2ZCEA 2LW7A 1W59A 1V55C 1NR1A 4YIPA 4DYLA 3MHSC 3CX5F 1Y4MA 1IBKO 1JJOA 4FZ0A 1QLEB 1GH6A 1WNSA 4FFKA 2EINB 2NR5A 5IDJA 4IHJA 4K0KB 1ROPA 2ZE5A 1R3IC 1QU7A 3P30A 2PTMA 2WAMA 2A0LA 4X64B 1M57B 5LP6B 3M7MX 3C3SA 4NXMO 2D2CB 3CC2V 1PNLA 3HR0A 4G28B 2XOKG 3O65A 4B3SO 2W6IG 2OIGA 1VEWA 2IJJA 3WU2Z 4DUZO 1NQTA 3MHHC 1YI2V 2IJIA 3ZRSA 2UXBB 2H3OA 4PJ0Z 2JJ2G 4GUNA 4JV5O 2DJVA 2Q0OC 3A0RA 4YY3B 1SQBH 3BHPA 1L1FA 4UB8Z 2OCCB 1KUQA 1XEQA 4I5SA 1KBHA 2V4DA 4ASUG 3QTCA 4WBNB 1VQMV 2WLNA 4FVMA 2IBZH 4DR4B 1FFXA 4PDRA 2EIMB 1P7GA 3E22A 3OD4A 1ZWIC 1NTKH 3U11A 1N0NA 4R50A 5DM6V 3RT3C 4DV2B 4K0KO 2LJ2A 1X4TA 1FXKC 4PA7A 3ZRWB 2PY5A 4UCVA 2N74A 2X6AA 3X2QB 1IVSA 1OCOC 4X64O 4FJCC 2B5UA 4I4TB 4J7JA 3CCSV 2H94A 1G8MA 3B8NA 4GX2A 1CXZB 4FLTA 2RMKB 4JI0B 3R65A 1B04A 3F5TA 5KHJA 3JARB 3M8AA 1WA8B 2R72A 1H2NA 4YXWG 2P67A 1TVKA 4RO2A 2RCVA 2WPDG 3CS5A 3ZMUA 2UXBO 4J9ZB 2HJFC 1K34A 1YHQV 3ETEA 2X6CA 3JCUZ 4B3RB 2ITCC 4YY3O 1SRYA 2PF4E 4LF9B 4GKKB 1GO3F 4J80A 4FK5C 1BS3A 5KAIZ 4GX5A 4DR5O 1V55B 1MOFA 1D5AA 1S76D 4X1YB 3ABLC 4J7KA 1H8EG 3BPZA 4B7KA 1JA8A 1SETA 2ADQB 1B6QA 2QM4A 3K5OA 1WAZA 4DR6B 5JJEB 4DV2O 4OXSA 1H2LA 1AI7A 2BTQB 1Q81W 2BCCH 4NTXA 5FNVB 3SR2C 5CBHA 1FJGB 2EZOA 4IIJA 4LF7B 3LSUA 3FYEB 2YIBA 4JI0O 4B3TB 5IYDO 3B4SA 2W6JG 4D7TA 3JYCA 1PL0A 5EC1C 2EIJC 4HAMA 4HNAA 5ITZA 3JALA 4X1IB 3UKMA 3FYIB 1JCHA 3EXAA 5B1OA 4OX9B 3E8FA 3ZRVA 1S5HC 4NVPA 4WFGA 1URFA 4B3RO 4MTXA 4F6EA 4FLXA 1VQ6V 4NKGB 1U97A 4LF9O 4GKKO 4X62B 3CYOA 1K9MW 1NBMG 2QDOA 2N04A 3RYHB 5IJ9A 3CJHB 3JD4A 2ZXWC 2Q7HA 1EM1A 3JD2A 1VF6A 3BABA 1AJPA 3CD6V 2LGWA 2PGGA 1S5LZ 1SA0A 1Y6XA 1VMGA 4EEQA 3AG7A 3QO8A 5JJJB 3QNEA 4I4TA 3SYOA 4BR6A 2DQ0A 4LF7O 5H5NA 4LNUA 4O2BA 1E1QG 1FXKB 3ZS8C 5KX5B 4DR7B 3A8TA 4QGPA 5IYCO 1OCOB 3H1LH 1XBLA 4HZ3A 4TQFA 5KMGA 1SQXH 4TSFG 2CGNA 3SGIA 1NS1A 3AEIA 2YC0A 3ETQA 4X8AA 3IAYA 1WB8A 3QVNA 1Q7YW 1NU1H 5KAFZ 3E89A 3AG1C 3ZMSA 2XUMA 5E79Z 4X62O 4IYHA 1I7FA 2P7TC 4DK1A 1VQ9V 1K73W 1XOUA 1FPOA 3UM7A 2MW2B 1WJZA 3QO5A 4K3AA 2VWJA 4Q6GA 5LXTB 5LOVA 3CSXA 4GZRB 1W0JG 2QWRB 4MVMA 3ABLB 3FB8C 2EX3A 3LNNA 3JD0A 5BMVB 3N2KA 1JX9A 2QWNB 4X9QA 2Q6AA 1N4CA 1XL4A 3H1KH 4UV9A 3L9DA 1THZA 2WLIA 1H2MA 4XDLA 4JAAA 3J80N 3E86A 3FX7A 4I0XA 3CMAV 3FAVA 3LDCA 4IT5A 3S3WA 3H9VA 3A2FA 1RPOA 4KP4A 1GN3A 1JVMA 4JI6B 1ZSPA 2CH7B 5EBLC 1L0LH 4B3MO 1Q6HA 5B66Z 2AW9A 1EN5A 1P7BA 5B1AC 4UCSA 1XL6A 2DW4A 3RBZA 4O4JB 1SZTA 3VQXA 3FB5C 1RFYA 4JYCA 2FKXA 1HNWB 2WA4A 1M56C 4K35A 2HFEC 5K1PA 2JEUA 3RYFB 4JI2B 4PA9A 4XDJA 3STLC 3K5NA 3OFNG 2M7WA 1Q90D 4DRXA 2Y0PA 2JGDB 5TISZ 2ZXWB 4MVZA 4PDMA 5LHHA 4RWUA 1K92A 3RVZA 1XNQB 4GYCB 4JF3A 1YDXA 4E4EA 2K1EA 2PZSA 4UFZA 2XAFA 4UCRA 2XNDG 3K58A 1CPYA 1Y74A 5JVDB 3SYAA 4NXNO 1G6UA 5DEDA 4UVCA 3JAMN 1ZLZA 4JI7O 3BVOA 1YF2A 4JI6O 3HKDB 4UXNA 1VP7A 3UCSC 1ENVA 1QQCA 3FFQA 5JQGB 1F23A 1JFFB 2HR3A 3VBBA 1XMQB 4ICGA 3EFFK 3CRAA 5KHKA 2AHYA 5IYBO 1E1RG 5D5PA 4J11A 2Y69C 1NVPD 1GAXA 1NH2B 3AG1B 4JI2O 2C2AA 1TA8A 1K8AW 1M90W 1TUBA 3CCEV 2HKOA 4JI1B 2E5LB 2IW5A 1SF9A 2DOSA 3I56V 3ZHUA 2UUCB 1AJQA 1EN4A 1IXBA 1XHZA 1N33O 3SYQA 1XI1A 1UFIA 5B3SC 2A79B 3SPHA 1EFRG 1YEWA 2X7RB 4IHJB 4BW5A 1XMOO 5IT9N 1QBZA 2QWPB 3L74H 2XAGA 4X65O 4JPRA 3STZC 3I55V 4WFBV 1US6A 3CXCU 3P32A 2IH1C 5EZYA 3ABTA 5CA0A 3A0HZ 1Q43A 4UCTA 2YSUB 1MNGA 5FL7G 5CBFA 4FFBA 4RUEA 4F6RA 4QIWF 5B1AB 2YIAA 1VQ7V 3H1IH 2ETNA 2GHYA 5L3DA 4BAYA 5F2VO 3AG3C 3DC6A 1M56B 5CMUA 1VF6C 4JI1O 2E5LO 2UUCO 2YICA 5EIBD 1VQOV 5CA3A 1K7DA 4N23A 1FFXB 2HVKC 1BCCH 3QF7A 4DUYO 3SPJA 3E22B 1IBLB 2X0LA 3FKSG 2HHHB 4DR2O 3RWRD 1KMIZ 1ORQC 3UQ8A 3ZHRA 1LR1A 2V7QG 1XREA 4GT1A 3HKEA 1VQ5V 4LFAB 1M4UA 2VWKA 4R6ZA 2QTOA 4NXMB 2OCHA 3B2EE 5BZBA 5CN0A 4U7NA 1BSMA 4UUJC 3G71V 1K33A 4KL1A 2ATKC 1RSOA 1TVKB 5B1BC 3P3PA 4FLWA 2YI9A 3CWBH 2YS8A 4PA4A 3TETA 2ZE8A 3OEEG 2UXDB 3FB6C 2ZNJA 1HW7A 1XQ8A 2BE3A 4EFBA 2EJ7A 4P30A 1AI4A 2Y69B 4FLUA 3LDEA 2AGAA 4LBEC 2CTPA 1FYJA 2XAQA 1IBLO 5CA1A 2HHHO 5LGUA 3G6BA 3T4DA 4TQDA 1GN4A 4O4LA 3JSLA 1F7YA 5B3SB 1V9PA 4IIJB 4W4LA 4LFAO 5EK0A 1HWYA 4W4KA 1I5YA 3CB2A 2CGOA 3JSNA 1H8HG 3K79A 1R3LC 2ODMA 4HNAB 1YSCA 4J10A 4WFHA 5ITZB 3JALB 2OTLV 4MVQA 5A9GA 1ZUQA 4JI4B 2WLKA 2HLDG 1D5NA 4D7SA 2JIZG 5KHHA 1NR7A 3HKBA 4CC6A 1N36O 4RQFA 2LFRA 2UXDO 4IL6Z 3CMEV 4G27B 1GMGA 4FIPC 4C7UA 4DV4B 1V54C 3QO7A 3T1YO 3ZCCA 2WLHA 3W7SA 1Q5OA 1HNXB 2JJ1G 1VQLV 5IJ9B 4DR5B 1WB7A 5L3FA 3AG3B 2BOCC 2YUAA 4GX1A 4X89A 2GV9A 2Q67A 1QHTA 1SA0B 3MDSA 4AHCA 4YJ2A 1IX9A 2ZR3A 4ZOLA 2JRIA 3ZIAG 1JMKC 3CRQA 4FLZA 4AILC 4DV0B 4MVRA 1SQFA 4LNUB 4O2BB 4Z2WA 4JZ2A 4K8ZA 3T2MA 4JI4O 3VQVA 5KMGB 2Y0IA 1M1KW 3IC9A 2WLMA 5JH7A 2QKSA 2F23A 5GW7A 3JATA 5D5QA 4J7ZA 1MABG 5LA6A 2QWOB 3ZMVA 4DV4O 5B1BB 3OT7A 2WWWA 2UUBO 1HNXO 1HDJA 3ZX6A 1DGSA 1VIBA 2Q68A 3TXSA 1SS3A 1S5JA 1Y76A 1S0VA 3AG2C 5H6QA 3U10A 3HKCA 5FLXN 2VS0A 4FMTA 4WFAV 2BSKA 1H38A 4JYBA 5LOVB 4H0LB 3TGUH 1KD1W 4D6TH 2R9AA 3CEIA 3N2KB 3OMNB 4DV0O 3OUSA 4AQYB 3B8MA 4JI5B 3WB1A 2BTOA 5J2UA 2DN9A 2WLIB 3APOA 2L35A 4I0XB 4J42A 3RYIA 3FAVB 4MTFA 4X1KA 4DR1B 2FL4A 1P4RA 4QE9A 1NTZH 2Q73A 5LL6Y 1NT2B 3C3TA 2A3QA 4LP8A 4PA6A 1YXBA 2RQ6A 4WFEA 5L3EA 2X6BA 2MK3A 1WP7A 3CC7V 3PJSK 2Q4PA 4K8XA 3K5LA 1V54B 2QKCA 1LUWA 2Q5ZA 3K57A 3H01A 2Y4UA 2JVDA 3SDLA 1B06A 3UT5A 4DRXB 2AXTZ 1AP5A 2D3OW 2OWOA 2PI4A 2F93B 2HEPA 4NR1A 4LC1A 2IU0A 3BEHA 1GM9A 4JTCB 3K59A 4AQYO 3N2GA 4IYIA 4JI5O 4JGSA 3W7UA 2H8PC 1XHXA
chains in the Genus database with same CATH topology
3K03A 1R6KA 1SESA 2HVJC 2XNDG 1W2BU 1CPYA 2B1GA 4MTGA 1KP3A 1JQ0A 3SYAA 4RAIA 1W0KG 3SJQC 4UVCA 4HYOA 1R3KC 1VQ8V 1GTOA 3M99B 3F7YC 4UXNA 2EBOA 1ENVA 4R8CA 4F4LA 1OCRB 1F23A 3CCRV 2HR3A 3VBBA 3ETGA 3KG2A 2QA4V 3K08A 3GWOA 3EFFK 2GSMB 2ZDIC 3SPCA 2AHYA 3OEHG 3OR6C 3ASNB 5IYBO 5KA5A 5EBWC 1E1RG 4X88A 1RPRA 1NVPD 2Y69C 1H2GA 4RUFA 4P9OA 4TWKA 3G4SV 1OCZB 5C93A 1NH2B 1PD3A 3AG1B 3WFVA 4R7CA 1V55C 2C2AA 1K8AW 1M90W 3ZN1A 1QVFU 1NR1A 4MS2A 5KUMA 3CCEV 1FXVA 1PNKA 2HKOA 3MHSC 2IW5A 3I56V 1RM1B 1Y4MA 1AJQA 3AG2B 4EKWA 1QLEB 1OCCC 1GM8A 3SYQA 4MW3A 2EINB 1GK9A 5B3SC 1AR1B 3W7WA 2A79B 4Q20A 3SPHA 3ASOC 5IDJA 4JASA 3OW2U 1EFRG 2B1IA 1K4CC 5LGTA 1YTFB 2EIKC 2W0FC 2X7RB 2WLJA 4BW5A 1LNQA 1ROPA 1QBZA 1JPXA 1K5SA 1R3IC 3P30A 4UVAA 3OMIB 1N8RW 2XAGA 2WAMA 2A0LA 3OAAG 3G6EV 1M57B 2R9RB 4JPRA 3STZC 1CP9A 3T1CA 3I55V 4WFBV 2XAJA 3CXCU 3IFXA 1UJWB 3P32A 3CC2V 1PNLA 2IH1C 5LHIA 4G28B 2XOKG 3ABTA 2LP7A 2W6IG 3ABKC 2IJJA 2YSUB 3SPIA 1NQTA 3MHHC 5FL7G 2IJIA 1YI2V 5CBFA 3E8HA 3CCMV 3ZRSA 4RUEA 2IJHA 4QIWF 5B1AB 2JJ2G 2R9IA 4QE7A 1COWG 1VQ7V 3ETDA 3A0RA 1L1FA 2F43G 2OCCB 2GHYA 1EZJA 5KUKA 3K06A 4KFMA 4I5SA 5L3DA 4BAYA 4DXWA 3AG3C 4MVOA 1NH2D 1M56B 4L87A 5CMUA 5LBQA 3K9AA 4ASUG 1J95A 1WLEA 3K3WA 1VQMV 4CBCA 1VQOV 2WLNA 5CA3A 1K7DA 4N23A 2HVKC 4PDRA 2EIMB 4JAUA 4PDLA 2WSSG 3SPJA 5KA6A 2X0LA 1S3JA 4MVUA 1ZWIC 1G4YB 3OR7C 3FKSG 4R50A 5EC2C 1YJ9V 1AI5A 2YEVB 5DM6V 1ORQC 2YEVA 1KECA 1JOYA 1GM7A 1FXKC 4PA7A 1GKFA 1YTFD 2V7QG 3ZRWB 3ZRWA 4GT1A 2X6AA 3X2QB 1OCOC 4FJCC 2B5UA 4R6ZA 5H6RA 3CCSV 1VQ5V 2H94A 3B77A 1G8MA 3B8NA 4GX2A 5L3GA 2QTOA 1E79G 3GB7C 3F5WC 3R65A 4U7OA 2XAHA 3LNMB 3DGEA 4UV8A 5BZBA 5CN0A 4U7NA 3CCJV 3T4ZA 1QCEA 4UUJC 3CCUV 2QM7A 3G71V 3HPLC 5H9CA 3ML0A 1K33A 1DF4A 1K4DC 2ATKC 4QPJA 2EJRA 3MD0A 4YXWG 2P67A 5B1BC 4WFFA 4RO2A 4PA3A 2WPDG 3ZMUA 3CPWU 3E83A 1F4NA 4J9ZB 2HJFC 2QM8A 4PA4A 1K34A 3TETA 1S72V 3OEEG 1YHQV 3FB6C 1Y66A 3D3IA 2X6CA 3ETEA 1CEZA 2ITCC 1SRYA 2Y48A 2ZDIA 3ABMC 4JAVA 1NKDA 1BMFG 1GO3F 4P30A 1AI4A 2Y69B 2ITDC 4FK5C 4CZZA 3AG4C 3ZN0A 4GX5A 3LDEA 3LSSA 1V55B 1MOFA 2P6JA 4LBEC 4ZBMA 1S76D 3ZRXA 2CK3G 3ABLC 1H8EG 2XAQA 1YIJV 4H33A 1SETA 1B6QA 1MSWD 2JEXA 3FB7C 4J9YB 5LGUA 4RQEA 3T4DA 4MT8A 1OCCB 2BOBC 3OE7G 4OXSA 3W7TA 3RVYA 1AI7A 1Q81W 4G2KA 1KP2A 5HFLA 2DWDC 5E1AC 5B3SB 5CBHA 3ASOB 2EZOA 3K04A 5EK0A 2EIKB 3FYEB 2ZD9A 2DYRC 3F7VC 3ZMTA 1HWYA 3BY6A 1I5YA 3TCUA 1H8HG 5IYDO 4GCZA 2PI5A 3K79A 1R3LC 2W6JG 4BIZA 3JYCA 1PL0A 2XASA 2EIJC 5EC1C 2OTLV 1QR9A 1YSCA 2EILC 4HAMA 4WFHA 4MVQA 5IY5C 2WLKA 2HLDG 2Z3YA 3OM3B 3UKMA 3FYIB 1NJIW 1JCHA 2JIZG 1DLBA 5J9PC 1R3JC 1MG1A 4P2ZA 5B1OA 1NR7A 3E8FA 3ZRVA 3ABKB 3OGCC 1S5HC 4WFGA 2LFRA 4RQFA 3SYPA 2EIJB 2UXXA 5CBGA 4MTXA 3CMEV 2EZPA 4G27B 1GMGA 1VQ6V 4FIPC 1V54C 4BIUA 3QO7A 1EBOA 3ZCCA 1IXMA 1DF5A 2NLJC 2WLHA 3W7SA 1K9MW 3CYOA 1BHAA 3LSQA 2JDIG 1NBMG 2JJ1G 3ABUA 3CCVV 1VQLV 3TK1A 3WG7C 3CC4V 2DYSC 1VQPV 3VOUA 2UXNA 1KC8W 4E2LA 1AJNA 1DTOA 5LGNA 3JD4A 2WLLB 3K0DA 5L3FA 2ZXWC 3AG3B 2BOCC 2OT5A 3JD2A 3SYCA 1S77D 4GX1A 2KB1A 4X89A 1AJPA 3CD6V 4XDKA 4N21A 4XBFA 2Q67A 2FTKA 4MW8A 5L3BA 3ZIAG 2ZR3A 3QO8A 3QNEA 4MVRA 3SYOA 2DQ0A 1TUEB 3E8GA 3LUTB 1E1QG 1I5XA 1FXKB 1FXKA 5B1NA 2IU3A 1OZ0A 5IYCO 1OCOB 3T2MA 4WCEV 1QVGU 1OCRC 1M1KW 4HZ3A 2WLMA 4TSFG 1FXHA 2QKSA 1JJ2U 3OUFA 3AEIA 2P90A 5GW7A 3CCLV 3SPGA 4MSWC 1BHBA 1QR8A 3LDDA 2Z5UA 1Q82W 3ASNC 4X8AA 3DTUB 4JTDB 3CCQV 1YITV 1MABG 5L3CA 1Q7YW 3OMAB 1YJWV 3ZMVA 5B1BB 1OCZC 3E89A 2WWWA 3JD1A 1F51A 3AG1C 3CP1A 3ZMSA 1R73A 3E35A 2P7TC 4H37A 1AI6A 1VQ4V 1VQ9V 4PELA 2JK5C 2Q68A 4UVBA 3ABMB 1RM1C 1QLNA 1KQSU 4MTOA 1S0VA 2AHZA 3AG2C 1K73W 2Q69A 5H6QA 1QLEC 3UM7A 3QO5A 4QNHB 4DO2A 4FMTA 3AG4B 4WFAV 1AROP 2EINC 1F4MA 1H38A 4JYBA 4LCUC 5EBMC 3EHBB 3E8BA 4QPKA 1W0JG 1KD1W 4MVMA 3ABLB 3FB8C 4PDVA 1K3EA 1K5QA 3JD0A 4ZKIA 2A9HA 1OHHG 3OMNB 1JX9A 2Q6AA 3OUSA 1XL4A 3B8MA 4UV9A 2IJKA 1M57C 4JTAB 1THZA 2WLIB 2WLIA 4XDLA 2NNUA 3E86A 3IGAC 4TT3G 3CMAV 4MTFA 3HB3B 2DYRB 3LDCA 1PNMA 1WPXA 1FS0G 3ZMZA 4WF9V 1P4RA 1RPOA 4KP4A 1JVMA 4QE9A 3E2EA 2EILB 5EBLC 5IY5B 3NXSA 1P7BA 5B1AC 3ZJZA 4LP8A 4PA6A 1XL6A 4WFEA 2DW4A 5L3EA 2HG5C 3RBZA 2X6BA 1NVPB 2MK3A 4KUMA 1SZTA 2ZR2A 2OCCC 3FB5C 4JYCA 1K97A 3JD3A 3CC7V 1YJNV 1BL8A 4GX0A 3RW0A 3D36A 1R6NA 1M56C 3PJSK 2HFEC 2LFSA 1V54B 2JEUA 4FPPA 1M9NA 3W7XA 2WLLA 3IC7A 4I9WA 4PA9A 3H01A 4XDJA 2DQ3A 4MVSA 2IH3C 3STLC 1PKXA 2QEXV 3JCZA 1SERA 3OFNG 3WG7B 2EIMC 2DYSB 1FFTB 3K0GA 2M7WA 1VQNV 2D3OW 5LHGA 1Q86W 2PI4A 4Z1MG 2ZXWB 4LC1A 4QJFB 2IU0A 4MVZA 4PDMA 5LHHA 3BEHA 2OTJV 1GM9A 2V1DA 4JTCB 1K92A 3RVZA 5DN6G 3X2QC 4JGSA 1VQKV 2QE7G 2DWEC 4JF3A 3W7UA 2ZQMA 2H8PC 2K1EA 4P9PA 5HFMA 2XAFA 1KKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 V;  1VQ6 V;  1W2B U;  1VQ4 V;  1M1K W;  1VQ9 V;  1VQN V;  1JJ2 U;  3CPW U;  2D3O W;  1Q86 W;  1KQS U;  3OW2 U;  3G4S V;  1S72 V;  3CCL V;  1YIJ V;  1YHQ V;  1K73 W;  1K9M W;  1VQ8 V;  2OTL V;  3CCS V;  1VQ5 V;  1Q82 W;  1VQM V;  3CCV V;  1VQL V;  3CC7 V;  1K8A W;  1VQO V;  1YI2 V;  3CCQ V;  1YIT V;  1M90 W;  4WFA V;  1YJN V;  1VQP V;  3CC4 V;  1QVF U;  2OTJ V;  3CCM V;  3CCE V;  3CMA V;  1Q7Y W;  1NJI W;  1KC8 W;  1YJW V;  3CCR V;  1N8R W;  1VQK V;  1KD1 W;  3CCJ V;  3I56 V;  1VQ7 V;  2QA4 V;  3G6E V;  1Q81 W;  4WF9 V;  2QEX V;  3CCU V;  3I55 V;  4WFB V;  1R73 A;  5DM6 V;  3G71 V;  4WCE V;  3CXC U;  1YJ9 V;  3CD6 V;  3CME V;  1QVG U; 
#chains in the Genus database with same CATH topology
 3K03 A;  1Y74 B;  1AB3 A;  4MTG A;  1KP3 A;  4DR1 O;  3SJQ C;  4DW1 A;  4DV5 B;  4A5U B;  4JZG A;  4B3M B;  3RN4 A;  3JAK A;  2Z0A A;  4R8C A;  4F4L A;  2G38 A;  3BFR A;  3SJB C;  1L0N H;  3SPC A;  2JS5 A;  2CTQ A;  3OEH G;  4CH3 A;  5KA5 A;  1P84 F;  3EVK A;  1H2G A;  1WN7 A;  2L6L A;  3WFV A;  4R7C A;  4LFC B;  2UUA O;  1TUB B;  5KUM A;  2A06 H;  2ARH A;  4UCU A;  1IUR A;  3AG2 B;  4I50 A;  4EKW A;  1GM8 A;  2E76 B;  4MW3 A;  4CS4 A;  3PN1 A;  4TV9 A;  1AR1 B;  3W7W A;  3G80 A;  4Q20 A;  3RGB A;  4JAS A;  5IYZ A;  2B1I A;  1YTF B;  2WLJ A;  2ZNI A;  2VQE B;  3I5D A;  4U3F H;  2M6Y A;  2VRZ A;  4UVA A;  4NXN B;  3RYC A;  3OMI B;  5EYP A;  1N8R W;  5B5E Z;  1G1X B;  3DXR A;  4JI7 B;  1CP9 A;  3T1C A;  4ZHQ A;  4DV5 O;  5EZY B;  2QSA A;  5CA0 B;  5LHI A;  1Z2G A;  5IWA O;  3ABK C;  4U3J A;  4CH6 A;  1TGO A;  3B40 A;  3SJA C;  4X20 A;  1NI8 A;  1AR5 A;  2ZE7 A;  3CCM V;  4FFB B;  4F6R B;  1Z5V A;  5CB4 A;  2Q8V A;  3APQ A;  2IJH A;  3OTO B;  2R9I A;  4QE7 A;  4LF4 B;  3ETD A;  4LFC O;  2F43 G;  3OTF A;  4KFM A;  3ZHQ A;  4DXW A;  4MVO A;  4ZI7 A;  1NH2 D;  4L87 A;  5LMN B;  4O2A A;  5KHG A;  1WLE A;  3CXH F;  4NYK A;  1N33 B;  4H44 B;  4PDL A;  1S3J A;  4MVU A;  1G4Y B;  1T5E A;  2YEV A;  1ZAU A;  1XMO B;  1KEC A;  4Z1V A;  1JOY A;  1GM7 A;  2VQE O;  4X65 B;  3HKE B;  3U0Z A;  1O9H A;  5H6R A;  1PP9 H;  5L3G A;  2QTS A;  3GB7 C;  3F5W C;  4U7O A;  4DV1 O;  3LNM B;  4UV8 A;  4TV8 A;  4DK0 A;  1XNR B;  3CCJ V;  1QCE A;  3CCU V;  3HPL C;  3ML0 A;  1DF4 A;  4QPJ A;  1RSO B;  2EJR A;  1XDC A;  3MD0 A;  5J2T A;  4BW9 A;  5IE9 A;  4WFF A;  5BR8 B;  4LH6 A;  2KG7 A;  3CPW U;  2VQF O;  5FPO A;  3E83 A;  1F4N A;  4EB6 A;  3OTO O;  3L71 H;  1SQG A;  4LF4 O;  3D3I A;  1SQP H;  2LW1 A;  1MA1 A;  1HR0 B;  1NKD A;  5LMN O;  2ITD C;  4CZZ A;  2PYL A;  3AG4 C;  3ZN0 A;  4LWS A;  2IM9 A;  3LSS A;  4CC5 A;  3Q4H A;  4ZBM A;  2CK3 G;  4DUY B;  5C8Y A;  5CA1 B;  4DR2 B;  2JEX A;  3FB7 C;  4J9Y B;  3CE2 A;  4MT8 A;  2JS3 A;  4O4L B;  2ADP A;  3JAS A;  3OE7 G;  3W7T A;  3RVY A;  4G2K A;  1KP2 A;  2DWD C;  5E1A C;  1GRJ A;  3GVM A;  2GTS A;  2ZD9 A;  2DYR C;  3F7V C;  1Q3E A;  3TCU A;  2PI5 A;  4LF5 B;  1XNR O;  4BIZ A;  3UO3 A;  1QR9 A;  2EIL C;  4DR3 B;  2Z3Y A;  2P5O A;  1AVM A;  1NJI W;  2ZIO A;  1R3J C;  1LUV A;  5BR8 O;  4JYY A;  4P2Z A;  3HKB B;  4CS2 A;  3ABK B;  5LYJ A;  3SYP A;  2UXX A;  1FD9 A;  5CBG A;  4X66 B;  4YJ3 A;  3L73 H;  1SZX A;  1M93 A;  1HR0 O;  5KLV H;  2R70 A;  2JDI G;  3UO2 A;  3CCV V;  3ZBH A;  3TK1 A;  2O57 A;  3CC4 V;  3JAW A;  1VQP V;  2UXN A;  3WB2 A;  1KC8 W;  1AJN A;  1DTO A;  3CHX A;  5LGN A;  3L70 H;  2Q9L A;  3SYC A;  2KB1 A;  3BCC H;  4DV3 B;  4XDK A;  1BZK A;  4FZ1 A;  4XBF A;  3ZHV A;  1N32 B;  4LH7 A;  4YJ2 B;  4MW8 A;  4ZOL B;  2CDY A;  3ZHT A;  4EFE A;  4LF6 O;  5BXZ A;  2Q7G A;  1IZ3 A;  3E8G A;  1AR4 A;  3WB0 A;  2P22 C;  1I5X A;  4ZIB A;  4LF5 O;  2GDS A;  2YIB D;  1M5I A;  2IU3 A;  1OZ0 A;  1QVG U;  4O4H A;  4DR3 O;  1XIL A;  1OCR C;  4LF8 B;  5JH7 B;  1I94 B;  1FXH A;  1VF5 B;  3JAT B;  2P90 A;  3CCL V;  1N36 B;  3SPG A;  4MSW C;  4AI8 A;  1BHB A;  2Z5U A;  3ASN C;  4OPH A;  3CCQ V;  4X66 O;  3TXQ A;  5LA6 B;  5L3C A;  2OYQ A;  2QWQ B;  1H2S B;  1OCZ C;  4UB6 Z;  3T1Y B;  4FLV A;  4BWA A;  1I08 A;  4TUY A;  3BAA A;  2WA3 A;  3ICX A;  4H37 A;  1AI6 A;  1VQ4 V;  2P4V A;  4UVB A;  1DK1 A;  1Y76 B;  4B7E A;  1RM1 C;  1QLN A;  1KQS U;  4MTO A;  4KXR A;  4NTW A;  3HKC B;  2ZIN A;  1ZL8 A;  4PI0 A;  1GN2 A;  4QNH B;  4DO2 A;  4DV3 O;  1PM9 A;  2BSK B;  3AG4 B;  1F4M A;  3DSQ A;  4LCU C;  2ZM6 B;  3EHB B;  3E8B A;  1N32 O;  1FKA O;  1K3E A;  1K5Q A;  4PI2 A;  4L8J A;  5DEC A;  4I55 A;  2HJD A;  1MSD A;  5J2U B;  2UU9 O;  2KKW A;  3RYI B;  3VQW A;  2NNU A;  3IGA C;  4TT3 G;  4X1K B;  4JI8 B;  2LGQ A;  2F4V B;  4LF8 O;  4FM1 A;  3HB3 B;  2DYR B;  4H13 B;  1NTM H;  1PNM A;  1WPX A;  1B3Q A;  1I94 O;  4DV6 O;  1VAR A;  1NZ6 A;  5FPR A;  1WPB A;  3ZED A;  2W0X A;  2EIL B;  3H1J H;  2GTA A;  3G67 A;  3NXS A;  3ZJZ A;  3B09 A;  1L8D A;  2UUB B;  1OV9 A;  2GUZ A;  2ZR2 A;  3CRR A;  3FD9 A;  3JD3 A;  4B08 A;  1BL8 A;  2YXH A;  2NN4 A;  3D36 A;  5IJ0 A;  1R6N A;  4FPP A;  3W7X A;  3IC7 A;  4I9W A;  1PL4 A;  4J41 A;  4MVS A;  2ZKO A;  1IBM B;  1SER A;  5GTI Z;  1FFT B;  3UT5 B;  4BIO A;  4NTY A;  1VQN V;  4GKJ B;  2Q0A A;  1Q86 W;  2GBO A;  2ZM6 O;  2RJZ A;  1P49 A;  2E74 B;  2OTJ V;  2V1D A;  2ZIM A;  2P4K A;  1XUQ A;  3N2G B;  5DN6 G;  3J7A U;  1VQK V;  3H1H H;  4FM2 A;  1OJH A;  4I9Q A;  5HFM A;  2XAS A;  1Q8I A;  1R6K A;  1SES A;  2HVJ C;  1W2B U;  2B1G A;  1YCI A;  4JI8 O;  2F4V O;  2AZ0 A;  4HYO A;  1R3K C;  1GTO A;  2CTW A;  3M99 B;  4PD4 F;  3F7Y C;  2N05 A;  3JAK B;  1OCR B;  3KKY A;  2FYU H;  2AZ2 A;  2CUG A;  3KG2 A;  2QA4 V;  4DW0 A;  4O4I A;  2GSM B;  3ASN B;  1HNZ B;  5EBW C;  4X88 A;  4RUF A;  4P9O A;  3T1H B;  1OCZ B;  3GWK C;  1PD3 A;  2XT9 A;  2CAZ C;  5JCO A;  3ZN1 A;  1IBM O;  1QVF U;  4MS2 A;  1FXV A;  1PNK A;  2ZT9 B;  4GKJ O;  1N0J A;  5BY1 A;  4YHH B;  1RM1 B;  1YZB A;  4I50 B;  1OCC C;  4DR4 O;  1GK9 A;  4TV9 B;  5IYZ B;  3OW2 U;  3ASO C;  1HP8 A;  2F66 C;  3CRC A;  1K4C C;  5LGT A;  2EIK C;  2W0F C;  1GN6 A;  1LNQ A;  1JPX A;  1K5S A;  4YIO A;  3RYC B;  5EYP B;  3AK1 A;  3DXR B;  1BT8 A;  3OAA G;  3G6E V;  2R9R B;  4ZHQ B;  5LP6 A;  2XAJ A;  3IFX A;  1UJW B;  1O9G A;  1H2K A;  2LP7 A;  1WP8 A;  2F1M A;  4U3J B;  4X20 B;  3SPI A;  3BA8 A;  1EN6 A;  3E8H A;  5CB4 B;  1HNZ O;  1COW G;  3T1H O;  2Y4T A;  2UUA B;  3KCX A;  1EZJ A;  5KUK A;  4FM0 A;  3K06 A;  4ZI7 B;  2QKA A;  2B9Z A;  4O2A B;  5LBQ A;  3K9A A;  1J95 A;  4YHH O;  3K3W A;  1ZTE A;  4WBN A;  3L75 H;  4CBC A;  2FB5 A;  2YID A;  4CH4 A;  4JAU A;  2WSS G;  5KA6 A;  3OR7 C;  5EC2 C;  1YJ9 V;  1AI5 A;  2YEV B;  4DV7 B;  4DR6 O;  1GKF A;  1YTF D;  1TAE A;  3ZRW A;  1FJG O;  1J5E B;  3B77 A;  1MZF A;  1E79 G;  4NB5 A;  3D8C A;  2XAH A;  4TV8 B;  4B3T O;  3DGE A;  5IWA B;  1D2D A;  3KZI Z;  3R66 A;  5GTH Z;  3T4Z A;  3JAR A;  1WA8 A;  2P06 A;  2QM7 A;  2LQT A;  5H9C A;  5J2T B;  1K4D C;  2E75 B;  4PA3 A;  1A32 A;  2KG7 B;  2QJ1 A;  4EB6 B;  2QM8 A;  1S72 V;  4OX9 O;  4I7Z B;  1Y66 A;  2ZE6 A;  1CEZ A;  1RP3 B;  3THO A;  1JR9 A;  5K1X A;  2Y48 A;  2ZDI A;  3P3N A;  3ABM C;  4JAV A;  1BMF G;  2QGN A;  4LFB B;  1SC5 B;  4IGG A;  4LWS B;  1AP6 A;  2PUS A;  3Q4H B;  2P6J A;  5JWP A;  3ZRX A;  4X1Y A;  5C8Y B;  2PYJ A;  1Z5W A;  1YIJ V;  4H33 A;  3OGI B;  4LR3 A;  1MSW D;  4RQE A;  4JYA B;  4DV7 O;  1OCC B;  3JAS B;  2BOB C;  1Q6I A;  1VF7 A;  5HFL A;  2BTQ A;  5FNV A;  3ASO B;  3K04 A;  1J5E O;  1AIL A;  2RNB A;  2EIK B;  3AK3 A;  3ZMT A;  4HBN A;  4DV1 B;  3BY6 A;  4GCZ A;  3KCY A;  3IJ4 A;  4JI3 B;  4DR7 O;  1R1B A;  2K9P A;  5IY5 C;  4X1I A;  3OM3 B;  2CE4 A;  3S3X A;  1DLB A;  5J9P C;  1MG1 A;  2VQF B;  3RFR A;  3TJT A;  1Q6U A;  3OGC C;  5LYJ B;  1MMM A;  3C90 A;  2E3C A;  2EIJ B;  3D36 C;  4YJ3 B;  2EZP A;  1BQ0 A;  3SJC C;  4BIU A;  1EBO A;  3ZHS A;  1IXM A;  1DF5 A;  2NLJ C;  4LFB O;  1BHA A;  3LSQ A;  2KQX A;  3ABU A;  2HP8 A;  3WG7 C;  1YVW A;  3JAW B;  2DYS C;  3VOU A;  3RYH A;  3BA9 A;  5LMU B;  3CJH A;  4E2L A;  1MZE A;  1SKV A;  2WLL B;  3K0D A;  2OT5 A;  2DE0 X;  1S77 D;  2RDC A;  4N21 A;  4PV1 B;  4JYA O;  2FTK A;  3K5M A;  5L3B A;  2XHB A;  2ILM A;  2XTA A;  1UPG A;  1R6T A;  1TUE B;  3VQY A;  3LUT B;  5GON B;  1PPJ H;  2UXC B;  1FXK A;  1IDS A;  5KX5 A;  4JI3 O;  5B1N A;  4WCE V;  4O4H B;  1N34 B;  3O9O A;  5AG2 A;  1JJ2 U;  1KKC A;  3OUF A;  3L72 H;  1ZX3 A;  1BE3 H;  1EZV H;  2Q7E A;  2CTR A;  1QR8 A;  3LDD A;  1Q82 W;  3DTU B;  4JTD B;  5JJN B;  1YIT V;  2YI8 A;  3OMA B;  1YJW V;  3JD1 A;  1F51 A;  4ABM A;  3CP1 A;  1X59 A;  4CH5 A;  5JCO C;  1R73 A;  4TUY B;  1U96 A;  3E35 A;  5EIB C;  1HNW O;  2YXY A;  4PEL A;  2JK5 C;  5LMU O;  3ABM B;  1I0H A;  2AHZ A;  4OGQ B;  3AK2 A;  2Q69 A;  1QLE C;  1ZL8 B;  1ARO P;  4CS3 A;  2EIN C;  4TOI A;  3QG5 A;  5LXT A;  2RN9 A;  5EBM C;  4QPK A;  2QR4 A;  3J81 N;  4PDV A;  4ZKI A;  2A9H A;  2LO1 A;  4OPA A;  5BMV A;  1OHH G;  5KHI A;  4LF6 B;  4KHP B;  4I55 B;  1XNQ O;  2IJK A;  1M57 C;  5LP6 C;  3D3Q A;  4JTA B;  2UXC O;  2KSD A;  2FML A;  1N34 O;  1PV0 A;  1FS0 G;  3ZMZ A;  4WF9 V;  4PHZ A;  3E2E A;  3NR7 A;  2A7W A;  2CH7 A;  5IY5 B;  2F95 B;  2HG5 C;  1NVP B;  4O4J A;  2EUL A;  1XMQ O;  2GUZ B;  3DC5 A;  4KUM A;  2OCC C;  4FLY A;  1K97 A;  5A2Q N;  3A0B Z;  1YJN V;  3RW0 A;  3CRM A;  4GX0 A;  5IJ0 B;  1BGY H;  1QNM A;  2LFS A;  1M9N A;  2WLL A;  3RYF A;  1SQQ H;  2DQ3 A;  2IH3 C;  1PKX A;  2QEX V;  3JCZ A;  3WG7 B;  2EIM C;  2DYS B;  3K9S A;  3K0G A;  1KB9 F;  5LHG A;  2JGD A;  4Z1M G;  1IBK B;  4QJF B;  1Y67 A;  4KHP O;  1FAF A;  2YDE A;  5GON A;  3X2Q C;  2QE7 G;  2DWE C;  2ZQM A;  2UU9 B;  4GLX A;  4P9P A;  1KKD A;  5H2F Z;  1JQ0 A;  5JVD A;  4RAI A;  1W0K G;  1SQV H;  2YXL A;  4DV6 B;  1KYO F;  2JGU A;  1VQ8 V;  2DMX A;  3N27 A;  3HKD A;  2EBO A;  4B3S B;  5JQG A;  3CCR V;  1JFF A;  3ETG A;  3MAQ A;  4O4I B;  4DUZ B;  3K08 A;  3GWO A;  2ZDI C;  4UCO A;  1KU9 A;  3OR6 C;  1BQZ A;  1RPR A;  3BRC A;  4TWK A;  2OIE A;  4JV5 B;  3G4S V;  5C93 A;  2ZCE A;  2LW7 A;  1W59 A;  1V55 C;  1NR1 A;  4YIP A;  4DYL A;  3MHS C;  3CX5 F;  1Y4M A;  1IBK O;  1JJO A;  4FZ0 A;  1QLE B;  1GH6 A;  1WNS A;  4FFK A;  2EIN B;  2NR5 A;  5IDJ A;  4IHJ A;  4K0K B;  1ROP A;  2ZE5 A;  1R3I C;  1QU7 A;  3P30 A;  2PTM A;  2WAM A;  2A0L A;  4X64 B;  1M57 B;  5LP6 B;  3M7M X;  3C3S A;  4NXM O;  2D2C B;  3CC2 V;  1PNL A;  3HR0 A;  4G28 B;  2XOK G;  3O65 A;  4B3S O;  2W6I G;  2OIG A;  1VEW A;  2IJJ A;  3WU2 Z;  4DUZ O;  1NQT A;  3MHH C;  1YI2 V;  2IJI A;  3ZRS A;  2UXB B;  2H3O A;  4PJ0 Z;  2JJ2 G;  4GUN A;  4JV5 O;  2DJV A;  2Q0O C;  3A0R A;  4YY3 B;  1SQB H;  3BHP A;  1L1F A;  4UB8 Z;  2OCC B;  1KUQ A;  1XEQ A;  4I5S A;  1KBH A;  2V4D A;  4ASU G;  3QTC A;  4WBN B;  1VQM V;  2WLN A;  4FVM A;  2IBZ H;  4DR4 B;  1FFX A;  4PDR A;  2EIM B;  1P7G A;  3E22 A;  3OD4 A;  1ZWI C;  1NTK H;  3U11 A;  1N0N A;  4R50 A;  5DM6 V;  3RT3 C;  4DV2 B;  4K0K O;  2LJ2 A;  1X4T A;  1FXK C;  4PA7 A;  3ZRW B;  2PY5 A;  4UCV A;  2N74 A;  2X6A A;  3X2Q B;  1IVS A;  1OCO C;  4X64 O;  4FJC C;  2B5U A;  4I4T B;  4J7J A;  3CCS V;  2H94 A;  1G8M A;  3B8N A;  4GX2 A;  1CXZ B;  4FLT A;  2RMK B;  4JI0 B;  3R65 A;  1B04 A;  3F5T A;  5KHJ A;  3JAR B;  3M8A A;  1WA8 B;  2R72 A;  1H2N A;  4YXW G;  2P67 A;  1TVK A;  4RO2 A;  2RCV A;  2WPD G;  3CS5 A;  3ZMU A;  2UXB O;  4J9Z B;  2HJF C;  1K34 A;  1YHQ V;  3ETE A;  2X6C A;  3JCU Z;  4B3R B;  2ITC C;  4YY3 O;  1SRY A;  2PF4 E;  4LF9 B;  4GKK B;  1GO3 F;  4J80 A;  4FK5 C;  1BS3 A;  5KAI Z;  4GX5 A;  4DR5 O;  1V55 B;  1MOF A;  1D5A A;  1S76 D;  4X1Y B;  3ABL C;  4J7K A;  1H8E G;  3BPZ A;  4B7K A;  1JA8 A;  1SET A;  2ADQ B;  1B6Q A;  2QM4 A;  3K5O A;  1WAZ A;  4DR6 B;  5JJE B;  4DV2 O;  4OXS A;  1H2L A;  1AI7 A;  2BTQ B;  1Q81 W;  2BCC H;  4NTX A;  5FNV B;  3SR2 C;  5CBH A;  1FJG B;  2EZO A;  4IIJ A;  4LF7 B;  3LSU A;  3FYE B;  2YIB A;  4JI0 O;  4B3T B;  5IYD O;  3B4S A;  2W6J G;  4D7T A;  3JYC A;  1PL0 A;  5EC1 C;  2EIJ C;  4HAM A;  4HNA A;  5ITZ A;  3JAL A;  4X1I B;  3UKM A;  3FYI B;  1JCH A;  3EXA A;  5B1O A;  4OX9 B;  3E8F A;  3ZRV A;  1S5H C;  4NVP A;  4WFG A;  1URF A;  4B3R O;  4MTX A;  4F6E A;  4FLX A;  1VQ6 V;  4NKG B;  1U97 A;  4LF9 O;  4GKK O;  4X62 B;  3CYO A;  1K9M W;  1NBM G;  2QDO A;  2N04 A;  3RYH B;  5IJ9 A;  3CJH B;  3JD4 A;  2ZXW C;  2Q7H A;  1EM1 A;  3JD2 A;  1VF6 A;  3BAB A;  1AJP A;  3CD6 V;  2LGW A;  2PGG A;  1S5L Z;  1SA0 A;  1Y6X A;  1VMG A;  4EEQ A;  3AG7 A;  3QO8 A;  5JJJ B;  3QNE A;  4I4T A;  3SYO A;  4BR6 A;  2DQ0 A;  4LF7 O;  5H5N A;  4LNU A;  4O2B A;  1E1Q G;  1FXK B;  3ZS8 C;  5KX5 B;  4DR7 B;  3A8T A;  4QGP A;  5IYC O;  1OCO B;  3H1L H;  1XBL A;  4HZ3 A;  4TQF A;  5KMG A;  1SQX H;  4TSF G;  2CGN A;  3SGI A;  1NS1 A;  3AEI A;  2YC0 A;  3ETQ A;  4X8A A;  3IAY A;  1WB8 A;  3QVN A;  1Q7Y W;  1NU1 H;  5KAF Z;  3E89 A;  3AG1 C;  3ZMS A;  2XUM A;  5E79 Z;  4X62 O;  4IYH A;  1I7F A;  2P7T C;  4DK1 A;  1VQ9 V;  1K73 W;  1XOU A;  1FPO A;  3UM7 A;  2MW2 B;  1WJZ A;  3QO5 A;  4K3A A;  2VWJ A;  4Q6G A;  5LXT B;  5LOV A;  3CSX A;  4GZR B;  1W0J G;  2QWR B;  4MVM A;  3ABL B;  3FB8 C;  2EX3 A;  3LNN A;  3JD0 A;  5BMV B;  3N2K A;  1JX9 A;  2QWN B;  4X9Q A;  2Q6A A;  1N4C A;  1XL4 A;  3H1K H;  4UV9 A;  3L9D A;  1THZ A;  2WLI A;  1H2M A;  4XDL A;  4JAA A;  3J80 N;  3E86 A;  3FX7 A;  4I0X A;  3CMA V;  3FAV A;  3LDC A;  4IT5 A;  3S3W A;  3H9V A;  3A2F A;  1RPO A;  4KP4 A;  1GN3 A;  1JVM A;  4JI6 B;  1ZSP A;  2CH7 B;  5EBL C;  1L0L H;  4B3M O;  1Q6H A;  5B66 Z;  2AW9 A;  1EN5 A;  1P7B A;  5B1A C;  4UCS A;  1XL6 A;  2DW4 A;  3RBZ A;  4O4J B;  1SZT A;  3VQX A;  3FB5 C;  1RFY A;  4JYC A;  2FKX A;  1HNW B;  2WA4 A;  1M56 C;  4K35 A;  2HFE C;  5K1P A;  2JEU A;  3RYF B;  4JI2 B;  4PA9 A;  4XDJ A;  3STL C;  3K5N A;  3OFN G;  2M7W A;  1Q90 D;  4DRX A;  2Y0P A;  2JGD B;  5TIS Z;  2ZXW B;  4MVZ A;  4PDM A;  5LHH A;  4RWU A;  1K92 A;  3RVZ A;  1XNQ B;  4GYC B;  4JF3 A;  1YDX A;  4E4E A;  2K1E A;  2PZS A;  4UFZ A;  2XAF A;  4UCR A;  2XND G;  3K58 A;  1CPY A;  1Y74 A;  5JVD B;  3SYA A;  4NXN O;  1G6U A;  5DED A;  4UVC A;  3JAM N;  1ZLZ A;  4JI7 O;  3BVO A;  1YF2 A;  4JI6 O;  3HKD B;  4UXN A;  1VP7 A;  3UCS C;  1ENV A;  1QQC A;  3FFQ A;  5JQG B;  1F23 A;  1JFF B;  2HR3 A;  3VBB A;  1XMQ B;  4ICG A;  3EFF K;  3CRA A;  5KHK A;  2AHY A;  5IYB O;  1E1R G;  5D5P A;  4J11 A;  2Y69 C;  1NVP D;  1GAX A;  1NH2 B;  3AG1 B;  4JI2 O;  2C2A A;  1TA8 A;  1K8A W;  1M90 W;  1TUB A;  3CCE V;  2HKO A;  4JI1 B;  2E5L B;  2IW5 A;  1SF9 A;  2DOS A;  3I56 V;  3ZHU A;  2UUC B;  1AJQ A;  1EN4 A;  1IXB A;  1XHZ A;  1N33 O;  3SYQ A;  1XI1 A;  1UFI A;  5B3S C;  2A79 B;  3SPH A;  1EFR G;  1YEW A;  2X7R B;  4IHJ B;  4BW5 A;  1XMO O;  5IT9 N;  1QBZ A;  2QWP B;  3L74 H;  2XAG A;  4X65 O;  4JPR A;  3STZ C;  3I55 V;  4WFB V;  1US6 A;  3CXC U;  3P32 A;  2IH1 C;  5EZY A;  3ABT A;  5CA0 A;  3A0H Z;  1Q43 A;  4UCT A;  2YSU B;  1MNG A;  5FL7 G;  5CBF A;  4FFB A;  4RUE A;  4F6R A;  4QIW F;  5B1A B;  2YIA A;  1VQ7 V;  3H1I H;  2ETN A;  2GHY A;  5L3D A;  4BAY A;  5F2V O;  3AG3 C;  3DC6 A;  1M56 B;  5CMU A;  1VF6 C;  4JI1 O;  2E5L O;  2UUC O;  2YIC A;  5EIB D;  1VQO V;  5CA3 A;  1K7D A;  4N23 A;  1FFX B;  2HVK C;  1BCC H;  3QF7 A;  4DUY O;  3SPJ A;  3E22 B;  1IBL B;  2X0L A;  3FKS G;  2HHH B;  4DR2 O;  3RWR D;  1KMI Z;  1ORQ C;  3UQ8 A;  3ZHR A;  1LR1 A;  2V7Q G;  1XRE A;  4GT1 A;  3HKE A;  1VQ5 V;  4LFA B;  1M4U A;  2VWK A;  4R6Z A;  2QTO A;  4NXM B;  2OCH A;  3B2E E;  5BZB A;  5CN0 A;  4U7N A;  1BSM A;  4UUJ C;  3G71 V;  1K33 A;  4KL1 A;  2ATK C;  1RSO A;  1TVK B;  5B1B C;  3P3P A;  4FLW A;  2YI9 A;  3CWB H;  2YS8 A;  4PA4 A;  3TET A;  2ZE8 A;  3OEE G;  2UXD B;  3FB6 C;  2ZNJ A;  1HW7 A;  1XQ8 A;  2BE3 A;  4EFB A;  2EJ7 A;  4P30 A;  1AI4 A;  2Y69 B;  4FLU A;  3LDE A;  2AGA A;  4LBE C;  2CTP A;  1FYJ A;  2XAQ A;  1IBL O;  5CA1 A;  2HHH O;  5LGU A;  3G6B A;  3T4D A;  4TQD A;  1GN4 A;  4O4L A;  3JSL A;  1F7Y A;  5B3S B;  1V9P A;  4IIJ B;  4W4L A;  4LFA O;  5EK0 A;  1HWY A;  4W4K A;  1I5Y A;  3CB2 A;  2CGO A;  3JSN A;  1H8H G;  3K79 A;  1R3L C;  2ODM A;  4HNA B;  1YSC A;  4J10 A;  4WFH A;  5ITZ B;  3JAL B;  2OTL V;  4MVQ A;  5A9G A;  1ZUQ A;  4JI4 B;  2WLK A;  2HLD G;  1D5N A;  4D7S A;  2JIZ G;  5KHH A;  1NR7 A;  3HKB A;  4CC6 A;  1N36 O;  4RQF A;  2LFR A;  2UXD O;  4IL6 Z;  3CME V;  4G27 B;  1GMG A;  4FIP C;  4C7U A;  4DV4 B;  1V54 C;  3QO7 A;  3T1Y O;  3ZCC A;  2WLH A;  3W7S A;  1Q5O A;  1HNX B;  2JJ1 G;  1VQL V;  5IJ9 B;  4DR5 B;  1WB7 A;  5L3F A;  3AG3 B;  2BOC C;  2YUA A;  4GX1 A;  4X89 A;  2GV9 A;  2Q67 A;  1QHT A;  1SA0 B;  3MDS A;  4AHC A;  4YJ2 A;  1IX9 A;  2ZR3 A;  4ZOL A;  2JRI A;  3ZIA G;  1JMK C;  3CRQ A;  4FLZ A;  4AIL C;  4DV0 B;  4MVR A;  1SQF A;  4LNU B;  4O2B B;  4Z2W A;  4JZ2 A;  4K8Z A;  3T2M A;  4JI4 O;  3VQV A;  5KMG B;  2Y0I A;  1M1K W;  3IC9 A;  2WLM A;  5JH7 A;  2QKS A;  2F23 A;  5GW7 A;  3JAT A;  5D5Q A;  4J7Z A;  1MAB G;  5LA6 A;  2QWO B;  3ZMV A;  4DV4 O;  5B1B B;  3OT7 A;  2WWW A;  2UUB O;  1HNX O;  1HDJ A;  3ZX6 A;  1DGS A;  1VIB A;  2Q68 A;  3TXS A;  1SS3 A;  1S5J A;  1Y76 A;  1S0V A;  3AG2 C;  5H6Q A;  3U10 A;  3HKC A;  5FLX N;  2VS0 A;  4FMT A;  4WFA V;  2BSK A;  1H38 A;  4JYB A;  5LOV B;  4H0L B;  3TGU H;  1KD1 W;  4D6T H;  2R9A A;  3CEI A;  3N2K B;  3OMN B;  4DV0 O;  3OUS A;  4AQY B;  3B8M A;  4JI5 B;  3WB1 A;  2BTO A;  5J2U A;  2DN9 A;  2WLI B;  3APO A;  2L35 A;  4I0X B;  4J42 A;  3RYI A;  3FAV B;  4MTF A;  4X1K A;  4DR1 B;  2FL4 A;  1P4R A;  4QE9 A;  1NTZ H;  2Q73 A;  5LL6 Y;  1NT2 B;  3C3T A;  2A3Q A;  4LP8 A;  4PA6 A;  1YXB A;  2RQ6 A;  4WFE A;  5L3E A;  2X6B A;  2MK3 A;  1WP7 A;  3CC7 V;  3PJS K;  2Q4P A;  4K8X A;  3K5L A;  1V54 B;  2QKC A;  1LUW A;  2Q5Z A;  3K57 A;  3H01 A;  2Y4U A;  2JVD A;  3SDL A;  1B06 A;  3UT5 A;  4DRX B;  2AXT Z;  1AP5 A;  2D3O W;  2OWO A;  2PI4 A;  2F93 B;  2HEP A;  4NR1 A;  4LC1 A;  2IU0 A;  3BEH A;  1GM9 A;  4JTC B;  3K59 A;  4AQY O;  3N2G A;  4IYI A;  4JI5 O;  4JGS A;  3W7U A;  2H8P C;  1XHX A; 
#chains in the Genus database with same CATH homology
 3K03 A;  1R6K A;  1SES A;  2HVJ C;  2XND G;  1W2B U;  1CPY A;  2B1G A;  4MTG A;  1KP3 A;  1JQ0 A;  3SYA A;  4RAI A;  1W0K G;  3SJQ C;  4UVC A;  4HYO A;  1R3K C;  1VQ8 V;  1GTO A;  3M99 B;  3F7Y C;  4UXN A;  2EBO A;  1ENV A;  4R8C A;  4F4L A;  1OCR B;  1F23 A;  3CCR V;  2HR3 A;  3VBB A;  3ETG A;  3KG2 A;  2QA4 V;  3K08 A;  3GWO A;  3EFF K;  2GSM B;  2ZDI C;  3SPC A;  2AHY A;  3OEH G;  3OR6 C;  3ASN B;  5IYB O;  5KA5 A;  5EBW C;  1E1R G;  4X88 A;  1RPR A;  1NVP D;  2Y69 C;  1H2G A;  4RUF A;  4P9O A;  4TWK A;  3G4S V;  1OCZ B;  5C93 A;  1NH2 B;  1PD3 A;  3AG1 B;  3WFV A;  4R7C A;  1V55 C;  2C2A A;  1K8A W;  1M90 W;  3ZN1 A;  1QVF U;  1NR1 A;  4MS2 A;  5KUM A;  3CCE V;  1FXV A;  1PNK A;  2HKO A;  3MHS C;  2IW5 A;  3I56 V;  1RM1 B;  1Y4M A;  1AJQ A;  3AG2 B;  4EKW A;  1QLE B;  1OCC C;  1GM8 A;  3SYQ A;  4MW3 A;  2EIN B;  1GK9 A;  5B3S C;  1AR1 B;  3W7W A;  2A79 B;  4Q20 A;  3SPH A;  3ASO C;  5IDJ A;  4JAS A;  3OW2 U;  1EFR G;  2B1I A;  1K4C C;  5LGT A;  1YTF B;  2EIK C;  2W0F C;  2X7R B;  2WLJ A;  4BW5 A;  1LNQ A;  1ROP A;  1QBZ A;  1JPX A;  1K5S A;  1R3I C;  3P30 A;  4UVA A;  3OMI B;  1N8R W;  2XAG A;  2WAM A;  2A0L A;  3OAA G;  3G6E V;  1M57 B;  2R9R B;  4JPR A;  3STZ C;  1CP9 A;  3T1C A;  3I55 V;  4WFB V;  2XAJ A;  3CXC U;  3IFX A;  1UJW B;  3P32 A;  3CC2 V;  1PNL A;  2IH1 C;  5LHI A;  4G28 B;  2XOK G;  3ABT A;  2LP7 A;  2W6I G;  3ABK C;  2IJJ A;  2YSU B;  3SPI A;  1NQT A;  3MHH C;  5FL7 G;  2IJI A;  1YI2 V;  5CBF A;  3E8H A;  3CCM V;  3ZRS A;  4RUE A;  2IJH A;  4QIW F;  5B1A B;  2JJ2 G;  2R9I A;  4QE7 A;  1COW G;  1VQ7 V;  3ETD A;  3A0R A;  1L1F A;  2F43 G;  2OCC B;  2GHY A;  1EZJ A;  5KUK A;  3K06 A;  4KFM A;  4I5S A;  5L3D A;  4BAY A;  4DXW A;  3AG3 C;  4MVO A;  1NH2 D;  1M56 B;  4L87 A;  5CMU A;  5LBQ A;  3K9A A;  4ASU G;  1J95 A;  1WLE A;  3K3W A;  1VQM V;  4CBC A;  1VQO V;  2WLN A;  5CA3 A;  1K7D A;  4N23 A;  2HVK C;  4PDR A;  2EIM B;  4JAU A;  4PDL A;  2WSS G;  3SPJ A;  5KA6 A;  2X0L A;  1S3J A;  4MVU A;  1ZWI C;  1G4Y B;  3OR7 C;  3FKS G;  4R50 A;  5EC2 C;  1YJ9 V;  1AI5 A;  2YEV B;  5DM6 V;  1ORQ C;  2YEV A;  1KEC A;  1JOY A;  1GM7 A;  1FXK C;  4PA7 A;  1GKF A;  1YTF D;  2V7Q G;  3ZRW B;  3ZRW A;  4GT1 A;  2X6A A;  3X2Q B;  1OCO C;  4FJC C;  2B5U A;  4R6Z A;  5H6R A;  3CCS V;  1VQ5 V;  2H94 A;  3B77 A;  1G8M A;  3B8N A;  4GX2 A;  5L3G A;  2QTO A;  1E79 G;  3GB7 C;  3F5W C;  3R65 A;  4U7O A;  2XAH A;  3LNM B;  3DGE A;  4UV8 A;  5BZB A;  5CN0 A;  4U7N A;  3CCJ V;  3T4Z A;  1QCE A;  4UUJ C;  3CCU V;  2QM7 A;  3G71 V;  3HPL C;  5H9C A;  3ML0 A;  1K33 A;  1DF4 A;  1K4D C;  2ATK C;  4QPJ A;  2EJR A;  3MD0 A;  4YXW G;  2P67 A;  5B1B C;  4WFF A;  4RO2 A;  4PA3 A;  2WPD G;  3ZMU A;  3CPW U;  3E83 A;  1F4N A;  4J9Z B;  2HJF C;  2QM8 A;  4PA4 A;  1K34 A;  3TET A;  1S72 V;  3OEE G;  1YHQ V;  3FB6 C;  1Y66 A;  3D3I A;  2X6C A;  3ETE A;  1CEZ A;  2ITC C;  1SRY A;  2Y48 A;  2ZDI A;  3ABM C;  4JAV A;  1NKD A;  1BMF G;  1GO3 F;  4P30 A;  1AI4 A;  2Y69 B;  2ITD C;  4FK5 C;  4CZZ A;  3AG4 C;  3ZN0 A;  4GX5 A;  3LDE A;  3LSS A;  1V55 B;  1MOF A;  2P6J A;  4LBE C;  4ZBM A;  1S76 D;  3ZRX A;  2CK3 G;  3ABL C;  1H8E G;  2XAQ A;  1YIJ V;  4H33 A;  1SET A;  1B6Q A;  1MSW D;  2JEX A;  3FB7 C;  4J9Y B;  5LGU A;  4RQE A;  3T4D A;  4MT8 A;  1OCC B;  2BOB C;  3OE7 G;  4OXS A;  3W7T A;  3RVY A;  1AI7 A;  1Q81 W;  4G2K A;  1KP2 A;  5HFL A;  2DWD C;  5E1A C;  5B3S B;  5CBH A;  3ASO B;  2EZO A;  3K04 A;  5EK0 A;  2EIK B;  3FYE B;  2ZD9 A;  2DYR C;  3F7V C;  3ZMT A;  1HWY A;  3BY6 A;  1I5Y A;  3TCU A;  1H8H G;  5IYD O;  4GCZ A;  2PI5 A;  3K79 A;  1R3L C;  2W6J G;  4BIZ A;  3JYC A;  1PL0 A;  2XAS A;  2EIJ C;  5EC1 C;  2OTL V;  1QR9 A;  1YSC A;  2EIL C;  4HAM A;  4WFH A;  4MVQ A;  5IY5 C;  2WLK A;  2HLD G;  2Z3Y A;  3OM3 B;  3UKM A;  3FYI B;  1NJI W;  1JCH A;  2JIZ G;  1DLB A;  5J9P C;  1R3J C;  1MG1 A;  4P2Z A;  5B1O A;  1NR7 A;  3E8F A;  3ZRV A;  3ABK B;  3OGC C;  1S5H C;  4WFG A;  2LFR A;  4RQF A;  3SYP A;  2EIJ B;  2UXX A;  5CBG A;  4MTX A;  3CME V;  2EZP A;  4G27 B;  1GMG A;  1VQ6 V;  4FIP C;  1V54 C;  4BIU A;  3QO7 A;  1EBO A;  3ZCC A;  1IXM A;  1DF5 A;  2NLJ C;  2WLH A;  3W7S A;  1K9M W;  3CYO A;  1BHA A;  3LSQ A;  2JDI G;  1NBM G;  2JJ1 G;  3ABU A;  3CCV V;  1VQL V;  3TK1 A;  3WG7 C;  3CC4 V;  2DYS C;  1VQP V;  3VOU A;  2UXN A;  1KC8 W;  4E2L A;  1AJN A;  1DTO A;  5LGN A;  3JD4 A;  2WLL B;  3K0D A;  5L3F A;  2ZXW C;  3AG3 B;  2BOC C;  2OT5 A;  3JD2 A;  3SYC A;  1S77 D;  4GX1 A;  2KB1 A;  4X89 A;  1AJP A;  3CD6 V;  4XDK A;  4N21 A;  4XBF A;  2Q67 A;  2FTK A;  4MW8 A;  5L3B A;  3ZIA G;  2ZR3 A;  3QO8 A;  3QNE A;  4MVR A;  3SYO A;  2DQ0 A;  1TUE B;  3E8G A;  3LUT B;  1E1Q G;  1I5X A;  1FXK B;  1FXK A;  5B1N A;  2IU3 A;  1OZ0 A;  5IYC O;  1OCO B;  3T2M A;  4WCE V;  1QVG U;  1OCR C;  1M1K W;  4HZ3 A;  2WLM A;  4TSF G;  1FXH A;  2QKS A;  1JJ2 U;  3OUF A;  3AEI A;  2P90 A;  5GW7 A;  3CCL V;  3SPG A;  4MSW C;  1BHB A;  1QR8 A;  3LDD A;  2Z5U A;  1Q82 W;  3ASN C;  4X8A A;  3DTU B;  4JTD B;  3CCQ V;  1YIT V;  1MAB G;  5L3C A;  1Q7Y W;  3OMA B;  1YJW V;  3ZMV A;  5B1B B;  1OCZ C;  3E89 A;  2WWW A;  3JD1 A;  1F51 A;  3AG1 C;  3CP1 A;  3ZMS A;  1R73 A;  3E35 A;  2P7T C;  4H37 A;  1AI6 A;  1VQ4 V;  1VQ9 V;  4PEL A;  2JK5 C;  2Q68 A;  4UVB A;  3ABM B;  1RM1 C;  1QLN A;  1KQS U;  4MTO A;  1S0V A;  2AHZ A;  3AG2 C;  1K73 W;  2Q69 A;  5H6Q A;  1QLE C;  3UM7 A;  3QO5 A;  4QNH B;  4DO2 A;  4FMT A;  3AG4 B;  4WFA V;  1ARO P;  2EIN C;  1F4M A;  1H38 A;  4JYB A;  4LCU C;  5EBM C;  3EHB B;  3E8B A;  4QPK A;  1W0J G;  1KD1 W;  4MVM A;  3ABL B;  3FB8 C;  4PDV A;  1K3E A;  1K5Q A;  3JD0 A;  4ZKI A;  2A9H A;  1OHH G;  3OMN B;  1JX9 A;  2Q6A A;  3OUS A;  1XL4 A;  3B8M A;  4UV9 A;  2IJK A;  1M57 C;  4JTA B;  1THZ A;  2WLI B;  2WLI A;  4XDL A;  2NNU A;  3E86 A;  3IGA C;  4TT3 G;  3CMA V;  4MTF A;  3HB3 B;  2DYR B;  3LDC A;  1PNM A;  1WPX A;  1FS0 G;  3ZMZ A;  4WF9 V;  1P4R A;  1RPO A;  4KP4 A;  1JVM A;  4QE9 A;  3E2E A;  2EIL B;  5EBL C;  5IY5 B;  3NXS A;  1P7B A;  5B1A C;  3ZJZ A;  4LP8 A;  4PA6 A;  1XL6 A;  4WFE A;  2DW4 A;  5L3E A;  2HG5 C;  3RBZ A;  2X6B A;  1NVP B;  2MK3 A;  4KUM A;  1SZT A;  2ZR2 A;  2OCC C;  3FB5 C;  4JYC A;  1K97 A;  3JD3 A;  3CC7 V;  1YJN V;  1BL8 A;  4GX0 A;  3RW0 A;  3D36 A;  1R6N A;  1M56 C;  3PJS K;  2HFE C;  2LFS A;  1V54 B;  2JEU A;  4FPP A;  1M9N A;  3W7X A;  2WLL A;  3IC7 A;  4I9W A;  4PA9 A;  3H01 A;  4XDJ A;  2DQ3 A;  4MVS A;  2IH3 C;  3STL C;  1PKX A;  2QEX V;  3JCZ A;  1SER A;  3OFN G;  3WG7 B;  2EIM C;  2DYS B;  1FFT B;  3K0G A;  2M7W A;  1VQN V;  2D3O W;  5LHG A;  1Q86 W;  2PI4 A;  4Z1M G;  2ZXW B;  4LC1 A;  4QJF B;  2IU0 A;  4MVZ A;  4PDM A;  5LHH A;  3BEH A;  2OTJ V;  1GM9 A;  2V1D A;  4JTC B;  1K92 A;  3RVZ A;  5DN6 G;  3X2Q C;  4JGS A;  1VQK V;  2QE7 G;  2DWE C;  4JF3 A;  3W7U A;  2ZQM A;  2H8P C;  2K1E A;  4P9P A;  5HFM A;  2XAF A;  1KKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...