4N23A

Crystal structure of the gp2 core domain from the california academy of science virus, monoclinic symmetry
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
123
structure length
123
Chain Sequence
b'ENLYFQGNMKQIEDKIEEILSKIYHIENEIARIKKLIGAIASKIIKTANYTTNALFLLNKEESEIRDHVVEHELALNYLLAHQGGLCNVVKGPMCSSDIDDFSKNVSDMIDKVHEEMKKFYHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GP2 Ectodomain
publication title Structural Characterization of the Glycoprotein GP2 Core Domain from the CAS Virus, a Novel Arenavirus-Like Species.
pubmed doi rcsb
source organism Cas virus
molecule tags Viral protein
total genus 52
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4n23A00
4FK5C 4N23A 5H9CA 4JGSA 1Y66A 5KA6A 3M99B 1SZTA 1MOFA 2X7RB 1MG1A 2LP7A 1K33A 3MHSC 5HFMA 2EZPA 5HFLA 4FJCC 4E2LA 1QBZA 4JPRA 3P30A 1DF5A 2EZOA 3B8NA 3K9AA 5CN0A 3WFVA 2MK3A 1ENVA 1EBOA 4JF3A 2P6JA 3H01A 1QR9A 3CYOA 1K34A 2OT5A 1JPXA 1I5XA 2EBOA 2M7WA 1QR8A 1Y4MA 5KA5A 5CMUA 4G2KA 3GWOA 1DLBA 1QCEA 3MHHC 3CP1A 4N21A 4FIPC 1JQ0A 1F23A 3B8MA 1DF4A 3B77A 1I5YA
chains in the Genus database with same CATH superfamily
4P30A 3T2MA 1B04A 4O4JB 4CS4A 1CXZB 5JJEB 4DR5B 2ZE6A 2PYLA 4HAMA 1MNGA 1KYOF 2HHHB 1V55C 1URFA 3ABLB 3ZEDA 5IJ0B 4JYCA 3JD4A 4MTXA 4QNHB 3J80N 2EIMB 1Q6IA 4X88A 4TV9B 5JH7A 4JAAA 5GONB 5LP6C 1CPYA 1M57B 2ADQB 4FLUA 4EFEA 1S0VA 4NTWA 3UCSC 3U10A 2IBZH 5EC1C 2RQ6A 4CH6A 2OT5A 5L3EA 3ZHSA 2AZ2A 4GKKB 3D3IA 2KQXA 5GW7A 3B2EE 1FXKC 4NXMO 1I7FA 3F7YC 3H1LH 3BCCH 1OJHA 4A5UB 3QO7A 2L6LA 3VOUA 4NVPA 2CH7A 1UPGA 3SPJA 2XOKG 3BRCA 3RWRD 2RNBA 4D6TH 3AK2A 3E22B 1K92A 2DJVA 1VP7A 2UXBB 5FPRA 1QVFU 2GSMB 2YEVA 1YDXA 2JRIA 3VQVA 2ZM6O 4B3RB 2LQTA 3K9SA 4B3MB 1S5LZ 2HEPA 3IAYA 4JASA 1I0HA 5KUKA 5DECA 2P6JA 2EULA 1IXMA 1DGSA 3CRMA 5H2FZ 2NLJC 3AG4B 5JH7B 1QU7A 3MHHC 1N32B 3L9DA 2EINC 3U0ZA 1QVGU 1AP5A 4TQFA 3TETA 1XL6A 1R3JC 2EZPA 1BQZA 3HKEB 4TOIA 3ASOB 4LF6O 3ZMSA 3E2EA 3D3QA 1XQ8A 1VQOV 4X89A 1H38A 3BA8A 4X1KA 5CMUA 2ZKOA 1AP6A 5LHGA 3B8MA 3EFFK 4X9QA 4CC6A 2UXNA 3CCRV 3JAKA 4DK0A 5FL7G 1L1FA 3CX5F 3S3XA 1XMOO 3FYEB 1SERA 1BL8A 4RUEA 3RBZA 3A0BZ 2IJHA 3OMIB 3AG1C 4IHJA 4J11A 1YVWA 1WJZA 4JAUA 2Q7HA 3ZX6A 3A0HZ 3ABKC 4I50A 3SJCC 2X6BA 3JAWB 3LDDA 4JPRA 1MA1A 3RYIA 2JGDB 3CS5A 5GTIZ 5H5NA 3UO2A 1H2SB 5D5PA 4U7OA 1Y4MA 4YIOA 3K06A 5IJ9A 1IBLO 4NXMB 1ZLZA 2QWOB 2WWWA 4UVBA 5BMVA 1F23A 4PELA 4CH3A 3RYCA 3E8HA 5LGUA 1ZAUA 1XNRO 4CBCA 2ATKC 2QKCA 3U11A 3RFRA 1ZX3A 2PTMA 3ASNB 1H2GA 5LYJA 1N33O 1B06A 3SYAA 2ZQMA 3ZRWA 1FJGO 3JAKB 1W2BU 2Y69C 3S3WA 1K8AW 2IJIA 1M90W 4PV1B 1R73A 3K3WA 2HVKC 4CS3A 3OM3B 2Z0AA 4BW9A 3N2KA 3K57A 1LUWA 5CN0A 4ZI7B 1TA8A 1BZKA 2AW9A 4ZOLB 1CP9A 1OCOC 4TSFG 2QGNA 5BY1A 3OMAB 2MW2B 4DYLA 2KKWA 3MAQA 2YSUB 2DMXA 4LF6B 3VQYA 1WPBA 2OIEA 4GX0A 2LJ2A 1ROPA 5IWAB 4J9ZB 2QM7A 2QTOA 4IYHA 1IXBA 5L3DA 1NBMG 1KU9A 2ADPA 4NXNB 1Y74B 4UXNA 2Q67A 1L0LH 1PD3A 4JI6O 2E74B 2RDCA 4QE9A 5LYJB 2X6AA 1HW7A 2UU9O 1XMOB 3O9OA 1XL4A 3D36A 5EC2C 2Q6AA 4NB5A 4O4LA 1LR1A 3JASB 3JARA 1RPOA 4ICGA 1SQXH 3ZMUA 2Q4PA 1VQ6V 1YJ9V 2LGQA 2JK5C 1IURA 1US6A 4JI3B 1FKAO 2Q68A 4B7EA 2CE4A 4Q6GA 4GT1A 5JCOC 3K79A 1WAZA 2Z5UA 3HKCB 2UXXA 1Y76B 4YIPA 2DW4A 1Q82W 4F6EA 3ZHTA 2XASA 2M7WA 1IBLB 4OPHA 4JI5O 1DF4A 4J7KA 1JX9A 2CTRA 2Q69A 4MVOA 2E75B 3CB2A 3ABMC 3SJQC 2Q73A 1JFFA 4UCOA 4MVZA 4B7KA 3KCYA 2AHZA 5B66Z 4YHHO 1QR9A 1FJGB 1HNXO 3ETQA 2D2CB 4JZGA 1JVMA 2DWDC 4O4LB 3DSQA 5EZYB 2FYUH 5D5QA 3UT5A 3QTCA 2F4VO 3LSQA 2JS5A 1GN2A 5IT9N 3HKBA 4MVQA 1VQ9V 3CCSV 4MVSA 4LH6A 3M99B 5K1PA 1VARA 5KAFZ 4UVCA 4DR7O 1D5NA 3APOA 3X2QB 1YCIA 3JATB 3FB6C 3UKMA 5IDJA 4QPJA 1H2MA 1GM9A 1NJIW 3AG3C 2CTPA 1A32A 1VQPV 4JV5O 2DE0X 2HVJC 2CUGA 5LGTA 3OGCC 4DV7O 3K04A 3B77A 4P9PA 5B1BB 4DUYO 4JI6B 3F5TA 5H9CA 2E5LO 1MOFA 1R6NA 2UU9B 3B40A 3H1HH 1IBKO 3IFXA 3RGBA 4WFEA 3WFVA 1W59A 5LXTA 2DYSC 5IYDO 3ZN1A 5B1AC 4GZRB 2IJJA 2YXYA 2DYRC 4DV3O 3KKYA 4CH5A 4DUZB 4JI4O 5KHIA 1R1BA 1SC5B 4FLWA 1N4CA 2CAZC 5K1XA 1AILA 1ZSPA 3E8BA 3BEHA 5L3CA 2CK3G 3IC9A 3IGAC 3E89A 4JI5B 1L8DA 4LWSB 5TISZ 1JQ0A 2EIMC 1BT8A 1ZWIC 1M4UA 4LFBO 3ZBHA 4MVUA 1AR5A 2VQEO 1M57C 2OWOA 3B8NA 2WLIB 4WCEV 4GX1A 4YHHB 3JSLA 1H2KA 5A2QN 4JTDB 3J81N 1BCCH 2JDIG 2ZE5A 1CEZA 3OR7C 3DC5A 5BZBA 2ZR3A 3K0DA 3LSSA 4J41A 1VQNV 2CDYA 4FFBA 5CA0A 1FPOA 1MG1A 1BQ0A 1KP3A 1PNKA 2O57A 2W6IG 1P7GA 3SYPA 4LF5O 2NNUA 2EZOA 2WLLA 4HYOA 3ZS8C 2R9IA 2F4VB 1N8RW 4IGGA 3DXRB 5JQGA 4TQDA 2H94A 4UB8Z 5AG2A 5ITZB 5EBLC 4DR7B 2YIAA 4WFGA 2UUAO 1Q7YW 3JD1A 4PDRA 2XT9A 3SGIA 4JV5B 2NN4A 3AG4C 2JEXA 4WF9V 3LDEA 3AK3A 4JYAB 1S5JA 3MD0A 2K1EA 2B9ZA 4DUYB 1Q90D 1EFRG 2HLDG 1VQLV 2E5LB 3PN1A 4QIWF 1IBKB 1KKDA 4Z1VA 3B09A 3ICXA 5CBFA 4DV0O 3ZHUA 4O4HB 4BIOA 1H2NA 3ASOC 4JI8B 1EBOA 5B3SB 1N34O 1OCRB 3BHPA 3R65A 4FFBB 3BVOA 1G6UA 3LUTB 3H1IH 1IBMO 3IJ4A 1ZL8A 4WFFA 4YJ2A 4JI4B 3ZMVA 4ZHQA 3JAMN 5J2UB 2AHYA 5KA6A 1P84F 5KHJA 2BE3A 1WLEA 1SETA 1EN5A 2UXCO 2V4DA 4JTAB 5LGNA 1QHTA 2ARHA 3A2FA 1AR4A 1Z2GA 2LW7A 3T4DA 1RPRA 1RSOB 3WB1A 1F7YA 1IDSA 4W4LA 5L3FA 2BTQA 2ZDIA 1G8MA 2ZXWC 4LNUB 5KLVH 1THZA 1SQBH 1IZ3A 4LFBB 2AXTZ 4B08A 1AI6A 1B3QA 2VQEB 3W7WA 3FFQA 4X62O 3HR0A 4B3TO 1DF5A 4BR6A 2XAJA 4DR6B 3H1JH 4NTXA 2GTSA 3H01A 5F2VO 3EVKA 2XAGA 2G38A 2FKXA 4O2BA 4H33A 4I0XB 2QSAA 4RQFA 2AGAA 4LF5B 2DWEC 2HR3A 4X20B 2WLNA 2WLJA 4DRXB 3GB7C 4KUMA 3QO5A 1M56B 4J10A 3ASNC 4DR1B 5LOVB 3R66A 4O4IA 4X1IA 4ZHQB 1VQ4V 1D2DA 3SPHA 2VQFO 1XHXA 2P4VA 3ZMZA 2W0XA 4DV4O 1W0JG 4UV8A 1NTKH 2N74A 2KG7A 2IM9A 2GUZA 4PA4A 2VS0A 4Q20A 2UUAB 3K0GA 3W7XA 2B1IA 3CHXA 1GH6A 3AG2C 4GUNA 3G4SV 2YXLA 4MT8A 1AJNA 2EILB 4BIUA 2LW1A 5C8YA 3I5DA 4KHPO 2EBOA 5J9PC 1NZ6A 3G6BA 1AVMA 2AZ0A 1AJQA 4CS2A 4CH4A 3ML0A 1Q5OA 3CXHF 1ZUQA 2LP7A 4DV0B 1XOUA 2HG5C 1S5HC 1TUBA 1HNZB 3SPGA 5LP6A 1ZTEA 1N34B 2PI5A 2BTOA 2FTKA 2W6JG 4AILC 1IBMB 2WPDG 3AEIA 1BMFG 4FMTA 2CH7B 1PL0A 5LBQA 1R3KC 2EIJB 4H44B 4MVRA 2UXCB 1FD9A 1FXKA 5BR8O 3N27A 2JGUA 2GV9A 4ASUG 3BFRA 3ZHQA 3BABA 2ZNIA 2CTWA 2GBOA 3RYFA 3OT7A 1KD1W 3DTUB 2KG7B 1FYJA 2YEVB 1VF6C 4WFAV 3K5OA 5CA1A 1B6QA 1E1QG 4GYCB 2Q0AA 2ODMA 4X62B 4B3TB 2V7QG 1WA8A 2VWJA 4KXRA 1R3IC 3E8GA 5KHKA 1AI4A 1NT2B 1OV9A 2LGWA 1PP9H 2DQ0A 1S77D 1U96A 4JI2O 2N04A 4WBNA 3VBBA 4MS2A 1NH2B 1LUVA 1I5YA 2ZINA 4FLYA 2Y48A 4I55A 1GRJA 4X64O 1IVSA 3A8TA 4FLZA 3CCUV 4LC1A 4NYKA 4X1KB 2IW5A 4BIZA 3W7TA 2VQFB 3SYQA 3K5NA 5FPOA 4DV4B 4DR3O 2QWRB 5CB4A 5CBHA 3ZCCA 1QQCA 2ZM6B 3RYFB 1NR1A 1P49A 5IYBO 1K3EA 1K97A 3EXAA 3C90A 1K5QA 3ZRSA 4IHJB 4FLTA 3ZMTA 4FM2A 4KHPB 2YC0A 2OCHA 3H1KH 5FNVA 4I50B 1DLBA 1WA8B 2F23A 3RYIB 1SQQH 3X2QC 1VIBA 4WBNB 3WU2Z 4JI1O 1NI8A 5IJ9B 3O65A 4LF9O 1YXBA 4BWAA 2XAHA 5BMVB 2X6CA 4K0KO 1SKVA 4B3SO 3RYCB 4OGQB 4GKJO 1UFIA 4I55B 1MSDA 3LSUA 3KZIZ 2EINB 3P3NA 4MTFA 3BAAA 4NKGB 4BW5A 2P5OA 4DXWA 1H8EG 1SA0A 4UCUA 5CA3A 1X59A 5BR8B 5KMGA 1SF9A 1SQFA 4HNAA 3ZRWB 2QDOA 4U3JA 1WP7A 3ETGA 4UVAA 4TV8A 1SZXA 3OTOO 2OTLV 1NU1H 2OIGA 3FD9A 1VEWA 4F6RA 4PA3A 4TWKA 1W0KG 3BPZA 3ABTA 4G27B 3N2KB 1WPXA 3TGUH 2H8PC 1KBHA 4R7CA 1PKXA 4DW0A 2ZE8A 4HBNA 2A9HA 1OHHG 1RFYA 1DTOA 1SRYA 3RYHA 1M9NA 1X4TA 4D7SA 4DR2O 5LMNO 4WFBV 1EM1A 2FL4A 3GVMA 3CXCU 4DK1A 2JJ1G 3ZJZA 4X64B 1XNRB 1YEWA 3TCUA 4UFZA 3B4SA 2UUCO 3F5WC 4DW1A 1O9HA 2OCCB 1Q43A 1N33B 3CRRA 4DR3B 1SA0B 4H0LB 5KMGB 3SYCA 4J9YB 2P06A 4K8XA 3SPCA 1J5EO 4TV8B 5EYPA 3THOA 5E1AC 3CC2V 4F6RB 1TAEA 1PNLA 3JARB 1KECA 4X65O 3JSNA 4FM1A 4AQYO 1RP3B 3Q4HA 2PF4E 2F95B 5IE9A 1IX9A 1GM7A 3OEHG 2Y69B 2Y4UA 1BS3A 2JS3A 5KX5A 4N23A 2Q9LA 1Y6XA 3WB0A 5IYZA 1Q8IA 1RM1B 2QTSA 2PY5A 4JI1B 4UCSA 4LF9B 2VWKA 2Y4TA 3I56V 1JMKC 1Z5WA 2RCVA 1K4CC 4K0KB 2A7WA 3STZC 3CJHA 4B3SB 3HB3B 4D7TA 4GKJB 5JCOA 1NVPD 2Q0OC 4UCRA 1S3JA 4GX2A 3BY6A 3ZRVA 1R3LC 4PI2A 3G67A 3QG5A 1JFFB 1FFXA 2X0LA 1PPJH 4DO2A 2XUMA 1YJWV 4DV6O 4G28B 2EIKC 2ZIOA 1FXVA 2IH3C 4QPKA 1SS3A 1OCCB 1V54C 4LFAO 1N0JA 5B1OA 1K34A 3JD2A 5EYPB 5LL6Y 3WG7C 1E79G 3CRAA 4AI8A 3CC4V 2YIBD 3DGEA 4OX9O 1Y66A 4FM0A 2Z3YA 3UT5B 3Q4HB 3HKBB 4LFCO 1JR9A 4DR2B 5LMNB 3FB8C 3OAAG 3ABLC 4I4TA 3JALA 4P9OA 1HWYA 4PDLA 4H37A 2ZNJA 4IIJA 1WN7A 1K7DA 2UUCB 4JI7O 2QWQB 1AI7A 4PHZA 1K5SA 3ZRXA 3TXSA 2MK3A 4LF7O 1G4YB 4FFKA 2Q5ZA 2B1GA 1HNXB 1FFXB 4YY3O 1R6TA 3T4ZA 1J5EB 1XHZA 3FAVA 5LXTB 3BA9A 1V9PA 4DV5O 5EIBD 5L3GA 3ABMB 4JTCB 4AQYB 4YJ3A 3CEIA 3T1YO 3K5LA 5A9GA 2ILMA 3RW0A 1YZBA 1Y67A 4OPAA 3KCXA 4JYYA 5IY5B 2WAMA 4TUYA 4DV2O 4QE7A 4DR4O 1AR1B 1XNQO 1H8HG 4I4TB 1YIJV 2K9PA 4EEQA 1SESA 2ITDC 3JALB 2EILC 3HKDA 5EIBC 2ETNA 4X66O 1OZ0A 1K9MW 4IIJB 1L0NH 3FYIB 2QKSA 4DV7B 3LNMB 3CP1A 1GAXA 2YDEA 1FAFA 4B3RO 5IJ0A 2ZCEA 1SQGA 4DV6B 4JYBA 3RT3C 1M93A 3FX7A 4P2ZA 3E8FA 5GONA 4LFAB 3OR6C 2DOSA 2ZT9B 1YJNV 2WLHA 3SR2C 3CCMV 1XBLA 5CA0B 1DK1A 3AK1A 5H6QA 2WA4A 4DV3B 3OUSA 4OX9B 1NS1A 2WLLB 2P67A 2EIJC 1R6KA 2VRZA 4TT3G 2F1MA 3G80A 3W7SA 2HKOA 5JQGB 4E4EA 2OTJV 3QNEA 1UJWB 4Z1MG 2OYQA 2DYSB 4TUYB 2ZIMA 3GWOA 3L71H 2JVDA 1VF7A 4I9WA 2DYRB 1T5EA 1NR7A 3E22A 3HKDB 4J42A 3L75H 3TXQA 2WLMA 1MMMA 3DC6A 4JI7B 4PJ0Z 1VQ5V 4X1YA 3VQWA 4LF7B 2QKAA 2UXDO 5B1NA 3W7UA 3QF7A 4FZ1A 4QJFB 4YY3B 2HP8A 1VQ7V 2V1DA 4G2KA 1J95A 4RWUA 3K5MA 3CCVV 5LA6A 1BHBA 1OCZB 5E79Z 3CC7V 4I9QA 1WB7A 4IL6Z 4DV5B 3M8AA 2XAQA 1E1RG 1O9GA 4LBEC 1QLNA 1GO3F 3T1YB 1ZL8B 4YJ2B 2E76B 2YI9A 1HDJA 3HKEA 1QR8A 1XDCA 4MSWC 2QM8A 4O2AA 1YHQV 4GLXA 4DV2B 3TJTA 2NR5A 4DR4B 1XNQB 2A79B 2GTAA 2IJKA 2XHBA 3QO8A 2QE7G 4E2LA 2BTQB 2YXHA 4FVMA 3ETDA 3P30A 2FMLA 2PGGA 4X66B 2JJ2G 3ZHRA 1NTMH 3OGIB 1VMGA 1WNSA 4FIPC 1COWG 2X7RB 4X1YB 1PNMA 3UQ8A 1YITV 3J7AU 3CSXA 1I94O 2C2AA 4YXWG 3OUFA 2IU3A 2QEXV 4PD4F 1Q3EA 4O2BB 5LA6B 3E86A 2R72A 3JAWA 3K03A 2GDSA 1PV0A 5H6RA 2JGDA 4ZKIA 1U97A 5JVDA 3CCEV 1Q6UA 1QLEB 4K35A 4J80A 1GM8A 4O4IB 2PZSA 2CTQA 1BE3H 4X1IB 4O2AB 4FLVA 2F93B 1EZVH 2P90A 1D5AA 2R9RB 4PI0A 4ZIBA 5IWAO 4J7ZA 2GUZB 2XTAA 4GCZA 3MDSA 1XUQA 1H2LA 1QCEA 4NXNO 2KSDA 4XDJA 1F51A 3JD0A 1JA8A 2KB1A 3C3SA 3CD6V 1WP8A 5C8YB 1PM9A 1NKDA 3CRQA 4J7JA 2UXDB 3T1HO 2LFSA 2ZR2A 4MTGA 1XMQO 4ZI7A 5KA5A 1V55B 2EJRA 2QJ1A 2WA3A 2ZXWB 1GKFA 2BOCC 1YF2A 1YTFB 1TUBB 4ZOLA 1EZJA 5LMUO 3APQA 2QR4A 2R70A 3MHSC 4JI3O 5LP6B 1F4NA 2ITCC 2OCCC 4PA7A 4F4LA 5JVDB 3M7MX 1HR0O 1GMGA 3L70H 2Y0IA 4OXSA 1FXKB 2D3OW 2BSKA 4FK5C 4JI0O 4JGSA 2PI4A 4FZ0A 3D36C 1XEQA 2XAFA 3CCJV 4NR1A 1Y74A 3ZN0A 4MTOA 4W4KA 4LF8O 5CA1B 2QWNB 2HJDA 3PJSK 1JPXA 2WLKA 2W0FC 1SQVH 2YI8A 2PYJA 4CC5A 3OEEG 1GN3A 3EHBB 4LCUC 4EB6A 3JASA 4LP8A 1Q6HA 1VF6A 2YUAA 4CZZA 1RM1C 1I94B 1S72V 2A3QA 4XBFA 3AG2B 3ZHVA 2CGNA 4UV9A 1NTZH 2DQ3A 5KAIZ 1MZEA 4MW8A 1F4MA 3HKCA 1WB8A 1Y76A 4XDLA 5C93A 5B1BC 4UCVA 4JZ2A 1JJOA 1FS0G 3NR7A 1JOYA 1OCCC 2HFEC 2YICA 3OTFA 1M5IA 5CB4B 4JF3A 1QNMA 2BSKB 3E35A 3OD4A 3L74H 2CGOA 3ABUA 4DV1O 3AG7A 2UUBO 1KQSU 4ZBMA 3CCQV 1PL4A 1Z5VA 5DM6V 5HFLA 2ZE7A 3SJBC 3T1HB 5LHIA 5FNVB 3ZIAG 4KP4A 4EB6B 4JI2B 3IC7A 3CYOA 1XMQB 4LF4O 1BHAA 5EZYA 2RN9A 3K58A 4AHCA 3AG1B 2H3OA 5LMUB 4DUZO 3N2GA 4RUFA 1EN6A 4FLXA 3ABKB 3SPIA 3F7VC 4PDVA 4PA6A 1VQ8V 1HR0B 2F66C 1KB9F 4X8AA 1N0NA 4LH7A 3FB5C 3JATA 1XI1A 5J2TA 4JI0B 4HNAB 5JWPA 2M6YA 4UCTA 4U3JB 4UB6Z 1FFTB 5HFMA 1K73W 1TVKA 1K4DC 1HNWO 4LF8B 4EFBA 5L3BA 4MW3A 3CE2A 4RQEA 5IY5C 1XILA 1XREA 4L8JA 2IH1C 3RYHB 3C3TA 4RO2A 3P32A 3CPWU 2A0LA 1BGYH 4PA9A 4XDKA 1VQMV 4LR3A 3CRCA 3N2GB 3RN4A 1MZFA 1M1KW 4L87A 4Z2WA 1Q81W 1OCOB 3K59A 1MSWD 1BSMA 3RVZA 3SYOA 5LHHA 2ZD9A 4K3AA 2LFRA 2P7TC 4LWSA 1S76D 1YI2V 3UO3A 5J2TB 3JD3A 3OE7G 3UM7A 3OTOB 4BAYA 5B3SC 5JJJB 4JAVA 1OCRC 1GK9A 2WLIA 2Q8VA 4RAIA 2A06H 3OW2U 2DN9A 4JYAO 1LNQA 3TK1A 2E3CA 1TVKB 3P3PA 4DV1B 1KP2A 4PDMA 2UUBB 5JJNB 4HZ3A 5FLXN 1SZTA 1N36O 3A0RA 4UUJC 4FJCC 4JI8O 3LDCA 2R9AA 2B5UA 3K9AA 4LF4B 3JCUZ 3JYCA 5KHGA 1I5XA 5KX5B 2N05A 1AROP 5IYZB 1TUEB 3H9VA 2RMKB 2QWPB 1AJPA 2YIDA 3DXRA 2Q7EA 2WSSG 1SQPH 1NQTA 3CJHB 3CMAV 4R6ZA 3HPLC 5CBGA 5ITZA 2XNDG 4DR5O 3G6EV 3SJAC 2HHHO 4IYIA 3OFNG 4I5SA 1AI5A 4KFMA 1VF5B 4N21A 3T1CA 3RVYA 1OCZC 3K08A 4MVMA 3E83A 5BXZA 3OMNB 1KC8W 3L73H 5DN6G 3WB2A 5IYCO 1HNWB 5EBMC 4GX5A 3KG2A 1M56C 3NXSA 2P4KA 1ENVA 4X65B 4DR6O 4I7ZB 4WFHA 4H13B 4O4HA 3L72H 4C7UA 2PUSA 4GKKO 4IT5A 5DEDA 2LO1A 2Q7GA 2BOBC 4R50A 3CWBH 1P4RA 3G71V 2FB5A 1K33A 3FKSG 1G1XB 1P7BA 5EBWC 3QVNA 2ZDIC 1TGOA 1QBZA 3CCLV 2Y0PA 1GN4A 2F43G 4DR1O 5J2UA 2GHYA 2JEUA 3I55V 1MABG 4U7NA 3GWKC 2BCCH 3FB7C 4O4JA 4FPPA 4EKWA 2HJFC 2QM4A 1RSOA 2UXBO 1KKCA 1KUQA 1YSCA 2YS8A 4LNUA 1HP8A 1GTOA 3ETEA 4B3MO 4U3FH 4K8ZA 2QA4V 3VQXA 3D8CA 1KMIZ 2L35A 4TV9A 4ABMA 2YIBA 1VQKV 2EJ7A 3AG3B 1JCHA 2RJZA 1GN6A 4KL1A 3FAVB 3CMEV 1N32O 3LNNA 1QLEC 1N36B 5KUMA 4YJ3B 2JIZG 1EN4A 3STLC 2IU0A 5GTHZ 4QGPA 4R8CA 5EK0A 2P22C 2EIKB 1AB3A 5B5EZ 1HNZO 4I0XA 1JJ2U 4LFCB 1FXHA 2EX3A 3SDLA 4X20A 1V54B 1ORQC 4DRXA 3JCZA 1NH2D 5KHHA 1YTFD 5B1AB 5LOVA 4NTYA 1Q86W 1I08A 3WG7B 1NVPB
chains in the Genus database with same CATH topology
1WPXA 2KB1A 4P30A 3T2MA 2H8PC 3CD6V 4R7CA 1NKDA 1PKXA 2A9HA 3E8BA 3BEHA 1OHHG 1SRYA 1DTOA 4HAMA 5L3CA 2CK3G 2LFSA 1M9NA 2ZR2A 4MTGA 4WFBV 1V55C 3IGAC 3ABLB 5KA5A 3E89A 1V55B 2EJRA 2ZXWB 1GKFA 2BOCC 4JYCA 3JD4A 1JQ0A 2EIMC 4MTXA 4QNHB 1YTFB 2EIMB 4X88A 3CXCU 1ZWIC 2JJ1G 1EZJA 3ZJZA 4MVUA 3MHSC 1M57C 1CPYA 3TCUA 1M57B 1F4NA 1S0VA 2ITCC 3F5WC 3B8NA 2WLIB 4WCEV 2OCCC 4PA7A 4F4LA 4GX1A 2OCCB 5EC1C 1GMGA 2OT5A 4JTDB 5L3EA 3D3IA 5GW7A 2JDIG 1FXKC 4OXSA 3SYCA 1FXKB 1CEZA 3OR7C 2D3OW 5BZBA 2ZR3A 3F7YC 4J9YB 3K0DA 3LSSA 4FK5C 1VQNV 4JGSA 3SPCA 2PI4A 1MG1A 1KP3A 1PNKA 2XAFA 2W6IG 3CCJV 3QO7A 5E1AC 3SYPA 3VOUA 3CC2V 2NNUA 3ZN0A 4MTOA 1PNLA 2EZOA 2WLLA 3SPJA 1KECA 4HYOA 2R9IA 2XOKG 3PJSK 1N8RW 1JPXA 2WLKA 2W0FC 1K92A 3OEEG 1GM7A 3EHBB 3OEHG 4LCUC 2Y69B 1QVFU 2H94A 2GSMB 2YEVA 4N23A 4LP8A 5EBLC 4CZZA 1RM1C 4WFGA 1RM1B 1Q7YW 1S72V 3JD1A 3AG2B 4PDRA 4JASA 4XBFA 5KUKA 4UV9A 3I56V 2DQ3A 1K4CC 2P6JA 3STZC 3AG4C 1IXMA 3HB3B 2JEXA 4WF9V 4MW8A 2NLJC 3AG4B 3LDEA 1F4MA 1NVPD 3MD0A 3MHHC 2K1EA 4XDLA 5C93A 2EINC 1S3JA 4GX2A 5B1BC 1QVGU 3BY6A 2HLDG 1EFRG 3ZRVA 1R3LC 1VQLV 2X0LA 4QIWF 4DO2A 1KKDA 3TETA 1YJWV 5CBFA 1XL6A 1R3JC 1FS0G 2EIKC 2EZPA 4G28B 1FXVA 2IH3C 3ASOC 4QPKA 3ASOB 1JOYA 1OCCC 2HFEC 1EBOA 1OCCB 3ZMSA 4JF3A 3E2EA 1V54C 3E35A 1K34A 3JD2A 5B1OA 5B3SB 1VQOV 4X89A 1OCRB 3R65A 1H38A 3LUTB 5CMUA 5LHGA 3WG7C 3B8MA 4WFFA 3EFFK 1E79G 3ABUA 3CC4V 2UXNA 3ZMVA 3DGEA 3CCRV 1KQSU 1Y66A 2AHYA 5KA6A 4ZBMA 2Z3YA 3CCQV 1WLEA 1SETA 5FL7G 1L1FA 5DM6V 5HFLA 4JTAB 5LGNA 5LHIA 3FYEB 3ZIAG 4KP4A 3T4DA 1RPRA 1SERA 3IC7A 3CYOA 1BHAA 1BL8A 5L3FA 3FB8C 4RUEA 2ZDIA 3ABLC 3OAAG 3RBZA 1G8MA 2IJHA 3OMIB 2ZXWC 4P9OA 1HWYA 3AG1C 4PDLA 4H37A 1THZA 3AG1B 4JAUA 4RUFA 1AI6A 3ABKC 2X6BA 3W7WA 3ABKB 1K7DA 3F7VC 3SPIA 4PDVA 4PA6A 1AI7A 3LDDA 1VQ8V 4JPRA 1DF5A 2XAJA 1K5SA 3ZRXA 2MK3A 1G4YB 4X8AA 3H01A 3FB5C 2B1GA 1Y4MA 4U7OA 3K06A 2XAGA 2WWWA 4H33A 4UVBA 3T4ZA 1F23A 4PELA 3E8HA 5LGUA 1FFTB 4RQFA 5HFMA 2DWEC 2HR3A 2WLNA 2WLJA 4CBCA 1K73W 1K4DC 3GB7C 4KUMA 2ATKC 3QO5A 3ABMB 5L3GA 1M56B 3ASNC 4JTCB 5L3BA 3ASNB 1H2GA 4MW3A 3SYAA 1VQ4V 2ZQMA 3ZRWA 3SPHA 4RQEA 3RW0A 1W2BU 3ZMZA 5IY5C 1W0JG 5IY5B 2Y69C 4UV8A 2WAMA 1K8AW 4QE7A 4PA4A 2IJIA 4Q20A 1M90W 1AR1B 2IH1C 3K0GA 3W7XA 1R73A 2B1IA 3K3WA 1H8HG 2HVKC 3OM3B 4RO2A 3AG2C 3P32A 3G4SV 1YIJV 5CN0A 1SESA 2A0LA 2ITDC 3CPWU 2EILC 4MT8A 4PA9A 1AJNA 2EILB 4XDKA 4BIUA 1OZ0A 1K9MW 1VQMV 2EBOA 1M1KW 3FYIB 5J9PC 4L87A 1CP9A 1OCOC 1Q81W 4TSFG 2QKSA 1OCOB 1MSWD 3LNMB 3CP1A 1AJQA 3ML0A 3OMAB 3RVZA 3SYOA 5LHHA 2LP7A 2ZD9A 4JYBA 2LFRA 2P7TC 1S76D 2HG5C 1S5HC 1YI2V 2YSUB 4P2ZA 3E8FA 3SPGA 4GX0A 3JD3A 3OR6C 3OE7G 1YJNV 3UM7A 2WLHA 1ROPA 2PI5A 4BAYA 5B3SC 4J9ZB 4JAVA 1OCRC 3CCMV 2QM7A 2QTOA 5L3DA 1GK9A 2WLIA 4RAIA 1NBMG 2FTKA 2W6JG 3OW2U 5H6QA 1LNQA 2WPDG 3AEIA 3TK1A 3OUSA 1BMFG 1KP2A 4PDMA 4FMTA 1PL0A 4UXNA 2Q67A 1PD3A 5LBQA 1R3KC 2WLLB 2P67A 4HZ3A 2EIJC 1SZTA 1R6KA 2EIJB 4MVRA 4QE9A 4TT3G 2X6AA 3A0RA 1FXKA 4UUJC 3W7SA 2HKOA 4FJCC 4ASUG 2OTJV 3QNEA 3LDCA 3K9AA 2B5UA 1UJWB 4Z1MG 1KD1W 1XL4A 2DYSB 3JYCA 3D36A 3DTUB 5EC2C 1I5XA 2Q6AA 2YEVB 1AROP 4WFAV 1RPOA 1TUEB 3GWOA 3ZMUA 4I9WA 1AJPA 2DYRB 1NR7A 1B6QA 1VQ6V 1E1QG 1YJ9V 2JK5C 2WSSG 2WLMA 1NQTA 2V7QG 2Q68A 3CMAV 4GT1A 1VQ5V 4R6ZA 3HPLC 3K79A 1R3IC 5CBGA 2Z5UA 3E8GA 2UXXA 1AI4A 2XNDG 2DQ0A 5B1NA 1S77D 3W7UA 2DW4A 1Q82W 3G6EV 2XASA 4QJFB 2M7WA 1VQ7V 3OFNG 2V1DA 4G2KA 4I5SA 3VBBA 1AI5A 1J95A 4KFMA 4MS2A 1NH2B 4N21A 3T1CA 3CCVV 3RVYA 1DF4A 1I5YA 1BHBA 1JX9A 1OCZC 3K08A 4MVMA 1OCZB 3E83A 2Q69A 3CC7V 2Y48A 4MVOA 3OMNB 1KC8W 5DN6G 5IYCO 2XAQA 4GX5A 5EBMC 3ABMC 3KG2A 3SJQC 1M56C 4LC1A 3CCUV 1E1RG 2IW5A 4LBEC 3NXSA 4MVZA 1ENVA 1QLNA 1GO3F 2AHZA 4WFHA 4BIZA 1QR9A 3W7TA 1QR8A 3SYQA 4MSWC 2QM8A 5CBHA 1YHQV 2BOBC 4R50A 3ZCCA 1P4RA 3G71V 2A79B 1NR1A 1K33A 3FKSG 1P7BA 2IJKA 5EBWC 5IYBO 1JVMA 1K3EA 2ZDIC 1K97A 2DWDC 2QE7G 3QO8A 4E2LA 1QBZA 3ETDA 3P30A 3CCLV 2F43G 1K5QA 3ZRSA 2GHYA 2JEUA 3I55V 1MABG 4U7NA 3ZMTA 2JJ2G 3LSQA 3FB7C 4FPPA 4EKWA 2HJFC 1DLBA 4MVQA 1VQ9V 4FIPC 1COWG 2X7RB 3CCSV 4MVSA 1PNMA 1YSCA 1YITV 3M99B 3X2QC 4UVCA 3X2QB 2C2AA 4YXWG 1GTOA 3ETEA 3FB6C 3UKMA 3OUFA 2IU3A 4QPJA 5IDJA 2QA4V 2QEXV 1GM9A 2XAHA 1NJIW 1VQKV 3E86A 2X6CA 3AG3C 3K03A 1VQPV 3AG3B 1JCHA 2HVJC 5H6RA 4ZKIA 3CMEV 5LGTA 3OGCC 3K04A 2EINB 3B77A 4P9PA 5B1BB 3CCEV 4MTFA 1QLEC 4BW5A 5H9CA 1QLEB 5KUMA 4DXWA 1H8EG 1MOFA 5CA3A 1R6NA 2JIZG 3STLC 3IFXA 1GM8A 4R8CA 2IU0A 5EK0A 2EIKB 4WFEA 3ZRWB 3WFVA 1JJ2U 2P90A 1FXHA 3ETGA 2DYSC 4UVAA 5IYDO 1V54B 2R9RB 1ORQC 2OTLV 3ZN1A 3JCZA 4GCZA 1NH2D 1YTFD 5B1AC 4PA3A 4TWKA 5B1AB 1QCEA 1W0KG 2IJJA 1Q86W 4XDJA 3ABTA 1F51A 3JD0A 2DYRC 3WG7B 4G27B 1NVPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK5 C;  4N23 A;  5H9C A;  4JGS A;  1Y66 A;  5KA6 A;  3M99 B;  1SZT A;  1MOF A;  2X7R B;  1MG1 A;  2LP7 A;  1K33 A;  3MHS C;  5HFM A;  2EZP A;  5HFL A;  4FJC C;  4E2L A;  1QBZ A;  4JPR A;  3P30 A;  1DF5 A;  2EZO A;  3B8N A;  3K9A A;  5CN0 A;  3WFV A;  2MK3 A;  1ENV A;  1EBO A;  4JF3 A;  2P6J A;  3H01 A;  1QR9 A;  3CYO A;  1K34 A;  2OT5 A;  1JPX A;  1I5X A;  2EBO A;  2M7W A;  1QR8 A;  1Y4M A;  5KA5 A;  5CMU A;  4G2K A;  3GWO A;  1DLB A;  1QCE A;  3MHH C;  3CP1 A;  4N21 A;  4FIP C;  1JQ0 A;  1F23 A;  3B8M A;  1DF4 A;  3B77 A;  1I5Y A; 
#chains in the Genus database with same CATH topology
 4P30 A;  3T2M A;  1B04 A;  4O4J B;  4CS4 A;  1CXZ B;  5JJE B;  4DR5 B;  2ZE6 A;  2PYL A;  4HAM A;  1MNG A;  1KYO F;  2HHH B;  1V55 C;  1URF A;  3ABL B;  3ZED A;  5IJ0 B;  4JYC A;  3JD4 A;  4MTX A;  4QNH B;  3J80 N;  2EIM B;  1Q6I A;  4X88 A;  4TV9 B;  5JH7 A;  4JAA A;  5GON B;  5LP6 C;  1CPY A;  1M57 B;  2ADQ B;  4FLU A;  4EFE A;  1S0V A;  4NTW A;  3UCS C;  3U10 A;  2IBZ H;  5EC1 C;  2RQ6 A;  4CH6 A;  2OT5 A;  5L3E A;  3ZHS A;  2AZ2 A;  4GKK B;  3D3I A;  2KQX A;  5GW7 A;  3B2E E;  1FXK C;  4NXM O;  1I7F A;  3F7Y C;  3H1L H;  3BCC H;  1OJH A;  4A5U B;  3QO7 A;  2L6L A;  3VOU A;  4NVP A;  2CH7 A;  1UPG A;  3SPJ A;  2XOK G;  3BRC A;  3RWR D;  2RNB A;  4D6T H;  3AK2 A;  3E22 B;  1K92 A;  2DJV A;  1VP7 A;  2UXB B;  5FPR A;  1QVF U;  2GSM B;  2YEV A;  1YDX A;  2JRI A;  3VQV A;  2ZM6 O;  4B3R B;  2LQT A;  3K9S A;  4B3M B;  1S5L Z;  2HEP A;  3IAY A;  4JAS A;  1I0H A;  5KUK A;  5DEC A;  2P6J A;  2EUL A;  1IXM A;  1DGS A;  3CRM A;  5H2F Z;  2NLJ C;  3AG4 B;  5JH7 B;  1QU7 A;  3MHH C;  1N32 B;  3L9D A;  2EIN C;  3U0Z A;  1QVG U;  1AP5 A;  4TQF A;  3TET A;  1XL6 A;  1R3J C;  2EZP A;  1BQZ A;  3HKE B;  4TOI A;  3ASO B;  4LF6 O;  3ZMS A;  3E2E A;  3D3Q A;  1XQ8 A;  1VQO V;  4X89 A;  1H38 A;  3BA8 A;  4X1K A;  5CMU A;  2ZKO A;  1AP6 A;  5LHG A;  3B8M A;  3EFF K;  4X9Q A;  4CC6 A;  2UXN A;  3CCR V;  3JAK A;  4DK0 A;  5FL7 G;  1L1F A;  3CX5 F;  3S3X A;  1XMO O;  3FYE B;  1SER A;  1BL8 A;  4RUE A;  3RBZ A;  3A0B Z;  2IJH A;  3OMI B;  3AG1 C;  4IHJ A;  4J11 A;  1YVW A;  1WJZ A;  4JAU A;  2Q7H A;  3ZX6 A;  3A0H Z;  3ABK C;  4I50 A;  3SJC C;  2X6B A;  3JAW B;  3LDD A;  4JPR A;  1MA1 A;  3RYI A;  2JGD B;  3CS5 A;  5GTI Z;  5H5N A;  3UO2 A;  1H2S B;  5D5P A;  4U7O A;  1Y4M A;  4YIO A;  3K06 A;  5IJ9 A;  1IBL O;  4NXM B;  1ZLZ A;  2QWO B;  2WWW A;  4UVB A;  5BMV A;  1F23 A;  4PEL A;  4CH3 A;  3RYC A;  3E8H A;  5LGU A;  1ZAU A;  1XNR O;  4CBC A;  2ATK C;  2QKC A;  3U11 A;  3RFR A;  1ZX3 A;  2PTM A;  3ASN B;  1H2G A;  5LYJ A;  1N33 O;  1B06 A;  3SYA A;  2ZQM A;  3ZRW A;  1FJG O;  3JAK B;  1W2B U;  2Y69 C;  3S3W A;  1K8A W;  2IJI A;  1M90 W;  4PV1 B;  1R73 A;  3K3W A;  2HVK C;  4CS3 A;  3OM3 B;  2Z0A A;  4BW9 A;  3N2K A;  3K57 A;  1LUW A;  5CN0 A;  4ZI7 B;  1TA8 A;  1BZK A;  2AW9 A;  4ZOL B;  1CP9 A;  1OCO C;  4TSF G;  2QGN A;  5BY1 A;  3OMA B;  2MW2 B;  4DYL A;  2KKW A;  3MAQ A;  2YSU B;  2DMX A;  4LF6 B;  3VQY A;  1WPB A;  2OIE A;  4GX0 A;  2LJ2 A;  1ROP A;  5IWA B;  4J9Z B;  2QM7 A;  2QTO A;  4IYH A;  1IXB A;  5L3D A;  1NBM G;  1KU9 A;  2ADP A;  4NXN B;  1Y74 B;  4UXN A;  2Q67 A;  1L0L H;  1PD3 A;  4JI6 O;  2E74 B;  2RDC A;  4QE9 A;  5LYJ B;  2X6A A;  1HW7 A;  2UU9 O;  1XMO B;  3O9O A;  1XL4 A;  3D36 A;  5EC2 C;  2Q6A A;  4NB5 A;  4O4L A;  1LR1 A;  3JAS B;  3JAR A;  1RPO A;  4ICG A;  1SQX H;  3ZMU A;  2Q4P A;  1VQ6 V;  1YJ9 V;  2LGQ A;  2JK5 C;  1IUR A;  1US6 A;  4JI3 B;  1FKA O;  2Q68 A;  4B7E A;  2CE4 A;  4Q6G A;  4GT1 A;  5JCO C;  3K79 A;  1WAZ A;  2Z5U A;  3HKC B;  2UXX A;  1Y76 B;  4YIP A;  2DW4 A;  1Q82 W;  4F6E A;  3ZHT A;  2XAS A;  2M7W A;  1IBL B;  4OPH A;  4JI5 O;  1DF4 A;  4J7K A;  1JX9 A;  2CTR A;  2Q69 A;  4MVO A;  2E75 B;  3CB2 A;  3ABM C;  3SJQ C;  2Q73 A;  1JFF A;  4UCO A;  4MVZ A;  4B7K A;  3KCY A;  2AHZ A;  5B66 Z;  4YHH O;  1QR9 A;  1FJG B;  1HNX O;  3ETQ A;  2D2C B;  4JZG A;  1JVM A;  2DWD C;  4O4L B;  3DSQ A;  5EZY B;  2FYU H;  5D5Q A;  3UT5 A;  3QTC A;  2F4V O;  3LSQ A;  2JS5 A;  1GN2 A;  5IT9 N;  3HKB A;  4MVQ A;  1VQ9 V;  3CCS V;  4MVS A;  4LH6 A;  3M99 B;  5K1P A;  1VAR A;  5KAF Z;  4UVC A;  4DR7 O;  1D5N A;  3APO A;  3X2Q B;  1YCI A;  3JAT B;  3FB6 C;  3UKM A;  5IDJ A;  4QPJ A;  1H2M A;  1GM9 A;  1NJI W;  3AG3 C;  2CTP A;  1A32 A;  1VQP V;  4JV5 O;  2DE0 X;  2HVJ C;  2CUG A;  5LGT A;  3OGC C;  4DV7 O;  3K04 A;  3B77 A;  4P9P A;  5B1B B;  4DUY O;  4JI6 B;  3F5T A;  5H9C A;  2E5L O;  1MOF A;  1R6N A;  2UU9 B;  3B40 A;  3H1H H;  1IBK O;  3IFX A;  3RGB A;  4WFE A;  3WFV A;  1W59 A;  5LXT A;  2DYS C;  5IYD O;  3ZN1 A;  5B1A C;  4GZR B;  2IJJ A;  2YXY A;  2DYR C;  4DV3 O;  3KKY A;  4CH5 A;  4DUZ B;  4JI4 O;  5KHI A;  1R1B A;  1SC5 B;  4FLW A;  1N4C A;  2CAZ C;  5K1X A;  1AIL A;  1ZSP A;  3E8B A;  3BEH A;  5L3C A;  2CK3 G;  3IC9 A;  3IGA C;  3E89 A;  4JI5 B;  1L8D A;  4LWS B;  5TIS Z;  1JQ0 A;  2EIM C;  1BT8 A;  1ZWI C;  1M4U A;  4LFB O;  3ZBH A;  4MVU A;  1AR5 A;  2VQE O;  1M57 C;  2OWO A;  3B8N A;  2WLI B;  4WCE V;  4GX1 A;  4YHH B;  3JSL A;  1H2K A;  5A2Q N;  4JTD B;  3J81 N;  1BCC H;  2JDI G;  2ZE5 A;  1CEZ A;  3OR7 C;  3DC5 A;  5BZB A;  2ZR3 A;  3K0D A;  3LSS A;  4J41 A;  1VQN V;  2CDY A;  4FFB A;  5CA0 A;  1FPO A;  1MG1 A;  1BQ0 A;  1KP3 A;  1PNK A;  2O57 A;  2W6I G;  1P7G A;  3SYP A;  4LF5 O;  2NNU A;  2EZO A;  2WLL A;  4HYO A;  3ZS8 C;  2R9I A;  2F4V B;  1N8R W;  4IGG A;  3DXR B;  5JQG A;  4TQD A;  2H94 A;  4UB8 Z;  5AG2 A;  5ITZ B;  5EBL C;  4DR7 B;  2YIA A;  4WFG A;  2UUA O;  1Q7Y W;  3JD1 A;  4PDR A;  2XT9 A;  3SGI A;  4JV5 B;  2NN4 A;  3AG4 C;  2JEX A;  4WF9 V;  3LDE A;  3AK3 A;  4JYA B;  1S5J A;  3MD0 A;  2K1E A;  2B9Z A;  4DUY B;  1Q90 D;  1EFR G;  2HLD G;  1VQL V;  2E5L B;  3PN1 A;  4QIW F;  1IBK B;  1KKD A;  4Z1V A;  3B09 A;  3ICX A;  5CBF A;  4DV0 O;  3ZHU A;  4O4H B;  4BIO A;  1H2N A;  3ASO C;  4JI8 B;  1EBO A;  5B3S B;  1N34 O;  1OCR B;  3BHP A;  3R65 A;  4FFB B;  3BVO A;  1G6U A;  3LUT B;  3H1I H;  1IBM O;  3IJ4 A;  1ZL8 A;  4WFF A;  4YJ2 A;  4JI4 B;  3ZMV A;  4ZHQ A;  3JAM N;  5J2U B;  2AHY A;  5KA6 A;  1P84 F;  5KHJ A;  2BE3 A;  1WLE A;  1SET A;  1EN5 A;  2UXC O;  2V4D A;  4JTA B;  5LGN A;  1QHT A;  2ARH A;  3A2F A;  1AR4 A;  1Z2G A;  2LW7 A;  3T4D A;  1RPR A;  1RSO B;  3WB1 A;  1F7Y A;  1IDS A;  4W4L A;  5L3F A;  2BTQ A;  2ZDI A;  1G8M A;  2ZXW C;  4LNU B;  5KLV H;  1THZ A;  1SQB H;  1IZ3 A;  4LFB B;  2AXT Z;  4B08 A;  1AI6 A;  1B3Q A;  2VQE B;  3W7W A;  3FFQ A;  4X62 O;  3HR0 A;  4B3T O;  1DF5 A;  4BR6 A;  2XAJ A;  4DR6 B;  3H1J H;  4NTX A;  2GTS A;  3H01 A;  5F2V O;  3EVK A;  2XAG A;  2G38 A;  2FKX A;  4O2B A;  4H33 A;  4I0X B;  2QSA A;  4RQF A;  2AGA A;  4LF5 B;  2DWE C;  2HR3 A;  4X20 B;  2WLN A;  2WLJ A;  4DRX B;  3GB7 C;  4KUM A;  3QO5 A;  1M56 B;  4J10 A;  3ASN C;  4DR1 B;  5LOV B;  3R66 A;  4O4I A;  4X1I A;  4ZHQ B;  1VQ4 V;  1D2D A;  3SPH A;  2VQF O;  1XHX A;  2P4V A;  3ZMZ A;  2W0X A;  4DV4 O;  1W0J G;  4UV8 A;  1NTK H;  2N74 A;  2KG7 A;  2IM9 A;  2GUZ A;  4PA4 A;  2VS0 A;  4Q20 A;  2UUA B;  3K0G A;  3W7X A;  2B1I A;  3CHX A;  1GH6 A;  3AG2 C;  4GUN A;  3G4S V;  2YXL A;  4MT8 A;  1AJN A;  2EIL B;  4BIU A;  2LW1 A;  5C8Y A;  3I5D A;  4KHP O;  2EBO A;  5J9P C;  1NZ6 A;  3G6B A;  1AVM A;  2AZ0 A;  1AJQ A;  4CS2 A;  4CH4 A;  3ML0 A;  1Q5O A;  3CXH F;  1ZUQ A;  2LP7 A;  4DV0 B;  1XOU A;  2HG5 C;  1S5H C;  1TUB A;  1HNZ B;  3SPG A;  5LP6 A;  1ZTE A;  1N34 B;  2PI5 A;  2BTO A;  2FTK A;  2W6J G;  4AIL C;  1IBM B;  2WPD G;  3AEI A;  1BMF G;  4FMT A;  2CH7 B;  1PL0 A;  5LBQ A;  1R3K C;  2EIJ B;  4H44 B;  4MVR A;  2UXC B;  1FD9 A;  1FXK A;  5BR8 O;  3N27 A;  2JGU A;  2GV9 A;  4ASU G;  3BFR A;  3ZHQ A;  3BAB A;  2ZNI A;  2CTW A;  2GBO A;  3RYF A;  3OT7 A;  1KD1 W;  3DTU B;  2KG7 B;  1FYJ A;  2YEV B;  1VF6 C;  4WFA V;  3K5O A;  5CA1 A;  1B6Q A;  1E1Q G;  4GYC B;  2Q0A A;  2ODM A;  4X62 B;  4B3T B;  2V7Q G;  1WA8 A;  2VWJ A;  4KXR A;  1R3I C;  3E8G A;  5KHK A;  1AI4 A;  1NT2 B;  1OV9 A;  2LGW A;  1PP9 H;  2DQ0 A;  1S77 D;  1U96 A;  4JI2 O;  2N04 A;  4WBN A;  3VBB A;  4MS2 A;  1NH2 B;  1LUV A;  1I5Y A;  2ZIN A;  4FLY A;  2Y48 A;  4I55 A;  1GRJ A;  4X64 O;  1IVS A;  3A8T A;  4FLZ A;  3CCU V;  4LC1 A;  4NYK A;  4X1K B;  2IW5 A;  4BIZ A;  3W7T A;  2VQF B;  3SYQ A;  3K5N A;  5FPO A;  4DV4 B;  4DR3 O;  2QWR B;  5CB4 A;  5CBH A;  3ZCC A;  1QQC A;  2ZM6 B;  3RYF B;  1NR1 A;  1P49 A;  5IYB O;  1K3E A;  1K97 A;  3EXA A;  3C90 A;  1K5Q A;  3ZRS A;  4IHJ B;  4FLT A;  3ZMT A;  4FM2 A;  4KHP B;  2YC0 A;  2OCH A;  3H1K H;  5FNV A;  4I50 B;  1DLB A;  1WA8 B;  2F23 A;  3RYI B;  1SQQ H;  3X2Q C;  1VIB A;  4WBN B;  3WU2 Z;  4JI1 O;  1NI8 A;  5IJ9 B;  3O65 A;  4LF9 O;  1YXB A;  4BWA A;  2XAH A;  5BMV B;  2X6C A;  4K0K O;  1SKV A;  4B3S O;  3RYC B;  4OGQ B;  4GKJ O;  1UFI A;  4I55 B;  1MSD A;  3LSU A;  3KZI Z;  2EIN B;  3P3N A;  4MTF A;  3BAA A;  4NKG B;  4BW5 A;  2P5O A;  4DXW A;  1H8E G;  1SA0 A;  4UCU A;  5CA3 A;  1X59 A;  5BR8 B;  5KMG A;  1SF9 A;  1SQF A;  4HNA A;  3ZRW B;  2QDO A;  4U3J A;  1WP7 A;  3ETG A;  4UVA A;  4TV8 A;  1SZX A;  3OTO O;  2OTL V;  1NU1 H;  2OIG A;  3FD9 A;  1VEW A;  4F6R A;  4PA3 A;  4TWK A;  1W0K G;  3BPZ A;  3ABT A;  4G27 B;  3N2K B;  1WPX A;  3TGU H;  2H8P C;  1KBH A;  4R7C A;  1PKX A;  4DW0 A;  2ZE8 A;  4HBN A;  2A9H A;  1OHH G;  1RFY A;  1DTO A;  1SRY A;  3RYH A;  1M9N A;  1X4T A;  4D7S A;  4DR2 O;  5LMN O;  4WFB V;  1EM1 A;  2FL4 A;  3GVM A;  3CXC U;  4DK1 A;  2JJ1 G;  3ZJZ A;  4X64 B;  1XNR B;  1YEW A;  3TCU A;  4UFZ A;  3B4S A;  2UUC O;  3F5W C;  4DW1 A;  1O9H A;  2OCC B;  1Q43 A;  1N33 B;  3CRR A;  4DR3 B;  1SA0 B;  4H0L B;  5KMG B;  3SYC A;  4J9Y B;  2P06 A;  4K8X A;  3SPC A;  1J5E O;  4TV8 B;  5EYP A;  3THO A;  5E1A C;  3CC2 V;  4F6R B;  1TAE A;  1PNL A;  3JAR B;  1KEC A;  4X65 O;  3JSN A;  4FM1 A;  4AQY O;  1RP3 B;  3Q4H A;  2PF4 E;  2F95 B;  5IE9 A;  1IX9 A;  1GM7 A;  3OEH G;  2Y69 B;  2Y4U A;  1BS3 A;  2JS3 A;  5KX5 A;  4N23 A;  2Q9L A;  1Y6X A;  3WB0 A;  5IYZ A;  1Q8I A;  1RM1 B;  2QTS A;  2PY5 A;  4JI1 B;  4UCS A;  4LF9 B;  2VWK A;  2Y4T A;  3I56 V;  1JMK C;  1Z5W A;  2RCV A;  1K4C C;  4K0K B;  2A7W A;  3STZ C;  3CJH A;  4B3S B;  3HB3 B;  4D7T A;  4GKJ B;  5JCO A;  1NVP D;  2Q0O C;  4UCR A;  1S3J A;  4GX2 A;  3BY6 A;  3ZRV A;  1R3L C;  4PI2 A;  3G67 A;  3QG5 A;  1JFF B;  1FFX A;  2X0L A;  1PPJ H;  4DO2 A;  2XUM A;  1YJW V;  4DV6 O;  4G28 B;  2EIK C;  2ZIO A;  1FXV A;  2IH3 C;  4QPK A;  1SS3 A;  1OCC B;  1V54 C;  4LFA O;  1N0J A;  5B1O A;  1K34 A;  3JD2 A;  5EYP B;  5LL6 Y;  3WG7 C;  1E79 G;  3CRA A;  4AI8 A;  3CC4 V;  2YIB D;  3DGE A;  4OX9 O;  1Y66 A;  4FM0 A;  2Z3Y A;  3UT5 B;  3Q4H B;  3HKB B;  4LFC O;  1JR9 A;  4DR2 B;  5LMN B;  3FB8 C;  3OAA G;  3ABL C;  4I4T A;  3JAL A;  4P9O A;  1HWY A;  4PDL A;  4H37 A;  2ZNJ A;  4IIJ A;  1WN7 A;  1K7D A;  2UUC B;  4JI7 O;  2QWQ B;  1AI7 A;  4PHZ A;  1K5S A;  3ZRX A;  3TXS A;  2MK3 A;  4LF7 O;  1G4Y B;  4FFK A;  2Q5Z A;  2B1G A;  1HNX B;  1FFX B;  4YY3 O;  1R6T A;  3T4Z A;  1J5E B;  1XHZ A;  3FAV A;  5LXT B;  3BA9 A;  1V9P A;  4DV5 O;  5EIB D;  5L3G A;  3ABM B;  4JTC B;  4AQY B;  4YJ3 A;  3CEI A;  3T1Y O;  3K5L A;  5A9G A;  2ILM A;  3RW0 A;  1YZB A;  1Y67 A;  4OPA A;  3KCX A;  4JYY A;  5IY5 B;  2WAM A;  4TUY A;  4DV2 O;  4QE7 A;  4DR4 O;  1AR1 B;  1XNQ O;  1H8H G;  4I4T B;  1YIJ V;  2K9P A;  4EEQ A;  1SES A;  2ITD C;  3JAL B;  2EIL C;  3HKD A;  5EIB C;  2ETN A;  4X66 O;  1OZ0 A;  1K9M W;  4IIJ B;  1L0N H;  3FYI B;  2QKS A;  4DV7 B;  3LNM B;  3CP1 A;  1GAX A;  2YDE A;  1FAF A;  4B3R O;  5IJ0 A;  2ZCE A;  1SQG A;  4DV6 B;  4JYB A;  3RT3 C;  1M93 A;  3FX7 A;  4P2Z A;  3E8F A;  5GON A;  4LFA B;  3OR6 C;  2DOS A;  2ZT9 B;  1YJN V;  2WLH A;  3SR2 C;  3CCM V;  1XBL A;  5CA0 B;  1DK1 A;  3AK1 A;  5H6Q A;  2WA4 A;  4DV3 B;  3OUS A;  4OX9 B;  1NS1 A;  2WLL B;  2P67 A;  2EIJ C;  1R6K A;  2VRZ A;  4TT3 G;  2F1M A;  3G80 A;  3W7S A;  2HKO A;  5JQG B;  4E4E A;  2OTJ V;  3QNE A;  1UJW B;  4Z1M G;  2OYQ A;  2DYS B;  4TUY B;  2ZIM A;  3GWO A;  3L71 H;  2JVD A;  1VF7 A;  4I9W A;  2DYR B;  1T5E A;  1NR7 A;  3E22 A;  3HKD B;  4J42 A;  3L75 H;  3TXQ A;  2WLM A;  1MMM A;  3DC6 A;  4JI7 B;  4PJ0 Z;  1VQ5 V;  4X1Y A;  3VQW A;  4LF7 B;  2QKA A;  2UXD O;  5B1N A;  3W7U A;  3QF7 A;  4FZ1 A;  4QJF B;  4YY3 B;  2HP8 A;  1VQ7 V;  2V1D A;  4G2K A;  1J95 A;  4RWU A;  3K5M A;  3CCV V;  5LA6 A;  1BHB A;  1OCZ B;  5E79 Z;  3CC7 V;  4I9Q A;  1WB7 A;  4IL6 Z;  4DV5 B;  3M8A A;  2XAQ A;  1E1R G;  1O9G A;  4LBE C;  1QLN A;  1GO3 F;  3T1Y B;  1ZL8 B;  4YJ2 B;  2E76 B;  2YI9 A;  1HDJ A;  3HKE A;  1QR8 A;  1XDC A;  4MSW C;  2QM8 A;  4O2A A;  1YHQ V;  4GLX A;  4DV2 B;  3TJT A;  2NR5 A;  4DR4 B;  1XNQ B;  2A79 B;  2GTA A;  2IJK A;  2XHB A;  3QO8 A;  2QE7 G;  4E2L A;  2BTQ B;  2YXH A;  4FVM A;  3ETD A;  3P30 A;  2FML A;  2PGG A;  4X66 B;  2JJ2 G;  3ZHR A;  1NTM H;  3OGI B;  1VMG A;  1WNS A;  4FIP C;  1COW G;  2X7R B;  4X1Y B;  1PNM A;  3UQ8 A;  1YIT V;  3J7A U;  3CSX A;  1I94 O;  2C2A A;  4YXW G;  3OUF A;  2IU3 A;  2QEX V;  4PD4 F;  1Q3E A;  4O2B B;  5LA6 B;  3E86 A;  2R72 A;  3JAW A;  3K03 A;  2GDS A;  1PV0 A;  5H6R A;  2JGD A;  4ZKI A;  1U97 A;  5JVD A;  3CCE V;  1Q6U A;  1QLE B;  4K35 A;  4J80 A;  1GM8 A;  4O4I B;  2PZS A;  2CTQ A;  1BE3 H;  4X1I B;  4O2A B;  4FLV A;  2F93 B;  1EZV H;  2P90 A;  1D5A A;  2R9R B;  4PI0 A;  4ZIB A;  5IWA O;  4J7Z A;  2GUZ B;  2XTA A;  4GCZ A;  3MDS A;  1XUQ A;  1H2L A;  1QCE A;  4NXN O;  2KSD A;  4XDJ A;  1F51 A;  3JD0 A;  1JA8 A;  2KB1 A;  3C3S A;  3CD6 V;  1WP8 A;  5C8Y B;  1PM9 A;  1NKD A;  3CRQ A;  4J7J A;  2UXD B;  3T1H O;  2LFS A;  2ZR2 A;  4MTG A;  1XMQ O;  4ZI7 A;  5KA5 A;  1V55 B;  2EJR A;  2QJ1 A;  2WA3 A;  2ZXW B;  1GKF A;  2BOC C;  1YF2 A;  1YTF B;  1TUB B;  4ZOL A;  1EZJ A;  5LMU O;  3APQ A;  2QR4 A;  2R70 A;  3MHS C;  4JI3 O;  5LP6 B;  1F4N A;  2ITC C;  2OCC C;  4PA7 A;  4F4L A;  5JVD B;  3M7M X;  1HR0 O;  1GMG A;  3L70 H;  2Y0I A;  4OXS A;  1FXK B;  2D3O W;  2BSK A;  4FK5 C;  4JI0 O;  4JGS A;  2PI4 A;  4FZ0 A;  3D36 C;  1XEQ A;  2XAF A;  3CCJ V;  4NR1 A;  1Y74 A;  3ZN0 A;  4MTO A;  4W4K A;  4LF8 O;  5CA1 B;  2QWN B;  2HJD A;  3PJS K;  1JPX A;  2WLK A;  2W0F C;  1SQV H;  2YI8 A;  2PYJ A;  4CC5 A;  3OEE G;  1GN3 A;  3EHB B;  4LCU C;  4EB6 A;  3JAS A;  4LP8 A;  1Q6H A;  1VF6 A;  2YUA A;  4CZZ A;  1RM1 C;  1I94 B;  1S72 V;  2A3Q A;  4XBF A;  3AG2 B;  3ZHV A;  2CGN A;  4UV9 A;  1NTZ H;  2DQ3 A;  5KAI Z;  1MZE A;  4MW8 A;  1F4M A;  3HKC A;  1WB8 A;  1Y76 A;  4XDL A;  5C93 A;  5B1B C;  4UCV A;  4JZ2 A;  1JJO A;  1FS0 G;  3NR7 A;  1JOY A;  1OCC C;  2HFE C;  2YIC A;  3OTF A;  1M5I A;  5CB4 B;  4JF3 A;  1QNM A;  2BSK B;  3E35 A;  3OD4 A;  3L74 H;  2CGO A;  3ABU A;  4DV1 O;  3AG7 A;  2UUB O;  1KQS U;  4ZBM A;  3CCQ V;  1PL4 A;  1Z5V A;  5DM6 V;  5HFL A;  2ZE7 A;  3SJB C;  3T1H B;  5LHI A;  5FNV B;  3ZIA G;  4KP4 A;  4EB6 B;  4JI2 B;  3IC7 A;  3CYO A;  1XMQ B;  4LF4 O;  1BHA A;  5EZY A;  2RN9 A;  3K58 A;  4AHC A;  3AG1 B;  2H3O A;  5LMU B;  4DUZ O;  3N2G A;  4RUF A;  1EN6 A;  4FLX A;  3ABK B;  3SPI A;  3F7V C;  4PDV A;  4PA6 A;  1VQ8 V;  1HR0 B;  2F66 C;  1KB9 F;  4X8A A;  1N0N A;  4LH7 A;  3FB5 C;  3JAT A;  1XI1 A;  5J2T A;  4JI0 B;  4HNA B;  5JWP A;  2M6Y A;  4UCT A;  4U3J B;  4UB6 Z;  1FFT B;  5HFM A;  1K73 W;  1TVK A;  1K4D C;  1HNW O;  4LF8 B;  4EFB A;  5L3B A;  4MW3 A;  3CE2 A;  4RQE A;  5IY5 C;  1XIL A;  1XRE A;  4L8J A;  2IH1 C;  3RYH B;  3C3T A;  4RO2 A;  3P32 A;  3CPW U;  2A0L A;  1BGY H;  4PA9 A;  4XDK A;  1VQM V;  4LR3 A;  3CRC A;  3N2G B;  3RN4 A;  1MZF A;  1M1K W;  4L87 A;  4Z2W A;  1Q81 W;  1OCO B;  3K59 A;  1MSW D;  1BSM A;  3RVZ A;  3SYO A;  5LHH A;  2ZD9 A;  4K3A A;  2LFR A;  2P7T C;  4LWS A;  1S76 D;  1YI2 V;  3UO3 A;  5J2T B;  3JD3 A;  3OE7 G;  3UM7 A;  3OTO B;  4BAY A;  5B3S C;  5JJJ B;  4JAV A;  1OCR C;  1GK9 A;  2WLI A;  2Q8V A;  4RAI A;  2A06 H;  3OW2 U;  2DN9 A;  4JYA O;  1LNQ A;  3TK1 A;  2E3C A;  1TVK B;  3P3P A;  4DV1 B;  1KP2 A;  4PDM A;  2UUB B;  5JJN B;  4HZ3 A;  5FLX N;  1SZT A;  1N36 O;  3A0R A;  4UUJ C;  4FJC C;  4JI8 O;  3LDC A;  2R9A A;  2B5U A;  3K9A A;  4LF4 B;  3JCU Z;  3JYC A;  5KHG A;  1I5X A;  5KX5 B;  2N05 A;  1ARO P;  5IYZ B;  1TUE B;  3H9V A;  2RMK B;  2QWP B;  1AJP A;  2YID A;  3DXR A;  2Q7E A;  2WSS G;  1SQP H;  1NQT A;  3CJH B;  3CMA V;  4R6Z A;  3HPL C;  5CBG A;  5ITZ A;  2XND G;  4DR5 O;  3G6E V;  3SJA C;  2HHH O;  4IYI A;  3OFN G;  4I5S A;  1AI5 A;  4KFM A;  1VF5 B;  4N21 A;  3T1C A;  3RVY A;  1OCZ C;  3K08 A;  4MVM A;  3E83 A;  5BXZ A;  3OMN B;  1KC8 W;  3L73 H;  5DN6 G;  3WB2 A;  5IYC O;  1HNW B;  5EBM C;  4GX5 A;  3KG2 A;  1M56 C;  3NXS A;  2P4K A;  1ENV A;  4X65 B;  4DR6 O;  4I7Z B;  4WFH A;  4H13 B;  4O4H A;  3L72 H;  4C7U A;  2PUS A;  4GKK O;  4IT5 A;  5DED A;  2LO1 A;  2Q7G A;  2BOB C;  4R50 A;  3CWB H;  1P4R A;  3G71 V;  2FB5 A;  1K33 A;  3FKS G;  1G1X B;  1P7B A;  5EBW C;  3QVN A;  2ZDI C;  1TGO A;  1QBZ A;  3CCL V;  2Y0P A;  1GN4 A;  2F43 G;  4DR1 O;  5J2U A;  2GHY A;  2JEU A;  3I55 V;  1MAB G;  4U7N A;  3GWK C;  2BCC H;  3FB7 C;  4O4J A;  4FPP A;  4EKW A;  2HJF C;  2QM4 A;  1RSO A;  2UXB O;  1KKC A;  1KUQ A;  1YSC A;  2YS8 A;  4LNU A;  1HP8 A;  1GTO A;  3ETE A;  4B3M O;  4U3F H;  4K8Z A;  2QA4 V;  3VQX A;  3D8C A;  1KMI Z;  2L35 A;  4TV9 A;  4ABM A;  2YIB A;  1VQK V;  2EJ7 A;  3AG3 B;  1JCH A;  2RJZ A;  1GN6 A;  4KL1 A;  3FAV B;  3CME V;  1N32 O;  3LNN A;  1QLE C;  1N36 B;  5KUM A;  4YJ3 B;  2JIZ G;  1EN4 A;  3STL C;  2IU0 A;  5GTH Z;  4QGP A;  4R8C A;  5EK0 A;  2P22 C;  2EIK B;  1AB3 A;  5B5E Z;  1HNZ O;  4I0X A;  1JJ2 U;  4LFC B;  1FXH A;  2EX3 A;  3SDL A;  4X20 A;  1V54 B;  1ORQ C;  4DRX A;  3JCZ A;  1NH2 D;  5KHH A;  1YTF D;  5B1A B;  5LOV A;  4NTY A;  1Q86 W;  1I08 A;  3WG7 B;  1NVP B; 
#chains in the Genus database with same CATH homology
 1WPX A;  2KB1 A;  4P30 A;  3T2M A;  2H8P C;  3CD6 V;  4R7C A;  1NKD A;  1PKX A;  2A9H A;  3E8B A;  3BEH A;  1OHH G;  1SRY A;  1DTO A;  4HAM A;  5L3C A;  2CK3 G;  2LFS A;  1M9N A;  2ZR2 A;  4MTG A;  4WFB V;  1V55 C;  3IGA C;  3ABL B;  5KA5 A;  3E89 A;  1V55 B;  2EJR A;  2ZXW B;  1GKF A;  2BOC C;  4JYC A;  3JD4 A;  1JQ0 A;  2EIM C;  4MTX A;  4QNH B;  1YTF B;  2EIM B;  4X88 A;  3CXC U;  1ZWI C;  2JJ1 G;  1EZJ A;  3ZJZ A;  4MVU A;  3MHS C;  1M57 C;  1CPY A;  3TCU A;  1M57 B;  1F4N A;  1S0V A;  2ITC C;  3F5W C;  3B8N A;  2WLI B;  4WCE V;  2OCC C;  4PA7 A;  4F4L A;  4GX1 A;  2OCC B;  5EC1 C;  1GMG A;  2OT5 A;  4JTD B;  5L3E A;  3D3I A;  5GW7 A;  2JDI G;  1FXK C;  4OXS A;  3SYC A;  1FXK B;  1CEZ A;  3OR7 C;  2D3O W;  5BZB A;  2ZR3 A;  3F7Y C;  4J9Y B;  3K0D A;  3LSS A;  4FK5 C;  1VQN V;  4JGS A;  3SPC A;  2PI4 A;  1MG1 A;  1KP3 A;  1PNK A;  2XAF A;  2W6I G;  3CCJ V;  3QO7 A;  5E1A C;  3SYP A;  3VOU A;  3CC2 V;  2NNU A;  3ZN0 A;  4MTO A;  1PNL A;  2EZO A;  2WLL A;  3SPJ A;  1KEC A;  4HYO A;  2R9I A;  2XOK G;  3PJS K;  1N8R W;  1JPX A;  2WLK A;  2W0F C;  1K92 A;  3OEE G;  1GM7 A;  3EHB B;  3OEH G;  4LCU C;  2Y69 B;  1QVF U;  2H94 A;  2GSM B;  2YEV A;  4N23 A;  4LP8 A;  5EBL C;  4CZZ A;  1RM1 C;  4WFG A;  1RM1 B;  1Q7Y W;  1S72 V;  3JD1 A;  3AG2 B;  4PDR A;  4JAS A;  4XBF A;  5KUK A;  4UV9 A;  3I56 V;  2DQ3 A;  1K4C C;  2P6J A;  3STZ C;  3AG4 C;  1IXM A;  3HB3 B;  2JEX A;  4WF9 V;  4MW8 A;  2NLJ C;  3AG4 B;  3LDE A;  1F4M A;  1NVP D;  3MD0 A;  3MHH C;  2K1E A;  4XDL A;  5C93 A;  2EIN C;  1S3J A;  4GX2 A;  5B1B C;  1QVG U;  3BY6 A;  2HLD G;  1EFR G;  3ZRV A;  1R3L C;  1VQL V;  2X0L A;  4QIW F;  4DO2 A;  1KKD A;  3TET A;  1YJW V;  5CBF A;  1XL6 A;  1R3J C;  1FS0 G;  2EIK C;  2EZP A;  4G28 B;  1FXV A;  2IH3 C;  3ASO C;  4QPK A;  3ASO B;  1JOY A;  1OCC C;  2HFE C;  1EBO A;  1OCC B;  3ZMS A;  4JF3 A;  3E2E A;  1V54 C;  3E35 A;  1K34 A;  3JD2 A;  5B1O A;  5B3S B;  1VQO V;  4X89 A;  1OCR B;  3R65 A;  1H38 A;  3LUT B;  5CMU A;  5LHG A;  3WG7 C;  3B8M A;  4WFF A;  3EFF K;  1E79 G;  3ABU A;  3CC4 V;  2UXN A;  3ZMV A;  3DGE A;  3CCR V;  1KQS U;  1Y66 A;  2AHY A;  5KA6 A;  4ZBM A;  2Z3Y A;  3CCQ V;  1WLE A;  1SET A;  5FL7 G;  1L1F A;  5DM6 V;  5HFL A;  4JTA B;  5LGN A;  5LHI A;  3FYE B;  3ZIA G;  4KP4 A;  3T4D A;  1RPR A;  1SER A;  3IC7 A;  3CYO A;  1BHA A;  1BL8 A;  5L3F A;  3FB8 C;  4RUE A;  2ZDI A;  3ABL C;  3OAA G;  3RBZ A;  1G8M A;  2IJH A;  3OMI B;  2ZXW C;  4P9O A;  1HWY A;  3AG1 C;  4PDL A;  4H37 A;  1THZ A;  3AG1 B;  4JAU A;  4RUF A;  1AI6 A;  3ABK C;  2X6B A;  3W7W A;  3ABK B;  1K7D A;  3F7V C;  3SPI A;  4PDV A;  4PA6 A;  1AI7 A;  3LDD A;  1VQ8 V;  4JPR A;  1DF5 A;  2XAJ A;  1K5S A;  3ZRX A;  2MK3 A;  1G4Y B;  4X8A A;  3H01 A;  3FB5 C;  2B1G A;  1Y4M A;  4U7O A;  3K06 A;  2XAG A;  2WWW A;  4H33 A;  4UVB A;  3T4Z A;  1F23 A;  4PEL A;  3E8H A;  5LGU A;  1FFT B;  4RQF A;  5HFM A;  2DWE C;  2HR3 A;  2WLN A;  2WLJ A;  4CBC A;  1K73 W;  1K4D C;  3GB7 C;  4KUM A;  2ATK C;  3QO5 A;  3ABM B;  5L3G A;  1M56 B;  3ASN C;  4JTC B;  5L3B A;  3ASN B;  1H2G A;  4MW3 A;  3SYA A;  1VQ4 V;  2ZQM A;  3ZRW A;  3SPH A;  4RQE A;  3RW0 A;  1W2B U;  3ZMZ A;  5IY5 C;  1W0J G;  5IY5 B;  2Y69 C;  4UV8 A;  2WAM A;  1K8A W;  4QE7 A;  4PA4 A;  2IJI A;  4Q20 A;  1M90 W;  1AR1 B;  2IH1 C;  3K0G A;  3W7X A;  1R73 A;  2B1I A;  3K3W A;  1H8H G;  2HVK C;  3OM3 B;  4RO2 A;  3AG2 C;  3P32 A;  3G4S V;  1YIJ V;  5CN0 A;  1SES A;  2A0L A;  2ITD C;  3CPW U;  2EIL C;  4MT8 A;  4PA9 A;  1AJN A;  2EIL B;  4XDK A;  4BIU A;  1OZ0 A;  1K9M W;  1VQM V;  2EBO A;  1M1K W;  3FYI B;  5J9P C;  4L87 A;  1CP9 A;  1OCO C;  1Q81 W;  4TSF G;  2QKS A;  1OCO B;  1MSW D;  3LNM B;  3CP1 A;  1AJQ A;  3ML0 A;  3OMA B;  3RVZ A;  3SYO A;  5LHH A;  2LP7 A;  2ZD9 A;  4JYB A;  2LFR A;  2P7T C;  1S76 D;  2HG5 C;  1S5H C;  1YI2 V;  2YSU B;  4P2Z A;  3E8F A;  3SPG A;  4GX0 A;  3JD3 A;  3OR6 C;  3OE7 G;  1YJN V;  3UM7 A;  2WLH A;  1ROP A;  2PI5 A;  4BAY A;  5B3S C;  4J9Z B;  4JAV A;  1OCR C;  3CCM V;  2QM7 A;  2QTO A;  5L3D A;  1GK9 A;  2WLI A;  4RAI A;  1NBM G;  2FTK A;  2W6J G;  3OW2 U;  5H6Q A;  1LNQ A;  2WPD G;  3AEI A;  3TK1 A;  3OUS A;  1BMF G;  1KP2 A;  4PDM A;  4FMT A;  1PL0 A;  4UXN A;  2Q67 A;  1PD3 A;  5LBQ A;  1R3K C;  2WLL B;  2P67 A;  4HZ3 A;  2EIJ C;  1SZT A;  1R6K A;  2EIJ B;  4MVR A;  4QE9 A;  4TT3 G;  2X6A A;  3A0R A;  1FXK A;  4UUJ C;  3W7S A;  2HKO A;  4FJC C;  4ASU G;  2OTJ V;  3QNE A;  3LDC A;  3K9A A;  2B5U A;  1UJW B;  4Z1M G;  1KD1 W;  1XL4 A;  2DYS B;  3JYC A;  3D36 A;  3DTU B;  5EC2 C;  1I5X A;  2Q6A A;  2YEV B;  1ARO P;  4WFA V;  1RPO A;  1TUE B;  3GWO A;  3ZMU A;  4I9W A;  1AJP A;  2DYR B;  1NR7 A;  1B6Q A;  1VQ6 V;  1E1Q G;  1YJ9 V;  2JK5 C;  2WSS G;  2WLM A;  1NQT A;  2V7Q G;  2Q68 A;  3CMA V;  4GT1 A;  1VQ5 V;  4R6Z A;  3HPL C;  3K79 A;  1R3I C;  5CBG A;  2Z5U A;  3E8G A;  2UXX A;  1AI4 A;  2XND G;  2DQ0 A;  5B1N A;  1S77 D;  3W7U A;  2DW4 A;  1Q82 W;  3G6E V;  2XAS A;  4QJF B;  2M7W A;  1VQ7 V;  3OFN G;  2V1D A;  4G2K A;  4I5S A;  3VBB A;  1AI5 A;  1J95 A;  4KFM A;  4MS2 A;  1NH2 B;  4N21 A;  3T1C A;  3CCV V;  3RVY A;  1DF4 A;  1I5Y A;  1BHB A;  1JX9 A;  1OCZ C;  3K08 A;  4MVM A;  1OCZ B;  3E83 A;  2Q69 A;  3CC7 V;  2Y48 A;  4MVO A;  3OMN B;  1KC8 W;  5DN6 G;  5IYC O;  2XAQ A;  4GX5 A;  5EBM C;  3ABM C;  3KG2 A;  3SJQ C;  1M56 C;  4LC1 A;  3CCU V;  1E1R G;  2IW5 A;  4LBE C;  3NXS A;  4MVZ A;  1ENV A;  1QLN A;  1GO3 F;  2AHZ A;  4WFH A;  4BIZ A;  1QR9 A;  3W7T A;  1QR8 A;  3SYQ A;  4MSW C;  2QM8 A;  5CBH A;  1YHQ V;  2BOB C;  4R50 A;  3ZCC A;  1P4R A;  3G71 V;  2A79 B;  1NR1 A;  1K33 A;  3FKS G;  1P7B A;  2IJK A;  5EBW C;  5IYB O;  1JVM A;  1K3E A;  2ZDI C;  1K97 A;  2DWD C;  2QE7 G;  3QO8 A;  4E2L A;  1QBZ A;  3ETD A;  3P30 A;  3CCL V;  2F43 G;  1K5Q A;  3ZRS A;  2GHY A;  2JEU A;  3I55 V;  1MAB G;  4U7N A;  3ZMT A;  2JJ2 G;  3LSQ A;  3FB7 C;  4FPP A;  4EKW A;  2HJF C;  1DLB A;  4MVQ A;  1VQ9 V;  4FIP C;  1COW G;  2X7R B;  3CCS V;  4MVS A;  1PNM A;  1YSC A;  1YIT V;  3M99 B;  3X2Q C;  4UVC A;  3X2Q B;  2C2A A;  4YXW G;  1GTO A;  3ETE A;  3FB6 C;  3UKM A;  3OUF A;  2IU3 A;  4QPJ A;  5IDJ A;  2QA4 V;  2QEX V;  1GM9 A;  2XAH A;  1NJI W;  1VQK V;  3E86 A;  2X6C A;  3AG3 C;  3K03 A;  1VQP V;  3AG3 B;  1JCH A;  2HVJ C;  5H6R A;  4ZKI A;  3CME V;  5LGT A;  3OGC C;  3K04 A;  2EIN B;  3B77 A;  4P9P A;  5B1B B;  3CCE V;  4MTF A;  1QLE C;  4BW5 A;  5H9C A;  1QLE B;  5KUM A;  4DXW A;  1H8E G;  1MOF A;  5CA3 A;  1R6N A;  2JIZ G;  3STL C;  3IFX A;  1GM8 A;  4R8C A;  2IU0 A;  5EK0 A;  2EIK B;  4WFE A;  3ZRW B;  3WFV A;  1JJ2 U;  2P90 A;  1FXH A;  3ETG A;  2DYS C;  4UVA A;  5IYD O;  1V54 B;  2R9R B;  1ORQ C;  2OTL V;  3ZN1 A;  3JCZ A;  4GCZ A;  1NH2 D;  1YTF D;  5B1A C;  4PA3 A;  4TWK A;  5B1A B;  1QCE A;  1W0K G;  2IJJ A;  1Q86 W;  4XDJ A;  3ABT A;  1F51 A;  3JD0 A;  2DYR C;  3WG7 B;  4G27 B;  1NVP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...