4N23A

Crystal structure of the gp2 core domain from the california academy of science virus, monoclinic symmetry
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
123
structure length
123
Chain Sequence
ENLYFQGNMKQIEDKIEEILSKIYHIENEIARIKKLIGAIASKIIKTANYTTNALFLLNKEESEIRDHVVEHELALNYLLAHQGGLCNVVKGPMCSSDIDDFSKNVSDMIDKVHEEMKKFYHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords GP2 Ectodomain
publication title Structural Characterization of the Glycoprotein GP2 Core Domain from the CAS Virus, a Novel Arenavirus-Like Species.
pubmed doi rcsb
source organism Cas virus
total genus 52
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4n23A00
3CP1A 1F23A 1MOFA 3B77A 1QR8A 5H9CA 5HFMA 5KA6A 2OT5A 3H01A 4FIPC 3M99B 4JF3A 4E2LA 1SZTA 1MG1A 4JPRA 4N21A 2X7RB 5HFLA 1DF5A 1QBZA 3P30A 1I5XA 1Y4MA 3GWOA 2P6JA 1K34A 1QR9A 1DF4A 1DLBA 2EZOA 3K9AA 4JGSA 3MHHC 4FJCC 3CYOA 3MHSC 1Y66A 1JPXA 1EBOA 2LP7A 1I5YA 4G2KA 5CMUA 4FK5C 3WFVA 3B8NA 4N23A 2M7WA 2MK3A 5CN0A 5KA5A 2EBOA 1JQ0A 2EZPA 1QCEA 3B8MA 1K33A 1ENVA
chains in the Genus database with same CATH superfamily
4WF9V 1R6NA 5H9CA 1ROPA 4J11A 2B1IA 3FB6C 4ICGA 1FJGB 1T5EA 4UCVA 5DEDA 1R1BA 3ZRWB 3MHHC 4DK1A 1S72V 2Q7EA 1QLNA 5L3GA 2ZNJA 2CTWA 2VQEO 3ZEDA 5CN0A 3CX5F 2F66C 2YSUB 4I50B 5EZYB 3U10A 4E2LA 3N2GB 3ZMSA 4GYCB 4TV8A 1VP7A 2BE3A 2LJ2A 1G6UA 2M6YA 4GKJO 1S0VA 3K08A 3LSUA 2IM9A 3CCQV 4JASA 3ABLB 1M57B 5B1AC 3CWBH 5E79Z 1GRJA 1YITV 3VQVA 3E8BA 4TV9A 3LDEA 3JASB 4JF3A 3SJAC 2E5LB 4ZI7A 1NH2B 1M56B 2FL4A 3QF7A 5CB4A 4QPJA 1RPRA 5CA3A 3AK1A 3CMAV 5LBQA 2JGUA 3K3WA 2AW9A 3RFRA 3KCYA 1NBMG 4DV2B 2EINC 2Z3YA 1HNWO 2X6CA 4UV9A 2JRIA 2DWDC 4JYBA 4GX1A 3CCLV 2CE4A 4E4EA 3AG1B 3LSQA 2ZIMA 3PN1A 2CH7A 3E8GA 3BCCH 2NNUA 4NTYA 2HHHB 1COWG 3UQ8A 4JTCB 3THOA 2LP7A 4LF5O 2YXYA 2JIZG 4LCUC 2XHBA 2HFEC 3CCUV 2H3OA 2IJKA 1TVKB 3FB5C 2XAFA 1LUVA 1SZTA 4BR6A 3OUFA 1F51A 3H1HH 2IH3C 3ETEA 3HKDA 3RYFA 4DK0A 3OGIB 3ZN0A 1YXBA 5H6RA 4MTXA 1QQCA 5C93A 1OCOC 1MZEA 1F4NA 5B5EZ 4UVBA 1G1XB 1VARA 4UCSA 5LYJB 3P3NA 4KHPB 1QHTA 3CE2A 4YY3B 3LDCA 4JAUA 3L73H 3QO5A 1XHXA 3OW2U 4IYIA 3JD3A 3OT7A 4TUYB 4X89A 2P67A 4YHHB 2R9IA 1XL6A 2FB5A 2Q8VA 4UXNA 3TETA 2DN9A 1I0HA 1L8DA 2CTQA 3JAWB 3X2QC 4WBNA 5EC2C 2L35A 3EVKA 3DC5A 1Q90D 4J7JA 2YIBD 5FPOA 3JAKA 3W7UA 3CYOA 3F7VC 4DV6B 2OCCB 2ZXWB 1GO3F 4B3RO 5E1AC 2BTOA 3ABMC 4DV2O 3CJHA 1Y67A 5IYBO 1IBLB 5EYPB 4FLTA 2ZE8A 2Q0AA 5CBHA 2QTSA 3ZHRA 5B1OA 1V54C 3CEIA 3OUSA 4IGGA 1OCZB 1Z2GA 4QJFB 1VQ6V 2HHHO 1U96A 2L6LA 2HJFC 3HKCB 3VBBA 1D5NA 1MNGA 2DQ3A 1H2SB 3UT5B 2P22C 5IT9N 3L74H 3JALA 1OCCB 4A5UB 5KHJA 4OPAA 2QTOA 4WFGA 3E86A 2YIDA 3HKBB 3CRMA 1M4UA 5J2TA 4DR5O 2Y0PA 1DLBA 2ETNA 3OGCC 1VQLV 3ASOB 2LO1A 2KSDA 4DV3B 3JCZA 2R9AA 2WLLB 1ENVA 2JVDA 4O4IA 3E8FA 4JI6B 3D36C 4KHPO 4JPRA 4YY3O 1YEWA 2KG7A 5BZBA 4JYAO 2AGAA 1Y4MA 4YJ2A 4YXWG 3JATA 1BGYH 4O4JB 3K9SA 2IH1C 4XDKA 2OWOA 3BA8A 4FVMA 4HZ3A 3HKEB 2PYJA 1AROP 4ASUG 4YHHO 4DV0B 1DK1A 3H01A 1RM1C 3JSLA 3K57A 4JTDB 2C2AA 1Q6UA 4ZBMA 1GAXA 1YIJV 5CA1A 3H9VA 2HKOA 4WCEV 1DTOA 3R66A 2XTAA 1YI2V 5LP6B 4UB6Z 2AXTZ 4F6EA 3B8NA 1SQVH 3QVNA 4BIUA 1BE3H 1YZBA 1XI1A 1V9PA 3HPLC 2Q0OC 1WNSA 1F4MA 3NR7A 1XMQB 2NR5A 3ZHTA 3N2KA 1V55C 4O4HB 3P30A 5L3EA 3H1KH 4RWUA 1BHAA 1IBKB 1TUBA 4J7KA 2QA4V 3ZN1A 2Q68A 3TK1A 5FNVA 4TQFA 1RSOB 1VF7A 3I56V 4LF7B 4JYYA 2BSKA 2A79B 1NR1A 3M7MX 2JK5C 3K9AA 2P7TC 1CEZA 1I7FA 1HDJA 1K7DA 1B06A 3UO2A 4DV3O 1Q5OA 4FFKA 3K5NA 2RCVA 1UJWB 2MK3A 4PA3A 4MTOA 3QNEA 4AILC 4MTGA 4JI6O 5JH7B 1WA8A 1F7YA 5TISZ 3QO7A 4J7ZA 4DR4O 1Q7YW 4DR6B 1ORQC 4UB8Z 3CS5A 4FM2A 1NU1H 3WB0A 3CCJV 1KYOF 4GZRB 2PF4E 3WFVA 2EZPA 2P90A 1J95A 3DXRB 3AG7A 4DV0O 1Q3EA 2DMXA 4RQEA 1I5XA 2NLJC 1MMMA 4CS3A 3BFRA 2GV9A 3CCRV 2QKCA 3OR6C 1N34B 1Y74B 2EILC 4I55A 3L70H 1HR0O 1W59A 5DECA 2OIEA 1M90W 1MOFA 2DYRB 3RYIB 4LF4B 4DR3O 3S3XA 4TV9B 1HNZB 4WFEA 1RPOA 2EZOA 4ZI7B 3T1HB 1IBKO 5GTIZ 1HW7A 4FMTA 5CB4B 3U0ZA 4KP4A 5B3SB 1Y76A 2P4VA 2EULA 2FYUH 4PDLA 1SQXH 1BL8A 5LGNA 1ZTEA 4P2ZA 2E3CA 2XASA 3ZBHA 2QM4A 1E1RG 2F1MA 1SERA 4UCUA 4NB5A 1HP8A 2Q7HA 3D3IA 3CCMV 3F5WC 4ZHQA 2X7RB 2F4VB 3TCUA 1GMGA 3B09A 2DYSB 4Z2WA 3ABKC 3CC7V 3ZHUA 1B04A 1Q6IA 4BW5A 4LF6B 2EIMB 3E22B 1Q8IA 2UUAO 4HNAA 4PELA 1I94B 4DR6O 2E74B 1H2MA 3TJTA 4IIJB 4U7NA 3HKDB 1VQ4V 3G4SV 1W2BU 2OCHA 1ZAUA 3ASNB 5D5QA 5JWPA 5JCOC 3PJSK 3JSNA 1R3LC 1PV0A 3L75H 3J81N 2VWKA 4H0LB 4WFAV 3K03A 5IDJA 3LNMB 1DGSA 4DRXA 4LP8A 4X8AA 3FKSG 4H13B 1N34O 5FPRA 5BMVA 1FFTB 3AK3A 3FFQA 3E35A 4FM1A 3OMIB 1E1QG 3M99B 5H5NA 4J41A 3CHXA 2JJ2G 1HNZO 3T1HO 4WBNB 3LDDA 4FJCC 4ABMA 4R7CA 4DYLA 3A0HZ 1G8MA 1XMOB 1GK9A 4NXMB 2FMLA 4N21A 2RNBA 1MA1A 5KUMA 1QR8A 5LXTA 1OJHA 5C8YA 5IJ0B 5LMNB 2MW2B 1QVGU 5KX5A 3OMNB 3ZMVA 1XBLA 3QG5A 5IYDO 3P32A 1SRYA 3AG4C 4JGSA 1WJZA 4B08A 2UXCB 1WB8A 1SKVA 3JYCA 1IX9A 1XDCA 4JV5O 4Z1MG 3BRCA 2F4VO 2EJRA 4GKKO 5J2UB 3H1LH 3STLC 1SQQH 2Q4PA 5HFLA 4TSFG 2KKWA 2BCCH 3UKMA 5ITZA 4LF6O 1AI6A 4FFBB 1W0KG 1I94O 1VQPV 2XAGA 4J80A 1BQZA 1N8RW 1KKCA 1AR4A 2GBOA 4NTXA 5B1AB 3ZRXA 5EBLC 2PZSA 1ZSPA 3GWOA 4TQDA 5GTHZ 1EZVH 4DV5B 3OEEG 3BHPA 4LFAO 4AHCA 1WPXA 2CUGA 2YI9A 2WLMA 4YIOA 2KG7B 2QJ1A 4YJ2B 1NKDA 1FS0G 1N4CA 3JATB 2EIJB 5FL7G 3AEIA 5KHKA 5EIBC 3Q4HB 1R6TA 4EB6A 4CZZA 2P4KA 1NVPB 2EINB 4C7UA 1MSWD 4GX2A 2YUAA 3O9OA 5IYCO 1ZL8B 4LF9B 2LW7A 4RUEA 1Q86W 2F93B 1SC5B 4GX0A 2UXXA 4G2KA 4B3RB 1AR5A 1XMOO 4WFBV 1KMIZ 4NXMO 4LFCB 1QLEC 2PYLA 5JJNB 3FX7A 1EN4A 4FIPC 3OFNG 4RQFA 3T4ZA 2H94A 5LMNO 1X4TA 2E75B 5IYZA 1S5HC 3ABLC 1M57C 3TGUH 5IWAB 2F43G 3FYIB 2UXNA 4MVOA 4W4KA 1IBMB 4MT8A 3SR2C 4X20B 2UXCO 4UCTA 3I55V 1TUBB 5JQGA 5JCOA 5LA6B 4HYOA 3BABA 4GLXA 3CRAA 1SA0A 5FNVB 1OCOB 1ZLZA 4JI5O 4CH6A 4F6RA 1Q6HA 1NT2B 2RN9A 1B3QA 3W7SA 1JVMA 3CMEV 3ZJZA 4DR5B 1TGOA 2YXLA 2RDCA 5B1BB 4DW0A 4FLZA 3ZHQA 3KZIZ 1GM7A 1NVPD 2PY5A 1FXKC 1SQFA 5LMUB 3K5LA 3FB7C 3IC9A 1Z5WA 4O2AB 4DV5O 3AG1C 4DUYO 5CBGA 2UUBB 3ZRVA 4BIZA 2QE7G 3SJQC 3UO3A 4MVMA 4YIPA 4X62O 4JYAB 3X2QB 1K34A 1WA8B 1SZXA 3RT3C 4I4TB 4PA7A 4XBFA 3TXSA 1EN6A 4CS2A 2QKSA 4YJ3A 5DN6G 5LOVA 3WB2A 3ML0A 4ZKIA 3K58A 3SYOA 3K59A 2UXBO 1FAFA 1PKXA 2Z5UA 2QR4A 2ZCEA 4LWSB 4NXNO 4PI0A 4OX9B 5IE9A 2K9PA 1XREA 3ABMB 2A0LA 4IHJB 4JAVA 5KHIA 1H2GA 3W7WA 3AG2B 2JEXA 5H2FZ 1L1FA 5A2QN 1V54B 1TUEB 4LF9O 4JI0B 4F4LA 1XUQA 5GW7A 4JI2B 3SGIA 1JFFB 5IY5C 1PPJH 4X1IA 4LFCO 1L0NH 5GONB 2X0LA 2OT5A 2OYQA 2OTJV 2ILMA 1GKFA 4LC1A 3RYHA 1LNQA 2BTQA 1CP9A 5L3FA 2VRZA 2B5UA 4U3FH 5IWAO 1IDSA 1Q81W 1L0LH 1S3JA 1Q82W 4IT5A 2V1DA 3H1JH 4X1YA 5IJ9B 1IBMO 1RP3B 5BR8O 2ZR3A 2JGDB 3ZRSA 4JI4O 1QVFU 3BY6A 1K8AW 4MVRA 1AILA 5L3BA 3ICXA 2YS8A 3CPWU 2Y4TA 2YI8A 3BAAA 1GN2A 4X64B 3SPIA 3JARA 4I9QA 1IXMA 4PD4F 3SJBC 3G6EV 4P30A 3SPHA 1K92A 5EC1C 3ZMTA 3GVMA 5CBFA 1K4CC 5LMUO 4N23A 4AQYB 1W0JG 4D6TH 5KA6A 1VF5B 4J42A 4OPHA 1D5AA 2ADPA 3SYPA 3ZRWA 2UUBO 3EFFK 3APOA 4DR4B 3IJ4A 2XAHA 4QIWF 4LFBB 1WP7A 2XAQA 4ZOLA 1N33B 5EZYA 4JYCA 2LGQA 4K0KB 5LHGA 1IZ3A 2GTSA 3N2GA 2ZD9A 4UUJC 2Y0IA 4GX5A 2HVKC 3WG7C 2ZQMA 4OX9O 2QWNB 3C3TA 1EN5A 1OHHG 2G38A 2HJDA 4DR7B 1IURA 5JJEB 1YVWA 1KD1W 1OCRB 1V55B 3FYEB 1PM9A 4MW3A 4X1KB 4XDLA 1FD9A 3JASA 2EIKB 5K1XA 5LL6Y 5KAFZ 2GSMB 4JI0O 2DW4A 1HR0B 4DRXB 4JI2O 1QCEA 4G27B 1WB7A 2E76B 5BMVB 4DUZB 2HP8A 1GH6A 5J9PC 3KKYA 1XQ8A 3D3QA 4DR3B 2QWPB 3STZC 3RVZA 2R72A 2ZINA 3CC2V 1FXKA 3BVOA 4K8XA 1WN7A 1EFRG 1JOYA 1VQMV 1P7BA 2CGOA 1JQ0A 5CA0A 2UU9B 1THZA 3OEHG 3M8AA 1SESA 3OAAG 5LHIA 2Q69A 4X64O 2N04A 1BHBA 3IC7A 1RFYA 3MD0A 3ABTA 4UVCA 1TVKA 2HR3A 5EBWC 4CC6A 1M1KW 4AQYO 3JD4A 4D7SA 4PI2A 4X65B 2W0XA 1VQOV 1QU7A 3ETDA 4K35A 2UUAB 3G6BA 4UFZA 1M9NA 5ITZB 4LFBO 3P3PA 1N33O 2ADQB 2ATKC 1KECA 2ZT9B 1BT8A 4K0KO 1P49A 1PD3A 1FXHA 1YF2A 3SPJA 4B3MB 3JD0A 2QM7A 1F23A 5L3DA 4P9PA 2YICA 3A0BZ 1FKAO 5FLXN 3AG3C 1EZJA 3K5MA 2Y69C 4DR7O 3T1CA 2QWRB 3CD6V 2WLIA 1BCCH 4QE7A 4TV8B 4AI8A 3SYQA 4BW9A 2PI5A 4K8ZA 4MS2A 4J10A 1AI4A 2M7WA 3JAWA 2GHYA 1VQ7V 4X88A 1AP5A 4DUZO 2AZ2A 5B1NA 1K73W 2CDYA 4L87A 3IAYA 1NQTA 4EB6B 2P5OA 3JD1A 3CCSV 4RO2A 1P7GA 3G80A 1VQKV 2Q67A 1H38A 3R65A 3RYCA 1VMGA 3D8CA 5EYPA 4DO2A 1KQSU 4Q20A 1XNQB 2XOKG 1KP2A 2V4DA 2UU9O 1GTOA 3RW0A 1P84F 1Q43A 1WAZA 3ABKB 1AJQA 1GN6A 4UVAA 5KAIZ 4EFEA 3HKCA 2GUZA 2R70A 3QTCA 3SYCA 4JV5B 2CH7B 2DYRC 4FZ0A 4I9WA 4MTFA 4GKKB 4H44B 4X65O 1JMKC 2YEVA 4JI8O 4Z1VA 4CC5A 2ODMA 1SF9A 2A3QA 4F6RB 1XEQA 3CSXA 3DTUB 1WLEA 3RYFB 2W0FC 1R3IC 2HLDG 4B3MO 4FM0A 1VQ9V 4O4JA 1O9HA 5D5PA 4LFAB 5L3CA 3HKEA 2DWEC 1LR1A 1GN3A 4TOIA 4DR1B 1KP3A 2DYSC 1BS3A 1M5IA 2ZM6B 3B40A 2EIMC 4YJ3B 1H2LA 4HAMA 1N0JA 5LOVB 1KB9F 1NTKH 2EX3A 1UPGA 4QNHB 3FD9A 3CC4V 4QE9A 3ZHVA 3AG4B 3I5DA 1JPXA 4H33A 3DGEA 4TT3G 4D7TA 3JAKB 4CBCA 5B66Z 4DV7B 2EBOA 1LUWA 2JDIG 1XNQO 2WSSG 1FFXA 5HFMA 4L8JA 3B2EE 4PHZA 2N05A 4EKWA 2DJVA 4GCZA 1MG1A 1AJNA 5JVDA 1FXVA 1K97A 3CJHB 1J5EO 4X9QA 4I0XA 1RSOA 2BTQB 5AG2A 4KFMA 4I7ZB 1CPYA 5K1PA 5KMGA 4JAAA 3CP1A 2VQFB 1S77D 4JI5B 5F2VO 2IJIA 1NR7A 1M93A 2R9RB 1Z5VA 4O2BA 1DF5A 1GM9A 1WP8A 3L72H 4PJ0Z 3VQXA 3JALB 3CRRA 4X66O 2CK3G 1E79G 1KUQA 1SQPH 5J2TB 3JARB 2HEPA 4LR3A 3U11A 5JH7A 2ZIOA 1VQ5V 3B8MA 1PL4A 4DV1B 2AHZA 2UUCO 4DUYB 3SJCC 2AZ0A 4LH6A 2CGNA 2JEUA 4X62B 4O4IB 3IGAC 5BXZA 4LNUA 1SQGA 1K4DC 3E83A 3DXRA 2XAJA 4BIOA 4Q6GA 3BEHA 4DR1O 3A0RA 1H8HG 1KBHA 4ZOLB 2UXBB 4DV4O 3ZMUA 2ZM6O 4NXNB 2O57A 4CS4A 3FAVA 1QLEB 1Y74A 1N32B 3A2FA 4U7OA 2P6JA 3C3SA 1GN4A 3UM7A 3SDLA 4G28B 3RYIA 1XILA 2B9ZA 4O4LA 1YDXA 3CXCU 5KHHA 4DV7O 5CA1B 1ZWIC 4JI3O 3JD2A 4B7KA 4IL6Z 3JAMN 4HBNA 2WLNA 1H2KA 4JZ2A 2FTKA 2YC0A 1VEWA 3HR0A 2GTAA 2DE0X 2KQXA 2EIJC 5EIBD 3N2KB 5BR8B 2IU3A 4RAIA 1D2DA 2QM8A 4LF8B 4UCRA 2OIGA 4JI4B 3DSQA 1FXKB 1M56C 2VQFO 3B4SA 4NYKA 3W7TA 5CA0B 2HG5C 4K3AA 2WLJA 2H8PC 2BSKB 2IJHA 5CMUA 3G71V 3E22A 1JR9A 1S5JA 4DV1O 5DM6V 2LGWA 4JI7B 3ZHSA 3OTFA 4RUFA 2QWOB 4IIJA 1FJGO 1R3JC 3G67A 4QGPA 1ZUQA 4UV8A 2ITCC 2FKXA 2PTMA 3MAQA 4GT1A 1K3EA 2RJZA 1AI7A 1NH2D 1AVMA 2WPDG 1N36B 4FLWA 1KKDA 1K9MW 3C90A 3CB2A 4GUNA 4J9ZB 1G4YB 1VQNV 1FPOA 2YXHA 5IY5B 1HNXB 4FPPA 2W6IG 2CTPA 5B1BC 4U3JA 1H2NA 2D3OW 1R73A 2ZE7A 1N32O 4BWAA 2WA4A 1CXZB 1IVSA 4PA4A 1O9GA 4JZGA 1PL0A 1FYJA 2QDOA 2WLIB 1VQ8V 4FZ1A 1S76D 2P06A 3T1YB 3OTOB 2E5LO 3ZS8C 2Y48A 4I55B 3RVYA 2IJJA 2Q5ZA 4KL1A 2Q73A 2YIAA 3ZCCA 5JJJB 1MSDA 4TWKA 4B3SB 3J80N 3E89A 4FLXA 4W4LA 1YJNV 5IJ0A 1I5YA 2Q9LA 4LF8O 1U97A 3QO8A 3MDSA 4LBEC 3SYAA 1XHZA 1Y76B 4XDJA 2QWQB 3RYCB 4PDRA 5KHGA 3AG2C 4IYHA 2AHYA 1OV9A 1A32A 4BAYA 1QR9A 2OCCC 2ZXWC 2BOBC 1VF6C 3LSSA 3WU2Z 2QGNA 5J2UA 2Z0AA 1JJ2U 1PNMA 2GUZB 1UFIA 1ZX3A 2ZE6A 1K33A 3O65A 4MW8A 5LGUA 3K06A 4FFBA 4OGQB 4JI7O 4ZHQB 2JS3A 1NTZH 3WG7B 1OCZC 2W6JG 1RM1B 4PA9A 3RWRD 2WWWA 4CH5A 2YEVB 2ZE5A 2X6BA 1N36O 4I50A 4UCOA 4HNAB 1KC8W 1AB3A 1K5SA 1OCCC 2WA3A 4MVZA 2JJ1G 4R6ZA 4JTAB 1YSCA 4MVQA 3BA9A 4J9YB 5A9GA 1HNXO 3ASOC 2XT9A 1Y6XA 3Q4HA 1PNLA 2DOSA 2CAZC 4FLYA 4MVSA 2B1GA 3ETQA 3T1YO 3K0DA 1HWYA 3OTOO 1ZL8A 1US6A 2JS5A 3K5OA 1QBZA 1TAEA 2ITDC 4B3SO 3CRCA 4DV6O 3GWKC 1TA8A 2LFSA 3FB8C 1GM8A 5H6QA 2CTRA 3K0GA 1KU9A 3ABUA 3B77A 2IU0A 1IBLO 1VIBA 1OCRC 1FFXB 4X20A 2RMKB 5LXTB 3APQA 4WFHA 5C8YB 2EIKC 1WPBA 5JVDB 5LA6A 2LW1A 3WB1A 5KX5B 5LP6C 3VOUA 2YIBA 4JI1B 3RBZA 1EBOA 2YDEA 3CRQA 4I0XB 1XOUA 1JX9A 5KA5A 3J7AU 2ZDIC 5KMGB 3A8TA 2NN4A 4JI8B 1NZ6A 1XNRB 2IW5A 2K1EA 3AG3B 4PDMA 2Y69B 4O2BB 4DR2B 1BMFG 4O2AA 1Y66A 1BSMA 1AR1B 1R3KC 1PNKA 4FK5C 5LYJA 2QSAA 1YHQV 2EILB 2OTLV 5EK0A 1S5LZ 4I4TA 3N27A 2QEXV 3ETGA 2XNDG 4ZIBA 3E8HA 4TUYA 3LUTB 2WAMA 3EXAA 4LWSA 2PGGA 4NTWA 4LNUB 4B3TB 1PP9H 4IHJA 4EFBA 4MSWC 4QPKA 3KG2A 3SPCA 3CXHF 2F23A 1URFA 2PUSA 3VQYA 3F5TA 3EHBB 1VF6A 3FAVB 1EM1A 1JFFA 3JCUZ 5GONA 1YJWV 1AP6A 4P9OA 4H37A 3KCXA 3HB3B 3BPZA 3RN4A 2X6AA 3AK2A 1JCHA 5LHHA 4O4LB 1XMQO 2RQ6A 3SPGA 3K79A 3T4DA 5IJ9A 1JJOA 2VS0A 1BQ0A 2HVJC 2JGDA 3CCVV 2UXDB 3S3WA 1J5EB 4PA6A 3DC6A 4MVUA 1MABG 2ARHA 2KB1A 5IYZB 3UT5A 4JI1O 2XUMA 2N74A 4R8CA 3HKBA 3D36A 4WFFA 4LF7O 5JQGB 2ZNIA 4I5SA 3GB7C 2A9HA 1SA0B 5B3SC 3UCSC 1XNRO 1IXBA 4X66B 3H1IH 2WLLA 1SS3A 2LFRA 3VQWA 4DXWA 4DR2O 1N0NA 3W7XA 3ZIAG 1QNMA 4CH3A 4EEQA 2WLKA 2LQTA 4NR1A 3OD4A 2UUCB 2Q7GA 2ZKOA 1AI5A 4B7EA 2PI4A 2VWJA 2F95B 3OM3B 5KLVH 5KUKA 3MHSC 1YTFB 2QKAA 4KUMA 4NKGB 1SQBH 2VQEB 2BOCC 3NXSA 1XL4A 4B3TO 4DV4B 3T2MA 2D2CB 5LGTA 4NVPA 5BY1A 3ZMZA 4X1KA 4GKJB 4OXSA 1BZKA 3RGBA 1DF4A 5LP6A 2Y4UA 4FLVA 3E2EA 3ASNC 4U3JB 5EBMC 1JA8A 4LH7A 1NJIW 1NTMH 2ZDIA 3OR7C 2WLHA 4JI3B 4O4HA 1YJ9V 3IFXA 4CH4A 4PV1B 4LF4O 1H8EG 2A06H 4R50A 4X1IB 4FLUA 3L9DA 2IBZH 1I08A 2EJ7A 2UXDO 3F7YC 3LNNA 1X59A 3RYHB 2A7WA 4KXRA 2ZR2A 2GDSA 4X1YB 1R6KA 3OMAB 1HNWB 3K04A 1YTFD 1B6QA 4PDVA 1K5QA 3TXQA 2V7QG 3ZX6A 1NI8A 1MZFA 1YCIA 1NS1A 1P4RA 2DQ0A 3L71H 3OE7G 1SETA 3CCEV 4DW1A 4LF5B 1OZ0A 2Q6AA 1AJPA
chains in the Genus database with same CATH topology
4WF9V 1R6NA 5H9CA 1VQNV 1ROPA 2B1IA 5J9PC 3FB6C 5IY5B 4FPPA 2W6IG 5B1BC 1E1RG 2D3OW 1SERA 3STZC 1R73A 3RVZA 3ZRWB 3MHHC 4PA4A 3CC2V 1S72V 1FXKA 3D3IA 1PL0A 3CCMV 3F5WC 1QLNA 5L3GA 1EFRG 2WLIB 1JOYA 1VQMV 1P7BA 1VQ8V 5CN0A 1JQ0A 1S76D 2X7RB 2YSUB 3TCUA 1GMGA 1THZA 2DYSB 3OEHG 3ABKC 3CC7V 1SESA 4E2LA 3OAAG 2Y48A 3ZMSA 3RVYA 2IJJA 4BW5A 3ZCCA 2EIMB 5LHIA 2Q69A 1S0VA 4TWKA 4PELA 1BHBA 3K08A 3IC7A 3MD0A 3E89A 3CCQV 4JASA 3ABLB 1M57B 3ABTA 4U7NA 4UVCA 5B1AC 1VQ4V 2HR3A 1YJNV 5EBWC 3G4SV 1I5YA 1W2BU 3ASNB 3QO8A 1M1KW 4LBEC 3SYAA 3PJSK 1YITV 3JD4A 4XDJA 3E8BA 1R3LC 3LDEA 4JF3A 4PDRA 1VQOV 3AG2C 1NH2B 1M56B 3ETDA 2AHYA 4QPJA 1RPRA 5CA3A 3CMAV 4BAYA 1QR9A 2OCCC 2ZXWC 4WFAV 3K03A 5IDJA 3LNMB 4LP8A 2BOBC 4X8AA 1M9NA 3LSSA 5LBQA 3FKSG 1FFTB 2ATKC 1KECA 1JJ2U 1PNMA 3K3WA 1PD3A 1FXHA 3SPJA 3E35A 1K33A 4MW8A 5LGUA 3JD0A 2QM7A 1F23A 1NBMG 3K06A 2EINC 5L3DA 2Z3YA 3OMIB 4P9PA 1E1QG 3M99B 2X6CA 4UV9A 2DWDC 4JYBA 4GX1A 3CCLV 3WG7B 3AG1B 1OCZC 3AG3C 1EZJA 2W6JG 3LSQA 2JJ2G 2Y69C 3T1CA 1RM1B 4PA9A 3CD6V 3E8GA 2WWWA 2YEVB 2NNUA 2WLIA 4QE7A 1COWG 3LDDA 4FJCC 4JTCB 3SYQA 2PI5A 4R7CA 2X6BA 2LP7A 2JIZG 4LCUC 1G8MA 1KC8W 4MS2A 1GK9A 1K5SA 2HFEC 1AI4A 2M7WA 3CCUV 2GHYA 1OCCC 4N21A 1VQ7V 4MVZA 2IJKA 2JJ1G 4R6ZA 4X88A 4JTAB 1YSCA 5KUMA 1QR8A 4MVQA 3FB5C 2XAFA 4J9YB 1SZTA 5B1NA 1QVGU 1K73W 3OMNB 4L87A 3ZMVA 3OUFA 1F51A 3P32A 2IH3C 5IYDO 1SRYA 3AG4C 3ASOC 1NQTA 3ETEA 3JD1A 3CCSV 4RO2A 3ZN0A 4JGSA 1VQKV 2Q67A 1H38A 1PNLA 3JYCA 5H6RA 4MTXA 3R65A 4Z1MG 4DO2A 1KQSU 4Q20A 4MVSA 1OCOC 5C93A 2XOKG 2B1GA 1F4NA 4UVBA 1KP2A 2EJRA 1GTOA 3K0DA 1HWYA 3RW0A 3STLC 3ABKB 5HFLA 1AJQA 1QBZA 4TSFG 3UKMA 4UVAA 1AI6A 2ITDC 1W0KG 1VQPV 3LDCA 4JAUA 2XAGA 3QO5A 1N8RW 3OW2U 2LFSA 3SYCA 3FB8C 3JD3A 1GM8A 2DYRC 5H6QA 5B1AB 4X89A 3ZRXA 5EBLC 2P67A 4I9WA 3GWOA 2R9IA 3K0GA 3ABUA 4MTFA 3B77A 2IU0A 1XL6A 4UXNA 3TETA 3OEEG 2YEVA 3X2QC 1OCRC 5EC2C 4WFHA 1WPXA 2EIKC 2WLMA 3W7UA 3DTUB 3VOUA 3CYOA 3F7VC 2OCCB 2ZXWB 3RBZA 1WLEA 1EBOA 1GO3F 1NKDA 2W0FC 1FS0G 5E1AC 1JX9A 5KA5A 5FL7G 1R3IC 2EIJB 3AEIA 2HLDG 2ZDIC 3ABMC 1VQ9V 4CZZA 5IYBO 1NVPB 5CBHA 2EINB 5B1OA 5L3CA 1V54C 1MSWD 4GX2A 2IW5A 5IYCO 3OUSA 2DWEC 2K1EA 1OCZB 3AG3B 4QJFB 1VQ6V 4PDMA 2Y69B 1BMFG 1Y66A 1AR1B 1Q86W 4RUEA 1R3KC 2HJFC 4G2KA 4GX0A 2UXXA 1KP3A 1PNKA 2DYSC 4FK5C 3VBBA 4WFBV 2DQ3A 1QLEC 1YHQV 2EIMC 2EILB 2OTLV 5EK0A 4FIPC 1OCCB 3OFNG 4HAMA 4RQFA 3T4ZA 2H94A 2QTOA 3E86A 4WFGA 2QEXV 1S5HC 3ABLC 1M57C 4QNHB 3ETGA 2F43G 3FYIB 2XNDG 2UXNA 1DLBA 3OGCC 3CC4V 3E8HA 4QE9A 1VQLV 3AG4B 3ASOB 4MVOA 4MT8A 3LUTB 2WAMA 1JPXA 3I55V 4H33A 3DGEA 4TT3G 4CBCA 4HYOA 3JCZA 2EBOA 2WLLB 2JDIG 1ENVA 2WSSG 5HFMA 4MSWC 4QPKA 3KG2A 3E8FA 3SPCA 1OCOB 4EKWA 4GCZA 1MG1A 1AJNA 4JPRA 1FXVA 1K97A 3W7SA 1JVMA 5BZBA 3CMEV 3ZJZA 1Y4MA 4YXWG 3EHBB 5B1BB 4XDKA 2IH1C 4KFMA 1GM7A 4HZ3A 1YJWV 1NVPD 1CPYA 4P9OA 1FXKC 4H37A 3CP1A 3HB3B 3FB7C 1AROP 4ASUG 2X6AA 3AG1C 1JCHA 5CBGA 3H01A 5LHHA 1RM1C 1S77D 2IJIA 3ZRVA 3SPGA 1NR7A 3K79A 2QE7G 2R9RB 4JTDB 3SJQC 3T4DA 4BIZA 1DF5A 4MVMA 2HVJC 2C2AA 1GM9A 3CCVV 3X2QB 1K34A 2CK3G 4ZBMA 4PA6A 1E79G 4MVUA 1YIJV 1MABG 2KB1A 4PA7A 4XBFA 2HKOA 4WCEV 1DTOA 2QKSA 1YI2V 5DN6G 3B8NA 3ML0A 4ZKIA 3B8MA 3SYOA 1VQ5V 4R8CA 1PKXA 4BIUA 2Z5UA 3D36A 2AHZA 3HPLC 4WFFA 1F4MA 3ABMB 2A0LA 4JAVA 2JEUA 1V55C 4I5SA 1H2GA 3GB7C 3P30A 5L3EA 2A9HA 5B3SC 3W7WA 3IGAC 1BHAA 3AG2B 2JEXA 1L1FA 2QA4V 1K4DC 1V54B 3E83A 2WLLA 3ZN1A 2LFRA 1TUEB 2XAJA 4DXWA 2Q68A 3TK1A 3W7XA 3BEHA 3ZIAG 3A0RA 2WLKA 4F4LA 5GW7A 1H8HG 5IY5C 3ZMUA 2X0LA 2OT5A 3I56V 2OTJV 1GKFA 4LC1A 1QLEB 1AI5A 1LNQA 1CP9A 2PI4A 2A79B 5L3FA 1NR1A 2B5UA 2JK5C 1Q81W 1S3JA 2P6JA 4U7OA 3K9AA 2P7TC 3OM3B 1Q82W 2V1DA 3UM7A 1CEZA 5KUKA 4G28B 3MHSC 1YTFB 1K7DA 4KUMA 2ZR3A 3ZRSA 2BOCC 3NXSA 1XL4A 1UJWB 2MK3A 4PA3A 3CXCU 4MTOA 1ZWIC 1QVFU 3QNEA 3BY6A 3JD2A 1K8AW 3T2MA 4MVRA 4MTGA 5LGTA 2WLNA 5L3BA 3CPWU 2FTKA 3QO7A 3ZMZA 3SPIA 4OXSA 1Q7YW 1IXMA 1DF4A 3E2EA 3G6EV 3ASNC 1ORQC 4P30A 2EIJC 3SPHA 1K92A 5EBMC 5EC1C 3ZMTA 2IU3A 4RAIA 5CBFA 2QM8A 3CCJV 1K4CC 1NJIW 3WFVA 2ZDIA 4N23A 3OR7C 2EZPA 2P90A 2WLHA 1J95A 1W0JG 1FXKB 1M56C 5KA6A 1YJ9V 3IFXA 3SYPA 3W7TA 3ZRWA 3EFFK 1H8EG 2HG5C 4R50A 4RQEA 1I5XA 2NLJC 2WLJA 2XAHA 3F7YC 4QIWF 2H8PC 2XAQA 3CCRV 3OR6C 4JYCA 2IJHA 2ZR2A 2EILC 5CMUA 5LHGA 2ZD9A 4UUJC 3G71V 4GX5A 2HVKC 1M90W 1MOFA 3WG7C 1R6KA 3OMAB 2DYRB 5DM6V 3K04A 2ZQMA 1YTFD 4RUFA 1B6QA 4PDVA 1K5QA 1OHHG 2V7QG 1R3JC 4WFEA 1RPOA 2EZOA 4UV8A 2ITCC 1KD1W 1OCRB 1P4RA 1V55B 2DQ0A 4FMTA 4GT1A 4KP4A 3OE7G 1K3EA 1SETA 1AI7A 3FYEB 2WPDG 5B3SB 3CCEV 1NH2D 4MW3A 4XDLA 1KKDA 1K9MW 2EIKB 4PDLA 2GSMB 1OZ0A 2DW4A 1BL8A 5LGNA 2Q6AA 4P2ZA 2XASA 4J9ZB 1QCEA 4G27B 1G4YB 1AJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CP1 A;  1F23 A;  1MOF A;  3B77 A;  1QR8 A;  5H9C A;  5HFM A;  5KA6 A;  2OT5 A;  3H01 A;  4FIP C;  3M99 B;  4JF3 A;  4E2L A;  1SZT A;  1MG1 A;  4JPR A;  4N21 A;  2X7R B;  5HFL A;  1DF5 A;  1QBZ A;  3P30 A;  1I5X A;  1Y4M A;  3GWO A;  2P6J A;  1K34 A;  1QR9 A;  1DF4 A;  1DLB A;  2EZO A;  3K9A A;  4JGS A;  3MHH C;  4FJC C;  3CYO A;  3MHS C;  1Y66 A;  1JPX A;  1EBO A;  2LP7 A;  1I5Y A;  4G2K A;  5CMU A;  4FK5 C;  3WFV A;  3B8N A;  4N23 A;  2M7W A;  2MK3 A;  5CN0 A;  5KA5 A;  2EBO A;  1JQ0 A;  2EZP A;  1QCE A;  3B8M A;  1K33 A;  1ENV A; 
#chains in the Genus database with same CATH topology
 4WF9 V;  1R6N A;  5H9C A;  1ROP A;  4J11 A;  2B1I A;  3FB6 C;  4ICG A;  1FJG B;  1T5E A;  4UCV A;  5DED A;  1R1B A;  3ZRW B;  3MHH C;  4DK1 A;  1S72 V;  2Q7E A;  1QLN A;  5L3G A;  2ZNJ A;  2CTW A;  2VQE O;  3ZED A;  5CN0 A;  3CX5 F;  2F66 C;  2YSU B;  4I50 B;  5EZY B;  3U10 A;  4E2L A;  3N2G B;  3ZMS A;  4GYC B;  4TV8 A;  1VP7 A;  2BE3 A;  2LJ2 A;  1G6U A;  2M6Y A;  4GKJ O;  1S0V A;  3K08 A;  3LSU A;  2IM9 A;  3CCQ V;  4JAS A;  3ABL B;  1M57 B;  5B1A C;  3CWB H;  5E79 Z;  1GRJ A;  1YIT V;  3VQV A;  3E8B A;  4TV9 A;  3LDE A;  3JAS B;  4JF3 A;  3SJA C;  2E5L B;  4ZI7 A;  1NH2 B;  1M56 B;  2FL4 A;  3QF7 A;  5CB4 A;  4QPJ A;  1RPR A;  5CA3 A;  3AK1 A;  3CMA V;  5LBQ A;  2JGU A;  3K3W A;  2AW9 A;  3RFR A;  3KCY A;  1NBM G;  4DV2 B;  2EIN C;  2Z3Y A;  1HNW O;  2X6C A;  4UV9 A;  2JRI A;  2DWD C;  4JYB A;  4GX1 A;  3CCL V;  2CE4 A;  4E4E A;  3AG1 B;  3LSQ A;  2ZIM A;  3PN1 A;  2CH7 A;  3E8G A;  3BCC H;  2NNU A;  4NTY A;  2HHH B;  1COW G;  3UQ8 A;  4JTC B;  3THO A;  2LP7 A;  4LF5 O;  2YXY A;  2JIZ G;  4LCU C;  2XHB A;  2HFE C;  3CCU V;  2H3O A;  2IJK A;  1TVK B;  3FB5 C;  2XAF A;  1LUV A;  1SZT A;  4BR6 A;  3OUF A;  1F51 A;  3H1H H;  2IH3 C;  3ETE A;  3HKD A;  3RYF A;  4DK0 A;  3OGI B;  3ZN0 A;  1YXB A;  5H6R A;  4MTX A;  1QQC A;  5C93 A;  1OCO C;  1MZE A;  1F4N A;  5B5E Z;  4UVB A;  1G1X B;  1VAR A;  4UCS A;  5LYJ B;  3P3N A;  4KHP B;  1QHT A;  3CE2 A;  4YY3 B;  3LDC A;  4JAU A;  3L73 H;  3QO5 A;  1XHX A;  3OW2 U;  4IYI A;  3JD3 A;  3OT7 A;  4TUY B;  4X89 A;  2P67 A;  4YHH B;  2R9I A;  1XL6 A;  2FB5 A;  2Q8V A;  4UXN A;  3TET A;  2DN9 A;  1I0H A;  1L8D A;  2CTQ A;  3JAW B;  3X2Q C;  4WBN A;  5EC2 C;  2L35 A;  3EVK A;  3DC5 A;  1Q90 D;  4J7J A;  2YIB D;  5FPO A;  3JAK A;  3W7U A;  3CYO A;  3F7V C;  4DV6 B;  2OCC B;  2ZXW B;  1GO3 F;  4B3R O;  5E1A C;  2BTO A;  3ABM C;  4DV2 O;  3CJH A;  1Y67 A;  5IYB O;  1IBL B;  5EYP B;  4FLT A;  2ZE8 A;  2Q0A A;  5CBH A;  2QTS A;  3ZHR A;  5B1O A;  1V54 C;  3CEI A;  3OUS A;  4IGG A;  1OCZ B;  1Z2G A;  4QJF B;  1VQ6 V;  2HHH O;  1U96 A;  2L6L A;  2HJF C;  3HKC B;  3VBB A;  1D5N A;  1MNG A;  2DQ3 A;  1H2S B;  3UT5 B;  2P22 C;  5IT9 N;  3L74 H;  3JAL A;  1OCC B;  4A5U B;  5KHJ A;  4OPA A;  2QTO A;  4WFG A;  3E86 A;  2YID A;  3HKB B;  3CRM A;  1M4U A;  5J2T A;  4DR5 O;  2Y0P A;  1DLB A;  2ETN A;  3OGC C;  1VQL V;  3ASO B;  2LO1 A;  2KSD A;  4DV3 B;  3JCZ A;  2R9A A;  2WLL B;  1ENV A;  2JVD A;  4O4I A;  3E8F A;  4JI6 B;  3D36 C;  4KHP O;  4JPR A;  4YY3 O;  1YEW A;  2KG7 A;  5BZB A;  4JYA O;  2AGA A;  1Y4M A;  4YJ2 A;  4YXW G;  3JAT A;  1BGY H;  4O4J B;  3K9S A;  2IH1 C;  4XDK A;  2OWO A;  3BA8 A;  4FVM A;  4HZ3 A;  3HKE B;  2PYJ A;  1ARO P;  4ASU G;  4YHH O;  4DV0 B;  1DK1 A;  3H01 A;  1RM1 C;  3JSL A;  3K57 A;  4JTD B;  2C2A A;  1Q6U A;  4ZBM A;  1GAX A;  1YIJ V;  5CA1 A;  3H9V A;  2HKO A;  4WCE V;  1DTO A;  3R66 A;  2XTA A;  1YI2 V;  5LP6 B;  4UB6 Z;  2AXT Z;  4F6E A;  3B8N A;  1SQV H;  3QVN A;  4BIU A;  1BE3 H;  1YZB A;  1XI1 A;  1V9P A;  3HPL C;  2Q0O C;  1WNS A;  1F4M A;  3NR7 A;  1XMQ B;  2NR5 A;  3ZHT A;  3N2K A;  1V55 C;  4O4H B;  3P30 A;  5L3E A;  3H1K H;  4RWU A;  1BHA A;  1IBK B;  1TUB A;  4J7K A;  2QA4 V;  3ZN1 A;  2Q68 A;  3TK1 A;  5FNV A;  4TQF A;  1RSO B;  1VF7 A;  3I56 V;  4LF7 B;  4JYY A;  2BSK A;  2A79 B;  1NR1 A;  3M7M X;  2JK5 C;  3K9A A;  2P7T C;  1CEZ A;  1I7F A;  1HDJ A;  1K7D A;  1B06 A;  3UO2 A;  4DV3 O;  1Q5O A;  4FFK A;  3K5N A;  2RCV A;  1UJW B;  2MK3 A;  4PA3 A;  4MTO A;  3QNE A;  4AIL C;  4MTG A;  4JI6 O;  5JH7 B;  1WA8 A;  1F7Y A;  5TIS Z;  3QO7 A;  4J7Z A;  4DR4 O;  1Q7Y W;  4DR6 B;  1ORQ C;  4UB8 Z;  3CS5 A;  4FM2 A;  1NU1 H;  3WB0 A;  3CCJ V;  1KYO F;  4GZR B;  2PF4 E;  3WFV A;  2EZP A;  2P90 A;  1J95 A;  3DXR B;  3AG7 A;  4DV0 O;  1Q3E A;  2DMX A;  4RQE A;  1I5X A;  2NLJ C;  1MMM A;  4CS3 A;  3BFR A;  2GV9 A;  3CCR V;  2QKC A;  3OR6 C;  1N34 B;  1Y74 B;  2EIL C;  4I55 A;  3L70 H;  1HR0 O;  1W59 A;  5DEC A;  2OIE A;  1M90 W;  1MOF A;  2DYR B;  3RYI B;  4LF4 B;  4DR3 O;  3S3X A;  4TV9 B;  1HNZ B;  4WFE A;  1RPO A;  2EZO A;  4ZI7 B;  3T1H B;  1IBK O;  5GTI Z;  1HW7 A;  4FMT A;  5CB4 B;  3U0Z A;  4KP4 A;  5B3S B;  1Y76 A;  2P4V A;  2EUL A;  2FYU H;  4PDL A;  1SQX H;  1BL8 A;  5LGN A;  1ZTE A;  4P2Z A;  2E3C A;  2XAS A;  3ZBH A;  2QM4 A;  1E1R G;  2F1M A;  1SER A;  4UCU A;  4NB5 A;  1HP8 A;  2Q7H A;  3D3I A;  3CCM V;  3F5W C;  4ZHQ A;  2X7R B;  2F4V B;  3TCU A;  1GMG A;  3B09 A;  2DYS B;  4Z2W A;  3ABK C;  3CC7 V;  3ZHU A;  1B04 A;  1Q6I A;  4BW5 A;  4LF6 B;  2EIM B;  3E22 B;  1Q8I A;  2UUA O;  4HNA A;  4PEL A;  1I94 B;  4DR6 O;  2E74 B;  1H2M A;  3TJT A;  4IIJ B;  4U7N A;  3HKD B;  1VQ4 V;  3G4S V;  1W2B U;  2OCH A;  1ZAU A;  3ASN B;  5D5Q A;  5JWP A;  5JCO C;  3PJS K;  3JSN A;  1R3L C;  1PV0 A;  3L75 H;  3J81 N;  2VWK A;  4H0L B;  4WFA V;  3K03 A;  5IDJ A;  3LNM B;  1DGS A;  4DRX A;  4LP8 A;  4X8A A;  3FKS G;  4H13 B;  1N34 O;  5FPR A;  5BMV A;  1FFT B;  3AK3 A;  3FFQ A;  3E35 A;  4FM1 A;  3OMI B;  1E1Q G;  3M99 B;  5H5N A;  4J41 A;  3CHX A;  2JJ2 G;  1HNZ O;  3T1H O;  4WBN B;  3LDD A;  4FJC C;  4ABM A;  4R7C A;  4DYL A;  3A0H Z;  1G8M A;  1XMO B;  1GK9 A;  4NXM B;  2FML A;  4N21 A;  2RNB A;  1MA1 A;  5KUM A;  1QR8 A;  5LXT A;  1OJH A;  5C8Y A;  5IJ0 B;  5LMN B;  2MW2 B;  1QVG U;  5KX5 A;  3OMN B;  3ZMV A;  1XBL A;  3QG5 A;  5IYD O;  3P32 A;  1SRY A;  3AG4 C;  4JGS A;  1WJZ A;  4B08 A;  2UXC B;  1WB8 A;  1SKV A;  3JYC A;  1IX9 A;  1XDC A;  4JV5 O;  4Z1M G;  3BRC A;  2F4V O;  2EJR A;  4GKK O;  5J2U B;  3H1L H;  3STL C;  1SQQ H;  2Q4P A;  5HFL A;  4TSF G;  2KKW A;  2BCC H;  3UKM A;  5ITZ A;  4LF6 O;  1AI6 A;  4FFB B;  1W0K G;  1I94 O;  1VQP V;  2XAG A;  4J80 A;  1BQZ A;  1N8R W;  1KKC A;  1AR4 A;  2GBO A;  4NTX A;  5B1A B;  3ZRX A;  5EBL C;  2PZS A;  1ZSP A;  3GWO A;  4TQD A;  5GTH Z;  1EZV H;  4DV5 B;  3OEE G;  3BHP A;  4LFA O;  4AHC A;  1WPX A;  2CUG A;  2YI9 A;  2WLM A;  4YIO A;  2KG7 B;  2QJ1 A;  4YJ2 B;  1NKD A;  1FS0 G;  1N4C A;  3JAT B;  2EIJ B;  5FL7 G;  3AEI A;  5KHK A;  5EIB C;  3Q4H B;  1R6T A;  4EB6 A;  4CZZ A;  2P4K A;  1NVP B;  2EIN B;  4C7U A;  1MSW D;  4GX2 A;  2YUA A;  3O9O A;  5IYC O;  1ZL8 B;  4LF9 B;  2LW7 A;  4RUE A;  1Q86 W;  2F93 B;  1SC5 B;  4GX0 A;  2UXX A;  4G2K A;  4B3R B;  1AR5 A;  1XMO O;  4WFB V;  1KMI Z;  4NXM O;  4LFC B;  1QLE C;  2PYL A;  5JJN B;  3FX7 A;  1EN4 A;  4FIP C;  3OFN G;  4RQF A;  3T4Z A;  2H94 A;  5LMN O;  1X4T A;  2E75 B;  5IYZ A;  1S5H C;  3ABL C;  1M57 C;  3TGU H;  5IWA B;  2F43 G;  3FYI B;  2UXN A;  4MVO A;  4W4K A;  1IBM B;  4MT8 A;  3SR2 C;  4X20 B;  2UXC O;  4UCT A;  3I55 V;  1TUB B;  5JQG A;  5JCO A;  5LA6 B;  4HYO A;  3BAB A;  4GLX A;  3CRA A;  1SA0 A;  5FNV B;  1OCO B;  1ZLZ A;  4JI5 O;  4CH6 A;  4F6R A;  1Q6H A;  1NT2 B;  2RN9 A;  1B3Q A;  3W7S A;  1JVM A;  3CME V;  3ZJZ A;  4DR5 B;  1TGO A;  2YXL A;  2RDC A;  5B1B B;  4DW0 A;  4FLZ A;  3ZHQ A;  3KZI Z;  1GM7 A;  1NVP D;  2PY5 A;  1FXK C;  1SQF A;  5LMU B;  3K5L A;  3FB7 C;  3IC9 A;  1Z5W A;  4O2A B;  4DV5 O;  3AG1 C;  4DUY O;  5CBG A;  2UUB B;  3ZRV A;  4BIZ A;  2QE7 G;  3SJQ C;  3UO3 A;  4MVM A;  4YIP A;  4X62 O;  4JYA B;  3X2Q B;  1K34 A;  1WA8 B;  1SZX A;  3RT3 C;  4I4T B;  4PA7 A;  4XBF A;  3TXS A;  1EN6 A;  4CS2 A;  2QKS A;  4YJ3 A;  5DN6 G;  5LOV A;  3WB2 A;  3ML0 A;  4ZKI A;  3K58 A;  3SYO A;  3K59 A;  2UXB O;  1FAF A;  1PKX A;  2Z5U A;  2QR4 A;  2ZCE A;  4LWS B;  4NXN O;  4PI0 A;  4OX9 B;  5IE9 A;  2K9P A;  1XRE A;  3ABM B;  2A0L A;  4IHJ B;  4JAV A;  5KHI A;  1H2G A;  3W7W A;  3AG2 B;  2JEX A;  5H2F Z;  1L1F A;  5A2Q N;  1V54 B;  1TUE B;  4LF9 O;  4JI0 B;  4F4L A;  1XUQ A;  5GW7 A;  4JI2 B;  3SGI A;  1JFF B;  5IY5 C;  1PPJ H;  4X1I A;  4LFC O;  1L0N H;  5GON B;  2X0L A;  2OT5 A;  2OYQ A;  2OTJ V;  2ILM A;  1GKF A;  4LC1 A;  3RYH A;  1LNQ A;  2BTQ A;  1CP9 A;  5L3F A;  2VRZ A;  2B5U A;  4U3F H;  5IWA O;  1IDS A;  1Q81 W;  1L0L H;  1S3J A;  1Q82 W;  4IT5 A;  2V1D A;  3H1J H;  4X1Y A;  5IJ9 B;  1IBM O;  1RP3 B;  5BR8 O;  2ZR3 A;  2JGD B;  3ZRS A;  4JI4 O;  1QVF U;  3BY6 A;  1K8A W;  4MVR A;  1AIL A;  5L3B A;  3ICX A;  2YS8 A;  3CPW U;  2Y4T A;  2YI8 A;  3BAA A;  1GN2 A;  4X64 B;  3SPI A;  3JAR A;  4I9Q A;  1IXM A;  4PD4 F;  3SJB C;  3G6E V;  4P30 A;  3SPH A;  1K92 A;  5EC1 C;  3ZMT A;  3GVM A;  5CBF A;  1K4C C;  5LMU O;  4N23 A;  4AQY B;  1W0J G;  4D6T H;  5KA6 A;  1VF5 B;  4J42 A;  4OPH A;  1D5A A;  2ADP A;  3SYP A;  3ZRW A;  2UUB O;  3EFF K;  3APO A;  4DR4 B;  3IJ4 A;  2XAH A;  4QIW F;  4LFB B;  1WP7 A;  2XAQ A;  4ZOL A;  1N33 B;  5EZY A;  4JYC A;  2LGQ A;  4K0K B;  5LHG A;  1IZ3 A;  2GTS A;  3N2G A;  2ZD9 A;  4UUJ C;  2Y0I A;  4GX5 A;  2HVK C;  3WG7 C;  2ZQM A;  4OX9 O;  2QWN B;  3C3T A;  1EN5 A;  1OHH G;  2G38 A;  2HJD A;  4DR7 B;  1IUR A;  5JJE B;  1YVW A;  1KD1 W;  1OCR B;  1V55 B;  3FYE B;  1PM9 A;  4MW3 A;  4X1K B;  4XDL A;  1FD9 A;  3JAS A;  2EIK B;  5K1X A;  5LL6 Y;  5KAF Z;  2GSM B;  4JI0 O;  2DW4 A;  1HR0 B;  4DRX B;  4JI2 O;  1QCE A;  4G27 B;  1WB7 A;  2E76 B;  5BMV B;  4DUZ B;  2HP8 A;  1GH6 A;  5J9P C;  3KKY A;  1XQ8 A;  3D3Q A;  4DR3 B;  2QWP B;  3STZ C;  3RVZ A;  2R72 A;  2ZIN A;  3CC2 V;  1FXK A;  3BVO A;  4K8X A;  1WN7 A;  1EFR G;  1JOY A;  1VQM V;  1P7B A;  2CGO A;  1JQ0 A;  5CA0 A;  2UU9 B;  1THZ A;  3OEH G;  3M8A A;  1SES A;  3OAA G;  5LHI A;  2Q69 A;  4X64 O;  2N04 A;  1BHB A;  3IC7 A;  1RFY A;  3MD0 A;  3ABT A;  4UVC A;  1TVK A;  2HR3 A;  5EBW C;  4CC6 A;  1M1K W;  4AQY O;  3JD4 A;  4D7S A;  4PI2 A;  4X65 B;  2W0X A;  1VQO V;  1QU7 A;  3ETD A;  4K35 A;  2UUA B;  3G6B A;  4UFZ A;  1M9N A;  5ITZ B;  4LFB O;  3P3P A;  1N33 O;  2ADQ B;  2ATK C;  1KEC A;  2ZT9 B;  1BT8 A;  4K0K O;  1P49 A;  1PD3 A;  1FXH A;  1YF2 A;  3SPJ A;  4B3M B;  3JD0 A;  2QM7 A;  1F23 A;  5L3D A;  4P9P A;  2YIC A;  3A0B Z;  1FKA O;  5FLX N;  3AG3 C;  1EZJ A;  3K5M A;  2Y69 C;  4DR7 O;  3T1C A;  2QWR B;  3CD6 V;  2WLI A;  1BCC H;  4QE7 A;  4TV8 B;  4AI8 A;  3SYQ A;  4BW9 A;  2PI5 A;  4K8Z A;  4MS2 A;  4J10 A;  1AI4 A;  2M7W A;  3JAW A;  2GHY A;  1VQ7 V;  4X88 A;  1AP5 A;  4DUZ O;  2AZ2 A;  5B1N A;  1K73 W;  2CDY A;  4L87 A;  3IAY A;  1NQT A;  4EB6 B;  2P5O A;  3JD1 A;  3CCS V;  4RO2 A;  1P7G A;  3G80 A;  1VQK V;  2Q67 A;  1H38 A;  3R65 A;  3RYC A;  1VMG A;  3D8C A;  5EYP A;  4DO2 A;  1KQS U;  4Q20 A;  1XNQ B;  2XOK G;  1KP2 A;  2V4D A;  2UU9 O;  1GTO A;  3RW0 A;  1P84 F;  1Q43 A;  1WAZ A;  3ABK B;  1AJQ A;  1GN6 A;  4UVA A;  5KAI Z;  4EFE A;  3HKC A;  2GUZ A;  2R70 A;  3QTC A;  3SYC A;  4JV5 B;  2CH7 B;  2DYR C;  4FZ0 A;  4I9W A;  4MTF A;  4GKK B;  4H44 B;  4X65 O;  1JMK C;  2YEV A;  4JI8 O;  4Z1V A;  4CC5 A;  2ODM A;  1SF9 A;  2A3Q A;  4F6R B;  1XEQ A;  3CSX A;  3DTU B;  1WLE A;  3RYF B;  2W0F C;  1R3I C;  2HLD G;  4B3M O;  4FM0 A;  1VQ9 V;  4O4J A;  1O9H A;  5D5P A;  4LFA B;  5L3C A;  3HKE A;  2DWE C;  1LR1 A;  1GN3 A;  4TOI A;  4DR1 B;  1KP3 A;  2DYS C;  1BS3 A;  1M5I A;  2ZM6 B;  3B40 A;  2EIM C;  4YJ3 B;  1H2L A;  4HAM A;  1N0J A;  5LOV B;  1KB9 F;  1NTK H;  2EX3 A;  1UPG A;  4QNH B;  3FD9 A;  3CC4 V;  4QE9 A;  3ZHV A;  3AG4 B;  3I5D A;  1JPX A;  4H33 A;  3DGE A;  4TT3 G;  4D7T A;  3JAK B;  4CBC A;  5B66 Z;  4DV7 B;  2EBO A;  1LUW A;  2JDI G;  1XNQ O;  2WSS G;  1FFX A;  5HFM A;  4L8J A;  3B2E E;  4PHZ A;  2N05 A;  4EKW A;  2DJV A;  4GCZ A;  1MG1 A;  1AJN A;  5JVD A;  1FXV A;  1K97 A;  3CJH B;  1J5E O;  4X9Q A;  4I0X A;  1RSO A;  2BTQ B;  5AG2 A;  4KFM A;  4I7Z B;  1CPY A;  5K1P A;  5KMG A;  4JAA A;  3CP1 A;  2VQF B;  1S77 D;  4JI5 B;  5F2V O;  2IJI A;  1NR7 A;  1M93 A;  2R9R B;  1Z5V A;  4O2B A;  1DF5 A;  1GM9 A;  1WP8 A;  3L72 H;  4PJ0 Z;  3VQX A;  3JAL B;  3CRR A;  4X66 O;  2CK3 G;  1E79 G;  1KUQ A;  1SQP H;  5J2T B;  3JAR B;  2HEP A;  4LR3 A;  3U11 A;  5JH7 A;  2ZIO A;  1VQ5 V;  3B8M A;  1PL4 A;  4DV1 B;  2AHZ A;  2UUC O;  4DUY B;  3SJC C;  2AZ0 A;  4LH6 A;  2CGN A;  2JEU A;  4X62 B;  4O4I B;  3IGA C;  5BXZ A;  4LNU A;  1SQG A;  1K4D C;  3E83 A;  3DXR A;  2XAJ A;  4BIO A;  4Q6G A;  3BEH A;  4DR1 O;  3A0R A;  1H8H G;  1KBH A;  4ZOL B;  2UXB B;  4DV4 O;  3ZMU A;  2ZM6 O;  4NXN B;  2O57 A;  4CS4 A;  3FAV A;  1QLE B;  1Y74 A;  1N32 B;  3A2F A;  4U7O A;  2P6J A;  3C3S A;  1GN4 A;  3UM7 A;  3SDL A;  4G28 B;  3RYI A;  1XIL A;  2B9Z A;  4O4L A;  1YDX A;  3CXC U;  5KHH A;  4DV7 O;  5CA1 B;  1ZWI C;  4JI3 O;  3JD2 A;  4B7K A;  4IL6 Z;  3JAM N;  4HBN A;  2WLN A;  1H2K A;  4JZ2 A;  2FTK A;  2YC0 A;  1VEW A;  3HR0 A;  2GTA A;  2DE0 X;  2KQX A;  2EIJ C;  5EIB D;  3N2K B;  5BR8 B;  2IU3 A;  4RAI A;  1D2D A;  2QM8 A;  4LF8 B;  4UCR A;  2OIG A;  4JI4 B;  3DSQ A;  1FXK B;  1M56 C;  2VQF O;  3B4S A;  4NYK A;  3W7T A;  5CA0 B;  2HG5 C;  4K3A A;  2WLJ A;  2H8P C;  2BSK B;  2IJH A;  5CMU A;  3G71 V;  3E22 A;  1JR9 A;  1S5J A;  4DV1 O;  5DM6 V;  2LGW A;  4JI7 B;  3ZHS A;  3OTF A;  4RUF A;  2QWO B;  4IIJ A;  1FJG O;  1R3J C;  3G67 A;  4QGP A;  1ZUQ A;  4UV8 A;  2ITC C;  2FKX A;  2PTM A;  3MAQ A;  4GT1 A;  1K3E A;  2RJZ A;  1AI7 A;  1NH2 D;  1AVM A;  2WPD G;  1N36 B;  4FLW A;  1KKD A;  1K9M W;  3C90 A;  3CB2 A;  4GUN A;  4J9Z B;  1G4Y B;  1VQN V;  1FPO A;  2YXH A;  5IY5 B;  1HNX B;  4FPP A;  2W6I G;  2CTP A;  5B1B C;  4U3J A;  1H2N A;  2D3O W;  1R73 A;  2ZE7 A;  1N32 O;  4BWA A;  2WA4 A;  1CXZ B;  1IVS A;  4PA4 A;  1O9G A;  4JZG A;  1PL0 A;  1FYJ A;  2QDO A;  2WLI B;  1VQ8 V;  4FZ1 A;  1S76 D;  2P06 A;  3T1Y B;  3OTO B;  2E5L O;  3ZS8 C;  2Y48 A;  4I55 B;  3RVY A;  2IJJ A;  2Q5Z A;  4KL1 A;  2Q73 A;  2YIA A;  3ZCC A;  5JJJ B;  1MSD A;  4TWK A;  4B3S B;  3J80 N;  3E89 A;  4FLX A;  4W4L A;  1YJN V;  5IJ0 A;  1I5Y A;  2Q9L A;  4LF8 O;  1U97 A;  3QO8 A;  3MDS A;  4LBE C;  3SYA A;  1XHZ A;  1Y76 B;  4XDJ A;  2QWQ B;  3RYC B;  4PDR A;  5KHG A;  3AG2 C;  4IYH A;  2AHY A;  1OV9 A;  1A32 A;  4BAY A;  1QR9 A;  2OCC C;  2ZXW C;  2BOB C;  1VF6 C;  3LSS A;  3WU2 Z;  2QGN A;  5J2U A;  2Z0A A;  1JJ2 U;  1PNM A;  2GUZ B;  1UFI A;  1ZX3 A;  2ZE6 A;  1K33 A;  3O65 A;  4MW8 A;  5LGU A;  3K06 A;  4FFB A;  4OGQ B;  4JI7 O;  4ZHQ B;  2JS3 A;  1NTZ H;  3WG7 B;  1OCZ C;  2W6J G;  1RM1 B;  4PA9 A;  3RWR D;  2WWW A;  4CH5 A;  2YEV B;  2ZE5 A;  2X6B A;  1N36 O;  4I50 A;  4UCO A;  4HNA B;  1KC8 W;  1AB3 A;  1K5S A;  1OCC C;  2WA3 A;  4MVZ A;  2JJ1 G;  4R6Z A;  4JTA B;  1YSC A;  4MVQ A;  3BA9 A;  4J9Y B;  5A9G A;  1HNX O;  3ASO C;  2XT9 A;  1Y6X A;  3Q4H A;  1PNL A;  2DOS A;  2CAZ C;  4FLY A;  4MVS A;  2B1G A;  3ETQ A;  3T1Y O;  3K0D A;  1HWY A;  3OTO O;  1ZL8 A;  1US6 A;  2JS5 A;  3K5O A;  1QBZ A;  1TAE A;  2ITD C;  4B3S O;  3CRC A;  4DV6 O;  3GWK C;  1TA8 A;  2LFS A;  3FB8 C;  1GM8 A;  5H6Q A;  2CTR A;  3K0G A;  1KU9 A;  3ABU A;  3B77 A;  2IU0 A;  1IBL O;  1VIB A;  1OCR C;  1FFX B;  4X20 A;  2RMK B;  5LXT B;  3APQ A;  4WFH A;  5C8Y B;  2EIK C;  1WPB A;  5JVD B;  5LA6 A;  2LW1 A;  3WB1 A;  5KX5 B;  5LP6 C;  3VOU A;  2YIB A;  4JI1 B;  3RBZ A;  1EBO A;  2YDE A;  3CRQ A;  4I0X B;  1XOU A;  1JX9 A;  5KA5 A;  3J7A U;  2ZDI C;  5KMG B;  3A8T A;  2NN4 A;  4JI8 B;  1NZ6 A;  1XNR B;  2IW5 A;  2K1E A;  3AG3 B;  4PDM A;  2Y69 B;  4O2B B;  4DR2 B;  1BMF G;  4O2A A;  1Y66 A;  1BSM A;  1AR1 B;  1R3K C;  1PNK A;  4FK5 C;  5LYJ A;  2QSA A;  1YHQ V;  2EIL B;  2OTL V;  5EK0 A;  1S5L Z;  4I4T A;  3N27 A;  2QEX V;  3ETG A;  2XND G;  4ZIB A;  3E8H A;  4TUY A;  3LUT B;  2WAM A;  3EXA A;  4LWS A;  2PGG A;  4NTW A;  4LNU B;  4B3T B;  1PP9 H;  4IHJ A;  4EFB A;  4MSW C;  4QPK A;  3KG2 A;  3SPC A;  3CXH F;  2F23 A;  1URF A;  2PUS A;  3VQY A;  3F5T A;  3EHB B;  1VF6 A;  3FAV B;  1EM1 A;  1JFF A;  3JCU Z;  5GON A;  1YJW V;  1AP6 A;  4P9O A;  4H37 A;  3KCX A;  3HB3 B;  3BPZ A;  3RN4 A;  2X6A A;  3AK2 A;  1JCH A;  5LHH A;  4O4L B;  1XMQ O;  2RQ6 A;  3SPG A;  3K79 A;  3T4D A;  5IJ9 A;  1JJO A;  2VS0 A;  1BQ0 A;  2HVJ C;  2JGD A;  3CCV V;  2UXD B;  3S3W A;  1J5E B;  4PA6 A;  3DC6 A;  4MVU A;  1MAB G;  2ARH A;  2KB1 A;  5IYZ B;  3UT5 A;  4JI1 O;  2XUM A;  2N74 A;  4R8C A;  3HKB A;  3D36 A;  4WFF A;  4LF7 O;  5JQG B;  2ZNI A;  4I5S A;  3GB7 C;  2A9H A;  1SA0 B;  5B3S C;  3UCS C;  1XNR O;  1IXB A;  4X66 B;  3H1I H;  2WLL A;  1SS3 A;  2LFR A;  3VQW A;  4DXW A;  4DR2 O;  1N0N A;  3W7X A;  3ZIA G;  1QNM A;  4CH3 A;  4EEQ A;  2WLK A;  2LQT A;  4NR1 A;  3OD4 A;  2UUC B;  2Q7G A;  2ZKO A;  1AI5 A;  4B7E A;  2PI4 A;  2VWJ A;  2F95 B;  3OM3 B;  5KLV H;  5KUK A;  3MHS C;  1YTF B;  2QKA A;  4KUM A;  4NKG B;  1SQB H;  2VQE B;  2BOC C;  3NXS A;  1XL4 A;  4B3T O;  4DV4 B;  3T2M A;  2D2C B;  5LGT A;  4NVP A;  5BY1 A;  3ZMZ A;  4X1K A;  4GKJ B;  4OXS A;  1BZK A;  3RGB A;  1DF4 A;  5LP6 A;  2Y4U A;  4FLV A;  3E2E A;  3ASN C;  4U3J B;  5EBM C;  1JA8 A;  4LH7 A;  1NJI W;  1NTM H;  2ZDI A;  3OR7 C;  2WLH A;  4JI3 B;  4O4H A;  1YJ9 V;  3IFX A;  4CH4 A;  4PV1 B;  4LF4 O;  1H8E G;  2A06 H;  4R50 A;  4X1I B;  4FLU A;  3L9D A;  2IBZ H;  1I08 A;  2EJ7 A;  2UXD O;  3F7Y C;  3LNN A;  1X59 A;  3RYH B;  2A7W A;  4KXR A;  2ZR2 A;  2GDS A;  4X1Y B;  1R6K A;  3OMA B;  1HNW B;  3K04 A;  1YTF D;  1B6Q A;  4PDV A;  1K5Q A;  3TXQ A;  2V7Q G;  3ZX6 A;  1NI8 A;  1MZF A;  1YCI A;  1NS1 A;  1P4R A;  2DQ0 A;  3L71 H;  3OE7 G;  1SET A;  3CCE V;  4DW1 A;  4LF5 B;  1OZ0 A;  2Q6A A;  1AJP A; 
#chains in the Genus database with same CATH homology
 4WF9 V;  1R6N A;  5H9C A;  1VQN V;  1ROP A;  2B1I A;  5J9P C;  3FB6 C;  5IY5 B;  4FPP A;  2W6I G;  5B1B C;  1E1R G;  2D3O W;  1SER A;  3STZ C;  1R73 A;  3RVZ A;  3ZRW B;  3MHH C;  4PA4 A;  3CC2 V;  1S72 V;  1FXK A;  3D3I A;  1PL0 A;  3CCM V;  3F5W C;  1QLN A;  5L3G A;  1EFR G;  2WLI B;  1JOY A;  1VQM V;  1P7B A;  1VQ8 V;  5CN0 A;  1JQ0 A;  1S76 D;  2X7R B;  2YSU B;  3TCU A;  1GMG A;  1THZ A;  2DYS B;  3OEH G;  3ABK C;  3CC7 V;  1SES A;  4E2L A;  3OAA G;  2Y48 A;  3ZMS A;  3RVY A;  2IJJ A;  4BW5 A;  3ZCC A;  2EIM B;  5LHI A;  2Q69 A;  1S0V A;  4TWK A;  4PEL A;  1BHB A;  3K08 A;  3IC7 A;  3MD0 A;  3E89 A;  3CCQ V;  4JAS A;  3ABL B;  1M57 B;  3ABT A;  4U7N A;  4UVC A;  5B1A C;  1VQ4 V;  2HR3 A;  1YJN V;  5EBW C;  3G4S V;  1I5Y A;  1W2B U;  3ASN B;  3QO8 A;  1M1K W;  4LBE C;  3SYA A;  3PJS K;  1YIT V;  3JD4 A;  4XDJ A;  3E8B A;  1R3L C;  3LDE A;  4JF3 A;  4PDR A;  1VQO V;  3AG2 C;  1NH2 B;  1M56 B;  3ETD A;  2AHY A;  4QPJ A;  1RPR A;  5CA3 A;  3CMA V;  4BAY A;  1QR9 A;  2OCC C;  2ZXW C;  4WFA V;  3K03 A;  5IDJ A;  3LNM B;  4LP8 A;  2BOB C;  4X8A A;  1M9N A;  3LSS A;  5LBQ A;  3FKS G;  1FFT B;  2ATK C;  1KEC A;  1JJ2 U;  1PNM A;  3K3W A;  1PD3 A;  1FXH A;  3SPJ A;  3E35 A;  1K33 A;  4MW8 A;  5LGU A;  3JD0 A;  2QM7 A;  1F23 A;  1NBM G;  3K06 A;  2EIN C;  5L3D A;  2Z3Y A;  3OMI B;  4P9P A;  1E1Q G;  3M99 B;  2X6C A;  4UV9 A;  2DWD C;  4JYB A;  4GX1 A;  3CCL V;  3WG7 B;  3AG1 B;  1OCZ C;  3AG3 C;  1EZJ A;  2W6J G;  3LSQ A;  2JJ2 G;  2Y69 C;  3T1C A;  1RM1 B;  4PA9 A;  3CD6 V;  3E8G A;  2WWW A;  2YEV B;  2NNU A;  2WLI A;  4QE7 A;  1COW G;  3LDD A;  4FJC C;  4JTC B;  3SYQ A;  2PI5 A;  4R7C A;  2X6B A;  2LP7 A;  2JIZ G;  4LCU C;  1G8M A;  1KC8 W;  4MS2 A;  1GK9 A;  1K5S A;  2HFE C;  1AI4 A;  2M7W A;  3CCU V;  2GHY A;  1OCC C;  4N21 A;  1VQ7 V;  4MVZ A;  2IJK A;  2JJ1 G;  4R6Z A;  4X88 A;  4JTA B;  1YSC A;  5KUM A;  1QR8 A;  4MVQ A;  3FB5 C;  2XAF A;  4J9Y B;  1SZT A;  5B1N A;  1QVG U;  1K73 W;  3OMN B;  4L87 A;  3ZMV A;  3OUF A;  1F51 A;  3P32 A;  2IH3 C;  5IYD O;  1SRY A;  3AG4 C;  3ASO C;  1NQT A;  3ETE A;  3JD1 A;  3CCS V;  4RO2 A;  3ZN0 A;  4JGS A;  1VQK V;  2Q67 A;  1H38 A;  1PNL A;  3JYC A;  5H6R A;  4MTX A;  3R65 A;  4Z1M G;  4DO2 A;  1KQS U;  4Q20 A;  4MVS A;  1OCO C;  5C93 A;  2XOK G;  2B1G A;  1F4N A;  4UVB A;  1KP2 A;  2EJR A;  1GTO A;  3K0D A;  1HWY A;  3RW0 A;  3STL C;  3ABK B;  5HFL A;  1AJQ A;  1QBZ A;  4TSF G;  3UKM A;  4UVA A;  1AI6 A;  2ITD C;  1W0K G;  1VQP V;  3LDC A;  4JAU A;  2XAG A;  3QO5 A;  1N8R W;  3OW2 U;  2LFS A;  3SYC A;  3FB8 C;  3JD3 A;  1GM8 A;  2DYR C;  5H6Q A;  5B1A B;  4X89 A;  3ZRX A;  5EBL C;  2P67 A;  4I9W A;  3GWO A;  2R9I A;  3K0G A;  3ABU A;  4MTF A;  3B77 A;  2IU0 A;  1XL6 A;  4UXN A;  3TET A;  3OEE G;  2YEV A;  3X2Q C;  1OCR C;  5EC2 C;  4WFH A;  1WPX A;  2EIK C;  2WLM A;  3W7U A;  3DTU B;  3VOU A;  3CYO A;  3F7V C;  2OCC B;  2ZXW B;  3RBZ A;  1WLE A;  1EBO A;  1GO3 F;  1NKD A;  2W0F C;  1FS0 G;  5E1A C;  1JX9 A;  5KA5 A;  5FL7 G;  1R3I C;  2EIJ B;  3AEI A;  2HLD G;  2ZDI C;  3ABM C;  1VQ9 V;  4CZZ A;  5IYB O;  1NVP B;  5CBH A;  2EIN B;  5B1O A;  5L3C A;  1V54 C;  1MSW D;  4GX2 A;  2IW5 A;  5IYC O;  3OUS A;  2DWE C;  2K1E A;  1OCZ B;  3AG3 B;  4QJF B;  1VQ6 V;  4PDM A;  2Y69 B;  1BMF G;  1Y66 A;  1AR1 B;  1Q86 W;  4RUE A;  1R3K C;  2HJF C;  4G2K A;  4GX0 A;  2UXX A;  1KP3 A;  1PNK A;  2DYS C;  4FK5 C;  3VBB A;  4WFB V;  2DQ3 A;  1QLE C;  1YHQ V;  2EIM C;  2EIL B;  2OTL V;  5EK0 A;  4FIP C;  1OCC B;  3OFN G;  4HAM A;  4RQF A;  3T4Z A;  2H94 A;  2QTO A;  3E86 A;  4WFG A;  2QEX V;  1S5H C;  3ABL C;  1M57 C;  4QNH B;  3ETG A;  2F43 G;  3FYI B;  2XND G;  2UXN A;  1DLB A;  3OGC C;  3CC4 V;  3E8H A;  4QE9 A;  1VQL V;  3AG4 B;  3ASO B;  4MVO A;  4MT8 A;  3LUT B;  2WAM A;  1JPX A;  3I55 V;  4H33 A;  3DGE A;  4TT3 G;  4CBC A;  4HYO A;  3JCZ A;  2EBO A;  2WLL B;  2JDI G;  1ENV A;  2WSS G;  5HFM A;  4MSW C;  4QPK A;  3KG2 A;  3E8F A;  3SPC A;  1OCO B;  4EKW A;  4GCZ A;  1MG1 A;  1AJN A;  4JPR A;  1FXV A;  1K97 A;  3W7S A;  1JVM A;  5BZB A;  3CME V;  3ZJZ A;  1Y4M A;  4YXW G;  3EHB B;  5B1B B;  4XDK A;  2IH1 C;  4KFM A;  1GM7 A;  4HZ3 A;  1YJW V;  1NVP D;  1CPY A;  4P9O A;  1FXK C;  4H37 A;  3CP1 A;  3HB3 B;  3FB7 C;  1ARO P;  4ASU G;  2X6A A;  3AG1 C;  1JCH A;  5CBG A;  3H01 A;  5LHH A;  1RM1 C;  1S77 D;  2IJI A;  3ZRV A;  3SPG A;  1NR7 A;  3K79 A;  2QE7 G;  2R9R B;  4JTD B;  3SJQ C;  3T4D A;  4BIZ A;  1DF5 A;  4MVM A;  2HVJ C;  2C2A A;  1GM9 A;  3CCV V;  3X2Q B;  1K34 A;  2CK3 G;  4ZBM A;  4PA6 A;  1E79 G;  4MVU A;  1YIJ V;  1MAB G;  2KB1 A;  4PA7 A;  4XBF A;  2HKO A;  4WCE V;  1DTO A;  2QKS A;  1YI2 V;  5DN6 G;  3B8N A;  3ML0 A;  4ZKI A;  3B8M A;  3SYO A;  1VQ5 V;  4R8C A;  1PKX A;  4BIU A;  2Z5U A;  3D36 A;  2AHZ A;  3HPL C;  4WFF A;  1F4M A;  3ABM B;  2A0L A;  4JAV A;  2JEU A;  1V55 C;  4I5S A;  1H2G A;  3GB7 C;  3P30 A;  5L3E A;  2A9H A;  5B3S C;  3W7W A;  3IGA C;  1BHA A;  3AG2 B;  2JEX A;  1L1F A;  2QA4 V;  1K4D C;  1V54 B;  3E83 A;  2WLL A;  3ZN1 A;  2LFR A;  1TUE B;  2XAJ A;  4DXW A;  2Q68 A;  3TK1 A;  3W7X A;  3BEH A;  3ZIA G;  3A0R A;  2WLK A;  4F4L A;  5GW7 A;  1H8H G;  5IY5 C;  3ZMU A;  2X0L A;  2OT5 A;  3I56 V;  2OTJ V;  1GKF A;  4LC1 A;  1QLE B;  1AI5 A;  1LNQ A;  1CP9 A;  2PI4 A;  2A79 B;  5L3F A;  1NR1 A;  2B5U A;  2JK5 C;  1Q81 W;  1S3J A;  2P6J A;  4U7O A;  3K9A A;  2P7T C;  3OM3 B;  1Q82 W;  2V1D A;  3UM7 A;  1CEZ A;  5KUK A;  4G28 B;  3MHS C;  1YTF B;  1K7D A;  4KUM A;  2ZR3 A;  3ZRS A;  2BOC C;  3NXS A;  1XL4 A;  1UJW B;  2MK3 A;  4PA3 A;  3CXC U;  4MTO A;  1ZWI C;  1QVF U;  3QNE A;  3BY6 A;  3JD2 A;  1K8A W;  3T2M A;  4MVR A;  4MTG A;  5LGT A;  2WLN A;  5L3B A;  3CPW U;  2FTK A;  3QO7 A;  3ZMZ A;  3SPI A;  4OXS A;  1Q7Y W;  1IXM A;  1DF4 A;  3E2E A;  3G6E V;  3ASN C;  1ORQ C;  4P30 A;  2EIJ C;  3SPH A;  1K92 A;  5EBM C;  5EC1 C;  3ZMT A;  2IU3 A;  4RAI A;  5CBF A;  2QM8 A;  3CCJ V;  1K4C C;  1NJI W;  3WFV A;  2ZDI A;  4N23 A;  3OR7 C;  2EZP A;  2P90 A;  2WLH A;  1J95 A;  1W0J G;  1FXK B;  1M56 C;  5KA6 A;  1YJ9 V;  3IFX A;  3SYP A;  3W7T A;  3ZRW A;  3EFF K;  1H8E G;  2HG5 C;  4R50 A;  4RQE A;  1I5X A;  2NLJ C;  2WLJ A;  2XAH A;  3F7Y C;  4QIW F;  2H8P C;  2XAQ A;  3CCR V;  3OR6 C;  4JYC A;  2IJH A;  2ZR2 A;  2EIL C;  5CMU A;  5LHG A;  2ZD9 A;  4UUJ C;  3G71 V;  4GX5 A;  2HVK C;  1M90 W;  1MOF A;  3WG7 C;  1R6K A;  3OMA B;  2DYR B;  5DM6 V;  3K04 A;  2ZQM A;  1YTF D;  4RUF A;  1B6Q A;  4PDV A;  1K5Q A;  1OHH G;  2V7Q G;  1R3J C;  4WFE A;  1RPO A;  2EZO A;  4UV8 A;  2ITC C;  1KD1 W;  1OCR B;  1P4R A;  1V55 B;  2DQ0 A;  4FMT A;  4GT1 A;  4KP4 A;  3OE7 G;  1K3E A;  1SET A;  1AI7 A;  3FYE B;  2WPD G;  5B3S B;  3CCE V;  1NH2 D;  4MW3 A;  4XDL A;  1KKD A;  1K9M W;  2EIK B;  4PDL A;  2GSM B;  1OZ0 A;  2DW4 A;  1BL8 A;  5LGN A;  2Q6A A;  4P2Z A;  2XAS A;  4J9Z B;  1QCE A;  4G27 B;  1G4Y B;  1AJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...