1DF5A

Interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
publication title Interactions between HIV-1 gp41 core and detergents and their implications for membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 24
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1df5A00
3MHSC 3K9AA 1MOFA 1I5XA 2EZPA 1QR9A 3B77A 4N21A 3B8MA 5HFLA 1Y4MA 3CP1A 3H01A 4FJCC 3CYOA 2EZOA 1ENVA 1DF4A 4FIPC 4G2KA 4N23A 3GWOA 1K33A 5KA6A 1JPXA 3WFVA 1DLBA 3P30A 2LP7A 1EBOA 1QBZA 2P6JA 2X7RB 5CMUA 5KA5A 1JQ0A 3M99B 1SZTA 2EBOA 5HFMA 1MG1A 2M7WA 4FK5C 3B8NA 4JF3A 1F23A 5H9CA 1K34A 1I5YA 2OT5A 1DF5A 1QCEA 4E2LA 2MK3A 4JPRA 5CN0A 3MHHC 1Y66A 4JGSA 1QR8A
chains in the Genus database with same CATH superfamily
1G8MA 4F6RA 4LF4O 3L73H 2JJ2G 1Y74B 2CAZC 1R1BA 3CRQA 4DYLA 1RP3B 1M4UA 4YIPA 5E1AC 3GVMA 4JV5O 3E22B 4JYCA 4AI8A 2A06H 3OW2U 3HPLC 3BCCH 1SA0A 2PI5A 2JEXA 2ADQB 2FB5A 5LA6A 1YJWV 1IBMB 3T4DA 2A7WA 1UPGA 2F43G 1FAFA 1Y4MA 3U10A 3T1HB 2Q0AA 3PJSK 2BTOA 4D6TH 1DK1A 2BTQB 3D36C 3E22A 3IFXA 1P7BA 4QPKA 2PGGA 3E8FA 5B1BB 2P4VA 1F23A 2ITDC 3WB2A 2EIJB 2F93B 3TJTA 3CEIA 4AILC 2UUCO 3P3NA 2QEXV 5EBLC 4JPRA 3ETGA 3FYEB 3D3QA 1M56C 5FL7G 5FNVA 5GW7A 2Q5ZA 1S3JA 4BW5A 1BCCH 1ZAUA 4X88A 3CS5A 1NI8A 1P49A 4DR3O 4P2ZA 3AG3B 3TETA 2QKAA 3RW0A 3C3TA 2CTPA 2EINB 1Y66A 2JGDB 1TUEB 3CSXA 5LYJB 1VARA 1FXVA 1XL6A 1QHTA 3E35A 5KMGA 1NVPB 1EBOA 1SQGA 3AEIA 2QJ1A 1KUQA 1W59A 3HKDB 1OHHG 3DGEA 1FFXA 4I4TA 2HEPA 1S0VA 4UCRA 4JI2O 3VBBA 2UUCB 5HFLA 3AG4C 1UFIA 4X66B 4JI7O 2M6YA 4O4HA 4O4LA 1I94O 5LMNO 3K04A 2FKXA 3UQ8A 1VQKV 5LMUB 2P7TC 5BR8O 3TCUA 4JI6O 4UVAA 4ZKIA 2PF4E 1K97A 2QSAA 3ICXA 1VF7A 1A32A 1CP9A 3LNMB 1W0JG 4WFFA 4FIPC 1V54C 4DV3O 2BCCH 3AG2B 1OCZB 3FB5C 2DYRC 2WLIB 1WP8A 2KG7A 4F6EA 4R7CA 3CCMV 2X0LA 4YHHO 2H94A 3ZBHA 1HP8A 1RFYA 1V55B 3J80N 3FAVB 3ETEA 2GUZB 1PNMA 5KHGA 3OT7A 3A8TA 1O9GA 4JI7B 3IJ4A 2WLIA 4XDKA 4MVUA 5LMNB 2ZM6O 1S76D 4PJ0Z 4RWUA 1XI1A 2HHHO 5CB4A 5KHJA 4DR2B 2D3OW 1H2LA 3UM7A 3C90A 4PELA 4X89A 2Y0IA 2QM8A 1R3IC 3ABLB 1RPRA 2ZR3A 1Q3EA 2LW7A 3ZHRA 5JVDB 4QE7A 4ICGA 5LL6Y 1MSDA 1AJQA 4OPAA 2WSSG 5D5PA 2WAMA 4J7JA 5ITZA 3T2MA 2CTRA 4DXWA 3CRAA 3KG2A 3CCSV 1K5SA 4DV1O 2DMXA 1YZBA 2IW5A 4QE9A 5JVDA 1Q7YW 1N0NA 2Y4UA 1F4MA 5TISZ 1SS3A 3CRCA 2HHHB 1PD3A 4IIJA 3B2EE 5B1BC 2IJIA 4DV7B 2KKWA 2EIJC 2EILB 1H2MA 5H6QA 5LXTA 2B1GA 3APOA 2A0LA 5EZYA 4MTXA 1QVGU 1GKFA 2YI8A 1SQXH 1BQ0A 2QWRB 1SC5B 2GHYA 1XBLA 4O2BA 3N2KA 2OCCB 2P5OA 2YIBD 4GUNA 3AG3C 2CH7A 5IYBO 1KQSU 4U3JB 1ZX3A 2EINC 2W6JG 3MDSA 4JI1O 1ROPA 2ZIOA 4YY3B 3TK1A 4JI0O 3K58A 3CRRA 3ZHUA 1K9MW 1VQOV 1I5XA 2QWQB 2F23A 1IURA 1DF4A 3HKCB 1AI7A 1MNGA 1IDSA 4U7OA 4JI3B 1OJHA 1N34O 1YHQV 3L9DA 1Z5WA 4U3FH 4DR6B 3E8GA 2VQFB 1Q6UA 4X62B 1VQ4V 3SYQA 3L75H 2XOKG 1WJZA 2B5UA 2AXTZ 3B8MA 3ZRVA 2LGWA 4DR1B 1ENVA 5LHHA 3DTUB 4YJ3B 3G4SV 1NTMH 2EIMB 2ZNJA 2XNDG 3L70H 5B66Z 4JI4O 4PI2A 3OTOO 1PNKA 3JAWB 3I55V 5IT9N 3AG7A 2Y48A 5CN0A 2R72A 3H1JH 3SYPA 2CGNA 4LFCO 1MOFA 4Z2WA 4MW3A 3AG2C 2HVKC 1OCZC 2ARHA 4QIWF 2ZKOA 3EFFK 5EIBC 3K5LA 2QA4V 3OUFA 1KP2A 1ZUQA 4GCZA 3O65A 1FXKB 4P9PA 4PA6A 3RWRD 4DV0O 5D5QA 4PDRA 1N34B 1COWG 3JAWA 1V55C 1N32B 4JI5O 3D8CA 2VQEO 3WB0A 4TUYB 4A5UB 4K8XA 2JS3A 2OIEA 4KHPO 2YEVA 5L3EA 2CDYA 4LFAO 1H2KA 1N36O 5J9PC 4C7UA 3W7WA 1I5YA 3ABKB 2XHBA 4OPHA 2Q69A 4B3MO 5KHKA 3OTOB 1BSMA 2XAGA 1VQLV 2JS5A 3QVNA 3FX7A 3L71H 4JI8O 5KAIZ 2XT9A 4J80A 4IYHA 1S5HC 3ABLC 5A9GA 2XUMA 2N04A 3H1LH 3RYFA 1HNZO 4L87A 3LDDA 3B8NA 5LGUA 1Q86W 3AG1B 1R6NA 4B08A 3D36A 3H1IH 3K03A 4X9QA 4DV0B 3VQVA 1NR7A 3AK2A 4DV5O 3KZIZ 1JFFB 1L0NH 3BEHA 2X6CA 4PDLA 4LF9O 1KKCA 5B5EZ 5JJNB 4NXMB 3W7SA 1SZTA 2DN9A 4MVRA 4O4IB 1GM9A 4HAMA 5IJ0B 3BRCA 1AR5A 4LF7O 2LFRA 2R9AA 1JFFA 4IHJB 4L8JA 1OCRB 4KUMA 2EILC 4PI0A 1PP9H 1D5NA 4FFBA 4FLTA 4ZOLB 2WWWA 4O4JB 5IYZA 3L72H 1TVKB 4LWSA 4CH5A 3CE2A 1N4CA 3CCQV 5IJ0A 2LJ2A 2OCCC 4TV9A 2YICA 3FB6C 4DV2B 4EKWA 4B3TO 3X2QB 2DYSB 4ZOLA 4OX9O 4LF9B 4ABMA 2M7WA 1TUBA 4TWKA 5KHHA 5JJJB 2Z5UA 3ZHTA 1YSCA 1RM1B 3LDEA 5IYCO 5CA0B 4N21A 5K1XA 2EJ7A 4UV9A 5K1PA 5GTIZ 4TV8A 2BE3A 4B3SO 1OZ0A 1R3LC 4EFEA 1XNRO 1K8AW 1MG1A 2LQTA 3R66A 3LSSA 2Q7GA 2H3OA 1Q81W 1YJNV 3PN1A 3G71V 5KUMA 1BS3A 3CP1A 2EIMC 1E1RG 5DEDA 4MSWC 3F7VC 1M93A 4WFHA 1XREA 4OX9B 3ZIAG 1F4NA 4FMTA 2IM9A 1YEWA 4LC1A 3RN4A 1QVFU 4LP8A 3B77A 1L0LH 3CD6V 2ZE8A 4UXNA 5KX5B 3W7TA 1FXKC 5EBMC 4UCVA 2GTAA 1WA8B 2HLDG 1W0KG 2JJ1G 4PA4A 3TXSA 5JQGA 1J5EO 1CPYA 4FLZA 4UVBA 3JATA 4YJ2A 5JWPA 4B3SB 5JCOA 3DXRB 5LGNA 4FLWA 4UCUA 1P84F 1H8EG 1Y74A 4DR7O 2IH3C 4FLUA 4X20B 2ZE5A 3ZN0A 3ABKC 1W2BU 3LSUA 2Q4PA 3JCZA 1ZWIC 5EK0A 2ZDIA 3BVOA 4QGPA 2B9ZA 3ZHSA 4XBFA 1XOUA 4YXWG 2RMKB 4LF6B 1JMKC 2P90A 3GWOA 4LF4B 2HP8A 3AG1C 2BTQA 4DK0A 4JV5B 4BIZA 1SESA 1Q5OA 1ZLZA 5JH7B 3STLC 3A0BZ 1TAEA 1BQZA 1IBKO 2NN4A 3K79A 3VQXA 4Z1MG 4KL1A 4JYBA 1OCCB 3K0DA 1K5QA 2YIDA 1JCHA 1LUVA 4MVOA 3G67A 1J95A 3CC2V 2B1IA 4I55B 2ZT9B 2CGOA 1Q6IA 1KBHA 5AG2A 1KD1W 3R65A 3QNEA 3CJHB 1H38A 5JH7A 2YXYA 1U97A 5BZBA 5IE9A 1OCRC 1NU1H 3ABTA 1M5IA 1Y76B 2CE4A 2LFSA 3SPGA 2JDIG 2P67A 1FJGO 2JGDA 1XDCA 1MSWD 4PDMA 4LH6A 5LYJA 3KCYA 4E4EA 1YVWA 2FMLA 3K59A 5HFMA 5L3GA 1NZ6A 4FLYA 3RGBA 1AB3A 1I08A 3HKDA 4JYAO 1K34A 4H37A 5KHIA 1GRJA 1ZTEA 4DR3B 1QR8A 3X2QC 1WNSA 1KP3A 2DYSC 4ZIBA 2PTMA 3HR0A 4GKJO 1HNWO 3K57A 1QLEB 1AI5A 2E74B 3SJQC 2F95B 2Q6AA 4RAIA 3GB7C 3VOUA 3WU2Z 2UU9O 4I5SA 4TQFA 2DQ3A 3EVKA 2JK5C 2GV9A 3APQA 4JAAA 4Z1VA 3ZJZA 1Q6HA 4LR3A 5LHIA 1AJPA 1KYOF 1HW7A 1GM8A 3VQWA 3W7UA 3ZMTA 4BIUA 2L35A 4RO2A 4GX2A 1JJ2U 4JI2B 1EZJA 1VF6C 1FJGB 1X59A 4ZHQB 3EHBB 5CMUA 3CCLV 3MD0A 3T1CA 4DV6O 1XL4A 1FD9A 4UUJC 4JF3A 4ZBMA 1JOYA 3BFRA 2R70A 4J7KA 5EC2C 1RSOB 1I94B 4UB8Z 1ZL8B 5LOVB 4JYAB 3JD1A 2HFEC 3HKEB 5BR8B 4JI6B 4PD4F 2X6BA 3FAVA 1OCOB 4G2KA 2R9IA 1NS1A 2Y69B 2K1EA 5JCOC 1S77D 4HNAB 2GUZA 4F4LA 1FKAO 3B40A 1AROP 2VS0A 4DV3B 3SPIA 3HKBB 1BMFG 4CH3A 1ZL8A 3ZMZA 3OR7C 2UXDO 5LOVA 1E1QG 4WFBV 1B04A 1NT2B 2QWPB 1Z2GA 2NLJC 2HJFC 4YHHB 4MVSA 2ZDIC 4DW1A 4OGQB 3W7XA 2DJVA 2UXCO 2ZINA 5BXZA 5CA1B 2Q0OC 1MA1A 2QGNA 4JTAB 1US6A 1WB8A 3DSQA 1KECA 1PM9A 4IGGA 5KLVH 5L3BA 2ZM6B 2AZ0A 5IY5B 2ZIMA 4I9WA 3ZHQA 1VQ5V 1GM7A 5IJ9B 3WB1A 3ETQA 4X1IB 4NTYA 1AR1B 1K7DA 2ZE7A 1HR0O 3RFRA 2N05A 1LR1A 3ABMB 1KB9F 5FLXN 4MTFA 1M1KW 3KCXA 3B09A 3SPJA 3JYCA 2JIZG 3UCSC 2E5LO 2H8PC 3QO8A 2UXDB 2PY5A 4EFBA 1QBZA 5IJ9A 4O2AB 3JAMN 4UCTA 4LF5O 1FXHA 1K3EA 2UXCB 3OM3B 3LSQA 4WF9V 1OCCC 2ZXWB 1NQTA 2DW4A 2PI4A 2AHYA 1THZA 4JAVA 2F4VO 4DV1B 2OTLV 3SYCA 2WLLB 3OEEG 4X1YB 2EJRA 2XAHA 4K0KO 2X7RB 3UKMA 3ZRXA 2AW9A 4U3JA 3ZHVA 4DW0A 5EYPB 3K0GA 2OIGA 1DF5A 1Y6XA 3CMAV 3FYIB 1D5AA 2GSMB 4WFAV 1BE3H 1HR0B 2AHZA 3CPWU 2QKCA 3CHXA 1N0JA 4LFBO 4B7KA 4Q6GA 2W0XA 4MTOA 4N23A 1S72V 2BOCC 5KA6A 3HKCA 4X1YA 4KXRA 1N33O 4UB6Z 4PHZA 2UUAO 1Q43A 3SPHA 3JSNA 3HB3B 3K5MA 1IXBA 5J2UB 2XAJA 2YUAA 4H33A 1QLEC 2ZQMA 4J10A 4JI1B 4BW9A 1XHXA 1IVSA 3FD9A 4JI0B 4PV1B 3O9OA 3ZX6A 3OEHG 4YJ3A 4K8ZA 4QNHB 2CTWA 4TQDA 1ORQC 1SRYA 4QJFB 3K9AA 2QKSA 2YXHA 3NR7A 2F1MA 4I0XB 4WBNB 3CCEV 2FL4A 2EULA 2JRIA 1FXKA 1N33B 2UUAB 1B3QA 2RDCA 3S3XA 2ILMA 5L3DA 4JI4B 3E83A 1RPOA 1OCOC 3SDLA 2Y69C 3BA9A 3OR6C 5DECA 2UXBO 3CYOA 4TUYA 1NTZH 4LFCB 2IU0A 4X8AA 1AP5A 3WFVA 3FFQA 1VQ6V 2FYUH 2HG5C 3RYIB 4JAUA 1VQ7V 3Q4HB 1Q8IA 2A9HA 3OD4A 1B6QA 5LBQA 1XHZA 4P30A 3CMEV 2MK3A 4HZ3A 3IC7A 4MVZA 4OXSA 4LF8O 4UCOA 2Z3YA 4YIOA 3OAAG 4JZGA 2DQ0A 4GKKO 3P32A 4JI5B 2VQEB 1KMIZ 1YDXA 1B06A 3G80A 2OTJV 3RYIA 3Q4HA 1XMOO 3J7AU 4KHPB 1TA8A 1IX9A 2WA4A 4DR5O 2A3QA 4NYKA 5J2TB 4LFAB 1AI4A 1LUWA 5C8YB 5H5NA 1N36B 1BGYH 5IY5C 2V4DA 4RUEA 2NR5A 5B1AB 2WLKA 1NTKH 3CWBH 4B3MB 3JAKB 1OV9A 4LNUB 4DUYO 4CS2A 4QPJA 2PZSA 2QM4A 1HNXO 3BABA 4JI8B 3ABMC 3FKSG 2WLHA 2PYJA 1Q82W 3BHPA 1SQFA 5IDJA 2HJDA 4O4IA 2DWDC 1HNZB 4NKGB 1GN2A 1K4CC 3H1HH 4LH7A 1QLNA 5LGTA 4IL6Z 2YIBA 5EC1C 4J7ZA 4IHJA 3JAKA 4DV5B 1XILA 2EZOA 5DM6V 1M57B 1SQQH 2LGQA 3T1YO 3STZC 4O4JA 3UT5B 2EBOA 1G1XB 2Z0AA 5GONB 1TVKA 2ZXWC 1QCEA 3FB8C 1XMOB 2ZCEA 1EM1A 4DR5B 4X1KB 1JX9A 2Y4TA 1GO3F 5JJEB 2Q7HA 4ZI7B 4LF7B 4FLXA 5H6RA 4DRXB 3SJCC 4ASUG 3MAQA 4DUYB 1YCIA 3M99B 2EX3A 1BHAA 3UT5A 2CK3G 5GONA 3JD0A 3FB7C 4MTGA 4FZ1A 3CCVV 2BSKB 1DGSA 5KAFZ 2RNBA 4X1KA 1QR9A 4NVPA 5CA0A 3RYHB 2QTSA 2V1DA 3ZMUA 4ZI7A 1SZXA 1IBMO 4B3TB 1VF6A 2QTOA 1E79G 2AZ2A 3F7YC 4R50A 2BSKA 2QDOA 2YI9A 3T1HO 2G38A 5EBWC 4F6RB 2WLJA 3BA8A 2EZPA 1VIBA 1VQPV 3BPZA 3RYHA 2Q73A 5H2FZ 1FPOA 2UUBO 3CCRV 4MS2A 3D3IA 3F5WC 3GWKC 1BHBA 1JQ0A 4MW8A 4FPPA 1SA0B 1IZ3A 1JJOA 5LA6B 3K5NA 2XAFA 4TSFG 1XNRB 3CRMA 4JTCB 1JVMA 3JARB 4PA3A 1R3KC 2YXLA 2QE7G 3CB2A 2JEUA 5KX5A 4CH4A 1K33A 1YF2A 2KB1A 5E79Z 3U11A 1R6KA 1WA8A 1IBLO 4CH6A 1G6UA 1K4DC 1WB7A 1FYJA 1VQ8V 3DXRA 1URFA 2GBOA 3JARA 4J9YB 4PA7A 5FNVB 2RCVA 4H0LB 4BAYA 2GTSA 4CS4A 3QF7A 2P4KA 1AR4A 2RN9A 4UCSA 1VQNV 2P6JA 4X20A 3K06A 5CBFA 3K5OA 5LHGA 2X6AA 2UUBB 4DK1A 2XASA 3CC7V 1NH2D 2AGAA 1J5EB 4DV4O 3ASNB 3SYAA 2Q8VA 3JSLA 1SQBH 4J9ZB 3DC5A 1R73A 4JGSA 1M90W 4X66O 1WPBA 4NTWA 3U0ZA 4TOIA 2V7QG 1D2DA 5KMGB 2LO1A 1U96A 3JD3A 5LMUO 3M8AA 3C3SA 4DR7B 4I7ZB 1FFXB 5H9CA 3ABUA 4I4TB 1V9PA 5B1AC 4E2LA 3A0RA 1IBLB 4P9OA 3JCUZ 3BY6A 3ZN1A 1P7GA 3S3WA 4RQEA 2P06A 3ETDA 4O4HB 4O4LB 1AI6A 2Q68A 4K3AA 5IWAO 4I55A 2RJZA 4DUZO 1H2NA 4UFZA 3CJHA 5L3CA 5B1NA 4WCEV 2JVDA 1M57C 1Q90D 4DV4B 3E86A 2DWEC 1KU9A 1Y76A 3ML0A 2HVJC 5BY1A 4UVCA 1IBKB 3J81N 1I7FA 3OTFA 1XMQO 2XAQA 1QQCA 4WFGA 5B3SB 5C93A 1KKDA 1KC8W 2ODMA 2QWNB 1RM1C 2DE0X 2KG7B 3OE7G 4DR2O 3P3PA 3CXCU 4IT5A 5IYDO 3N2GB 2Q9LA 1Z5VA 1XEQA 1FS0G 4AQYO 3AK3A 4CS3A 4CC5A 4FLVA 4MT8A 1YI2V 4MVMA 2EIKB 5IWAB 4X64O 4DO2A 3SR2C 4DUZB 2IJKA 2YSUB 5CB4B 2QM7A 3K3WA 3N2GA 3H01A 2LW1A 1N8RW 2Q67A 3H9VA 4NTXA 4Q20A 2D2CB 4GKJB 5BMVB 1BT8A 5LP6B 1HNWB 4ZHQA 2CUGA 4BWAA 1XMQB 4LBEC 4H44B 3RVZA 5CBGA 2UU9B 4G27B 2WLMA 1RSOA 3OGCC 4DV7O 4X65O 5KUKA 2E3CA 3H1KH 1BL8A 3HKEA 3EXAA 5CBHA 4U7NA 1K92A 2Y0PA 5ITZB 5BMVA 5LP6A 4HNAA 2ITCC 1BZKA 1VMGA 4AQYB 3KKYA 1QNMA 4G28B 3RBZA 3I5DA 2WLNA 3OMIB 1EN4A 3HKBA 3WG7B 4DV6B 1JR9A 4HBNA 5B1OA 1GN6A 4X64B 4KP4A 4IIJB 1NH2B 1EN5A 3E8BA 2WA3A 4YY3O 1WPXA 3ASOB 5LXTB 4XDLA 1HDJA 2VWKA 5EZYB 4FM2A 5CA1A 1PV0A 3T4ZA 2PYLA 3TGUH 5KA5A 4JI3O 4O2BB 3N2KB 2W0FC 4X65B 3THOA 4DR6O 2XTAA 2VRZA 2CH7B 2VQFO 4X62O 3ASNC 3K9SA 3JASB 4X1IA 2HR3A 2YDEA 5FPOA 4NXNO 1UJWB 4DR1O 2E76B 1GH6A 3E89A 4CBCA 4FJCC 1EN6A 3SJBC 3RYCB 3SPCA 2BOBC 2LP7A 4K35A 4XDJA 1SQVH 2QWOB 4O2AA 3JASA 4EB6B 3E8HA 4FVMA 4H13B 1YJ9V 1WN7A 3RT3C 3JD2A 1ZSPA 1XNQO 3ZMVA 2YC0A 1EZVH 1S5JA 2R9RB 3ZMSA 4AHCA 1H2SB 3QTCA 1Y67A 3RYCA 1NKDA 2W6IG 2WLLA 2E5LB 5DN6G 1N32O 4NR1A 2VWJA 4EB6A 1M9NA 3M7MX 2ZR2A 3BAAA 2P22C 5EYPA 3ZRWB 1NBMG 2O57A 3MHHC 4PA9A 4LF5B 4LCUC 2F66C 1QU7A 3K08A 3A0HZ 1MZEA 2ATKC 4NXNB 5B3SC 3IGAC 1YTFD 1GMGA 1DLBA 3ZCCA 2F4VB 2YIAA 2IH1C 1EFRG 1T5EA 4RUFA 3JD4A 4I50B 3IC9A 4K0KB 5J2UA 4FM0A 3ZRWA 5A2QN 5FPRA 4PDVA 1XNQB 2GDSA 2KSDA 1XQ8A 4GX5A 2YEVB 3OFNG 2DOSA 4LFBB 4TT3G 2FTKA 1CXZB 2ZE6A 2EIKC 3LDCA 3SGIA 3UO2A 1HWYA 2C2AA 4GX0A 4UV8A 1VEWA 4I50A 2A79B 4R8CA 1X4TA 2Q7EA 4I9QA 1GN3A 3OUSA 3IAYA 1PL4A 2IU3A 4NXMO 5LP6C 2E75B 4BR6A 3UO3A 4I0XA 3G6BA 4BIOA 4WBNA 5GTHZ 3RYFB 4B7EA 1CEZA 1R3JC 4RQFA 3CC4V 2KQXA 3ZEDA 3F5TA 4JASA 3RVYA 1SKVA 3CXHF 2K9PA 1LNQA 4JTDB 3OMNB 4IYIA 2NNUA 1XUQA 1VP7A 3P30A 1PNLA 1M56B 2ETNA 1VQ9V 3WG7C 1SF9A 1PKXA 4DV2O 1L1FA 1MABG 4B3RO 1WLEA 4FZ0A 3CCJV 4HYOA 1GK9A 2WPDG 3ASOC 3AK1A 4FFBB 2IBZH 3E2EA 3A2FA 1GTOA 5IYZB 2OYQA 3DC6A 3QO5A 1YITV 2UXBB 2YS8A 4LWSB 1WP7A 4FM1A 1TGOA 1NJIW 1F51A 2N74A 1PPJH 1SETA 5J2TA 1AILA 4TV9B 5C8YA 2UXXA 1VF5B 2RQ6A 4J11A 1S5LZ 2OCHA 4J41A 3CX5F 3OGIB 1IXMA 4LNUA 4LF8B 3ZRSA 1K73W 4J42A 5L3FA 3LUTB 3AG4B 3SJAC 1YXBA 4GKKB 1TUBB 2ZD9A 4DR4O 5F2VO 1NVPD 1G4YB 4NB5A 1SERA 1VQMV 1MMMA 3MHSC 1WAZA 4TV8B 3G6EV 4B3RB 1AVMA 1L8DA 3QG5A 4D7SA 1NR1A 4CZZA 4WFEA 4GX1A 3I56V 4GZRB 1O9HA 1HNXB 4MVQA 2CTQA 2HKOA 1V54B 1H8HG 1GN4A 1P4RA 3NXSA 3L74H 4GYCB 2JGUA 3N27A 1YTFB 4W4LA 3QO7A 5CA3A 1JA8A 2DYRB 1H2GA 2L6LA 3TXQA 2OWOA 1SQPH 4W4KA 3VQYA 4GLXA 1F7YA 4EEQA 3JALB 2UXNA 3B4SA 3CCUV 4FFKA 4DRXA 3SYOA 2PUSA 2ZNIA 3LNNA 3T1YB 4R6ZA 2MW2B 2OT5A 4JZ2A 4KFMA 2ADPA 4DR4B 1AJNA 2IJJA 1AP6A 5EIBD 3OMAB 1I0HA 2QR4A 3ZS8C 4GT1A 1DTOA 1R6TA 3JALA 4CC6A 5JQGB 1JPXA 2IJHA 3JATB 4YJ2B 4FK5C 1MZFA 1YIJV 4JYYA 1FFTB 4LF6O 1GAXA 1PL0A 4D7TA
chains in the Genus database with same CATH topology
3CXCU 2ZXWB 3BEHA 1G8MA 1NQTA 2DW4A 2PI4A 2AHYA 2X6CA 5IYDO 2JJ2G 1THZA 4JAVA 4PDLA 2OTLV 3SYCA 5E1AC 1FS0G 2WLLB 3OEEG 4JYCA 2EJRA 2XAHA 2X7RB 3W7SA 1SZTA 3UKMA 3ZRXA 3OW2U 4MVRA 4MT8A 3HPLC 1GM9A 1YI2V 4HAMA 2PI5A 3K0GA 2JEXA 4MVMA 1DF5A 2EIKB 3CMAV 1YJWV 3FYIB 2GSMB 3T4DA 4DO2A 4WFAV 2F43G 2AHZA 2LFRA 3CPWU 2IJKA 2YSUB 2QM7A 3K3WA 1OCRB 1Y4MA 3H01A 4KUMA 1N8RW 2EILC 2Q67A 4MTOA 3PJSK 4N23A 1S72V 2BOCC 2WWWA 5KA6A 4Q20A 3IFXA 1P7BA 4QPKA 3E8FA 3SPHA 5B1BB 3HB3B 1F23A 2ITDC 2EIJB 4LBEC 3RVZA 3CCQV 2XAJA 5CBGA 4G27B 2WLMA 2QEXV 3OGCC 4H33A 2OCCC 5EBLC 4JPRA 1QLEC 2ZQMA 3ETGA 3FYEB 5KUKA 3FB6C 1BL8A 1M56C 5FL7G 5CBHA 4EKWA 4U7NA 5GW7A 3X2QB 3OEHG 1K92A 2DYSB 1S3JA 4BW5A 4X88A 2ITCC 4QNHB 2M7WA 4TWKA 4P2ZA 4G28B 3AG3B 3RBZA 2Z5UA 2WLNA 3TETA 1YSCA 3OMIB 3RW0A 1ORQC 1SRYA 2EINB 1Y66A 3LDEA 3WG7B 4QJFB 1RM1B 5IYCO 3K9AA 5B1OA 4N21A 2QKSA 4UV9A 4KP4A 1TUEB 1NH2B 3E8BA 3CCEV 1FXVA 1XL6A 3E35A 1NVPB 1EBOA 1OZ0A 1R3LC 1WPXA 3ASOB 3AEIA 1K8AW 4XDLA 1MG1A 1FXKA 3LSSA 1OHHG 3DGEA 1S0VA 5L3DA 1Q81W 3T4ZA 1YJNV 3G71V 3E83A 5KA5A 1RPOA 1OCOC 5KUMA 3VBBA 2Y69C 5HFLA 3OR6C 3AG4C 3CP1A 2EIMC 3CYOA 2W0FC 1E1RG 2IU0A 4X8AA 3WFVA 1VQ6V 2HG5C 3ASNC 4JAUA 4MSWC 3F7VC 1VQ7V 4WFHA 3K04A 1VQKV 2A9HA 3ZIAG 1F4NA 4FMTA 1B6QA 5LBQA 2P7TC 3TCUA 2HR3A 4LC1A 4P30A 2MK3A 4UVAA 3CMEV 4HZ3A 3IC7A 1UJWB 4MVZA 4ZKIA 4OXSA 1K97A 1QVFU 4LP8A 3B77A 3E89A 2Z3YA 3CD6V 4UXNA 1CP9A 3OAAG 4CBCA 2DQ0A 3LNMB 4FJCC 1W0JG 3W7TA 1FXKC 5EBMC 4WFFA 4FIPC 3P32A 3SPCA 2JJ1G 2HLDG 1W0KG 2BOBC 1V54C 2LP7A 4PA4A 4XDJA 2OTJV 3AG2B 1CPYA 4UVBA 1OCZB 3E8HA 3FB5C 1YJ9V 2DYRC 3JD2A 2WLIB 1AI4A 3ZMVA 5LGNA 4R7CA 3CCMV 2X0LA 5IY5C 2R9RB 3ZMSA 2H94A 4RUEA 5B1AB 2WLKA 1V55B 1H8EG 2IH3C 4QPJA 3ETEA 1NKDA 2W6IG 3ZN0A 1PNMA 2WLLA 3ABMC 3FKSG 3ABKC 1W2BU 2WLHA 5DN6G 1Q82W 1M9NA 5IDJA 3JCZA 1ZWIC 5EK0A 2DWDC 2ZDIA 2ZR2A 2WLIA 4XDKA 4MVUA 3ZRWB 1NBMG 3MHHC 1K4CC 4PA9A 1QLNA 1S76D 4XBFA 4LCUC 5LGTA 3K08A 4YXWG 5EC1C 2ATKC 2D3OW 5B3SC 3IGAC 2EZOA 2P90A 5DM6V 1M57B 1YTFD 3UM7A 1GMGA 3GWOA 3AG1C 4PELA 1DLBA 4X89A 3STZC 3ZCCA 2IH1C 1EFRG 2EBOA 2QM8A 4RUFA 1R3IC 3JD4A 3ABLB 1RPRA 4BIZA 2ZXWC 1SESA 2ZR3A 3STLC 1QCEA 3FB8C 3ZRWA 4PDVA 4QE7A 3K79A 1JX9A 4Z1MG 1GO3F 4GX5A 2YEVB 4JYBA 1OCCB 1AJQA 3K0DA 3OFNG 1K5QA 5H6RA 2WSSG 2WAMA 1JCHA 4MVOA 4TT3G 4ASUG 2FTKA 1J95A 3M99B 3LDCA 2B1IA 2EIKC 3CC2V 3T2MA 1BHAA 2CK3G 1HWYA 4DXWA 2C2AA 3JD0A 4GX0A 3FB7C 4UV8A 1KD1W 3R65A 3KG2A 3QNEA 2A79B 4R8CA 1H38A 3CCSV 1K5SA 4MTGA 5BZBA 3CCVV 1OCRC 2IW5A 4QE9A 3ABTA 1Q7YW 3OUSA 2LFSA 3SPGA 2IU3A 2JDIG 2P67A 1QR9A 1F4MA 1MSWD 4PDMA 2V1DA 3ZMUA 1PD3A 5B1BC 2IJIA 2EIJC 1CEZA 1R3JC 2EILB 4RQFA 5HFMA 5H6QA 5L3GA 2B1GA 3CC4V 2QTOA 1E79G 1K34A 2A0LA 4H37A 3F7YC 4R50A 4MTXA 4JASA 3RVYA 5EBWC 1QR8A 2WLJA 3X2QC 1QVGU 1KP3A 1GKFA 2DYSC 2EZPA 2GHYA 1VQPV 1LNQA 4JTDB 2OCCB 3OMNB 1QLEB 1AI5A 3SJQC 2Q6AA 2NNUA 4RAIA 3CCRV 4MS2A 3D3IA 3F5WC 3AG3C 3P30A 1PNLA 3GB7C 1BHBA 1M56B 1JQ0A 3VOUA 5IYBO 4MW8A 4FPPA 1KQSU 4I5SA 1VQ9V 2DQ3A 2EINC 3WG7C 2JK5C 2W6JG 1PKXA 2XAFA 1ROPA 4TSFG 3TK1A 4JTCB 3ZJZA 1L1FA 1MABG 1JVMA 1K9MW 4PA3A 5LHIA 1WLEA 1VQOV 1AJPA 1I5XA 1GM8A 1R3KC 3CCJV 3W7UA 2QE7G 1GK9A 4HYOA 2WPDG 3ZMTA 3ASOC 4BIUA 2JEUA 3E2EA 1DF4A 1GTOA 4GX2A 4RO2A 1AI7A 1EZJA 1JJ2U 1K33A 4U7OA 3QO5A 2KB1A 3EHBB 5CMUA 1YITV 3CCLV 1YHQV 1R6KA 3MD0A 3T1CA 1XL4A 4UUJC 4JF3A 1K4DC 4ZBMA 1NJIW 1F51A 1JOYA 3E8GA 1VQ8V 5EC2C 1SETA 3SYQA 1VQ4V 2UXXA 2XOKG 3JD1A 2B5UA 2HFEC 4J9YB 3B8MA 4PA7A 4BAYA 3ZRVA 2X6BA 1IXMA 1ENVA 1OCOB 4G2KA 5LHHA 3ZRSA 2R9IA 3DTUB 1K73W 2Y69B 5L3FA 2K1EA 1VQNV 3LUTB 3G4SV 2P6JA 3AG4B 3K06A 5CBFA 1S77D 2EIMB 2XNDG 4F4LA 2ZD9A 5LHGA 2X6AA 1AROP 2XASA 3CC7V 1PNKA 1NH2D 3I55V 3ASNB 1NVPD 2Y48A 3SPIA 3SYAA 1BMFG 1G4YB 4J9ZB 5CN0A 3ZMZA 3OR7C 1SERA 1VQMV 1R73A 4JGSA 3SYPA 3MHSC 1M90W 1MOFA 1E1QG 4WFBV 3G6EV 2V7QG 4MW3A 3AG2C 2HVKC 1OCZC 2NLJC 2HJFC 3EFFK 4QIWF 1NR1A 2QA4V 3JD3A 4CZZA 4MVSA 2ZDIC 3OUFA 1KP2A 4WFEA 4GCZA 4GX1A 4P9PA 1FXKB 3W7XA 3I56V 4PA6A 5H9CA 4PDRA 3ABUA 4MVQA 2HKOA 1COWG 1V54B 1H8HG 1P4RA 3NXSA 5B1AC 4E2LA 1V55C 3A0RA 4JTAB 4P9OA 1YTFB 1KECA 3QO7A 3BY6A 3ZN1A 5CA3A 2DYRB 1H2GA 5L3BA 4RQEA 5IY5B 2YEVA 4I9WA 2UXNA 3ETDA 5L3EA 3CCUV 1VQ5V 1GM7A 3SYOA 1AI6A 2Q68A 5J9PC 1AR1B 1K7DA 4R6ZA 3W7WA 3ABMB 2OT5A 1I5YA 3ABKB 4KFMA 4MTFA 2Q69A 5L3CA 5B1NA 1AJNA 2IJJA 3SPJA 4WCEV 1M1KW 3JYCA 1M57C 2JIZG 2XAGA 3E86A 1VQLV 2DWEC 3OMAB 3ML0A 2HVJC 4GT1A 2H8PC 3QO8A 4UVCA 1DTOA 1S5HC 1JPXA 3ABLC 1QBZA 2XAQA 4WFGA 5B3SB 2IJHA 5C93A 1KKDA 4L87A 3LDDA 1KC8W 4FK5C 3B8NA 5LGUA 1Q86W 3AG1B 1RM1C 1R6NA 1FXHA 3D36A 1YIJV 3OE7G 1K3EA 3K03A 1FFTB 1NR7A 3OM3B 3LSQA 4WF9V 1PL0A 1OCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS C;  3K9A A;  1MOF A;  1I5X A;  2EZP A;  1QR9 A;  3B77 A;  4N21 A;  3B8M A;  5HFL A;  1Y4M A;  3CP1 A;  3H01 A;  4FJC C;  3CYO A;  2EZO A;  1ENV A;  1DF4 A;  4FIP C;  4G2K A;  4N23 A;  3GWO A;  1K33 A;  5KA6 A;  1JPX A;  3WFV A;  1DLB A;  3P30 A;  2LP7 A;  1EBO A;  1QBZ A;  2P6J A;  2X7R B;  5CMU A;  5KA5 A;  1JQ0 A;  3M99 B;  1SZT A;  2EBO A;  5HFM A;  1MG1 A;  2M7W A;  4FK5 C;  3B8N A;  4JF3 A;  1F23 A;  5H9C A;  1K34 A;  1I5Y A;  2OT5 A;  1DF5 A;  1QCE A;  4E2L A;  2MK3 A;  4JPR A;  5CN0 A;  3MHH C;  1Y66 A;  4JGS A;  1QR8 A; 
#chains in the Genus database with same CATH topology
 1G8M A;  4F6R A;  4LF4 O;  3L73 H;  2JJ2 G;  1Y74 B;  2CAZ C;  1R1B A;  3CRQ A;  4DYL A;  1RP3 B;  1M4U A;  4YIP A;  5E1A C;  3GVM A;  4JV5 O;  3E22 B;  4JYC A;  4AI8 A;  2A06 H;  3OW2 U;  3HPL C;  3BCC H;  1SA0 A;  2PI5 A;  2JEX A;  2ADQ B;  2FB5 A;  5LA6 A;  1YJW V;  1IBM B;  3T4D A;  2A7W A;  1UPG A;  2F43 G;  1FAF A;  1Y4M A;  3U10 A;  3T1H B;  2Q0A A;  3PJS K;  2BTO A;  4D6T H;  1DK1 A;  2BTQ B;  3D36 C;  3E22 A;  3IFX A;  1P7B A;  4QPK A;  2PGG A;  3E8F A;  5B1B B;  2P4V A;  1F23 A;  2ITD C;  3WB2 A;  2EIJ B;  2F93 B;  3TJT A;  3CEI A;  4AIL C;  2UUC O;  3P3N A;  2QEX V;  5EBL C;  4JPR A;  3ETG A;  3FYE B;  3D3Q A;  1M56 C;  5FL7 G;  5FNV A;  5GW7 A;  2Q5Z A;  1S3J A;  4BW5 A;  1BCC H;  1ZAU A;  4X88 A;  3CS5 A;  1NI8 A;  1P49 A;  4DR3 O;  4P2Z A;  3AG3 B;  3TET A;  2QKA A;  3RW0 A;  3C3T A;  2CTP A;  2EIN B;  1Y66 A;  2JGD B;  1TUE B;  3CSX A;  5LYJ B;  1VAR A;  1FXV A;  1XL6 A;  1QHT A;  3E35 A;  5KMG A;  1NVP B;  1EBO A;  1SQG A;  3AEI A;  2QJ1 A;  1KUQ A;  1W59 A;  3HKD B;  1OHH G;  3DGE A;  1FFX A;  4I4T A;  2HEP A;  1S0V A;  4UCR A;  4JI2 O;  3VBB A;  2UUC B;  5HFL A;  3AG4 C;  1UFI A;  4X66 B;  4JI7 O;  2M6Y A;  4O4H A;  4O4L A;  1I94 O;  5LMN O;  3K04 A;  2FKX A;  3UQ8 A;  1VQK V;  5LMU B;  2P7T C;  5BR8 O;  3TCU A;  4JI6 O;  4UVA A;  4ZKI A;  2PF4 E;  1K97 A;  2QSA A;  3ICX A;  1VF7 A;  1A32 A;  1CP9 A;  3LNM B;  1W0J G;  4WFF A;  4FIP C;  1V54 C;  4DV3 O;  2BCC H;  3AG2 B;  1OCZ B;  3FB5 C;  2DYR C;  2WLI B;  1WP8 A;  2KG7 A;  4F6E A;  4R7C A;  3CCM V;  2X0L A;  4YHH O;  2H94 A;  3ZBH A;  1HP8 A;  1RFY A;  1V55 B;  3J80 N;  3FAV B;  3ETE A;  2GUZ B;  1PNM A;  5KHG A;  3OT7 A;  3A8T A;  1O9G A;  4JI7 B;  3IJ4 A;  2WLI A;  4XDK A;  4MVU A;  5LMN B;  2ZM6 O;  1S76 D;  4PJ0 Z;  4RWU A;  1XI1 A;  2HHH O;  5CB4 A;  5KHJ A;  4DR2 B;  2D3O W;  1H2L A;  3UM7 A;  3C90 A;  4PEL A;  4X89 A;  2Y0I A;  2QM8 A;  1R3I C;  3ABL B;  1RPR A;  2ZR3 A;  1Q3E A;  2LW7 A;  3ZHR A;  5JVD B;  4QE7 A;  4ICG A;  5LL6 Y;  1MSD A;  1AJQ A;  4OPA A;  2WSS G;  5D5P A;  2WAM A;  4J7J A;  5ITZ A;  3T2M A;  2CTR A;  4DXW A;  3CRA A;  3KG2 A;  3CCS V;  1K5S A;  4DV1 O;  2DMX A;  1YZB A;  2IW5 A;  4QE9 A;  5JVD A;  1Q7Y W;  1N0N A;  2Y4U A;  1F4M A;  5TIS Z;  1SS3 A;  3CRC A;  2HHH B;  1PD3 A;  4IIJ A;  3B2E E;  5B1B C;  2IJI A;  4DV7 B;  2KKW A;  2EIJ C;  2EIL B;  1H2M A;  5H6Q A;  5LXT A;  2B1G A;  3APO A;  2A0L A;  5EZY A;  4MTX A;  1QVG U;  1GKF A;  2YI8 A;  1SQX H;  1BQ0 A;  2QWR B;  1SC5 B;  2GHY A;  1XBL A;  4O2B A;  3N2K A;  2OCC B;  2P5O A;  2YIB D;  4GUN A;  3AG3 C;  2CH7 A;  5IYB O;  1KQS U;  4U3J B;  1ZX3 A;  2EIN C;  2W6J G;  3MDS A;  4JI1 O;  1ROP A;  2ZIO A;  4YY3 B;  3TK1 A;  4JI0 O;  3K58 A;  3CRR A;  3ZHU A;  1K9M W;  1VQO V;  1I5X A;  2QWQ B;  2F23 A;  1IUR A;  1DF4 A;  3HKC B;  1AI7 A;  1MNG A;  1IDS A;  4U7O A;  4JI3 B;  1OJH A;  1N34 O;  1YHQ V;  3L9D A;  1Z5W A;  4U3F H;  4DR6 B;  3E8G A;  2VQF B;  1Q6U A;  4X62 B;  1VQ4 V;  3SYQ A;  3L75 H;  2XOK G;  1WJZ A;  2B5U A;  2AXT Z;  3B8M A;  3ZRV A;  2LGW A;  4DR1 B;  1ENV A;  5LHH A;  3DTU B;  4YJ3 B;  3G4S V;  1NTM H;  2EIM B;  2ZNJ A;  2XND G;  3L70 H;  5B66 Z;  4JI4 O;  4PI2 A;  3OTO O;  1PNK A;  3JAW B;  3I55 V;  5IT9 N;  3AG7 A;  2Y48 A;  5CN0 A;  2R72 A;  3H1J H;  3SYP A;  2CGN A;  4LFC O;  1MOF A;  4Z2W A;  4MW3 A;  3AG2 C;  2HVK C;  1OCZ C;  2ARH A;  4QIW F;  2ZKO A;  3EFF K;  5EIB C;  3K5L A;  2QA4 V;  3OUF A;  1KP2 A;  1ZUQ A;  4GCZ A;  3O65 A;  1FXK B;  4P9P A;  4PA6 A;  3RWR D;  4DV0 O;  5D5Q A;  4PDR A;  1N34 B;  1COW G;  3JAW A;  1V55 C;  1N32 B;  4JI5 O;  3D8C A;  2VQE O;  3WB0 A;  4TUY B;  4A5U B;  4K8X A;  2JS3 A;  2OIE A;  4KHP O;  2YEV A;  5L3E A;  2CDY A;  4LFA O;  1H2K A;  1N36 O;  5J9P C;  4C7U A;  3W7W A;  1I5Y A;  3ABK B;  2XHB A;  4OPH A;  2Q69 A;  4B3M O;  5KHK A;  3OTO B;  1BSM A;  2XAG A;  1VQL V;  2JS5 A;  3QVN A;  3FX7 A;  3L71 H;  4JI8 O;  5KAI Z;  2XT9 A;  4J80 A;  4IYH A;  1S5H C;  3ABL C;  5A9G A;  2XUM A;  2N04 A;  3H1L H;  3RYF A;  1HNZ O;  4L87 A;  3LDD A;  3B8N A;  5LGU A;  1Q86 W;  3AG1 B;  1R6N A;  4B08 A;  3D36 A;  3H1I H;  3K03 A;  4X9Q A;  4DV0 B;  3VQV A;  1NR7 A;  3AK2 A;  4DV5 O;  3KZI Z;  1JFF B;  1L0N H;  3BEH A;  2X6C A;  4PDL A;  4LF9 O;  1KKC A;  5B5E Z;  5JJN B;  4NXM B;  3W7S A;  1SZT A;  2DN9 A;  4MVR A;  4O4I B;  1GM9 A;  4HAM A;  5IJ0 B;  3BRC A;  1AR5 A;  4LF7 O;  2LFR A;  2R9A A;  1JFF A;  4IHJ B;  4L8J A;  1OCR B;  4KUM A;  2EIL C;  4PI0 A;  1PP9 H;  1D5N A;  4FFB A;  4FLT A;  4ZOL B;  2WWW A;  4O4J B;  5IYZ A;  3L72 H;  1TVK B;  4LWS A;  4CH5 A;  3CE2 A;  1N4C A;  3CCQ V;  5IJ0 A;  2LJ2 A;  2OCC C;  4TV9 A;  2YIC A;  3FB6 C;  4DV2 B;  4EKW A;  4B3T O;  3X2Q B;  2DYS B;  4ZOL A;  4OX9 O;  4LF9 B;  4ABM A;  2M7W A;  1TUB A;  4TWK A;  5KHH A;  5JJJ B;  2Z5U A;  3ZHT A;  1YSC A;  1RM1 B;  3LDE A;  5IYC O;  5CA0 B;  4N21 A;  5K1X A;  2EJ7 A;  4UV9 A;  5K1P A;  5GTI Z;  4TV8 A;  2BE3 A;  4B3S O;  1OZ0 A;  1R3L C;  4EFE A;  1XNR O;  1K8A W;  1MG1 A;  2LQT A;  3R66 A;  3LSS A;  2Q7G A;  2H3O A;  1Q81 W;  1YJN V;  3PN1 A;  3G71 V;  5KUM A;  1BS3 A;  3CP1 A;  2EIM C;  1E1R G;  5DED A;  4MSW C;  3F7V C;  1M93 A;  4WFH A;  1XRE A;  4OX9 B;  3ZIA G;  1F4N A;  4FMT A;  2IM9 A;  1YEW A;  4LC1 A;  3RN4 A;  1QVF U;  4LP8 A;  3B77 A;  1L0L H;  3CD6 V;  2ZE8 A;  4UXN A;  5KX5 B;  3W7T A;  1FXK C;  5EBM C;  4UCV A;  2GTA A;  1WA8 B;  2HLD G;  1W0K G;  2JJ1 G;  4PA4 A;  3TXS A;  5JQG A;  1J5E O;  1CPY A;  4FLZ A;  4UVB A;  3JAT A;  4YJ2 A;  5JWP A;  4B3S B;  5JCO A;  3DXR B;  5LGN A;  4FLW A;  4UCU A;  1P84 F;  1H8E G;  1Y74 A;  4DR7 O;  2IH3 C;  4FLU A;  4X20 B;  2ZE5 A;  3ZN0 A;  3ABK C;  1W2B U;  3LSU A;  2Q4P A;  3JCZ A;  1ZWI C;  5EK0 A;  2ZDI A;  3BVO A;  4QGP A;  2B9Z A;  3ZHS A;  4XBF A;  1XOU A;  4YXW G;  2RMK B;  4LF6 B;  1JMK C;  2P90 A;  3GWO A;  4LF4 B;  2HP8 A;  3AG1 C;  2BTQ A;  4DK0 A;  4JV5 B;  4BIZ A;  1SES A;  1Q5O A;  1ZLZ A;  5JH7 B;  3STL C;  3A0B Z;  1TAE A;  1BQZ A;  1IBK O;  2NN4 A;  3K79 A;  3VQX A;  4Z1M G;  4KL1 A;  4JYB A;  1OCC B;  3K0D A;  1K5Q A;  2YID A;  1JCH A;  1LUV A;  4MVO A;  3G67 A;  1J95 A;  3CC2 V;  2B1I A;  4I55 B;  2ZT9 B;  2CGO A;  1Q6I A;  1KBH A;  5AG2 A;  1KD1 W;  3R65 A;  3QNE A;  3CJH B;  1H38 A;  5JH7 A;  2YXY A;  1U97 A;  5BZB A;  5IE9 A;  1OCR C;  1NU1 H;  3ABT A;  1M5I A;  1Y76 B;  2CE4 A;  2LFS A;  3SPG A;  2JDI G;  2P67 A;  1FJG O;  2JGD A;  1XDC A;  1MSW D;  4PDM A;  4LH6 A;  5LYJ A;  3KCY A;  4E4E A;  1YVW A;  2FML A;  3K59 A;  5HFM A;  5L3G A;  1NZ6 A;  4FLY A;  3RGB A;  1AB3 A;  1I08 A;  3HKD A;  4JYA O;  1K34 A;  4H37 A;  5KHI A;  1GRJ A;  1ZTE A;  4DR3 B;  1QR8 A;  3X2Q C;  1WNS A;  1KP3 A;  2DYS C;  4ZIB A;  2PTM A;  3HR0 A;  4GKJ O;  1HNW O;  3K57 A;  1QLE B;  1AI5 A;  2E74 B;  3SJQ C;  2F95 B;  2Q6A A;  4RAI A;  3GB7 C;  3VOU A;  3WU2 Z;  2UU9 O;  4I5S A;  4TQF A;  2DQ3 A;  3EVK A;  2JK5 C;  2GV9 A;  3APQ A;  4JAA A;  4Z1V A;  3ZJZ A;  1Q6H A;  4LR3 A;  5LHI A;  1AJP A;  1KYO F;  1HW7 A;  1GM8 A;  3VQW A;  3W7U A;  3ZMT A;  4BIU A;  2L35 A;  4RO2 A;  4GX2 A;  1JJ2 U;  4JI2 B;  1EZJ A;  1VF6 C;  1FJG B;  1X59 A;  4ZHQ B;  3EHB B;  5CMU A;  3CCL V;  3MD0 A;  3T1C A;  4DV6 O;  1XL4 A;  1FD9 A;  4UUJ C;  4JF3 A;  4ZBM A;  1JOY A;  3BFR A;  2R70 A;  4J7K A;  5EC2 C;  1RSO B;  1I94 B;  4UB8 Z;  1ZL8 B;  5LOV B;  4JYA B;  3JD1 A;  2HFE C;  3HKE B;  5BR8 B;  4JI6 B;  4PD4 F;  2X6B A;  3FAV A;  1OCO B;  4G2K A;  2R9I A;  1NS1 A;  2Y69 B;  2K1E A;  5JCO C;  1S77 D;  4HNA B;  2GUZ A;  4F4L A;  1FKA O;  3B40 A;  1ARO P;  2VS0 A;  4DV3 B;  3SPI A;  3HKB B;  1BMF G;  4CH3 A;  1ZL8 A;  3ZMZ A;  3OR7 C;  2UXD O;  5LOV A;  1E1Q G;  4WFB V;  1B04 A;  1NT2 B;  2QWP B;  1Z2G A;  2NLJ C;  2HJF C;  4YHH B;  4MVS A;  2ZDI C;  4DW1 A;  4OGQ B;  3W7X A;  2DJV A;  2UXC O;  2ZIN A;  5BXZ A;  5CA1 B;  2Q0O C;  1MA1 A;  2QGN A;  4JTA B;  1US6 A;  1WB8 A;  3DSQ A;  1KEC A;  1PM9 A;  4IGG A;  5KLV H;  5L3B A;  2ZM6 B;  2AZ0 A;  5IY5 B;  2ZIM A;  4I9W A;  3ZHQ A;  1VQ5 V;  1GM7 A;  5IJ9 B;  3WB1 A;  3ETQ A;  4X1I B;  4NTY A;  1AR1 B;  1K7D A;  2ZE7 A;  1HR0 O;  3RFR A;  2N05 A;  1LR1 A;  3ABM B;  1KB9 F;  5FLX N;  4MTF A;  1M1K W;  3KCX A;  3B09 A;  3SPJ A;  3JYC A;  2JIZ G;  3UCS C;  2E5L O;  2H8P C;  3QO8 A;  2UXD B;  2PY5 A;  4EFB A;  1QBZ A;  5IJ9 A;  4O2A B;  3JAM N;  4UCT A;  4LF5 O;  1FXH A;  1K3E A;  2UXC B;  3OM3 B;  3LSQ A;  4WF9 V;  1OCC C;  2ZXW B;  1NQT A;  2DW4 A;  2PI4 A;  2AHY A;  1THZ A;  4JAV A;  2F4V O;  4DV1 B;  2OTL V;  3SYC A;  2WLL B;  3OEE G;  4X1Y B;  2EJR A;  2XAH A;  4K0K O;  2X7R B;  3UKM A;  3ZRX A;  2AW9 A;  4U3J A;  3ZHV A;  4DW0 A;  5EYP B;  3K0G A;  2OIG A;  1DF5 A;  1Y6X A;  3CMA V;  3FYI B;  1D5A A;  2GSM B;  4WFA V;  1BE3 H;  1HR0 B;  2AHZ A;  3CPW U;  2QKC A;  3CHX A;  1N0J A;  4LFB O;  4B7K A;  4Q6G A;  2W0X A;  4MTO A;  4N23 A;  1S72 V;  2BOC C;  5KA6 A;  3HKC A;  4X1Y A;  4KXR A;  1N33 O;  4UB6 Z;  4PHZ A;  2UUA O;  1Q43 A;  3SPH A;  3JSN A;  3HB3 B;  3K5M A;  1IXB A;  5J2U B;  2XAJ A;  2YUA A;  4H33 A;  1QLE C;  2ZQM A;  4J10 A;  4JI1 B;  4BW9 A;  1XHX A;  1IVS A;  3FD9 A;  4JI0 B;  4PV1 B;  3O9O A;  3ZX6 A;  3OEH G;  4YJ3 A;  4K8Z A;  4QNH B;  2CTW A;  4TQD A;  1ORQ C;  1SRY A;  4QJF B;  3K9A A;  2QKS A;  2YXH A;  3NR7 A;  2F1M A;  4I0X B;  4WBN B;  3CCE V;  2FL4 A;  2EUL A;  2JRI A;  1FXK A;  1N33 B;  2UUA B;  1B3Q A;  2RDC A;  3S3X A;  2ILM A;  5L3D A;  4JI4 B;  3E83 A;  1RPO A;  1OCO C;  3SDL A;  2Y69 C;  3BA9 A;  3OR6 C;  5DEC A;  2UXB O;  3CYO A;  4TUY A;  1NTZ H;  4LFC B;  2IU0 A;  4X8A A;  1AP5 A;  3WFV A;  3FFQ A;  1VQ6 V;  2FYU H;  2HG5 C;  3RYI B;  4JAU A;  1VQ7 V;  3Q4H B;  1Q8I A;  2A9H A;  3OD4 A;  1B6Q A;  5LBQ A;  1XHZ A;  4P30 A;  3CME V;  2MK3 A;  4HZ3 A;  3IC7 A;  4MVZ A;  4OXS A;  4LF8 O;  4UCO A;  2Z3Y A;  4YIO A;  3OAA G;  4JZG A;  2DQ0 A;  4GKK O;  3P32 A;  4JI5 B;  2VQE B;  1KMI Z;  1YDX A;  1B06 A;  3G80 A;  2OTJ V;  3RYI A;  3Q4H A;  1XMO O;  3J7A U;  4KHP B;  1TA8 A;  1IX9 A;  2WA4 A;  4DR5 O;  2A3Q A;  4NYK A;  5J2T B;  4LFA B;  1AI4 A;  1LUW A;  5C8Y B;  5H5N A;  1N36 B;  1BGY H;  5IY5 C;  2V4D A;  4RUE A;  2NR5 A;  5B1A B;  2WLK A;  1NTK H;  3CWB H;  4B3M B;  3JAK B;  1OV9 A;  4LNU B;  4DUY O;  4CS2 A;  4QPJ A;  2PZS A;  2QM4 A;  1HNX O;  3BAB A;  4JI8 B;  3ABM C;  3FKS G;  2WLH A;  2PYJ A;  1Q82 W;  3BHP A;  1SQF A;  5IDJ A;  2HJD A;  4O4I A;  2DWD C;  1HNZ B;  4NKG B;  1GN2 A;  1K4C C;  3H1H H;  4LH7 A;  1QLN A;  5LGT A;  4IL6 Z;  2YIB A;  5EC1 C;  4J7Z A;  4IHJ A;  3JAK A;  4DV5 B;  1XIL A;  2EZO A;  5DM6 V;  1M57 B;  1SQQ H;  2LGQ A;  3T1Y O;  3STZ C;  4O4J A;  3UT5 B;  2EBO A;  1G1X B;  2Z0A A;  5GON B;  1TVK A;  2ZXW C;  1QCE A;  3FB8 C;  1XMO B;  2ZCE A;  1EM1 A;  4DR5 B;  4X1K B;  1JX9 A;  2Y4T A;  1GO3 F;  5JJE B;  2Q7H A;  4ZI7 B;  4LF7 B;  4FLX A;  5H6R A;  4DRX B;  3SJC C;  4ASU G;  3MAQ A;  4DUY B;  1YCI A;  3M99 B;  2EX3 A;  1BHA A;  3UT5 A;  2CK3 G;  5GON A;  3JD0 A;  3FB7 C;  4MTG A;  4FZ1 A;  3CCV V;  2BSK B;  1DGS A;  5KAF Z;  2RNB A;  4X1K A;  1QR9 A;  4NVP A;  5CA0 A;  3RYH B;  2QTS A;  2V1D A;  3ZMU A;  4ZI7 A;  1SZX A;  1IBM O;  4B3T B;  1VF6 A;  2QTO A;  1E79 G;  2AZ2 A;  3F7Y C;  4R50 A;  2BSK A;  2QDO A;  2YI9 A;  3T1H O;  2G38 A;  5EBW C;  4F6R B;  2WLJ A;  3BA8 A;  2EZP A;  1VIB A;  1VQP V;  3BPZ A;  3RYH A;  2Q73 A;  5H2F Z;  1FPO A;  2UUB O;  3CCR V;  4MS2 A;  3D3I A;  3F5W C;  3GWK C;  1BHB A;  1JQ0 A;  4MW8 A;  4FPP A;  1SA0 B;  1IZ3 A;  1JJO A;  5LA6 B;  3K5N A;  2XAF A;  4TSF G;  1XNR B;  3CRM A;  4JTC B;  1JVM A;  3JAR B;  4PA3 A;  1R3K C;  2YXL A;  2QE7 G;  3CB2 A;  2JEU A;  5KX5 A;  4CH4 A;  1K33 A;  1YF2 A;  2KB1 A;  5E79 Z;  3U11 A;  1R6K A;  1WA8 A;  1IBL O;  4CH6 A;  1G6U A;  1K4D C;  1WB7 A;  1FYJ A;  1VQ8 V;  3DXR A;  1URF A;  2GBO A;  3JAR A;  4J9Y B;  4PA7 A;  5FNV B;  2RCV A;  4H0L B;  4BAY A;  2GTS A;  4CS4 A;  3QF7 A;  2P4K A;  1AR4 A;  2RN9 A;  4UCS A;  1VQN V;  2P6J A;  4X20 A;  3K06 A;  5CBF A;  3K5O A;  5LHG A;  2X6A A;  2UUB B;  4DK1 A;  2XAS A;  3CC7 V;  1NH2 D;  2AGA A;  1J5E B;  4DV4 O;  3ASN B;  3SYA A;  2Q8V A;  3JSL A;  1SQB H;  4J9Z B;  3DC5 A;  1R73 A;  4JGS A;  1M90 W;  4X66 O;  1WPB A;  4NTW A;  3U0Z A;  4TOI A;  2V7Q G;  1D2D A;  5KMG B;  2LO1 A;  1U96 A;  3JD3 A;  5LMU O;  3M8A A;  3C3S A;  4DR7 B;  4I7Z B;  1FFX B;  5H9C A;  3ABU A;  4I4T B;  1V9P A;  5B1A C;  4E2L A;  3A0R A;  1IBL B;  4P9O A;  3JCU Z;  3BY6 A;  3ZN1 A;  1P7G A;  3S3W A;  4RQE A;  2P06 A;  3ETD A;  4O4H B;  4O4L B;  1AI6 A;  2Q68 A;  4K3A A;  5IWA O;  4I55 A;  2RJZ A;  4DUZ O;  1H2N A;  4UFZ A;  3CJH A;  5L3C A;  5B1N A;  4WCE V;  2JVD A;  1M57 C;  1Q90 D;  4DV4 B;  3E86 A;  2DWE C;  1KU9 A;  1Y76 A;  3ML0 A;  2HVJ C;  5BY1 A;  4UVC A;  1IBK B;  3J81 N;  1I7F A;  3OTF A;  1XMQ O;  2XAQ A;  1QQC A;  4WFG A;  5B3S B;  5C93 A;  1KKD A;  1KC8 W;  2ODM A;  2QWN B;  1RM1 C;  2DE0 X;  2KG7 B;  3OE7 G;  4DR2 O;  3P3P A;  3CXC U;  4IT5 A;  5IYD O;  3N2G B;  2Q9L A;  1Z5V A;  1XEQ A;  1FS0 G;  4AQY O;  3AK3 A;  4CS3 A;  4CC5 A;  4FLV A;  4MT8 A;  1YI2 V;  4MVM A;  2EIK B;  5IWA B;  4X64 O;  4DO2 A;  3SR2 C;  4DUZ B;  2IJK A;  2YSU B;  5CB4 B;  2QM7 A;  3K3W A;  3N2G A;  3H01 A;  2LW1 A;  1N8R W;  2Q67 A;  3H9V A;  4NTX A;  4Q20 A;  2D2C B;  4GKJ B;  5BMV B;  1BT8 A;  5LP6 B;  1HNW B;  4ZHQ A;  2CUG A;  4BWA A;  1XMQ B;  4LBE C;  4H44 B;  3RVZ A;  5CBG A;  2UU9 B;  4G27 B;  2WLM A;  1RSO A;  3OGC C;  4DV7 O;  4X65 O;  5KUK A;  2E3C A;  3H1K H;  1BL8 A;  3HKE A;  3EXA A;  5CBH A;  4U7N A;  1K92 A;  2Y0P A;  5ITZ B;  5BMV A;  5LP6 A;  4HNA A;  2ITC C;  1BZK A;  1VMG A;  4AQY B;  3KKY A;  1QNM A;  4G28 B;  3RBZ A;  3I5D A;  2WLN A;  3OMI B;  1EN4 A;  3HKB A;  3WG7 B;  4DV6 B;  1JR9 A;  4HBN A;  5B1O A;  1GN6 A;  4X64 B;  4KP4 A;  4IIJ B;  1NH2 B;  1EN5 A;  3E8B A;  2WA3 A;  4YY3 O;  1WPX A;  3ASO B;  5LXT B;  4XDL A;  1HDJ A;  2VWK A;  5EZY B;  4FM2 A;  5CA1 A;  1PV0 A;  3T4Z A;  2PYL A;  3TGU H;  5KA5 A;  4JI3 O;  4O2B B;  3N2K B;  2W0F C;  4X65 B;  3THO A;  4DR6 O;  2XTA A;  2VRZ A;  2CH7 B;  2VQF O;  4X62 O;  3ASN C;  3K9S A;  3JAS B;  4X1I A;  2HR3 A;  2YDE A;  5FPO A;  4NXN O;  1UJW B;  4DR1 O;  2E76 B;  1GH6 A;  3E89 A;  4CBC A;  4FJC C;  1EN6 A;  3SJB C;  3RYC B;  3SPC A;  2BOB C;  2LP7 A;  4K35 A;  4XDJ A;  1SQV H;  2QWO B;  4O2A A;  3JAS A;  4EB6 B;  3E8H A;  4FVM A;  4H13 B;  1YJ9 V;  1WN7 A;  3RT3 C;  3JD2 A;  1ZSP A;  1XNQ O;  3ZMV A;  2YC0 A;  1EZV H;  1S5J A;  2R9R B;  3ZMS A;  4AHC A;  1H2S B;  3QTC A;  1Y67 A;  3RYC A;  1NKD A;  2W6I G;  2WLL A;  2E5L B;  5DN6 G;  1N32 O;  4NR1 A;  2VWJ A;  4EB6 A;  1M9N A;  3M7M X;  2ZR2 A;  3BAA A;  2P22 C;  5EYP A;  3ZRW B;  1NBM G;  2O57 A;  3MHH C;  4PA9 A;  4LF5 B;  4LCU C;  2F66 C;  1QU7 A;  3K08 A;  3A0H Z;  1MZE A;  2ATK C;  4NXN B;  5B3S C;  3IGA C;  1YTF D;  1GMG A;  1DLB A;  3ZCC A;  2F4V B;  2YIA A;  2IH1 C;  1EFR G;  1T5E A;  4RUF A;  3JD4 A;  4I50 B;  3IC9 A;  4K0K B;  5J2U A;  4FM0 A;  3ZRW A;  5A2Q N;  5FPR A;  4PDV A;  1XNQ B;  2GDS A;  2KSD A;  1XQ8 A;  4GX5 A;  2YEV B;  3OFN G;  2DOS A;  4LFB B;  4TT3 G;  2FTK A;  1CXZ B;  2ZE6 A;  2EIK C;  3LDC A;  3SGI A;  3UO2 A;  1HWY A;  2C2A A;  4GX0 A;  4UV8 A;  1VEW A;  4I50 A;  2A79 B;  4R8C A;  1X4T A;  2Q7E A;  4I9Q A;  1GN3 A;  3OUS A;  3IAY A;  1PL4 A;  2IU3 A;  4NXM O;  5LP6 C;  2E75 B;  4BR6 A;  3UO3 A;  4I0X A;  3G6B A;  4BIO A;  4WBN A;  5GTH Z;  3RYF B;  4B7E A;  1CEZ A;  1R3J C;  4RQF A;  3CC4 V;  2KQX A;  3ZED A;  3F5T A;  4JAS A;  3RVY A;  1SKV A;  3CXH F;  2K9P A;  1LNQ A;  4JTD B;  3OMN B;  4IYI A;  2NNU A;  1XUQ A;  1VP7 A;  3P30 A;  1PNL A;  1M56 B;  2ETN A;  1VQ9 V;  3WG7 C;  1SF9 A;  1PKX A;  4DV2 O;  1L1F A;  1MAB G;  4B3R O;  1WLE A;  4FZ0 A;  3CCJ V;  4HYO A;  1GK9 A;  2WPD G;  3ASO C;  3AK1 A;  4FFB B;  2IBZ H;  3E2E A;  3A2F A;  1GTO A;  5IYZ B;  2OYQ A;  3DC6 A;  3QO5 A;  1YIT V;  2UXB B;  2YS8 A;  4LWS B;  1WP7 A;  4FM1 A;  1TGO A;  1NJI W;  1F51 A;  2N74 A;  1PPJ H;  1SET A;  5J2T A;  1AIL A;  4TV9 B;  5C8Y A;  2UXX A;  1VF5 B;  2RQ6 A;  4J11 A;  1S5L Z;  2OCH A;  4J41 A;  3CX5 F;  3OGI B;  1IXM A;  4LNU A;  4LF8 B;  3ZRS A;  1K73 W;  4J42 A;  5L3F A;  3LUT B;  3AG4 B;  3SJA C;  1YXB A;  4GKK B;  1TUB B;  2ZD9 A;  4DR4 O;  5F2V O;  1NVP D;  1G4Y B;  4NB5 A;  1SER A;  1VQM V;  1MMM A;  3MHS C;  1WAZ A;  4TV8 B;  3G6E V;  4B3R B;  1AVM A;  1L8D A;  3QG5 A;  4D7S A;  1NR1 A;  4CZZ A;  4WFE A;  4GX1 A;  3I56 V;  4GZR B;  1O9H A;  1HNX B;  4MVQ A;  2CTQ A;  2HKO A;  1V54 B;  1H8H G;  1GN4 A;  1P4R A;  3NXS A;  3L74 H;  4GYC B;  2JGU A;  3N27 A;  1YTF B;  4W4L A;  3QO7 A;  5CA3 A;  1JA8 A;  2DYR B;  1H2G A;  2L6L A;  3TXQ A;  2OWO A;  1SQP H;  4W4K A;  3VQY A;  4GLX A;  1F7Y A;  4EEQ A;  3JAL B;  2UXN A;  3B4S A;  3CCU V;  4FFK A;  4DRX A;  3SYO A;  2PUS A;  2ZNI A;  3LNN A;  3T1Y B;  4R6Z A;  2MW2 B;  2OT5 A;  4JZ2 A;  4KFM A;  2ADP A;  4DR4 B;  1AJN A;  2IJJ A;  1AP6 A;  5EIB D;  3OMA B;  1I0H A;  2QR4 A;  3ZS8 C;  4GT1 A;  1DTO A;  1R6T A;  3JAL A;  4CC6 A;  5JQG B;  1JPX A;  2IJH A;  3JAT B;  4YJ2 B;  4FK5 C;  1MZF A;  1YIJ V;  4JYY A;  1FFT B;  4LF6 O;  1GAX A;  1PL0 A;  4D7T A; 
#chains in the Genus database with same CATH homology
 3CXC U;  2ZXW B;  3BEH A;  1G8M A;  1NQT A;  2DW4 A;  2PI4 A;  2AHY A;  2X6C A;  5IYD O;  2JJ2 G;  1THZ A;  4JAV A;  4PDL A;  2OTL V;  3SYC A;  5E1A C;  1FS0 G;  2WLL B;  3OEE G;  4JYC A;  2EJR A;  2XAH A;  2X7R B;  3W7S A;  1SZT A;  3UKM A;  3ZRX A;  3OW2 U;  4MVR A;  4MT8 A;  3HPL C;  1GM9 A;  1YI2 V;  4HAM A;  2PI5 A;  3K0G A;  2JEX A;  4MVM A;  1DF5 A;  2EIK B;  3CMA V;  1YJW V;  3FYI B;  2GSM B;  3T4D A;  4DO2 A;  4WFA V;  2F43 G;  2AHZ A;  2LFR A;  3CPW U;  2IJK A;  2YSU B;  2QM7 A;  3K3W A;  1OCR B;  1Y4M A;  3H01 A;  4KUM A;  1N8R W;  2EIL C;  2Q67 A;  4MTO A;  3PJS K;  4N23 A;  1S72 V;  2BOC C;  2WWW A;  5KA6 A;  4Q20 A;  3IFX A;  1P7B A;  4QPK A;  3E8F A;  3SPH A;  5B1B B;  3HB3 B;  1F23 A;  2ITD C;  2EIJ B;  4LBE C;  3RVZ A;  3CCQ V;  2XAJ A;  5CBG A;  4G27 B;  2WLM A;  2QEX V;  3OGC C;  4H33 A;  2OCC C;  5EBL C;  4JPR A;  1QLE C;  2ZQM A;  3ETG A;  3FYE B;  5KUK A;  3FB6 C;  1BL8 A;  1M56 C;  5FL7 G;  5CBH A;  4EKW A;  4U7N A;  5GW7 A;  3X2Q B;  3OEH G;  1K92 A;  2DYS B;  1S3J A;  4BW5 A;  4X88 A;  2ITC C;  4QNH B;  2M7W A;  4TWK A;  4P2Z A;  4G28 B;  3AG3 B;  3RBZ A;  2Z5U A;  2WLN A;  3TET A;  1YSC A;  3OMI B;  3RW0 A;  1ORQ C;  1SRY A;  2EIN B;  1Y66 A;  3LDE A;  3WG7 B;  4QJF B;  1RM1 B;  5IYC O;  3K9A A;  5B1O A;  4N21 A;  2QKS A;  4UV9 A;  4KP4 A;  1TUE B;  1NH2 B;  3E8B A;  3CCE V;  1FXV A;  1XL6 A;  3E35 A;  1NVP B;  1EBO A;  1OZ0 A;  1R3L C;  1WPX A;  3ASO B;  3AEI A;  1K8A W;  4XDL A;  1MG1 A;  1FXK A;  3LSS A;  1OHH G;  3DGE A;  1S0V A;  5L3D A;  1Q81 W;  3T4Z A;  1YJN V;  3G71 V;  3E83 A;  5KA5 A;  1RPO A;  1OCO C;  5KUM A;  3VBB A;  2Y69 C;  5HFL A;  3OR6 C;  3AG4 C;  3CP1 A;  2EIM C;  3CYO A;  2W0F C;  1E1R G;  2IU0 A;  4X8A A;  3WFV A;  1VQ6 V;  2HG5 C;  3ASN C;  4JAU A;  4MSW C;  3F7V C;  1VQ7 V;  4WFH A;  3K04 A;  1VQK V;  2A9H A;  3ZIA G;  1F4N A;  4FMT A;  1B6Q A;  5LBQ A;  2P7T C;  3TCU A;  2HR3 A;  4LC1 A;  4P30 A;  2MK3 A;  4UVA A;  3CME V;  4HZ3 A;  3IC7 A;  1UJW B;  4MVZ A;  4ZKI A;  4OXS A;  1K97 A;  1QVF U;  4LP8 A;  3B77 A;  3E89 A;  2Z3Y A;  3CD6 V;  4UXN A;  1CP9 A;  3OAA G;  4CBC A;  2DQ0 A;  3LNM B;  4FJC C;  1W0J G;  3W7T A;  1FXK C;  5EBM C;  4WFF A;  4FIP C;  3P32 A;  3SPC A;  2JJ1 G;  2HLD G;  1W0K G;  2BOB C;  1V54 C;  2LP7 A;  4PA4 A;  4XDJ A;  2OTJ V;  3AG2 B;  1CPY A;  4UVB A;  1OCZ B;  3E8H A;  3FB5 C;  1YJ9 V;  2DYR C;  3JD2 A;  2WLI B;  1AI4 A;  3ZMV A;  5LGN A;  4R7C A;  3CCM V;  2X0L A;  5IY5 C;  2R9R B;  3ZMS A;  2H94 A;  4RUE A;  5B1A B;  2WLK A;  1V55 B;  1H8E G;  2IH3 C;  4QPJ A;  3ETE A;  1NKD A;  2W6I G;  3ZN0 A;  1PNM A;  2WLL A;  3ABM C;  3FKS G;  3ABK C;  1W2B U;  2WLH A;  5DN6 G;  1Q82 W;  1M9N A;  5IDJ A;  3JCZ A;  1ZWI C;  5EK0 A;  2DWD C;  2ZDI A;  2ZR2 A;  2WLI A;  4XDK A;  4MVU A;  3ZRW B;  1NBM G;  3MHH C;  1K4C C;  4PA9 A;  1QLN A;  1S76 D;  4XBF A;  4LCU C;  5LGT A;  3K08 A;  4YXW G;  5EC1 C;  2ATK C;  2D3O W;  5B3S C;  3IGA C;  2EZO A;  2P90 A;  5DM6 V;  1M57 B;  1YTF D;  3UM7 A;  1GMG A;  3GWO A;  3AG1 C;  4PEL A;  1DLB A;  4X89 A;  3STZ C;  3ZCC A;  2IH1 C;  1EFR G;  2EBO A;  2QM8 A;  4RUF A;  1R3I C;  3JD4 A;  3ABL B;  1RPR A;  4BIZ A;  2ZXW C;  1SES A;  2ZR3 A;  3STL C;  1QCE A;  3FB8 C;  3ZRW A;  4PDV A;  4QE7 A;  3K79 A;  1JX9 A;  4Z1M G;  1GO3 F;  4GX5 A;  2YEV B;  4JYB A;  1OCC B;  1AJQ A;  3K0D A;  3OFN G;  1K5Q A;  5H6R A;  2WSS G;  2WAM A;  1JCH A;  4MVO A;  4TT3 G;  4ASU G;  2FTK A;  1J95 A;  3M99 B;  3LDC A;  2B1I A;  2EIK C;  3CC2 V;  3T2M A;  1BHA A;  2CK3 G;  1HWY A;  4DXW A;  2C2A A;  3JD0 A;  4GX0 A;  3FB7 C;  4UV8 A;  1KD1 W;  3R65 A;  3KG2 A;  3QNE A;  2A79 B;  4R8C A;  1H38 A;  3CCS V;  1K5S A;  4MTG A;  5BZB A;  3CCV V;  1OCR C;  2IW5 A;  4QE9 A;  3ABT A;  1Q7Y W;  3OUS A;  2LFS A;  3SPG A;  2IU3 A;  2JDI G;  2P67 A;  1QR9 A;  1F4M A;  1MSW D;  4PDM A;  2V1D A;  3ZMU A;  1PD3 A;  5B1B C;  2IJI A;  2EIJ C;  1CEZ A;  1R3J C;  2EIL B;  4RQF A;  5HFM A;  5H6Q A;  5L3G A;  2B1G A;  3CC4 V;  2QTO A;  1E79 G;  1K34 A;  2A0L A;  4H37 A;  3F7Y C;  4R50 A;  4MTX A;  4JAS A;  3RVY A;  5EBW C;  1QR8 A;  2WLJ A;  3X2Q C;  1QVG U;  1KP3 A;  1GKF A;  2DYS C;  2EZP A;  2GHY A;  1VQP V;  1LNQ A;  4JTD B;  2OCC B;  3OMN B;  1QLE B;  1AI5 A;  3SJQ C;  2Q6A A;  2NNU A;  4RAI A;  3CCR V;  4MS2 A;  3D3I A;  3F5W C;  3AG3 C;  3P30 A;  1PNL A;  3GB7 C;  1BHB A;  1M56 B;  1JQ0 A;  3VOU A;  5IYB O;  4MW8 A;  4FPP A;  1KQS U;  4I5S A;  1VQ9 V;  2DQ3 A;  2EIN C;  3WG7 C;  2JK5 C;  2W6J G;  1PKX A;  2XAF A;  1ROP A;  4TSF G;  3TK1 A;  4JTC B;  3ZJZ A;  1L1F A;  1MAB G;  1JVM A;  1K9M W;  4PA3 A;  5LHI A;  1WLE A;  1VQO V;  1AJP A;  1I5X A;  1GM8 A;  1R3K C;  3CCJ V;  3W7U A;  2QE7 G;  1GK9 A;  4HYO A;  2WPD G;  3ZMT A;  3ASO C;  4BIU A;  2JEU A;  3E2E A;  1DF4 A;  1GTO A;  4GX2 A;  4RO2 A;  1AI7 A;  1EZJ A;  1JJ2 U;  1K33 A;  4U7O A;  3QO5 A;  2KB1 A;  3EHB B;  5CMU A;  1YIT V;  3CCL V;  1YHQ V;  1R6K A;  3MD0 A;  3T1C A;  1XL4 A;  4UUJ C;  4JF3 A;  1K4D C;  4ZBM A;  1NJI W;  1F51 A;  1JOY A;  3E8G A;  1VQ8 V;  5EC2 C;  1SET A;  3SYQ A;  1VQ4 V;  2UXX A;  2XOK G;  3JD1 A;  2B5U A;  2HFE C;  4J9Y B;  3B8M A;  4PA7 A;  4BAY A;  3ZRV A;  2X6B A;  1IXM A;  1ENV A;  1OCO B;  4G2K A;  5LHH A;  3ZRS A;  2R9I A;  3DTU B;  1K73 W;  2Y69 B;  5L3F A;  2K1E A;  1VQN V;  3LUT B;  3G4S V;  2P6J A;  3AG4 B;  3K06 A;  5CBF A;  1S77 D;  2EIM B;  2XND G;  4F4L A;  2ZD9 A;  5LHG A;  2X6A A;  1ARO P;  2XAS A;  3CC7 V;  1PNK A;  1NH2 D;  3I55 V;  3ASN B;  1NVP D;  2Y48 A;  3SPI A;  3SYA A;  1BMF G;  1G4Y B;  4J9Z B;  5CN0 A;  3ZMZ A;  3OR7 C;  1SER A;  1VQM V;  1R73 A;  4JGS A;  3SYP A;  3MHS C;  1M90 W;  1MOF A;  1E1Q G;  4WFB V;  3G6E V;  2V7Q G;  4MW3 A;  3AG2 C;  2HVK C;  1OCZ C;  2NLJ C;  2HJF C;  3EFF K;  4QIW F;  1NR1 A;  2QA4 V;  3JD3 A;  4CZZ A;  4MVS A;  2ZDI C;  3OUF A;  1KP2 A;  4WFE A;  4GCZ A;  4GX1 A;  4P9P A;  1FXK B;  3W7X A;  3I56 V;  4PA6 A;  5H9C A;  4PDR A;  3ABU A;  4MVQ A;  2HKO A;  1COW G;  1V54 B;  1H8H G;  1P4R A;  3NXS A;  5B1A C;  4E2L A;  1V55 C;  3A0R A;  4JTA B;  4P9O A;  1YTF B;  1KEC A;  3QO7 A;  3BY6 A;  3ZN1 A;  5CA3 A;  2DYR B;  1H2G A;  5L3B A;  4RQE A;  5IY5 B;  2YEV A;  4I9W A;  2UXN A;  3ETD A;  5L3E A;  3CCU V;  1VQ5 V;  1GM7 A;  3SYO A;  1AI6 A;  2Q68 A;  5J9P C;  1AR1 B;  1K7D A;  4R6Z A;  3W7W A;  3ABM B;  2OT5 A;  1I5Y A;  3ABK B;  4KFM A;  4MTF A;  2Q69 A;  5L3C A;  5B1N A;  1AJN A;  2IJJ A;  3SPJ A;  4WCE V;  1M1K W;  3JYC A;  1M57 C;  2JIZ G;  2XAG A;  3E86 A;  1VQL V;  2DWE C;  3OMA B;  3ML0 A;  2HVJ C;  4GT1 A;  2H8P C;  3QO8 A;  4UVC A;  1DTO A;  1S5H C;  1JPX A;  3ABL C;  1QBZ A;  2XAQ A;  4WFG A;  5B3S B;  2IJH A;  5C93 A;  1KKD A;  4L87 A;  3LDD A;  1KC8 W;  4FK5 C;  3B8N A;  5LGU A;  1Q86 W;  3AG1 B;  1RM1 C;  1R6N A;  1FXH A;  3D36 A;  1YIJ V;  3OE7 G;  1K3E A;  3K03 A;  1FFT B;  1NR7 A;  3OM3 B;  3LSQ A;  4WF9 V;  1PL0 A;  1OCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...