1DF5A

Interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
publication title Interactions between HIV-1 gp41 core and detergents and their implications for membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 24
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1df5A00
5HFMA 3MHHC 4JF3A 4N21A 2MK3A 1DF4A 2P6JA 5KA6A 5HFLA 5CN0A 3B8MA 1Y4MA 1K34A 2EZPA 3CP1A 1QR8A 4FIPC 3WFVA 2EBOA 1QR9A 3B8NA 3P30A 4JPRA 1QBZA 2LP7A 1JPXA 4N23A 1F23A 5KA5A 3K9AA 3MHSC 2X7RB 1DF5A 5CMUA 2EZOA 1SZTA 4FJCC 1EBOA 4JGSA 4E2LA 2M7WA 3M99B 3GWOA 1QCEA 5H9CA 4G2KA 1ENVA 1JQ0A 3CYOA 3H01A 1DLBA 2OT5A 3B77A 1Y66A 1K33A 1I5XA 1I5YA 1MG1A 1MOFA 4FK5C
chains in the Genus database with same CATH superfamily
4N21A 2P6JA 3FB7C 1VQ4V 2WLHA 5KHGA 2YSUB 4J10A 2Y48A 4ZOLA 2CTQA 4MVSA 3SPCA 1VQ8V 5JQGB 4ZKIA 4LF7B 4BIOA 4I9QA 4F6EA 1XUQA 2B1IA 1N0NA 4DUZO 1GH6A 3N27A 1P84F 2F4VB 1KKDA 2ZT9B 3EVKA 3OT7A 3IFXA 3T4DA 5GONB 3E8HA 1OCZB 1JPXA 3JD0A 5KUMA 1B04A 2X7RB 3M8AA 1K9MW 2P7TC 3E8GA 1Z2GA 3LDCA 3ZMTA 4CC5A 3U10A 3JCUZ 2P06A 4QPJA 4J9ZB 2DYSB 3RYIB 3AG1C 5IY5C 4YIPA 1YJ9V 1MABG 2PZSA 3F5WC 4JI8O 3RYFA 1K5QA 1IDSA 1W0KG 2Y4TA 5LMUO 4R6ZA 2CUGA 2A0LA 4J7ZA 4FFKA 4GX2A 1JVMA 4DR3O 2UXBB 2UXXA 2JJ1G 2WWWA 4ZIBA 3QO7A 5BMVA 3PN1A 3TJTA 4UCSA 3T1HB 3KZIZ 1VQ6V 4LH6A 1VF5B 1UPGA 3ZMUA 3K79A 2R9IA 3SJAC 1F23A 1A32A 4GX0A 5B1NA 4X1YA 1JCHA 4LC1A 2PF4E 4MVMA 2Q7EA 4GX1A 5B1BB 1WB8A 3ZEDA 3W7TA 3MDSA 1I08A 2JGDB 2VWKA 4IHJA 5LBQA 5E1AC 2QKAA 4JI7B 1BE3H 2YS8A 2IJHA 4EB6B 1VQPV 3CRRA 5CA0A 5LHGA 3T1YB 3J81N 3L71H 4X66B 3K5LA 4DV7O 2W0FC 3K08A 3E8FA 2V4DA 2ZE5A 3T2MA 4DV6B 4DV2O 1KBHA 1XDCA 2EILC 4X65O 3BAAA 2JGUA 3SPGA 1M9NA 1HDJA 5HFLA 5JCOA 2QWRB 2IJKA 3CRCA 1PPJH 2EULA 2FL4A 2RDCA 2E5LB 4DR4O 2LJ2A 2WLMA 4OX9B 4LFCO 1WP8A 3TCUA 4JI5B 1FS0G 5DN6G 3ASOC 1PP9H 5LMNB 4G2KA 3RVZA 1MNGA 3AG3C 4MVUA 4WFBV 3K5NA 4CS4A 4X1YB 2Y0IA 4UB6Z 2VQFO 3I55V 4DV5O 2XNDG 4I5SA 1SZXA 3SDLA 3N2GA 1TAEA 4UVAA 3RYCA 3H9VA 2FB5A 3JD4A 4JASA 2BSKA 4CBCA 1NQTA 4ZI7A 1K33A 2QSAA 5HFMA 1VEWA 3RN4A 5JJEB 1QHTA 1LUVA 2P67A 3ZHRA 2ZNJA 5CA3A 3W7XA 4X8AA 3FFQA 1D5AA 2EJRA 3JYCA 3FB6C 4FFBB 3U0ZA 4GKKO 1K7DA 3UQ8A 3JD3A 2BTQA 2HR3A 4P2ZA 1Q81W 4I0XB 1JFFA 1WP7A 3K04A 1XREA 1FXHA 1V54B 2BOCC 2FMLA 1JJ2U 3CRMA 3RYHA 1YI2V 1D2DA 5IDJA 2RCVA 2CAZC 4FLZA 2VQEO 3H01A 4EKWA 3L9DA 4CC6A 4YY3B 4MVZA 3BCCH 1OCCC 4IIJA 1YCIA 1MMMA 3JALA 1DF4A 3K59A 1G8MA 4UCVA 2VWJA 1HW7A 2V7QG 3J80N 2DQ0A 4MTOA 4I50A 5CA1B 4DR2B 2XAJA 1BHBA 4K35A 3ZMSA 2GBOA 3RVYA 1NH2B 3K06A 1JR9A 5C8YA 3CRQA 4X9QA 5IYZA 1Z5VA 1RM1B 2DYSC 5B1AC 5IYCO 2FTKA 1NTZH 2ZM6B 3FB8C 4FK5C 1KD1W 1IX9A 4ZBMA 3CCEV 1XOUA 4LFBB 1TUBA 3LUTB 2CK3G 4LF6B 3ABMB 1KKCA 2YC0A 1GM8A 2CE4A 2DQ3A 4I7ZB 3FB5C 4NXNO 4L8JA 4YJ2B 5BZBA 2WSSG 3B40A 3O65A 4K8XA 1I5XA 5C93A 2Q69A 4O4JB 1Q90D 2IM9A 1SF9A 3OUSA 4J7KA 2L6LA 3CPWU 3AEIA 4E4EA 4J9YB 3GVMA 4JI3O 4O4LB 1IXBA 3OGIB 4B3MO 2B1GA 2EIMB 3CSXA 1GO3F 5IJ0B 4FLTA 3N2KA 1V55C 1N36O 4B3RB 1F4NA 1X59A 5LGTA 4MVQA 1XEQA 4G28B 4W4KA 2YIAA 3JASA 4DV3O 3OW2U 1B6QA 4RAIA 4YJ3A 3OTOO 3OEHG 3F7VC 4LR3A 4JGSA 3C3TA 4H13B 3CCSV 4JI6O 3STZC 2UXCO 5FPOA 1QVFU 3ETGA 5DM6V 1HNXO 1M1KW 4KUMA 3JATA 3I56V 4PA7A 4X62O 1FXVA 3E22B 4CZZA 3BPZA 3H1HH 1UFIA 1YZBA 4MTXA 1US6A 2B9ZA 2HHHO 1DK1A 1HP8A 2KG7B 3W7WA 3N2KB 5LGUA 5ITZA 2X6CA 2UXDO 4XBFA 2ZCEA 4O2AB 2LFRA 1CP9A 3OUFA 4KXRA 4DUZB 3CC7V 1YHQV 5JVDA 1QQCA 5CMUA 2Q8VA 4KHPO 3KCXA 2DW4A 1MA1A 4PI2A 4YJ3B 1SA0A 2QTOA 4MSWC 1EZJA 1MOFA 1EN4A 4R8CA 2P4KA 4DXWA 1ZL8B 4Z1VA 1KQSU 3OEEG 1ZWIC 3BA8A 3B8MA 5JCOC 3DGEA 5TISZ 4JI0O 2LW1A 1RPRA 2AZ2A 4DR5B 5IY5B 2PTMA 2GTAA 3CXCU 4UVBA 4JI8B 1R3JC 1YVWA 1FXKA 1ENVA 5LMUB 4JYYA 4X1IA 1U96A 2AHZA 4U7OA 4PD4F 1J5EO 4DR3B 3VQXA 1S72V 1BQ0A 5ITZB 3BA9A 3ZHVA 2W6JG 1ROPA 3L73H 1H8EG 4JI1B 4PV1B 4LWSA 3SJQC 1AROP 5EC2C 5JVDB 2YUAA 1FPOA 4JF3A 3ETQA 2DWDC 5LXTA 2NNUA 5KX5A 3F5TA 3ABUA 5CBHA 1WNSA 3OMIB 4DO2A 1VQNV 4U3FH 1RM1C 3THOA 1SQFA 3CE2A 4OPAA 4H44B 3X2QC 2YI8A 5IJ9A 3DTUB 4DV7B 3CCQV 2E76B 3ABMC 4ZHQB 4U3JA 4DV2B 1IBLO 2EZPA 2UU9B 2EILB 1JA8A 2IW5A 5FNVA 1Y67A 4X65B 4WF9V 4ABMA 4UCTA 5B1OA 3ZHUA 1VQOV 3RWRD 4WBNA 4DR4B 4LFCB 3AG7A 1Q6HA 1FJGB 1HNWB 5IWAO 5EZYA 4PA4A 1BL8A 4D7SA 1TGOA 4WFEA 5B5EZ 3UCSC 2YIBA 4JI2O 2UUAO 5L3FA 3CC4V 2EIMC 1Q8IA 4R50A 3JD2A 4NTWA 3WB0A 2QR4A 2VQFB 4DV5B 5D5PA 2DMXA 3BEHA 1F51A 2M7WA 1TUEB 1P4RA 5CB4B 3SPHA 1PM9A 1YDXA 3ML0A 4JI4O 3Q4HA 1FFXA 1KC8W 3JAKA 3SYOA 2CH7B 3E8BA 1IZ3A 5KHIA 1DTOA 1PD3A 4OGQB 5K1XA 4JV5O 3MAQA 2ZXWB 1U97A 5FNVB 5H9CA 1KP2A 1WLEA 5EBMC 3OM3B 3C3SA 1FD9A 4WBNB 4GKKB 3ABTA 3SR2C 1TA8A 2WLLB 3TGUH 3OE7G 4NXMB 3ZHQA 1DF5A 2PI5A 4KL1A 2VS0A 1URFA 2IJIA 1BQZA 5LP6A 4DR7O 4TV9B 4F4LA 5IT9N 5LA6A 2VQEB 2WLIA 4FLVA 1NI8A 1OCCB 4DR6O 1GN4A 4HBNA 1FFXB 4FM1A 1NTKH 1B3QA 4O4HB 1R6TA 2EJ7A 3AG2C 3K5OA 2XAHA 2HG5C 1DLBA 1BCCH 2HVKC 1FFTB 3CCRV 2XAQA 4LBEC 2D3OW 3K57A 1AILA 1QU7A 5B1AB 4GX5A 4FIPC 1N34O 1P49A 3K9AA 1PNMA 3EHBB 4K0KO 2HLDG 1VQ7V 2Q73A 2CDYA 4ZOLB 2Q0OC 3SYAA 3ABKC 2IH1C 1F7YA 3CS5A 1T5EA 1GK9A 5J2UA 4X89A 1FAFA 5JJJB 4NXNB 4JZ2A 4FLXA 4NYKA 4YIOA 3CJHA 4IYIA 2JEXA 2M6YA 4WFGA 1N33O 1PNKA 1K92A 1YXBA 2X6AA 3ZJZA 4JI3B 2X6BA 1SQBH 4Z1MG 1Y66A 1QLEC 2K1EA 4B3MB 3OTFA 5LYJA 4K8ZA 1V55B 3R66A 2LQTA 2WA3A 1N36B 1K3EA 3APQA 4J7JA 4H33A 1GN2A 3CEIA 2Y0PA 1L0NH 5KA5A 4DV3B 4AQYO 4RQEA 1AR4A 2ZIMA 3RYFB 2ZDIA 1P7GA 4F6RA 1WPXA 1FXKC 1RP3B 1CPYA 3QO5A 2WLJA 3L70H 3OD4A 4GT1A 1COWG 4JI6B 2UXCB 4CH5A 1HNXB 4PI0A 4K3AA 5BMVB 1YF2A 4TOIA 3VQYA 5BR8O 2Q68A 3CYOA 3M7MX 2BTOA 3IC9A 3IJ4A 1VF7A 1Q6IA 2GV9A 3VQWA 3ETEA 4BWAA 4JZGA 4TWKA 3ZRSA 2C2AA 3T4ZA 5LYJB 4TT3G 4IHJB 1G6UA 1ZLZA 1H2SB 2UXDB 1VMGA 4PELA 5CA0B 3BY6A 2JIZG 1W59A 1M4UA 2P22C 4HNAA 1NBMG 4B3SO 4KHPB 3NXSA 3OAAG 4LF4O 3HKDA 4F6RB 2GTSA 3ZCCA 3FAVA 1AR5A 2ZXWC 3E83A 3PJSK 5LHIA 5DEDA 4DV4O 1Q7YW 3DC6A 1SZTA 3M99B 1RSOA 5EBLC 2Z3YA 4TUYA 1XI1A 1L0LH 1H2LA 2F93B 4G27B 4I55A 1THZA 4UCRA 5KHJA 1J5EB 1SQVH 1AP5A 2A7WA 2CTRA 3HKCA 1R3LC 2EIJB 1AP6A 3CXHF 1JQ0A 2QKCA 3FD9A 3N2GB 5KMGA 3RYCB 1XNQB 4XDLA 2XUMA 5CBGA 1MSDA 1WA8A 3HPLC 5BY1A 2BSKB 3ABLB 4ZI7B 5FLXN 1NKDA 3AK2A 4U7NA 2WAMA 3HKDB 1AI7A 2F4VO 2JJ2G 1XQ8A 3P3NA 4JYAO 3GWOA 4LFAB 2DWEC 1YTFB 1AVMA 3SPIA 3LSUA 4JYBA 2N05A 5JH7A 3ZMZA 1I7FA 1RSOB 1NTMH 3ZX6A 3X2QB 2YXLA 1XBLA 2BTQB 2ZR2A 3FYEB 1WJZA 1YEWA 1SESA 4IYHA 1V9PA 3LDDA 3RFRA 3CCJV 1RPOA 1LNQA 1IBLB 2AXTZ 1JFFB 5LP6C 2NLJC 1WPBA 2L35A 2UUCO 1TVKA 2QWNB 3WB2A 2DOSA 3RYHB 3BRCA 5KAFZ 3CMEV 4B3TO 1F4MA 2DYRC 5IWAB 1WAZA 1R73A 4IIJB 2YIBD 4JPRA 4O4IA 3JSLA 3JALB 2ZE6A 1EZVH 3CMAV 1Q5OA 4JI2B 2QWPB 4I4TA 3AK1A 4I50B 4PA6A 3ZN0A 2W6IG 3HKEA 2QEXV 4IL6Z 2Q67A 4LF5O 3ZS8C 1OZ0A 3CCMV 2QA4V 3HKBA 4XDKA 3I5DA 3RT3C 5C8YB 1R1BA 5IYZB 2P4VA 4LP8A 3CP1A 2P5OA 3UT5A 1H2GA 5L3EA 3A0RA 4IGGA 3ZRVA 1TUBB 1M57C 1K97A 1KB9F 4JV5B 1ZX3A 4RWUA 1G4YB 4UXNA 4D6TH 4X20A 2JS5A 2GUZA 4R7CA 4PHZA 4UV9A 1IVSA 4LNUA 4DV6O 4NVPA 2Z0AA 4DK0A 3LSQA 1SS3A 2GSMB 1GRJA 1E1QG 2XAGA 1Y74A 3ZMVA 1G1XB 3OR7C 1Q86W 1AJNA 2E5LO 2F23A 1GM7A 4QPKA 4I4TB 3HKEB 4JI5O 1K34A 1XNRO 1AJQA 3JAWA 3P30A 4DW0A 3HKBB 3P3PA 1AR1B 2Y4UA 2ZIOA 2HKOA 3JASB 3SYCA 4IT5A 1R6KA 1K4CC 4DR6B 1NZ6A 1HR0O 1KP3A 3ZRWA 1Y76A 2ZDIC 5E79Z 4BIUA 4JAVA 3MHHC 3A8TA 5IE9A 3AG2B 2Y69C 2E74B 4EFBA 2ADQB 2NR5A 3DC5A 3F7YC 2OCCC 2Z5UA 4FZ0A 4YXWG 3JATB 1VF6A 2WLKA 4KP4A 1N34B 4FVMA 1NR7A 2RNBA 2YXHA 1Y74B 1BGYH 1JMKC 3A0HZ 3GWKC 5L3CA 2NN4A 3ABKB 2D2CB 1BHAA 4MTGA 2IBZH 4OXSA 2QWQB 2EIJC 4N23A 4DR1O 1VQ9V 3ASNB 3JAWB 1HNZO 1L8DA 3JARA 3ABLC 2OT5A 3NR7A 3G80A 5LOVA 2AZ0A 3SPJA 3BHPA 3J7AU 3JSNA 1IBMO 3RGBA 3K9SA 1R3KC 3ZRWB 1VQLV 2LGQA 1SA0B 1QLEB 4KFMA 1YSCA 4ICGA 1QVGU 5EIBC 1W2BU 2UUBO 1JOYA 1GM9A 1AI5A 1OCRB 1QCEA 3KKYA 2ZNIA 4PDVA 2YDEA 2OIGA 1D5NA 4AQYB 4DR2O 5H2FZ 2OWOA 1FYJA 1VARA 4QGPA 3WU2Z 1FXKB 3K0GA 4X1IB 5EBWC 4YHHO 4J11A 4BW5A 5J2TA 1XMQO 3G6BA 3ICXA 4TV8A 2ZM6O 4RO2A 5L3BA 4X1KA 5JJNB 4LFBO 3QG5A 4LF6O 4LWSB 4O2BA 3W7UA 3K5MA 5LHHA 3U11A 2F1MA 1B06A 4GLXA 5LOVB 1I0HA 2H94A 2BE3A 5LXTB 3TETA 2OTJV 3CCUV 5KX5B 4JAUA 1YITV 3KCYA 1LUWA 5H5NA 4DW1A 5FL7G 1K73W 2WPDG 1XMOO 5H6RA 1BSMA 3LDEA 4NR1A 1H2NA 5JQGA 2DJVA 1YJWV 4LF9O 2FYUH 5IJ9B 4XDJA 3CD6V 3JAMN 3CCVV 2O57A 2JK5C 4DV1O 4LF4B 5DECA 3OR6C 2ITCC 4MW8A 1YTFD 4U3JB 5EIBD 2XHBA 2LW7A 4UCOA 2YEVA 4Z2WA 2CGOA 3L75H 4LH7A 5GONA 4DV4B 2LFSA 4WFHA 1YJNV 1XHZA 1WN7A 3RW0A 5KA6A 2ADPA 1IURA 2AHYA 2LGWA 1PL4A 1QR8A 1KUQA 3CB2A 4PA9A 5EZYB 2ZE7A 3QF7A 2V1DA 1AI4A 2UXNA 3AK3A 1GN6A 1ZUQA 3OMAB 2HP8A 3E89A 1N8RW 3UO3A 2R70A 3K3WA 2XT9A 2ZR3A 1ZAUA 4DK1A 3D36A 1S3JA 3SYPA 3P32A 5A2QN 4NB5A 4Q20A 3Q4HB 1KECA 3D3QA 3UO2A 3JAKB 3R65A 4PJ0Z 4WFAV 3VOUA 3B77A 2XASA 2EIKC 2YEVB 5L3DA 4JYAB 1RFYA 3TXSA 4PDMA 4A5UB 1SETA 2ITDC 4EEQA 3E86A 1NS1A 3TXQA 3BABA 1Q6UA 2JGDA 3H1LH 1SKVA 4NTYA 2WLNA 1OCOB 4EB6A 4FM2A 2Q9LA 1E1RG 2XOKG 4DR5O 1E79G 2HEPA 3VBBA 3JD1A 5LP6B 2HJFC 1AJPA 1EM1A 2DN9A 5LGNA 2UUCB 3ASNC 3BVOA 1N4CA 5LA6B 1M90W 1O9GA 2R9RB 2EINC 1Q82W 2WLIB 4BIZA 2DYRB 4B3TB 2YI9A 4X64O 1M56C 2QTSA 3DSQA 2N74A 1NJIW 5H6QA 1VIBA 4MVRA 4JI1O 4CH4A 1PNLA 3UKMA 4LF8O 4LF5B 3K03A 4GUNA 1GTOA 1OCRC 2X0LA 2PY5A 3S3XA 1H38A 4JYCA 1VF6C 2PGGA 3QO8A 4DV0O 4RUFA 2Q6AA 4GKJO 3OTOB 1M57B 2F95B 3BFRA 1R6NA 3DXRA 3LNMB 5IYBO 3G71V 2AGAA 4AHCA 3RBZA 5J2UB 2OTLV 5EYPA 3D3IA 2EZOA 3K58A 2BOBC 4D7TA 2KQXA 3CJHB 3C90A 4X62B 2UU9O 4FLYA 3ZIAG 5KLVH 3LNNA 1I94O 2R9AA 4FFBA 4AILC 2IH3C 1SQPH 3S3WA 1ZSPA 4J42A 2HHHB 1FJGO 1HNWO 4JTDB 2RJZA 4HZ3A 1XNRB 4I0XA 2GDSA 5B3SB 4H0LB 1NU1H 4FPPA 3FKSG 4BW9A 1HR0B 5J9PC 3SJBC 3B2EE 4UVCA 1P7BA 1NVPB 4DUYO 1IBKO 2LP7A 2Y69B 2Q7GA 4BAYA 3DXRB 3MD0A 4JI0B 4P9OA 2OCCB 2ZE8A 2Q5ZA 5EYPB 2JDIG 1MG1A 2QE7G 2ZINA 1M93A 5CA1A 2OIEA 4QNHB 5CN0A 4J41A 1Y6XA 3CRAA 4HYOA 2Q7HA 3B8NA 1N32O 1SERA 4B7EA 1JJOA 3MHSC 2Q4PA 1YIJV 2QM8A 4W4LA 1EBOA 2H3OA 1XL4A 5JWPA 5FPRA 4DR1B 1H2KA 4X88A 4NXMO 3FYIB 1GKFA 3ZN1A 1HNZB 2QM7A 2G38A 1BMFG 1LR1A 4LF7O 2EBOA 1SC5B 4HNAB 1QR9A 4YJ2A 2QM4A 4EFEA 1QLNA 1CXZB 5KAIZ 1IBMB 4CS3A 3FAVB 4JTAB 1Q43A 4O4JA 2PYJA 1K4DC 3G6EV 2QGNA 1S77D 4H37A 4WFFA 2HVJC 1NR1A 3ETDA 1OCZC 1O9HA 2OCHA 2UUBB 4O4LA 3G4SV 1X4TA 2CTWA 1BT8A 1HWYA 1Y4MA 5IJ0A 4TQDA 3E2EA 4TUYB 5LL6Y 2XTAA 2ODMA 1GAXA 2JEUA 1OCOC 3AG4B 4NTXA 1S5LZ 4I55B 4ASUG 4YHHB 1Z5WA 2ARHA 1XMQB 1SRYA 4Q6GA 1PV0A 1M5IA 3HKCB 3OMNB 1K5SA 2AW9A 4MT8A 3D36C 5EC1C 5KMGB 1SQGA 2UXBO 3VQVA 1WA8B 2ETNA 2ILMA 3T1HO 3WG7B 3ZBHA 2UUAB 2DE0X 3D8CA 5F2VO 2A9HA 5CBFA 2FKXA 3E22A 1KYOF 1ORQC 2YICA 3WFVA 1XMOB 5JH7B 4JI4B 5B1BC 3E35A 2W0XA 4MW3A 2KG7A 1VP7A 2BCCH 4FJCC 4LF9B 4CH3A 4FM0A 2GHYA 2QDOA 4P30A 1N0JA 4O2AA 4QE9A 4JI7O 1NT2B 4CH6A 4DV1B 1S5HC 1I5YA 3CHXA 4GZRB 3T1YO 5GTHZ 2MK3A 4X66O 4JAAA 5GW7A 3WB1A 1KMIZ 1TVKB 4L87A 4UV8A 2ZD9A 2QJ1A 3GB7C 4B7KA 1EFRG 5B66Z 1ZL8A 4TSFG 1WB7A 4BR6A 3ZHTA 4O4IB 2K9PA 3KG2A 3B09A 4OX9O 2LO1A 1CEZA 1OV9A 4JTCB 5IYDO 4DR7B 1SQXH 4OPHA 1H2MA 5LMNO 4FLUA 1MSWD 2HJDA 1JX9A 3B4SA 3SJCC 1FKAO 2RMKB 1GN3A 3H1KH 5B3SC 3CWBH 1VQ5V 3UT5B 3L74H 3G67A 2OYQA 2XAFA 2B5UA 2KKWA 3ZHSA 3ZRXA 4B08A 4QJFB 4CS2A 3IAYA 5KHKA 2F43G 2EIKB 2R72A 4X20B 1GMGA 2GUZB 2ZQMA 3A0BZ 1MZFA 2VRZA 4PDLA 4LNUB 2F66C 3EFFK 5KUKA 1MZEA 4K0KB 3L72H 2RN9A 3EXAA 2P90A 1VQKV 2JS3A 5KHHA 2CTPA 3K0DA 3AG1B 4RQFA 4ZHQA 1UJWB 2EINB 2QWOB 1DGSA 4LCUC 4QE7A 1PL0A 1OJHA 2QKSA 4GCZA 1N33B 3CX5F 3QVNA 4GYCB 4P9PA 1M56B 1V54C 4X64B 3W7SA 2KSDA 1Y76B 4UCUA 4DYLA 2PUSA 1S0VA 1QBZA 3APOA 4YY3O 4DRXA 3SYQA 1XNQO 3HB3B 4LF8B 4HAMA 4MTFA 5L3GA 3OGCC 5EK0A 4TQFA 3UM7A 2IJJA 2A3QA 2JVDA 5K1PA 1R3IC 5A9GA 3QTCA 4J80A 4PA3A 4PDRA 2IU3A 1VQMV 1NVPD 5GTIZ 2YXYA 1S5JA 1AI6A 4DV0B 4LFAO 5CB4A 3AG4C 4GKJB 4I9WA 3H1IH 1BS3A 1KU9A 1XL6A 1Q3EA 1XHXA 1BZKA 3IGAC 2ZKOA 4QIWF 3TK1A 1OHHG 2CH7A 4MVOA 3T1CA 2KB1A 1QNMA 3FX7A 4UFZA 5BR8B 2CGNA 3JARB 1S76D 2RQ6A 5D5QA 1I94B 3WG7C 3QNEA 4FLWA 2JRIA 1AB3A 5BXZA 2A79B 4RUEA 1J95A 3HR0A 3JCZA 1L1FA 1EN5A 4DRXB 4MS2A 2WLLA 1XILA 3ASOB 4FMTA 4UUJC 3OFNG 2YIDA 3H1JH 3AG3B 3LSSA 3O9OA 4WCEV 2E75B 4B3RO 4TV9A 3IC7A 5AG2A 4FZ1A 2IU0A 4B3SB 1EN6A 3CCLV 2H8PC 2ATKC 4DUYB 2MW2B 1IBKB 2PYLA 3SGIA 5J2TB 4TV8B 3STLC 2WA4A 1PKXA 1ZTEA 4C7UA 2A06H 4X1KB 2PI4A 4O4HA 2E3CA 4AI8A 1IXMA 1K8AW 4UB8Z 1NH2D 1W0JG 4O2BB 3CC2V 1H8HG 2N04A 2EX3A 4E2LA 1SQQH 3A2FA 3RYIA 1N32B 2Q0AA 4NKGB 2HFEC
chains in the Genus database with same CATH topology
4N21A 2P6JA 3FB7C 1VQ4V 2WLHA 2IH3C 2YSUB 3CMEV 1S72V 1F4MA 2DYRC 1R73A 2Y48A 4JPRA 4JTDB 4MVSA 3SPCA 2W6JG 1ROPA 3CMAV 1VQ8V 1H8EG 3SJQC 4ZKIA 1AROP 4HZ3A 5EC2C 4PA6A 2QEXV 3ZN0A 2W6IG 2Q67A 2B1IA 5B3SB 4FPPA 4JF3A 1OZ0A 3FKSG 3CCMV 2QA4V 4XDKA 1KKDA 2DWDC 5J9PC 3IFXA 4UVCA 1P7BA 4LP8A 3T4DA 2NNUA 3CP1A 1NVPB 3ABUA 3E8HA 1H2GA 1OCZB 5CBHA 3OMIB 5L3EA 2LP7A 1JPXA 2Y69B 3JD0A 5KUMA 4BAYA 4DO2A 3A0RA 1VQNV 3MD0A 2X7RB 1RM1C 3ZRVA 1K9MW 2P7TC 1M57C 3E8GA 4P9OA 3LDCA 1K97A 2OCCB 3X2QC 3ZMTA 1G4YB 4UXNA 2JDIG 1MG1A 2QE7G 3DTUB 3CCQV 4R7CA 4QNHB 4QPJA 3ABMC 4J9ZB 5CN0A 2DYSB 5IY5C 3AG1C 4UV9A 2EZPA 1YJ9V 1MABG 2EILB 3F5WC 2IW5A 4HYOA 3B8NA 1K5QA 1W0KG 4WF9V 3LSQA 2GSMB 4R6ZA 1SERA 1E1QG 2A0LA 3MHSC 1YIJV 2XAGA 2QM8A 1EBOA 5B1OA 4GX2A 1VQOV 3ZMVA 1JVMA 1XL4A 3OR7C 1Q86W 1AJNA 2UXXA 2JJ1G 4X88A 3FYIB 2WWWA 3QO7A 4PA4A 1GKFA 1GM7A 3ZN1A 4QPKA 1VQ6V 1BL8A 2QM7A 1BMFG 4WFEA 1K34A 3ZMUA 1AJQA 3K79A 5L3FA 2EBOA 3CC4V 1QR9A 2EIMC 3P30A 4R50A 2R9IA 1AR1B 3JD2A 1QLNA 1F23A 2HKOA 4GX0A 3SYCA 5B1NA 1JCHA 1R6KA 3BEHA 1F51A 1K4CC 4JTAB 2M7WA 1TUEB 1P4RA 4LC1A 4MVMA 3SPHA 1KP3A 4GX1A 5B1BB 3ZRWA 1K4DC 2ZDIC 3G6EV 3W7TA 1S77D 4H37A 4WFFA 2HVJC 1NR1A 4BIUA 4JAVA 3ML0A 3ETDA 1OCZC 5LBQA 3MHHC 5E1AC 3AG2B 3G4SV 1KC8W 3SYOA 2Y69C 1HWYA 2IJHA 1Y4MA 3E8BA 1VQPV 3E2EA 1DTOA 1PD3A 5LHGA 2JEUA 2OCCC 2Z5UA 3F7YC 1OCOC 2ZXWB 4YXWG 3AG4B 2W0FC 3K08A 2WLKA 4KP4A 3E8FA 4ASUG 3T2MA 5H9CA 1KP2A 1WLEA 1NR7A 1SRYA 2EILC 5EBMC 3SPGA 3OM3B 1M9NA 3OMNB 5HFLA 2IJKA 1K5SA 4MT8A 5L3CA 3ABKB 3ABTA 2WLLB 3OE7G 1BHAA 4MTGA 5EC1C 4OXSA 2WLMA 2EIJC 4N23A 1VQ9V 1DF5A 3TCUA 2PI5A 3ASNB 1FS0G 5DN6G 3ASOC 2IJIA 3WG7B 4G2KA 3RVZA 3AG3C 4MVUA 3ABLC 4WFBV 2OT5A 4F4LA 2A9HA 5CBFA 3SPJA 1R3KC 1ORQC 2WLIA 3ZRWB 3I55V 1VQLV 1OCCB 1QLEB 2XNDG 4I5SA 3WFVA 4KFMA 1YSCA 5B1BC 3E35A 1QVGU 4MW3A 4UVAA 4FJCC 1W2BU 1JOYA 3JD4A 4JASA 1GM9A 1AI5A 1OCRB 1QCEA 2GHYA 4PDVA 3AG2C 4QE9A 4P30A 4CBCA 2XAHA 2HG5C 1NQTA 1DLBA 1K33A 1S5HC 1I5YA 2HVKC 1FFTB 3CCRV 2XAQA 4LBEC 5HFMA 2D3OW 2MK3A 2P67A 5CA3A 3W7XA 1FXKB 3K0GA 4X8AA 5B1AB 5GW7A 4GX5A 2EJRA 5EBWC 4FIPC 4BW5A 4L87A 4UV8A 2ZD9A 3JYCA 3FB6C 3GB7C 3K9AA 1PNMA 4RO2A 3EHBB 2HLDG 1EFRG 1VQ7V 4TSFG 5L3BA 1K7DA 3SYAA 3ABKC 2IH1C 3JD3A 1GK9A 3KG2A 2HR3A 4P2ZA 1CEZA 4X89A 4JTCB 1Q81W 3W7UA 5IYDO 5LHHA 3K04A 2JEXA 1FXHA 1V54B 4WFGA 1MSWD 2BOCC 1JX9A 2H94A 1JJ2U 1YI2V 5IDJA 3TETA 2OTJV 3CCUV 1VQ5V 4JAUA 5B3SC 1YITV 1PNKA 2XAFA 1K92A 2X6AA 3H01A 5FL7G 3ZJZA 2B5UA 2X6BA 4EKWA 4MVZA 1K73W 4Z1MG 1Y66A 3ZRXA 1OCCC 2WPDG 1QLEC 2K1EA 1V55B 5H6RA 3LDEA 1DF4A 4QJFB 1K3EA 1G8MA 2V7QG 1YJWV 2F43G 2EIKB 4H33A 4XDJA 2DQ0A 4MTOA 3CD6V 3CCVV 2XAJA 1BHBA 1GMGA 2JK5C 2ZQMA 3OR6C 2ITCC 4MW8A 3ZMSA 5KA5A 1YTFD 4PDLA 4RQEA 3RVYA 1NH2B 2YEVA 3K06A 2ZDIA 1WPXA 1FXKC 1RM1B 2DYSC 3EFFK 5B1AC 5IYCO 2FTKA 1CPYA 3QO5A 3FB8C 2LFSA 4FK5C 4WFHA 2WLJA 5KUKA 1YJNV 1KD1W 4ZBMA 3RW0A 4GT1A 3CCEV 5KA6A 1COWG 2AHYA 2P90A 1VQKV 1QR8A 3LUTB 2CK3G 4PA9A 3K0DA 3ABMB 3AG1B 1GM8A 2V1DA 1AI4A 2UXNA 2DQ3A 4RQFA 3OMAB 3E89A 3FB5C 1N8RW 2Q68A 5BZBA 1UJWB 3CYOA 2EINB 2WSSG 4LCUC 4QE7A 1PL0A 1I5XA 2QKSA 4GCZA 3K3WA 5C93A 3ETEA 2Q69A 2ZR3A 4TWKA 4P9PA 1M56B 1V54C 3ZRSA 3D36A 1S3JA 3W7SA 2C2AA 3OUSA 3SYPA 3P32A 3CPWU 3AEIA 3T4ZA 4TT3G 4Q20A 1QBZA 1S0VA 4J9YB 1KECA 3SYQA 3HB3B 2B1GA 2EIMB 1GO3F 4HAMA 4MTFA 5L3GA 1V55C 3OGCC 3R65A 1F4NA 5EK0A 4PELA 3UM7A 3BY6A 4WFAV 2IJJA 3VOUA 2JIZG 1R3IC 3B77A 4PA3A 2XASA 1NBMG 2EIKC 2YEVB 4MVQA 5L3DA 4PDRA 5LGTA 2IU3A 1VQMV 1NVPD 4G28B 3NXSA 3OAAG 3OW2U 1AI6A 3ZCCA 4PDMA 1SETA 2ITDC 1B6QA 2ZXWC 3AG4C 4RAIA 4I9WA 3E83A 3E86A 3PJSK 5LHIA 1XL6A 3OEHG 3F7VC 1Q7YW 3IGAC 1SZTA 4QIWF 3TK1A 4JGSA 3M99B 1OHHG 5EBLC 3CCSV 2WLNA 1OCOB 4MVOA 3STZC 3T1CA 1QVFU 2KB1A 3ETGA 2Z3YA 5DM6V 1E1RG 2XOKG 1E79G 1M1KW 3VBBA 3JD1A 2HJFC 1AJPA 4KUMA 4G27B 3I56V 5LGNA 1THZA 1S76D 4PA7A 3ASNC 1M90W 1FXVA 3WG7C 4CZZA 2R9RB 3QNEA 2EINC 1Q82W 2WLIB 4BIZA 2DYRB 2A79B 4RUEA 1R3LC 2EIJB 1J95A 1M56C 1JQ0A 3JCZA 4MTXA 1L1FA 4MS2A 2WLLA 4FMTA 3ASOB 4UUJC 3W7WA 3OFNG 4XDLA 1NJIW 5CBGA 5LGUA 5H6QA 3AG3B 2X6CA 3HPLC 4MVRA 4XBFA 3ABLB 3LSSA 1PNLA 3UKMA 2LFRA 4WCEV 1CP9A 3OUFA 1NKDA 4U7NA 3K03A 3IC7A 3CC7V 2WAMA 1YHQV 1GTOA 1OCRC 2X0LA 2IU0A 1AI7A 3CCLV 5CMUA 1H38A 2H8PC 2ATKC 2JJ2G 4JYCA 3GWOA 2DWEC 1YTFB 2DW4A 3QO8A 3SPIA 4RUFA 2QTOA 4MSWC 4JYBA 2Q6AA 1EZJA 3STLC 1MOFA 1M57B 4R8CA 3ZMZA 4DXWA 1PKXA 1KQSU 3OEEG 1ZWIC 3B8MA 3X2QB 1R6NA 2PI4A 3LNMB 3DGEA 1IXMA 1RPRA 5IYBO 1K8AW 2ZR2A 3G71V 1NH2D 3FYEB 3RBZA 1SESA 5IY5B 1W0JG 2OTLV 3LDDA 3CC2V 1H8HG 3CCJV 1RPOA 1LNQA 3CXCU 3D3IA 2EZOA 4UVBA 2BOBC 4E2LA 1R3JC 1FXKA 1ENVA 2NLJC 3ZIAG 2AHZA 4U7OA 2HFEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFM A;  3MHH C;  4JF3 A;  4N21 A;  2MK3 A;  1DF4 A;  2P6J A;  5KA6 A;  5HFL A;  5CN0 A;  3B8M A;  1Y4M A;  1K34 A;  2EZP A;  3CP1 A;  1QR8 A;  4FIP C;  3WFV A;  2EBO A;  1QR9 A;  3B8N A;  3P30 A;  4JPR A;  1QBZ A;  2LP7 A;  1JPX A;  4N23 A;  1F23 A;  5KA5 A;  3K9A A;  3MHS C;  2X7R B;  1DF5 A;  5CMU A;  2EZO A;  1SZT A;  4FJC C;  1EBO A;  4JGS A;  4E2L A;  2M7W A;  3M99 B;  3GWO A;  1QCE A;  5H9C A;  4G2K A;  1ENV A;  1JQ0 A;  3CYO A;  3H01 A;  1DLB A;  2OT5 A;  3B77 A;  1Y66 A;  1K33 A;  1I5X A;  1I5Y A;  1MG1 A;  1MOF A;  4FK5 C; 
#chains in the Genus database with same CATH topology
 4N21 A;  2P6J A;  3FB7 C;  1VQ4 V;  2WLH A;  5KHG A;  2YSU B;  4J10 A;  2Y48 A;  4ZOL A;  2CTQ A;  4MVS A;  3SPC A;  1VQ8 V;  5JQG B;  4ZKI A;  4LF7 B;  4BIO A;  4I9Q A;  4F6E A;  1XUQ A;  2B1I A;  1N0N A;  4DUZ O;  1GH6 A;  3N27 A;  1P84 F;  2F4V B;  1KKD A;  2ZT9 B;  3EVK A;  3OT7 A;  3IFX A;  3T4D A;  5GON B;  3E8H A;  1OCZ B;  1JPX A;  3JD0 A;  5KUM A;  1B04 A;  2X7R B;  3M8A A;  1K9M W;  2P7T C;  3E8G A;  1Z2G A;  3LDC A;  3ZMT A;  4CC5 A;  3U10 A;  3JCU Z;  2P06 A;  4QPJ A;  4J9Z B;  2DYS B;  3RYI B;  3AG1 C;  5IY5 C;  4YIP A;  1YJ9 V;  1MAB G;  2PZS A;  3F5W C;  4JI8 O;  3RYF A;  1K5Q A;  1IDS A;  1W0K G;  2Y4T A;  5LMU O;  4R6Z A;  2CUG A;  2A0L A;  4J7Z A;  4FFK A;  4GX2 A;  1JVM A;  4DR3 O;  2UXB B;  2UXX A;  2JJ1 G;  2WWW A;  4ZIB A;  3QO7 A;  5BMV A;  3PN1 A;  3TJT A;  4UCS A;  3T1H B;  3KZI Z;  1VQ6 V;  4LH6 A;  1VF5 B;  1UPG A;  3ZMU A;  3K79 A;  2R9I A;  3SJA C;  1F23 A;  1A32 A;  4GX0 A;  5B1N A;  4X1Y A;  1JCH A;  4LC1 A;  2PF4 E;  4MVM A;  2Q7E A;  4GX1 A;  5B1B B;  1WB8 A;  3ZED A;  3W7T A;  3MDS A;  1I08 A;  2JGD B;  2VWK A;  4IHJ A;  5LBQ A;  5E1A C;  2QKA A;  4JI7 B;  1BE3 H;  2YS8 A;  2IJH A;  4EB6 B;  1VQP V;  3CRR A;  5CA0 A;  5LHG A;  3T1Y B;  3J81 N;  3L71 H;  4X66 B;  3K5L A;  4DV7 O;  2W0F C;  3K08 A;  3E8F A;  2V4D A;  2ZE5 A;  3T2M A;  4DV6 B;  4DV2 O;  1KBH A;  1XDC A;  2EIL C;  4X65 O;  3BAA A;  2JGU A;  3SPG A;  1M9N A;  1HDJ A;  5HFL A;  5JCO A;  2QWR B;  2IJK A;  3CRC A;  1PPJ H;  2EUL A;  2FL4 A;  2RDC A;  2E5L B;  4DR4 O;  2LJ2 A;  2WLM A;  4OX9 B;  4LFC O;  1WP8 A;  3TCU A;  4JI5 B;  1FS0 G;  5DN6 G;  3ASO C;  1PP9 H;  5LMN B;  4G2K A;  3RVZ A;  1MNG A;  3AG3 C;  4MVU A;  4WFB V;  3K5N A;  4CS4 A;  4X1Y B;  2Y0I A;  4UB6 Z;  2VQF O;  3I55 V;  4DV5 O;  2XND G;  4I5S A;  1SZX A;  3SDL A;  3N2G A;  1TAE A;  4UVA A;  3RYC A;  3H9V A;  2FB5 A;  3JD4 A;  4JAS A;  2BSK A;  4CBC A;  1NQT A;  4ZI7 A;  1K33 A;  2QSA A;  5HFM A;  1VEW A;  3RN4 A;  5JJE B;  1QHT A;  1LUV A;  2P67 A;  3ZHR A;  2ZNJ A;  5CA3 A;  3W7X A;  4X8A A;  3FFQ A;  1D5A A;  2EJR A;  3JYC A;  3FB6 C;  4FFB B;  3U0Z A;  4GKK O;  1K7D A;  3UQ8 A;  3JD3 A;  2BTQ A;  2HR3 A;  4P2Z A;  1Q81 W;  4I0X B;  1JFF A;  1WP7 A;  3K04 A;  1XRE A;  1FXH A;  1V54 B;  2BOC C;  2FML A;  1JJ2 U;  3CRM A;  3RYH A;  1YI2 V;  1D2D A;  5IDJ A;  2RCV A;  2CAZ C;  4FLZ A;  2VQE O;  3H01 A;  4EKW A;  3L9D A;  4CC6 A;  4YY3 B;  4MVZ A;  3BCC H;  1OCC C;  4IIJ A;  1YCI A;  1MMM A;  3JAL A;  1DF4 A;  3K59 A;  1G8M A;  4UCV A;  2VWJ A;  1HW7 A;  2V7Q G;  3J80 N;  2DQ0 A;  4MTO A;  4I50 A;  5CA1 B;  4DR2 B;  2XAJ A;  1BHB A;  4K35 A;  3ZMS A;  2GBO A;  3RVY A;  1NH2 B;  3K06 A;  1JR9 A;  5C8Y A;  3CRQ A;  4X9Q A;  5IYZ A;  1Z5V A;  1RM1 B;  2DYS C;  5B1A C;  5IYC O;  2FTK A;  1NTZ H;  2ZM6 B;  3FB8 C;  4FK5 C;  1KD1 W;  1IX9 A;  4ZBM A;  3CCE V;  1XOU A;  4LFB B;  1TUB A;  3LUT B;  2CK3 G;  4LF6 B;  3ABM B;  1KKC A;  2YC0 A;  1GM8 A;  2CE4 A;  2DQ3 A;  4I7Z B;  3FB5 C;  4NXN O;  4L8J A;  4YJ2 B;  5BZB A;  2WSS G;  3B40 A;  3O65 A;  4K8X A;  1I5X A;  5C93 A;  2Q69 A;  4O4J B;  1Q90 D;  2IM9 A;  1SF9 A;  3OUS A;  4J7K A;  2L6L A;  3CPW U;  3AEI A;  4E4E A;  4J9Y B;  3GVM A;  4JI3 O;  4O4L B;  1IXB A;  3OGI B;  4B3M O;  2B1G A;  2EIM B;  3CSX A;  1GO3 F;  5IJ0 B;  4FLT A;  3N2K A;  1V55 C;  1N36 O;  4B3R B;  1F4N A;  1X59 A;  5LGT A;  4MVQ A;  1XEQ A;  4G28 B;  4W4K A;  2YIA A;  3JAS A;  4DV3 O;  3OW2 U;  1B6Q A;  4RAI A;  4YJ3 A;  3OTO O;  3OEH G;  3F7V C;  4LR3 A;  4JGS A;  3C3T A;  4H13 B;  3CCS V;  4JI6 O;  3STZ C;  2UXC O;  5FPO A;  1QVF U;  3ETG A;  5DM6 V;  1HNX O;  1M1K W;  4KUM A;  3JAT A;  3I56 V;  4PA7 A;  4X62 O;  1FXV A;  3E22 B;  4CZZ A;  3BPZ A;  3H1H H;  1UFI A;  1YZB A;  4MTX A;  1US6 A;  2B9Z A;  2HHH O;  1DK1 A;  1HP8 A;  2KG7 B;  3W7W A;  3N2K B;  5LGU A;  5ITZ A;  2X6C A;  2UXD O;  4XBF A;  2ZCE A;  4O2A B;  2LFR A;  1CP9 A;  3OUF A;  4KXR A;  4DUZ B;  3CC7 V;  1YHQ V;  5JVD A;  1QQC A;  5CMU A;  2Q8V A;  4KHP O;  3KCX A;  2DW4 A;  1MA1 A;  4PI2 A;  4YJ3 B;  1SA0 A;  2QTO A;  4MSW C;  1EZJ A;  1MOF A;  1EN4 A;  4R8C A;  2P4K A;  4DXW A;  1ZL8 B;  4Z1V A;  1KQS U;  3OEE G;  1ZWI C;  3BA8 A;  3B8M A;  5JCO C;  3DGE A;  5TIS Z;  4JI0 O;  2LW1 A;  1RPR A;  2AZ2 A;  4DR5 B;  5IY5 B;  2PTM A;  2GTA A;  3CXC U;  4UVB A;  4JI8 B;  1R3J C;  1YVW A;  1FXK A;  1ENV A;  5LMU B;  4JYY A;  4X1I A;  1U96 A;  2AHZ A;  4U7O A;  4PD4 F;  1J5E O;  4DR3 B;  3VQX A;  1S72 V;  1BQ0 A;  5ITZ B;  3BA9 A;  3ZHV A;  2W6J G;  1ROP A;  3L73 H;  1H8E G;  4JI1 B;  4PV1 B;  4LWS A;  3SJQ C;  1ARO P;  5EC2 C;  5JVD B;  2YUA A;  1FPO A;  4JF3 A;  3ETQ A;  2DWD C;  5LXT A;  2NNU A;  5KX5 A;  3F5T A;  3ABU A;  5CBH A;  1WNS A;  3OMI B;  4DO2 A;  1VQN V;  4U3F H;  1RM1 C;  3THO A;  1SQF A;  3CE2 A;  4OPA A;  4H44 B;  3X2Q C;  2YI8 A;  5IJ9 A;  3DTU B;  4DV7 B;  3CCQ V;  2E76 B;  3ABM C;  4ZHQ B;  4U3J A;  4DV2 B;  1IBL O;  2EZP A;  2UU9 B;  2EIL B;  1JA8 A;  2IW5 A;  5FNV A;  1Y67 A;  4X65 B;  4WF9 V;  4ABM A;  4UCT A;  5B1O A;  3ZHU A;  1VQO V;  3RWR D;  4WBN A;  4DR4 B;  4LFC B;  3AG7 A;  1Q6H A;  1FJG B;  1HNW B;  5IWA O;  5EZY A;  4PA4 A;  1BL8 A;  4D7S A;  1TGO A;  4WFE A;  5B5E Z;  3UCS C;  2YIB A;  4JI2 O;  2UUA O;  5L3F A;  3CC4 V;  2EIM C;  1Q8I A;  4R50 A;  3JD2 A;  4NTW A;  3WB0 A;  2QR4 A;  2VQF B;  4DV5 B;  5D5P A;  2DMX A;  3BEH A;  1F51 A;  2M7W A;  1TUE B;  1P4R A;  5CB4 B;  3SPH A;  1PM9 A;  1YDX A;  3ML0 A;  4JI4 O;  3Q4H A;  1FFX A;  1KC8 W;  3JAK A;  3SYO A;  2CH7 B;  3E8B A;  1IZ3 A;  5KHI A;  1DTO A;  1PD3 A;  4OGQ B;  5K1X A;  4JV5 O;  3MAQ A;  2ZXW B;  1U97 A;  5FNV B;  5H9C A;  1KP2 A;  1WLE A;  5EBM C;  3OM3 B;  3C3S A;  1FD9 A;  4WBN B;  4GKK B;  3ABT A;  3SR2 C;  1TA8 A;  2WLL B;  3TGU H;  3OE7 G;  4NXM B;  3ZHQ A;  1DF5 A;  2PI5 A;  4KL1 A;  2VS0 A;  1URF A;  2IJI A;  1BQZ A;  5LP6 A;  4DR7 O;  4TV9 B;  4F4L A;  5IT9 N;  5LA6 A;  2VQE B;  2WLI A;  4FLV A;  1NI8 A;  1OCC B;  4DR6 O;  1GN4 A;  4HBN A;  1FFX B;  4FM1 A;  1NTK H;  1B3Q A;  4O4H B;  1R6T A;  2EJ7 A;  3AG2 C;  3K5O A;  2XAH A;  2HG5 C;  1DLB A;  1BCC H;  2HVK C;  1FFT B;  3CCR V;  2XAQ A;  4LBE C;  2D3O W;  3K57 A;  1AIL A;  1QU7 A;  5B1A B;  4GX5 A;  4FIP C;  1N34 O;  1P49 A;  3K9A A;  1PNM A;  3EHB B;  4K0K O;  2HLD G;  1VQ7 V;  2Q73 A;  2CDY A;  4ZOL B;  2Q0O C;  3SYA A;  3ABK C;  2IH1 C;  1F7Y A;  3CS5 A;  1T5E A;  1GK9 A;  5J2U A;  4X89 A;  1FAF A;  5JJJ B;  4NXN B;  4JZ2 A;  4FLX A;  4NYK A;  4YIO A;  3CJH A;  4IYI A;  2JEX A;  2M6Y A;  4WFG A;  1N33 O;  1PNK A;  1K92 A;  1YXB A;  2X6A A;  3ZJZ A;  4JI3 B;  2X6B A;  1SQB H;  4Z1M G;  1Y66 A;  1QLE C;  2K1E A;  4B3M B;  3OTF A;  5LYJ A;  4K8Z A;  1V55 B;  3R66 A;  2LQT A;  2WA3 A;  1N36 B;  1K3E A;  3APQ A;  4J7J A;  4H33 A;  1GN2 A;  3CEI A;  2Y0P A;  1L0N H;  5KA5 A;  4DV3 B;  4AQY O;  4RQE A;  1AR4 A;  2ZIM A;  3RYF B;  2ZDI A;  1P7G A;  4F6R A;  1WPX A;  1FXK C;  1RP3 B;  1CPY A;  3QO5 A;  2WLJ A;  3L70 H;  3OD4 A;  4GT1 A;  1COW G;  4JI6 B;  2UXC B;  4CH5 A;  1HNX B;  4PI0 A;  4K3A A;  5BMV B;  1YF2 A;  4TOI A;  3VQY A;  5BR8 O;  2Q68 A;  3CYO A;  3M7M X;  2BTO A;  3IC9 A;  3IJ4 A;  1VF7 A;  1Q6I A;  2GV9 A;  3VQW A;  3ETE A;  4BWA A;  4JZG A;  4TWK A;  3ZRS A;  2C2A A;  3T4Z A;  5LYJ B;  4TT3 G;  4IHJ B;  1G6U A;  1ZLZ A;  1H2S B;  2UXD B;  1VMG A;  4PEL A;  5CA0 B;  3BY6 A;  2JIZ G;  1W59 A;  1M4U A;  2P22 C;  4HNA A;  1NBM G;  4B3S O;  4KHP B;  3NXS A;  3OAA G;  4LF4 O;  3HKD A;  4F6R B;  2GTS A;  3ZCC A;  3FAV A;  1AR5 A;  2ZXW C;  3E83 A;  3PJS K;  5LHI A;  5DED A;  4DV4 O;  1Q7Y W;  3DC6 A;  1SZT A;  3M99 B;  1RSO A;  5EBL C;  2Z3Y A;  4TUY A;  1XI1 A;  1L0L H;  1H2L A;  2F93 B;  4G27 B;  4I55 A;  1THZ A;  4UCR A;  5KHJ A;  1J5E B;  1SQV H;  1AP5 A;  2A7W A;  2CTR A;  3HKC A;  1R3L C;  2EIJ B;  1AP6 A;  3CXH F;  1JQ0 A;  2QKC A;  3FD9 A;  3N2G B;  5KMG A;  3RYC B;  1XNQ B;  4XDL A;  2XUM A;  5CBG A;  1MSD A;  1WA8 A;  3HPL C;  5BY1 A;  2BSK B;  3ABL B;  4ZI7 B;  5FLX N;  1NKD A;  3AK2 A;  4U7N A;  2WAM A;  3HKD B;  1AI7 A;  2F4V O;  2JJ2 G;  1XQ8 A;  3P3N A;  4JYA O;  3GWO A;  4LFA B;  2DWE C;  1YTF B;  1AVM A;  3SPI A;  3LSU A;  4JYB A;  2N05 A;  5JH7 A;  3ZMZ A;  1I7F A;  1RSO B;  1NTM H;  3ZX6 A;  3X2Q B;  2YXL A;  1XBL A;  2BTQ B;  2ZR2 A;  3FYE B;  1WJZ A;  1YEW A;  1SES A;  4IYH A;  1V9P A;  3LDD A;  3RFR A;  3CCJ V;  1RPO A;  1LNQ A;  1IBL B;  2AXT Z;  1JFF B;  5LP6 C;  2NLJ C;  1WPB A;  2L35 A;  2UUC O;  1TVK A;  2QWN B;  3WB2 A;  2DOS A;  3RYH B;  3BRC A;  5KAF Z;  3CME V;  4B3T O;  1F4M A;  2DYR C;  5IWA B;  1WAZ A;  1R73 A;  4IIJ B;  2YIB D;  4JPR A;  4O4I A;  3JSL A;  3JAL B;  2ZE6 A;  1EZV H;  3CMA V;  1Q5O A;  4JI2 B;  2QWP B;  4I4T A;  3AK1 A;  4I50 B;  4PA6 A;  3ZN0 A;  2W6I G;  3HKE A;  2QEX V;  4IL6 Z;  2Q67 A;  4LF5 O;  3ZS8 C;  1OZ0 A;  3CCM V;  2QA4 V;  3HKB A;  4XDK A;  3I5D A;  3RT3 C;  5C8Y B;  1R1B A;  5IYZ B;  2P4V A;  4LP8 A;  3CP1 A;  2P5O A;  3UT5 A;  1H2G A;  5L3E A;  3A0R A;  4IGG A;  3ZRV A;  1TUB B;  1M57 C;  1K97 A;  1KB9 F;  4JV5 B;  1ZX3 A;  4RWU A;  1G4Y B;  4UXN A;  4D6T H;  4X20 A;  2JS5 A;  2GUZ A;  4R7C A;  4PHZ A;  4UV9 A;  1IVS A;  4LNU A;  4DV6 O;  4NVP A;  2Z0A A;  4DK0 A;  3LSQ A;  1SS3 A;  2GSM B;  1GRJ A;  1E1Q G;  2XAG A;  1Y74 A;  3ZMV A;  1G1X B;  3OR7 C;  1Q86 W;  1AJN A;  2E5L O;  2F23 A;  1GM7 A;  4QPK A;  4I4T B;  3HKE B;  4JI5 O;  1K34 A;  1XNR O;  1AJQ A;  3JAW A;  3P30 A;  4DW0 A;  3HKB B;  3P3P A;  1AR1 B;  2Y4U A;  2ZIO A;  2HKO A;  3JAS B;  3SYC A;  4IT5 A;  1R6K A;  1K4C C;  4DR6 B;  1NZ6 A;  1HR0 O;  1KP3 A;  3ZRW A;  1Y76 A;  2ZDI C;  5E79 Z;  4BIU A;  4JAV A;  3MHH C;  3A8T A;  5IE9 A;  3AG2 B;  2Y69 C;  2E74 B;  4EFB A;  2ADQ B;  2NR5 A;  3DC5 A;  3F7Y C;  2OCC C;  2Z5U A;  4FZ0 A;  4YXW G;  3JAT B;  1VF6 A;  2WLK A;  4KP4 A;  1N34 B;  4FVM A;  1NR7 A;  2RNB A;  2YXH A;  1Y74 B;  1BGY H;  1JMK C;  3A0H Z;  3GWK C;  5L3C A;  2NN4 A;  3ABK B;  2D2C B;  1BHA A;  4MTG A;  2IBZ H;  4OXS A;  2QWQ B;  2EIJ C;  4N23 A;  4DR1 O;  1VQ9 V;  3ASN B;  3JAW B;  1HNZ O;  1L8D A;  3JAR A;  3ABL C;  2OT5 A;  3NR7 A;  3G80 A;  5LOV A;  2AZ0 A;  3SPJ A;  3BHP A;  3J7A U;  3JSN A;  1IBM O;  3RGB A;  3K9S A;  1R3K C;  3ZRW B;  1VQL V;  2LGQ A;  1SA0 B;  1QLE B;  4KFM A;  1YSC A;  4ICG A;  1QVG U;  5EIB C;  1W2B U;  2UUB O;  1JOY A;  1GM9 A;  1AI5 A;  1OCR B;  1QCE A;  3KKY A;  2ZNI A;  4PDV A;  2YDE A;  2OIG A;  1D5N A;  4AQY B;  4DR2 O;  5H2F Z;  2OWO A;  1FYJ A;  1VAR A;  4QGP A;  3WU2 Z;  1FXK B;  3K0G A;  4X1I B;  5EBW C;  4YHH O;  4J11 A;  4BW5 A;  5J2T A;  1XMQ O;  3G6B A;  3ICX A;  4TV8 A;  2ZM6 O;  4RO2 A;  5L3B A;  4X1K A;  5JJN B;  4LFB O;  3QG5 A;  4LF6 O;  4LWS B;  4O2B A;  3W7U A;  3K5M A;  5LHH A;  3U11 A;  2F1M A;  1B06 A;  4GLX A;  5LOV B;  1I0H A;  2H94 A;  2BE3 A;  5LXT B;  3TET A;  2OTJ V;  3CCU V;  5KX5 B;  4JAU A;  1YIT V;  3KCY A;  1LUW A;  5H5N A;  4DW1 A;  5FL7 G;  1K73 W;  2WPD G;  1XMO O;  5H6R A;  1BSM A;  3LDE A;  4NR1 A;  1H2N A;  5JQG A;  2DJV A;  1YJW V;  4LF9 O;  2FYU H;  5IJ9 B;  4XDJ A;  3CD6 V;  3JAM N;  3CCV V;  2O57 A;  2JK5 C;  4DV1 O;  4LF4 B;  5DEC A;  3OR6 C;  2ITC C;  4MW8 A;  1YTF D;  4U3J B;  5EIB D;  2XHB A;  2LW7 A;  4UCO A;  2YEV A;  4Z2W A;  2CGO A;  3L75 H;  4LH7 A;  5GON A;  4DV4 B;  2LFS A;  4WFH A;  1YJN V;  1XHZ A;  1WN7 A;  3RW0 A;  5KA6 A;  2ADP A;  1IUR A;  2AHY A;  2LGW A;  1PL4 A;  1QR8 A;  1KUQ A;  3CB2 A;  4PA9 A;  5EZY B;  2ZE7 A;  3QF7 A;  2V1D A;  1AI4 A;  2UXN A;  3AK3 A;  1GN6 A;  1ZUQ A;  3OMA B;  2HP8 A;  3E89 A;  1N8R W;  3UO3 A;  2R70 A;  3K3W A;  2XT9 A;  2ZR3 A;  1ZAU A;  4DK1 A;  3D36 A;  1S3J A;  3SYP A;  3P32 A;  5A2Q N;  4NB5 A;  4Q20 A;  3Q4H B;  1KEC A;  3D3Q A;  3UO2 A;  3JAK B;  3R65 A;  4PJ0 Z;  4WFA V;  3VOU A;  3B77 A;  2XAS A;  2EIK C;  2YEV B;  5L3D A;  4JYA B;  1RFY A;  3TXS A;  4PDM A;  4A5U B;  1SET A;  2ITD C;  4EEQ A;  3E86 A;  1NS1 A;  3TXQ A;  3BAB A;  1Q6U A;  2JGD A;  3H1L H;  1SKV A;  4NTY A;  2WLN A;  1OCO B;  4EB6 A;  4FM2 A;  2Q9L A;  1E1R G;  2XOK G;  4DR5 O;  1E79 G;  2HEP A;  3VBB A;  3JD1 A;  5LP6 B;  2HJF C;  1AJP A;  1EM1 A;  2DN9 A;  5LGN A;  2UUC B;  3ASN C;  3BVO A;  1N4C A;  5LA6 B;  1M90 W;  1O9G A;  2R9R B;  2EIN C;  1Q82 W;  2WLI B;  4BIZ A;  2DYR B;  4B3T B;  2YI9 A;  4X64 O;  1M56 C;  2QTS A;  3DSQ A;  2N74 A;  1NJI W;  5H6Q A;  1VIB A;  4MVR A;  4JI1 O;  4CH4 A;  1PNL A;  3UKM A;  4LF8 O;  4LF5 B;  3K03 A;  4GUN A;  1GTO A;  1OCR C;  2X0L A;  2PY5 A;  3S3X A;  1H38 A;  4JYC A;  1VF6 C;  2PGG A;  3QO8 A;  4DV0 O;  4RUF A;  2Q6A A;  4GKJ O;  3OTO B;  1M57 B;  2F95 B;  3BFR A;  1R6N A;  3DXR A;  3LNM B;  5IYB O;  3G71 V;  2AGA A;  4AHC A;  3RBZ A;  5J2U B;  2OTL V;  5EYP A;  3D3I A;  2EZO A;  3K58 A;  2BOB C;  4D7T A;  2KQX A;  3CJH B;  3C90 A;  4X62 B;  2UU9 O;  4FLY A;  3ZIA G;  5KLV H;  3LNN A;  1I94 O;  2R9A A;  4FFB A;  4AIL C;  2IH3 C;  1SQP H;  3S3W A;  1ZSP A;  4J42 A;  2HHH B;  1FJG O;  1HNW O;  4JTD B;  2RJZ A;  4HZ3 A;  1XNR B;  4I0X A;  2GDS A;  5B3S B;  4H0L B;  1NU1 H;  4FPP A;  3FKS G;  4BW9 A;  1HR0 B;  5J9P C;  3SJB C;  3B2E E;  4UVC A;  1P7B A;  1NVP B;  4DUY O;  1IBK O;  2LP7 A;  2Y69 B;  2Q7G A;  4BAY A;  3DXR B;  3MD0 A;  4JI0 B;  4P9O A;  2OCC B;  2ZE8 A;  2Q5Z A;  5EYP B;  2JDI G;  1MG1 A;  2QE7 G;  2ZIN A;  1M93 A;  5CA1 A;  2OIE A;  4QNH B;  5CN0 A;  4J41 A;  1Y6X A;  3CRA A;  4HYO A;  2Q7H A;  3B8N A;  1N32 O;  1SER A;  4B7E A;  1JJO A;  3MHS C;  2Q4P A;  1YIJ V;  2QM8 A;  4W4L A;  1EBO A;  2H3O A;  1XL4 A;  5JWP A;  5FPR A;  4DR1 B;  1H2K A;  4X88 A;  4NXM O;  3FYI B;  1GKF A;  3ZN1 A;  1HNZ B;  2QM7 A;  2G38 A;  1BMF G;  1LR1 A;  4LF7 O;  2EBO A;  1SC5 B;  4HNA B;  1QR9 A;  4YJ2 A;  2QM4 A;  4EFE A;  1QLN A;  1CXZ B;  5KAI Z;  1IBM B;  4CS3 A;  3FAV B;  4JTA B;  1Q43 A;  4O4J A;  2PYJ A;  1K4D C;  3G6E V;  2QGN A;  1S77 D;  4H37 A;  4WFF A;  2HVJ C;  1NR1 A;  3ETD A;  1OCZ C;  1O9H A;  2OCH A;  2UUB B;  4O4L A;  3G4S V;  1X4T A;  2CTW A;  1BT8 A;  1HWY A;  1Y4M A;  5IJ0 A;  4TQD A;  3E2E A;  4TUY B;  5LL6 Y;  2XTA A;  2ODM A;  1GAX A;  2JEU A;  1OCO C;  3AG4 B;  4NTX A;  1S5L Z;  4I55 B;  4ASU G;  4YHH B;  1Z5W A;  2ARH A;  1XMQ B;  1SRY A;  4Q6G A;  1PV0 A;  1M5I A;  3HKC B;  3OMN B;  1K5S A;  2AW9 A;  4MT8 A;  3D36 C;  5EC1 C;  5KMG B;  1SQG A;  2UXB O;  3VQV A;  1WA8 B;  2ETN A;  2ILM A;  3T1H O;  3WG7 B;  3ZBH A;  2UUA B;  2DE0 X;  3D8C A;  5F2V O;  2A9H A;  5CBF A;  2FKX A;  3E22 A;  1KYO F;  1ORQ C;  2YIC A;  3WFV A;  1XMO B;  5JH7 B;  4JI4 B;  5B1B C;  3E35 A;  2W0X A;  4MW3 A;  2KG7 A;  1VP7 A;  2BCC H;  4FJC C;  4LF9 B;  4CH3 A;  4FM0 A;  2GHY A;  2QDO A;  4P30 A;  1N0J A;  4O2A A;  4QE9 A;  4JI7 O;  1NT2 B;  4CH6 A;  4DV1 B;  1S5H C;  1I5Y A;  3CHX A;  4GZR B;  3T1Y O;  5GTH Z;  2MK3 A;  4X66 O;  4JAA A;  5GW7 A;  3WB1 A;  1KMI Z;  1TVK B;  4L87 A;  4UV8 A;  2ZD9 A;  2QJ1 A;  3GB7 C;  4B7K A;  1EFR G;  5B66 Z;  1ZL8 A;  4TSF G;  1WB7 A;  4BR6 A;  3ZHT A;  4O4I B;  2K9P A;  3KG2 A;  3B09 A;  4OX9 O;  2LO1 A;  1CEZ A;  1OV9 A;  4JTC B;  5IYD O;  4DR7 B;  1SQX H;  4OPH A;  1H2M A;  5LMN O;  4FLU A;  1MSW D;  2HJD A;  1JX9 A;  3B4S A;  3SJC C;  1FKA O;  2RMK B;  1GN3 A;  3H1K H;  5B3S C;  3CWB H;  1VQ5 V;  3UT5 B;  3L74 H;  3G67 A;  2OYQ A;  2XAF A;  2B5U A;  2KKW A;  3ZHS A;  3ZRX A;  4B08 A;  4QJF B;  4CS2 A;  3IAY A;  5KHK A;  2F43 G;  2EIK B;  2R72 A;  4X20 B;  1GMG A;  2GUZ B;  2ZQM A;  3A0B Z;  1MZF A;  2VRZ A;  4PDL A;  4LNU B;  2F66 C;  3EFF K;  5KUK A;  1MZE A;  4K0K B;  3L72 H;  2RN9 A;  3EXA A;  2P90 A;  1VQK V;  2JS3 A;  5KHH A;  2CTP A;  3K0D A;  3AG1 B;  4RQF A;  4ZHQ A;  1UJW B;  2EIN B;  2QWO B;  1DGS A;  4LCU C;  4QE7 A;  1PL0 A;  1OJH A;  2QKS A;  4GCZ A;  1N33 B;  3CX5 F;  3QVN A;  4GYC B;  4P9P A;  1M56 B;  1V54 C;  4X64 B;  3W7S A;  2KSD A;  1Y76 B;  4UCU A;  4DYL A;  2PUS A;  1S0V A;  1QBZ A;  3APO A;  4YY3 O;  4DRX A;  3SYQ A;  1XNQ O;  3HB3 B;  4LF8 B;  4HAM A;  4MTF A;  5L3G A;  3OGC C;  5EK0 A;  4TQF A;  3UM7 A;  2IJJ A;  2A3Q A;  2JVD A;  5K1P A;  1R3I C;  5A9G A;  3QTC A;  4J80 A;  4PA3 A;  4PDR A;  2IU3 A;  1VQM V;  1NVP D;  5GTI Z;  2YXY A;  1S5J A;  1AI6 A;  4DV0 B;  4LFA O;  5CB4 A;  3AG4 C;  4GKJ B;  4I9W A;  3H1I H;  1BS3 A;  1KU9 A;  1XL6 A;  1Q3E A;  1XHX A;  1BZK A;  3IGA C;  2ZKO A;  4QIW F;  3TK1 A;  1OHH G;  2CH7 A;  4MVO A;  3T1C A;  2KB1 A;  1QNM A;  3FX7 A;  4UFZ A;  5BR8 B;  2CGN A;  3JAR B;  1S76 D;  2RQ6 A;  5D5Q A;  1I94 B;  3WG7 C;  3QNE A;  4FLW A;  2JRI A;  1AB3 A;  5BXZ A;  2A79 B;  4RUE A;  1J95 A;  3HR0 A;  3JCZ A;  1L1F A;  1EN5 A;  4DRX B;  4MS2 A;  2WLL A;  1XIL A;  3ASO B;  4FMT A;  4UUJ C;  3OFN G;  2YID A;  3H1J H;  3AG3 B;  3LSS A;  3O9O A;  4WCE V;  2E75 B;  4B3R O;  4TV9 A;  3IC7 A;  5AG2 A;  4FZ1 A;  2IU0 A;  4B3S B;  1EN6 A;  3CCL V;  2H8P C;  2ATK C;  4DUY B;  2MW2 B;  1IBK B;  2PYL A;  3SGI A;  5J2T B;  4TV8 B;  3STL C;  2WA4 A;  1PKX A;  1ZTE A;  4C7U A;  2A06 H;  4X1K B;  2PI4 A;  4O4H A;  2E3C A;  4AI8 A;  1IXM A;  1K8A W;  4UB8 Z;  1NH2 D;  1W0J G;  4O2B B;  3CC2 V;  1H8H G;  2N04 A;  2EX3 A;  4E2L A;  1SQQ H;  3A2F A;  3RYI A;  1N32 B;  2Q0A A;  4NKG B;  2HFE C; 
#chains in the Genus database with same CATH homology
 4N21 A;  2P6J A;  3FB7 C;  1VQ4 V;  2WLH A;  2IH3 C;  2YSU B;  3CME V;  1S72 V;  1F4M A;  2DYR C;  1R73 A;  2Y48 A;  4JPR A;  4JTD B;  4MVS A;  3SPC A;  2W6J G;  1ROP A;  3CMA V;  1VQ8 V;  1H8E G;  3SJQ C;  4ZKI A;  1ARO P;  4HZ3 A;  5EC2 C;  4PA6 A;  2QEX V;  3ZN0 A;  2W6I G;  2Q67 A;  2B1I A;  5B3S B;  4FPP A;  4JF3 A;  1OZ0 A;  3FKS G;  3CCM V;  2QA4 V;  4XDK A;  1KKD A;  2DWD C;  5J9P C;  3IFX A;  4UVC A;  1P7B A;  4LP8 A;  3T4D A;  2NNU A;  3CP1 A;  1NVP B;  3ABU A;  3E8H A;  1H2G A;  1OCZ B;  5CBH A;  3OMI B;  5L3E A;  2LP7 A;  1JPX A;  2Y69 B;  3JD0 A;  5KUM A;  4BAY A;  4DO2 A;  3A0R A;  1VQN V;  3MD0 A;  2X7R B;  1RM1 C;  3ZRV A;  1K9M W;  2P7T C;  1M57 C;  3E8G A;  4P9O A;  3LDC A;  1K97 A;  2OCC B;  3X2Q C;  3ZMT A;  1G4Y B;  4UXN A;  2JDI G;  1MG1 A;  2QE7 G;  3DTU B;  3CCQ V;  4R7C A;  4QNH B;  4QPJ A;  3ABM C;  4J9Z B;  5CN0 A;  2DYS B;  5IY5 C;  3AG1 C;  4UV9 A;  2EZP A;  1YJ9 V;  1MAB G;  2EIL B;  3F5W C;  2IW5 A;  4HYO A;  3B8N A;  1K5Q A;  1W0K G;  4WF9 V;  3LSQ A;  2GSM B;  4R6Z A;  1SER A;  1E1Q G;  2A0L A;  3MHS C;  1YIJ V;  2XAG A;  2QM8 A;  1EBO A;  5B1O A;  4GX2 A;  1VQO V;  3ZMV A;  1JVM A;  1XL4 A;  3OR7 C;  1Q86 W;  1AJN A;  2UXX A;  2JJ1 G;  4X88 A;  3FYI B;  2WWW A;  3QO7 A;  4PA4 A;  1GKF A;  1GM7 A;  3ZN1 A;  4QPK A;  1VQ6 V;  1BL8 A;  2QM7 A;  1BMF G;  4WFE A;  1K34 A;  3ZMU A;  1AJQ A;  3K79 A;  5L3F A;  2EBO A;  3CC4 V;  1QR9 A;  2EIM C;  3P30 A;  4R50 A;  2R9I A;  1AR1 B;  3JD2 A;  1QLN A;  1F23 A;  2HKO A;  4GX0 A;  3SYC A;  5B1N A;  1JCH A;  1R6K A;  3BEH A;  1F51 A;  1K4C C;  4JTA B;  2M7W A;  1TUE B;  1P4R A;  4LC1 A;  4MVM A;  3SPH A;  1KP3 A;  4GX1 A;  5B1B B;  3ZRW A;  1K4D C;  2ZDI C;  3G6E V;  3W7T A;  1S77 D;  4H37 A;  4WFF A;  2HVJ C;  1NR1 A;  4BIU A;  4JAV A;  3ML0 A;  3ETD A;  1OCZ C;  5LBQ A;  3MHH C;  5E1A C;  3AG2 B;  3G4S V;  1KC8 W;  3SYO A;  2Y69 C;  1HWY A;  2IJH A;  1Y4M A;  3E8B A;  1VQP V;  3E2E A;  1DTO A;  1PD3 A;  5LHG A;  2JEU A;  2OCC C;  2Z5U A;  3F7Y C;  1OCO C;  2ZXW B;  4YXW G;  3AG4 B;  2W0F C;  3K08 A;  2WLK A;  4KP4 A;  3E8F A;  4ASU G;  3T2M A;  5H9C A;  1KP2 A;  1WLE A;  1NR7 A;  1SRY A;  2EIL C;  5EBM C;  3SPG A;  3OM3 B;  1M9N A;  3OMN B;  5HFL A;  2IJK A;  1K5S A;  4MT8 A;  5L3C A;  3ABK B;  3ABT A;  2WLL B;  3OE7 G;  1BHA A;  4MTG A;  5EC1 C;  4OXS A;  2WLM A;  2EIJ C;  4N23 A;  1VQ9 V;  1DF5 A;  3TCU A;  2PI5 A;  3ASN B;  1FS0 G;  5DN6 G;  3ASO C;  2IJI A;  3WG7 B;  4G2K A;  3RVZ A;  3AG3 C;  4MVU A;  3ABL C;  4WFB V;  2OT5 A;  4F4L A;  2A9H A;  5CBF A;  3SPJ A;  1R3K C;  1ORQ C;  2WLI A;  3ZRW B;  3I55 V;  1VQL V;  1OCC B;  1QLE B;  2XND G;  4I5S A;  3WFV A;  4KFM A;  1YSC A;  5B1B C;  3E35 A;  1QVG U;  4MW3 A;  4UVA A;  4FJC C;  1W2B U;  1JOY A;  3JD4 A;  4JAS A;  1GM9 A;  1AI5 A;  1OCR B;  1QCE A;  2GHY A;  4PDV A;  3AG2 C;  4QE9 A;  4P30 A;  4CBC A;  2XAH A;  2HG5 C;  1NQT A;  1DLB A;  1K33 A;  1S5H C;  1I5Y A;  2HVK C;  1FFT B;  3CCR V;  2XAQ A;  4LBE C;  5HFM A;  2D3O W;  2MK3 A;  2P67 A;  5CA3 A;  3W7X A;  1FXK B;  3K0G A;  4X8A A;  5B1A B;  5GW7 A;  4GX5 A;  2EJR A;  5EBW C;  4FIP C;  4BW5 A;  4L87 A;  4UV8 A;  2ZD9 A;  3JYC A;  3FB6 C;  3GB7 C;  3K9A A;  1PNM A;  4RO2 A;  3EHB B;  2HLD G;  1EFR G;  1VQ7 V;  4TSF G;  5L3B A;  1K7D A;  3SYA A;  3ABK C;  2IH1 C;  3JD3 A;  1GK9 A;  3KG2 A;  2HR3 A;  4P2Z A;  1CEZ A;  4X89 A;  4JTC B;  1Q81 W;  3W7U A;  5IYD O;  5LHH A;  3K04 A;  2JEX A;  1FXH A;  1V54 B;  4WFG A;  1MSW D;  2BOC C;  1JX9 A;  2H94 A;  1JJ2 U;  1YI2 V;  5IDJ A;  3TET A;  2OTJ V;  3CCU V;  1VQ5 V;  4JAU A;  5B3S C;  1YIT V;  1PNK A;  2XAF A;  1K92 A;  2X6A A;  3H01 A;  5FL7 G;  3ZJZ A;  2B5U A;  2X6B A;  4EKW A;  4MVZ A;  1K73 W;  4Z1M G;  1Y66 A;  3ZRX A;  1OCC C;  2WPD G;  1QLE C;  2K1E A;  1V55 B;  5H6R A;  3LDE A;  1DF4 A;  4QJF B;  1K3E A;  1G8M A;  2V7Q G;  1YJW V;  2F43 G;  2EIK B;  4H33 A;  4XDJ A;  2DQ0 A;  4MTO A;  3CD6 V;  3CCV V;  2XAJ A;  1BHB A;  1GMG A;  2JK5 C;  2ZQM A;  3OR6 C;  2ITC C;  4MW8 A;  3ZMS A;  5KA5 A;  1YTF D;  4PDL A;  4RQE A;  3RVY A;  1NH2 B;  2YEV A;  3K06 A;  2ZDI A;  1WPX A;  1FXK C;  1RM1 B;  2DYS C;  3EFF K;  5B1A C;  5IYC O;  2FTK A;  1CPY A;  3QO5 A;  3FB8 C;  2LFS A;  4FK5 C;  4WFH A;  2WLJ A;  5KUK A;  1YJN V;  1KD1 W;  4ZBM A;  3RW0 A;  4GT1 A;  3CCE V;  5KA6 A;  1COW G;  2AHY A;  2P90 A;  1VQK V;  1QR8 A;  3LUT B;  2CK3 G;  4PA9 A;  3K0D A;  3ABM B;  3AG1 B;  1GM8 A;  2V1D A;  1AI4 A;  2UXN A;  2DQ3 A;  4RQF A;  3OMA B;  3E89 A;  3FB5 C;  1N8R W;  2Q68 A;  5BZB A;  1UJW B;  3CYO A;  2EIN B;  2WSS G;  4LCU C;  4QE7 A;  1PL0 A;  1I5X A;  2QKS A;  4GCZ A;  3K3W A;  5C93 A;  3ETE A;  2Q69 A;  2ZR3 A;  4TWK A;  4P9P A;  1M56 B;  1V54 C;  3ZRS A;  3D36 A;  1S3J A;  3W7S A;  2C2A A;  3OUS A;  3SYP A;  3P32 A;  3CPW U;  3AEI A;  3T4Z A;  4TT3 G;  4Q20 A;  1QBZ A;  1S0V A;  4J9Y B;  1KEC A;  3SYQ A;  3HB3 B;  2B1G A;  2EIM B;  1GO3 F;  4HAM A;  4MTF A;  5L3G A;  1V55 C;  3OGC C;  3R65 A;  1F4N A;  5EK0 A;  4PEL A;  3UM7 A;  3BY6 A;  4WFA V;  2IJJ A;  3VOU A;  2JIZ G;  1R3I C;  3B77 A;  4PA3 A;  2XAS A;  1NBM G;  2EIK C;  2YEV B;  4MVQ A;  5L3D A;  4PDR A;  5LGT A;  2IU3 A;  1VQM V;  1NVP D;  4G28 B;  3NXS A;  3OAA G;  3OW2 U;  1AI6 A;  3ZCC A;  4PDM A;  1SET A;  2ITD C;  1B6Q A;  2ZXW C;  3AG4 C;  4RAI A;  4I9W A;  3E83 A;  3E86 A;  3PJS K;  5LHI A;  1XL6 A;  3OEH G;  3F7V C;  1Q7Y W;  3IGA C;  1SZT A;  4QIW F;  3TK1 A;  4JGS A;  3M99 B;  1OHH G;  5EBL C;  3CCS V;  2WLN A;  1OCO B;  4MVO A;  3STZ C;  3T1C A;  1QVF U;  2KB1 A;  3ETG A;  2Z3Y A;  5DM6 V;  1E1R G;  2XOK G;  1E79 G;  1M1K W;  3VBB A;  3JD1 A;  2HJF C;  1AJP A;  4KUM A;  4G27 B;  3I56 V;  5LGN A;  1THZ A;  1S76 D;  4PA7 A;  3ASN C;  1M90 W;  1FXV A;  3WG7 C;  4CZZ A;  2R9R B;  3QNE A;  2EIN C;  1Q82 W;  2WLI B;  4BIZ A;  2DYR B;  2A79 B;  4RUE A;  1R3L C;  2EIJ B;  1J95 A;  1M56 C;  1JQ0 A;  3JCZ A;  4MTX A;  1L1F A;  4MS2 A;  2WLL A;  4FMT A;  3ASO B;  4UUJ C;  3W7W A;  3OFN G;  4XDL A;  1NJI W;  5CBG A;  5LGU A;  5H6Q A;  3AG3 B;  2X6C A;  3HPL C;  4MVR A;  4XBF A;  3ABL B;  3LSS A;  1PNL A;  3UKM A;  2LFR A;  4WCE V;  1CP9 A;  3OUF A;  1NKD A;  4U7N A;  3K03 A;  3IC7 A;  3CC7 V;  2WAM A;  1YHQ V;  1GTO A;  1OCR C;  2X0L A;  2IU0 A;  1AI7 A;  3CCL V;  5CMU A;  1H38 A;  2H8P C;  2ATK C;  2JJ2 G;  4JYC A;  3GWO A;  2DWE C;  1YTF B;  2DW4 A;  3QO8 A;  3SPI A;  4RUF A;  2QTO A;  4MSW C;  4JYB A;  2Q6A A;  1EZJ A;  3STL C;  1MOF A;  1M57 B;  4R8C A;  3ZMZ A;  4DXW A;  1PKX A;  1KQS U;  3OEE G;  1ZWI C;  3B8M A;  3X2Q B;  1R6N A;  2PI4 A;  3LNM B;  3DGE A;  1IXM A;  1RPR A;  5IYB O;  1K8A W;  2ZR2 A;  3G71 V;  1NH2 D;  3FYE B;  3RBZ A;  1SES A;  5IY5 B;  1W0J G;  2OTL V;  3LDD A;  3CC2 V;  1H8H G;  3CCJ V;  1RPO A;  1LNQ A;  3CXC U;  3D3I A;  2EZO A;  4UVB A;  2BOB C;  4E2L A;  1R3J C;  1FXK A;  1ENV A;  2NLJ C;  3ZIA G;  2AHZ A;  4U7O A;  2HFE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...