1K33A

Crystal structure analysis of the gp41 core mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
66
structure length
62
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQGRGGWMEWDREANNYTSLIHSLIEESQNQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein GP41
publication title Interhelical interactions in the gp41 core: implications for activation of HIV-1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 27
structure length 62
sequence length 66
ec nomenclature
pdb deposition date 2001-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k33A00
4E2LA 5CMUA 1I5YA 3CP1A 1MOFA 3B77A 3MHHC 1Y4MA 1DLBA 3H01A 4N23A 1Y66A 5HFLA 1QBZA 2P6JA 1F23A 1QCEA 4N21A 1DF4A 3P30A 2OT5A 2EZPA 2MK3A 3B8MA 4FJCC 1EBOA 4FK5C 4JGSA 4JPRA 1K33A 1QR8A 5CN0A 5HFMA 5KA5A 3M99B 4G2KA 1QR9A 3WFVA 3MHSC 2LP7A 2M7WA 4JF3A 1SZTA 3CYOA 3GWOA 5KA6A 1ENVA 5H9CA 1MG1A 1JPXA 1DF5A 2X7RB 3B8NA 1K34A 4FIPC 1JQ0A 2EZOA 3K9AA 1I5XA 2EBOA
chains in the Genus database with same CATH superfamily
5IWAO 2GSMB 4GT1A 5EK0A 3DTUB 5GONB 5JQGA 1CPYA 3K5OA 1N4CA 4F6EA 4FLWA 3SPJA 2GTAA 1QCEA 4MVOA 4DUZO 2AHZA 3WB2A 1O9HA 3T1CA 5LP6B 3AEIA 1Q6IA 1MABG 4J7ZA 2W6JG 5CB4A 1AJNA 3FFQA 5EIBC 2FKXA 1ZTEA 4MVUA 4X64B 1KU9A 1EZVH 2RMKB 3BA9A 2QKSA 3ABLB 5LYJB 2QGNA 2AXTZ 4DW0A 5BR8O 3CCQV 3ZEDA 4B3RB 3OM3B 4JASA 3X2QC 1VQ5V 4O2AA 4B7KA 4JI4O 1ZL8B 1SETA 1H2LA 1SS3A 1EN5A 4RQFA 5KAFZ 5LMUB 1QBZA 1YJWV 2AGAA 1FXVA 2HHHB 2N74A 4LF9B 2XAJA 5JJEB 2UXXA 1SRYA 4JZGA 5KMGB 1NR1A 4DUYO 3N2GA 4DR5O 3Q4HB 3OTOB 3AG2B 5KA6A 1KMIZ 2EBOA 1MOFA 2XAHA 3CRMA 4MW8A 4GKKB 3TGUH 3AG1C 3F5WC 1N36B 4K0KO 2Q5ZA 3K9SA 4OX9B 2IU3A 1CP9A 5JQGB 4UVAA 5EC1C 1XUQA 3CB2A 4H13B 5IJ0A 1XNQO 2IM9A 2P22C 2WLLA 2F4VO 4DV1B 2WAMA 1XNRB 4JI1O 2QM7A 2EINC 1FS0G 4N21A 1R3JC 3CCLV 1OCOB 1E1RG 1AILA 1NQTA 5CB4B 4DV4B 3K5NA 4O4IA 1G6UA 2NN4A 1XL6A 2ZE7A 3FAVA 4F6RA 1JPXA 2E75B 4R6ZA 2EZOA 3HKBA 4Z1VA 1PV0A 3W7XA 1Q90D 1TA8A 2X0LA 3QF7A 2CTWA 3F7YC 4ZI7A 2ZIOA 3DC6A 3CC2V 3WB0A 5A9GA 1SF9A 1V54C 1HNWO 2H94A 1UJWB 4JPRA 2LJ2A 4O2AB 2ZM6B 1LUWA 1P84F 2P06A 1N33B 1DF5A 1KP3A 3CCUV 3DSQA 4UXNA 1OCRB 4D7SA 2YICA 4GX2A 2UUBB 1TUEB 5GTIZ 5JWPA 1VMGA 3N2GB 2Q69A 4WFEA 4BR6A 3QG5A 5J9PC 3T1YB 2A06H 3K5LA 1HNXB 1K4DC 3R65A 1W2BU 1DK1A 4DR1O 5EC2C 5JH7A 2DOSA 1NVPD 1VQ8V 3OE7G 5DN6G 2XNDG 2QJ1A 4LFCB 4X66O 1COWG 1DF4A 1FKAO 3QO8A 1GO3F 3MD0A 3S3XA 5IJ0B 4J7JA 3ZHVA 1GM8A 2WLLB 1R73A 3K08A 2OCHA 4CC5A 2HVJC 2Q67A 3I5DA 1PD3A 4DV7O 3RYHA 1XEQA 2IJKA 4O4IB 3FAVB 3STZC 4F6RB 2C2AA 4JI8O 3U0ZA 4FJCC 5BR8B 3HKBB 3RVZA 1QR9A 4PDLA 2KB1A 1KD1W 2E5LB 1SERA 3W7TA 3L72H 1KBHA 1FFXA 1NS1A 1R6TA 4ZI7B 1FPOA 4I9WA 4JI4B 3KKYA 1NH2D 4HAMA 2W0XA 3K58A 2RDCA 4LCUC 4X20A 4B3MO 1MZFA 3VBBA 1YI2V 1VQ7V 2ZNIA 2WLMA 3UM7A 3TXSA 4IYHA 3MHSC 1Q8IA 1KKCA 3JAWA 3E22A 2H8PC 4UCTA 1KYOF 1F7YA 3KCXA 1WAZA 3VQXA 2ATKC 1Y4MA 2DQ3A 2Q6AA 2CE4A 2P5OA 2WA3A 5IY5C 3TXQA 2X6CA 4GX0A 1B06A 4FK5C 4DV5B 1QLEC 2XHBA 4LF8O 2YI9A 3F5TA 5JH7B 3E8FA 3AG4C 1MSWD 1ROPA 5L3CA 4FVMA 1Q3EA 4UB6Z 4ZOLA 5LMNB 1YZBA 1NKDA 4RO2A 1RM1C 4PA6A 5LA6A 4EFEA 2R9IA 2Q8VA 2CTRA 1KB9F 4FPPA 4AILC 1R6KA 2ODMA 4PDMA 5H6QA 1GM9A 3RYHB 5L3EA 3MHHC 3D8CA 5FPRA 4P2ZA 4JTCB 3CCVV 4L87A 3OUSA 4P30A 1T5EA 1FFXB 3ZMUA 3DC5A 4YIPA 2PGGA 1OCZB 4X20B 3ETDA 2E3CA 2XT9A 3BY6A 4NTXA 4CS2A 1OCCC 2EULA 2QWRB 5HFLA 5KHHA 2N05A 4CS4A 4DR6B 4JI0B 2WLIA 3JAWB 4GKJB 1RP3B 3E22B 3L71H 4FLYA 5KAIZ 1K33A 4OXSA 4FM1A 4UB8Z 3K04A 3QO5A 1FXHA 4MW3A 4JV5B 1TAEA 2HEPA 4LH7A 1W0JG 4BWAA 1YTFD 1N32B 3H1KH 3HR0A 2A3QA 4U3JA 4X66B 1F23A 2JDIG 2P67A 4KFMA 2QM8A 3SJCC 1N8RW 2MW2B 1N0JA 4DXWA 2OYQA 4CH5A 4OPAA 4UVCA 4LP8A 3ABMC 3ZMVA 1H8EG 5LHHA 2F93B 3EFFK 4H37A 3RYFA 1NVPB 2WWWA 3P3PA 5LA6B 1JX9A 2ZT9B 1XL4A 2A79B 4JI8B 3E8GA 2ITCC 2X6BA 4B3RO 3LDDA 4LH6A 1K92A 5KUKA 4XDLA 3G6BA 3ABLC 3JAMN 3K9AA 1NTMH 4DO2A 1G4YB 3BVOA 3HB3B 3A0HZ 4DV6B 3K0GA 3OGIB 5LMUO 2CTQA 5D5QA 3SR2C 1AB3A 2HHHO 4LF9O 3ASOC 1X4TA 2LP7A 5LGUA 1PPJH 3OTOO 5IT9N 4DR2B 1AR1B 3AK2A 1NH2B 2WLIB 1Q6HA 1U97A 4OPHA 1JVMA 4XDKA 2RN9A 4HBNA 4X89A 3MAQA 5C93A 1N36O 3VOUA 1GRJA 3G4SV 3G80A 1GTOA 4OX9O 4QIWF 2FMLA 1SESA 2Y0IA 3T4DA 5B1AC 4U3JB 4X9QA 1Y76A 3THOA 2ZDIC 4I5SA 3WG7B 4JI6B 4JYYA 4G28B 1FJGB 4DV1O 1XNRO 2CGNA 3BPZA 1OV9A 1EBOA 3W7SA 2ZXWB 4PJ0Z 2ZE8A 3IAYA 4X1YA 4DV4O 2ZQMA 1YHQV 3RYFB 2Y0PA 2EIKC 1FFTB 2Q7HA 5B1BB 4JTDB 4K35A 3ZHSA 3ZHTA 3QVNA 3B09A 3SYOA 1P4RA 3VQWA 1Y67A 1M4UA 1JMKC 1S5HC 3D3QA 2LO1A 2Y48A 4X1IA 3FB6C 5CA0A 4PI2A 4NVPA 2ZM6O 2OTJV 2Q7EA 1N33O 1E1QG 4PA7A 5CA1A 5IJ9A 2UXNA 1US6A 4UCUA 2VWJA 4W4LA 3CCEV 2UUBO 5E79Z 1V55C 3ZHQA 2BCCH 4JYBA 3M8AA 2QWNB 3ZRVA 1B04A 3CCJV 3CPWU 3T1YO 2BOCC 4ZBMA 4EKWA 1QU7A 4YIOA 1L8DA 1MG1A 2ZD9A 1HNXO 1K4CC 2UUAB 2DYRB 2Q9LA 1I94B 1MZEA 3CWBH 4ZHQA 3UO3A 1RFYA 2QE7G 3SYQA 4WFGA 2QA4V 2JVDA 3LSUA 2WLKA 4I0XA 4LFCO 1WLEA 5EIBD 3JD4A 2PZSA 2YUAA 2BOBC 2HKOA 3D36C 4RWUA 1W0KG 4WF9V 1Y76B 1NZ6A 3I56V 1OJHA 1K34A 3H1IH 4LC1A 4MVMA 1YJ9V 3E86A 1SQXH 4IL6Z 1QVFU 4CH6A 1YTFB 5L3DA 4ASUG 4X1YB 3MDSA 3RBZA 1CEZA 2NR5A 1AROP 1QLNA 3RWRD 2OIGA 2YDEA 1TVKA 2QM4A 2YIBD 4WFHA 4LF5B 4G2KA 4JAVA 4X62O 3JATA 2E5LO 1JJOA 4DR3B 2RCVA 1NBMG 1VP7A 3OAAG 1WB7A 2P90A 1H2MA 4X1IB 2PTMA 5CA0B 2UXDB 2EIMC 5B3SB 4JI2B 4CS3A 2ZINA 4R7CA 4J7KA 1AI7A 1ZSPA 4BW9A 3CCRV 5CA1B 5IJ9B 5B66Z 3AG3B 2M7WA 3PJSK 3CYOA 1RPRA 1I7FA 2EILB 3B2EE 1V9PA 2YXYA 4K3AA 4X88A 1VEWA 1S76D 2HVKC 3L74H 1QVGU 3B40A 1H2GA 2OT5A 4FLXA 3JYCA 3RT3C 2JIZG 4DV5O 5JCOA 4ZHQB 3JSLA 1F4NA 2PI4A 4FZ1A 4MTXA 3P3NA 1R1BA 4NR1A 4I0XB 3B77A 1M56B 1CXZB 2PYLA 3OMIB 4HNAA 3DXRA 3JARA 5LMNO 2HP8A 2Q4PA 2Y4UA 3P30A 3ZBHA 1NTKH 5IYBO 5KHIA 4JF3A 1SZTA 1K5QA 1YDXA 4PDRA 1KECA 2GHYA 3L70H 4Q20A 1TVKB 4DR4B 5EBWC 3P32A 4JI7B 4LFBB 3JATB 5GW7A 1XQ8A 5EBMC 4ZIBA 1TUBA 3HKDA 4KHPB 3A2FA 4X8AA 1PNMA 4LFAB 2Y4TA 2YIBA 3BHPA 3PN1A 4H44B 3BA8A 4K8XA 4WFFA 3TCUA 3ABKC 3TETA 3CXHF 2AZ2A 4DR6O 4JI0O 4GKJO 4DK0A 2DYSB 3SPIA 5KHKA 3APQA 4JV5O 2LFSA 1X59A 1ZUQA 2ETNA 3ABTA 4CBCA 1DLBA 3SYCA 1Y66A 3G71V 1N32O 1PNKA 5H5NA 4NXNB 1EN6A 4YHHB 4J42A 2YEVA 2FL4A 4LF7B 1L0NH 3KCYA 3OMAB 1K9MW 3J80N 1JR9A 1Q5OA 4HNAB 3RYCA 3DXRB 3JARB 5GTHZ 4BIUA 5FNVA 1WB8A 2IJJA 4IT5A 2PYJA 1WP8A 4WCEV 2WLJA 4PA9A 3CC4V 2UUCB 1M5IA 4NTWA 1IXMA 2W6IG 5L3FA 1XMQB 3IGAC 4X62B 3O9OA 1K73W 1KC8W 4WBNA 3CP1A 2H3OA 1L0LH 3H01A 2FB5A 3X2QB 5BZBA 4DV6O 2BTQA 1IBMB 2OCCC 1TUBB 2JK5C 3HKDB 1YSCA 1JFFA 2ADPA 3RYIA 3JD0A 4FMTA 1KUQA 1F51A 1Q6UA 1IZ3A 1H2NA 1UFIA 2FYUH 1JCHA 1B3QA 4NXMB 4DR2O 4UVBA 3EVKA 4DR7B 5DM6V 1M93A 1AR5A 3ETEA 1MNGA 1WN7A 4H0LB 2UXCO 3EHBB 2KSDA 2QWOB 2LGQA 2CTPA 3R66A 2ZE5A 3VQVA 3CS5A 2JEXA 1ENVA 4LF4B 2R70A 1BT8A 4FFBA 4D7TA 5ITZA 4A5UB 4CZZA 3FYEB 2EIJC 2YEVB 2JS5A 2K1EA 1Y6XA 2Q0AA 4JI6O 3BFRA 3H1LH 2AZ0A 1FJGO 1MMMA 3K3WA 4DV2O 4IGGA 5HFMA 3RYCB 2R9RB 1N0NA 5K1PA 1GKFA 4TWKA 2PY5A 3ZN0A 2VRZA 3ASNC 1BMFG 4TV8A 4UUJC 2EINB 5FNVB 1XMOB 1VF6A 4FIPC 4MVQA 1IXBA 2NNUA 1SKVA 4AQYB 3J7AU 2PI5A 3U11A 1F4MA 1M57C 2YI8A 3SJAC 2R72A 4G27B 2B9ZA 1YF2A 3JCZA 5B1BC 1AI6A 1BZKA 3KZIZ 2VQFB 1ORQC 4WBNB 1AP5A 2XASA 1D5AA 2DWEC 2YIDA 2HR3A 1JQ0A 4J9YB 3IJ4A 1V54B 3TK1A 2BTQB 3GWKC 1QHTA 1LUVA 1GH6A 1WP7A 2B5UA 2ILMA 1FAFA 2LFRA 1JFFB 3RYIB 4QPJA 2NLJC 1D2DA 2JRIA 4I50A 1BQZA 5L3GA 5JJJB 2VWKA 1K97A 2QEXV 5LHGA 3IC9A 1HW7A 3UQ8A 3SYAA 1FXKC 1YXBA 2UUAO 1I94O 5K1XA 4TUYA 1OHHG 1M9NA 2N04A 4MVSA 2V1DA 3CC7V 3JSNA 1DGSA 3LNNA 3LNMB 4JI5B 2Z5UA 4O2BA 4FFBB 5CN0A 1JA8A 1YJNV 4F4LA 1IBLO 5ITZB 4R8CA 3ZJZA 1K5SA 3GVMA 1I0HA 2IU0A 2F43G 5IYDO 5LP6C 3STLC 5KLVH 3T1HB 2JEUA 3ICXA 2D2CB 4X1KA 3JCUZ 2LW7A 4YXWG 5H6RA 4TQDA 4TV8B 3B8MA 2BTOA 5CA3A 3HKEA 2L6LA 4LF5O 2XAGA 2XOKG 2P4KA 2OWOA 3RFRA 2P7TC 2GBOA 4Z1MG 4DR3O 1NR7A 2UXDO 5D5PA 3SJQC 4JI2O 4MVZA 2YIAA 3F7VC 1HP8A 1KQSU 5A2QN 3N27A 1SZXA 1WNSA 4JGSA 1EN4A 2UXBB 1LNQA 5KUMA 1IX9A 3H1HH 2IH1C 2XTAA 2UU9B 2JGUA 5FPOA 4NTYA 4I50B 2EILC 4KL1A 3AG2C 3RN4A 2UXCB 3BAAA 1AI5A 2O57A 2VQEB 4JTAB 3WFVA 4CC6A 1NTZH 4RAIA 3APOA 1BL8A 2WLNA 3K79A 5IY5B 4TUYB 4EEQA 3D3IA 3BABA 4QE7A 5IYZA 2JJ2G 3JASA 1QLEB 1HNZB 2QTOA 4O2BB 4J80A 5C8YA 3AG4B 3FB5C 1NU1H 2PUSA 3J81N 4O4JA 4DV2B 3ZMZA 1LR1A 5LBQA 3RGBA 2Z0AA 3OTFA 5J2TA 2RQ6A 4OGQB 1OCOC 4X1KB 3ML0A 1RM1B 3CCSV 2EX3A 3ZN1A 5IE9A 3HKEB 4DR4O 4PD4F 1ZAUA 1HWYA 4B7EA 1Y74A 4JI7O 3LDEA 4FLTA 1XI1A 5LOVA 4LFBO 3C3TA 3JD2A 3DGEA 4D6TH 3ZMTA 1SA0A 1OZ0A 2OIEA 3EXAA 2CDYA 2BSKA 4LNUA 3TJTA 1XBLA 2QSAA 4KHPO 4PA3A 4LFAO 1SQVH 1J5EB 1FD9A 2F23A 2AHYA 3SJBC 4I55A 2GDSA 1OCRC 3L73H 3ZHRA 1OCCB 3CXCU 2IJHA 2B1IA 1SC5B 2JGDA 3CMEV 1A32A 2V4DA 4LWSA 5CBHA 5CMUA 4UCRA 1H2SB 1VQKV 3OEEG 1Q43A 4GYCB 3BCCH 2QR4A 2ZNJA 1PL0A 4NXNO 2A7WA 4MS2A 4YHHO 4LF7O 5KA5A 4X65B 1BS3A 1IBLB 5IYZB 2K9PA 3WU2Z 4JZ2A 3JASB 4FLZA 4ABMA 2Q7GA 5C8YB 3SGIA 2ZDIA 1P7GA 1NI8A 1VQLV 4O4JB 3ZCCA 4TV9A 4FM0A 5IYCO 3ABMB 1M1KW 4KP4A 4U7OA 2UUCO 5KX5A 5J2TB 1S72V 1TGOA 5LXTA 3L75H 4XBFA 1XMQO 3M7MX 1R6NA 1AJQA 2QKCA 2QKAA 2R9AA 3AG7A 3ZX6A 1Y74B 3E8HA 4CH3A 5LOVB 3CJHA 4DV0B 3JAKA 2WSSG 1VQNV 5DECA 4FZ0A 1VQ4V 4YJ3A 1SA0B 2DW4A 1IBMO 2JJ1G 2BSKB 4LNUB 3CSXA 3OT7A 2GV9A 4UCOA 4MSWC 2YC0A 3K59A 1VQ6V 2YXHA 2KG7A 4MTGA 3ETQA 2E76B 2CH7A 4GZRB 1XHZA 1I5YA 4NXMO 4NB5A 4I55B 3ASOB 3OR7C 1N34B 2WA4A 1WA8A 4WFAV 4DR7O 3FKSG 1FYJA 2W0FC 3L9DA 2JGDB 1VQMV 1PKXA 2RNBA 1SQBH 4LWSB 4K8ZA 4TT3G 2Q73A 3NXSA 4CH4A 4DW1A 4J10A 1VF5B 4LF4O 2AW9A 1K3EA 5B5EZ 3CE2A 1GM7A 5TISZ 3ETGA 1Q81W 4B3TB 2DQ0A 2KKWA 5B1AB 3D36A 4RUFA 2EJRA 1Z5WA 3ZIAG 1URFA 5BMVA 4GUNA 4JI3B 4Q6GA 2DWDC 4TV9B 4U3FH 1XMOO 4TOIA 4LF6B 2LGWA 1DTOA 2G38A 1P49A 4AQYO 1H38A 1MA1A 5L3BA 5KX5B 1VIBA 4JYAB 5LXTB 5LHIA 2EIKB 4I4TA 1O9GA 3N2KA 1JJ2U 4H33A 1JOYA 4DRXA 5LL6Y 4LBEC 4J41A 2VQFO 3OD4A 2RJZA 4R50A 2IBZH 1S5LZ 3CJHB 3JAKB 5H2FZ 1YIJV 3SDLA 1AVMA 2L35A 2CAZC 4YJ3B 2B1GA 4UCSA 3CX5F 5BXZA 4AHCA 4L8JA 2DJVA 3W7UA 1OCZC 2DE0X 3CHXA 1S0VA 2KG7B 1PNLA 4QGPA 3W7WA 2XAQA 2CH7B 2HJFC 3K57A 2PF4E 2JS3A 4DYLA 2Y69B 1WA8B 2A0LA 1I5XA 1V55B 1I08A 4BAYA 3LDCA 4DV3B 5JVDA 1GK9A 1EM1A 1IBKB 4UCVA 1Q82W 3QNEA 1AJPA 2GTSA 1HR0B 4KUMA 4JAUA 4PV1B 1YITV 4JI5O 2QDOA 1GN3A 4GX5A 3M99B 4LR3A 1EZJA 1W59A 1SQGA 4J9ZB 4NKGB 2M6YA 3HPLC 4P9OA 1S5JA 2WPDG 5IWAB 4AI8A 4O4HA 2HG5C 4EB6A 1SQFA 3T1HO 3BRCA 4GLXA 1H8HG 2DMXA 4BIZA 4DUZB 5BMVB 2ZR3A 3CEIA 5FLXN 2IJIA 1K7DA 3E35A 4QPKA 1VQ9V 1EFRG 3AK3A 5B1NA 1BHAA 4JAAA 3E8BA 4RQEA 1VF6C 4I4TB 1NJIW 3UT5A 3N2KB 4Z2WA 5DEDA 2GUZA 4DRXB 2KQXA 4EFBA 4O4LA 1G1XB 1S77D 2EZPA 4E4EA 1XREA 2EIMB 4WFBV 4W4KA 2UXBO 1BHBA 1G8MA 1NT2B 3K06A 3ZS8C 3UO2A 2UU9O 2E74B 4NYKA 3UCSC 4UV9A 2F1MA 5B1OA 2IW5A 3SPGA 2VQEO 4DUYB 1XOUA 4DR5B 3E2EA 5JVDB 5J2UA 4FLVA 3AG1B 4FM2A 5KHJA 3QO7A 1RPOA 1R3LC 1HNZO 5BY1A 4GX1A 1M90W 1E79G 3LSSA 4K0KB 2ZE6A 1XHXA 2DN9A 3WG7C 3VQYA 4PELA 2D3OW 3HKCA 4O4HB 1VQPV 4EB6B 4YY3O 1R3IC 2Q0OC 1XNQB 4PA4A 1UPGA 1R3KC 3T4ZA 2ZXWC 2IH3C 3ZMSA 4N23A 2F4VB 1GAXA 4JI1B 3OEHG 4MVRA 1Z2GA 3G6EV 1YEWA 1BSMA 4ICGA 1GN4A 3ZHUA 4PDVA 3UT5B 3K5MA 4B3SO 1IDSA 1WPXA 1SQPH 2GUZB 3H9VA 3LUTB 5IDJA 1YCIA 3A0BZ 4IIJA 1RSOA 4O4LB 2OTLV 1J5EO 1PM9A 3UKMA 1U96A 3BEHA 1QNMA 1HNWB 1GMGA 4HZ3A 3C90A 4U7NA 3GWOA 2F66C 1PL4A 3ABKB 3AK1A 3S3WA 1H2KA 1MSDA 1IURA 2FTKA 2QWPB 3CRCA 1Q7YW 5J2UB 2DYRC 3A0RA 1BGYH 2EJ7A 3ZRWA 3O65A 4X65O 4MT8A 5EZYA 4MTFA 1XDCA 1KP2A 5FL7G 4DR1B 2ZIMA 3C3SA 2F95B 5CBGA 4HYOA 1Z5VA 5AG2A 2P6JA 3ZRXA 1KKDA 3HKCB 2BE3A 2P4VA 2V7QG 3E89A 3QTCA 2YS8A 5EYPA 5H9CA 2YXLA 4ZOLB 3JD3A 4XDJA 2XUMA 2CGOA 4X64O 1S3JA 3K03A 3K0DA 5KHGA 3I55V 2XAFA 1WJZA 3GB7C 4DV0O 3CRQA 3OFNG 4IHJA 4DV7B 1PP9H 1WPBA 4TSFG 2HJDA 4PHZA 2CK3G 1L1FA 2MK3A 4GCZA 3LSQA 5B3SC 4QJFB 4IIJB 1RSOB 1ZX3A 1THZA 4I9QA 2OCCB 1Q86W 4C7UA 4E2LA 1AR4A 4B08A 3ZRSA 1ZLZA 2ADQB 3T2MA 4YJ2A 2HLDG 3AG3C 1N34O 3FX7A 1BCCH 4B3MB 3OUFA 4KXRA 1J95A 2QWQB 3RVYA 4QE9A 1SQQH 1BE3H 1GN2A 4FLUA 4QNHB 3IC7A 2Z3YA 3RW0A 1FXKA 4BW5A 3OGCC 3JALA 3WB1A 3ZRWB 4BIOA 3B4SA 1VF7A 3NR7A 4GKKO 4B3TO 5F2VO 1VQOV 1B6QA 5GONA 1AI4A 5EZYB 2CUGA 4LF8B 1M56C 1P7BA 2EIJB 1ZWIC 3CRAA 3B8NA 4YY3B 4JI3O 5LP6A 1AP6A 3JD1A 4LF6O 4MTOA 2ARHA 1HDJA 3ASNB 2LQTA 4FFKA 4PI0A 2Q68A 4JYAO 3KG2A 4TQFA 5EYPB 2ZKOA 1YVWA 3H1JH 3CCMV 3A8TA 3G67A 1M57B 5CBFA 3FD9A 1D5NA 4B3SB 4J11A 5LGNA 5LYJA 2WLHA 1VARA 3CRRA 4UV8A 4IHJB 1K8AW 2LW1A 4RUEA 2YSUB 3OR6C 4IYIA 5EBLC 1XILA 1ZL8A 3U10A 1GN6A 3FB7C 3FYIB 1QR8A 4DK1A 1BQ0A 4UFZA 4YJ2B 5E1AC 3FB8C 2X7RB 4I7ZB 5LGTA 1IVSA 3OMNB 5KMGA 4P9PA 3CMAV 2ZCEA 2QTSA 4DV3O 2X6AA 3Q4HA 3SYPA 1IBKO 2ZR2A 2DYSC 2VS0A 5JJNB 3SPCA 3CD6V 2Y69C 1QQCA 1HR0O 2HFEC 1FXKB 2ITDC 3IFXA 3JALB 4JYCA 3OW2U 3E83A 2A9HA 4ZKIA 3ABUA 5JCOC 3SPHA
chains in the Genus database with same CATH topology
2GSMB 4GT1A 5EK0A 4CZZA 3FYEB 1G4YB 2B1GA 3DTUB 1CPYA 2EIJC 2YEVB 2K1EA 3HB3B 3W7UA 3K0GA 3SPJA 1OCZC 1S0VA 1QCEA 4MVOA 4DO2A 2AHZA 3K3WA 1PNLA 3T1CA 3W7WA 2XAQA 5HFMA 3ASOC 2R9RB 3AEIA 2LP7A 2HJFC 1GKFA 4TWKA 5LGUA 3ZN0A 1MABG 3ASNC 1BMFG 4UUJC 2EINB 4MVQA 4FIPC 2Y69B 2A0LA 2W6JG 1I5XA 1V55B 2NNUA 1AR1B 4BAYA 3LDCA 1AJNA 1GK9A 4MVUA 1NH2B 2PI5A 1Q82W 2WLIB 3QNEA 1F4MA 1M57C 1AJPA 4G27B 1JVMA 2QKSA 3JCZA 4KUMA 4JAUA 4XDKA 5B1BC 1AI6A 3ABLB 1YITV 4X89A 3CCQV 5C93A 4GX5A 3M99B 1ORQC 1EZJA 3VOUA 3OM3B 2XASA 4J9ZB 4JASA 3G4SV 3X2QC 1GTOA 2DWEC 4QIWF 3HPLC 1SESA 4P9OA 2HR3A 3T4DA 1VQ5V 5B1AC 1JQ0A 4J9YB 2WPDG 1V54B 3TK1A 1SETA 2B5UA 2ZDIC 2HG5C 4I5SA 3WG7B 2LFRA 4RQFA 4QPJA 4G28B 1QBZA 1YJWV 1H8HG 4BIZA 2ZR3A 2NLJC 1FXVA 2XAJA 1EBOA 3W7SA 2IJIA 2ZXWB 1K7DA 2UXXA 3E35A 1SRYA 4QPKA 1NR1A 5L3GA 2ZQMA 1YHQV 1VQ9V 1EFRG 1K97A 5B1NA 1BHAA 2QEXV 2EIKC 3E8BA 3AG2B 5LHGA 5KA6A 1FFTB 5B1BB 2EBOA 4JTDB 4RQEA 3SYAA 1FXKC 1NJIW 1MOFA 1P4RA 3SYOA 2XAHA 4MW8A 1OHHG 1M9NA 1S5HC 4MVSA 1YIJV 2V1DA 3CC7V 2Y48A 3FB6C 3AG1C 3LNMB 2Z5UA 3F5WC 1S77D 2EZPA 5CN0A 2EIMB 4WFBV 1YJNV 4F4LA 1BHBA 2OTJV 1G8MA 3K06A 4R8CA 2IU3A 3ZJZA 1CP9A 1E1QG 4PA7A 1K5SA 4UVAA 5EC1C 2UXNA 2IU0A 2F43G 5IYDO 3STLC 3CCEV 2JEUA 2WLLA 2WAMA 2QM7A 2EINC 1FS0G 4N21A 1R3JC 4YXWG 1V55C 5H6RA 1OCOB 1E1RG 4UV9A 3CCLV 3B8MA 4JYBA 1NQTA 2IW5A 5B1OA 3ZRVA 5CA3A 3CCJV 3CPWU 2BOCC 2XAGA 3SPGA 2XOKG 3E2EA 4ZBMA 4EKWA 1XL6A 1MG1A 2ZD9A 1JPXA 2P7TC 4R6ZA 1K4CC 2EZOA 4Z1MG 2DYRB 3AG1B 1NR7A 3W7XA 2X0LA 1RPOA 3QO7A 2QE7G 3SYQA 3SJQC 4WFGA 1R3LC 2QA4V 4MVZA 3F7YC 3F7VC 4GX1A 1M90W 2WLKA 3CC2V 1WLEA 1V54C 1E79G 3LSSA 1KQSU 2H94A 1UJWB 4JGSA 3JD4A 4JPRA 2BOBC 2HKOA 4WF9V 3WG7C 1W0KG 1LNQA 5KUMA 4PELA 2D3OW 3I56V 1DF5A 1VQPV 2IH1C 1K34A 1KP3A 4LC1A 3CCUV 1R3IC 4UXNA 4MVMA 4PA4A 1YJ9V 1OCRB 3E86A 1R3KC 3T4ZA 4GX2A 2ZXWC 1QVFU 2IH3C 3ZMSA 4N23A 1TUEB 1YTFB 3OEHG 5L3DA 4ASUG 2EILC 4MVRA 3G6EV 3AG2C 3RBZA 1CEZA 1AI5A 2Q69A 4WFEA 1AROP 1QLNA 5J9PC 4WFHA 4PDVA 4G2KA 4JTAB 3WFVA 4RAIA 1BL8A 2WLNA 1K4DC 3K79A 5IY5B 1WPXA 4JAVA 3R65A 3LUTB 1NBMG 3D3IA 3OAAG 1W2BU 2P90A 5IDJA 4QE7A 5EC2C 2JJ2G 2EIMC 1QLEB 1NVPD 5B3SB 2OTLV 2QTOA 3UKMA 4R7CA 1VQ8V 1AI7A 3AG4B 3OE7G 5DN6G 2XNDG 3BEHA 3FB5C 1COWG 1GMGA 4HZ3A 1DF4A 3CCRV 3QO8A 1GO3F 3ZMZA 4U7NA 3MD0A 5LBQA 3AG3B 2M7WA 3PJSK 3GWOA 3CYOA 1RPRA 1GM8A 3ABKB 2EILB 2WLLB 1OCOC 3ML0A 4X88A 1R73A 1RM1B 3CCSV 3K08A 2HVJC 2Q67A 2FTKA 3ZN1A 1S76D 2HVKC 1Q7YW 1PD3A 1QVGU 1HWYA 2IJKA 2DYRC 1H2GA 3LDEA 3STZC 3A0RA 2C2AA 2OT5A 3ZRWA 4FJCC 3JD2A 3JYCA 3DGEA 2JIZG 3RVZA 1QR9A 3ZMTA 4PDLA 1F4NA 2KB1A 1OZ0A 4MTXA 1KD1W 2PI4A 3W7TA 1SERA 4MT8A 4MTFA 1KP2A 5FL7G 4PA3A 4I9WA 1NH2D 3B77A 1M56B 5CBGA 4HAMA 4HYOA 4LCUC 3OMIB 2P6JA 3ZRXA 2AHYA 3VBBA 1KKDA 1YI2V 1VQ7V 3P30A 1OCRC 2WLMA 3UM7A 2V7QG 3E89A 1OCCB 3CXCU 5IYBO 2IJHA 2B1IA 3MHSC 4JF3A 1SZTA 5H9CA 1K5QA 3CMEV 2H8PC 4PDRA 1KECA 3JD3A 4XDJA 5CBHA 5CMUA 2ATKC 1Y4MA 2DQ3A 1VQKV 2GHYA 1S3JA 3K03A 3K0DA 3OEEG 4Q20A 3I55V 2XAFA 2Q6AA 3GB7C 5EBWC 3OFNG 5IY5C 3P32A 2X6CA 4GX0A 1PL0A 4TSFG 2CK3G 5GW7A 4MS2A 1L1FA 2MK3A 4FK5C 4GCZA 5KA5A 1QLEC 3LSQA 5EBMC 5B3SC 4QJFB 3E8FA 3AG4C 1MSWD 1THZA 4X8AA 1PNMA 2OCCB 2ZDIA 1Q86W 1ROPA 4E2LA 5L3CA 3ZRSA 1VQLV 3T2MA 3ZCCA 2HLDG 3AG3C 4WFFA 3OUFA 5IYCO 3ABMB 3TCUA 3ABKC 1J95A 1NKDA 4KP4A 3TETA 1M1KW 4RO2A 4U7OA 3RVYA 4QE9A 1RM1C 4PA6A 1S72V 2R9IA 4QNHB 3IC7A 2DYSB 2Z3YA 3RW0A 3SPIA 4FPPA 4XBFA 1FXKA 4BW5A 1R6KA 1R6NA 1AJQA 4PDMA 5H6QA 3OGCC 2LFSA 1GM9A 5L3EA 3E8HA 3ABTA 4CBCA 3MHHC 1DLBA 3SYCA 1Y66A 3ZRWB 4P2ZA 3G71V 4JTCB 2WSSG 1PNKA 4L87A 3CCVV 1VQNV 3OUSA 1VQOV 1VQ4V 2DW4A 4P30A 1B6QA 2JJ1G 1AI4A 2YEVA 1M56C 3ZMUA 1P7BA 2EIJB 3OMAB 4MSWC 1K9MW 1VQ6V 1ZWIC 4MTGA 1OCZB 3B8NA 3ETDA 3JD1A 4MTOA 3BY6A 1I5YA 4BIUA 3ASOB 1OCCC 3OR7C 2IJJA 5HFLA 3ASNB 4WFAV 4WCEV 2WLJA 4PA9A 3CC4V 2Q68A 3KG2A 3FKSG 2W0FC 2WLIA 1VQMV 1PKXA 3CCMV 1K33A 4OXSA 4TT3G 1IXMA 1M57B 3NXSA 5CBFA 3K04A 3QO5A 2W6IG 5L3FA 1FXHA 4MW3A 5LGNA 3IGAC 1K73W 2WLHA 4UV8A 1KC8W 1K8AW 1K3EA 3CP1A 4RUEA 1W0JG 2YSUB 3H01A 1GM7A 3OR6C 1YTFD 3X2QB 3ETGA 5EBLC 5BZBA 1Q81W 2DQ0A 1F23A 2JDIG 2P67A 2OCCC 4KFMA 2QM8A 5B1AB 2JK5C 1N8RW 1YSCA 3D36A 4RUFA 3FB7C 3FYIB 2EJRA 1QR8A 4DXWA 3JD0A 4FMTA 3ZIAG 1F51A 4UVCA 4LP8A 3ABMC 3ZMVA 5E1AC 3FB8C 2X7RB 1H8EG 2DWDC 5LHHA 5LGTA 3EFFK 3OMNB 1JCHA 1DTOA 4P9PA 3CMAV 4H37A 2X6AA 3SYPA 4UVBA 1NVPB 1H38A 5L3BA 2WWWA 2ZR2A 2DYSC 3SPCA 5DM6V 3CD6V 5LHIA 2Y69C 2EIKB 1JX9A 3ETEA 1XL4A 1JJ2U 2A79B 4H33A 2HFEC 1FXKB 1JOYA 3E8GA 2ITDC 3EHBB 2ITCC 2X6BA 4LBEC 3IFXA 3LDDA 4JYCA 3OW2U 4R50A 3E83A 2JEXA 1ENVA 2A9HA 4ZKIA 3ABUA 1K92A 5KUKA 4XDLA 3ABLC 3K9AA 3SPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2L A;  5CMU A;  1I5Y A;  3CP1 A;  1MOF A;  3B77 A;  3MHH C;  1Y4M A;  1DLB A;  3H01 A;  4N23 A;  1Y66 A;  5HFL A;  1QBZ A;  2P6J A;  1F23 A;  1QCE A;  4N21 A;  1DF4 A;  3P30 A;  2OT5 A;  2EZP A;  2MK3 A;  3B8M A;  4FJC C;  1EBO A;  4FK5 C;  4JGS A;  4JPR A;  1K33 A;  1QR8 A;  5CN0 A;  5HFM A;  5KA5 A;  3M99 B;  4G2K A;  1QR9 A;  3WFV A;  3MHS C;  2LP7 A;  2M7W A;  4JF3 A;  1SZT A;  3CYO A;  3GWO A;  5KA6 A;  1ENV A;  5H9C A;  1MG1 A;  1JPX A;  1DF5 A;  2X7R B;  3B8N A;  1K34 A;  4FIP C;  1JQ0 A;  2EZO A;  3K9A A;  1I5X A;  2EBO A; 
#chains in the Genus database with same CATH topology
 5IWA O;  2GSM B;  4GT1 A;  5EK0 A;  3DTU B;  5GON B;  5JQG A;  1CPY A;  3K5O A;  1N4C A;  4F6E A;  4FLW A;  3SPJ A;  2GTA A;  1QCE A;  4MVO A;  4DUZ O;  2AHZ A;  3WB2 A;  1O9H A;  3T1C A;  5LP6 B;  3AEI A;  1Q6I A;  1MAB G;  4J7Z A;  2W6J G;  5CB4 A;  1AJN A;  3FFQ A;  5EIB C;  2FKX A;  1ZTE A;  4MVU A;  4X64 B;  1KU9 A;  1EZV H;  2RMK B;  3BA9 A;  2QKS A;  3ABL B;  5LYJ B;  2QGN A;  2AXT Z;  4DW0 A;  5BR8 O;  3CCQ V;  3ZED A;  4B3R B;  3OM3 B;  4JAS A;  3X2Q C;  1VQ5 V;  4O2A A;  4B7K A;  4JI4 O;  1ZL8 B;  1SET A;  1H2L A;  1SS3 A;  1EN5 A;  4RQF A;  5KAF Z;  5LMU B;  1QBZ A;  1YJW V;  2AGA A;  1FXV A;  2HHH B;  2N74 A;  4LF9 B;  2XAJ A;  5JJE B;  2UXX A;  1SRY A;  4JZG A;  5KMG B;  1NR1 A;  4DUY O;  3N2G A;  4DR5 O;  3Q4H B;  3OTO B;  3AG2 B;  5KA6 A;  1KMI Z;  2EBO A;  1MOF A;  2XAH A;  3CRM A;  4MW8 A;  4GKK B;  3TGU H;  3AG1 C;  3F5W C;  1N36 B;  4K0K O;  2Q5Z A;  3K9S A;  4OX9 B;  2IU3 A;  1CP9 A;  5JQG B;  4UVA A;  5EC1 C;  1XUQ A;  3CB2 A;  4H13 B;  5IJ0 A;  1XNQ O;  2IM9 A;  2P22 C;  2WLL A;  2F4V O;  4DV1 B;  2WAM A;  1XNR B;  4JI1 O;  2QM7 A;  2EIN C;  1FS0 G;  4N21 A;  1R3J C;  3CCL V;  1OCO B;  1E1R G;  1AIL A;  1NQT A;  5CB4 B;  4DV4 B;  3K5N A;  4O4I A;  1G6U A;  2NN4 A;  1XL6 A;  2ZE7 A;  3FAV A;  4F6R A;  1JPX A;  2E75 B;  4R6Z A;  2EZO A;  3HKB A;  4Z1V A;  1PV0 A;  3W7X A;  1Q90 D;  1TA8 A;  2X0L A;  3QF7 A;  2CTW A;  3F7Y C;  4ZI7 A;  2ZIO A;  3DC6 A;  3CC2 V;  3WB0 A;  5A9G A;  1SF9 A;  1V54 C;  1HNW O;  2H94 A;  1UJW B;  4JPR A;  2LJ2 A;  4O2A B;  2ZM6 B;  1LUW A;  1P84 F;  2P06 A;  1N33 B;  1DF5 A;  1KP3 A;  3CCU V;  3DSQ A;  4UXN A;  1OCR B;  4D7S A;  2YIC A;  4GX2 A;  2UUB B;  1TUE B;  5GTI Z;  5JWP A;  1VMG A;  3N2G B;  2Q69 A;  4WFE A;  4BR6 A;  3QG5 A;  5J9P C;  3T1Y B;  2A06 H;  3K5L A;  1HNX B;  1K4D C;  3R65 A;  1W2B U;  1DK1 A;  4DR1 O;  5EC2 C;  5JH7 A;  2DOS A;  1NVP D;  1VQ8 V;  3OE7 G;  5DN6 G;  2XND G;  2QJ1 A;  4LFC B;  4X66 O;  1COW G;  1DF4 A;  1FKA O;  3QO8 A;  1GO3 F;  3MD0 A;  3S3X A;  5IJ0 B;  4J7J A;  3ZHV A;  1GM8 A;  2WLL B;  1R73 A;  3K08 A;  2OCH A;  4CC5 A;  2HVJ C;  2Q67 A;  3I5D A;  1PD3 A;  4DV7 O;  3RYH A;  1XEQ A;  2IJK A;  4O4I B;  3FAV B;  3STZ C;  4F6R B;  2C2A A;  4JI8 O;  3U0Z A;  4FJC C;  5BR8 B;  3HKB B;  3RVZ A;  1QR9 A;  4PDL A;  2KB1 A;  1KD1 W;  2E5L B;  1SER A;  3W7T A;  3L72 H;  1KBH A;  1FFX A;  1NS1 A;  1R6T A;  4ZI7 B;  1FPO A;  4I9W A;  4JI4 B;  3KKY A;  1NH2 D;  4HAM A;  2W0X A;  3K58 A;  2RDC A;  4LCU C;  4X20 A;  4B3M O;  1MZF A;  3VBB A;  1YI2 V;  1VQ7 V;  2ZNI A;  2WLM A;  3UM7 A;  3TXS A;  4IYH A;  3MHS C;  1Q8I A;  1KKC A;  3JAW A;  3E22 A;  2H8P C;  4UCT A;  1KYO F;  1F7Y A;  3KCX A;  1WAZ A;  3VQX A;  2ATK C;  1Y4M A;  2DQ3 A;  2Q6A A;  2CE4 A;  2P5O A;  2WA3 A;  5IY5 C;  3TXQ A;  2X6C A;  4GX0 A;  1B06 A;  4FK5 C;  4DV5 B;  1QLE C;  2XHB A;  4LF8 O;  2YI9 A;  3F5T A;  5JH7 B;  3E8F A;  3AG4 C;  1MSW D;  1ROP A;  5L3C A;  4FVM A;  1Q3E A;  4UB6 Z;  4ZOL A;  5LMN B;  1YZB A;  1NKD A;  4RO2 A;  1RM1 C;  4PA6 A;  5LA6 A;  4EFE A;  2R9I A;  2Q8V A;  2CTR A;  1KB9 F;  4FPP A;  4AIL C;  1R6K A;  2ODM A;  4PDM A;  5H6Q A;  1GM9 A;  3RYH B;  5L3E A;  3MHH C;  3D8C A;  5FPR A;  4P2Z A;  4JTC B;  3CCV V;  4L87 A;  3OUS A;  4P30 A;  1T5E A;  1FFX B;  3ZMU A;  3DC5 A;  4YIP A;  2PGG A;  1OCZ B;  4X20 B;  3ETD A;  2E3C A;  2XT9 A;  3BY6 A;  4NTX A;  4CS2 A;  1OCC C;  2EUL A;  2QWR B;  5HFL A;  5KHH A;  2N05 A;  4CS4 A;  4DR6 B;  4JI0 B;  2WLI A;  3JAW B;  4GKJ B;  1RP3 B;  3E22 B;  3L71 H;  4FLY A;  5KAI Z;  1K33 A;  4OXS A;  4FM1 A;  4UB8 Z;  3K04 A;  3QO5 A;  1FXH A;  4MW3 A;  4JV5 B;  1TAE A;  2HEP A;  4LH7 A;  1W0J G;  4BWA A;  1YTF D;  1N32 B;  3H1K H;  3HR0 A;  2A3Q A;  4U3J A;  4X66 B;  1F23 A;  2JDI G;  2P67 A;  4KFM A;  2QM8 A;  3SJC C;  1N8R W;  2MW2 B;  1N0J A;  4DXW A;  2OYQ A;  4CH5 A;  4OPA A;  4UVC A;  4LP8 A;  3ABM C;  3ZMV A;  1H8E G;  5LHH A;  2F93 B;  3EFF K;  4H37 A;  3RYF A;  1NVP B;  2WWW A;  3P3P A;  5LA6 B;  1JX9 A;  2ZT9 B;  1XL4 A;  2A79 B;  4JI8 B;  3E8G A;  2ITC C;  2X6B A;  4B3R O;  3LDD A;  4LH6 A;  1K92 A;  5KUK A;  4XDL A;  3G6B A;  3ABL C;  3JAM N;  3K9A A;  1NTM H;  4DO2 A;  1G4Y B;  3BVO A;  3HB3 B;  3A0H Z;  4DV6 B;  3K0G A;  3OGI B;  5LMU O;  2CTQ A;  5D5Q A;  3SR2 C;  1AB3 A;  2HHH O;  4LF9 O;  3ASO C;  1X4T A;  2LP7 A;  5LGU A;  1PPJ H;  3OTO O;  5IT9 N;  4DR2 B;  1AR1 B;  3AK2 A;  1NH2 B;  2WLI B;  1Q6H A;  1U97 A;  4OPH A;  1JVM A;  4XDK A;  2RN9 A;  4HBN A;  4X89 A;  3MAQ A;  5C93 A;  1N36 O;  3VOU A;  1GRJ A;  3G4S V;  3G80 A;  1GTO A;  4OX9 O;  4QIW F;  2FML A;  1SES A;  2Y0I A;  3T4D A;  5B1A C;  4U3J B;  4X9Q A;  1Y76 A;  3THO A;  2ZDI C;  4I5S A;  3WG7 B;  4JI6 B;  4JYY A;  4G28 B;  1FJG B;  4DV1 O;  1XNR O;  2CGN A;  3BPZ A;  1OV9 A;  1EBO A;  3W7S A;  2ZXW B;  4PJ0 Z;  2ZE8 A;  3IAY A;  4X1Y A;  4DV4 O;  2ZQM A;  1YHQ V;  3RYF B;  2Y0P A;  2EIK C;  1FFT B;  2Q7H A;  5B1B B;  4JTD B;  4K35 A;  3ZHS A;  3ZHT A;  3QVN A;  3B09 A;  3SYO A;  1P4R A;  3VQW A;  1Y67 A;  1M4U A;  1JMK C;  1S5H C;  3D3Q A;  2LO1 A;  2Y48 A;  4X1I A;  3FB6 C;  5CA0 A;  4PI2 A;  4NVP A;  2ZM6 O;  2OTJ V;  2Q7E A;  1N33 O;  1E1Q G;  4PA7 A;  5CA1 A;  5IJ9 A;  2UXN A;  1US6 A;  4UCU A;  2VWJ A;  4W4L A;  3CCE V;  2UUB O;  5E79 Z;  1V55 C;  3ZHQ A;  2BCC H;  4JYB A;  3M8A A;  2QWN B;  3ZRV A;  1B04 A;  3CCJ V;  3CPW U;  3T1Y O;  2BOC C;  4ZBM A;  4EKW A;  1QU7 A;  4YIO A;  1L8D A;  1MG1 A;  2ZD9 A;  1HNX O;  1K4C C;  2UUA B;  2DYR B;  2Q9L A;  1I94 B;  1MZE A;  3CWB H;  4ZHQ A;  3UO3 A;  1RFY A;  2QE7 G;  3SYQ A;  4WFG A;  2QA4 V;  2JVD A;  3LSU A;  2WLK A;  4I0X A;  4LFC O;  1WLE A;  5EIB D;  3JD4 A;  2PZS A;  2YUA A;  2BOB C;  2HKO A;  3D36 C;  4RWU A;  1W0K G;  4WF9 V;  1Y76 B;  1NZ6 A;  3I56 V;  1OJH A;  1K34 A;  3H1I H;  4LC1 A;  4MVM A;  1YJ9 V;  3E86 A;  1SQX H;  4IL6 Z;  1QVF U;  4CH6 A;  1YTF B;  5L3D A;  4ASU G;  4X1Y B;  3MDS A;  3RBZ A;  1CEZ A;  2NR5 A;  1ARO P;  1QLN A;  3RWR D;  2OIG A;  2YDE A;  1TVK A;  2QM4 A;  2YIB D;  4WFH A;  4LF5 B;  4G2K A;  4JAV A;  4X62 O;  3JAT A;  2E5L O;  1JJO A;  4DR3 B;  2RCV A;  1NBM G;  1VP7 A;  3OAA G;  1WB7 A;  2P90 A;  1H2M A;  4X1I B;  2PTM A;  5CA0 B;  2UXD B;  2EIM C;  5B3S B;  4JI2 B;  4CS3 A;  2ZIN A;  4R7C A;  4J7K A;  1AI7 A;  1ZSP A;  4BW9 A;  3CCR V;  5CA1 B;  5IJ9 B;  5B66 Z;  3AG3 B;  2M7W A;  3PJS K;  3CYO A;  1RPR A;  1I7F A;  2EIL B;  3B2E E;  1V9P A;  2YXY A;  4K3A A;  4X88 A;  1VEW A;  1S76 D;  2HVK C;  3L74 H;  1QVG U;  3B40 A;  1H2G A;  2OT5 A;  4FLX A;  3JYC A;  3RT3 C;  2JIZ G;  4DV5 O;  5JCO A;  4ZHQ B;  3JSL A;  1F4N A;  2PI4 A;  4FZ1 A;  4MTX A;  3P3N A;  1R1B A;  4NR1 A;  4I0X B;  3B77 A;  1M56 B;  1CXZ B;  2PYL A;  3OMI B;  4HNA A;  3DXR A;  3JAR A;  5LMN O;  2HP8 A;  2Q4P A;  2Y4U A;  3P30 A;  3ZBH A;  1NTK H;  5IYB O;  5KHI A;  4JF3 A;  1SZT A;  1K5Q A;  1YDX A;  4PDR A;  1KEC A;  2GHY A;  3L70 H;  4Q20 A;  1TVK B;  4DR4 B;  5EBW C;  3P32 A;  4JI7 B;  4LFB B;  3JAT B;  5GW7 A;  1XQ8 A;  5EBM C;  4ZIB A;  1TUB A;  3HKD A;  4KHP B;  3A2F A;  4X8A A;  1PNM A;  4LFA B;  2Y4T A;  2YIB A;  3BHP A;  3PN1 A;  4H44 B;  3BA8 A;  4K8X A;  4WFF A;  3TCU A;  3ABK C;  3TET A;  3CXH F;  2AZ2 A;  4DR6 O;  4JI0 O;  4GKJ O;  4DK0 A;  2DYS B;  3SPI A;  5KHK A;  3APQ A;  4JV5 O;  2LFS A;  1X59 A;  1ZUQ A;  2ETN A;  3ABT A;  4CBC A;  1DLB A;  3SYC A;  1Y66 A;  3G71 V;  1N32 O;  1PNK A;  5H5N A;  4NXN B;  1EN6 A;  4YHH B;  4J42 A;  2YEV A;  2FL4 A;  4LF7 B;  1L0N H;  3KCY A;  3OMA B;  1K9M W;  3J80 N;  1JR9 A;  1Q5O A;  4HNA B;  3RYC A;  3DXR B;  3JAR B;  5GTH Z;  4BIU A;  5FNV A;  1WB8 A;  2IJJ A;  4IT5 A;  2PYJ A;  1WP8 A;  4WCE V;  2WLJ A;  4PA9 A;  3CC4 V;  2UUC B;  1M5I A;  4NTW A;  1IXM A;  2W6I G;  5L3F A;  1XMQ B;  3IGA C;  4X62 B;  3O9O A;  1K73 W;  1KC8 W;  4WBN A;  3CP1 A;  2H3O A;  1L0L H;  3H01 A;  2FB5 A;  3X2Q B;  5BZB A;  4DV6 O;  2BTQ A;  1IBM B;  2OCC C;  1TUB B;  2JK5 C;  3HKD B;  1YSC A;  1JFF A;  2ADP A;  3RYI A;  3JD0 A;  4FMT A;  1KUQ A;  1F51 A;  1Q6U A;  1IZ3 A;  1H2N A;  1UFI A;  2FYU H;  1JCH A;  1B3Q A;  4NXM B;  4DR2 O;  4UVB A;  3EVK A;  4DR7 B;  5DM6 V;  1M93 A;  1AR5 A;  3ETE A;  1MNG A;  1WN7 A;  4H0L B;  2UXC O;  3EHB B;  2KSD A;  2QWO B;  2LGQ A;  2CTP A;  3R66 A;  2ZE5 A;  3VQV A;  3CS5 A;  2JEX A;  1ENV A;  4LF4 B;  2R70 A;  1BT8 A;  4FFB A;  4D7T A;  5ITZ A;  4A5U B;  4CZZ A;  3FYE B;  2EIJ C;  2YEV B;  2JS5 A;  2K1E A;  1Y6X A;  2Q0A A;  4JI6 O;  3BFR A;  3H1L H;  2AZ0 A;  1FJG O;  1MMM A;  3K3W A;  4DV2 O;  4IGG A;  5HFM A;  3RYC B;  2R9R B;  1N0N A;  5K1P A;  1GKF A;  4TWK A;  2PY5 A;  3ZN0 A;  2VRZ A;  3ASN C;  1BMF G;  4TV8 A;  4UUJ C;  2EIN B;  5FNV B;  1XMO B;  1VF6 A;  4FIP C;  4MVQ A;  1IXB A;  2NNU A;  1SKV A;  4AQY B;  3J7A U;  2PI5 A;  3U11 A;  1F4M A;  1M57 C;  2YI8 A;  3SJA C;  2R72 A;  4G27 B;  2B9Z A;  1YF2 A;  3JCZ A;  5B1B C;  1AI6 A;  1BZK A;  3KZI Z;  2VQF B;  1ORQ C;  4WBN B;  1AP5 A;  2XAS A;  1D5A A;  2DWE C;  2YID A;  2HR3 A;  1JQ0 A;  4J9Y B;  3IJ4 A;  1V54 B;  3TK1 A;  2BTQ B;  3GWK C;  1QHT A;  1LUV A;  1GH6 A;  1WP7 A;  2B5U A;  2ILM A;  1FAF A;  2LFR A;  1JFF B;  3RYI B;  4QPJ A;  2NLJ C;  1D2D A;  2JRI A;  4I50 A;  1BQZ A;  5L3G A;  5JJJ B;  2VWK A;  1K97 A;  2QEX V;  5LHG A;  3IC9 A;  1HW7 A;  3UQ8 A;  3SYA A;  1FXK C;  1YXB A;  2UUA O;  1I94 O;  5K1X A;  4TUY A;  1OHH G;  1M9N A;  2N04 A;  4MVS A;  2V1D A;  3CC7 V;  3JSN A;  1DGS A;  3LNN A;  3LNM B;  4JI5 B;  2Z5U A;  4O2B A;  4FFB B;  5CN0 A;  1JA8 A;  1YJN V;  4F4L A;  1IBL O;  5ITZ B;  4R8C A;  3ZJZ A;  1K5S A;  3GVM A;  1I0H A;  2IU0 A;  2F43 G;  5IYD O;  5LP6 C;  3STL C;  5KLV H;  3T1H B;  2JEU A;  3ICX A;  2D2C B;  4X1K A;  3JCU Z;  2LW7 A;  4YXW G;  5H6R A;  4TQD A;  4TV8 B;  3B8M A;  2BTO A;  5CA3 A;  3HKE A;  2L6L A;  4LF5 O;  2XAG A;  2XOK G;  2P4K A;  2OWO A;  3RFR A;  2P7T C;  2GBO A;  4Z1M G;  4DR3 O;  1NR7 A;  2UXD O;  5D5P A;  3SJQ C;  4JI2 O;  4MVZ A;  2YIA A;  3F7V C;  1HP8 A;  1KQS U;  5A2Q N;  3N27 A;  1SZX A;  1WNS A;  4JGS A;  1EN4 A;  2UXB B;  1LNQ A;  5KUM A;  1IX9 A;  3H1H H;  2IH1 C;  2XTA A;  2UU9 B;  2JGU A;  5FPO A;  4NTY A;  4I50 B;  2EIL C;  4KL1 A;  3AG2 C;  3RN4 A;  2UXC B;  3BAA A;  1AI5 A;  2O57 A;  2VQE B;  4JTA B;  3WFV A;  4CC6 A;  1NTZ H;  4RAI A;  3APO A;  1BL8 A;  2WLN A;  3K79 A;  5IY5 B;  4TUY B;  4EEQ A;  3D3I A;  3BAB A;  4QE7 A;  5IYZ A;  2JJ2 G;  3JAS A;  1QLE B;  1HNZ B;  2QTO A;  4O2B B;  4J80 A;  5C8Y A;  3AG4 B;  3FB5 C;  1NU1 H;  2PUS A;  3J81 N;  4O4J A;  4DV2 B;  3ZMZ A;  1LR1 A;  5LBQ A;  3RGB A;  2Z0A A;  3OTF A;  5J2T A;  2RQ6 A;  4OGQ B;  1OCO C;  4X1K B;  3ML0 A;  1RM1 B;  3CCS V;  2EX3 A;  3ZN1 A;  5IE9 A;  3HKE B;  4DR4 O;  4PD4 F;  1ZAU A;  1HWY A;  4B7E A;  1Y74 A;  4JI7 O;  3LDE A;  4FLT A;  1XI1 A;  5LOV A;  4LFB O;  3C3T A;  3JD2 A;  3DGE A;  4D6T H;  3ZMT A;  1SA0 A;  1OZ0 A;  2OIE A;  3EXA A;  2CDY A;  2BSK A;  4LNU A;  3TJT A;  1XBL A;  2QSA A;  4KHP O;  4PA3 A;  4LFA O;  1SQV H;  1J5E B;  1FD9 A;  2F23 A;  2AHY A;  3SJB C;  4I55 A;  2GDS A;  1OCR C;  3L73 H;  3ZHR A;  1OCC B;  3CXC U;  2IJH A;  2B1I A;  1SC5 B;  2JGD A;  3CME V;  1A32 A;  2V4D A;  4LWS A;  5CBH A;  5CMU A;  4UCR A;  1H2S B;  1VQK V;  3OEE G;  1Q43 A;  4GYC B;  3BCC H;  2QR4 A;  2ZNJ A;  1PL0 A;  4NXN O;  2A7W A;  4MS2 A;  4YHH O;  4LF7 O;  5KA5 A;  4X65 B;  1BS3 A;  1IBL B;  5IYZ B;  2K9P A;  3WU2 Z;  4JZ2 A;  3JAS B;  4FLZ A;  4ABM A;  2Q7G A;  5C8Y B;  3SGI A;  2ZDI A;  1P7G A;  1NI8 A;  1VQL V;  4O4J B;  3ZCC A;  4TV9 A;  4FM0 A;  5IYC O;  3ABM B;  1M1K W;  4KP4 A;  4U7O A;  2UUC O;  5KX5 A;  5J2T B;  1S72 V;  1TGO A;  5LXT A;  3L75 H;  4XBF A;  1XMQ O;  3M7M X;  1R6N A;  1AJQ A;  2QKC A;  2QKA A;  2R9A A;  3AG7 A;  3ZX6 A;  1Y74 B;  3E8H A;  4CH3 A;  5LOV B;  3CJH A;  4DV0 B;  3JAK A;  2WSS G;  1VQN V;  5DEC A;  4FZ0 A;  1VQ4 V;  4YJ3 A;  1SA0 B;  2DW4 A;  1IBM O;  2JJ1 G;  2BSK B;  4LNU B;  3CSX A;  3OT7 A;  2GV9 A;  4UCO A;  4MSW C;  2YC0 A;  3K59 A;  1VQ6 V;  2YXH A;  2KG7 A;  4MTG A;  3ETQ A;  2E76 B;  2CH7 A;  4GZR B;  1XHZ A;  1I5Y A;  4NXM O;  4NB5 A;  4I55 B;  3ASO B;  3OR7 C;  1N34 B;  2WA4 A;  1WA8 A;  4WFA V;  4DR7 O;  3FKS G;  1FYJ A;  2W0F C;  3L9D A;  2JGD B;  1VQM V;  1PKX A;  2RNB A;  1SQB H;  4LWS B;  4K8Z A;  4TT3 G;  2Q73 A;  3NXS A;  4CH4 A;  4DW1 A;  4J10 A;  1VF5 B;  4LF4 O;  2AW9 A;  1K3E A;  5B5E Z;  3CE2 A;  1GM7 A;  5TIS Z;  3ETG A;  1Q81 W;  4B3T B;  2DQ0 A;  2KKW A;  5B1A B;  3D36 A;  4RUF A;  2EJR A;  1Z5W A;  3ZIA G;  1URF A;  5BMV A;  4GUN A;  4JI3 B;  4Q6G A;  2DWD C;  4TV9 B;  4U3F H;  1XMO O;  4TOI A;  4LF6 B;  2LGW A;  1DTO A;  2G38 A;  1P49 A;  4AQY O;  1H38 A;  1MA1 A;  5L3B A;  5KX5 B;  1VIB A;  4JYA B;  5LXT B;  5LHI A;  2EIK B;  4I4T A;  1O9G A;  3N2K A;  1JJ2 U;  4H33 A;  1JOY A;  4DRX A;  5LL6 Y;  4LBE C;  4J41 A;  2VQF O;  3OD4 A;  2RJZ A;  4R50 A;  2IBZ H;  1S5L Z;  3CJH B;  3JAK B;  5H2F Z;  1YIJ V;  3SDL A;  1AVM A;  2L35 A;  2CAZ C;  4YJ3 B;  2B1G A;  4UCS A;  3CX5 F;  5BXZ A;  4AHC A;  4L8J A;  2DJV A;  3W7U A;  1OCZ C;  2DE0 X;  3CHX A;  1S0V A;  2KG7 B;  1PNL A;  4QGP A;  3W7W A;  2XAQ A;  2CH7 B;  2HJF C;  3K57 A;  2PF4 E;  2JS3 A;  4DYL A;  2Y69 B;  1WA8 B;  2A0L A;  1I5X A;  1V55 B;  1I08 A;  4BAY A;  3LDC A;  4DV3 B;  5JVD A;  1GK9 A;  1EM1 A;  1IBK B;  4UCV A;  1Q82 W;  3QNE A;  1AJP A;  2GTS A;  1HR0 B;  4KUM A;  4JAU A;  4PV1 B;  1YIT V;  4JI5 O;  2QDO A;  1GN3 A;  4GX5 A;  3M99 B;  4LR3 A;  1EZJ A;  1W59 A;  1SQG A;  4J9Z B;  4NKG B;  2M6Y A;  3HPL C;  4P9O A;  1S5J A;  2WPD G;  5IWA B;  4AI8 A;  4O4H A;  2HG5 C;  4EB6 A;  1SQF A;  3T1H O;  3BRC A;  4GLX A;  1H8H G;  2DMX A;  4BIZ A;  4DUZ B;  5BMV B;  2ZR3 A;  3CEI A;  5FLX N;  2IJI A;  1K7D A;  3E35 A;  4QPK A;  1VQ9 V;  1EFR G;  3AK3 A;  5B1N A;  1BHA A;  4JAA A;  3E8B A;  4RQE A;  1VF6 C;  4I4T B;  1NJI W;  3UT5 A;  3N2K B;  4Z2W A;  5DED A;  2GUZ A;  4DRX B;  2KQX A;  4EFB A;  4O4L A;  1G1X B;  1S77 D;  2EZP A;  4E4E A;  1XRE A;  2EIM B;  4WFB V;  4W4K A;  2UXB O;  1BHB A;  1G8M A;  1NT2 B;  3K06 A;  3ZS8 C;  3UO2 A;  2UU9 O;  2E74 B;  4NYK A;  3UCS C;  4UV9 A;  2F1M A;  5B1O A;  2IW5 A;  3SPG A;  2VQE O;  4DUY B;  1XOU A;  4DR5 B;  3E2E A;  5JVD B;  5J2U A;  4FLV A;  3AG1 B;  4FM2 A;  5KHJ A;  3QO7 A;  1RPO A;  1R3L C;  1HNZ O;  5BY1 A;  4GX1 A;  1M90 W;  1E79 G;  3LSS A;  4K0K B;  2ZE6 A;  1XHX A;  2DN9 A;  3WG7 C;  3VQY A;  4PEL A;  2D3O W;  3HKC A;  4O4H B;  1VQP V;  4EB6 B;  4YY3 O;  1R3I C;  2Q0O C;  1XNQ B;  4PA4 A;  1UPG A;  1R3K C;  3T4Z A;  2ZXW C;  2IH3 C;  3ZMS A;  4N23 A;  2F4V B;  1GAX A;  4JI1 B;  3OEH G;  4MVR A;  1Z2G A;  3G6E V;  1YEW A;  1BSM A;  4ICG A;  1GN4 A;  3ZHU A;  4PDV A;  3UT5 B;  3K5M A;  4B3S O;  1IDS A;  1WPX A;  1SQP H;  2GUZ B;  3H9V A;  3LUT B;  5IDJ A;  1YCI A;  3A0B Z;  4IIJ A;  1RSO A;  4O4L B;  2OTL V;  1J5E O;  1PM9 A;  3UKM A;  1U96 A;  3BEH A;  1QNM A;  1HNW B;  1GMG A;  4HZ3 A;  3C90 A;  4U7N A;  3GWO A;  2F66 C;  1PL4 A;  3ABK B;  3AK1 A;  3S3W A;  1H2K A;  1MSD A;  1IUR A;  2FTK A;  2QWP B;  3CRC A;  1Q7Y W;  5J2U B;  2DYR C;  3A0R A;  1BGY H;  2EJ7 A;  3ZRW A;  3O65 A;  4X65 O;  4MT8 A;  5EZY A;  4MTF A;  1XDC A;  1KP2 A;  5FL7 G;  4DR1 B;  2ZIM A;  3C3S A;  2F95 B;  5CBG A;  4HYO A;  1Z5V A;  5AG2 A;  2P6J A;  3ZRX A;  1KKD A;  3HKC B;  2BE3 A;  2P4V A;  2V7Q G;  3E89 A;  3QTC A;  2YS8 A;  5EYP A;  5H9C A;  2YXL A;  4ZOL B;  3JD3 A;  4XDJ A;  2XUM A;  2CGO A;  4X64 O;  1S3J A;  3K03 A;  3K0D A;  5KHG A;  3I55 V;  2XAF A;  1WJZ A;  3GB7 C;  4DV0 O;  3CRQ A;  3OFN G;  4IHJ A;  4DV7 B;  1PP9 H;  1WPB A;  4TSF G;  2HJD A;  4PHZ A;  2CK3 G;  1L1F A;  2MK3 A;  4GCZ A;  3LSQ A;  5B3S C;  4QJF B;  4IIJ B;  1RSO B;  1ZX3 A;  1THZ A;  4I9Q A;  2OCC B;  1Q86 W;  4C7U A;  4E2L A;  1AR4 A;  4B08 A;  3ZRS A;  1ZLZ A;  2ADQ B;  3T2M A;  4YJ2 A;  2HLD G;  3AG3 C;  1N34 O;  3FX7 A;  1BCC H;  4B3M B;  3OUF A;  4KXR A;  1J95 A;  2QWQ B;  3RVY A;  4QE9 A;  1SQQ H;  1BE3 H;  1GN2 A;  4FLU A;  4QNH B;  3IC7 A;  2Z3Y A;  3RW0 A;  1FXK A;  4BW5 A;  3OGC C;  3JAL A;  3WB1 A;  3ZRW B;  4BIO A;  3B4S A;  1VF7 A;  3NR7 A;  4GKK O;  4B3T O;  5F2V O;  1VQO V;  1B6Q A;  5GON A;  1AI4 A;  5EZY B;  2CUG A;  4LF8 B;  1M56 C;  1P7B A;  2EIJ B;  1ZWI C;  3CRA A;  3B8N A;  4YY3 B;  4JI3 O;  5LP6 A;  1AP6 A;  3JD1 A;  4LF6 O;  4MTO A;  2ARH A;  1HDJ A;  3ASN B;  2LQT A;  4FFK A;  4PI0 A;  2Q68 A;  4JYA O;  3KG2 A;  4TQF A;  5EYP B;  2ZKO A;  1YVW A;  3H1J H;  3CCM V;  3A8T A;  3G67 A;  1M57 B;  5CBF A;  3FD9 A;  1D5N A;  4B3S B;  4J11 A;  5LGN A;  5LYJ A;  2WLH A;  1VAR A;  3CRR A;  4UV8 A;  4IHJ B;  1K8A W;  2LW1 A;  4RUE A;  2YSU B;  3OR6 C;  4IYI A;  5EBL C;  1XIL A;  1ZL8 A;  3U10 A;  1GN6 A;  3FB7 C;  3FYI B;  1QR8 A;  4DK1 A;  1BQ0 A;  4UFZ A;  4YJ2 B;  5E1A C;  3FB8 C;  2X7R B;  4I7Z B;  5LGT A;  1IVS A;  3OMN B;  5KMG A;  4P9P A;  3CMA V;  2ZCE A;  2QTS A;  4DV3 O;  2X6A A;  3Q4H A;  3SYP A;  1IBK O;  2ZR2 A;  2DYS C;  2VS0 A;  5JJN B;  3SPC A;  3CD6 V;  2Y69 C;  1QQC A;  1HR0 O;  2HFE C;  1FXK B;  2ITD C;  3IFX A;  3JAL B;  4JYC A;  3OW2 U;  3E83 A;  2A9H A;  4ZKI A;  3ABU A;  5JCO C;  3SPH A; 
#chains in the Genus database with same CATH homology
 2GSM B;  4GT1 A;  5EK0 A;  4CZZ A;  3FYE B;  1G4Y B;  2B1G A;  3DTU B;  1CPY A;  2EIJ C;  2YEV B;  2K1E A;  3HB3 B;  3W7U A;  3K0G A;  3SPJ A;  1OCZ C;  1S0V A;  1QCE A;  4MVO A;  4DO2 A;  2AHZ A;  3K3W A;  1PNL A;  3T1C A;  3W7W A;  2XAQ A;  5HFM A;  3ASO C;  2R9R B;  3AEI A;  2LP7 A;  2HJF C;  1GKF A;  4TWK A;  5LGU A;  3ZN0 A;  1MAB G;  3ASN C;  1BMF G;  4UUJ C;  2EIN B;  4MVQ A;  4FIP C;  2Y69 B;  2A0L A;  2W6J G;  1I5X A;  1V55 B;  2NNU A;  1AR1 B;  4BAY A;  3LDC A;  1AJN A;  1GK9 A;  4MVU A;  1NH2 B;  2PI5 A;  1Q82 W;  2WLI B;  3QNE A;  1F4M A;  1M57 C;  1AJP A;  4G27 B;  1JVM A;  2QKS A;  3JCZ A;  4KUM A;  4JAU A;  4XDK A;  5B1B C;  1AI6 A;  3ABL B;  1YIT V;  4X89 A;  3CCQ V;  5C93 A;  4GX5 A;  3M99 B;  1ORQ C;  1EZJ A;  3VOU A;  3OM3 B;  2XAS A;  4J9Z B;  4JAS A;  3G4S V;  3X2Q C;  1GTO A;  2DWE C;  4QIW F;  3HPL C;  1SES A;  4P9O A;  2HR3 A;  3T4D A;  1VQ5 V;  5B1A C;  1JQ0 A;  4J9Y B;  2WPD G;  1V54 B;  3TK1 A;  1SET A;  2B5U A;  2ZDI C;  2HG5 C;  4I5S A;  3WG7 B;  2LFR A;  4RQF A;  4QPJ A;  4G28 B;  1QBZ A;  1YJW V;  1H8H G;  4BIZ A;  2ZR3 A;  2NLJ C;  1FXV A;  2XAJ A;  1EBO A;  3W7S A;  2IJI A;  2ZXW B;  1K7D A;  2UXX A;  3E35 A;  1SRY A;  4QPK A;  1NR1 A;  5L3G A;  2ZQM A;  1YHQ V;  1VQ9 V;  1EFR G;  1K97 A;  5B1N A;  1BHA A;  2QEX V;  2EIK C;  3E8B A;  3AG2 B;  5LHG A;  5KA6 A;  1FFT B;  5B1B B;  2EBO A;  4JTD B;  4RQE A;  3SYA A;  1FXK C;  1NJI W;  1MOF A;  1P4R A;  3SYO A;  2XAH A;  4MW8 A;  1OHH G;  1M9N A;  1S5H C;  4MVS A;  1YIJ V;  2V1D A;  3CC7 V;  2Y48 A;  3FB6 C;  3AG1 C;  3LNM B;  2Z5U A;  3F5W C;  1S77 D;  2EZP A;  5CN0 A;  2EIM B;  4WFB V;  1YJN V;  4F4L A;  1BHB A;  2OTJ V;  1G8M A;  3K06 A;  4R8C A;  2IU3 A;  3ZJZ A;  1CP9 A;  1E1Q G;  4PA7 A;  1K5S A;  4UVA A;  5EC1 C;  2UXN A;  2IU0 A;  2F43 G;  5IYD O;  3STL C;  3CCE V;  2JEU A;  2WLL A;  2WAM A;  2QM7 A;  2EIN C;  1FS0 G;  4N21 A;  1R3J C;  4YXW G;  1V55 C;  5H6R A;  1OCO B;  1E1R G;  4UV9 A;  3CCL V;  3B8M A;  4JYB A;  1NQT A;  2IW5 A;  5B1O A;  3ZRV A;  5CA3 A;  3CCJ V;  3CPW U;  2BOC C;  2XAG A;  3SPG A;  2XOK G;  3E2E A;  4ZBM A;  4EKW A;  1XL6 A;  1MG1 A;  2ZD9 A;  1JPX A;  2P7T C;  4R6Z A;  1K4C C;  2EZO A;  4Z1M G;  2DYR B;  3AG1 B;  1NR7 A;  3W7X A;  2X0L A;  1RPO A;  3QO7 A;  2QE7 G;  3SYQ A;  3SJQ C;  4WFG A;  1R3L C;  2QA4 V;  4MVZ A;  3F7Y C;  3F7V C;  4GX1 A;  1M90 W;  2WLK A;  3CC2 V;  1WLE A;  1V54 C;  1E79 G;  3LSS A;  1KQS U;  2H94 A;  1UJW B;  4JGS A;  3JD4 A;  4JPR A;  2BOB C;  2HKO A;  4WF9 V;  3WG7 C;  1W0K G;  1LNQ A;  5KUM A;  4PEL A;  2D3O W;  3I56 V;  1DF5 A;  1VQP V;  2IH1 C;  1K34 A;  1KP3 A;  4LC1 A;  3CCU V;  1R3I C;  4UXN A;  4MVM A;  4PA4 A;  1YJ9 V;  1OCR B;  3E86 A;  1R3K C;  3T4Z A;  4GX2 A;  2ZXW C;  1QVF U;  2IH3 C;  3ZMS A;  4N23 A;  1TUE B;  1YTF B;  3OEH G;  5L3D A;  4ASU G;  2EIL C;  4MVR A;  3G6E V;  3AG2 C;  3RBZ A;  1CEZ A;  1AI5 A;  2Q69 A;  4WFE A;  1ARO P;  1QLN A;  5J9P C;  4WFH A;  4PDV A;  4G2K A;  4JTA B;  3WFV A;  4RAI A;  1BL8 A;  2WLN A;  1K4D C;  3K79 A;  5IY5 B;  1WPX A;  4JAV A;  3R65 A;  3LUT B;  1NBM G;  3D3I A;  3OAA G;  1W2B U;  2P90 A;  5IDJ A;  4QE7 A;  5EC2 C;  2JJ2 G;  2EIM C;  1QLE B;  1NVP D;  5B3S B;  2OTL V;  2QTO A;  3UKM A;  4R7C A;  1VQ8 V;  1AI7 A;  3AG4 B;  3OE7 G;  5DN6 G;  2XND G;  3BEH A;  3FB5 C;  1COW G;  1GMG A;  4HZ3 A;  1DF4 A;  3CCR V;  3QO8 A;  1GO3 F;  3ZMZ A;  4U7N A;  3MD0 A;  5LBQ A;  3AG3 B;  2M7W A;  3PJS K;  3GWO A;  3CYO A;  1RPR A;  1GM8 A;  3ABK B;  2EIL B;  2WLL B;  1OCO C;  3ML0 A;  4X88 A;  1R73 A;  1RM1 B;  3CCS V;  3K08 A;  2HVJ C;  2Q67 A;  2FTK A;  3ZN1 A;  1S76 D;  2HVK C;  1Q7Y W;  1PD3 A;  1QVG U;  1HWY A;  2IJK A;  2DYR C;  1H2G A;  3LDE A;  3STZ C;  3A0R A;  2C2A A;  2OT5 A;  3ZRW A;  4FJC C;  3JD2 A;  3JYC A;  3DGE A;  2JIZ G;  3RVZ A;  1QR9 A;  3ZMT A;  4PDL A;  1F4N A;  2KB1 A;  1OZ0 A;  4MTX A;  1KD1 W;  2PI4 A;  3W7T A;  1SER A;  4MT8 A;  4MTF A;  1KP2 A;  5FL7 G;  4PA3 A;  4I9W A;  1NH2 D;  3B77 A;  1M56 B;  5CBG A;  4HAM A;  4HYO A;  4LCU C;  3OMI B;  2P6J A;  3ZRX A;  2AHY A;  3VBB A;  1KKD A;  1YI2 V;  1VQ7 V;  3P30 A;  1OCR C;  2WLM A;  3UM7 A;  2V7Q G;  3E89 A;  1OCC B;  3CXC U;  5IYB O;  2IJH A;  2B1I A;  3MHS C;  4JF3 A;  1SZT A;  5H9C A;  1K5Q A;  3CME V;  2H8P C;  4PDR A;  1KEC A;  3JD3 A;  4XDJ A;  5CBH A;  5CMU A;  2ATK C;  1Y4M A;  2DQ3 A;  1VQK V;  2GHY A;  1S3J A;  3K03 A;  3K0D A;  3OEE G;  4Q20 A;  3I55 V;  2XAF A;  2Q6A A;  3GB7 C;  5EBW C;  3OFN G;  5IY5 C;  3P32 A;  2X6C A;  4GX0 A;  1PL0 A;  4TSF G;  2CK3 G;  5GW7 A;  4MS2 A;  1L1F A;  2MK3 A;  4FK5 C;  4GCZ A;  5KA5 A;  1QLE C;  3LSQ A;  5EBM C;  5B3S C;  4QJF B;  3E8F A;  3AG4 C;  1MSW D;  1THZ A;  4X8A A;  1PNM A;  2OCC B;  2ZDI A;  1Q86 W;  1ROP A;  4E2L A;  5L3C A;  3ZRS A;  1VQL V;  3T2M A;  3ZCC A;  2HLD G;  3AG3 C;  4WFF A;  3OUF A;  5IYC O;  3ABM B;  3TCU A;  3ABK C;  1J95 A;  1NKD A;  4KP4 A;  3TET A;  1M1K W;  4RO2 A;  4U7O A;  3RVY A;  4QE9 A;  1RM1 C;  4PA6 A;  1S72 V;  2R9I A;  4QNH B;  3IC7 A;  2DYS B;  2Z3Y A;  3RW0 A;  3SPI A;  4FPP A;  4XBF A;  1FXK A;  4BW5 A;  1R6K A;  1R6N A;  1AJQ A;  4PDM A;  5H6Q A;  3OGC C;  2LFS A;  1GM9 A;  5L3E A;  3E8H A;  3ABT A;  4CBC A;  3MHH C;  1DLB A;  3SYC A;  1Y66 A;  3ZRW B;  4P2Z A;  3G71 V;  4JTC B;  2WSS G;  1PNK A;  4L87 A;  3CCV V;  1VQN V;  3OUS A;  1VQO V;  1VQ4 V;  2DW4 A;  4P30 A;  1B6Q A;  2JJ1 G;  1AI4 A;  2YEV A;  1M56 C;  3ZMU A;  1P7B A;  2EIJ B;  3OMA B;  4MSW C;  1K9M W;  1VQ6 V;  1ZWI C;  4MTG A;  1OCZ B;  3B8N A;  3ETD A;  3JD1 A;  4MTO A;  3BY6 A;  1I5Y A;  4BIU A;  3ASO B;  1OCC C;  3OR7 C;  2IJJ A;  5HFL A;  3ASN B;  4WFA V;  4WCE V;  2WLJ A;  4PA9 A;  3CC4 V;  2Q68 A;  3KG2 A;  3FKS G;  2W0F C;  2WLI A;  1VQM V;  1PKX A;  3CCM V;  1K33 A;  4OXS A;  4TT3 G;  1IXM A;  1M57 B;  3NXS A;  5CBF A;  3K04 A;  3QO5 A;  2W6I G;  5L3F A;  1FXH A;  4MW3 A;  5LGN A;  3IGA C;  1K73 W;  2WLH A;  4UV8 A;  1KC8 W;  1K8A W;  1K3E A;  3CP1 A;  4RUE A;  1W0J G;  2YSU B;  3H01 A;  1GM7 A;  3OR6 C;  1YTF D;  3X2Q B;  3ETG A;  5EBL C;  5BZB A;  1Q81 W;  2DQ0 A;  1F23 A;  2JDI G;  2P67 A;  2OCC C;  4KFM A;  2QM8 A;  5B1A B;  2JK5 C;  1N8R W;  1YSC A;  3D36 A;  4RUF A;  3FB7 C;  3FYI B;  2EJR A;  1QR8 A;  4DXW A;  3JD0 A;  4FMT A;  3ZIA G;  1F51 A;  4UVC A;  4LP8 A;  3ABM C;  3ZMV A;  5E1A C;  3FB8 C;  2X7R B;  1H8E G;  2DWD C;  5LHH A;  5LGT A;  3EFF K;  3OMN B;  1JCH A;  1DTO A;  4P9P A;  3CMA V;  4H37 A;  2X6A A;  3SYP A;  4UVB A;  1NVP B;  1H38 A;  5L3B A;  2WWW A;  2ZR2 A;  2DYS C;  3SPC A;  5DM6 V;  3CD6 V;  5LHI A;  2Y69 C;  2EIK B;  1JX9 A;  3ETE A;  1XL4 A;  1JJ2 U;  2A79 B;  4H33 A;  2HFE C;  1FXK B;  1JOY A;  3E8G A;  2ITD C;  3EHB B;  2ITC C;  2X6B A;  4LBE C;  3IFX A;  3LDD A;  4JYC A;  3OW2 U;  4R50 A;  3E83 A;  2JEX A;  1ENV A;  2A9H A;  4ZKI A;  3ABU A;  1K92 A;  5KUK A;  4XDL A;  3ABL C;  3K9A A;  3SPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...