1QR9A

Inhibition of hiv-1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQATVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of human immunodeficiency virus type 1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion.
pubmed rcsb
molecule tags Viral protein
molecule keywords GP41 ENVELOPE PROTEIN
total genus 27
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qr9A00
3B77A 1SZTA 1I5XA 1K33A 4JPRA 2X7RB 1ENVA 4G2KA 4N23A 1Y4MA 5H9CA 1QBZA 5HFLA 1K34A 4JGSA 1QR9A 1QR8A 3MHSC 4JF3A 4FK5C 3K9AA 1I5YA 3WFVA 4E2LA 5HFMA 1MOFA 1DF4A 3P30A 5KA5A 2OT5A 4FIPC 4N21A 1Y66A 1JQ0A 1QCEA 2EBOA 2MK3A 3CYOA 3MHHC 1DLBA 2LP7A 5CN0A 3B8MA 3CP1A 2P6JA 1DF5A 3B8NA 2EZPA 4FJCC 5CMUA 5KA6A 1EBOA 1MG1A 2EZOA 1JPXA 3M99B 3GWOA 3H01A 2M7WA 1F23A
chains in the Genus database with same CATH superfamily
1I5XA 3ABMB 2YXHA 1RSOB 2H8PC 4J9ZB 3ZEDA 2IJJA 2KSDA 4BW9A 3J80N 1TVKB 4U7NA 4JAVA 1AR5A 1M4UA 1AP6A 2KQXA 4F6EA 2DYRC 1GN6A 3SYAA 5EC1C 4GKJB 3RYIA 4DR4O 2O57A 1F51A 1Z5VA 1XOUA 2RQ6A 2XAQA 3FB7C 1KKCA 4OPHA 5B5EZ 4PA4A 2WLIA 4JF3A 1EN6A 4JI8B 4YIPA 4DV7O 3OMIB 4U7OA 2LQTA 2CAZC 2JEXA 2XASA 2OYQA 3UO2A 3FB6C 4OX9O 3N2KA 4RUFA 2Q4PA 4FLZA 4LFAB 2AW9A 4R8CA 5A9GA 2UXCB 3SR2C 5LGTA 4DR6O 4KP4A 5IWAO 1P49A 2EULA 2YEVB 5LGNA 4PD4F 5IT9N 3B2EE 3SPGA 4FM1A 3RT3C 1QVGU 3ML0A 2X6CA 4E2LA 3P30A 1JVMA 3LUTB 1H2KA 1MSDA 4LP8A 3BPZA 4Z1VA 1L1FA 4FM2A 3WG7B 1NJIW 3AG3C 5KA6A 1N4CA 1BT8A 1EBOA 4YHHO 1ZAUA 3K79A 3K5OA 2H3OA 2ZIOA 5CA0A 2CH7B 2NN4A 1WNSA 4TWKA 1S3JA 4E4EA 5IYZA 1V9PA 3UKMA 1B06A 1XILA 4DV2O 2JGDA 1G8MA 4LF9B 3HKBB 1WP7A 1AJNA 2IJIA 1L8DA 3W7XA 2UUBB 2XOKG 3SPJA 5IY5B 1JR9A 3CJHB 1VQMV 1XEQA 4D7SA 2UUBO 4JPRA 2EJ7A 1D5AA 2WLNA 3LSUA 5LP6A 2JJ2G 2RMKB 1SQVH 3T2MA 2L6LA 1EN5A 3AG7A 1CP9A 2HG5C 2PGGA 2DN9A 4EKWA 4DW1A 5GTHZ 3E8HA 3QF7A 3SYCA 3BRCA 2GV9A 1PL0A 3KG2A 4YHHB 2WSSG 1YITV 2Q69A 4OPAA 1SA0A 3CWBH 2GBOA 1U96A 2WAMA 3JCUZ 1SA0B 4U3JB 2OCCC 4TV8B 4JI5O 3HKCA 3OW2U 1HWYA 2WPDG 5KAFZ 2QR4A 2EIMC 1XHXA 2QWOB 1H2LA 3SJBC 2G38A 2ZIMA 3L9DA 1URFA 2UUAO 1KBHA 3BA9A 4WFGA 4WFFA 5EZYB 1XHZA 2RJZA 4I55B 4H13B 3OUSA 5EZYA 3AEIA 1AR4A 4LWSA 3J81N 4AILC 5CMUA 2Q7EA 3CPWU 2F1MA 4DR4B 1ZUQA 5KHIA 1F23A 1VARA 3RVYA 5EBWC 3DC6A 3EXAA 4BR6A 3T1YB 3QVNA 4JI6B 4DR7O 2UUAB 1I5YA 4J7KA 1AILA 2Q7HA 3CMEV 4BAYA 1AROP 3HPLC 2Z0AA 5FL7G 1RPRA 5KLVH 4QNHB 1S5HC 2FKXA 3JAKB 1YXBA 3H1KH 5DM6V 4UCTA 1IDSA 5ITZA 5DECA 4U3FH 5D5QA 1R73A 4LCUC 1UJWB 3OD4A 4UFZA 1ROPA 1XL4A 1K5QA 4JYYA 1O9GA 4FIPC 1FS0G 4I50A 4R6ZA 1Y76A 1KP3A 5BMVB 4L87A 1NTZH 4LC1A 2BCCH 1HNXO 2N04A 4RUEA 1NR1A 4BIZA 4TV9A 3AG1B 1Q43A 1GM9A 5JJEB 4O4JB 3OMAB 4A5UB 3U0ZA 4X64B 4X8AA 2K1EA 4PA3A 1DTOA 4GYCB 1QCEA 4FFKA 1N36O 1AVMA 4EB6B 5LHHA 5IY5C 4DV0B 3ETQA 5CBGA 1XNRB 2CUGA 4LF9O 5B3SC 1QVFU 1BCCH 4DV2B 3ABTA 1JFFB 1GM7A 3L73H 4I9QA 2YIDA 1BSMA 4LF6O 4UCVA 1KU9A 3OFNG 3SJAC 2UXNA 1AI4A 3ZHVA 1N34B 2P6JA 5ITZB 2W6JG 3K5MA 2IJHA 4I7ZB 2YUAA 1D2DA 3KCYA 5BR8O 3K3WA 4WF9V 1AJPA 4X66O 4H44B 5DEDA 1H2NA 2JGDB 4JI3O 2LW1A 4NB5A 2YI8A 1IXMA 5KUKA 1H8HG 2EX3A 3S3XA 4LFAO 1PNLA 1I08A 3A2FA 4MVMA 1AB3A 3QO5A 2Q9LA 4I0XA 5LBQA 1AP5A 1BE3H 4QE9A 2XTAA 1OCRC 1JJ2U 5BMVA 1OCOB 2VQEO 1QR9A 2RCVA 3MHSC 4Q20A 3K9AA 2YIBA 2HVJC 2NR5A 1PD3A 5KMGA 5JJJB 5KA5A 4R50A 4IHJA 3ZHRA 4FPPA 4DV5O 1K9MW 4B3SO 1JFFA 3CRMA 3GWOA 3DSQA 2DYSB 3CCEV 1PNMA 3HR0A 1Q6UA 4DUYB 3GB7C 4CS4A 2QKCA 3BVOA 5KHKA 3T1HO 2CTRA 1WP8A 4U3JA 3A0HZ 5IJ9B 3AG2B 4AI8A 2F66C 4EFBA 2YIBD 1V54B 3TK1A 2EILB 4X20A 2R9IA 3OT7A 4JYAO 3AG4C 1VQ8V 1VF6A 1B6QA 4FLTA 3CS5A 4PDRA 3E22A 2ZXWC 2ETNA 4X1KB 4JI1O 4HYOA 4F4LA 2DQ3A 2VWKA 4O4IA 2QSAA 2JK5C 3G71V 3TXQA 3K5LA 1S72V 3OTFA 4KFMA 4H37A 5GONB 1CXZB 3ZMTA 2Y0PA 1GRJA 1JPXA 3H01A 5H5NA 3OTOO 5B1NA 3K03A 2IM9A 1IBMO 4UUJC 4OGQB 4RQEA 1NI8A 2XT9A 4CH4A 1US6A 2ZD9A 3H1HH 1JOYA 2QKAA 3RYFA 1NH2B 4MT8A 1YI2V 2E76B 4FLVA 3B8NA 2NNUA 1J5EO 2EIKB 2JRIA 4J41A 1P7GA 3SYQA 4KUMA 4RAIA 1XMOO 1EN4A 3CX5F 4PJ0Z 5CB4B 2GSMB 3G6BA 3UO3A 2LW7A 2OIGA 1EM1A 3CCRV 3F5TA 3B8MA 5KHGA 2ZCEA 3QG5A 3AK3A 3CCUV 3RYCB 5B1AC 1CEZA 2JS5A 4L8JA 1IURA 2F43G 5KMGB 4DV6O 3F7YC 3OEHG 2OCCB 3ETEA 3JSNA 5J2TB 3N27A 1YVWA 4GUNA 1SC5B 4KXRA 4JI1B 3ZRWB 3UCSC 4FJCC 4DUZO 1XMQO 2WA3A 3D36C 5LXTA 1M1KW 1G4YB 1BL8A 1NZ6A 1Z5WA 2QGNA 2FMLA 1RPOA 1SQBH 2HKOA 4IIJB 4JTCB 1Q86W 2MW2B 2R72A 4MS2A 4EFEA 1DF4A 5LP6C 3CCSV 4D6TH 4JAAA 3K9SA 3TGUH 4FVMA 1KP2A 4O4IB 4FZ1A 2Z3YA 3SPCA 2X7RB 4DV5B 1R6KA 1WPXA 1Y4MA 3FX7A 1Q6HA 1QU7A 4J7ZA 2ZR3A 3AG2C 3VQXA 2VQEB 1BQ0A 3RW0A 3CYOA 3ZN0A 2XAGA 4JZ2A 3M7MX 2IW5A 2PTMA 4BIUA 2OCHA 5IJ0B 2LJ2A 1K3EA 2YIAA 5IJ0A 1Z2GA 3BEHA 3K06A 3CCLV 3BA8A 3ASNC 3THOA 2BE3A 4Q6GA 3STZC 1QR8A 1QLEB 2AHYA 5JQGB 5E1AC 3SYOA 1JQ0A 1NR7A 3FYIB 1RSOA 1HW7A 1NQTA 3F5WC 4K8XA 4YJ2A 4LH7A 4J10A 2D3OW 2ATKC 5JCOA 1N34O 2QWQB 2UUCB 4UVBA 5FPOA 2YXYA 4DV1O 3VBBA 1FJGB 3ZRSA 1VQOV 2YICA 4PA7A 2RDCA 1TA8A 2EIKC 2EJRA 2F93B 3SGIA 1WN7A 1XNRO 2PI4A 2B1GA 1THZA 3E35A 1JMKC 3UM7A 5HFLA 2DYSC 1NTKH 2P90A 1HR0O 3KKYA 1SQFA 5B3SB 4X64O 3ABMC 1FYJA 4NVPA 4DV3B 2A79B 2ZE5A 2YC0A 2B1IA 1HNXB 1IX9A 2ZE7A 2A9HA 4LF8O 1WAZA 2YI9A 1PNKA 2WLHA 4X1KA 2EINC 2IU3A 4UCUA 1Q82W 4HZ3A 4UVCA 1AI6A 4MSWC 4PA9A 3G6EV 3K04A 4DR5O 2ZXWB 3SYPA 2EINB 2V4DA 3CCQV 3LSSA 4FLUA 4UV9A 2EILC 5H6RA 3L75H 2UU9B 4LF5B 3IFXA 4WFAV 4JI4O 1W2BU 4PI0A 2BSKB 4RWUA 1HDJA 4LFBO 3SJQC 5K1XA 1QBZA 4JGSA 4D7TA 1BGYH 3B40A 5EIBC 1Y66A 4IGGA 3RYHB 4JI6O 3RYIB 3T1YO 3P32A 3H1JH 4XDKA 2N05A 2F4VB 2UXDB 1RFYA 4I50B 1O9HA 1MG1A 4O2AA 1OHHG 4FLWA 3RYCA 4O2AB 3OUFA 2B9ZA 2HJFC 1K8AW 3AK1A 3QO8A 5IE9A 1YJ9V 4UCSA 1N33B 1IXBA 1EZVH 3DXRB 3N2KB 4GCZA 2WLKA 2DMXA 1GH6A 2DWDC 4HBNA 2XNDG 1PV0A 4X65O 1WJZA 1VMGA 5LMUO 5LGUA 2OTLV 1F7YA 2CK3G 3SJCC 1FD9A 5F2VO 3UQ8A 2Y48A 2ZQMA 3C3TA 1MSWD 4JTAB 5CA3A 1XDCA 1Q6IA 2OT5A 4JI5B 2JJ1G 1FAFA 5A2QN 1FFXB 1IBLB 1IBLO 1VP7A 1QLEC 2QE7G 1OCZB 5H6QA 2IJKA 2PF4E 5CB4A 1EFRG 1Q7YW 2OIEA 2P7TC 4H33A 3HKBA 3JAKA 3Q4HB 1R6NA 4FK5C 1CPYA 3IAYA 1NU1H 1R3LC 3R65A 4W4LA 1SETA 4N21A 2VS0A 5CA1B 2DE0X 2Y69C 4DR2B 1BHBA 4KL1A 1FXKB 2Q68A 4X88A 4PELA 3PN1A 3RYHA 1FXKA 5JVDB 4DYLA 3CCJV 3X2QB 4GLXA 1IBKO 1QNMA 1VF6C 2QM8A 1OZ0A 3W7UA 4B7KA 4XDLA 4DRXA 3CXCU 4LNUA 2WLLB 4NTWA 2YEVA 4DR1O 1VQ4V 1SF9A 5FPRA 3BY6A 4HAMA 1KUQA 3CJHA 4MVOA 1YEWA 2QEXV 3O9OA 3ZCCA 2PYLA 5LHGA 5KUMA 4X62O 4JYBA 3K59A 1ZX3A 1YHQV 3ABLC 4LF5O 4DK1A 3VQVA 3RVZA 2ITCC 4LH6A 2JDIG 1FFTB 4ZI7B 2KG7B 1F4MA 2WLMA 2LGWA 2EBOA 5JJNB 5L3FA 2V1DA 4GX0A 1AR1B 5IWAB 4LF4O 3K08A 4MVUA 2UXCO 2R9AA 3JAMN 1QQCA 4NXMO 1SZTA 4J42A 1XNQO 4OX9B 3E8FA 4TUYB 4YIOA 3ASOC 4DV7B 4LF8B 2HLDG 2W0XA 2ADPA 1LR1A 2IH3C 3VOUA 3HB3B 4WFBV 2WLIB 3IGAC 4DV3O 2DJVA 3I56V 4WFHA 1JJOA 2E5LO 1HNZB 3C3SA 3WB2A 4G27B 1D5NA 1OV9A 2N74A 4GKJO 3M8AA 5JH7A 3L74H 4P9PA 4IYHA 5L3CA 1W59A 4JI2O 2EIJC 5IYDO 2OTJV 4IIJA 2P22C 4NR1A 1H8EG 1KC8W 1FXKC 3STLC 1XREA 2CTQA 4UB6Z 3B77A 4LF7B 2HHHO 5KHHA 4MTGA 3ABKB 3HKEA 4FFBB 2BTQA 4ZI7A 1I0HA 2UUCO 4K0KB 3CCMV 2QTOA 2BTQB 3U10A 2B5UA 5EBLC 2PUSA 1RP3B 4JV5O 4O4LA 3B4SA 1HP8A 2DOSA 3BFRA 4NTYA 4EEQA 2EZOA 2BOBC 5FLXN 1UFIA 2ZDIC 1M9NA 1N32B 1QLNA 1COWG 1ZLZA 2AXTZ 1VQLV 3BCCH 3NR7A 3RGBA 2QM7A 4X1YA 5IYBO 4I0XB 4X1IB 1K97A 3L70H 1OCZC 4UCRA 5BY1A 2ZE8A 1N0JA 1DF5A 2QM4A 4P30A 4NTXA 1NVPB 3VQYA 4LFCB 4ZOLA 5E79Z 3FAVB 4F6RA 2E75B 3G4SV 2A06H 3AG3B 3CC4V 2ZNJA 4X1IA 4X9QA 3Q4HA 2A7WA 1SKVA 1R3KC 4FLXA 1SRYA 2A3QA 2AHZA 1DLBA 1QHTA 2QWRB 1K4DC 3OE7G 4MTXA 3KZIZ 2QWNB 5LYJA 2DW4A 4DXWA 5GONA 3LDDA 2GDSA 1K73W 2ZM6B 1M57C 4JI0O 3CCVV 1M5IA 2MK3A 4DV4B 1FFXA 4DUZB 1U97A 2VWJA 1NT2B 3RFRA 1W0JG 1ZL8A 5JCOC 2R9RB 2FL4A 1R3JC 2JGUA 3DXRA 4JI7O 5JVDA 4DV4O 3OAAG 5LL6Y 3P3PA 4GKKO 1PPJH 4P9OA 1GK9A 1XUQA 4YJ3A 3WB1A 1V54C 4CH6A 1VQNV 1GKFA 3M99B 4MW3A 1I94O 4ASUG 3OGIB 2PI5A 4UVAA 5FNVB 1XMOB 1M90W 3ZIAG 4B08A 4MTFA 5JQGA 1J5EB 2XAHA 2FB5A 2WA4A 4B3TB 3APOA 1TUEB 1YJNV 2EZPA 4LFCO 4CZZA 3LDEA 4KHPO 3EHBB 5IYZB 3P3NA 5L3GA 1KMIZ 4WBNA 4FM0A 5J2UA 4G2KA 4TOIA 3JALA 4O2BA 4B3MB 1IBMB 1OCCB 4J7JA 3CRCA 2ARHA 1KB9F 1X4TA 4O4JA 2HEPA 2CH7A 4UV8A 1G1XB 4QGPA 1OCCC 2GHYA 3ZX6A 2CTPA 1N32O 2GUZA 4JYCA 4W4KA 2Y4TA 5JH7B 3ZJZA 4CH5A 3E22B 3ASNB 3RN4A 1NVPD 1MABG 5AG2A 3ICXA 1KD1W 1WPBA 4TSFG 1W0KG 4GT1A 3H1LH 5C93A 3K5NA 2HR3A 4JYAB 4KHPB 1Y67A 1KQSU 5TISZ 4I4TB 2AGAA 2OWOA 1NTMH 3QO7A 5JWPA 3L71H 3E8GA 4LF7O 2QJ1A 4K35A 2P4VA 1ZWIC 4TV8A 2CE4A 3JD4A 4YJ3B 1GM8A 1B04A 5B1OA 1LUVA 4DUYO 3CB2A 2ZE6A 4GX1A 4MTOA 1BHAA 3JD0A 1R6TA 4Z2WA 3MHHC 5CN0A 3K58A 2Q5ZA 4CC6A 1MZFA 4J80A 1HNZO 5LP6B 5LOVB 4X1YB 5EK0A 4GKKB 4MVSA 1TUBB 2F23A 3GWKC 1K7DA 5H9CA 1DGSA 2CDYA 3B09A 2IH1C 4IYIA 4OXSA 1WB7A 2CTWA 3LNNA 4PA6A 3JSLA 3OGCC 3T4DA 1YCIA 4MVQA 4NXNB 1MZEA 3OR6C 4XDJA 1XNQB 1S0VA 4Z1MG 4JI0B 1VF5B 4AQYB 3PJSK 1G6UA 5K1PA 2ZM6O 3RWRD 2HFEC 2V7QG 2M6YA 3ETDA 1F4NA 4ZOLB 3CRQA 3UT5A 4X66B 3D3IA 4DR3B 4K8ZA 3APQA 2QA4V 2ZR2A 5BR8B 2KB1A 3BHPA 3IC9A 5GW7A 1L0NH 5CA1A 1GMGA 4X62B 1KECA 1VQ7V 3JALB 4O2BB 1MNGA 2ZKOA 2KG7A 2M7WA 4B3RB 2ZT9B 3RYFB 3JD1A 5GTIZ 4IL6Z 1Y74A 3JCZA 5B66Z 3ZMVA 3WFVA 2UXBB 2P67A 3EVKA 4TT3G 3X2QC 2WLJA 2YS8A 1GN3A 1K92A 3W7SA 2LGQA 3N2GB 3DC5A 4DR2O 1BZKA 5CBHA 3ZS8C 3HKCB 4RQFA 1PKXA 1BMFG 5BZBA 4GX5A 2DYRB 1HNWO 2Y0IA 4FFBA 3CP1A 3ZHTA 2XUMA 4F6RB 3TCUA 3T4ZA 4JV5B 4ICGA 1BQZA 1S77D 3ETGA 4DW0A 3SDLA 2ZNIA 3FB5C 1SESA 4UXNA 4I55A 3ZMSA 1XBLA 2L35A 1TVKA 4CBCA 4O4HA 1SS3A 1TUBA 2X6AA 4JTDB 3RBZA 1H2GA 3JD2A 2GUZB 3G67A 5LMUB 2Q67A 4TUYA 4JI2B 4X65B 1S5JA 1SQQH 4DR7B 2A0LA 1GN4A 3HKDA 3KCXA 1E1RG 3AG4B 4LBEC 5LYJB 2E5LB 2EIMB 2QTSA 4UCOA 1BS3A 2VRZA 1XI1A 3FAVA 4J11A 3CMAV 1I7FA 1K33A 1OCOC 3TETA 1YTFB 2X6BA 1KYOF 3QNEA 1VQPV 3I55V 4J9YB 2ODMA 2Q7GA 4NXMB 5EIBD 4FMTA 4YJ2B 3ZN1A 4LF4B 3ZHQA 3NXSA 1M56B 1ZSPA 2HVKC 1Y74B 3ZHUA 3OEEG 4LFBB 3WG7C 5L3EA 1YSCA 2IBZH 2UXXA 2ZDIA 3SPIA 4ZKIA 1WA8B 1ORQC 1H38A 1KKDA 2D2CB 2WLLA 1K5SA 2GTAA 3D3QA 4PI2A 1P84F 3OMNB 4NYKA 4O4LB 3FKSG 2NLJC 4YXWG 1YDXA 4DR1B 5C8YA 3ZRWA 4TV9B 3ABUA 4JASA 3F7VC 4CS2A 3D8CA 1EZJA 3FD9A 1V55B 4O4HB 4N23A 3H9VA 1XQ8A 3O65A 5EC2C 1IBKB 2P5OA 5D5PA 2Q8VA 3JASA 2QWPB 3CC7V 1RM1B 5IYCO 3CE2A 4WBNB 1HR0B 4GX2A 4NKGB 2P4KA 2Q0AA 2YXLA 3ZHSA 1WLEA 1X59A 1Y6XA 1VQKV 1T5EA 1H2SB 3CRAA 3JATB 3ZMUA 3JD3A 1SERA 1NH2D 4MW8A 3VQWA 2GTSA 5CA0B 4QIWF 1YIJV 3S3WA 2Y4UA 1VQ6V 2QKSA 1FJGO 2YSUB 4CC5A 4DV1B 5J2UB 2JS3A 3HKEB 1NKDA 3C90A 4XBFA 3FYEB 5IJ9A 1Q90D 3CEIA 3AG1C 3G80A 3IC7A 1HNWB 3CXHF 2Z5UA 4DR6B 3TXSA 1FXHA 4R7CA 2R70A 1M56C 2LO1A 1VF7A 1FPOA 4RO2A 3N2GA 5BXZA 1N33O 4JI8O 2E3CA 1SQXH 3ZBHA 4GZRB 3WU2Z 5H2FZ 2XAJA 3TJTA 3CC2V 1PP9H 3A8TA 4DRXB 3A0RA 5EYPB 3BABA 2UXBO 2CGOA 1J95A 5LXTB 4TQFA 5LA6A 2F4VO 2UXDO 2BSKA 3MAQA 1FXVA 4ZIBA 1NBMG 4B3RO 3A0BZ 4BWAA 3E2EA 5C8YB 4JI4B 1A32A 5DN6G 2PY5A 2UU9O 1K4CC 4DR3O 4UB8Z 5LHIA 5B1BC 3WB0A 2IU0A 3AK2A 4DR5B 1JA8A 2JIZG 2H94A 3ZRXA 4ABMA 4YY3B 3U11A 4AQYO 1S76D 1R3IC 4MVRA 1R1BA 2JVDA 4ZBMA 1XMQB 3LSQA 2Q73A 4NXNO 4K3AA 3E8BA 4BW5A 4PHZA 4FLYA 2C2AA 1SZXA 2ZINA 3DTUB 1Q81W 3ABKC 1M93A 4DV6B 4PDMA 5LMNO 2PZSA 1V55C 3K0GA 2XHBA 1YF2A 2W0FC 1E1QG 3HKDB 2AZ0A 1P7BA 1GTOA 5LA6B 4C7UA 5B1AB 2RNBA 2LFSA 2YDEA 2LP7A 4FZ0A 4I4TA 3ZRVA 3L72H 1S5LZ 4LNUB 1ZTEA 1YTFD 4CH3A 1E79G 1GN2A 3ASOB 3IJ4A 4X20B 2ITDC 1H2MA 4HNAA 5L3DA 5IDJA 2BTOA 3DGEA 3W7WA 3K57A 4I9WA 4EB6A 3D36A 2VQFB 2P06A 1JX9A 3OTOB 2CGNA 2HP8A 4IT5A 4I5SA 1AI5A 3ZMZA 3MDSA 1FKAO 3J7AU 3K0DA 5J2TA 5KX5A 3EFFK 3JATA 4B7EA 4B3MO 1TGOA 1Y76B 1TAEA 3E86A 3ABLB 4IHJB 2W6IG 3SPHA 2KKWA 4X89A 5J9PC 3I5DA 1P4RA 2F95B 4ZHQB 1IZ3A 1OJHA 4AHCA 4B3TO 2LFRA 1WB8A 1VEWA 4G28B 3T1CA 3T1HB 1GO3F 5EBMC 2Q6AA 5KAIZ 4PDVA 4DK0A 1I94B 2DWEC 1GAXA 4B3SB 1L0LH 2Y69B 1PM9A 4QJFB 3CD6V 5EYPA 3LNMB 2JEUA 4DO2A 3W7TA 1UPGA 4WCEV 3BAAA 4JI7B 2QDOA 1VQ5V 4P2ZA 3FB8C 4PV1B 1IVSA 4BIOA 3E83A 3JASB 4QE7A 1Q5OA 1AI7A 1Q3EA 2X0LA 5LOVA 3OM3B 2FTKA 3H1IH 3OR7C 4JI3B 4H0LB 2EIJB 4LR3A 2VQFO 2HJDA 5CBFA 4TQDA 1B3QA 4MVZA 5L3BA 3LDCA 3JARA 1M57B 1SQPH 3JYCA 3JARB 1LUWA 1PL4A 1MMMA 4QPJA 4HNAB 4JAUA 2XAFA 5HFMA 1MOFA 3GVMA 4QPKA 4ZHQA 1MA1A 3CSXA 5KHJA 4LF6B 4LWSB 1N8RW 1AJQA 1YZBA 2E74B 1Q8IA 2FYUH 3MD0A 1VIBA 1RM1C 4WFEA 3CRRA 4DV0O 1DK1A 1ENVA 5KX5B 1N36B 5FNVA 1K34A 3E89A 1YJWV 2PYJA 5LMNB 1LNQA 3QTCA 2AZ2A 1N0NA 2Q0OC 3JAWA 4PDLA 1NS1A 2RN9A 1XL6A 3JAWB 1OCRB 5B1BB 2DQ0A 3FFQA 2BOCC 3R66A 1ZL8B 4JZGA 1VQ9V 1SQGA 1JCHA 3CHXA 4YY3O 4CS3A 3UT5B 4K0KO 2ILMA 2ADQB 2K9PA 1WA8A 2HHHB 2WWWA
chains in the Genus database with same CATH topology
3B77A 1I5XA 1ORQC 3ABMB 3SYQA 4KUMA 2H8PC 3ABKB 4MTGA 1H38A 1KKDA 4J9ZB 2WLLA 1K5SA 4RAIA 2IJJA 3OMNB 3CCMV 2QTOA 4U7NA 2B5UA 4JAVA 3FKSG 2GSMB 5EBLC 2NLJC 4YXWG 2DYRC 3CCRV 3SYAA 3B8MA 3ZRWA 5EC1C 3CCUV 5C93A 5B1AC 2EZOA 3ABUA 1CEZA 2BOBC 4JASA 3F7VC 2ZDIC 1EZJA 1M9NA 2F43G 1F51A 1QLNA 2XAQA 1COWG 1V55B 3FB7C 4N23A 1VQLV 3F7YC 3OEHG 2OCCB 5EC2C 2QM7A 5IYBO 3ETEA 4PA4A 2WLIA 4JF3A 3CC7V 1RM1B 1K97A 5IYCO 1OCZC 4GX2A 1WLEA 3OMIB 4U7OA 1VQKV 2JEXA 3ZRWB 2XASA 3FB6C 1DF5A 4FJCC 4RUFA 4P30A 3ZMUA 3JD3A 4R8CA 1NVPB 5LGTA 1SERA 1M1KW 1NH2D 4MW8A 4KP4A 1G4YB 1BL8A 2YEVB 5LGNA 4QIWF 1YIJV 1RPOA 3G4SV 2HKOA 3AG3B 3SPGA 3CC4V 1VQ6V 4JTCB 1QVGU 1Q86W 2QKSA 2X6CA 3ML0A 4E2LA 4MS2A 1DF4A 3P30A 1JVMA 3LUTB 1R3KC 1SRYA 2YSUB 3CCSV 4LP8A 1L1FA 2AHZA 3WG7B 1DLBA 1NJIW 1NKDA 3AG3C 5KA6A 1EBOA 1K4DC 1KP2A 3OE7G 4XBFA 3K79A 3FYEB 4MTXA 2Z3YA 3SPCA 2X7RB 1R6KA 2DW4A 1WPXA 1Y4MA 3AG1C 4DXWA 4TWKA 1S3JA 3IC7A 3LDDA 3UKMA 1K73W 2Z5UA 1M57C 2ZR3A 1G8MA 1FXHA 3AG2C 4R7CA 3CCVV 3RW0A 1AJNA 2IJIA 2MK3A 3CYOA 1M56C 3W7XA 3ZN0A 2XAGA 2IW5A 4RO2A 4BIUA 2XOKG 3SPJA 5IY5B 1W0JG 1K3EA 1VQMV 2R9RB 4JPRA 1R3JC 3BEHA 3K06A 2XAJA 3CC2V 3CCLV 2WLNA 3OAAG 3ASNC 3STZC 1QR8A 4P9OA 2JJ2G 3A0RA 1QLEB 2AHYA 3T2MA 1J95A 5E1AC 3SYOA 1CP9A 2HG5C 1JQ0A 1GK9A 1NR7A 3FYIB 4EKWA 1NQTA 3F5WC 3E8HA 3SYCA 1V54C 1FXVA 1VQNV 1GKFA 3M99B 1NBMG 4MW3A 1PL0A 3KG2A 2WSSG 4ASUG 1YITV 2Q69A 2D3OW 2ATKC 2PI5A 3E2EA 4UVBA 2WAMA 4UVAA 1M90W 2OCCC 3ZIAG 5DN6G 3OW2U 4MTFA 3VBBA 1K4CC 1HWYA 2XAHA 3ZRSA 2WPDG 2EIMC 1TUEB 1VQOV 5LHIA 4PA7A 5B1BC 1YJNV 2EZPA 2IU0A 2EIKC 2EJRA 3LDEA 4CZZA 2JIZG 3EHBB 2H94A 3ZRXA 1S76D 1R3IC 4MVRA 2PI4A 5L3GA 4ZBMA 3LSQA 2B1GA 1THZA 4G2KA 3E35A 4WFGA 3UM7A 3E8BA 4WFFA 5HFLA 4BW5A 1OCCB 2DYSC 2P90A 2C2AA 5B3SB 3OUSA 3ABMC 3DTUB 1Q81W 3AEIA 3ABKC 4UV8A 2A79B 4PDMA 1OCCC 5CMUA 2GHYA 2B1IA 3CPWU 1F23A 4JYCA 3RVYA 5EBWC 1V55C 3K0GA 3ZJZA 2A9HA 1PNKA 2W0FC 2WLHA 3ASNB 1E1QG 2EINC 1NVPD 1P7BA 1MABG 1GTOA 1KD1W 5B1AB 2IU3A 4TSFG 1I5YA 1W0KG 3CMEV 4GT1A 1Q82W 4HZ3A 4BAYA 1AROP 2HR3A 1AI6A 2LFSA 3HPLC 4MSWC 4PA9A 3K04A 4UVCA 3G6EV 1KQSU 5FL7G 1RPRA 2ZXWB 3SYPA 4QNHB 2EINB 2LP7A 3CCQV 3QO7A 3LSSA 3E8GA 4UV9A 2EILC 1S5HC 5H6RA 3ZRVA 1ZWIC 5DM6V 3IFXA 4WFAV 3JD4A 1W2BU 1YTFD 1R73A 4LCUC 3SJQC 1GM8A 1QBZA 1E79G 1UJWB 4JGSA 5B1OA 3ASOB 4GX1A 4MTOA 1ROPA 1XL4A 1K5QA 1BHAA 4FIPC 2ITDC 3JD0A 1FS0G 1Y66A 4R6ZA 3MHHC 5L3DA 5CN0A 3DGEA 5IDJA 3W7WA 3P32A 4XDKA 4I9WA 1KP3A 3D36A 4L87A 1MG1A 1JX9A 4LC1A 4RUEA 1OHHG 1NR1A 4BIZA 5EK0A 4MVSA 3AG1B 3OUFA 1AI5A 4I5SA 3ZMZA 2HJFC 1GM9A 1K7DA 5H9CA 1K8AW 3QO8A 2IH1C 4OXSA 1YJ9V 3OMAB 4X8AA 2K1EA 4PA3A 1DTOA 3K0DA 4PA6A 4GCZA 3EFFK 3OGCC 3T4DA 1QCEA 2WLKA 5LHHA 4MVQA 2DWDC 2XNDG 3OR6C 4XDJA 5IY5C 5CBGA 1S0VA 4Z1MG 3E86A 5B3SC 3ABLB 5LGUA 3PJSK 2W6IG 1QVFU 3SPHA 4X89A 5J9PC 3ABTA 1P4RA 2OTLV 2HFEC 2CK3G 2V7QG 1GM7A 3ETDA 1F4NA 3D3IA 2Y48A 3OFNG 2LFRA 2ZQMA 1MSWD 2QA4V 4JTAB 5CA3A 2ZR2A 4G28B 2OT5A 2KB1A 3T1CA 2JJ1G 1GO3F 5GW7A 5EBMC 2UXNA 1AI4A 1GMGA 2Q6AA 1KECA 1VQ7V 2P6JA 2W6JG 4PDVA 2IJHA 1QLEC 2M7WA 2DWEC 1OCZB 2QE7G 3K3WA 3JD1A 4WF9V 5H6QA 2IJKA 1AJPA 3JCZA 2Y69B 1EFRG 1Q7YW 2P7TC 4H33A 3ZMVA 1R6NA 1IXMA 4FK5C 4QJFB 3WFVA 1CPYA 5KUKA 3CD6V 1R3LC 3LNMB 1H8HG 3R65A 2P67A 1SETA 4N21A 4TT3G 2JEUA 3X2QC 4DO2A 1PNLA 3W7TA 4WCEV 2WLJA 2Y69C 1VQ5V 1BHBA 4P2ZA 1FXKB 3FB8C 4MVMA 2Q68A 4X88A 4PELA 1K92A 1FXKA 3QO5A 3E83A 5LBQA 4QE9A 3CCJV 3X2QB 4QE7A 3W7SA 1AI7A 1OCRC 1JJ2U 2QM8A 1OCOB 1OZ0A 3W7UA 5CBHA 1QR9A 3MHSC 4Q20A 2X0LA 3K9AA 2HVJC 4RQFA 1PKXA 1BMFG 1PD3A 5BZBA 3OM3B 4GX5A 2DYRB 2FTKA 5KA5A 4R50A 4XDLA 3OR7C 3CXCU 2EIJB 4FPPA 5CBFA 2WLLB 3CP1A 2YEVA 1K9MW 1VQ4V 3BY6A 4HAMA 4MVZA 5L3BA 3LDCA 4MVOA 3TCUA 2QEXV 3GWOA 3T4ZA 1M57B 2DYSB 3CCEV 1S77D 3ZCCA 1PNMA 3ETGA 3JYCA 5LHGA 5KUMA 3GB7C 4QPJA 4JAUA 4JYBA 3FB5C 1YHQV 3ABLC 2XAFA 1SESA 2ITCC 1MOFA 3RVZA 4UXNA 5HFMA 3ZMSA 4QPKA 2JDIG 1FFTB 1F4MA 2WLMA 3AG2B 2EBOA 4CBCA 5L3FA 1N8RW 1AJQA 1V54B 3TK1A 2EILB 2V1DA 2X6AA 4GX0A 2R9IA 1AR1B 4JTDB 1H2GA 3RBZA 3JD2A 3K08A 3MD0A 4MVUA 1RM1C 3AG4C 2Q67A 1SZTA 4WFEA 1VQ8V 1B6QA 1ENVA 3E8FA 4PDRA 2A0LA 2ZXWC 4HYOA 4F4LA 1K34A 3ASOC 2HLDG 2DQ3A 1E1RG 3E89A 1YJWV 3AG4B 2JK5C 4LBEC 3G71V 1LNQA 2IH3C 2EIMB 1S72V 3VOUA 3HB3B 4WFBV 2WLIB 4KFMA 4H37A 3IGAC 4PDLA 3ZMTA 3I56V 1JPXA 4WFHA 3H01A 3CMAV 5B1NA 1XL6A 3K03A 4G27B 1K33A 1OCRB 5B1BB 1OCOC 3TETA 2DQ0A 1YTFB 4P9PA 2BOCC 2X6BA 4UUJC 5L3CA 3QNEA 1VQPV 4RQEA 3I55V 4J9YB 1VQ9V 1JCHA 4FMTA 2ZD9A 2EIJC 1JOYA 3ZN1A 1NH2B 3NXSA 4MT8A 1M56B 5IYDO 1YI2V 2OTJV 2HVKC 3OEEG 3WG7C 3B8NA 5L3EA 1YSCA 2UXXA 1H8EG 1KC8W 1FXKC 2ZDIA 3STLC 3SPIA 2WWWA 2NNUA 4ZKIA 2EIKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B77 A;  1SZT A;  1I5X A;  1K33 A;  4JPR A;  2X7R B;  1ENV A;  4G2K A;  4N23 A;  1Y4M A;  5H9C A;  1QBZ A;  5HFL A;  1K34 A;  4JGS A;  1QR9 A;  1QR8 A;  3MHS C;  4JF3 A;  4FK5 C;  3K9A A;  1I5Y A;  3WFV A;  4E2L A;  5HFM A;  1MOF A;  1DF4 A;  3P30 A;  5KA5 A;  2OT5 A;  4FIP C;  4N21 A;  1Y66 A;  1JQ0 A;  1QCE A;  2EBO A;  2MK3 A;  3CYO A;  3MHH C;  1DLB A;  2LP7 A;  5CN0 A;  3B8M A;  3CP1 A;  2P6J A;  1DF5 A;  3B8N A;  2EZP A;  4FJC C;  5CMU A;  5KA6 A;  1EBO A;  1MG1 A;  2EZO A;  1JPX A;  3M99 B;  3GWO A;  3H01 A;  2M7W A;  1F23 A; 
#chains in the Genus database with same CATH topology
 1I5X A;  3ABM B;  2YXH A;  1RSO B;  2H8P C;  4J9Z B;  3ZED A;  2IJJ A;  2KSD A;  4BW9 A;  3J80 N;  1TVK B;  4U7N A;  4JAV A;  1AR5 A;  1M4U A;  1AP6 A;  2KQX A;  4F6E A;  2DYR C;  1GN6 A;  3SYA A;  5EC1 C;  4GKJ B;  3RYI A;  4DR4 O;  2O57 A;  1F51 A;  1Z5V A;  1XOU A;  2RQ6 A;  2XAQ A;  3FB7 C;  1KKC A;  4OPH A;  5B5E Z;  4PA4 A;  2WLI A;  4JF3 A;  1EN6 A;  4JI8 B;  4YIP A;  4DV7 O;  3OMI B;  4U7O A;  2LQT A;  2CAZ C;  2JEX A;  2XAS A;  2OYQ A;  3UO2 A;  3FB6 C;  4OX9 O;  3N2K A;  4RUF A;  2Q4P A;  4FLZ A;  4LFA B;  2AW9 A;  4R8C A;  5A9G A;  2UXC B;  3SR2 C;  5LGT A;  4DR6 O;  4KP4 A;  5IWA O;  1P49 A;  2EUL A;  2YEV B;  5LGN A;  4PD4 F;  5IT9 N;  3B2E E;  3SPG A;  4FM1 A;  3RT3 C;  1QVG U;  3ML0 A;  2X6C A;  4E2L A;  3P30 A;  1JVM A;  3LUT B;  1H2K A;  1MSD A;  4LP8 A;  3BPZ A;  4Z1V A;  1L1F A;  4FM2 A;  3WG7 B;  1NJI W;  3AG3 C;  5KA6 A;  1N4C A;  1BT8 A;  1EBO A;  4YHH O;  1ZAU A;  3K79 A;  3K5O A;  2H3O A;  2ZIO A;  5CA0 A;  2CH7 B;  2NN4 A;  1WNS A;  4TWK A;  1S3J A;  4E4E A;  5IYZ A;  1V9P A;  3UKM A;  1B06 A;  1XIL A;  4DV2 O;  2JGD A;  1G8M A;  4LF9 B;  3HKB B;  1WP7 A;  1AJN A;  2IJI A;  1L8D A;  3W7X A;  2UUB B;  2XOK G;  3SPJ A;  5IY5 B;  1JR9 A;  3CJH B;  1VQM V;  1XEQ A;  4D7S A;  2UUB O;  4JPR A;  2EJ7 A;  1D5A A;  2WLN A;  3LSU A;  5LP6 A;  2JJ2 G;  2RMK B;  1SQV H;  3T2M A;  2L6L A;  1EN5 A;  3AG7 A;  1CP9 A;  2HG5 C;  2PGG A;  2DN9 A;  4EKW A;  4DW1 A;  5GTH Z;  3E8H A;  3QF7 A;  3SYC A;  3BRC A;  2GV9 A;  1PL0 A;  3KG2 A;  4YHH B;  2WSS G;  1YIT V;  2Q69 A;  4OPA A;  1SA0 A;  3CWB H;  2GBO A;  1U96 A;  2WAM A;  3JCU Z;  1SA0 B;  4U3J B;  2OCC C;  4TV8 B;  4JI5 O;  3HKC A;  3OW2 U;  1HWY A;  2WPD G;  5KAF Z;  2QR4 A;  2EIM C;  1XHX A;  2QWO B;  1H2L A;  3SJB C;  2G38 A;  2ZIM A;  3L9D A;  1URF A;  2UUA O;  1KBH A;  3BA9 A;  4WFG A;  4WFF A;  5EZY B;  1XHZ A;  2RJZ A;  4I55 B;  4H13 B;  3OUS A;  5EZY A;  3AEI A;  1AR4 A;  4LWS A;  3J81 N;  4AIL C;  5CMU A;  2Q7E A;  3CPW U;  2F1M A;  4DR4 B;  1ZUQ A;  5KHI A;  1F23 A;  1VAR A;  3RVY A;  5EBW C;  3DC6 A;  3EXA A;  4BR6 A;  3T1Y B;  3QVN A;  4JI6 B;  4DR7 O;  2UUA B;  1I5Y A;  4J7K A;  1AIL A;  2Q7H A;  3CME V;  4BAY A;  1ARO P;  3HPL C;  2Z0A A;  5FL7 G;  1RPR A;  5KLV H;  4QNH B;  1S5H C;  2FKX A;  3JAK B;  1YXB A;  3H1K H;  5DM6 V;  4UCT A;  1IDS A;  5ITZ A;  5DEC A;  4U3F H;  5D5Q A;  1R73 A;  4LCU C;  1UJW B;  3OD4 A;  4UFZ A;  1ROP A;  1XL4 A;  1K5Q A;  4JYY A;  1O9G A;  4FIP C;  1FS0 G;  4I50 A;  4R6Z A;  1Y76 A;  1KP3 A;  5BMV B;  4L87 A;  1NTZ H;  4LC1 A;  2BCC H;  1HNX O;  2N04 A;  4RUE A;  1NR1 A;  4BIZ A;  4TV9 A;  3AG1 B;  1Q43 A;  1GM9 A;  5JJE B;  4O4J B;  3OMA B;  4A5U B;  3U0Z A;  4X64 B;  4X8A A;  2K1E A;  4PA3 A;  1DTO A;  4GYC B;  1QCE A;  4FFK A;  1N36 O;  1AVM A;  4EB6 B;  5LHH A;  5IY5 C;  4DV0 B;  3ETQ A;  5CBG A;  1XNR B;  2CUG A;  4LF9 O;  5B3S C;  1QVF U;  1BCC H;  4DV2 B;  3ABT A;  1JFF B;  1GM7 A;  3L73 H;  4I9Q A;  2YID A;  1BSM A;  4LF6 O;  4UCV A;  1KU9 A;  3OFN G;  3SJA C;  2UXN A;  1AI4 A;  3ZHV A;  1N34 B;  2P6J A;  5ITZ B;  2W6J G;  3K5M A;  2IJH A;  4I7Z B;  2YUA A;  1D2D A;  3KCY A;  5BR8 O;  3K3W A;  4WF9 V;  1AJP A;  4X66 O;  4H44 B;  5DED A;  1H2N A;  2JGD B;  4JI3 O;  2LW1 A;  4NB5 A;  2YI8 A;  1IXM A;  5KUK A;  1H8H G;  2EX3 A;  3S3X A;  4LFA O;  1PNL A;  1I08 A;  3A2F A;  4MVM A;  1AB3 A;  3QO5 A;  2Q9L A;  4I0X A;  5LBQ A;  1AP5 A;  1BE3 H;  4QE9 A;  2XTA A;  1OCR C;  1JJ2 U;  5BMV A;  1OCO B;  2VQE O;  1QR9 A;  2RCV A;  3MHS C;  4Q20 A;  3K9A A;  2YIB A;  2HVJ C;  2NR5 A;  1PD3 A;  5KMG A;  5JJJ B;  5KA5 A;  4R50 A;  4IHJ A;  3ZHR A;  4FPP A;  4DV5 O;  1K9M W;  4B3S O;  1JFF A;  3CRM A;  3GWO A;  3DSQ A;  2DYS B;  3CCE V;  1PNM A;  3HR0 A;  1Q6U A;  4DUY B;  3GB7 C;  4CS4 A;  2QKC A;  3BVO A;  5KHK A;  3T1H O;  2CTR A;  1WP8 A;  4U3J A;  3A0H Z;  5IJ9 B;  3AG2 B;  4AI8 A;  2F66 C;  4EFB A;  2YIB D;  1V54 B;  3TK1 A;  2EIL B;  4X20 A;  2R9I A;  3OT7 A;  4JYA O;  3AG4 C;  1VQ8 V;  1VF6 A;  1B6Q A;  4FLT A;  3CS5 A;  4PDR A;  3E22 A;  2ZXW C;  2ETN A;  4X1K B;  4JI1 O;  4HYO A;  4F4L A;  2DQ3 A;  2VWK A;  4O4I A;  2QSA A;  2JK5 C;  3G71 V;  3TXQ A;  3K5L A;  1S72 V;  3OTF A;  4KFM A;  4H37 A;  5GON B;  1CXZ B;  3ZMT A;  2Y0P A;  1GRJ A;  1JPX A;  3H01 A;  5H5N A;  3OTO O;  5B1N A;  3K03 A;  2IM9 A;  1IBM O;  4UUJ C;  4OGQ B;  4RQE A;  1NI8 A;  2XT9 A;  4CH4 A;  1US6 A;  2ZD9 A;  3H1H H;  1JOY A;  2QKA A;  3RYF A;  1NH2 B;  4MT8 A;  1YI2 V;  2E76 B;  4FLV A;  3B8N A;  2NNU A;  1J5E O;  2EIK B;  2JRI A;  4J41 A;  1P7G A;  3SYQ A;  4KUM A;  4RAI A;  1XMO O;  1EN4 A;  3CX5 F;  4PJ0 Z;  5CB4 B;  2GSM B;  3G6B A;  3UO3 A;  2LW7 A;  2OIG A;  1EM1 A;  3CCR V;  3F5T A;  3B8M A;  5KHG A;  2ZCE A;  3QG5 A;  3AK3 A;  3CCU V;  3RYC B;  5B1A C;  1CEZ A;  2JS5 A;  4L8J A;  1IUR A;  2F43 G;  5KMG B;  4DV6 O;  3F7Y C;  3OEH G;  2OCC B;  3ETE A;  3JSN A;  5J2T B;  3N27 A;  1YVW A;  4GUN A;  1SC5 B;  4KXR A;  4JI1 B;  3ZRW B;  3UCS C;  4FJC C;  4DUZ O;  1XMQ O;  2WA3 A;  3D36 C;  5LXT A;  1M1K W;  1G4Y B;  1BL8 A;  1NZ6 A;  1Z5W A;  2QGN A;  2FML A;  1RPO A;  1SQB H;  2HKO A;  4IIJ B;  4JTC B;  1Q86 W;  2MW2 B;  2R72 A;  4MS2 A;  4EFE A;  1DF4 A;  5LP6 C;  3CCS V;  4D6T H;  4JAA A;  3K9S A;  3TGU H;  4FVM A;  1KP2 A;  4O4I B;  4FZ1 A;  2Z3Y A;  3SPC A;  2X7R B;  4DV5 B;  1R6K A;  1WPX A;  1Y4M A;  3FX7 A;  1Q6H A;  1QU7 A;  4J7Z A;  2ZR3 A;  3AG2 C;  3VQX A;  2VQE B;  1BQ0 A;  3RW0 A;  3CYO A;  3ZN0 A;  2XAG A;  4JZ2 A;  3M7M X;  2IW5 A;  2PTM A;  4BIU A;  2OCH A;  5IJ0 B;  2LJ2 A;  1K3E A;  2YIA A;  5IJ0 A;  1Z2G A;  3BEH A;  3K06 A;  3CCL V;  3BA8 A;  3ASN C;  3THO A;  2BE3 A;  4Q6G A;  3STZ C;  1QR8 A;  1QLE B;  2AHY A;  5JQG B;  5E1A C;  3SYO A;  1JQ0 A;  1NR7 A;  3FYI B;  1RSO A;  1HW7 A;  1NQT A;  3F5W C;  4K8X A;  4YJ2 A;  4LH7 A;  4J10 A;  2D3O W;  2ATK C;  5JCO A;  1N34 O;  2QWQ B;  2UUC B;  4UVB A;  5FPO A;  2YXY A;  4DV1 O;  3VBB A;  1FJG B;  3ZRS A;  1VQO V;  2YIC A;  4PA7 A;  2RDC A;  1TA8 A;  2EIK C;  2EJR A;  2F93 B;  3SGI A;  1WN7 A;  1XNR O;  2PI4 A;  2B1G A;  1THZ A;  3E35 A;  1JMK C;  3UM7 A;  5HFL A;  2DYS C;  1NTK H;  2P90 A;  1HR0 O;  3KKY A;  1SQF A;  5B3S B;  4X64 O;  3ABM C;  1FYJ A;  4NVP A;  4DV3 B;  2A79 B;  2ZE5 A;  2YC0 A;  2B1I A;  1HNX B;  1IX9 A;  2ZE7 A;  2A9H A;  4LF8 O;  1WAZ A;  2YI9 A;  1PNK A;  2WLH A;  4X1K A;  2EIN C;  2IU3 A;  4UCU A;  1Q82 W;  4HZ3 A;  4UVC A;  1AI6 A;  4MSW C;  4PA9 A;  3G6E V;  3K04 A;  4DR5 O;  2ZXW B;  3SYP A;  2EIN B;  2V4D A;  3CCQ V;  3LSS A;  4FLU A;  4UV9 A;  2EIL C;  5H6R A;  3L75 H;  2UU9 B;  4LF5 B;  3IFX A;  4WFA V;  4JI4 O;  1W2B U;  4PI0 A;  2BSK B;  4RWU A;  1HDJ A;  4LFB O;  3SJQ C;  5K1X A;  1QBZ A;  4JGS A;  4D7T A;  1BGY H;  3B40 A;  5EIB C;  1Y66 A;  4IGG A;  3RYH B;  4JI6 O;  3RYI B;  3T1Y O;  3P32 A;  3H1J H;  4XDK A;  2N05 A;  2F4V B;  2UXD B;  1RFY A;  4I50 B;  1O9H A;  1MG1 A;  4O2A A;  1OHH G;  4FLW A;  3RYC A;  4O2A B;  3OUF A;  2B9Z A;  2HJF C;  1K8A W;  3AK1 A;  3QO8 A;  5IE9 A;  1YJ9 V;  4UCS A;  1N33 B;  1IXB A;  1EZV H;  3DXR B;  3N2K B;  4GCZ A;  2WLK A;  2DMX A;  1GH6 A;  2DWD C;  4HBN A;  2XND G;  1PV0 A;  4X65 O;  1WJZ A;  1VMG A;  5LMU O;  5LGU A;  2OTL V;  1F7Y A;  2CK3 G;  3SJC C;  1FD9 A;  5F2V O;  3UQ8 A;  2Y48 A;  2ZQM A;  3C3T A;  1MSW D;  4JTA B;  5CA3 A;  1XDC A;  1Q6I A;  2OT5 A;  4JI5 B;  2JJ1 G;  1FAF A;  5A2Q N;  1FFX B;  1IBL B;  1IBL O;  1VP7 A;  1QLE C;  2QE7 G;  1OCZ B;  5H6Q A;  2IJK A;  2PF4 E;  5CB4 A;  1EFR G;  1Q7Y W;  2OIE A;  2P7T C;  4H33 A;  3HKB A;  3JAK A;  3Q4H B;  1R6N A;  4FK5 C;  1CPY A;  3IAY A;  1NU1 H;  1R3L C;  3R65 A;  4W4L A;  1SET A;  4N21 A;  2VS0 A;  5CA1 B;  2DE0 X;  2Y69 C;  4DR2 B;  1BHB A;  4KL1 A;  1FXK B;  2Q68 A;  4X88 A;  4PEL A;  3PN1 A;  3RYH A;  1FXK A;  5JVD B;  4DYL A;  3CCJ V;  3X2Q B;  4GLX A;  1IBK O;  1QNM A;  1VF6 C;  2QM8 A;  1OZ0 A;  3W7U A;  4B7K A;  4XDL A;  4DRX A;  3CXC U;  4LNU A;  2WLL B;  4NTW A;  2YEV A;  4DR1 O;  1VQ4 V;  1SF9 A;  5FPR A;  3BY6 A;  4HAM A;  1KUQ A;  3CJH A;  4MVO A;  1YEW A;  2QEX V;  3O9O A;  3ZCC A;  2PYL A;  5LHG A;  5KUM A;  4X62 O;  4JYB A;  3K59 A;  1ZX3 A;  1YHQ V;  3ABL C;  4LF5 O;  4DK1 A;  3VQV A;  3RVZ A;  2ITC C;  4LH6 A;  2JDI G;  1FFT B;  4ZI7 B;  2KG7 B;  1F4M A;  2WLM A;  2LGW A;  2EBO A;  5JJN B;  5L3F A;  2V1D A;  4GX0 A;  1AR1 B;  5IWA B;  4LF4 O;  3K08 A;  4MVU A;  2UXC O;  2R9A A;  3JAM N;  1QQC A;  4NXM O;  1SZT A;  4J42 A;  1XNQ O;  4OX9 B;  3E8F A;  4TUY B;  4YIO A;  3ASO C;  4DV7 B;  4LF8 B;  2HLD G;  2W0X A;  2ADP A;  1LR1 A;  2IH3 C;  3VOU A;  3HB3 B;  4WFB V;  2WLI B;  3IGA C;  4DV3 O;  2DJV A;  3I56 V;  4WFH A;  1JJO A;  2E5L O;  1HNZ B;  3C3S A;  3WB2 A;  4G27 B;  1D5N A;  1OV9 A;  2N74 A;  4GKJ O;  3M8A A;  5JH7 A;  3L74 H;  4P9P A;  4IYH A;  5L3C A;  1W59 A;  4JI2 O;  2EIJ C;  5IYD O;  2OTJ V;  4IIJ A;  2P22 C;  4NR1 A;  1H8E G;  1KC8 W;  1FXK C;  3STL C;  1XRE A;  2CTQ A;  4UB6 Z;  3B77 A;  4LF7 B;  2HHH O;  5KHH A;  4MTG A;  3ABK B;  3HKE A;  4FFB B;  2BTQ A;  4ZI7 A;  1I0H A;  2UUC O;  4K0K B;  3CCM V;  2QTO A;  2BTQ B;  3U10 A;  2B5U A;  5EBL C;  2PUS A;  1RP3 B;  4JV5 O;  4O4L A;  3B4S A;  1HP8 A;  2DOS A;  3BFR A;  4NTY A;  4EEQ A;  2EZO A;  2BOB C;  5FLX N;  1UFI A;  2ZDI C;  1M9N A;  1N32 B;  1QLN A;  1COW G;  1ZLZ A;  2AXT Z;  1VQL V;  3BCC H;  3NR7 A;  3RGB A;  2QM7 A;  4X1Y A;  5IYB O;  4I0X B;  4X1I B;  1K97 A;  3L70 H;  1OCZ C;  4UCR A;  5BY1 A;  2ZE8 A;  1N0J A;  1DF5 A;  2QM4 A;  4P30 A;  4NTX A;  1NVP B;  3VQY A;  4LFC B;  4ZOL A;  5E79 Z;  3FAV B;  4F6R A;  2E75 B;  3G4S V;  2A06 H;  3AG3 B;  3CC4 V;  2ZNJ A;  4X1I A;  4X9Q A;  3Q4H A;  2A7W A;  1SKV A;  1R3K C;  4FLX A;  1SRY A;  2A3Q A;  2AHZ A;  1DLB A;  1QHT A;  2QWR B;  1K4D C;  3OE7 G;  4MTX A;  3KZI Z;  2QWN B;  5LYJ A;  2DW4 A;  4DXW A;  5GON A;  3LDD A;  2GDS A;  1K73 W;  2ZM6 B;  1M57 C;  4JI0 O;  3CCV V;  1M5I A;  2MK3 A;  4DV4 B;  1FFX A;  4DUZ B;  1U97 A;  2VWJ A;  1NT2 B;  3RFR A;  1W0J G;  1ZL8 A;  5JCO C;  2R9R B;  2FL4 A;  1R3J C;  2JGU A;  3DXR A;  4JI7 O;  5JVD A;  4DV4 O;  3OAA G;  5LL6 Y;  3P3P A;  4GKK O;  1PPJ H;  4P9O A;  1GK9 A;  1XUQ A;  4YJ3 A;  3WB1 A;  1V54 C;  4CH6 A;  1VQN V;  1GKF A;  3M99 B;  4MW3 A;  1I94 O;  4ASU G;  3OGI B;  2PI5 A;  4UVA A;  5FNV B;  1XMO B;  1M90 W;  3ZIA G;  4B08 A;  4MTF A;  5JQG A;  1J5E B;  2XAH A;  2FB5 A;  2WA4 A;  4B3T B;  3APO A;  1TUE B;  1YJN V;  2EZP A;  4LFC O;  4CZZ A;  3LDE A;  4KHP O;  3EHB B;  5IYZ B;  3P3N A;  5L3G A;  1KMI Z;  4WBN A;  4FM0 A;  5J2U A;  4G2K A;  4TOI A;  3JAL A;  4O2B A;  4B3M B;  1IBM B;  1OCC B;  4J7J A;  3CRC A;  2ARH A;  1KB9 F;  1X4T A;  4O4J A;  2HEP A;  2CH7 A;  4UV8 A;  1G1X B;  4QGP A;  1OCC C;  2GHY A;  3ZX6 A;  2CTP A;  1N32 O;  2GUZ A;  4JYC A;  4W4K A;  2Y4T A;  5JH7 B;  3ZJZ A;  4CH5 A;  3E22 B;  3ASN B;  3RN4 A;  1NVP D;  1MAB G;  5AG2 A;  3ICX A;  1KD1 W;  1WPB A;  4TSF G;  1W0K G;  4GT1 A;  3H1L H;  5C93 A;  3K5N A;  2HR3 A;  4JYA B;  4KHP B;  1Y67 A;  1KQS U;  5TIS Z;  4I4T B;  2AGA A;  2OWO A;  1NTM H;  3QO7 A;  5JWP A;  3L71 H;  3E8G A;  4LF7 O;  2QJ1 A;  4K35 A;  2P4V A;  1ZWI C;  4TV8 A;  2CE4 A;  3JD4 A;  4YJ3 B;  1GM8 A;  1B04 A;  5B1O A;  1LUV A;  4DUY O;  3CB2 A;  2ZE6 A;  4GX1 A;  4MTO A;  1BHA A;  3JD0 A;  1R6T A;  4Z2W A;  3MHH C;  5CN0 A;  3K58 A;  2Q5Z A;  4CC6 A;  1MZF A;  4J80 A;  1HNZ O;  5LP6 B;  5LOV B;  4X1Y B;  5EK0 A;  4GKK B;  4MVS A;  1TUB B;  2F23 A;  3GWK C;  1K7D A;  5H9C A;  1DGS A;  2CDY A;  3B09 A;  2IH1 C;  4IYI A;  4OXS A;  1WB7 A;  2CTW A;  3LNN A;  4PA6 A;  3JSL A;  3OGC C;  3T4D A;  1YCI A;  4MVQ A;  4NXN B;  1MZE A;  3OR6 C;  4XDJ A;  1XNQ B;  1S0V A;  4Z1M G;  4JI0 B;  1VF5 B;  4AQY B;  3PJS K;  1G6U A;  5K1P A;  2ZM6 O;  3RWR D;  2HFE C;  2V7Q G;  2M6Y A;  3ETD A;  1F4N A;  4ZOL B;  3CRQ A;  3UT5 A;  4X66 B;  3D3I A;  4DR3 B;  4K8Z A;  3APQ A;  2QA4 V;  2ZR2 A;  5BR8 B;  2KB1 A;  3BHP A;  3IC9 A;  5GW7 A;  1L0N H;  5CA1 A;  1GMG A;  4X62 B;  1KEC A;  1VQ7 V;  3JAL B;  4O2B B;  1MNG A;  2ZKO A;  2KG7 A;  2M7W A;  4B3R B;  2ZT9 B;  3RYF B;  3JD1 A;  5GTI Z;  4IL6 Z;  1Y74 A;  3JCZ A;  5B66 Z;  3ZMV A;  3WFV A;  2UXB B;  2P67 A;  3EVK A;  4TT3 G;  3X2Q C;  2WLJ A;  2YS8 A;  1GN3 A;  1K92 A;  3W7S A;  2LGQ A;  3N2G B;  3DC5 A;  4DR2 O;  1BZK A;  5CBH A;  3ZS8 C;  3HKC B;  4RQF A;  1PKX A;  1BMF G;  5BZB A;  4GX5 A;  2DYR B;  1HNW O;  2Y0I A;  4FFB A;  3CP1 A;  3ZHT A;  2XUM A;  4F6R B;  3TCU A;  3T4Z A;  4JV5 B;  4ICG A;  1BQZ A;  1S77 D;  3ETG A;  4DW0 A;  3SDL A;  2ZNI A;  3FB5 C;  1SES A;  4UXN A;  4I55 A;  3ZMS A;  1XBL A;  2L35 A;  1TVK A;  4CBC A;  4O4H A;  1SS3 A;  1TUB A;  2X6A A;  4JTD B;  3RBZ A;  1H2G A;  3JD2 A;  2GUZ B;  3G67 A;  5LMU B;  2Q67 A;  4TUY A;  4JI2 B;  4X65 B;  1S5J A;  1SQQ H;  4DR7 B;  2A0L A;  1GN4 A;  3HKD A;  3KCX A;  1E1R G;  3AG4 B;  4LBE C;  5LYJ B;  2E5L B;  2EIM B;  2QTS A;  4UCO A;  1BS3 A;  2VRZ A;  1XI1 A;  3FAV A;  4J11 A;  3CMA V;  1I7F A;  1K33 A;  1OCO C;  3TET A;  1YTF B;  2X6B A;  1KYO F;  3QNE A;  1VQP V;  3I55 V;  4J9Y B;  2ODM A;  2Q7G A;  4NXM B;  5EIB D;  4FMT A;  4YJ2 B;  3ZN1 A;  4LF4 B;  3ZHQ A;  3NXS A;  1M56 B;  1ZSP A;  2HVK C;  1Y74 B;  3ZHU A;  3OEE G;  4LFB B;  3WG7 C;  5L3E A;  1YSC A;  2IBZ H;  2UXX A;  2ZDI A;  3SPI A;  4ZKI A;  1WA8 B;  1ORQ C;  1H38 A;  1KKD A;  2D2C B;  2WLL A;  1K5S A;  2GTA A;  3D3Q A;  4PI2 A;  1P84 F;  3OMN B;  4NYK A;  4O4L B;  3FKS G;  2NLJ C;  4YXW G;  1YDX A;  4DR1 B;  5C8Y A;  3ZRW A;  4TV9 B;  3ABU A;  4JAS A;  3F7V C;  4CS2 A;  3D8C A;  1EZJ A;  3FD9 A;  1V55 B;  4O4H B;  4N23 A;  3H9V A;  1XQ8 A;  3O65 A;  5EC2 C;  1IBK B;  2P5O A;  5D5P A;  2Q8V A;  3JAS A;  2QWP B;  3CC7 V;  1RM1 B;  5IYC O;  3CE2 A;  4WBN B;  1HR0 B;  4GX2 A;  4NKG B;  2P4K A;  2Q0A A;  2YXL A;  3ZHS A;  1WLE A;  1X59 A;  1Y6X A;  1VQK V;  1T5E A;  1H2S B;  3CRA A;  3JAT B;  3ZMU A;  3JD3 A;  1SER A;  1NH2 D;  4MW8 A;  3VQW A;  2GTS A;  5CA0 B;  4QIW F;  1YIJ V;  3S3W A;  2Y4U A;  1VQ6 V;  2QKS A;  1FJG O;  2YSU B;  4CC5 A;  4DV1 B;  5J2U B;  2JS3 A;  3HKE B;  1NKD A;  3C90 A;  4XBF A;  3FYE B;  5IJ9 A;  1Q90 D;  3CEI A;  3AG1 C;  3G80 A;  3IC7 A;  1HNW B;  3CXH F;  2Z5U A;  4DR6 B;  3TXS A;  1FXH A;  4R7C A;  2R70 A;  1M56 C;  2LO1 A;  1VF7 A;  1FPO A;  4RO2 A;  3N2G A;  5BXZ A;  1N33 O;  4JI8 O;  2E3C A;  1SQX H;  3ZBH A;  4GZR B;  3WU2 Z;  5H2F Z;  2XAJ A;  3TJT A;  3CC2 V;  1PP9 H;  3A8T A;  4DRX B;  3A0R A;  5EYP B;  3BAB A;  2UXB O;  2CGO A;  1J95 A;  5LXT B;  4TQF A;  5LA6 A;  2F4V O;  2UXD O;  2BSK A;  3MAQ A;  1FXV A;  4ZIB A;  1NBM G;  4B3R O;  3A0B Z;  4BWA A;  3E2E A;  5C8Y B;  4JI4 B;  1A32 A;  5DN6 G;  2PY5 A;  2UU9 O;  1K4C C;  4DR3 O;  4UB8 Z;  5LHI A;  5B1B C;  3WB0 A;  2IU0 A;  3AK2 A;  4DR5 B;  1JA8 A;  2JIZ G;  2H94 A;  3ZRX A;  4ABM A;  4YY3 B;  3U11 A;  4AQY O;  1S76 D;  1R3I C;  4MVR A;  1R1B A;  2JVD A;  4ZBM A;  1XMQ B;  3LSQ A;  2Q73 A;  4NXN O;  4K3A A;  3E8B A;  4BW5 A;  4PHZ A;  4FLY A;  2C2A A;  1SZX A;  2ZIN A;  3DTU B;  1Q81 W;  3ABK C;  1M93 A;  4DV6 B;  4PDM A;  5LMN O;  2PZS A;  1V55 C;  3K0G A;  2XHB A;  1YF2 A;  2W0F C;  1E1Q G;  3HKD B;  2AZ0 A;  1P7B A;  1GTO A;  5LA6 B;  4C7U A;  5B1A B;  2RNB A;  2LFS A;  2YDE A;  2LP7 A;  4FZ0 A;  4I4T A;  3ZRV A;  3L72 H;  1S5L Z;  4LNU B;  1ZTE A;  1YTF D;  4CH3 A;  1E79 G;  1GN2 A;  3ASO B;  3IJ4 A;  4X20 B;  2ITD C;  1H2M A;  4HNA A;  5L3D A;  5IDJ A;  2BTO A;  3DGE A;  3W7W A;  3K57 A;  4I9W A;  4EB6 A;  3D36 A;  2VQF B;  2P06 A;  1JX9 A;  3OTO B;  2CGN A;  2HP8 A;  4IT5 A;  4I5S A;  1AI5 A;  3ZMZ A;  3MDS A;  1FKA O;  3J7A U;  3K0D A;  5J2T A;  5KX5 A;  3EFF K;  3JAT A;  4B7E A;  4B3M O;  1TGO A;  1Y76 B;  1TAE A;  3E86 A;  3ABL B;  4IHJ B;  2W6I G;  3SPH A;  2KKW A;  4X89 A;  5J9P C;  3I5D A;  1P4R A;  2F95 B;  4ZHQ B;  1IZ3 A;  1OJH A;  4AHC A;  4B3T O;  2LFR A;  1WB8 A;  1VEW A;  4G28 B;  3T1C A;  3T1H B;  1GO3 F;  5EBM C;  2Q6A A;  5KAI Z;  4PDV A;  4DK0 A;  1I94 B;  2DWE C;  1GAX A;  4B3S B;  1L0L H;  2Y69 B;  1PM9 A;  4QJF B;  3CD6 V;  5EYP A;  3LNM B;  2JEU A;  4DO2 A;  3W7T A;  1UPG A;  4WCE V;  3BAA A;  4JI7 B;  2QDO A;  1VQ5 V;  4P2Z A;  3FB8 C;  4PV1 B;  1IVS A;  4BIO A;  3E83 A;  3JAS B;  4QE7 A;  1Q5O A;  1AI7 A;  1Q3E A;  2X0L A;  5LOV A;  3OM3 B;  2FTK A;  3H1I H;  3OR7 C;  4JI3 B;  4H0L B;  2EIJ B;  4LR3 A;  2VQF O;  2HJD A;  5CBF A;  4TQD A;  1B3Q A;  4MVZ A;  5L3B A;  3LDC A;  3JAR A;  1M57 B;  1SQP H;  3JYC A;  3JAR B;  1LUW A;  1PL4 A;  1MMM A;  4QPJ A;  4HNA B;  4JAU A;  2XAF A;  5HFM A;  1MOF A;  3GVM A;  4QPK A;  4ZHQ A;  1MA1 A;  3CSX A;  5KHJ A;  4LF6 B;  4LWS B;  1N8R W;  1AJQ A;  1YZB A;  2E74 B;  1Q8I A;  2FYU H;  3MD0 A;  1VIB A;  1RM1 C;  4WFE A;  3CRR A;  4DV0 O;  1DK1 A;  1ENV A;  5KX5 B;  1N36 B;  5FNV A;  1K34 A;  3E89 A;  1YJW V;  2PYJ A;  5LMN B;  1LNQ A;  3QTC A;  2AZ2 A;  1N0N A;  2Q0O C;  3JAW A;  4PDL A;  1NS1 A;  2RN9 A;  1XL6 A;  3JAW B;  1OCR B;  5B1B B;  2DQ0 A;  3FFQ A;  2BOC C;  3R66 A;  1ZL8 B;  4JZG A;  1VQ9 V;  1SQG A;  1JCH A;  3CHX A;  4YY3 O;  4CS3 A;  3UT5 B;  4K0K O;  2ILM A;  2ADQ B;  2K9P A;  1WA8 A;  2HHH B;  2WWW A; 
#chains in the Genus database with same CATH homology
 3B77 A;  1I5X A;  1ORQ C;  3ABM B;  3SYQ A;  4KUM A;  2H8P C;  3ABK B;  4MTG A;  1H38 A;  1KKD A;  4J9Z B;  2WLL A;  1K5S A;  4RAI A;  2IJJ A;  3OMN B;  3CCM V;  2QTO A;  4U7N A;  2B5U A;  4JAV A;  3FKS G;  2GSM B;  5EBL C;  2NLJ C;  4YXW G;  2DYR C;  3CCR V;  3SYA A;  3B8M A;  3ZRW A;  5EC1 C;  3CCU V;  5C93 A;  5B1A C;  2EZO A;  3ABU A;  1CEZ A;  2BOB C;  4JAS A;  3F7V C;  2ZDI C;  1EZJ A;  1M9N A;  2F43 G;  1F51 A;  1QLN A;  2XAQ A;  1COW G;  1V55 B;  3FB7 C;  4N23 A;  1VQL V;  3F7Y C;  3OEH G;  2OCC B;  5EC2 C;  2QM7 A;  5IYB O;  3ETE A;  4PA4 A;  2WLI A;  4JF3 A;  3CC7 V;  1RM1 B;  1K97 A;  5IYC O;  1OCZ C;  4GX2 A;  1WLE A;  3OMI B;  4U7O A;  1VQK V;  2JEX A;  3ZRW B;  2XAS A;  3FB6 C;  1DF5 A;  4FJC C;  4RUF A;  4P30 A;  3ZMU A;  3JD3 A;  4R8C A;  1NVP B;  5LGT A;  1SER A;  1M1K W;  1NH2 D;  4MW8 A;  4KP4 A;  1G4Y B;  1BL8 A;  2YEV B;  5LGN A;  4QIW F;  1YIJ V;  1RPO A;  3G4S V;  2HKO A;  3AG3 B;  3SPG A;  3CC4 V;  1VQ6 V;  4JTC B;  1QVG U;  1Q86 W;  2QKS A;  2X6C A;  3ML0 A;  4E2L A;  4MS2 A;  1DF4 A;  3P30 A;  1JVM A;  3LUT B;  1R3K C;  1SRY A;  2YSU B;  3CCS V;  4LP8 A;  1L1F A;  2AHZ A;  3WG7 B;  1DLB A;  1NJI W;  1NKD A;  3AG3 C;  5KA6 A;  1EBO A;  1K4D C;  1KP2 A;  3OE7 G;  4XBF A;  3K79 A;  3FYE B;  4MTX A;  2Z3Y A;  3SPC A;  2X7R B;  1R6K A;  2DW4 A;  1WPX A;  1Y4M A;  3AG1 C;  4DXW A;  4TWK A;  1S3J A;  3IC7 A;  3LDD A;  3UKM A;  1K73 W;  2Z5U A;  1M57 C;  2ZR3 A;  1G8M A;  1FXH A;  3AG2 C;  4R7C A;  3CCV V;  3RW0 A;  1AJN A;  2IJI A;  2MK3 A;  3CYO A;  1M56 C;  3W7X A;  3ZN0 A;  2XAG A;  2IW5 A;  4RO2 A;  4BIU A;  2XOK G;  3SPJ A;  5IY5 B;  1W0J G;  1K3E A;  1VQM V;  2R9R B;  4JPR A;  1R3J C;  3BEH A;  3K06 A;  2XAJ A;  3CC2 V;  3CCL V;  2WLN A;  3OAA G;  3ASN C;  3STZ C;  1QR8 A;  4P9O A;  2JJ2 G;  3A0R A;  1QLE B;  2AHY A;  3T2M A;  1J95 A;  5E1A C;  3SYO A;  1CP9 A;  2HG5 C;  1JQ0 A;  1GK9 A;  1NR7 A;  3FYI B;  4EKW A;  1NQT A;  3F5W C;  3E8H A;  3SYC A;  1V54 C;  1FXV A;  1VQN V;  1GKF A;  3M99 B;  1NBM G;  4MW3 A;  1PL0 A;  3KG2 A;  2WSS G;  4ASU G;  1YIT V;  2Q69 A;  2D3O W;  2ATK C;  2PI5 A;  3E2E A;  4UVB A;  2WAM A;  4UVA A;  1M90 W;  2OCC C;  3ZIA G;  5DN6 G;  3OW2 U;  4MTF A;  3VBB A;  1K4C C;  1HWY A;  2XAH A;  3ZRS A;  2WPD G;  2EIM C;  1TUE B;  1VQO V;  5LHI A;  4PA7 A;  5B1B C;  1YJN V;  2EZP A;  2IU0 A;  2EIK C;  2EJR A;  3LDE A;  4CZZ A;  2JIZ G;  3EHB B;  2H94 A;  3ZRX A;  1S76 D;  1R3I C;  4MVR A;  2PI4 A;  5L3G A;  4ZBM A;  3LSQ A;  2B1G A;  1THZ A;  4G2K A;  3E35 A;  4WFG A;  3UM7 A;  3E8B A;  4WFF A;  5HFL A;  4BW5 A;  1OCC B;  2DYS C;  2P90 A;  2C2A A;  5B3S B;  3OUS A;  3ABM C;  3DTU B;  1Q81 W;  3AEI A;  3ABK C;  4UV8 A;  2A79 B;  4PDM A;  1OCC C;  5CMU A;  2GHY A;  2B1I A;  3CPW U;  1F23 A;  4JYC A;  3RVY A;  5EBW C;  1V55 C;  3K0G A;  3ZJZ A;  2A9H A;  1PNK A;  2W0F C;  2WLH A;  3ASN B;  1E1Q G;  2EIN C;  1NVP D;  1P7B A;  1MAB G;  1GTO A;  1KD1 W;  5B1A B;  2IU3 A;  4TSF G;  1I5Y A;  1W0K G;  3CME V;  4GT1 A;  1Q82 W;  4HZ3 A;  4BAY A;  1ARO P;  2HR3 A;  1AI6 A;  2LFS A;  3HPL C;  4MSW C;  4PA9 A;  3K04 A;  4UVC A;  3G6E V;  1KQS U;  5FL7 G;  1RPR A;  2ZXW B;  3SYP A;  4QNH B;  2EIN B;  2LP7 A;  3CCQ V;  3QO7 A;  3LSS A;  3E8G A;  4UV9 A;  2EIL C;  1S5H C;  5H6R A;  3ZRV A;  1ZWI C;  5DM6 V;  3IFX A;  4WFA V;  3JD4 A;  1W2B U;  1YTF D;  1R73 A;  4LCU C;  3SJQ C;  1GM8 A;  1QBZ A;  1E79 G;  1UJW B;  4JGS A;  5B1O A;  3ASO B;  4GX1 A;  4MTO A;  1ROP A;  1XL4 A;  1K5Q A;  1BHA A;  4FIP C;  2ITD C;  3JD0 A;  1FS0 G;  1Y66 A;  4R6Z A;  3MHH C;  5L3D A;  5CN0 A;  3DGE A;  5IDJ A;  3W7W A;  3P32 A;  4XDK A;  4I9W A;  1KP3 A;  3D36 A;  4L87 A;  1MG1 A;  1JX9 A;  4LC1 A;  4RUE A;  1OHH G;  1NR1 A;  4BIZ A;  5EK0 A;  4MVS A;  3AG1 B;  3OUF A;  1AI5 A;  4I5S A;  3ZMZ A;  2HJF C;  1GM9 A;  1K7D A;  5H9C A;  1K8A W;  3QO8 A;  2IH1 C;  4OXS A;  1YJ9 V;  3OMA B;  4X8A A;  2K1E A;  4PA3 A;  1DTO A;  3K0D A;  4PA6 A;  4GCZ A;  3EFF K;  3OGC C;  3T4D A;  1QCE A;  2WLK A;  5LHH A;  4MVQ A;  2DWD C;  2XND G;  3OR6 C;  4XDJ A;  5IY5 C;  5CBG A;  1S0V A;  4Z1M G;  3E86 A;  5B3S C;  3ABL B;  5LGU A;  3PJS K;  2W6I G;  1QVF U;  3SPH A;  4X89 A;  5J9P C;  3ABT A;  1P4R A;  2OTL V;  2HFE C;  2CK3 G;  2V7Q G;  1GM7 A;  3ETD A;  1F4N A;  3D3I A;  2Y48 A;  3OFN G;  2LFR A;  2ZQM A;  1MSW D;  2QA4 V;  4JTA B;  5CA3 A;  2ZR2 A;  4G28 B;  2OT5 A;  2KB1 A;  3T1C A;  2JJ1 G;  1GO3 F;  5GW7 A;  5EBM C;  2UXN A;  1AI4 A;  1GMG A;  2Q6A A;  1KEC A;  1VQ7 V;  2P6J A;  2W6J G;  4PDV A;  2IJH A;  1QLE C;  2M7W A;  2DWE C;  1OCZ B;  2QE7 G;  3K3W A;  3JD1 A;  4WF9 V;  5H6Q A;  2IJK A;  1AJP A;  3JCZ A;  2Y69 B;  1EFR G;  1Q7Y W;  2P7T C;  4H33 A;  3ZMV A;  1R6N A;  1IXM A;  4FK5 C;  4QJF B;  3WFV A;  1CPY A;  5KUK A;  3CD6 V;  1R3L C;  3LNM B;  1H8H G;  3R65 A;  2P67 A;  1SET A;  4N21 A;  4TT3 G;  2JEU A;  3X2Q C;  4DO2 A;  1PNL A;  3W7T A;  4WCE V;  2WLJ A;  2Y69 C;  1VQ5 V;  1BHB A;  4P2Z A;  1FXK B;  3FB8 C;  4MVM A;  2Q68 A;  4X88 A;  4PEL A;  1K92 A;  1FXK A;  3QO5 A;  3E83 A;  5LBQ A;  4QE9 A;  3CCJ V;  3X2Q B;  4QE7 A;  3W7S A;  1AI7 A;  1OCR C;  1JJ2 U;  2QM8 A;  1OCO B;  1OZ0 A;  3W7U A;  5CBH A;  1QR9 A;  3MHS C;  4Q20 A;  2X0L A;  3K9A A;  2HVJ C;  4RQF A;  1PKX A;  1BMF G;  1PD3 A;  5BZB A;  3OM3 B;  4GX5 A;  2DYR B;  2FTK A;  5KA5 A;  4R50 A;  4XDL A;  3OR7 C;  3CXC U;  2EIJ B;  4FPP A;  5CBF A;  2WLL B;  3CP1 A;  2YEV A;  1K9M W;  1VQ4 V;  3BY6 A;  4HAM A;  4MVZ A;  5L3B A;  3LDC A;  4MVO A;  3TCU A;  2QEX V;  3GWO A;  3T4Z A;  1M57 B;  2DYS B;  3CCE V;  1S77 D;  3ZCC A;  1PNM A;  3ETG A;  3JYC A;  5LHG A;  5KUM A;  3GB7 C;  4QPJ A;  4JAU A;  4JYB A;  3FB5 C;  1YHQ V;  3ABL C;  2XAF A;  1SES A;  2ITC C;  1MOF A;  3RVZ A;  4UXN A;  5HFM A;  3ZMS A;  4QPK A;  2JDI G;  1FFT B;  1F4M A;  2WLM A;  3AG2 B;  2EBO A;  4CBC A;  5L3F A;  1N8R W;  1AJQ A;  1V54 B;  3TK1 A;  2EIL B;  2V1D A;  2X6A A;  4GX0 A;  2R9I A;  1AR1 B;  4JTD B;  1H2G A;  3RBZ A;  3JD2 A;  3K08 A;  3MD0 A;  4MVU A;  1RM1 C;  3AG4 C;  2Q67 A;  1SZT A;  4WFE A;  1VQ8 V;  1B6Q A;  1ENV A;  3E8F A;  4PDR A;  2A0L A;  2ZXW C;  4HYO A;  4F4L A;  1K34 A;  3ASO C;  2HLD G;  2DQ3 A;  1E1R G;  3E89 A;  1YJW V;  3AG4 B;  2JK5 C;  4LBE C;  3G71 V;  1LNQ A;  2IH3 C;  2EIM B;  1S72 V;  3VOU A;  3HB3 B;  4WFB V;  2WLI B;  4KFM A;  4H37 A;  3IGA C;  4PDL A;  3ZMT A;  3I56 V;  1JPX A;  4WFH A;  3H01 A;  3CMA V;  5B1N A;  1XL6 A;  3K03 A;  4G27 B;  1K33 A;  1OCR B;  5B1B B;  1OCO C;  3TET A;  2DQ0 A;  1YTF B;  4P9P A;  2BOC C;  2X6B A;  4UUJ C;  5L3C A;  3QNE A;  1VQP V;  4RQE A;  3I55 V;  4J9Y B;  1VQ9 V;  1JCH A;  4FMT A;  2ZD9 A;  2EIJ C;  1JOY A;  3ZN1 A;  1NH2 B;  3NXS A;  4MT8 A;  1M56 B;  5IYD O;  1YI2 V;  2OTJ V;  2HVK C;  3OEE G;  3WG7 C;  3B8N A;  5L3E A;  1YSC A;  2UXX A;  1H8E G;  1KC8 W;  1FXK C;  2ZDI A;  3STL C;  3SPI A;  2WWW A;  2NNU A;  4ZKI A;  2EIK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...