1NH2B

Crystal structure of a yeast tfiia/tbp/dna complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
46
structure length
46
Chain Sequence
NAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*GP*TP*AP*(5IU)P*GP*TP*AP*TP*AP*(5IU)P*AP*AP*AP*AP*C
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2002-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nh2B00
3W7SA 3D3IA 5CA3A 2P90A 3W7UA 1YTFB 1RM1C 1S3JA 3BY6A 3W7XA 3W7TA 4HAMA 5GW7A 2HR3A 1NH2B 3IC7A 3E35A 2WAMA 1NVPB 3W7WA
chains in the Genus database with same CATH superfamily
3ZHUA 1XQ8A 3JD1A 3ETGA 2QDOA 3BRCA 2EIMB 3CX5F 5GW7A 1HNXB 5E1AC 3HKEB 5KHIA 1H2NA 3VOUA 1I5YA 3JD2A 5IYBO 3ICXA 4I7ZB 3HPLC 4ZBMA 1K4DC 5EBMC 5A9GA 1AR5A 1WPXA 1OCOB 4DUZO 1IBKB 1Y74A 4F6RA 1WP7A 4DR1B 4U3FH 3CRMA 5IJ9B 2HR3A 4H0LB 3ZRWB 1O9GA 3ZBHA 2YIAA 1S5HC 2QM8A 2OTJV 2GHYA 1YJ9V 2HFEC 4GX2A 4ZHQB 4AQYO 1ZLZA 2NNUA 1NJIW 4CH4A 1BQ0A 2F66C 1QBZA 2GTSA 2ADPA 2AXTZ 2D3OW 1XNQB 1ZWIC 1PP9H 4DV6O 2YXYA 4UCSA 4B08A 2Q6AA 3ABUA 3ML0A 4PDMA 4TOIA 1JJ2U 4FLXA 2EJ7A 3CMAV 4DK0A 3SPGA 4PI0A 3BY6A 2IU3A 2WLLB 4FJCC 4I4TA 1NU1H 1YTFD 5FNVB 2F4VB 1SESA 5B1BB 4FLVA 2ZT9B 1HW7A 3P32A 4LNUA 3SYOA 1XI1A 4X1KA 1AVMA 1SQBH 5BMVB 4FLUA 3SJQC 4OX9B 2KSDA 2WLKA 5JVDB 3CCVV 2F23A 4EFEA 1K8AW 1N33O 5D5PA 5BY1A 3SR2C 3AG1B 3LSQA 3N2GA 4TV9B 4TUYB 2ITDC 2V4DA 2OTLV 3OTOO 1QLEB 1DGSA 3HKCB 4LF5B 4B7KA 2UUBB 2VQFB 2AW9A 1K7DA 2EBOA 4DR2B 4YJ2B 2EZPA 1VEWA 1TA8A 3K58A 4DR4B 5JJNB 1HNZB 2LQTA 4FLWA 4G27B 1SQFA 3ABMC 3UQ8A 2UUCB 4DR6O 3OAAG 3SJBC 3TGUH 4PD4F 1L1FA 3ZRSA 2ZM6O 2IH1C 1CP9A 4JAVA 4Z2WA 4FPPA 3BA9A 5IDJA 3ZJZA 5CBFA 5EZYB 1IX9A 4CS3A 2GSMB 3UM7A 4D7TA 5DECA 3P30A 3JATB 1E1QG 2DWEC 2E5LB 4GX1A 5LXTB 2Y48A 2IH3C 3K0DA 4X66O 4FFBB 4BWAA 5IYZA 1VQLV 4P2ZA 1F51A 5JCOC 2LW7A 4DRXB 3I56V 3K5OA 1S0VA 1VMGA 4ZOLB 1Q3EA 4QIWF 4DV2O 4HNAB 2XNDG 2CTRA 4OPHA 1GKFA 1PNKA 2CTQA 4O2BA 4UVBA 1XMQO 4R8CA 4WFFA 1RP3B 1PNLA 4LR3A 4LF6B 2M7WA 3ZX6A 4EFBA 1AI5A 5EIBD 3TK1A 5GONB 4P30A 1JR9A 2R9RB 2Y4TA 3AK2A 4WFHA 4DV7B 5L3BA 5KAFZ 4C7UA 2UXDB 4O4HB 3VQXA 1YHQV 1K9MW 4GKJB 1RSOA 1K5SA 3ZMVA 1IZ3A 3C3TA 3X2QC 3SGIA 1R3KC 3E83A 2UXCO 2LW1A 3QG5A 3AG4C 3H01A 3L72H 5B1BC 1NTKH 1YI2V 1FXKB 2PYLA 4CH6A 2ILMA 1Q8IA 4QPKA 1H2MA 3FB6C 3K9SA 3CD6V 4MW3A 4PV1B 4PA4A 1YXBA 4NXMB 4KL1A 3SPCA 4IL6Z 1KMIZ 3K06A 1HNWO 1TGOA 1TUBB 4FMTA 2VWKA 1R3IC 1M56C 2P67A 5IY5C 1NBMG 1NTZH 5BR8O 2GUZB 2R9AA 4TT3G 1XMOO 4DR6B 5LP6B 1VF5B 1VF6C 1V54B 3BPZA 4EB6B 2HHHO 3E22B 1I94O 1JOYA 2KB1A 3RYCB 5B5EZ 4X1YA 5JQGA 4X8AA 4UB6Z 1XUQA 1DF4A 1BGYH 2BOCC 1MSWD 2AZ0A 3F7YC 2W0XA 1SQGA 3UCSC 2L6LA 2YI9A 1KU9A 1COWG 2G38A 4DW1A 4TSFG 4HYOA 1B6QA 2JEUA 4KHPB 3KG2A 1FXVA 2OT5A 1OCRB 2WLHA 3AG2C 4LFCB 3RGBA 2BCCH 4X66B 2HVJC 2RCVA 1GN3A 1R6NA 5AG2A 3SJAC 3F7VC 1YVWA 1M57B 3BFRA 1JPXA 2Z0AA 5EIBC 3A0BZ 2B9ZA 1XHZA 5KUKA 4XDLA 3RW0A 1NR1A 3F5TA 5DM6V 5K1XA 2A79B 1SC5B 3JARB 3E35A 1ZUQA 4RAIA 1NQTA 2OCCC 3TXQA 1RPOA 2DJVA 3ABLC 5KMGA 4JI2O 1VQ5V 2JVDA 3HKDA 2K9PA 1J5EO 1K97A 2ZE7A 3JD3A 2EZOA 4PELA 3D36C 5FLXN 3B4SA 5L3EA 2QKAA 2UXCB 2IJKA 4WCEV 3J7AU 1SKVA 3W7WA 1Y67A 2CH7A 1PL4A 3K79A 4NTXA 3QTCA 3CJHA 2YIDA 2ZQMA 2IM9A 4R6ZA 4J7JA 2VQEO 3AG7A 2EIJC 3A0RA 4JZGA 5LOVA 4JF3A 3O9OA 1Q43A 4JAUA 2XAFA 2GTAA 2H3OA 1S76D 2VWJA 3ZMUA 4LF9B 4F6EA 5BR8B 5A2QN 3K5NA 1TVKA 3JASA 4MTGA 1QNMA 3Q4HA 3GWOA 5KLVH 4YJ3A 3T1YO 4GX0A 5LA6A 3HKBB 2ZE8A 3JAWB 2JS3A 4JI1O 2H8PC 2WAMA 3VQVA 1FS0G 1N0NA 1BT8A 1OZ0A 4O4IA 1THZA 2N74A 3BAAA 1KP2A 1NR7A 3D3IA 4FIPC 4L87A 1WLEA 1EZJA 4UVAA 4JYYA 2ZIMA 1EM1A 1S5JA 5KX5B 1O9HA 4UV8A 3AG3C 1EBOA 4JI8B 2QR4A 3S3XA 1AI6A 3DTUB 4CS4A 1QU7A 1Y76B 1Q6UA 1US6A 3L75H 3RFRA 2ZINA 2XAHA 1OCZC 3RYHA 3TXSA 3JCUZ 4LWSA 3H1KH 1GM8A 2ZXWC 2ZDIA 2E3CA 1X4TA 1URFA 4Q20A 3QVNA 1JQ0A 3UO3A 4JI3O 2V1DA 4FM2A 2BSKA 3VBBA 2MW2B 3K5MA 4DV4B 3JSNA 5D5QA 3CCUV 4X62B 1ENVA 3CRAA 4B3SO 3B8NA 1IBLB 3CXHF 4JTAB 4YHHO 5C8YB 4TV8B 1J5EB 2EIKC 4DV3O 1CEZA 4DR3O 1GMGA 1KB9F 3ZCCA 4K35A 3ZS8C 1D5AA 2LO1A 3GVMA 3LUTB 1SZXA 3ABMB 4JI0O 4JYCA 4UCOA 1W0JG 5KAIZ 1UJWB 4DR5O 4FM0A 1MG1A 3G6BA 4X1YB 4WBNB 5LMNB 1BS3A 4FK5C 4NYKA 5E79Z 1FFXA 1KD1W 2P6JA 4MTOA 1VQNV 2DQ0A 4LFAO 1NT2B 1L0NH 2RDCA 1H8EG 1F7YA 1WJZA 3CC4V 1XNRO 2XAGA 3HB3B 3UKMA 3DSQA 1F4MA 3CC2V 5J2TB 3OW2U 2OCHA 3FB8C 4NB5A 2UU9O 3MHHC 5LGUA 3T1YB 4LFBO 4YY3O 2DQ3A 5LHIA 1KP3A 2P90A 3E8FA 2P06A 3FX7A 2AGAA 3K5LA 1K92A 1N32B 1I0HA 4KXRA 4MVSA 2FTKA 3KKYA 5B1AC 4BIUA 3NR7A 2JDIG 2DWDC 4IIJA 4PA7A 3ASOC 1BE3H 2JJ2G 4GKKO 4DV1O 1GO3F 1YTFB 4FLYA 3K04A 3CYOA 3N2KA 5CA0A 2YXLA 1QQCA 1JVMA 3ASNC 4J9ZB 4ZI7A 3P3PA 4O4LB 4JI5O 1H38A 2IJIA 1IBMB 3K9AA 4O2AA 1R6KA 3MHSC 4I0XB 3KCYA 5CMUA 3X2QB 3I55V 2ODMA 2YSUB 2HG5C 3FAVA 3A2FA 1SQPH 3FD9A 2C2AA 3AG4B 5CBHA 1GN6A 1K4CC 4JTCB 3FB7C 4DO2A 2B5UA 4B3SB 2QWQB 1K3EA 1VP7A 2RMKB 5K1PA 1BQZA 1D2DA 5LYJB 1XILA 2P5OA 2HP8A 2Q7EA 4N23A 4BW5A 3TJTA 2WLNA 1BHAA 5JJJB 1VQ6V 3OT7A 1ZL8A 3U11A 5KUMA 2IU0A 1EN5A 1E79G 2K1EA 1M56B 3L73H 5IY5B 1KQSU 2JJ1G 2Q7HA 4W4KA 4Z1MG 4IHJA 4CC5A 2UUAO 4FZ0A 1IDSA 5EC2C 3ABTA 4JI6B 3E8GA 1MABG 3JALA 1VIBA 4XDJA 1HDJA 3ETQA 1R3LC 4JYAO 1JFFA 1A32A 2LFSA 4L8JA 4LFAB 3SYPA 4WFAV 3SDLA 3ZHSA 2R9IA 3RYFA 2QM7A 4CZZA 1V55C 4FM1A 2QWOB 3D8CA 4CC6A 1M9NA 5CB4B 5CA1A 3UT5B 4RWUA 2PYJA 4LFBB 3E8BA 2DW4A 3AG2B 2BE3A 4J10A 4R50A 3MAQA 2WWWA 1G4YB 2FL4A 5LHGA 5ITZA 1Q90D 3N27A 3RVYA 4DUZB 3G4SV 1K73W 3T1HO 3K0GA 5EYPB 4DUYO 4R7CA 1DF5A 1QR8A 4JI7O 5GTIZ 2B1IA 3MD0A 3WB1A 4AQYB 4DV1B 2ZD9A 3WFVA 4ABMA 4X1IB 5H2FZ 1L8DA 3SPHA 1WPBA 4UUJC 4DV6B 3ZMTA 3IC9A 3T1CA 2OCCB 4I55A 3OM3B 3ABLB 3LNNA 3M7MX 4FLZA 2Y0IA 5LMUO 1WA8A 4H13B 1Q6HA 2YDEA 4B3TO 1SRYA 3B2EE 4K0KO 2RJZA 3QO7A 1FYJA 4O4JB 5TISZ 5JH7B 2W0FC 4A5UB 4UVCA 3CRQA 2ZCEA 3PN1A 1T5EA 3I5DA 2FB5A 1I08A 2CE4A 2F1MA 4KFMA 4U3JB 1XEQA 2IJHA 4JI4O 1NZ6A 3M8AA 3CCQV 1XDCA 4K8ZA 2EIJB 2RNBA 2DOSA 2EILB 1VQ4V 2N05A 2P7TC 2DYRC 1N33B 3ABKC 2XOKG 1EFRG 4P9OA 1SERA 1G1XB 3OTOB 3WG7C 5KA5A 2F95B 4WF9V 3ZHVA 3DXRA 2YC0A 1FPOA 2Q67A 1QHTA 4PJ0Z 2WLIA 2YIBA 1OCCB 4DR7O 3O65A 4FLTA 2Q0AA 2KG7A 3ZRVA 1JJOA 1Y74B 2DN9A 2KQXA 5EK0A 3CP1A 4F6RB 1YJNV 3WU2Z 1RPRA 3ZHRA 1RFYA 1EZVH 1SA0A 1YZBA 4IIJB 2A0LA 4LCUC 4CS2A 1Y6XA 1XHXA 4TWKA 1M5IA 2FKXA 2WLMA 1P4RA 3AG3B 5IJ0A 1ZSPA 2BTQA 2ZM6B 3OUSA 5CBGA 2IBZH 4J42A 2ZR3A 3E89A 3BA8A 2OIGA 2E76B 1SS3A 1NKDA 2DYSC 1OCZB 4RUFA 2HJFC 3K3WA 1IXBA 2ZXWB 2B1GA 1AJPA 2ZE5A 4TQFA 2YEVA 4X20A 3HR0A 4DUYB 2JRIA 4JYBA 2QEXV 3A8TA 2ZDIC 4I50A 2Q69A 4I4TB 1AR1B 2L35A 3B77A 3LDEA 2R70A 3RYIA 4LNUB 2ZIOA 4X1KB 4DV2B 1PNMA 3UO2A 4UXNA 2W6JG 2QWRB 4YIOA 3HKEA 3F5WC 2OIEA 2KKWA 4GCZA 1K33A 4WFGA 2A3QA 1ZL8B 3L71H 4RQFA 1XMQB 1PPJH 1I5XA 3N2GB 2EIKB 2E74B 2UXBO 4JASA 4ASUG 1WP8A 1X59A 3L70H 5IJ9A 4IYHA 2CGOA 3ZRWA 5IYDO 5IWAO 4U7OA 1HR0O 2CTWA 2VRZA 4ZHQA 3K03A 2JIZG 3JSLA 2WLJA 4JI4B 3FYEB 2CDYA 1JFFB 3SYAA 1IVSA 2X6BA 1XBLA 3EFFK 4NVPA 1VQPV 1MSDA 1YCIA 4HAMA 3T4DA 4X64O 2EILC 1KUQA 5DN6G 1M1KW 1HNWB 1K5QA 2A06H 1AB3A 4CBCA 1BHBA 3CE2A 5CN0A 4PI2A 4NXNO 4GLXA 2WLLA 4MS2A 3ZIAG 3RVZA 2WA4A 3TETA 1XMOB 3ZHTA 1OCCC 2Q8VA 4X9QA 1AJQA 2QTSA 5B1AB 4BIOA 5IYZB 5BMVA 1VQ8V 2HHHB 4XBFA 3CC7V 4PA3A 5JVDA 1I94B 3OE7G 4E4EA 3ASOB 5LGTA 3OGIB 1UFIA 1FKAO 3ZHQA 4KP4A 1F23A 4O2BB 4J9YB 4AILC 4TV9A 3CXCU 3GWKC 2OYQA 4I9WA 3HKCA 2QWNB 2Z5UA 3ASNB 2PY5A 5HFLA 4X89A 2ITCC 4YJ2A 4H33A 4DR1O 4PDVA 2PF4E 3E86A 4DXWA 1NVPD 1SF9A 2CUGA 1RM1C 1RSOB 4OPAA 5BZBA 1SZTA 1YSCA 4HZ3A 1ORQC 1IURA 4IGGA 2AHZA 1QR9A 1R3JC 4RO2A 2RQ6A 3NXSA 4UCTA 3CEIA 2AHYA 2HLDG 2JEXA 5KHKA 2QA4V 3C3SA 1Q5OA 2QM4A 5KHJA 3KZIZ 1B04A 4GUNA 4RUEA 3SPIA 1GK9A 2O57A 1P49A 4OXSA 4MVMA 3OMNB 2UXBB 1AP5A 1QCEA 4NR1A 4CH5A 4B3MO 1MA1A 5EZYA 2WLIB 4JI2B 1YIJV 4K8XA 4ZKIA 2YICA 2NN4A 2XAQA 2Z3YA 1PD3A 3JATA 4LBEC 2ETNA 5LXTA 3DC5A 2IJJA 4QGPA 2F4VO 1MMMA 3J80N 4FFBA 1Q7YW 1FJGO 4DRXA 4X65O 1S3JA 1PV0A 3IAYA 3STZC 3TCUA 4HNAA 2EINC 2Y69C 2ZE6A 4OX9O 4LF7O 2BTOA 5F2VO 3T2MA 4MVZA 3G80A 1GN4A 2VQEB 3JD4A 5JQGB 4X64B 4CH3A 1V55B 1KYOF 1P84F 4BAYA 3B8MA 2X6CA 2P22C 1WNSA 3QO5A 5GONA 2UUBO 2EJRA 2Q68A 1P7BA 1Q86W 3OR7C 1M93A 4N21A 1WB8A 2YI8A 1DLBA 2VS0A 3WB2A 4DR4O 1FXHA 1UPGA 2XUMA 4O4HA 5JJEB 2FMLA 2F43G 5H5NA 2BOBC 5H6RA 2NLJC 1SQQH 3JAMN 2UUCO 3RYIB 4LC1A 4JI1B 4JTDB 5B1NA 1Q6IA 5H6QA 4U7NA 1NS1A 3RBZA 4GX5A 1FXKA 4LH6A 3W7TA 3M99B 2YS8A 4JV5O 1DTOA 1GRJA 4MTFA 1N0JA 1ZAUA 1N8RW 2HEPA 5B66Z 2ZNJA 3STLC 1TUBA 2Q73A 4B7EA 4H44B 1J95A 1W59A 1VARA 1AR4A 3VQWA 5KMGB 4J80A 3K59A 4WFBV 2DE0X 2GUZA 3CRRA 3HKDB 2JGUA 2E5LO 1M4UA 1N34O 5LP6A 3R66A 1QVGU 2H94A 1S5LZ 2JGDA 4PHZA 3L74H 1IXMA 4EB6A 4EEQA 4JI3B 1W2BU 2ARHA 3E22A 1I7FA 2CH7B 1BSMA 5EBWC 3RYCA 2W6IG 2HVKC 2A9HA 2QWPB 3CJHB 3B09A 5EC1C 2CGNA 4B3RO 2EULA 5L3GA 1FAFA 2DYRB 3ABKB 4JGSA 4B3MB 3JYCA 3CCJV 4HBNA 3E8HA 5LOVB 4LF6O 4GT1A 5L3FA 4YHHB 3ZEDA 4NTWA 4GYCB 3WG7B 4Z1VA 3EXAA 3CCRV 4DW0A 4DV3B 2QKCA 4DV7O 4DR3B 1TVKB 3JASB 2UXDO 4X88A 4GKJO 1FJGB 4P9PA 4X65B 3Q4HB 1S77D 4YJ3B 4AHCA 2MK3A 1SQVH 2CTPA 5LA6B 4JI0B 1KC8W 4LF7B 4LP8A 4PA6A 3AK1A 3C90A 3K08A 4IYIA 4DR5B 1XREA 1M90W 3OEHG 4O4IB 1YF2A 1CPYA 4LF8O 3JARA 4D6TH 4NXMO 1R1BA 2QGNA 3CMEV 2FYUH 3IC7A 1PL0A 3JCZA 1XNRB 2DYSB 1E1RG 1U97A 5J2UA 1AROP 1SQXH 3ZMSA 4BIZA 2YUAA 3WB0A 1XL4A 2V7QG 3P3NA 3RYHB 4DV0O 2UU9B 3APOA 4LWSB 3L9DA 2IW5A 1R6TA 4YY3B 1GM9A 5B3SC 2WA3A 1HWYA 3H1LH 5GTHZ 1ZX3A 4NKGB 1GAXA 3OD4A 3IGAC 1Z5WA 1JX9A 2BSKB 3E2EA 3AEIA 1N36O 3U10A 1G6UA 4JV5B 3EVKA 5B1OA 2LP7A 4G2KA 4UFZA 4LH7A 2EIMC 1NI8A 3JD0A 3LSUA 4GKKB 5LBQA 1H2LA 3AK3A 2LGWA 2XASA 3FFQA 4K3AA 1KECA 1GH6A 3DC6A 2PUSA 4MTXA 4XDKA 4KHPO 4LFCO 4JI5B 1N34B 1OCOC 4UV9A 3OFNG 3ZMZA 3HKBA 1VQOV 3G6EV 3JAWA 4I9QA 5IE9A 2PI4A 4YXWG 4MVQA 4MW8A 3APQA 1TAEA 4AI8A 1LUVA 5EBLC 1AI7A 2Y0PA 4B3RB 1OV9A 5KX5A 1R73A 2RN9A 4MVUA 1F4NA 5LHHA 1Y76A 2QKSA 1FFXB 4W4LA 1QVFU 2N04A 5KHGA 1EN4A 3BCCH 1Q81W 3RT3C 1XOUA 2F93B 4GZRB 5J9PC 4FFKA 4YIPA 3OTFA 4DV5O 5CA3A 1KKCA 1XL6A 5KHHA 1AILA 1ZTEA 5C93A 2X0LA 3KCXA 5BXZA 1VQMV 3CSXA 2PI5A 2UUAB 3MDSA 4PA9A 1NH2B 3LSSA 1JMKC 4ICGA 4LF8B 4UCVA 4J7KA 3ETDA 3BEHA 2X7RB 4BR6A 5FPRA 1LR1A 1VQ7V 2CAZC 4JYAB 2XAJA 1D5NA 1LNQA 2M6YA 2CK3G 5C8YA 1G8MA 4TV8A 3AG1C 3B40A 4TQDA 3IFXA 4LF9O 4WFEA 3K57A 1QLEC 4QNHB 3N2KB 5CA0B 4LF4O 4DV0B 3RN4A 1S72V 2ZKOA 3RWRD 4ZI7B 3OEEG 2AZ2A 4UCRA 1NH2D 3T4ZA 2JGDB 2QSAA 3G71V 4O2AB 3SYCA 2LGQA 1RM1B 3W7XA 5LGNA 3T1HB 1H2KA 1N36B 2UXNA 4JI7B 4WBNA 1AI4A 3FAVB 2JK5C 3JAKA 2OWOA 1H8HG 1AP6A 3CHXA 2ZNIA 4JI8O 1N4CA 3ZRXA 2LFRA 3CCMV 2GV9A 3BVOA 2Q7GA 1B06A 3SJCC 2HJDA 3LNMB 5J2TA 2EX3A 2NR5A 1V9PA 3BABA 1JA8A 5LMUB 4QJFB 4B3TB 1Y66A 4PDLA 4E2LA 4K0KB 2ATKC 3CCSV 3A0HZ 3CWBH 1OJHA 1MZEA 3GB7C 5JWPA 1Z2GA 4JPRA 5JCOA 2Y4UA 1MZFA 2P4KA 4IHJB 4DV4O 5LL6Y 2EINB 1OHHG 2ADQB 1K34A 2Y69B 1W0KG 3D3QA 3S3WA 3THOA 4FVMA 4JAAA 1GTOA 4IT5A 1DK1A 1EN6A 4X62O 3JALB 3H1JH 4G28B 5HFMA 1IBLO 1QLNA 4J11A 1JCHA 3CS5A 3OMIB 3RYFB 5J2UB 4J41A 5IYCO 3H9VA 5DEDA 2D2CB 4O4LA 5CA1B 4DV5B 2YXHA 2P4VA 3EHBB 3SPJA 3BHPA 4I0XA 1Z5VA 4BW9A 1GM7A 3FB5C 4NTYA 4QE7A 3QO8A 4MSWC 3J81N 4DR7B 4I5SA 1PKXA 3H1IH 5ITZB 4UB8Z 2XHBA 5L3DA 3R65A 1Q82W 3LDDA 3CCEV 3CB2A 3VQYA 5FNVA 3OGCC 3ZN1A 2Q9LA 5H9CA 2XTAA 5FPOA 1SETA 1WAZA 5LMNO 4QPJA 1FXKC 1MOFA 3PJSK 1ROPA 5LYJA 5IT9N 4ZIBA 3DGEA 1H2GA 1NVPB 3FKSG 3W7SA 2WPDG 4LF4B 1HNXO 1VQKV 4MT8A 4I55B 2A7WA 1HP8A 1BMFG 4DYLA 4J7ZA 4TUYA 1WA8B 1L0LH 1CXZB 1AJNA 1P7GA 2QJ1A 1BZKA 1VF6A 2HKOA 1N32O 1IBKO 3FYIB 5LP6C 1MNGA 4MVOA 3SYQA 3W7UA 1V54C 4H37A 3CPWU 5KA6A 1FFTB 4D7SA 3QF7A 4MVRA 2GBOA 2XT9A 1YJWV 2LJ2A 1YITV 1VQ9V 1XNQO 5CB4A 3UT5A 4RQEA 4UCUA 1PM9A 1IBMO 1LUWA 1WB7A 5FL7G 2UXXA 3DXRB 3U0ZA 1OCRC 2X6AA 4F4LA 5EYPA 2KG7B 2PTMA 2Q5ZA 2DMXA 2GDSA 1NTMH 3LDCA 2Q0OC 1FD9A 5IWAB 1KKDA 1BL8A 1TUEB 2JS5A 1H2SB 1M57C 4OGQB 1HR0B 2E75B 2PGGA 1YDXA 1SA0B 1YEWA 3CRCA 4X1IA 4ZOLA 3ZN0A 4FZ1A 1BCCH 3IJ4A 5IJ0B 2BTQB 1U96A 2QTOA 3OUFA 4JZ2A 4KUMA 2YIBD 3ETEA 2Q4PA 3H1HH 2R72A 1VF7A 1Y4MA 1WN7A 4DK1A 1KBHA 2ZR2A 4O4JA 5JH7A 3D36A 4LF5O 2VQFO 5L3CA 4NXNB 1GN2A 2WSSG 3OR6C 5B3SB 2YEVB 4X20B 4DR2O 3QNEA 2QE7G 3CCLV 3G67A 1HNZO 4PDRA 2PZSA 4I50B 3JAKB 4U3JA 4JI6O 1B3QA 3OMAB 4EKWA 4Q6GA 4QE9A
chains in the Genus database with same CATH topology
1S76D 3ZMUA 1AROP 3JD1A 3ZMSA 4BIZA 2A0LA 3ETGA 4LCUC 4MTGA 1XL4A 2V7QG 4TWKA 2WLMA 1P4RA 3AG3B 3GWOA 2EIMB 2IW5A 3OUSA 4GX0A 1GM9A 5GW7A 5B3SC 5CBGA 2ZR3A 5E1AC 1HWYA 3E89A 2H8PC 2WAMA 3IGAC 1JX9A 1I5YA 3VOUA 3JD2A 5IYBO 1FS0G 1NKDA 3AEIA 2DYSC 3E2EA 1OZ0A 3HPLC 1OCZB 4ZBMA 1K4DC 5EBMC 1THZA 4RUFA 3D3IA 1KP2A 1NR7A 2HJFC 3K3WA 4FIPC 1WPXA 4L87A 1WLEA 1EZJA 1OCOB 2ZXWB 2B1GA 4UVAA 1AJPA 5B1OA 2LP7A 2YEVA 4G2KA 4UV8A 3AG3C 2EIMC 1EBOA 3JD0A 4JYBA 2QEXV 2ZDIC 5LBQA 1AI6A 2Q69A 3DTUB 2HR3A 3ZRWB 2XASA 1AR1B 1KECA 1S5HC 2QM8A 3B77A 2OTJV 3LDEA 2GHYA 1YJ9V 2HFEC 4GX2A 4MTXA 4XDKA 2XAHA 1OCZC 2NNUA 1NJIW 1PNMA 1QBZA 1GM8A 1OCOC 2W6JG 2ZXWC 4UXNA 4UV9A 3OFNG 2D3OW 2ZDIA 1ZWIC 3ZMZA 1VQOV 3G6EV 3F5WC 4GCZA 1K33A 4Q20A 4WFGA 4RQFA 1JQ0A 2V1DA 2PI4A 4YXWG 4MVQA 4MW8A 3VBBA 1I5XA 2Q6AA 3ABUA 3ML0A 4PDMA 2EIKB 1JJ2U 4JASA 5EBLC 1AI7A 3CMAV 4ASUG 1R73A 3CCUV 1ENVA 3SPGA 4MVUA 3BY6A 1F4NA 2IU3A 2WLLB 3B8NA 4FJCC 5LHHA 2QKSA 3ZRWA 5IYDO 1YTFD 1QVFU 4JTAB 1SESA 5B1BB 4U7OA 3P32A 1Q81W 3K03A 3SYOA 2EIKC 2JIZG 2WLJA 3FYEB 1CEZA 1GMGA 3SYAA 3SJQC 5J9PC 3ZCCA 2X6BA 5CA3A 2WLKA 3CCVV 1XL6A 3EFFK 5C93A 3LUTB 1K8AW 1VQPV 2X0LA 3ABMB 3AG1B 4JYCA 1VQMV 3LSQA 1W0JG 4HAMA 2PI5A 2ITDC 3T4DA 2OTLV 1QLEB 2EILC 1UJWB 5DN6G 4PA9A 1NH2B 3LSSA 1M1KW 1K5QA 1MG1A 1K7DA 2EBOA 3ETDA 4CBCA 1BHBA 3BEHA 2X7RB 5CN0A 1VQ7V 2EZPA 2WLLA 4MS2A 4FK5C 3ZIAG 1KD1W 2XAJA 1LNQA 3RVZA 2P6JA 4MTOA 4G27B 1VQNV 2DQ0A 3TETA 2CK3G 3ABMC 1G8MA 1H8EG 1OCCC 3AG1C 3CC4V 1AJQA 2XAGA 3IFXA 3HB3B 3UKMA 5B1AB 4WFEA 1F4MA 3CC2V 1QLEC 4QNHB 3OW2U 3OAAG 1VQ8V 1S72V 4XBFA 3CC7V 3FB8C 4PA3A 3OEEG 3MHHC 5LGUA 1L1FA 3OE7G 3ASOB 3T4ZA 1NH2D 3ZRSA 2DQ3A 2IH1C 1CP9A 4JAVA 5LGTA 5LHIA 1KP3A 3G71V 2P90A 3E8FA 4KP4A 1F23A 4FPPA 3SYCA 4J9YB 1RM1B 3CXCU 1K92A 3W7XA 5LGNA 4I9WA 4MVSA 2UXNA 5IDJA 2FTKA 2Z5UA 3ASNB 5B1AC 5HFLA 4BIUA 1AI4A 2JK5C 3ZJZA 2JDIG 4X89A 2DWDC 2ITCC 5CBFA 1H8HG 4H33A 2GSMB 4PA7A 3ASOC 3UM7A 4PDVA 2JJ2G 3ZRXA 2LFRA 1GO3F 3E86A 3P30A 4DXWA 3CCMV 1NVPD 1E1QG 2DWEC 1YTFB 4GX1A 1RM1C 2Y48A 2IH3C 3K0DA 3K04A 5BZBA 3CYOA 1SZTA 1VQLV 1YSCA 3LNMB 4P2ZA 1F51A 4HZ3A 3I56V 1ORQC 1JVMA 3ASNC 1S0VA 4J9ZB 2AHZA 4QIWF 1H38A 4QJFB 2XNDG 1Y66A 1QR9A 1R3JC 4RO2A 2IJIA 4PDLA 3NXSA 4E2LA 1GKFA 2QA4V 2AHYA 2HLDG 2JEXA 1R6KA 3K9AA 1PNKA 3MHSC 2ATKC 3CCSV 4UVBA 3GB7C 5CMUA 4R8CA 4RUEA 3SPIA 1GK9A 4JPRA 3X2QB 4OXSA 4WFFA 4MVMA 3OMNB 3I55V 1PNLA 1QCEA 2HG5C 2YSUB 2M7WA 2C2AA 3AG4B 1AI5A 1OHHG 2EINB 5CBHA 1K34A 1K4CC 1W0KG 2Y69B 3TK1A 4P30A 2WLIB 4JTCB 3FB7C 1GTOA 2R9RB 4DO2A 2B5UA 1YIJV 4ZKIA 1K3EA 4WFHA 4G28B 5HFMA 2XAQA 2Z3YA 1PD3A 4LBEC 5L3BA 1QLNA 1JCHA 2IJJA 1YHQV 1K9MW 1K5SA 3ZMVA 4N23A 3OMIB 1Q7YW 3X2QC 4BW5A 1R3KC 2WLNA 3E83A 1BHAA 1S3JA 1VQ6V 5IYCO 5KUMA 3STZC 2IU0A 3TCUA 1E79G 2K1EA 2EINC 3AG4C 1M56B 2Y69C 3H01A 5IY5B 1KQSU 3EHBB 5B1BC 3SPJA 1YI2V 1FXKB 2JJ1G 1GM7A 3FB5C 4QPKA 3T2MA 3FB6C 3QO8A 4MSWC 4MVZA 4QE7A 4I5SA 1PKXA 3JD4A 3CD6V 5L3DA 4Z1MG 4MW3A 4PA4A 1V55B 3R65A 1Q82W 3SPCA 4BAYA 3LDDA 3CCEV 3K06A 3B8MA 2X6CA 3QO5A 3OGCC 5EC2C 3ZN1A 4FMTA 3ABTA 5H9CA 2EJRA 2Q68A 3E8GA 1P7BA 1Q86W 1R3IC 1SETA 3OR7C 1M56C 1MABG 4N21A 2P67A 4XDJA 5IY5C 1R3LC 4QPJA 1FXKC 1DLBA 1MOFA 1NBMG 3PJSK 1ROPA 1FXHA 2LFSA 3SYPA 4WFAV 3DGEA 1H2GA 2F43G 4TT3G 1NVPB 2R9IA 2BOBC 3FKSG 5H6RA 2QM7A 2NLJC 3W7SA 2WPDG 4CZZA 1V55C 1VQKV 1V54B 1M9NA 4LC1A 4MT8A 4JTDB 5B1NA 5H6QA 1BMFG 4U7NA 3RBZA 4GX5A 1FXKA 3W7TA 3E8BA 2DW4A 1JOYA 2KB1A 3AG2B 3M99B 4R50A 2WWWA 1G4YB 1AJNA 5LHGA 4X8AA 3RVYA 1DTOA 2BOCC 1DF4A 4MTFA 1MSWD 1N8RW 3G4SV 2HKOA 1K73W 3F7YC 3FYIB 3K0GA 4R7CA 1DF5A 3STLC 4MVOA 1QR8A 3SYQA 2B1IA 3W7UA 1COWG 1V54C 4H37A 3CPWU 1J95A 5KA6A 1FFTB 3MD0A 4TSFG 4HYOA 1B6QA 2JEUA 3KG2A 4MVRA 4WFBV 1FXVA 2OT5A 1OCRB 2WLHA 3AG2C 2ZD9A 3WFVA 1YJWV 2HVJC 3SPHA 1QVGU 4UUJC 2H94A 1YITV 1VQ9V 3ZMTA 3T1CA 1R6NA 2OCCB 1IXMA 3F7VC 4RQEA 3OM3B 3ABLB 1M57B 1W2BU 5EBWC 1JPXA 2W6IG 1SRYA 5KUKA 2HVKC 2A9HA 4XDLA 3RW0A 5FL7G 1NR1A 5EC1C 2UXXA 1OCRC 2X6AA 3QO7A 5DM6V 4F4LA 2A79B 2W0FC 5L3GA 3E35A 4UVCA 2DYRB 4RAIA 3ABKB 4JGSA 3JYCA 1NQTA 3CCJV 3LDCA 3E8HA 4GT1A 5L3FA 2OCCC 1RPOA 1KKDA 1BL8A 1TUEB 3ABLC 1M57C 4KFMA 3WG7B 1VQ5V 3CCRV 1K97A 2IJHA 3CCQV 3JD3A 2EZOA 2EIJB 3ZN0A 4X88A 4PELA 2EILB 5L3EA 4P9PA 1VQ4V 1S77D 2IJKA 2P7TC 2DYRC 2MK3A 3ABKC 2XOKG 4WCEV 2QTOA 1EFRG 3OUFA 4KUMA 3W7WA 4P9OA 1SERA 3ETEA 1KC8W 4LP8A 4PA6A 3K08A 3K79A 3WG7C 1M90W 5KA5A 4WF9V 1Y4MA 3OEHG 2ZQMA 2ZR2A 2Q67A 3D36A 2WLIA 1CPYA 1OCCB 4R6ZA 5L3CA 2EIJC 3A0RA 2WSSG 3ZRVA 3OR6C 5B3SB 2YEVB 3QNEA 2QE7G 4JF3A 3CCLV 5EK0A 3CMEV 3CP1A 4JAUA 3IC7A 2XAFA 1PL0A 1YJNV 4PDRA 3JCZA 4QE9A 3OMAB 4EKWA 1RPRA 2DYSB 1E1RG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W7S A;  3D3I A;  5CA3 A;  2P90 A;  3W7U A;  1YTF B;  1RM1 C;  1S3J A;  3BY6 A;  3W7X A;  3W7T A;  4HAM A;  5GW7 A;  2HR3 A;  1NH2 B;  3IC7 A;  3E35 A;  2WAM A;  1NVP B;  3W7W A; 
#chains in the Genus database with same CATH topology
 3ZHU A;  1XQ8 A;  3JD1 A;  3ETG A;  2QDO A;  3BRC A;  2EIM B;  3CX5 F;  5GW7 A;  1HNX B;  5E1A C;  3HKE B;  5KHI A;  1H2N A;  3VOU A;  1I5Y A;  3JD2 A;  5IYB O;  3ICX A;  4I7Z B;  3HPL C;  4ZBM A;  1K4D C;  5EBM C;  5A9G A;  1AR5 A;  1WPX A;  1OCO B;  4DUZ O;  1IBK B;  1Y74 A;  4F6R A;  1WP7 A;  4DR1 B;  4U3F H;  3CRM A;  5IJ9 B;  2HR3 A;  4H0L B;  3ZRW B;  1O9G A;  3ZBH A;  2YIA A;  1S5H C;  2QM8 A;  2OTJ V;  2GHY A;  1YJ9 V;  2HFE C;  4GX2 A;  4ZHQ B;  4AQY O;  1ZLZ A;  2NNU A;  1NJI W;  4CH4 A;  1BQ0 A;  2F66 C;  1QBZ A;  2GTS A;  2ADP A;  2AXT Z;  2D3O W;  1XNQ B;  1ZWI C;  1PP9 H;  4DV6 O;  2YXY A;  4UCS A;  4B08 A;  2Q6A A;  3ABU A;  3ML0 A;  4PDM A;  4TOI A;  1JJ2 U;  4FLX A;  2EJ7 A;  3CMA V;  4DK0 A;  3SPG A;  4PI0 A;  3BY6 A;  2IU3 A;  2WLL B;  4FJC C;  4I4T A;  1NU1 H;  1YTF D;  5FNV B;  2F4V B;  1SES A;  5B1B B;  4FLV A;  2ZT9 B;  1HW7 A;  3P32 A;  4LNU A;  3SYO A;  1XI1 A;  4X1K A;  1AVM A;  1SQB H;  5BMV B;  4FLU A;  3SJQ C;  4OX9 B;  2KSD A;  2WLK A;  5JVD B;  3CCV V;  2F23 A;  4EFE A;  1K8A W;  1N33 O;  5D5P A;  5BY1 A;  3SR2 C;  3AG1 B;  3LSQ A;  3N2G A;  4TV9 B;  4TUY B;  2ITD C;  2V4D A;  2OTL V;  3OTO O;  1QLE B;  1DGS A;  3HKC B;  4LF5 B;  4B7K A;  2UUB B;  2VQF B;  2AW9 A;  1K7D A;  2EBO A;  4DR2 B;  4YJ2 B;  2EZP A;  1VEW A;  1TA8 A;  3K58 A;  4DR4 B;  5JJN B;  1HNZ B;  2LQT A;  4FLW A;  4G27 B;  1SQF A;  3ABM C;  3UQ8 A;  2UUC B;  4DR6 O;  3OAA G;  3SJB C;  3TGU H;  4PD4 F;  1L1F A;  3ZRS A;  2ZM6 O;  2IH1 C;  1CP9 A;  4JAV A;  4Z2W A;  4FPP A;  3BA9 A;  5IDJ A;  3ZJZ A;  5CBF A;  5EZY B;  1IX9 A;  4CS3 A;  2GSM B;  3UM7 A;  4D7T A;  5DEC A;  3P30 A;  3JAT B;  1E1Q G;  2DWE C;  2E5L B;  4GX1 A;  5LXT B;  2Y48 A;  2IH3 C;  3K0D A;  4X66 O;  4FFB B;  4BWA A;  5IYZ A;  1VQL V;  4P2Z A;  1F51 A;  5JCO C;  2LW7 A;  4DRX B;  3I56 V;  3K5O A;  1S0V A;  1VMG A;  4ZOL B;  1Q3E A;  4QIW F;  4DV2 O;  4HNA B;  2XND G;  2CTR A;  4OPH A;  1GKF A;  1PNK A;  2CTQ A;  4O2B A;  4UVB A;  1XMQ O;  4R8C A;  4WFF A;  1RP3 B;  1PNL A;  4LR3 A;  4LF6 B;  2M7W A;  3ZX6 A;  4EFB A;  1AI5 A;  5EIB D;  3TK1 A;  5GON B;  4P30 A;  1JR9 A;  2R9R B;  2Y4T A;  3AK2 A;  4WFH A;  4DV7 B;  5L3B A;  5KAF Z;  4C7U A;  2UXD B;  4O4H B;  3VQX A;  1YHQ V;  1K9M W;  4GKJ B;  1RSO A;  1K5S A;  3ZMV A;  1IZ3 A;  3C3T A;  3X2Q C;  3SGI A;  1R3K C;  3E83 A;  2UXC O;  2LW1 A;  3QG5 A;  3AG4 C;  3H01 A;  3L72 H;  5B1B C;  1NTK H;  1YI2 V;  1FXK B;  2PYL A;  4CH6 A;  2ILM A;  1Q8I A;  4QPK A;  1H2M A;  3FB6 C;  3K9S A;  3CD6 V;  4MW3 A;  4PV1 B;  4PA4 A;  1YXB A;  4NXM B;  4KL1 A;  3SPC A;  4IL6 Z;  1KMI Z;  3K06 A;  1HNW O;  1TGO A;  1TUB B;  4FMT A;  2VWK A;  1R3I C;  1M56 C;  2P67 A;  5IY5 C;  1NBM G;  1NTZ H;  5BR8 O;  2GUZ B;  2R9A A;  4TT3 G;  1XMO O;  4DR6 B;  5LP6 B;  1VF5 B;  1VF6 C;  1V54 B;  3BPZ A;  4EB6 B;  2HHH O;  3E22 B;  1I94 O;  1JOY A;  2KB1 A;  3RYC B;  5B5E Z;  4X1Y A;  5JQG A;  4X8A A;  4UB6 Z;  1XUQ A;  1DF4 A;  1BGY H;  2BOC C;  1MSW D;  2AZ0 A;  3F7Y C;  2W0X A;  1SQG A;  3UCS C;  2L6L A;  2YI9 A;  1KU9 A;  1COW G;  2G38 A;  4DW1 A;  4TSF G;  4HYO A;  1B6Q A;  2JEU A;  4KHP B;  3KG2 A;  1FXV A;  2OT5 A;  1OCR B;  2WLH A;  3AG2 C;  4LFC B;  3RGB A;  2BCC H;  4X66 B;  2HVJ C;  2RCV A;  1GN3 A;  1R6N A;  5AG2 A;  3SJA C;  3F7V C;  1YVW A;  1M57 B;  3BFR A;  1JPX A;  2Z0A A;  5EIB C;  3A0B Z;  2B9Z A;  1XHZ A;  5KUK A;  4XDL A;  3RW0 A;  1NR1 A;  3F5T A;  5DM6 V;  5K1X A;  2A79 B;  1SC5 B;  3JAR B;  3E35 A;  1ZUQ A;  4RAI A;  1NQT A;  2OCC C;  3TXQ A;  1RPO A;  2DJV A;  3ABL C;  5KMG A;  4JI2 O;  1VQ5 V;  2JVD A;  3HKD A;  2K9P A;  1J5E O;  1K97 A;  2ZE7 A;  3JD3 A;  2EZO A;  4PEL A;  3D36 C;  5FLX N;  3B4S A;  5L3E A;  2QKA A;  2UXC B;  2IJK A;  4WCE V;  3J7A U;  1SKV A;  3W7W A;  1Y67 A;  2CH7 A;  1PL4 A;  3K79 A;  4NTX A;  3QTC A;  3CJH A;  2YID A;  2ZQM A;  2IM9 A;  4R6Z A;  4J7J A;  2VQE O;  3AG7 A;  2EIJ C;  3A0R A;  4JZG A;  5LOV A;  4JF3 A;  3O9O A;  1Q43 A;  4JAU A;  2XAF A;  2GTA A;  2H3O A;  1S76 D;  2VWJ A;  3ZMU A;  4LF9 B;  4F6E A;  5BR8 B;  5A2Q N;  3K5N A;  1TVK A;  3JAS A;  4MTG A;  1QNM A;  3Q4H A;  3GWO A;  5KLV H;  4YJ3 A;  3T1Y O;  4GX0 A;  5LA6 A;  3HKB B;  2ZE8 A;  3JAW B;  2JS3 A;  4JI1 O;  2H8P C;  2WAM A;  3VQV A;  1FS0 G;  1N0N A;  1BT8 A;  1OZ0 A;  4O4I A;  1THZ A;  2N74 A;  3BAA A;  1KP2 A;  1NR7 A;  3D3I A;  4FIP C;  4L87 A;  1WLE A;  1EZJ A;  4UVA A;  4JYY A;  2ZIM A;  1EM1 A;  1S5J A;  5KX5 B;  1O9H A;  4UV8 A;  3AG3 C;  1EBO A;  4JI8 B;  2QR4 A;  3S3X A;  1AI6 A;  3DTU B;  4CS4 A;  1QU7 A;  1Y76 B;  1Q6U A;  1US6 A;  3L75 H;  3RFR A;  2ZIN A;  2XAH A;  1OCZ C;  3RYH A;  3TXS A;  3JCU Z;  4LWS A;  3H1K H;  1GM8 A;  2ZXW C;  2ZDI A;  2E3C A;  1X4T A;  1URF A;  4Q20 A;  3QVN A;  1JQ0 A;  3UO3 A;  4JI3 O;  2V1D A;  4FM2 A;  2BSK A;  3VBB A;  2MW2 B;  3K5M A;  4DV4 B;  3JSN A;  5D5Q A;  3CCU V;  4X62 B;  1ENV A;  3CRA A;  4B3S O;  3B8N A;  1IBL B;  3CXH F;  4JTA B;  4YHH O;  5C8Y B;  4TV8 B;  1J5E B;  2EIK C;  4DV3 O;  1CEZ A;  4DR3 O;  1GMG A;  1KB9 F;  3ZCC A;  4K35 A;  3ZS8 C;  1D5A A;  2LO1 A;  3GVM A;  3LUT B;  1SZX A;  3ABM B;  4JI0 O;  4JYC A;  4UCO A;  1W0J G;  5KAI Z;  1UJW B;  4DR5 O;  4FM0 A;  1MG1 A;  3G6B A;  4X1Y B;  4WBN B;  5LMN B;  1BS3 A;  4FK5 C;  4NYK A;  5E79 Z;  1FFX A;  1KD1 W;  2P6J A;  4MTO A;  1VQN V;  2DQ0 A;  4LFA O;  1NT2 B;  1L0N H;  2RDC A;  1H8E G;  1F7Y A;  1WJZ A;  3CC4 V;  1XNR O;  2XAG A;  3HB3 B;  3UKM A;  3DSQ A;  1F4M A;  3CC2 V;  5J2T B;  3OW2 U;  2OCH A;  3FB8 C;  4NB5 A;  2UU9 O;  3MHH C;  5LGU A;  3T1Y B;  4LFB O;  4YY3 O;  2DQ3 A;  5LHI A;  1KP3 A;  2P90 A;  3E8F A;  2P06 A;  3FX7 A;  2AGA A;  3K5L A;  1K92 A;  1N32 B;  1I0H A;  4KXR A;  4MVS A;  2FTK A;  3KKY A;  5B1A C;  4BIU A;  3NR7 A;  2JDI G;  2DWD C;  4IIJ A;  4PA7 A;  3ASO C;  1BE3 H;  2JJ2 G;  4GKK O;  4DV1 O;  1GO3 F;  1YTF B;  4FLY A;  3K04 A;  3CYO A;  3N2K A;  5CA0 A;  2YXL A;  1QQC A;  1JVM A;  3ASN C;  4J9Z B;  4ZI7 A;  3P3P A;  4O4L B;  4JI5 O;  1H38 A;  2IJI A;  1IBM B;  3K9A A;  4O2A A;  1R6K A;  3MHS C;  4I0X B;  3KCY A;  5CMU A;  3X2Q B;  3I55 V;  2ODM A;  2YSU B;  2HG5 C;  3FAV A;  3A2F A;  1SQP H;  3FD9 A;  2C2A A;  3AG4 B;  5CBH A;  1GN6 A;  1K4C C;  4JTC B;  3FB7 C;  4DO2 A;  2B5U A;  4B3S B;  2QWQ B;  1K3E A;  1VP7 A;  2RMK B;  5K1P A;  1BQZ A;  1D2D A;  5LYJ B;  1XIL A;  2P5O A;  2HP8 A;  2Q7E A;  4N23 A;  4BW5 A;  3TJT A;  2WLN A;  1BHA A;  5JJJ B;  1VQ6 V;  3OT7 A;  1ZL8 A;  3U11 A;  5KUM A;  2IU0 A;  1EN5 A;  1E79 G;  2K1E A;  1M56 B;  3L73 H;  5IY5 B;  1KQS U;  2JJ1 G;  2Q7H A;  4W4K A;  4Z1M G;  4IHJ A;  4CC5 A;  2UUA O;  4FZ0 A;  1IDS A;  5EC2 C;  3ABT A;  4JI6 B;  3E8G A;  1MAB G;  3JAL A;  1VIB A;  4XDJ A;  1HDJ A;  3ETQ A;  1R3L C;  4JYA O;  1JFF A;  1A32 A;  2LFS A;  4L8J A;  4LFA B;  3SYP A;  4WFA V;  3SDL A;  3ZHS A;  2R9I A;  3RYF A;  2QM7 A;  4CZZ A;  1V55 C;  4FM1 A;  2QWO B;  3D8C A;  4CC6 A;  1M9N A;  5CB4 B;  5CA1 A;  3UT5 B;  4RWU A;  2PYJ A;  4LFB B;  3E8B A;  2DW4 A;  3AG2 B;  2BE3 A;  4J10 A;  4R50 A;  3MAQ A;  2WWW A;  1G4Y B;  2FL4 A;  5LHG A;  5ITZ A;  1Q90 D;  3N27 A;  3RVY A;  4DUZ B;  3G4S V;  1K73 W;  3T1H O;  3K0G A;  5EYP B;  4DUY O;  4R7C A;  1DF5 A;  1QR8 A;  4JI7 O;  5GTI Z;  2B1I A;  3MD0 A;  3WB1 A;  4AQY B;  4DV1 B;  2ZD9 A;  3WFV A;  4ABM A;  4X1I B;  5H2F Z;  1L8D A;  3SPH A;  1WPB A;  4UUJ C;  4DV6 B;  3ZMT A;  3IC9 A;  3T1C A;  2OCC B;  4I55 A;  3OM3 B;  3ABL B;  3LNN A;  3M7M X;  4FLZ A;  2Y0I A;  5LMU O;  1WA8 A;  4H13 B;  1Q6H A;  2YDE A;  4B3T O;  1SRY A;  3B2E E;  4K0K O;  2RJZ A;  3QO7 A;  1FYJ A;  4O4J B;  5TIS Z;  5JH7 B;  2W0F C;  4A5U B;  4UVC A;  3CRQ A;  2ZCE A;  3PN1 A;  1T5E A;  3I5D A;  2FB5 A;  1I08 A;  2CE4 A;  2F1M A;  4KFM A;  4U3J B;  1XEQ A;  2IJH A;  4JI4 O;  1NZ6 A;  3M8A A;  3CCQ V;  1XDC A;  4K8Z A;  2EIJ B;  2RNB A;  2DOS A;  2EIL B;  1VQ4 V;  2N05 A;  2P7T C;  2DYR C;  1N33 B;  3ABK C;  2XOK G;  1EFR G;  4P9O A;  1SER A;  1G1X B;  3OTO B;  3WG7 C;  5KA5 A;  2F95 B;  4WF9 V;  3ZHV A;  3DXR A;  2YC0 A;  1FPO A;  2Q67 A;  1QHT A;  4PJ0 Z;  2WLI A;  2YIB A;  1OCC B;  4DR7 O;  3O65 A;  4FLT A;  2Q0A A;  2KG7 A;  3ZRV A;  1JJO A;  1Y74 B;  2DN9 A;  2KQX A;  5EK0 A;  3CP1 A;  4F6R B;  1YJN V;  3WU2 Z;  1RPR A;  3ZHR A;  1RFY A;  1EZV H;  1SA0 A;  1YZB A;  4IIJ B;  2A0L A;  4LCU C;  4CS2 A;  1Y6X A;  1XHX A;  4TWK A;  1M5I A;  2FKX A;  2WLM A;  1P4R A;  3AG3 B;  5IJ0 A;  1ZSP A;  2BTQ A;  2ZM6 B;  3OUS A;  5CBG A;  2IBZ H;  4J42 A;  2ZR3 A;  3E89 A;  3BA8 A;  2OIG A;  2E76 B;  1SS3 A;  1NKD A;  2DYS C;  1OCZ B;  4RUF A;  2HJF C;  3K3W A;  1IXB A;  2ZXW B;  2B1G A;  1AJP A;  2ZE5 A;  4TQF A;  2YEV A;  4X20 A;  3HR0 A;  4DUY B;  2JRI A;  4JYB A;  2QEX V;  3A8T A;  2ZDI C;  4I50 A;  2Q69 A;  4I4T B;  1AR1 B;  2L35 A;  3B77 A;  3LDE A;  2R70 A;  3RYI A;  4LNU B;  2ZIO A;  4X1K B;  4DV2 B;  1PNM A;  3UO2 A;  4UXN A;  2W6J G;  2QWR B;  4YIO A;  3HKE A;  3F5W C;  2OIE A;  2KKW A;  4GCZ A;  1K33 A;  4WFG A;  2A3Q A;  1ZL8 B;  3L71 H;  4RQF A;  1XMQ B;  1PPJ H;  1I5X A;  3N2G B;  2EIK B;  2E74 B;  2UXB O;  4JAS A;  4ASU G;  1WP8 A;  1X59 A;  3L70 H;  5IJ9 A;  4IYH A;  2CGO A;  3ZRW A;  5IYD O;  5IWA O;  4U7O A;  1HR0 O;  2CTW A;  2VRZ A;  4ZHQ A;  3K03 A;  2JIZ G;  3JSL A;  2WLJ A;  4JI4 B;  3FYE B;  2CDY A;  1JFF B;  3SYA A;  1IVS A;  2X6B A;  1XBL A;  3EFF K;  4NVP A;  1VQP V;  1MSD A;  1YCI A;  4HAM A;  3T4D A;  4X64 O;  2EIL C;  1KUQ A;  5DN6 G;  1M1K W;  1HNW B;  1K5Q A;  2A06 H;  1AB3 A;  4CBC A;  1BHB A;  3CE2 A;  5CN0 A;  4PI2 A;  4NXN O;  4GLX A;  2WLL A;  4MS2 A;  3ZIA G;  3RVZ A;  2WA4 A;  3TET A;  1XMO B;  3ZHT A;  1OCC C;  2Q8V A;  4X9Q A;  1AJQ A;  2QTS A;  5B1A B;  4BIO A;  5IYZ B;  5BMV A;  1VQ8 V;  2HHH B;  4XBF A;  3CC7 V;  4PA3 A;  5JVD A;  1I94 B;  3OE7 G;  4E4E A;  3ASO B;  5LGT A;  3OGI B;  1UFI A;  1FKA O;  3ZHQ A;  4KP4 A;  1F23 A;  4O2B B;  4J9Y B;  4AIL C;  4TV9 A;  3CXC U;  3GWK C;  2OYQ A;  4I9W A;  3HKC A;  2QWN B;  2Z5U A;  3ASN B;  2PY5 A;  5HFL A;  4X89 A;  2ITC C;  4YJ2 A;  4H33 A;  4DR1 O;  4PDV A;  2PF4 E;  3E86 A;  4DXW A;  1NVP D;  1SF9 A;  2CUG A;  1RM1 C;  1RSO B;  4OPA A;  5BZB A;  1SZT A;  1YSC A;  4HZ3 A;  1ORQ C;  1IUR A;  4IGG A;  2AHZ A;  1QR9 A;  1R3J C;  4RO2 A;  2RQ6 A;  3NXS A;  4UCT A;  3CEI A;  2AHY A;  2HLD G;  2JEX A;  5KHK A;  2QA4 V;  3C3S A;  1Q5O A;  2QM4 A;  5KHJ A;  3KZI Z;  1B04 A;  4GUN A;  4RUE A;  3SPI A;  1GK9 A;  2O57 A;  1P49 A;  4OXS A;  4MVM A;  3OMN B;  2UXB B;  1AP5 A;  1QCE A;  4NR1 A;  4CH5 A;  4B3M O;  1MA1 A;  5EZY A;  2WLI B;  4JI2 B;  1YIJ V;  4K8X A;  4ZKI A;  2YIC A;  2NN4 A;  2XAQ A;  2Z3Y A;  1PD3 A;  3JAT A;  4LBE C;  2ETN A;  5LXT A;  3DC5 A;  2IJJ A;  4QGP A;  2F4V O;  1MMM A;  3J80 N;  4FFB A;  1Q7Y W;  1FJG O;  4DRX A;  4X65 O;  1S3J A;  1PV0 A;  3IAY A;  3STZ C;  3TCU A;  4HNA A;  2EIN C;  2Y69 C;  2ZE6 A;  4OX9 O;  4LF7 O;  2BTO A;  5F2V O;  3T2M A;  4MVZ A;  3G80 A;  1GN4 A;  2VQE B;  3JD4 A;  5JQG B;  4X64 B;  4CH3 A;  1V55 B;  1KYO F;  1P84 F;  4BAY A;  3B8M A;  2X6C A;  2P22 C;  1WNS A;  3QO5 A;  5GON A;  2UUB O;  2EJR A;  2Q68 A;  1P7B A;  1Q86 W;  3OR7 C;  1M93 A;  4N21 A;  1WB8 A;  2YI8 A;  1DLB A;  2VS0 A;  3WB2 A;  4DR4 O;  1FXH A;  1UPG A;  2XUM A;  4O4H A;  5JJE B;  2FML A;  2F43 G;  5H5N A;  2BOB C;  5H6R A;  2NLJ C;  1SQQ H;  3JAM N;  2UUC O;  3RYI B;  4LC1 A;  4JI1 B;  4JTD B;  5B1N A;  1Q6I A;  5H6Q A;  4U7N A;  1NS1 A;  3RBZ A;  4GX5 A;  1FXK A;  4LH6 A;  3W7T A;  3M99 B;  2YS8 A;  4JV5 O;  1DTO A;  1GRJ A;  4MTF A;  1N0J A;  1ZAU A;  1N8R W;  2HEP A;  5B66 Z;  2ZNJ A;  3STL C;  1TUB A;  2Q73 A;  4B7E A;  4H44 B;  1J95 A;  1W59 A;  1VAR A;  1AR4 A;  3VQW A;  5KMG B;  4J80 A;  3K59 A;  4WFB V;  2DE0 X;  2GUZ A;  3CRR A;  3HKD B;  2JGU A;  2E5L O;  1M4U A;  1N34 O;  5LP6 A;  3R66 A;  1QVG U;  2H94 A;  1S5L Z;  2JGD A;  4PHZ A;  3L74 H;  1IXM A;  4EB6 A;  4EEQ A;  4JI3 B;  1W2B U;  2ARH A;  3E22 A;  1I7F A;  2CH7 B;  1BSM A;  5EBW C;  3RYC A;  2W6I G;  2HVK C;  2A9H A;  2QWP B;  3CJH B;  3B09 A;  5EC1 C;  2CGN A;  4B3R O;  2EUL A;  5L3G A;  1FAF A;  2DYR B;  3ABK B;  4JGS A;  4B3M B;  3JYC A;  3CCJ V;  4HBN A;  3E8H A;  5LOV B;  4LF6 O;  4GT1 A;  5L3F A;  4YHH B;  3ZED A;  4NTW A;  4GYC B;  3WG7 B;  4Z1V A;  3EXA A;  3CCR V;  4DW0 A;  4DV3 B;  2QKC A;  4DV7 O;  4DR3 B;  1TVK B;  3JAS B;  2UXD O;  4X88 A;  4GKJ O;  1FJG B;  4P9P A;  4X65 B;  3Q4H B;  1S77 D;  4YJ3 B;  4AHC A;  2MK3 A;  1SQV H;  2CTP A;  5LA6 B;  4JI0 B;  1KC8 W;  4LF7 B;  4LP8 A;  4PA6 A;  3AK1 A;  3C90 A;  3K08 A;  4IYI A;  4DR5 B;  1XRE A;  1M90 W;  3OEH G;  4O4I B;  1YF2 A;  1CPY A;  4LF8 O;  3JAR A;  4D6T H;  4NXM O;  1R1B A;  2QGN A;  3CME V;  2FYU H;  3IC7 A;  1PL0 A;  3JCZ A;  1XNR B;  2DYS B;  1E1R G;  1U97 A;  5J2U A;  1ARO P;  1SQX H;  3ZMS A;  4BIZ A;  2YUA A;  3WB0 A;  1XL4 A;  2V7Q G;  3P3N A;  3RYH B;  4DV0 O;  2UU9 B;  3APO A;  4LWS B;  3L9D A;  2IW5 A;  1R6T A;  4YY3 B;  1GM9 A;  5B3S C;  2WA3 A;  1HWY A;  3H1L H;  5GTH Z;  1ZX3 A;  4NKG B;  1GAX A;  3OD4 A;  3IGA C;  1Z5W A;  1JX9 A;  2BSK B;  3E2E A;  3AEI A;  1N36 O;  3U10 A;  1G6U A;  4JV5 B;  3EVK A;  5B1O A;  2LP7 A;  4G2K A;  4UFZ A;  4LH7 A;  2EIM C;  1NI8 A;  3JD0 A;  3LSU A;  4GKK B;  5LBQ A;  1H2L A;  3AK3 A;  2LGW A;  2XAS A;  3FFQ A;  4K3A A;  1KEC A;  1GH6 A;  3DC6 A;  2PUS A;  4MTX A;  4XDK A;  4KHP O;  4LFC O;  4JI5 B;  1N34 B;  1OCO C;  4UV9 A;  3OFN G;  3ZMZ A;  3HKB A;  1VQO V;  3G6E V;  3JAW A;  4I9Q A;  5IE9 A;  2PI4 A;  4YXW G;  4MVQ A;  4MW8 A;  3APQ A;  1TAE A;  4AI8 A;  1LUV A;  5EBL C;  1AI7 A;  2Y0P A;  4B3R B;  1OV9 A;  5KX5 A;  1R73 A;  2RN9 A;  4MVU A;  1F4N A;  5LHH A;  1Y76 A;  2QKS A;  1FFX B;  4W4L A;  1QVF U;  2N04 A;  5KHG A;  1EN4 A;  3BCC H;  1Q81 W;  3RT3 C;  1XOU A;  2F93 B;  4GZR B;  5J9P C;  4FFK A;  4YIP A;  3OTF A;  4DV5 O;  5CA3 A;  1KKC A;  1XL6 A;  5KHH A;  1AIL A;  1ZTE A;  5C93 A;  2X0L A;  3KCX A;  5BXZ A;  1VQM V;  3CSX A;  2PI5 A;  2UUA B;  3MDS A;  4PA9 A;  1NH2 B;  3LSS A;  1JMK C;  4ICG A;  4LF8 B;  4UCV A;  4J7K A;  3ETD A;  3BEH A;  2X7R B;  4BR6 A;  5FPR A;  1LR1 A;  1VQ7 V;  2CAZ C;  4JYA B;  2XAJ A;  1D5N A;  1LNQ A;  2M6Y A;  2CK3 G;  5C8Y A;  1G8M A;  4TV8 A;  3AG1 C;  3B40 A;  4TQD A;  3IFX A;  4LF9 O;  4WFE A;  3K57 A;  1QLE C;  4QNH B;  3N2K B;  5CA0 B;  4LF4 O;  4DV0 B;  3RN4 A;  1S72 V;  2ZKO A;  3RWR D;  4ZI7 B;  3OEE G;  2AZ2 A;  4UCR A;  1NH2 D;  3T4Z A;  2JGD B;  2QSA A;  3G71 V;  4O2A B;  3SYC A;  2LGQ A;  1RM1 B;  3W7X A;  5LGN A;  3T1H B;  1H2K A;  1N36 B;  2UXN A;  4JI7 B;  4WBN A;  1AI4 A;  3FAV B;  2JK5 C;  3JAK A;  2OWO A;  1H8H G;  1AP6 A;  3CHX A;  2ZNI A;  4JI8 O;  1N4C A;  3ZRX A;  2LFR A;  3CCM V;  2GV9 A;  3BVO A;  2Q7G A;  1B06 A;  3SJC C;  2HJD A;  3LNM B;  5J2T A;  2EX3 A;  2NR5 A;  1V9P A;  3BAB A;  1JA8 A;  5LMU B;  4QJF B;  4B3T B;  1Y66 A;  4PDL A;  4E2L A;  4K0K B;  2ATK C;  3CCS V;  3A0H Z;  3CWB H;  1OJH A;  1MZE A;  3GB7 C;  5JWP A;  1Z2G A;  4JPR A;  5JCO A;  2Y4U A;  1MZF A;  2P4K A;  4IHJ B;  4DV4 O;  5LL6 Y;  2EIN B;  1OHH G;  2ADQ B;  1K34 A;  2Y69 B;  1W0K G;  3D3Q A;  3S3W A;  3THO A;  4FVM A;  4JAA A;  1GTO A;  4IT5 A;  1DK1 A;  1EN6 A;  4X62 O;  3JAL B;  3H1J H;  4G28 B;  5HFM A;  1IBL O;  1QLN A;  4J11 A;  1JCH A;  3CS5 A;  3OMI B;  3RYF B;  5J2U B;  4J41 A;  5IYC O;  3H9V A;  5DED A;  2D2C B;  4O4L A;  5CA1 B;  4DV5 B;  2YXH A;  2P4V A;  3EHB B;  3SPJ A;  3BHP A;  4I0X A;  1Z5V A;  4BW9 A;  1GM7 A;  3FB5 C;  4NTY A;  4QE7 A;  3QO8 A;  4MSW C;  3J81 N;  4DR7 B;  4I5S A;  1PKX A;  3H1I H;  5ITZ B;  4UB8 Z;  2XHB A;  5L3D A;  3R65 A;  1Q82 W;  3LDD A;  3CCE V;  3CB2 A;  3VQY A;  5FNV A;  3OGC C;  3ZN1 A;  2Q9L A;  5H9C A;  2XTA A;  5FPO A;  1SET A;  1WAZ A;  5LMN O;  4QPJ A;  1FXK C;  1MOF A;  3PJS K;  1ROP A;  5LYJ A;  5IT9 N;  4ZIB A;  3DGE A;  1H2G A;  1NVP B;  3FKS G;  3W7S A;  2WPD G;  4LF4 B;  1HNX O;  1VQK V;  4MT8 A;  4I55 B;  2A7W A;  1HP8 A;  1BMF G;  4DYL A;  4J7Z A;  4TUY A;  1WA8 B;  1L0L H;  1CXZ B;  1AJN A;  1P7G A;  2QJ1 A;  1BZK A;  1VF6 A;  2HKO A;  1N32 O;  1IBK O;  3FYI B;  5LP6 C;  1MNG A;  4MVO A;  3SYQ A;  3W7U A;  1V54 C;  4H37 A;  3CPW U;  5KA6 A;  1FFT B;  4D7S A;  3QF7 A;  4MVR A;  2GBO A;  2XT9 A;  1YJW V;  2LJ2 A;  1YIT V;  1VQ9 V;  1XNQ O;  5CB4 A;  3UT5 A;  4RQE A;  4UCU A;  1PM9 A;  1IBM O;  1LUW A;  1WB7 A;  5FL7 G;  2UXX A;  3DXR B;  3U0Z A;  1OCR C;  2X6A A;  4F4L A;  5EYP A;  2KG7 B;  2PTM A;  2Q5Z A;  2DMX A;  2GDS A;  1NTM H;  3LDC A;  2Q0O C;  1FD9 A;  5IWA B;  1KKD A;  1BL8 A;  1TUE B;  2JS5 A;  1H2S B;  1M57 C;  4OGQ B;  1HR0 B;  2E75 B;  2PGG A;  1YDX A;  1SA0 B;  1YEW A;  3CRC A;  4X1I A;  4ZOL A;  3ZN0 A;  4FZ1 A;  1BCC H;  3IJ4 A;  5IJ0 B;  2BTQ B;  1U96 A;  2QTO A;  3OUF A;  4JZ2 A;  4KUM A;  2YIB D;  3ETE A;  2Q4P A;  3H1H H;  2R72 A;  1VF7 A;  1Y4M A;  1WN7 A;  4DK1 A;  1KBH A;  2ZR2 A;  4O4J A;  5JH7 A;  3D36 A;  4LF5 O;  2VQF O;  5L3C A;  4NXN B;  1GN2 A;  2WSS G;  3OR6 C;  5B3S B;  2YEV B;  4X20 B;  4DR2 O;  3QNE A;  2QE7 G;  3CCL V;  3G67 A;  1HNZ O;  4PDR A;  2PZS A;  4I50 B;  3JAK B;  4U3J A;  4JI6 O;  1B3Q A;  3OMA B;  4EKW A;  4Q6G A;  4QE9 A; 
#chains in the Genus database with same CATH homology
 1S76 D;  3ZMU A;  1ARO P;  3JD1 A;  3ZMS A;  4BIZ A;  2A0L A;  3ETG A;  4LCU C;  4MTG A;  1XL4 A;  2V7Q G;  4TWK A;  2WLM A;  1P4R A;  3AG3 B;  3GWO A;  2EIM B;  2IW5 A;  3OUS A;  4GX0 A;  1GM9 A;  5GW7 A;  5B3S C;  5CBG A;  2ZR3 A;  5E1A C;  1HWY A;  3E89 A;  2H8P C;  2WAM A;  3IGA C;  1JX9 A;  1I5Y A;  3VOU A;  3JD2 A;  5IYB O;  1FS0 G;  1NKD A;  3AEI A;  2DYS C;  3E2E A;  1OZ0 A;  3HPL C;  1OCZ B;  4ZBM A;  1K4D C;  5EBM C;  1THZ A;  4RUF A;  3D3I A;  1KP2 A;  1NR7 A;  2HJF C;  3K3W A;  4FIP C;  1WPX A;  4L87 A;  1WLE A;  1EZJ A;  1OCO B;  2ZXW B;  2B1G A;  4UVA A;  1AJP A;  5B1O A;  2LP7 A;  2YEV A;  4G2K A;  4UV8 A;  3AG3 C;  2EIM C;  1EBO A;  3JD0 A;  4JYB A;  2QEX V;  2ZDI C;  5LBQ A;  1AI6 A;  2Q69 A;  3DTU B;  2HR3 A;  3ZRW B;  2XAS A;  1AR1 B;  1KEC A;  1S5H C;  2QM8 A;  3B77 A;  2OTJ V;  3LDE A;  2GHY A;  1YJ9 V;  2HFE C;  4GX2 A;  4MTX A;  4XDK A;  2XAH A;  1OCZ C;  2NNU A;  1NJI W;  1PNM A;  1QBZ A;  1GM8 A;  1OCO C;  2W6J G;  2ZXW C;  4UXN A;  4UV9 A;  3OFN G;  2D3O W;  2ZDI A;  1ZWI C;  3ZMZ A;  1VQO V;  3G6E V;  3F5W C;  4GCZ A;  1K33 A;  4Q20 A;  4WFG A;  4RQF A;  1JQ0 A;  2V1D A;  2PI4 A;  4YXW G;  4MVQ A;  4MW8 A;  3VBB A;  1I5X A;  2Q6A A;  3ABU A;  3ML0 A;  4PDM A;  2EIK B;  1JJ2 U;  4JAS A;  5EBL C;  1AI7 A;  3CMA V;  4ASU G;  1R73 A;  3CCU V;  1ENV A;  3SPG A;  4MVU A;  3BY6 A;  1F4N A;  2IU3 A;  2WLL B;  3B8N A;  4FJC C;  5LHH A;  2QKS A;  3ZRW A;  5IYD O;  1YTF D;  1QVF U;  4JTA B;  1SES A;  5B1B B;  4U7O A;  3P32 A;  1Q81 W;  3K03 A;  3SYO A;  2EIK C;  2JIZ G;  2WLJ A;  3FYE B;  1CEZ A;  1GMG A;  3SYA A;  3SJQ C;  5J9P C;  3ZCC A;  2X6B A;  5CA3 A;  2WLK A;  3CCV V;  1XL6 A;  3EFF K;  5C93 A;  3LUT B;  1K8A W;  1VQP V;  2X0L A;  3ABM B;  3AG1 B;  4JYC A;  1VQM V;  3LSQ A;  1W0J G;  4HAM A;  2PI5 A;  2ITD C;  3T4D A;  2OTL V;  1QLE B;  2EIL C;  1UJW B;  5DN6 G;  4PA9 A;  1NH2 B;  3LSS A;  1M1K W;  1K5Q A;  1MG1 A;  1K7D A;  2EBO A;  3ETD A;  4CBC A;  1BHB A;  3BEH A;  2X7R B;  5CN0 A;  1VQ7 V;  2EZP A;  2WLL A;  4MS2 A;  4FK5 C;  3ZIA G;  1KD1 W;  2XAJ A;  1LNQ A;  3RVZ A;  2P6J A;  4MTO A;  4G27 B;  1VQN V;  2DQ0 A;  3TET A;  2CK3 G;  3ABM C;  1G8M A;  1H8E G;  1OCC C;  3AG1 C;  3CC4 V;  1AJQ A;  2XAG A;  3IFX A;  3HB3 B;  3UKM A;  5B1A B;  4WFE A;  1F4M A;  3CC2 V;  1QLE C;  4QNH B;  3OW2 U;  3OAA G;  1VQ8 V;  1S72 V;  4XBF A;  3CC7 V;  3FB8 C;  4PA3 A;  3OEE G;  3MHH C;  5LGU A;  1L1F A;  3OE7 G;  3ASO B;  3T4Z A;  1NH2 D;  3ZRS A;  2DQ3 A;  2IH1 C;  1CP9 A;  4JAV A;  5LGT A;  5LHI A;  1KP3 A;  3G71 V;  2P90 A;  3E8F A;  4KP4 A;  1F23 A;  4FPP A;  3SYC A;  4J9Y B;  1RM1 B;  3CXC U;  1K92 A;  3W7X A;  5LGN A;  4I9W A;  4MVS A;  2UXN A;  5IDJ A;  2FTK A;  2Z5U A;  3ASN B;  5B1A C;  5HFL A;  4BIU A;  1AI4 A;  2JK5 C;  3ZJZ A;  2JDI G;  4X89 A;  2DWD C;  2ITC C;  5CBF A;  1H8H G;  4H33 A;  2GSM B;  4PA7 A;  3ASO C;  3UM7 A;  4PDV A;  2JJ2 G;  3ZRX A;  2LFR A;  1GO3 F;  3E86 A;  3P30 A;  4DXW A;  3CCM V;  1NVP D;  1E1Q G;  2DWE C;  1YTF B;  4GX1 A;  1RM1 C;  2Y48 A;  2IH3 C;  3K0D A;  3K04 A;  5BZB A;  3CYO A;  1SZT A;  1VQL V;  1YSC A;  3LNM B;  4P2Z A;  1F51 A;  4HZ3 A;  3I56 V;  1ORQ C;  1JVM A;  3ASN C;  1S0V A;  4J9Z B;  2AHZ A;  4QIW F;  1H38 A;  4QJF B;  2XND G;  1Y66 A;  1QR9 A;  1R3J C;  4RO2 A;  2IJI A;  4PDL A;  3NXS A;  4E2L A;  1GKF A;  2QA4 V;  2AHY A;  2HLD G;  2JEX A;  1R6K A;  3K9A A;  1PNK A;  3MHS C;  2ATK C;  3CCS V;  4UVB A;  3GB7 C;  5CMU A;  4R8C A;  4RUE A;  3SPI A;  1GK9 A;  4JPR A;  3X2Q B;  4OXS A;  4WFF A;  4MVM A;  3OMN B;  3I55 V;  1PNL A;  1QCE A;  2HG5 C;  2YSU B;  2M7W A;  2C2A A;  3AG4 B;  1AI5 A;  1OHH G;  2EIN B;  5CBH A;  1K34 A;  1K4C C;  1W0K G;  2Y69 B;  3TK1 A;  4P30 A;  2WLI B;  4JTC B;  3FB7 C;  1GTO A;  2R9R B;  4DO2 A;  2B5U A;  1YIJ V;  4ZKI A;  1K3E A;  4WFH A;  4G28 B;  5HFM A;  2XAQ A;  2Z3Y A;  1PD3 A;  4LBE C;  5L3B A;  1QLN A;  1JCH A;  2IJJ A;  1YHQ V;  1K9M W;  1K5S A;  3ZMV A;  4N23 A;  3OMI B;  1Q7Y W;  3X2Q C;  4BW5 A;  1R3K C;  2WLN A;  3E83 A;  1BHA A;  1S3J A;  1VQ6 V;  5IYC O;  5KUM A;  3STZ C;  2IU0 A;  3TCU A;  1E79 G;  2K1E A;  2EIN C;  3AG4 C;  1M56 B;  2Y69 C;  3H01 A;  5IY5 B;  1KQS U;  3EHB B;  5B1B C;  3SPJ A;  1YI2 V;  1FXK B;  2JJ1 G;  1GM7 A;  3FB5 C;  4QPK A;  3T2M A;  3FB6 C;  3QO8 A;  4MSW C;  4MVZ A;  4QE7 A;  4I5S A;  1PKX A;  3JD4 A;  3CD6 V;  5L3D A;  4Z1M G;  4MW3 A;  4PA4 A;  1V55 B;  3R65 A;  1Q82 W;  3SPC A;  4BAY A;  3LDD A;  3CCE V;  3K06 A;  3B8M A;  2X6C A;  3QO5 A;  3OGC C;  5EC2 C;  3ZN1 A;  4FMT A;  3ABT A;  5H9C A;  2EJR A;  2Q68 A;  3E8G A;  1P7B A;  1Q86 W;  1R3I C;  1SET A;  3OR7 C;  1M56 C;  1MAB G;  4N21 A;  2P67 A;  4XDJ A;  5IY5 C;  1R3L C;  4QPJ A;  1FXK C;  1DLB A;  1MOF A;  1NBM G;  3PJS K;  1ROP A;  1FXH A;  2LFS A;  3SYP A;  4WFA V;  3DGE A;  1H2G A;  2F43 G;  4TT3 G;  1NVP B;  2R9I A;  2BOB C;  3FKS G;  5H6R A;  2QM7 A;  2NLJ C;  3W7S A;  2WPD G;  4CZZ A;  1V55 C;  1VQK V;  1V54 B;  1M9N A;  4LC1 A;  4MT8 A;  4JTD B;  5B1N A;  5H6Q A;  1BMF G;  4U7N A;  3RBZ A;  4GX5 A;  1FXK A;  3W7T A;  3E8B A;  2DW4 A;  1JOY A;  2KB1 A;  3AG2 B;  3M99 B;  4R50 A;  2WWW A;  1G4Y B;  1AJN A;  5LHG A;  4X8A A;  3RVY A;  1DTO A;  2BOC C;  1DF4 A;  4MTF A;  1MSW D;  1N8R W;  3G4S V;  2HKO A;  1K73 W;  3F7Y C;  3FYI B;  3K0G A;  4R7C A;  1DF5 A;  3STL C;  4MVO A;  1QR8 A;  3SYQ A;  2B1I A;  3W7U A;  1COW G;  1V54 C;  4H37 A;  3CPW U;  1J95 A;  5KA6 A;  1FFT B;  3MD0 A;  4TSF G;  4HYO A;  1B6Q A;  2JEU A;  3KG2 A;  4MVR A;  4WFB V;  1FXV A;  2OT5 A;  1OCR B;  2WLH A;  3AG2 C;  2ZD9 A;  3WFV A;  1YJW V;  2HVJ C;  3SPH A;  1QVG U;  4UUJ C;  2H94 A;  1YIT V;  1VQ9 V;  3ZMT A;  3T1C A;  1R6N A;  2OCC B;  1IXM A;  3F7V C;  4RQE A;  3OM3 B;  3ABL B;  1M57 B;  1W2B U;  5EBW C;  1JPX A;  2W6I G;  1SRY A;  5KUK A;  2HVK C;  2A9H A;  4XDL A;  3RW0 A;  5FL7 G;  1NR1 A;  5EC1 C;  2UXX A;  1OCR C;  2X6A A;  3QO7 A;  5DM6 V;  4F4L A;  2A79 B;  2W0F C;  5L3G A;  3E35 A;  4UVC A;  2DYR B;  4RAI A;  3ABK B;  4JGS A;  3JYC A;  1NQT A;  3CCJ V;  3LDC A;  3E8H A;  4GT1 A;  5L3F A;  2OCC C;  1RPO A;  1KKD A;  1BL8 A;  1TUE B;  3ABL C;  1M57 C;  4KFM A;  3WG7 B;  1VQ5 V;  3CCR V;  1K97 A;  2IJH A;  3CCQ V;  3JD3 A;  2EZO A;  2EIJ B;  3ZN0 A;  4X88 A;  4PEL A;  2EIL B;  5L3E A;  4P9P A;  1VQ4 V;  1S77 D;  2IJK A;  2P7T C;  2DYR C;  2MK3 A;  3ABK C;  2XOK G;  4WCE V;  2QTO A;  1EFR G;  3OUF A;  4KUM A;  3W7W A;  4P9O A;  1SER A;  3ETE A;  1KC8 W;  4LP8 A;  4PA6 A;  3K08 A;  3K79 A;  3WG7 C;  1M90 W;  5KA5 A;  4WF9 V;  1Y4M A;  3OEH G;  2ZQM A;  2ZR2 A;  2Q67 A;  3D36 A;  2WLI A;  1CPY A;  1OCC B;  4R6Z A;  5L3C A;  2EIJ C;  3A0R A;  2WSS G;  3ZRV A;  3OR6 C;  5B3S B;  2YEV B;  3QNE A;  2QE7 G;  4JF3 A;  3CCL V;  5EK0 A;  3CME V;  3CP1 A;  4JAU A;  3IC7 A;  2XAF A;  1PL0 A;  1YJN V;  4PDR A;  3JCZ A;  4QE9 A;  3OMA B;  4EKW A;  1RPR A;  2DYS B;  1E1R G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...