1DF5A

Interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
publication title Interactions between HIV-1 gp41 core and detergents and their implications for membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 24
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1df5A00
3MHHC 4JF3A 4FIPC 5CMUA 3GWOA 1ENVA 1DLBA 1MOFA 2MK3A 1QCEA 2P6JA 1I5YA 1DF4A 1QBZA 1DF5A 5HFMA 2EZOA 3M99B 2OT5A 3H01A 3CP1A 5HFLA 3B8MA 3MHSC 3CYOA 2M7WA 1F23A 3B8NA 1QR8A 1K34A 3WFVA 1EBOA 1QR9A 2X7RB 4JPRA 1Y66A 2EBOA 4E2LA 1Y4MA 1K33A 3B77A 1I5XA 3K9AA 1JPXA 4FJCC 4JGSA 5KA6A 3P30A 5CN0A 2EZPA 2LP7A 4FK5C 4G2KA 5KA5A 1SZTA 1MG1A 4N23A 4N21A 1JQ0A 5H9CA
chains in the Genus database with same CATH superfamily
1P4RA 2YXYA 1N0NA 3K3WA 1JJOA 1M4UA 4HZ3A 4DUZB 1N33O 1D5NA 2EJRA 1GK9A 4GKKO 1M9NA 4B7KA 3SJBC 1VQ7V 3K06A 2UXXA 3K5NA 2RMKB 1YJWV 3SDLA 2ADQB 1HWYA 3UT5A 4X62O 4YHHB 1W2BU 4LFAO 5DM6V 5LP6A 2JRIA 3JCZA 4FLZA 3AEIA 1MMMA 2QKAA 2JDIG 1H38A 1Q8IA 2E76B 1Q86W 4ABMA 4Z2WA 2M7WA 3JARA 4OGQB 4JI3O 1AILA 3AG2B 5CA1B 1FXVA 3CRAA 4JTCB 2VRZA 1VQPV 3CXCU 3LSQA 3CPWU 4FLUA 2DWDC 4UVBA 1SC5B 4CH4A 1XNQO 2EULA 2JIZG 3RVZA 3J80N 1BZKA 4JI0O 4JAAA 1QBZA 4PV1B 1Q82W 2VWKA 3ZBHA 4DK1A 3CYOA 1XMOB 2NNUA 2L6LA 1ROPA 2B1IA 4X1KA 4WFBV 2HHHO 2BE3A 3BHPA 2F23A 1EZJA 3QTCA 5KHIA 2JGDA 5JCOC 1K8AW 4CS2A 1JA8A 3ZS8C 3LDCA 3RYHA 4TQFA 2ZNIA 5BMVA 1T5EA 2WA4A 4CZZA 1S77D 3E86A 3W7UA 1QNMA 5A9GA 4DV1O 3N2GB 3ZRSA 1CP9A 1BCCH 1YCIA 4IHJB 4MSWC 5CBGA 1H2SB 4TV8A 1Y76A 3RVYA 1NH2D 3OMIB 4FLXA 1BE3H 3BVOA 2UXDO 5E79Z 2AXTZ 2QTSA 5GW7A 3WU2Z 1NU1H 4X9QA 5LMNO 4PI2A 2KG7B 1N33B 4LFBO 1MSWD 1MSDA 1NTKH 2IJHA 2DQ3A 2WWWA 4GKKB 5J2UA 1VQ8V 2W6JG 3FB7C 1XMQO 1AROP 4ZIBA 4ZI7B 3JD0A 4LBEC 3AG3B 1F51A 4X62B 1B06A 3CRRA 1YF2A 2JVDA 1GN6A 4LFAB 3JAKB 3ASNB 1K5SA 2ZE6A 1B04A 1VF7A 4O4LA 4DXWA 4DUYO 2EIJB 4JI3B 2WLIB 4DR5O 4PDMA 1P7GA 3T1CA 4DR2O 1XHXA 5IJ0B 3ZMZA 4X65O 1FKAO 3CC2V 4K8XA 4D7SA 1XNQB 1PL0A 3VOUA 4JI0B 4J9ZB 3RYIB 2QKSA 3VQXA 1SZTA 3AK1A 2DN9A 4FLWA 2Q67A 2KSDA 3ABUA 2DW4A 5LXTA 2JEXA 4LNUA 5JVDA 2HHHB 1VQ6V 1R6NA 5IJ9B 1NZ6A 1Z5VA 1TUBB 1KD1W 4B3RO 2CK3G 1EN4A 2NLJC 2OTLV 4DR3O 1WB7A 2JK5C 1JCHA 4F4LA 2QR4A 2Q73A 3OEHG 4I0XA 3F5TA 1LUWA 5B1AC 4F6RA 2XTAA 1TAEA 1JQ0A 3CC4V 1YHQV 2E74B 1SQVH 4LH6A 1FFXB 4GCZA 3CCMV 2A0LA 3P3PA 2WLKA 1JJ2U 4O4IB 1LR1A 4JAVA 4DV1B 1RM1C 4JAUA 5LOVB 1JFFB 4JYCA 3FD9A 3K0GA 2YIBA 1UPGA 4MVOA 1THZA 3RWRD 1VQ9V 1COWG 3CEIA 5CN0A 2IM9A 1YTFD 3ZHVA 3ABMB 2UXDB 1NKDA 1X59A 4W4KA 1KMIZ 2CTPA 3MD0A 3IGAC 1SA0A 3JATA 2KKWA 1WN7A 1KYOF 2BOBC 3JD2A 2IJJA 2WAMA 2XAFA 5LHIA 1QHTA 1BSMA 1YJNV 3Q4HB 4LFBB 5ITZA 1IVSA 2EX3A 4IYHA 1G4YB 1GMGA 4I7ZB 2Q0AA 2PI4A 3AG1C 4PHZA 1XMQB 3LDEA 4KP4A 1NVPB 5KMGB 1RSOB 5L3EA 3SPJA 1IDSA 1YI2V 4PA7A 4X89A 1OCZC 4G28B 1SRYA 3FB6C 3CP1A 4YJ3A 5B1OA 5JH7A 3K5OA 3CC7V 2Q7EA 1D5AA 2CUGA 4FM0A 4DUYB 4H0LB 2OIEA 4JZGA 1VQNV 1NI8A 2ZDIC 5LL6Y 4R7CA 2BTQB 4DR5B 1Q7YW 1WA8A 4DR2B 4W4LA 4OPHA 2EIMC 2LFRA 1R3IC 3T1HO 1Q6HA 3BA8A 5LGUA 4X65B 4XDLA 3ABTA 3ZN1A 5IE9A 2OCCB 4WF9V 3RYCB 3SJAC 4DV0O 2X0LA 1Z5WA 1PNKA 1VQMV 2JGUA 4X88A 4LCUC 4ZHQB 4RUEA 1K3EA 3CSXA 3HKEB 3PJSK 5JQGB 4FMTA 2WSSG 3BAAA 4B3RB 1I5YA 1FAFA 5FNVB 3UQ8A 1SQPH 4DR3B 1VQLV 1B6QA 3MAQA 1TVKA 4DV6O 2GDSA 3SYOA 4MW8A 2CH7A 4DO2A 3AG3C 3AG4C 4DRXB 3QVNA 1GN3A 5IY5C 2ATKC 2PYLA 4WFFA 1Q43A 3HR0A 1OCRB 3BY6A 4TT3G 2CGNA 3QG5A 5LHHA 1L8DA 1KP2A 1QR8A 1EBOA 2IH1C 1ZL8B 4BAYA 5F2VO 4IIJA 1SKVA 2A7WA 1M93A 3ZJZA 3ZCCA 4FK5C 3GB7C 4QIWF 1MG1A 4RUFA 3EHBB 3N2KA 2Y0PA 2P4VA 4O4JA 3FYEB 4GX2A 3OFNG 1SZXA 3CX5F 4B08A 4NTWA 2FYUH 2RJZA 1YDXA 4IGGA 3RT3C 5B3SB 1Q81W 3L74H 1M57B 3K79A 5FPRA 3BPZA 1A32A 2WLNA 4KHPO 4MVSA 4JGSA 5EYPA 4LF7O 3C90A 3K03A 4IL6Z 3CRQA 3HKBA 1AI7A 3VQYA 4UB8Z 4PDLA 3G4SV 1BT8A 3UT5B 4YJ2A 1PL4A 5LP6B 5LHGA 3B2EE 2HJDA 3SJCC 1BS3A 4GKJO 3X2QC 3T1HB 5J9PC 3JARB 1M90W 4FZ1A 3F5WC 1FJGO 5CMUA 1S5JA 3T4ZA 1W0JG 1FXKA 4J42A 4EB6B 1R3JC 4DV0B 4XDKA 5BR8O 4NXMO 3NXSA 1M56B 4IT5A 3TCUA 4B7EA 4CC5A 2RDCA 4H37A 3QO7A 2R9RB 4J10A 3ETQA 4X1KB 4FLVA 1D2DA 1G6UA 5C8YA 3ZN0A 3OGIB 4GX5A 1K4CC 3CCRV 2HEPA 1HNWO 3L70H 1XDCA 3CMEV 3WB0A 2JGDB 3WG7C 2YIDA 3O65A 4DV6B 1RPOA 2V1DA 2E3CA 4QPKA 1QLEB 3RYHB 2P90A 4FJCC 3U11A 2GV9A 5BMVB 5BY1A 1PNMA 3R65A 2Q5ZA 1NT2B 4TV8B 2QTOA 3A2FA 3ETEA 2A3QA 1NTZH 4E2LA 4GZRB 1K33A 1V54B 1EN6A 1GO3F 4DW1A 2R70A 3SYQA 1XMOO 4ZBMA 3DC5A 2XNDG 1B3QA 4DV4O 3CCVV 5LGNA 5KX5B 3R66A 4DR6O 4KHPB 2GBOA 3S3WA 3IFXA 4LF7B 1OCCC 2LJ2A 5J2UB 2Z0AA 4U3FH 1KBHA 2N05A 3W7WA 3EXAA 4RWUA 4LH7A 3J7AU 4NB5A 5GONA 4MTGA 2NR5A 4O4LB 4GKJB 4WBNA 5KAFZ 1OZ0A 4EEQA 2H8PC 2QM8A 1UFIA 4QJFB 3LDDA 1FJGB 3ML0A 5B1BC 3W7SA 4TSFG 1I5XA 2H3OA 1BHBA 1PV0A 3QNEA 3WB2A 3PN1A 4NYKA 1KU9A 5BR8B 4NXMB 3E89A 4JF3A 1VQOV 3BRCA 3I55V 1YJ9V 3LNNA 3M99B 2GUZA 3BA9A 5LXTB 5IYDO 3H1LH 3CS5A 2YC0A 5LBQA 4LNUB 1F23A 1K97A 5JVDB 3P3NA 1HNWB 2OCHA 2DJVA 3WB1A 1K4DC 5J2TA 4UV9A 4JI4O 4R50A 4AI8A 4I0XB 5KUKA 2P6JA 4WFEA 3K9SA 1G1XB 5LYJB 2QWQB 3I56V 4J7JA 1EZVH 1K92A 2LGWA 1GN4A 2IJKA 3DTUB 2YS8A 2PGGA 5CB4A 3OMAB 2PF4E 2RCVA 4LC1A 2B5UA 4L87A 4TUYA 2IU0A 3L75H 2ZE8A 2Q7HA 3RYFA 1XREA 4NXNO 2FL4A 1TGOA 3CB2A 1YXBA 4J80A 2V4DA 1AI4A 2YIAA 3JATB 1CPYA 3D8CA 4FLTA 3TJTA 2XAGA 2Z5UA 4P9OA 1H2KA 4MVRA 1N4CA 4DR4O 2ZR2A 4BWAA 4DV4B 5ITZB 4HBNA 4DR6B 3E8GA 3J81N 1KP3A 2R9IA 1OHHG 3GWOA 3ICXA 4I55B 5JCOA 3A8TA 4UXNA 3K04A 3CXHF 4EFEA 3W7TA 4O2AA 4PD4F 1Q3EA 1DGSA 2AHZA 4YJ3B 2KQXA 5JH7B 4U3JA 1FPOA 2CE4A 1R73A 4U7NA 3CCQV 1O9GA 2ZXWC 2EINC 2AHYA 1V55C 2FTKA 4DR7O 2CGOA 4TV9A 4I9QA 1WA8B 4DV3O 2Y69C 1R6TA 2UUAO 3JASA 2BCCH 4I50A 3CCJV 1QVFU 1NR1A 4X64O 5IYZB 5IYBO 3K9AA 3STLC 3E8BA 3GVMA 1M5IA 3DSQA 1YVWA 1QLNA 2D2CB 2IBZH 3DXRA 4O2BA 1PD3A 4JI4B 4CBCA 3ZRWA 1GTOA 4TOIA 2A9HA 1DK1A 1YIJV 1TVKB 4MW3A 4OPAA 4PA6A 3TETA 3OW2U 3K0DA 1IZ3A 4JV5O 4NVPA 2CH7B 3HKDA 3BFRA 3I5DA 4QE7A 2X6CA 2F4VO 5HFLA 2UXBO 4UCOA 1IBKO 2QDOA 2YXLA 1K34A 1GRJA 1QR9A 4YIOA 1S3JA 4NXNB 2H94A 5B5EZ 4I5SA 3B4SA 4N23A 2ZCEA 4IIJB 2JEUA 1BMFG 1AB3A 3ZX6A 5EBMC 2VQEB 5L3GA 1DF5A 3G71V 4DR4B 2WLHA 4CS3A 4O4JB 1H2LA 4FM1A 4X1IA 3ZMUA 1KB9F 5FPOA 2F93B 1AP6A 5DN6G 1QQCA 2ETNA 4JI1O 4JTDB 5DEDA 2ZINA 1MABG 1WP8A 3OMNB 5EYPB 1J95A 4OX9O 4UCSA 3AG7A 3KCYA 3JSNA 2D3OW 2CTRA 3H01A 2YUAA 1TA8A 4FFBA 2HP8A 4YJ2B 2P5OA 3G6BA 3RGBA 1SQFA 2ZD9A 3KKYA 4DR7B 1XL6A 4KFMA 4RAIA 4BW9A 5JJNB 4DV3B 1OCOB 2UUAB 2DYRB 2GTSA 2X6AA 1WNSA 3CCLV 5KHJA 4X64B 2PI5A 2IH3C 1NVPD 3AG2C 2LO1A 1W59A 4H13B 2B9ZA 4DW0A 3UO2A 3JYCA 5CA1A 4LF6O 1FXKB 4IYIA 3IC9A 2RN9A 4MVZA 4R8CA 2ZM6O 3RBZA 3SJQC 3UKMA 3ABKB 5C8YB 1H2GA 1HW7A 1OV9A 1VF6C 4LF9O 1FFTB 4JTAB 4JV5B 3ZHQA 2IU3A 5D5PA 2DYSB 4FVMA 4UVCA 1XEQA 2F4VB 2ZDIA 2PTMA 3ZMTA 4TWKA 5IDJA 2UXBB 1IBKB 3OTOO 3BCCH 2QGNA 1YITV 1S5LZ 1DTOA 3CJHA 3A0HZ 3MHSC 3ZEDA 4K0KB 5BXZA 2YDEA 5KUMA 1ZUQA 1IURA 4Q20A 1LNQA 4JYAO 4DYLA 2LP7A 3QO8A 4PDVA 5H5NA 1Z2GA 3FX7A 1LUVA 5JWPA 1HP8A 1RPRA 4ZKIA 4MVUA 1R6KA 4CH6A 1JVMA 4MVQA 4JI1B 2B1GA 1I7FA 2KG7A 4KL1A 4OX9B 5AG2A 2EIKB 5H6QA 1VARA 4GUNA 2WPDG 1OJHA 1URFA 2ZNJA 2QWPB 3JD4A 4X66O 5H9CA 5GONB 3ASOB 3E2EA 4XBFA 1DF4A 2W0FC 3KZIZ 2VWJA 3ABLB 2ZR3A 4D7TA 1WPXA 4LF8B 3ASNC 4EKWA 2HG5C 5LMUO 4WBNB 2XUMA 2ZKOA 5E1AC 3TK1A 2FMLA 2EIJC 1FS0G 1BL8A 1PKXA 2EBOA 1K5QA 3FKSG 1WP7A 4MTXA 3P30A 2E75B 2ARHA 4JI8O 1SF9A 1Y4MA 2OIGA 4LF6B 2WLLA 2QWNB 2EILB 1U96A 3DC6A 4DV7O 2EZOA 2ZM6B 4PELA 1HNXO 2YEVA 2HLDG 2GUZB 1PM9A 4B3MO 3JAMN 4YY3O 4LF9B 4X20A 1ENVA 1GM7A 4J9YB 5J2TB 1IXBA 1Y74A 2QJ1A 4H33A 2VS0A 5IWAO 1TUBA 5BZBA 4UCTA 2AW9A 4DV5O 3OTOB 3ZHSA 1AP5A 5CB4B 3FFQA 4O4IA 5GTIZ 2N74A 3ZIAG 1J5EO 2Y48A 2W6IG 4TUYB 3KCXA 2CAZC 3SGIA 4LFCO 5LOVA 4R6ZA 1EFRG 1R3LC 3KG2A 1YEWA 2QE7G 3CCSV 4FFKA 3OR6C 4JYAB 3ABMC 3D3IA 3SR2C 1KUQA 1KECA 1XI1A 3F7YC 4LF4B 3NR7A 1IBLO 1SQXH 3ZRXA 3EFFK 3HPLC 4DR1O 4GX1A 1CEZA 3IJ4A 3CRCA 3OT7A 1XNRO 1R1BA 5FL7G 2QSAA 3C3TA 3FYIB 2OWOA 4X66B 4FPPA 4O2AB 4LF5O 2Y0IA 4Q6GA 5EZYA 3OUSA 2XAJA 4U3JB 5LA6A 3E22A 2GHYA 3FAVA 3AK3A 1BGYH 5LMUB 3L9DA 4JI2O 2L35A 2HJFC 1F4NA 1Y76B 2YXHA 4JI8B 3ETDA 3K58A 3JASB 4I50B 3ZHUA 2VQFO 4JI7O 1NR7A 2XAQA 4DV7B 2K9PA 2OCCC 1HNXB 2IJIA 1MA1A 1E1QG 4UCRA 1GM9A 4J7ZA 1WLEA 5KAIZ 1AR1B 2UUBO 4B3MB 3DXRB 4O2BB 2K1EA 4YY3B 2Z3YA 1AR5A 5IWAB 4WFAV 2PUSA 3LNMB 2GTAA 4C7UA 3LUTB 4PA4A 4DV5B 4U7OA 1WAZA 2HVJC 2X6BA 3HKDB 4QGPA 3JCUZ 4P30A 1E79G 4XDJA 1J5EB 5D5QA 1OCRC 3JAWA 4LFCB 3E8HA 2UU9O 1PPJH 1M1KW 3C3SA 2V7QG 3APQA 2YICA 1UJWB 3JALA 4PA9A 3T2MA 4O4HA 1FYJA 3OD4A 1ZSPA 1F4MA 2Q0OC 2Q6AA 1IBLB 2R72A 1ORQC 4K35A 4J7KA 3B77A 3RN4A 3D36C 4DR1B 2M6YA 4EFBA 5L3DA 4X1IB 2XAHA 4H44B 2BOCC 1XNRB 2YIBD 5B3SC 1GKFA 1M57C 4WFHA 4F6RB 4BIUA 4A5UB 3A0RA 5B1AB 4K3AA 2ZT9B 1P84F 4LF5B 4HNAA 3BEHA 3JD1A 4L8JA 4NKGB 4B3SO 1QU7A 3STZC 4FFBB 4NTXA 1AJQA 1NTMH 2BSKA 4PA3A 1RM1B 4JI2B 5LP6C 1X4TA 1BQZA 1HR0O 1XOUA 2PYJA 1JOYA 3B40A 1L0NH 4X1YA 2VQFB 4MTOA 2OT5A 4RQFA 4JI7B 1SA0B 4CH3A 5K1PA 2E5LO 2VQEO 4LP8A 4UV8A 3HKCA 4CS4A 3SYCA 1K73W 3K57A 3THOA 1N8RW 5CBHA 3ZHRA 1NJIW 1S76D 4WFGA 3ZMSA 1S5HC 4EB6A 1M56C 3CCEV 2LGQA 1CXZB 2UUBB 1DLBA 5IT9N 2QWRB 2ZIMA 4JZ2A 1WPBA 1Q90D 4FZ0A 3AG1B 1L0LH 3OE7G 2AZ0A 4AQYO 3L71H 2WLMA 2X7RB 1OCZB 4MT8A 1Y66A 1KKDA 3TGUH 1VP7A 3AK2A 2ILMA 1R3KC 1SQBH 4B3TO 1QLEC 3SYPA 3UCSC 1PP9H 1SS3A 2RQ6A 1SQQH 3H1JH 2G38A 1U97A 2JJ1G 3K5LA 2EIMB 2P67A 2UU9B 2Q68A 4I9WA 3OAAG 3CJHB 1AI5A 2YI8A 2AGAA 4ZOLA 4QE9A 4LWSA 4ICGA 5KA5A 4N21A 4UCUA 3LSUA 1V54C 3CMAV 3OGCC 4GLXA 1SQGA 2HR3A 3T1YO 3TXQA 1F7YA 1VQKV 3H1IH 1H8HG 1GN2A 2OTJV 1S0VA 4UUJC 5KX5A 1NH2B 4TQDA 4FIPC 4J11A 4B3SB 1XQ8A 2Y4UA 2BTOA 3AG4B 5IY5B 5CA0A 3SPIA 3F7VC 4RQEA 1P49A 1HR0B 3TXSA 2XT9A 1I94O 1S72V 1QVGU 4K0KO 5EC1C 2LW7A 3ZRVA 2UUCO 2Q4PA 2QM4A 2E5LB 3FB5C 2WLLB 1US6A 1IX9A 1PNLA 5EBLC 5LGTA 4QPJA 3DGEA 1FD9A 3N2KB 3CHXA 1VF5B 4I4TA 2DQ0A 5KLVH 3E83A 4KXRA 2YEVB 3MDSA 2QM7A 4QNHB 5KHKA 4AQYB 4JI6O 3HKBB 3SPGA 4X20B 2UXNA 4PJ0Z 1KC8W 1Y74B 5B1NA 2ODMA 5JJJB 4WCEV 1VQ5V 1VQ4V 3B8NA 5EIBD 4B3TB 2P4KA 1AI6A 4LF8O 4D6TH 1JX9A 2P06A 2MW2B 3X2QB 5LYJA 1WJZA 3QF7A 2HKOA 1MNGA 1GM8A 3OTFA 1BHAA 3D3QA 1YZBA 3B09A 4MVMA 1NQTA 5EK0A 3K08A 2QEXV 1N32O 4Z1VA 1FXHA 1ZX3A 4BW5A 3T1YB 4LR3A 3JSLA 5LMNB 1XL4A 1O9HA 3OR7C 1VF6A 3P32A 3CE2A 4JPRA 3WG7B 1Q5OA 4DV2O 1YTFB 1BQ0A 3M7MX 1I08A 1MZEA 1JPXA 5KA6A 4I55A 1RFYA 3K5MA 2C2AA 1XUQA 3RFRA 3M8AA 5EZYB 1H2NA 5LA6B 2F43G 3E22B 3FAVB 1I94B 2N04A 4OXSA 2KB1A 2W0XA 3ZMVA 5FLXN 2A06H 4UFZA 4YIPA 3SYAA 3N2GA 4F6EA 2UUCB 4RO2A 4DK0A 4IHJA 2JJ2G 2P22C 4G2KA 2CTWA 4UCVA 3OUFA 2XASA 1NS1A 1MOFA 1HDJA 4FLYA 1N36O 4LF4O 1E1RG 5IYZA 1N0JA 1RP3B 4KUMA 3G6EV 3EVKA 5KHGA 2O57A 2LW1A 2WA3A 4JI5O 3HB3B 4JI6B 1OCCB 3S3XA 2YI9A 5H2FZ 4BR6A 4ZI7A 4NTYA 2MK3A 1KKCA 2QWOB 1IBMO 3B8MA 2Q7GA 2EJ7A 3JAKA 2DWEC 2DMXA 5TISZ 5C93A 2WLIA 3T4DA 4P9PA 1AJNA 3JAWB 5B1BB 3RW0A 1K7DA 1QCEA 1SESA 5IJ0A 2NN4A 3JALB 4MS2A 3GWKC 4O4HB 2PY5A 2LQTA 1N32B 1L1FA 1N34O 2PZSA 2UXCO 3RYIA 3CCUV 2ITCC 3JD3A 4NR1A 2RNBA 1XILA 2FKXA 1ZWIC 5H6RA 5IJ9A 4DV2B 4AHCA 3U0ZA 1MZFA 2CDYA 3OM3B 4CC6A 4K8ZA 1GAXA 1Y6XA 1HNZO 4JYBA 3UM7A 3G80A 4JYYA 4HNAB 2JS3A 1TUEB 2ZIOA 2LFSA 2DOSA 1FFXA 2BSKB 3IAYA 5CA3A 3OEEG 1K9MW 1JFFA 3RYFB 1OCOC 2QA4V 4X8AA 4X1YB 2DYRC 5CBFA 2Q8VA 1Y67A 2OYQA 2HVKC 3HKCB 1N36B 3L72H 4P2ZA 3LSSA 2QKCA 1FXKC 3A0BZ 4HYOA 5EIBC 1VMGA 1H2MA 2ITDC 2CTQA 3L73H 1H8EG 3ZHTA 1SETA 2ZE7A 5K1XA 2F1MA 3Q4HA 4JI5B 1VIBA 3H1HH 3W7XA 3H1KH 5KHHA 2R9AA 1AVMA 2F66C 4DUZO 1GH6A 1P7BA 3ABKC 5KMGA 1RSOA 1XHZA 3ETGA 2F95B 1IBMB 2EZPA 4JASA 3VQWA 3K59A 2ZQMA 3CD6V 4UVAA 1AJPA 2P7TC 3IC7A 2ZXWB 2EINB 1SERA 1NBMG 4YHHO 4HAMA 5L3CA 2DYSC 4TV9B 2FB5A 1V55B 4GT1A 1JMKC 2BTQA 3G67A 2Y69B 4PI0A 3BABA 1EN5A 5DECA 5EC2C 1KQSU 1Q6UA 1XBLA 2AZ2A 4ZOLB 4UB6Z 4E4EA 4LWSB 1ZAUA 3QO5A 4AILC 1YSCA 1N34B 2UXCB 3U10A 1IXMA 3RYCA 4CH5A 3CRMA 5EBWC 3VBBA 4GYCB 4BIOA 2Q9LA 4ZHQA 3SPHA 3HKEA 3SPCA 1EM1A 3H9VA 3VQVA 4Z1MG 5JQGA 5IYCO 3ZRWB 2ZE5A 2Q69A 5FNVA 3MHHC 2Y4TA 2WLJA 4PDRA 1HNZB 2EIKC 2YSUB 2GSMB 5HFMA 1JR9A 2XOKG 4GX0A 3N27A 3E8FA 5A2QN 1ZLZA 3ASOC 4BIZA 4G27B 5L3BA 3O9OA 4DRXA 5CA0B 1ZTEA 3ABLC 1I0HA 2IW5A 2DE0X 2HFEC 4YXWG 2JS5A 1V9PA 5JJEB 2A79B 4FM2A 3FB8C 2ADPA 1ZL8A 3APOA 1VEWA 3E35A 3WFVA 5L3FA 1Q6IA 4MTFA 1W0KG 1AR4A 1WB8A 2EILC 4I4TB 5B66Z 3CWBH 4J41A 5GTHZ 3UO3A 2XHBA 4ASUG 3D36A 1G8MA
chains in the Genus database with same CATH topology
5IDJA 1P4RA 5CMUA 4FIPC 3K3WA 3T4ZA 1W0JG 1FXKA 1YITV 1R3JC 4HZ3A 4XDKA 1DTOA 3MHSC 2EJRA 3AG4B 3NXSA 1M56B 5KUMA 3TCUA 5IY5B 1GK9A 4Q20A 1M9NA 3F7VC 3SPIA 4RQEA 4H37A 3QO7A 2R9RB 1VQ7V 3K06A 2UXXA 1LNQA 1YJWV 1S72V 1QVGU 2LP7A 3QO8A 4PDVA 3ZN0A 1HWYA 5EC1C 4GX5A 3ZRVA 1K4CC 3CCRV 1W2BU 5DM6V 1RPRA 4ZKIA 3CMEV 3JCZA 3AEIA 3FB5C 3WG7C 4MVUA 2JDIG 1H38A 2WLLB 1RPOA 1R6KA 1PNLA 5EBLC 5LGTA 4QPJA 1JVMA 3DGEA 1Q86W 2V1DA 4MVQA 2M7WA 2DQ0A 4QPKA 2B1GA 1QLEB 3AG2B 1FXVA 2P90A 2EIKB 3E83A 4FJCC 4JTCB 2YEVB 5H6QA 1VQPV 2WPDG 3CXCU 3LSQA 3CPWU 1PNMA 3JD4A 3R65A 2DWDC 5H9CA 4UVBA 2QM7A 4QNHB 3ASOB 3E2EA 2JIZG 4XBFA 3RVZA 3SPGA 1DF4A 1QBZA 2W0FC 1Q82W 3ABLB 2ZR3A 1WPXA 2UXNA 1KC8W 3ASNC 5B1NA 4EKWA 3CYOA 2HG5C 4WCEV 1VQ5V 2NNUA 1VQ4V 5E1AC 2QTOA 3B8NA 3TK1A 3ETEA 1ROPA 2EIJC 2B1IA 1FS0G 1BL8A 1PKXA 4WFBV 2EBOA 1K5QA 3FKSG 4E2LA 1K33A 1V54B 1AI6A 4MTXA 1GO3F 1EZJA 1JX9A 3P30A 3SYQA 4ZBMA 1Y4MA 3X2QB 2WLLA 1K8AW 2XNDG 2HKOA 3CCVV 2EILB 5LGNA 1GM8A 1BHAA 2EZOA 3LDCA 4PELA 3IFXA 1OCCC 2YEVA 2HLDG 4MVMA 1NQTA 3W7WA 5EK0A 4CZZA 1S77D 3E86A 3K08A 3W7UA 2QEXV 3ZRSA 4MTGA 1CP9A 4MSWC 5CBGA 1ENVA 1GM7A 1FXHA 4J9YB 3RVYA 4H33A 4BW5A 1NH2D 3OMIB 5BZBA 1XL4A 1OZ0A 5GW7A 2H8PC 2QM8A 3OR7C 4QJFB 3LDDA 3ML0A 5B1BC 3P32A 4JPRA 3W7SA 3WG7B 1YTFB 4TSFG 1I5XA 1JPXA 5KA6A 1BHBA 3QNEA 2C2AA 3E89A 1MSWD 4JF3A 3ZIAG 1VQOV 2IJHA 2Y48A 2W6IG 2DQ3A 2WWWA 2F43G 3I55V 1VQ8V 2W6JG 3FB7C 1EFRG 1R3LC 3KG2A 4R6ZA 1YJ9V 1AROP 2QE7G 3M99B 3CCSV 3OR6C 4OXSA 5IYDO 2KB1A 3JD0A 3ZMVA 4LBEC 5LBQA 3AG3B 1F51A 3ABMC 1F23A 1K97A 3SYAA 3D3IA 4RO2A 2JJ2G 1KECA 1K4DC 3ASNB 3F7YC 1K5SA 4UV9A 4DXWA 4G2KA 4R50A 3OUFA 2EIJB 2XASA 3ZRXA 3EFFK 1MOFA 2WLIB 3HPLC 5KUKA 2P6JA 4GX1A 4WFEA 1CEZA 4PDMA 1E1RG 3T1CA 5FL7G 3I56V 1K92A 3FYIB 3ZMZA 4KUMA 2IJKA 3G6EV 3DTUB 4FPPA 3CC2V 3OMAB 4LC1A 3OUSA 1PL0A 2XAJA 3HB3B 3VOUA 2B5UA 4L87A 2IU0A 1OCCB 4J9ZB 2QKSA 1SZTA 2GHYA 2Q67A 3ABUA 2DW4A 2MK3A 2JEXA 2HJFC 1VQ6V 1R6NA 1F4NA 3B8MA 1AI4A 3ETDA 1CPYA 2XAGA 2Z5UA 2DWEC 4P9OA 1KD1W 2CK3G 2NLJC 4MVRA 2OTLV 2ZR2A 2JK5C 1JCHA 4F4LA 1NR7A 2XAQA 3OEHG 5C93A 5B1AC 2WLIA 3T4DA 2OCCC 4P9PA 1JQ0A 1AJNA 3E8GA 2IJIA 3CC4V 1KP3A 1YHQV 2R9IA 1E1QG 1OHHG 3GWOA 5B1BB 1GM9A 3RW0A 4GCZA 3CCMV 1K7DA 1QCEA 1SESA 2A0LA 2WLKA 1JJ2U 1WLEA 4UXNA 3K04A 1AR1B 4MS2A 4JAVA 3W7TA 1RM1C 4JAUA 1L1FA 4JYCA 2AHZA 2K1EA 3K0GA 4MVOA 3CCUV 1THZA 2Z3YA 2ITCC 1VQ9V 1R73A 1COWG 4U7NA 3CCQV 2ZXWC 2EINC 5CN0A 3JD3A 1YTFD 4WFAV 3ABMB 3LNMB 2AHYA 1V55C 1NKDA 2FTKA 3LUTB 3MD0A 4PA4A 1ZWIC 3IGAC 5H6RA 2Y69C 4U7OA 2BOBC 2HVJC 3CCJV 2X6BA 1QVFU 3JD2A 3OM3B 1NR1A 2IJJA 2WAMA 4P30A 2XAFA 5LHIA 1E79G 4JYBA 4XDJA 3UM7A 1YJNV 1G4YB 1GMGA 1OCRC 5IYBO 1TUEB 3K9AA 3STLC 2LFSA 3E8BA 2PI4A 3E8HA 3AG1C 3LDEA 4KP4A 1NVPB 1QLNA 1M1KW 2V7QG 5L3EA 1UJWB 3SPJA 4PA9A 1YI2V 4PA7A 3T2MA 5CA3A 4X89A 3OEEG 1OCZC 1K9MW 4G28B 1SRYA 3FB6C 3CP1A 5B1OA 1F4MA 1OCOC 1PD3A 3CC7V 2QA4V 4X8AA 2DYRC 2Q6AA 4CBCA 5CBFA 3ZRWA 1GTOA 1ORQC 2A9HA 1VQNV 2HVKC 2ZDIC 3B77A 1YIJV 4R7CA 4MW3A 5L3DA 4PA6A 3TETA 1Q7YW 2XAHA 4P2ZA 2BOCC 3OW2U 3LSSA 1FXKC 3K0DA 2EIMC 2LFRA 4HYOA 1R3IC 2ITDC 5B3SC 1GKFA 1M57C 4WFHA 1H8EG 5LGUA 1SETA 4QE7A 2X6CA 4BIUA 3A0RA 4XDLA 3ABTA 5B1AB 5HFLA 3ZN1A 2OCCB 3W7XA 4WF9V 3BEHA 3JD1A 1K34A 1QR9A 3STZC 1S3JA 2X0LA 1PNKA 1P7BA 3ABKC 1VQMV 1AJQA 3ETGA 4X88A 4LCUC 2H94A 4PA3A 2EZPA 4JASA 4RUEA 1RM1B 4I5SA 4N23A 2JEUA 1BMFG 1K3EA 3PJSK 2ZQMA 3CD6V 4UVAA 4FMTA 5EBMC 2WSSG 1AJPA 2P7TC 3IC7A 1JOYA 1I5YA 2ZXWB 5L3GA 2EINB 1DF5A 4MTOA 3G71V 2OT5A 4RQFA 1SERA 1NBMG 4HAMA 5L3CA 2DYSC 2WLHA 1V55B 4GT1A 1VQLV 1B6QA 4LP8A 4UV8A 3ZMUA 2Y69B 3SYCA 5DN6G 3ZMTA 5EC2C 1K73W 1KQSU 3SYOA 4MW8A 1N8RW 5CBHA 4JTDB 1NJIW 1S76D 4WFGA 4DO2A 1MABG 3ZMSA 1S5HC 3AG3C 3AG4C 1M56C 3OMNB 3CCEV 5IY5C 2ATKC 1J95A 1DLBA 3QO5A 4WFFA 1YSCA 1OCRB 3BY6A 4TT3G 2D3OW 3AG1B 5LHHA 1IXMA 3H01A 3OE7G 5EBWC 3VBBA 1KP2A 1QR8A 1EBOA 2WLMA 2IH1C 2X7RB 2ZD9A 1OCZB 4MT8A 1Y66A 3SPHA 1KKDA 1XL6A 4KFMA 4RAIA 4BAYA 1OCOB 3SPCA 5IYCO 3ZJZA 4Z1MG 3ZCCA 4FK5C 3GB7C 4QIWF 3ZRWB 1MG1A 2DYRB 4RUFA 2Q69A 2X6AA 3EHBB 3MHHC 3CCLV 1R3KC 2PI5A 2IH3C 1QLEC 2WLJA 4PDRA 3AG2C 3SYPA 1NVPD 3FYEB 4GX2A 3OFNG 2EIKC 2YSUB 2GSMB 5HFMA 3JYCA 2XOKG 4GX0A 2JJ1G 1FXKB 2EIMB 2P67A 2Q68A 3E8FA 4I9WA 3OAAG 5B3SB 1Q81W 1M57B 1AI5A 4MVZA 4R8CA 3ASOC 3K79A 4G27B 4BIZA 5L3BA 2WLNA 4MVSA 4JGSA 4QE9A 3RBZA 3ABLC 3K03A 3SJQC 2IW5A 5KA5A 2HFEC 4N21A 4TWKA 1AI7A 4YXWG 4PDLA 3UKMA 3G4SV 3ABKB 1H2GA 2A79B 1V54C 3CMAV 3FB8C 5LHGA 3OGCC 1FFTB 2HR3A 3X2QC 3E35A 4JTAB 3WFVA 1VQKV 5L3FA 1H8HG 4MTFA 1W0KG 2IU3A 5J9PC 2EILC 2OTJV 1M90W 2DYSB 4UVCA 1S0VA 4UUJC 4ASUG 2ZDIA 1NH2B 3D36A 1G8MA 3F5WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH C;  4JF3 A;  4FIP C;  5CMU A;  3GWO A;  1ENV A;  1DLB A;  1MOF A;  2MK3 A;  1QCE A;  2P6J A;  1I5Y A;  1DF4 A;  1QBZ A;  1DF5 A;  5HFM A;  2EZO A;  3M99 B;  2OT5 A;  3H01 A;  3CP1 A;  5HFL A;  3B8M A;  3MHS C;  3CYO A;  2M7W A;  1F23 A;  3B8N A;  1QR8 A;  1K34 A;  3WFV A;  1EBO A;  1QR9 A;  2X7R B;  4JPR A;  1Y66 A;  2EBO A;  4E2L A;  1Y4M A;  1K33 A;  3B77 A;  1I5X A;  3K9A A;  1JPX A;  4FJC C;  4JGS A;  5KA6 A;  3P30 A;  5CN0 A;  2EZP A;  2LP7 A;  4FK5 C;  4G2K A;  5KA5 A;  1SZT A;  1MG1 A;  4N23 A;  4N21 A;  1JQ0 A;  5H9C A; 
#chains in the Genus database with same CATH topology
 1P4R A;  2YXY A;  1N0N A;  3K3W A;  1JJO A;  1M4U A;  4HZ3 A;  4DUZ B;  1N33 O;  1D5N A;  2EJR A;  1GK9 A;  4GKK O;  1M9N A;  4B7K A;  3SJB C;  1VQ7 V;  3K06 A;  2UXX A;  3K5N A;  2RMK B;  1YJW V;  3SDL A;  2ADQ B;  1HWY A;  3UT5 A;  4X62 O;  4YHH B;  1W2B U;  4LFA O;  5DM6 V;  5LP6 A;  2JRI A;  3JCZ A;  4FLZ A;  3AEI A;  1MMM A;  2QKA A;  2JDI G;  1H38 A;  1Q8I A;  2E76 B;  1Q86 W;  4ABM A;  4Z2W A;  2M7W A;  3JAR A;  4OGQ B;  4JI3 O;  1AIL A;  3AG2 B;  5CA1 B;  1FXV A;  3CRA A;  4JTC B;  2VRZ A;  1VQP V;  3CXC U;  3LSQ A;  3CPW U;  4FLU A;  2DWD C;  4UVB A;  1SC5 B;  4CH4 A;  1XNQ O;  2EUL A;  2JIZ G;  3RVZ A;  3J80 N;  1BZK A;  4JI0 O;  4JAA A;  1QBZ A;  4PV1 B;  1Q82 W;  2VWK A;  3ZBH A;  4DK1 A;  3CYO A;  1XMO B;  2NNU A;  2L6L A;  1ROP A;  2B1I A;  4X1K A;  4WFB V;  2HHH O;  2BE3 A;  3BHP A;  2F23 A;  1EZJ A;  3QTC A;  5KHI A;  2JGD A;  5JCO C;  1K8A W;  4CS2 A;  1JA8 A;  3ZS8 C;  3LDC A;  3RYH A;  4TQF A;  2ZNI A;  5BMV A;  1T5E A;  2WA4 A;  4CZZ A;  1S77 D;  3E86 A;  3W7U A;  1QNM A;  5A9G A;  4DV1 O;  3N2G B;  3ZRS A;  1CP9 A;  1BCC H;  1YCI A;  4IHJ B;  4MSW C;  5CBG A;  1H2S B;  4TV8 A;  1Y76 A;  3RVY A;  1NH2 D;  3OMI B;  4FLX A;  1BE3 H;  3BVO A;  2UXD O;  5E79 Z;  2AXT Z;  2QTS A;  5GW7 A;  3WU2 Z;  1NU1 H;  4X9Q A;  5LMN O;  4PI2 A;  2KG7 B;  1N33 B;  4LFB O;  1MSW D;  1MSD A;  1NTK H;  2IJH A;  2DQ3 A;  2WWW A;  4GKK B;  5J2U A;  1VQ8 V;  2W6J G;  3FB7 C;  1XMQ O;  1ARO P;  4ZIB A;  4ZI7 B;  3JD0 A;  4LBE C;  3AG3 B;  1F51 A;  4X62 B;  1B06 A;  3CRR A;  1YF2 A;  2JVD A;  1GN6 A;  4LFA B;  3JAK B;  3ASN B;  1K5S A;  2ZE6 A;  1B04 A;  1VF7 A;  4O4L A;  4DXW A;  4DUY O;  2EIJ B;  4JI3 B;  2WLI B;  4DR5 O;  4PDM A;  1P7G A;  3T1C A;  4DR2 O;  1XHX A;  5IJ0 B;  3ZMZ A;  4X65 O;  1FKA O;  3CC2 V;  4K8X A;  4D7S A;  1XNQ B;  1PL0 A;  3VOU A;  4JI0 B;  4J9Z B;  3RYI B;  2QKS A;  3VQX A;  1SZT A;  3AK1 A;  2DN9 A;  4FLW A;  2Q67 A;  2KSD A;  3ABU A;  2DW4 A;  5LXT A;  2JEX A;  4LNU A;  5JVD A;  2HHH B;  1VQ6 V;  1R6N A;  5IJ9 B;  1NZ6 A;  1Z5V A;  1TUB B;  1KD1 W;  4B3R O;  2CK3 G;  1EN4 A;  2NLJ C;  2OTL V;  4DR3 O;  1WB7 A;  2JK5 C;  1JCH A;  4F4L A;  2QR4 A;  2Q73 A;  3OEH G;  4I0X A;  3F5T A;  1LUW A;  5B1A C;  4F6R A;  2XTA A;  1TAE A;  1JQ0 A;  3CC4 V;  1YHQ V;  2E74 B;  1SQV H;  4LH6 A;  1FFX B;  4GCZ A;  3CCM V;  2A0L A;  3P3P A;  2WLK A;  1JJ2 U;  4O4I B;  1LR1 A;  4JAV A;  4DV1 B;  1RM1 C;  4JAU A;  5LOV B;  1JFF B;  4JYC A;  3FD9 A;  3K0G A;  2YIB A;  1UPG A;  4MVO A;  1THZ A;  3RWR D;  1VQ9 V;  1COW G;  3CEI A;  5CN0 A;  2IM9 A;  1YTF D;  3ZHV A;  3ABM B;  2UXD B;  1NKD A;  1X59 A;  4W4K A;  1KMI Z;  2CTP A;  3MD0 A;  3IGA C;  1SA0 A;  3JAT A;  2KKW A;  1WN7 A;  1KYO F;  2BOB C;  3JD2 A;  2IJJ A;  2WAM A;  2XAF A;  5LHI A;  1QHT A;  1BSM A;  1YJN V;  3Q4H B;  4LFB B;  5ITZ A;  1IVS A;  2EX3 A;  4IYH A;  1G4Y B;  1GMG A;  4I7Z B;  2Q0A A;  2PI4 A;  3AG1 C;  4PHZ A;  1XMQ B;  3LDE A;  4KP4 A;  1NVP B;  5KMG B;  1RSO B;  5L3E A;  3SPJ A;  1IDS A;  1YI2 V;  4PA7 A;  4X89 A;  1OCZ C;  4G28 B;  1SRY A;  3FB6 C;  3CP1 A;  4YJ3 A;  5B1O A;  5JH7 A;  3K5O A;  3CC7 V;  2Q7E A;  1D5A A;  2CUG A;  4FM0 A;  4DUY B;  4H0L B;  2OIE A;  4JZG A;  1VQN V;  1NI8 A;  2ZDI C;  5LL6 Y;  4R7C A;  2BTQ B;  4DR5 B;  1Q7Y W;  1WA8 A;  4DR2 B;  4W4L A;  4OPH A;  2EIM C;  2LFR A;  1R3I C;  3T1H O;  1Q6H A;  3BA8 A;  5LGU A;  4X65 B;  4XDL A;  3ABT A;  3ZN1 A;  5IE9 A;  2OCC B;  4WF9 V;  3RYC B;  3SJA C;  4DV0 O;  2X0L A;  1Z5W A;  1PNK A;  1VQM V;  2JGU A;  4X88 A;  4LCU C;  4ZHQ B;  4RUE A;  1K3E A;  3CSX A;  3HKE B;  3PJS K;  5JQG B;  4FMT A;  2WSS G;  3BAA A;  4B3R B;  1I5Y A;  1FAF A;  5FNV B;  3UQ8 A;  1SQP H;  4DR3 B;  1VQL V;  1B6Q A;  3MAQ A;  1TVK A;  4DV6 O;  2GDS A;  3SYO A;  4MW8 A;  2CH7 A;  4DO2 A;  3AG3 C;  3AG4 C;  4DRX B;  3QVN A;  1GN3 A;  5IY5 C;  2ATK C;  2PYL A;  4WFF A;  1Q43 A;  3HR0 A;  1OCR B;  3BY6 A;  4TT3 G;  2CGN A;  3QG5 A;  5LHH A;  1L8D A;  1KP2 A;  1QR8 A;  1EBO A;  2IH1 C;  1ZL8 B;  4BAY A;  5F2V O;  4IIJ A;  1SKV A;  2A7W A;  1M93 A;  3ZJZ A;  3ZCC A;  4FK5 C;  3GB7 C;  4QIW F;  1MG1 A;  4RUF A;  3EHB B;  3N2K A;  2Y0P A;  2P4V A;  4O4J A;  3FYE B;  4GX2 A;  3OFN G;  1SZX A;  3CX5 F;  4B08 A;  4NTW A;  2FYU H;  2RJZ A;  1YDX A;  4IGG A;  3RT3 C;  5B3S B;  1Q81 W;  3L74 H;  1M57 B;  3K79 A;  5FPR A;  3BPZ A;  1A32 A;  2WLN A;  4KHP O;  4MVS A;  4JGS A;  5EYP A;  4LF7 O;  3C90 A;  3K03 A;  4IL6 Z;  3CRQ A;  3HKB A;  1AI7 A;  3VQY A;  4UB8 Z;  4PDL A;  3G4S V;  1BT8 A;  3UT5 B;  4YJ2 A;  1PL4 A;  5LP6 B;  5LHG A;  3B2E E;  2HJD A;  3SJC C;  1BS3 A;  4GKJ O;  3X2Q C;  3T1H B;  5J9P C;  3JAR B;  1M90 W;  4FZ1 A;  3F5W C;  1FJG O;  5CMU A;  1S5J A;  3T4Z A;  1W0J G;  1FXK A;  4J42 A;  4EB6 B;  1R3J C;  4DV0 B;  4XDK A;  5BR8 O;  4NXM O;  3NXS A;  1M56 B;  4IT5 A;  3TCU A;  4B7E A;  4CC5 A;  2RDC A;  4H37 A;  3QO7 A;  2R9R B;  4J10 A;  3ETQ A;  4X1K B;  4FLV A;  1D2D A;  1G6U A;  5C8Y A;  3ZN0 A;  3OGI B;  4GX5 A;  1K4C C;  3CCR V;  2HEP A;  1HNW O;  3L70 H;  1XDC A;  3CME V;  3WB0 A;  2JGD B;  3WG7 C;  2YID A;  3O65 A;  4DV6 B;  1RPO A;  2V1D A;  2E3C A;  4QPK A;  1QLE B;  3RYH B;  2P90 A;  4FJC C;  3U11 A;  2GV9 A;  5BMV B;  5BY1 A;  1PNM A;  3R65 A;  2Q5Z A;  1NT2 B;  4TV8 B;  2QTO A;  3A2F A;  3ETE A;  2A3Q A;  1NTZ H;  4E2L A;  4GZR B;  1K33 A;  1V54 B;  1EN6 A;  1GO3 F;  4DW1 A;  2R70 A;  3SYQ A;  1XMO O;  4ZBM A;  3DC5 A;  2XND G;  1B3Q A;  4DV4 O;  3CCV V;  5LGN A;  5KX5 B;  3R66 A;  4DR6 O;  4KHP B;  2GBO A;  3S3W A;  3IFX A;  4LF7 B;  1OCC C;  2LJ2 A;  5J2U B;  2Z0A A;  4U3F H;  1KBH A;  2N05 A;  3W7W A;  3EXA A;  4RWU A;  4LH7 A;  3J7A U;  4NB5 A;  5GON A;  4MTG A;  2NR5 A;  4O4L B;  4GKJ B;  4WBN A;  5KAF Z;  1OZ0 A;  4EEQ A;  2H8P C;  2QM8 A;  1UFI A;  4QJF B;  3LDD A;  1FJG B;  3ML0 A;  5B1B C;  3W7S A;  4TSF G;  1I5X A;  2H3O A;  1BHB A;  1PV0 A;  3QNE A;  3WB2 A;  3PN1 A;  4NYK A;  1KU9 A;  5BR8 B;  4NXM B;  3E89 A;  4JF3 A;  1VQO V;  3BRC A;  3I55 V;  1YJ9 V;  3LNN A;  3M99 B;  2GUZ A;  3BA9 A;  5LXT B;  5IYD O;  3H1L H;  3CS5 A;  2YC0 A;  5LBQ A;  4LNU B;  1F23 A;  1K97 A;  5JVD B;  3P3N A;  1HNW B;  2OCH A;  2DJV A;  3WB1 A;  1K4D C;  5J2T A;  4UV9 A;  4JI4 O;  4R50 A;  4AI8 A;  4I0X B;  5KUK A;  2P6J A;  4WFE A;  3K9S A;  1G1X B;  5LYJ B;  2QWQ B;  3I56 V;  4J7J A;  1EZV H;  1K92 A;  2LGW A;  1GN4 A;  2IJK A;  3DTU B;  2YS8 A;  2PGG A;  5CB4 A;  3OMA B;  2PF4 E;  2RCV A;  4LC1 A;  2B5U A;  4L87 A;  4TUY A;  2IU0 A;  3L75 H;  2ZE8 A;  2Q7H A;  3RYF A;  1XRE A;  4NXN O;  2FL4 A;  1TGO A;  3CB2 A;  1YXB A;  4J80 A;  2V4D A;  1AI4 A;  2YIA A;  3JAT B;  1CPY A;  3D8C A;  4FLT A;  3TJT A;  2XAG A;  2Z5U A;  4P9O A;  1H2K A;  4MVR A;  1N4C A;  4DR4 O;  2ZR2 A;  4BWA A;  4DV4 B;  5ITZ B;  4HBN A;  4DR6 B;  3E8G A;  3J81 N;  1KP3 A;  2R9I A;  1OHH G;  3GWO A;  3ICX A;  4I55 B;  5JCO A;  3A8T A;  4UXN A;  3K04 A;  3CXH F;  4EFE A;  3W7T A;  4O2A A;  4PD4 F;  1Q3E A;  1DGS A;  2AHZ A;  4YJ3 B;  2KQX A;  5JH7 B;  4U3J A;  1FPO A;  2CE4 A;  1R73 A;  4U7N A;  3CCQ V;  1O9G A;  2ZXW C;  2EIN C;  2AHY A;  1V55 C;  2FTK A;  4DR7 O;  2CGO A;  4TV9 A;  4I9Q A;  1WA8 B;  4DV3 O;  2Y69 C;  1R6T A;  2UUA O;  3JAS A;  2BCC H;  4I50 A;  3CCJ V;  1QVF U;  1NR1 A;  4X64 O;  5IYZ B;  5IYB O;  3K9A A;  3STL C;  3E8B A;  3GVM A;  1M5I A;  3DSQ A;  1YVW A;  1QLN A;  2D2C B;  2IBZ H;  3DXR A;  4O2B A;  1PD3 A;  4JI4 B;  4CBC A;  3ZRW A;  1GTO A;  4TOI A;  2A9H A;  1DK1 A;  1YIJ V;  1TVK B;  4MW3 A;  4OPA A;  4PA6 A;  3TET A;  3OW2 U;  3K0D A;  1IZ3 A;  4JV5 O;  4NVP A;  2CH7 B;  3HKD A;  3BFR A;  3I5D A;  4QE7 A;  2X6C A;  2F4V O;  5HFL A;  2UXB O;  4UCO A;  1IBK O;  2QDO A;  2YXL A;  1K34 A;  1GRJ A;  1QR9 A;  4YIO A;  1S3J A;  4NXN B;  2H94 A;  5B5E Z;  4I5S A;  3B4S A;  4N23 A;  2ZCE A;  4IIJ B;  2JEU A;  1BMF G;  1AB3 A;  3ZX6 A;  5EBM C;  2VQE B;  5L3G A;  1DF5 A;  3G71 V;  4DR4 B;  2WLH A;  4CS3 A;  4O4J B;  1H2L A;  4FM1 A;  4X1I A;  3ZMU A;  1KB9 F;  5FPO A;  2F93 B;  1AP6 A;  5DN6 G;  1QQC A;  2ETN A;  4JI1 O;  4JTD B;  5DED A;  2ZIN A;  1MAB G;  1WP8 A;  3OMN B;  5EYP B;  1J95 A;  4OX9 O;  4UCS A;  3AG7 A;  3KCY A;  3JSN A;  2D3O W;  2CTR A;  3H01 A;  2YUA A;  1TA8 A;  4FFB A;  2HP8 A;  4YJ2 B;  2P5O A;  3G6B A;  3RGB A;  1SQF A;  2ZD9 A;  3KKY A;  4DR7 B;  1XL6 A;  4KFM A;  4RAI A;  4BW9 A;  5JJN B;  4DV3 B;  1OCO B;  2UUA B;  2DYR B;  2GTS A;  2X6A A;  1WNS A;  3CCL V;  5KHJ A;  4X64 B;  2PI5 A;  2IH3 C;  1NVP D;  3AG2 C;  2LO1 A;  1W59 A;  4H13 B;  2B9Z A;  4DW0 A;  3UO2 A;  3JYC A;  5CA1 A;  4LF6 O;  1FXK B;  4IYI A;  3IC9 A;  2RN9 A;  4MVZ A;  4R8C A;  2ZM6 O;  3RBZ A;  3SJQ C;  3UKM A;  3ABK B;  5C8Y B;  1H2G A;  1HW7 A;  1OV9 A;  1VF6 C;  4LF9 O;  1FFT B;  4JTA B;  4JV5 B;  3ZHQ A;  2IU3 A;  5D5P A;  2DYS B;  4FVM A;  4UVC A;  1XEQ A;  2F4V B;  2ZDI A;  2PTM A;  3ZMT A;  4TWK A;  5IDJ A;  2UXB B;  1IBK B;  3OTO O;  3BCC H;  2QGN A;  1YIT V;  1S5L Z;  1DTO A;  3CJH A;  3A0H Z;  3MHS C;  3ZED A;  4K0K B;  5BXZ A;  2YDE A;  5KUM A;  1ZUQ A;  1IUR A;  4Q20 A;  1LNQ A;  4JYA O;  4DYL A;  2LP7 A;  3QO8 A;  4PDV A;  5H5N A;  1Z2G A;  3FX7 A;  1LUV A;  5JWP A;  1HP8 A;  1RPR A;  4ZKI A;  4MVU A;  1R6K A;  4CH6 A;  1JVM A;  4MVQ A;  4JI1 B;  2B1G A;  1I7F A;  2KG7 A;  4KL1 A;  4OX9 B;  5AG2 A;  2EIK B;  5H6Q A;  1VAR A;  4GUN A;  2WPD G;  1OJH A;  1URF A;  2ZNJ A;  2QWP B;  3JD4 A;  4X66 O;  5H9C A;  5GON B;  3ASO B;  3E2E A;  4XBF A;  1DF4 A;  2W0F C;  3KZI Z;  2VWJ A;  3ABL B;  2ZR3 A;  4D7T A;  1WPX A;  4LF8 B;  3ASN C;  4EKW A;  2HG5 C;  5LMU O;  4WBN B;  2XUM A;  2ZKO A;  5E1A C;  3TK1 A;  2FML A;  2EIJ C;  1FS0 G;  1BL8 A;  1PKX A;  2EBO A;  1K5Q A;  3FKS G;  1WP7 A;  4MTX A;  3P30 A;  2E75 B;  2ARH A;  4JI8 O;  1SF9 A;  1Y4M A;  2OIG A;  4LF6 B;  2WLL A;  2QWN B;  2EIL B;  1U96 A;  3DC6 A;  4DV7 O;  2EZO A;  2ZM6 B;  4PEL A;  1HNX O;  2YEV A;  2HLD G;  2GUZ B;  1PM9 A;  4B3M O;  3JAM N;  4YY3 O;  4LF9 B;  4X20 A;  1ENV A;  1GM7 A;  4J9Y B;  5J2T B;  1IXB A;  1Y74 A;  2QJ1 A;  4H33 A;  2VS0 A;  5IWA O;  1TUB A;  5BZB A;  4UCT A;  2AW9 A;  4DV5 O;  3OTO B;  3ZHS A;  1AP5 A;  5CB4 B;  3FFQ A;  4O4I A;  5GTI Z;  2N74 A;  3ZIA G;  1J5E O;  2Y48 A;  2W6I G;  4TUY B;  3KCX A;  2CAZ C;  3SGI A;  4LFC O;  5LOV A;  4R6Z A;  1EFR G;  1R3L C;  3KG2 A;  1YEW A;  2QE7 G;  3CCS V;  4FFK A;  3OR6 C;  4JYA B;  3ABM C;  3D3I A;  3SR2 C;  1KUQ A;  1KEC A;  1XI1 A;  3F7Y C;  4LF4 B;  3NR7 A;  1IBL O;  1SQX H;  3ZRX A;  3EFF K;  3HPL C;  4DR1 O;  4GX1 A;  1CEZ A;  3IJ4 A;  3CRC A;  3OT7 A;  1XNR O;  1R1B A;  5FL7 G;  2QSA A;  3C3T A;  3FYI B;  2OWO A;  4X66 B;  4FPP A;  4O2A B;  4LF5 O;  2Y0I A;  4Q6G A;  5EZY A;  3OUS A;  2XAJ A;  4U3J B;  5LA6 A;  3E22 A;  2GHY A;  3FAV A;  3AK3 A;  1BGY H;  5LMU B;  3L9D A;  4JI2 O;  2L35 A;  2HJF C;  1F4N A;  1Y76 B;  2YXH A;  4JI8 B;  3ETD A;  3K58 A;  3JAS B;  4I50 B;  3ZHU A;  2VQF O;  4JI7 O;  1NR7 A;  2XAQ A;  4DV7 B;  2K9P A;  2OCC C;  1HNX B;  2IJI A;  1MA1 A;  1E1Q G;  4UCR A;  1GM9 A;  4J7Z A;  1WLE A;  5KAI Z;  1AR1 B;  2UUB O;  4B3M B;  3DXR B;  4O2B B;  2K1E A;  4YY3 B;  2Z3Y A;  1AR5 A;  5IWA B;  4WFA V;  2PUS A;  3LNM B;  2GTA A;  4C7U A;  3LUT B;  4PA4 A;  4DV5 B;  4U7O A;  1WAZ A;  2HVJ C;  2X6B A;  3HKD B;  4QGP A;  3JCU Z;  4P30 A;  1E79 G;  4XDJ A;  1J5E B;  5D5Q A;  1OCR C;  3JAW A;  4LFC B;  3E8H A;  2UU9 O;  1PPJ H;  1M1K W;  3C3S A;  2V7Q G;  3APQ A;  2YIC A;  1UJW B;  3JAL A;  4PA9 A;  3T2M A;  4O4H A;  1FYJ A;  3OD4 A;  1ZSP A;  1F4M A;  2Q0O C;  2Q6A A;  1IBL B;  2R72 A;  1ORQ C;  4K35 A;  4J7K A;  3B77 A;  3RN4 A;  3D36 C;  4DR1 B;  2M6Y A;  4EFB A;  5L3D A;  4X1I B;  2XAH A;  4H44 B;  2BOC C;  1XNR B;  2YIB D;  5B3S C;  1GKF A;  1M57 C;  4WFH A;  4F6R B;  4BIU A;  4A5U B;  3A0R A;  5B1A B;  4K3A A;  2ZT9 B;  1P84 F;  4LF5 B;  4HNA A;  3BEH A;  3JD1 A;  4L8J A;  4NKG B;  4B3S O;  1QU7 A;  3STZ C;  4FFB B;  4NTX A;  1AJQ A;  1NTM H;  2BSK A;  4PA3 A;  1RM1 B;  4JI2 B;  5LP6 C;  1X4T A;  1BQZ A;  1HR0 O;  1XOU A;  2PYJ A;  1JOY A;  3B40 A;  1L0N H;  4X1Y A;  2VQF B;  4MTO A;  2OT5 A;  4RQF A;  4JI7 B;  1SA0 B;  4CH3 A;  5K1P A;  2E5L O;  2VQE O;  4LP8 A;  4UV8 A;  3HKC A;  4CS4 A;  3SYC A;  1K73 W;  3K57 A;  3THO A;  1N8R W;  5CBH A;  3ZHR A;  1NJI W;  1S76 D;  4WFG A;  3ZMS A;  1S5H C;  4EB6 A;  1M56 C;  3CCE V;  2LGQ A;  1CXZ B;  2UUB B;  1DLB A;  5IT9 N;  2QWR B;  2ZIM A;  4JZ2 A;  1WPB A;  1Q90 D;  4FZ0 A;  3AG1 B;  1L0L H;  3OE7 G;  2AZ0 A;  4AQY O;  3L71 H;  2WLM A;  2X7R B;  1OCZ B;  4MT8 A;  1Y66 A;  1KKD A;  3TGU H;  1VP7 A;  3AK2 A;  2ILM A;  1R3K C;  1SQB H;  4B3T O;  1QLE C;  3SYP A;  3UCS C;  1PP9 H;  1SS3 A;  2RQ6 A;  1SQQ H;  3H1J H;  2G38 A;  1U97 A;  2JJ1 G;  3K5L A;  2EIM B;  2P67 A;  2UU9 B;  2Q68 A;  4I9W A;  3OAA G;  3CJH B;  1AI5 A;  2YI8 A;  2AGA A;  4ZOL A;  4QE9 A;  4LWS A;  4ICG A;  5KA5 A;  4N21 A;  4UCU A;  3LSU A;  1V54 C;  3CMA V;  3OGC C;  4GLX A;  1SQG A;  2HR3 A;  3T1Y O;  3TXQ A;  1F7Y A;  1VQK V;  3H1I H;  1H8H G;  1GN2 A;  2OTJ V;  1S0V A;  4UUJ C;  5KX5 A;  1NH2 B;  4TQD A;  4FIP C;  4J11 A;  4B3S B;  1XQ8 A;  2Y4U A;  2BTO A;  3AG4 B;  5IY5 B;  5CA0 A;  3SPI A;  3F7V C;  4RQE A;  1P49 A;  1HR0 B;  3TXS A;  2XT9 A;  1I94 O;  1S72 V;  1QVG U;  4K0K O;  5EC1 C;  2LW7 A;  3ZRV A;  2UUC O;  2Q4P A;  2QM4 A;  2E5L B;  3FB5 C;  2WLL B;  1US6 A;  1IX9 A;  1PNL A;  5EBL C;  5LGT A;  4QPJ A;  3DGE A;  1FD9 A;  3N2K B;  3CHX A;  1VF5 B;  4I4T A;  2DQ0 A;  5KLV H;  3E83 A;  4KXR A;  2YEV B;  3MDS A;  2QM7 A;  4QNH B;  5KHK A;  4AQY B;  4JI6 O;  3HKB B;  3SPG A;  4X20 B;  2UXN A;  4PJ0 Z;  1KC8 W;  1Y74 B;  5B1N A;  2ODM A;  5JJJ B;  4WCE V;  1VQ5 V;  1VQ4 V;  3B8N A;  5EIB D;  4B3T B;  2P4K A;  1AI6 A;  4LF8 O;  4D6T H;  1JX9 A;  2P06 A;  2MW2 B;  3X2Q B;  5LYJ A;  1WJZ A;  3QF7 A;  2HKO A;  1MNG A;  1GM8 A;  3OTF A;  1BHA A;  3D3Q A;  1YZB A;  3B09 A;  4MVM A;  1NQT A;  5EK0 A;  3K08 A;  2QEX V;  1N32 O;  4Z1V A;  1FXH A;  1ZX3 A;  4BW5 A;  3T1Y B;  4LR3 A;  3JSL A;  5LMN B;  1XL4 A;  1O9H A;  3OR7 C;  1VF6 A;  3P32 A;  3CE2 A;  4JPR A;  3WG7 B;  1Q5O A;  4DV2 O;  1YTF B;  1BQ0 A;  3M7M X;  1I08 A;  1MZE A;  1JPX A;  5KA6 A;  4I55 A;  1RFY A;  3K5M A;  2C2A A;  1XUQ A;  3RFR A;  3M8A A;  5EZY B;  1H2N A;  5LA6 B;  2F43 G;  3E22 B;  3FAV B;  1I94 B;  2N04 A;  4OXS A;  2KB1 A;  2W0X A;  3ZMV A;  5FLX N;  2A06 H;  4UFZ A;  4YIP A;  3SYA A;  3N2G A;  4F6E A;  2UUC B;  4RO2 A;  4DK0 A;  4IHJ A;  2JJ2 G;  2P22 C;  4G2K A;  2CTW A;  4UCV A;  3OUF A;  2XAS A;  1NS1 A;  1MOF A;  1HDJ A;  4FLY A;  1N36 O;  4LF4 O;  1E1R G;  5IYZ A;  1N0J A;  1RP3 B;  4KUM A;  3G6E V;  3EVK A;  5KHG A;  2O57 A;  2LW1 A;  2WA3 A;  4JI5 O;  3HB3 B;  4JI6 B;  1OCC B;  3S3X A;  2YI9 A;  5H2F Z;  4BR6 A;  4ZI7 A;  4NTY A;  2MK3 A;  1KKC A;  2QWO B;  1IBM O;  3B8M A;  2Q7G A;  2EJ7 A;  3JAK A;  2DWE C;  2DMX A;  5TIS Z;  5C93 A;  2WLI A;  3T4D A;  4P9P A;  1AJN A;  3JAW B;  5B1B B;  3RW0 A;  1K7D A;  1QCE A;  1SES A;  5IJ0 A;  2NN4 A;  3JAL B;  4MS2 A;  3GWK C;  4O4H B;  2PY5 A;  2LQT A;  1N32 B;  1L1F A;  1N34 O;  2PZS A;  2UXC O;  3RYI A;  3CCU V;  2ITC C;  3JD3 A;  4NR1 A;  2RNB A;  1XIL A;  2FKX A;  1ZWI C;  5H6R A;  5IJ9 A;  4DV2 B;  4AHC A;  3U0Z A;  1MZF A;  2CDY A;  3OM3 B;  4CC6 A;  4K8Z A;  1GAX A;  1Y6X A;  1HNZ O;  4JYB A;  3UM7 A;  3G80 A;  4JYY A;  4HNA B;  2JS3 A;  1TUE B;  2ZIO A;  2LFS A;  2DOS A;  1FFX A;  2BSK B;  3IAY A;  5CA3 A;  3OEE G;  1K9M W;  1JFF A;  3RYF B;  1OCO C;  2QA4 V;  4X8A A;  4X1Y B;  2DYR C;  5CBF A;  2Q8V A;  1Y67 A;  2OYQ A;  2HVK C;  3HKC B;  1N36 B;  3L72 H;  4P2Z A;  3LSS A;  2QKC A;  1FXK C;  3A0B Z;  4HYO A;  5EIB C;  1VMG A;  1H2M A;  2ITD C;  2CTQ A;  3L73 H;  1H8E G;  3ZHT A;  1SET A;  2ZE7 A;  5K1X A;  2F1M A;  3Q4H A;  4JI5 B;  1VIB A;  3H1H H;  3W7X A;  3H1K H;  5KHH A;  2R9A A;  1AVM A;  2F66 C;  4DUZ O;  1GH6 A;  1P7B A;  3ABK C;  5KMG A;  1RSO A;  1XHZ A;  3ETG A;  2F95 B;  1IBM B;  2EZP A;  4JAS A;  3VQW A;  3K59 A;  2ZQM A;  3CD6 V;  4UVA A;  1AJP A;  2P7T C;  3IC7 A;  2ZXW B;  2EIN B;  1SER A;  1NBM G;  4YHH O;  4HAM A;  5L3C A;  2DYS C;  4TV9 B;  2FB5 A;  1V55 B;  4GT1 A;  1JMK C;  2BTQ A;  3G67 A;  2Y69 B;  4PI0 A;  3BAB A;  1EN5 A;  5DEC A;  5EC2 C;  1KQS U;  1Q6U A;  1XBL A;  2AZ2 A;  4ZOL B;  4UB6 Z;  4E4E A;  4LWS B;  1ZAU A;  3QO5 A;  4AIL C;  1YSC A;  1N34 B;  2UXC B;  3U10 A;  1IXM A;  3RYC A;  4CH5 A;  3CRM A;  5EBW C;  3VBB A;  4GYC B;  4BIO A;  2Q9L A;  4ZHQ A;  3SPH A;  3HKE A;  3SPC A;  1EM1 A;  3H9V A;  3VQV A;  4Z1M G;  5JQG A;  5IYC O;  3ZRW B;  2ZE5 A;  2Q69 A;  5FNV A;  3MHH C;  2Y4T A;  2WLJ A;  4PDR A;  1HNZ B;  2EIK C;  2YSU B;  2GSM B;  5HFM A;  1JR9 A;  2XOK G;  4GX0 A;  3N27 A;  3E8F A;  5A2Q N;  1ZLZ A;  3ASO C;  4BIZ A;  4G27 B;  5L3B A;  3O9O A;  4DRX A;  5CA0 B;  1ZTE A;  3ABL C;  1I0H A;  2IW5 A;  2DE0 X;  2HFE C;  4YXW G;  2JS5 A;  1V9P A;  5JJE B;  2A79 B;  4FM2 A;  3FB8 C;  2ADP A;  1ZL8 A;  3APO A;  1VEW A;  3E35 A;  3WFV A;  5L3F A;  1Q6I A;  4MTF A;  1W0K G;  1AR4 A;  1WB8 A;  2EIL C;  4I4T B;  5B66 Z;  3CWB H;  4J41 A;  5GTH Z;  3UO3 A;  2XHB A;  4ASU G;  3D36 A;  1G8M A; 
#chains in the Genus database with same CATH homology
 5IDJ A;  1P4R A;  5CMU A;  4FIP C;  3K3W A;  3T4Z A;  1W0J G;  1FXK A;  1YIT V;  1R3J C;  4HZ3 A;  4XDK A;  1DTO A;  3MHS C;  2EJR A;  3AG4 B;  3NXS A;  1M56 B;  5KUM A;  3TCU A;  5IY5 B;  1GK9 A;  4Q20 A;  1M9N A;  3F7V C;  3SPI A;  4RQE A;  4H37 A;  3QO7 A;  2R9R B;  1VQ7 V;  3K06 A;  2UXX A;  1LNQ A;  1YJW V;  1S72 V;  1QVG U;  2LP7 A;  3QO8 A;  4PDV A;  3ZN0 A;  1HWY A;  5EC1 C;  4GX5 A;  3ZRV A;  1K4C C;  3CCR V;  1W2B U;  5DM6 V;  1RPR A;  4ZKI A;  3CME V;  3JCZ A;  3AEI A;  3FB5 C;  3WG7 C;  4MVU A;  2JDI G;  1H38 A;  2WLL B;  1RPO A;  1R6K A;  1PNL A;  5EBL C;  5LGT A;  4QPJ A;  1JVM A;  3DGE A;  1Q86 W;  2V1D A;  4MVQ A;  2M7W A;  2DQ0 A;  4QPK A;  2B1G A;  1QLE B;  3AG2 B;  1FXV A;  2P90 A;  2EIK B;  3E83 A;  4FJC C;  4JTC B;  2YEV B;  5H6Q A;  1VQP V;  2WPD G;  3CXC U;  3LSQ A;  3CPW U;  1PNM A;  3JD4 A;  3R65 A;  2DWD C;  5H9C A;  4UVB A;  2QM7 A;  4QNH B;  3ASO B;  3E2E A;  2JIZ G;  4XBF A;  3RVZ A;  3SPG A;  1DF4 A;  1QBZ A;  2W0F C;  1Q82 W;  3ABL B;  2ZR3 A;  1WPX A;  2UXN A;  1KC8 W;  3ASN C;  5B1N A;  4EKW A;  3CYO A;  2HG5 C;  4WCE V;  1VQ5 V;  2NNU A;  1VQ4 V;  5E1A C;  2QTO A;  3B8N A;  3TK1 A;  3ETE A;  1ROP A;  2EIJ C;  2B1I A;  1FS0 G;  1BL8 A;  1PKX A;  4WFB V;  2EBO A;  1K5Q A;  3FKS G;  4E2L A;  1K33 A;  1V54 B;  1AI6 A;  4MTX A;  1GO3 F;  1EZJ A;  1JX9 A;  3P30 A;  3SYQ A;  4ZBM A;  1Y4M A;  3X2Q B;  2WLL A;  1K8A W;  2XND G;  2HKO A;  3CCV V;  2EIL B;  5LGN A;  1GM8 A;  1BHA A;  2EZO A;  3LDC A;  4PEL A;  3IFX A;  1OCC C;  2YEV A;  2HLD G;  4MVM A;  1NQT A;  3W7W A;  5EK0 A;  4CZZ A;  1S77 D;  3E86 A;  3K08 A;  3W7U A;  2QEX V;  3ZRS A;  4MTG A;  1CP9 A;  4MSW C;  5CBG A;  1ENV A;  1GM7 A;  1FXH A;  4J9Y B;  3RVY A;  4H33 A;  4BW5 A;  1NH2 D;  3OMI B;  5BZB A;  1XL4 A;  1OZ0 A;  5GW7 A;  2H8P C;  2QM8 A;  3OR7 C;  4QJF B;  3LDD A;  3ML0 A;  5B1B C;  3P32 A;  4JPR A;  3W7S A;  3WG7 B;  1YTF B;  4TSF G;  1I5X A;  1JPX A;  5KA6 A;  1BHB A;  3QNE A;  2C2A A;  3E89 A;  1MSW D;  4JF3 A;  3ZIA G;  1VQO V;  2IJH A;  2Y48 A;  2W6I G;  2DQ3 A;  2WWW A;  2F43 G;  3I55 V;  1VQ8 V;  2W6J G;  3FB7 C;  1EFR G;  1R3L C;  3KG2 A;  4R6Z A;  1YJ9 V;  1ARO P;  2QE7 G;  3M99 B;  3CCS V;  3OR6 C;  4OXS A;  5IYD O;  2KB1 A;  3JD0 A;  3ZMV A;  4LBE C;  5LBQ A;  3AG3 B;  1F51 A;  3ABM C;  1F23 A;  1K97 A;  3SYA A;  3D3I A;  4RO2 A;  2JJ2 G;  1KEC A;  1K4D C;  3ASN B;  3F7Y C;  1K5S A;  4UV9 A;  4DXW A;  4G2K A;  4R50 A;  3OUF A;  2EIJ B;  2XAS A;  3ZRX A;  3EFF K;  1MOF A;  2WLI B;  3HPL C;  5KUK A;  2P6J A;  4GX1 A;  4WFE A;  1CEZ A;  4PDM A;  1E1R G;  3T1C A;  5FL7 G;  3I56 V;  1K92 A;  3FYI B;  3ZMZ A;  4KUM A;  2IJK A;  3G6E V;  3DTU B;  4FPP A;  3CC2 V;  3OMA B;  4LC1 A;  3OUS A;  1PL0 A;  2XAJ A;  3HB3 B;  3VOU A;  2B5U A;  4L87 A;  2IU0 A;  1OCC B;  4J9Z B;  2QKS A;  1SZT A;  2GHY A;  2Q67 A;  3ABU A;  2DW4 A;  2MK3 A;  2JEX A;  2HJF C;  1VQ6 V;  1R6N A;  1F4N A;  3B8M A;  1AI4 A;  3ETD A;  1CPY A;  2XAG A;  2Z5U A;  2DWE C;  4P9O A;  1KD1 W;  2CK3 G;  2NLJ C;  4MVR A;  2OTL V;  2ZR2 A;  2JK5 C;  1JCH A;  4F4L A;  1NR7 A;  2XAQ A;  3OEH G;  5C93 A;  5B1A C;  2WLI A;  3T4D A;  2OCC C;  4P9P A;  1JQ0 A;  1AJN A;  3E8G A;  2IJI A;  3CC4 V;  1KP3 A;  1YHQ V;  2R9I A;  1E1Q G;  1OHH G;  3GWO A;  5B1B B;  1GM9 A;  3RW0 A;  4GCZ A;  3CCM V;  1K7D A;  1QCE A;  1SES A;  2A0L A;  2WLK A;  1JJ2 U;  1WLE A;  4UXN A;  3K04 A;  1AR1 B;  4MS2 A;  4JAV A;  3W7T A;  1RM1 C;  4JAU A;  1L1F A;  4JYC A;  2AHZ A;  2K1E A;  3K0G A;  4MVO A;  3CCU V;  1THZ A;  2Z3Y A;  2ITC C;  1VQ9 V;  1R73 A;  1COW G;  4U7N A;  3CCQ V;  2ZXW C;  2EIN C;  5CN0 A;  3JD3 A;  1YTF D;  4WFA V;  3ABM B;  3LNM B;  2AHY A;  1V55 C;  1NKD A;  2FTK A;  3LUT B;  3MD0 A;  4PA4 A;  1ZWI C;  3IGA C;  5H6R A;  2Y69 C;  4U7O A;  2BOB C;  2HVJ C;  3CCJ V;  2X6B A;  1QVF U;  3JD2 A;  3OM3 B;  1NR1 A;  2IJJ A;  2WAM A;  4P30 A;  2XAF A;  5LHI A;  1E79 G;  4JYB A;  4XDJ A;  3UM7 A;  1YJN V;  1G4Y B;  1GMG A;  1OCR C;  5IYB O;  1TUE B;  3K9A A;  3STL C;  2LFS A;  3E8B A;  2PI4 A;  3E8H A;  3AG1 C;  3LDE A;  4KP4 A;  1NVP B;  1QLN A;  1M1K W;  2V7Q G;  5L3E A;  1UJW B;  3SPJ A;  4PA9 A;  1YI2 V;  4PA7 A;  3T2M A;  5CA3 A;  4X89 A;  3OEE G;  1OCZ C;  1K9M W;  4G28 B;  1SRY A;  3FB6 C;  3CP1 A;  5B1O A;  1F4M A;  1OCO C;  1PD3 A;  3CC7 V;  2QA4 V;  4X8A A;  2DYR C;  2Q6A A;  4CBC A;  5CBF A;  3ZRW A;  1GTO A;  1ORQ C;  2A9H A;  1VQN V;  2HVK C;  2ZDI C;  3B77 A;  1YIJ V;  4R7C A;  4MW3 A;  5L3D A;  4PA6 A;  3TET A;  1Q7Y W;  2XAH A;  4P2Z A;  2BOC C;  3OW2 U;  3LSS A;  1FXK C;  3K0D A;  2EIM C;  2LFR A;  4HYO A;  1R3I C;  2ITD C;  5B3S C;  1GKF A;  1M57 C;  4WFH A;  1H8E G;  5LGU A;  1SET A;  4QE7 A;  2X6C A;  4BIU A;  3A0R A;  4XDL A;  3ABT A;  5B1A B;  5HFL A;  3ZN1 A;  2OCC B;  3W7X A;  4WF9 V;  3BEH A;  3JD1 A;  1K34 A;  1QR9 A;  3STZ C;  1S3J A;  2X0L A;  1PNK A;  1P7B A;  3ABK C;  1VQM V;  1AJQ A;  3ETG A;  4X88 A;  4LCU C;  2H94 A;  4PA3 A;  2EZP A;  4JAS A;  4RUE A;  1RM1 B;  4I5S A;  4N23 A;  2JEU A;  1BMF G;  1K3E A;  3PJS K;  2ZQM A;  3CD6 V;  4UVA A;  4FMT A;  5EBM C;  2WSS G;  1AJP A;  2P7T C;  3IC7 A;  1JOY A;  1I5Y A;  2ZXW B;  5L3G A;  2EIN B;  1DF5 A;  4MTO A;  3G71 V;  2OT5 A;  4RQF A;  1SER A;  1NBM G;  4HAM A;  5L3C A;  2DYS C;  2WLH A;  1V55 B;  4GT1 A;  1VQL V;  1B6Q A;  4LP8 A;  4UV8 A;  3ZMU A;  2Y69 B;  3SYC A;  5DN6 G;  3ZMT A;  5EC2 C;  1K73 W;  1KQS U;  3SYO A;  4MW8 A;  1N8R W;  5CBH A;  4JTD B;  1NJI W;  1S76 D;  4WFG A;  4DO2 A;  1MAB G;  3ZMS A;  1S5H C;  3AG3 C;  3AG4 C;  1M56 C;  3OMN B;  3CCE V;  5IY5 C;  2ATK C;  1J95 A;  1DLB A;  3QO5 A;  4WFF A;  1YSC A;  1OCR B;  3BY6 A;  4TT3 G;  2D3O W;  3AG1 B;  5LHH A;  1IXM A;  3H01 A;  3OE7 G;  5EBW C;  3VBB A;  1KP2 A;  1QR8 A;  1EBO A;  2WLM A;  2IH1 C;  2X7R B;  2ZD9 A;  1OCZ B;  4MT8 A;  1Y66 A;  3SPH A;  1KKD A;  1XL6 A;  4KFM A;  4RAI A;  4BAY A;  1OCO B;  3SPC A;  5IYC O;  3ZJZ A;  4Z1M G;  3ZCC A;  4FK5 C;  3GB7 C;  4QIW F;  3ZRW B;  1MG1 A;  2DYR B;  4RUF A;  2Q69 A;  2X6A A;  3EHB B;  3MHH C;  3CCL V;  1R3K C;  2PI5 A;  2IH3 C;  1QLE C;  2WLJ A;  4PDR A;  3AG2 C;  3SYP A;  1NVP D;  3FYE B;  4GX2 A;  3OFN G;  2EIK C;  2YSU B;  2GSM B;  5HFM A;  3JYC A;  2XOK G;  4GX0 A;  2JJ1 G;  1FXK B;  2EIM B;  2P67 A;  2Q68 A;  3E8F A;  4I9W A;  3OAA G;  5B3S B;  1Q81 W;  1M57 B;  1AI5 A;  4MVZ A;  4R8C A;  3ASO C;  3K79 A;  4G27 B;  4BIZ A;  5L3B A;  2WLN A;  4MVS A;  4JGS A;  4QE9 A;  3RBZ A;  3ABL C;  3K03 A;  3SJQ C;  2IW5 A;  5KA5 A;  2HFE C;  4N21 A;  4TWK A;  1AI7 A;  4YXW G;  4PDL A;  3UKM A;  3G4S V;  3ABK B;  1H2G A;  2A79 B;  1V54 C;  3CMA V;  3FB8 C;  5LHG A;  3OGC C;  1FFT B;  2HR3 A;  3X2Q C;  3E35 A;  4JTA B;  3WFV A;  1VQK V;  5L3F A;  1H8H G;  4MTF A;  1W0K G;  2IU3 A;  5J9P C;  2EIL C;  2OTJ V;  1M90 W;  2DYS B;  4UVC A;  1S0V A;  4UUJ C;  4ASU G;  2ZDI A;  1NH2 B;  3D36 A;  1G8M A;  3F5W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...