1DF5A

Interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
68
structure length
68
Chain Sequence
b'SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
publication title Interactions between HIV-1 gp41 core and detergents and their implications for membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 24
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1df5A00
2X7RB 3H01A 1I5XA 4FK5C 3CP1A 1DF5A 2OT5A 2P6JA 3MHSC 3CYOA 5H9CA 1K33A 1Y66A 5HFLA 3GWOA 5HFMA 1EBOA 1QR9A 3P30A 2EZPA 4N23A 5CMUA 1JPXA 3K9AA 3B8NA 1QCEA 4JF3A 1MOFA 3MHHC 4FJCC 1ENVA 5CN0A 4FIPC 3M99B 3B8MA 2EZOA 1QR8A 4E2LA 1DLBA 1DF4A 2EBOA 1I5YA 1MG1A 5KA6A 1JQ0A 1Y4MA 2M7WA 4JGSA 2LP7A 5KA5A 3B77A 4G2KA 1QBZA 1K34A 4N21A 2MK3A 3WFVA 1SZTA 1F23A 4JPRA
chains in the Genus database with same CATH superfamily
2Q67A 4JV5B 2UXBB 2HHHB 1MSDA 4FLTA 3DC6A 3QVNA 1ZWIC 5FL7G 2LJ2A 2H94A 1FXKB 2QR4A 4OPAA 5LP6B 2ZNJA 1X59A 4DUYO 4AHCA 4ZKIA 5BMVB 1N32B 2Q0OC 1ZL8B 2Y0PA 5DN6G 1VQ8V 4XBFA 4B3RB 2WLIB 1H2LA 3OEHG 3UCSC 3RYFA 3WB2A 4GT1A 5B66Z 1M90W 2UXXA 3ASNB 3E83A 3JSNA 4TV9A 3MHHC 2V1DA 4JYCA 1K8AW 2F43G 5IYBO 4NVPA 2YXYA 2YXHA 3ZRSA 3W7WA 1Q8IA 1FFXA 4J7KA 1JMKC 5E79Z 5IWAO 2EILB 3SPHA 5JVDA 3APOA 3ABMC 1OCZB 1XQ8A 4WCEV 1XL6A 2GUZB 5LGTA 3WB1A 5J2UA 4IIJA 3SGIA 3SR2C 2QKCA 4HNAA 3A8TA 1DF4A 3H1LH 2JJ1G 3RYIB 5CB4B 3NR7A 3B4SA 2W6JG 1LUWA 4LF5O 3KKYA 5LYJA 4NYKA 1XNQO 2ITDC 4DR6B 5KLVH 3QNEA 3ZS8C 1QVGU 4JYAO 1ROPA 2YI9A 3K9SA 4JAUA 1VQNV 4DV3B 4B7KA 3HKBB 1MZEA 3JASB 2DN9A 1E79G 2KB1A 2P6JA 2K1EA 3IAYA 2IH1C 3WG7C 2Y69C 4P9OA 4LF9B 2A06H 4KXRA 1TA8A 1NI8A 2XNDG 4X65O 5DECA 1TUEB 4NTYA 1BS3A 1QU7A 4J41A 3CCMV 4JI2B 4JI1O 3GVMA 2N05A 4X64O 2XUMA 4O4LB 1N36O 1K4CC 1HNXO 4DV6O 2LQTA 2F95B 4MVOA 4P30A 3UO2A 4FLYA 2DYSB 3ZRXA 1R6NA 3K79A 2JGDB 4KHPB 2ZM6B 2R9AA 2UU9B 2FMLA 5EC1C 3SJAC 4O2BA 5BZBA 1ZX3A 4NXNO 3OT7A 1GO3F 5JJEB 2QKAA 3ABUA 5JCOC 2UUCB 3FX7A 3CP1A 4U7OA 3ZHRA 2B9ZA 1K92A 1AI6A 4TUYA 3OMNB 2UXCB 4DR2B 2UXDB 4MTGA 1JJOA 2EBOA 5FNVA 3SYAA 3K58A 3ABTA 5B1NA 4UFZA 4EEQA 5JQGB 1RSOB 1KD1W 3OFNG 4QPJA 2X7RB 3B2EE 3RGBA 2JS5A 3OW2U 1EN5A 5EYPA 3BA8A 2PI5A 4FJCC 2QWNB 1KQSU 3F5TA 2RCVA 3N2GA 3BRCA 1QBZA 3SJCC 1VF6A 2CAZC 3OR6C 2Q7EA 2FL4A 2QWQB 3CX5F 1YCIA 1JCHA 5LA6A 2E5LO 2WLMA 1GN6A 4QGPA 1XMQO 2XT9A 3HPLC 5C8YA 4I5SA 1WNSA 2OCCB 1H2MA 3CHXA 1DK1A 3DXRA 5H5NA 4O4JB 4DV7B 1M93A 4NXMB 4JI5B 3E8FA 2DYRC 1HWYA 1Q7YW 1NVPD 2BOCC 5KHJA 1FAFA 2EIMC 3CYOA 4X20A 2N04A 5KUMA 4B3SO 1NR1A 2BTQB 5IJ9A 3AK1A 2EINC 2Z3YA 2VQFO 3CXCU 1HNWO 2IJHA 1FXHA 5CBFA 2YIAA 3ASOC 3T2MA 1DGSA 1TUBA 4I9WA 3JAMN 2ADPA 4QNHB 4DV1O 4K3AA 2P67A 1I5XA 1V54C 2IU3A 1EN6A 3HKCA 2IH3C 5KHKA 4JAAA 2YC0A 4H33A 1XILA 1D5AA 4P9PA 3ABLB 2CTRA 5KMGA 3CJHA 1ENVA 3UM7A 4AQYB 1AR1B 3ZEDA 3BPZA 3IFXA 1GMGA 4DV2B 4U3JA 1Z2GA 3ETQA 1N8RW 4YXWG 4I55A 3L75H 1A32A 1K33A 4O4IA 4QE7A 1VQ4V 1PPJH 1TAEA 5AG2A 1AB3A 4GKJO 2DMXA 1SS3A 1GN4A 4X1KA 4C7UA 5CA1B 3BABA 4ZBMA 2HKOA 2KQXA 1WA8A 1P7GA 3UT5B 2E3CA 1BCCH 1PL4A 4GX1A 5B1AB 1M57C 4LNUA 3ZHUA 1L0LH 1PD3A 3HKDB 2EIKB 1J5EB 3JAWA 4X1YA 3RWRD 2DQ3A 2PZSA 1IZ3A 4JI3B 3VQVA 4GUNA 4I50A 3QF7A 4MVMA 1T5EA 4PELA 2RNBA 1W0KG 3E89A 3FB8C 2CGOA 2R9RB 1EZJA 3FFQA 5KAIZ 1FYJA 1KKCA 3S3XA 1VQPV 2CGNA 4YHHB 1XUQA 4R7CA 4NKGB 1QVFU 4BW9A 2EZOA 3CCLV 4F4LA 2OWOA 4L87A 4UVBA 3RYCA 2ODMA 3G4SV 4EFEA 2Q7GA 1AROP 2A79B 2YEVB 1PNLA 2OT5A 2GTAA 1Y66A 2QE7G 4YIPA 4DR5O 1VQ6V 4LFBO 3CCQV 2ZDIC 4ZHQB 1JR9A 3OMAB 1IURA 3K5MA 5KHHA 3BCCH 3E22B 4E4EA 4YJ2A 1XREA 4UB6Z 1XL4A 3ZHVA 3QO7A 2G38A 2WLLB 4KL1A 1KMIZ 5IWAB 1JJ2U 1VF6C 2XHBA 5JJNB 1VARA 5LL6Y 4YY3O 1BE3H 3BVOA 1RM1C 4Z1MG 2DWDC 4JZ2A 4JI7O 3OTOO 2FTKA 1M56C 1SQBH 3MHSC 3T4ZA 4DV5O 1Q3EA 2P7TC 3FYIB 4LF5B 2EJ7A 4QPKA 5CMUA 3SYCA 3CCJV 1GN3A 1XNQB 1AJQA 1HNZO 2YXLA 4PDVA 2ZIMA 5B5EZ 1BHAA 4JYAB 1PL0A 3A0RA 4LFAO 1M4UA 1FXKA 3JALB 1HR0O 2XAHA 1WPXA 1CXZB 5BMVA 4XDKA 1JA8A 1ZL8A 1OCRC 4LR3A 1GRJA 3S3WA 2WLIA 1B3QA 1S72V 2JVDA 3SPJA 1FFTB 4DRXB 3FB6C 4IYHA 1I08A 2UUAO 1RPOA 3A0BZ 1YZBA 4JPRA 4WBNB 2XAJA 4AILC 1KU9A 3B40A 4X65B 4MVUA 1MA1A 2Q69A 1BGYH 3ZRWB 2YS8A 3CE2A 3QO5A 1PM9A 5L3GA 1Q6HA 4ABMA 4JI1B 2KG7B 4I4TB 3MD0A 4TV8B 3AG2B 1S77D 2Q4PA 4F6RB 1NKDA 1SQFA 1D5NA 3QG5A 3HKEA 3WB0A 5KAFZ 1YJNV 2QGNA 1N36B 3ZJZA 1VQ5V 2YIDA 1AJPA 2Q9LA 1HNXB 4DV6B 3J7AU 3EVKA 1G6UA 2QA4V 5J2TA 1S76D 1YXBA 3RYIA 1MABG 3AG4B 5CB4A 1JX9A 1N4CA 5JCOA 4FZ0A 5LMNO 4DR1O 2VWJA 3DC5A 1IBMO 2H8PC 1NVPB 2QWRB 1VQOV 3OE7G 3ETGA 3RVZA 3NXSA 4GKKO 4LF8O 5A2QN 2F66C 4J42A 1N0JA 1HP8A 3G6EV 5CBGA 5D5QA 5H2FZ 1KC8W 3H1IH 2JK5C 4XDJA 5IY5C 3ZMVA 2GHYA 1QLNA 4H44B 1PP9H 3Q4HB 4JASA 4AI8A 1GK9A 2WA3A 2R72A 1H8EG 4RQEA 3H1KH 2QJ1A 4N21A 4GX2A 1UJWB 4ZI7B 1M5IA 3ZMZA 2B1IA 1H2KA 1OCOB 2OYQA 1Q6IA 4MSWC 3ABKB 1KB9F 4KUMA 4R8CA 4FFBB 4PDLA 1IXBA 4J10A 1XDCA 1PNKA 4LF7O 5KHIA 2VRZA 1WLEA 4J80A 2ZD9A 3STLC 4LF6O 3U11A 4CZZA 5L3CA 1SRYA 1JPXA 1AP5A 4GCZA 1S0VA 1S5HC 4K35A 5L3FA 2EIJC 1XNRO 2EX3A 2E5LB 4RAIA 2BSKB 2CTPA 4MTXA 3JCUZ 1FD9A 4IHJB 1K5QA 2A0LA 3R65A 2ZNIA 5IYZB 2HP8A 3X2QC 1FS0G 2Z0AA 1Q82W 2GTSA 1E1QG 2JEXA 4B3SB 3SDLA 3TGUH 2WAMA 1XMOO 2VQFB 1IDSA 4PA4A 1HNWB 1D2DA 3EXAA 1B06A 5EIBD 1MSWD 4DV1B 1I0HA 3T1HO 4CS3A 3FAVB 4B3MO 4LWSB 5JH7B 4QE9A 5EZYB 5JQGA 2CTWA 1FXKC 5LP6C 3TXQA 1QQCA 1KP2A 1Y4MA 1WB8A 4DUZO 2ZXWB 2ATKC 4UCVA 2DW4A 2R70A 3H01A 1AI4A 2PTMA 3ZHQA 3ASNC 2PYLA 1CP9A 1VEWA 2CK3G 2NLJC 2ZIOA 4FLUA 5B1BC 4UCTA 1YF2A 2CUGA 3U10A 4DV0O 4GKJB 1BQ0A 3FD9A 3JD3A 4IT5A 3RVYA 4H37A 2MK3A 1V55B 2WA4A 1OZ0A 2EILC 2PUSA 5IT9N 2LGWA 4O4JA 1OCZC 2LFSA 1UFIA 3CEIA 3RFRA 4PDMA 3KCXA 5JVDB 1QLEB 4TWKA 4PI0A 3W7SA 2QSAA 2YICA 5J2UB 2ARHA 2OCHA 5BR8O 2BTQA 4HNAB 1BZKA 2HVKC 4MTFA 2PY5A 1OV9A 2PGGA 3K03A 2YIBA 1YSCA 4EB6A 3LDDA 4Q6GA 1MOFA 3T1CA 3W7UA 4DR4O 4JV5O 3JARB 1ZLZA 2DOSA 2L35A 2XASA 3OGIB 1SC5B 3RYHB 4DK1A 2ZDIA 1LNQA 1M1KW 5HFMA 3ML0A 1Z5WA 4J11A 4K8ZA 1LR1A 2VWKA 1N34O 4DR5B 1MG1A 2GSMB 4O4HB 5J9PC 1ORQC 2LW7A 4LFBB 4CS4A 4JI4O 1YJWV 3L9DA 5EBLC 1VQ9V 3M7MX 5LBQA 1AI7A 5CA1A 1DF5A 1NTKH 3BA9A 4Z2WA 1VMGA 2V4DA 3DSQA 4PA6A 4A5UB 1ZSPA 3AK3A 3M99B 3F7VC 1TVKB 1SQPH 2IJIA 3O9OA 2P5OA 1H2NA 3EHBB 2P4VA 2LW1A 2ILMA 1NZ6A 2XTAA 1P4RA 3D36C 2JJ2G 4KP4A 1XEQA 2L6LA 2DYSC 2AW9A 3JD0A 3OTOB 3D8CA 3ZBHA 2Q8VA 4DV5B 3F7YC 4UCRA 4FLXA 2HVJC 4WFBV 1JFFA 4XDLA 3W7TA 1B04A 2PI4A 1FXVA 2R9IA 2F4VB 1HNZB 1COWG 5EBWC 4ASUG 4DV4O 3GWOA 5B3SB 1YITV 4LFAB 4N23A 1V9PA 4UCOA 4RWUA 1HR0B 2P22C 3SYQA 3STZC 5KX5A 4MVQA 3TK1A 2YEVA 2AHYA 3OGCC 2OTJV 5KA5A 2ZQMA 1P49A 5H6QA 4D7SA 3ZN1A 1Q90D 5FNVB 4ZHQA 1URFA 2E76B 3CD6V 5LOVB 3G71V 2UUAB 3K3WA 3PJSK 3ZMTA 5CBHA 3CMEV 2X6CA 3E22A 3EFFK 3IC7A 3A2FA 2ZKOA 1NTMH 4JTCB 3CMAV 1H8HG 1XHXA 3CRQA 4MT8A 1XOUA 1R73A 4BWAA 1SQGA 5LGNA 1VP7A 4ZOLB 1AJNA 1K34A 3R66A 1YIJV 2ETNA 3L72H 1GTOA 5K1XA 2DWEC 4FK5C 3UKMA 2AZ2A 4DR3O 2Y0IA 4WFFA 2P06A 4NB5A 1QR9A 4L8JA 2Q5ZA 4MW3A 2ZE7A 4B7EA 1EFRG 4OPHA 2OCCC 3PN1A 1KYOF 4BR6A 5L3DA 4WFAV 4K0KB 2M7WA 4DR1B 3SYPA 4UCUA 2HR3A 3ZMSA 5IJ0B 5C8YB 3T4DA 3E2EA 5ITZA 4D6TH 3DTUB 2UU9O 4GKKB 2V7QG 4LF8B 4I0XA 1FJGO 4JI6O 2WLHA 1VQMV 3KZIZ 3JALA 3BHPA 4X20B 5F2VO 1VIBA 2HJDA 4I9QA 4JTDB 3B77A 2HJFC 4W4KA 5IJ9B 4DUYB 2NNUA 2EJRA 2PF4E 3G6BA 3FYEB 4R50A 4DRXA 1TUBB 3CC7V 2E74B 3ABLC 3SYOA 1Q86W 4DR7O 1YEWA 2WLJA 1EM1A 4WBNA 1HW7A 1IBKO 4BIZA 2D3OW 3AG1B 3ZRWA 2F23A 3W7XA 5BXZA 3A0HZ 2O57A 5KMGB 5L3EA 3CJHB 2Q0AA 4LF7B 2KG7A 1Z5VA 3B09A 3P32A 4KFMA 3E8BA 4U3JB 5C93A 4LF6B 4UUJC 2MW2B 2Y4TA 4QIWF 4O4IB 3FB5C 3G80A 1S5LZ 4CH3A 1XNRB 1WN7A 4UB8Z 4X1KB 4PA7A 5B1AC 4J9YB 4D7TA 4JI0O 3AG3B 2ZINA 4B3TO 2XOKG 5LXTB 2A9HA 1WA8B 1K9MW 3CWBH 3JAKB 3SPCA 1GKFA 4LNUB 3JATB 4FM0A 2BOBC 1WB7A 2OTLV 3JAWB 4X1YB 4W4LA 1OCCB 2JRIA 3E8HA 4MW8A 3ZHTA 4F6EA 4RO2A 4TSFG 4JGSA 5GONB 4O2AB 4I50B 1Y6XA 4FVMA 5GTIZ 1OJHA 5LP6A 3P30A 5TISZ 3RBZA 1U96A 5E1AC 1IBLO 4ZI7A 2QM8A 3T1HB 1Y74B 4B3MB 3CRRA 4PA9A 3UO3A 2W6IG 4FFBA 4MS2A 4DUZB 3RYCB 2QKSA 1OHHG 4FZ1A 3K06A 2P90A 4J7JA 5BY1A 1MMMA 2QM7A 1JVMA 3BY6A 1XI1A 2QEXV 4WFHA 4CH5A 4EKWA 3CCUV 1ZTEA 4X64B 1GM9A 2N74A 3F5WC 1MZFA 1M9NA 2DE0X 3FB7C 1P7BA 3SPGA 2GUZA 2UUBO 4DV0B 2RN9A 4NTWA 1WJZA 1KUQA 3P3PA 2JS3A 1R6KA 2BSKA 3ABMB 3AG7A 3E86A 4YJ2B 2AZ0A 2F1MA 3CRAA 1SERA 2JDIG 5IYZA 4K8XA 3OEEG 4X1IB 5LMUO 2AGAA 2BE3A 2ZE6A 3HB3B 2RDCA 3ETEA 1NT2B 4MVSA 4LFCO 3SJBC 2BCCH 4LF4O 4NXNB 3ETDA 5BR8B 4HBNA 1Q5OA 1YI2V 3HKBA 2DQ0A 4PA3A 3K04A 3JASA 3CB2A 1K73W 3AK2A 1FPOA 3H1HH 4CH4A 2ITCC 5L3BA 2WLKA 4LC1A 4X66O 3FAVA 1Y67A 4LWSA 5JH7A 2YIBD 4YHHO 4DR4B 5EK0A 5EZYA 2C2AA 4MVRA 1XHZA 1FKAO 1MNGA 3VOUA 5LGUA 3I56V 3WG7B 1PNMA 4X89A 2Y69B 1GN2A 4WFEA 3P3NA 2VS0A 4PD4F 2XAGA 3LDEA 3LDCA 2A3QA 2Z5UA 1N34B 1EZVH 4O4LA 4IL6Z 4RUFA 1ZAUA 1P84F 1AI5A 4JI4B 4NR1A 4CC5A 4X62O 5B1BB 2RJZA 1R6TA 3AG2C 1ZUQA 2QM4A 3D36A 1BQZA 1F4NA 2JIZG 1XMQB 2ZCEA 4GYCB 2HLDG 5CA0B 2A7WA 4FLVA 4CC6A 1CEZA 2JGDA 3APQA 2W0FC 2CH7B 3HKEB 4TQDA 1U97A 1N0NA 3N2KB 3TCUA 4WFGA 3AG4C 4OX9O 2YDEA 3QO8A 2ZT9B 4JF3A 2YUAA 1N33O 1SQQH 5J2TB 5DEDA 4FPPA 1KECA 4G28B 4ZIBA 1R1BA 5KHGA 1Y76B 2NN4A 5IYDO 4YJ3B 1SA0B 5JJJB 3CS5A 4UVCA 3JARA 3MAQA 3OM3B 3U0ZA 2QWOB 1BT8A 4DV4B 3RYHA 1RSOA 1GM8A 4ICGA 2Y4UA 1SETA 2JGUA 4FLWA 1YDXA 3K59A 4H0LB 1BHBA 1AP6A 4JTAB 4J9ZB 4JI8O 4BIOA 1Q6UA 1IX9A 3OD4A 4X9QA 4O4HA 3BAAA 3O65A 5HFLA 4NTXA 1OCOC 3ABKC 3T1YO 4BW5A 1I94O 1G1XB 1GH6A 3CSXA 5FLXN 1WP8A 3RYFB 3CC2V 1YVWA 4TV9B 1KP3A 4G2KA 1Q81W 2CE4A 5IE9A 4LH6A 2VQEO 2IM9A 1G8MA 5H9CA 1NH2D 1TVKA 1US6A 2X6AA 3JYCA 2Y48A 2Q73A 2AXTZ 4Z1VA 4UV9A 4DR3B 1FFXB 4PJ0Z 1H38A 2ADQB 3LSUA 2GV9A 1WPBA 4UCSA 2RQ6A 1F51A 3LSSA 2QTOA 2JEUA 2DYRB 4GX0A 4IIJB 2EIMB 2X0LA 3AEIA 4B08A 2LGQA 1EBOA 4U7NA 1QCEA 2KSDA 2EINB 2WLNA 1WP7A 5LYJB 1FJGB 1G4YB 3ASOB 4JI6B 2IW5A 3BFRA 4U3FH 1VF5B 1LUVA 4GZRB 3UQ8A 2HHHO 4DYLA 1QNMA 2UXBO 3MDSA 3K5NA 3ZRVA 1F23A 1V54B 1L1FA 3K5OA 5A9GA 1H2SB 2ZE5A 3CCVV 2LO1A 4TT3G 1CPYA 3ICXA 1N32O 1R3JC 5CN0A 4RUEA 3K57A 2FKXA 4B3RO 3VBBA 4GX5A 2OIGA 5LOVA 1W59A 4DR7B 1YTFD 4UV8A 1F4MA 3GWKC 3CCRV 2ZXWC 1IBKB 1UPGA 3B8MA 1S3JA 4FFKA 2PYJA 3JD1A 4ZOLA 3UT5A 4UXNA 4PHZA 3G67A 3HKDA 2ZE8A 3JD4A 1M57B 1R3KC 3H9VA 4YY3B 1RPRA 1O9HA 1V55C 5KUKA 1TGOA 3TXSA 3WU2Z 1XBLA 4FM1A 1NBMG 4JZGA 4JI7B 4P2ZA 4JI0B 4J7ZA 1RP3B 2YSUB 4B3TB 5IJ0A 2HFEC 4FM2A 1I5YA 1QLEC 3TJTA 1IVSA 4PDRA 3K08A 2HEPA 5B1OA 2P4KA 4LP8A 4DR6O 4CBCA 3CC4V 3N27A 4O2BB 3OUSA 3HR0A 5EC2C 2Q7HA 1WAZA 4DV3O 2BTOA 3LNNA 1JQ0A 5GTHZ 3C3SA 4TUYB 4EB6B 1IBLB 2XAFA 1F7YA 4LBEC 1DTOA 4LF9O 1IXMA 4G27B 2DJVA 4FLZA 3JCZA 4RQFA 2YI8A 4DW1A 3RW0A 1SQVH 5EYPB 1SZXA 1BL8A 4JI2O 2WLLA 4WF9V 3CCSV 3WFVA 4Q20A 4MTOA 1GM7A 1H2GA 5JWPA 2D2CB 3N2GB 3QTCA 2UUBB 1NR7A 3K9AA 5GW7A 3B8NA 4DK0A 2ZR3A 1VQ7V 4OGQB 4TQFA 3LUTB 3FKSG 5LXTA 1RM1B 5LA6B 3BEHA 4GLXA 3JAKA 2E75B 5LMNB 5LHHA 1BMFG 3JATA 1M56B 2QTSA 1E1RG 1B6QA 1IBMB 1NTZH 5LMUB 4KHPO 3D3QA 3K5LA 3DXRB 2ZM6O 2WPDG 4I7ZB 5GONA 4LFCB 5LHGA 4LF4B 2X6BA 4O2AA 5FPOA 3IC9A 1J95A 1L0NH 2UUCO 3J81N 2NR5A 2EULA 1PKXA 2GBOA 4X88A 3ZMUA 2UXCO 4DR2O 2F93B 2UXDO 3K0GA 3GB7C 1JFFB 4X66B 1Y74A 3ZCCA 5B3SC 1OCRB 1K7DA 1SESA 2IJKA 3C90A 1R3LC 3H1JH 2B5UA 2OIEA 4X8AA 3HKCB 5IDJA 3SJQC 4HAMA 3TETA 2M6YA 4BIUA 2LP7A 4BAYA 5EBMC 3M8AA 5KX5B 2RMKB 3KG2A 4I4TA 1K4DC 1EN4A 4TV8A 4F6RA 3CRMA 1SKVA 1KKDA 3ZIAG 4FIPC 4I55B 4E2LA 1DLBA 3IJ4A 4X62B 3RT3C 1KBHA 4TOIA 2KKWA 1NJIW 2IU0A 5LHIA 3THOA 1AR5A 5IYCO 2ZR2A 1NH2B 2GDSA 5CA3A 2WWWA 3J80N 2IJJA 4R6ZA 1SQXH 3SPIA 3E8GA 4JYYA 5FPRA 4FMTA 2CDYA 2FB5A 4X1IA 2EIKC 3ZHSA 2EZPA 3CCEV 1QHTA 1S5JA 3LNMB 4DV7O 1R3IC 4NXMO 2H3OA 4DO2A 1AR4A 4JI5O 2XAQA 3OUFA 1NU1H 4HYOA 4H13B 4OX9B 4OXSA 1JOYA 1N33B 3D3IA 4JAVA 1VQLV 1YJ9V 3VQWA 2Q6AA 3L71H 1AVMA 3DGEA 1Q43A 3Q4HA 4HZ3A 3RN4A 1PV0A 3I55V 2UXNA 4PI2A 1XMOB 3OMIB 4LH7A 5IY5B 2QWPB 1I7FA 5D5PA 2CTQA 5ITZB 2WSSG 1QR8A 2F4VO 1GAXA 1K3EA 2FYUH 3CPWU 4I0XB 3K0DA 5EIBC 1W2BU 2W0XA 1SZTA 3I5DA 2QDOA 1X4TA 3ZX6A 1W0JG 4PV1B 4QJFB 4JI8B 4EFBA 4AQYO 3VQXA 2IBZH 1YTFB 4DV2O 1BSMA 1O9GA 3E35A 3T1YB 1I94B 3AG1C 1NS1A 1YHQV 5K1PA 3OAAG 3CXHF 4LCUC 1THZA 3JSLA 4JYBA 3VQYA 1L8DA 3L70H 4CH6A 4YIOA 2VQEB 4IHJA 5CA0A 3OR7C 2EIJB 2LFRA 2B1GA 3IGAC 2CH7A 4IGGA 5H6RA 1VQKV 3N2KA 4MVZA 1J5EO 4UVAA 3OTFA 4IYIA 2Q68A 1RFYA 1HDJA 1SF9A 3AG3C 4CS2A 1K5SA 4JI3O 3X2QB 3C3TA 3L73H 1Y76A 4K0KO 2AHZA 4YJ3A 1SA0A 3KCYA 3ZN0A 3CRCA 2HG5C 1K97A 1AILA 5KA6A 4DXWA 1OCCC 2K9PA 1NQTA 3LSQA 3L74H 5DM6V 1VF7A 4DW0A 3JD2A
chains in the Genus database with same CATH topology
2Q67A 1COWG 1XL4A 5EBWC 3QO7A 1G8MA 4ASUG 5H9CA 1NH2D 3JYCA 2WLLB 2X6AA 3GWOA 5B3SB 2Y48A 1YITV 4N23A 1ZWIC 5FL7G 4UV9A 1JJ2U 3SYQA 1H38A 3STZC 2H94A 1FXKB 4MVQA 3TK1A 2YEVA 2AHYA 4ZKIA 3OGCC 2OTJV 1RM1C 1F51A 4Z1MG 2DWDC 3LSSA 2QTOA 5KA5A 2ZQMA 5H6QA 5DN6G 1VQ8V 2JEUA 4XBFA 2DYRB 4GX0A 2WLIB 3ZN1A 2FTKA 1M56C 2EIMB 2X0LA 3AEIA 3OEHG 3CD6V 3G71V 1M90W 4GT1A 3MHSC 3T4ZA 2UXXA 3K3WA 2P7TC 3ASNB 3E83A 3FYIB 1EBOA 4QPKA 3PJSK 5CMUA 3ZMTA 5CBHA 3CMEV 2X6CA 3EFFK 3IC7A 1QCEA 4U7NA 2EINB 3MHHC 2V1DA 2WLNA 3SYCA 4JTCB 4JYCA 3CMAV 3CCJV 1H8HG 1AJQA 1K8AW 1G4YB 2F43G 4PDVA 4MT8A 3ASOB 2IW5A 1BHAA 5IYBO 1R73A 5LGNA 1PL0A 1AJNA 1K34A 3A0RA 1YIJV 3ZRSA 3ZRVA 3W7WA 1F23A 1GTOA 1V54B 1FXKA 1L1FA 2DWEC 4FK5C 2XAHA 1WPXA 2EILB 3UKMA 3SPHA 4WFFA 4XDKA 3ABMC 3CCVV 1OCZB 4TT3G 1QR9A 4WCEV 1CPYA 1XL6A 1OCRC 5LGTA 1R3JC 4MW3A 5CN0A 4RUEA 2WLIA 1S72V 3SPJA 1FFTB 1DF4A 3VBBA 4GX5A 1EFRG 2OCCC 5L3DA 4WFAV 3FB6C 1YTFD 2JJ1G 2M7WA 4UV8A 3SYPA 1F4MA 2HR3A 3ZMSA 2ZXWC 3CCRV 1RPOA 2W6JG 3B8MA 4JPRA 2XAJA 3T4DA 3E2EA 1S3JA 4MVUA 3DTUB 2Q69A 3ZRWB 3JD1A 2V7QG 2ITDC 3QO5A 5L3GA 2WLHA 3QNEA 1QVGU 4UXNA 3MD0A 1VQMV 3AG2B 1S77D 1ROPA 1NKDA 4JAUA 1YJNV 1VQNV 4JTDB 3B77A 2HJFC 3JD4A 3ZJZA 1M57B 1VQ5V 1R3KC 1AJPA 2NNUA 1RPRA 2EJRA 2QA4V 1V55C 1E79G 2KB1A 1S76D 5KUKA 2P6JA 2K1EA 3FYEB 4R50A 1NBMG 2IH1C 4P2ZA 1MABG 3AG4B 3WG7C 1JX9A 3CC7V 2YSUB 2Y69C 3ABLC 4P9OA 3SYOA 1Q86W 2HFEC 2WLJA 1I5YA 1QLEC 4BIZA 2D3OW 2H8PC 2XNDG 3AG1B 3ZRWA 1NVPB 1VQOV 4PDRA 3W7XA 3OE7G 3K08A 3ETGA 5B1OA 3RVZA 5L3EA 3NXSA 1TUEB 4LP8A 4CBCA 3CC4V 3CCMV 3OUSA 3G6EV 3P32A 5CBGA 4KFMA 3E8BA 5EC2C 1KC8W 4XDJA 2JK5C 5C93A 5IY5C 3ZMVA 2GHYA 1QLNA 4UUJC 1K4CC 4QIWF 4JASA 1GK9A 3FB5C 4MVOA 1JQ0A 1H8EG 4RQEA 2XAFA 4N21A 4GX2A 1UJWB 4P30A 4PA7A 5B1AC 4J9YB 4LBEC 3AG3B 2XOKG 3ZMZA 1DTOA 2A9HA 2DYSB 3ZRXA 1K9MW 2B1IA 1OCOB 1IXMA 4MSWC 1R6NA 3ABKB 3K79A 4G27B 3SPCA 1GKFA 4KUMA 4R8CA 3JCZA 4RQFA 2BOBC 4PDLA 2OTLV 3RW0A 5EC1C 1PNKA 1OCCB 5BZBA 3E8HA 4MW8A 1BL8A 1WLEA 4RO2A 4TSFG 4JGSA 2WLLA 4WF9V 2ZD9A 1GO3F 3CCSV 3ABUA 3WFVA 4Q20A 4MTOA 1GM7A 3STLC 3CP1A 1H2GA 4U7OA 4CZZA 1K92A 5L3CA 1AI6A 3P30A 1SRYA 3OMNB 1JPXA 1NR7A 3K9AA 5GW7A 3B8NA 4GCZA 1S0VA 3RBZA 2ZR3A 1S5HC 4MTGA 1VQ7V 5E1AC 5L3FA 2EIJC 3LUTB 2EBOA 4RAIA 2QM8A 3FKSG 3SYAA 4MTXA 1RM1B 3ABTA 4PA9A 3BEHA 5B1NA 5LHHA 1BMFG 2W6IG 1K5QA 2A0LA 1M56B 3R65A 4MS2A 1E1RG 3OFNG 1KD1W 1B6QA 4QPJA 2X7RB 3OW2U 2QKSA 3X2QC 1FS0G 2WPDG 1Q82W 1OHHG 2PI5A 5LHGA 3K06A 2P90A 4FJCC 2X6BA 2QM7A 1JVMA 3BY6A 1E1QG 2QEXV 1KQSU 4WFHA 4EKWA 1J95A 2JEXA 3CCUV 1GM9A 2WAMA 3F5WC 1QBZA 1M9NA 3FB7C 4PA4A 1PKXA 1P7BA 4X88A 3SPGA 3ZMUA 3OR6C 3K0GA 3GB7C 1MSWD 1R6KA 1JCHA 3ABMB 2WLMA 3ZCCA 5B3SC 3E86A 1OCRB 1K7DA 1SESA 2IJKA 4QE9A 1R3LC 3HPLC 1SERA 2B5UA 4X8AA 1FXKC 4I5SA 2JDIG 2OCCB 5IDJA 3SJQC 4HAMA 3TETA 1KP2A 1Y4MA 3OEEG 4BIUA 2LP7A 2ZXWB 4BAYA 5EBMC 2ATKC 3E8FA 3HB3B 2DYRC 2DW4A 1HWYA 3ETEA 1NVPD 4MVSA 1Q7YW 3H01A 2BOCC 3KG2A 2EIMC 1K4DC 1AI4A 3CYOA 3ETDA 3ASNC 1CP9A 2CK3G 2NLJC 5KUMA 1NR1A 1KKDA 1YI2V 2DQ0A 5B1BC 4PA3A 3K04A 3ZIAG 4FIPC 2EINC 2Z3YA 1K73W 4E2LA 1DLBA 3CXCU 2IJHA 1FXHA 2ITCC 5CBFA 1NJIW 3ASOC 2IU0A 3T2MA 3JD3A 5L3BA 5LHIA 2WLKA 4I9WA 4LC1A 3RVYA 2ZR2A 4H37A 4QNHB 5IYCO 2MK3A 5CA3A 1NH2B 1V55B 2WWWA 5EK0A 2C2AA 2IJJA 4R6ZA 2P67A 4MVRA 1I5XA 1OZ0A 1V54C 2IU3A 2EILC 3VOUA 3SPIA 2IH3C 3E8GA 5LGUA 3I56V 4FMTA 3WG7B 1PNMA 4H33A 2EIKC 3CCEV 2EZPA 4X89A 1OCZC 4P9PA 2Y69B 3ABLB 2LFSA 4WFEA 1ENVA 4PDMA 3LNMB 3UM7A 1R3IC 4DO2A 2XAGA 1QLEB 1AR1B 2XAQA 4TWKA 3OUFA 4HYOA 3LDEA 4OXSA 1JOYA 3LDCA 3IFXA 3W7SA 1GMGA 3D3IA 4JAVA 1VQLV 2Z5UA 1YJ9V 2Q6AA 1N8RW 4YXWG 3DGEA 4RUFA 4HZ3A 2HVKC 4MTFA 3I55V 2UXNA 1AI5A 3K03A 1K33A 4QE7A 3OMIB 1VQ4V 5IY5B 1YSCA 5B1BB 3LDDA 1MOFA 2WSSG 1QR8A 3AG2C 1K3EA 4ZBMA 3D36A 3T1CA 3W7UA 3CPWU 2HKOA 1F4NA 2JIZG 3K0DA 1W2BU 4GX1A 2HLDG 1CEZA 5B1AB 1M57C 2XASA 1SZTA 2ZDIA 1LNQA 1PD3A 2W0FC 1W0JG 1M1KW 2EIKB 4QJFB 5HFMA 3ML0A 3TCUA 2DQ3A 4WFGA 3AG4C 3QO8A 4JF3A 1YTFB 4FPPA 1KECA 1MG1A 2GSMB 3E35A 4G28B 1ORQC 4MVMA 5J9PC 4PELA 3AG1C 1YHQV 1W0KG 3E89A 3FB8C 1YJWV 5EBLC 5IYDO 1VQ9V 3OAAG 4LCUC 2R9RB 1EZJA 1THZA 1AI7A 4JYBA 5LBQA 1DF5A 4UVCA 1VQPV 3OM3B 4PA6A 4R7CA 3OR7C 2EIJB 2LFRA 1QVFU 3M99B 2EZOA 2B1GA 3IGAC 3CCLV 4F4LA 1GM8A 3F7VC 4L87A 5H6RA 1VQKV 4UVBA 1SETA 4MVZA 3G4SV 2IJIA 1BHBA 4JTAB 4J9ZB 1AROP 4UVAA 2A79B 2Q68A 3EHBB 2YEVB 1P4RA 1K5SA 3AG3C 1PNLA 2OT5A 2JJ2G 4KP4A 2DYSC 1Y66A 5HFLA 3X2QB 3JD0A 2QE7G 1OCOC 1VQ6V 3ABKC 4BW5A 2AHZA 3CCQV 2ZDIC 3F7YC 3ZN0A 2HG5C 3CC2V 2HVJC 1K97A 4WFBV 5KA6A 3OMAB 4DXWA 1OCCC 4XDLA 3W7TA 1KP3A 1NQTA 3LSQA 4G2KA 2PI4A 1Q81W 1FXVA 2R9IA 5DM6V 3JD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7R B;  3H01 A;  1I5X A;  4FK5 C;  3CP1 A;  1DF5 A;  2OT5 A;  2P6J A;  3MHS C;  3CYO A;  5H9C A;  1K33 A;  1Y66 A;  5HFL A;  3GWO A;  5HFM A;  1EBO A;  1QR9 A;  3P30 A;  2EZP A;  4N23 A;  5CMU A;  1JPX A;  3K9A A;  3B8N A;  1QCE A;  4JF3 A;  1MOF A;  3MHH C;  4FJC C;  1ENV A;  5CN0 A;  4FIP C;  3M99 B;  3B8M A;  2EZO A;  1QR8 A;  4E2L A;  1DLB A;  1DF4 A;  2EBO A;  1I5Y A;  1MG1 A;  5KA6 A;  1JQ0 A;  1Y4M A;  2M7W A;  4JGS A;  2LP7 A;  5KA5 A;  3B77 A;  4G2K A;  1QBZ A;  1K34 A;  4N21 A;  2MK3 A;  3WFV A;  1SZT A;  1F23 A;  4JPR A; 
#chains in the Genus database with same CATH topology
 2Q67 A;  4JV5 B;  2UXB B;  2HHH B;  1MSD A;  4FLT A;  3DC6 A;  3QVN A;  1ZWI C;  5FL7 G;  2LJ2 A;  2H94 A;  1FXK B;  2QR4 A;  4OPA A;  5LP6 B;  2ZNJ A;  1X59 A;  4DUY O;  4AHC A;  4ZKI A;  5BMV B;  1N32 B;  2Q0O C;  1ZL8 B;  2Y0P A;  5DN6 G;  1VQ8 V;  4XBF A;  4B3R B;  2WLI B;  1H2L A;  3OEH G;  3UCS C;  3RYF A;  3WB2 A;  4GT1 A;  5B66 Z;  1M90 W;  2UXX A;  3ASN B;  3E83 A;  3JSN A;  4TV9 A;  3MHH C;  2V1D A;  4JYC A;  1K8A W;  2F43 G;  5IYB O;  4NVP A;  2YXY A;  2YXH A;  3ZRS A;  3W7W A;  1Q8I A;  1FFX A;  4J7K A;  1JMK C;  5E79 Z;  5IWA O;  2EIL B;  3SPH A;  5JVD A;  3APO A;  3ABM C;  1OCZ B;  1XQ8 A;  4WCE V;  1XL6 A;  2GUZ B;  5LGT A;  3WB1 A;  5J2U A;  4IIJ A;  3SGI A;  3SR2 C;  2QKC A;  4HNA A;  3A8T A;  1DF4 A;  3H1L H;  2JJ1 G;  3RYI B;  5CB4 B;  3NR7 A;  3B4S A;  2W6J G;  1LUW A;  4LF5 O;  3KKY A;  5LYJ A;  4NYK A;  1XNQ O;  2ITD C;  4DR6 B;  5KLV H;  3QNE A;  3ZS8 C;  1QVG U;  4JYA O;  1ROP A;  2YI9 A;  3K9S A;  4JAU A;  1VQN V;  4DV3 B;  4B7K A;  3HKB B;  1MZE A;  3JAS B;  2DN9 A;  1E79 G;  2KB1 A;  2P6J A;  2K1E A;  3IAY A;  2IH1 C;  3WG7 C;  2Y69 C;  4P9O A;  4LF9 B;  2A06 H;  4KXR A;  1TA8 A;  1NI8 A;  2XND G;  4X65 O;  5DEC A;  1TUE B;  4NTY A;  1BS3 A;  1QU7 A;  4J41 A;  3CCM V;  4JI2 B;  4JI1 O;  3GVM A;  2N05 A;  4X64 O;  2XUM A;  4O4L B;  1N36 O;  1K4C C;  1HNX O;  4DV6 O;  2LQT A;  2F95 B;  4MVO A;  4P30 A;  3UO2 A;  4FLY A;  2DYS B;  3ZRX A;  1R6N A;  3K79 A;  2JGD B;  4KHP B;  2ZM6 B;  2R9A A;  2UU9 B;  2FML A;  5EC1 C;  3SJA C;  4O2B A;  5BZB A;  1ZX3 A;  4NXN O;  3OT7 A;  1GO3 F;  5JJE B;  2QKA A;  3ABU A;  5JCO C;  2UUC B;  3FX7 A;  3CP1 A;  4U7O A;  3ZHR A;  2B9Z A;  1K92 A;  1AI6 A;  4TUY A;  3OMN B;  2UXC B;  4DR2 B;  2UXD B;  4MTG A;  1JJO A;  2EBO A;  5FNV A;  3SYA A;  3K58 A;  3ABT A;  5B1N A;  4UFZ A;  4EEQ A;  5JQG B;  1RSO B;  1KD1 W;  3OFN G;  4QPJ A;  2X7R B;  3B2E E;  3RGB A;  2JS5 A;  3OW2 U;  1EN5 A;  5EYP A;  3BA8 A;  2PI5 A;  4FJC C;  2QWN B;  1KQS U;  3F5T A;  2RCV A;  3N2G A;  3BRC A;  1QBZ A;  3SJC C;  1VF6 A;  2CAZ C;  3OR6 C;  2Q7E A;  2FL4 A;  2QWQ B;  3CX5 F;  1YCI A;  1JCH A;  5LA6 A;  2E5L O;  2WLM A;  1GN6 A;  4QGP A;  1XMQ O;  2XT9 A;  3HPL C;  5C8Y A;  4I5S A;  1WNS A;  2OCC B;  1H2M A;  3CHX A;  1DK1 A;  3DXR A;  5H5N A;  4O4J B;  4DV7 B;  1M93 A;  4NXM B;  4JI5 B;  3E8F A;  2DYR C;  1HWY A;  1Q7Y W;  1NVP D;  2BOC C;  5KHJ A;  1FAF A;  2EIM C;  3CYO A;  4X20 A;  2N04 A;  5KUM A;  4B3S O;  1NR1 A;  2BTQ B;  5IJ9 A;  3AK1 A;  2EIN C;  2Z3Y A;  2VQF O;  3CXC U;  1HNW O;  2IJH A;  1FXH A;  5CBF A;  2YIA A;  3ASO C;  3T2M A;  1DGS A;  1TUB A;  4I9W A;  3JAM N;  2ADP A;  4QNH B;  4DV1 O;  4K3A A;  2P67 A;  1I5X A;  1V54 C;  2IU3 A;  1EN6 A;  3HKC A;  2IH3 C;  5KHK A;  4JAA A;  2YC0 A;  4H33 A;  1XIL A;  1D5A A;  4P9P A;  3ABL B;  2CTR A;  5KMG A;  3CJH A;  1ENV A;  3UM7 A;  4AQY B;  1AR1 B;  3ZED A;  3BPZ A;  3IFX A;  1GMG A;  4DV2 B;  4U3J A;  1Z2G A;  3ETQ A;  1N8R W;  4YXW G;  4I55 A;  3L75 H;  1A32 A;  1K33 A;  4O4I A;  4QE7 A;  1VQ4 V;  1PPJ H;  1TAE A;  5AG2 A;  1AB3 A;  4GKJ O;  2DMX A;  1SS3 A;  1GN4 A;  4X1K A;  4C7U A;  5CA1 B;  3BAB A;  4ZBM A;  2HKO A;  2KQX A;  1WA8 A;  1P7G A;  3UT5 B;  2E3C A;  1BCC H;  1PL4 A;  4GX1 A;  5B1A B;  1M57 C;  4LNU A;  3ZHU A;  1L0L H;  1PD3 A;  3HKD B;  2EIK B;  1J5E B;  3JAW A;  4X1Y A;  3RWR D;  2DQ3 A;  2PZS A;  1IZ3 A;  4JI3 B;  3VQV A;  4GUN A;  4I50 A;  3QF7 A;  4MVM A;  1T5E A;  4PEL A;  2RNB A;  1W0K G;  3E89 A;  3FB8 C;  2CGO A;  2R9R B;  1EZJ A;  3FFQ A;  5KAI Z;  1FYJ A;  1KKC A;  3S3X A;  1VQP V;  2CGN A;  4YHH B;  1XUQ A;  4R7C A;  4NKG B;  1QVF U;  4BW9 A;  2EZO A;  3CCL V;  4F4L A;  2OWO A;  4L87 A;  4UVB A;  3RYC A;  2ODM A;  3G4S V;  4EFE A;  2Q7G A;  1ARO P;  2A79 B;  2YEV B;  1PNL A;  2OT5 A;  2GTA A;  1Y66 A;  2QE7 G;  4YIP A;  4DR5 O;  1VQ6 V;  4LFB O;  3CCQ V;  2ZDI C;  4ZHQ B;  1JR9 A;  3OMA B;  1IUR A;  3K5M A;  5KHH A;  3BCC H;  3E22 B;  4E4E A;  4YJ2 A;  1XRE A;  4UB6 Z;  1XL4 A;  3ZHV A;  3QO7 A;  2G38 A;  2WLL B;  4KL1 A;  1KMI Z;  5IWA B;  1JJ2 U;  1VF6 C;  2XHB A;  5JJN B;  1VAR A;  5LL6 Y;  4YY3 O;  1BE3 H;  3BVO A;  1RM1 C;  4Z1M G;  2DWD C;  4JZ2 A;  4JI7 O;  3OTO O;  2FTK A;  1M56 C;  1SQB H;  3MHS C;  3T4Z A;  4DV5 O;  1Q3E A;  2P7T C;  3FYI B;  4LF5 B;  2EJ7 A;  4QPK A;  5CMU A;  3SYC A;  3CCJ V;  1GN3 A;  1XNQ B;  1AJQ A;  1HNZ O;  2YXL A;  4PDV A;  2ZIM A;  5B5E Z;  1BHA A;  4JYA B;  1PL0 A;  3A0R A;  4LFA O;  1M4U A;  1FXK A;  3JAL B;  1HR0 O;  2XAH A;  1WPX A;  1CXZ B;  5BMV A;  4XDK A;  1JA8 A;  1ZL8 A;  1OCR C;  4LR3 A;  1GRJ A;  3S3W A;  2WLI A;  1B3Q A;  1S72 V;  2JVD A;  3SPJ A;  1FFT B;  4DRX B;  3FB6 C;  4IYH A;  1I08 A;  2UUA O;  1RPO A;  3A0B Z;  1YZB A;  4JPR A;  4WBN B;  2XAJ A;  4AIL C;  1KU9 A;  3B40 A;  4X65 B;  4MVU A;  1MA1 A;  2Q69 A;  1BGY H;  3ZRW B;  2YS8 A;  3CE2 A;  3QO5 A;  1PM9 A;  5L3G A;  1Q6H A;  4ABM A;  4JI1 B;  2KG7 B;  4I4T B;  3MD0 A;  4TV8 B;  3AG2 B;  1S77 D;  2Q4P A;  4F6R B;  1NKD A;  1SQF A;  1D5N A;  3QG5 A;  3HKE A;  3WB0 A;  5KAF Z;  1YJN V;  2QGN A;  1N36 B;  3ZJZ A;  1VQ5 V;  2YID A;  1AJP A;  2Q9L A;  1HNX B;  4DV6 B;  3J7A U;  3EVK A;  1G6U A;  2QA4 V;  5J2T A;  1S76 D;  1YXB A;  3RYI A;  1MAB G;  3AG4 B;  5CB4 A;  1JX9 A;  1N4C A;  5JCO A;  4FZ0 A;  5LMN O;  4DR1 O;  2VWJ A;  3DC5 A;  1IBM O;  2H8P C;  1NVP B;  2QWR B;  1VQO V;  3OE7 G;  3ETG A;  3RVZ A;  3NXS A;  4GKK O;  4LF8 O;  5A2Q N;  2F66 C;  4J42 A;  1N0J A;  1HP8 A;  3G6E V;  5CBG A;  5D5Q A;  5H2F Z;  1KC8 W;  3H1I H;  2JK5 C;  4XDJ A;  5IY5 C;  3ZMV A;  2GHY A;  1QLN A;  4H44 B;  1PP9 H;  3Q4H B;  4JAS A;  4AI8 A;  1GK9 A;  2WA3 A;  2R72 A;  1H8E G;  4RQE A;  3H1K H;  2QJ1 A;  4N21 A;  4GX2 A;  1UJW B;  4ZI7 B;  1M5I A;  3ZMZ A;  2B1I A;  1H2K A;  1OCO B;  2OYQ A;  1Q6I A;  4MSW C;  3ABK B;  1KB9 F;  4KUM A;  4R8C A;  4FFB B;  4PDL A;  1IXB A;  4J10 A;  1XDC A;  1PNK A;  4LF7 O;  5KHI A;  2VRZ A;  1WLE A;  4J80 A;  2ZD9 A;  3STL C;  4LF6 O;  3U11 A;  4CZZ A;  5L3C A;  1SRY A;  1JPX A;  1AP5 A;  4GCZ A;  1S0V A;  1S5H C;  4K35 A;  5L3F A;  2EIJ C;  1XNR O;  2EX3 A;  2E5L B;  4RAI A;  2BSK B;  2CTP A;  4MTX A;  3JCU Z;  1FD9 A;  4IHJ B;  1K5Q A;  2A0L A;  3R65 A;  2ZNI A;  5IYZ B;  2HP8 A;  3X2Q C;  1FS0 G;  2Z0A A;  1Q82 W;  2GTS A;  1E1Q G;  2JEX A;  4B3S B;  3SDL A;  3TGU H;  2WAM A;  1XMO O;  2VQF B;  1IDS A;  4PA4 A;  1HNW B;  1D2D A;  3EXA A;  1B06 A;  5EIB D;  1MSW D;  4DV1 B;  1I0H A;  3T1H O;  4CS3 A;  3FAV B;  4B3M O;  4LWS B;  5JH7 B;  4QE9 A;  5EZY B;  5JQG A;  2CTW A;  1FXK C;  5LP6 C;  3TXQ A;  1QQC A;  1KP2 A;  1Y4M A;  1WB8 A;  4DUZ O;  2ZXW B;  2ATK C;  4UCV A;  2DW4 A;  2R70 A;  3H01 A;  1AI4 A;  2PTM A;  3ZHQ A;  3ASN C;  2PYL A;  1CP9 A;  1VEW A;  2CK3 G;  2NLJ C;  2ZIO A;  4FLU A;  5B1B C;  4UCT A;  1YF2 A;  2CUG A;  3U10 A;  4DV0 O;  4GKJ B;  1BQ0 A;  3FD9 A;  3JD3 A;  4IT5 A;  3RVY A;  4H37 A;  2MK3 A;  1V55 B;  2WA4 A;  1OZ0 A;  2EIL C;  2PUS A;  5IT9 N;  2LGW A;  4O4J A;  1OCZ C;  2LFS A;  1UFI A;  3CEI A;  3RFR A;  4PDM A;  3KCX A;  5JVD B;  1QLE B;  4TWK A;  4PI0 A;  3W7S A;  2QSA A;  2YIC A;  5J2U B;  2ARH A;  2OCH A;  5BR8 O;  2BTQ A;  4HNA B;  1BZK A;  2HVK C;  4MTF A;  2PY5 A;  1OV9 A;  2PGG A;  3K03 A;  2YIB A;  1YSC A;  4EB6 A;  3LDD A;  4Q6G A;  1MOF A;  3T1C A;  3W7U A;  4DR4 O;  4JV5 O;  3JAR B;  1ZLZ A;  2DOS A;  2L35 A;  2XAS A;  3OGI B;  1SC5 B;  3RYH B;  4DK1 A;  2ZDI A;  1LNQ A;  1M1K W;  5HFM A;  3ML0 A;  1Z5W A;  4J11 A;  4K8Z A;  1LR1 A;  2VWK A;  1N34 O;  4DR5 B;  1MG1 A;  2GSM B;  4O4H B;  5J9P C;  1ORQ C;  2LW7 A;  4LFB B;  4CS4 A;  4JI4 O;  1YJW V;  3L9D A;  5EBL C;  1VQ9 V;  3M7M X;  5LBQ A;  1AI7 A;  5CA1 A;  1DF5 A;  1NTK H;  3BA9 A;  4Z2W A;  1VMG A;  2V4D A;  3DSQ A;  4PA6 A;  4A5U B;  1ZSP A;  3AK3 A;  3M99 B;  3F7V C;  1TVK B;  1SQP H;  2IJI A;  3O9O A;  2P5O A;  1H2N A;  3EHB B;  2P4V A;  2LW1 A;  2ILM A;  1NZ6 A;  2XTA A;  1P4R A;  3D36 C;  2JJ2 G;  4KP4 A;  1XEQ A;  2L6L A;  2DYS C;  2AW9 A;  3JD0 A;  3OTO B;  3D8C A;  3ZBH A;  2Q8V A;  4DV5 B;  3F7Y C;  4UCR A;  4FLX A;  2HVJ C;  4WFB V;  1JFF A;  4XDL A;  3W7T A;  1B04 A;  2PI4 A;  1FXV A;  2R9I A;  2F4V B;  1HNZ B;  1COW G;  5EBW C;  4ASU G;  4DV4 O;  3GWO A;  5B3S B;  1YIT V;  4LFA B;  4N23 A;  1V9P A;  4UCO A;  4RWU A;  1HR0 B;  2P22 C;  3SYQ A;  3STZ C;  5KX5 A;  4MVQ A;  3TK1 A;  2YEV A;  2AHY A;  3OGC C;  2OTJ V;  5KA5 A;  2ZQM A;  1P49 A;  5H6Q A;  4D7S A;  3ZN1 A;  1Q90 D;  5FNV B;  4ZHQ A;  1URF A;  2E76 B;  3CD6 V;  5LOV B;  3G71 V;  2UUA B;  3K3W A;  3PJS K;  3ZMT A;  5CBH A;  3CME V;  2X6C A;  3E22 A;  3EFF K;  3IC7 A;  3A2F A;  2ZKO A;  1NTM H;  4JTC B;  3CMA V;  1H8H G;  1XHX A;  3CRQ A;  4MT8 A;  1XOU A;  1R73 A;  4BWA A;  1SQG A;  5LGN A;  1VP7 A;  4ZOL B;  1AJN A;  1K34 A;  3R66 A;  1YIJ V;  2ETN A;  3L72 H;  1GTO A;  5K1X A;  2DWE C;  4FK5 C;  3UKM A;  2AZ2 A;  4DR3 O;  2Y0I A;  4WFF A;  2P06 A;  4NB5 A;  1QR9 A;  4L8J A;  2Q5Z A;  4MW3 A;  2ZE7 A;  4B7E A;  1EFR G;  4OPH A;  2OCC C;  3PN1 A;  1KYO F;  4BR6 A;  5L3D A;  4WFA V;  4K0K B;  2M7W A;  4DR1 B;  3SYP A;  4UCU A;  2HR3 A;  3ZMS A;  5IJ0 B;  5C8Y B;  3T4D A;  3E2E A;  5ITZ A;  4D6T H;  3DTU B;  2UU9 O;  4GKK B;  2V7Q G;  4LF8 B;  4I0X A;  1FJG O;  4JI6 O;  2WLH A;  1VQM V;  3KZI Z;  3JAL A;  3BHP A;  4X20 B;  5F2V O;  1VIB A;  2HJD A;  4I9Q A;  4JTD B;  3B77 A;  2HJF C;  4W4K A;  5IJ9 B;  4DUY B;  2NNU A;  2EJR A;  2PF4 E;  3G6B A;  3FYE B;  4R50 A;  4DRX A;  1TUB B;  3CC7 V;  2E74 B;  3ABL C;  3SYO A;  1Q86 W;  4DR7 O;  1YEW A;  2WLJ A;  1EM1 A;  4WBN A;  1HW7 A;  1IBK O;  4BIZ A;  2D3O W;  3AG1 B;  3ZRW A;  2F23 A;  3W7X A;  5BXZ A;  3A0H Z;  2O57 A;  5KMG B;  5L3E A;  3CJH B;  2Q0A A;  4LF7 B;  2KG7 A;  1Z5V A;  3B09 A;  3P32 A;  4KFM A;  3E8B A;  4U3J B;  5C93 A;  4LF6 B;  4UUJ C;  2MW2 B;  2Y4T A;  4QIW F;  4O4I B;  3FB5 C;  3G80 A;  1S5L Z;  4CH3 A;  1XNR B;  1WN7 A;  4UB8 Z;  4X1K B;  4PA7 A;  5B1A C;  4J9Y B;  4D7T A;  4JI0 O;  3AG3 B;  2ZIN A;  4B3T O;  2XOK G;  5LXT B;  2A9H A;  1WA8 B;  1K9M W;  3CWB H;  3JAK B;  3SPC A;  1GKF A;  4LNU B;  3JAT B;  4FM0 A;  2BOB C;  1WB7 A;  2OTL V;  3JAW B;  4X1Y B;  4W4L A;  1OCC B;  2JRI A;  3E8H A;  4MW8 A;  3ZHT A;  4F6E A;  4RO2 A;  4TSF G;  4JGS A;  5GON B;  4O2A B;  4I50 B;  1Y6X A;  4FVM A;  5GTI Z;  1OJH A;  5LP6 A;  3P30 A;  5TIS Z;  3RBZ A;  1U96 A;  5E1A C;  1IBL O;  4ZI7 A;  2QM8 A;  3T1H B;  1Y74 B;  4B3M B;  3CRR A;  4PA9 A;  3UO3 A;  2W6I G;  4FFB A;  4MS2 A;  4DUZ B;  3RYC B;  2QKS A;  1OHH G;  4FZ1 A;  3K06 A;  2P90 A;  4J7J A;  5BY1 A;  1MMM A;  2QM7 A;  1JVM A;  3BY6 A;  1XI1 A;  2QEX V;  4WFH A;  4CH5 A;  4EKW A;  3CCU V;  1ZTE A;  4X64 B;  1GM9 A;  2N74 A;  3F5W C;  1MZF A;  1M9N A;  2DE0 X;  3FB7 C;  1P7B A;  3SPG A;  2GUZ A;  2UUB O;  4DV0 B;  2RN9 A;  4NTW A;  1WJZ A;  1KUQ A;  3P3P A;  2JS3 A;  1R6K A;  2BSK A;  3ABM B;  3AG7 A;  3E86 A;  4YJ2 B;  2AZ0 A;  2F1M A;  3CRA A;  1SER A;  2JDI G;  5IYZ A;  4K8X A;  3OEE G;  4X1I B;  5LMU O;  2AGA A;  2BE3 A;  2ZE6 A;  3HB3 B;  2RDC A;  3ETE A;  1NT2 B;  4MVS A;  4LFC O;  3SJB C;  2BCC H;  4LF4 O;  4NXN B;  3ETD A;  5BR8 B;  4HBN A;  1Q5O A;  1YI2 V;  3HKB A;  2DQ0 A;  4PA3 A;  3K04 A;  3JAS A;  3CB2 A;  1K73 W;  3AK2 A;  1FPO A;  3H1H H;  4CH4 A;  2ITC C;  5L3B A;  2WLK A;  4LC1 A;  4X66 O;  3FAV A;  1Y67 A;  4LWS A;  5JH7 A;  2YIB D;  4YHH O;  4DR4 B;  5EK0 A;  5EZY A;  2C2A A;  4MVR A;  1XHZ A;  1FKA O;  1MNG A;  3VOU A;  5LGU A;  3I56 V;  3WG7 B;  1PNM A;  4X89 A;  2Y69 B;  1GN2 A;  4WFE A;  3P3N A;  2VS0 A;  4PD4 F;  2XAG A;  3LDE A;  3LDC A;  2A3Q A;  2Z5U A;  1N34 B;  1EZV H;  4O4L A;  4IL6 Z;  4RUF A;  1ZAU A;  1P84 F;  1AI5 A;  4JI4 B;  4NR1 A;  4CC5 A;  4X62 O;  5B1B B;  2RJZ A;  1R6T A;  3AG2 C;  1ZUQ A;  2QM4 A;  3D36 A;  1BQZ A;  1F4N A;  2JIZ G;  1XMQ B;  2ZCE A;  4GYC B;  2HLD G;  5CA0 B;  2A7W A;  4FLV A;  4CC6 A;  1CEZ A;  2JGD A;  3APQ A;  2W0F C;  2CH7 B;  3HKE B;  4TQD A;  1U97 A;  1N0N A;  3N2K B;  3TCU A;  4WFG A;  3AG4 C;  4OX9 O;  2YDE A;  3QO8 A;  2ZT9 B;  4JF3 A;  2YUA A;  1N33 O;  1SQQ H;  5J2T B;  5DED A;  4FPP A;  1KEC A;  4G28 B;  4ZIB A;  1R1B A;  5KHG A;  1Y76 B;  2NN4 A;  5IYD O;  4YJ3 B;  1SA0 B;  5JJJ B;  3CS5 A;  4UVC A;  3JAR A;  3MAQ A;  3OM3 B;  3U0Z A;  2QWO B;  1BT8 A;  4DV4 B;  3RYH A;  1RSO A;  1GM8 A;  4ICG A;  2Y4U A;  1SET A;  2JGU A;  4FLW A;  1YDX A;  3K59 A;  4H0L B;  1BHB A;  1AP6 A;  4JTA B;  4J9Z B;  4JI8 O;  4BIO A;  1Q6U A;  1IX9 A;  3OD4 A;  4X9Q A;  4O4H A;  3BAA A;  3O65 A;  5HFL A;  4NTX A;  1OCO C;  3ABK C;  3T1Y O;  4BW5 A;  1I94 O;  1G1X B;  1GH6 A;  3CSX A;  5FLX N;  1WP8 A;  3RYF B;  3CC2 V;  1YVW A;  4TV9 B;  1KP3 A;  4G2K A;  1Q81 W;  2CE4 A;  5IE9 A;  4LH6 A;  2VQE O;  2IM9 A;  1G8M A;  5H9C A;  1NH2 D;  1TVK A;  1US6 A;  2X6A A;  3JYC A;  2Y48 A;  2Q73 A;  2AXT Z;  4Z1V A;  4UV9 A;  4DR3 B;  1FFX B;  4PJ0 Z;  1H38 A;  2ADQ B;  3LSU A;  2GV9 A;  1WPB A;  4UCS A;  2RQ6 A;  1F51 A;  3LSS A;  2QTO A;  2JEU A;  2DYR B;  4GX0 A;  4IIJ B;  2EIM B;  2X0L A;  3AEI A;  4B08 A;  2LGQ A;  1EBO A;  4U7N A;  1QCE A;  2KSD A;  2EIN B;  2WLN A;  1WP7 A;  5LYJ B;  1FJG B;  1G4Y B;  3ASO B;  4JI6 B;  2IW5 A;  3BFR A;  4U3F H;  1VF5 B;  1LUV A;  4GZR B;  3UQ8 A;  2HHH O;  4DYL A;  1QNM A;  2UXB O;  3MDS A;  3K5N A;  3ZRV A;  1F23 A;  1V54 B;  1L1F A;  3K5O A;  5A9G A;  1H2S B;  2ZE5 A;  3CCV V;  2LO1 A;  4TT3 G;  1CPY A;  3ICX A;  1N32 O;  1R3J C;  5CN0 A;  4RUE A;  3K57 A;  2FKX A;  4B3R O;  3VBB A;  4GX5 A;  2OIG A;  5LOV A;  1W59 A;  4DR7 B;  1YTF D;  4UV8 A;  1F4M A;  3GWK C;  3CCR V;  2ZXW C;  1IBK B;  1UPG A;  3B8M A;  1S3J A;  4FFK A;  2PYJ A;  3JD1 A;  4ZOL A;  3UT5 A;  4UXN A;  4PHZ A;  3G67 A;  3HKD A;  2ZE8 A;  3JD4 A;  1M57 B;  1R3K C;  3H9V A;  4YY3 B;  1RPR A;  1O9H A;  1V55 C;  5KUK A;  1TGO A;  3TXS A;  3WU2 Z;  1XBL A;  4FM1 A;  1NBM G;  4JZG A;  4JI7 B;  4P2Z A;  4JI0 B;  4J7Z A;  1RP3 B;  2YSU B;  4B3T B;  5IJ0 A;  2HFE C;  4FM2 A;  1I5Y A;  1QLE C;  3TJT A;  1IVS A;  4PDR A;  3K08 A;  2HEP A;  5B1O A;  2P4K A;  4LP8 A;  4DR6 O;  4CBC A;  3CC4 V;  3N27 A;  4O2B B;  3OUS A;  3HR0 A;  5EC2 C;  2Q7H A;  1WAZ A;  4DV3 O;  2BTO A;  3LNN A;  1JQ0 A;  5GTH Z;  3C3S A;  4TUY B;  4EB6 B;  1IBL B;  2XAF A;  1F7Y A;  4LBE C;  1DTO A;  4LF9 O;  1IXM A;  4G27 B;  2DJV A;  4FLZ A;  3JCZ A;  4RQF A;  2YI8 A;  4DW1 A;  3RW0 A;  1SQV H;  5EYP B;  1SZX A;  1BL8 A;  4JI2 O;  2WLL A;  4WF9 V;  3CCS V;  3WFV A;  4Q20 A;  4MTO A;  1GM7 A;  1H2G A;  5JWP A;  2D2C B;  3N2G B;  3QTC A;  2UUB B;  1NR7 A;  3K9A A;  5GW7 A;  3B8N A;  4DK0 A;  2ZR3 A;  1VQ7 V;  4OGQ B;  4TQF A;  3LUT B;  3FKS G;  5LXT A;  1RM1 B;  5LA6 B;  3BEH A;  4GLX A;  3JAK A;  2E75 B;  5LMN B;  5LHH A;  1BMF G;  3JAT A;  1M56 B;  2QTS A;  1E1R G;  1B6Q A;  1IBM B;  1NTZ H;  5LMU B;  4KHP O;  3D3Q A;  3K5L A;  3DXR B;  2ZM6 O;  2WPD G;  4I7Z B;  5GON A;  4LFC B;  5LHG A;  4LF4 B;  2X6B A;  4O2A A;  5FPO A;  3IC9 A;  1J95 A;  1L0N H;  2UUC O;  3J81 N;  2NR5 A;  2EUL A;  1PKX A;  2GBO A;  4X88 A;  3ZMU A;  2UXC O;  4DR2 O;  2F93 B;  2UXD O;  3K0G A;  3GB7 C;  1JFF B;  4X66 B;  1Y74 A;  3ZCC A;  5B3S C;  1OCR B;  1K7D A;  1SES A;  2IJK A;  3C90 A;  1R3L C;  3H1J H;  2B5U A;  2OIE A;  4X8A A;  3HKC B;  5IDJ A;  3SJQ C;  4HAM A;  3TET A;  2M6Y A;  4BIU A;  2LP7 A;  4BAY A;  5EBM C;  3M8A A;  5KX5 B;  2RMK B;  3KG2 A;  4I4T A;  1K4D C;  1EN4 A;  4TV8 A;  4F6R A;  3CRM A;  1SKV A;  1KKD A;  3ZIA G;  4FIP C;  4I55 B;  4E2L A;  1DLB A;  3IJ4 A;  4X62 B;  3RT3 C;  1KBH A;  4TOI A;  2KKW A;  1NJI W;  2IU0 A;  5LHI A;  3THO A;  1AR5 A;  5IYC O;  2ZR2 A;  1NH2 B;  2GDS A;  5CA3 A;  2WWW A;  3J80 N;  2IJJ A;  4R6Z A;  1SQX H;  3SPI A;  3E8G A;  4JYY A;  5FPR A;  4FMT A;  2CDY A;  2FB5 A;  4X1I A;  2EIK C;  3ZHS A;  2EZP A;  3CCE V;  1QHT A;  1S5J A;  3LNM B;  4DV7 O;  1R3I C;  4NXM O;  2H3O A;  4DO2 A;  1AR4 A;  4JI5 O;  2XAQ A;  3OUF A;  1NU1 H;  4HYO A;  4H13 B;  4OX9 B;  4OXS A;  1JOY A;  1N33 B;  3D3I A;  4JAV A;  1VQL V;  1YJ9 V;  3VQW A;  2Q6A A;  3L71 H;  1AVM A;  3DGE A;  1Q43 A;  3Q4H A;  4HZ3 A;  3RN4 A;  1PV0 A;  3I55 V;  2UXN A;  4PI2 A;  1XMO B;  3OMI B;  4LH7 A;  5IY5 B;  2QWP B;  1I7F A;  5D5P A;  2CTQ A;  5ITZ B;  2WSS G;  1QR8 A;  2F4V O;  1GAX A;  1K3E A;  2FYU H;  3CPW U;  4I0X B;  3K0D A;  5EIB C;  1W2B U;  2W0X A;  1SZT A;  3I5D A;  2QDO A;  1X4T A;  3ZX6 A;  1W0J G;  4PV1 B;  4QJF B;  4JI8 B;  4EFB A;  4AQY O;  3VQX A;  2IBZ H;  1YTF B;  4DV2 O;  1BSM A;  1O9G A;  3E35 A;  3T1Y B;  1I94 B;  3AG1 C;  1NS1 A;  1YHQ V;  5K1P A;  3OAA G;  3CXH F;  4LCU C;  1THZ A;  3JSL A;  4JYB A;  3VQY A;  1L8D A;  3L70 H;  4CH6 A;  4YIO A;  2VQE B;  4IHJ A;  5CA0 A;  3OR7 C;  2EIJ B;  2LFR A;  2B1G A;  3IGA C;  2CH7 A;  4IGG A;  5H6R A;  1VQK V;  3N2K A;  4MVZ A;  1J5E O;  4UVA A;  3OTF A;  4IYI A;  2Q68 A;  1RFY A;  1HDJ A;  1SF9 A;  3AG3 C;  4CS2 A;  1K5S A;  4JI3 O;  3X2Q B;  3C3T A;  3L73 H;  1Y76 A;  4K0K O;  2AHZ A;  4YJ3 A;  1SA0 A;  3KCY A;  3ZN0 A;  3CRC A;  2HG5 C;  1K97 A;  1AIL A;  5KA6 A;  4DXW A;  1OCC C;  2K9P A;  1NQT A;  3LSQ A;  3L74 H;  5DM6 V;  1VF7 A;  4DW0 A;  3JD2 A; 
#chains in the Genus database with same CATH homology
 2Q67 A;  1COW G;  1XL4 A;  5EBW C;  3QO7 A;  1G8M A;  4ASU G;  5H9C A;  1NH2 D;  3JYC A;  2WLL B;  2X6A A;  3GWO A;  5B3S B;  2Y48 A;  1YIT V;  4N23 A;  1ZWI C;  5FL7 G;  4UV9 A;  1JJ2 U;  3SYQ A;  1H38 A;  3STZ C;  2H94 A;  1FXK B;  4MVQ A;  3TK1 A;  2YEV A;  2AHY A;  4ZKI A;  3OGC C;  2OTJ V;  1RM1 C;  1F51 A;  4Z1M G;  2DWD C;  3LSS A;  2QTO A;  5KA5 A;  2ZQM A;  5H6Q A;  5DN6 G;  1VQ8 V;  2JEU A;  4XBF A;  2DYR B;  4GX0 A;  2WLI B;  3ZN1 A;  2FTK A;  1M56 C;  2EIM B;  2X0L A;  3AEI A;  3OEH G;  3CD6 V;  3G71 V;  1M90 W;  4GT1 A;  3MHS C;  3T4Z A;  2UXX A;  3K3W A;  2P7T C;  3ASN B;  3E83 A;  3FYI B;  1EBO A;  4QPK A;  3PJS K;  5CMU A;  3ZMT A;  5CBH A;  3CME V;  2X6C A;  3EFF K;  3IC7 A;  1QCE A;  4U7N A;  2EIN B;  3MHH C;  2V1D A;  2WLN A;  3SYC A;  4JTC B;  4JYC A;  3CMA V;  3CCJ V;  1H8H G;  1AJQ A;  1K8A W;  1G4Y B;  2F43 G;  4PDV A;  4MT8 A;  3ASO B;  2IW5 A;  1BHA A;  5IYB O;  1R73 A;  5LGN A;  1PL0 A;  1AJN A;  1K34 A;  3A0R A;  1YIJ V;  3ZRS A;  3ZRV A;  3W7W A;  1F23 A;  1GTO A;  1V54 B;  1FXK A;  1L1F A;  2DWE C;  4FK5 C;  2XAH A;  1WPX A;  2EIL B;  3UKM A;  3SPH A;  4WFF A;  4XDK A;  3ABM C;  3CCV V;  1OCZ B;  4TT3 G;  1QR9 A;  4WCE V;  1CPY A;  1XL6 A;  1OCR C;  5LGT A;  1R3J C;  4MW3 A;  5CN0 A;  4RUE A;  2WLI A;  1S72 V;  3SPJ A;  1FFT B;  1DF4 A;  3VBB A;  4GX5 A;  1EFR G;  2OCC C;  5L3D A;  4WFA V;  3FB6 C;  1YTF D;  2JJ1 G;  2M7W A;  4UV8 A;  3SYP A;  1F4M A;  2HR3 A;  3ZMS A;  2ZXW C;  3CCR V;  1RPO A;  2W6J G;  3B8M A;  4JPR A;  2XAJ A;  3T4D A;  3E2E A;  1S3J A;  4MVU A;  3DTU B;  2Q69 A;  3ZRW B;  3JD1 A;  2V7Q G;  2ITD C;  3QO5 A;  5L3G A;  2WLH A;  3QNE A;  1QVG U;  4UXN A;  3MD0 A;  1VQM V;  3AG2 B;  1S77 D;  1ROP A;  1NKD A;  4JAU A;  1YJN V;  1VQN V;  4JTD B;  3B77 A;  2HJF C;  3JD4 A;  3ZJZ A;  1M57 B;  1VQ5 V;  1R3K C;  1AJP A;  2NNU A;  1RPR A;  2EJR A;  2QA4 V;  1V55 C;  1E79 G;  2KB1 A;  1S76 D;  5KUK A;  2P6J A;  2K1E A;  3FYE B;  4R50 A;  1NBM G;  2IH1 C;  4P2Z A;  1MAB G;  3AG4 B;  3WG7 C;  1JX9 A;  3CC7 V;  2YSU B;  2Y69 C;  3ABL C;  4P9O A;  3SYO A;  1Q86 W;  2HFE C;  2WLJ A;  1I5Y A;  1QLE C;  4BIZ A;  2D3O W;  2H8P C;  2XND G;  3AG1 B;  3ZRW A;  1NVP B;  1VQO V;  4PDR A;  3W7X A;  3OE7 G;  3K08 A;  3ETG A;  5B1O A;  3RVZ A;  5L3E A;  3NXS A;  1TUE B;  4LP8 A;  4CBC A;  3CC4 V;  3CCM V;  3OUS A;  3G6E V;  3P32 A;  5CBG A;  4KFM A;  3E8B A;  5EC2 C;  1KC8 W;  4XDJ A;  2JK5 C;  5C93 A;  5IY5 C;  3ZMV A;  2GHY A;  1QLN A;  4UUJ C;  1K4C C;  4QIW F;  4JAS A;  1GK9 A;  3FB5 C;  4MVO A;  1JQ0 A;  1H8E G;  4RQE A;  2XAF A;  4N21 A;  4GX2 A;  1UJW B;  4P30 A;  4PA7 A;  5B1A C;  4J9Y B;  4LBE C;  3AG3 B;  2XOK G;  3ZMZ A;  1DTO A;  2A9H A;  2DYS B;  3ZRX A;  1K9M W;  2B1I A;  1OCO B;  1IXM A;  4MSW C;  1R6N A;  3ABK B;  3K79 A;  4G27 B;  3SPC A;  1GKF A;  4KUM A;  4R8C A;  3JCZ A;  4RQF A;  2BOB C;  4PDL A;  2OTL V;  3RW0 A;  5EC1 C;  1PNK A;  1OCC B;  5BZB A;  3E8H A;  4MW8 A;  1BL8 A;  1WLE A;  4RO2 A;  4TSF G;  4JGS A;  2WLL A;  4WF9 V;  2ZD9 A;  1GO3 F;  3CCS V;  3ABU A;  3WFV A;  4Q20 A;  4MTO A;  1GM7 A;  3STL C;  3CP1 A;  1H2G A;  4U7O A;  4CZZ A;  1K92 A;  5L3C A;  1AI6 A;  3P30 A;  1SRY A;  3OMN B;  1JPX A;  1NR7 A;  3K9A A;  5GW7 A;  3B8N A;  4GCZ A;  1S0V A;  3RBZ A;  2ZR3 A;  1S5H C;  4MTG A;  1VQ7 V;  5E1A C;  5L3F A;  2EIJ C;  3LUT B;  2EBO A;  4RAI A;  2QM8 A;  3FKS G;  3SYA A;  4MTX A;  1RM1 B;  3ABT A;  4PA9 A;  3BEH A;  5B1N A;  5LHH A;  1BMF G;  2W6I G;  1K5Q A;  2A0L A;  1M56 B;  3R65 A;  4MS2 A;  1E1R G;  3OFN G;  1KD1 W;  1B6Q A;  4QPJ A;  2X7R B;  3OW2 U;  2QKS A;  3X2Q C;  1FS0 G;  2WPD G;  1Q82 W;  1OHH G;  2PI5 A;  5LHG A;  3K06 A;  2P90 A;  4FJC C;  2X6B A;  2QM7 A;  1JVM A;  3BY6 A;  1E1Q G;  2QEX V;  1KQS U;  4WFH A;  4EKW A;  1J95 A;  2JEX A;  3CCU V;  1GM9 A;  2WAM A;  3F5W C;  1QBZ A;  1M9N A;  3FB7 C;  4PA4 A;  1PKX A;  1P7B A;  4X88 A;  3SPG A;  3ZMU A;  3OR6 C;  3K0G A;  3GB7 C;  1MSW D;  1R6K A;  1JCH A;  3ABM B;  2WLM A;  3ZCC A;  5B3S C;  3E86 A;  1OCR B;  1K7D A;  1SES A;  2IJK A;  4QE9 A;  1R3L C;  3HPL C;  1SER A;  2B5U A;  4X8A A;  1FXK C;  4I5S A;  2JDI G;  2OCC B;  5IDJ A;  3SJQ C;  4HAM A;  3TET A;  1KP2 A;  1Y4M A;  3OEE G;  4BIU A;  2LP7 A;  2ZXW B;  4BAY A;  5EBM C;  2ATK C;  3E8F A;  3HB3 B;  2DYR C;  2DW4 A;  1HWY A;  3ETE A;  1NVP D;  4MVS A;  1Q7Y W;  3H01 A;  2BOC C;  3KG2 A;  2EIM C;  1K4D C;  1AI4 A;  3CYO A;  3ETD A;  3ASN C;  1CP9 A;  2CK3 G;  2NLJ C;  5KUM A;  1NR1 A;  1KKD A;  1YI2 V;  2DQ0 A;  5B1B C;  4PA3 A;  3K04 A;  3ZIA G;  4FIP C;  2EIN C;  2Z3Y A;  1K73 W;  4E2L A;  1DLB A;  3CXC U;  2IJH A;  1FXH A;  2ITC C;  5CBF A;  1NJI W;  3ASO C;  2IU0 A;  3T2M A;  3JD3 A;  5L3B A;  5LHI A;  2WLK A;  4I9W A;  4LC1 A;  3RVY A;  2ZR2 A;  4H37 A;  4QNH B;  5IYC O;  2MK3 A;  5CA3 A;  1NH2 B;  1V55 B;  2WWW A;  5EK0 A;  2C2A A;  2IJJ A;  4R6Z A;  2P67 A;  4MVR A;  1I5X A;  1OZ0 A;  1V54 C;  2IU3 A;  2EIL C;  3VOU A;  3SPI A;  2IH3 C;  3E8G A;  5LGU A;  3I56 V;  4FMT A;  3WG7 B;  1PNM A;  4H33 A;  2EIK C;  3CCE V;  2EZP A;  4X89 A;  1OCZ C;  4P9P A;  2Y69 B;  3ABL B;  2LFS A;  4WFE A;  1ENV A;  4PDM A;  3LNM B;  3UM7 A;  1R3I C;  4DO2 A;  2XAG A;  1QLE B;  1AR1 B;  2XAQ A;  4TWK A;  3OUF A;  4HYO A;  3LDE A;  4OXS A;  1JOY A;  3LDC A;  3IFX A;  3W7S A;  1GMG A;  3D3I A;  4JAV A;  1VQL V;  2Z5U A;  1YJ9 V;  2Q6A A;  1N8R W;  4YXW G;  3DGE A;  4RUF A;  4HZ3 A;  2HVK C;  4MTF A;  3I55 V;  2UXN A;  1AI5 A;  3K03 A;  1K33 A;  4QE7 A;  3OMI B;  1VQ4 V;  5IY5 B;  1YSC A;  5B1B B;  3LDD A;  1MOF A;  2WSS G;  1QR8 A;  3AG2 C;  1K3E A;  4ZBM A;  3D36 A;  3T1C A;  3W7U A;  3CPW U;  2HKO A;  1F4N A;  2JIZ G;  3K0D A;  1W2B U;  4GX1 A;  2HLD G;  1CEZ A;  5B1A B;  1M57 C;  2XAS A;  1SZT A;  2ZDI A;  1LNQ A;  1PD3 A;  2W0F C;  1W0J G;  1M1K W;  2EIK B;  4QJF B;  5HFM A;  3ML0 A;  3TCU A;  2DQ3 A;  4WFG A;  3AG4 C;  3QO8 A;  4JF3 A;  1YTF B;  4FPP A;  1KEC A;  1MG1 A;  2GSM B;  3E35 A;  4G28 B;  1ORQ C;  4MVM A;  5J9P C;  4PEL A;  3AG1 C;  1YHQ V;  1W0K G;  3E89 A;  3FB8 C;  1YJW V;  5EBL C;  5IYD O;  1VQ9 V;  3OAA G;  4LCU C;  2R9R B;  1EZJ A;  1THZ A;  1AI7 A;  4JYB A;  5LBQ A;  1DF5 A;  4UVC A;  1VQP V;  3OM3 B;  4PA6 A;  4R7C A;  3OR7 C;  2EIJ B;  2LFR A;  1QVF U;  3M99 B;  2EZO A;  2B1G A;  3IGA C;  3CCL V;  4F4L A;  1GM8 A;  3F7V C;  4L87 A;  5H6R A;  1VQK V;  4UVB A;  1SET A;  4MVZ A;  3G4S V;  2IJI A;  1BHB A;  4JTA B;  4J9Z B;  1ARO P;  4UVA A;  2A79 B;  2Q68 A;  3EHB B;  2YEV B;  1P4R A;  1K5S A;  3AG3 C;  1PNL A;  2OT5 A;  2JJ2 G;  4KP4 A;  2DYS C;  1Y66 A;  5HFL A;  3X2Q B;  3JD0 A;  2QE7 G;  1OCO C;  1VQ6 V;  3ABK C;  4BW5 A;  2AHZ A;  3CCQ V;  2ZDI C;  3F7Y C;  3ZN0 A;  2HG5 C;  3CC2 V;  2HVJ C;  1K97 A;  4WFB V;  5KA6 A;  3OMA B;  4DXW A;  1OCC C;  4XDL A;  3W7T A;  1KP3 A;  1NQT A;  3LSQ A;  4G2K A;  2PI4 A;  1Q81 W;  1FXV A;  2R9I A;  5DM6 V;  3JD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...