1NH2B

Crystal structure of a yeast tfiia/tbp/dna complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
46
structure length
46
Chain Sequence
b'NAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*TP*AP*(5IU)P*GP*TP*AP*TP*AP*(5IU)P*AP*AP*AP*AP*C
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 19
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2002-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nh2B00
3E35A 3W7SA 1YTFB 3BY6A 3W7WA 4HAMA 1NH2B 5CA3A 2WAMA 3W7XA 3D3IA 5GW7A 3W7TA 2P90A 1NVPB 1RM1C 3W7UA 3IC7A 1S3JA 2HR3A
chains in the Genus database with same CATH superfamily
1NTZH 1VF6C 3JD2A 4FLZA 4IYHA 2OTLV 2GUZA 3OR7C 1Y4MA 4JPRA 5IYBO 1W2BU 4MTFA 2ETNA 4OPAA 1GM9A 4JYBA 4YHHO 2YXLA 4MVMA 4MT8A 4PA4A 1DF4A 1XL6A 3T4ZA 1KB9F 3JD3A 4AI8A 3AEIA 3ASNB 4MTXA 2GV9A 3CX5F 2UUCB 5KX5B 2V7QG 3QG5A 1IBMB 1H8HG 1KUQA 3K5NA 4DV3B 2UU9B 3ZN0A 3HKEB 3M99B 1JOYA 4MVZA 4MTOA 1XREA 4WCEV 2KB1A 4LF8O 3E89A 1WLEA 1VF5B 3JCUZ 4X66B 2EIJB 1UPGA 2Y0IA 1WP7A 1VQ9V 1BS3A 1Y76B 2CDYA 1DLBA 4NKGB 2AXTZ 1P49A 1VQOV 1NBMG 2P5OA 1GN2A 4FVMA 4DR4B 4JI6O 4RAIA 4RUFA 2P4VA 3EXAA 3ZJZA 3TXSA 2FB5A 4B3RO 1K5QA 1HDJA 5B1AB 2D2CB 2Y69C 4FIPC 3AG4B 2GDSA 1AI4A 4AHCA 4IGGA 1Z5VA 2JS5A 3T1YO 1IBLB 2XUMA 5E79Z 3N2GB 3JD4A 1N33B 4FLYA 2ZM6B 4NTXA 4OXSA 3SJAC 1JA8A 2QWRB 3ETEA 3JSLA 1FJGO 4LFCO 5LMNO 2F23A 1VQ8V 3JATB 1H2NA 3LDEA 3OTFA 1SA0A 3F7YC 4DV4B 1OV9A 5LGUA 2JEUA 1Y74B 4MS2A 1KMIZ 2H3OA 1W0KG 3SYQA 3N2GA 2ITDC 2PI5A 1AILA 1R3IC 4QJFB 4X64O 1SQVH 1YIJV 4ZHQB 3BRCA 2OYQA 3R66A 1FD9A 1AI5A 2UXCB 1XL4A 2HJFC 2LW7A 3A0HZ 4TV8B 1RM1C 2PTMA 2JGDB 3JATA 1D5AA 1BMFG 2WLJA 1B06A 3S3XA 2E5LB 3CCMV 1DK1A 1EN4A 2CGOA 3ZHTA 5EYPA 1Y74A 1AJNA 4KXRA 3UCSC 1DF5A 1D5NA 3ZRVA 2WLIB 1QLNA 2LGWA 1P7GA 3G6EV 3JAWB 4J9YB 3ZMUA 3H9VA 4X20B 4TV8A 4U7NA 1VQ7V 2Q69A 4LH6A 1TUEB 3AK2A 3IAYA 5LBQA 1OCOB 1YSCA 1VQ4V 4LH7A 3CXCU 1NQTA 4KUMA 3RYIB 2LGQA 5H6RA 2LJ2A 2NNUA 4CH6A 1FAFA 1UFIA 2EINB 4DK1A 1U96A 4PA9A 4JAAA 2MW2B 1KECA 1NS1A 5LYJB 1XMOO 4GKKO 1SQPH 4R7CA 3JAWA 3UO2A 4GX0A 4DR7B 1KP3A 2LP7A 3G67A 4X20A 4DV0B 1M5IA 4UFZA 2LQTA 3CC2V 1W59A 3RFRA 2WLNA 3ZHVA 2IJIA 1QLEC 2R9RB 2IU3A 2YDEA 2Q73A 4DR5B 5LHIA 4TUYB 3CYOA 3B09A 4YJ3B 4BIOA 4J10A 2UUAB 4QPJA 3RYIA 2EULA 5JJEB 1J95A 2L6LA 1P84F 5LYJA 4JAVA 5JQGB 2AHYA 1QNMA 1QBZA 4X89A 3LDDA 2HHHB 1VP7A 4DO2A 1DGSA 1HNZO 1WAZA 2EIMB 1OJHA 3TK1A 4TUYA 4YJ3A 2QKAA 3CCSV 1HP8A 1YTFB 1NR7A 3BY6A 1BGYH 2OWOA 5GONB 1WA8B 3VQYA 1YJ9V 3TETA 5LOVA 3D36A 2QKSA 1R6KA 1URFA 2QSAA 2QA4V 3CMAV 5IY5C 4J7KA 1AR4A 1L1FA 2F4VB 4BW5A 4MW8A 1M56B 4JI1O 1YCIA 2YIBA 3OD4A 3H01A 4X88A 4I0XB 5GONA 3SPCA 1WA8A 2QJ1A 4FZ1A 4LWSB 1W0JG 4JYAO 4B3SB 4I50B 1AROP 2JVDA 2JS3A 2WLHA 2XOKG 3GVMA 1VQMV 1EZJA 4EKWA 2HJDA 3CCUV 3K59A 4I0XA 4J80A 3FKSG 4FLVA 4KP4A 2JIZG 5FNVB 4G27B 2CE4A 1R1BA 2ZR3A 5B3SC 4DV2O 1AI6A 4JI7O 5GTHZ 4GLXA 4DR1O 2OCCB 4TSFG 3K9SA 2ZDIC 1AP6A 1G6UA 1NH2B 1ZLZA 5IJ0B 4UCVA 3D3IA 5GW7A 3E8FA 1TVKA 1RP3B 1XILA 2QWNB 1XMQO 2WA3A 1YEWA 3JSNA 4GCZA 5FNVA 4LFAB 4E4EA 1R3JC 3WB0A 4DV5O 1MMMA 1S0VA 1GRJA 2IM9A 4GYCB 1VF6A 1H38A 1F23A 5IJ0A 5CA1B 4G2KA 2HVKC 3PJSK 1YF2A 4JTDB 5JWPA 4NXNB 4BIUA 1N32O 3QO7A 4B3MO 2GTSA 4GKJO 1Y66A 3ICXA 2WLMA 1WN7A 4JASA 5B66Z 2YI9A 1T5EA 2OT5A 4NB5A 3RYFB 4L8JA 1L0NH 1MOFA 2KG7B 3FYEB 5L3CA 2DYRC 4TV9B 1IURA 4EFBA 4KL1A 4IIJB 2QTOA 3ZHRA 1Q81W 2JJ1G 3ETGA 5EK0A 3IC9A 1GK9A 3EHBB 3KCYA 2HLDG 4FFKA 3SDLA 1KYOF 4XDJA 2BTQB 1K3EA 2DQ3A 1IBKO 3ZHSA 5F2VO 1K33A 3TJTA 3HKBB 4JV5O 1XNQB 3C90A 1BHBA 1GN4A 4LF7B 2ARHA 2KG7A 2Y69B 1SS3A 1ROPA 3OT7A 4LP8A 2BSKB 3OM3B 1XUQA 4TV9A 3NR7A 1L8DA 4IIJA 2BE3A 3ABUA 5BR8O 4KHPO 1VMGA 2IU0A 2ILMA 5KA5A 5C8YA 2BTQA 4CBCA 5IWAO 5B1OA 2RN9A 3HKBA 2DJVA 2CTWA 1EZVH 2QE7G 5LHHA 4IYIA 1Z2GA 4O4LB 2E3CA 2DWEC 4Z2WA 3JYCA 4JI5O 3G80A 1K4DC 1JX9A 4LF9O 3ABKB 1XOUA 2B9ZA 3W7TA 5K1XA 4OX9B 2DWDC 3CEIA 1Q6HA 1BQ0A 3IC7A 2WLLB 4DXWA 1RM1B 5KAIZ 1WPBA 3CC7V 4FFBB 3RVZA 2QEXV 4X1KB 4O4LA 1MABG 4O4HB 3HKCB 2XAJA 1IX9A 3ZRXA 3BHPA 2WAMA 5TISZ 3OTOB 1N4CA 4NXMO 5L3FA 1N8RW 1S5JA 1QR9A 2YUAA 1KD1W 3AG2C 3FB5C 1VIBA 2GUZB 4B7EA 2QWOB 3JD1A 5FL7G 4PA3A 2ZE5A 3ETQA 4FFBA 4X65B 1YVWA 4RQEA 3T1HB 4X1KA 2HP8A 3HR0A 2VQEO 1LUVA 4O4HA 1I5YA 1B3QA 3SPHA 2A3QA 2HFEC 1BQZA 5KHIA 5H5NA 2JK5C 4E2LA 1J5EB 3DC6A 4J41A 1HR0O 2ZCEA 3CPWU 1DTOA 3F5WC 2MK3A 1N0NA 1SERA 1NI8A 5AG2A 2Q5ZA 1B6QA 3T1CA 5EZYB 1QLEB 1Q6UA 4O4IB 2UXDO 1MZEA 4D7TA 3THOA 1TA8A 1I94O 2DQ0A 2F95B 1AP5A 2UUBB 3T4DA 3FB8C 1VF7A 2YIAA 4LF5B 3OUSA 5FPRA 4DR6B 5H9CA 3L74H 2EJRA 4CC6A 3CRCA 1AJQA 1XHZA 1YI2V 2PGGA 3JAKB 5DEDA 5EZYA 1E1RG 3K58A 2Q67A 1KQSU 4TQDA 1JR9A 4O4IA 3TCUA 4K8ZA 4PDMA 2FL4A 2GSMB 3CRAA 2R9IA 1NR1A 2Q4PA 5HFMA 1QQCA 5LA6A 2QWPB 1V55C 1PNKA 2FTKA 4MVQA 4MVUA 3O9OA 1SETA 3FD9A 4ZI7B 1QVFU 1D2DA 2VRZA 3B77A 4DW1A 4JI4O 4YXWG 1NVPB 4QE9A 3H1HH 3JAKA 3CE2A 5IYDO 2EILB 4MVRA 1Q90D 1N36O 1WPXA 2EZOA 1GM8A 1SZXA 4PA7A 3CCRV 3ZRSA 4R50A 4LF4B 1HNWB 5LMUO 1SC5B 2K9PA 1U97A 4QE7A 4K0KO 4ZI7A 4JGSA 1SA0B 4PI0A 4FM0A 3AG3C 5CBHA 2Q8VA 1R73A 4G28B 3JASB 3HKDA 1GTOA 2HVJC 1HNXB 3O65A 4IT5A 4DV1O 4AQYB 4B3TB 2BCCH 1XNRO 3P30A 5CB4B 2ZD9A 2K1EA 2ZIMA 2JGUA 2QM7A 1IZ3A 1M57B 5EC2C 4MTGA 3EFFK 4WFHA 2XHBA 1CPYA 4BR6A 2ZINA 1KC8W 2P06A 5DECA 4P9PA 4U3JB 2ZT9B 1I08A 2JRIA 3SPJA 5B3SB 3JASA 5EYPB 4CZZA 4JI8B 1GH6A 1P4RA 5KHKA 1S76D 5CB4A 2M6YA 1YITV 1G8MA 1XQ8A 5A2QN 4JI0B 3ABLB 1N34B 3E22B 5CMUA 1ZAUA 2N04A 2UXNA 4U3JA 4N23A 2Z5UA 4DUYO 1H2LA 2WSSG 2ZE6A 3QO8A 3ZMSA 4HAMA 4DV7B 5EBMC 1H2GA 2YC0A 4W4LA 2EZPA 5LL6Y 3ZRWB 1AR5A 1E1QG 3VBBA 3GWOA 2RJZA 2ZDIA 3ZN1A 5LXTB 3UT5B 2VWKA 1KP2A 1VQKV 5KHGA 1NJIW 2UXBO 3ZHQA 3ZMZA 3E22A 4ZBMA 1AI7A 4UVBA 4X62O 5H2FZ 5KHHA 4JAUA 2B1GA 3MDSA 5JVDA 3CMEV 3FFQA 3ABMB 4J42A 2XNDG 1PKXA 5H6QA 3BPZA 3ZRWA 2YICA 4K3AA 1Q82W 5LXTA 3UT5A 4YHHB 4NVPA 1PV0A 2DYRB 1MNGA 4FLUA 2PYLA 4Z1MG 4PHZA 2CK3G 5DM6V 3W7WA 3KG2A 1K5SA 2PF4E 1GAXA 4H33A 3WFVA 1Y67A 4RWUA 3X2QC 1K73W 1E79G 2A79B 5JCOC 4WFGA 1I7FA 4D7SA 3K5OA 4GUNA 1F4NA 1SRYA 2X7RB 4H37A 2ATKC 1AR1B 3ETDA 3JALB 4NTYA 1ZL8B 4PELA 1TUBA 4DR2O 5LOVB 5BY1A 1H2MA 4LF8B 3SYAA 3S3WA 3VQXA 1QVGU 2E76B 2DYSC 3T2MA 1LR1A 2B1IA 4GX2A 4LF6O 1PL0A 4EB6B 2XAGA 3A2FA 1K4CC 3E8HA 3SGIA 3WG7B 3KKYA 3IJ4A 3ZX6A 1Q86W 1WJZA 4HNAB 2RNBA 3GB7C 4CS3A 2IH3C 4JI6B 2V1DA 2ZE8A 3JALA 1RFYA 1ZL8A 5BMVB 5LP6C 4YY3O 2XAFA 3CJHB 1XI1A 4B3RB 3OGIB 4XDKA 4D6TH 3I55V 4PA6A 1OCZC 1EN5A 1UJWB 4EB6A 3T1YB 4LR3A 4OPHA 4DV6O 2FKXA 1YHQV 5EBLC 4HNAA 5KA6A 5IT9N 5L3DA 5KLVH 1FPOA 2VQFO 2H8PC 5IE9A 3K57A 4W4KA 5BMVA 1RSOB 2NN4A 2DOSA 1FJGB 3AG1B 3CJHA 4LFCB 5LMNB 3RGBA 3OEHG 3OEEG 4I9WA 2YSUB 2LO1A 3B4SA 4DR3O 1OZ0A 3AG2B 3GWKC 5LGTA 4UVAA 5B1AC 3M7MX 1TGOA 3RT3C 3P3PA 3DXRB 4HBNA 1TVKB 2RMKB 4JI3O 1IXMA 3DSQA 4X64B 3CSXA 4I5SA 1RSOA 2GTAA 2JJ2G 2IW5A 4TOIA 4XDLA 1SQFA 3SPGA 1K8AW 1WB8A 5CA3A 1O9GA 2PY5A 1R3KC 4DW0A 4QIWF 3L70H 1ENVA 3SJBC 3UO3A 4JTAB 1SKVA 3DXRA 2YEVB 4ZIBA 1H2KA 3OE7G 4EFEA 3T1HO 3FB7C 4BW9A 2GHYA 4LNUB 2CGNA 2N74A 4P2ZA 5CN0A 2GBOA 1EN6A 3C3SA 4WFAV 2LFRA 4YIOA 5C93A 1QU7A 3E83A 1WP8A 4O4JB 2QDOA 4WF9V 4LFBO 1YJWV 3G71V 2EX3A 2YEVA 3ML0A 3ZS8C 1SZTA 4GKKB 1XMOB 3BA8A 2RCVA 4JYYA 4LNUA 3RN4A 2JEXA 2W6IG 2X6AA 5IYZA 1V55B 3L9DA 3OMNB 3RYHB 3SJQC 4R8CA 4O4JA 3QO5A 5B1NA 2ZXWC 1OCOC 1M1KW 2FYUH 1COWG 3KCXA 5C8YB 2F1MA 3R65A 1JJ2U 2UUCO 3RBZA 3MD0A 1IBMO 4FPPA 2N05A 3ASOC 3JCZA 4DV3O 2UU9O 4TT3G 3Q4HA 1HNZB 1Q5OA 1RPRA 4ZOLB 3RYHA 3AG3B 4O2AB 4DRXA 3E35A 4B08A 4X66O 3ZHUA 2KQXA 2XAHA 2P67A 3W7XA 1S72V 2ODMA 2NLJC 1FXKC 3CWBH 4O2BB 3LSQA 4DR4O 2V4DA 2PUSA 2QGNA 1BSMA 4JTCB 2B5UA 4A5UB 4I4TB 2IBZH 4ZOLA 1BE3H 2P7TC 4O2AA 1K92A 2WLKA 2BOCC 3H1LH 4FZ0A 1BL8A 2CH7B 3LSUA 4UCOA 3BABA 4C7UA 4JI1B 3OMIB 2ZQMA 1YDXA 2AHZA 4JZGA 1IBLO 4U3FH 2QTSA 4IHJB 3RYCB 1JFFB 4O2BA 2YIDA 1N33O 1F51A 1EM1A 3OMAB 2ZM6O 4JZ2A 4K35A 1P7BA 3SYPA 1QCEA 2R72A 3LNMB 2X0LA 4JYAB 2P4KA 5CBFA 4I4TA 3N2KB 3CB2A 1WNSA 1L0LH 3STLC 4N21A 2CH7A 2DN9A 4DV4O 2BTOA 1YTFD 4I7ZB 5JH7B 1M56C 4IHJA 1ZWIC 4JF3A 2Z3YA 3G6BA 3RYCA 2AW9A 1JFFA 5CBGA 3C3TA 3AK3A 2QR4A 2OIGA 4DV2B 3B40A 1PPJH 4JI7B 4GX1A 4GX5A 2ZIOA 2Q68A 4DR1B 2ZE7A 3E2EA 2A7WA 3RWRD 2UXCO 3KZIZ 3N2KA 1CXZB 3K03A 3CCVV 2UXXA 2E5LO 2HEPA 3OUFA 5JH7A 3K9AA 3K08A 1XMQB 4UB8Z 1SF9A 1Y6XA 3APQA 1Z5WA 1RPOA 3SR2C 1YXBA 4AILC 3UQ8A 2AGAA 2P90A 4DV5B 2E75B 5B5EZ 3WB2A 4Q6GA 1PNLA 3CCQV 3ZMTA 3W7UA 1FFXB 1FFTB 3X2QB 4Z1VA 2A9HA 5LA6B 1KKDA 1N32B 3BA9A 4B3MB 4GKJB 4PDLA 1K34A 1AJPA 3UKMA 2ZKOA 5J2TB 3B8MA 5L3GA 3F5TA 1ZX3A 3ABTA 4DR7O 1SESA 1NH2D 2DYSB 4DV0O 3J80N 1G1XB 2EIKC 2CTPA 1GKFA 2X6CA 4KFMA 1FFXA 3K0GA 2WPDG 3QNEA 3RVYA 4MSWC 1M93A 2M7WA 4DR5O 3BEHA 5IDJA 1GM7A 1OCCC 5JCOA 3K06A 2UUAO 1HWYA 4B7KA 4I9QA 4K8XA 1FXVA 4CH5A 4WBNB 4MW3A 1IBKB 5KUKA 3E8GA 3E86A 5J2TA 1AB3A 3P3NA 5LP6B 3SJCC 4DUZB 3HKDB 4JV5B 1GMGA 1SQBH 1EBOA 5IY5B 1VQPV 4CS2A 3U11A 4PDVA 4PV1B 1OCRC 1ORQC 2HHHO 1OCZB 3JAMN 3W7SA 2Y4UA 4WFFA 2YXHA 2C2AA 1PNMA 3BAAA 3I5DA 5BR8B 1V54C 2XTAA 4KHPB 5GTIZ 2KKWA 4RQFA 4EEQA 4QGPA 3L72H 4WBNA 4DK0A 2LW1A 3AG7A 1SQGA 1LUWA 5KX5A 5IWAB 4GZRB 2AZ0A 5LP6A 1XEQA 3K79A 3P32A 1TAEA 2ITCC 3HKEA 1IXBA 1VQ6V 1JCHA 4X1IB 5B1BC 3CXHF 1Q3EA 4JI5B 3RW0A 3VQWA 5K1PA 4LF9B 1M90W 2F4VO 2IJKA 1Y76A 3IGAC 1G4YB 3CD6V 2EBOA 2RQ6A 3E8BA 2HR3A 3D8CA 4NR1A 3MAQA 2Y0PA 2Q7HA 1K9MW 2Z0AA 3CRQA 3K5LA 3G4SV 3SPIA 2OIEA 2RDCA 4JI2B 4X1IA 2Q7EA 4I55B 1ZTEA 4UCRA 4B3SO 5A9GA 5KUMA 3BCCH 1MZFA 4NXMB 3H1IH 3BVOA 4UV9A 4FM1A 3ABKC 4BAYA 1SQQH 5JVDB 1A32A 3U10A 4XBFA 4MVSA 3A8TA 1PL4A 1PD3A 4I55A 1FKAO 1R6TA 2VQEB 2IJJA 2LFSA 2DE0X 3A0BZ 3BFRA 1IVSA 1H2SB 5BZBA 2QM4A 3CC4V 4Q20A 1HR0B 3CP1A 4LC1A 3CRMA 3CCJV 4ZHQA 3H1JH 4LFAO 4CH3A 1H8EG 3HPLC 2PYJA 4FLXA 2IJHA 2JGDA 3QTCA 5LGNA 2UXDB 2ZXWB 1TUBB 3OW2U 1I94B 1JJOA 2P6JA 1XBLA 4UCTA 2NR5A 1PP9H 1HW7A 4F6RB 4NXNO 2W6JG 4UVCA 3ASOB 4U7OA 4PI2A 2WLIA 2ZNIA 3OAAG 5L3BA 1JVMA 4DYLA 2Q0OC 4YIPA 2BOBC 3K5MA 1X4TA 1EFRG 2ZR2A 4FLTA 1NTMH 3F7VC 4R6ZA 3DTUB 2Q7GA 3M8AA 1FXKB 2OTJV 1Q43A 3FB6C 4F6RA 4X1YB 1M4UA 3ASNC 4JI4B 4UXNA 4WFBV 2ZNJA 5ITZB 1XNQO 4BWAA 1N36B 2F66C 3D3QA 4LF7O 2VS0A 3APOA 2CTRA 4HYOA 5J9PC 4NTWA 5LMUB 4K0KB 1FXKA 1NZ6A 1R6NA 4X1YA 2QWQB 1PM9A 3VOUA 4YJ2B 5D5QA 1X59A 4LBEC 2IH1C 2HG5C 2XT9A 4FMTA 5L3EA 5LHGA 1YZBA 2EIJC 1VQ5V 1NU1H 3FAVB 5JQGA 4J7JA 4RO2A 1NT2B 4DV1B 4H0LB 5ITZA 1XNRB 1VQLV 2YXYA 2YI8A 3EVKA 4IL6Z 2EILC 2OCHA 1O9HA 3CS5A 1V9PA 3ZIAG 1K7DA 1NVPD 1FXHA 4OGQB 2ADQB 4QPKA 4YJ2A 2R70A 1AVMA 2Q6AA 4OX9O 3AG4C 3FAVA 5KMGB 5EIBC 3K3WA 4F4LA 1WB7A 4J9ZB 5KHJA 2H94A 1NTKH 1N0JA 3N27A 1BT8A 3JARB 1ZSPA 5EC1C 2Q0AA 3I56V 3ZBHA 3OTOO 5EIBD 1M57C 4X9QA 1QHTA 3ZCCA 4DUYB 3IFXA 5J2UB 2DMXA 2AZ2A 2X6BA 5IYCO 5KMGA 1QR8A 1F4MA 1YJNV 1S5HC 4LWSA 3OGCC 2L35A 3B8NA 3JARA 4X65O 1JQ0A 2A0LA 4I50A 2XAQA 4F6EA 3CHXA 2UXBB 3WU2Z 5IYZB 2WA4A 3OFNG 4LCUC 3LSSA 4BIZA 3UM7A 3ABLC 1VEWA 4X62B 3JD0A 4UCUA 4UCSA 5JJNB 3U0ZA 4UUJC 5J2UA 1BCCH 3OR6C 1J5EO 1VARA 1LNQA 3MHHC 5IJ9B 4TWKA 2CUGA 1GN3A 5JJJB 4J7ZA 4PD4F 4CH4A 1F7YA 2EIKB 4CC5A 1CEZA 2DW4A 1VQNV 1Q7YW 4CS4A 2E74B 3ZMVA 4FK5C 4JYCA 1GO3F 1OCCB 1XDCA 3Q4HB 1XHXA 2A06H 2CAZC 3HB3B 4DRXB 1S3JA 2UUBO 2D3OW 4LF5O 3FYIB 4ZKIA 5IJ9A 2W0XA 4UV8A 3DC5A 4DR6O 1M9NA 1OCRB 3ABMC 2Y48A 1ZUQA 3L75H 4X8AA 2EINC 4DR2B 4PDRA 4ABMA 4QNHB 1K97A 1V54B 4J11A 4FM2A 5CA1A 3VQVA 2Y4TA 2WWWA 4LF6B 3CRRA 2HKOA 1I5XA 4ASUG 1JPXA 2O57A 3RYFA 4DUZO 3QVNA 2ADPA 5B1BB 2VWJA 4FLWA 1R3LC 1MA1A 4YY3B 1BZKA 5EBWC 5CA0B 1MG1A 4WFEA 4MVOA 2R9AA 1Q6IA 3D36C 1IDSA 5FPOA 5DN6G 3L73H 3K04A 4TQFA 5FLXN 4UB6Z 4LF4O 1HNWO 1THZA 3DGEA 3L71H 2EIMC 4DV6B 1GN6A 4P30A 3TGUH 5E1AC 4P9OA 1KKCA 3WG7C 3SYCA 1HNXO 3STZC 3TXQA 2F43G 5HFLA 2VQFB 2PI4A 4AQYO 4B3TO 4FJCC 1CP9A 3B2EE 1B04A 5CA0A 2BSKA 3J81N 4H13B 3CCLV 2KSDA 3QF7A 4DR3B 2F93B 1NKDA 2YIBD 2QM8A 1US6A 3FX7A 2G38A 4H44B 5BXZA 3LUTB 2JDIG 4ICGA 4JI3B 1S5LZ 2P22C 1JMKC 3H1KH 3AK1A 2CTQA 4JI8O 4JI2O 1BHAA 2YS8A 1Q8IA 1SQXH 5D5PA 4PJ0Z 4NYKA 4JI0O 3NXSA 2FMLA 1N34O 4HZ3A 2EJ7A 3AG1C 3CCEV 1S77D 1MSWD 3ZEDA 1OHHG 3K0DA 3MHSC 1KU9A 4DV7O 2Q9LA 2QKCA 2WLLA 3J7AU 1FS0G 1I0HA 3LDCA 1KBHA 4GT1A 3A0RA 3HKCA 5KAFZ 2XASA 3LNNA 4L87A 2PZSA 3PN1A 3SYOA 2W0FC 1FYJA 2OCCC 3WB1A 1MSDA 4LFBB 4RUEA
chains in the Genus database with same CATH topology
3EHBB 2HLDG 3JD2A 4XDJA 1YHQV 5EBLC 1K3EA 2OTLV 4XBFA 4MVSA 2DQ3A 3OR7C 1Y4MA 5KA6A 4JPRA 5IYBO 5L3DA 1W2BU 1K33A 1PD3A 2H8PC 4MTFA 1GM9A 4JYBA 1BHBA 4MVMA 4MT8A 2IJJA 2Y69B 4PA4A 3AG1B 1ROPA 4LP8A 1DF4A 3OEHG 1XL6A 3OEEG 2LFSA 3OM3B 4I9WA 3T4ZA 2YSUB 3JD3A 1OZ0A 3AEIA 3ASNB 3ABUA 3AG2B 5LGTA 5BZBA 4UVAA 4MTXA 5B1AC 3CC4V 2IU0A 4Q20A 5KA5A 3CP1A 4CBCA 4LC1A 5B1OA 3CCJV 1IXMA 2V7QG 1H8HG 1H8EG 3HPLC 4I5SA 3ZN0A 3M99B 2IJHA 2QE7G 5LHHA 1JOYA 4MVZA 4MTOA 5LGNA 4WCEV 2JJ2G 2KB1A 2ZXWB 2IW5A 2DWEC 3JYCA 4XDLA 1K4DC 3OW2U 1JX9A 3E89A 3SPGA 3ABKB 1K8AW 1WLEA 2P6JA 5CA3A 2EIJB 1R3KC 4QIWF 1VQ9V 1ENVA 3W7TA 4JTAB 1DLBA 2W6JG 4UVCA 2YEVB 3ASOB 4U7OA 2WLIA 2DWDC 3OAAG 3OE7G 5L3BA 1VQOV 1NBMG 3IC7A 2WLLB 1JVMA 4DXWA 1RM1B 3FB7C 4RAIA 3CC7V 2GHYA 3RVZA 2QEXV 4RUFA 2BOBC 4P2ZA 5CN0A 1EFRG 2ZR2A 1MABG 2XAJA 3ZJZA 3ZRXA 2WAMA 3F7VC 3DTUB 4R6ZA 1K5QA 4WFAV 5B1AB 2LFRA 5C93A 3E83A 2Y69C 4FIPC 3AG4B 5L3FA 1AI4A 4WF9V 1N8RW 1FXKB 2OTJV 1QR9A 3FB6C 1YJWV 1KD1W 3G71V 2YEVA 3ASNC 3ML0A 3AG2C 3FB5C 4UXNA 1SZTA 3JD4A 4OXSA 4WFBV 3JD1A 5FL7G 4PA3A 3ETEA 2JEXA 2W6IG 4RQEA 2X6AA 1V55B 1I5YA 3SPHA 1VQ8V 2HFEC 3OMNB 4HYOA 5J9PC 3SJQC 4R8CA 3LDEA 3QO5A 5B1NA 3F7YC 2ZXWC 2JK5C 1OCOC 1FXKA 4E2LA 1M1KW 1R6NA 5LGUA 3VOUA 2JEUA 1COWG 4LBEC 2IH1C 4MS2A 2HG5C 1VQ5V 4FMTA 5L3EA 1DTOA 2EIJC 5LHGA 3F5WC 3CPWU 1W0KG 3SYQA 2MK3A 4RO2A 2ITDC 3R65A 1JJ2U 3RBZA 2PI5A 1SERA 1R3IC 4QJFB 3MD0A 4FPPA 1B6QA 1YIJV 3ASOC 3JCZA 1VQLV 3T1CA 1QLEB 1AI5A 4TT3G 1XL4A 2HJFC 2EILC 1RM1C 1RPRA 1BMFG 2WLJA 3AG3B 2DQ0A 3E35A 3ZIAG 1K7DA 3CCMV 1NVPD 3T4DA 3FB8C 1FXHA 2XAHA 4QPKA 1AJNA 2Q6AA 3AG4C 3OUSA 2P67A 3W7XA 1S72V 2NLJC 1DF5A 1FXKC 5H9CA 2EJRA 1AJQA 3K3WA 4F4LA 3ZRVA 4J9ZB 1YI2V 2WLIB 1QLNA 2H94A 3LSQA 3G6EV 1E1RG 4J9YB 3ZMUA 2Q67A 1KQSU 4JTCB 5EC1C 2B5UA 3TCUA 4U7NA 1VQ7V 2Q69A 3I56V 4PDMA 2GSMB 1TUEB 2R9IA 1NR1A 5LBQA 1OCOB 2P7TC 5HFMA 1YSCA 1K92A 1VQ4V 3CXCU 2WLKA 2BOCC 1M57C 1V55C 1BL8A 1PNKA 2FTKA 4MVQA 1NQTA 3OMIB 2ZQMA 4MVUA 4KUMA 3ZCCA 1SETA 2AHZA 3IFXA 1QVFU 5H6RA 2NNUA 2X6BA 5IYCO 3B77A 4YXWG 1NVPB 2EINB 1QR8A 4PA9A 4QE9A 1F4MA 1F51A 1YJNV 1KECA 3OMAB 1S5HC 4R7CA 5IYDO 3OGCC 4GX0A 2EILB 1P7BA 3B8NA 1KP3A 1QCEA 4MVRA 3SYPA 2LP7A 1JQ0A 3LNMB 2A0LA 2X0LA 5CBFA 2XAQA 3CC2V 2WLNA 3OFNG 4LCUC 1WPXA 2EZOA 1GM8A 2IJIA 3LSSA 3STLC 1QLEC 2R9RB 3UM7A 2IU3A 4BIZA 4N21A 3ABLC 4PA7A 3CCRV 3JD0A 3ZRSA 4R50A 5LHIA 1YTFD 4QE7A 3CYOA 4JGSA 4UUJC 4QPJA 1M56C 1ZWIC 3AG3C 3OR6C 2Z3YA 4JF3A 5CBHA 1J95A 1R73A 1LNQA 3MHHC 4G28B 1GTOA 5CBGA 2HVJC 4TWKA 4JAVA 2EIKB 2AHYA 1CEZA 4GX1A 2DW4A 1QBZA 3P30A 4GX5A 4X89A 1Q7YW 1VQNV 2Q68A 3LDDA 3ZMVA 4FK5C 3E2EA 2ZD9A 2K1EA 4JYCA 4DO2A 1GO3F 1OCCB 1M57B 2QM7A 4MTGA 5EC2C 3EFFK 2EIMB 4WFHA 1CPYA 3K03A 3CCVV 1KC8W 2UXXA 3TK1A 4P9PA 3HB3B 3OUFA 1S3JA 3K9AA 2D3OW 3K08A 3SPJA 5B3SB 3CCSV 3FYIB 4ZKIA 1YTFB 1NR7A 4UV8A 4CZZA 1M9NA 3BY6A 1RPOA 1OCRB 3ABMC 2Y48A 1P4RA 1YJ9V 1S76D 3TETA 3D36A 4X8AA 1YITV 1G8MA 2EINC 2QKSA 4PDRA 1R6KA 2P90A 4QNHB 1K97A 1V54B 2QA4V 3ABLB 1PNLA 3CMAV 3CCQV 5IY5C 3ZMTA 5CMUA 3W7UA 2WWWA 1FFTB 1L1FA 3X2QB 4BW5A 4MW8A 1M56B 2UXNA 2A9HA 4N23A 2Z5UA 2HKOA 1I5XA 1KKDA 4ASUG 2WSSG 1JPXA 3QO8A 3ZMSA 4HAMA 5EBMC 3H01A 4PDLA 1K34A 1H2GA 4X88A 1AJPA 3UKMA 3B8MA 5L3GA 5B1BB 3SPCA 2EZPA 3ZRWB 1R3LC 1E1QG 3VBBA 3GWOA 3ABTA 2ZDIA 3ZN1A 1SESA 1NH2D 1W0JG 2DYSB 5EBWC 1KP2A 1VQKV 1MG1A 1NJIW 2EIKC 3ZMZA 2X6CA 1GKFA 4MVOA 4WFEA 1AROP 4KFMA 3K0GA 4ZBMA 2WPDG 3QNEA 3RVYA 5DN6G 4MSWC 1AI7A 2M7WA 3K04A 4UVBA 3BEHA 2WLHA 5IDJA 2XOKG 4JAUA 1GM7A 1OCCC 2B1GA 1THZA 3DGEA 3K06A 1VQMV 2EIMC 1EZJA 1HWYA 4EKWA 1FXVA 4P30A 3CCUV 5E1AC 3CMEV 4MW3A 4P9OA 5KUKA 3ABMB 3FKSG 3E8GA 2XNDG 1PKXA 3E86A 3SYCA 3WG7C 4KP4A 2JIZG 5H6QA 4G27B 3STZC 3ZRWA 2F43G 5HFLA 2ZR3A 2PI4A 5B3SC 1AI6A 1GMGA 4FJCC 1Q82W 1CP9A 1EBOA 2DYRB 4Z1MG 5IY5B 1VQPV 2OCCB 4PDVA 1OCRC 2CK3G 1ORQC 4TSFG 1OCZB 3W7SA 5DM6V 3W7WA 3CCLV 2ZDIC 3KG2A 4WFFA 2C2AA 1NH2B 1PNMA 1K5SA 3D3IA 1NKDA 1V54C 2QM8A 5GW7A 4H33A 4RQFA 3WFVA 3E8FA 3X2QC 1K73W 3LUTB 2JDIG 1E79G 2A79B 4WFGA 4GCZA 3K79A 3P32A 2ITCC 1F4NA 1SRYA 2X7RB 4H37A 2ATKC 1AR1B 3ETDA 1BHAA 1VQ6V 1R3JC 1JCHA 4PELA 5B1BC 3SYAA 1S0VA 3RW0A 3NXSA 4HZ3A 1QVGU 3AG1C 1M90W 1H38A 1F23A 2DYSC 3CCEV 3T2MA 2B1IA 1S77D 2IJKA 4GX2A 3IGAC 4G2KA 1PL0A 2HVKC 1OHHG 1G4YB 3PJSK 3CD6V 2EBOA 1MSWD 3K0DA 4JTDB 2XAGA 1K4CC 4BIUA 3E8HA 3WG7B 3MHSC 3E8BA 3QO7A 2HR3A 1Y66A 1Q86W 2WLLA 2WLMA 4JASA 1FS0G 3LDCA 2OT5A 3GB7C 2IH3C 4GT1A 2V1DA 1K9MW 3A0RA 3G4SV 3SPIA 1MOFA 2XAFA 3FYEB 2XASA 4L87A 5L3CA 3SYOA 5KUMA 2W0FC 2DYRC 4XDKA 3I55V 2OCCC 4PA6A 4UV9A 1OCZC 2QTOA 1Q81W 2JJ1G 3ETGA 1UJWB 5EK0A 1GK9A 3ABKC 4BAYA 4RUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E35 A;  3W7S A;  1YTF B;  3BY6 A;  3W7W A;  4HAM A;  1NH2 B;  5CA3 A;  2WAM A;  3W7X A;  3D3I A;  5GW7 A;  3W7T A;  2P90 A;  1NVP B;  1RM1 C;  3W7U A;  3IC7 A;  1S3J A;  2HR3 A; 
#chains in the Genus database with same CATH topology
 1NTZ H;  1VF6 C;  3JD2 A;  4FLZ A;  4IYH A;  2OTL V;  2GUZ A;  3OR7 C;  1Y4M A;  4JPR A;  5IYB O;  1W2B U;  4MTF A;  2ETN A;  4OPA A;  1GM9 A;  4JYB A;  4YHH O;  2YXL A;  4MVM A;  4MT8 A;  4PA4 A;  1DF4 A;  1XL6 A;  3T4Z A;  1KB9 F;  3JD3 A;  4AI8 A;  3AEI A;  3ASN B;  4MTX A;  2GV9 A;  3CX5 F;  2UUC B;  5KX5 B;  2V7Q G;  3QG5 A;  1IBM B;  1H8H G;  1KUQ A;  3K5N A;  4DV3 B;  2UU9 B;  3ZN0 A;  3HKE B;  3M99 B;  1JOY A;  4MVZ A;  4MTO A;  1XRE A;  4WCE V;  2KB1 A;  4LF8 O;  3E89 A;  1WLE A;  1VF5 B;  3JCU Z;  4X66 B;  2EIJ B;  1UPG A;  2Y0I A;  1WP7 A;  1VQ9 V;  1BS3 A;  1Y76 B;  2CDY A;  1DLB A;  4NKG B;  2AXT Z;  1P49 A;  1VQO V;  1NBM G;  2P5O A;  1GN2 A;  4FVM A;  4DR4 B;  4JI6 O;  4RAI A;  4RUF A;  2P4V A;  3EXA A;  3ZJZ A;  3TXS A;  2FB5 A;  4B3R O;  1K5Q A;  1HDJ A;  5B1A B;  2D2C B;  2Y69 C;  4FIP C;  3AG4 B;  2GDS A;  1AI4 A;  4AHC A;  4IGG A;  1Z5V A;  2JS5 A;  3T1Y O;  1IBL B;  2XUM A;  5E79 Z;  3N2G B;  3JD4 A;  1N33 B;  4FLY A;  2ZM6 B;  4NTX A;  4OXS A;  3SJA C;  1JA8 A;  2QWR B;  3ETE A;  3JSL A;  1FJG O;  4LFC O;  5LMN O;  2F23 A;  1VQ8 V;  3JAT B;  1H2N A;  3LDE A;  3OTF A;  1SA0 A;  3F7Y C;  4DV4 B;  1OV9 A;  5LGU A;  2JEU A;  1Y74 B;  4MS2 A;  1KMI Z;  2H3O A;  1W0K G;  3SYQ A;  3N2G A;  2ITD C;  2PI5 A;  1AIL A;  1R3I C;  4QJF B;  4X64 O;  1SQV H;  1YIJ V;  4ZHQ B;  3BRC A;  2OYQ A;  3R66 A;  1FD9 A;  1AI5 A;  2UXC B;  1XL4 A;  2HJF C;  2LW7 A;  3A0H Z;  4TV8 B;  1RM1 C;  2PTM A;  2JGD B;  3JAT A;  1D5A A;  1BMF G;  2WLJ A;  1B06 A;  3S3X A;  2E5L B;  3CCM V;  1DK1 A;  1EN4 A;  2CGO A;  3ZHT A;  5EYP A;  1Y74 A;  1AJN A;  4KXR A;  3UCS C;  1DF5 A;  1D5N A;  3ZRV A;  2WLI B;  1QLN A;  2LGW A;  1P7G A;  3G6E V;  3JAW B;  4J9Y B;  3ZMU A;  3H9V A;  4X20 B;  4TV8 A;  4U7N A;  1VQ7 V;  2Q69 A;  4LH6 A;  1TUE B;  3AK2 A;  3IAY A;  5LBQ A;  1OCO B;  1YSC A;  1VQ4 V;  4LH7 A;  3CXC U;  1NQT A;  4KUM A;  3RYI B;  2LGQ A;  5H6R A;  2LJ2 A;  2NNU A;  4CH6 A;  1FAF A;  1UFI A;  2EIN B;  4DK1 A;  1U96 A;  4PA9 A;  4JAA A;  2MW2 B;  1KEC A;  1NS1 A;  5LYJ B;  1XMO O;  4GKK O;  1SQP H;  4R7C A;  3JAW A;  3UO2 A;  4GX0 A;  4DR7 B;  1KP3 A;  2LP7 A;  3G67 A;  4X20 A;  4DV0 B;  1M5I A;  4UFZ A;  2LQT A;  3CC2 V;  1W59 A;  3RFR A;  2WLN A;  3ZHV A;  2IJI A;  1QLE C;  2R9R B;  2IU3 A;  2YDE A;  2Q73 A;  4DR5 B;  5LHI A;  4TUY B;  3CYO A;  3B09 A;  4YJ3 B;  4BIO A;  4J10 A;  2UUA B;  4QPJ A;  3RYI A;  2EUL A;  5JJE B;  1J95 A;  2L6L A;  1P84 F;  5LYJ A;  4JAV A;  5JQG B;  2AHY A;  1QNM A;  1QBZ A;  4X89 A;  3LDD A;  2HHH B;  1VP7 A;  4DO2 A;  1DGS A;  1HNZ O;  1WAZ A;  2EIM B;  1OJH A;  3TK1 A;  4TUY A;  4YJ3 A;  2QKA A;  3CCS V;  1HP8 A;  1YTF B;  1NR7 A;  3BY6 A;  1BGY H;  2OWO A;  5GON B;  1WA8 B;  3VQY A;  1YJ9 V;  3TET A;  5LOV A;  3D36 A;  2QKS A;  1R6K A;  1URF A;  2QSA A;  2QA4 V;  3CMA V;  5IY5 C;  4J7K A;  1AR4 A;  1L1F A;  2F4V B;  4BW5 A;  4MW8 A;  1M56 B;  4JI1 O;  1YCI A;  2YIB A;  3OD4 A;  3H01 A;  4X88 A;  4I0X B;  5GON A;  3SPC A;  1WA8 A;  2QJ1 A;  4FZ1 A;  4LWS B;  1W0J G;  4JYA O;  4B3S B;  4I50 B;  1ARO P;  2JVD A;  2JS3 A;  2WLH A;  2XOK G;  3GVM A;  1VQM V;  1EZJ A;  4EKW A;  2HJD A;  3CCU V;  3K59 A;  4I0X A;  4J80 A;  3FKS G;  4FLV A;  4KP4 A;  2JIZ G;  5FNV B;  4G27 B;  2CE4 A;  1R1B A;  2ZR3 A;  5B3S C;  4DV2 O;  1AI6 A;  4JI7 O;  5GTH Z;  4GLX A;  4DR1 O;  2OCC B;  4TSF G;  3K9S A;  2ZDI C;  1AP6 A;  1G6U A;  1NH2 B;  1ZLZ A;  5IJ0 B;  4UCV A;  3D3I A;  5GW7 A;  3E8F A;  1TVK A;  1RP3 B;  1XIL A;  2QWN B;  1XMQ O;  2WA3 A;  1YEW A;  3JSN A;  4GCZ A;  5FNV A;  4LFA B;  4E4E A;  1R3J C;  3WB0 A;  4DV5 O;  1MMM A;  1S0V A;  1GRJ A;  2IM9 A;  4GYC B;  1VF6 A;  1H38 A;  1F23 A;  5IJ0 A;  5CA1 B;  4G2K A;  2HVK C;  3PJS K;  1YF2 A;  4JTD B;  5JWP A;  4NXN B;  4BIU A;  1N32 O;  3QO7 A;  4B3M O;  2GTS A;  4GKJ O;  1Y66 A;  3ICX A;  2WLM A;  1WN7 A;  4JAS A;  5B66 Z;  2YI9 A;  1T5E A;  2OT5 A;  4NB5 A;  3RYF B;  4L8J A;  1L0N H;  1MOF A;  2KG7 B;  3FYE B;  5L3C A;  2DYR C;  4TV9 B;  1IUR A;  4EFB A;  4KL1 A;  4IIJ B;  2QTO A;  3ZHR A;  1Q81 W;  2JJ1 G;  3ETG A;  5EK0 A;  3IC9 A;  1GK9 A;  3EHB B;  3KCY A;  2HLD G;  4FFK A;  3SDL A;  1KYO F;  4XDJ A;  2BTQ B;  1K3E A;  2DQ3 A;  1IBK O;  3ZHS A;  5F2V O;  1K33 A;  3TJT A;  3HKB B;  4JV5 O;  1XNQ B;  3C90 A;  1BHB A;  1GN4 A;  4LF7 B;  2ARH A;  2KG7 A;  2Y69 B;  1SS3 A;  1ROP A;  3OT7 A;  4LP8 A;  2BSK B;  3OM3 B;  1XUQ A;  4TV9 A;  3NR7 A;  1L8D A;  4IIJ A;  2BE3 A;  3ABU A;  5BR8 O;  4KHP O;  1VMG A;  2IU0 A;  2ILM A;  5KA5 A;  5C8Y A;  2BTQ A;  4CBC A;  5IWA O;  5B1O A;  2RN9 A;  3HKB A;  2DJV A;  2CTW A;  1EZV H;  2QE7 G;  5LHH A;  4IYI A;  1Z2G A;  4O4L B;  2E3C A;  2DWE C;  4Z2W A;  3JYC A;  4JI5 O;  3G80 A;  1K4D C;  1JX9 A;  4LF9 O;  3ABK B;  1XOU A;  2B9Z A;  3W7T A;  5K1X A;  4OX9 B;  2DWD C;  3CEI A;  1Q6H A;  1BQ0 A;  3IC7 A;  2WLL B;  4DXW A;  1RM1 B;  5KAI Z;  1WPB A;  3CC7 V;  4FFB B;  3RVZ A;  2QEX V;  4X1K B;  4O4L A;  1MAB G;  4O4H B;  3HKC B;  2XAJ A;  1IX9 A;  3ZRX A;  3BHP A;  2WAM A;  5TIS Z;  3OTO B;  1N4C A;  4NXM O;  5L3F A;  1N8R W;  1S5J A;  1QR9 A;  2YUA A;  1KD1 W;  3AG2 C;  3FB5 C;  1VIB A;  2GUZ B;  4B7E A;  2QWO B;  3JD1 A;  5FL7 G;  4PA3 A;  2ZE5 A;  3ETQ A;  4FFB A;  4X65 B;  1YVW A;  4RQE A;  3T1H B;  4X1K A;  2HP8 A;  3HR0 A;  2VQE O;  1LUV A;  4O4H A;  1I5Y A;  1B3Q A;  3SPH A;  2A3Q A;  2HFE C;  1BQZ A;  5KHI A;  5H5N A;  2JK5 C;  4E2L A;  1J5E B;  3DC6 A;  4J41 A;  1HR0 O;  2ZCE A;  3CPW U;  1DTO A;  3F5W C;  2MK3 A;  1N0N A;  1SER A;  1NI8 A;  5AG2 A;  2Q5Z A;  1B6Q A;  3T1C A;  5EZY B;  1QLE B;  1Q6U A;  4O4I B;  2UXD O;  1MZE A;  4D7T A;  3THO A;  1TA8 A;  1I94 O;  2DQ0 A;  2F95 B;  1AP5 A;  2UUB B;  3T4D A;  3FB8 C;  1VF7 A;  2YIA A;  4LF5 B;  3OUS A;  5FPR A;  4DR6 B;  5H9C A;  3L74 H;  2EJR A;  4CC6 A;  3CRC A;  1AJQ A;  1XHZ A;  1YI2 V;  2PGG A;  3JAK B;  5DED A;  5EZY A;  1E1R G;  3K58 A;  2Q67 A;  1KQS U;  4TQD A;  1JR9 A;  4O4I A;  3TCU A;  4K8Z A;  4PDM A;  2FL4 A;  2GSM B;  3CRA A;  2R9I A;  1NR1 A;  2Q4P A;  5HFM A;  1QQC A;  5LA6 A;  2QWP B;  1V55 C;  1PNK A;  2FTK A;  4MVQ A;  4MVU A;  3O9O A;  1SET A;  3FD9 A;  4ZI7 B;  1QVF U;  1D2D A;  2VRZ A;  3B77 A;  4DW1 A;  4JI4 O;  4YXW G;  1NVP B;  4QE9 A;  3H1H H;  3JAK A;  3CE2 A;  5IYD O;  2EIL B;  4MVR A;  1Q90 D;  1N36 O;  1WPX A;  2EZO A;  1GM8 A;  1SZX A;  4PA7 A;  3CCR V;  3ZRS A;  4R50 A;  4LF4 B;  1HNW B;  5LMU O;  1SC5 B;  2K9P A;  1U97 A;  4QE7 A;  4K0K O;  4ZI7 A;  4JGS A;  1SA0 B;  4PI0 A;  4FM0 A;  3AG3 C;  5CBH A;  2Q8V A;  1R73 A;  4G28 B;  3JAS B;  3HKD A;  1GTO A;  2HVJ C;  1HNX B;  3O65 A;  4IT5 A;  4DV1 O;  4AQY B;  4B3T B;  2BCC H;  1XNR O;  3P30 A;  5CB4 B;  2ZD9 A;  2K1E A;  2ZIM A;  2JGU A;  2QM7 A;  1IZ3 A;  1M57 B;  5EC2 C;  4MTG A;  3EFF K;  4WFH A;  2XHB A;  1CPY A;  4BR6 A;  2ZIN A;  1KC8 W;  2P06 A;  5DEC A;  4P9P A;  4U3J B;  2ZT9 B;  1I08 A;  2JRI A;  3SPJ A;  5B3S B;  3JAS A;  5EYP B;  4CZZ A;  4JI8 B;  1GH6 A;  1P4R A;  5KHK A;  1S76 D;  5CB4 A;  2M6Y A;  1YIT V;  1G8M A;  1XQ8 A;  5A2Q N;  4JI0 B;  3ABL B;  1N34 B;  3E22 B;  5CMU A;  1ZAU A;  2N04 A;  2UXN A;  4U3J A;  4N23 A;  2Z5U A;  4DUY O;  1H2L A;  2WSS G;  2ZE6 A;  3QO8 A;  3ZMS A;  4HAM A;  4DV7 B;  5EBM C;  1H2G A;  2YC0 A;  4W4L A;  2EZP A;  5LL6 Y;  3ZRW B;  1AR5 A;  1E1Q G;  3VBB A;  3GWO A;  2RJZ A;  2ZDI A;  3ZN1 A;  5LXT B;  3UT5 B;  2VWK A;  1KP2 A;  1VQK V;  5KHG A;  1NJI W;  2UXB O;  3ZHQ A;  3ZMZ A;  3E22 A;  4ZBM A;  1AI7 A;  4UVB A;  4X62 O;  5H2F Z;  5KHH A;  4JAU A;  2B1G A;  3MDS A;  5JVD A;  3CME V;  3FFQ A;  3ABM B;  4J42 A;  2XND G;  1PKX A;  5H6Q A;  3BPZ A;  3ZRW A;  2YIC A;  4K3A A;  1Q82 W;  5LXT A;  3UT5 A;  4YHH B;  4NVP A;  1PV0 A;  2DYR B;  1MNG A;  4FLU A;  2PYL A;  4Z1M G;  4PHZ A;  2CK3 G;  5DM6 V;  3W7W A;  3KG2 A;  1K5S A;  2PF4 E;  1GAX A;  4H33 A;  3WFV A;  1Y67 A;  4RWU A;  3X2Q C;  1K73 W;  1E79 G;  2A79 B;  5JCO C;  4WFG A;  1I7F A;  4D7S A;  3K5O A;  4GUN A;  1F4N A;  1SRY A;  2X7R B;  4H37 A;  2ATK C;  1AR1 B;  3ETD A;  3JAL B;  4NTY A;  1ZL8 B;  4PEL A;  1TUB A;  4DR2 O;  5LOV B;  5BY1 A;  1H2M A;  4LF8 B;  3SYA A;  3S3W A;  3VQX A;  1QVG U;  2E76 B;  2DYS C;  3T2M A;  1LR1 A;  2B1I A;  4GX2 A;  4LF6 O;  1PL0 A;  4EB6 B;  2XAG A;  3A2F A;  1K4C C;  3E8H A;  3SGI A;  3WG7 B;  3KKY A;  3IJ4 A;  3ZX6 A;  1Q86 W;  1WJZ A;  4HNA B;  2RNB A;  3GB7 C;  4CS3 A;  2IH3 C;  4JI6 B;  2V1D A;  2ZE8 A;  3JAL A;  1RFY A;  1ZL8 A;  5BMV B;  5LP6 C;  4YY3 O;  2XAF A;  3CJH B;  1XI1 A;  4B3R B;  3OGI B;  4XDK A;  4D6T H;  3I55 V;  4PA6 A;  1OCZ C;  1EN5 A;  1UJW B;  4EB6 A;  3T1Y B;  4LR3 A;  4OPH A;  4DV6 O;  2FKX A;  1YHQ V;  5EBL C;  4HNA A;  5KA6 A;  5IT9 N;  5L3D A;  5KLV H;  1FPO A;  2VQF O;  2H8P C;  5IE9 A;  3K57 A;  4W4K A;  5BMV A;  1RSO B;  2NN4 A;  2DOS A;  1FJG B;  3AG1 B;  3CJH A;  4LFC B;  5LMN B;  3RGB A;  3OEH G;  3OEE G;  4I9W A;  2YSU B;  2LO1 A;  3B4S A;  4DR3 O;  1OZ0 A;  3AG2 B;  3GWK C;  5LGT A;  4UVA A;  5B1A C;  3M7M X;  1TGO A;  3RT3 C;  3P3P A;  3DXR B;  4HBN A;  1TVK B;  2RMK B;  4JI3 O;  1IXM A;  3DSQ A;  4X64 B;  3CSX A;  4I5S A;  1RSO A;  2GTA A;  2JJ2 G;  2IW5 A;  4TOI A;  4XDL A;  1SQF A;  3SPG A;  1K8A W;  1WB8 A;  5CA3 A;  1O9G A;  2PY5 A;  1R3K C;  4DW0 A;  4QIW F;  3L70 H;  1ENV A;  3SJB C;  3UO3 A;  4JTA B;  1SKV A;  3DXR A;  2YEV B;  4ZIB A;  1H2K A;  3OE7 G;  4EFE A;  3T1H O;  3FB7 C;  4BW9 A;  2GHY A;  4LNU B;  2CGN A;  2N74 A;  4P2Z A;  5CN0 A;  2GBO A;  1EN6 A;  3C3S A;  4WFA V;  2LFR A;  4YIO A;  5C93 A;  1QU7 A;  3E83 A;  1WP8 A;  4O4J B;  2QDO A;  4WF9 V;  4LFB O;  1YJW V;  3G71 V;  2EX3 A;  2YEV A;  3ML0 A;  3ZS8 C;  1SZT A;  4GKK B;  1XMO B;  3BA8 A;  2RCV A;  4JYY A;  4LNU A;  3RN4 A;  2JEX A;  2W6I G;  2X6A A;  5IYZ A;  1V55 B;  3L9D A;  3OMN B;  3RYH B;  3SJQ C;  4R8C A;  4O4J A;  3QO5 A;  5B1N A;  2ZXW C;  1OCO C;  1M1K W;  2FYU H;  1COW G;  3KCX A;  5C8Y B;  2F1M A;  3R65 A;  1JJ2 U;  2UUC O;  3RBZ A;  3MD0 A;  1IBM O;  4FPP A;  2N05 A;  3ASO C;  3JCZ A;  4DV3 O;  2UU9 O;  4TT3 G;  3Q4H A;  1HNZ B;  1Q5O A;  1RPR A;  4ZOL B;  3RYH A;  3AG3 B;  4O2A B;  4DRX A;  3E35 A;  4B08 A;  4X66 O;  3ZHU A;  2KQX A;  2XAH A;  2P67 A;  3W7X A;  1S72 V;  2ODM A;  2NLJ C;  1FXK C;  3CWB H;  4O2B B;  3LSQ A;  4DR4 O;  2V4D A;  2PUS A;  2QGN A;  1BSM A;  4JTC B;  2B5U A;  4A5U B;  4I4T B;  2IBZ H;  4ZOL A;  1BE3 H;  2P7T C;  4O2A A;  1K92 A;  2WLK A;  2BOC C;  3H1L H;  4FZ0 A;  1BL8 A;  2CH7 B;  3LSU A;  4UCO A;  3BAB A;  4C7U A;  4JI1 B;  3OMI B;  2ZQM A;  1YDX A;  2AHZ A;  4JZG A;  1IBL O;  4U3F H;  2QTS A;  4IHJ B;  3RYC B;  1JFF B;  4O2B A;  2YID A;  1N33 O;  1F51 A;  1EM1 A;  3OMA B;  2ZM6 O;  4JZ2 A;  4K35 A;  1P7B A;  3SYP A;  1QCE A;  2R72 A;  3LNM B;  2X0L A;  4JYA B;  2P4K A;  5CBF A;  4I4T A;  3N2K B;  3CB2 A;  1WNS A;  1L0L H;  3STL C;  4N21 A;  2CH7 A;  2DN9 A;  4DV4 O;  2BTO A;  1YTF D;  4I7Z B;  5JH7 B;  1M56 C;  4IHJ A;  1ZWI C;  4JF3 A;  2Z3Y A;  3G6B A;  3RYC A;  2AW9 A;  1JFF A;  5CBG A;  3C3T A;  3AK3 A;  2QR4 A;  2OIG A;  4DV2 B;  3B40 A;  1PPJ H;  4JI7 B;  4GX1 A;  4GX5 A;  2ZIO A;  2Q68 A;  4DR1 B;  2ZE7 A;  3E2E A;  2A7W A;  3RWR D;  2UXC O;  3KZI Z;  3N2K A;  1CXZ B;  3K03 A;  3CCV V;  2UXX A;  2E5L O;  2HEP A;  3OUF A;  5JH7 A;  3K9A A;  3K08 A;  1XMQ B;  4UB8 Z;  1SF9 A;  1Y6X A;  3APQ A;  1Z5W A;  1RPO A;  3SR2 C;  1YXB A;  4AIL C;  3UQ8 A;  2AGA A;  2P90 A;  4DV5 B;  2E75 B;  5B5E Z;  3WB2 A;  4Q6G A;  1PNL A;  3CCQ V;  3ZMT A;  3W7U A;  1FFX B;  1FFT B;  3X2Q B;  4Z1V A;  2A9H A;  5LA6 B;  1KKD A;  1N32 B;  3BA9 A;  4B3M B;  4GKJ B;  4PDL A;  1K34 A;  1AJP A;  3UKM A;  2ZKO A;  5J2T B;  3B8M A;  5L3G A;  3F5T A;  1ZX3 A;  3ABT A;  4DR7 O;  1SES A;  1NH2 D;  2DYS B;  4DV0 O;  3J80 N;  1G1X B;  2EIK C;  2CTP A;  1GKF A;  2X6C A;  4KFM A;  1FFX A;  3K0G A;  2WPD G;  3QNE A;  3RVY A;  4MSW C;  1M93 A;  2M7W A;  4DR5 O;  3BEH A;  5IDJ A;  1GM7 A;  1OCC C;  5JCO A;  3K06 A;  2UUA O;  1HWY A;  4B7K A;  4I9Q A;  4K8X A;  1FXV A;  4CH5 A;  4WBN B;  4MW3 A;  1IBK B;  5KUK A;  3E8G A;  3E86 A;  5J2T A;  1AB3 A;  3P3N A;  5LP6 B;  3SJC C;  4DUZ B;  3HKD B;  4JV5 B;  1GMG A;  1SQB H;  1EBO A;  5IY5 B;  1VQP V;  4CS2 A;  3U11 A;  4PDV A;  4PV1 B;  1OCR C;  1ORQ C;  2HHH O;  1OCZ B;  3JAM N;  3W7S A;  2Y4U A;  4WFF A;  2YXH A;  2C2A A;  1PNM A;  3BAA A;  3I5D A;  5BR8 B;  1V54 C;  2XTA A;  4KHP B;  5GTI Z;  2KKW A;  4RQF A;  4EEQ A;  4QGP A;  3L72 H;  4WBN A;  4DK0 A;  2LW1 A;  3AG7 A;  1SQG A;  1LUW A;  5KX5 A;  5IWA B;  4GZR B;  2AZ0 A;  5LP6 A;  1XEQ A;  3K79 A;  3P32 A;  1TAE A;  2ITC C;  3HKE A;  1IXB A;  1VQ6 V;  1JCH A;  4X1I B;  5B1B C;  3CXH F;  1Q3E A;  4JI5 B;  3RW0 A;  3VQW A;  5K1P A;  4LF9 B;  1M90 W;  2F4V O;  2IJK A;  1Y76 A;  3IGA C;  1G4Y B;  3CD6 V;  2EBO A;  2RQ6 A;  3E8B A;  2HR3 A;  3D8C A;  4NR1 A;  3MAQ A;  2Y0P A;  2Q7H A;  1K9M W;  2Z0A A;  3CRQ A;  3K5L A;  3G4S V;  3SPI A;  2OIE A;  2RDC A;  4JI2 B;  4X1I A;  2Q7E A;  4I55 B;  1ZTE A;  4UCR A;  4B3S O;  5A9G A;  5KUM A;  3BCC H;  1MZF A;  4NXM B;  3H1I H;  3BVO A;  4UV9 A;  4FM1 A;  3ABK C;  4BAY A;  1SQQ H;  5JVD B;  1A32 A;  3U10 A;  4XBF A;  4MVS A;  3A8T A;  1PL4 A;  1PD3 A;  4I55 A;  1FKA O;  1R6T A;  2VQE B;  2IJJ A;  2LFS A;  2DE0 X;  3A0B Z;  3BFR A;  1IVS A;  1H2S B;  5BZB A;  2QM4 A;  3CC4 V;  4Q20 A;  1HR0 B;  3CP1 A;  4LC1 A;  3CRM A;  3CCJ V;  4ZHQ A;  3H1J H;  4LFA O;  4CH3 A;  1H8E G;  3HPL C;  2PYJ A;  4FLX A;  2IJH A;  2JGD A;  3QTC A;  5LGN A;  2UXD B;  2ZXW B;  1TUB B;  3OW2 U;  1I94 B;  1JJO A;  2P6J A;  1XBL A;  4UCT A;  2NR5 A;  1PP9 H;  1HW7 A;  4F6R B;  4NXN O;  2W6J G;  4UVC A;  3ASO B;  4U7O A;  4PI2 A;  2WLI A;  2ZNI A;  3OAA G;  5L3B A;  1JVM A;  4DYL A;  2Q0O C;  4YIP A;  2BOB C;  3K5M A;  1X4T A;  1EFR G;  2ZR2 A;  4FLT A;  1NTM H;  3F7V C;  4R6Z A;  3DTU B;  2Q7G A;  3M8A A;  1FXK B;  2OTJ V;  1Q43 A;  3FB6 C;  4F6R A;  4X1Y B;  1M4U A;  3ASN C;  4JI4 B;  4UXN A;  4WFB V;  2ZNJ A;  5ITZ B;  1XNQ O;  4BWA A;  1N36 B;  2F66 C;  3D3Q A;  4LF7 O;  2VS0 A;  3APO A;  2CTR A;  4HYO A;  5J9P C;  4NTW A;  5LMU B;  4K0K B;  1FXK A;  1NZ6 A;  1R6N A;  4X1Y A;  2QWQ B;  1PM9 A;  3VOU A;  4YJ2 B;  5D5Q A;  1X59 A;  4LBE C;  2IH1 C;  2HG5 C;  2XT9 A;  4FMT A;  5L3E A;  5LHG A;  1YZB A;  2EIJ C;  1VQ5 V;  1NU1 H;  3FAV B;  5JQG A;  4J7J A;  4RO2 A;  1NT2 B;  4DV1 B;  4H0L B;  5ITZ A;  1XNR B;  1VQL V;  2YXY A;  2YI8 A;  3EVK A;  4IL6 Z;  2EIL C;  2OCH A;  1O9H A;  3CS5 A;  1V9P A;  3ZIA G;  1K7D A;  1NVP D;  1FXH A;  4OGQ B;  2ADQ B;  4QPK A;  4YJ2 A;  2R70 A;  1AVM A;  2Q6A A;  4OX9 O;  3AG4 C;  3FAV A;  5KMG B;  5EIB C;  3K3W A;  4F4L A;  1WB7 A;  4J9Z B;  5KHJ A;  2H94 A;  1NTK H;  1N0J A;  3N27 A;  1BT8 A;  3JAR B;  1ZSP A;  5EC1 C;  2Q0A A;  3I56 V;  3ZBH A;  3OTO O;  5EIB D;  1M57 C;  4X9Q A;  1QHT A;  3ZCC A;  4DUY B;  3IFX A;  5J2U B;  2DMX A;  2AZ2 A;  2X6B A;  5IYC O;  5KMG A;  1QR8 A;  1F4M A;  1YJN V;  1S5H C;  4LWS A;  3OGC C;  2L35 A;  3B8N A;  3JAR A;  4X65 O;  1JQ0 A;  2A0L A;  4I50 A;  2XAQ A;  4F6E A;  3CHX A;  2UXB B;  3WU2 Z;  5IYZ B;  2WA4 A;  3OFN G;  4LCU C;  3LSS A;  4BIZ A;  3UM7 A;  3ABL C;  1VEW A;  4X62 B;  3JD0 A;  4UCU A;  4UCS A;  5JJN B;  3U0Z A;  4UUJ C;  5J2U A;  1BCC H;  3OR6 C;  1J5E O;  1VAR A;  1LNQ A;  3MHH C;  5IJ9 B;  4TWK A;  2CUG A;  1GN3 A;  5JJJ B;  4J7Z A;  4PD4 F;  4CH4 A;  1F7Y A;  2EIK B;  4CC5 A;  1CEZ A;  2DW4 A;  1VQN V;  1Q7Y W;  4CS4 A;  2E74 B;  3ZMV A;  4FK5 C;  4JYC A;  1GO3 F;  1OCC B;  1XDC A;  3Q4H B;  1XHX A;  2A06 H;  2CAZ C;  3HB3 B;  4DRX B;  1S3J A;  2UUB O;  2D3O W;  4LF5 O;  3FYI B;  4ZKI A;  5IJ9 A;  2W0X A;  4UV8 A;  3DC5 A;  4DR6 O;  1M9N A;  1OCR B;  3ABM C;  2Y48 A;  1ZUQ A;  3L75 H;  4X8A A;  2EIN C;  4DR2 B;  4PDR A;  4ABM A;  4QNH B;  1K97 A;  1V54 B;  4J11 A;  4FM2 A;  5CA1 A;  3VQV A;  2Y4T A;  2WWW A;  4LF6 B;  3CRR A;  2HKO A;  1I5X A;  4ASU G;  1JPX A;  2O57 A;  3RYF A;  4DUZ O;  3QVN A;  2ADP A;  5B1B B;  2VWJ A;  4FLW A;  1R3L C;  1MA1 A;  4YY3 B;  1BZK A;  5EBW C;  5CA0 B;  1MG1 A;  4WFE A;  4MVO A;  2R9A A;  1Q6I A;  3D36 C;  1IDS A;  5FPO A;  5DN6 G;  3L73 H;  3K04 A;  4TQF A;  5FLX N;  4UB6 Z;  4LF4 O;  1HNW O;  1THZ A;  3DGE A;  3L71 H;  2EIM C;  4DV6 B;  1GN6 A;  4P30 A;  3TGU H;  5E1A C;  4P9O A;  1KKC A;  3WG7 C;  3SYC A;  1HNX O;  3STZ C;  3TXQ A;  2F43 G;  5HFL A;  2VQF B;  2PI4 A;  4AQY O;  4B3T O;  4FJC C;  1CP9 A;  3B2E E;  1B04 A;  5CA0 A;  2BSK A;  3J81 N;  4H13 B;  3CCL V;  2KSD A;  3QF7 A;  4DR3 B;  2F93 B;  1NKD A;  2YIB D;  2QM8 A;  1US6 A;  3FX7 A;  2G38 A;  4H44 B;  5BXZ A;  3LUT B;  2JDI G;  4ICG A;  4JI3 B;  1S5L Z;  2P22 C;  1JMK C;  3H1K H;  3AK1 A;  2CTQ A;  4JI8 O;  4JI2 O;  1BHA A;  2YS8 A;  1Q8I A;  1SQX H;  5D5P A;  4PJ0 Z;  4NYK A;  4JI0 O;  3NXS A;  2FML A;  1N34 O;  4HZ3 A;  2EJ7 A;  3AG1 C;  3CCE V;  1S77 D;  1MSW D;  3ZED A;  1OHH G;  3K0D A;  3MHS C;  1KU9 A;  4DV7 O;  2Q9L A;  2QKC A;  2WLL A;  3J7A U;  1FS0 G;  1I0H A;  3LDC A;  1KBH A;  4GT1 A;  3A0R A;  3HKC A;  5KAF Z;  2XAS A;  3LNN A;  4L87 A;  2PZS A;  3PN1 A;  3SYO A;  2W0F C;  1FYJ A;  2OCC C;  3WB1 A;  1MSD A;  4LFB B;  4RUE A; 
#chains in the Genus database with same CATH homology
 3EHB B;  2HLD G;  3JD2 A;  4XDJ A;  1YHQ V;  5EBL C;  1K3E A;  2OTL V;  4XBF A;  4MVS A;  2DQ3 A;  3OR7 C;  1Y4M A;  5KA6 A;  4JPR A;  5IYB O;  5L3D A;  1W2B U;  1K33 A;  1PD3 A;  2H8P C;  4MTF A;  1GM9 A;  4JYB A;  1BHB A;  4MVM A;  4MT8 A;  2IJJ A;  2Y69 B;  4PA4 A;  3AG1 B;  1ROP A;  4LP8 A;  1DF4 A;  3OEH G;  1XL6 A;  3OEE G;  2LFS A;  3OM3 B;  4I9W A;  3T4Z A;  2YSU B;  3JD3 A;  1OZ0 A;  3AEI A;  3ASN B;  3ABU A;  3AG2 B;  5LGT A;  5BZB A;  4UVA A;  4MTX A;  5B1A C;  3CC4 V;  2IU0 A;  4Q20 A;  5KA5 A;  3CP1 A;  4CBC A;  4LC1 A;  5B1O A;  3CCJ V;  1IXM A;  2V7Q G;  1H8H G;  1H8E G;  3HPL C;  4I5S A;  3ZN0 A;  3M99 B;  2IJH A;  2QE7 G;  5LHH A;  1JOY A;  4MVZ A;  4MTO A;  5LGN A;  4WCE V;  2JJ2 G;  2KB1 A;  2ZXW B;  2IW5 A;  2DWE C;  3JYC A;  4XDL A;  1K4D C;  3OW2 U;  1JX9 A;  3E89 A;  3SPG A;  3ABK B;  1K8A W;  1WLE A;  2P6J A;  5CA3 A;  2EIJ B;  1R3K C;  4QIW F;  1VQ9 V;  1ENV A;  3W7T A;  4JTA B;  1DLB A;  2W6J G;  4UVC A;  2YEV B;  3ASO B;  4U7O A;  2WLI A;  2DWD C;  3OAA G;  3OE7 G;  5L3B A;  1VQO V;  1NBM G;  3IC7 A;  2WLL B;  1JVM A;  4DXW A;  1RM1 B;  3FB7 C;  4RAI A;  3CC7 V;  2GHY A;  3RVZ A;  2QEX V;  4RUF A;  2BOB C;  4P2Z A;  5CN0 A;  1EFR G;  2ZR2 A;  1MAB G;  2XAJ A;  3ZJZ A;  3ZRX A;  2WAM A;  3F7V C;  3DTU B;  4R6Z A;  1K5Q A;  4WFA V;  5B1A B;  2LFR A;  5C93 A;  3E83 A;  2Y69 C;  4FIP C;  3AG4 B;  5L3F A;  1AI4 A;  4WF9 V;  1N8R W;  1FXK B;  2OTJ V;  1QR9 A;  3FB6 C;  1YJW V;  1KD1 W;  3G71 V;  2YEV A;  3ASN C;  3ML0 A;  3AG2 C;  3FB5 C;  4UXN A;  1SZT A;  3JD4 A;  4OXS A;  4WFB V;  3JD1 A;  5FL7 G;  4PA3 A;  3ETE A;  2JEX A;  2W6I G;  4RQE A;  2X6A A;  1V55 B;  1I5Y A;  3SPH A;  1VQ8 V;  2HFE C;  3OMN B;  4HYO A;  5J9P C;  3SJQ C;  4R8C A;  3LDE A;  3QO5 A;  5B1N A;  3F7Y C;  2ZXW C;  2JK5 C;  1OCO C;  1FXK A;  4E2L A;  1M1K W;  1R6N A;  5LGU A;  3VOU A;  2JEU A;  1COW G;  4LBE C;  2IH1 C;  4MS2 A;  2HG5 C;  1VQ5 V;  4FMT A;  5L3E A;  1DTO A;  2EIJ C;  5LHG A;  3F5W C;  3CPW U;  1W0K G;  3SYQ A;  2MK3 A;  4RO2 A;  2ITD C;  3R65 A;  1JJ2 U;  3RBZ A;  2PI5 A;  1SER A;  1R3I C;  4QJF B;  3MD0 A;  4FPP A;  1B6Q A;  1YIJ V;  3ASO C;  3JCZ A;  1VQL V;  3T1C A;  1QLE B;  1AI5 A;  4TT3 G;  1XL4 A;  2HJF C;  2EIL C;  1RM1 C;  1RPR A;  1BMF G;  2WLJ A;  3AG3 B;  2DQ0 A;  3E35 A;  3ZIA G;  1K7D A;  3CCM V;  1NVP D;  3T4D A;  3FB8 C;  1FXH A;  2XAH A;  4QPK A;  1AJN A;  2Q6A A;  3AG4 C;  3OUS A;  2P67 A;  3W7X A;  1S72 V;  2NLJ C;  1DF5 A;  1FXK C;  5H9C A;  2EJR A;  1AJQ A;  3K3W A;  4F4L A;  3ZRV A;  4J9Z B;  1YI2 V;  2WLI B;  1QLN A;  2H94 A;  3LSQ A;  3G6E V;  1E1R G;  4J9Y B;  3ZMU A;  2Q67 A;  1KQS U;  4JTC B;  5EC1 C;  2B5U A;  3TCU A;  4U7N A;  1VQ7 V;  2Q69 A;  3I56 V;  4PDM A;  2GSM B;  1TUE B;  2R9I A;  1NR1 A;  5LBQ A;  1OCO B;  2P7T C;  5HFM A;  1YSC A;  1K92 A;  1VQ4 V;  3CXC U;  2WLK A;  2BOC C;  1M57 C;  1V55 C;  1BL8 A;  1PNK A;  2FTK A;  4MVQ A;  1NQT A;  3OMI B;  2ZQM A;  4MVU A;  4KUM A;  3ZCC A;  1SET A;  2AHZ A;  3IFX A;  1QVF U;  5H6R A;  2NNU A;  2X6B A;  5IYC O;  3B77 A;  4YXW G;  1NVP B;  2EIN B;  1QR8 A;  4PA9 A;  4QE9 A;  1F4M A;  1F51 A;  1YJN V;  1KEC A;  3OMA B;  1S5H C;  4R7C A;  5IYD O;  3OGC C;  4GX0 A;  2EIL B;  1P7B A;  3B8N A;  1KP3 A;  1QCE A;  4MVR A;  3SYP A;  2LP7 A;  1JQ0 A;  3LNM B;  2A0L A;  2X0L A;  5CBF A;  2XAQ A;  3CC2 V;  2WLN A;  3OFN G;  4LCU C;  1WPX A;  2EZO A;  1GM8 A;  2IJI A;  3LSS A;  3STL C;  1QLE C;  2R9R B;  3UM7 A;  2IU3 A;  4BIZ A;  4N21 A;  3ABL C;  4PA7 A;  3CCR V;  3JD0 A;  3ZRS A;  4R50 A;  5LHI A;  1YTF D;  4QE7 A;  3CYO A;  4JGS A;  4UUJ C;  4QPJ A;  1M56 C;  1ZWI C;  3AG3 C;  3OR6 C;  2Z3Y A;  4JF3 A;  5CBH A;  1J95 A;  1R73 A;  1LNQ A;  3MHH C;  4G28 B;  1GTO A;  5CBG A;  2HVJ C;  4TWK A;  4JAV A;  2EIK B;  2AHY A;  1CEZ A;  4GX1 A;  2DW4 A;  1QBZ A;  3P30 A;  4GX5 A;  4X89 A;  1Q7Y W;  1VQN V;  2Q68 A;  3LDD A;  3ZMV A;  4FK5 C;  3E2E A;  2ZD9 A;  2K1E A;  4JYC A;  4DO2 A;  1GO3 F;  1OCC B;  1M57 B;  2QM7 A;  4MTG A;  5EC2 C;  3EFF K;  2EIM B;  4WFH A;  1CPY A;  3K03 A;  3CCV V;  1KC8 W;  2UXX A;  3TK1 A;  4P9P A;  3HB3 B;  3OUF A;  1S3J A;  3K9A A;  2D3O W;  3K08 A;  3SPJ A;  5B3S B;  3CCS V;  3FYI B;  4ZKI A;  1YTF B;  1NR7 A;  4UV8 A;  4CZZ A;  1M9N A;  3BY6 A;  1RPO A;  1OCR B;  3ABM C;  2Y48 A;  1P4R A;  1YJ9 V;  1S76 D;  3TET A;  3D36 A;  4X8A A;  1YIT V;  1G8M A;  2EIN C;  2QKS A;  4PDR A;  1R6K A;  2P90 A;  4QNH B;  1K97 A;  1V54 B;  2QA4 V;  3ABL B;  1PNL A;  3CMA V;  3CCQ V;  5IY5 C;  3ZMT A;  5CMU A;  3W7U A;  2WWW A;  1FFT B;  1L1F A;  3X2Q B;  4BW5 A;  4MW8 A;  1M56 B;  2UXN A;  2A9H A;  4N23 A;  2Z5U A;  2HKO A;  1I5X A;  1KKD A;  4ASU G;  2WSS G;  1JPX A;  3QO8 A;  3ZMS A;  4HAM A;  5EBM C;  3H01 A;  4PDL A;  1K34 A;  1H2G A;  4X88 A;  1AJP A;  3UKM A;  3B8M A;  5L3G A;  5B1B B;  3SPC A;  2EZP A;  3ZRW B;  1R3L C;  1E1Q G;  3VBB A;  3GWO A;  3ABT A;  2ZDI A;  3ZN1 A;  1SES A;  1NH2 D;  1W0J G;  2DYS B;  5EBW C;  1KP2 A;  1VQK V;  1MG1 A;  1NJI W;  2EIK C;  3ZMZ A;  2X6C A;  1GKF A;  4MVO A;  4WFE A;  1ARO P;  4KFM A;  3K0G A;  4ZBM A;  2WPD G;  3QNE A;  3RVY A;  5DN6 G;  4MSW C;  1AI7 A;  2M7W A;  3K04 A;  4UVB A;  3BEH A;  2WLH A;  5IDJ A;  2XOK G;  4JAU A;  1GM7 A;  1OCC C;  2B1G A;  1THZ A;  3DGE A;  3K06 A;  1VQM V;  2EIM C;  1EZJ A;  1HWY A;  4EKW A;  1FXV A;  4P30 A;  3CCU V;  5E1A C;  3CME V;  4MW3 A;  4P9O A;  5KUK A;  3ABM B;  3FKS G;  3E8G A;  2XND G;  1PKX A;  3E86 A;  3SYC A;  3WG7 C;  4KP4 A;  2JIZ G;  5H6Q A;  4G27 B;  3STZ C;  3ZRW A;  2F43 G;  5HFL A;  2ZR3 A;  2PI4 A;  5B3S C;  1AI6 A;  1GMG A;  4FJC C;  1Q82 W;  1CP9 A;  1EBO A;  2DYR B;  4Z1M G;  5IY5 B;  1VQP V;  2OCC B;  4PDV A;  1OCR C;  2CK3 G;  1ORQ C;  4TSF G;  1OCZ B;  3W7S A;  5DM6 V;  3W7W A;  3CCL V;  2ZDI C;  3KG2 A;  4WFF A;  2C2A A;  1NH2 B;  1PNM A;  1K5S A;  3D3I A;  1NKD A;  1V54 C;  2QM8 A;  5GW7 A;  4H33 A;  4RQF A;  3WFV A;  3E8F A;  3X2Q C;  1K73 W;  3LUT B;  2JDI G;  1E79 G;  2A79 B;  4WFG A;  4GCZ A;  3K79 A;  3P32 A;  2ITC C;  1F4N A;  1SRY A;  2X7R B;  4H37 A;  2ATK C;  1AR1 B;  3ETD A;  1BHA A;  1VQ6 V;  1R3J C;  1JCH A;  4PEL A;  5B1B C;  3SYA A;  1S0V A;  3RW0 A;  3NXS A;  4HZ3 A;  1QVG U;  3AG1 C;  1M90 W;  1H38 A;  1F23 A;  2DYS C;  3CCE V;  3T2M A;  2B1I A;  1S77 D;  2IJK A;  4GX2 A;  3IGA C;  4G2K A;  1PL0 A;  2HVK C;  1OHH G;  1G4Y B;  3PJS K;  3CD6 V;  2EBO A;  1MSW D;  3K0D A;  4JTD B;  2XAG A;  1K4C C;  4BIU A;  3E8H A;  3WG7 B;  3MHS C;  3E8B A;  3QO7 A;  2HR3 A;  1Y66 A;  1Q86 W;  2WLL A;  2WLM A;  4JAS A;  1FS0 G;  3LDC A;  2OT5 A;  3GB7 C;  2IH3 C;  4GT1 A;  2V1D A;  1K9M W;  3A0R A;  3G4S V;  3SPI A;  1MOF A;  2XAF A;  3FYE B;  2XAS A;  4L87 A;  5L3C A;  3SYO A;  5KUM A;  2W0F C;  2DYR C;  4XDK A;  3I55 V;  2OCC C;  4PA6 A;  4UV9 A;  1OCZ C;  2QTO A;  1Q81 W;  2JJ1 G;  3ETG A;  1UJW B;  5EK0 A;  1GK9 A;  3ABK C;  4BAY A;  4RUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...