1KC8W

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kc8W00
2QEXV 1Q86W 1VQLV 3CCJV 1N8RW 1S72V 1VQNV 1VQ8V 1KD1W 1KC8W 4WF9V 3CXCU 3G4SV 3CCVV 3CC7V 1K73W 1VQ5V 1K8AW 1VQPV 3CCUV 1VQMV 1VQ4V 3CMAV 1VQ7V 1VQ6V 3CCRV 1R73A 1M1KW 1K9MW 1YJ9V 1YHQV 2OTLV 2QA4V 3CCLV 1Q81W 3CC4V 4WCEV 1QVFU 3CCSV 1YI2V 2OTJV 1KQSU 1YJWV 1M90W 3I56V 1JJ2U 3CCMV 1W2BU 3CPWU 3CD6V 3OW2U 5DM6V 4WFAV 1Q7YW 3CCQV 1QVGU 1NJIW 1VQ9V 2D3OW 3CCEV 1YJNV 1VQKV 1Q82W 1VQOV 1YITV 3CC2V 1YIJV 3CMEV 4WFBV 3I55V 3G6EV 3G71V
chains in the Genus database with same CATH superfamily
1N8RW 3ZRXA 3P32A 5LXTB 3MD0A 3STLC 3UCSC 2P4KA 2PZSA 1SETA 4OX9O 1BQZA 1S77D 3JD1A 4UFZA 3FD9A 2L6LA 2ZE8A 4TSFG 1PM9A 1B06A 4U7NA 3ETDA 1R3LC 2GV9A 4I9WA 4MVMA 1CP9A 4KXRA 1JFFA 4I50B 1JMKC 1J95A 2DWDC 1VMGA 1Q6IA 5KLVH 3APOA 3OR6C 1MNGA 1E79G 2KKWA 3JATB 1QLEB 4NVPA 2LGQA 3NXSA 1N4CA 4TOIA 2YSUB 3BA8A 2NLJC 3E83A 4JV5B 3BEHA 4B3TO 4X20B 1QLNA 2IU3A 2IM9A 4X1IB 4IYHA 2X7RB 3I55V 1YI2V 3OTFA 3D3IA 5EBMC 3UO2A 1W0JG 5A9GA 2E3CA 2RQ6A 4UXNA 3ABMB 1ZLZA 5LBQA 1TVKB 1QU7A 3I56V 2YIAA 4I55A 1QVGU 4NB5A 1SZXA 1H2GA 3KKYA 3TJTA 3G6EV 5J2UB 2BTQB 1VQNV 2WLIB 2X6AA 3CYOA 3QF7A 1HNZB 1R6NA 2UUAO 1ZSPA 1N32B 4DRXA 1WPBA 1KECA 2GTSA 3JCUZ 2DJVA 5EIBC 1SQBH 2X0LA 4DV1B 1FXKB 3E8BA 2JRIA 5GTHZ 2OWOA 4IL6Z 1GRJA 5L3DA 4PD4F 1KD1W 3FB7C 1UFIA 5KHHA 1SQQH 5CA1A 4RUFA 5LA6A 2ADQB 2UUBO 3LDEA 3SDLA 1FXHA 4K8ZA 3TCUA 4JI5O 2DYSC 3RT3C 3ZN1A 4EEQA 1B04A 1XEQA 3AG4C 4DV6B 4Q6GA 1OCRB 1Y67A 3HB3B 2KQXA 3IFXA 4LFBB 2KG7B 3THOA 2HVKC 2YEVB 3SYQA 4J80A 2ITDC 4O4LB 1K92A 3HKEA 3X2QC 3WU2Z 4BW9A 4NXMB 2EJ7A 1PNLA 5F2VO 5B1BB 3CCQV 3E22B 1SERA 5L3GA 3LSUA 2EIJB 3R65A 2QDOA 3EXAA 1ZUQA 2OCCC 4PA4A 4DK1A 3ABTA 2QM4A 1OZ0A 3K79A 2DYRC 4J9ZB 5E1AC 3T1YB 5IJ9A 4H33A 2XASA 3JASA 5KAIZ 5C8YB 1AR4A 2W0FC 2HLDG 4J10A 3ZHRA 2WLNA 2RDCA 2RN9A 4GKJO 3JSLA 1JOYA 5KMGA 5FNVB 3RBZA 1Y6XA 3B77A 4J7ZA 4G2KA 4LWSA 1GMGA 4D7SA 4GX2A 4O4JB 1R6KA 1BMFG 1JVMA 3SPIA 4B3SB 2PYLA 2Y4TA 2BSKB 4R50A 4J41A 2ZR2A 1US6A 2QSAA 1VQ8V 1R1BA 3CSXA 1Q6UA 1XMQB 1SC5B 4JI3O 4LF9B 3UT5A 1V55C 2PGGA 4K35A 1IBKB 4JI0B 1NZ6A 4JTAB 2A06H 4EFEA 4LCUC 2QWPB 4YJ3B 3E8FA 5H5NA 2BOCC 3DTUB 4CBCA 3ZMTA 5L3CA 3CMAV 4MVRA 2LJ2A 4UUJC 4HYOA 4PI0A 1YJ9V 3SJCC 2QTOA 3UQ8A 4ZBMA 1XHZA 2HFEC 1GN6A 2YXYA 1IBMO 3JAMN 5DM6V 1TAEA 1NR7A 1YITV 4JTCB 5IY5C 1NQTA 5LMUO 2QE7G 4U3JA 2EJRA 2ZE6A 3LSQA 3AG3C 2ZE5A 1WB7A 2PI4A 1L0NH 2WLHA 5LP6C 4LF8O 4B3RO 1L0LH 2QWNB 3IC7A 4JI1O 4DV0O 3ABKC 2DE0X 4ZKIA 3KCYA 4DR7O 5ITZB 4WFHA 4DR1B 3CRRA 4B3MO 1VQPV 1FAFA 1GN2A 4JI2B 4WBNA 3SR2C 1KKCA 1BCCH 2HJFC 5EC1C 2EILC 1HNWO 3E35A 3OUFA 1VQ9V 2H94A 5H6RA 5JH7B 1IZ3A 5CA0A 2KB1A 2EIMC 5J2TB 1K5SA 2P06A 1N0JA 1EZVH 4BAYA 4X1YA 4Q20A 3D36C 2Q73A 3D3QA 4LC1A 4LNUA 3ZMVA 4PV1B 3CCLV 1N0NA 4ZI7A 2EZOA 2JS3A 3K03A 4DR2B 2UU9O 5H9CA 1I5YA 1RPOA 1HR0B 1NVPB 1S5LZ 1N36O 3U10A 3L9DA 1H2MA 4DR4O 4DUZB 3ABLB 1GM7A 3P3NA 1Y76B 5EBLC 5BZBA 2DOSA 4FM1A 2Y69C 3DXRA 5D5PA 4X8AA 4P9PA 2Q9LA 1DK1A 3JARA 4DV4O 3SPCA 4EFBA 2QWOB 5A2QN 4DK0A 3Q4HA 4ABMA 4PELA 1N34O 3HPLC 3OEEG 4YIOA 3G67A 2F23A 2R9IA 4NTWA 2ZD9A 4MVZA 2P22C 1FJGB 3M8AA 5KHIA 2NR5A 3UO3A 4JI4B 3O9OA 4LF4O 3JAWA 1J5EB 3JD0A 2W0XA 4I0XB 4PDLA 5AG2A 1AJPA 2ZNIA 3N2GA 4F6EA 1QHTA 3CHXA 5LGTA 1M56B 3G80A 2F95B 2R9RB 5CBGA 2YC0A 4LF6B 2XUMA 2NN4A 3AG2C 3ASOB 4O4HA 2QA4V 3B8MA 5LP6A 1S5JA 2HKOA 4QJFB 2XNDG 1OCOC 4JI6B 3MHSC 5FPRA 3SPHA 2F4VO 1PNMA 4OPAA 1JQ0A 1RP3B 2FYUH 1Q6HA 2ZKOA 4DV5O 1K73W 3H1KH 1FFXA 2QWQB 1I5XA 2FL4A 3DSQA 5BY1A 1IXMA 2PF4E 2WLLA 4TT3G 4MTXA 5LGNA 4B08A 1AJQA 2V7QG 5CMUA 1GAXA 1XQ8A 3CC2V 1AR1B 3D36A 1E1QG 4PJ0Z 1AI4A 2CE4A 1Y74A 5E79Z 4FLWA 3ZX6A 2A79B 1AB3A 1WP8A 3FX7A 1YZBA 3P30A 4X64B 3CPWU 1LUVA 3ZN0A 2VQFB 2L35A 4P9OA 5LYJA 3AEIA 4PDRA 4DV7B 2ZE7A 5IJ9B 3WB0A 3R66A 2QM8A 3ASNC 1ENVA 5L3FA 3GVMA 3CS5A 3ZMUA 2FTKA 1D5NA 3LNNA 5JCOC 1FXVA 4YY3B 3CXHF 4JV5O 1M57B 2BCCH 5KX5A 1O9GA 3JYCA 1Z5VA 2UXCB 1TGOA 2ZXWB 4UCUA 2P67A 4HNAA 4F4LA 2IJHA 2CH7A 3RWRD 4LF7B 2EX3A 3RYFA 1OCCC 2Q7EA 1Q86W 2B1GA 5BMVB 1P7BA 3OE7G 3IC9A 3ZEDA 2DN9A 3T1CA 1M5IA 4JTDB 2Z5UA 3CJHB 3HKBA 3WFVA 1EBOA 1YJWV 1BL8A 3CCMV 3CP1A 1SA0B 5IJ0A 4PA6A 1YTFD 4X66B 1QR8A 4J42A 3ZHVA 1HNZO 4O2AB 1WAZA 1GN3A 4AQYB 4FMTA 1S72V 1N32O 3VQXA 3E89A 1G6UA 2ZDIC 1VQ6V 3HKDB 4MTOA 3FYIB 4DV1O 4ZHQB 4JI7B 3LSSA 3BRCA 5EZYB 2CUGA 1H2NA 2A3QA 3RYHB 5JQGA 3OFNG 4PDMA 2R72A 1S0VA 4FIPC 4NTXA 1TUBA 5EYPA 1I08A 4DV6O 2A7WA 1NH2D 5H6QA 3BCCH 1HDJA 4HBNA 2D2CB 4IHJB 4LFBO 1MABG 3MHHC 4UCSA 3S3WA 1DLBA 3M99B 2V1DA 1P4RA 3CXCU 3B8NA 1Q8IA 4NXMO 4UV8A 2ZIMA 1JCHA 1KP2A 1KB9F 4UV9A 4GKKB 4UB6Z 4AI8A 1H8HG 1YIJV 1KC8W 2LFRA 2JGDB 4F6RA 5JCOA 4NR1A 4KHPB 5CA0B 2N74A 2F43G 5DEDA 1GN4A 2DWEC 4Z1VA 5KUKA 3T1YO 1G8MA 4WFFA 1Q81W 3GWKC 1MOFA 2LO1A 4KP4A 3K9SA 1VARA 3N2KA 3K59A 1LUWA 2HEPA 1KMIZ 2EZPA 4B7KA 4LBEC 1H2SB 4GCZA 4YJ2A 1IBLB 4QGPA 1GKFA 3RYIA 2BE3A 4MW8A 1WA8A 4BR6A 4DR3B 3CB2A 4U3FH 3CX5F 2AGAA 2H3OA 1VF6C 4B3SO 4QPJA 1ZX3A 3TGUH 1H2KA 3AK1A 2HJDA 5IYZA 5KUMA 3A2FA 3RYCB 2VQEB 2UUCB 1YSCA 1XMQO 1Y66A 1U97A 4LF9O 1MA1A 3ETGA 3CC7V 3E86A 3SYCA 2ZDIA 3FAVA 2ZM6B 3ZRWA 5KHJA 3K5NA 1NKDA 1IBKO 4JI0O 3EHBB 2LFSA 3OMAB 4AILC 3CCSV 4O4IA 3WG7C 3MAQA 1EM1A 1JA8A 4X1KA 5EIBD 1ZL8B 4RUEA 2WA4A 4CH3A 2AHZA 1D5AA 2CK3G 1XL4A 1YEWA 4NXNB 1K97A 2ZQMA 4O2BA 2W6IG 1H8EG 4ASUG 1WLEA 3BVOA 2PUSA 5DN6G 4MW3A 4FLZA 4FM2A 4UCVA 3CCRV 1MSDA 2CAZC 1O9HA 1GM8A 4YHHB 4MVSA 3H1JH 4NKGB 2YIBA 4H13B 3K0GA 3H01A 1I94B 3ZHUA 4WFAV 2GUZB 3ABKB 5B1AB 1VQ4V 2Q67A 1VQ7V 2XAHA 1MZFA 2UXXA 2P7TC 3F7VC 3BHPA 4UCRA 3OR7C 2IU0A 4I4TB 3VQWA 1NR1A 2E76B 3K0DA 4RO2A 3B4SA 4J9YB 1BHAA 2HG5C 1EZJA 1QBZA 4ZOLA 3K58A 2YS8A 4IIJB 1YDXA 3JAKA 4DR1O 2EILB 2Q4PA 3FB8C 1QLEC 1K33A 5LMNB 4JI2O 2JEXA 3QO5A 4UVCA 2OYQA 2Q68A 2VWJA 1CEZA 2X6CA 4I9QA 4H0LB 1JR9A 3OGIB 1Y74B 2DQ3A 2OCHA 4Z1MG 5B3SC 3CCEV 1XILA 5GW7A 4TUYB 4IT5A 2MK3A 4K0KB 3ABMC 3O65A 2EINB 1B6QA 1GTOA 4CC6A 3TXSA 5LYJB 1OHHG 3T1HB 4X65B 3H1IH 3A8TA 4GX5A 5CB4A 1VF6A 4DR2O 1U96A 3A0BZ 3AG1B 4FLTA 2R70A 1HR0O 1AI7A 4DR5B 4N23A 3S3XA 4DUZO 4PHZA 3IGAC 3ETQA 3KZIZ 3C3TA 4TV9B 5L3BA 1VP7A 3BPZA 1LNQA 1YHQV 2PY5A 2WLMA 4AHCA 1WNSA 3WB2A 4EB6A 1RSOB 3H9VA 3HKCA 5LOVB 3CCJV 1SQGA 2AXTZ 1CPYA 1S3JA 1WB8A 2ZCEA 1FJGO 3B09A 1XUQA 1SQFA 1W59A 4JI4O 4LH6A 2JJ2G 1J5EO 1I7FA 5LXTA 3J7AU 2XHBA 2D3OW 2F1MA 5DECA 1SKVA 4LF6O 3G6BA 2IH3C 4TV8B 1BGYH 1QCEA 5GONB 1SQPH 1S76D 5B1BC 4I50A 1GH6A 2QTSA 4JI6O 4FLUA 2E5LB 4QE9A 4UVAA 5BXZA 3LUTB 4FJCC 2IH1C 1PD3A 4J11A 3JATA 2JDIG 5FL7G 4CZZA 2Z3YA 3G4SV 3LNMB 1JFFB 3AK2A 4QE7A 3K08A 1F4NA 4X20A 3ZCCA 2O57A 3STZC 1M9NA 4XDKA 2RJZA 3ZRSA 2R9AA 4NTYA 1BHBA 2GSMB 1XNRB 3W7WA 4FZ0A 4X89A 2QEXV 4I5SA 1Q5OA 1GK9A 4J7JA 3ZHSA 4LFCB 1TVKA 1MZEA 2ZINA 5JVDA 3OEHG 1X4TA 2AW9A 3ASNB 5D5QA 4X64O 1NI8A 2VQFO 2Y0IA 2P5OA 5J2UA 2BTQA 4H44B 2WLIA 4D7TA 2YDEA 5JJEB 2AHYA 2E75B 4DV7O 4NYKA 2UXNA 4MSWC 2QM7A 1YTFB 3GWOA 2Q6AA 5K1XA 4JYYA 5LL6Y 1K3EA 3SPGA 4DYLA 4X62B 3OMIB 4YY3O 4I55B 2LW1A 1NBMG 3SYOA 2K9PA 5IYDO 2UXCO 1CXZB 1K5QA 2N04A 4LF7O 4DXWA 2AZ2A 4DRXB 3BABA 1Z2GA 3DC5A 5B66Z 1JPXA 1URFA 1V54B 2CGOA 1VF7A 3FYEB 1N33B 4PA9A 3W7UA 3BY6A 3K9AA 3IJ4A 2YICA 2JGUA 3ZRWB 4RAIA 4X66O 2KG7A 3BFRA 4FLVA 5CA1B 5LA6B 1NH2B 4FFBA 2YEVA 4GLXA 4DV3B 4AQYO 4O4LA 5B5EZ 3E8HA 1OCZB 1E1RG 1RM1B 5LHGA 1RPRA 1NU1H 4JI7O 3E22A 3JD4A 1YVWA 4FLYA 2F93B 1IVSA 2XAJA 3E8GA 4X9QA 1PP9H 3HKEB 4ZIBA 1Q7YW 2PTMA 5KA6A 5HFLA 2ODMA 1XREA 2LW7A 1AR5A 2B5UA 4DV2B 5KA5A 2NNUA 1K4DC 1IX9A 3L72H 1PL4A 2CDYA 1Z5WA 3OTOB 2YI8A 1F7YA 2OTJV 4OGQB 5IT9N 3KG2A 2IW5A 3F7YC 1AJNA 5FNVA 4RQFA 4DO2A 1YXBA 5LGUA 1XNQB 1TUEB 3JASB 2WLKA 1XHXA 4D6TH 1A32A 2G38A 4JAVA 4O4JA 4GKKO 2EBOA 1XI1A 4JZGA 1BQ0A 1NTKH 5IE9A 2BSKA 4G28B 3JALA 2Q0AA 5KMGB 4CS3A 4QPKA 4RQEA 4LWSB 3ABLC 1PKXA 3CMEV 4JYAB 4KHPO 2Z0AA 2JJ1G 4YXWG 2WA3A 1LR1A 2A9HA 1F4MA 4TQFA 4YJ3A 3LDCA 4FM0A 5CN0A 1R6TA 4XDLA 3ZRVA 3CC4V 2HHHB 3J80N 3M7MX 3UT5B 1NTZH 1IBLO 1XDCA 1JX9A 2RMKB 5FLXN 1VQ5V 3W7SA 4DR3O 3QTCA 4X88A 4DR6B 2XOKG 3C3SA 2M6YA 2WWWA 5JJNB 3CWBH 5CBHA 1XBLA 4GYCB 2DW4A 3U11A 3VQVA 2C2AA 1THZA 3SPJA 2UUCO 2VQEO 2QJ1A 3WB1A 4JZ2A 2UXBB 1M56C 2QKSA 2DYSB 1HNXB 1AILA 2LQTA 5GTIZ 1WP7A 2ZM6O 4TQDA 1W0KG 3AG4B 3AG7A 3ASOC 4BIZA 2DMXA 4N21A 3RFRA 2ZIOA 3TK1A 5IDJA 1BT8A 1SQVH 5ITZA 5CBFA 4U3JB 2JIZG 1AROP 2Q7GA 1XMOB 3X2QB 4CH6A 2OIEA 2UXDB 4NXNO 2FB5A 3ZHTA 5IWAB 3VQYA 1MG1A 1XOUA 1XL6A 2FMLA 3KCXA 4YHHO 4P30A 5JH7A 5J2TA 2M7WA 5EC2C 1ZAUA 2OCCB 1EN6A 1W2BU 3CD6V 1I94O 3RW0A 4KL1A 2K1EA 4GT1A 4WBNB 2DYRB 1RFYA 4DW0A 3L75H 4JI8B 3C90A 5BR8B 1YCIA 2YIBD 1DF5A 5IYCO 4J7KA 4LFAB 1EN5A 4X1YB 3A0HZ 3K5OA 3QNEA 2WPDG 4XDJA 2YUAA 4LNUB 4XBFA 2GHYA 4JPRA 1ZTEA 1Y76A 3T4DA 1VQKV 4ZI7B 5LMNO 2MW2B 2FKXA 4MS2A 3FKSG 4DUYB 1FS0G 2JEUA 5B3SB 1M57C 3SYPA 1M93A 4PA7A 2ZXWC 3ZS8C 3W7TA 2ZR3A 3ZMSA 1BZKA 4MVOA 1QR9A 5JVDB 1V55B 2IJKA 4BIUA 4FK5C 2WSSG 2DQ0A 4OPHA 2CTPA 3TXQA 4E2LA 4ICGA 2CTWA 2OT5A 4K0KO 1MMMA 4CS4A 5B1NA 2WAMA 3DXRB 2XT9A 1SF9A 3JARB 1Q43A 3T1HO 4X65O 2QKCA 3Q4HB 3IAYA 1WJZA 2JS5A 1DGSA 3ICXA 3PJSK 3APQA 3NR7A 1AI6A 4I0XA 4DR5O 1NT2B 4JF3A 2WLJA 4W4KA 3L74H 3VOUA 1P84F 1K4CC 4H37A 2EIKC 1Q3EA 3K3WA 2OTLV 1WN7A 4MVQA 4TWKA 3JAWB 3CE2A 2LP7A 3ABUA 5IY5B 1SZTA 1KKDA 3N2GB 2XTAA 2E74B 4OX9B 4KFMA 2W6JG 4BWAA 3U0ZA 3SJQC 1FPOA 3F5WC 4BW5A 3AG3B 4O4HB 1T5EA 5LP6B 4K8XA 1AVMA 4FFBB 1F23A 3CCVV 1S5HC 3FB5C 1OV9A 3K5LA 1IURA 1AI5A 3SGIA 4HAMA 3DGEA 3JD3A 3B2EE 1DTOA 2ZT9B 1F51A 2B1IA 1FFXB 3L71H 1M90W 4FVMA 1IXBA 2Q0OC 2RCVA 3DC6A 4B3TB 3T2MA 4MVUA 2WLLB 5LHHA 4B7EA 3CRCA 4WFEA 2EIMB 2E5LO 3A0RA 2HR3A 1KP3A 1P49A 1KU9A 2P4VA 1UJWB 1BSMA 3RN4A 1Y4MA 1EN4A 1SESA 1NTMH 3OMNB 1ZWIC 4CC5A 1Q90D 3EVKA 1KYOF 2ARHA 5H2FZ 1AP6A 1QQCA 4GX1A 2YXLA 2UUAB 3L70H 2PYJA 2ILMA 1XNRO 4UB8Z 4RWUA 3QO7A 4A5UB 2XAQA 1G1XB 5BMVA 4JAUA 2Y69B 3JALB 5J9PC 4FFKA 4LFCO 2HVJC 5KX5B 2Q69A 3SJAC 2B9ZA 3AK3A 3CJHA 4HNAB 1K8AW 2CH7B 1SA0A 3RYFB 1M1KW 2AZ0A 1FXKC 2CTRA 2H8PC 4O2AA 4JASA 3B40A 4YIPA 5JWPA 2UUBB 1QVFU 1K34A 3D8CA 4JI5B 3OUSA 2QGNA 3HKDA 4X62O 4R7CA 2ETNA 1KUQA 3HKBB 1JJOA 2Y0PA 4ZHQA 5IJ0B 3VBBA 3JD2A 1AP5A 3RVYA 1GO3F 4LH7A 3K06A 2XAGA 5EZYA 3K5MA 1SS3A 4CH5A 2EULA 3W7XA 3RYHA 1QNMA 1OCRC 5FPOA 3I5DA 2CGNA 3AG2B 1MSWD 1TA8A 3SYAA 1N33O 1OCOB 4U7OA 2XAFA 2V4DA 3P3PA 4IYIA 2YIDA 3PN1A 1R3KC 5JQGB 1K9MW 4G27B 1HP8A 4IHJA 3ZHQA 1COWG 4WCEV 3ZBHA 4DV3O 4JYCA 2JK5C 1WPXA 2VRZA 2EIJC 5B1AC 1TUBB 5EYPB 4PI2A 4CH4A 3BAAA 4C7UA 2ZNJA 2ADPA 5CA3A 4GKJB 1BE3H 3K57A 4X1IA 1X59A 2JGDA 5KAFZ 1VQOV 1ROPA 1EFRG 4DV2O 1VQLV 4E4EA 4Z2WA 2OIGA 3QO8A 4GX0A 3FFQA 5K1PA 1PPJH 2Q7HA 3OT7A 3OTOO 4JI3B 4FPPA 5TISZ 4LF5O 4F6RB 1JJ2U 2YI9A 3RGBA 2GDSA 1XNQO 2EINC 4UCTA 1YJNV 2IJJA 1VF5B 3N2KB 4WF9V 4K3AA 1L1FA 2Q5ZA 1I0HA 3AG1C 2CTQA 3UM7A 1FXKA 1OCCB 4YJ2B 3RYCA 3RYIB 1WA8B 2P90A 2ATKC 4I7ZB 2Q8VA 4UCOA 2P6JA 1K7DA 4KUMA 3BA9A 4JYAO 2KSDA 1IBMB 2VWKA 3CRQA 5LHIA 4DW1A 1M4UA 2Y4UA 2Y48A 4L8JA 1KBHA 5IYZB 1B3QA 5LMUB 5L3EA 1ZL8A 1PL0A 2HHHO 4BIOA 1G4YB 2GBOA 3F5TA 3FAVB 1L8DA 2GTAA 3N27A 4B3RB 1PNKA 4LF8B 4DR6O 4JI1B 4O4IB 2IBZH 4DV0B 4DR7B 4X1KB 1BS3A 4JGSA 1R73A 3OGCC 4B3MB 3LDDA 4MTFA 1H38A 3H1LH 4O2BB 2UXBO 2GUZA 1HNXO 3L73H 3QG5A 1SRYA 4W4LA 1HNWB 3MDSA 3G71V 1OJHA 4I4TA 2QR4A 3EFFK 2PI5A 4MT8A 4MTGA 3CRAA 1SQXH 4JYBA 5B1OA 2ITCC 1YF2A 4R8CA 5C8YA 4IIJA 2X6BA 4PA3A 1XMOO 5IYBO 2QWRB 2UXDO 2RNBA 3ZMZA 4GZRB 2LGWA 4LF5B 4P2ZA 2UU9B 4WFGA 5IWAO 1R3IC 3ZJZA 4QIWF 5EBWC 3GB7C 1N36B 2A0LA 4R6ZA 1VQMV 1FFTB 4ZOLB 4DR4B 3JAKB 3OM3B 1PV0A 4GUNA 5EK0A 4TUYA 1KQSU 4PDVA 3OW2U 3ETEA 1GM9A 1NJIW 4JI8O 1HW7A 4DV4B 5BR8O 3ZIAG 1FYJA 4JAAA 4LFAO 1HWYA 5KHGA 3H1HH 5JJJB 1N34B 4OXSA 4IGGA 1FKAO 4QNHB 3RVZA 5C93A 3JCZA 1VEWA 3CEIA 3JSNA 2IJIA 2YXHA 1NS1A 4DUYO 5CB4B 1NVPD 1Q82W 4TV9A 1ORQC 4WFBV 4LF4B 3QVNA 1H2LA 4EKWA 1RSOA 3J81N 2F66C 3HR0A 5LOVA 3ML0A 1R3JC 5KHKA 1V54C 3FB6C 3OD4A 1P7GA 4UVBA 2JVDA 1UPGA 3WG7B 2QKAA 3UKMA 2F4VB 3OAAG 3TETA 3CCUV 1D2DA 4DV5B 4EB6B 2EIKB 4FZ1A 1V9PA 4LR3A 3T4ZA 2BTOA 2N05A 1IDSA 3HKCB 3K04A 3SJBC 4FLXA 1OCZC 3CRMA 1RM1C 4HZ3A 4TV8A 5HFMA 4L87A 1DF4A 1VIBA 3E2EA 4CS2A 5GONA 4LP8A 2HP8A 2BOBC 2VS0A 1FD9A
chains in the Genus database with same CATH topology
1N8RW 3ZRXA 3P32A 1F23A 3MD0A 3CCVV 3STLC 2IH3C 1K73W 1S5HC 3FB5C 1I5XA 1QCEA 1SETA 1S77D 3JD1A 1S76D 1AI5A 5B1BC 4TSFG 4U7NA 4HAMA 3DGEA 3JD3A 3ETDA 4QE9A 1R3LC 1DTOA 4UVAA 1IXMA 1F51A 2B1IA 2WLLA 4I9WA 3LUTB 4MVMA 4TT3G 4MTXA 1M90W 5LGNA 4FJCC 1CP9A 1AJQA 2V7QG 5CMUA 2IH1C 1PD3A 3T2MA 3CC2V 4MVUA 2JDIG 1AR1B 3D36A 1J95A 2DWDC 2WLLB 5FL7G 4CZZA 2Z3YA 5LHHA 1E1QG 3G4SV 1AI4A 3LNMB 3OR6C 4WFEA 2EIMB 3K08A 4QE7A 3A0RA 1F4NA 1E79G 3ZCCA 1QLEB 3STZC 2A79B 1M9NA 2HR3A 4XDKA 3ZRSA 3NXSA 1KP3A 2YSUB 2NLJC 3P30A 3E83A 1UJWB 3CPWU 1BHBA 2GSMB 3BEHA 3ZN0A 4P9OA 1Y4MA 1QLNA 2IU3A 3W7WA 1SESA 3AEIA 4PDRA 3OMNB 2X7RB 3I55V 4X89A 1YI2V 1ZWIC 2QEXV 4I5SA 1GK9A 3D3IA 2QM8A 3ASNC 5EBMC 1ENVA 5L3FA 3OEHG 2FTKA 3ZMUA 1W0JG 4GX1A 1FXVA 3ASNB 4UXNA 3ABMB 1M57B 5LBQA 3QO7A 2WLIA 3I56V 3JYCA 2XAQA 2ZXWB 2P67A 2AHYA 4F4LA 2UXNA 4JAUA 1QVGU 4MSWC 2IJHA 2QM7A 2Y69B 5J9PC 1YTFB 1H2GA 3GWOA 2Q6AA 2HVJC 3G6EV 1OCCC 2Q69A 2WLIB 2B1GA 1Q86W 1VQNV 2X6AA 3CYOA 1K3EA 3SPGA 3OMIB 1R6NA 1K8AW 1P7BA 1NBMG 3OE7G 3SYOA 1M1KW 1KECA 5IYDO 1FXKC 3T1CA 4JTDB 2H8PC 1K5QA 2X0LA 2Z5UA 4JASA 1QVFU 1K34A 3WFVA 1EBOA 1YJWV 1BL8A 3CCMV 3CP1A 1FXKB 4DXWA 3E8BA 3OUSA 4PA6A 1YTFD 1QR8A 4R7CA 5L3DA 4FMTA 1S72V 1JPXA 3FB7C 1KD1W 1V54B 3VBBA 3JD2A 3FYEB 3RVYA 1GO3F 3E89A 2ZDIC 1VQ6V 3K06A 4MTOA 2XAGA 3FYIB 4RUFA 4PA9A 3W7UA 3LDEA 3BY6A 1FXHA 3W7XA 3K9AA 3TCUA 1OCRC 2DYSC 3ZN1A 3ZRWB 4RAIA 3LSSA 3AG4C 1NH2B 2YEVA 3AG2B 1MSWD 3SYAA 1OCRB 3E8HA 3HB3B 3OFNG 1OCZB 1OCOB 1E1RG 3IFXA 1RM1B 4U7OA 2XAFA 4PDMA 5LHGA 1RPRA 2HVKC 2YEVB 3SYQA 2ITDC 1S0VA 1K92A 4FIPC 1R3KC 1K9MW 4G27B 3X2QC 3JD4A 1COWG 4WCEV 4JYCA 2JK5C 1PNLA 1WPXA 2XAJA 3E8GA 1NH2D 5H6QA 5B1BB 2EIJC 5KA6A 3CCQV 1Q7YW 1SERA 5HFLA 5B1AC 1MABG 3MHHC 1DLBA 5L3GA 3M99B 2V1DA 2EIJB 3R65A 1P4RA 5CA3A 3CXCU 2B5UA 3B8NA 5KA5A 2NNUA 1K4DC 2OCCC 4UV8A 1JCHA 4PA4A 1KP2A 4UV9A 3ABTA 1OZ0A 3K79A 2DYRC 4J9ZB 2OTJV 5E1AC 1H8HG 3KG2A 2IW5A 3F7YC 4H33A 2XASA 1AJNA 2W0FC 2HLDG 4RQFA 2WLNA 4DO2A 1VQOV 1ROPA 1YIJV 1EFRG 5LGUA 1VQLV 1TUEB 1JOYA 1KC8W 2LFRA 2WLKA 3QO8A 4GX0A 3RBZA 3B77A 4JAVA 2F43G 4G2KA 2EBOA 2DWEC 5KUKA 1GMGA 1G8MA 4FPPA 4G28B 4WFFA 1Q81W 1MOFA 4GX2A 4KP4A 4QPKA 1JJ2U 1R6KA 4RQEA 1BMFG 1JVMA 3SPIA 3ABLC 1PKXA 2EINC 4R50A 2EZPA 1YJNV 4LBEC 4GCZA 2IJJA 3CMEV 1GKFA 2ZR2A 1VQ8V 2JJ1G 4MW8A 4WF9V 4YXWG 1L1FA 2A9HA 1F4MA 1V55C 3AG1C 3UM7A 1FXKA 1OCCB 3LDCA 5CN0A 4XDLA 3ZRVA 3CC4V 2P90A 2ATKC 4JTAB 4QPJA 2P6JA 4LCUC 1K7DA 4KUMA 1JX9A 3E8FA 5KUMA 1YSCA 5LHIA 2BOCC 1Y66A 3W7SA 1VQ5V 4X88A 3ETGA 3CC7V 2XOKG 3DTUB 3E86A 3SYCA 4CBCA 3ZMTA 2WWWA 2Y48A 2ZDIA 3ZRWA 5L3CA 3CMAV 4MVRA 1NKDA 4UUJC 5L3EA 5CBHA 4HYOA 1PL0A 3EHBB 1YJ9V 2LFSA 2DW4A 2QTOA 1G4YB 3OMAB 4ZBMA 3CCSV 2HFEC 2C2AA 1THZA 3SPJA 3WG7C 5DM6V 1PNKA 4RUEA 1M56C 2AHZA 1NR7A 2QKSA 2DYSB 1YITV 4JTCB 2CK3G 5IY5C 1XL4A 1NQTA 1W0KG 3AG4B 1K97A 2ZQMA 3ASOC 4BIZA 2QE7G 2W6IG 1H8EG 4ASUG 1WLEA 5DN6G 2EJRA 4MW3A 4JGSA 4N21A 3LSQA 3CCRV 1R73A 3OGCC 3LDDA 3TK1A 5IDJA 4MTFA 1GM8A 3AG3C 1H38A 2PI4A 2WLHA 4MVSA 5CBFA 2JIZG 1AROP 3IC7A 3X2QB 1SRYA 3K0GA 3ABKC 4ZKIA 3H01A 4WFAV 3G71V 3EFFK 4WFHA 2PI5A 3ABKB 5B1AB 4MT8A 1VQPV 1VQ4V 2Q67A 1MG1A 4MTGA 1VQ7V 2ITCC 2XAHA 4JYBA 2UXXA 1XL6A 2P7TC 4R8CA 5B1OA 3F7VC 3OR7C 2IU0A 4P30A 2X6BA 1NR1A 4PA3A 2M7WA 5EC2C 3K0DA 4RO2A 5IYBO 2HJFC 2OCCB 5EC1C 1W2BU 2EILC 4J9YB 3ZMZA 3E35A 3OUFA 3CD6V 1BHAA 3RW0A 2HG5C 1VQ9V 1EZJA 1QBZA 2H94A 2K1EA 4GT1A 5H6RA 4P2ZA 2DYRB 2KB1A 2EIMC 4WFGA 1K5SA 2EILB 3FB8C 1R3IC 4BAYA 3ZJZA 4QIWF 4Q20A 1QLEC 1K33A 5EBWC 1DF5A 3GB7C 2A0LA 2JEXA 3QO5A 4R6ZA 1VQMV 5IYCO 4UVCA 1FFTB 2Q68A 1CEZA 2X6CA 4LC1A 3ZMVA 3OM3B 3CCLV 5EK0A 2EZOA 3K03A 1KQSU 3QNEA 4PDVA 2DQ3A 2WPDG 4XDJA 3OW2U 5H9CA 1I5YA 1RPOA 3ETEA 4XBFA 1GM9A 1NJIW 4Z1MG 2GHYA 4JPRA 5B3SC 3CCEV 3T4DA 1VQKV 1NVPB 5GW7A 4MS2A 3ZIAG 3FKSG 1FS0G 2MK3A 2JEUA 1HWYA 5B3SB 3ABMC 3ABLB 2EINB 1M57C 1B6QA 1GTOA 1GM7A 4OXSA 5EBLC 3SYPA 1OHHG 4PA7A 5BZBA 2ZXWC 4QNHB 3RVZA 4GX5A 3W7TA 2Y69C 2ZR3A 3ZMSA 4MVOA 5C93A 1QR9A 3JCZA 1V55B 2IJKA 3AG1B 4FK5C 2WSSG 2DQ0A 4P9PA 4X8AA 4BIUA 1AI7A 2IJIA 3SPCA 4E2LA 4N23A 2OT5A 1NVPD 1Q82W 5B1NA 2WAMA 1ORQC 4WFBV 4PELA 3IGAC 3HPLC 3OEEG 4EKWA 2R9IA 2ZD9A 5L3BA 4MVZA 1LNQA 1YHQV 2WLMA 3PJSK 1AI6A 3ML0A 4JF3A 2WLJA 1R3JC 1V54C 3FB6C 4UVBA 3VOUA 3JD0A 1K4CC 4PDLA 3WG7B 4H37A 1AJPA 2EIKC 3K3WA 3UKMA 3CCJV 2OTLV 4MVQA 3OAAG 1CPYA 4TWKA 5LGTA 1M56B 1S3JA 3TETA 2R9RB 3CCUV 5CBGA 2LP7A 3ABUA 5IY5B 2EIKB 3T4ZA 1SZTA 3AG2C 1KKDA 3ASOB 2QA4V 3B8MA 3K04A 2HKOA 2JJ2G 4KFMA 2W6JG 4QJFB 2XNDG 1OCZC 1OCOC 3MHSC 1RM1C 3SJQC 4HZ3A 3F5WC 5HFMA 4L87A 1DF4A 3SPHA 3AG3B 4BW5A 1PNMA 2D3OW 3E2EA 4LP8A 1JQ0A 2BOBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX V;  1Q86 W;  1VQL V;  3CCJ V;  1N8R W;  1S72 V;  1VQN V;  1VQ8 V;  1KD1 W;  1KC8 W;  4WF9 V;  3CXC U;  3G4S V;  3CCV V;  3CC7 V;  1K73 W;  1VQ5 V;  1K8A W;  1VQP V;  3CCU V;  1VQM V;  1VQ4 V;  3CMA V;  1VQ7 V;  1VQ6 V;  3CCR V;  1R73 A;  1M1K W;  1K9M W;  1YJ9 V;  1YHQ V;  2OTL V;  2QA4 V;  3CCL V;  1Q81 W;  3CC4 V;  4WCE V;  1QVF U;  3CCS V;  1YI2 V;  2OTJ V;  1KQS U;  1YJW V;  1M90 W;  3I56 V;  1JJ2 U;  3CCM V;  1W2B U;  3CPW U;  3CD6 V;  3OW2 U;  5DM6 V;  4WFA V;  1Q7Y W;  3CCQ V;  1QVG U;  1NJI W;  1VQ9 V;  2D3O W;  3CCE V;  1YJN V;  1VQK V;  1Q82 W;  1VQO V;  1YIT V;  3CC2 V;  1YIJ V;  3CME V;  4WFB V;  3I55 V;  3G6E V;  3G71 V; 
#chains in the Genus database with same CATH topology
 1N8R W;  3ZRX A;  3P32 A;  5LXT B;  3MD0 A;  3STL C;  3UCS C;  2P4K A;  2PZS A;  1SET A;  4OX9 O;  1BQZ A;  1S77 D;  3JD1 A;  4UFZ A;  3FD9 A;  2L6L A;  2ZE8 A;  4TSF G;  1PM9 A;  1B06 A;  4U7N A;  3ETD A;  1R3L C;  2GV9 A;  4I9W A;  4MVM A;  1CP9 A;  4KXR A;  1JFF A;  4I50 B;  1JMK C;  1J95 A;  2DWD C;  1VMG A;  1Q6I A;  5KLV H;  3APO A;  3OR6 C;  1MNG A;  1E79 G;  2KKW A;  3JAT B;  1QLE B;  4NVP A;  2LGQ A;  3NXS A;  1N4C A;  4TOI A;  2YSU B;  3BA8 A;  2NLJ C;  3E83 A;  4JV5 B;  3BEH A;  4B3T O;  4X20 B;  1QLN A;  2IU3 A;  2IM9 A;  4X1I B;  4IYH A;  2X7R B;  3I55 V;  1YI2 V;  3OTF A;  3D3I A;  5EBM C;  3UO2 A;  1W0J G;  5A9G A;  2E3C A;  2RQ6 A;  4UXN A;  3ABM B;  1ZLZ A;  5LBQ A;  1TVK B;  1QU7 A;  3I56 V;  2YIA A;  4I55 A;  1QVG U;  4NB5 A;  1SZX A;  1H2G A;  3KKY A;  3TJT A;  3G6E V;  5J2U B;  2BTQ B;  1VQN V;  2WLI B;  2X6A A;  3CYO A;  3QF7 A;  1HNZ B;  1R6N A;  2UUA O;  1ZSP A;  1N32 B;  4DRX A;  1WPB A;  1KEC A;  2GTS A;  3JCU Z;  2DJV A;  5EIB C;  1SQB H;  2X0L A;  4DV1 B;  1FXK B;  3E8B A;  2JRI A;  5GTH Z;  2OWO A;  4IL6 Z;  1GRJ A;  5L3D A;  4PD4 F;  1KD1 W;  3FB7 C;  1UFI A;  5KHH A;  1SQQ H;  5CA1 A;  4RUF A;  5LA6 A;  2ADQ B;  2UUB O;  3LDE A;  3SDL A;  1FXH A;  4K8Z A;  3TCU A;  4JI5 O;  2DYS C;  3RT3 C;  3ZN1 A;  4EEQ A;  1B04 A;  1XEQ A;  3AG4 C;  4DV6 B;  4Q6G A;  1OCR B;  1Y67 A;  3HB3 B;  2KQX A;  3IFX A;  4LFB B;  2KG7 B;  3THO A;  2HVK C;  2YEV B;  3SYQ A;  4J80 A;  2ITD C;  4O4L B;  1K92 A;  3HKE A;  3X2Q C;  3WU2 Z;  4BW9 A;  4NXM B;  2EJ7 A;  1PNL A;  5F2V O;  5B1B B;  3CCQ V;  3E22 B;  1SER A;  5L3G A;  3LSU A;  2EIJ B;  3R65 A;  2QDO A;  3EXA A;  1ZUQ A;  2OCC C;  4PA4 A;  4DK1 A;  3ABT A;  2QM4 A;  1OZ0 A;  3K79 A;  2DYR C;  4J9Z B;  5E1A C;  3T1Y B;  5IJ9 A;  4H33 A;  2XAS A;  3JAS A;  5KAI Z;  5C8Y B;  1AR4 A;  2W0F C;  2HLD G;  4J10 A;  3ZHR A;  2WLN A;  2RDC A;  2RN9 A;  4GKJ O;  3JSL A;  1JOY A;  5KMG A;  5FNV B;  3RBZ A;  1Y6X A;  3B77 A;  4J7Z A;  4G2K A;  4LWS A;  1GMG A;  4D7S A;  4GX2 A;  4O4J B;  1R6K A;  1BMF G;  1JVM A;  3SPI A;  4B3S B;  2PYL A;  2Y4T A;  2BSK B;  4R50 A;  4J41 A;  2ZR2 A;  1US6 A;  2QSA A;  1VQ8 V;  1R1B A;  3CSX A;  1Q6U A;  1XMQ B;  1SC5 B;  4JI3 O;  4LF9 B;  3UT5 A;  1V55 C;  2PGG A;  4K35 A;  1IBK B;  4JI0 B;  1NZ6 A;  4JTA B;  2A06 H;  4EFE A;  4LCU C;  2QWP B;  4YJ3 B;  3E8F A;  5H5N A;  2BOC C;  3DTU B;  4CBC A;  3ZMT A;  5L3C A;  3CMA V;  4MVR A;  2LJ2 A;  4UUJ C;  4HYO A;  4PI0 A;  1YJ9 V;  3SJC C;  2QTO A;  3UQ8 A;  4ZBM A;  1XHZ A;  2HFE C;  1GN6 A;  2YXY A;  1IBM O;  3JAM N;  5DM6 V;  1TAE A;  1NR7 A;  1YIT V;  4JTC B;  5IY5 C;  1NQT A;  5LMU O;  2QE7 G;  4U3J A;  2EJR A;  2ZE6 A;  3LSQ A;  3AG3 C;  2ZE5 A;  1WB7 A;  2PI4 A;  1L0N H;  2WLH A;  5LP6 C;  4LF8 O;  4B3R O;  1L0L H;  2QWN B;  3IC7 A;  4JI1 O;  4DV0 O;  3ABK C;  2DE0 X;  4ZKI A;  3KCY A;  4DR7 O;  5ITZ B;  4WFH A;  4DR1 B;  3CRR A;  4B3M O;  1VQP V;  1FAF A;  1GN2 A;  4JI2 B;  4WBN A;  3SR2 C;  1KKC A;  1BCC H;  2HJF C;  5EC1 C;  2EIL C;  1HNW O;  3E35 A;  3OUF A;  1VQ9 V;  2H94 A;  5H6R A;  5JH7 B;  1IZ3 A;  5CA0 A;  2KB1 A;  2EIM C;  5J2T B;  1K5S A;  2P06 A;  1N0J A;  1EZV H;  4BAY A;  4X1Y A;  4Q20 A;  3D36 C;  2Q73 A;  3D3Q A;  4LC1 A;  4LNU A;  3ZMV A;  4PV1 B;  3CCL V;  1N0N A;  4ZI7 A;  2EZO A;  2JS3 A;  3K03 A;  4DR2 B;  2UU9 O;  5H9C A;  1I5Y A;  1RPO A;  1HR0 B;  1NVP B;  1S5L Z;  1N36 O;  3U10 A;  3L9D A;  1H2M A;  4DR4 O;  4DUZ B;  3ABL B;  1GM7 A;  3P3N A;  1Y76 B;  5EBL C;  5BZB A;  2DOS A;  4FM1 A;  2Y69 C;  3DXR A;  5D5P A;  4X8A A;  4P9P A;  2Q9L A;  1DK1 A;  3JAR A;  4DV4 O;  3SPC A;  4EFB A;  2QWO B;  5A2Q N;  4DK0 A;  3Q4H A;  4ABM A;  4PEL A;  1N34 O;  3HPL C;  3OEE G;  4YIO A;  3G67 A;  2F23 A;  2R9I A;  4NTW A;  2ZD9 A;  4MVZ A;  2P22 C;  1FJG B;  3M8A A;  5KHI A;  2NR5 A;  3UO3 A;  4JI4 B;  3O9O A;  4LF4 O;  3JAW A;  1J5E B;  3JD0 A;  2W0X A;  4I0X B;  4PDL A;  5AG2 A;  1AJP A;  2ZNI A;  3N2G A;  4F6E A;  1QHT A;  3CHX A;  5LGT A;  1M56 B;  3G80 A;  2F95 B;  2R9R B;  5CBG A;  2YC0 A;  4LF6 B;  2XUM A;  2NN4 A;  3AG2 C;  3ASO B;  4O4H A;  2QA4 V;  3B8M A;  5LP6 A;  1S5J A;  2HKO A;  4QJF B;  2XND G;  1OCO C;  4JI6 B;  3MHS C;  5FPR A;  3SPH A;  2F4V O;  1PNM A;  4OPA A;  1JQ0 A;  1RP3 B;  2FYU H;  1Q6H A;  2ZKO A;  4DV5 O;  1K73 W;  3H1K H;  1FFX A;  2QWQ B;  1I5X A;  2FL4 A;  3DSQ A;  5BY1 A;  1IXM A;  2PF4 E;  2WLL A;  4TT3 G;  4MTX A;  5LGN A;  4B08 A;  1AJQ A;  2V7Q G;  5CMU A;  1GAX A;  1XQ8 A;  3CC2 V;  1AR1 B;  3D36 A;  1E1Q G;  4PJ0 Z;  1AI4 A;  2CE4 A;  1Y74 A;  5E79 Z;  4FLW A;  3ZX6 A;  2A79 B;  1AB3 A;  1WP8 A;  3FX7 A;  1YZB A;  3P30 A;  4X64 B;  3CPW U;  1LUV A;  3ZN0 A;  2VQF B;  2L35 A;  4P9O A;  5LYJ A;  3AEI A;  4PDR A;  4DV7 B;  2ZE7 A;  5IJ9 B;  3WB0 A;  3R66 A;  2QM8 A;  3ASN C;  1ENV A;  5L3F A;  3GVM A;  3CS5 A;  3ZMU A;  2FTK A;  1D5N A;  3LNN A;  5JCO C;  1FXV A;  4YY3 B;  3CXH F;  4JV5 O;  1M57 B;  2BCC H;  5KX5 A;  1O9G A;  3JYC A;  1Z5V A;  2UXC B;  1TGO A;  2ZXW B;  4UCU A;  2P67 A;  4HNA A;  4F4L A;  2IJH A;  2CH7 A;  3RWR D;  4LF7 B;  2EX3 A;  3RYF A;  1OCC C;  2Q7E A;  1Q86 W;  2B1G A;  5BMV B;  1P7B A;  3OE7 G;  3IC9 A;  3ZED A;  2DN9 A;  3T1C A;  1M5I A;  4JTD B;  2Z5U A;  3CJH B;  3HKB A;  3WFV A;  1EBO A;  1YJW V;  1BL8 A;  3CCM V;  3CP1 A;  1SA0 B;  5IJ0 A;  4PA6 A;  1YTF D;  4X66 B;  1QR8 A;  4J42 A;  3ZHV A;  1HNZ O;  4O2A B;  1WAZ A;  1GN3 A;  4AQY B;  4FMT A;  1S72 V;  1N32 O;  3VQX A;  3E89 A;  1G6U A;  2ZDI C;  1VQ6 V;  3HKD B;  4MTO A;  3FYI B;  4DV1 O;  4ZHQ B;  4JI7 B;  3LSS A;  3BRC A;  5EZY B;  2CUG A;  1H2N A;  2A3Q A;  3RYH B;  5JQG A;  3OFN G;  4PDM A;  2R72 A;  1S0V A;  4FIP C;  4NTX A;  1TUB A;  5EYP A;  1I08 A;  4DV6 O;  2A7W A;  1NH2 D;  5H6Q A;  3BCC H;  1HDJ A;  4HBN A;  2D2C B;  4IHJ B;  4LFB O;  1MAB G;  3MHH C;  4UCS A;  3S3W A;  1DLB A;  3M99 B;  2V1D A;  1P4R A;  3CXC U;  3B8N A;  1Q8I A;  4NXM O;  4UV8 A;  2ZIM A;  1JCH A;  1KP2 A;  1KB9 F;  4UV9 A;  4GKK B;  4UB6 Z;  4AI8 A;  1H8H G;  1YIJ V;  1KC8 W;  2LFR A;  2JGD B;  4F6R A;  5JCO A;  4NR1 A;  4KHP B;  5CA0 B;  2N74 A;  2F43 G;  5DED A;  1GN4 A;  2DWE C;  4Z1V A;  5KUK A;  3T1Y O;  1G8M A;  4WFF A;  1Q81 W;  3GWK C;  1MOF A;  2LO1 A;  4KP4 A;  3K9S A;  1VAR A;  3N2K A;  3K59 A;  1LUW A;  2HEP A;  1KMI Z;  2EZP A;  4B7K A;  4LBE C;  1H2S B;  4GCZ A;  4YJ2 A;  1IBL B;  4QGP A;  1GKF A;  3RYI A;  2BE3 A;  4MW8 A;  1WA8 A;  4BR6 A;  4DR3 B;  3CB2 A;  4U3F H;  3CX5 F;  2AGA A;  2H3O A;  1VF6 C;  4B3S O;  4QPJ A;  1ZX3 A;  3TGU H;  1H2K A;  3AK1 A;  2HJD A;  5IYZ A;  5KUM A;  3A2F A;  3RYC B;  2VQE B;  2UUC B;  1YSC A;  1XMQ O;  1Y66 A;  1U97 A;  4LF9 O;  1MA1 A;  3ETG A;  3CC7 V;  3E86 A;  3SYC A;  2ZDI A;  3FAV A;  2ZM6 B;  3ZRW A;  5KHJ A;  3K5N A;  1NKD A;  1IBK O;  4JI0 O;  3EHB B;  2LFS A;  3OMA B;  4AIL C;  3CCS V;  4O4I A;  3WG7 C;  3MAQ A;  1EM1 A;  1JA8 A;  4X1K A;  5EIB D;  1ZL8 B;  4RUE A;  2WA4 A;  4CH3 A;  2AHZ A;  1D5A A;  2CK3 G;  1XL4 A;  1YEW A;  4NXN B;  1K97 A;  2ZQM A;  4O2B A;  2W6I G;  1H8E G;  4ASU G;  1WLE A;  3BVO A;  2PUS A;  5DN6 G;  4MW3 A;  4FLZ A;  4FM2 A;  4UCV A;  3CCR V;  1MSD A;  2CAZ C;  1O9H A;  1GM8 A;  4YHH B;  4MVS A;  3H1J H;  4NKG B;  2YIB A;  4H13 B;  3K0G A;  3H01 A;  1I94 B;  3ZHU A;  4WFA V;  2GUZ B;  3ABK B;  5B1A B;  1VQ4 V;  2Q67 A;  1VQ7 V;  2XAH A;  1MZF A;  2UXX A;  2P7T C;  3F7V C;  3BHP A;  4UCR A;  3OR7 C;  2IU0 A;  4I4T B;  3VQW A;  1NR1 A;  2E76 B;  3K0D A;  4RO2 A;  3B4S A;  4J9Y B;  1BHA A;  2HG5 C;  1EZJ A;  1QBZ A;  4ZOL A;  3K58 A;  2YS8 A;  4IIJ B;  1YDX A;  3JAK A;  4DR1 O;  2EIL B;  2Q4P A;  3FB8 C;  1QLE C;  1K33 A;  5LMN B;  4JI2 O;  2JEX A;  3QO5 A;  4UVC A;  2OYQ A;  2Q68 A;  2VWJ A;  1CEZ A;  2X6C A;  4I9Q A;  4H0L B;  1JR9 A;  3OGI B;  1Y74 B;  2DQ3 A;  2OCH A;  4Z1M G;  5B3S C;  3CCE V;  1XIL A;  5GW7 A;  4TUY B;  4IT5 A;  2MK3 A;  4K0K B;  3ABM C;  3O65 A;  2EIN B;  1B6Q A;  1GTO A;  4CC6 A;  3TXS A;  5LYJ B;  1OHH G;  3T1H B;  4X65 B;  3H1I H;  3A8T A;  4GX5 A;  5CB4 A;  1VF6 A;  4DR2 O;  1U96 A;  3A0B Z;  3AG1 B;  4FLT A;  2R70 A;  1HR0 O;  1AI7 A;  4DR5 B;  4N23 A;  3S3X A;  4DUZ O;  4PHZ A;  3IGA C;  3ETQ A;  3KZI Z;  3C3T A;  4TV9 B;  5L3B A;  1VP7 A;  3BPZ A;  1LNQ A;  1YHQ V;  2PY5 A;  2WLM A;  4AHC A;  1WNS A;  3WB2 A;  4EB6 A;  1RSO B;  3H9V A;  3HKC A;  5LOV B;  3CCJ V;  1SQG A;  2AXT Z;  1CPY A;  1S3J A;  1WB8 A;  2ZCE A;  1FJG O;  3B09 A;  1XUQ A;  1SQF A;  1W59 A;  4JI4 O;  4LH6 A;  2JJ2 G;  1J5E O;  1I7F A;  5LXT A;  3J7A U;  2XHB A;  2D3O W;  2F1M A;  5DEC A;  1SKV A;  4LF6 O;  3G6B A;  2IH3 C;  4TV8 B;  1BGY H;  1QCE A;  5GON B;  1SQP H;  1S76 D;  5B1B C;  4I50 A;  1GH6 A;  2QTS A;  4JI6 O;  4FLU A;  2E5L B;  4QE9 A;  4UVA A;  5BXZ A;  3LUT B;  4FJC C;  2IH1 C;  1PD3 A;  4J11 A;  3JAT A;  2JDI G;  5FL7 G;  4CZZ A;  2Z3Y A;  3G4S V;  3LNM B;  1JFF B;  3AK2 A;  4QE7 A;  3K08 A;  1F4N A;  4X20 A;  3ZCC A;  2O57 A;  3STZ C;  1M9N A;  4XDK A;  2RJZ A;  3ZRS A;  2R9A A;  4NTY A;  1BHB A;  2GSM B;  1XNR B;  3W7W A;  4FZ0 A;  4X89 A;  2QEX V;  4I5S A;  1Q5O A;  1GK9 A;  4J7J A;  3ZHS A;  4LFC B;  1TVK A;  1MZE A;  2ZIN A;  5JVD A;  3OEH G;  1X4T A;  2AW9 A;  3ASN B;  5D5Q A;  4X64 O;  1NI8 A;  2VQF O;  2Y0I A;  2P5O A;  5J2U A;  2BTQ A;  4H44 B;  2WLI A;  4D7T A;  2YDE A;  5JJE B;  2AHY A;  2E75 B;  4DV7 O;  4NYK A;  2UXN A;  4MSW C;  2QM7 A;  1YTF B;  3GWO A;  2Q6A A;  5K1X A;  4JYY A;  5LL6 Y;  1K3E A;  3SPG A;  4DYL A;  4X62 B;  3OMI B;  4YY3 O;  4I55 B;  2LW1 A;  1NBM G;  3SYO A;  2K9P A;  5IYD O;  2UXC O;  1CXZ B;  1K5Q A;  2N04 A;  4LF7 O;  4DXW A;  2AZ2 A;  4DRX B;  3BAB A;  1Z2G A;  3DC5 A;  5B66 Z;  1JPX A;  1URF A;  1V54 B;  2CGO A;  1VF7 A;  3FYE B;  1N33 B;  4PA9 A;  3W7U A;  3BY6 A;  3K9A A;  3IJ4 A;  2YIC A;  2JGU A;  3ZRW B;  4RAI A;  4X66 O;  2KG7 A;  3BFR A;  4FLV A;  5CA1 B;  5LA6 B;  1NH2 B;  4FFB A;  2YEV A;  4GLX A;  4DV3 B;  4AQY O;  4O4L A;  5B5E Z;  3E8H A;  1OCZ B;  1E1R G;  1RM1 B;  5LHG A;  1RPR A;  1NU1 H;  4JI7 O;  3E22 A;  3JD4 A;  1YVW A;  4FLY A;  2F93 B;  1IVS A;  2XAJ A;  3E8G A;  4X9Q A;  1PP9 H;  3HKE B;  4ZIB A;  1Q7Y W;  2PTM A;  5KA6 A;  5HFL A;  2ODM A;  1XRE A;  2LW7 A;  1AR5 A;  2B5U A;  4DV2 B;  5KA5 A;  2NNU A;  1K4D C;  1IX9 A;  3L72 H;  1PL4 A;  2CDY A;  1Z5W A;  3OTO B;  2YI8 A;  1F7Y A;  2OTJ V;  4OGQ B;  5IT9 N;  3KG2 A;  2IW5 A;  3F7Y C;  1AJN A;  5FNV A;  4RQF A;  4DO2 A;  1YXB A;  5LGU A;  1XNQ B;  1TUE B;  3JAS B;  2WLK A;  1XHX A;  4D6T H;  1A32 A;  2G38 A;  4JAV A;  4O4J A;  4GKK O;  2EBO A;  1XI1 A;  4JZG A;  1BQ0 A;  1NTK H;  5IE9 A;  2BSK A;  4G28 B;  3JAL A;  2Q0A A;  5KMG B;  4CS3 A;  4QPK A;  4RQE A;  4LWS B;  3ABL C;  1PKX A;  3CME V;  4JYA B;  4KHP O;  2Z0A A;  2JJ1 G;  4YXW G;  2WA3 A;  1LR1 A;  2A9H A;  1F4M A;  4TQF A;  4YJ3 A;  3LDC A;  4FM0 A;  5CN0 A;  1R6T A;  4XDL A;  3ZRV A;  3CC4 V;  2HHH B;  3J80 N;  3M7M X;  3UT5 B;  1NTZ H;  1IBL O;  1XDC A;  1JX9 A;  2RMK B;  5FLX N;  1VQ5 V;  3W7S A;  4DR3 O;  3QTC A;  4X88 A;  4DR6 B;  2XOK G;  3C3S A;  2M6Y A;  2WWW A;  5JJN B;  3CWB H;  5CBH A;  1XBL A;  4GYC B;  2DW4 A;  3U11 A;  3VQV A;  2C2A A;  1THZ A;  3SPJ A;  2UUC O;  2VQE O;  2QJ1 A;  3WB1 A;  4JZ2 A;  2UXB B;  1M56 C;  2QKS A;  2DYS B;  1HNX B;  1AIL A;  2LQT A;  5GTI Z;  1WP7 A;  2ZM6 O;  4TQD A;  1W0K G;  3AG4 B;  3AG7 A;  3ASO C;  4BIZ A;  2DMX A;  4N21 A;  3RFR A;  2ZIO A;  3TK1 A;  5IDJ A;  1BT8 A;  1SQV H;  5ITZ A;  5CBF A;  4U3J B;  2JIZ G;  1ARO P;  2Q7G A;  1XMO B;  3X2Q B;  4CH6 A;  2OIE A;  2UXD B;  4NXN O;  2FB5 A;  3ZHT A;  5IWA B;  3VQY A;  1MG1 A;  1XOU A;  1XL6 A;  2FML A;  3KCX A;  4YHH O;  4P30 A;  5JH7 A;  5J2T A;  2M7W A;  5EC2 C;  1ZAU A;  2OCC B;  1EN6 A;  1W2B U;  3CD6 V;  1I94 O;  3RW0 A;  4KL1 A;  2K1E A;  4GT1 A;  4WBN B;  2DYR B;  1RFY A;  4DW0 A;  3L75 H;  4JI8 B;  3C90 A;  5BR8 B;  1YCI A;  2YIB D;  1DF5 A;  5IYC O;  4J7K A;  4LFA B;  1EN5 A;  4X1Y B;  3A0H Z;  3K5O A;  3QNE A;  2WPD G;  4XDJ A;  2YUA A;  4LNU B;  4XBF A;  2GHY A;  4JPR A;  1ZTE A;  1Y76 A;  3T4D A;  1VQK V;  4ZI7 B;  5LMN O;  2MW2 B;  2FKX A;  4MS2 A;  3FKS G;  4DUY B;  1FS0 G;  2JEU A;  5B3S B;  1M57 C;  3SYP A;  1M93 A;  4PA7 A;  2ZXW C;  3ZS8 C;  3W7T A;  2ZR3 A;  3ZMS A;  1BZK A;  4MVO A;  1QR9 A;  5JVD B;  1V55 B;  2IJK A;  4BIU A;  4FK5 C;  2WSS G;  2DQ0 A;  4OPH A;  2CTP A;  3TXQ A;  4E2L A;  4ICG A;  2CTW A;  2OT5 A;  4K0K O;  1MMM A;  4CS4 A;  5B1N A;  2WAM A;  3DXR B;  2XT9 A;  1SF9 A;  3JAR B;  1Q43 A;  3T1H O;  4X65 O;  2QKC A;  3Q4H B;  3IAY A;  1WJZ A;  2JS5 A;  1DGS A;  3ICX A;  3PJS K;  3APQ A;  3NR7 A;  1AI6 A;  4I0X A;  4DR5 O;  1NT2 B;  4JF3 A;  2WLJ A;  4W4K A;  3L74 H;  3VOU A;  1P84 F;  1K4C C;  4H37 A;  2EIK C;  1Q3E A;  3K3W A;  2OTL V;  1WN7 A;  4MVQ A;  4TWK A;  3JAW B;  3CE2 A;  2LP7 A;  3ABU A;  5IY5 B;  1SZT A;  1KKD A;  3N2G B;  2XTA A;  2E74 B;  4OX9 B;  4KFM A;  2W6J G;  4BWA A;  3U0Z A;  3SJQ C;  1FPO A;  3F5W C;  4BW5 A;  3AG3 B;  4O4H B;  1T5E A;  5LP6 B;  4K8X A;  1AVM A;  4FFB B;  1F23 A;  3CCV V;  1S5H C;  3FB5 C;  1OV9 A;  3K5L A;  1IUR A;  1AI5 A;  3SGI A;  4HAM A;  3DGE A;  3JD3 A;  3B2E E;  1DTO A;  2ZT9 B;  1F51 A;  2B1I A;  1FFX B;  3L71 H;  1M90 W;  4FVM A;  1IXB A;  2Q0O C;  2RCV A;  3DC6 A;  4B3T B;  3T2M A;  4MVU A;  2WLL B;  5LHH A;  4B7E A;  3CRC A;  4WFE A;  2EIM B;  2E5L O;  3A0R A;  2HR3 A;  1KP3 A;  1P49 A;  1KU9 A;  2P4V A;  1UJW B;  1BSM A;  3RN4 A;  1Y4M A;  1EN4 A;  1SES A;  1NTM H;  3OMN B;  1ZWI C;  4CC5 A;  1Q90 D;  3EVK A;  1KYO F;  2ARH A;  5H2F Z;  1AP6 A;  1QQC A;  4GX1 A;  2YXL A;  2UUA B;  3L70 H;  2PYJ A;  2ILM A;  1XNR O;  4UB8 Z;  4RWU A;  3QO7 A;  4A5U B;  2XAQ A;  1G1X B;  5BMV A;  4JAU A;  2Y69 B;  3JAL B;  5J9P C;  4FFK A;  4LFC O;  2HVJ C;  5KX5 B;  2Q69 A;  3SJA C;  2B9Z A;  3AK3 A;  3CJH A;  4HNA B;  1K8A W;  2CH7 B;  1SA0 A;  3RYF B;  1M1K W;  2AZ0 A;  1FXK C;  2CTR A;  2H8P C;  4O2A A;  4JAS A;  3B40 A;  4YIP A;  5JWP A;  2UUB B;  1QVF U;  1K34 A;  3D8C A;  4JI5 B;  3OUS A;  2QGN A;  3HKD A;  4X62 O;  4R7C A;  2ETN A;  1KUQ A;  3HKB B;  1JJO A;  2Y0P A;  4ZHQ A;  5IJ0 B;  3VBB A;  3JD2 A;  1AP5 A;  3RVY A;  1GO3 F;  4LH7 A;  3K06 A;  2XAG A;  5EZY A;  3K5M A;  1SS3 A;  4CH5 A;  2EUL A;  3W7X A;  3RYH A;  1QNM A;  1OCR C;  5FPO A;  3I5D A;  2CGN A;  3AG2 B;  1MSW D;  1TA8 A;  3SYA A;  1N33 O;  1OCO B;  4U7O A;  2XAF A;  2V4D A;  3P3P A;  4IYI A;  2YID A;  3PN1 A;  1R3K C;  5JQG B;  1K9M W;  4G27 B;  1HP8 A;  4IHJ A;  3ZHQ A;  1COW G;  4WCE V;  3ZBH A;  4DV3 O;  4JYC A;  2JK5 C;  1WPX A;  2VRZ A;  2EIJ C;  5B1A C;  1TUB B;  5EYP B;  4PI2 A;  4CH4 A;  3BAA A;  4C7U A;  2ZNJ A;  2ADP A;  5CA3 A;  4GKJ B;  1BE3 H;  3K57 A;  4X1I A;  1X59 A;  2JGD A;  5KAF Z;  1VQO V;  1ROP A;  1EFR G;  4DV2 O;  1VQL V;  4E4E A;  4Z2W A;  2OIG A;  3QO8 A;  4GX0 A;  3FFQ A;  5K1P A;  1PPJ H;  2Q7H A;  3OT7 A;  3OTO O;  4JI3 B;  4FPP A;  5TIS Z;  4LF5 O;  4F6R B;  1JJ2 U;  2YI9 A;  3RGB A;  2GDS A;  1XNQ O;  2EIN C;  4UCT A;  1YJN V;  2IJJ A;  1VF5 B;  3N2K B;  4WF9 V;  4K3A A;  1L1F A;  2Q5Z A;  1I0H A;  3AG1 C;  2CTQ A;  3UM7 A;  1FXK A;  1OCC B;  4YJ2 B;  3RYC A;  3RYI B;  1WA8 B;  2P90 A;  2ATK C;  4I7Z B;  2Q8V A;  4UCO A;  2P6J A;  1K7D A;  4KUM A;  3BA9 A;  4JYA O;  2KSD A;  1IBM B;  2VWK A;  3CRQ A;  5LHI A;  4DW1 A;  1M4U A;  2Y4U A;  2Y48 A;  4L8J A;  1KBH A;  5IYZ B;  1B3Q A;  5LMU B;  5L3E A;  1ZL8 A;  1PL0 A;  2HHH O;  4BIO A;  1G4Y B;  2GBO A;  3F5T A;  3FAV B;  1L8D A;  2GTA A;  3N27 A;  4B3R B;  1PNK A;  4LF8 B;  4DR6 O;  4JI1 B;  4O4I B;  2IBZ H;  4DV0 B;  4DR7 B;  4X1K B;  1BS3 A;  4JGS A;  1R73 A;  3OGC C;  4B3M B;  3LDD A;  4MTF A;  1H38 A;  3H1L H;  4O2B B;  2UXB O;  2GUZ A;  1HNX O;  3L73 H;  3QG5 A;  1SRY A;  4W4L A;  1HNW B;  3MDS A;  3G71 V;  1OJH A;  4I4T A;  2QR4 A;  3EFF K;  2PI5 A;  4MT8 A;  4MTG A;  3CRA A;  1SQX H;  4JYB A;  5B1O A;  2ITC C;  1YF2 A;  4R8C A;  5C8Y A;  4IIJ A;  2X6B A;  4PA3 A;  1XMO O;  5IYB O;  2QWR B;  2UXD O;  2RNB A;  3ZMZ A;  4GZR B;  2LGW A;  4LF5 B;  4P2Z A;  2UU9 B;  4WFG A;  5IWA O;  1R3I C;  3ZJZ A;  4QIW F;  5EBW C;  3GB7 C;  1N36 B;  2A0L A;  4R6Z A;  1VQM V;  1FFT B;  4ZOL B;  4DR4 B;  3JAK B;  3OM3 B;  1PV0 A;  4GUN A;  5EK0 A;  4TUY A;  1KQS U;  4PDV A;  3OW2 U;  3ETE A;  1GM9 A;  1NJI W;  4JI8 O;  1HW7 A;  4DV4 B;  5BR8 O;  3ZIA G;  1FYJ A;  4JAA A;  4LFA O;  1HWY A;  5KHG A;  3H1H H;  5JJJ B;  1N34 B;  4OXS A;  4IGG A;  1FKA O;  4QNH B;  3RVZ A;  5C93 A;  3JCZ A;  1VEW A;  3CEI A;  3JSN A;  2IJI A;  2YXH A;  1NS1 A;  4DUY O;  5CB4 B;  1NVP D;  1Q82 W;  4TV9 A;  1ORQ C;  4WFB V;  4LF4 B;  3QVN A;  1H2L A;  4EKW A;  1RSO A;  3J81 N;  2F66 C;  3HR0 A;  5LOV A;  3ML0 A;  1R3J C;  5KHK A;  1V54 C;  3FB6 C;  3OD4 A;  1P7G A;  4UVB A;  2JVD A;  1UPG A;  3WG7 B;  2QKA A;  3UKM A;  2F4V B;  3OAA G;  3TET A;  3CCU V;  1D2D A;  4DV5 B;  4EB6 B;  2EIK B;  4FZ1 A;  1V9P A;  4LR3 A;  3T4Z A;  2BTO A;  2N05 A;  1IDS A;  3HKC B;  3K04 A;  3SJB C;  4FLX A;  1OCZ C;  3CRM A;  1RM1 C;  4HZ3 A;  4TV8 A;  5HFM A;  4L87 A;  1DF4 A;  1VIB A;  3E2E A;  4CS2 A;  5GON A;  4LP8 A;  2HP8 A;  2BOB C;  2VS0 A;  1FD9 A; 
#chains in the Genus database with same CATH homology
 1N8R W;  3ZRX A;  3P32 A;  1F23 A;  3MD0 A;  3CCV V;  3STL C;  2IH3 C;  1K73 W;  1S5H C;  3FB5 C;  1I5X A;  1QCE A;  1SET A;  1S77 D;  3JD1 A;  1S76 D;  1AI5 A;  5B1B C;  4TSF G;  4U7N A;  4HAM A;  3DGE A;  3JD3 A;  3ETD A;  4QE9 A;  1R3L C;  1DTO A;  4UVA A;  1IXM A;  1F51 A;  2B1I A;  2WLL A;  4I9W A;  3LUT B;  4MVM A;  4TT3 G;  4MTX A;  1M90 W;  5LGN A;  4FJC C;  1CP9 A;  1AJQ A;  2V7Q G;  5CMU A;  2IH1 C;  1PD3 A;  3T2M A;  3CC2 V;  4MVU A;  2JDI G;  1AR1 B;  3D36 A;  1J95 A;  2DWD C;  2WLL B;  5FL7 G;  4CZZ A;  2Z3Y A;  5LHH A;  1E1Q G;  3G4S V;  1AI4 A;  3LNM B;  3OR6 C;  4WFE A;  2EIM B;  3K08 A;  4QE7 A;  3A0R A;  1F4N A;  1E79 G;  3ZCC A;  1QLE B;  3STZ C;  2A79 B;  1M9N A;  2HR3 A;  4XDK A;  3ZRS A;  3NXS A;  1KP3 A;  2YSU B;  2NLJ C;  3P30 A;  3E83 A;  1UJW B;  3CPW U;  1BHB A;  2GSM B;  3BEH A;  3ZN0 A;  4P9O A;  1Y4M A;  1QLN A;  2IU3 A;  3W7W A;  1SES A;  3AEI A;  4PDR A;  3OMN B;  2X7R B;  3I55 V;  4X89 A;  1YI2 V;  1ZWI C;  2QEX V;  4I5S A;  1GK9 A;  3D3I A;  2QM8 A;  3ASN C;  5EBM C;  1ENV A;  5L3F A;  3OEH G;  2FTK A;  3ZMU A;  1W0J G;  4GX1 A;  1FXV A;  3ASN B;  4UXN A;  3ABM B;  1M57 B;  5LBQ A;  3QO7 A;  2WLI A;  3I56 V;  3JYC A;  2XAQ A;  2ZXW B;  2P67 A;  2AHY A;  4F4L A;  2UXN A;  4JAU A;  1QVG U;  4MSW C;  2IJH A;  2QM7 A;  2Y69 B;  5J9P C;  1YTF B;  1H2G A;  3GWO A;  2Q6A A;  2HVJ C;  3G6E V;  1OCC C;  2Q69 A;  2WLI B;  2B1G A;  1Q86 W;  1VQN V;  2X6A A;  3CYO A;  1K3E A;  3SPG A;  3OMI B;  1R6N A;  1K8A W;  1P7B A;  1NBM G;  3OE7 G;  3SYO A;  1M1K W;  1KEC A;  5IYD O;  1FXK C;  3T1C A;  4JTD B;  2H8P C;  1K5Q A;  2X0L A;  2Z5U A;  4JAS A;  1QVF U;  1K34 A;  3WFV A;  1EBO A;  1YJW V;  1BL8 A;  3CCM V;  3CP1 A;  1FXK B;  4DXW A;  3E8B A;  3OUS A;  4PA6 A;  1YTF D;  1QR8 A;  4R7C A;  5L3D A;  4FMT A;  1S72 V;  1JPX A;  3FB7 C;  1KD1 W;  1V54 B;  3VBB A;  3JD2 A;  3FYE B;  3RVY A;  1GO3 F;  3E89 A;  2ZDI C;  1VQ6 V;  3K06 A;  4MTO A;  2XAG A;  3FYI B;  4RUF A;  4PA9 A;  3W7U A;  3LDE A;  3BY6 A;  1FXH A;  3W7X A;  3K9A A;  3TCU A;  1OCR C;  2DYS C;  3ZN1 A;  3ZRW B;  4RAI A;  3LSS A;  3AG4 C;  1NH2 B;  2YEV A;  3AG2 B;  1MSW D;  3SYA A;  1OCR B;  3E8H A;  3HB3 B;  3OFN G;  1OCZ B;  1OCO B;  1E1R G;  3IFX A;  1RM1 B;  4U7O A;  2XAF A;  4PDM A;  5LHG A;  1RPR A;  2HVK C;  2YEV B;  3SYQ A;  2ITD C;  1S0V A;  1K92 A;  4FIP C;  1R3K C;  1K9M W;  4G27 B;  3X2Q C;  3JD4 A;  1COW G;  4WCE V;  4JYC A;  2JK5 C;  1PNL A;  1WPX A;  2XAJ A;  3E8G A;  1NH2 D;  5H6Q A;  5B1B B;  2EIJ C;  5KA6 A;  3CCQ V;  1Q7Y W;  1SER A;  5HFL A;  5B1A C;  1MAB G;  3MHH C;  1DLB A;  5L3G A;  3M99 B;  2V1D A;  2EIJ B;  3R65 A;  1P4R A;  5CA3 A;  3CXC U;  2B5U A;  3B8N A;  5KA5 A;  2NNU A;  1K4D C;  2OCC C;  4UV8 A;  1JCH A;  4PA4 A;  1KP2 A;  4UV9 A;  3ABT A;  1OZ0 A;  3K79 A;  2DYR C;  4J9Z B;  2OTJ V;  5E1A C;  1H8H G;  3KG2 A;  2IW5 A;  3F7Y C;  4H33 A;  2XAS A;  1AJN A;  2W0F C;  2HLD G;  4RQF A;  2WLN A;  4DO2 A;  1VQO V;  1ROP A;  1YIJ V;  1EFR G;  5LGU A;  1VQL V;  1TUE B;  1JOY A;  1KC8 W;  2LFR A;  2WLK A;  3QO8 A;  4GX0 A;  3RBZ A;  3B77 A;  4JAV A;  2F43 G;  4G2K A;  2EBO A;  2DWE C;  5KUK A;  1GMG A;  1G8M A;  4FPP A;  4G28 B;  4WFF A;  1Q81 W;  1MOF A;  4GX2 A;  4KP4 A;  4QPK A;  1JJ2 U;  1R6K A;  4RQE A;  1BMF G;  1JVM A;  3SPI A;  3ABL C;  1PKX A;  2EIN C;  4R50 A;  2EZP A;  1YJN V;  4LBE C;  4GCZ A;  2IJJ A;  3CME V;  1GKF A;  2ZR2 A;  1VQ8 V;  2JJ1 G;  4MW8 A;  4WF9 V;  4YXW G;  1L1F A;  2A9H A;  1F4M A;  1V55 C;  3AG1 C;  3UM7 A;  1FXK A;  1OCC B;  3LDC A;  5CN0 A;  4XDL A;  3ZRV A;  3CC4 V;  2P90 A;  2ATK C;  4JTA B;  4QPJ A;  2P6J A;  4LCU C;  1K7D A;  4KUM A;  1JX9 A;  3E8F A;  5KUM A;  1YSC A;  5LHI A;  2BOC C;  1Y66 A;  3W7S A;  1VQ5 V;  4X88 A;  3ETG A;  3CC7 V;  2XOK G;  3DTU B;  3E86 A;  3SYC A;  4CBC A;  3ZMT A;  2WWW A;  2Y48 A;  2ZDI A;  3ZRW A;  5L3C A;  3CMA V;  4MVR A;  1NKD A;  4UUJ C;  5L3E A;  5CBH A;  4HYO A;  1PL0 A;  3EHB B;  1YJ9 V;  2LFS A;  2DW4 A;  2QTO A;  1G4Y B;  3OMA B;  4ZBM A;  3CCS V;  2HFE C;  2C2A A;  1THZ A;  3SPJ A;  3WG7 C;  5DM6 V;  1PNK A;  4RUE A;  1M56 C;  2AHZ A;  1NR7 A;  2QKS A;  2DYS B;  1YIT V;  4JTC B;  2CK3 G;  5IY5 C;  1XL4 A;  1NQT A;  1W0K G;  3AG4 B;  1K97 A;  2ZQM A;  3ASO C;  4BIZ A;  2QE7 G;  2W6I G;  1H8E G;  4ASU G;  1WLE A;  5DN6 G;  2EJR A;  4MW3 A;  4JGS A;  4N21 A;  3LSQ A;  3CCR V;  1R73 A;  3OGC C;  3LDD A;  3TK1 A;  5IDJ A;  4MTF A;  1GM8 A;  3AG3 C;  1H38 A;  2PI4 A;  2WLH A;  4MVS A;  5CBF A;  2JIZ G;  1ARO P;  3IC7 A;  3X2Q B;  1SRY A;  3K0G A;  3ABK C;  4ZKI A;  3H01 A;  4WFA V;  3G71 V;  3EFF K;  4WFH A;  2PI5 A;  3ABK B;  5B1A B;  4MT8 A;  1VQP V;  1VQ4 V;  2Q67 A;  1MG1 A;  4MTG A;  1VQ7 V;  2ITC C;  2XAH A;  4JYB A;  2UXX A;  1XL6 A;  2P7T C;  4R8C A;  5B1O A;  3F7V C;  3OR7 C;  2IU0 A;  4P30 A;  2X6B A;  1NR1 A;  4PA3 A;  2M7W A;  5EC2 C;  3K0D A;  4RO2 A;  5IYB O;  2HJF C;  2OCC B;  5EC1 C;  1W2B U;  2EIL C;  4J9Y B;  3ZMZ A;  3E35 A;  3OUF A;  3CD6 V;  1BHA A;  3RW0 A;  2HG5 C;  1VQ9 V;  1EZJ A;  1QBZ A;  2H94 A;  2K1E A;  4GT1 A;  5H6R A;  4P2Z A;  2DYR B;  2KB1 A;  2EIM C;  4WFG A;  1K5S A;  2EIL B;  3FB8 C;  1R3I C;  4BAY A;  3ZJZ A;  4QIW F;  4Q20 A;  1QLE C;  1K33 A;  5EBW C;  1DF5 A;  3GB7 C;  2A0L A;  2JEX A;  3QO5 A;  4R6Z A;  1VQM V;  5IYC O;  4UVC A;  1FFT B;  2Q68 A;  1CEZ A;  2X6C A;  4LC1 A;  3ZMV A;  3OM3 B;  3CCL V;  5EK0 A;  2EZO A;  3K03 A;  1KQS U;  3QNE A;  4PDV A;  2DQ3 A;  2WPD G;  4XDJ A;  3OW2 U;  5H9C A;  1I5Y A;  1RPO A;  3ETE A;  4XBF A;  1GM9 A;  1NJI W;  4Z1M G;  2GHY A;  4JPR A;  5B3S C;  3CCE V;  3T4D A;  1VQK V;  1NVP B;  5GW7 A;  4MS2 A;  3ZIA G;  3FKS G;  1FS0 G;  2MK3 A;  2JEU A;  1HWY A;  5B3S B;  3ABM C;  3ABL B;  2EIN B;  1M57 C;  1B6Q A;  1GTO A;  1GM7 A;  4OXS A;  5EBL C;  3SYP A;  1OHH G;  4PA7 A;  5BZB A;  2ZXW C;  4QNH B;  3RVZ A;  4GX5 A;  3W7T A;  2Y69 C;  2ZR3 A;  3ZMS A;  4MVO A;  5C93 A;  1QR9 A;  3JCZ A;  1V55 B;  2IJK A;  3AG1 B;  4FK5 C;  2WSS G;  2DQ0 A;  4P9P A;  4X8A A;  4BIU A;  1AI7 A;  2IJI A;  3SPC A;  4E2L A;  4N23 A;  2OT5 A;  1NVP D;  1Q82 W;  5B1N A;  2WAM A;  1ORQ C;  4WFB V;  4PEL A;  3IGA C;  3HPL C;  3OEE G;  4EKW A;  2R9I A;  2ZD9 A;  5L3B A;  4MVZ A;  1LNQ A;  1YHQ V;  2WLM A;  3PJS K;  1AI6 A;  3ML0 A;  4JF3 A;  2WLJ A;  1R3J C;  1V54 C;  3FB6 C;  4UVB A;  3VOU A;  3JD0 A;  1K4C C;  4PDL A;  3WG7 B;  4H37 A;  1AJP A;  2EIK C;  3K3W A;  3UKM A;  3CCJ V;  2OTL V;  4MVQ A;  3OAA G;  1CPY A;  4TWK A;  5LGT A;  1M56 B;  1S3J A;  3TET A;  2R9R B;  3CCU V;  5CBG A;  2LP7 A;  3ABU A;  5IY5 B;  2EIK B;  3T4Z A;  1SZT A;  3AG2 C;  1KKD A;  3ASO B;  2QA4 V;  3B8M A;  3K04 A;  2HKO A;  2JJ2 G;  4KFM A;  2W6J G;  4QJF B;  2XND G;  1OCZ C;  1OCO C;  3MHS C;  1RM1 C;  3SJQ C;  4HZ3 A;  3F5W C;  5HFM A;  4L87 A;  1DF4 A;  3SPH A;  3AG3 B;  4BW5 A;  1PNM A;  2D3O W;  3E2E A;  4LP8 A;  1JQ0 A;  2BOB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...