4N23A

Crystal structure of the gp2 core domain from the california academy of science virus, monoclinic symmetry
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
123
structure length
123
Chain Sequence
ENLYFQGNMKQIEDKIEEILSKIYHIENEIARIKKLIGAIASKIIKTANYTTNALFLLNKEESEIRDHVVEHELALNYLLAHQGGLCNVVKGPMCSSDIDDFSKNVSDMIDKVHEEMKKFYHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GP2 Ectodomain
publication title Structural Characterization of the Glycoprotein GP2 Core Domain from the CAS Virus, a Novel Arenavirus-Like Species.
pubmed doi rcsb
source organism Cas virus
molecule tags Viral protein
total genus 52
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4n23A00
1K34A 1SZTA 3B8NA 1JQ0A 1MG1A 3MHSC 5H9CA 5KA6A 1DLBA 1ENVA 3MHHC 1DF5A 5CMUA 1JPXA 3B77A 1QBZA 2X7RB 3M99B 1Y66A 4G2KA 5CN0A 4N21A 3GWOA 2MK3A 2OT5A 1DF4A 1I5YA 2M7WA 5HFLA 4N23A 1QR8A 1QCEA 1Y4MA 4JGSA 3WFVA 2P6JA 1I5XA 3P30A 4JPRA 5HFMA 4FIPC 1MOFA 3B8MA 3CYOA 3H01A 4FJCC 2EBOA 2LP7A 4JF3A 4FK5C 1K33A 3CP1A 5KA5A 2EZOA 1EBOA 1F23A 4E2LA 1QR9A 3K9AA 2EZPA
chains in the Genus database with same CATH superfamily
1I0HA 3K08A 4PA4A 5KHGA 4LF6B 1QVGU 1K4CC 4HBNA 5IY5B 1PV0A 3GWKC 4PA7A 4FLTA 3H9VA 5KHIA 4YJ2A 2L6LA 1E1RG 1NTKH 2DYRC 4UFZA 2QWQB 2EIJB 5KHKA 1NTZH 1HW7A 1FS0G 2CTPA 3MD0A 1IURA 4IYIA 5ITZB 1WN7A 3CYOA 3RYHA 1ORQC 3OGCC 5B1NA 4QE9A 3FB5C 2FYUH 4XDLA 4YXWG 4CZZA 3CRRA 3AG3B 1H2LA 4R7CA 1R6TA 1Y67A 2P5OA 1WP7A 3ABMB 5CA1A 2E76B 1YI2V 3ETGA 3CX5F 2W0XA 4UV9A 4R6ZA 4O4LA 2UUAB 2R9IA 4G2KA 5B3SB 4JI3B 1I7FA 1KP2A 3U11A 2UUCO 2P4KA 3AK2A 3T1YB 2CAZC 2DN9A 5LYJB 1NU1H 1FXKA 4P30A 2IH1C 4CBCA 4W4LA 4CS3A 1OCCC 1N8RW 2B1GA 4FM0A 1XL4A 1WA8A 1H2KA 3M99B 2JEXA 4B3RB 4QJFB 3ASNC 4B7KA 1QLEC 3ASOC 3OUSA 2WLIA 4LF4B 3EFFK 2OWOA 4DV6B 4NYKA 4LF8O 2EIKB 3L70H 1H2MA 1K92A 4XDKA 3JD1A 4JYCA 3CCRV 2NNUA 3H1KH 1AJQA 1Q86W 3W7SA 4DV5O 1JMKC 3FD9A 2ZKOA 3CRCA 4CH4A 3B40A 4K3AA 4RUEA 3STZC 2YIBA 2PI5A 1TAEA 2EINC 5EBMC 1Q6HA 2B9ZA 5GONA 1G6UA 4I4TA 4NTYA 1K8AW 1BQ0A 4ZOLB 4JAUA 1XNRB 4PI2A 4DRXA 1AI7A 1V55C 1ZL8B 1VF6A 1R3IC 4DV7O 1IBLO 4GX5A 4XBFA 2IH3C 4K0KB 1FAFA 4LFBB 4DV2B 1Q3EA 4CS2A 1MSWD 4JV5B 4CC5A 3WG7C 4LF5O 5J2TA 5CA0A 4DR1B 5BZBA 1G1XB 2LGQA 1COWG 3G6BA 4X65B 1IVSA 2DMXA 1I94B 4YHHO 2WLNA 4FZ1A 3ZMVA 5CMUA 1BT8A 1SQFA 1AR5A 3JCUZ 3S3XA 3ZMUA 4TV9B 3SJAC 2DYRB 2LGWA 3DGEA 3JASA 1Y6XA 1ZWIC 4J41A 1NH2D 1L0NH 3BABA 3ICXA 2JDIG 3ZMZA 1R6KA 2JK5C 2NLJC 2W6IG 3ABTA 4K35A 3FFQA 3L73H 3VQVA 3VOUA 3FB7C 3CE2A 1AR1B 4QIWF 1GO3F 4G27B 4PD4F 1PP9H 1Y74A 1S5HC 4YIOA 2VS0A 3KKYA 5LP6A 5IYCO 4OX9O 2HHHO 1S72V 4LH6A 4H0LB 1YTFB 4Z1VA 1H38A 1VMGA 3HPLC 1GMGA 2JVDA 2A9HA 5EK0A 4JI7O 2QA4V 5EIBC 1KMIZ 5LA6A 3DTUB 1QBZA 4Q6GA 4F6EA 3UM7A 4PA3A 2UXNA 1RPOA 3BVOA 1NT2B 4FLVA 2B1IA 2YXLA 4DR7O 1EN4A 2CTRA 1VQ6V 2HR3A 4HNAB 1V9PA 2QGNA 4H13B 1J5EO 1K3EA 1OCCB 3B8NA 1GTOA 2WLMA 4GX0A 1BZKA 4QPKA 5B66Z 5C8YA 4GT1A 2GTAA 1VQMV 3I5DA 2UUBB 1KC8W 3HB3B 5J9PC 1IBKB 3T1HO 1QLEB 3ASOB 1OCZC 4LF7O 5KX5A 2R9AA 3DC6A 5EC2C 4XDJA 1K5QA 1ROPA 4I0XA 3ZEDA 4UVAA 4AQYO 3N2KA 1FPOA 1Q43A 1GKFA 4JYAO 5E1AC 4ABMA 4JASA 4QE7A 1KUQA 3OW2U 2HJFC 1MZFA 2O57A 3ZIAG 4LR3A 3QVNA 4BIUA 5IYZB 2UXBB 4FPPA 2OCCB 2DE0X 4R8CA 2YDEA 4DUYO 4LFAO 1M56C 3CCUV 3KCXA 3SPCA 4X20B 3SDLA 1NQTA 4WFHA 2QKSA 1KKCA 5B1BC 4JGSA 3LNNA 2RN9A 2YC0A 2YIDA 1EZJA 1X59A 2BTQA 2A3QA 3GB7C 2KG7A 3A0RA 4PJ0Z 3U10A 2UUAO 4A5UB 5DECA 2JS3A 4JI3O 3SGIA 4X1KA 2XAJA 5LMUO 1THZA 4IIJB 1DLBA 3HKCB 4AHCA 4B3MO 1BL8A 1TGOA 3OR7C 1VQ7V 2ADQB 4LFCB 3A0HZ 1Z5WA 1M57B 3JAWB 3P3PA 1SQQH 1M5IA 4I50A 3WB1A 4QPJA 4DR3O 1K34A 2QDOA 3OT7A 3ML0A 3J80N 1NJIW 2QM4A 1ENVA 2DJVA 1AI4A 1P7GA 1V54C 4FLWA 2OIEA 3JD0A 1TVKA 1QR8A 4UCTA 3FAVA 4U3JB 1QVFU 3T2MA 1HNZB 3EXAA 1L1FA 1N34B 1N0NA 3OD4A 1FXKC 3G71V 2Q0AA 1N0JA 1YJ9V 1VF5B 1FFXA 2WA4A 4ZBMA 1FJGB 3TCUA 4WFFA 4UCUA 1GN4A 4CH6A 2AW9A 4B08A 2QKCA 5KAFZ 3BRCA 3STLC 1XNRO 5LOVA 3VQXA 3TJTA 2QWPB 3AK3A 4J42A 5LHGA 4DR6O 4C7UA 3W7TA 3AG7A 3JD2A 3RYIA 4JYYA 3E22A 1NS1A 3JARB 5FPOA 2FL4A 2A79B 1XDCA 2CUGA 3L71H 3K04A 4RAIA 3DC5A 4UVBA 2CTWA 2OT5A 3HKEA 5BXZA 3QO7A 1OCZB 1MMMA 3CWBH 2HP8A 1SQGA 2Q7HA 4RWUA 1GM9A 1AP6A 4NVPA 2UU9O 2OTJV 4O2AB 4LWSB 1AJNA 5BR8O 4EKWA 1VF6C 1RFYA 3G80A 4ZI7B 1P49A 3CC4V 4FMTA 5KHJA 5IJ0B 2P90A 1MNGA 1BGYH 1JFFA 2IJJA 2X6CA 4JI5B 1RM1C 2Z0AA 1LR1A 4J7ZA 1Y76A 4JI6O 2Z5UA 2DQ3A 2IU0A 1F4NA 1N33B 3F5TA 1A32A 3ZHVA 1YIJV 2ZNJA 4YJ2B 3FKSG 5JH7A 4DK1A 2F66C 2F4VB 3RVYA 3ABLC 4NXMB 4TUYA 3QG5A 3RYHB 2ZXWC 4KUMA 3A2FA 1VQ4V 5LBQA 4O2BA 2WPDG 3BHPA 1PPJH 2X7RB 1XL6A 2HVKC 1LUVA 4UV8A 5EBWC 5LP6C 2Q7EA 1NVPD 1JOYA 1S5JA 3KG2A 1SQXH 5CA1B 2EX3A 2IJIA 1IXMA 3O65A 4X66O 2OTLV 2UUBO 5JWPA 4JAAA 2YIAA 1K73W 2JIZG 5JQGA 4O4LB 4KP4A 1SF9A 2PTMA 1XNQO 3JAMN 5L3CA 2AHZA 2UXXA 4J7JA 2LFSA 5HFLA 4BWAA 3JAKA 2P6JA 4J11A 4G28B 4OPHA 5BMVB 3H01A 4UB8Z 1X4TA 3IFXA 4J10A 2QSAA 2YI9A 4FK5C 1FXKB 3OTFA 4LH7A 5D5QA 1NI8A 2AZ0A 1S76D 4DR4O 5DEDA 4ZHQA 1ZAUA 4PHZA 3W7XA 1WA8B 1LNQA 2VWJA 4X1IB 1OCRB 4JI0O 2CTQA 2KB1A 3JALB 1S77D 2ADPA 1GM7A 2WLIB 5B1OA 1YDXA 4LBEC 4TSFG 1P84F 3HKBB 4FLUA 3K0GA 4I5SA 3ZBHA 2DQ0A 2FMLA 3K9AA 2YICA 2QWOB 2UXCB 3VQWA 2IJKA 1YJNV 2DYSB 4YJ3A 1Q6UA 3AG4C 1WAZA 3CMEV 4IYHA 4RUFA 1VQPV 5LGNA 1N32B 1NTMH 2HJDA 5GONB 5IDJA 5CBFA 4I4TB 4DRXB 4B3TO 4MS2A 3RW0A 3SR2C 4WF9V 4FLZA 1SESA 4JTDB 4W4KA 4ZKIA 2BSKA 4LNUA 3UQ8A 3EVKA 4LC1A 1I5YA 1H8EG 1E1QG 3AG1C 1Y4MA 5KMGA 3HR0A 4O4IB 4PDMA 3X2QB 1O9HA 3FYIB 5FL7G 4I9QA 2XASA 4KFMA 2DWEC 1ZTEA 4B3SO 5FNVA 3JCZA 3K5MA 2YXYA 1JPXA 1YJWV 1HNZO 2ZE6A 1YXBA 2OYQA 1IDSA 2K9PA 1HR0O 2RQ6A 4JZGA 2YEVB 4I55A 3ZN1A 1R3JC 1HNXB 4H44B 2ZM6B 3DXRA 1F7YA 4GYCB 2YSUB 5DN6G 2RNBA 1AJPA 4UXNA 3JATA 5CN0A 3SPHA 1KB9F 1HNWB 3UO2A 3CPWU 1Y74B 5LP6B 3K0DA 2Y4TA 5EZYA 1AB3A 1OCOC 1SZXA 2BE3A 1PM9A 5CB4B 1SA0A 3R66A 2EILC 5JJNB 4LF9B 5CBHA 3N2GB 4I9WA 2YI8A 1JX9A 2K1EA 4MTXA 1VQ8V 5LHHA 3SYQA 4DXWA 5LA6B 4J7KA 3HKDA 1XHXA 3L9DA 1O9GA 4FIPC 1YEWA 2A7WA 1AI5A 1UFIA 2ETNA 2WLHA 3E2EA 1XMOO 2WSSG 4RQFA 2ILMA 4X88A 2F93B 3IC7A 5LMNO 4GKKO 3LSQA 5C8YB 2ZDIA 4H37A 3R65A 4JI5O 1DGSA 2CH7B 3U0ZA 2ITCC 1T5EA 1OHHG 3B8MA 1PNLA 5K1PA 3ETEA 2E5LO 4D6TH 5AG2A 3H1JH 1N33O 4I0XB 5J2UA 4DV3O 2W0FC 4NXNO 3B4SA 3N2KB 3OGIB 3S3WA 4K8XA 2QWNB 2A0LA 1XMQO 4Q20A 2DWDC 3AG4B 1PL0A 3ZHSA 1QU7A 4JI4B 1KKDA 4MW3A 3FX7A 3OEEG 3ZMSA 1SS3A 1R6NA 3P3NA 1EN6A 2Q7GA 2YS8A 5IYBO 4X64B 1GN3A 2XTAA 1DK1A 3KCYA 3RN4A 3OEHG 1R3KC 1XEQA 4JZ2A 5JVDB 2GUZA 1WPXA 3AG1B 1BHAA 5LYJA 4UB6Z 1FXHA 2KG7B 2BOCC 4F4LA 4HYOA 4L8JA 1W0JG 4PI0A 1SQPH 3CCMV 2GTSA 3ZHQA 4X1KB 2ZCEA 2E3CA 1GH6A 3OAAG 3BAAA 2DOSA 2VQEO 3ABKC 4PA6A 4WBNB 3CS5A 1QLNA 2BTOA 4Z2WA 1UPGA 3ZMTA 4JI1B 2AHYA 2JGUA 2CGNA 4MT8A 4EFBA 4O4JA 4PDRA 4DV1B 3JD4A 2W6JG 4MVSA 3OTOO 5JJEB 4I50B 2VWKA 4BIZA 3LUTB 3ZJZA 1B3QA 3CRMA 2LW1A 5JCOA 2QR4A 1GM8A 1N36B 5EBLC 3D3QA 2GBOA 3WB0A 3D36A 1Y66A 2Q0OC 5LXTA 1B04A 1FD9A 1TVKB 4MVUA 4DV0B 1VQOV 4GX2A 3ASNB 3FAVB 4LF6O 2OCHA 2EILB 1KD1W 3T1CA 3B2EE 4F6RB 1ZL8A 1IBMB 3SYCA 1FFXB 4E4EA 2ZINA 2MW2B 4GKJB 3CRAA 3M8AA 4IGGA 4LCUC 1DF4A 1ZUQA 3A8TA 3Q4HB 5LOVB 2EINB 2UXDB 4RO2A 5IJ9B 2VQFB 2HEPA 3JYCA 3RWRD 3RYIB 4TOIA 3E22B 2N74A 1V55B 2JGDA 2IJHA 4IT5A 2IU3A 4QGPA 5KAIZ 2QTSA 1XHZA 1BCCH 1FXVA 5H6RA 3EHBB 3RYCB 4TQFA 4TV9A 2JJ2G 4JI2B 2HKOA 1L0LH 3CCLV 2RJZA 4MTOA 4BIOA 5EYPA 1AR4A 3WG7B 2A06H 4U7OA 1EN5A 4EB6B 2F1MA 3IJ4A 4I7ZB 3CCSV 2G38A 4DV4B 3T1YO 5GTHZ 1U97A 1KQSU 4X1YB 2ZM6O 3ZX6A 1SKVA 3CEIA 1JFFB 2H8PC 1FFTB 3SPJA 1XI1A 2QEXV 4GX1A 2Q6AA 3UT5B 1P7BA 2X6BA 3RBZA 1YSCA 4X62B 2V4DA 3RVZA 3DSQA 4B3RO 2F43G 4X89A 2ZQMA 2M6YA 4LF4O 3CB2A 4DV6O 2JEUA 3ZHRA 5DM6V 1Q82W 2GDSA 3ETQA 1GN2A 4JYBA 2WLLB 2P4VA 1SQVH 4LF9O 5JH7B 2QJ1A 4AILC 3BEHA 4TUYB 1AILA 3W7UA 1XREA 4L87A 3SPIA 4U7NA 4TV8B 1AP5A 3L75H 3L72H 2LW7A 2AZ2A 2UUCB 1YF2A 4FLYA 2RDCA 2WWWA 2R70A 3ZRWA 3K3WA 4K0KO 4WFEA 2XAFA 4LFBO 4DV2O 4JV5O 1K5SA 2D2CB 1E79G 2C2AA 4DR1O 3OE7G 3J7AU 4X65O 1I94O 3PJSK 1PL4A 3CJHB 3K9SA 5E79Z 1WB7A 3C3SA 3OR6C 4KXRA 4X8AA 3TK1A 4BW9A 3OMNB 4UUJC 4JI4O 4ZHQB 1M4UA 4KL1A 4AI8A 2XT9A 2ZDIC 2Q9LA 2Y0PA 3N27A 1IZ3A 1MABG 2EIJC 4DV5B 2AGAA 4FFBB 1I5XA 1YTFD 3E86A 1AI6A 3K06A 1VF7A 2Q4PA 1RSOA 3C3TA 1F23A 2F95B 1ZSPA 2EJRA 3BCCH 4D7TA 2FKXA 1AROP 3HKCA 2EULA 1M56B 4GUNA 4EFEA 1GAXA 1SC5B 3TGUH 3CSXA 4MSWC 3AG3C 4YY3B 3JAWA 1KU9A 3IAYA 4DV7B 1W2BU 5B1BB 2YUAA 4GLXA 4UCRA 1TUEB 3B09A 2EZOA 3H1IH 1SZTA 3CRQA 4LF5B 1XQ8A 1S0VA 5B3SC 4MVMA 4LNUB 3NXSA 2M7WA 4YHHB 2D3OW 1R73A 3UKMA 1PD3A 1UJWB 4IHJA 1JJ2U 1TUBA 4P2ZA 5KMGB 1YHQV 4UCOA 3E8FA 1G4YB 4NR1A 2ARHA 2OIGA 1IBKO 1DF5A 1VIBA 3ZN0A 2P67A 4CH3A 2ZD9A 3GVMA 1V54B 3QTCA 2XAQA 4PA9A 4BR6A 1BS3A 2Y69C 3P30A 5LHIA 1NH2B 2EIKC 1IBMO 5A2QN 4I55B 3BFRA 3AEIA 4OX9B 3C90A 5B5EZ 3JARA 1K7DA 2HHHB 4J9ZB 3K5LA 2EIMC 1JQ0A 5JCOC 5H9CA 2ZIOA 2CE4A 3D36C 5IE9A 3J81N 4PV1B 2DW4A 2VQFO 2HG5C 4JI7B 3T4DA 2IM9A 5HFMA 2UXBO 5H5NA 3G4SV 4WFGA 4WFBV 1SA0B 3T4ZA 5GTIZ 1PNMA 4DR7B 4PDLA 2HLDG 2RCVA 3E35A 4MTFA 1VARA 5CBGA 1OV9A 2JRIA 1GK9A 1Q5OA 1J5EB 1Q90D 3CC7V 3CCVV 2KQXA 4MVRA 1NR1A 3OUFA 3OMIB 4DO2A 3AG2C 1D5NA 1F51A 2EJ7A 3WU2Z 2L35A 1BQZA 1HP8A 3CHXA 4DV4O 4WCEV 2RMKB 4NTXA 4U3FH 3VQYA 4MVQA 4LFCO 5IWAB 2Y48A 1B06A 1R1BA 4DW1A 4AQYB 4NB5A 1ZX3A 3H1HH 4JYAB 1EM1A 2QE7G 4X62O 4YIPA 1SQBH 1GN6A 1H8HG 3RYFA 5J2TB 5CA0B 3LNMB 2PI4A 1QR9A 1RM1B 5J2UB 2EZPA 3CC2V 2XAGA 4MVOA 5EIBD 3UO3A 3B77A 2ZNIA 2KSDA 4UCVA 1N34O 5B1AC 4O4HA 4DUYB 4LFAB 1H2GA 5TISZ 2LJ2A 3JASB 4UCSA 1FJGO 1LUWA 3PN1A 1W59A 4GCZA 3ABLB 3D3IA 4DW0A 2P22C 4FZ0A 4UVCA 2ZXWB 4P9PA 4OPAA 3TXQA 5LMUB 5BMVA 4B3MB 4WFAV 2GUZB 1J95A 2IW5A 3WFVA 4HAMA 3K03A 4RQEA 1QHTA 1CPYA 2XNDG 4PELA 3BPZA 3A0BZ 3SJQC 2XAHA 3RFRA 2ZE8A 4FM2A 5L3DA 4X1IA 3QO8A 4JI8B 1R3LC 4IL6Z 1VP7A 4DR3B 3VBBA 1WP8A 1JJOA 1NZ6A 3JALA 5KLVH 2Y69B 2Y4UA 4JPRA 4O4JB 4GZRB 3CXHF 3HKBA 2R9RB 3FB8C 1MZEA 1VQ9V 1HDJA 1QNMA 1YCIA 3APQA 2WLJA 2EIMB 5EC1C 1US6A 3M7MX 5CA3A 4K8ZA 4ASUG 2KKWA 2PF4E 5LXTB 1ZLZA 2HFEC 5L3EA 5FPRA 2Q73A 5KX5B 2EBOA 1OZ0A 5ITZA 1VQ5V 1K33A 3THOA 3JSLA 1YVWA 2OCCC 1WLEA 4DR6B 4YY3O 1WNSA 5H2FZ 2IBZH 1H2NA 2F4VO 4ZIBA 5H6QA 4O4IA 3ABUA 4FM1A 2V1DA 4NXMO 3AG2B 2Q67A 2LO1A 5KUMA 1L8DA 3TETA 2ZT9B 3UCSC 3F7VC 3SYAA 1EBOA 4JTCB 2JGDB 3BA8A 4D7SA 2ZR3A 1YZBA 2GSMB 4Z1MG 3MHHC 1Q6IA 2LQTA 1RP3B 2PUSA 3I56V 2CDYA 2UU9B 1CP9A 4R50A 1B6QA 1AVMA 5BR8B 1M57C 1D2DA 4HZ3A 1QCEA 3TXSA 3QO5A 3W7WA 1SERA 2ATKC 2YEVA 2BTQB 5EYPB 5JJJB 3AK1A 1CXZB 2GHYA 5KA5A 1FKAO 1JVMA 3CD6V 2Q69A 4JTAB 2X0LA 2ZE7A 3ZS8C 1KYOF 3SYPA 4CH5A 5IYDO 4P9OA 4N23A 5B1AB 3MAQA 4JI6B 2BOBC 5CB4A 1WPBA 3BA9A 5L3BA 4MVZA 3SPGA 4FVMA 3CP1A 2V7QG 3N2GA 1EFRG 2YXHA 1M93A 1F4MA 3CCQV 4DUZB 4CC6A 4DR5B 1N4CA 2QWRB 2MK3A 2YIBD 5KHHA 1BHBA 5C93A 3H1LH 1M9NA 3CCEV 1OCOB 2UXCO 4ZOLA 1IXBA 1Q7YW 2Q5ZA 2JJ1G 3E8GA 1M90W 3I55V 2F23A 3F7YC 4FFKA 1MG1A 1G8MA 4OXSA 1N32O 4X66B 3GWOA 3QNEA 2CH7A 1XNQB 4KHPB 2B5UA 3L74H 1U96A 2FB5A 1NVPB 2ZR2A 5IWAO 4TWKA 3OMAB 1MA1A 3RGBA 3ZRWB 4B7EA 1VEWA 5F2VO 1JR9A 4DR4B 3K57A 3HKEB 4JI0B 1XILA 4DR2B 3KZIZ 3G6EV 3K59A 2PYLA 2GV9A 5L3FA 4CS4A 2JS5A 2CGOA 4QNHB 5JVDA 3E8HA 4DYLA 1HNXO 2PY5A 5LL6Y 1W0KG 3ZHTA 2XHBA 3JD3A 1RSOB 1HNWO 1XUQA 1Y76B 4WBNA 1WJZA 4B3TB 1NBMG 4N21A 3NR7A 1VQKV 1XBLA 1OJHA 2Q8VA 2E74B 1K97A 2LFRA 3P32A 4MTGA 4BW5A 2BCCH 4HNAA 4OGQB 4JI8O 3CMAV 5KUKA 4EEQA 1SETA 3APOA 5KA6A 4O2BB 4B3SB 1HWYA 1MSDA 3QF7A 3ABKB 4TQDA 1KBHA 1WB8A 2NN4A 3FYEB 2Z3YA 4JAVA 2PYJA 4IHJB 1TUBB 4H33A 3O9OA 1VQNV 3LDEA 5FLXN 3SJBC 2ZIMA 1HR0B 4F6RA 3K5OA 2VRZA 2XUMA 3LSSA 1OCRC 5JQGB 3ZCCA 1DTOA 3Q4HA 2WA3A 3JAKB 2H94A 1TA8A 2X6AA 2ITDC 3SJCC 5IJ9A 1K4DC 2LP7A 3F5WC 3OM3B 3K79A 4X9QA 2P06A 2P7TC 5IYZA 3E89A 3SYOA 3MHSC 4LF8B 5IY5C 2XOKG 1P4RA 2DYSC 1S5LZ 3RYCA 5IT9N 4X20A 2Y0IA 2ZE5A 2WLKA 3FB6C 4X64O 1D5AA 3ZRSA 1H2SB 4NKGB 3CCJV 4EB6A 4ICGA 4TT3G 2N04A 3WB2A 2QM8A 4IIJA 1Q81W 2Q68A 2HVJC 1XMOB 3ZHUA 1KECA 2H3OA 4X1YA 4YJ3B 5K1XA 2QTOA 2FTKA 3IGAC 5LMNB 1VQLV 4GKKB 1IBLB 3X2QC 3ABMC 1XOUA 3UT5A 3LDDA 2N05A 3ETDA 5LGUA 4PDVA 2E5LB 4JI1O 2PZSA 3E83A 1Z2GA 4DV3B 4DV1O 3LDCA 4NXNB 3CXCU 2BSKB 2WLLA 3E8BA 4U3JA 5L3GA 1GRJA 1XMQB 1KP3A 1QQCA 1S3JA 1JA8A 3IC9A 3K5NA 1N36O 4DUZO 4JF3A 3RYFB 3BY6A 3OFNG 5BY1A 4DR5O 1BSMA 1Q8IA 2AXTZ 1URFA 4LP8A 5FNVB 4DV0O 5GW7A 3ZRXA 4TV8A 3ZRVA 4DK0A 2R72A 4O4HB 1M1KW 2NR5A 5LGTA 1Z5VA 1BE3H 4GKJO 4E2LA 3DXRB 2QM7A 3K58A 1SRYA 4KHPO 1I08A 3RT3C 2UXDO 3JATB 3LSUA 2PGGA 4NTWA 1EZVH 1YITV 1NKDA 4MW8A 2VQEB 5EZYB 4BAYA 5A9GA 3CJHA 4FJCC 1RPRA 2QKAA 4FLXA 1PNKA 2ODMA 4J9YB 1PKXA 3OTOB 4O2AA 4LWSA 1JCHA 4JI2O 3D8CA 3JSNA 4ZI7A 1FYJA 5IJ0A 4DR2O 1IX9A 5D5PA 4FFBA 3G67A 2E75B 1CEZA 3HKDB 2CK3G 4J80A 1MOFA 1NR7A 3T1HB 2WAMA 1BMFG 1K9MW 4LF7B 3MDSA
chains in the Genus database with same CATH topology
1V55B 3K08A 2IJHA 1WLEA 2IU3A 4PA4A 2OTJV 1AJNA 4EKWA 1QVGU 1K4CC 5IY5B 1FXVA 5H6RA 4PA7A 3CC4V 4FMTA 3EHBB 2JJ2G 2P90A 2HKOA 5H6QA 1E1RG 2DYRC 3ABUA 3CCLV 2EIJB 2V1DA 3AG2B 2Q67A 4MTOA 5KUMA 3TETA 1FS0G 3MD0A 3WG7B 2IJJA 2X6CA 4U7OA 3F7VC 3SYAA 1RM1C 1EBOA 3CYOA 4JTCB 1ORQC 3OGCC 5B1NA 2ZR3A 4Z1MG 2GSMB 3CCSV 4QE9A 3MHHC 3FB5C 2Z5UA 2DQ3A 3I56V 2IU0A 1F4NA 1CP9A 4R50A 1YIJV 1B6QA 4XDLA 1M57C 4YXWG 1KQSU 4CZZA 4HZ3A 3AG3B 1QCEA 3QO5A 3FKSG 4R7CA 3W7WA 1SERA 2ATKC 2YEVA 3ABMB 2H8PC 1FFTB 3SPJA 3RVYA 2QEXV 1YI2V 4GX1A 2Q6AA 3ABLC 1P7BA 2GHYA 5KA5A 2X6BA 3ETGA 1JVMA 3CD6V 3RBZA 4UV9A 2ZXWC 2Q69A 4R6ZA 1YSCA 4KUMA 1VQ4V 3RVZA 5LBQA 4JTAB 2WPDG 2X0LA 2F43G 4X89A 2R9IA 2ZQMA 2X7RB 1XL6A 3SYPA 4G2KA 2HVKC 5IYDO 5B3SB 4P9OA 2JEUA 5DM6V 1Q82W 4N23A 5B1AB 1KP2A 4UV8A 4JYBA 2WLLB 5EBWC 2BOBC 1NVPD 1JOYA 5L3BA 3KG2A 4MVZA 1FXKA 4P30A 2IH1C 3SPGA 2IJIA 3CP1A 4CBCA 1IXMA 3BEHA 2V7QG 1OCCC 1N8RW 2OTLV 1EFRG 3W7UA 1F4MA 3CCQV 2B1GA 1K73W 2JIZG 1XL4A 4KP4A 4L87A 3SPIA 5L3CA 2AHZA 4U7NA 3M99B 2JEXA 2UXXA 2MK3A 2LFSA 5HFLA 1BHBA 4QJFB 5C93A 3ASNC 1QLEC 3ASOC 3OUSA 2P6JA 2WLIA 4G28B 3EFFK 1M9NA 3CCEV 3H01A 1OCOB 2EIKB 3IFXA 4FK5C 1Q7YW 2JJ1G 1FXKB 3E8GA 1M90W 1K92A 2WWWA 3JD1A 4JYCA 4XDKA 3I55V 3CCRV 2NNUA 3F7YC 1S76D 1AJQA 3ZRWA 1Q86W 3K3WA 1MG1A 1G8MA 4WFEA 2XAFA 3W7SA 3W7XA 1LNQA 4OXSA 1OCRB 3GWOA 4RUEA 2KB1A 3QNEA 3STZC 1K5SA 2PI5A 1E79G 2C2AA 3OE7G 1S77D 2EINC 5EBMC 1GM7A 2WLIB 2B5UA 1NVPB 2ZR2A 5B1OA 1K8AW 4LBEC 3PJSK 4TSFG 4JAUA 3K0GA 4I5SA 3OMAB 4TWKA 1AI7A 2DQ0A 1V55C 3OR6C 4X8AA 3TK1A 3K9AA 3ZRWB 3OMNB 4UUJC 1R3IC 2IJKA 1YJNV 2DYSB 4GX5A 2ZDIC 3AG4C 4XBFA 3CMEV 2IH3C 4RUFA 1VQPV 2EIJC 1MABG 5LGNA 1I5XA 1YTFD 3E86A 5IDJA 5CBFA 1MSWD 1AI6A 3WG7C 3K06A 5BZBA 3G6EV 1COWG 1F23A 2EJRA 4MS2A 1AROP 3RW0A 5L3FA 2WLNA 4WF9V 3ZMVA 5CMUA 4QNHB 1M56B 1SESA 4JTDB 4ZKIA 4LC1A 4MSWC 3ZMUA 1I5YA 3E8HA 3AG3C 2DYRB 1H8EG 1E1QG 3AG1C 1Y4MA 3DGEA 1W2BU 5B1BB 1ZWIC 1NH2D 4PDMA 2JDIG 1W0KG 3X2QB 3ZMZA 1R6KA 3FYIB 5FL7G 1TUEB 2XASA 2JK5C 2NLJC 3JD3A 4KFMA 2DWEC 2EZOA 2W6IG 3ABTA 3JCZA 1SZTA 3VOUA 3FB7C 1AR1B 4QIWF 1GO3F 4G27B 1S0VA 1JPXA 1YJWV 5B3SC 4MVMA 1NBMG 4N21A 3NXSA 2M7WA 1S5HC 1VQKV 2D3OW 1R73A 3UKMA 1PD3A 1UJWB 1JJ2U 5IYCO 4P2ZA 1K97A 2LFRA 3P32A 4MTGA 3E8FA 1YHQV 4BW5A 1S72V 1YTFB 2YEVB 3ZN1A 1R3JC 1G4YB 3CMAV 5KUKA 1H38A 2YSUB 5DN6G 1SETA 3HPLC 5KA6A 1GMGA 2A9HA 5EK0A 2QA4V 1DF5A 3DTUB 1AJPA 3ZN0A 1QBZA 4UXNA 2P67A 1HWYA 5CN0A 3SPHA 3ABKB 2ZD9A 1V54B 3UM7A 4PA3A 3CPWU 2UXNA 3FYEB 1RPOA 2Z3YA 4JAVA 2XAQA 4PA9A 3K0DA 2B1IA 2Y69C 3P30A 4H33A 1OCOC 1VQNV 5LHIA 1NH2B 2EIKC 3LDEA 1VQ6V 2HR3A 2EILC 3AEIA 1K3EA 1K7DA 1OCCB 4J9ZB 5CBHA 3B8NA 2EIMC 1JQ0A 1JX9A 2K1EA 4I9WA 4MTXA 1GTOA 2WLMA 5H9CA 4GX0A 5LHHA 1VQ8V 3SYQA 3LSSA 4DXWA 1OCRC 4QPKA 4GT1A 3ZCCA 1VQMV 2DW4A 1KC8W 3HB3B 1DTOA 2HG5C 5J9PC 3T4DA 1QLEB 3ASOB 2H94A 1OCZC 2X6AA 2ITDC 5HFMA 4FIPC 5EC2C 1K4DC 1AI5A 3G4SV 4WFGA 2LP7A 3F5WC 1K5QA 3OM3B 4XDJA 3T4ZA 4WFBV 3K79A 1ROPA 2WLHA 3E2EA 2WSSG 2P7TC 1PNMA 4RQFA 4PDLA 3E89A 2HLDG 4UVAA 3SYOA 3E35A 3MHSC 4MTFA 5CBGA 5IY5C 2XOKG 4X88A 1P4RA 1GK9A 2DYSC 3IC7A 1GKFA 3LSQA 5E1AC 2ZDIA 4H37A 3CC7V 3CCVV 4JASA 4MVRA 1NR1A 3R65A 2WLKA 3FB6C 3OUFA 4QE7A 3OMIB 2ITCC 3AG2C 4DO2A 1OHHG 3OW2U 2HJFC 1F51A 1PNLA 3B8MA 3ETEA 3ZIAG 3ZRSA 4BIUA 3CCJV 4WCEV 4TT3G 2W0FC 2QM8A 4FPPA 2OCCB 4R8CA 4MVQA 1Q81W 1M56C 2Q68A 3CCUV 2HVJC 2Y48A 2A0LA 3SPCA 1KECA 4Q20A 1NQTA 2DWDC 3AG4B 1PL0A 4WFHA 2QTOA 2FTKA 3IGAC 2QKSA 5B1BC 1VQLV 4JGSA 4MW3A 1KKDA 3OEEG 3X2QC 3ABMC 1EZJA 3ZMSA 2QE7G 3GB7C 1R6NA 1H8HG 3A0RA 3LDDA 3ETDA 5LGUA 4PDVA 5IYBO 3LNMB 2PI4A 1QR9A 1RM1B 3CC2V 2EZPA 2XAGA 4MVOA 2XAJA 1THZA 1DLBA 3E83A 1BL8A 3B77A 3OEHG 1R3KC 3LDCA 3OR7C 3CXCU 1VQ7V 2WLLA 5B1AC 3E8BA 1M57B 1WPXA 1H2GA 3AG1B 5L3GA 1BHAA 1KP3A 1S3JA 1FXHA 2BOCC 4JF3A 4HYOA 3BY6A 4F4LA 3OFNG 1W0JG 4GCZA 3ABLB 3D3IA 4QPJA 3CCMV 1K34A 4LP8A 3ML0A 4UVCA 1NJIW 2ZXWB 4P9PA 3OAAG 1ENVA 3ABKC 4PA6A 5GW7A 1AI4A 3ZRXA 1V54C 3ZRVA 3JD0A 1QLNA 3ZMTA 1QR8A 2AHYA 1M1KW 4WFAV 4MT8A 1J95A 2IW5A 3WFVA 4PDRA 5LGTA 1QVFU 3T2MA 3JD4A 2W6JG 4HAMA 3K03A 4MVSA 4RQEA 1L1FA 1CPYA 2XNDG 4PELA 4BIZA 1FXKC 3LUTB 3G71V 3ZJZA 4E2LA 1YJ9V 3SJQC 2XAHA 1GM8A 2QM7A 5EBLC 4ZBMA 1SRYA 5L3DA 3TCUA 3QO8A 4WFFA 1R3LC 3D36A 1Y66A 3VBBA 4MVUA 3STLC 1VQOV 4GX2A 1YITV 1NKDA 4MW8A 3ASNB 2Y69B 4JPRA 4BAYA 5LHGA 2R9RB 4FJCC 3FB8C 1RPRA 1VQ9V 2EILB 3W7TA 3JD2A 1KD1W 3T1CA 1PNKA 4J9YB 1PKXA 2WLJA 1JCHA 3SYCA 2EIMB 5EC1C 2A79B 3K04A 4RAIA 5CA3A 4UVBA 4ASUG 4LCUC 2OT5A 1DF4A 2HFEC 5L3EA 1CEZA 3QO7A 1OCZB 2EINB 2CK3G 4RO2A 1MOFA 1NR7A 2EBOA 1OZ0A 1VQ5V 2WAMA 1K33A 3JYCA 1BMFG 1K9MW 1GM9A 2OCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K34 A;  1SZT A;  3B8N A;  1JQ0 A;  1MG1 A;  3MHS C;  5H9C A;  5KA6 A;  1DLB A;  1ENV A;  3MHH C;  1DF5 A;  5CMU A;  1JPX A;  3B77 A;  1QBZ A;  2X7R B;  3M99 B;  1Y66 A;  4G2K A;  5CN0 A;  4N21 A;  3GWO A;  2MK3 A;  2OT5 A;  1DF4 A;  1I5Y A;  2M7W A;  5HFL A;  4N23 A;  1QR8 A;  1QCE A;  1Y4M A;  4JGS A;  3WFV A;  2P6J A;  1I5X A;  3P30 A;  4JPR A;  5HFM A;  4FIP C;  1MOF A;  3B8M A;  3CYO A;  3H01 A;  4FJC C;  2EBO A;  2LP7 A;  4JF3 A;  4FK5 C;  1K33 A;  3CP1 A;  5KA5 A;  2EZO A;  1EBO A;  1F23 A;  4E2L A;  1QR9 A;  3K9A A;  2EZP A; 
#chains in the Genus database with same CATH topology
 1I0H A;  3K08 A;  4PA4 A;  5KHG A;  4LF6 B;  1QVG U;  1K4C C;  4HBN A;  5IY5 B;  1PV0 A;  3GWK C;  4PA7 A;  4FLT A;  3H9V A;  5KHI A;  4YJ2 A;  2L6L A;  1E1R G;  1NTK H;  2DYR C;  4UFZ A;  2QWQ B;  2EIJ B;  5KHK A;  1NTZ H;  1HW7 A;  1FS0 G;  2CTP A;  3MD0 A;  1IUR A;  4IYI A;  5ITZ B;  1WN7 A;  3CYO A;  3RYH A;  1ORQ C;  3OGC C;  5B1N A;  4QE9 A;  3FB5 C;  2FYU H;  4XDL A;  4YXW G;  4CZZ A;  3CRR A;  3AG3 B;  1H2L A;  4R7C A;  1R6T A;  1Y67 A;  2P5O A;  1WP7 A;  3ABM B;  5CA1 A;  2E76 B;  1YI2 V;  3ETG A;  3CX5 F;  2W0X A;  4UV9 A;  4R6Z A;  4O4L A;  2UUA B;  2R9I A;  4G2K A;  5B3S B;  4JI3 B;  1I7F A;  1KP2 A;  3U11 A;  2UUC O;  2P4K A;  3AK2 A;  3T1Y B;  2CAZ C;  2DN9 A;  5LYJ B;  1NU1 H;  1FXK A;  4P30 A;  2IH1 C;  4CBC A;  4W4L A;  4CS3 A;  1OCC C;  1N8R W;  2B1G A;  4FM0 A;  1XL4 A;  1WA8 A;  1H2K A;  3M99 B;  2JEX A;  4B3R B;  4QJF B;  3ASN C;  4B7K A;  1QLE C;  3ASO C;  3OUS A;  2WLI A;  4LF4 B;  3EFF K;  2OWO A;  4DV6 B;  4NYK A;  4LF8 O;  2EIK B;  3L70 H;  1H2M A;  1K92 A;  4XDK A;  3JD1 A;  4JYC A;  3CCR V;  2NNU A;  3H1K H;  1AJQ A;  1Q86 W;  3W7S A;  4DV5 O;  1JMK C;  3FD9 A;  2ZKO A;  3CRC A;  4CH4 A;  3B40 A;  4K3A A;  4RUE A;  3STZ C;  2YIB A;  2PI5 A;  1TAE A;  2EIN C;  5EBM C;  1Q6H A;  2B9Z A;  5GON A;  1G6U A;  4I4T A;  4NTY A;  1K8A W;  1BQ0 A;  4ZOL B;  4JAU A;  1XNR B;  4PI2 A;  4DRX A;  1AI7 A;  1V55 C;  1ZL8 B;  1VF6 A;  1R3I C;  4DV7 O;  1IBL O;  4GX5 A;  4XBF A;  2IH3 C;  4K0K B;  1FAF A;  4LFB B;  4DV2 B;  1Q3E A;  4CS2 A;  1MSW D;  4JV5 B;  4CC5 A;  3WG7 C;  4LF5 O;  5J2T A;  5CA0 A;  4DR1 B;  5BZB A;  1G1X B;  2LGQ A;  1COW G;  3G6B A;  4X65 B;  1IVS A;  2DMX A;  1I94 B;  4YHH O;  2WLN A;  4FZ1 A;  3ZMV A;  5CMU A;  1BT8 A;  1SQF A;  1AR5 A;  3JCU Z;  3S3X A;  3ZMU A;  4TV9 B;  3SJA C;  2DYR B;  2LGW A;  3DGE A;  3JAS A;  1Y6X A;  1ZWI C;  4J41 A;  1NH2 D;  1L0N H;  3BAB A;  3ICX A;  2JDI G;  3ZMZ A;  1R6K A;  2JK5 C;  2NLJ C;  2W6I G;  3ABT A;  4K35 A;  3FFQ A;  3L73 H;  3VQV A;  3VOU A;  3FB7 C;  3CE2 A;  1AR1 B;  4QIW F;  1GO3 F;  4G27 B;  4PD4 F;  1PP9 H;  1Y74 A;  1S5H C;  4YIO A;  2VS0 A;  3KKY A;  5LP6 A;  5IYC O;  4OX9 O;  2HHH O;  1S72 V;  4LH6 A;  4H0L B;  1YTF B;  4Z1V A;  1H38 A;  1VMG A;  3HPL C;  1GMG A;  2JVD A;  2A9H A;  5EK0 A;  4JI7 O;  2QA4 V;  5EIB C;  1KMI Z;  5LA6 A;  3DTU B;  1QBZ A;  4Q6G A;  4F6E A;  3UM7 A;  4PA3 A;  2UXN A;  1RPO A;  3BVO A;  1NT2 B;  4FLV A;  2B1I A;  2YXL A;  4DR7 O;  1EN4 A;  2CTR A;  1VQ6 V;  2HR3 A;  4HNA B;  1V9P A;  2QGN A;  4H13 B;  1J5E O;  1K3E A;  1OCC B;  3B8N A;  1GTO A;  2WLM A;  4GX0 A;  1BZK A;  4QPK A;  5B66 Z;  5C8Y A;  4GT1 A;  2GTA A;  1VQM V;  3I5D A;  2UUB B;  1KC8 W;  3HB3 B;  5J9P C;  1IBK B;  3T1H O;  1QLE B;  3ASO B;  1OCZ C;  4LF7 O;  5KX5 A;  2R9A A;  3DC6 A;  5EC2 C;  4XDJ A;  1K5Q A;  1ROP A;  4I0X A;  3ZED A;  4UVA A;  4AQY O;  3N2K A;  1FPO A;  1Q43 A;  1GKF A;  4JYA O;  5E1A C;  4ABM A;  4JAS A;  4QE7 A;  1KUQ A;  3OW2 U;  2HJF C;  1MZF A;  2O57 A;  3ZIA G;  4LR3 A;  3QVN A;  4BIU A;  5IYZ B;  2UXB B;  4FPP A;  2OCC B;  2DE0 X;  4R8C A;  2YDE A;  4DUY O;  4LFA O;  1M56 C;  3CCU V;  3KCX A;  3SPC A;  4X20 B;  3SDL A;  1NQT A;  4WFH A;  2QKS A;  1KKC A;  5B1B C;  4JGS A;  3LNN A;  2RN9 A;  2YC0 A;  2YID A;  1EZJ A;  1X59 A;  2BTQ A;  2A3Q A;  3GB7 C;  2KG7 A;  3A0R A;  4PJ0 Z;  3U10 A;  2UUA O;  4A5U B;  5DEC A;  2JS3 A;  4JI3 O;  3SGI A;  4X1K A;  2XAJ A;  5LMU O;  1THZ A;  4IIJ B;  1DLB A;  3HKC B;  4AHC A;  4B3M O;  1BL8 A;  1TGO A;  3OR7 C;  1VQ7 V;  2ADQ B;  4LFC B;  3A0H Z;  1Z5W A;  1M57 B;  3JAW B;  3P3P A;  1SQQ H;  1M5I A;  4I50 A;  3WB1 A;  4QPJ A;  4DR3 O;  1K34 A;  2QDO A;  3OT7 A;  3ML0 A;  3J80 N;  1NJI W;  2QM4 A;  1ENV A;  2DJV A;  1AI4 A;  1P7G A;  1V54 C;  4FLW A;  2OIE A;  3JD0 A;  1TVK A;  1QR8 A;  4UCT A;  3FAV A;  4U3J B;  1QVF U;  3T2M A;  1HNZ B;  3EXA A;  1L1F A;  1N34 B;  1N0N A;  3OD4 A;  1FXK C;  3G71 V;  2Q0A A;  1N0J A;  1YJ9 V;  1VF5 B;  1FFX A;  2WA4 A;  4ZBM A;  1FJG B;  3TCU A;  4WFF A;  4UCU A;  1GN4 A;  4CH6 A;  2AW9 A;  4B08 A;  2QKC A;  5KAF Z;  3BRC A;  3STL C;  1XNR O;  5LOV A;  3VQX A;  3TJT A;  2QWP B;  3AK3 A;  4J42 A;  5LHG A;  4DR6 O;  4C7U A;  3W7T A;  3AG7 A;  3JD2 A;  3RYI A;  4JYY A;  3E22 A;  1NS1 A;  3JAR B;  5FPO A;  2FL4 A;  2A79 B;  1XDC A;  2CUG A;  3L71 H;  3K04 A;  4RAI A;  3DC5 A;  4UVB A;  2CTW A;  2OT5 A;  3HKE A;  5BXZ A;  3QO7 A;  1OCZ B;  1MMM A;  3CWB H;  2HP8 A;  1SQG A;  2Q7H A;  4RWU A;  1GM9 A;  1AP6 A;  4NVP A;  2UU9 O;  2OTJ V;  4O2A B;  4LWS B;  1AJN A;  5BR8 O;  4EKW A;  1VF6 C;  1RFY A;  3G80 A;  4ZI7 B;  1P49 A;  3CC4 V;  4FMT A;  5KHJ A;  5IJ0 B;  2P90 A;  1MNG A;  1BGY H;  1JFF A;  2IJJ A;  2X6C A;  4JI5 B;  1RM1 C;  2Z0A A;  1LR1 A;  4J7Z A;  1Y76 A;  4JI6 O;  2Z5U A;  2DQ3 A;  2IU0 A;  1F4N A;  1N33 B;  3F5T A;  1A32 A;  3ZHV A;  1YIJ V;  2ZNJ A;  4YJ2 B;  3FKS G;  5JH7 A;  4DK1 A;  2F66 C;  2F4V B;  3RVY A;  3ABL C;  4NXM B;  4TUY A;  3QG5 A;  3RYH B;  2ZXW C;  4KUM A;  3A2F A;  1VQ4 V;  5LBQ A;  4O2B A;  2WPD G;  3BHP A;  1PPJ H;  2X7R B;  1XL6 A;  2HVK C;  1LUV A;  4UV8 A;  5EBW C;  5LP6 C;  2Q7E A;  1NVP D;  1JOY A;  1S5J A;  3KG2 A;  1SQX H;  5CA1 B;  2EX3 A;  2IJI A;  1IXM A;  3O65 A;  4X66 O;  2OTL V;  2UUB O;  5JWP A;  4JAA A;  2YIA A;  1K73 W;  2JIZ G;  5JQG A;  4O4L B;  4KP4 A;  1SF9 A;  2PTM A;  1XNQ O;  3JAM N;  5L3C A;  2AHZ A;  2UXX A;  4J7J A;  2LFS A;  5HFL A;  4BWA A;  3JAK A;  2P6J A;  4J11 A;  4G28 B;  4OPH A;  5BMV B;  3H01 A;  4UB8 Z;  1X4T A;  3IFX A;  4J10 A;  2QSA A;  2YI9 A;  4FK5 C;  1FXK B;  3OTF A;  4LH7 A;  5D5Q A;  1NI8 A;  2AZ0 A;  1S76 D;  4DR4 O;  5DED A;  4ZHQ A;  1ZAU A;  4PHZ A;  3W7X A;  1WA8 B;  1LNQ A;  2VWJ A;  4X1I B;  1OCR B;  4JI0 O;  2CTQ A;  2KB1 A;  3JAL B;  1S77 D;  2ADP A;  1GM7 A;  2WLI B;  5B1O A;  1YDX A;  4LBE C;  4TSF G;  1P84 F;  3HKB B;  4FLU A;  3K0G A;  4I5S A;  3ZBH A;  2DQ0 A;  2FML A;  3K9A A;  2YIC A;  2QWO B;  2UXC B;  3VQW A;  2IJK A;  1YJN V;  2DYS B;  4YJ3 A;  1Q6U A;  3AG4 C;  1WAZ A;  3CME V;  4IYH A;  4RUF A;  1VQP V;  5LGN A;  1N32 B;  1NTM H;  2HJD A;  5GON B;  5IDJ A;  5CBF A;  4I4T B;  4DRX B;  4B3T O;  4MS2 A;  3RW0 A;  3SR2 C;  4WF9 V;  4FLZ A;  1SES A;  4JTD B;  4W4K A;  4ZKI A;  2BSK A;  4LNU A;  3UQ8 A;  3EVK A;  4LC1 A;  1I5Y A;  1H8E G;  1E1Q G;  3AG1 C;  1Y4M A;  5KMG A;  3HR0 A;  4O4I B;  4PDM A;  3X2Q B;  1O9H A;  3FYI B;  5FL7 G;  4I9Q A;  2XAS A;  4KFM A;  2DWE C;  1ZTE A;  4B3S O;  5FNV A;  3JCZ A;  3K5M A;  2YXY A;  1JPX A;  1YJW V;  1HNZ O;  2ZE6 A;  1YXB A;  2OYQ A;  1IDS A;  2K9P A;  1HR0 O;  2RQ6 A;  4JZG A;  2YEV B;  4I55 A;  3ZN1 A;  1R3J C;  1HNX B;  4H44 B;  2ZM6 B;  3DXR A;  1F7Y A;  4GYC B;  2YSU B;  5DN6 G;  2RNB A;  1AJP A;  4UXN A;  3JAT A;  5CN0 A;  3SPH A;  1KB9 F;  1HNW B;  3UO2 A;  3CPW U;  1Y74 B;  5LP6 B;  3K0D A;  2Y4T A;  5EZY A;  1AB3 A;  1OCO C;  1SZX A;  2BE3 A;  1PM9 A;  5CB4 B;  1SA0 A;  3R66 A;  2EIL C;  5JJN B;  4LF9 B;  5CBH A;  3N2G B;  4I9W A;  2YI8 A;  1JX9 A;  2K1E A;  4MTX A;  1VQ8 V;  5LHH A;  3SYQ A;  4DXW A;  5LA6 B;  4J7K A;  3HKD A;  1XHX A;  3L9D A;  1O9G A;  4FIP C;  1YEW A;  2A7W A;  1AI5 A;  1UFI A;  2ETN A;  2WLH A;  3E2E A;  1XMO O;  2WSS G;  4RQF A;  2ILM A;  4X88 A;  2F93 B;  3IC7 A;  5LMN O;  4GKK O;  3LSQ A;  5C8Y B;  2ZDI A;  4H37 A;  3R65 A;  4JI5 O;  1DGS A;  2CH7 B;  3U0Z A;  2ITC C;  1T5E A;  1OHH G;  3B8M A;  1PNL A;  5K1P A;  3ETE A;  2E5L O;  4D6T H;  5AG2 A;  3H1J H;  1N33 O;  4I0X B;  5J2U A;  4DV3 O;  2W0F C;  4NXN O;  3B4S A;  3N2K B;  3OGI B;  3S3W A;  4K8X A;  2QWN B;  2A0L A;  1XMQ O;  4Q20 A;  2DWD C;  3AG4 B;  1PL0 A;  3ZHS A;  1QU7 A;  4JI4 B;  1KKD A;  4MW3 A;  3FX7 A;  3OEE G;  3ZMS A;  1SS3 A;  1R6N A;  3P3N A;  1EN6 A;  2Q7G A;  2YS8 A;  5IYB O;  4X64 B;  1GN3 A;  2XTA A;  1DK1 A;  3KCY A;  3RN4 A;  3OEH G;  1R3K C;  1XEQ A;  4JZ2 A;  5JVD B;  2GUZ A;  1WPX A;  3AG1 B;  1BHA A;  5LYJ A;  4UB6 Z;  1FXH A;  2KG7 B;  2BOC C;  4F4L A;  4HYO A;  4L8J A;  1W0J G;  4PI0 A;  1SQP H;  3CCM V;  2GTS A;  3ZHQ A;  4X1K B;  2ZCE A;  2E3C A;  1GH6 A;  3OAA G;  3BAA A;  2DOS A;  2VQE O;  3ABK C;  4PA6 A;  4WBN B;  3CS5 A;  1QLN A;  2BTO A;  4Z2W A;  1UPG A;  3ZMT A;  4JI1 B;  2AHY A;  2JGU A;  2CGN A;  4MT8 A;  4EFB A;  4O4J A;  4PDR A;  4DV1 B;  3JD4 A;  2W6J G;  4MVS A;  3OTO O;  5JJE B;  4I50 B;  2VWK A;  4BIZ A;  3LUT B;  3ZJZ A;  1B3Q A;  3CRM A;  2LW1 A;  5JCO A;  2QR4 A;  1GM8 A;  1N36 B;  5EBL C;  3D3Q A;  2GBO A;  3WB0 A;  3D36 A;  1Y66 A;  2Q0O C;  5LXT A;  1B04 A;  1FD9 A;  1TVK B;  4MVU A;  4DV0 B;  1VQO V;  4GX2 A;  3ASN B;  3FAV B;  4LF6 O;  2OCH A;  2EIL B;  1KD1 W;  3T1C A;  3B2E E;  4F6R B;  1ZL8 A;  1IBM B;  3SYC A;  1FFX B;  4E4E A;  2ZIN A;  2MW2 B;  4GKJ B;  3CRA A;  3M8A A;  4IGG A;  4LCU C;  1DF4 A;  1ZUQ A;  3A8T A;  3Q4H B;  5LOV B;  2EIN B;  2UXD B;  4RO2 A;  5IJ9 B;  2VQF B;  2HEP A;  3JYC A;  3RWR D;  3RYI B;  4TOI A;  3E22 B;  2N74 A;  1V55 B;  2JGD A;  2IJH A;  4IT5 A;  2IU3 A;  4QGP A;  5KAI Z;  2QTS A;  1XHZ A;  1BCC H;  1FXV A;  5H6R A;  3EHB B;  3RYC B;  4TQF A;  4TV9 A;  2JJ2 G;  4JI2 B;  2HKO A;  1L0L H;  3CCL V;  2RJZ A;  4MTO A;  4BIO A;  5EYP A;  1AR4 A;  3WG7 B;  2A06 H;  4U7O A;  1EN5 A;  4EB6 B;  2F1M A;  3IJ4 A;  4I7Z B;  3CCS V;  2G38 A;  4DV4 B;  3T1Y O;  5GTH Z;  1U97 A;  1KQS U;  4X1Y B;  2ZM6 O;  3ZX6 A;  1SKV A;  3CEI A;  1JFF B;  2H8P C;  1FFT B;  3SPJ A;  1XI1 A;  2QEX V;  4GX1 A;  2Q6A A;  3UT5 B;  1P7B A;  2X6B A;  3RBZ A;  1YSC A;  4X62 B;  2V4D A;  3RVZ A;  3DSQ A;  4B3R O;  2F43 G;  4X89 A;  2ZQM A;  2M6Y A;  4LF4 O;  3CB2 A;  4DV6 O;  2JEU A;  3ZHR A;  5DM6 V;  1Q82 W;  2GDS A;  3ETQ A;  1GN2 A;  4JYB A;  2WLL B;  2P4V A;  1SQV H;  4LF9 O;  5JH7 B;  2QJ1 A;  4AIL C;  3BEH A;  4TUY B;  1AIL A;  3W7U A;  1XRE A;  4L87 A;  3SPI A;  4U7N A;  4TV8 B;  1AP5 A;  3L75 H;  3L72 H;  2LW7 A;  2AZ2 A;  2UUC B;  1YF2 A;  4FLY A;  2RDC A;  2WWW A;  2R70 A;  3ZRW A;  3K3W A;  4K0K O;  4WFE A;  2XAF A;  4LFB O;  4DV2 O;  4JV5 O;  1K5S A;  2D2C B;  1E79 G;  2C2A A;  4DR1 O;  3OE7 G;  3J7A U;  4X65 O;  1I94 O;  3PJS K;  1PL4 A;  3CJH B;  3K9S A;  5E79 Z;  1WB7 A;  3C3S A;  3OR6 C;  4KXR A;  4X8A A;  3TK1 A;  4BW9 A;  3OMN B;  4UUJ C;  4JI4 O;  4ZHQ B;  1M4U A;  4KL1 A;  4AI8 A;  2XT9 A;  2ZDI C;  2Q9L A;  2Y0P A;  3N27 A;  1IZ3 A;  1MAB G;  2EIJ C;  4DV5 B;  2AGA A;  4FFB B;  1I5X A;  1YTF D;  3E86 A;  1AI6 A;  3K06 A;  1VF7 A;  2Q4P A;  1RSO A;  3C3T A;  1F23 A;  2F95 B;  1ZSP A;  2EJR A;  3BCC H;  4D7T A;  2FKX A;  1ARO P;  3HKC A;  2EUL A;  1M56 B;  4GUN A;  4EFE A;  1GAX A;  1SC5 B;  3TGU H;  3CSX A;  4MSW C;  3AG3 C;  4YY3 B;  3JAW A;  1KU9 A;  3IAY A;  4DV7 B;  1W2B U;  5B1B B;  2YUA A;  4GLX A;  4UCR A;  1TUE B;  3B09 A;  2EZO A;  3H1I H;  1SZT A;  3CRQ A;  4LF5 B;  1XQ8 A;  1S0V A;  5B3S C;  4MVM A;  4LNU B;  3NXS A;  2M7W A;  4YHH B;  2D3O W;  1R73 A;  3UKM A;  1PD3 A;  1UJW B;  4IHJ A;  1JJ2 U;  1TUB A;  4P2Z A;  5KMG B;  1YHQ V;  4UCO A;  3E8F A;  1G4Y B;  4NR1 A;  2ARH A;  2OIG A;  1IBK O;  1DF5 A;  1VIB A;  3ZN0 A;  2P67 A;  4CH3 A;  2ZD9 A;  3GVM A;  1V54 B;  3QTC A;  2XAQ A;  4PA9 A;  4BR6 A;  1BS3 A;  2Y69 C;  3P30 A;  5LHI A;  1NH2 B;  2EIK C;  1IBM O;  5A2Q N;  4I55 B;  3BFR A;  3AEI A;  4OX9 B;  3C90 A;  5B5E Z;  3JAR A;  1K7D A;  2HHH B;  4J9Z B;  3K5L A;  2EIM C;  1JQ0 A;  5JCO C;  5H9C A;  2ZIO A;  2CE4 A;  3D36 C;  5IE9 A;  3J81 N;  4PV1 B;  2DW4 A;  2VQF O;  2HG5 C;  4JI7 B;  3T4D A;  2IM9 A;  5HFM A;  2UXB O;  5H5N A;  3G4S V;  4WFG A;  4WFB V;  1SA0 B;  3T4Z A;  5GTI Z;  1PNM A;  4DR7 B;  4PDL A;  2HLD G;  2RCV A;  3E35 A;  4MTF A;  1VAR A;  5CBG A;  1OV9 A;  2JRI A;  1GK9 A;  1Q5O A;  1J5E B;  1Q90 D;  3CC7 V;  3CCV V;  2KQX A;  4MVR A;  1NR1 A;  3OUF A;  3OMI B;  4DO2 A;  3AG2 C;  1D5N A;  1F51 A;  2EJ7 A;  3WU2 Z;  2L35 A;  1BQZ A;  1HP8 A;  3CHX A;  4DV4 O;  4WCE V;  2RMK B;  4NTX A;  4U3F H;  3VQY A;  4MVQ A;  4LFC O;  5IWA B;  2Y48 A;  1B06 A;  1R1B A;  4DW1 A;  4AQY B;  4NB5 A;  1ZX3 A;  3H1H H;  4JYA B;  1EM1 A;  2QE7 G;  4X62 O;  4YIP A;  1SQB H;  1GN6 A;  1H8H G;  3RYF A;  5J2T B;  5CA0 B;  3LNM B;  2PI4 A;  1QR9 A;  1RM1 B;  5J2U B;  2EZP A;  3CC2 V;  2XAG A;  4MVO A;  5EIB D;  3UO3 A;  3B77 A;  2ZNI A;  2KSD A;  4UCV A;  1N34 O;  5B1A C;  4O4H A;  4DUY B;  4LFA B;  1H2G A;  5TIS Z;  2LJ2 A;  3JAS B;  4UCS A;  1FJG O;  1LUW A;  3PN1 A;  1W59 A;  4GCZ A;  3ABL B;  3D3I A;  4DW0 A;  2P22 C;  4FZ0 A;  4UVC A;  2ZXW B;  4P9P A;  4OPA A;  3TXQ A;  5LMU B;  5BMV A;  4B3M B;  4WFA V;  2GUZ B;  1J95 A;  2IW5 A;  3WFV A;  4HAM A;  3K03 A;  4RQE A;  1QHT A;  1CPY A;  2XND G;  4PEL A;  3BPZ A;  3A0B Z;  3SJQ C;  2XAH A;  3RFR A;  2ZE8 A;  4FM2 A;  5L3D A;  4X1I A;  3QO8 A;  4JI8 B;  1R3L C;  4IL6 Z;  1VP7 A;  4DR3 B;  3VBB A;  1WP8 A;  1JJO A;  1NZ6 A;  3JAL A;  5KLV H;  2Y69 B;  2Y4U A;  4JPR A;  4O4J B;  4GZR B;  3CXH F;  3HKB A;  2R9R B;  3FB8 C;  1MZE A;  1VQ9 V;  1HDJ A;  1QNM A;  1YCI A;  3APQ A;  2WLJ A;  2EIM B;  5EC1 C;  1US6 A;  3M7M X;  5CA3 A;  4K8Z A;  4ASU G;  2KKW A;  2PF4 E;  5LXT B;  1ZLZ A;  2HFE C;  5L3E A;  5FPR A;  2Q73 A;  5KX5 B;  2EBO A;  1OZ0 A;  5ITZ A;  1VQ5 V;  1K33 A;  3THO A;  3JSL A;  1YVW A;  2OCC C;  1WLE A;  4DR6 B;  4YY3 O;  1WNS A;  5H2F Z;  2IBZ H;  1H2N A;  2F4V O;  4ZIB A;  5H6Q A;  4O4I A;  3ABU A;  4FM1 A;  2V1D A;  4NXM O;  3AG2 B;  2Q67 A;  2LO1 A;  5KUM A;  1L8D A;  3TET A;  2ZT9 B;  3UCS C;  3F7V C;  3SYA A;  1EBO A;  4JTC B;  2JGD B;  3BA8 A;  4D7S A;  2ZR3 A;  1YZB A;  2GSM B;  4Z1M G;  3MHH C;  1Q6I A;  2LQT A;  1RP3 B;  2PUS A;  3I56 V;  2CDY A;  2UU9 B;  1CP9 A;  4R50 A;  1B6Q A;  1AVM A;  5BR8 B;  1M57 C;  1D2D A;  4HZ3 A;  1QCE A;  3TXS A;  3QO5 A;  3W7W A;  1SER A;  2ATK C;  2YEV A;  2BTQ B;  5EYP B;  5JJJ B;  3AK1 A;  1CXZ B;  2GHY A;  5KA5 A;  1FKA O;  1JVM A;  3CD6 V;  2Q69 A;  4JTA B;  2X0L A;  2ZE7 A;  3ZS8 C;  1KYO F;  3SYP A;  4CH5 A;  5IYD O;  4P9O A;  4N23 A;  5B1A B;  3MAQ A;  4JI6 B;  2BOB C;  5CB4 A;  1WPB A;  3BA9 A;  5L3B A;  4MVZ A;  3SPG A;  4FVM A;  3CP1 A;  2V7Q G;  3N2G A;  1EFR G;  2YXH A;  1M93 A;  1F4M A;  3CCQ V;  4DUZ B;  4CC6 A;  4DR5 B;  1N4C A;  2QWR B;  2MK3 A;  2YIB D;  5KHH A;  1BHB A;  5C93 A;  3H1L H;  1M9N A;  3CCE V;  1OCO B;  2UXC O;  4ZOL A;  1IXB A;  1Q7Y W;  2Q5Z A;  2JJ1 G;  3E8G A;  1M90 W;  3I55 V;  2F23 A;  3F7Y C;  4FFK A;  1MG1 A;  1G8M A;  4OXS A;  1N32 O;  4X66 B;  3GWO A;  3QNE A;  2CH7 A;  1XNQ B;  4KHP B;  2B5U A;  3L74 H;  1U96 A;  2FB5 A;  1NVP B;  2ZR2 A;  5IWA O;  4TWK A;  3OMA B;  1MA1 A;  3RGB A;  3ZRW B;  4B7E A;  1VEW A;  5F2V O;  1JR9 A;  4DR4 B;  3K57 A;  3HKE B;  4JI0 B;  1XIL A;  4DR2 B;  3KZI Z;  3G6E V;  3K59 A;  2PYL A;  2GV9 A;  5L3F A;  4CS4 A;  2JS5 A;  2CGO A;  4QNH B;  5JVD A;  3E8H A;  4DYL A;  1HNX O;  2PY5 A;  5LL6 Y;  1W0K G;  3ZHT A;  2XHB A;  3JD3 A;  1RSO B;  1HNW O;  1XUQ A;  1Y76 B;  4WBN A;  1WJZ A;  4B3T B;  1NBM G;  4N21 A;  3NR7 A;  1VQK V;  1XBL A;  1OJH A;  2Q8V A;  2E74 B;  1K97 A;  2LFR A;  3P32 A;  4MTG A;  4BW5 A;  2BCC H;  4HNA A;  4OGQ B;  4JI8 O;  3CMA V;  5KUK A;  4EEQ A;  1SET A;  3APO A;  5KA6 A;  4O2B B;  4B3S B;  1HWY A;  1MSD A;  3QF7 A;  3ABK B;  4TQD A;  1KBH A;  1WB8 A;  2NN4 A;  3FYE B;  2Z3Y A;  4JAV A;  2PYJ A;  4IHJ B;  1TUB B;  4H33 A;  3O9O A;  1VQN V;  3LDE A;  5FLX N;  3SJB C;  2ZIM A;  1HR0 B;  4F6R A;  3K5O A;  2VRZ A;  2XUM A;  3LSS A;  1OCR C;  5JQG B;  3ZCC A;  1DTO A;  3Q4H A;  2WA3 A;  3JAK B;  2H94 A;  1TA8 A;  2X6A A;  2ITD C;  3SJC C;  5IJ9 A;  1K4D C;  2LP7 A;  3F5W C;  3OM3 B;  3K79 A;  4X9Q A;  2P06 A;  2P7T C;  5IYZ A;  3E89 A;  3SYO A;  3MHS C;  4LF8 B;  5IY5 C;  2XOK G;  1P4R A;  2DYS C;  1S5L Z;  3RYC A;  5IT9 N;  4X20 A;  2Y0I A;  2ZE5 A;  2WLK A;  3FB6 C;  4X64 O;  1D5A A;  3ZRS A;  1H2S B;  4NKG B;  3CCJ V;  4EB6 A;  4ICG A;  4TT3 G;  2N04 A;  3WB2 A;  2QM8 A;  4IIJ A;  1Q81 W;  2Q68 A;  2HVJ C;  1XMO B;  3ZHU A;  1KEC A;  2H3O A;  4X1Y A;  4YJ3 B;  5K1X A;  2QTO A;  2FTK A;  3IGA C;  5LMN B;  1VQL V;  4GKK B;  1IBL B;  3X2Q C;  3ABM C;  1XOU A;  3UT5 A;  3LDD A;  2N05 A;  3ETD A;  5LGU A;  4PDV A;  2E5L B;  4JI1 O;  2PZS A;  3E83 A;  1Z2G A;  4DV3 B;  4DV1 O;  3LDC A;  4NXN B;  3CXC U;  2BSK B;  2WLL A;  3E8B A;  4U3J A;  5L3G A;  1GRJ A;  1XMQ B;  1KP3 A;  1QQC A;  1S3J A;  1JA8 A;  3IC9 A;  3K5N A;  1N36 O;  4DUZ O;  4JF3 A;  3RYF B;  3BY6 A;  3OFN G;  5BY1 A;  4DR5 O;  1BSM A;  1Q8I A;  2AXT Z;  1URF A;  4LP8 A;  5FNV B;  4DV0 O;  5GW7 A;  3ZRX A;  4TV8 A;  3ZRV A;  4DK0 A;  2R72 A;  4O4H B;  1M1K W;  2NR5 A;  5LGT A;  1Z5V A;  1BE3 H;  4GKJ O;  4E2L A;  3DXR B;  2QM7 A;  3K58 A;  1SRY A;  4KHP O;  1I08 A;  3RT3 C;  2UXD O;  3JAT B;  3LSU A;  2PGG A;  4NTW A;  1EZV H;  1YIT V;  1NKD A;  4MW8 A;  2VQE B;  5EZY B;  4BAY A;  5A9G A;  3CJH A;  4FJC C;  1RPR A;  2QKA A;  4FLX A;  1PNK A;  2ODM A;  4J9Y B;  1PKX A;  3OTO B;  4O2A A;  4LWS A;  1JCH A;  4JI2 O;  3D8C A;  3JSN A;  4ZI7 A;  1FYJ A;  5IJ0 A;  4DR2 O;  1IX9 A;  5D5P A;  4FFB A;  3G67 A;  2E75 B;  1CEZ A;  3HKD B;  2CK3 G;  4J80 A;  1MOF A;  1NR7 A;  3T1H B;  2WAM A;  1BMF G;  1K9M W;  4LF7 B;  3MDS A; 
#chains in the Genus database with same CATH homology
 1V55 B;  3K08 A;  2IJH A;  1WLE A;  2IU3 A;  4PA4 A;  2OTJ V;  1AJN A;  4EKW A;  1QVG U;  1K4C C;  5IY5 B;  1FXV A;  5H6R A;  4PA7 A;  3CC4 V;  4FMT A;  3EHB B;  2JJ2 G;  2P90 A;  2HKO A;  5H6Q A;  1E1R G;  2DYR C;  3ABU A;  3CCL V;  2EIJ B;  2V1D A;  3AG2 B;  2Q67 A;  4MTO A;  5KUM A;  3TET A;  1FS0 G;  3MD0 A;  3WG7 B;  2IJJ A;  2X6C A;  4U7O A;  3F7V C;  3SYA A;  1RM1 C;  1EBO A;  3CYO A;  4JTC B;  1ORQ C;  3OGC C;  5B1N A;  2ZR3 A;  4Z1M G;  2GSM B;  3CCS V;  4QE9 A;  3MHH C;  3FB5 C;  2Z5U A;  2DQ3 A;  3I56 V;  2IU0 A;  1F4N A;  1CP9 A;  4R50 A;  1YIJ V;  1B6Q A;  4XDL A;  1M57 C;  4YXW G;  1KQS U;  4CZZ A;  4HZ3 A;  3AG3 B;  1QCE A;  3QO5 A;  3FKS G;  4R7C A;  3W7W A;  1SER A;  2ATK C;  2YEV A;  3ABM B;  2H8P C;  1FFT B;  3SPJ A;  3RVY A;  2QEX V;  1YI2 V;  4GX1 A;  2Q6A A;  3ABL C;  1P7B A;  2GHY A;  5KA5 A;  2X6B A;  3ETG A;  1JVM A;  3CD6 V;  3RBZ A;  4UV9 A;  2ZXW C;  2Q69 A;  4R6Z A;  1YSC A;  4KUM A;  1VQ4 V;  3RVZ A;  5LBQ A;  4JTA B;  2WPD G;  2X0L A;  2F43 G;  4X89 A;  2R9I A;  2ZQM A;  2X7R B;  1XL6 A;  3SYP A;  4G2K A;  2HVK C;  5IYD O;  5B3S B;  4P9O A;  2JEU A;  5DM6 V;  1Q82 W;  4N23 A;  5B1A B;  1KP2 A;  4UV8 A;  4JYB A;  2WLL B;  5EBW C;  2BOB C;  1NVP D;  1JOY A;  5L3B A;  3KG2 A;  4MVZ A;  1FXK A;  4P30 A;  2IH1 C;  3SPG A;  2IJI A;  3CP1 A;  4CBC A;  1IXM A;  3BEH A;  2V7Q G;  1OCC C;  1N8R W;  2OTL V;  1EFR G;  3W7U A;  1F4M A;  3CCQ V;  2B1G A;  1K73 W;  2JIZ G;  1XL4 A;  4KP4 A;  4L87 A;  3SPI A;  5L3C A;  2AHZ A;  4U7N A;  3M99 B;  2JEX A;  2UXX A;  2MK3 A;  2LFS A;  5HFL A;  1BHB A;  4QJF B;  5C93 A;  3ASN C;  1QLE C;  3ASO C;  3OUS A;  2P6J A;  2WLI A;  4G28 B;  3EFF K;  1M9N A;  3CCE V;  3H01 A;  1OCO B;  2EIK B;  3IFX A;  4FK5 C;  1Q7Y W;  2JJ1 G;  1FXK B;  3E8G A;  1M90 W;  1K92 A;  2WWW A;  3JD1 A;  4JYC A;  4XDK A;  3I55 V;  3CCR V;  2NNU A;  3F7Y C;  1S76 D;  1AJQ A;  3ZRW A;  1Q86 W;  3K3W A;  1MG1 A;  1G8M A;  4WFE A;  2XAF A;  3W7S A;  3W7X A;  1LNQ A;  4OXS A;  1OCR B;  3GWO A;  4RUE A;  2KB1 A;  3QNE A;  3STZ C;  1K5S A;  2PI5 A;  1E79 G;  2C2A A;  3OE7 G;  1S77 D;  2EIN C;  5EBM C;  1GM7 A;  2WLI B;  2B5U A;  1NVP B;  2ZR2 A;  5B1O A;  1K8A W;  4LBE C;  3PJS K;  4TSF G;  4JAU A;  3K0G A;  4I5S A;  3OMA B;  4TWK A;  1AI7 A;  2DQ0 A;  1V55 C;  3OR6 C;  4X8A A;  3TK1 A;  3K9A A;  3ZRW B;  3OMN B;  4UUJ C;  1R3I C;  2IJK A;  1YJN V;  2DYS B;  4GX5 A;  2ZDI C;  3AG4 C;  4XBF A;  3CME V;  2IH3 C;  4RUF A;  1VQP V;  2EIJ C;  1MAB G;  5LGN A;  1I5X A;  1YTF D;  3E86 A;  5IDJ A;  5CBF A;  1MSW D;  1AI6 A;  3WG7 C;  3K06 A;  5BZB A;  3G6E V;  1COW G;  1F23 A;  2EJR A;  4MS2 A;  1ARO P;  3RW0 A;  5L3F A;  2WLN A;  4WF9 V;  3ZMV A;  5CMU A;  4QNH B;  1M56 B;  1SES A;  4JTD B;  4ZKI A;  4LC1 A;  4MSW C;  3ZMU A;  1I5Y A;  3E8H A;  3AG3 C;  2DYR B;  1H8E G;  1E1Q G;  3AG1 C;  1Y4M A;  3DGE A;  1W2B U;  5B1B B;  1ZWI C;  1NH2 D;  4PDM A;  2JDI G;  1W0K G;  3X2Q B;  3ZMZ A;  1R6K A;  3FYI B;  5FL7 G;  1TUE B;  2XAS A;  2JK5 C;  2NLJ C;  3JD3 A;  4KFM A;  2DWE C;  2EZO A;  2W6I G;  3ABT A;  3JCZ A;  1SZT A;  3VOU A;  3FB7 C;  1AR1 B;  4QIW F;  1GO3 F;  4G27 B;  1S0V A;  1JPX A;  1YJW V;  5B3S C;  4MVM A;  1NBM G;  4N21 A;  3NXS A;  2M7W A;  1S5H C;  1VQK V;  2D3O W;  1R73 A;  3UKM A;  1PD3 A;  1UJW B;  1JJ2 U;  5IYC O;  4P2Z A;  1K97 A;  2LFR A;  3P32 A;  4MTG A;  3E8F A;  1YHQ V;  4BW5 A;  1S72 V;  1YTF B;  2YEV B;  3ZN1 A;  1R3J C;  1G4Y B;  3CMA V;  5KUK A;  1H38 A;  2YSU B;  5DN6 G;  1SET A;  3HPL C;  5KA6 A;  1GMG A;  2A9H A;  5EK0 A;  2QA4 V;  1DF5 A;  3DTU B;  1AJP A;  3ZN0 A;  1QBZ A;  4UXN A;  2P67 A;  1HWY A;  5CN0 A;  3SPH A;  3ABK B;  2ZD9 A;  1V54 B;  3UM7 A;  4PA3 A;  3CPW U;  2UXN A;  3FYE B;  1RPO A;  2Z3Y A;  4JAV A;  2XAQ A;  4PA9 A;  3K0D A;  2B1I A;  2Y69 C;  3P30 A;  4H33 A;  1OCO C;  1VQN V;  5LHI A;  1NH2 B;  2EIK C;  3LDE A;  1VQ6 V;  2HR3 A;  2EIL C;  3AEI A;  1K3E A;  1K7D A;  1OCC B;  4J9Z B;  5CBH A;  3B8N A;  2EIM C;  1JQ0 A;  1JX9 A;  2K1E A;  4I9W A;  4MTX A;  1GTO A;  2WLM A;  5H9C A;  4GX0 A;  5LHH A;  1VQ8 V;  3SYQ A;  3LSS A;  4DXW A;  1OCR C;  4QPK A;  4GT1 A;  3ZCC A;  1VQM V;  2DW4 A;  1KC8 W;  3HB3 B;  1DTO A;  2HG5 C;  5J9P C;  3T4D A;  1QLE B;  3ASO B;  2H94 A;  1OCZ C;  2X6A A;  2ITD C;  5HFM A;  4FIP C;  5EC2 C;  1K4D C;  1AI5 A;  3G4S V;  4WFG A;  2LP7 A;  3F5W C;  1K5Q A;  3OM3 B;  4XDJ A;  3T4Z A;  4WFB V;  3K79 A;  1ROP A;  2WLH A;  3E2E A;  2WSS G;  2P7T C;  1PNM A;  4RQF A;  4PDL A;  3E89 A;  2HLD G;  4UVA A;  3SYO A;  3E35 A;  3MHS C;  4MTF A;  5CBG A;  5IY5 C;  2XOK G;  4X88 A;  1P4R A;  1GK9 A;  2DYS C;  3IC7 A;  1GKF A;  3LSQ A;  5E1A C;  2ZDI A;  4H37 A;  3CC7 V;  3CCV V;  4JAS A;  4MVR A;  1NR1 A;  3R65 A;  2WLK A;  3FB6 C;  3OUF A;  4QE7 A;  3OMI B;  2ITC C;  3AG2 C;  4DO2 A;  1OHH G;  3OW2 U;  2HJF C;  1F51 A;  1PNL A;  3B8M A;  3ETE A;  3ZIA G;  3ZRS A;  4BIU A;  3CCJ V;  4WCE V;  4TT3 G;  2W0F C;  2QM8 A;  4FPP A;  2OCC B;  4R8C A;  4MVQ A;  1Q81 W;  1M56 C;  2Q68 A;  3CCU V;  2HVJ C;  2Y48 A;  2A0L A;  3SPC A;  1KEC A;  4Q20 A;  1NQT A;  2DWD C;  3AG4 B;  1PL0 A;  4WFH A;  2QTO A;  2FTK A;  3IGA C;  2QKS A;  5B1B C;  1VQL V;  4JGS A;  4MW3 A;  1KKD A;  3OEE G;  3X2Q C;  3ABM C;  1EZJ A;  3ZMS A;  2QE7 G;  3GB7 C;  1R6N A;  1H8H G;  3A0R A;  3LDD A;  3ETD A;  5LGU A;  4PDV A;  5IYB O;  3LNM B;  2PI4 A;  1QR9 A;  1RM1 B;  3CC2 V;  2EZP A;  2XAG A;  4MVO A;  2XAJ A;  1THZ A;  1DLB A;  3E83 A;  1BL8 A;  3B77 A;  3OEH G;  1R3K C;  3LDC A;  3OR7 C;  3CXC U;  1VQ7 V;  2WLL A;  5B1A C;  3E8B A;  1M57 B;  1WPX A;  1H2G A;  3AG1 B;  5L3G A;  1BHA A;  1KP3 A;  1S3J A;  1FXH A;  2BOC C;  4JF3 A;  4HYO A;  3BY6 A;  4F4L A;  3OFN G;  1W0J G;  4GCZ A;  3ABL B;  3D3I A;  4QPJ A;  3CCM V;  1K34 A;  4LP8 A;  3ML0 A;  4UVC A;  1NJI W;  2ZXW B;  4P9P A;  3OAA G;  1ENV A;  3ABK C;  4PA6 A;  5GW7 A;  1AI4 A;  3ZRX A;  1V54 C;  3ZRV A;  3JD0 A;  1QLN A;  3ZMT A;  1QR8 A;  2AHY A;  1M1K W;  4WFA V;  4MT8 A;  1J95 A;  2IW5 A;  3WFV A;  4PDR A;  5LGT A;  1QVF U;  3T2M A;  3JD4 A;  2W6J G;  4HAM A;  3K03 A;  4MVS A;  4RQE A;  1L1F A;  1CPY A;  2XND G;  4PEL A;  4BIZ A;  1FXK C;  3LUT B;  3G71 V;  3ZJZ A;  4E2L A;  1YJ9 V;  3SJQ C;  2XAH A;  1GM8 A;  2QM7 A;  5EBL C;  4ZBM A;  1SRY A;  5L3D A;  3TCU A;  3QO8 A;  4WFF A;  1R3L C;  3D36 A;  1Y66 A;  3VBB A;  4MVU A;  3STL C;  1VQO V;  4GX2 A;  1YIT V;  1NKD A;  4MW8 A;  3ASN B;  2Y69 B;  4JPR A;  4BAY A;  5LHG A;  2R9R B;  4FJC C;  3FB8 C;  1RPR A;  1VQ9 V;  2EIL B;  3W7T A;  3JD2 A;  1KD1 W;  3T1C A;  1PNK A;  4J9Y B;  1PKX A;  2WLJ A;  1JCH A;  3SYC A;  2EIM B;  5EC1 C;  2A79 B;  3K04 A;  4RAI A;  5CA3 A;  4UVB A;  4ASU G;  4LCU C;  2OT5 A;  1DF4 A;  2HFE C;  5L3E A;  1CEZ A;  3QO7 A;  1OCZ B;  2EIN B;  2CK3 G;  4RO2 A;  1MOF A;  1NR7 A;  2EBO A;  1OZ0 A;  1VQ5 V;  2WAM A;  1K33 A;  3JYC A;  1BMF G;  1K9M W;  1GM9 A;  2OCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...