1K33A

Crystal structure analysis of the gp41 core mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
66
structure length
62
Chain Sequence
b'SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQGRGGWMEWDREANNYTSLIHSLIEESQNQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein GP41
publication title Interhelical interactions in the gp41 core: implications for activation of HIV-1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 27
structure length 62
sequence length 66
ec nomenclature
pdb deposition date 2001-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k33A00
1QR8A 3CYOA 1JPXA 2MK3A 3GWOA 2EBOA 5CN0A 1QR9A 4G2KA 3B77A 3CP1A 1QBZA 2P6JA 1F23A 3B8NA 4FIPC 1K33A 4E2LA 4N21A 1MOFA 4FK5C 5H9CA 4N23A 2EZOA 5KA5A 1DLBA 1Y4MA 3P30A 1Y66A 5HFMA 3B8MA 2X7RB 5CMUA 1ENVA 1MG1A 2OT5A 3WFVA 1DF4A 1I5XA 3MHSC 1EBOA 5HFLA 1K34A 3H01A 1QCEA 4JGSA 3K9AA 1I5YA 3MHHC 4JF3A 1SZTA 2LP7A 5KA6A 1DF5A 1JQ0A 2EZPA 2M7WA 3M99B 4FJCC 4JPRA
chains in the Genus database with same CATH superfamily
1S72V 2WLHA 4TQDA 1FFTB 3GB7C 1JR9A 4MW8A 1ZL8A 4LBEC 2ZXWC 3K5NA 4FLWA 4DV7O 4K35A 1RM1B 4DRXB 1S5JA 3EXAA 4AILC 3K0DA 1PNMA 3L9DA 4FFBB 2FYUH 1AVMA 1VEWA 2RJZA 2IBZH 2HVKC 2L35A 5TISZ 2EILC 2HG5C 1YITV 1SF9A 2YIBA 1NH2D 2EINC 3BAAA 3L70H 3UQ8A 2M6YA 5BY1A 5DN6G 4CS3A 1I0HA 4I0XB 1XMOB 3AG4B 2B1GA 1EZVH 4CS4A 2VWJA 4X20A 3DC5A 4DUZO 4DV6O 3SR2C 4EEQA 1YJNV 4EFEA 3ASOB 2CAZC 5IYZB 1AI6A 2WWWA 2WPDG 1O9GA 3ZHSA 3OUSA 3VQXA 1YTFD 4QGPA 1SKVA 4L87A 2UUCO 4DUZB 1Y66A 3VBBA 3CCRV 5L3EA 4LWSA 4J11A 2N04A 3BA9A 3A0HZ 3CMAV 4DR5B 3UO2A 1G4YB 1VF5B 4LF7B 4OXSA 4MVSA 4JYCA 4B7KA 3TK1A 2UXCO 1K92A 5FNVA 3ZHTA 1KC8W 4X65O 3OMNB 1XMQB 1IXBA 1XL4A 1SQQH 3ZRXA 1Q3EA 5H6QA 3H1HH 2RCVA 2YI8A 4KL1A 4NTYA 5IJ9B 2XAJA 4JZGA 3BY6A 3IGAC 1BQ0A 3UT5A 2PGGA 2LP7A 3M99B 2UXCB 4LFCB 1R3IC 2LFSA 2EBOA 3N27A 1QR9A 4TOIA 1TUBB 2JJ1G 5EZYA 1F23A 4FM2A 4TV9A 5J2TA 2OCCB 3UM7A 4X62O 4P30A 3K9AA 1YEWA 1KU9A 1LR1A 3E86A 1SZTA 3SJAC 3QO7A 2B1IA 4JF3A 1M56C 1WB7A 2DQ0A 2MK3A 3DXRB 3WG7B 4NXNO 3K9SA 3LSUA 3K79A 2DN9A 1K7DA 2EIKB 4YIOA 3RVYA 3W7TA 3JATA 4Z1MG 1L0NH 2XHBA 3E89A 1FXKA 2LJ2A 1E1QG 4TQFA 3ZX6A 3K5MA 2Q67A 3JD0A 4KHPO 4JI6B 2CH7A 4I4TA 1N4CA 2E5LB 4G27B 4MVRA 1M90W 1K33A 3NR7A 5LYJA 4AHCA 1FJGO 4JTDB 3CCVV 1EM1A 1SQVH 3APOA 4X1IB 4JI5O 1OZ0A 3CXCU 1MSWD 3IFXA 3B40A 4RWUA 2ZD9A 4RUEA 4DV3B 3DGEA 3ICXA 3EHBB 2XNDG 2WLMA 1N32B 2QE7G 3I56V 1RSOA 2W0XA 2YIDA 2AZ0A 3B77A 4CS2A 1BQZA 3FB8C 3G6BA 4CH5A 2GHYA 4GZRB 5LHIA 4TUYA 1VQ8V 1J5EB 5CA3A 3C3TA 5JQGA 3A8TA 4DUYO 3ABLC 5BXZA 5CBFA 1UFIA 2P4VA 3T1HB 3C3SA 2QKAA 4H13B 2Q7GA 3SYPA 3CJHB 5B1AC 3AG1B 3QO8A 3LNMB 2HEPA 4LR3A 4JV5B 4RQEA 3LDEA 1PP9H 2QJ1A 4QNHB 2N74A 4ZI7B 2ZM6O 4WFBV 4GX5A 4HBNA 3GWOA 5EIBC 1F4MA 1K3EA 1AB3A 2UXDO 2PTMA 3PJSK 3STZC 2O57A 1Y67A 4UCRA 1CEZA 3TXSA 4TSFG 2CTQA 4U7NA 2YS8A 3JALB 4K8XA 5BMVA 4EFBA 2PI4A 1N36O 4XBFA 1RM1C 2JRIA 4JAUA 5H6RA 2X6AA 1JQ0A 3JCZA 2QWQB 4PV1B 2ZE5A 4I7ZB 3RYCA 1FFXB 2IJHA 4X9QA 3U11A 3SYOA 5LP6A 1FXKC 1GRJA 3WB2A 4DV5B 2P06A 2F4VO 3ZHVA 4EB6B 1Q6UA 4LFAO 3CCQV 2AGAA 1KD1W 5EC1C 4PA6A 1HNZO 2Q6AA 4QIWF 4CC5A 2WLLB 3ZMTA 5E1AC 4D7SA 4WFHA 1R3LC 5KMGB 4DO2A 2WAMA 4P9OA 4ABMA 4FZ1A 1P49A 1R3JC 4UCUA 2RDCA 1Y74A 1XNRB 3ASOC 4E4EA 1K5SA 2NN4A 2QWOB 4BAYA 3KCYA 2DMXA 5LMNO 1JX9A 2JS5A 1M1KW 1HNZB 2WLKA 3QO5A 5KX5B 1XI1A 1JPXA 1SQPH 1M57C 4D6TH 5EYPA 3CRRA 5D5QA 5CA1A 4U3JA 1F51A 5IJ0B 1LNQA 1GM7A 1TAEA 1VQ6V 5A9GA 2ZDIC 1ZLZA 1ROPA 3TXQA 4JGSA 4JI1O 5JH7A 4FM1A 2QM7A 1MNGA 5E79Z 4G28B 1L0LH 3FYIB 4DR1O 2Q7HA 1FPOA 1YJ9V 1TA8A 2PUSA 5LA6B 3CMEV 1YIJV 4JI8O 3E22A 4R7CA 3N2KA 5FLXN 2GSMB 1VQ5V 3IJ4A 3H9VA 3OMIB 3VQYA 4B3MO 1H2LA 1P7GA 1L8DA 5KA6A 2Q73A 1S5LZ 3T1YO 1K97A 1BS3A 3SJCC 3RYIA 2VQFB 4I55A 4HAMA 2UUAO 3HKBB 3J81N 4NYKA 5FL7G 3WG7C 3CC4V 4B3MB 1Q82W 1UPGA 2PY5A 1XNQB 1S5HC 2A9HA 4OPHA 3U10A 3JASA 1AP6A 2R72A 2JEXA 4U7OA 4WFAV 2XAGA 2FL4A 4UV8A 5ITZB 5LP6C 2Y69C 1OCCB 4YJ3B 5JCOC 3ABKB 3FAVA 4K0KO 4TWKA 2BE3A 2EX3A 3L72H 3P3NA 2ADPA 4DR3B 4L8JA 1B04A 1P84F 2QDOA 2JJ2G 2GBOA 4B3RO 1JOYA 1TVKB 2KKWA 4GKKO 4UV9A 2ODMA 1WAZA 4J7KA 1P4RA 5KHGA 3CX5F 2DE0X 1DK1A 3IAYA 2NR5A 2MW2B 4B3RB 3Q4HA 1XREA 3E8GA 1VF6C 1W0KG 1Y6XA 4LF5O 2OTJV 4LF9O 3F7YC 5IE9A 4KP4A 1QVGU 2GDSA 2EZPA 1HNXO 3ZRWB 3EVKA 5J2UB 1SZXA 2DYRB 1BGYH 2Q8VA 1ZL8B 1HNWO 3ZHQA 4LP8A 4JI0O 2EIMB 5EK0A 5K1XA 5CB4A 4J42A 1MMMA 3FX7A 2Q9LA 3AG2C 3HKEA 1HR0O 4DR6B 1AI4A 3JAWA 1QLEB 4X66O 4GX0A 5JJNB 1VF7A 4DR4B 1GO3F 1QLNA 3QTCA 1SC5B 1WN7A 5CA0B 1EZJA 1D5AA 2UUBO 2UU9B 2NNUA 1FKAO 3BABA 3UCSC 2Y4UA 1WP7A 2QR4A 4J7ZA 4B3TB 4LC1A 1HP8A 1S0VA 4ZBMA 4WFGA 4DR7O 2HHHO 3ZMVA 3ASNB 2DJVA 1IZ3A 1ZX3A 2YUAA 2UUBB 3H1KH 4JI2B 4GKJB 4ZHQB 3RYHA 4KXRA 2OIEA 3LUTB 4LWSB 4DR7B 4LF4O 1Y76B 2P4KA 4PA9A 2HHHB 5D5PA 2R9RB 1VQ7V 5C8YB 3K06A 5JJEB 1N0JA 3F5TA 1AJQA 5FNVB 4WBNA 3SGIA 1R6NA 2Z5UA 3MHSC 1KECA 4PDRA 2EJRA 2LW7A 2X6BA 3OTFA 2YDEA 4UCOA 1I5YA 1M5IA 4J10A 1GKFA 2PF4E 4YIPA 4WF9V 4R8CA 3CRQA 1E79G 3SJBC 1KKCA 2P67A 5KLVH 4LF6B 3RYFA 1JFFA 4N21A 5EZYB 1H2GA 4O4HB 2EZOA 4UXNA 3SPJA 4TV9B 1S77D 1OCRC 3CCSV 4DV4B 3RFRA 2P5OA 5L3GA 2HVJC 5KAIZ 4H0LB 4QE7A 3K03A 4P9PA 4DV7B 1IBKO 2Q7EA 3J80N 1WA8A 4MVUA 3A0BZ 2FKXA 3CCEV 4EKWA 2F93B 3JAKA 5KA5A 4GYCB 3QVNA 5CMUA 3G67A 4YHHO 2R9AA 5GTHZ 1MZEA 1KYOF 4BIOA 4XDLA 1VQOV 1W59A 1NTMH 4DR2O 1SETA 4DK1A 1BZKA 4PDMA 4JAAA 4PD4F 2QEXV 1JMKC 1RPOA 4J80A 4I4TB 2YIBD 4XDJA 4MVQA 4GX2A 2ZKOA 5IT9N 2BSKA 4ZOLA 3CS5A 5JVDB 5LYJB 1SS3A 1KP3A 2QM8A 4DV6B 4X1KA 4MW3A 3CCUV 2Q4PA 3H01A 2JK5C 1YI2V 1BHBA 1AJPA 3ZMSA 5IDJA 5DECA 3IC9A 4FLXA 4JYAO 3FFQA 2UUCB 1PL4A 2DYSC 3RWRD 1W0JG 3ABKC 1SRYA 5B1BC 4F4LA 3TETA 1Q7YW 3D36C 2IU0A 4Q6GA 5JQGB 2LO1A 2XUMA 2HJFC 3ZHUA 1NJIW 5B1NA 4JYAB 1JJ2U 1JA8A 4X65B 3EFFK 2CTWA 4CH4A 2ILMA 2QA4V 4PA7A 1RPRA 1DLBA 1NQTA 5B5EZ 3MAQA 5LXTA 3CRMA 2KG7B 1G1XB 3M7MX 1GAXA 3JARA 5B1OA 4DRXA 5J9PC 4UVBA 1D5NA 4GLXA 1IURA 4FK5C 4FFBA 2DOSA 4X62B 3U0ZA 2JGDB 1BT8A 1U96A 1Z5VA 4IIJA 4K3AA 3ZRVA 4J9ZB 1PPJH 4NXNB 2G38A 2ZNIA 5B3SC 4I0XA 3H1JH 1D2DA 1WJZA 2GTSA 3K08A 4U3FH 2LGWA 4XDKA 4YY3O 4PHZA 4P2ZA 1OHHG 4MTXA 1YCIA 2D2CB 5KHHA 1TGOA 5IYZA 3CXHF 3B09A 3ZCCA 4TV8B 4CBCA 1V54B 5LOVB 5B66Z 2PYLA 2ZINA 4KHPB 3LSSA 2OCHA 1Q86W 2GV9A 5JWPA 5IY5B 2FB5A 2WA3A 2NLJC 1FJGB 4YY3B 1Y74B 3BRCA 3RVZA 1URFA 2PI5A 1PM9A 1SERA 3HKDA 4JI5B 1EN6A 4OPAA 5BR8O 2E74B 4JPRA 2ZDIA 2WLIA 3E8FA 1GN3A 2HJDA 1GM8A 2HKOA 4YJ2B 1VARA 3BEHA 1GN2A 2A3QA 1OCZC 2R9IA 4DUYB 3ZJZA 4U3JB 1FAFA 5C93A 1QCEA 1FS0G 1I7FA 2XOKG 2CGNA 4ICGA 5JH7B 5EBMC 1GN6A 3HKCA 5HFMA 2UXBO 4B3SO 1J95A 3N2KB 2X7RB 3CEIA 4JZ2A 5LL6Y 1ORQC 3JAMN 4BWAA 4IHJA 4DV1O 2GUZB 4FLYA 3DXRA 3MHHC 4PELA 1PKXA 3CWBH 2ZM6B 5L3DA 2QKSA 5KUKA 2JDIG 2CK3G 2IJIA 4H44B 3APQA 2UXDB 3FB5C 4UCVA 3RYIB 4NKGB 2Y0PA 4A5UB 2XASA 2B5UA 2Q0AA 3L73H 5JCOA 3OUFA 1YJWV 3WFVA 1G6UA 3BPZA 4LNUB 1N36B 1CP9A 2JGUA 1I08A 2V1DA 1BSMA 2K9PA 3LDCA 3AG4C 1GH6A 3CYOA 4MSWC 1ZUQA 1MABG 3NXSA 4AQYO 4YXWG 4IGGA 5CBGA 4NXMO 3FAVB 4X1IA 1IBMO 2F4VB 1KKDA 4LFAB 4MS2A 4OX9O 4O4IA 1BL8A 4JAVA 4JASA 3FB7C 2QTSA 1AI7A 3SYQA 2ZR3A 4BIZA 1VF6A 5H5NA 4DW0A 1QQCA 4JI7O 2ADQB 2C2AA 5IWAO 1R6TA 2CTPA 5LMNB 2H94A 1OJHA 2ZXWB 3P32A 3AK2A 4DXWA 3VQWA 1LUVA 2VQEO 1AR4A 3I55V 1QR8A 3CJHA 1M93A 1SA0B 4BIUA 2OWOA 1L1FA 3X2QB 3CE2A 3B8NA 3MD0A 3C90A 2YEVB 1FD9A 2QSAA 3WB1A 2EILB 3OEHG 3CCLV 2EINB 1X59A 3OGCC 4JI1B 4ZI7A 5CB4B 5IYDO 2VQEB 3E35A 5KHJA 2OCCC 3SPGA 3HKEB 4WFEA 1NKDA 4DR1B 2WLNA 2B9ZA 4FZ0A 5LGUA 1AP5A 4WCEV 3JAWB 4JI8B 1XILA 4BW5A 3FB6C 2ZIOA 3JALA 3CC7V 1NTKH 1SESA 4JI4O 4O2BB 1US6A 3K0GA 3F5WC 2EIKC 2UXNA 3PN1A 3T1YB 1P7BA 1FFXA 1SQFA 1IBLO 2ZT9B 1GM9A 2UUAB 1MA1A 5EBLC 4FLTA 1N33O 1AI5A 4UB6Z 1SQXH 4RO2A 4X89A 4JI4B 1QU7A 5KAFZ 2EIJB 4O2AA 5LGTA 1XBLA 4QPJA 4LFBO 4BR6A 5KMGA 1IBLB 3B4SA 3UO3A 3CCMV 5GONB 2JS3A 4K0KB 4G2KA 4I5SA 3GVMA 3OFNG 1GTOA 4O4JA 4CH3A 1COWG 4WBNB 1NI8A 2F43G 4NTWA 1IDSA 2JIZG 1ZWIC 4LFBB 1MG1A 2IH3C 4GKKB 1JCHA 2IJJA 2V4DA 3WB0A 3RT3C 3S3XA 1U97A 5KHIA 3VQVA 3GWKC 4GT1A 4F6RB 3CRCA 2W6JG 1YXBA 4FLVA 5IJ0A 4X64O 1K8AW 4J9YB 4X1YA 3FD9A 1M56B 4GX1A 3RYFB 1JFFB 1QHTA 4LF5B 4LF9B 1AR1B 4C7UA 1HNXB 3AG1C 4HNAA 1T5EA 1Z5WA 3OE7G 4R6ZA 4X88A 2H3OA 4PA3A 1PNLA 3QF7A 4X64B 4JTCB 3JD2A 3SPCA 1OCOB 1HNWB 1I94O 1GK9A 2ZIMA 1WA8B 4JI0B 3ML0A 2Z3YA 4DV2O 1V9PA 4X20B 5LMUO 1HR0B 1NS1A 1F4NA 3AK1A 2ZQMA 4BW9A 2L6LA 3OM3B 4PDVA 3HKBA 4X66B 4B08A 1Q8IA 1XQ8A 3W7SA 4MTGA 2P6JA 4GCZA 4I9QA 1VQNV 1MOFA 3BCCH 4QE9A 3KKYA 3E8BA 5F2VO 2ITCC 4KFMA 3CSXA 1R3KC 5DEDA 1F7YA 1Q81W 4ZOLB 2Q68A 4JI3O 4LH6A 3G4SV 3RBZA 4X1KB 2FTKA 2N05A 2Z0AA 3QG5A 4YJ3A 4FJCC 3D36A 3OMAB 3N2GA 4W4LA 3ABLB 3RGBA 1XEQA 3OR6C 1H2KA 3LSQA 1DGSA 2OYQA 1NR7A 2Q5ZA 3KCXA 4W4KA 1YSCA 4JI3B 3IC7A 3W7XA 1I5XA 3G71V 2WA4A 4LF4B 2P22C 5KHKA 3ZBHA 1EN5A 1R73A 3CHXA 2E75B 3OD4A 5B1AB 4UCSA 3UT5B 3E83A 3AK3A 1EFRG 4UUJC 4MT8A 3D8CA 3TGUH 2LGQA 5EC2C 4O4LA 5J2TB 4R50A 3JD1A 1K34A 1MSDA 2YIAA 2H8PC 1H38A 1B6QA 2JEUA 3ETQA 5LXTB 2QM4A 3LDDA 5CN0A 1ZSPA 3DC6A 3SPHA 3T1CA 3JARB 3S3WA 1Q6HA 4H37A 1XMOO 1YZBA 2PZSA 4DV0O 1PV0A 3X2QC 4I50A 4IYHA 1QNMA 3JD3A 2Y0IA 2F66C 4QJFB 3JATB 4D7TA 2YXHA 1UJWB 1GMGA 1FXKB 2BTQA 1N34O 4UB8Z 3AEIA 1IBKB 4IIJB 2X0LA 1H8EG 5CA0A 4FM0A 2R70A 2XT9A 2CH7B 4FMTA 4DV0B 5DM6V 3B8MA 4YHHB 1ENVA 1DF4A 2XTAA 1E1RG 1N0NA 1N34B 3MDSA 4DR5O 4DR2B 3R65A 4CZZA 4LF7O 1YF2A 3ZHRA 1K5QA 5L3FA 4ZHQA 4FLUA 3JSLA 1RSOB 1HW7A 3CC2V 1XMQO 2F1MA 1CXZB 1M9NA 2KQXA 1VQ4V 1OCCC 1Y76A 2OT5A 3T2MA 4TUYB 1M57B 1B3QA 5C8YA 3HKDB 3K57A 4LFCO 2EIJC 1M4UA 3ETGA 2WLIB 2Y4TA 2AHZA 2CGOA 1KQSU 3K5LA 2ZR2A 2K1EA 2HLDG 3ABMB 2W6IG 4UVCA 2VRZA 3SDLA 3ABUA 2DWEC 2ZCEA 1VQPV 3E2EA 5K1PA 1NTZH 2YI9A 1RFYA 1DTOA 1K4DC 1R1BA 1XL6A 3OW2U 2ITDC 4MTOA 4O4HA 4PA4A 1BHAA 2XAHA 3AG3B 4B7EA 2DYRC 2P7TC 3VOUA 3HKCB 2E76B 2BOBC 5EIBD 3L71H 4IHJB 1PL0A 5BMVB 2EIMC 2DWDC 4DW1A 3A2FA 5LGNA 1HWYA 3O9OA 1Z2GA 4PI0A 4FLZA 4JI6O 5FPOA 4ASUG 3RYCB 2E5LO 1V55B 4I9WA 3T4ZA 1BE3H 1THZA 2IU3A 5LP6B 1QLEC 2Y69B 1OCOC 1ZAUA 3B2EE 1SQBH 5IYCO 1WB8A 5LBQA 3L75H 4DYLA 2IH1C 4JYBA 4IL6Z 4DV3O 1N32O 3J7AU 4UFZA 3L74H 3AG7A 5JVDA 3QNEA 1RP3B 2F95B 3JSNA 1VQLV 1R6KA 1J5EO 3ASNC 1VQ9V 1QVFU 4JYYA 2A79B 1IXMA 3JCUZ 3T1HO 4O4IB 2ZE6A 3STLC 3CPWU 2ZNJA 3K58A 2IM9A 1IVSA 4MTFA 2CTRA 4J41A 5EYPB 5IJ9A 1Q6IA 5CA1B 4AI8A 3H1IH 4JV5O 1FYJA 5BR8B 2ARHA 2CE4A 3O65A 3OEEG 3ZMUA 1AILA 5JJJB 2Q69A 1TUBA 4FPPA 3W7WA 2XAQA 2E3CA 1QBZA 3P3PA 1K73W 2F23A 3AG2B 2BTOA 3RW0A 1YVWA 2LFRA 3E22B 2KG7A 4CC6A 5A2QN 2IJKA 3KG2A 2Q0OC 5H2FZ 3I5DA 3F7VC 4ZKIA 2YC0A 4I55B 2YXYA 2JGDA 4KUMA 2UXBB 4B3SB 4DV5O 2P90A 4DV1B 1NT2B 2YICA 2KB1A 1PNKA 3JASB 2X6CA 5L3BA 1Q90D 1Q5OA 4FIPC 1XNRO 4K8ZA 1JVMA 1NU1H 1XHZA 5IYBO 2FMLA 1G8MA 3ZRSA 4TV8A 5LOVA 1LUWA 4UCTA 1JJOA 3SYCA 4O2AB 1NVPB 1DF5A 4HYOA 4TT3G 3W7UA 4AQYB 2BOCC 3HPLC 1VP7A 1K4CC 4NXMB 2YSUB 3KZIZ 2AZ2A 1IBMB 2HFEC 4X8AA 3ZS8C 1H2NA 5BZBA 5GTIZ 1H2MA 4O4JB 3R66A 4OX9B 1AJNA 5EBWC 1KBHA 1AROP 3Q4HB 3E8HA 1KUQA 3HB3B 2DQ3A 1S3JA 3ETEA 3HR0A 4H33A 2DW4A 4HZ3A 1GN4A 1XUQA 1ZTEA 3ABTA 4YJ2A 4RQFA 3CP1A 4JI7B 3SPIA 1OCRB 1BMFG 1WPXA 2VS0A 2LQTA 5LHGA 5IWAB 1Q43A 3SYAA 1MZFA 4PI2A 2AW9A 4X1YB 4PDLA 3TJTA 3D3IA 3TCUA 1YHQV 3ZIAG 4LCUC 2BCCH 5KUMA 1TUEB 3ABMC 4HNAB 2XAFA 2VQFO 4PJ0Z 3CRAA 3FYEB 4RUFA 2GUZA 3CB2A 3K59A 1K9MW 3UKMA 1O9HA 3JYCA 1XNQO 1FXHA 4IYIA 3CCJV 1NR1A 2RMKB 3AG3C 1KP2A 3WU2Z 4OGQB 1AR5A 3K3WA 3BFRA 3DTUB 3OT7A 1B06A 3THOA 4J7JA 3RN4A 3CD6V 3M8AA 2RN9A 2OTLV 1A32A 4EB6A 4DR3O 4LNUA 4QPKA 3P30A 3OR7C 3ZMZA 2ZE7A 3RYHB 1V55C 2WLLA 2WSSG 1H8HG 1XHXA 3ZEDA 2DYSB 2RNBA 3H1LH 5B1BB 4ZIBA 2GTAA 4MVMA 1VMGA 1N33B 2YXLA 3N2GB 5FPRA 5GW7A 1V54C 3T4DA 3SJQC 5CBHA 3JD4A 4JTAB 2ETNA 5IY5C 1W2BU 4Z1VA 3G80A 5KX5A 1NVPD 4UVAA 2CUGA 4NTXA 1WNSA 3ETDA 1YDXA 1PD3A 1NZ6A 3FKSG 2QGNA 1SQGA 2VWKA 1HDJA 4FFKA 1WP8A 2RQ6A 5L3CA 3D3QA 3K5OA 3OAAG 3DSQA 4O4LB 2OIGA 1SA0A 3OTOO 2M7WA 2QWNB 2W0FC 1KMIZ 1NH2B 2Y48A 4LH7A 4DR6O 2LW1A 5LA6A 2YEVA 2QKCA 4DR4O 3BA8A 1EN4A 1XOUA 4E2LA 2UU9O 3JAKB 5B3SB 2ZE8A 1IX9A 1OV9A 3OTOB 4B3TO 3A0RA 1N8RW 4I50B 4LF8O 3OGIB 3ZN1A 1YTFB 1WPBA 3K04A 1VIBA 2A7WA 2BTQB 1I94B 4Q20A 2V7QG 2QWRB 2EJ7A 2CDYA 5AG2A 2A06H 4N23A 4O2BA 2ATKC 2QWPB 4JI2O 4GKJO 4DV2B 1KB9F 1EBOA 5HFLA 5LMUB 4LF8B 2BSKB 5ITZA 3LNNA 2JVDA 3ZN0A 4F6EA 4Z2WA 2AHYA 4NR1A 1NBMG 2AXTZ 4MVZA 1VQMV 3BVOA 1BCCH 1TVKA 2UXXA 4RAIA 3G6EV 4CH6A 2IW5A 1X4TA 2HR3A 5GONA 1S76D 1WLEA 1OCZB 2EULA 4WFFA 4NVPA 1XDCA 2WLJA 5LHHA 3BHPA 1CPYA 4DK0A 4LF6O 4FVMA 4MVOA 2PYJA 5H9CA 1FXVA 4IT5A 1Y4MA 2HP8A 2QTOA 2D3OW 4GUNA 4NB5A 1VQKV 3ZRWA 2A0LA 2KSDA 1H2SB 4F6RA 5J2UA 4DV4O
chains in the Genus database with same CATH topology
3CYOA 1S72V 2WLHA 5LGNA 1FFTB 3GB7C 4MSWC 4MW8A 1HWYA 1MABG 3NXSA 4LBEC 2ZXWC 1P4RA 4YXWG 5CBGA 4ASUG 1V55B 4I9WA 3T4ZA 1RM1B 1KKDA 1THZA 4MS2A 2IU3A 3K0DA 1PNMA 1QLEC 2Y69B 3E8GA 1W0KG 1OCOC 1BL8A 4JAVA 2OTJV 5IYCO 4JASA 5LBQA 3F7YC 3FB7C 4KP4A 1QVGU 2IH1C 1AI7A 2EZPA 2HVKC 4JYBA 2ZR3A 3SYQA 3ZRWB 4BIZA 2EILC 2HG5C 1YITV 2DYRB 1NH2D 2EINC 5DN6G 3QNEA 2C2AA 3AG4B 2B1GA 4LP8A 2EIMB 1VQLV 5EK0A 1R6KA 2H94A 3ASNC 1VQ9V 1QVFU 2ZXWB 3P32A 2A79B 1YJNV 1IXMA 3AG2C 4DXWA 3ASOB 3I55V 1QR8A 3STLC 3CPWU 1AI6A 1AI4A 4BIUA 2WWWA 2WPDG 1QLEB 4GX0A 3OUSA 1L1FA 1YTFD 1GO3F 3X2QB 1QLNA 4L87A 3B8NA 3MD0A 4MTFA 1EZJA 2YEVB 2NNUA 1Y66A 3VBBA 3CCRV 5L3EA 2EILB 3OEHG 3CCLV 2EINB 4LC1A 3OGCC 3CMAV 1S0VA 5IYDO 4ZBMA 3OEEG 3E35A 1G4YB 3ZMUA 4OXSA 2OCCC 4WFGA 4MVSA 4JYCA 3TK1A 3SPGA 4WFEA 1NKDA 2Q69A 2WLNA 4FPPA 1K92A 5LGUA 3W7WA 3ZMVA 2XAQA 3ASNB 4WCEV 1KC8W 1QBZA 1K73W 3OMNB 3AG2B 4BW5A 1XL4A 3FB6C 3ZRXA 3RW0A 3CC7V 5H6QA 2LFRA 1SESA 2XAJA 3K0GA 3BY6A 3IGAC 3F5WC 3LUTB 2EIKC 2UXNA 2LP7A 1P7BA 4PA9A 3M99B 2IJKA 2R9RB 1VQ7V 3KG2A 3K06A 1R3IC 2LFSA 2EBOA 1GM9A 3F7VC 1QR9A 1AJQA 2JJ1G 1F23A 5EBLC 4ZKIA 1AI5A 2OCCB 3UM7A 4KUMA 4RO2A 1R6NA 4X89A 2P90A 2Z5UA 2EIJB 3MHSC 1KECA 5LGTA 4PDRA 4QPJA 2EJRA 2X6BA 4P30A 3K9AA 1I5YA 3E86A 1SZTA 3QO7A 2KB1A 1GKFA 2B1IA 4JF3A 1M56C 1PNKA 2DQ0A 2MK3A 4WF9V 3WG7B 3CCMV 2X6CA 4R8CA 5L3BA 1E79G 4G2KA 4I5SA 2P67A 3OFNG 3K79A 1GTOA 1K7DA 2EIKB 4FIPC 3RVYA 4N21A 1JVMA 1H2GA 1COWG 2EZOA 2F43G 5IYBO 3W7TA 2JIZG 4UXNA 3SPJA 4Z1MG 1ZWIC 1S77D 1G8MA 1MG1A 3ZRSA 2IH3C 3E89A 1FXKA 1OCRC 3CCSV 3SYCA 1NVPB 1E1QG 1JCHA 2IJJA 1DF5A 5L3GA 2HVJC 4HYOA 4QE7A 3K03A 4TT3G 2Q67A 3JD0A 3W7UA 4GT1A 4P9PA 2BOCC 2W6JG 3HPLC 1K4CC 1K8AW 2YSUB 4MVUA 4J9YB 4G27B 2HFEC 4MVRA 1K33A 4X8AA 1M90W 3CCEV 4EKWA 5BZBA 4JTDB 5KA5A 1M56B 4GX1A 3CCVV 1AJNA 5CMUA 5EBWC 1AROP 3E8HA 3HB3B 1OZ0A 4XDLA 1AR1B 3CXCU 2DQ3A 1S3JA 3AG1C 3ETEA 3IFXA 1VQOV 3OE7G 4H33A 4R6ZA 1MSWD 2ZD9A 4X88A 4RUEA 3DGEA 2DW4A 1SETA 3EHBB 4HZ3A 2XNDG 2WLMA 4RQFA 2QE7G 3ABTA 1PNLA 4PA3A 3I56V 4JTCB 3B77A 3CP1A 3JD2A 4PDMA 3SPCA 1OCOB 3SPIA 1OCRB 2QEXV 1BMFG 1WPXA 1RPOA 3FB8C 1GK9A 2GHYA 5LHGA 3ML0A 4XDJA 5LHIA 4MVQA 4GX2A 2Z3YA 3SYAA 1VQ8V 5CA3A 2QM8A 1KP3A 4PDLA 4MW3A 3CCUV 3D3IA 3ABLC 5CBFA 3TCUA 3H01A 1YHQV 3ZIAG 2JK5C 1YI2V 4LCUC 5KUMA 1F4NA 2ZQMA 1BHBA 1TUEB 3ABMC 1AJPA 3OM3B 3ZMSA 4PDVA 5IDJA 2XAFA 3W7SA 4MTGA 3SYPA 2P6JA 4GCZA 3FYEB 5B1AC 1VQNV 1MOFA 3AG1B 3QO8A 4RUFA 2DYSC 4QE9A 3E8BA 1W0JG 2ITCC 3LNMB 4KFMA 3ABKC 1SRYA 1R3KC 5B1BC 4F4LA 3TETA 1Q7YW 1Q81W 4RQEA 1K9MW 2Q68A 2IU0A 3LDEA 3UKMA 3G4SV 3JYCA 3RBZA 2FTKA 1FXHA 4QNHB 2HJFC 3CCJV 1NR1A 3AG3C 4FJCC 1NJIW 5B1NA 3D36A 4GX5A 4WFBV 3GWOA 1KP2A 1JJ2U 3OMAB 1F4MA 1K3EA 3ABLB 3EFFK 3K3WA 3DTUB 3OR6C 3LSQA 3PJSK 3CD6V 3STZC 2OTLV 1NR7A 2QA4V 4PA7A 1RPRA 4QPKA 1DLBA 1NQTA 3P30A 1CEZA 3OR7C 3ZMZA 1YSCA 4TSFG 4U7NA 3IC7A 3W7XA 1I5XA 3G71V 2PI4A 1V55C 4XBFA 2WLLA 1RM1C 4JAUA 5H6RA 2WSSG 1H8HG 2X6AA 1R73A 5B1AB 1JQ0A 3JCZA 2DYSB 3E83A 1EFRG 4UUJC 5B1BB 4MT8A 5B1OA 5J9PC 4UVBA 2IJHA 4MVMA 5GW7A 3SYOA 1V54C 1FXKC 4FK5C 3T4DA 3SJQC 5CBHA 3JD4A 4JTAB 5EC2C 3CCQV 4R50A 3JD1A 5IY5C 1K34A 1KD1W 5EC1C 4PA6A 1W2BU 2Q6AA 2H8PC 1H38A 1B6QA 2JEUA 1NVPD 4QIWF 2WLLB 3ZMTA 5E1AC 4UVAA 3ZRVA 4WFHA 4J9ZB 3LDDA 1R3LC 4DO2A 3ETDA 2WAMA 5CN0A 4P9OA 1PD3A 5B3SC 1R3JC 3SPHA 3T1CA 3FKSG 3ASOC 1K5SA 3K08A 4H37A 4BAYA 4XDKA 4P2ZA 1OHHG 4MTXA 3X2QC 1JX9A 1M1KW 3JD3A 5L3CA 3OAAG 2WLKA 4QJFB 3ZCCA 4CBCA 1UJWB 1V54B 1GMGA 2M7WA 1FXKB 3QO5A 2W0FC 3AEIA 1JPXA 1NH2B 3LSSA 2Y48A 1Q86W 2X0LA 1M57C 1H8EG 5IY5B 2YEVA 2NLJC 4E2LA 4FMTA 1F51A 1LNQA 3RVZA 1GM7A 5DM6V 1VQ6V 3B8MA 2PI5A 1ENVA 1SERA 1DF4A 2ZDIC 5B3SB 1ROPA 1E1RG 3A0RA 4JGSA 1N8RW 3R65A 4CZZA 2QM7A 4JPRA 2ZDIA 2WLIA 3E8FA 3ZN1A 4G28B 1YTFB 3FYIB 3K04A 1K5QA 5L3FA 1YJ9V 4Q20A 1GM8A 2V7QG 2HKOA 3BEHA 3CC2V 3CMEV 1YIJV 4R7CA 4N23A 1OCZC 2ATKC 2R9IA 1M9NA 2GSMB 1VQ4V 1OCCC 3ZJZA 1VQ5V 2OT5A 3T2MA 1M57B 1EBOA 5HFLA 3OMIB 5C93A 1QCEA 3ZN0A 1FS0G 5KA6A 2XOKG 1K97A 2EIJC 2AHYA 1NBMG 3ETGA 2WLIB 4HAMA 5EBMC 2AHZA 1KQSU 4MVZA 1VQMV 2ZR2A 2K1EA 3WG7C 5FL7G 2HLDG 3CC4V 3ABMB 5HFMA 1J95A 2UXXA 2X7RB 1Q82W 4RAIA 1ORQC 2W6IG 4UVCA 3G6EV 3ABUA 2IW5A 1S5HC 2A9HA 2DWEC 1VQPV 3E2EA 2HR3A 3MHHC 4PELA 1PKXA 2JEXA 1S76D 4U7OA 4WFAV 1WLEA 2XAGA 5L3DA 4UV8A 1OCZB 4WFFA 2QKSA 1DTOA 1K4DC 5KUKA 2JDIG 2Y69C 1OCCB 1XL6A 2CK3G 3OW2U 2IJIA 3ABKB 3FB5C 2WLJA 4TWKA 2ITDC 4MTOA 5LHHA 1CPYA 4PA4A 1BHAA 2XASA 2B5UA 4MVOA 5H9CA 1FXVA 1Y4MA 2XAHA 3OUFA 2QTOA 3AG3B 1YJWV 2JJ2G 2DYRC 3WFVA 2D3OW 2P7TC 3VOUA 1VQKV 1CP9A 1JOYA 2BOBC 2V1DA 3ZRWA 2A0LA 3LDCA 1PL0A 3AG4C 4UV9A 2EIMC 2DWDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QR8 A;  3CYO A;  1JPX A;  2MK3 A;  3GWO A;  2EBO A;  5CN0 A;  1QR9 A;  4G2K A;  3B77 A;  3CP1 A;  1QBZ A;  2P6J A;  1F23 A;  3B8N A;  4FIP C;  1K33 A;  4E2L A;  4N21 A;  1MOF A;  4FK5 C;  5H9C A;  4N23 A;  2EZO A;  5KA5 A;  1DLB A;  1Y4M A;  3P30 A;  1Y66 A;  5HFM A;  3B8M A;  2X7R B;  5CMU A;  1ENV A;  1MG1 A;  2OT5 A;  3WFV A;  1DF4 A;  1I5X A;  3MHS C;  1EBO A;  5HFL A;  1K34 A;  3H01 A;  1QCE A;  4JGS A;  3K9A A;  1I5Y A;  3MHH C;  4JF3 A;  1SZT A;  2LP7 A;  5KA6 A;  1DF5 A;  1JQ0 A;  2EZP A;  2M7W A;  3M99 B;  4FJC C;  4JPR A; 
#chains in the Genus database with same CATH topology
 1S72 V;  2WLH A;  4TQD A;  1FFT B;  3GB7 C;  1JR9 A;  4MW8 A;  1ZL8 A;  4LBE C;  2ZXW C;  3K5N A;  4FLW A;  4DV7 O;  4K35 A;  1RM1 B;  4DRX B;  1S5J A;  3EXA A;  4AIL C;  3K0D A;  1PNM A;  3L9D A;  4FFB B;  2FYU H;  1AVM A;  1VEW A;  2RJZ A;  2IBZ H;  2HVK C;  2L35 A;  5TIS Z;  2EIL C;  2HG5 C;  1YIT V;  1SF9 A;  2YIB A;  1NH2 D;  2EIN C;  3BAA A;  3L70 H;  3UQ8 A;  2M6Y A;  5BY1 A;  5DN6 G;  4CS3 A;  1I0H A;  4I0X B;  1XMO B;  3AG4 B;  2B1G A;  1EZV H;  4CS4 A;  2VWJ A;  4X20 A;  3DC5 A;  4DUZ O;  4DV6 O;  3SR2 C;  4EEQ A;  1YJN V;  4EFE A;  3ASO B;  2CAZ C;  5IYZ B;  1AI6 A;  2WWW A;  2WPD G;  1O9G A;  3ZHS A;  3OUS A;  3VQX A;  1YTF D;  4QGP A;  1SKV A;  4L87 A;  2UUC O;  4DUZ B;  1Y66 A;  3VBB A;  3CCR V;  5L3E A;  4LWS A;  4J11 A;  2N04 A;  3BA9 A;  3A0H Z;  3CMA V;  4DR5 B;  3UO2 A;  1G4Y B;  1VF5 B;  4LF7 B;  4OXS A;  4MVS A;  4JYC A;  4B7K A;  3TK1 A;  2UXC O;  1K92 A;  5FNV A;  3ZHT A;  1KC8 W;  4X65 O;  3OMN B;  1XMQ B;  1IXB A;  1XL4 A;  1SQQ H;  3ZRX A;  1Q3E A;  5H6Q A;  3H1H H;  2RCV A;  2YI8 A;  4KL1 A;  4NTY A;  5IJ9 B;  2XAJ A;  4JZG A;  3BY6 A;  3IGA C;  1BQ0 A;  3UT5 A;  2PGG A;  2LP7 A;  3M99 B;  2UXC B;  4LFC B;  1R3I C;  2LFS A;  2EBO A;  3N27 A;  1QR9 A;  4TOI A;  1TUB B;  2JJ1 G;  5EZY A;  1F23 A;  4FM2 A;  4TV9 A;  5J2T A;  2OCC B;  3UM7 A;  4X62 O;  4P30 A;  3K9A A;  1YEW A;  1KU9 A;  1LR1 A;  3E86 A;  1SZT A;  3SJA C;  3QO7 A;  2B1I A;  4JF3 A;  1M56 C;  1WB7 A;  2DQ0 A;  2MK3 A;  3DXR B;  3WG7 B;  4NXN O;  3K9S A;  3LSU A;  3K79 A;  2DN9 A;  1K7D A;  2EIK B;  4YIO A;  3RVY A;  3W7T A;  3JAT A;  4Z1M G;  1L0N H;  2XHB A;  3E89 A;  1FXK A;  2LJ2 A;  1E1Q G;  4TQF A;  3ZX6 A;  3K5M A;  2Q67 A;  3JD0 A;  4KHP O;  4JI6 B;  2CH7 A;  4I4T A;  1N4C A;  2E5L B;  4G27 B;  4MVR A;  1M90 W;  1K33 A;  3NR7 A;  5LYJ A;  4AHC A;  1FJG O;  4JTD B;  3CCV V;  1EM1 A;  1SQV H;  3APO A;  4X1I B;  4JI5 O;  1OZ0 A;  3CXC U;  1MSW D;  3IFX A;  3B40 A;  4RWU A;  2ZD9 A;  4RUE A;  4DV3 B;  3DGE A;  3ICX A;  3EHB B;  2XND G;  2WLM A;  1N32 B;  2QE7 G;  3I56 V;  1RSO A;  2W0X A;  2YID A;  2AZ0 A;  3B77 A;  4CS2 A;  1BQZ A;  3FB8 C;  3G6B A;  4CH5 A;  2GHY A;  4GZR B;  5LHI A;  4TUY A;  1VQ8 V;  1J5E B;  5CA3 A;  3C3T A;  5JQG A;  3A8T A;  4DUY O;  3ABL C;  5BXZ A;  5CBF A;  1UFI A;  2P4V A;  3T1H B;  3C3S A;  2QKA A;  4H13 B;  2Q7G A;  3SYP A;  3CJH B;  5B1A C;  3AG1 B;  3QO8 A;  3LNM B;  2HEP A;  4LR3 A;  4JV5 B;  4RQE A;  3LDE A;  1PP9 H;  2QJ1 A;  4QNH B;  2N74 A;  4ZI7 B;  2ZM6 O;  4WFB V;  4GX5 A;  4HBN A;  3GWO A;  5EIB C;  1F4M A;  1K3E A;  1AB3 A;  2UXD O;  2PTM A;  3PJS K;  3STZ C;  2O57 A;  1Y67 A;  4UCR A;  1CEZ A;  3TXS A;  4TSF G;  2CTQ A;  4U7N A;  2YS8 A;  3JAL B;  4K8X A;  5BMV A;  4EFB A;  2PI4 A;  1N36 O;  4XBF A;  1RM1 C;  2JRI A;  4JAU A;  5H6R A;  2X6A A;  1JQ0 A;  3JCZ A;  2QWQ B;  4PV1 B;  2ZE5 A;  4I7Z B;  3RYC A;  1FFX B;  2IJH A;  4X9Q A;  3U11 A;  3SYO A;  5LP6 A;  1FXK C;  1GRJ A;  3WB2 A;  4DV5 B;  2P06 A;  2F4V O;  3ZHV A;  4EB6 B;  1Q6U A;  4LFA O;  3CCQ V;  2AGA A;  1KD1 W;  5EC1 C;  4PA6 A;  1HNZ O;  2Q6A A;  4QIW F;  4CC5 A;  2WLL B;  3ZMT A;  5E1A C;  4D7S A;  4WFH A;  1R3L C;  5KMG B;  4DO2 A;  2WAM A;  4P9O A;  4ABM A;  4FZ1 A;  1P49 A;  1R3J C;  4UCU A;  2RDC A;  1Y74 A;  1XNR B;  3ASO C;  4E4E A;  1K5S A;  2NN4 A;  2QWO B;  4BAY A;  3KCY A;  2DMX A;  5LMN O;  1JX9 A;  2JS5 A;  1M1K W;  1HNZ B;  2WLK A;  3QO5 A;  5KX5 B;  1XI1 A;  1JPX A;  1SQP H;  1M57 C;  4D6T H;  5EYP A;  3CRR A;  5D5Q A;  5CA1 A;  4U3J A;  1F51 A;  5IJ0 B;  1LNQ A;  1GM7 A;  1TAE A;  1VQ6 V;  5A9G A;  2ZDI C;  1ZLZ A;  1ROP A;  3TXQ A;  4JGS A;  4JI1 O;  5JH7 A;  4FM1 A;  2QM7 A;  1MNG A;  5E79 Z;  4G28 B;  1L0L H;  3FYI B;  4DR1 O;  2Q7H A;  1FPO A;  1YJ9 V;  1TA8 A;  2PUS A;  5LA6 B;  3CME V;  1YIJ V;  4JI8 O;  3E22 A;  4R7C A;  3N2K A;  5FLX N;  2GSM B;  1VQ5 V;  3IJ4 A;  3H9V A;  3OMI B;  3VQY A;  4B3M O;  1H2L A;  1P7G A;  1L8D A;  5KA6 A;  2Q73 A;  1S5L Z;  3T1Y O;  1K97 A;  1BS3 A;  3SJC C;  3RYI A;  2VQF B;  4I55 A;  4HAM A;  2UUA O;  3HKB B;  3J81 N;  4NYK A;  5FL7 G;  3WG7 C;  3CC4 V;  4B3M B;  1Q82 W;  1UPG A;  2PY5 A;  1XNQ B;  1S5H C;  2A9H A;  4OPH A;  3U10 A;  3JAS A;  1AP6 A;  2R72 A;  2JEX A;  4U7O A;  4WFA V;  2XAG A;  2FL4 A;  4UV8 A;  5ITZ B;  5LP6 C;  2Y69 C;  1OCC B;  4YJ3 B;  5JCO C;  3ABK B;  3FAV A;  4K0K O;  4TWK A;  2BE3 A;  2EX3 A;  3L72 H;  3P3N A;  2ADP A;  4DR3 B;  4L8J A;  1B04 A;  1P84 F;  2QDO A;  2JJ2 G;  2GBO A;  4B3R O;  1JOY A;  1TVK B;  2KKW A;  4GKK O;  4UV9 A;  2ODM A;  1WAZ A;  4J7K A;  1P4R A;  5KHG A;  3CX5 F;  2DE0 X;  1DK1 A;  3IAY A;  2NR5 A;  2MW2 B;  4B3R B;  3Q4H A;  1XRE A;  3E8G A;  1VF6 C;  1W0K G;  1Y6X A;  4LF5 O;  2OTJ V;  4LF9 O;  3F7Y C;  5IE9 A;  4KP4 A;  1QVG U;  2GDS A;  2EZP A;  1HNX O;  3ZRW B;  3EVK A;  5J2U B;  1SZX A;  2DYR B;  1BGY H;  2Q8V A;  1ZL8 B;  1HNW O;  3ZHQ A;  4LP8 A;  4JI0 O;  2EIM B;  5EK0 A;  5K1X A;  5CB4 A;  4J42 A;  1MMM A;  3FX7 A;  2Q9L A;  3AG2 C;  3HKE A;  1HR0 O;  4DR6 B;  1AI4 A;  3JAW A;  1QLE B;  4X66 O;  4GX0 A;  5JJN B;  1VF7 A;  4DR4 B;  1GO3 F;  1QLN A;  3QTC A;  1SC5 B;  1WN7 A;  5CA0 B;  1EZJ A;  1D5A A;  2UUB O;  2UU9 B;  2NNU A;  1FKA O;  3BAB A;  3UCS C;  2Y4U A;  1WP7 A;  2QR4 A;  4J7Z A;  4B3T B;  4LC1 A;  1HP8 A;  1S0V A;  4ZBM A;  4WFG A;  4DR7 O;  2HHH O;  3ZMV A;  3ASN B;  2DJV A;  1IZ3 A;  1ZX3 A;  2YUA A;  2UUB B;  3H1K H;  4JI2 B;  4GKJ B;  4ZHQ B;  3RYH A;  4KXR A;  2OIE A;  3LUT B;  4LWS B;  4DR7 B;  4LF4 O;  1Y76 B;  2P4K A;  4PA9 A;  2HHH B;  5D5P A;  2R9R B;  1VQ7 V;  5C8Y B;  3K06 A;  5JJE B;  1N0J A;  3F5T A;  1AJQ A;  5FNV B;  4WBN A;  3SGI A;  1R6N A;  2Z5U A;  3MHS C;  1KEC A;  4PDR A;  2EJR A;  2LW7 A;  2X6B A;  3OTF A;  2YDE A;  4UCO A;  1I5Y A;  1M5I A;  4J10 A;  1GKF A;  2PF4 E;  4YIP A;  4WF9 V;  4R8C A;  3CRQ A;  1E79 G;  3SJB C;  1KKC A;  2P67 A;  5KLV H;  4LF6 B;  3RYF A;  1JFF A;  4N21 A;  5EZY B;  1H2G A;  4O4H B;  2EZO A;  4UXN A;  3SPJ A;  4TV9 B;  1S77 D;  1OCR C;  3CCS V;  4DV4 B;  3RFR A;  2P5O A;  5L3G A;  2HVJ C;  5KAI Z;  4H0L B;  4QE7 A;  3K03 A;  4P9P A;  4DV7 B;  1IBK O;  2Q7E A;  3J80 N;  1WA8 A;  4MVU A;  3A0B Z;  2FKX A;  3CCE V;  4EKW A;  2F93 B;  3JAK A;  5KA5 A;  4GYC B;  3QVN A;  5CMU A;  3G67 A;  4YHH O;  2R9A A;  5GTH Z;  1MZE A;  1KYO F;  4BIO A;  4XDL A;  1VQO V;  1W59 A;  1NTM H;  4DR2 O;  1SET A;  4DK1 A;  1BZK A;  4PDM A;  4JAA A;  4PD4 F;  2QEX V;  1JMK C;  1RPO A;  4J80 A;  4I4T B;  2YIB D;  4XDJ A;  4MVQ A;  4GX2 A;  2ZKO A;  5IT9 N;  2BSK A;  4ZOL A;  3CS5 A;  5JVD B;  5LYJ B;  1SS3 A;  1KP3 A;  2QM8 A;  4DV6 B;  4X1K A;  4MW3 A;  3CCU V;  2Q4P A;  3H01 A;  2JK5 C;  1YI2 V;  1BHB A;  1AJP A;  3ZMS A;  5IDJ A;  5DEC A;  3IC9 A;  4FLX A;  4JYA O;  3FFQ A;  2UUC B;  1PL4 A;  2DYS C;  3RWR D;  1W0J G;  3ABK C;  1SRY A;  5B1B C;  4F4L A;  3TET A;  1Q7Y W;  3D36 C;  2IU0 A;  4Q6G A;  5JQG B;  2LO1 A;  2XUM A;  2HJF C;  3ZHU A;  1NJI W;  5B1N A;  4JYA B;  1JJ2 U;  1JA8 A;  4X65 B;  3EFF K;  2CTW A;  4CH4 A;  2ILM A;  2QA4 V;  4PA7 A;  1RPR A;  1DLB A;  1NQT A;  5B5E Z;  3MAQ A;  5LXT A;  3CRM A;  2KG7 B;  1G1X B;  3M7M X;  1GAX A;  3JAR A;  5B1O A;  4DRX A;  5J9P C;  4UVB A;  1D5N A;  4GLX A;  1IUR A;  4FK5 C;  4FFB A;  2DOS A;  4X62 B;  3U0Z A;  2JGD B;  1BT8 A;  1U96 A;  1Z5V A;  4IIJ A;  4K3A A;  3ZRV A;  4J9Z B;  1PPJ H;  4NXN B;  2G38 A;  2ZNI A;  5B3S C;  4I0X A;  3H1J H;  1D2D A;  1WJZ A;  2GTS A;  3K08 A;  4U3F H;  2LGW A;  4XDK A;  4YY3 O;  4PHZ A;  4P2Z A;  1OHH G;  4MTX A;  1YCI A;  2D2C B;  5KHH A;  1TGO A;  5IYZ A;  3CXH F;  3B09 A;  3ZCC A;  4TV8 B;  4CBC A;  1V54 B;  5LOV B;  5B66 Z;  2PYL A;  2ZIN A;  4KHP B;  3LSS A;  2OCH A;  1Q86 W;  2GV9 A;  5JWP A;  5IY5 B;  2FB5 A;  2WA3 A;  2NLJ C;  1FJG B;  4YY3 B;  1Y74 B;  3BRC A;  3RVZ A;  1URF A;  2PI5 A;  1PM9 A;  1SER A;  3HKD A;  4JI5 B;  1EN6 A;  4OPA A;  5BR8 O;  2E74 B;  4JPR A;  2ZDI A;  2WLI A;  3E8F A;  1GN3 A;  2HJD A;  1GM8 A;  2HKO A;  4YJ2 B;  1VAR A;  3BEH A;  1GN2 A;  2A3Q A;  1OCZ C;  2R9I A;  4DUY B;  3ZJZ A;  4U3J B;  1FAF A;  5C93 A;  1QCE A;  1FS0 G;  1I7F A;  2XOK G;  2CGN A;  4ICG A;  5JH7 B;  5EBM C;  1GN6 A;  3HKC A;  5HFM A;  2UXB O;  4B3S O;  1J95 A;  3N2K B;  2X7R B;  3CEI A;  4JZ2 A;  5LL6 Y;  1ORQ C;  3JAM N;  4BWA A;  4IHJ A;  4DV1 O;  2GUZ B;  4FLY A;  3DXR A;  3MHH C;  4PEL A;  1PKX A;  3CWB H;  2ZM6 B;  5L3D A;  2QKS A;  5KUK A;  2JDI G;  2CK3 G;  2IJI A;  4H44 B;  3APQ A;  2UXD B;  3FB5 C;  4UCV A;  3RYI B;  4NKG B;  2Y0P A;  4A5U B;  2XAS A;  2B5U A;  2Q0A A;  3L73 H;  5JCO A;  3OUF A;  1YJW V;  3WFV A;  1G6U A;  3BPZ A;  4LNU B;  1N36 B;  1CP9 A;  2JGU A;  1I08 A;  2V1D A;  1BSM A;  2K9P A;  3LDC A;  3AG4 C;  1GH6 A;  3CYO A;  4MSW C;  1ZUQ A;  1MAB G;  3NXS A;  4AQY O;  4YXW G;  4IGG A;  5CBG A;  4NXM O;  3FAV B;  4X1I A;  1IBM O;  2F4V B;  1KKD A;  4LFA B;  4MS2 A;  4OX9 O;  4O4I A;  1BL8 A;  4JAV A;  4JAS A;  3FB7 C;  2QTS A;  1AI7 A;  3SYQ A;  2ZR3 A;  4BIZ A;  1VF6 A;  5H5N A;  4DW0 A;  1QQC A;  4JI7 O;  2ADQ B;  2C2A A;  5IWA O;  1R6T A;  2CTP A;  5LMN B;  2H94 A;  1OJH A;  2ZXW B;  3P32 A;  3AK2 A;  4DXW A;  3VQW A;  1LUV A;  2VQE O;  1AR4 A;  3I55 V;  1QR8 A;  3CJH A;  1M93 A;  1SA0 B;  4BIU A;  2OWO A;  1L1F A;  3X2Q B;  3CE2 A;  3B8N A;  3MD0 A;  3C90 A;  2YEV B;  1FD9 A;  2QSA A;  3WB1 A;  2EIL B;  3OEH G;  3CCL V;  2EIN B;  1X59 A;  3OGC C;  4JI1 B;  4ZI7 A;  5CB4 B;  5IYD O;  2VQE B;  3E35 A;  5KHJ A;  2OCC C;  3SPG A;  3HKE B;  4WFE A;  1NKD A;  4DR1 B;  2WLN A;  2B9Z A;  4FZ0 A;  5LGU A;  1AP5 A;  4WCE V;  3JAW B;  4JI8 B;  1XIL A;  4BW5 A;  3FB6 C;  2ZIO A;  3JAL A;  3CC7 V;  1NTK H;  1SES A;  4JI4 O;  4O2B B;  1US6 A;  3K0G A;  3F5W C;  2EIK C;  2UXN A;  3PN1 A;  3T1Y B;  1P7B A;  1FFX A;  1SQF A;  1IBL O;  2ZT9 B;  1GM9 A;  2UUA B;  1MA1 A;  5EBL C;  4FLT A;  1N33 O;  1AI5 A;  4UB6 Z;  1SQX H;  4RO2 A;  4X89 A;  4JI4 B;  1QU7 A;  5KAF Z;  2EIJ B;  4O2A A;  5LGT A;  1XBL A;  4QPJ A;  4LFB O;  4BR6 A;  5KMG A;  1IBL B;  3B4S A;  3UO3 A;  3CCM V;  5GON B;  2JS3 A;  4K0K B;  4G2K A;  4I5S A;  3GVM A;  3OFN G;  1GTO A;  4O4J A;  4CH3 A;  1COW G;  4WBN B;  1NI8 A;  2F43 G;  4NTW A;  1IDS A;  2JIZ G;  1ZWI C;  4LFB B;  1MG1 A;  2IH3 C;  4GKK B;  1JCH A;  2IJJ A;  2V4D A;  3WB0 A;  3RT3 C;  3S3X A;  1U97 A;  5KHI A;  3VQV A;  3GWK C;  4GT1 A;  4F6R B;  3CRC A;  2W6J G;  1YXB A;  4FLV A;  5IJ0 A;  4X64 O;  1K8A W;  4J9Y B;  4X1Y A;  3FD9 A;  1M56 B;  4GX1 A;  3RYF B;  1JFF B;  1QHT A;  4LF5 B;  4LF9 B;  1AR1 B;  4C7U A;  1HNX B;  3AG1 C;  4HNA A;  1T5E A;  1Z5W A;  3OE7 G;  4R6Z A;  4X88 A;  2H3O A;  4PA3 A;  1PNL A;  3QF7 A;  4X64 B;  4JTC B;  3JD2 A;  3SPC A;  1OCO B;  1HNW B;  1I94 O;  1GK9 A;  2ZIM A;  1WA8 B;  4JI0 B;  3ML0 A;  2Z3Y A;  4DV2 O;  1V9P A;  4X20 B;  5LMU O;  1HR0 B;  1NS1 A;  1F4N A;  3AK1 A;  2ZQM A;  4BW9 A;  2L6L A;  3OM3 B;  4PDV A;  3HKB A;  4X66 B;  4B08 A;  1Q8I A;  1XQ8 A;  3W7S A;  4MTG A;  2P6J A;  4GCZ A;  4I9Q A;  1VQN V;  1MOF A;  3BCC H;  4QE9 A;  3KKY A;  3E8B A;  5F2V O;  2ITC C;  4KFM A;  3CSX A;  1R3K C;  5DED A;  1F7Y A;  1Q81 W;  4ZOL B;  2Q68 A;  4JI3 O;  4LH6 A;  3G4S V;  3RBZ A;  4X1K B;  2FTK A;  2N05 A;  2Z0A A;  3QG5 A;  4YJ3 A;  4FJC C;  3D36 A;  3OMA B;  3N2G A;  4W4L A;  3ABL B;  3RGB A;  1XEQ A;  3OR6 C;  1H2K A;  3LSQ A;  1DGS A;  2OYQ A;  1NR7 A;  2Q5Z A;  3KCX A;  4W4K A;  1YSC A;  4JI3 B;  3IC7 A;  3W7X A;  1I5X A;  3G71 V;  2WA4 A;  4LF4 B;  2P22 C;  5KHK A;  3ZBH A;  1EN5 A;  1R73 A;  3CHX A;  2E75 B;  3OD4 A;  5B1A B;  4UCS A;  3UT5 B;  3E83 A;  3AK3 A;  1EFR G;  4UUJ C;  4MT8 A;  3D8C A;  3TGU H;  2LGQ A;  5EC2 C;  4O4L A;  5J2T B;  4R50 A;  3JD1 A;  1K34 A;  1MSD A;  2YIA A;  2H8P C;  1H38 A;  1B6Q A;  2JEU A;  3ETQ A;  5LXT B;  2QM4 A;  3LDD A;  5CN0 A;  1ZSP A;  3DC6 A;  3SPH A;  3T1C A;  3JAR B;  3S3W A;  1Q6H A;  4H37 A;  1XMO O;  1YZB A;  2PZS A;  4DV0 O;  1PV0 A;  3X2Q C;  4I50 A;  4IYH A;  1QNM A;  3JD3 A;  2Y0I A;  2F66 C;  4QJF B;  3JAT B;  4D7T A;  2YXH A;  1UJW B;  1GMG A;  1FXK B;  2BTQ A;  1N34 O;  4UB8 Z;  3AEI A;  1IBK B;  4IIJ B;  2X0L A;  1H8E G;  5CA0 A;  4FM0 A;  2R70 A;  2XT9 A;  2CH7 B;  4FMT A;  4DV0 B;  5DM6 V;  3B8M A;  4YHH B;  1ENV A;  1DF4 A;  2XTA A;  1E1R G;  1N0N A;  1N34 B;  3MDS A;  4DR5 O;  4DR2 B;  3R65 A;  4CZZ A;  4LF7 O;  1YF2 A;  3ZHR A;  1K5Q A;  5L3F A;  4ZHQ A;  4FLU A;  3JSL A;  1RSO B;  1HW7 A;  3CC2 V;  1XMQ O;  2F1M A;  1CXZ B;  1M9N A;  2KQX A;  1VQ4 V;  1OCC C;  1Y76 A;  2OT5 A;  3T2M A;  4TUY B;  1M57 B;  1B3Q A;  5C8Y A;  3HKD B;  3K57 A;  4LFC O;  2EIJ C;  1M4U A;  3ETG A;  2WLI B;  2Y4T A;  2AHZ A;  2CGO A;  1KQS U;  3K5L A;  2ZR2 A;  2K1E A;  2HLD G;  3ABM B;  2W6I G;  4UVC A;  2VRZ A;  3SDL A;  3ABU A;  2DWE C;  2ZCE A;  1VQP V;  3E2E A;  5K1P A;  1NTZ H;  2YI9 A;  1RFY A;  1DTO A;  1K4D C;  1R1B A;  1XL6 A;  3OW2 U;  2ITD C;  4MTO A;  4O4H A;  4PA4 A;  1BHA A;  2XAH A;  3AG3 B;  4B7E A;  2DYR C;  2P7T C;  3VOU A;  3HKC B;  2E76 B;  2BOB C;  5EIB D;  3L71 H;  4IHJ B;  1PL0 A;  5BMV B;  2EIM C;  2DWD C;  4DW1 A;  3A2F A;  5LGN A;  1HWY A;  3O9O A;  1Z2G A;  4PI0 A;  4FLZ A;  4JI6 O;  5FPO A;  4ASU G;  3RYC B;  2E5L O;  1V55 B;  4I9W A;  3T4Z A;  1BE3 H;  1THZ A;  2IU3 A;  5LP6 B;  1QLE C;  2Y69 B;  1OCO C;  1ZAU A;  3B2E E;  1SQB H;  5IYC O;  1WB8 A;  5LBQ A;  3L75 H;  4DYL A;  2IH1 C;  4JYB A;  4IL6 Z;  4DV3 O;  1N32 O;  3J7A U;  4UFZ A;  3L74 H;  3AG7 A;  5JVD A;  3QNE A;  1RP3 B;  2F95 B;  3JSN A;  1VQL V;  1R6K A;  1J5E O;  3ASN C;  1VQ9 V;  1QVF U;  4JYY A;  2A79 B;  1IXM A;  3JCU Z;  3T1H O;  4O4I B;  2ZE6 A;  3STL C;  3CPW U;  2ZNJ A;  3K58 A;  2IM9 A;  1IVS A;  4MTF A;  2CTR A;  4J41 A;  5EYP B;  5IJ9 A;  1Q6I A;  5CA1 B;  4AI8 A;  3H1I H;  4JV5 O;  1FYJ A;  5BR8 B;  2ARH A;  2CE4 A;  3O65 A;  3OEE G;  3ZMU A;  1AIL A;  5JJJ B;  2Q69 A;  1TUB A;  4FPP A;  3W7W A;  2XAQ A;  2E3C A;  1QBZ A;  3P3P A;  1K73 W;  2F23 A;  3AG2 B;  2BTO A;  3RW0 A;  1YVW A;  2LFR A;  3E22 B;  2KG7 A;  4CC6 A;  5A2Q N;  2IJK A;  3KG2 A;  2Q0O C;  5H2F Z;  3I5D A;  3F7V C;  4ZKI A;  2YC0 A;  4I55 B;  2YXY A;  2JGD A;  4KUM A;  2UXB B;  4B3S B;  4DV5 O;  2P90 A;  4DV1 B;  1NT2 B;  2YIC A;  2KB1 A;  1PNK A;  3JAS B;  2X6C A;  5L3B A;  1Q90 D;  1Q5O A;  4FIP C;  1XNR O;  4K8Z A;  1JVM A;  1NU1 H;  1XHZ A;  5IYB O;  2FML A;  1G8M A;  3ZRS A;  4TV8 A;  5LOV A;  1LUW A;  4UCT A;  1JJO A;  3SYC A;  4O2A B;  1NVP B;  1DF5 A;  4HYO A;  4TT3 G;  3W7U A;  4AQY B;  2BOC C;  3HPL C;  1VP7 A;  1K4C C;  4NXM B;  2YSU B;  3KZI Z;  2AZ2 A;  1IBM B;  2HFE C;  4X8A A;  3ZS8 C;  1H2N A;  5BZB A;  5GTI Z;  1H2M A;  4O4J B;  3R66 A;  4OX9 B;  1AJN A;  5EBW C;  1KBH A;  1ARO P;  3Q4H B;  3E8H A;  1KUQ A;  3HB3 B;  2DQ3 A;  1S3J A;  3ETE A;  3HR0 A;  4H33 A;  2DW4 A;  4HZ3 A;  1GN4 A;  1XUQ A;  1ZTE A;  3ABT A;  4YJ2 A;  4RQF A;  3CP1 A;  4JI7 B;  3SPI A;  1OCR B;  1BMF G;  1WPX A;  2VS0 A;  2LQT A;  5LHG A;  5IWA B;  1Q43 A;  3SYA A;  1MZF A;  4PI2 A;  2AW9 A;  4X1Y B;  4PDL A;  3TJT A;  3D3I A;  3TCU A;  1YHQ V;  3ZIA G;  4LCU C;  2BCC H;  5KUM A;  1TUE B;  3ABM C;  4HNA B;  2XAF A;  2VQF O;  4PJ0 Z;  3CRA A;  3FYE B;  4RUF A;  2GUZ A;  3CB2 A;  3K59 A;  1K9M W;  3UKM A;  1O9H A;  3JYC A;  1XNQ O;  1FXH A;  4IYI A;  3CCJ V;  1NR1 A;  2RMK B;  3AG3 C;  1KP2 A;  3WU2 Z;  4OGQ B;  1AR5 A;  3K3W A;  3BFR A;  3DTU B;  3OT7 A;  1B06 A;  3THO A;  4J7J A;  3RN4 A;  3CD6 V;  3M8A A;  2RN9 A;  2OTL V;  1A32 A;  4EB6 A;  4DR3 O;  4LNU A;  4QPK A;  3P30 A;  3OR7 C;  3ZMZ A;  2ZE7 A;  3RYH B;  1V55 C;  2WLL A;  2WSS G;  1H8H G;  1XHX A;  3ZED A;  2DYS B;  2RNB A;  3H1L H;  5B1B B;  4ZIB A;  2GTA A;  4MVM A;  1VMG A;  1N33 B;  2YXL A;  3N2G B;  5FPR A;  5GW7 A;  1V54 C;  3T4D A;  3SJQ C;  5CBH A;  3JD4 A;  4JTA B;  2ETN A;  5IY5 C;  1W2B U;  4Z1V A;  3G80 A;  5KX5 A;  1NVP D;  4UVA A;  2CUG A;  4NTX A;  1WNS A;  3ETD A;  1YDX A;  1PD3 A;  1NZ6 A;  3FKS G;  2QGN A;  1SQG A;  2VWK A;  1HDJ A;  4FFK A;  1WP8 A;  2RQ6 A;  5L3C A;  3D3Q A;  3K5O A;  3OAA G;  3DSQ A;  4O4L B;  2OIG A;  1SA0 A;  3OTO O;  2M7W A;  2QWN B;  2W0F C;  1KMI Z;  1NH2 B;  2Y48 A;  4LH7 A;  4DR6 O;  2LW1 A;  5LA6 A;  2YEV A;  2QKC A;  4DR4 O;  3BA8 A;  1EN4 A;  1XOU A;  4E2L A;  2UU9 O;  3JAK B;  5B3S B;  2ZE8 A;  1IX9 A;  1OV9 A;  3OTO B;  4B3T O;  3A0R A;  1N8R W;  4I50 B;  4LF8 O;  3OGI B;  3ZN1 A;  1YTF B;  1WPB A;  3K04 A;  1VIB A;  2A7W A;  2BTQ B;  1I94 B;  4Q20 A;  2V7Q G;  2QWR B;  2EJ7 A;  2CDY A;  5AG2 A;  2A06 H;  4N23 A;  4O2B A;  2ATK C;  2QWP B;  4JI2 O;  4GKJ O;  4DV2 B;  1KB9 F;  1EBO A;  5HFL A;  5LMU B;  4LF8 B;  2BSK B;  5ITZ A;  3LNN A;  2JVD A;  3ZN0 A;  4F6E A;  4Z2W A;  2AHY A;  4NR1 A;  1NBM G;  2AXT Z;  4MVZ A;  1VQM V;  3BVO A;  1BCC H;  1TVK A;  2UXX A;  4RAI A;  3G6E V;  4CH6 A;  2IW5 A;  1X4T A;  2HR3 A;  5GON A;  1S76 D;  1WLE A;  1OCZ B;  2EUL A;  4WFF A;  4NVP A;  1XDC A;  2WLJ A;  5LHH A;  3BHP A;  1CPY A;  4DK0 A;  4LF6 O;  4FVM A;  4MVO A;  2PYJ A;  5H9C A;  1FXV A;  4IT5 A;  1Y4M A;  2HP8 A;  2QTO A;  2D3O W;  4GUN A;  4NB5 A;  1VQK V;  3ZRW A;  2A0L A;  2KSD A;  1H2S B;  4F6R A;  5J2U A;  4DV4 O; 
#chains in the Genus database with same CATH homology
 3CYO A;  1S72 V;  2WLH A;  5LGN A;  1FFT B;  3GB7 C;  4MSW C;  4MW8 A;  1HWY A;  1MAB G;  3NXS A;  4LBE C;  2ZXW C;  1P4R A;  4YXW G;  5CBG A;  4ASU G;  1V55 B;  4I9W A;  3T4Z A;  1RM1 B;  1KKD A;  1THZ A;  4MS2 A;  2IU3 A;  3K0D A;  1PNM A;  1QLE C;  2Y69 B;  3E8G A;  1W0K G;  1OCO C;  1BL8 A;  4JAV A;  2OTJ V;  5IYC O;  4JAS A;  5LBQ A;  3F7Y C;  3FB7 C;  4KP4 A;  1QVG U;  2IH1 C;  1AI7 A;  2EZP A;  2HVK C;  4JYB A;  2ZR3 A;  3SYQ A;  3ZRW B;  4BIZ A;  2EIL C;  2HG5 C;  1YIT V;  2DYR B;  1NH2 D;  2EIN C;  5DN6 G;  3QNE A;  2C2A A;  3AG4 B;  2B1G A;  4LP8 A;  2EIM B;  1VQL V;  5EK0 A;  1R6K A;  2H94 A;  3ASN C;  1VQ9 V;  1QVF U;  2ZXW B;  3P32 A;  2A79 B;  1YJN V;  1IXM A;  3AG2 C;  4DXW A;  3ASO B;  3I55 V;  1QR8 A;  3STL C;  3CPW U;  1AI6 A;  1AI4 A;  4BIU A;  2WWW A;  2WPD G;  1QLE B;  4GX0 A;  3OUS A;  1L1F A;  1YTF D;  1GO3 F;  3X2Q B;  1QLN A;  4L87 A;  3B8N A;  3MD0 A;  4MTF A;  1EZJ A;  2YEV B;  2NNU A;  1Y66 A;  3VBB A;  3CCR V;  5L3E A;  2EIL B;  3OEH G;  3CCL V;  2EIN B;  4LC1 A;  3OGC C;  3CMA V;  1S0V A;  5IYD O;  4ZBM A;  3OEE G;  3E35 A;  1G4Y B;  3ZMU A;  4OXS A;  2OCC C;  4WFG A;  4MVS A;  4JYC A;  3TK1 A;  3SPG A;  4WFE A;  1NKD A;  2Q69 A;  2WLN A;  4FPP A;  1K92 A;  5LGU A;  3W7W A;  3ZMV A;  2XAQ A;  3ASN B;  4WCE V;  1KC8 W;  1QBZ A;  1K73 W;  3OMN B;  3AG2 B;  4BW5 A;  1XL4 A;  3FB6 C;  3ZRX A;  3RW0 A;  3CC7 V;  5H6Q A;  2LFR A;  1SES A;  2XAJ A;  3K0G A;  3BY6 A;  3IGA C;  3F5W C;  3LUT B;  2EIK C;  2UXN A;  2LP7 A;  1P7B A;  4PA9 A;  3M99 B;  2IJK A;  2R9R B;  1VQ7 V;  3KG2 A;  3K06 A;  1R3I C;  2LFS A;  2EBO A;  1GM9 A;  3F7V C;  1QR9 A;  1AJQ A;  2JJ1 G;  1F23 A;  5EBL C;  4ZKI A;  1AI5 A;  2OCC B;  3UM7 A;  4KUM A;  4RO2 A;  1R6N A;  4X89 A;  2P90 A;  2Z5U A;  2EIJ B;  3MHS C;  1KEC A;  5LGT A;  4PDR A;  4QPJ A;  2EJR A;  2X6B A;  4P30 A;  3K9A A;  1I5Y A;  3E86 A;  1SZT A;  3QO7 A;  2KB1 A;  1GKF A;  2B1I A;  4JF3 A;  1M56 C;  1PNK A;  2DQ0 A;  2MK3 A;  4WF9 V;  3WG7 B;  3CCM V;  2X6C A;  4R8C A;  5L3B A;  1E79 G;  4G2K A;  4I5S A;  2P67 A;  3OFN G;  3K79 A;  1GTO A;  1K7D A;  2EIK B;  4FIP C;  3RVY A;  4N21 A;  1JVM A;  1H2G A;  1COW G;  2EZO A;  2F43 G;  5IYB O;  3W7T A;  2JIZ G;  4UXN A;  3SPJ A;  4Z1M G;  1ZWI C;  1S77 D;  1G8M A;  1MG1 A;  3ZRS A;  2IH3 C;  3E89 A;  1FXK A;  1OCR C;  3CCS V;  3SYC A;  1NVP B;  1E1Q G;  1JCH A;  2IJJ A;  1DF5 A;  5L3G A;  2HVJ C;  4HYO A;  4QE7 A;  3K03 A;  4TT3 G;  2Q67 A;  3JD0 A;  3W7U A;  4GT1 A;  4P9P A;  2BOC C;  2W6J G;  3HPL C;  1K4C C;  1K8A W;  2YSU B;  4MVU A;  4J9Y B;  4G27 B;  2HFE C;  4MVR A;  1K33 A;  4X8A A;  1M90 W;  3CCE V;  4EKW A;  5BZB A;  4JTD B;  5KA5 A;  1M56 B;  4GX1 A;  3CCV V;  1AJN A;  5CMU A;  5EBW C;  1ARO P;  3E8H A;  3HB3 B;  1OZ0 A;  4XDL A;  1AR1 B;  3CXC U;  2DQ3 A;  1S3J A;  3AG1 C;  3ETE A;  3IFX A;  1VQO V;  3OE7 G;  4H33 A;  4R6Z A;  1MSW D;  2ZD9 A;  4X88 A;  4RUE A;  3DGE A;  2DW4 A;  1SET A;  3EHB B;  4HZ3 A;  2XND G;  2WLM A;  4RQF A;  2QE7 G;  3ABT A;  1PNL A;  4PA3 A;  3I56 V;  4JTC B;  3B77 A;  3CP1 A;  3JD2 A;  4PDM A;  3SPC A;  1OCO B;  3SPI A;  1OCR B;  2QEX V;  1BMF G;  1WPX A;  1RPO A;  3FB8 C;  1GK9 A;  2GHY A;  5LHG A;  3ML0 A;  4XDJ A;  5LHI A;  4MVQ A;  4GX2 A;  2Z3Y A;  3SYA A;  1VQ8 V;  5CA3 A;  2QM8 A;  1KP3 A;  4PDL A;  4MW3 A;  3CCU V;  3D3I A;  3ABL C;  5CBF A;  3TCU A;  3H01 A;  1YHQ V;  3ZIA G;  2JK5 C;  1YI2 V;  4LCU C;  5KUM A;  1F4N A;  2ZQM A;  1BHB A;  1TUE B;  3ABM C;  1AJP A;  3OM3 B;  3ZMS A;  4PDV A;  5IDJ A;  2XAF A;  3W7S A;  4MTG A;  3SYP A;  2P6J A;  4GCZ A;  3FYE B;  5B1A C;  1VQN V;  1MOF A;  3AG1 B;  3QO8 A;  4RUF A;  2DYS C;  4QE9 A;  3E8B A;  1W0J G;  2ITC C;  3LNM B;  4KFM A;  3ABK C;  1SRY A;  1R3K C;  5B1B C;  4F4L A;  3TET A;  1Q7Y W;  1Q81 W;  4RQE A;  1K9M W;  2Q68 A;  2IU0 A;  3LDE A;  3UKM A;  3G4S V;  3JYC A;  3RBZ A;  2FTK A;  1FXH A;  4QNH B;  2HJF C;  3CCJ V;  1NR1 A;  3AG3 C;  4FJC C;  1NJI W;  5B1N A;  3D36 A;  4GX5 A;  4WFB V;  3GWO A;  1KP2 A;  1JJ2 U;  3OMA B;  1F4M A;  1K3E A;  3ABL B;  3EFF K;  3K3W A;  3DTU B;  3OR6 C;  3LSQ A;  3PJS K;  3CD6 V;  3STZ C;  2OTL V;  1NR7 A;  2QA4 V;  4PA7 A;  1RPR A;  4QPK A;  1DLB A;  1NQT A;  3P30 A;  1CEZ A;  3OR7 C;  3ZMZ A;  1YSC A;  4TSF G;  4U7N A;  3IC7 A;  3W7X A;  1I5X A;  3G71 V;  2PI4 A;  1V55 C;  4XBF A;  2WLL A;  1RM1 C;  4JAU A;  5H6R A;  2WSS G;  1H8H G;  2X6A A;  1R73 A;  5B1A B;  1JQ0 A;  3JCZ A;  2DYS B;  3E83 A;  1EFR G;  4UUJ C;  5B1B B;  4MT8 A;  5B1O A;  5J9P C;  4UVB A;  2IJH A;  4MVM A;  5GW7 A;  3SYO A;  1V54 C;  1FXK C;  4FK5 C;  3T4D A;  3SJQ C;  5CBH A;  3JD4 A;  4JTA B;  5EC2 C;  3CCQ V;  4R50 A;  3JD1 A;  5IY5 C;  1K34 A;  1KD1 W;  5EC1 C;  4PA6 A;  1W2B U;  2Q6A A;  2H8P C;  1H38 A;  1B6Q A;  2JEU A;  1NVP D;  4QIW F;  2WLL B;  3ZMT A;  5E1A C;  4UVA A;  3ZRV A;  4WFH A;  4J9Z B;  3LDD A;  1R3L C;  4DO2 A;  3ETD A;  2WAM A;  5CN0 A;  4P9O A;  1PD3 A;  5B3S C;  1R3J C;  3SPH A;  3T1C A;  3FKS G;  3ASO C;  1K5S A;  3K08 A;  4H37 A;  4BAY A;  4XDK A;  4P2Z A;  1OHH G;  4MTX A;  3X2Q C;  1JX9 A;  1M1K W;  3JD3 A;  5L3C A;  3OAA G;  2WLK A;  4QJF B;  3ZCC A;  4CBC A;  1UJW B;  1V54 B;  1GMG A;  2M7W A;  1FXK B;  3QO5 A;  2W0F C;  3AEI A;  1JPX A;  1NH2 B;  3LSS A;  2Y48 A;  1Q86 W;  2X0L A;  1M57 C;  1H8E G;  5IY5 B;  2YEV A;  2NLJ C;  4E2L A;  4FMT A;  1F51 A;  1LNQ A;  3RVZ A;  1GM7 A;  5DM6 V;  1VQ6 V;  3B8M A;  2PI5 A;  1ENV A;  1SER A;  1DF4 A;  2ZDI C;  5B3S B;  1ROP A;  1E1R G;  3A0R A;  4JGS A;  1N8R W;  3R65 A;  4CZZ A;  2QM7 A;  4JPR A;  2ZDI A;  2WLI A;  3E8F A;  3ZN1 A;  4G28 B;  1YTF B;  3FYI B;  3K04 A;  1K5Q A;  5L3F A;  1YJ9 V;  4Q20 A;  1GM8 A;  2V7Q G;  2HKO A;  3BEH A;  3CC2 V;  3CME V;  1YIJ V;  4R7C A;  4N23 A;  1OCZ C;  2ATK C;  2R9I A;  1M9N A;  2GSM B;  1VQ4 V;  1OCC C;  3ZJZ A;  1VQ5 V;  2OT5 A;  3T2M A;  1M57 B;  1EBO A;  5HFL A;  3OMI B;  5C93 A;  1QCE A;  3ZN0 A;  1FS0 G;  5KA6 A;  2XOK G;  1K97 A;  2EIJ C;  2AHY A;  1NBM G;  3ETG A;  2WLI B;  4HAM A;  5EBM C;  2AHZ A;  1KQS U;  4MVZ A;  1VQM V;  2ZR2 A;  2K1E A;  3WG7 C;  5FL7 G;  2HLD G;  3CC4 V;  3ABM B;  5HFM A;  1J95 A;  2UXX A;  2X7R B;  1Q82 W;  4RAI A;  1ORQ C;  2W6I G;  4UVC A;  3G6E V;  3ABU A;  2IW5 A;  1S5H C;  2A9H A;  2DWE C;  1VQP V;  3E2E A;  2HR3 A;  3MHH C;  4PEL A;  1PKX A;  2JEX A;  1S76 D;  4U7O A;  4WFA V;  1WLE A;  2XAG A;  5L3D A;  4UV8 A;  1OCZ B;  4WFF A;  2QKS A;  1DTO A;  1K4D C;  5KUK A;  2JDI G;  2Y69 C;  1OCC B;  1XL6 A;  2CK3 G;  3OW2 U;  2IJI A;  3ABK B;  3FB5 C;  2WLJ A;  4TWK A;  2ITD C;  4MTO A;  5LHH A;  1CPY A;  4PA4 A;  1BHA A;  2XAS A;  2B5U A;  4MVO A;  5H9C A;  1FXV A;  1Y4M A;  2XAH A;  3OUF A;  2QTO A;  3AG3 B;  1YJW V;  2JJ2 G;  2DYR C;  3WFV A;  2D3O W;  2P7T C;  3VOU A;  1VQK V;  1CP9 A;  1JOY A;  2BOB C;  2V1D A;  3ZRW A;  2A0L A;  3LDC A;  1PL0 A;  3AG4 C;  4UV9 A;  2EIM C;  2DWD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...