1QR9A

Inhibition of hiv-1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQATVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GP41 ENVELOPE PROTEIN
publication title Inhibition of human immunodeficiency virus type 1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion.
pubmed rcsb
total genus 27
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qr9A00
1SZTA 1DF4A 2X7RB 3H01A 4E2LA 5KA5A 1EBOA 4JGSA 3M99B 2EZPA 1ENVA 3K9AA 5CN0A 5HFLA 1QR8A 5HFMA 1MOFA 4N23A 2M7WA 2OT5A 3CYOA 1QCEA 1F23A 1K34A 3B77A 2MK3A 4JF3A 3WFVA 1Y66A 3CP1A 2EBOA 3B8MA 3GWOA 1JQ0A 1QR9A 3P30A 4JPRA 3B8NA 4FIPC 1DF5A 4G2KA 5H9CA 4FK5C 1Y4MA 1JPXA 1I5XA 3MHHC 1MG1A 1I5YA 2LP7A 1K33A 4N21A 1DLBA 2EZOA 4FJCC 5KA6A 2P6JA 3MHSC 1QBZA 5CMUA
chains in the Genus database with same CATH superfamily
4LP8A 1W59A 4PA9A 4CC5A 3T2MA 1YVWA 2Y69B 3TGUH 1YCIA 1AR4A 3C3TA 4DR7B 1MNGA 4LR3A 4JYBA 4GKKO 4XDLA 4ZHQA 1K4CC 2R9AA 4J9YB 5GTHZ 1SRYA 4F6RA 2H8PC 3AG4B 1R6KA 3PJSK 2E74B 4X20B 3CX5F 4MSWC 4R6ZA 3OFNG 1VQNV 2R72A 3NXSA 3FFQA 1VF7A 4FLUA 4X62O 2QSAA 1GH6A 1QLEB 5BMVA 2LO1A 1XMQO 1XILA 4JV5B 2ZR3A 1L8DA 1R73A 2YDEA 5EC1C 1LUWA 1ZX3A 4CH3A 1YXBA 4H33A 1WN7A 1JX9A 4NR1A 2Q68A 1GKFA 4TT3G 3OGIB 2K9PA 4UFZA 2WLNA 2XAHA 1SQXH 3OEEG 3A0HZ 1G4YB 4KFMA 1R3KC 2RQ6A 3FB6C 3U0ZA 4UVAA 3ABKC 3RWRD 3IGAC 5CA0A 2Q67A 4CBCA 3JAMN 2UXDB 3ETQA 3P30A 2VQFB 3R66A 4X8AA 4DR1O 3S3WA 1MMMA 2N74A 2ZT9B 5JH7B 4CZZA 4W4KA 2UXBB 1VF6A 1NR7A 5LA6B 2WLIA 3WB0A 2CE4A 3HKCA 1SESA 5JCOA 1EFRG 3ZRSA 1W2BU 1XQ8A 3JAWB 4TSFG 4HBNA 2JDIG 2Z0AA 3KZIZ 2VRZA 2HKOA 4X64B 3L74H 2Y4UA 3GWOA 3DXRA 4JZGA 2DE0X 1FAFA 1WJZA 5KLVH 3T1HB 5KX5A 1AJPA 1N34O 1HNWB 3K9SA 3SJCC 1GO3F 3SYCA 1NTKH 5KAIZ 1F7YA 1DF4A 1H2NA 4GUNA 3SYPA 2CTPA 4GX1A 4YIPA 4J42A 4I9QA 1GN2A 3AG2B 4O2AA 3ZMSA 2F93B 3ABMB 4J7ZA 1FFTB 4TV8B 1AJNA 5GONA 4B3RO 1EN4A 1GMGA 1WA8A 3K3WA 2PTMA 2OIEA 4DRXB 1W0KG 2AZ0A 2DYSC 3L70H 4ZBMA 5BZBA 4LNUB 3CRRA 1AI5A 5LMNB 1KQSU 2IW5A 2E75B 3B40A 4Z1VA 4DV7B 1Y6XA 3AK3A 4DV0O 3MHSC 1MABG 5KA5A 1GN3A 5E1AC 4JI1B 2KQXA 2PYJA 1H2MA 2Z3YA 5D5QA 3KCYA 1H2KA 2EINC 1S5LZ 2BTQA 4B3MO 5JJNB 5BR8O 1OCRC 3LDDA 3AG1C 4Q6GA 1AP5A 5LGUA 2JGDB 1R3JC 1N36O 2GTAA 1GM9A 5B1AC 3CHXA 1JVMA 3UM7A 1ZL8B 1KKCA 2A79B 3UT5A 2VWJA 5H9CA 1H38A 5CBHA 4DV3B 1FJGB 3OUFA 1H2SB 3E86A 4DV4O 3B2EE 2YIBA 2WAMA 4HAMA 4MVSA 2ILMA 2DQ3A 3JASA 4MVMA 2QKAA 2Y0PA 2AGAA 2AW9A 1BHBA 4X1KB 1P49A 1Y74B 3R65A 1W0JG 1KECA 3LSSA 3JALA 4GKKB 1VQKV 2HJFC 2EIJB 3ABLB 4IT5A 1S76D 4N23A 4CS4A 3CPWU 2IH3C 1ZSPA 3SJBC 4XBFA 2V7QG 3OTFA 1F4NA 5LYJA 2JGUA 5LHIA 5EIBD 1KP3A 1JPXA 2KG7A 2XOKG 4OX9O 2ZD9A 3HKDB 4JYAO 3SJQC 4UCTA 3QG5A 4QGPA 4LFCO 4FLTA 3BABA 4FFBB 1FFXA 2IH1C 4NXNO 2UU9O 1G8MA 4ZOLB 3ZRWA 3N2GB 1XMQB 4MVRA 1GAXA 3N2KA 4F4LA 4DO2A 1JA8A 4DR7O 1VQ5V 4GCZA 2HP8A 2B1GA 5H6QA 4PI0A 4EEQA 3E22B 3ZHTA 2RCVA 3CJHA 1IDSA 2KSDA 2PZSA 2A06H 3CC7V 4UXNA 3SGIA 4IYHA 4X1YA 5IYZA 1SA0B 1S3JA 4DR4B 4L8JA 3J80N 3K0GA 2LGWA 4HZ3A 2ZIOA 2H3OA 2YC0A 2QDOA 1XMOB 1NS1A 5HFMA 3CCMV 4DR1B 1WAZA 1XL4A 4I4TB 4ZI7A 2KKWA 1K34A 4JTDB 3IC9A 3F7VC 2ZNIA 3EFFK 4X65O 2CUGA 3L72H 5AG2A 4I0XA 4NXMO 1BGYH 3APQA 1EN6A 1KD1W 1YJ9V 4Z1MG 1Q82W 4U3FH 1I7FA 2HVKC 2FB5A 4MVUA 5IYCO 2CH7A 5B1BC 5LOVA 1IXMA 4LWSA 1WPXA 4QE9A 3WU2Z 5B1OA 3RFRA 1N34B 4KXRA 1OCCB 3CCRV 4G28B 3JSLA 2UXDO 2WWWA 3QVNA 2A0LA 2W0XA 3RN4A 4K8XA 3OMIB 1SZTA 3CD6V 1ZTEA 3F7YC 1YSCA 1M57B 3HKEB 4FM0A 5L3CA 5IJ0B 3ZX6A 4PI2A 1E79G 2P4VA 3BHPA 2QE7G 3CMEV 4B3RB 4P30A 1CPYA 1NBMG 4QPKA 4U3JB 1KMIZ 4X64O 1K92A 3E2EA 1V54B 3OE7G 1TUBA 1OCOB 2X7RB 3GWKC 3OD4A 1WLEA 1Q6HA 3JCUZ 4EFEA 4TUYA 5FNVA 1VF6C 3SJAC 2MW2B 3Q4HA 4O4HB 2PI4A 3D3IA 1GK9A 3ZMZA 2N04A 1HP8A 4DV0B 1PNMA 4UB8Z 1XHXA 2P4KA 4YY3O 5KHGA 1I0HA 2UUAO 4JI5B 3RYHB 3B09A 4FFKA 2CDYA 3FYEB 3APOA 3UCSC 4FLVA 2R9IA 1FS0G 1WB7A 4B3MB 5JQGA 3C3SA 4CH5A 1TVKA 3AG3C 3THOA 4RWUA 4LFAO 3STLC 1WNSA 1OCZC 5LMUB 2M6YA 4I50B 3SYAA 1URFA 4DV1B 1H2LA 1N36B 5KX5B 3VQYA 2JS5A 3BFRA 2EILC 1HR0B 2C2AA 4I55A 2HFEC 5H5NA 2CAZC 4J7KA 1SQVH 1JCHA 3CCJV 3P3PA 4QIWF 2PYLA 2ZR2A 1JOYA 1PL0A 3AK1A 1M9NA 3MD0A 4JI1O 2JEUA 4DR3O 2Q69A 1K5SA 1GM7A 2WLJA 1HDJA 2EJRA 4BW9A 2ZIMA 1COWG 3P3NA 1XEQA 5EBMC 4GZRB 4YJ2B 1VQ6V 3CYOA 3BA8A 4WBNA 4LFBO 2ZXWB 3L73H 1VQ4V 4JI6O 3E83A 3X2QC 3TXSA 4BIZA 4FM2A 3H1KH 1R3IC 2B5UA 5IE9A 2FKXA 2LW1A 5CA1B 1SZXA 1V55C 1DTOA 3JD3A 3CCUV 4TV9B 1K9MW 3ETEA 4MVZA 4LF7O 5L3GA 3W7WA 4OX9B 1PPJH 2CGOA 4JYAB 2BSKB 3ML0A 3A0BZ 2W6IG 3FAVB 2XAFA 4LFCB 4JI0O 5J2UB 4AQYO 4NXNB 1AR1B 4IGGA 2QWOB 4LF9O 4B08A 3W7SA 3WG7C 1X59A 1QR9A 4CS2A 1SQFA 4J7JA 2WLLA 2Y69C 5EZYB 3IC7A 1ZWIC 5EBWC 1BS3A 1JJOA 5KMGB 4JAAA 3ZHQA 4X9QA 5L3EA 5CN0A 3ZIAG 4WF9V 5EIBC 5LBQA 2IJIA 4JPRA 1PNLA 2DYRB 2QEXV 3B4SA 2F23A 4RUFA 2F1MA 4O4JA 5GTIZ 5IY5C 4HNAA 1D5AA 3KCXA 2Y4TA 1GM8A 1YTFB 3P32A 4X65B 2OIGA 4DW0A 1AP6A 1HWYA 4NXMB 2DOSA 2HEPA 5IYDO 4MTXA 3RYCB 1S5HC 5CBFA 5F2VO 1PV0A 5L3DA 3BAAA 3CCLV 1LR1A 2OYQA 4ICGA 5C93A 3K59A 1NH2D 4DR4O 2CTRA 2QA4V 3LSQA 1QR8A 4RUEA 1AILA 1E1QG 2UXXA 3VBBA 4MW3A 3DC6A 1XMOO 4UVBA 4O4IA 3ABKB 1S77D 2P22C 4IHJA 1MSWD 1LNQA 1NT2B 3VQVA 1RSOB 1JFFB 2GUZB 3D8CA 5JWPA 1XNRB 1RPRA 5LGTA 1QCEA 4TQDA 1L0NH 3CCQV 4LBEC 4OGQB 1L0LH 3ZEDA 3DTUB 1R3LC 2YI8A 4DR6B 1M4UA 1PKXA 5DN6G 3UQ8A 1YZBA 4BR6A 1VP7A 1I94B 3VQXA 1NZ6A 4RQFA 1R6NA 3KG2A 3HKBA 4LF8B 2BOBC 4YY3B 1NJIW 1VQ9V 2IJJA 2UUAB 4DV2O 2Q0OC 2LFSA 2NN4A 5GW7A 4X1IB 1K8AW 3C90A 4LFAB 4GKJO 3ABMC 4MT8A 4AILC 3RYFB 3K9AA 3L75H 2M7WA 1Y76B 3ZHVA 1MZEA 3ZRVA 5LHHA 3ZS8C 4GX2A 1BL8A 3W7TA 4X66B 1YIJV 3QO8A 2RMKB 5ITZB 4LC1A 2HHHO 2YXYA 5JVDB 5J2TB 1BQ0A 5LL6Y 3G71V 4DR3B 5C8YA 3JARA 2ZINA 4JI5O 5H2FZ 2YIDA 5EYPB 1AVMA 4R50A 1P84F 1R1BA 1WP8A 1B6QA 3QNEA 5CB4A 1K33A 2L6LA 1XHZA 4CH6A 2DQ0A 1CXZB 5LMUO 1QBZA 3K06A 2EIMC 4DV1O 4LFBB 1OCRB 1DGSA 2OTLV 3JD4A 2LFRA 1HR0O 4RO2A 3CRMA 2P06A 1G6UA 1IXBA 3K79A 4BWAA 2PI5A 4JI6B 1XNQB 3B8MA 4B3TO 1GN4A 4UVCA 5B1AB 1V9PA 1AR5A 3A2FA 2OWOA 3ZCCA 5LXTA 3EVKA 3M8AA 4FPPA 3FB7C 2YEVA 1AB3A 3SYOA 1RM1B 4JGSA 1NVPD 5JQGB 4LF7B 4YXWG 2ITCC 3CS5A 3FYIB 1UPGA 4JTAB 1KKDA 1PD3A 4JI0B 4AQYB 1OHHG 2XUMA 4LF9B 2NR5A 4DK1A 5IJ9B 2P90A 3L71H 1JR9A 4X20A 5B66Z 3D3QA 3RYIB 1MOFA 2Y48A 4H44B 2QJ1A 3K5NA 3IAYA 3ZHRA 4JI8B 2P67A 2D2CB 5IYBO 2EIJC 4MVQA 2R9RB 2W6JG 4AI8A 2JJ2G 4TWKA 1ROPA 2QKCA 2ADQB 3OAAG 3OUSA 1M56C 1PM9A 4I5SA 4WBNB 1BHAA 2IJHA 3OW2U 3BPZA 3CB2A 2YXLA 3TJTA 2LP7A 3ZRXA 1FXKC 3ASOB 3G80A 2ATKC 2L35A 4DW1A 4IIJB 3JD2A 2XASA 5LP6B 1VQ7V 1VQLV 3FD9A 5DEDA 2UUCO 4O4LB 5JH7A 3MHHC 2F4VO 5LA6A 4EB6B 4O2BB 4E4EA 3OMAB 3JATB 1IBKO 1SQPH 4PELA 1KP2A 1EBOA 1TUEB 1B3QA 2HJDA 2ODMA 2PY5A 3CRCA 2ZDIC 3IJ4A 2QTSA 4ZHQB 5KUKA 4F6RB 1U97A 2QWNB 5FLXN 3SPIA 4UCOA 1VF5B 4RAIA 1WB8A 4WFEA 2Y0IA 3CWBH 5EC2C 5A9GA 2PUSA 3ZMTA 4NB5A 5E79Z 1AI7A 5BMVB 4DV5O 3HB3B 4QJFB 3TCUA 3LDCA 3SPCA 4GYCB 1NI8A 1K5QA 4OXSA 3OR6C 1XBLA 4OPAA 2P6JA 3WB2A 3O9OA 1YHQV 3IFXA 3O65A 4PJ0Z 3QO5A 2JRIA 4DRXA 4WFHA 1IZ3A 3G6BA 3ZN0A 4MVOA 4FLZA 3K58A 4R8CA 4DV2B 4LNUA 5A2QN 3J81N 3CCSV 3ASNC 2JVDA 1XNRO 4R7CA 4DR5B 1FPOA 1J5EO 4FLXA 4GKJB 2NLJC 4TQFA 3EXAA 4WFFA 4E2LA 1QNMA 1P4RA 2XTAA 1VIBA 5IT9N 2Q7EA 5CA0B 3LUTB 3BY6A 4DR6O 1R6TA 2UXCO 2HHHB 3OTOB 1B06A 3RVYA 2FTKA 1I94O 1YITV 2CTWA 5L3BA 2WLIB 3ZN1A 4LF8O 3LNMB 4PA3A 1OJHA 2JGDA 4QE7A 3U11A 3HKCB 2LQTA 3ABUA 4P2ZA 4YIOA 2AXTZ 2XAQA 3BRCA 3OR7C 2XAJA 4JF3A 1EM1A 3CP1A 1ZL8A 4LF6O 1BT8A 3DXRB 2R70A 2V1DA 5KHKA 2ZM6B 1THZA 3AG3B 3H1IH 4AHCA 1OCZB 2DW4A 1PP9H 1MZFA 4EFBA 4X66O 2EIKC 3ZHUA 2OCCC 5LHGA 4B3TB 2EILB 4J80A 4XDJA 4LH7A 1Q6IA 4UCUA 4EKWA 4L87A 2B1IA 4P9OA 1NR1A 4O2AB 1HNXO 4XDKA 1MSDA 3RT3C 4FK5C 3CMAV 1GN6A 1TGOA 1ORQC 5GONB 4MW8A 3K57A 1DK1A 1AI6A 4FVMA 1Y74A 4X1KA 1WA8B 3H1HH 4F6EA 3BEHA 4DYLA 5TISZ 1H8EG 2Q73A 3CCEV 1FXVA 4QNHB 4H0LB 3A0RA 2F66C 2P5OA 3OT7A 2ZE5A 2ZE7A 4PA7A 3AG7A 3RGBA 4PDVA 5B3SC 1AI4A 2HVJC 4KHPO 2EJ7A 4FMTA 2A7WA 2EZOA 1XNQO 2ZXWC 1N32O 4CC6A 3HKDA 3K0DA 3CXCU 3X2QB 1XREA 4FFBA 4I9WA 4ZOLA 3N2GA 1FXKA 2QM8A 4G27B 1BMFG 1S0VA 2BTQB 3SDLA 5EK0A 2HR3A 1BQZA 4U7NA 4N21A 3K5LA 1WP7A 1N0JA 4NKGB 3E22A 4BW5A 4BAYA 4WFAV 4JASA 5CBGA 1HW7A 1P7GA 2WLKA 2ARHA 3JD0A 3E8HA 2EBOA 3UT5B 3A8TA 3JAKA 2WA3A 4PA4A 4MS2A 1KYOF 3WG7B 1SA0A 1Q90D 4DUYB 2WLMA 2ZDIA 5KA6A 2IM9A 3GB7C 1Z5WA 2OCHA 4JI8O 3U10A 3TXQA 1BSMA 1CP9A 4C7UA 4UV9A 4YJ3A 3AG4C 1IVSA 1ENVA 2QKSA 2UUCB 1Q3EA 1J95A 1L1FA 3SPGA 3JASB 4I4TA 2F4VB 4K0KB 2MK3A 2ZE8A 1ZUQA 3JCZA 1K3EA 4KUMA 4B7KA 2VS0A 1JJ2U 3F5TA 4NYKA 1IBKB 5KUMA 3K04A 3CCVV 2QTOA 2X0LA 4PA6A 3LDEA 2UUBB 1QLEC 1Z2GA 4FLYA 1Q6UA 3FKSG 3JALB 2RNBA 3UO2A 2DYRC 4JI4B 1IBMO 2AZ2A 4K3AA 2VQEB 3WFVA 1XL6A 4JI7O 5LYJB 5IY5B 2V4DA 1Z5VA 1FYJA 2CK3G 2KG7B 5IWAO 4FM1A 1HNZO 2JJ1G 2P7TC 4WCEV 1RPOA 2Q8VA 1VQOV 2FYUH 4GX0A 4UCVA 2GDSA 1FFXB 1SETA 3HKEA 3ZRWB 4DV5B 3H9VA 5IJ0A 4FIPC 3N2KB 4UB6Z 1EN5A 3I56V 5JJJB 2N05A 3DC5A 3H1LH 5KHJA 2WSSG 4U3JA 5KHIA 4D7SA 1T5EA 4K35A 1NU1H 2UXNA 3RBZA 2QWQB 3CJHB 5B5EZ 5K1PA 1KB9F 2DJVA 2NNUA 4O4HA 1F23A 4A5UB 4Z2WA 1J5EB 4GX5A 2A9HA 1VEWA 4X1YB 5IYZB 4JI2B 3RVZA 2LJ2A 1RFYA 4JYYA 2QM4A 1NTMH 3D36A 2AHYA 3RYHA 4UV8A 2UXCB 4X88A 1PNKA 3AEIA 4J9ZB 3EHBB 1GRJA 4ZI7B 2JK5C 4MTOA 1VMGA 3QO7A 2EULA 2IBZH 2JIZG 4NTWA 4OPHA 4I50A 4CS3A 5L3FA 2KB1A 3H1JH 1F51A 1SS3A 4I0XB 2YICA 3T4DA 1Q86W 2FL4A 4DR5O 3AG2C 1Q43A 2LW7A 3ABTA 4B3SO 4LF4O 4LF6B 2CH7B 2YI9A 5LOVB 4DXWA 4LWSB 5H6RA 1M5IA 3UO3A 2DWEC 4NTXA 5KAFZ 1OV9A 3BCCH 4X89A 2E3CA 4B7EA 5LGNA 2DYSB 3VOUA 4DV6O 1TA8A 3OTOO 1XI1A 4PV1B 3T4ZA 3FX7A 4TOIA 1KC8W 1HNXB 4MTFA 4J10A 4YJ2A 4YHHB 4PD4F 3MDSA 1FKAO 2QM7A 5K1XA 2QWRB 1IBLO 2G38A 2GTSA 2YIAA 3J7AU 3I55V 2QR4A 4FJCC 1NTZH 1SC5B 1TUBB 2EINB 2ZM6O 1FD9A 5CA1A 4QPJA 3SR2C 1FXHA 5EBLC 4LF5O 3NR7A 3CRQA 4TUYB 1B04A 5FNVB 4DUZO 3Q4HB 3AG1B 2Q6AA 4KHPB 4TV9A 2JEXA 3ZMVA 1XOUA 1N0NA 2EIMB 2BTOA 4W4LA 3UKMA 1N33O 1Y4MA 1N32B 5DM6V 1MG1A 1SKVA 2BSKA 2YXHA 3FAVA 3OM3B 5J2UA 1OZ0A 2X6BA 3F5WC 4NVPA 4DR2B 3ZJZA 1YEWA 2WLHA 1YDXA 2LGQA 1TVKB 4WFGA 4ZIBA 1TAEA 2Q7GA 3BA9A 2OTJV 4JI3B 1QVGU 1K7DA 2F43G 4WFBV 4G2KA 4J11A 1SERA 1H2GA 2W0FC 1RM1C 3M7MX 1Q81W 1Y67A 1H8HG 5EZYA 4LH6A 1P7BA 1BZKA 5BXZA 3HR0A 1N4CA 4I55B 3WB1A 3H01A 5KMGA 3MAQA 3T1CA 3T1YB 3M99B 5JJEB 1MA1A 3ICXA 4P9PA 1D5NA 2XHBA 4NTYA 2ZE6A 4Q20A 3HPLC 3KKYA 3ZBHA 4I7ZB 4D6TH 3G67A 2GV9A 4UCSA 1I5YA 3DSQA 3ABLC 2YIBD 3K08A 1D2DA 3TK1A 2JS3A 2FMLA 4JAVA 5BY1A 3FB5C 1AROP 1M93A 3OMNB 3G4SV 3CC4V 1M56B 4UUJC 3QTCA 1BCCH 1KBHA 2Q0AA 2ZCEA 3RYCA 4X62B 3LNNA 2ITDC 2XNDG 4BIOA 1IBMB 2GHYA 3CRAA 4JZ2A 4HYOA 1XDCA 4JI7B 4MTGA 4DUYO 1YTFD 1FXKB 2E5LO 5IWAB 1HNZB 3ASOC 2IJKA 4K0KO 2VWKA 1YI2V 3CSXA 3I5DA 3ZMUA 2K1EA 5LP6C 1JQ0A 1K97A 5CA3A 4PHZA 1RSOA 4KL1A 1JFFA 2GUZA 2BOCC 2UUBO 4DK0A 3S3XA 1SF9A 3JAWA 2CGNA 3BVOA 3ZHSA 3JAKB 2D3OW 1E1RG 4JI4O 1WPBA 3STZC 2Q7HA 1CEZA 2WLLB 2VQEO 1U96A 1DLBA 1X4TA 2PF4E 1KU9A 2F95B 4JV5O 3AK2A 4YJ3B 1O9HA 1K73W 2WA4A 1S72V 1QQCA 3CC2V 4FZ1A 2ETNA 5DECA 3ETDA 1KUQA 2RJZA 1G1XB 2RN9A 1XUQA 1LUVA 5B1BB 1QHTA 2XAGA 2ZQMA 4TV8A 2Q9LA 2YS8A 4O4JB 4JYCA 1Q8IA 1YF2A 4X1IA 2RDCA 4IL6Z 3N27A 4HNAB 2EZPA 3RYFA 1OCCC 3JD1A 1NH2B 1Y76A 1UFIA 3CXHF 1DF5A 2BCCH 3E8FA 3PN1A 3SPHA 3GVMA 1SQBH 5ITZA 1QVFU 1M57C 2VQFO 4B3SB 4LF4B 4FZ0A 2ADPA 1YJNV 1UJWB 5JVDA 5J2TA 2UXBO 3ASNB 4JI2O 2QWPB 2Z5UA 4PDMA 1VQPV 1M90W 2Q5ZA 2GSMB 2OT5A 2X6CA 1V54C 5EYPA 4DV6B 1OCOC 2IU0A 5FPOA 1I5XA 2HG5C 4O4IB 4IHJB 2HLDG 4H37A 4JAUA 2ZNJA 3L9DA 1NKDA 3T1HO 1HNWO 4BIUA 1IBLB 3QF7A 3K03A 3TETA 3JYCA 1O9GA 2O57A 1Q7YW 1AJQA 2DWDC 3VQWA 3D36C 5JCOC 2QGNA 3OEHG 3E89A 5FPRA 2ZKOA 3W7UA 2GBOA 3G6EV 4LF5B 1GTOA 2BE3A 5D5PA 1F4MA 4DUZB 3SYQA 1K4DC 5HFLA 3LSUA 4H13B 5BR8B 4KP4A 1N33B 3CE2A 3HKBB 2EIKB 3E8BA 2OCCB 3K5OA 4YHHO 1ZAUA 4ASUG 1EZVH 5IJ9A 5LMNO 1VQMV 1EZJA 1S5JA 2X6AA 3RW0A 4DV7O 4UCRA 3K5MA 3RYIA 4PDRA 3CEIA 1Y66A 2EX3A 1PL4A 1JMKC 3FB8C 1NQTA 3B8NA 5KHHA 4GLXA 3E8GA 4DV4B 4JTCB 4PDLA 5FL7G 4RQEA 1VQ8V 1I08A 4ZKIA 5B3SB 1QLNA 5CMUA 2WPDG 4U7OA 2IU3A 4IYIA 2PGGA 4ABMA 5J9PC 1SQQH 5C8YB 3JARB 1RP3B 4DR2O 3B77A 4FLWA 1N8RW 1IX9A 1M1KW 2YUAA 4J41A 1ZLZA 1V55B 2A3QA 5CB4B 3ETGA 4JI3O 4D7TA 4LCUC 2DN9A 2YSUB 4GT1A 2Q4PA 2AHZA 3JSNA 1US6A 4IIJA 1IURA 4DV3O 2XT9A 3E35A 3W7XA 1FJGO 1BE3H 4K8ZA 1NVPB 1SQGA 1YJWV 1A32A 2DMXA 3OGCC 5B1NA 5LP6A 3T1YO 2CTQA 1VARA 4O4LA 2E76B 4CH4A 5LXTB 4EB6A 2H94A 4O2BA 3DGEA 2B9ZA 2UU9B 1QU7A 2YEVB 3SPJA 2E5LB 1Q5OA 3JATA 5IDJA
chains in the Genus database with same CATH topology
3AG2C 2X7RB 4LP8A 3OUSA 4PA9A 3ABTA 1M56C 1WLEA 3T2MA 2Y69B 4I5SA 4DXWA 4JYBA 2PI4A 3D3IA 1GK9A 4XDLA 5H6RA 1BHAA 3ZMZA 1K4CC 2IJHA 4J9YB 1SRYA 3OW2U 2DWEC 2H8PC 3AG4B 1R6KA 4X89A 2LP7A 5LGNA 1PNMA 2DYSB 3ZRXA 3VOUA 1FXKC 3PJSK 3ASOB 4MSWC 1VQNV 2ATKC 3OFNG 4R6ZA 3T4ZA 3NXSA 3FYEB 1KC8W 3JD2A 4MTFA 1Q86W 2R9IA 1FS0G 3AG3C 1QLEB 2XASA 2QM7A 3STLC 1VQ7V 1VQLV 1OCZC 3MHHC 3SYAA 3I55V 2EILC 4FJCC 2C2AA 2ZR3A 2HFEC 3OMAB 1R73A 2EINB 5EC1C 4PELA 1KP2A 1EBOA 4H33A 1TUEB 4QPJA 1JCHA 1FXHA 5EBLC 3CCJV 4QIWF 1JX9A 3AG1B 2Q6AA 2ZDIC 2ZR2A 2JEXA 1PL0A 2Q68A 1GKFA 4TT3G 3ZMVA 1JOYA 1M9NA 2EIMB 3MD0A 5KUKA 2JEUA 3UKMA 2Q69A 1K5SA 2WLNA 1GM7A 1Y4MA 2XAHA 5DM6V 1MG1A 3SPIA 2WLJA 4RAIA 3OEEG 3OM3B 1G4YB 2EJRA 4WFEA 5EC2C 1OZ0A 2X6BA 3F5WC 4KFMA 1COWG 1R3KC 3ZJZA 5EBMC 3FB6C 4UVAA 2WLHA 1VQ6V 4WFGA 3ABKC 3IGAC 3CYOA 3ZMTA 2OTJV 2Q67A 4CBCA 1QVGU 1K7DA 2F43G 1AI7A 2ZXWB 4WFBV 3P30A 4X8AA 4G2KA 1VQ4V 1SERA 1H2GA 2W0FC 3HB3B 4QJFB 3TCUA 4CZZA 1RM1C 3LDCA 1Q81W 3SPCA 1H8HG 3E83A 1NR7A 3X2QC 1P7BA 4OXSA 1K5QA 2WLIA 3OR6C 4BIZA 2P6JA 1YHQV 2B5UA 1R3IC 3IFXA 3H01A 1SESA 3T1CA 3QO5A 1EFRG 3M99B 3ZRSA 1V55C 1DTOA 1W2BU 4P9PA 4WFHA 4TSFG 3JD3A 3ZN0A 3CCUV 2JDIG 4MVOA 4Q20A 1K9MW 3HPLC 3ETEA 4MVZA 4R8CA 2HKOA 3GWOA 5L3GA 3W7WA 3CCSV 3ASNC 4R7CA 1I5YA 3ML0A 3ABLC 2W6IG 2XAFA 1AJPA 2NLJC 3K08A 3SYCA 1GO3F 4WFFA 1AR1B 3TK1A 1DF4A 4JAVA 4E2LA 3SYPA 3W7SA 1P4RA 3FB5C 4GX1A 3WG7C 1AROP 3LUTB 3BY6A 3OMNB 3G4SV 3AG2B 3CC4V 3ZMSA 1QR9A 1M56B 4UUJC 3ABMB 3RVYA 2FTKA 2WLLA 2Y69C 1YITV 1FFTB 1ZWIC 3IC7A 5EBWC 5L3BA 2WLIB 1AJNA 3ZN1A 3LNMB 2ITDC 2XNDG 4PA3A 1GMGA 4QE7A 2GHYA 3K3WA 4HYOA 3ABUA 4P2ZA 4MTGA 1YTFD 1W0KG 5L3EA 5CN0A 1FXKB 3ZIAG 2DYSC 2XAQA 4WF9V 3OR7C 2XAJA 4ZBMA 4JF3A 3ASOC 3CP1A 5BZBA 5LBQA 2IJIA 4JPRA 1AI5A 1PNLA 2V1DA 2IJKA 1KQSU 2DYRB 2IW5A 2QEXV 1THZA 3AG3B 1YI2V 4RUFA 3ZMUA 2K1EA 1OCZB 2DW4A 3MHSC 1JQ0A 1K97A 1MABG 5KA5A 5CA3A 2EIKC 2OCCC 5E1AC 5IY5C 5LHGA 2BOCC 2EILB 4XDJA 4EKWA 2Z3YA 4L87A 2B1IA 1GM8A 4P9OA 1YTFB 3P32A 1NR1A 2EINC 2D3OW 1E1RG 4XDKA 3STZC 1HWYA 1CEZA 2WLLB 4FK5C 5IYDO 4MTXA 3CMAV 1OCRC 1S5HC 5CBFA 1DLBA 1ORQC 3LDDA 3AG1C 4MW8A 5L3DA 5LGUA 1AI6A 1R3JC 3CCLV 3BEHA 1GM9A 5C93A 5B1AC 1H8EG 1NH2D 1K73W 3CCEV 2QA4V 1FXVA 4QNHB 3LSQA 1QR8A 3A0RA 4RUEA 1E1QG 1S72V 2UXXA 3CC2V 1JVMA 4PA7A 3UM7A 3VBBA 4PDVA 3ETDA 4MW3A 2A79B 5B3SC 1AI4A 2HVJC 5H9CA 1H38A 4FMTA 4UVBA 3ABKB 5B1BB 1S77D 2EZOA 2XAGA 1MSWD 5CBHA 2ZQMA 1LNQA 4JYCA 2ZXWC 3OUFA 3E86A 3K0DA 3CXCU 2WAMA 4HAMA 3X2QB 4I9WA 2EZPA 4MVSA 1OCCC 1RPRA 3JD1A 5LGTA 1NH2B 1FXKA 2DQ3A 2QM8A 1QCEA 4G27B 1BMFG 1S0VA 4MVMA 3CCQV 1DF5A 3E8FA 3SPHA 4LBEC 5EK0A 2HR3A 4U7NA 1QVFU 1M57C 4N21A 3DTUB 1YJNV 1BHBA 1R3LC 1UJWB 3ASNB 3R65A 1W0JG 1KECA 1PKXA 2Z5UA 4PDMA 4BW5A 5DN6G 3LSSA 4BAYA 4WFAV 1VQKV 2HJFC 4JASA 5CBGA 1VQPV 2EIJB 3ABLB 1M90W 1S76D 4N23A 2GSMB 3CPWU 2IH3C 2WLKA 2OT5A 2X6CA 3JD0A 1R6NA 3E8HA 4RQFA 3KG2A 2EBOA 2BOBC 2V7QG 1V54C 4XBFA 1F4NA 1OCOC 2IU0A 5LHIA 1NJIW 4PA4A 1KP3A 1JPXA 1I5XA 2HG5C 4MS2A 2IJJA 3WG7B 1VQ9V 2XOKG 2HLDG 2WLMA 2ZDIA 4H37A 5KA6A 2LFSA 3GB7C 4JAUA 2ZD9A 5GW7A 1K8AW 1CP9A 3SJQC 1NKDA 3ABMC 4MT8A 4UV9A 4BIUA 2IH1C 3AG4C 1ENVA 1G8MA 3K9AA 2QKSA 3K03A 2M7WA 3ZRWA 3TETA 1J95A 3JYCA 1L1FA 3SPGA 2MK3A 3ZRVA 4MVRA 1Q7YW 1AJQA 2DWDC 3JCZA 4GX2A 5LHHA 4F4LA 1K3EA 1BL8A 4KUMA 3W7TA 4DO2A 3OEHG 3E89A 1JJ2U 1YIJV 1VQ5V 3QO8A 4GCZA 4LC1A 2B1GA 5H6QA 5KUMA 3W7UA 3G6EV 3K04A 1GTOA 3CCVV 2QTOA 2X0LA 4PA6A 1F4MA 3LDEA 1QLEC 3FKSG 3SYQA 1K4DC 3G71V 2DYRC 5HFLA 4KP4A 3WFVA 1XL6A 3CC7V 2EIKB 4UXNA 3E8BA 2OCCB 5IY5B 4R50A 4ASUG 2CK3G 1B6QA 3QNEA 1S3JA 2JJ1G 1K33A 2P7TC 4WCEV 1RPOA 1VQOV 2DQ0A 1VQMV 1EZJA 1QBZA 4GX0A 2X6AA 3K0GA 3K06A 4HZ3A 3RW0A 2EIMC 1OCRB 2OTLV 3JD4A 2LFRA 1SETA 4RO2A 3CCMV 5HFMA 3ZRWB 1XL4A 3K79A 4PDRA 1K34A 4JTDB 2PI5A 1Y66A 3B8MA 3F7VC 3FB8C 1NQTA 3B8NA 4FIPC 4UVCA 5B1AB 3EFFK 3I56V 3E8GA 4JTCB 3ZCCA 2WSSG 4PDLA 5FL7G 4FPPA 4RQEA 1VQ8V 3FB7C 4ZKIA 2YEVA 5B3SB 1QLNA 2UXNA 5CMUA 3RBZA 1KD1W 1YJ9V 4Z1MG 3SYOA 2WPDG 1Q82W 2HVKC 4U7OA 2IU3A 1RM1B 4MVUA 4JGSA 5IYCO 1NVPD 5J9PC 4YXWG 2ITCC 5B1BC 3FYIB 1IXMA 2NNUA 1WPXA 1F23A 4JTAB 3B77A 4QE9A 1KKDA 5B1OA 1N8RW 1M1KW 1PD3A 4GX5A 2A9HA 1OHHG 1OCCB 3RVZA 3CCRV 1V55B 4G28B 3ETGA 2P90A 2WWWA 4LCUC 2A0LA 2YSUB 3D36A 4GT1A 2AHYA 3OMIB 1SZTA 2AHZA 4UV8A 3CD6V 4X88A 1PNKA 3F7YC 1YSCA 1M57B 3AEIA 4J9ZB 3E35A 3W7XA 5L3CA 1MOFA 2Y48A 3EHBB 2JK5C 1NVPB 4MTOA 1YJWV 3QO7A 3OGCC 5B1NA 1E79G 2QE7G 2JIZG 2P67A 3CMEV 4P30A 1CPYA 1NBMG 5IYBO 5L3FA 2EIJC 2KB1A 4MVQA 4QPKA 2R9RB 2H94A 1F51A 3DGEA 2W6JG 1K92A 2JJ2G 4TWKA 3E2EA 2YEVB 1ROPA 1V54B 3OE7G 3SPJA 3T4DA 1OCOB 3OAAG 5IDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZT A;  1DF4 A;  2X7R B;  3H01 A;  4E2L A;  5KA5 A;  1EBO A;  4JGS A;  3M99 B;  2EZP A;  1ENV A;  3K9A A;  5CN0 A;  5HFL A;  1QR8 A;  5HFM A;  1MOF A;  4N23 A;  2M7W A;  2OT5 A;  3CYO A;  1QCE A;  1F23 A;  1K34 A;  3B77 A;  2MK3 A;  4JF3 A;  3WFV A;  1Y66 A;  3CP1 A;  2EBO A;  3B8M A;  3GWO A;  1JQ0 A;  1QR9 A;  3P30 A;  4JPR A;  3B8N A;  4FIP C;  1DF5 A;  4G2K A;  5H9C A;  4FK5 C;  1Y4M A;  1JPX A;  1I5X A;  3MHH C;  1MG1 A;  1I5Y A;  2LP7 A;  1K33 A;  4N21 A;  1DLB A;  2EZO A;  4FJC C;  5KA6 A;  2P6J A;  3MHS C;  1QBZ A;  5CMU A; 
#chains in the Genus database with same CATH topology
 4LP8 A;  1W59 A;  4PA9 A;  4CC5 A;  3T2M A;  1YVW A;  2Y69 B;  3TGU H;  1YCI A;  1AR4 A;  3C3T A;  4DR7 B;  1MNG A;  4LR3 A;  4JYB A;  4GKK O;  4XDL A;  4ZHQ A;  1K4C C;  2R9A A;  4J9Y B;  5GTH Z;  1SRY A;  4F6R A;  2H8P C;  3AG4 B;  1R6K A;  3PJS K;  2E74 B;  4X20 B;  3CX5 F;  4MSW C;  4R6Z A;  3OFN G;  1VQN V;  2R72 A;  3NXS A;  3FFQ A;  1VF7 A;  4FLU A;  4X62 O;  2QSA A;  1GH6 A;  1QLE B;  5BMV A;  2LO1 A;  1XMQ O;  1XIL A;  4JV5 B;  2ZR3 A;  1L8D A;  1R73 A;  2YDE A;  5EC1 C;  1LUW A;  1ZX3 A;  4CH3 A;  1YXB A;  4H33 A;  1WN7 A;  1JX9 A;  4NR1 A;  2Q68 A;  1GKF A;  4TT3 G;  3OGI B;  2K9P A;  4UFZ A;  2WLN A;  2XAH A;  1SQX H;  3OEE G;  3A0H Z;  1G4Y B;  4KFM A;  1R3K C;  2RQ6 A;  3FB6 C;  3U0Z A;  4UVA A;  3ABK C;  3RWR D;  3IGA C;  5CA0 A;  2Q67 A;  4CBC A;  3JAM N;  2UXD B;  3ETQ A;  3P30 A;  2VQF B;  3R66 A;  4X8A A;  4DR1 O;  3S3W A;  1MMM A;  2N74 A;  2ZT9 B;  5JH7 B;  4CZZ A;  4W4K A;  2UXB B;  1VF6 A;  1NR7 A;  5LA6 B;  2WLI A;  3WB0 A;  2CE4 A;  3HKC A;  1SES A;  5JCO A;  1EFR G;  3ZRS A;  1W2B U;  1XQ8 A;  3JAW B;  4TSF G;  4HBN A;  2JDI G;  2Z0A A;  3KZI Z;  2VRZ A;  2HKO A;  4X64 B;  3L74 H;  2Y4U A;  3GWO A;  3DXR A;  4JZG A;  2DE0 X;  1FAF A;  1WJZ A;  5KLV H;  3T1H B;  5KX5 A;  1AJP A;  1N34 O;  1HNW B;  3K9S A;  3SJC C;  1GO3 F;  3SYC A;  1NTK H;  5KAI Z;  1F7Y A;  1DF4 A;  1H2N A;  4GUN A;  3SYP A;  2CTP A;  4GX1 A;  4YIP A;  4J42 A;  4I9Q A;  1GN2 A;  3AG2 B;  4O2A A;  3ZMS A;  2F93 B;  3ABM B;  4J7Z A;  1FFT B;  4TV8 B;  1AJN A;  5GON A;  4B3R O;  1EN4 A;  1GMG A;  1WA8 A;  3K3W A;  2PTM A;  2OIE A;  4DRX B;  1W0K G;  2AZ0 A;  2DYS C;  3L70 H;  4ZBM A;  5BZB A;  4LNU B;  3CRR A;  1AI5 A;  5LMN B;  1KQS U;  2IW5 A;  2E75 B;  3B40 A;  4Z1V A;  4DV7 B;  1Y6X A;  3AK3 A;  4DV0 O;  3MHS C;  1MAB G;  5KA5 A;  1GN3 A;  5E1A C;  4JI1 B;  2KQX A;  2PYJ A;  1H2M A;  2Z3Y A;  5D5Q A;  3KCY A;  1H2K A;  2EIN C;  1S5L Z;  2BTQ A;  4B3M O;  5JJN B;  5BR8 O;  1OCR C;  3LDD A;  3AG1 C;  4Q6G A;  1AP5 A;  5LGU A;  2JGD B;  1R3J C;  1N36 O;  2GTA A;  1GM9 A;  5B1A C;  3CHX A;  1JVM A;  3UM7 A;  1ZL8 B;  1KKC A;  2A79 B;  3UT5 A;  2VWJ A;  5H9C A;  1H38 A;  5CBH A;  4DV3 B;  1FJG B;  3OUF A;  1H2S B;  3E86 A;  4DV4 O;  3B2E E;  2YIB A;  2WAM A;  4HAM A;  4MVS A;  2ILM A;  2DQ3 A;  3JAS A;  4MVM A;  2QKA A;  2Y0P A;  2AGA A;  2AW9 A;  1BHB A;  4X1K B;  1P49 A;  1Y74 B;  3R65 A;  1W0J G;  1KEC A;  3LSS A;  3JAL A;  4GKK B;  1VQK V;  2HJF C;  2EIJ B;  3ABL B;  4IT5 A;  1S76 D;  4N23 A;  4CS4 A;  3CPW U;  2IH3 C;  1ZSP A;  3SJB C;  4XBF A;  2V7Q G;  3OTF A;  1F4N A;  5LYJ A;  2JGU A;  5LHI A;  5EIB D;  1KP3 A;  1JPX A;  2KG7 A;  2XOK G;  4OX9 O;  2ZD9 A;  3HKD B;  4JYA O;  3SJQ C;  4UCT A;  3QG5 A;  4QGP A;  4LFC O;  4FLT A;  3BAB A;  4FFB B;  1FFX A;  2IH1 C;  4NXN O;  2UU9 O;  1G8M A;  4ZOL B;  3ZRW A;  3N2G B;  1XMQ B;  4MVR A;  1GAX A;  3N2K A;  4F4L A;  4DO2 A;  1JA8 A;  4DR7 O;  1VQ5 V;  4GCZ A;  2HP8 A;  2B1G A;  5H6Q A;  4PI0 A;  4EEQ A;  3E22 B;  3ZHT A;  2RCV A;  3CJH A;  1IDS A;  2KSD A;  2PZS A;  2A06 H;  3CC7 V;  4UXN A;  3SGI A;  4IYH A;  4X1Y A;  5IYZ A;  1SA0 B;  1S3J A;  4DR4 B;  4L8J A;  3J80 N;  3K0G A;  2LGW A;  4HZ3 A;  2ZIO A;  2H3O A;  2YC0 A;  2QDO A;  1XMO B;  1NS1 A;  5HFM A;  3CCM V;  4DR1 B;  1WAZ A;  1XL4 A;  4I4T B;  4ZI7 A;  2KKW A;  1K34 A;  4JTD B;  3IC9 A;  3F7V C;  2ZNI A;  3EFF K;  4X65 O;  2CUG A;  3L72 H;  5AG2 A;  4I0X A;  4NXM O;  1BGY H;  3APQ A;  1EN6 A;  1KD1 W;  1YJ9 V;  4Z1M G;  1Q82 W;  4U3F H;  1I7F A;  2HVK C;  2FB5 A;  4MVU A;  5IYC O;  2CH7 A;  5B1B C;  5LOV A;  1IXM A;  4LWS A;  1WPX A;  4QE9 A;  3WU2 Z;  5B1O A;  3RFR A;  1N34 B;  4KXR A;  1OCC B;  3CCR V;  4G28 B;  3JSL A;  2UXD O;  2WWW A;  3QVN A;  2A0L A;  2W0X A;  3RN4 A;  4K8X A;  3OMI B;  1SZT A;  3CD6 V;  1ZTE A;  3F7Y C;  1YSC A;  1M57 B;  3HKE B;  4FM0 A;  5L3C A;  5IJ0 B;  3ZX6 A;  4PI2 A;  1E79 G;  2P4V A;  3BHP A;  2QE7 G;  3CME V;  4B3R B;  4P30 A;  1CPY A;  1NBM G;  4QPK A;  4U3J B;  1KMI Z;  4X64 O;  1K92 A;  3E2E A;  1V54 B;  3OE7 G;  1TUB A;  1OCO B;  2X7R B;  3GWK C;  3OD4 A;  1WLE A;  1Q6H A;  3JCU Z;  4EFE A;  4TUY A;  5FNV A;  1VF6 C;  3SJA C;  2MW2 B;  3Q4H A;  4O4H B;  2PI4 A;  3D3I A;  1GK9 A;  3ZMZ A;  2N04 A;  1HP8 A;  4DV0 B;  1PNM A;  4UB8 Z;  1XHX A;  2P4K A;  4YY3 O;  5KHG A;  1I0H A;  2UUA O;  4JI5 B;  3RYH B;  3B09 A;  4FFK A;  2CDY A;  3FYE B;  3APO A;  3UCS C;  4FLV A;  2R9I A;  1FS0 G;  1WB7 A;  4B3M B;  5JQG A;  3C3S A;  4CH5 A;  1TVK A;  3AG3 C;  3THO A;  4RWU A;  4LFA O;  3STL C;  1WNS A;  1OCZ C;  5LMU B;  2M6Y A;  4I50 B;  3SYA A;  1URF A;  4DV1 B;  1H2L A;  1N36 B;  5KX5 B;  3VQY A;  2JS5 A;  3BFR A;  2EIL C;  1HR0 B;  2C2A A;  4I55 A;  2HFE C;  5H5N A;  2CAZ C;  4J7K A;  1SQV H;  1JCH A;  3CCJ V;  3P3P A;  4QIW F;  2PYL A;  2ZR2 A;  1JOY A;  1PL0 A;  3AK1 A;  1M9N A;  3MD0 A;  4JI1 O;  2JEU A;  4DR3 O;  2Q69 A;  1K5S A;  1GM7 A;  2WLJ A;  1HDJ A;  2EJR A;  4BW9 A;  2ZIM A;  1COW G;  3P3N A;  1XEQ A;  5EBM C;  4GZR B;  4YJ2 B;  1VQ6 V;  3CYO A;  3BA8 A;  4WBN A;  4LFB O;  2ZXW B;  3L73 H;  1VQ4 V;  4JI6 O;  3E83 A;  3X2Q C;  3TXS A;  4BIZ A;  4FM2 A;  3H1K H;  1R3I C;  2B5U A;  5IE9 A;  2FKX A;  2LW1 A;  5CA1 B;  1SZX A;  1V55 C;  1DTO A;  3JD3 A;  3CCU V;  4TV9 B;  1K9M W;  3ETE A;  4MVZ A;  4LF7 O;  5L3G A;  3W7W A;  4OX9 B;  1PPJ H;  2CGO A;  4JYA B;  2BSK B;  3ML0 A;  3A0B Z;  2W6I G;  3FAV B;  2XAF A;  4LFC B;  4JI0 O;  5J2U B;  4AQY O;  4NXN B;  1AR1 B;  4IGG A;  2QWO B;  4LF9 O;  4B08 A;  3W7S A;  3WG7 C;  1X59 A;  1QR9 A;  4CS2 A;  1SQF A;  4J7J A;  2WLL A;  2Y69 C;  5EZY B;  3IC7 A;  1ZWI C;  5EBW C;  1BS3 A;  1JJO A;  5KMG B;  4JAA A;  3ZHQ A;  4X9Q A;  5L3E A;  5CN0 A;  3ZIA G;  4WF9 V;  5EIB C;  5LBQ A;  2IJI A;  4JPR A;  1PNL A;  2DYR B;  2QEX V;  3B4S A;  2F23 A;  4RUF A;  2F1M A;  4O4J A;  5GTI Z;  5IY5 C;  4HNA A;  1D5A A;  3KCX A;  2Y4T A;  1GM8 A;  1YTF B;  3P32 A;  4X65 B;  2OIG A;  4DW0 A;  1AP6 A;  1HWY A;  4NXM B;  2DOS A;  2HEP A;  5IYD O;  4MTX A;  3RYC B;  1S5H C;  5CBF A;  5F2V O;  1PV0 A;  5L3D A;  3BAA A;  3CCL V;  1LR1 A;  2OYQ A;  4ICG A;  5C93 A;  3K59 A;  1NH2 D;  4DR4 O;  2CTR A;  2QA4 V;  3LSQ A;  1QR8 A;  4RUE A;  1AIL A;  1E1Q G;  2UXX A;  3VBB A;  4MW3 A;  3DC6 A;  1XMO O;  4UVB A;  4O4I A;  3ABK B;  1S77 D;  2P22 C;  4IHJ A;  1MSW D;  1LNQ A;  1NT2 B;  3VQV A;  1RSO B;  1JFF B;  2GUZ B;  3D8C A;  5JWP A;  1XNR B;  1RPR A;  5LGT A;  1QCE A;  4TQD A;  1L0N H;  3CCQ V;  4LBE C;  4OGQ B;  1L0L H;  3ZED A;  3DTU B;  1R3L C;  2YI8 A;  4DR6 B;  1M4U A;  1PKX A;  5DN6 G;  3UQ8 A;  1YZB A;  4BR6 A;  1VP7 A;  1I94 B;  3VQX A;  1NZ6 A;  4RQF A;  1R6N A;  3KG2 A;  3HKB A;  4LF8 B;  2BOB C;  4YY3 B;  1NJI W;  1VQ9 V;  2IJJ A;  2UUA B;  4DV2 O;  2Q0O C;  2LFS A;  2NN4 A;  5GW7 A;  4X1I B;  1K8A W;  3C90 A;  4LFA B;  4GKJ O;  3ABM C;  4MT8 A;  4AIL C;  3RYF B;  3K9A A;  3L75 H;  2M7W A;  1Y76 B;  3ZHV A;  1MZE A;  3ZRV A;  5LHH A;  3ZS8 C;  4GX2 A;  1BL8 A;  3W7T A;  4X66 B;  1YIJ V;  3QO8 A;  2RMK B;  5ITZ B;  4LC1 A;  2HHH O;  2YXY A;  5JVD B;  5J2T B;  1BQ0 A;  5LL6 Y;  3G71 V;  4DR3 B;  5C8Y A;  3JAR A;  2ZIN A;  4JI5 O;  5H2F Z;  2YID A;  5EYP B;  1AVM A;  4R50 A;  1P84 F;  1R1B A;  1WP8 A;  1B6Q A;  3QNE A;  5CB4 A;  1K33 A;  2L6L A;  1XHZ A;  4CH6 A;  2DQ0 A;  1CXZ B;  5LMU O;  1QBZ A;  3K06 A;  2EIM C;  4DV1 O;  4LFB B;  1OCR B;  1DGS A;  2OTL V;  3JD4 A;  2LFR A;  1HR0 O;  4RO2 A;  3CRM A;  2P06 A;  1G6U A;  1IXB A;  3K79 A;  4BWA A;  2PI5 A;  4JI6 B;  1XNQ B;  3B8M A;  4B3T O;  1GN4 A;  4UVC A;  5B1A B;  1V9P A;  1AR5 A;  3A2F A;  2OWO A;  3ZCC A;  5LXT A;  3EVK A;  3M8A A;  4FPP A;  3FB7 C;  2YEV A;  1AB3 A;  3SYO A;  1RM1 B;  4JGS A;  1NVP D;  5JQG B;  4LF7 B;  4YXW G;  2ITC C;  3CS5 A;  3FYI B;  1UPG A;  4JTA B;  1KKD A;  1PD3 A;  4JI0 B;  4AQY B;  1OHH G;  2XUM A;  4LF9 B;  2NR5 A;  4DK1 A;  5IJ9 B;  2P90 A;  3L71 H;  1JR9 A;  4X20 A;  5B66 Z;  3D3Q A;  3RYI B;  1MOF A;  2Y48 A;  4H44 B;  2QJ1 A;  3K5N A;  3IAY A;  3ZHR A;  4JI8 B;  2P67 A;  2D2C B;  5IYB O;  2EIJ C;  4MVQ A;  2R9R B;  2W6J G;  4AI8 A;  2JJ2 G;  4TWK A;  1ROP A;  2QKC A;  2ADQ B;  3OAA G;  3OUS A;  1M56 C;  1PM9 A;  4I5S A;  4WBN B;  1BHA A;  2IJH A;  3OW2 U;  3BPZ A;  3CB2 A;  2YXL A;  3TJT A;  2LP7 A;  3ZRX A;  1FXK C;  3ASO B;  3G80 A;  2ATK C;  2L35 A;  4DW1 A;  4IIJ B;  3JD2 A;  2XAS A;  5LP6 B;  1VQ7 V;  1VQL V;  3FD9 A;  5DED A;  2UUC O;  4O4L B;  5JH7 A;  3MHH C;  2F4V O;  5LA6 A;  4EB6 B;  4O2B B;  4E4E A;  3OMA B;  3JAT B;  1IBK O;  1SQP H;  4PEL A;  1KP2 A;  1EBO A;  1TUE B;  1B3Q A;  2HJD A;  2ODM A;  2PY5 A;  3CRC A;  2ZDI C;  3IJ4 A;  2QTS A;  4ZHQ B;  5KUK A;  4F6R B;  1U97 A;  2QWN B;  5FLX N;  3SPI A;  4UCO A;  1VF5 B;  4RAI A;  1WB8 A;  4WFE A;  2Y0I A;  3CWB H;  5EC2 C;  5A9G A;  2PUS A;  3ZMT A;  4NB5 A;  5E79 Z;  1AI7 A;  5BMV B;  4DV5 O;  3HB3 B;  4QJF B;  3TCU A;  3LDC A;  3SPC A;  4GYC B;  1NI8 A;  1K5Q A;  4OXS A;  3OR6 C;  1XBL A;  4OPA A;  2P6J A;  3WB2 A;  3O9O A;  1YHQ V;  3IFX A;  3O65 A;  4PJ0 Z;  3QO5 A;  2JRI A;  4DRX A;  4WFH A;  1IZ3 A;  3G6B A;  3ZN0 A;  4MVO A;  4FLZ A;  3K58 A;  4R8C A;  4DV2 B;  4LNU A;  5A2Q N;  3J81 N;  3CCS V;  3ASN C;  2JVD A;  1XNR O;  4R7C A;  4DR5 B;  1FPO A;  1J5E O;  4FLX A;  4GKJ B;  2NLJ C;  4TQF A;  3EXA A;  4WFF A;  4E2L A;  1QNM A;  1P4R A;  2XTA A;  1VIB A;  5IT9 N;  2Q7E A;  5CA0 B;  3LUT B;  3BY6 A;  4DR6 O;  1R6T A;  2UXC O;  2HHH B;  3OTO B;  1B06 A;  3RVY A;  2FTK A;  1I94 O;  1YIT V;  2CTW A;  5L3B A;  2WLI B;  3ZN1 A;  4LF8 O;  3LNM B;  4PA3 A;  1OJH A;  2JGD A;  4QE7 A;  3U11 A;  3HKC B;  2LQT A;  3ABU A;  4P2Z A;  4YIO A;  2AXT Z;  2XAQ A;  3BRC A;  3OR7 C;  2XAJ A;  4JF3 A;  1EM1 A;  3CP1 A;  1ZL8 A;  4LF6 O;  1BT8 A;  3DXR B;  2R70 A;  2V1D A;  5KHK A;  2ZM6 B;  1THZ A;  3AG3 B;  3H1I H;  4AHC A;  1OCZ B;  2DW4 A;  1PP9 H;  1MZF A;  4EFB A;  4X66 O;  2EIK C;  3ZHU A;  2OCC C;  5LHG A;  4B3T B;  2EIL B;  4J80 A;  4XDJ A;  4LH7 A;  1Q6I A;  4UCU A;  4EKW A;  4L87 A;  2B1I A;  4P9O A;  1NR1 A;  4O2A B;  1HNX O;  4XDK A;  1MSD A;  3RT3 C;  4FK5 C;  3CMA V;  1GN6 A;  1TGO A;  1ORQ C;  5GON B;  4MW8 A;  3K57 A;  1DK1 A;  1AI6 A;  4FVM A;  1Y74 A;  4X1K A;  1WA8 B;  3H1H H;  4F6E A;  3BEH A;  4DYL A;  5TIS Z;  1H8E G;  2Q73 A;  3CCE V;  1FXV A;  4QNH B;  4H0L B;  3A0R A;  2F66 C;  2P5O A;  3OT7 A;  2ZE5 A;  2ZE7 A;  4PA7 A;  3AG7 A;  3RGB A;  4PDV A;  5B3S C;  1AI4 A;  2HVJ C;  4KHP O;  2EJ7 A;  4FMT A;  2A7W A;  2EZO A;  1XNQ O;  2ZXW C;  1N32 O;  4CC6 A;  3HKD A;  3K0D A;  3CXC U;  3X2Q B;  1XRE A;  4FFB A;  4I9W A;  4ZOL A;  3N2G A;  1FXK A;  2QM8 A;  4G27 B;  1BMF G;  1S0V A;  2BTQ B;  3SDL A;  5EK0 A;  2HR3 A;  1BQZ A;  4U7N A;  4N21 A;  3K5L A;  1WP7 A;  1N0J A;  4NKG B;  3E22 A;  4BW5 A;  4BAY A;  4WFA V;  4JAS A;  5CBG A;  1HW7 A;  1P7G A;  2WLK A;  2ARH A;  3JD0 A;  3E8H A;  2EBO A;  3UT5 B;  3A8T A;  3JAK A;  2WA3 A;  4PA4 A;  4MS2 A;  1KYO F;  3WG7 B;  1SA0 A;  1Q90 D;  4DUY B;  2WLM A;  2ZDI A;  5KA6 A;  2IM9 A;  3GB7 C;  1Z5W A;  2OCH A;  4JI8 O;  3U10 A;  3TXQ A;  1BSM A;  1CP9 A;  4C7U A;  4UV9 A;  4YJ3 A;  3AG4 C;  1IVS A;  1ENV A;  2QKS A;  2UUC B;  1Q3E A;  1J95 A;  1L1F A;  3SPG A;  3JAS B;  4I4T A;  2F4V B;  4K0K B;  2MK3 A;  2ZE8 A;  1ZUQ A;  3JCZ A;  1K3E A;  4KUM A;  4B7K A;  2VS0 A;  1JJ2 U;  3F5T A;  4NYK A;  1IBK B;  5KUM A;  3K04 A;  3CCV V;  2QTO A;  2X0L A;  4PA6 A;  3LDE A;  2UUB B;  1QLE C;  1Z2G A;  4FLY A;  1Q6U A;  3FKS G;  3JAL B;  2RNB A;  3UO2 A;  2DYR C;  4JI4 B;  1IBM O;  2AZ2 A;  4K3A A;  2VQE B;  3WFV A;  1XL6 A;  4JI7 O;  5LYJ B;  5IY5 B;  2V4D A;  1Z5V A;  1FYJ A;  2CK3 G;  2KG7 B;  5IWA O;  4FM1 A;  1HNZ O;  2JJ1 G;  2P7T C;  4WCE V;  1RPO A;  2Q8V A;  1VQO V;  2FYU H;  4GX0 A;  4UCV A;  2GDS A;  1FFX B;  1SET A;  3HKE A;  3ZRW B;  4DV5 B;  3H9V A;  5IJ0 A;  4FIP C;  3N2K B;  4UB6 Z;  1EN5 A;  3I56 V;  5JJJ B;  2N05 A;  3DC5 A;  3H1L H;  5KHJ A;  2WSS G;  4U3J A;  5KHI A;  4D7S A;  1T5E A;  4K35 A;  1NU1 H;  2UXN A;  3RBZ A;  2QWQ B;  3CJH B;  5B5E Z;  5K1P A;  1KB9 F;  2DJV A;  2NNU A;  4O4H A;  1F23 A;  4A5U B;  4Z2W A;  1J5E B;  4GX5 A;  2A9H A;  1VEW A;  4X1Y B;  5IYZ B;  4JI2 B;  3RVZ A;  2LJ2 A;  1RFY A;  4JYY A;  2QM4 A;  1NTM H;  3D36 A;  2AHY A;  3RYH A;  4UV8 A;  2UXC B;  4X88 A;  1PNK A;  3AEI A;  4J9Z B;  3EHB B;  1GRJ A;  4ZI7 B;  2JK5 C;  4MTO A;  1VMG A;  3QO7 A;  2EUL A;  2IBZ H;  2JIZ G;  4NTW A;  4OPH A;  4I50 A;  4CS3 A;  5L3F A;  2KB1 A;  3H1J H;  1F51 A;  1SS3 A;  4I0X B;  2YIC A;  3T4D A;  1Q86 W;  2FL4 A;  4DR5 O;  3AG2 C;  1Q43 A;  2LW7 A;  3ABT A;  4B3S O;  4LF4 O;  4LF6 B;  2CH7 B;  2YI9 A;  5LOV B;  4DXW A;  4LWS B;  5H6R A;  1M5I A;  3UO3 A;  2DWE C;  4NTX A;  5KAF Z;  1OV9 A;  3BCC H;  4X89 A;  2E3C A;  4B7E A;  5LGN A;  2DYS B;  3VOU A;  4DV6 O;  1TA8 A;  3OTO O;  1XI1 A;  4PV1 B;  3T4Z A;  3FX7 A;  4TOI A;  1KC8 W;  1HNX B;  4MTF A;  4J10 A;  4YJ2 A;  4YHH B;  4PD4 F;  3MDS A;  1FKA O;  2QM7 A;  5K1X A;  2QWR B;  1IBL O;  2G38 A;  2GTS A;  2YIA A;  3J7A U;  3I55 V;  2QR4 A;  4FJC C;  1NTZ H;  1SC5 B;  1TUB B;  2EIN B;  2ZM6 O;  1FD9 A;  5CA1 A;  4QPJ A;  3SR2 C;  1FXH A;  5EBL C;  4LF5 O;  3NR7 A;  3CRQ A;  4TUY B;  1B04 A;  5FNV B;  4DUZ O;  3Q4H B;  3AG1 B;  2Q6A A;  4KHP B;  4TV9 A;  2JEX A;  3ZMV A;  1XOU A;  1N0N A;  2EIM B;  2BTO A;  4W4L A;  3UKM A;  1N33 O;  1Y4M A;  1N32 B;  5DM6 V;  1MG1 A;  1SKV A;  2BSK A;  2YXH A;  3FAV A;  3OM3 B;  5J2U A;  1OZ0 A;  2X6B A;  3F5W C;  4NVP A;  4DR2 B;  3ZJZ A;  1YEW A;  2WLH A;  1YDX A;  2LGQ A;  1TVK B;  4WFG A;  4ZIB A;  1TAE A;  2Q7G A;  3BA9 A;  2OTJ V;  4JI3 B;  1QVG U;  1K7D A;  2F43 G;  4WFB V;  4G2K A;  4J11 A;  1SER A;  1H2G A;  2W0F C;  1RM1 C;  3M7M X;  1Q81 W;  1Y67 A;  1H8H G;  5EZY A;  4LH6 A;  1P7B A;  1BZK A;  5BXZ A;  3HR0 A;  1N4C A;  4I55 B;  3WB1 A;  3H01 A;  5KMG A;  3MAQ A;  3T1C A;  3T1Y B;  3M99 B;  5JJE B;  1MA1 A;  3ICX A;  4P9P A;  1D5N A;  2XHB A;  4NTY A;  2ZE6 A;  4Q20 A;  3HPL C;  3KKY A;  3ZBH A;  4I7Z B;  4D6T H;  3G67 A;  2GV9 A;  4UCS A;  1I5Y A;  3DSQ A;  3ABL C;  2YIB D;  3K08 A;  1D2D A;  3TK1 A;  2JS3 A;  2FML A;  4JAV A;  5BY1 A;  3FB5 C;  1ARO P;  1M93 A;  3OMN B;  3G4S V;  3CC4 V;  1M56 B;  4UUJ C;  3QTC A;  1BCC H;  1KBH A;  2Q0A A;  2ZCE A;  3RYC A;  4X62 B;  3LNN A;  2ITD C;  2XND G;  4BIO A;  1IBM B;  2GHY A;  3CRA A;  4JZ2 A;  4HYO A;  1XDC A;  4JI7 B;  4MTG A;  4DUY O;  1YTF D;  1FXK B;  2E5L O;  5IWA B;  1HNZ B;  3ASO C;  2IJK A;  4K0K O;  2VWK A;  1YI2 V;  3CSX A;  3I5D A;  3ZMU A;  2K1E A;  5LP6 C;  1JQ0 A;  1K97 A;  5CA3 A;  4PHZ A;  1RSO A;  4KL1 A;  1JFF A;  2GUZ A;  2BOC C;  2UUB O;  4DK0 A;  3S3X A;  1SF9 A;  3JAW A;  2CGN A;  3BVO A;  3ZHS A;  3JAK B;  2D3O W;  1E1R G;  4JI4 O;  1WPB A;  3STZ C;  2Q7H A;  1CEZ A;  2WLL B;  2VQE O;  1U96 A;  1DLB A;  1X4T A;  2PF4 E;  1KU9 A;  2F95 B;  4JV5 O;  3AK2 A;  4YJ3 B;  1O9H A;  1K73 W;  2WA4 A;  1S72 V;  1QQC A;  3CC2 V;  4FZ1 A;  2ETN A;  5DEC A;  3ETD A;  1KUQ A;  2RJZ A;  1G1X B;  2RN9 A;  1XUQ A;  1LUV A;  5B1B B;  1QHT A;  2XAG A;  2ZQM A;  4TV8 A;  2Q9L A;  2YS8 A;  4O4J B;  4JYC A;  1Q8I A;  1YF2 A;  4X1I A;  2RDC A;  4IL6 Z;  3N27 A;  4HNA B;  2EZP A;  3RYF A;  1OCC C;  3JD1 A;  1NH2 B;  1Y76 A;  1UFI A;  3CXH F;  1DF5 A;  2BCC H;  3E8F A;  3PN1 A;  3SPH A;  3GVM A;  1SQB H;  5ITZ A;  1QVF U;  1M57 C;  2VQF O;  4B3S B;  4LF4 B;  4FZ0 A;  2ADP A;  1YJN V;  1UJW B;  5JVD A;  5J2T A;  2UXB O;  3ASN B;  4JI2 O;  2QWP B;  2Z5U A;  4PDM A;  1VQP V;  1M90 W;  2Q5Z A;  2GSM B;  2OT5 A;  2X6C A;  1V54 C;  5EYP A;  4DV6 B;  1OCO C;  2IU0 A;  5FPO A;  1I5X A;  2HG5 C;  4O4I B;  4IHJ B;  2HLD G;  4H37 A;  4JAU A;  2ZNJ A;  3L9D A;  1NKD A;  3T1H O;  1HNW O;  4BIU A;  1IBL B;  3QF7 A;  3K03 A;  3TET A;  3JYC A;  1O9G A;  2O57 A;  1Q7Y W;  1AJQ A;  2DWD C;  3VQW A;  3D36 C;  5JCO C;  2QGN A;  3OEH G;  3E89 A;  5FPR A;  2ZKO A;  3W7U A;  2GBO A;  3G6E V;  4LF5 B;  1GTO A;  2BE3 A;  5D5P A;  1F4M A;  4DUZ B;  3SYQ A;  1K4D C;  5HFL A;  3LSU A;  4H13 B;  5BR8 B;  4KP4 A;  1N33 B;  3CE2 A;  3HKB B;  2EIK B;  3E8B A;  2OCC B;  3K5O A;  4YHH O;  1ZAU A;  4ASU G;  1EZV H;  5IJ9 A;  5LMN O;  1VQM V;  1EZJ A;  1S5J A;  2X6A A;  3RW0 A;  4DV7 O;  4UCR A;  3K5M A;  3RYI A;  4PDR A;  3CEI A;  1Y66 A;  2EX3 A;  1PL4 A;  1JMK C;  3FB8 C;  1NQT A;  3B8N A;  5KHH A;  4GLX A;  3E8G A;  4DV4 B;  4JTC B;  4PDL A;  5FL7 G;  4RQE A;  1VQ8 V;  1I08 A;  4ZKI A;  5B3S B;  1QLN A;  5CMU A;  2WPD G;  4U7O A;  2IU3 A;  4IYI A;  2PGG A;  4ABM A;  5J9P C;  1SQQ H;  5C8Y B;  3JAR B;  1RP3 B;  4DR2 O;  3B77 A;  4FLW A;  1N8R W;  1IX9 A;  1M1K W;  2YUA A;  4J41 A;  1ZLZ A;  1V55 B;  2A3Q A;  5CB4 B;  3ETG A;  4JI3 O;  4D7T A;  4LCU C;  2DN9 A;  2YSU B;  4GT1 A;  2Q4P A;  2AHZ A;  3JSN A;  1US6 A;  4IIJ A;  1IUR A;  4DV3 O;  2XT9 A;  3E35 A;  3W7X A;  1FJG O;  1BE3 H;  4K8Z A;  1NVP B;  1SQG A;  1YJW V;  1A32 A;  2DMX A;  3OGC C;  5B1N A;  5LP6 A;  3T1Y O;  2CTQ A;  1VAR A;  4O4L A;  2E76 B;  4CH4 A;  5LXT B;  4EB6 A;  2H94 A;  4O2B A;  3DGE A;  2B9Z A;  2UU9 B;  1QU7 A;  2YEV B;  3SPJ A;  2E5L B;  1Q5O A;  3JAT A;  5IDJ A; 
#chains in the Genus database with same CATH homology
 3AG2 C;  2X7R B;  4LP8 A;  3OUS A;  4PA9 A;  3ABT A;  1M56 C;  1WLE A;  3T2M A;  2Y69 B;  4I5S A;  4DXW A;  4JYB A;  2PI4 A;  3D3I A;  1GK9 A;  4XDL A;  5H6R A;  1BHA A;  3ZMZ A;  1K4C C;  2IJH A;  4J9Y B;  1SRY A;  3OW2 U;  2DWE C;  2H8P C;  3AG4 B;  1R6K A;  4X89 A;  2LP7 A;  5LGN A;  1PNM A;  2DYS B;  3ZRX A;  3VOU A;  1FXK C;  3PJS K;  3ASO B;  4MSW C;  1VQN V;  2ATK C;  3OFN G;  4R6Z A;  3T4Z A;  3NXS A;  3FYE B;  1KC8 W;  3JD2 A;  4MTF A;  1Q86 W;  2R9I A;  1FS0 G;  3AG3 C;  1QLE B;  2XAS A;  2QM7 A;  3STL C;  1VQ7 V;  1VQL V;  1OCZ C;  3MHH C;  3SYA A;  3I55 V;  2EIL C;  4FJC C;  2C2A A;  2ZR3 A;  2HFE C;  3OMA B;  1R73 A;  2EIN B;  5EC1 C;  4PEL A;  1KP2 A;  1EBO A;  4H33 A;  1TUE B;  4QPJ A;  1JCH A;  1FXH A;  5EBL C;  3CCJ V;  4QIW F;  1JX9 A;  3AG1 B;  2Q6A A;  2ZDI C;  2ZR2 A;  2JEX A;  1PL0 A;  2Q68 A;  1GKF A;  4TT3 G;  3ZMV A;  1JOY A;  1M9N A;  2EIM B;  3MD0 A;  5KUK A;  2JEU A;  3UKM A;  2Q69 A;  1K5S A;  2WLN A;  1GM7 A;  1Y4M A;  2XAH A;  5DM6 V;  1MG1 A;  3SPI A;  2WLJ A;  4RAI A;  3OEE G;  3OM3 B;  1G4Y B;  2EJR A;  4WFE A;  5EC2 C;  1OZ0 A;  2X6B A;  3F5W C;  4KFM A;  1COW G;  1R3K C;  3ZJZ A;  5EBM C;  3FB6 C;  4UVA A;  2WLH A;  1VQ6 V;  4WFG A;  3ABK C;  3IGA C;  3CYO A;  3ZMT A;  2OTJ V;  2Q67 A;  4CBC A;  1QVG U;  1K7D A;  2F43 G;  1AI7 A;  2ZXW B;  4WFB V;  3P30 A;  4X8A A;  4G2K A;  1VQ4 V;  1SER A;  1H2G A;  2W0F C;  3HB3 B;  4QJF B;  3TCU A;  4CZZ A;  1RM1 C;  3LDC A;  1Q81 W;  3SPC A;  1H8H G;  3E83 A;  1NR7 A;  3X2Q C;  1P7B A;  4OXS A;  1K5Q A;  2WLI A;  3OR6 C;  4BIZ A;  2P6J A;  1YHQ V;  2B5U A;  1R3I C;  3IFX A;  3H01 A;  1SES A;  3T1C A;  3QO5 A;  1EFR G;  3M99 B;  3ZRS A;  1V55 C;  1DTO A;  1W2B U;  4P9P A;  4WFH A;  4TSF G;  3JD3 A;  3ZN0 A;  3CCU V;  2JDI G;  4MVO A;  4Q20 A;  1K9M W;  3HPL C;  3ETE A;  4MVZ A;  4R8C A;  2HKO A;  3GWO A;  5L3G A;  3W7W A;  3CCS V;  3ASN C;  4R7C A;  1I5Y A;  3ML0 A;  3ABL C;  2W6I G;  2XAF A;  1AJP A;  2NLJ C;  3K08 A;  3SYC A;  1GO3 F;  4WFF A;  1AR1 B;  3TK1 A;  1DF4 A;  4JAV A;  4E2L A;  3SYP A;  3W7S A;  1P4R A;  3FB5 C;  4GX1 A;  3WG7 C;  1ARO P;  3LUT B;  3BY6 A;  3OMN B;  3G4S V;  3AG2 B;  3CC4 V;  3ZMS A;  1QR9 A;  1M56 B;  4UUJ C;  3ABM B;  3RVY A;  2FTK A;  2WLL A;  2Y69 C;  1YIT V;  1FFT B;  1ZWI C;  3IC7 A;  5EBW C;  5L3B A;  2WLI B;  1AJN A;  3ZN1 A;  3LNM B;  2ITD C;  2XND G;  4PA3 A;  1GMG A;  4QE7 A;  2GHY A;  3K3W A;  4HYO A;  3ABU A;  4P2Z A;  4MTG A;  1YTF D;  1W0K G;  5L3E A;  5CN0 A;  1FXK B;  3ZIA G;  2DYS C;  2XAQ A;  4WF9 V;  3OR7 C;  2XAJ A;  4ZBM A;  4JF3 A;  3ASO C;  3CP1 A;  5BZB A;  5LBQ A;  2IJI A;  4JPR A;  1AI5 A;  1PNL A;  2V1D A;  2IJK A;  1KQS U;  2DYR B;  2IW5 A;  2QEX V;  1THZ A;  3AG3 B;  1YI2 V;  4RUF A;  3ZMU A;  2K1E A;  1OCZ B;  2DW4 A;  3MHS C;  1JQ0 A;  1K97 A;  1MAB G;  5KA5 A;  5CA3 A;  2EIK C;  2OCC C;  5E1A C;  5IY5 C;  5LHG A;  2BOC C;  2EIL B;  4XDJ A;  4EKW A;  2Z3Y A;  4L87 A;  2B1I A;  1GM8 A;  4P9O A;  1YTF B;  3P32 A;  1NR1 A;  2EIN C;  2D3O W;  1E1R G;  4XDK A;  3STZ C;  1HWY A;  1CEZ A;  2WLL B;  4FK5 C;  5IYD O;  4MTX A;  3CMA V;  1OCR C;  1S5H C;  5CBF A;  1DLB A;  1ORQ C;  3LDD A;  3AG1 C;  4MW8 A;  5L3D A;  5LGU A;  1AI6 A;  1R3J C;  3CCL V;  3BEH A;  1GM9 A;  5C93 A;  5B1A C;  1H8E G;  1NH2 D;  1K73 W;  3CCE V;  2QA4 V;  1FXV A;  4QNH B;  3LSQ A;  1QR8 A;  3A0R A;  4RUE A;  1E1Q G;  1S72 V;  2UXX A;  3CC2 V;  1JVM A;  4PA7 A;  3UM7 A;  3VBB A;  4PDV A;  3ETD A;  4MW3 A;  2A79 B;  5B3S C;  1AI4 A;  2HVJ C;  5H9C A;  1H38 A;  4FMT A;  4UVB A;  3ABK B;  5B1B B;  1S77 D;  2EZO A;  2XAG A;  1MSW D;  5CBH A;  2ZQM A;  1LNQ A;  4JYC A;  2ZXW C;  3OUF A;  3E86 A;  3K0D A;  3CXC U;  2WAM A;  4HAM A;  3X2Q B;  4I9W A;  2EZP A;  4MVS A;  1OCC C;  1RPR A;  3JD1 A;  5LGT A;  1NH2 B;  1FXK A;  2DQ3 A;  2QM8 A;  1QCE A;  4G27 B;  1BMF G;  1S0V A;  4MVM A;  3CCQ V;  1DF5 A;  3E8F A;  3SPH A;  4LBE C;  5EK0 A;  2HR3 A;  4U7N A;  1QVF U;  1M57 C;  4N21 A;  3DTU B;  1YJN V;  1BHB A;  1R3L C;  1UJW B;  3ASN B;  3R65 A;  1W0J G;  1KEC A;  1PKX A;  2Z5U A;  4PDM A;  4BW5 A;  5DN6 G;  3LSS A;  4BAY A;  4WFA V;  1VQK V;  2HJF C;  4JAS A;  5CBG A;  1VQP V;  2EIJ B;  3ABL B;  1M90 W;  1S76 D;  4N23 A;  2GSM B;  3CPW U;  2IH3 C;  2WLK A;  2OT5 A;  2X6C A;  3JD0 A;  1R6N A;  3E8H A;  4RQF A;  3KG2 A;  2EBO A;  2BOB C;  2V7Q G;  1V54 C;  4XBF A;  1F4N A;  1OCO C;  2IU0 A;  5LHI A;  1NJI W;  4PA4 A;  1KP3 A;  1JPX A;  1I5X A;  2HG5 C;  4MS2 A;  2IJJ A;  3WG7 B;  1VQ9 V;  2XOK G;  2HLD G;  2WLM A;  2ZDI A;  4H37 A;  5KA6 A;  2LFS A;  3GB7 C;  4JAU A;  2ZD9 A;  5GW7 A;  1K8A W;  1CP9 A;  3SJQ C;  1NKD A;  3ABM C;  4MT8 A;  4UV9 A;  4BIU A;  2IH1 C;  3AG4 C;  1ENV A;  1G8M A;  3K9A A;  2QKS A;  3K03 A;  2M7W A;  3ZRW A;  3TET A;  1J95 A;  3JYC A;  1L1F A;  3SPG A;  2MK3 A;  3ZRV A;  4MVR A;  1Q7Y W;  1AJQ A;  2DWD C;  3JCZ A;  4GX2 A;  5LHH A;  4F4L A;  1K3E A;  1BL8 A;  4KUM A;  3W7T A;  4DO2 A;  3OEH G;  3E89 A;  1JJ2 U;  1YIJ V;  1VQ5 V;  3QO8 A;  4GCZ A;  4LC1 A;  2B1G A;  5H6Q A;  5KUM A;  3W7U A;  3G6E V;  3K04 A;  1GTO A;  3CCV V;  2QTO A;  2X0L A;  4PA6 A;  1F4M A;  3LDE A;  1QLE C;  3FKS G;  3SYQ A;  1K4D C;  3G71 V;  2DYR C;  5HFL A;  4KP4 A;  3WFV A;  1XL6 A;  3CC7 V;  2EIK B;  4UXN A;  3E8B A;  2OCC B;  5IY5 B;  4R50 A;  4ASU G;  2CK3 G;  1B6Q A;  3QNE A;  1S3J A;  2JJ1 G;  1K33 A;  2P7T C;  4WCE V;  1RPO A;  1VQO V;  2DQ0 A;  1VQM V;  1EZJ A;  1QBZ A;  4GX0 A;  2X6A A;  3K0G A;  3K06 A;  4HZ3 A;  3RW0 A;  2EIM C;  1OCR B;  2OTL V;  3JD4 A;  2LFR A;  1SET A;  4RO2 A;  3CCM V;  5HFM A;  3ZRW B;  1XL4 A;  3K79 A;  4PDR A;  1K34 A;  4JTD B;  2PI5 A;  1Y66 A;  3B8M A;  3F7V C;  3FB8 C;  1NQT A;  3B8N A;  4FIP C;  4UVC A;  5B1A B;  3EFF K;  3I56 V;  3E8G A;  4JTC B;  3ZCC A;  2WSS G;  4PDL A;  5FL7 G;  4FPP A;  4RQE A;  1VQ8 V;  3FB7 C;  4ZKI A;  2YEV A;  5B3S B;  1QLN A;  2UXN A;  5CMU A;  3RBZ A;  1KD1 W;  1YJ9 V;  4Z1M G;  3SYO A;  2WPD G;  1Q82 W;  2HVK C;  4U7O A;  2IU3 A;  1RM1 B;  4MVU A;  4JGS A;  5IYC O;  1NVP D;  5J9P C;  4YXW G;  2ITC C;  5B1B C;  3FYI B;  1IXM A;  2NNU A;  1WPX A;  1F23 A;  4JTA B;  3B77 A;  4QE9 A;  1KKD A;  5B1O A;  1N8R W;  1M1K W;  1PD3 A;  4GX5 A;  2A9H A;  1OHH G;  1OCC B;  3RVZ A;  3CCR V;  1V55 B;  4G28 B;  3ETG A;  2P90 A;  2WWW A;  4LCU C;  2A0L A;  2YSU B;  3D36 A;  4GT1 A;  2AHY A;  3OMI B;  1SZT A;  2AHZ A;  4UV8 A;  3CD6 V;  4X88 A;  1PNK A;  3F7Y C;  1YSC A;  1M57 B;  3AEI A;  4J9Z B;  3E35 A;  3W7X A;  5L3C A;  1MOF A;  2Y48 A;  3EHB B;  2JK5 C;  1NVP B;  4MTO A;  1YJW V;  3QO7 A;  3OGC C;  5B1N A;  1E79 G;  2QE7 G;  2JIZ G;  2P67 A;  3CME V;  4P30 A;  1CPY A;  1NBM G;  5IYB O;  5L3F A;  2EIJ C;  2KB1 A;  4MVQ A;  4QPK A;  2R9R B;  2H94 A;  1F51 A;  3DGE A;  2W6J G;  1K92 A;  2JJ2 G;  4TWK A;  3E2E A;  2YEV B;  1ROP A;  1V54 B;  3OE7 G;  3SPJ A;  3T4D A;  1OCO B;  3OAA G;  5IDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...