1K33A

Crystal structure analysis of the gp41 core mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
66
structure length
62
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQGRGGWMEWDREANNYTSLIHSLIEESQNQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Transmembrane glycoprotein GP41
publication title Interhelical interactions in the gp41 core: implications for activation of HIV-1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 27
structure length 62
sequence length 66
ec nomenclature
pdb deposition date 2001-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k33A00
3H01A 5KA6A 4JF3A 5HFLA 1DF4A 4JGSA 1EBOA 2EZOA 2X7RB 4FK5C 3GWOA 4JPRA 1Y66A 3CP1A 5HFMA 1DLBA 2P6JA 3MHHC 1DF5A 1QBZA 4FIPC 4FJCC 4N23A 5CMUA 1QCEA 1JQ0A 2MK3A 5CN0A 3CYOA 4E2LA 1MG1A 1JPXA 1K34A 1QR8A 1Y4MA 1QR9A 2M7WA 3K9AA 3M99B 2LP7A 2OT5A 3WFVA 1K33A 5KA5A 3B77A 3P30A 3MHSC 1MOFA 3B8MA 2EZPA 5H9CA 3B8NA 1I5YA 1ENVA 2EBOA 4N21A 1F23A 4G2KA 1I5XA 1SZTA
chains in the Genus database with same CATH superfamily
2KQXA 3TXSA 4GX1A 3F7VC 4JI8B 5GTHZ 1HNWB 2ADQB 2BTQB 3W7UA 3AG1B 1THZA 2GSMB 3FKSG 4GYCB 1E1QG 3OM3B 2WAMA 5J2TA 2EZPA 2QWQB 1M56C 1F4MA 2NR5A 4Z1VA 2Q7EA 4JI2B 4MW8A 5K1PA 3HKCB 2QEXV 1IURA 1PP9H 1YXBA 4ZBMA 5GONB 1SQGA 3UO3A 3THOA 3G80A 5IY5C 5KX5A 5JQGB 2YDEA 3HPLC 2XOKG 1GTOA 4ZKIA 2K9PA 3GWOA 4J41A 3IGAC 1QNMA 4FFBB 4IHJB 4F6EA 1PM9A 4YJ3A 3E2EA 2DJVA 3ZRVA 4G28B 1VQ7V 1S5JA 4LF9B 2WSSG 1Y74A 3FB8C 3SPGA 3FB5C 3LDCA 5IYCO 2GTAA 5CA1B 1XMQO 1F51A 3UM7A 4PA9A 1CXZB 1KECA 3CWBH 1QU7A 1S5LZ 2H94A 4WFEA 1D5AA 3LSSA 4JAUA 1ZL8B 4YY3B 4MVZA 1QR8A 1FD9A 1OV9A 1H2KA 4DW1A 1R1BA 2QWPB 1AVMA 1BQZA 2OCHA 2P90A 4X1YA 2JJ2G 3CJHA 4JI7O 1VF6C 1YJNV 2NN4A 3H1KH 1XBLA 4DUZB 2WA4A 4KP4A 1S72V 1KP2A 4LFCB 2DOSA 5IYZB 4HYOA 1G4YB 4JYYA 2HJFC 3K9AA 2N05A 3UT5B 3F5TA 4DR6B 3UO2A 4LFBO 1VF7A 1M56B 3ZX6A 4QGPA 1AI7A 3ICXA 1XQ8A 3ZEDA 1K3EA 3BVOA 5H5NA 4JPRA 3UCSC 1GH6A 1DF5A 3CSXA 5CB4B 2UXCO 4DV3B 4IL6Z 1DK1A 3RYIA 5E1AC 1EN5A 3LNNA 1VQNV 2OCCB 1XNRB 1NQTA 4JTAB 1D5NA 2ZINA 1H8HG 5KA6A 1M1KW 4LH6A 4P9OA 1YTFD 3ZS8C 3RWRD 1R73A 2XASA 4WFBV 1G8MA 4OPHA 1BT8A 2N74A 2Q73A 4JI1B 1QLEC 3FYIB 3T1CA 4ZI7A 1UFIA 3W7XA 1F7YA 1UJWB 1GO3F 4DV4B 3CMAV 1TUBB 2L6LA 3E35A 1VQOV 4JI8O 3K59A 2ZDIA 1HNWO 3CC7V 1GN4A 4JAAA 2OT5A 3ZHUA 3KKYA 1FAFA 4BIZA 3EHBB 3F5WC 1P7GA 3KCYA 4MT8A 3T1HB 5AG2A 4DV1B 3ETGA 2ADPA 2EIMC 4MVOA 1XMOO 1EM1A 3FAVA 1DLBA 2KG7B 1WNSA 1Y4MA 3ZIAG 4WFFA 5CBGA 4KL1A 4B7EA 4K0KB 2BTQA 3KCXA 1SESA 2ATKC 1IXMA 3AK3A 3R66A 2BE3A 4UCTA 2P4VA 4FLZA 5IE9A 3ABMC 1JPXA 3K5LA 4BR6A 1BHBA 3ZBHA 5IWAB 5LA6B 3CD6V 1NH2B 5IJ0B 2R9AA 4QE9A 5C8YB 3HKCA 1VQ8V 2WLLB 1N34B 2UUAB 4I9QA 2A0LA 3JAWB 3WB1A 2PZSA 1M90W 3CRMA 1OCCB 1P49A 5JQGA 2HP8A 4J11A 1MZEA 3STZC 1MSDA 2QM7A 3UKMA 1L0NH 2ZE7A 2XAQA 5D5PA 5KA5A 1VMGA 3MHSC 1QLEB 3SJAC 4IHJA 1NTZH 2OYQA 2LFRA 4GUNA 4JV5O 2UXDB 3E22B 2XHBA 5HFLA 1KUQA 4PV1B 5B5EZ 5CA1A 3H1HH 5LGTA 3J7AU 2R72A 4FIPC 3FB6C 4F4LA 2OIGA 4DUZO 1HNXB 2GV9A 1YHQV 4LFCO 2PI5A 4B3RO 4TT3G 1ZL8A 3QF7A 2OTLV 4W4LA 5LYJB 3ZHQA 4DR6O 2RCVA 1W0KG 3E8HA 2F93B 3G6EV 3K9SA 3TXQA 3OUSA 1JCHA 2Z5UA 1O9HA 4FPPA 1XHXA 3QO5A 4DV3O 1E1RG 5IYZA 3I56V 1R6NA 4GZRB 3AEIA 4WFGA 1XNRO 3UT5A 5FPOA 2B1IA 2FB5A 1V55C 4LNUB 4U3JB 5JWPA 4O4JA 4JTCB 3TJTA 2AZ2A 1NT2B 3IC7A 1YDXA 2AXTZ 3LNMB 5CB4A 4TWKA 1Z2GA 3OEHG 2ZXWC 4UV9A 2FTKA 3ABLC 1R3LC 3G71V 4J7JA 1Q8IA 3FYEB 2IU0A 4B3SO 4BWAA 5LMNB 3ASOC 2CGNA 4GKJB 1SQXH 4GCZA 1SKVA 3CYOA 1PV0A 2YI9A 3C90A 3A0HZ 1FXVA 1OCOC 3AK2A 4X9QA 1VEWA 1MABG 2ARHA 3T1HO 4UCRA 3SJCC 4DV1O 1NVPD 1YEWA 1B04A 1WLEA 1I7FA 4H44B 4IIJB 3OGCC 1TUBA 4ZIBA 3VQWA 1XDCA 3TGUH 4K0KO 2IW5A 4B3TB 1B3QA 2EX3A 1SZTA 5L3GA 1WJZA 4IYHA 3SR2C 2G38A 2XAHA 1J95A 3GB7C 3K5MA 1V54C 5JJEB 1K97A 2Q8VA 1EZVH 3HB3B 3W7SA 3K0GA 3ZHTA 3SPHA 2CUGA 3N2KB 4IGGA 3CJHB 4DK1A 3SYQA 1AR5A 3L9DA 1KKDA 4JI6B 4RWUA 1SZXA 2KG7A 2D3OW 4DR5B 4CBCA 1FPOA 5EYPB 2N04A 3VQYA 2QKCA 5IWAO 4HBNA 3JALA 4PA6A 4UVAA 3BA9A 4LH7A 2FYUH 3ZMTA 3QVNA 4I0XA 1V55B 4DK0A 1KU9A 2IJHA 1N34O 2EINB 3OMNB 3CCSV 4NKGB 4JZGA 3AG7A 1GK9A 4UUJC 4KXRA 1IBMB 2VRZA 3T4ZA 2ZXWB 1JMKC 3ABLB 1L0LH 3H1JH 5LA6A 2UXDO 5JJNB 3VQXA 5IJ0A 5C8YA 1FJGB 4LF4B 4LC1A 2X6BA 3JAWA 2QM4A 5DM6V 3K3WA 2EJRA 5LXTB 1HNXO 4LF5B 2F4VB 3GVMA 2OTJV 1GMGA 3GWKC 2PTMA 4EFEA 5KUKA 2LFSA 1Z5WA 1Y66A 3MHHC 2AZ0A 1Y6XA 3ZHVA 3E22A 4WFAV 4I55B 3AG3C 1Y76B 4ZI7B 1COWG 3P30A 1AJNA 1CP9A 4CZZA 1PL0A 1ZSPA 1FKAO 4CH6A 2F43G 1F23A 3OTFA 4PDVA 1F4NA 2HFEC 1CPYA 1P4RA 3P32A 3OTOB 4DV7B 4UFZA 4JZ2A 5LYJA 3ABKB 4CC6A 2GUZB 2Q9LA 1N36B 4RUFA 3JD2A 2A06H 2IU3A 1IBKB 4Z2WA 3CCMV 3FAVB 5B1OA 1RPOA 1VQ6V 1Q7YW 3EXAA 4LR3A 2PF4E 1JR9A 4JF3A 4PELA 1OHHG 1EBOA 4X66B 5LP6C 5KHIA 5B1NA 3P3NA 3RFRA 1WB7A 4MW3A 1ZUQA 5B1BB 2X6AA 3BFRA 5LL6Y 4X64B 1K73W 3SPJA 2W0XA 1VIBA 5LMNO 4C7UA 4GKJO 2LQTA 4LNUA 4U3JA 1GKFA 5FNVB 1WA8B 1JFFA 1H2MA 3H1LH 1OZ0A 3WG7C 3HR0A 3JYCA 3SDLA 4JI4O 1US6A 3G67A 1Q90D 4NTXA 4FK5C 5EZYB 2PYJA 4CS4A 1SQFA 4E4EA 4H0LB 1FXKB 2OIEA 2FL4A 2XUMA 4OGQB 2JGDB 4RQFA 3M7MX 1FFXB 2L35A 1VQ4V 2IH3C 4EB6A 1KYOF 2DWEC 4BIOA 1S0VA 3K5OA 3CS5A 4B3TO 3I55V 4PDRA 4HZ3A 3D3IA 4DV5B 4DR4B 1N0JA 3CE2A 4QNHB 4UV8A 1U96A 1I94B 2XNDG 3CPWU 4JI5B 5B3SB 2XAGA 4JI6O 5H2FZ 1M4UA 4IIJA 5KHGA 4DR5O 1VQLV 1VQ5V 4UB8Z 5L3FA 2E75B 1KBHA 2ITCC 5L3EA 4KHPB 3D36C 3LUTB 5CMUA 2DQ3A 1BL8A 3K04A 1R3JC 4LBEC 4HAMA 4DR1B 2EILC 2MW2B 2IJIA 4O4LB 4J9ZB 3WU2Z 3BRCA 3MDSA 3R65A 4DV2B 2DN9A 3HKBB 4J80A 4QIWF 3N2KA 3NXSA 2A9HA 4PI0A 4JGSA 4GT1A 1GN2A 5LP6B 1BE3H 5EYPA 3K79A 1JJ2U 1K5QA 2JEUA 3M99B 4DO2A 3OGIB 3OT7A 4PJ0Z 3LSUA 2Q4PA 5B1AC 4PDMA 4YJ2B 4YIOA 2Y4TA 5IYBO 2KSDA 1FJGO 4FM0A 4LF4O 1SERA 4O4JB 3I5DA 4LF5O 2F4VO 3WG7B 2ZM6B 1H2GA 1SA0B 4UB6Z 2YIBD 1VQMV 4X89A 4PDLA 2H8PC 4PA7A 3ZMVA 5KHKA 3LSQA 4G27B 5LHHA 1RM1C 2HLDG 3DSQA 1TVKB 1IX9A 3QNEA 1I5YA 1LUWA 4X1IB 4DV0B 4P2ZA 3OD4A 2UU9B 5IY5B 4I5SA 1NBMG 1TA8A 4MTGA 2VWKA 4DR2B 1H8EG 1QVGU 1GN6A 5LXTA 3OTOO 1BGYH 4NXNB 2VS0A 1PNKA 2DQ0A 3Q4HB 4DV6B 1M57C 3JAKB 4DV7O 4DW0A 3E8BA 2XTAA 3K0DA 1RP3B 1WN7A 2BOCC 5KLVH 2YIAA 4JYAO 4LF7B 2X6CA 3F7YC 1W0JG 4O2AB 1OCRC 3ABTA 4I55A 1I0HA 4X88A 1ZTEA 1Y76A 4DUYO 1VQKV 1IBKO 5KMGB 3CXCU 4FMTA 1RFYA 4ASUG 1EZJA 4EKWA 3BPZA 4FFKA 3JASB 4FLXA 2R70A 3STLC 4X66O 1QCEA 2Z0AA 3SJBC 4BAYA 1AR1B 3BY6A 2UUBB 2JGUA 2EILB 2WWWA 5H9CA 4X64O 2GUZA 2C2AA 1Q86W 4X20B 4X1KB 2RDCA 4FZ0A 5KHJA 4H33A 5HFMA 3E8GA 1GN3A 4PI2A 4ZHQB 4JI2O 1S77D 1S5HC 3CHXA 3VOUA 1MNGA 3JALB 1MZFA 3IAYA 1Q5OA 5B1AB 4LP8A 1W59A 4I0XB 4CS3A 2ZD9A 4K3AA 2EULA 5L3BA 1YF2A 4BW5A 2Z3YA 5FNVA 2YC0A 1WA8A 1WP8A 4K35A 4NYKA 4RO2A 3D8CA 5GTIZ 2A79B 1HW7A 1Q6HA 1BMFG 2Q0AA 5EC2C 5EC1C 5EZYA 4DV5O 4UXNA 4DR4O 1FXKA 1XL4A 2WLHA 1NU1H 4N21A 4P30A 4LF9O 1XL6A 2UXBB 1I94O 1NH2D 1HNZB 2JGDA 3IFXA 2Y69C 1FFXA 1XNQB 1IXBA 1M5IA 4CH3A 3IJ4A 2B5UA 5BXZA 1WPBA 1EN4A 1M57B 4YY3O 4KHPO 2W6IG 3X2QC 2CDYA 1R3KC 4DR1O 5CBHA 1OCRB 2Q68A 1PNMA 2UXNA 2FMLA 4DV2O 4LF8B 2CH7B 5EBWC 1TUEB 1GRJA 2Q67A 3MAQA 4FJCC 1AI4A 3G6BA 4LWSB 4QPJA 4A5UB 2EIKC 2BCCH 3ASNC 3B4SA 5LGUA 1GM7A 1IBLB 4ABMA 1IZ3A 4O4LA 2EIMB 3AG2C 3S3WA 3RYHB 2HG5C 3HKEA 3RYCB 1QBZA 3HKBA 2ZM6O 4F6RB 1G6UA 4KFMA 5GW7A 3JD3A 1QLNA 2CTWA 2Q69A 2PY5A 2YUAA 5LP6A 1RPRA 3OUFA 2WA3A 2ZE6A 4FLUA 2A3QA 2BSKB 4YJ2A 2UU9O 1AP6A 4UVBA 2YIDA 1P84F 1AB3A 4DR2O 1MA1A 1JFFB 4U7NA 1R6TA 1EN6A 3ZN1A 3OEEG 4XDJA 3ABMB 1SA0A 2JK5C 4NXNO 1ZAUA 4AQYB 1CEZA 4DV6O 1GAXA 3VQVA 4JI1O 2HHHB 4LF7O 1TVKA 1S76D 4H13B 2HVJC 3JD0A 4YHHB 5DEDA 2CGOA 2QWRB 3K08A 4AI8A 4X1IA 4WBNB 2QKAA 3FD9A 4I9WA 2MK3A 4DV4O 4E2LA 3AK1A 2QKSA 4MTFA 3JSLA 4EB6B 1AR4A 3E86A 5LGNA 2ILMA 1SQVH 1SQQH 2IBZH 2CTRA 4UVCA 1B6QA 2UUBO 5D5QA 4ZOLB 3Q4HA 4KUMA 2YS8A 3JAKA 3ZHRA 4O4HB 4U3FH 2DMXA 2PYLA 3JARB 4NTWA 3N2GB 4O2AA 3SYCA 4OX9B 5KMGA 2XAJA 4CC5A 3ZMUA 2JS3A 5BR8B 2AHYA 4RUEA 3JASA 5BY1A 1VQPV 3SYPA 2YICA 3D36A 2P4KA 4NB5A 4L87A 4FZ1A 1H2SB 3KZIZ 5IDJA 5KAFZ 1YJ9V 3OR7C 4X20A 2CTPA 2IJKA 4X1KA 5CBFA 1KD1W 2ZIOA 4MTXA 2HJDA 1VF6A 1YIJV 2QR4A 1DTOA 1LUVA 2ZNIA 4ZHQA 3A8TA 2P5OA 4D7SA 2PUSA 1ORQC 2RQ6A 4DRXB 3BABA 3P3PA 2UXBO 1YCIA 3JCZA 2YEVB 4B08A 1HNZO 4B3MB 5JVDA 1BHAA 1XNQO 5JH7B 2UUAO 2M7WA 5J9PC 1K34A 3J81N 1QR9A 5EK0A 3DC6A 1B06A 2P67A 2P06A 5BMVA 4MS2A 3C3TA 1HWYA 1Y67A 4LCUC 2E3CA 1K8AW 3AG1C 1QVFU 1LR1A 1R6KA 1YZBA 5EIBD 1BS3A 1Q43A 3CCJV 2ODMA 4O2BB 2H3OA 4JI3B 4MVRA 3ASOB 2BTOA 2CE4A 1A32A 4JI7B 2ZNJA 2WLKA 2ZE5A 2ITDC 2QA4V 4PA4A 1PD3A 2HKOA 1OCOB 3MD0A 4OXSA 1IBLO 1M93A 2JS5A 5H6QA 3W7TA 3OFNG 3ZHSA 1WB8A 4LFBB 4TQDA 3T2MA 4JI0B 2CH7A 3DXRB 3QTCA 3CRQA 5B66Z 3ML0A 4LWSA 3ZJZA 1ZLZA 3ZMSA 5JCOC 4WFHA 1NZ6A 1AP5A 5KUMA 4TUYB 1SETA 3DC5A 3VBBA 2YXLA 1JQ0A 3L71H 1V54B 1BSMA 1MG1A 3ZRWB 5LHIA 5KHHA 3W7WA 3J80N 3APQA 3RYHA 3JATB 3RYCA 1XEQA 4FLTA 4GLXA 4F6RA 1XREA 1U97A 2Q7GA 4QJFB 2WPDG 3A2FA 1VP7A 2HHHO 3O9OA 4I7ZB 2BSKA 3E83A 5KAIZ 1MOFA 1URFA 2AW9A 1AILA 1NJIW 2YSUB 3T1YB 1YJWV 2WLJA 4WF9V 1N8RW 3AG4C 4J7KA 2YXHA 5C93A 2D2CB 3H9VA 3OW2U 2Q7HA 3RN4A 4OX9O 2Y48A 1FYJA 1XMOB 4WBNA 2FKXA 4NR1A 5A9GA 2VQFB 4X65B 5BR8O 2F66C 1L1FA 3ZMZA 3CCLV 1X59A 3LDDA 4ZOLA 3K06A 2WLIB 5BZBA 5L3CA 1ZX3A 1NS1A 3D3QA 4MVQA 2IH1C 5H6RA 4O4HA 2QTSA 3OMAB 1K33A 1K4DC 3AG3B 2OCCC 3RT3C 3JARA 4FLYA 1N33B 3WB0A 3N2GA 1I08A 2HR3A 4TOIA 4DR3B 3QO7A 2IJJA 1J5EB 1N4CA 2WLNA 3FB7C 3DTUB 1RSOB 2JDIG 4B3MO 2RN9A 3ETDA 2Q6AA 4AHCA 4FLWA 2E74B 4LFAB 1YSCA 4DXWA 4AILC 1M9NA 3IC9A 5A2QN 2VQEB 1K5SA 4PD4F 3CB2A 3HKEB 3BCCH 4GX5A 1IBMO 1WPXA 3A0RA 1TGOA 3U0ZA 2DYRC 2LW7A 3E89A 1KKCA 2P22C 2O57A 1AI5A 4R6ZA 3JCUZ 4DRXA 4JV5B 4I50B 5TISZ 2RMKB 3CCVV 4JI3O 2YEVA 3JAMN 2P7TC 1N32B 3BAAA 2ZQMA 5JH7A 4FLVA 3DGEA 3S3XA 2DWDC 3AG4B 2Y4UA 2LGQA 4IT5A 4B3RB 5K1XA 3JSNA 3B40A 4WCEV 2HVKC 2QDOA 3QO8A 3RBZA 3SPIA 5LMUB 4TSFG 3C3SA 4XDKA 1AJQA 4RAIA 2ZKOA 2UUCB 4O2BA 4W4KA 4JI0O 5LHGA 3RVYA 4LF6B 1KMIZ 3HKDB 1X4TA 2A7WA 2K1EA 5IJ9A 2E5LB 4MSWC 3ZRSA 3RYFA 2V4DA 1NR7A 1QHTA 2CTQA 5IT9N 2QM8A 4D7TA 2EJ7A 2QGNA 1L8DA 2QE7G 5IYDO 2YXYA 3U10A 1N36O 1YTFB 3QG5A 3OR6C 4DR7B 1YVWA 4O4IA 5LOVB 1MSWD 3CRAA 3L70H 2QWNB 3ETEA 2JEXA 3DXRA 1JOYA 1OCCC 1YITV 4UCUA 4HNAB 2R9RB 3CRRA 3CCRV 4MVSA 1SQBH 3EVKA 3RGBA 5DN6G 3OMIB 1AJPA 1KQSU 5J2UB 4TUYA 2Q0OC 2QJ1A 2ZR3A 1W2BU 2ETNA 3ZRWA 4B3SB 1JVMA 4I4TB 2X7RB 3JATA 4QE7A 3T1YO 3CX5F 4EFBA 2DYRB 3PJSK 1S3JA 4X62B 4TV8B 1H38A 2RNBA 2B9ZA 2Y0IA 2DYSC 2NNUA 3CCQV 1K92A 4XBFA 1SF9A 1ZWIC 2LJ2A 2JIZG 5JVDB 2RJZA 2CAZC 5FLXN 1G1XB 1Q3EA 2DE0X 2VQFO 1JA8A 2YI8A 4CH5A 4X65O 1E79G 5ITZA 1PPJH 5FPRA 3K58A 5CA0B 5BMVB 4R50A 3EFFK 1ROPA 4J42A 3M8AA 1RM1B 1XILA 3TETA 2QWOB 3SPCA 4TQFA 4UCSA 1N33O 4JI5O 1XOUA 2E76B 4DR3O 1K9MW 3NR7A 1J5EO 3K03A 3SGIA 1O9GA 1OCZC 4BIUA 2WLIA 1HDJA 3APOA 1SS3A 4JYCA 5GONA 4TV9B 4LFAO 1H2LA 1BCCH 3CMEV 2VQEO 3G4SV 1WP7A 1K4CC 2P6JA 4K8XA 3BHPA 1PL4A 4GX0A 1SC5B 2ZT9B 4ICGA 4PA3A 2Q5ZA 4FFBA 2EIJC 5JCOA 1NR1A 1SRYA 1I5XA 2IM9A 1RSOA 1YI2V 1Q81W 2QTOA 2AGAA 4JYBA 2PI4A 2VWJA 1N32O 1NI8A 3B09A 4FVMA 1D2DA 4MVMA 1IDSA 1VARA 2ZE8A 4K8ZA 4BW9A 5EBLC 2DYSB 5LMUO 2GDSA 5EBMC 3ZN0A 3T4DA 1HR0B 4NXMB 5LBQA 2BOBC 3JD1A 4I50A 4GX2A 2R9IA 2UUCO 4DV0O 4OPAA 4LF6O 1XI1A 3FFQA 4GKKB 2JJ1G 2E5LO 1EFRG 5F2VO 1HP8A 4DYLA 3B77A 3CXHF 1JX9A 3ETQA 3UQ8A 4QPKA 3O65A 5DECA 2F23A 2HEPA 4EEQA 4FM1A 1BZKA 2OWOA 2NLJC 4DR7O 2EINC 2Y69B 5J2TB 4L8JA 5E79Z 2GBOA 2YIBA 3HKDA 1Q6IA 2ZCEA 1KB9F 3OE7G 1VQ9V 2LW1A 1XUQA 3CRCA 1OCZB 3B8MA 4P9PA 4RQEA 3LDEA 5FL7G 2X0LA 2XT9A 3CEIA 3X2QB 3H01A 5EIBC 1N0NA 1NTMH 1V9PA 2JVDA 1Q6UA 2LGWA 1K7DA 2GTSA 1JJOA 3RW0A 5KX5B 5LOVA 4IYIA 4YIPA 3OAAG 1PKXA 4HNAA 4X62O 4JI4B 2EIKB 3ASNB 2EIJB 1ENVA 5JJJB 3CC4V 2CK3G 4R8CA 1IVSA 4YJ3B 4J10A 1Z5VA 3L72H 5J2UA 1LNQA 4Q20A 4UCOA 1Y74B 3SYOA 1NVPB 3CP1A 4XDLA 2UXXA 3AG2B 1AI6A 4H37A 2DW4A 3CCEV 4PHZA 4Z1MG 4I4TA 2ZIMA 2V1DA 1PNLA 1OJHA 3K57A 4JTDB 4MTOA 1DGSA 1Q82W 4CH4A 4TV8A 1WAZA 2ZDIC 2KKWA 3U11A 3TK1A 4J9YB 2XAFA 4R7CA 3L73H 3ABKC 4X1YB 1XMQB 1QQCA 2GHYA 4YXWG 5CA0A 1P7BA 5CA3A 4J7ZA 1H2NA 2F95B 3ZCCA 2QSAA 3SYAA 1SQPH 2LO1A 2AHZA 5B1BC 1GM9A 3E8FA 3A0BZ 2W0FC 1R3IC 2M6YA 4LF8O 2Y0PA 2JRIA 2LP7A 3ABUA 2B1GA 3RVZA 5IJ9B 4CS2A 1KC8W 1BQ0A 3JD4A 3RYFB 1KP3A 2ZR2A 3N27A 1FXKC 3RYIB 3SJQC 4MVUA 1UPGA 3PN1A 5L3DA 4TV9A 3WB2A 2WLLA 3KG2A 4O4IB 1XHZA 4U7OA 4JAVA 2KB1A 1TAEA 4G2KA 4UCVA 1VF5B 3CC2V 4Q6GA 1T5EA 4B7KA 1GM8A 3BA8A 3TCUA 1HR0O 2EZOA 4NXMO 1NTKH 2UXCB 2W6JG 4NTYA 5CN0A 1FS0G 3CCUV 4FM2A 4GKKO 2WLMA 4NVPA 4X8AA 2PGGA 3L75H 5B3SC 3B8NA 1NKDA 4AQYO 1DF4A 3FX7A 3K5NA 1FFTB 3B2EE 3H1IH 1AROP 3L74H 1FXHA 4N23A 2V7QG 1MMMA 4JYAB 3BEHA 4D6TH 4YHHO 3WFVA 4DUYB 4JASA 2EBOA 3ZRXA 5ITZB 2F1MA
chains in the Genus database with same CATH topology
5L3GA 1OCRB 2Q68A 2XAHA 1PNMA 2K1EA 2UXNA 3F7VC 4GX1A 1J95A 4MSWC 3GB7C 3W7UA 5EBWC 1TUEB 3ZRSA 2Q67A 3AG1B 1THZA 1V54C 1K97A 4FJCC 3HB3B 3W7SA 2GSMB 3K0GA 1NR7A 3FKSG 1AI4A 3SPHA 1E1QG 2QM8A 3OM3B 4QPJA 2EIKC 3ASNC 3SYQA 2WAMA 1KKDA 2EZPA 1M56C 5LGUA 2QE7G 2D3OW 5IYDO 1GM7A 4CBCA 1F4MA 1YTFB 3OR6C 1MSWD 4PA6A 4UVAA 3ETEA 2JEXA 1JOYA 2EIMB 1OCCC 3AG2C 1YITV 3ZMTA 4MW8A 1V55B 2HG5C 2IJHA 2R9RB 2EINB 1QBZA 3OMNB 3CCRV 3CCSV 4MVSA 2QEXV 4KFMA 5GW7A 3JD3A 5DN6G 1QLNA 2Q69A 4ZBMA 3OMIB 1AJPA 1KQSU 1GK9A 4UUJC 1RPRA 3OUFA 2ZR3A 1W2BU 3T4ZA 5IY5C 3ZRWA 2ZXWB 1JVMA 3HPLC 2XOKG 1GTOA 3ABLB 2X7RB 4ZKIA 4QE7A 3GWOA 3IGAC 4UVBA 2DYRB 3PJSK 1S3JA 3E2EA 3ZRVA 4G28B 1VQ7V 1H38A 4U7NA 2WSSG 2DYSC 3ZN1A 3OEEG 4XDJA 3ABMB 2JK5C 2NNUA 3FB8C 3SPGA 3CCQV 4LC1A 3FB5C 2X6BA 1CEZA 1K92A 4XBFA 3LDCA 3K3WA 2EJRA 5DM6V 5IYCO 1ZWIC 1F51A 3UM7A 4PA9A 2JIZG 2OTJV 1GMGA 1KECA 1S76D 2HVJC 3JD0A 2H94A 1E79G 5KUKA 4WFEA 2LFSA 1Y66A 3K08A 3LSSA 4JAUA 3MHHC 4I9WA 4MVZA 2MK3A 4WFAV 4R50A 4E2LA 3AG3C 2QKSA 3EFFK 1QR8A 4MTFA 1COWG 1ROPA 3E86A 3P30A 1AJNA 1CP9A 5LGNA 4CZZA 1PL0A 1RM1B 3TETA 4UVCA 1B6QA 2F43G 1F23A 2P90A 4PDVA 3SPCA 1F4NA 2JJ2G 2HFEC 1CPYA 1P4RA 3P32A 4KUMA 1YJNV 4KP4A 1S72V 1K9MW 1KP2A 3SYCA 3ABKB 4HYOA 1G4YB 2HJFC 3K03A 3K9AA 2XAJA 1OCZC 3JD2A 4RUFA 3ZMUA 2IU3A 2AHYA 4RUEA 1VQPV 1M56B 2WLIA 4BIUA 3CCMV 5B1OA 1RPOA 1VQ6V 4JYCA 3SYPA 3D36A 1Q7YW 4JF3A 4L87A 3CMEV 4PELA 1AI7A 1OHHG 1EBOA 1K3EA 4JPRA 5B1NA 5IDJA 3G4SV 1K4CC 2P6JA 1DF5A 1YJ9V 3OR7C 4MW3A 4GX0A 5B1BB 2IJKA 2X6AA 5CBFA 1K73W 3SPJA 1KD1W 4PA3A 4MTXA 1YIJV 5E1AC 1DTOA 1VQNV 1GKFA 2OCCB 2EIJC 1NQTA 1NR1A 4JTAB 1SRYA 1I5XA 1YI2V 1OZ0A 3WG7C 3JYCA 1H8HG 2QTOA 5KA6A 1Q81W 4JYBA 2PI4A 1ORQC 1M1KW 4P9OA 1YTFD 4FK5C 3JCZA 1R73A 2YEVB 2XASA 1FXKB 4MVMA 4WFBV 1BHAA 1G8MA 2M7WA 5EBLC 1K34A 5J9PC 1QR9A 4RQFA 2DYSB 5EK0A 1QLEC 2P67A 3FYIB 5EBMC 3ZN0A 1VQ4V 2IH3C 4MS2A 3T4DA 3T1CA 5LBQA 2DWEC 1HWYA 3W7XA 2BOBC 3JD1A 1UJWB 1S0VA 4GX2A 2R9IA 1GO3F 4LCUC 3CMAV 1K8AW 3AG1C 3I55V 1QVFU 4PDRA 1R6KA 4HZ3A 3D3IA 2JJ1G 3E35A 1VQOV 3CCJV 1EFRG 4MVRA 2ZDIA 3CC7V 3ASOB 2OT5A 4QNHB 3B77A 4UV8A 4BIZA 1JX9A 2XNDG 3EHBB 3F5WC 3CPWU 4QPKA 2WLKA 4MT8A 2ITDC 5B3SB 2XAGA 2QA4V 3ETGA 4PA4A 1PD3A 2HKOA 1OCOB 2EIMC 3MD0A 4MVOA 4OXSA 1VQLV 1VQ5V 2NLJC 5L3FA 2EINC 2Y69B 1DLBA 2ITCC 5H6QA 3OFNG 5L3EA 3W7TA 5CMUA 3LUTB 2DQ3A 1BL8A 1Y4MA 3ZIAG 3K04A 1R3JC 4LBEC 3OE7G 4WFFA 5CBGA 1VQ9V 4HAMA 3T2MA 2EILC 2IJIA 1OCZB 3B8MA 4P9PA 4J9ZB 4RQEA 3LDEA 5FL7G 1SESA 2X0LA 3R65A 2ATKC 1IXMA 3ML0A 4QIWF 3H01A 3X2QB 3NXSA 2A9HA 4JGSA 3ZJZA 4GT1A 1K7DA 3ZMSA 4WFHA 5KUMA 1SETA 3VBBA 3RW0A 3K79A 1JQ0A 1JJ2U 1K5QA 1V54B 3ABMC 1MG1A 1JPXA 3ZRWB 2JEUA 5LHIA 3M99B 4DO2A 3W7WA 3OAAG 1PKXA 1BHBA 5B1AC 2EIKB 4PDMA 3ASNB 3CD6V 1NH2B 5IYBO 2EIJB 1ENVA 4QE9A 3CC4V 2CK3G 4R8CA 1SERA 1VQ8V 4QJFB 2WPDG 3WG7B 2WLLB 1LNQA 4Q20A 1H2GA 1VQMV 4X89A 2A0LA 4PDLA 3SYOA 3CP1A 4XDLA 2UXXA 3AG2B 1OCCB 1NVPB 1M90W 1AI6A 4H37A 2DW4A 2H8PC 3CCEV 4PA7A 4Z1MG 3STZC 3ZMVA 2QM7A 3UKMA 3LSQA 2V1DA 1PNLA 2XAQA 3E83A 4G27B 5KA5A 5LHHA 2HLDG 1RM1C 3MHSC 1MOFA 4JTDB 4MTOA 1QLEB 1Q82W 2LFRA 3QNEA 1I5YA 1NJIW 2ZDIC 2YSUB 4P2ZA 1YJWV 5IY5B 3TK1A 4I5SA 1NBMG 2WLJA 4MTGA 5HFLA 4WF9V 1N8RW 3AG4C 1H8EG 1QVGU 4J9YB 2XAFA 4R7CA 5LGTA 5C93A 3ABKC 4FIPC 3FB6C 4F4LA 1PNKA 2DQ0A 1M57C 1YHQV 3OW2U 3E8BA 2PI5A 2GHYA 2Y48A 3K0DA 4YXWG 2BOCC 4TT3G 2X6CA 3F7YC 2OTLV 1W0JG 1P7BA 3ABTA 1OCRC 5CA3A 4X88A 1VQKV 1L1FA 3CXCU 4FMTA 4ASUG 1W0KG 3E8HA 3ZCCA 3ZMZA 3CCLV 1EZJA 3SYAA 4EKWA 3G6EV 2AHZA 3LDDA 5B1BC 3OUSA 1JCHA 3K06A 2WLIB 5BZBA 5L3CA 1GM9A 3E8FA 1QCEA 3STLC 2Z5UA 4MVQA 2IH1C 1R3IC 2W0FC 5H6RA 4BAYA 1AR1B 3BY6A 2LP7A 3OMAB 4FPPA 1K33A 1K4DC 2B1GA 3AG3B 2OCCC 3ABUA 3RVZA 2EILB 2WWWA 3QO5A 2HR3A 5H9CA 1E1RG 1KC8W 3I56V 1R6NA 3JD4A 2C2AA 1Q86W 3AEIA 4WFGA 1KP3A 3QO7A 2IJJA 2B1IA 2ZR2A 1FXKC 1V55C 2WLNA 3SJQC 4H33A 5HFMA 4MVUA 3E8GA 4JTCB 5L3DA 3FB7C 2WLLA 1S77D 3DTUB 3IC7A 2JDIG 1S5HC 3KG2A 3VOUA 3ETDA 2Q6AA 4U7OA 4JAVA 1YSCA 4DXWA 2KB1A 1M9NA 5B1AB 4LP8A 3LNMB 1K5SA 4TWKA 3OEHG 2ZXWC 4G2KA 2ZD9A 3CC2V 4UV9A 2FTKA 5L3BA 1GM8A 3ABLC 4GX5A 1R3LC 3TCUA 3G71V 4BW5A 1WPXA 2EZOA 2Z3YA 3A0RA 2W6JG 3FYEB 2IU0A 2DYRC 3ASOC 3E89A 4GCZA 1FS0G 4RO2A 5CN0A 3CYOA 1AI5A 2A79B 3CCUV 4R6ZA 1BMFG 5EC2C 2WLMA 5EC1C 4X8AA 4UXNA 3CCVV 2YEVA 2P7TC 1FXKA 1XL4A 5B3SC 2WLHA 3B8NA 4N21A 4P30A 2ZQMA 1XL6A 1FXVA 1OCOC 1NH2D 3DGEA 1NKDA 1DF4A 1MABG 3IFXA 1FFTB 2Y69C 2DWDC 3AG4B 1AROP 1FXHA 4N23A 2V7QG 1NVPD 4WCEV 2HVKC 3BEHA 3QO8A 3RBZA 2B5UA 3SPIA 1WLEA 4TSFG 3WFVA 1M57B 3OGCC 4XDKA 1AJQA 2W6IG 4RAIA 4JASA 2EBOA 3X2QC 3ZRXA 1R3KC 2IW5A 5LHGA 5CBHA 1SZTA 3RVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H01 A;  5KA6 A;  4JF3 A;  5HFL A;  1DF4 A;  4JGS A;  1EBO A;  2EZO A;  2X7R B;  4FK5 C;  3GWO A;  4JPR A;  1Y66 A;  3CP1 A;  5HFM A;  1DLB A;  2P6J A;  3MHH C;  1DF5 A;  1QBZ A;  4FIP C;  4FJC C;  4N23 A;  5CMU A;  1QCE A;  1JQ0 A;  2MK3 A;  5CN0 A;  3CYO A;  4E2L A;  1MG1 A;  1JPX A;  1K34 A;  1QR8 A;  1Y4M A;  1QR9 A;  2M7W A;  3K9A A;  3M99 B;  2LP7 A;  2OT5 A;  3WFV A;  1K33 A;  5KA5 A;  3B77 A;  3P30 A;  3MHS C;  1MOF A;  3B8M A;  2EZP A;  5H9C A;  3B8N A;  1I5Y A;  1ENV A;  2EBO A;  4N21 A;  1F23 A;  4G2K A;  1I5X A;  1SZT A; 
#chains in the Genus database with same CATH topology
 2KQX A;  3TXS A;  4GX1 A;  3F7V C;  4JI8 B;  5GTH Z;  1HNW B;  2ADQ B;  2BTQ B;  3W7U A;  3AG1 B;  1THZ A;  2GSM B;  3FKS G;  4GYC B;  1E1Q G;  3OM3 B;  2WAM A;  5J2T A;  2EZP A;  2QWQ B;  1M56 C;  1F4M A;  2NR5 A;  4Z1V A;  2Q7E A;  4JI2 B;  4MW8 A;  5K1P A;  3HKC B;  2QEX V;  1IUR A;  1PP9 H;  1YXB A;  4ZBM A;  5GON B;  1SQG A;  3UO3 A;  3THO A;  3G80 A;  5IY5 C;  5KX5 A;  5JQG B;  2YDE A;  3HPL C;  2XOK G;  1GTO A;  4ZKI A;  2K9P A;  3GWO A;  4J41 A;  3IGA C;  1QNM A;  4FFB B;  4IHJ B;  4F6E A;  1PM9 A;  4YJ3 A;  3E2E A;  2DJV A;  3ZRV A;  4G28 B;  1VQ7 V;  1S5J A;  4LF9 B;  2WSS G;  1Y74 A;  3FB8 C;  3SPG A;  3FB5 C;  3LDC A;  5IYC O;  2GTA A;  5CA1 B;  1XMQ O;  1F51 A;  3UM7 A;  4PA9 A;  1CXZ B;  1KEC A;  3CWB H;  1QU7 A;  1S5L Z;  2H94 A;  4WFE A;  1D5A A;  3LSS A;  4JAU A;  1ZL8 B;  4YY3 B;  4MVZ A;  1QR8 A;  1FD9 A;  1OV9 A;  1H2K A;  4DW1 A;  1R1B A;  2QWP B;  1AVM A;  1BQZ A;  2OCH A;  2P90 A;  4X1Y A;  2JJ2 G;  3CJH A;  4JI7 O;  1VF6 C;  1YJN V;  2NN4 A;  3H1K H;  1XBL A;  4DUZ B;  2WA4 A;  4KP4 A;  1S72 V;  1KP2 A;  4LFC B;  2DOS A;  5IYZ B;  4HYO A;  1G4Y B;  4JYY A;  2HJF C;  3K9A A;  2N05 A;  3UT5 B;  3F5T A;  4DR6 B;  3UO2 A;  4LFB O;  1VF7 A;  1M56 B;  3ZX6 A;  4QGP A;  1AI7 A;  3ICX A;  1XQ8 A;  3ZED A;  1K3E A;  3BVO A;  5H5N A;  4JPR A;  3UCS C;  1GH6 A;  1DF5 A;  3CSX A;  5CB4 B;  2UXC O;  4DV3 B;  4IL6 Z;  1DK1 A;  3RYI A;  5E1A C;  1EN5 A;  3LNN A;  1VQN V;  2OCC B;  1XNR B;  1NQT A;  4JTA B;  1D5N A;  2ZIN A;  1H8H G;  5KA6 A;  1M1K W;  4LH6 A;  4P9O A;  1YTF D;  3ZS8 C;  3RWR D;  1R73 A;  2XAS A;  4WFB V;  1G8M A;  4OPH A;  1BT8 A;  2N74 A;  2Q73 A;  4JI1 B;  1QLE C;  3FYI B;  3T1C A;  4ZI7 A;  1UFI A;  3W7X A;  1F7Y A;  1UJW B;  1GO3 F;  4DV4 B;  3CMA V;  1TUB B;  2L6L A;  3E35 A;  1VQO V;  4JI8 O;  3K59 A;  2ZDI A;  1HNW O;  3CC7 V;  1GN4 A;  4JAA A;  2OT5 A;  3ZHU A;  3KKY A;  1FAF A;  4BIZ A;  3EHB B;  3F5W C;  1P7G A;  3KCY A;  4MT8 A;  3T1H B;  5AG2 A;  4DV1 B;  3ETG A;  2ADP A;  2EIM C;  4MVO A;  1XMO O;  1EM1 A;  3FAV A;  1DLB A;  2KG7 B;  1WNS A;  1Y4M A;  3ZIA G;  4WFF A;  5CBG A;  4KL1 A;  4B7E A;  4K0K B;  2BTQ A;  3KCX A;  1SES A;  2ATK C;  1IXM A;  3AK3 A;  3R66 A;  2BE3 A;  4UCT A;  2P4V A;  4FLZ A;  5IE9 A;  3ABM C;  1JPX A;  3K5L A;  4BR6 A;  1BHB A;  3ZBH A;  5IWA B;  5LA6 B;  3CD6 V;  1NH2 B;  5IJ0 B;  2R9A A;  4QE9 A;  5C8Y B;  3HKC A;  1VQ8 V;  2WLL B;  1N34 B;  2UUA B;  4I9Q A;  2A0L A;  3JAW B;  3WB1 A;  2PZS A;  1M90 W;  3CRM A;  1OCC B;  1P49 A;  5JQG A;  2HP8 A;  4J11 A;  1MZE A;  3STZ C;  1MSD A;  2QM7 A;  3UKM A;  1L0N H;  2ZE7 A;  2XAQ A;  5D5P A;  5KA5 A;  1VMG A;  3MHS C;  1QLE B;  3SJA C;  4IHJ A;  1NTZ H;  2OYQ A;  2LFR A;  4GUN A;  4JV5 O;  2UXD B;  3E22 B;  2XHB A;  5HFL A;  1KUQ A;  4PV1 B;  5B5E Z;  5CA1 A;  3H1H H;  5LGT A;  3J7A U;  2R72 A;  4FIP C;  3FB6 C;  4F4L A;  2OIG A;  4DUZ O;  1HNX B;  2GV9 A;  1YHQ V;  4LFC O;  2PI5 A;  4B3R O;  4TT3 G;  1ZL8 A;  3QF7 A;  2OTL V;  4W4L A;  5LYJ B;  3ZHQ A;  4DR6 O;  2RCV A;  1W0K G;  3E8H A;  2F93 B;  3G6E V;  3K9S A;  3TXQ A;  3OUS A;  1JCH A;  2Z5U A;  1O9H A;  4FPP A;  1XHX A;  3QO5 A;  4DV3 O;  1E1R G;  5IYZ A;  3I56 V;  1R6N A;  4GZR B;  3AEI A;  4WFG A;  1XNR O;  3UT5 A;  5FPO A;  2B1I A;  2FB5 A;  1V55 C;  4LNU B;  4U3J B;  5JWP A;  4O4J A;  4JTC B;  3TJT A;  2AZ2 A;  1NT2 B;  3IC7 A;  1YDX A;  2AXT Z;  3LNM B;  5CB4 A;  4TWK A;  1Z2G A;  3OEH G;  2ZXW C;  4UV9 A;  2FTK A;  3ABL C;  1R3L C;  3G71 V;  4J7J A;  1Q8I A;  3FYE B;  2IU0 A;  4B3S O;  4BWA A;  5LMN B;  3ASO C;  2CGN A;  4GKJ B;  1SQX H;  4GCZ A;  1SKV A;  3CYO A;  1PV0 A;  2YI9 A;  3C90 A;  3A0H Z;  1FXV A;  1OCO C;  3AK2 A;  4X9Q A;  1VEW A;  1MAB G;  2ARH A;  3T1H O;  4UCR A;  3SJC C;  4DV1 O;  1NVP D;  1YEW A;  1B04 A;  1WLE A;  1I7F A;  4H44 B;  4IIJ B;  3OGC C;  1TUB A;  4ZIB A;  3VQW A;  1XDC A;  3TGU H;  4K0K O;  2IW5 A;  4B3T B;  1B3Q A;  2EX3 A;  1SZT A;  5L3G A;  1WJZ A;  4IYH A;  3SR2 C;  2G38 A;  2XAH A;  1J95 A;  3GB7 C;  3K5M A;  1V54 C;  5JJE B;  1K97 A;  2Q8V A;  1EZV H;  3HB3 B;  3W7S A;  3K0G A;  3ZHT A;  3SPH A;  2CUG A;  3N2K B;  4IGG A;  3CJH B;  4DK1 A;  3SYQ A;  1AR5 A;  3L9D A;  1KKD A;  4JI6 B;  4RWU A;  1SZX A;  2KG7 A;  2D3O W;  4DR5 B;  4CBC A;  1FPO A;  5EYP B;  2N04 A;  3VQY A;  2QKC A;  5IWA O;  4HBN A;  3JAL A;  4PA6 A;  4UVA A;  3BA9 A;  4LH7 A;  2FYU H;  3ZMT A;  3QVN A;  4I0X A;  1V55 B;  4DK0 A;  1KU9 A;  2IJH A;  1N34 O;  2EIN B;  3OMN B;  3CCS V;  4NKG B;  4JZG A;  3AG7 A;  1GK9 A;  4UUJ C;  4KXR A;  1IBM B;  2VRZ A;  3T4Z A;  2ZXW B;  1JMK C;  3ABL B;  1L0L H;  3H1J H;  5LA6 A;  2UXD O;  5JJN B;  3VQX A;  5IJ0 A;  5C8Y A;  1FJG B;  4LF4 B;  4LC1 A;  2X6B A;  3JAW A;  2QM4 A;  5DM6 V;  3K3W A;  2EJR A;  5LXT B;  1HNX O;  4LF5 B;  2F4V B;  3GVM A;  2OTJ V;  1GMG A;  3GWK C;  2PTM A;  4EFE A;  5KUK A;  2LFS A;  1Z5W A;  1Y66 A;  3MHH C;  2AZ0 A;  1Y6X A;  3ZHV A;  3E22 A;  4WFA V;  4I55 B;  3AG3 C;  1Y76 B;  4ZI7 B;  1COW G;  3P30 A;  1AJN A;  1CP9 A;  4CZZ A;  1PL0 A;  1ZSP A;  1FKA O;  4CH6 A;  2F43 G;  1F23 A;  3OTF A;  4PDV A;  1F4N A;  2HFE C;  1CPY A;  1P4R A;  3P32 A;  3OTO B;  4DV7 B;  4UFZ A;  4JZ2 A;  5LYJ A;  3ABK B;  4CC6 A;  2GUZ B;  2Q9L A;  1N36 B;  4RUF A;  3JD2 A;  2A06 H;  2IU3 A;  1IBK B;  4Z2W A;  3CCM V;  3FAV B;  5B1O A;  1RPO A;  1VQ6 V;  1Q7Y W;  3EXA A;  4LR3 A;  2PF4 E;  1JR9 A;  4JF3 A;  4PEL A;  1OHH G;  1EBO A;  4X66 B;  5LP6 C;  5KHI A;  5B1N A;  3P3N A;  3RFR A;  1WB7 A;  4MW3 A;  1ZUQ A;  5B1B B;  2X6A A;  3BFR A;  5LL6 Y;  4X64 B;  1K73 W;  3SPJ A;  2W0X A;  1VIB A;  5LMN O;  4C7U A;  4GKJ O;  2LQT A;  4LNU A;  4U3J A;  1GKF A;  5FNV B;  1WA8 B;  1JFF A;  1H2M A;  3H1L H;  1OZ0 A;  3WG7 C;  3HR0 A;  3JYC A;  3SDL A;  4JI4 O;  1US6 A;  3G67 A;  1Q90 D;  4NTX A;  4FK5 C;  5EZY B;  2PYJ A;  4CS4 A;  1SQF A;  4E4E A;  4H0L B;  1FXK B;  2OIE A;  2FL4 A;  2XUM A;  4OGQ B;  2JGD B;  4RQF A;  3M7M X;  1FFX B;  2L35 A;  1VQ4 V;  2IH3 C;  4EB6 A;  1KYO F;  2DWE C;  4BIO A;  1S0V A;  3K5O A;  3CS5 A;  4B3T O;  3I55 V;  4PDR A;  4HZ3 A;  3D3I A;  4DV5 B;  4DR4 B;  1N0J A;  3CE2 A;  4QNH B;  4UV8 A;  1U96 A;  1I94 B;  2XND G;  3CPW U;  4JI5 B;  5B3S B;  2XAG A;  4JI6 O;  5H2F Z;  1M4U A;  4IIJ A;  5KHG A;  4DR5 O;  1VQL V;  1VQ5 V;  4UB8 Z;  5L3F A;  2E75 B;  1KBH A;  2ITC C;  5L3E A;  4KHP B;  3D36 C;  3LUT B;  5CMU A;  2DQ3 A;  1BL8 A;  3K04 A;  1R3J C;  4LBE C;  4HAM A;  4DR1 B;  2EIL C;  2MW2 B;  2IJI A;  4O4L B;  4J9Z B;  3WU2 Z;  3BRC A;  3MDS A;  3R65 A;  4DV2 B;  2DN9 A;  3HKB B;  4J80 A;  4QIW F;  3N2K A;  3NXS A;  2A9H A;  4PI0 A;  4JGS A;  4GT1 A;  1GN2 A;  5LP6 B;  1BE3 H;  5EYP A;  3K79 A;  1JJ2 U;  1K5Q A;  2JEU A;  3M99 B;  4DO2 A;  3OGI B;  3OT7 A;  4PJ0 Z;  3LSU A;  2Q4P A;  5B1A C;  4PDM A;  4YJ2 B;  4YIO A;  2Y4T A;  5IYB O;  2KSD A;  1FJG O;  4FM0 A;  4LF4 O;  1SER A;  4O4J B;  3I5D A;  4LF5 O;  2F4V O;  3WG7 B;  2ZM6 B;  1H2G A;  1SA0 B;  4UB6 Z;  2YIB D;  1VQM V;  4X89 A;  4PDL A;  2H8P C;  4PA7 A;  3ZMV A;  5KHK A;  3LSQ A;  4G27 B;  5LHH A;  1RM1 C;  2HLD G;  3DSQ A;  1TVK B;  1IX9 A;  3QNE A;  1I5Y A;  1LUW A;  4X1I B;  4DV0 B;  4P2Z A;  3OD4 A;  2UU9 B;  5IY5 B;  4I5S A;  1NBM G;  1TA8 A;  4MTG A;  2VWK A;  4DR2 B;  1H8E G;  1QVG U;  1GN6 A;  5LXT A;  3OTO O;  1BGY H;  4NXN B;  2VS0 A;  1PNK A;  2DQ0 A;  3Q4H B;  4DV6 B;  1M57 C;  3JAK B;  4DV7 O;  4DW0 A;  3E8B A;  2XTA A;  3K0D A;  1RP3 B;  1WN7 A;  2BOC C;  5KLV H;  2YIA A;  4JYA O;  4LF7 B;  2X6C A;  3F7Y C;  1W0J G;  4O2A B;  1OCR C;  3ABT A;  4I55 A;  1I0H A;  4X88 A;  1ZTE A;  1Y76 A;  4DUY O;  1VQK V;  1IBK O;  5KMG B;  3CXC U;  4FMT A;  1RFY A;  4ASU G;  1EZJ A;  4EKW A;  3BPZ A;  4FFK A;  3JAS B;  4FLX A;  2R70 A;  3STL C;  4X66 O;  1QCE A;  2Z0A A;  3SJB C;  4BAY A;  1AR1 B;  3BY6 A;  2UUB B;  2JGU A;  2EIL B;  2WWW A;  5H9C A;  4X64 O;  2GUZ A;  2C2A A;  1Q86 W;  4X20 B;  4X1K B;  2RDC A;  4FZ0 A;  5KHJ A;  4H33 A;  5HFM A;  3E8G A;  1GN3 A;  4PI2 A;  4ZHQ B;  4JI2 O;  1S77 D;  1S5H C;  3CHX A;  3VOU A;  1MNG A;  3JAL B;  1MZF A;  3IAY A;  1Q5O A;  5B1A B;  4LP8 A;  1W59 A;  4I0X B;  4CS3 A;  2ZD9 A;  4K3A A;  2EUL A;  5L3B A;  1YF2 A;  4BW5 A;  2Z3Y A;  5FNV A;  2YC0 A;  1WA8 A;  1WP8 A;  4K35 A;  4NYK A;  4RO2 A;  3D8C A;  5GTI Z;  2A79 B;  1HW7 A;  1Q6H A;  1BMF G;  2Q0A A;  5EC2 C;  5EC1 C;  5EZY A;  4DV5 O;  4UXN A;  4DR4 O;  1FXK A;  1XL4 A;  2WLH A;  1NU1 H;  4N21 A;  4P30 A;  4LF9 O;  1XL6 A;  2UXB B;  1I94 O;  1NH2 D;  1HNZ B;  2JGD A;  3IFX A;  2Y69 C;  1FFX A;  1XNQ B;  1IXB A;  1M5I A;  4CH3 A;  3IJ4 A;  2B5U A;  5BXZ A;  1WPB A;  1EN4 A;  1M57 B;  4YY3 O;  4KHP O;  2W6I G;  3X2Q C;  2CDY A;  1R3K C;  4DR1 O;  5CBH A;  1OCR B;  2Q68 A;  1PNM A;  2UXN A;  2FML A;  4DV2 O;  4LF8 B;  2CH7 B;  5EBW C;  1TUE B;  1GRJ A;  2Q67 A;  3MAQ A;  4FJC C;  1AI4 A;  3G6B A;  4LWS B;  4QPJ A;  4A5U B;  2EIK C;  2BCC H;  3ASN C;  3B4S A;  5LGU A;  1GM7 A;  1IBL B;  4ABM A;  1IZ3 A;  4O4L A;  2EIM B;  3AG2 C;  3S3W A;  3RYH B;  2HG5 C;  3HKE A;  3RYC B;  1QBZ A;  3HKB A;  2ZM6 O;  4F6R B;  1G6U A;  4KFM A;  5GW7 A;  3JD3 A;  1QLN A;  2CTW A;  2Q69 A;  2PY5 A;  2YUA A;  5LP6 A;  1RPR A;  3OUF A;  2WA3 A;  2ZE6 A;  4FLU A;  2A3Q A;  2BSK B;  4YJ2 A;  2UU9 O;  1AP6 A;  4UVB A;  2YID A;  1P84 F;  1AB3 A;  4DR2 O;  1MA1 A;  1JFF B;  4U7N A;  1R6T A;  1EN6 A;  3ZN1 A;  3OEE G;  4XDJ A;  3ABM B;  1SA0 A;  2JK5 C;  4NXN O;  1ZAU A;  4AQY B;  1CEZ A;  4DV6 O;  1GAX A;  3VQV A;  4JI1 O;  2HHH B;  4LF7 O;  1TVK A;  1S76 D;  4H13 B;  2HVJ C;  3JD0 A;  4YHH B;  5DED A;  2CGO A;  2QWR B;  3K08 A;  4AI8 A;  4X1I A;  4WBN B;  2QKA A;  3FD9 A;  4I9W A;  2MK3 A;  4DV4 O;  4E2L A;  3AK1 A;  2QKS A;  4MTF A;  3JSL A;  4EB6 B;  1AR4 A;  3E86 A;  5LGN A;  2ILM A;  1SQV H;  1SQQ H;  2IBZ H;  2CTR A;  4UVC A;  1B6Q A;  2UUB O;  5D5Q A;  4ZOL B;  3Q4H A;  4KUM A;  2YS8 A;  3JAK A;  3ZHR A;  4O4H B;  4U3F H;  2DMX A;  2PYL A;  3JAR B;  4NTW A;  3N2G B;  4O2A A;  3SYC A;  4OX9 B;  5KMG A;  2XAJ A;  4CC5 A;  3ZMU A;  2JS3 A;  5BR8 B;  2AHY A;  4RUE A;  3JAS A;  5BY1 A;  1VQP V;  3SYP A;  2YIC A;  3D36 A;  2P4K A;  4NB5 A;  4L87 A;  4FZ1 A;  1H2S B;  3KZI Z;  5IDJ A;  5KAF Z;  1YJ9 V;  3OR7 C;  4X20 A;  2CTP A;  2IJK A;  4X1K A;  5CBF A;  1KD1 W;  2ZIO A;  4MTX A;  2HJD A;  1VF6 A;  1YIJ V;  2QR4 A;  1DTO A;  1LUV A;  2ZNI A;  4ZHQ A;  3A8T A;  2P5O A;  4D7S A;  2PUS A;  1ORQ C;  2RQ6 A;  4DRX B;  3BAB A;  3P3P A;  2UXB O;  1YCI A;  3JCZ A;  2YEV B;  4B08 A;  1HNZ O;  4B3M B;  5JVD A;  1BHA A;  1XNQ O;  5JH7 B;  2UUA O;  2M7W A;  5J9P C;  1K34 A;  3J81 N;  1QR9 A;  5EK0 A;  3DC6 A;  1B06 A;  2P67 A;  2P06 A;  5BMV A;  4MS2 A;  3C3T A;  1HWY A;  1Y67 A;  4LCU C;  2E3C A;  1K8A W;  3AG1 C;  1QVF U;  1LR1 A;  1R6K A;  1YZB A;  5EIB D;  1BS3 A;  1Q43 A;  3CCJ V;  2ODM A;  4O2B B;  2H3O A;  4JI3 B;  4MVR A;  3ASO B;  2BTO A;  2CE4 A;  1A32 A;  4JI7 B;  2ZNJ A;  2WLK A;  2ZE5 A;  2ITD C;  2QA4 V;  4PA4 A;  1PD3 A;  2HKO A;  1OCO B;  3MD0 A;  4OXS A;  1IBL O;  1M93 A;  2JS5 A;  5H6Q A;  3W7T A;  3OFN G;  3ZHS A;  1WB8 A;  4LFB B;  4TQD A;  3T2M A;  4JI0 B;  2CH7 A;  3DXR B;  3QTC A;  3CRQ A;  5B66 Z;  3ML0 A;  4LWS A;  3ZJZ A;  1ZLZ A;  3ZMS A;  5JCO C;  4WFH A;  1NZ6 A;  1AP5 A;  5KUM A;  4TUY B;  1SET A;  3DC5 A;  3VBB A;  2YXL A;  1JQ0 A;  3L71 H;  1V54 B;  1BSM A;  1MG1 A;  3ZRW B;  5LHI A;  5KHH A;  3W7W A;  3J80 N;  3APQ A;  3RYH A;  3JAT B;  3RYC A;  1XEQ A;  4FLT A;  4GLX A;  4F6R A;  1XRE A;  1U97 A;  2Q7G A;  4QJF B;  2WPD G;  3A2F A;  1VP7 A;  2HHH O;  3O9O A;  4I7Z B;  2BSK A;  3E83 A;  5KAI Z;  1MOF A;  1URF A;  2AW9 A;  1AIL A;  1NJI W;  2YSU B;  3T1Y B;  1YJW V;  2WLJ A;  4WF9 V;  1N8R W;  3AG4 C;  4J7K A;  2YXH A;  5C93 A;  2D2C B;  3H9V A;  3OW2 U;  2Q7H A;  3RN4 A;  4OX9 O;  2Y48 A;  1FYJ A;  1XMO B;  4WBN A;  2FKX A;  4NR1 A;  5A9G A;  2VQF B;  4X65 B;  5BR8 O;  2F66 C;  1L1F A;  3ZMZ A;  3CCL V;  1X59 A;  3LDD A;  4ZOL A;  3K06 A;  2WLI B;  5BZB A;  5L3C A;  1ZX3 A;  1NS1 A;  3D3Q A;  4MVQ A;  2IH1 C;  5H6R A;  4O4H A;  2QTS A;  3OMA B;  1K33 A;  1K4D C;  3AG3 B;  2OCC C;  3RT3 C;  3JAR A;  4FLY A;  1N33 B;  3WB0 A;  3N2G A;  1I08 A;  2HR3 A;  4TOI A;  4DR3 B;  3QO7 A;  2IJJ A;  1J5E B;  1N4C A;  2WLN A;  3FB7 C;  3DTU B;  1RSO B;  2JDI G;  4B3M O;  2RN9 A;  3ETD A;  2Q6A A;  4AHC A;  4FLW A;  2E74 B;  4LFA B;  1YSC A;  4DXW A;  4AIL C;  1M9N A;  3IC9 A;  5A2Q N;  2VQE B;  1K5S A;  4PD4 F;  3CB2 A;  3HKE B;  3BCC H;  4GX5 A;  1IBM O;  1WPX A;  3A0R A;  1TGO A;  3U0Z A;  2DYR C;  2LW7 A;  3E89 A;  1KKC A;  2P22 C;  2O57 A;  1AI5 A;  4R6Z A;  3JCU Z;  4DRX A;  4JV5 B;  4I50 B;  5TIS Z;  2RMK B;  3CCV V;  4JI3 O;  2YEV A;  3JAM N;  2P7T C;  1N32 B;  3BAA A;  2ZQM A;  5JH7 A;  4FLV A;  3DGE A;  3S3X A;  2DWD C;  3AG4 B;  2Y4U A;  2LGQ A;  4IT5 A;  4B3R B;  5K1X A;  3JSN A;  3B40 A;  4WCE V;  2HVK C;  2QDO A;  3QO8 A;  3RBZ A;  3SPI A;  5LMU B;  4TSF G;  3C3S A;  4XDK A;  1AJQ A;  4RAI A;  2ZKO A;  2UUC B;  4O2B A;  4W4K A;  4JI0 O;  5LHG A;  3RVY A;  4LF6 B;  1KMI Z;  3HKD B;  1X4T A;  2A7W A;  2K1E A;  5IJ9 A;  2E5L B;  4MSW C;  3ZRS A;  3RYF A;  2V4D A;  1NR7 A;  1QHT A;  2CTQ A;  5IT9 N;  2QM8 A;  4D7T A;  2EJ7 A;  2QGN A;  1L8D A;  2QE7 G;  5IYD O;  2YXY A;  3U10 A;  1N36 O;  1YTF B;  3QG5 A;  3OR6 C;  4DR7 B;  1YVW A;  4O4I A;  5LOV B;  1MSW D;  3CRA A;  3L70 H;  2QWN B;  3ETE A;  2JEX A;  3DXR A;  1JOY A;  1OCC C;  1YIT V;  4UCU A;  4HNA B;  2R9R B;  3CRR A;  3CCR V;  4MVS A;  1SQB H;  3EVK A;  3RGB A;  5DN6 G;  3OMI B;  1AJP A;  1KQS U;  5J2U B;  4TUY A;  2Q0O C;  2QJ1 A;  2ZR3 A;  1W2B U;  2ETN A;  3ZRW A;  4B3S B;  1JVM A;  4I4T B;  2X7R B;  3JAT A;  4QE7 A;  3T1Y O;  3CX5 F;  4EFB A;  2DYR B;  3PJS K;  1S3J A;  4X62 B;  4TV8 B;  1H38 A;  2RNB A;  2B9Z A;  2Y0I A;  2DYS C;  2NNU A;  3CCQ V;  1K92 A;  4XBF A;  1SF9 A;  1ZWI C;  2LJ2 A;  2JIZ G;  5JVD B;  2RJZ A;  2CAZ C;  5FLX N;  1G1X B;  1Q3E A;  2DE0 X;  2VQF O;  1JA8 A;  2YI8 A;  4CH5 A;  4X65 O;  1E79 G;  5ITZ A;  1PPJ H;  5FPR A;  3K58 A;  5CA0 B;  5BMV B;  4R50 A;  3EFF K;  1ROP A;  4J42 A;  3M8A A;  1RM1 B;  1XIL A;  3TET A;  2QWO B;  3SPC A;  4TQF A;  4UCS A;  1N33 O;  4JI5 O;  1XOU A;  2E76 B;  4DR3 O;  1K9M W;  3NR7 A;  1J5E O;  3K03 A;  3SGI A;  1O9G A;  1OCZ C;  4BIU A;  2WLI A;  1HDJ A;  3APO A;  1SS3 A;  4JYC A;  5GON A;  4TV9 B;  4LFA O;  1H2L A;  1BCC H;  3CME V;  2VQE O;  3G4S V;  1WP7 A;  1K4C C;  2P6J A;  4K8X A;  3BHP A;  1PL4 A;  4GX0 A;  1SC5 B;  2ZT9 B;  4ICG A;  4PA3 A;  2Q5Z A;  4FFB A;  2EIJ C;  5JCO A;  1NR1 A;  1SRY A;  1I5X A;  2IM9 A;  1RSO A;  1YI2 V;  1Q81 W;  2QTO A;  2AGA A;  4JYB A;  2PI4 A;  2VWJ A;  1N32 O;  1NI8 A;  3B09 A;  4FVM A;  1D2D A;  4MVM A;  1IDS A;  1VAR A;  2ZE8 A;  4K8Z A;  4BW9 A;  5EBL C;  2DYS B;  5LMU O;  2GDS A;  5EBM C;  3ZN0 A;  3T4D A;  1HR0 B;  4NXM B;  5LBQ A;  2BOB C;  3JD1 A;  4I50 A;  4GX2 A;  2R9I A;  2UUC O;  4DV0 O;  4OPA A;  4LF6 O;  1XI1 A;  3FFQ A;  4GKK B;  2JJ1 G;  2E5L O;  1EFR G;  5F2V O;  1HP8 A;  4DYL A;  3B77 A;  3CXH F;  1JX9 A;  3ETQ A;  3UQ8 A;  4QPK A;  3O65 A;  5DEC A;  2F23 A;  2HEP A;  4EEQ A;  4FM1 A;  1BZK A;  2OWO A;  2NLJ C;  4DR7 O;  2EIN C;  2Y69 B;  5J2T B;  4L8J A;  5E79 Z;  2GBO A;  2YIB A;  3HKD A;  1Q6I A;  2ZCE A;  1KB9 F;  3OE7 G;  1VQ9 V;  2LW1 A;  1XUQ A;  3CRC A;  1OCZ B;  3B8M A;  4P9P A;  4RQE A;  3LDE A;  5FL7 G;  2X0L A;  2XT9 A;  3CEI A;  3X2Q B;  3H01 A;  5EIB C;  1N0N A;  1NTM H;  1V9P A;  2JVD A;  1Q6U A;  2LGW A;  1K7D A;  2GTS A;  1JJO A;  3RW0 A;  5KX5 B;  5LOV A;  4IYI A;  4YIP A;  3OAA G;  1PKX A;  4HNA A;  4X62 O;  4JI4 B;  2EIK B;  3ASN B;  2EIJ B;  1ENV A;  5JJJ B;  3CC4 V;  2CK3 G;  4R8C A;  1IVS A;  4YJ3 B;  4J10 A;  1Z5V A;  3L72 H;  5J2U A;  1LNQ A;  4Q20 A;  4UCO A;  1Y74 B;  3SYO A;  1NVP B;  3CP1 A;  4XDL A;  2UXX A;  3AG2 B;  1AI6 A;  4H37 A;  2DW4 A;  3CCE V;  4PHZ A;  4Z1M G;  4I4T A;  2ZIM A;  2V1D A;  1PNL A;  1OJH A;  3K57 A;  4JTD B;  4MTO A;  1DGS A;  1Q82 W;  4CH4 A;  4TV8 A;  1WAZ A;  2ZDI C;  2KKW A;  3U11 A;  3TK1 A;  4J9Y B;  2XAF A;  4R7C A;  3L73 H;  3ABK C;  4X1Y B;  1XMQ B;  1QQC A;  2GHY A;  4YXW G;  5CA0 A;  1P7B A;  5CA3 A;  4J7Z A;  1H2N A;  2F95 B;  3ZCC A;  2QSA A;  3SYA A;  1SQP H;  2LO1 A;  2AHZ A;  5B1B C;  1GM9 A;  3E8F A;  3A0B Z;  2W0F C;  1R3I C;  2M6Y A;  4LF8 O;  2Y0P A;  2JRI A;  2LP7 A;  3ABU A;  2B1G A;  3RVZ A;  5IJ9 B;  4CS2 A;  1KC8 W;  1BQ0 A;  3JD4 A;  3RYF B;  1KP3 A;  2ZR2 A;  3N27 A;  1FXK C;  3RYI B;  3SJQ C;  4MVU A;  1UPG A;  3PN1 A;  5L3D A;  4TV9 A;  3WB2 A;  2WLL A;  3KG2 A;  4O4I B;  1XHZ A;  4U7O A;  4JAV A;  2KB1 A;  1TAE A;  4G2K A;  4UCV A;  1VF5 B;  3CC2 V;  4Q6G A;  1T5E A;  4B7K A;  1GM8 A;  3BA8 A;  3TCU A;  1HR0 O;  2EZO A;  4NXM O;  1NTK H;  2UXC B;  2W6J G;  4NTY A;  5CN0 A;  1FS0 G;  3CCU V;  4FM2 A;  4GKK O;  2WLM A;  4NVP A;  4X8A A;  2PGG A;  3L75 H;  5B3S C;  3B8N A;  1NKD A;  4AQY O;  1DF4 A;  3FX7 A;  3K5N A;  1FFT B;  3B2E E;  3H1I H;  1ARO P;  3L74 H;  1FXH A;  4N23 A;  2V7Q G;  1MMM A;  4JYA B;  3BEH A;  4D6T H;  4YHH O;  3WFV A;  4DUY B;  4JAS A;  2EBO A;  3ZRX A;  5ITZ B;  2F1M A; 
#chains in the Genus database with same CATH homology
 5L3G A;  1OCR B;  2Q68 A;  2XAH A;  1PNM A;  2K1E A;  2UXN A;  3F7V C;  4GX1 A;  1J95 A;  4MSW C;  3GB7 C;  3W7U A;  5EBW C;  1TUE B;  3ZRS A;  2Q67 A;  3AG1 B;  1THZ A;  1V54 C;  1K97 A;  4FJC C;  3HB3 B;  3W7S A;  2GSM B;  3K0G A;  1NR7 A;  3FKS G;  1AI4 A;  3SPH A;  1E1Q G;  2QM8 A;  3OM3 B;  4QPJ A;  2EIK C;  3ASN C;  3SYQ A;  2WAM A;  1KKD A;  2EZP A;  1M56 C;  5LGU A;  2QE7 G;  2D3O W;  5IYD O;  1GM7 A;  4CBC A;  1F4M A;  1YTF B;  3OR6 C;  1MSW D;  4PA6 A;  4UVA A;  3ETE A;  2JEX A;  1JOY A;  2EIM B;  1OCC C;  3AG2 C;  1YIT V;  3ZMT A;  4MW8 A;  1V55 B;  2HG5 C;  2IJH A;  2R9R B;  2EIN B;  1QBZ A;  3OMN B;  3CCR V;  3CCS V;  4MVS A;  2QEX V;  4KFM A;  5GW7 A;  3JD3 A;  5DN6 G;  1QLN A;  2Q69 A;  4ZBM A;  3OMI B;  1AJP A;  1KQS U;  1GK9 A;  4UUJ C;  1RPR A;  3OUF A;  2ZR3 A;  1W2B U;  3T4Z A;  5IY5 C;  3ZRW A;  2ZXW B;  1JVM A;  3HPL C;  2XOK G;  1GTO A;  3ABL B;  2X7R B;  4ZKI A;  4QE7 A;  3GWO A;  3IGA C;  4UVB A;  2DYR B;  3PJS K;  1S3J A;  3E2E A;  3ZRV A;  4G28 B;  1VQ7 V;  1H38 A;  4U7N A;  2WSS G;  2DYS C;  3ZN1 A;  3OEE G;  4XDJ A;  3ABM B;  2JK5 C;  2NNU A;  3FB8 C;  3SPG A;  3CCQ V;  4LC1 A;  3FB5 C;  2X6B A;  1CEZ A;  1K92 A;  4XBF A;  3LDC A;  3K3W A;  2EJR A;  5DM6 V;  5IYC O;  1ZWI C;  1F51 A;  3UM7 A;  4PA9 A;  2JIZ G;  2OTJ V;  1GMG A;  1KEC A;  1S76 D;  2HVJ C;  3JD0 A;  2H94 A;  1E79 G;  5KUK A;  4WFE A;  2LFS A;  1Y66 A;  3K08 A;  3LSS A;  4JAU A;  3MHH C;  4I9W A;  4MVZ A;  2MK3 A;  4WFA V;  4R50 A;  4E2L A;  3AG3 C;  2QKS A;  3EFF K;  1QR8 A;  4MTF A;  1COW G;  1ROP A;  3E86 A;  3P30 A;  1AJN A;  1CP9 A;  5LGN A;  4CZZ A;  1PL0 A;  1RM1 B;  3TET A;  4UVC A;  1B6Q A;  2F43 G;  1F23 A;  2P90 A;  4PDV A;  3SPC A;  1F4N A;  2JJ2 G;  2HFE C;  1CPY A;  1P4R A;  3P32 A;  4KUM A;  1YJN V;  4KP4 A;  1S72 V;  1K9M W;  1KP2 A;  3SYC A;  3ABK B;  4HYO A;  1G4Y B;  2HJF C;  3K03 A;  3K9A A;  2XAJ A;  1OCZ C;  3JD2 A;  4RUF A;  3ZMU A;  2IU3 A;  2AHY A;  4RUE A;  1VQP V;  1M56 B;  2WLI A;  4BIU A;  3CCM V;  5B1O A;  1RPO A;  1VQ6 V;  4JYC A;  3SYP A;  3D36 A;  1Q7Y W;  4JF3 A;  4L87 A;  3CME V;  4PEL A;  1AI7 A;  1OHH G;  1EBO A;  1K3E A;  4JPR A;  5B1N A;  5IDJ A;  3G4S V;  1K4C C;  2P6J A;  1DF5 A;  1YJ9 V;  3OR7 C;  4MW3 A;  4GX0 A;  5B1B B;  2IJK A;  2X6A A;  5CBF A;  1K73 W;  3SPJ A;  1KD1 W;  4PA3 A;  4MTX A;  1YIJ V;  5E1A C;  1DTO A;  1VQN V;  1GKF A;  2OCC B;  2EIJ C;  1NQT A;  1NR1 A;  4JTA B;  1SRY A;  1I5X A;  1YI2 V;  1OZ0 A;  3WG7 C;  3JYC A;  1H8H G;  2QTO A;  5KA6 A;  1Q81 W;  4JYB A;  2PI4 A;  1ORQ C;  1M1K W;  4P9O A;  1YTF D;  4FK5 C;  3JCZ A;  1R73 A;  2YEV B;  2XAS A;  1FXK B;  4MVM A;  4WFB V;  1BHA A;  1G8M A;  2M7W A;  5EBL C;  1K34 A;  5J9P C;  1QR9 A;  4RQF A;  2DYS B;  5EK0 A;  1QLE C;  2P67 A;  3FYI B;  5EBM C;  3ZN0 A;  1VQ4 V;  2IH3 C;  4MS2 A;  3T4D A;  3T1C A;  5LBQ A;  2DWE C;  1HWY A;  3W7X A;  2BOB C;  3JD1 A;  1UJW B;  1S0V A;  4GX2 A;  2R9I A;  1GO3 F;  4LCU C;  3CMA V;  1K8A W;  3AG1 C;  3I55 V;  1QVF U;  4PDR A;  1R6K A;  4HZ3 A;  3D3I A;  2JJ1 G;  3E35 A;  1VQO V;  3CCJ V;  1EFR G;  4MVR A;  2ZDI A;  3CC7 V;  3ASO B;  2OT5 A;  4QNH B;  3B77 A;  4UV8 A;  4BIZ A;  1JX9 A;  2XND G;  3EHB B;  3F5W C;  3CPW U;  4QPK A;  2WLK A;  4MT8 A;  2ITD C;  5B3S B;  2XAG A;  2QA4 V;  3ETG A;  4PA4 A;  1PD3 A;  2HKO A;  1OCO B;  2EIM C;  3MD0 A;  4MVO A;  4OXS A;  1VQL V;  1VQ5 V;  2NLJ C;  5L3F A;  2EIN C;  2Y69 B;  1DLB A;  2ITC C;  5H6Q A;  3OFN G;  5L3E A;  3W7T A;  5CMU A;  3LUT B;  2DQ3 A;  1BL8 A;  1Y4M A;  3ZIA G;  3K04 A;  1R3J C;  4LBE C;  3OE7 G;  4WFF A;  5CBG A;  1VQ9 V;  4HAM A;  3T2M A;  2EIL C;  2IJI A;  1OCZ B;  3B8M A;  4P9P A;  4J9Z B;  4RQE A;  3LDE A;  5FL7 G;  1SES A;  2X0L A;  3R65 A;  2ATK C;  1IXM A;  3ML0 A;  4QIW F;  3H01 A;  3X2Q B;  3NXS A;  2A9H A;  4JGS A;  3ZJZ A;  4GT1 A;  1K7D A;  3ZMS A;  4WFH A;  5KUM A;  1SET A;  3VBB A;  3RW0 A;  3K79 A;  1JQ0 A;  1JJ2 U;  1K5Q A;  1V54 B;  3ABM C;  1MG1 A;  1JPX A;  3ZRW B;  2JEU A;  5LHI A;  3M99 B;  4DO2 A;  3W7W A;  3OAA G;  1PKX A;  1BHB A;  5B1A C;  2EIK B;  4PDM A;  3ASN B;  3CD6 V;  1NH2 B;  5IYB O;  2EIJ B;  1ENV A;  4QE9 A;  3CC4 V;  2CK3 G;  4R8C A;  1SER A;  1VQ8 V;  4QJF B;  2WPD G;  3WG7 B;  2WLL B;  1LNQ A;  4Q20 A;  1H2G A;  1VQM V;  4X89 A;  2A0L A;  4PDL A;  3SYO A;  3CP1 A;  4XDL A;  2UXX A;  3AG2 B;  1OCC B;  1NVP B;  1M90 W;  1AI6 A;  4H37 A;  2DW4 A;  2H8P C;  3CCE V;  4PA7 A;  4Z1M G;  3STZ C;  3ZMV A;  2QM7 A;  3UKM A;  3LSQ A;  2V1D A;  1PNL A;  2XAQ A;  3E83 A;  4G27 B;  5KA5 A;  5LHH A;  2HLD G;  1RM1 C;  3MHS C;  1MOF A;  4JTD B;  4MTO A;  1QLE B;  1Q82 W;  2LFR A;  3QNE A;  1I5Y A;  1NJI W;  2ZDI C;  2YSU B;  4P2Z A;  1YJW V;  5IY5 B;  3TK1 A;  4I5S A;  1NBM G;  2WLJ A;  4MTG A;  5HFL A;  4WF9 V;  1N8R W;  3AG4 C;  1H8E G;  1QVG U;  4J9Y B;  2XAF A;  4R7C A;  5LGT A;  5C93 A;  3ABK C;  4FIP C;  3FB6 C;  4F4L A;  1PNK A;  2DQ0 A;  1M57 C;  1YHQ V;  3OW2 U;  3E8B A;  2PI5 A;  2GHY A;  2Y48 A;  3K0D A;  4YXW G;  2BOC C;  4TT3 G;  2X6C A;  3F7Y C;  2OTL V;  1W0J G;  1P7B A;  3ABT A;  1OCR C;  5CA3 A;  4X88 A;  1VQK V;  1L1F A;  3CXC U;  4FMT A;  4ASU G;  1W0K G;  3E8H A;  3ZCC A;  3ZMZ A;  3CCL V;  1EZJ A;  3SYA A;  4EKW A;  3G6E V;  2AHZ A;  3LDD A;  5B1B C;  3OUS A;  1JCH A;  3K06 A;  2WLI B;  5BZB A;  5L3C A;  1GM9 A;  3E8F A;  1QCE A;  3STL C;  2Z5U A;  4MVQ A;  2IH1 C;  1R3I C;  2W0F C;  5H6R A;  4BAY A;  1AR1 B;  3BY6 A;  2LP7 A;  3OMA B;  4FPP A;  1K33 A;  1K4D C;  2B1G A;  3AG3 B;  2OCC C;  3ABU A;  3RVZ A;  2EIL B;  2WWW A;  3QO5 A;  2HR3 A;  5H9C A;  1E1R G;  1KC8 W;  3I56 V;  1R6N A;  3JD4 A;  2C2A A;  1Q86 W;  3AEI A;  4WFG A;  1KP3 A;  3QO7 A;  2IJJ A;  2B1I A;  2ZR2 A;  1FXK C;  1V55 C;  2WLN A;  3SJQ C;  4H33 A;  5HFM A;  4MVU A;  3E8G A;  4JTC B;  5L3D A;  3FB7 C;  2WLL A;  1S77 D;  3DTU B;  3IC7 A;  2JDI G;  1S5H C;  3KG2 A;  3VOU A;  3ETD A;  2Q6A A;  4U7O A;  4JAV A;  1YSC A;  4DXW A;  2KB1 A;  1M9N A;  5B1A B;  4LP8 A;  3LNM B;  1K5S A;  4TWK A;  3OEH G;  2ZXW C;  4G2K A;  2ZD9 A;  3CC2 V;  4UV9 A;  2FTK A;  5L3B A;  1GM8 A;  3ABL C;  4GX5 A;  1R3L C;  3TCU A;  3G71 V;  4BW5 A;  1WPX A;  2EZO A;  2Z3Y A;  3A0R A;  2W6J G;  3FYE B;  2IU0 A;  2DYR C;  3ASO C;  3E89 A;  4GCZ A;  1FS0 G;  4RO2 A;  5CN0 A;  3CYO A;  1AI5 A;  2A79 B;  3CCU V;  4R6Z A;  1BMF G;  5EC2 C;  2WLM A;  5EC1 C;  4X8A A;  4UXN A;  3CCV V;  2YEV A;  2P7T C;  1FXK A;  1XL4 A;  5B3S C;  2WLH A;  3B8N A;  4N21 A;  4P30 A;  2ZQM A;  1XL6 A;  1FXV A;  1OCO C;  1NH2 D;  3DGE A;  1NKD A;  1DF4 A;  1MAB G;  3IFX A;  1FFT B;  2Y69 C;  2DWD C;  3AG4 B;  1ARO P;  1FXH A;  4N23 A;  2V7Q G;  1NVP D;  4WCE V;  2HVK C;  3BEH A;  3QO8 A;  3RBZ A;  2B5U A;  3SPI A;  1WLE A;  4TSF G;  3WFV A;  1M57 B;  3OGC C;  4XDK A;  1AJQ A;  2W6I G;  4RAI A;  4JAS A;  2EBO A;  3X2Q C;  3ZRX A;  1R3K C;  2IW5 A;  5LHG A;  5CBH A;  1SZT A;  3RVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...