1QR9A

Inhibition of hiv-1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQATVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41 ENVELOPE PROTEIN
publication title Inhibition of human immunodeficiency virus type 1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion.
pubmed rcsb
molecule tags Viral protein
total genus 27
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qr9A00
3B77A 1SZTA 2MK3A 2M7WA 1Y66A 2LP7A 4JGSA 3GWOA 4JF3A 1EBOA 1DLBA 1DF4A 4FJCC 4JPRA 1MG1A 1QR9A 1Y4MA 3CYOA 2P6JA 1I5YA 3MHHC 5KA6A 3B8MA 1JQ0A 1I5XA 1QR8A 3K9AA 3P30A 1ENVA 3B8NA 4FK5C 1QBZA 5HFMA 3H01A 5H9CA 4FIPC 3MHSC 5CN0A 2EZPA 3M99B 2OT5A 2X7RB 5HFLA 3CP1A 1JPXA 1QCEA 1MOFA 4G2KA 4N23A 2EZOA 2EBOA 4N21A 4E2LA 3WFVA 1F23A 1K33A 5CMUA 1K34A 1DF5A 5KA5A
chains in the Genus database with same CATH superfamily
3HKCA 4FLYA 2P7TC 2CTQA 3BCCH 3CS5A 4Q20A 3K9AA 4TWKA 2QJ1A 1CEZA 2X7RB 3KCYA 2QSAA 1SERA 2FB5A 1YITV 1S5LZ 4YIOA 3K57A 1L0LH 5LA6B 3IJ4A 2HKOA 2KKWA 1E1QG 2WA3A 2M7WA 1L0NH 2HVKC 2UXCB 1FAFA 3ZEDA 4NKGB 2DE0X 5B3SB 3CRRA 3OT7A 3N2GB 4FM0A 5LA6A 5L3GA 2D2CB 4DV2O 4JI7O 4D6TH 3ABMC 1AJPA 4FFBB 3H1JH 1OCOB 1YTFD 3JD1A 4IIJB 3L70H 3N2GA 3JD4A 1KYOF 4OPHA 1K7DA 1D5NA 4FFBA 4P30A 2JJ1G 1XHXA 4JI5O 1M57C 1QR8A 1WJZA 4PA7A 4TV8B 4IIJA 2JGUA 3FD9A 4ICGA 3ETDA 1N0JA 4B3RO 1OJHA 2IJJA 2QKSA 2W0XA 3SPHA 5IJ9B 2NR5A 2KQXA 4DV2B 4DV5O 4B3TO 1OHHG 1GN2A 3SJQC 4MVZA 1YJNV 2Z0AA 1HNWO 4Z1VA 4BW5A 4DV1B 5IJ9A 1W2BU 5B66Z 2Q68A 1IZ3A 4UXNA 4W4LA 4AILC 4BIUA 1PM9A 3RWRD 5JH7B 3SDLA 5IY5B 1QLEC 1H8HG 2W6IG 3AG2C 2R72A 3JAKA 4DV3O 4DV5B 5JQGB 2CGOA 4Z2WA 4OPAA 1S76D 4TSFG 3CCQV 3ABMB 1V55B 1UPGA 1QCEA 3G6EV 4F6RB 2YI9A 4LF9O 2N05A 3H1KH 4H0LB 1XHZA 4R6ZA 3OE7G 1GMGA 3W7XA 2Q7HA 2P4VA 2R9AA 1SQQH 4B7EA 3E83A 4BR6A 2DJVA 2DYRB 1VQ6V 4DV3B 2JS5A 1F7YA 1JFFB 5K1XA 5LP6B 5KAIZ 1P49A 3L9DA 4FFKA 3ASNC 1Y74B 1XQ8A 4X65B 3T4DA 4JF3A 3CC7V 1AVMA 2YXLA 2LQTA 3CRCA 1A32A 1Y4MA 5JJEB 2ADQB 3JAWB 4KXRA 3C3TA 4O4JB 3WB1A 2NLJC 3X2QC 1Y74A 1SQXH 3ZCCA 3H01A 4U7OA 3FYIB 5KUMA 3UO3A 4EEQA 2M6YA 5BY1A 5KLVH 1D5AA 1AI7A 3JAWA 3OEHG 1HDJA 3ETGA 4JPRA 5FPRA 5B5EZ 1B6QA 4YHHO 1QR9A 5KUKA 1YIJV 1BT8A 1I5YA 3EHBB 3RVYA 3AG4B 3WG7B 1G6UA 1QHTA 2EULA 1IBLB 4IT5A 2Y4UA 4X1YB 4L87A 5B1BB 1KQSU 5IWAO 2B1IA 2JS3A 3ZHQA 4OX9B 5L3DA 1S72V 2YIBA 3N2KA 4H44B 4O2BB 4FLZA 4X1YA 2YICA 4O4IA 1FXKB 3WB2A 2ZNIA 1Q6HA 3F7VC 1YZBA 3BFRA 3A2FA 3ZIAG 4X64O 2D3OW 4NVPA 3SPJA 1KKDA 4MT8A 1XOUA 3K0DA 4O2BA 5CA0A 3JD0A 4O2AB 2BOCC 3CCUV 4NTYA 4DYLA 2UUCO 4Q6GA 3F7YC 1FXKA 4JI4B 2A0LA 3EVKA 4YY3O 3SYOA 2N74A 3K03A 4EFBA 3D3QA 3JALA 4AQYO 1IBMB 2BCCH 3S3XA 1ZLZA 2NN4A 2UXBO 1YF2A 3ZHTA 5GONB 3DSQA 4DV6B 4KL1A 1VQKV 1HNZO 1Y66A 4UV9A 2UUBB 5L3BA 1VEWA 1V9PA 2XAGA 3DC5A 2UXNA 5KHJA 4QGPA 1J5EO 3PJSK 2IU3A 2Q7EA 2WSSG 2XNDG 5JVDB 2UUCB 3T1HO 1N8RW 2DWDC 3CCSV 2Q6AA 2WAMA 1QBZA 1EN5A 5IYZB 2OT5A 4LF7B 2XASA 1U96A 3CCJV 1COWG 1XBLA 4DW0A 1NTZH 5LL6Y 1H2NA 4UFZA 5C8YB 4LF6B 1XMOO 2JEUA 1OCRC 1TUBB 4NTWA 4CH3A 1J5EB 3BHPA 4XDJA 4ABMA 3Q4HA 4W4KA 2DYSB 2Q69A 3T1HB 5EZYB 2E3CA 1LR1A 5B1OA 5C8YA 3A0HZ 1P4RA 3QF7A 1EN6A 3W7UA 3H9VA 1NKDA 1TUBA 4FPPA 2F43G 2P22C 2WA4A 5EZYA 4B3SB 1S5HC 3FB7C 2ZM6O 2OWOA 1R3JC 2BSKB 1VQPV 3LNMB 1XMOB 4X8AA 3IGAC 1B04A 4AHCA 5EC1C 2PUSA 1VQ5V 1S0VA 1EFRG 2AGAA 3D8CA 2BSKA 5KA6A 4MTGA 1KD1W 1SETA 1ZTEA 5HFLA 4R7CA 1VARA 4NXMB 2FKXA 2WLLA 1FFXB 1XEQA 5DEDA 4NTXA 5LXTB 4IHJB 4JI2O 3QVNA 2ZXWB 5IYCO 2RDCA 3AG3B 2CTRA 1FFXA 4X89A 4BWAA 3JATB 2JK5C 4D7TA 2KB1A 5LXTA 3RN4A 2V1DA 3ZHRA 4IHJA 3RW0A 3O65A 3FB6C 2KSDA 1QQCA 1HWYA 1AI5A 1IX9A 3AK1A 2XUMA 3JATA 1IXBA 3SYQA 1X4TA 2ZIOA 4NYKA 3RYHB 2XAJA 4H13B 2YEVA 1BQ0A 3AK3A 2JRIA 5H9CA 3RYIA 3GB7C 3K59A 4K0KB 2X6AA 5FLXN 1F51A 3MAQA 3JAMN 1JA8A 1KKCA 4NB5A 4DV0B 4RO2A 4DXWA 1RPRA 2ZIMA 3RYHA 3E35A 1GM7A 2F4VB 3SR2C 2Y69C 5CBHA 4J9ZB 3CJHB 2DQ0A 4JV5B 3CCEV 4JI0O 3P3NA 4QE9A 3P32A 4XBFA 2EBOA 1LNQA 2YS8A 1RPOA 2R9IA 1VQ8V 3CJHA 4DR6O 3OEEG 3BVOA 1PPJH 2ZKOA 4FZ0A 5CBFA 1KMIZ 3OMIB 4UVBA 4UVCA 2GV9A 2C2AA 1K8AW 1CPYA 1SF9A 2A06H 5CN0A 2Z3YA 4RUEA 3A0RA 3A8TA 3ZJZA 3AK2A 4X1KA 4Z1MG 1R3KC 3ZN1A 1XNQO 2IW5A 4UUJC 4JI6O 3E86A 4DR2B 2QEXV 2EINB 5KMGA 1N33O 3BY6A 3FX7A 4J7JA 5LOVB 1HNXO 2GUZB 2Y0IA 1H2SB 2QWPB 2CGNA 1K97A 1H2KA 3RT3C 3LDCA 3B77A 2JEXA 1SZTA 2MK3A 4K8ZA 2PI5A 1HR0O 1RP3B 5LOVA 1SZXA 3C3SA 2GUZA 4UV8A 4ZKIA 2OTJV 2DN9A 1I5XA 4B08A 4DR7B 4PDVA 1XNQB 2Q0AA 4GCZA 4UB8Z 2EIJC 1AR1B 2PF4E 4IYHA 1CXZB 4JTCB 1VQOV 4GZRB 4JI8B 1E1RG 1SQVH 1NU1H 4DUYB 1EBOA 2UU9B 4NR1A 4OXSA 2AZ2A 3K08A 2BOBC 3B8MA 4LNUB 1N36B 1M56C 1YSCA 5FNVA 1HR0B 3E22B 1N0NA 2ILMA 1M93A 4QPJA 5BR8B 1AILA 4LNUA 5D5QA 1SQBH 1IBKO 1WNSA 1KC8W 2FMLA 5JCOA 2Y0PA 3E22A 4TUYB 3K5NA 2P6JA 1K73W 4HBNA 2V7QG 4I9QA 2YSUB 2JDIG 3QNEA 1BZKA 3CMAV 2VWJA 3BABA 4TUYA 1OCZB 3ETEA 5KAFZ 2UUAB 3R66A 2LP7A 4QJFB 2EIMB 3FYEB 4PHZA 4WCEV 3FAVB 5B1NA 2ODMA 1GAXA 1QVFU 4MSWC 2QWRB 3BAAA 3ASOC 3JASB 1IBKB 3NR7A 1GH6A 3K3WA 4GT1A 3ZMVA 4DR1O 1XMQO 4DR4B 1S5JA 4DUZO 1K3EA 3FAVA 2QA4V 3ZRXA 3JASA 4DV1O 1I08A 1S3JA 3VBBA 1PNKA 4JTAB 5J2TB 4DK1A 1S77D 4B3MO 1YJ9V 1R6NA 2EIKC 4PI2A 2QTSA 2A7WA 2DW4A 4LH6A 2LJ2A 2DQ3A 2A9HA 3OGIB 1K92A 5J2TA 5H6RA 1M1KW 5KA5A 4DR1B 4HNAB 2EJRA 1XMQB 4DUZB 2N04A 2HR3A 4J7ZA 4PA6A 1KB9F 3PN1A 3QTCA 2IJIA 1AJNA 3TXSA 4CC6A 2CUGA 4LF8B 5IJ0A 4LF5B 2ZDIC 4HNAA 2IU0A 3JAKB 1Q86W 4B3MB 1P84F 1BE3H 1NT2B 5BZBA 1NZ6A 4PA4A 1YTFB 1Q7YW 2Q73A 1XUQA 3CPWU 2ZE5A 5B1AC 1SA0A 5EIBC 2Q7GA 3T2MA 4GLXA 3JCZA 3KZIZ 3ZS8C 4X66O 3AG1C 2WLJA 4FM2A 1R3IC 3CE2A 5ITZA 1BHAA 4X65O 5E79Z 3ZRVA 4JAAA 3CCVV 1J95A 4U3FH 3K5OA 1Q43A 1RM1C 5EIBD 1Q5OA 2QM7A 2AZ0A 1WB7A 1I0HA 3TJTA 3D36C 2B9ZA 2ZE6A 1RFYA 1W0JG 1M57B 3B2EE 1EN4A 1OCCC 4X66B 1NH2D 4ZI7B 1MSWD 5BXZA 1IXMA 3JARB 4CS4A 4X88A 3HKEA 3JCUZ 1IBLO 4TQDA 4PDLA 3UKMA 4ZI7A 1FJGB 4OX9O 1YXBA 3JARA 3L71H 2QGNA 4RUFA 3T1YO 2EILC 2ZCEA 4PA9A 1WAZA 5J2UB 5L3EA 5LHHA 1G1XB 2LGWA 4CZZA 4H37A 1QLEB 3B09A 2ZDIA 3AG2B 4PD4F 3CC2V 5J2UA 2CH7B 1JR9A 3N2KB 5HFMA 3RGBA 3UQ8A 3P3PA 3VQYA 2EZOA 4JI4O 4O4IB 2EJ7A 1JMKC 3G80A 3T4ZA 2B5UA 2CH7A 3T1YB 4LP8A 4FMTA 4BIOA 4FJCC 3SJCC 1IBMO 5CA0B 4OGQB 3GWKC 3STZC 4UCUA 1QU7A 1R73A 1THZA 5EBMC 4DV6O 4IYIA 1OCCB 4MS2A 5J9PC 1XDCA 2XT9A 2ZNJA 4HAMA 2UUBO 4N21A 5IE9A 3JALB 5KX5B 3ASNB 1L1FA 4E4EA 3ABKC 1JOYA 1AJQA 1ZSPA 4TOIA 4EKWA 1FS0G 1KECA 1WN7A 2YIAA 1NVPD 3CYOA 1HP8A 2RN9A 4LF7O 4TT3G 4MTXA 1N4CA 2QKAA 3X2QB 5KX5A 3T1CA 5IDJA 4LF4B 2EILB 4MVOA 1MOFA 2YIDA 5DM6V 2ZE7A 3HR0A 2ZE8A 1K5SA 5D5PA 3J7AU 2A3QA 4LF6O 1IDSA 3CCRV 3GWOA 2X6BA 2E75B 1VQMV 3SJBC 1R1BA 1O9HA 1VF7A 3IC9A 1WPXA 2BTQB 5KHIA 2G38A 4G2KA 3EXAA 1BQZA 2WLKA 4GKKB 2QDOA 4B3SO 3Q4HB 4UB6Z 3ZMTA 1QLNA 2BTQA 2LFSA 2YUAA 4BIZA 1H38A 2ZT9B 4MTFA 4WFAV 3MHSC 1NBMG 1LUVA 1SC5B 2CAZC 4AI8A 3CSXA 3D3IA 4ZIBA 3STLC 4JYAB 3SYCA 4LWSA 1TAEA 3ABKB 5KHKA 3FKSG 3LDEA 2QWQB 1N34B 2RCVA 1PKXA 3HB3B 3K5LA 3CMEV 3U10A 4NXMO 3E2EA 5CB4B 1DTOA 2Q9LA 2IH1C 5BMVA 1KU9A 1GM8A 1MMMA 4LFBB 4NXNB 1ZWIC 4EB6B 1KUQA 5CB4A 3SGIA 2WLLB 1N32O 2F1MA 3ABUA 3ZHSA 4WF9V 1YVWA 3MDSA 4WFBV 3B8NA 1F4MA 4F4LA 1V54C 3L73H 1US6A 1GK9A 4DRXB 3E89A 1NJIW 2X6CA 2UXDO 3AEIA 4EB6A 3A0BZ 3OUSA 4DK0A 4UCSA 5CMUA 5A9GA 1GRJA 3O9OA 1G4YB 2CTWA 1GN4A 3VQVA 4DR5B 4GYCB 3UT5A 3G6BA 4K0KO 1SQGA 4DRXA 2MW2B 2WLHA 3I5DA 3OD4A 3ZHVA 4QNHB 4DV0O 1OCRB 1TUEB 2Q8VA 3M99B 4YIPA 5AG2A 4CH5A 3OUFA 1D2DA 1N32B 2F4VO 1BS3A 3M7MX 5E1AC 3U11A 4K8XA 3DC6A 3G71V 1DK1A 2YEVB 3VQXA 1UFIA 3RYIB 3K5MA 4MW3A 1K5QA 3QO5A 4JV5O 4PJ0Z 2UXDB 2VWKA 5IYBO 4CS3A 2GTAA 2H3OA 4N23A 1QNMA 5KHHA 1SQPH 3I56V 4J7KA 1VF5B 3J81N 3R65A 1DF4A 3QO8A 2AHZA 5LGNA 5EC2C 2LW7A 2FTKA 4JASA 1Z5VA 1Y6XA 4YJ3B 3JD3A 1PP9H 2ZQMA 4UCVA 1NR1A 3HKBB 1R6TA 3CB2A 3IC7A 4PV1B 2H94A 2P67A 1MZFA 2JVDA 4ZOLB 2XTAA 3E8HA 4YJ3A 4DR2O 2O57A 3KKYA 3HKBA 1Q6UA 1XREA 4FVMA 4IL6Z 4X1KB 4FLUA 4ZOLA 2ARHA 2HVJC 4UCRA 3IFXA 3ABLC 4WFGA 3J80N 5KMGB 1WB8A 4C7UA 2CE4A 5K1PA 4DR7O 5LHGA 4JI3B 3BPZA 4DV7B 3FFQA 3L74H 3E8FA 4PDMA 1K4DC 4LFAB 2P4KA 3JSNA 4JI8O 2E5LO 3C90A 1NTKH 4U7NA 3JYCA 4DUYO 1Q3EA 1W0KG 1TA8A 2UU9O 2WLMA 4LBEC 3TCUA 3APQA 2W0FC 4R8CA 2OIEA 2XAQA 1HW7A 3K04A 5LMNB 1N36O 2RJZA 5JJJB 2VQFB 4X62B 4B7KA 2VRZA 2Y69B 3JSLA 2WLIA 1H2LA 3CWBH 5BR8O 1XNRB 3CX5F 4PDRA 1OZ0A 1P7BA 1M4UA 2E5LB 5FNVB 3I55V 1M5IA 1MZEA 1ORQC 1E79G 1P7GA 1MG1A 1FFTB 1PL0A 5B3SC 2Q5ZA 1Q6IA 3CXCU 5CA3A 4YJ2B 3CEIA 3QO7A 4DR3O 2JIZG 1VQNV 2UUAO 1JPXA 1PD3A 3U0ZA 4KFMA 1OCOC 3GVMA 1VQ4V 4I9WA 4LC1A 5TISZ 4YJ2A 1UJWB 5CBGA 4P9OA 2QWNB 4GKJB 4KHPB 1AR5A 4DR4O 4QPKA 1NS1A 4J10A 4DV4B 2WWWA 4RQFA 1M9NA 4DR3B 3F5TA 3ML0A 3FB5C 2ITDC 2CK3G 4P2ZA 2W6JG 3LSUA 3CRMA 2QE7G 4I5SA 3NXSA 2QR4A 4ZBMA 1YEWA 3LDDA 3MHHC 3ICXA 1KBHA 3E8GA 4R50A 5FPOA 3M8AA 2EIJB 1WP8A 1VQ9V 2Q67A 2LFRA 3WFVA 1URFA 4ASUG 5C93A 2JJ2G 5IY5C 4LFCB 3BRCA 4LF8O 3RVZA 4TQFA 4UCOA 4LF5O 1BMFG 3G67A 4YXWG 2P5OA 2FYUH 4BW9A 3ZBHA 1M56B 3HPLC 1V55C 1OV9A 3CP1A 4RQEA 5KHGA 2L35A 1Z2GA 5H6QA 1VIBA 5IJ0B 4CC5A 4JGSA 2NNUA 1JCHA 4EFEA 1SRYA 3TETA 1T5EA 3H1HH 4LCUC 4I4TB 1BSMA 2CTPA 1ZX3A 3TGUH 2DYRC 1SA0B 5A2QN 5LP6C 1B3QA 4JI7B 2AHYA 1WPBA 1IVSA 4I4TA 4TV8A 3LSSA 2LO1A 2UXXA 5ITZB 2YC0A 3TXQA 4FLWA 4O4HB 4JYYA 1XILA 2R9RB 4UVAA 4CH4A 3ASOB 5GW7A 2E74B 3W7SA 1EZJA 3SPIA 1R6KA 3APOA 2A79B 4FLTA 4BAYA 2LGQA 4JI5B 2P06A 1MA1A 1R3LC 4O4HA 2IH3C 2H8PC 1PNMA 4B3RB 2ETNA 4GX0A 3OMAB 4IGGA 1DLBA 3L75H 1FJGO 4CBCA 2HFEC 3SYPA 3VOUA 3OTOO 4B3TB 3AG4C 3WG7C 1KP2A 1HNWB 3HKEB 2EIKB 5JH7A 4G28B 3ZRSA 5B1BC 1ZAUA 2Q0OC 1FXHA 4J80A 3OAAG 1TVKB 4X9QA 1I7FA 2YDEA 5JQGA 1DF5A 1PNLA 2IJHA 3L72H 2YIBD 2OCCC 1FXKC 4F6RA 3ZRWB 1TVKA 3H1LH 1Q82W 1NR7A 3DXRB 3CRQA 3OTOB 1Z5WA 4K35A 2CDYA 4DW1A 1BCCH 2Z5UA 2OTLV 1Q81W 2X0LA 3ZRWA 4ZHQB 1VQ7V 1VMGA 3DXRA 1GM9A 3LSQA 4P9PA 2VS0A 5B1AB 4LF9B 1JFFA 4HZ3A 5LP6A 3AG1B 3SYAA 2OCHA 1VF6C 3B4SA 2AW9A 5EBLC 3ZMZA 3ABTA 3HKDB 4ZHQA 2K9PA 4PI0A 4GX5A 3WB0A 1H8EG 1BL8A 5GTIZ 1JX9A 4I55B 2IBZH 4KP4A 2QM4A 4QIWF 1NH2B 4JZGA 4O4JA 2PGGA 1CP9A 2QM8A 5LGUA 1RM1B 1SESA 3HKDA 3LNNA 2WLNA 4LF4O 1WLEA 4LR3A 1NI8A 4I55A 4H33A 2Y4TA 3N27A 1KP3A 3SPCA 1JJ2U 4MVSA 3D36A 4XDLA 1AI4A 2ZR3A 3BEHA 3DGEA 3KG2A 2LW1A 3S3WA 2JGDB 4PA3A 3OGCC 1LUWA 2GHYA 1VQLV 2OCCB 4CS2A 3OTFA 2IJKA 2F95B 1JJOA 1O9GA 4YHHB 3K79A 3MD0A 1XL6A 4DO2A 4GKKO 2DYSC 1Q8IA 2JGDA 5IYDO 3OFNG 5IWAB 1FPOA 1K9MW 3ETQA 1U97A 3AG7A 3UO2A 4O2AA 4FZ1A 5LYJB 2HJFC 4JAVA 4JYAO 3G4SV 4J11A 1GN6A 1SKVA 3TK1A 2E76B 5EK0A 1N34O 2BE3A 4RWUA 4X64B 1BHBA 4WFHA 1EZVH 2F93B 1F4NA 5LYJA 1VF6A 1Q90D 3WU2Z 3EFFK 1G8MA 3K06A 1M90W 5GONA 4LWSB 1NVPB 2QWOB 1FKAO 2YXYA 1ROPA 1ZUQA 4YY3B 4LFBO 4U3JB 1XL4A 2HP8A 2Y48A 3ZX6A 2PZSA 4NXNO 2F23A 5F2VO 5JVDA 2DWEC 2WPDG 4AQYB 1K34A 2PI4A 2UXBB 2YXHA 5IYZA 4U3JA 1H2MA 3BA8A 5BMVB 1HNZB 4WFFA 2ZXWC 3DTUB 3P30A 3OW2U 2EX3A 3FB8C 3AG3C 5L3FA 4FIPC 1L8DA 4PELA 1XI1A 1VP7A 4DR5O 3RBZA 1K33A 3THOA 3K58A 4UCTA 3CC4V 1AP6A 1TGOA 1SS3A 3W7TA 2PYJA 1JQ0A 4JAUA 3OMNB 3ZHUA 2L6LA 1BGYH 4JYBA 3UT5B 2RQ6A 4GX2A 4J42A 4CH6A 1K4CC 2HHHO 1IURA 5H2FZ 2GSMB 2GDSA 2BTOA 1AP5A 2ADPA 1FYJA 1B06A 4QE7A 1W59A 3OR6C 2DMXA 2IM9A 2FL4A 4GX1A 4MVRA 1ZL8B 1AI6A 5EBWC 3CD6V 2OYQA 2PY5A 4I7ZB 1GO3F 5LGTA 2ZM6B 5GTHZ 3LUTB 1YJWV 2XHBA 3IAYA 4FM1A 2F66C 1ZL8A 2ATKC 3E8BA 2DOSA 4X1IB 2B1GA 3SPGA 3CRAA 2HHHB 1MNGA 2OIGA 3VQWA 4K3AA 3UCSC 2Q4PA 1GN3A 4JZ2A 1AB3A 2QTOA 4X1IA 4E2LA 5JWPA 1F23A 2YI8A 1PV0A 2K1EA 3UM7A 1JVMA 4JI1O 2AXTZ 3CHXA 4MVQA 3CCMV 3B40A 3OM3B 2EINC 4RAIA 2GBOA 4JI2B 1V54B 2HG5C 3RYFB 4LH7A 4JI3O 4DV7O 1FXVA 2HEPA 4WFEA 5LMUO 4HYOA 4LFAO 3BA9A 3ZN0A 4MW8A 5JJNB 2HJDA 1Y67A 5DECA 4JYCA 3RYFA 1ENVA 4JI1B 1H2GA 2R70A 2RMKB 3K9SA 5LMNO 1QVGU 1GTOA 1YCIA 5LBQA 2VQFO 1YDXA 4X62O 4FLVA 3KCXA 2XOKG 1AROP 4KUMA 1XNRO 3ZMUA 5LMUB 3H1IH 5JCOC 4FK5C 2P90A 2EZPA 2V4DA 1NQTA 3OR7C 5FL7G 2KG7B 4L8JA 5H5NA 2RNBA 5CA1B 4A5UB 3RYCB 2WLIB 5DN6G 3CXHF 4JI0B 2ZINA 2ZR2A 2HLDG 5IT9N 1FD9A 3CCLV 5LHIA 2QKCA 2KG7A 4MVMA 5L3CA 4DR6B 5CA1A 3SJAC 3QG5A 3RYCA 1WA8B 3ZMSA 4G27B 4J41A 1RSOB 4FLXA 1Y76B 1I94O 4MTOA 4J9YB 4I0XB 1OCZC 4GKJO 2PYLA 4I50B 4KHPO 2VQEO 1YHQV 1PL4A 2EIMC 1WA8A 3F5WC 1RSOA 4D7SA 1MABG 1Y76A 5EYPB 4DV4O 1MSDA 4I0XA 2ZD9A 1YI2V 4JTDB 4I50A 4XDKA 2PTMA 4O4LB 4JI6B 4TV9B 1NTMH 1N33B 3ABLB 1AR4A 2XAHA 5EYPA 4MVUA 1HNXB 4WBNB 3RFRA 4X20B 1I94B 1DGSA 1X59A 4F6EA 2ITCC 4O4LA 2VQEB 3HKCB 4TV9A 2GTSA 3K0GA 1GKFA 2XAFA 4WBNA 4X20A 4GUNA 3JD2A 1WP7A 4LFCO 2UXCO 3W7WA 1SQFA 1EM1A
chains in the Genus database with same CATH topology
1PNLA 2IJHA 3E35A 1GM7A 2P7TC 3ZMTA 1QLNA 2LFSA 4BIZA 2Y69C 5CBHA 2OCCC 1FXKC 4J9ZB 4Q20A 3ZRWB 1H38A 3K9AA 1Q82W 1NR7A 2DQ0A 4MTFA 4TWKA 3CCEV 4WFAV 3MHSC 1NBMG 1CEZA 2X7RB 1SERA 1YITV 4QE9A 3P32A 3D3IA 4XBFA 2EBOA 1LNQA 1RPOA 3STLC 3SYCA 2R9IA 2Z5UA 2HKOA 1VQ8V 1Q81W 2OTLV 3ABKB 2X0LA 1E1QG 3ZRWA 3FKSG 2M7WA 3LDEA 3OEEG 1VQ7V 2HVKC 1GM9A 1PKXA 3LSQA 5CBFA 4P9PA 3OMIB 4UVBA 5B3SB 3HB3B 5B1AB 4UVCA 3CMEV 4HZ3A 3AG1B 2C2AA 3SYAA 5L3GA 1K8AW 3E2EA 1CPYA 5EBLC 3ZMZA 3ABTA 5CN0A 2Z3YA 3ABMC 1AJPA 4RUEA 1DTOA 3A0RA 4GX5A 1H8EG 1BL8A 1OCOB 2IH1C 1JX9A 1YTFD 3JD1A 3ZJZA 1GM8A 4KP4A 1NH2B 4QIWF 3JD4A 1CP9A 2QM8A 4Z1MG 5LGUA 1R3KC 1ZWIC 3ZN1A 1RM1B 2IW5A 4UUJC 1SESA 1K7DA 4P30A 2JJ1G 2WLNA 1WLEA 3E86A 2WLLB 2QEXV 3ABUA 1M57C 1QR8A 4PA7A 4WF9V 2EINB 4WFBV 3B8NA 4H33A 1F4MA 3BY6A 3ETDA 4F4LA 1V54C 1KP3A 3SPCA 1GK9A 1JJ2U 2IJJA 2QKSA 1NJIW 3E89A 4MVSA 2X6CA 3D36A 3AEIA 1AI4A 4XDLA 3SPHA 1K97A 2ZR3A 3BEHA 3OUSA 3DGEA 3KG2A 5CMUA 3LDCA 1OHHG 2JEXA 3B77A 1SZTA 2MK3A 3SJQC 1G4YB 4MVZA 1YJNV 4PA3A 3OGCC 2PI5A 2GHYA 1VQLV 2OCCB 4BW5A 4UV8A 2IJKA 4ZKIA 2OTJV 2WLHA 1I5XA 4PDVA 4QNHB 1W2BU 1OCRB 3K79A 1TUEB 3MD0A 1XL6A 3M99B 4GCZA 4DO2A 2EIJC 2DYSC 3OUFA 1AR1B 4JTCB 1VQOV 2Q68A 5IYDO 4UXNA 5E1AC 3G71V 2YEVB 4BIUA 1E1RG 3OFNG 5IY5B 1QLEC 1H8HG 2W6IG 1EBOA 1K9MW 4MW3A 1K5QA 3QO5A 3AG2C 4OXSA 5IYBO 3K08A 2BOBC 3B8MA 2HJFC 4JAVA 1M56C 1YSCA 1S76D 4TSFG 3G4SV 3CCQV 3ABMB 1V55B 3TK1A 1QCEA 5EK0A 4N23A 4QPJA 3G6EV 1BHBA 4WFHA 3I56V 1F4NA 3R65A 1KC8W 1DF4A 3QO8A 2AHZA 3EFFK 1G8MA 2P6JA 3K06A 5LGNA 1K73W 5EC2C 4R6ZA 2FTKA 1M90W 3OE7G 1GMGA 4JASA 3W7XA 1NVPB 3JD3A 2ZQMA 2V7QG 2YSUB 2JDIG 1NR1A 1ROPA 3E83A 3IC7A 3QNEA 1XL4A 2DYRB 2H94A 2P67A 2Y48A 3CMAV 1VQ6V 1OCZB 2DWEC 2WPDG 3ASNC 1K34A 3ETEA 2PI4A 3E8HA 2LP7A 4QJFB 3T4DA 4JF3A 2EIMB 3CC7V 3FYEB 4WCEV 5B1NA 1Y4MA 1QVFU 4WFFA 4MSWC 2ZXWC 3ASOC 3DTUB 3P30A 2NLJC 3X2QC 3K3WA 3OW2U 4GT1A 3FB8C 3AG3C 3ZCCA 3H01A 4U7OA 4FIPC 3ZMVA 5L3FA 3FYIB 2HVJC 5KUMA 4PELA 1K3EA 3IFXA 3ABLC 4WFGA 2QA4V 3RBZA 3ZRXA 1K33A 1AI7A 3OEHG 3ETGA 1S3JA 3CC4V 4JPRA 3VBBA 1B6QA 5LHGA 1PNKA 1QR9A 5KUKA 1YIJV 4JTAB 3W7TA 1I5YA 3EHBB 3RVYA 3E8FA 1S77D 3AG4B 4PDMA 1K4DC 1JQ0A 3WG7B 1YJ9V 1R6NA 4JAUA 2EIKC 3OMNB 4L87A 5B1BB 1KQSU 4U7NA 2DW4A 2B1IA 3JYCA 4JYBA 2DQ3A 2A9HA 1W0KG 4GX2A 5L3DA 2WLMA 1S72V 1K92A 4LBEC 3TCUA 1M1KW 5H6RA 5KA5A 2W0FC 4R8CA 1K4CC 2XAQA 2EJRA 3K04A 2GSMB 2HR3A 4QE7A 2Y69B 4PA6A 3OR6C 1FXKB 2WLIA 3F7VC 4GX1A 4MVRA 2IJIA 3ZIAG 1AJNA 1AI6A 2D3OW 5EBWC 3SPJA 3CD6V 1KKDA 4MT8A 2ZDIC 4PDRA 1GO3F 2IU0A 1OZ0A 3K0DA 1P7BA 5LGTA 1Q86W 3JD0A 2BOCC 3LUTB 3CCUV 1YJWV 5BZBA 3F7YC 4PA4A 1YTFB 1FXKA 1Q7YW 3I55V 1ORQC 2ATKC 3E8BA 3CPWU 1E79G 2A0LA 1MG1A 1FFTB 1PL0A 2B1GA 5B1AC 5B3SC 3SPGA 3SYOA 3JCZA 3K03A 3T2MA 3CXCU 3AG1C 2WLJA 5CA3A 3QO7A 2JIZG 1VQNV 1R3IC 1BHAA 1JPXA 1PD3A 2QTOA 4KFMA 1OCOC 4E2LA 1VQKV 3ZRVA 1F23A 3CCVV 1VQ4V 1J95A 4I9WA 4LC1A 2K1EA 1Y66A 1JVMA 4UV9A 3UM7A 2QM7A 5L3BA 1UJWB 2XAGA 1RM1C 2UXNA 5CBGA 4P9OA 3PJSK 2IU3A 2WSSG 2XNDG 4MVQA 3CCMV 1N8RW 2DWDC 3OM3B 3CCSV 1W0JG 1M57B 2EINC 2Q6AA 4QPKA 2WAMA 4RAIA 1OCCC 1QBZA 2OT5A 1V54B 2HG5C 2WWWA 2XASA 1NH2D 4RQFA 1M9NA 1MSWD 3CCJV 1COWG 1IXMA 1FXVA 4WFEA 3ML0A 4HYOA 3FB5C 4X88A 2ITDC 2CK3G 4P2ZA 3ZN0A 2W6JG 2QE7G 4MW8A 4I5SA 3NXSA 4ZBMA 1DF5A 4PDLA 3LDDA 3MHHC 3UKMA 4JYCA 2JEUA 1ENVA 1H2GA 1OCRC 3E8GA 4R50A 4XDJA 4RUFA 2EILC 2EIJB 4PA9A 2DYSB 2Q69A 1VQ9V 2Q67A 2LFRA 1QVGU 1GTOA 5B1OA 5L3EA 5LBQA 5LHHA 3WFVA 1P4RA 3W7UA 4ASUG 5C93A 2JJ2G 5IY5C 4CZZA 4H37A 2XOKG 1NKDA 1QLEB 3RVZA 1AROP 2ZDIA 4FPPA 4KUMA 2F43G 3AG2B 3ZMUA 3CC2V 1BMFG 4YXWG 1S5HC 3FB7C 4FK5C 5HFMA 1M56B 2P90A 1V55C 3HPLC 2EZPA 1R3JC 3CP1A 1NQTA 3OR7C 4RQEA 5FL7G 2EZOA 1VQPV 3LNMB 4X8AA 3IGAC 2WLIB 5DN6G 5EC1C 5H6QA 2ZR2A 3T4ZA 2B5UA 2HLDG 4LP8A 3CCLV 4JGSA 4FMTA 5LHIA 2NNUA 1VQ5V 1S0VA 1EFRG 1JCHA 4FJCC 1SRYA 3TETA 3STZC 4MVMA 5L3CA 5KA6A 1R73A 4LCUC 1THZA 5EBMC 4MTGA 3ZMSA 1OCCB 4G27B 1KD1W 1SETA 4MS2A 5J9PC 5HFLA 2DYRC 4R7CA 4MTOA 4HAMA 4J9YB 1OCZC 4N21A 2AHYA 2WLLA 3ASNB 1L1FA 3ABKC 1JOYA 3LSSA 1AJQA 2UXXA 1YHQV 4EKWA 2EIMC 1FS0G 1KECA 3F5WC 1MABG 1NVPD 3CYOA 2R9RB 4UVAA 4TT3G 4MTXA 2ZXWB 3ASOB 5GW7A 2ZD9A 3W7SA 3X2QB 3T1CA 5IYCO 1EZJA 1YI2V 4JTDB 3AG3B 3SPIA 4XDKA 1R6KA 5IDJA 4X89A 2EILB 4MVOA 2JK5C 1MOFA 2A79B 2KB1A 4BAYA 5DM6V 1R3LC 2V1DA 3RW0A 2IH3C 3ABLB 2H8PC 3FB6C 1K5SA 1PNMA 2XAHA 4MVUA 4GX0A 3OMAB 3CCRV 1HWYA 3GWOA 1DLBA 1AI5A 2HFEC 2ITCC 3SYPA 3VOUA 4CBCA 2X6BA 3AG4C 3SYQA 1VQMV 3WG7C 2XAJA 1KP2A 2YEVA 3K0GA 2EIKB 1GKFA 5H9CA 4G28B 1WPXA 2XAFA 3ZRSA 5B1BC 3GB7C 3JD2A 2X6AA 4G2KA 1FXHA 1F51A 3OAAG 3W7WA 4RO2A 2WLKA 4DXWA 1RPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B77 A;  1SZT A;  2MK3 A;  2M7W A;  1Y66 A;  2LP7 A;  4JGS A;  3GWO A;  4JF3 A;  1EBO A;  1DLB A;  1DF4 A;  4FJC C;  4JPR A;  1MG1 A;  1QR9 A;  1Y4M A;  3CYO A;  2P6J A;  1I5Y A;  3MHH C;  5KA6 A;  3B8M A;  1JQ0 A;  1I5X A;  1QR8 A;  3K9A A;  3P30 A;  1ENV A;  3B8N A;  4FK5 C;  1QBZ A;  5HFM A;  3H01 A;  5H9C A;  4FIP C;  3MHS C;  5CN0 A;  2EZP A;  3M99 B;  2OT5 A;  2X7R B;  5HFL A;  3CP1 A;  1JPX A;  1QCE A;  1MOF A;  4G2K A;  4N23 A;  2EZO A;  2EBO A;  4N21 A;  4E2L A;  3WFV A;  1F23 A;  1K33 A;  5CMU A;  1K34 A;  1DF5 A;  5KA5 A; 
#chains in the Genus database with same CATH topology
 3HKC A;  4FLY A;  2P7T C;  2CTQ A;  3BCC H;  3CS5 A;  4Q20 A;  3K9A A;  4TWK A;  2QJ1 A;  1CEZ A;  2X7R B;  3KCY A;  2QSA A;  1SER A;  2FB5 A;  1YIT V;  1S5L Z;  4YIO A;  3K57 A;  1L0L H;  5LA6 B;  3IJ4 A;  2HKO A;  2KKW A;  1E1Q G;  2WA3 A;  2M7W A;  1L0N H;  2HVK C;  2UXC B;  1FAF A;  3ZED A;  4NKG B;  2DE0 X;  5B3S B;  3CRR A;  3OT7 A;  3N2G B;  4FM0 A;  5LA6 A;  5L3G A;  2D2C B;  4DV2 O;  4JI7 O;  4D6T H;  3ABM C;  1AJP A;  4FFB B;  3H1J H;  1OCO B;  1YTF D;  3JD1 A;  4IIJ B;  3L70 H;  3N2G A;  3JD4 A;  1KYO F;  4OPH A;  1K7D A;  1D5N A;  4FFB A;  4P30 A;  2JJ1 G;  1XHX A;  4JI5 O;  1M57 C;  1QR8 A;  1WJZ A;  4PA7 A;  4TV8 B;  4IIJ A;  2JGU A;  3FD9 A;  4ICG A;  3ETD A;  1N0J A;  4B3R O;  1OJH A;  2IJJ A;  2QKS A;  2W0X A;  3SPH A;  5IJ9 B;  2NR5 A;  2KQX A;  4DV2 B;  4DV5 O;  4B3T O;  1OHH G;  1GN2 A;  3SJQ C;  4MVZ A;  1YJN V;  2Z0A A;  1HNW O;  4Z1V A;  4BW5 A;  4DV1 B;  5IJ9 A;  1W2B U;  5B66 Z;  2Q68 A;  1IZ3 A;  4UXN A;  4W4L A;  4AIL C;  4BIU A;  1PM9 A;  3RWR D;  5JH7 B;  3SDL A;  5IY5 B;  1QLE C;  1H8H G;  2W6I G;  3AG2 C;  2R72 A;  3JAK A;  4DV3 O;  4DV5 B;  5JQG B;  2CGO A;  4Z2W A;  4OPA A;  1S76 D;  4TSF G;  3CCQ V;  3ABM B;  1V55 B;  1UPG A;  1QCE A;  3G6E V;  4F6R B;  2YI9 A;  4LF9 O;  2N05 A;  3H1K H;  4H0L B;  1XHZ A;  4R6Z A;  3OE7 G;  1GMG A;  3W7X A;  2Q7H A;  2P4V A;  2R9A A;  1SQQ H;  4B7E A;  3E83 A;  4BR6 A;  2DJV A;  2DYR B;  1VQ6 V;  4DV3 B;  2JS5 A;  1F7Y A;  1JFF B;  5K1X A;  5LP6 B;  5KAI Z;  1P49 A;  3L9D A;  4FFK A;  3ASN C;  1Y74 B;  1XQ8 A;  4X65 B;  3T4D A;  4JF3 A;  3CC7 V;  1AVM A;  2YXL A;  2LQT A;  3CRC A;  1A32 A;  1Y4M A;  5JJE B;  2ADQ B;  3JAW B;  4KXR A;  3C3T A;  4O4J B;  3WB1 A;  2NLJ C;  3X2Q C;  1Y74 A;  1SQX H;  3ZCC A;  3H01 A;  4U7O A;  3FYI B;  5KUM A;  3UO3 A;  4EEQ A;  2M6Y A;  5BY1 A;  5KLV H;  1D5A A;  1AI7 A;  3JAW A;  3OEH G;  1HDJ A;  3ETG A;  4JPR A;  5FPR A;  5B5E Z;  1B6Q A;  4YHH O;  1QR9 A;  5KUK A;  1YIJ V;  1BT8 A;  1I5Y A;  3EHB B;  3RVY A;  3AG4 B;  3WG7 B;  1G6U A;  1QHT A;  2EUL A;  1IBL B;  4IT5 A;  2Y4U A;  4X1Y B;  4L87 A;  5B1B B;  1KQS U;  5IWA O;  2B1I A;  2JS3 A;  3ZHQ A;  4OX9 B;  5L3D A;  1S72 V;  2YIB A;  3N2K A;  4H44 B;  4O2B B;  4FLZ A;  4X1Y A;  2YIC A;  4O4I A;  1FXK B;  3WB2 A;  2ZNI A;  1Q6H A;  3F7V C;  1YZB A;  3BFR A;  3A2F A;  3ZIA G;  4X64 O;  2D3O W;  4NVP A;  3SPJ A;  1KKD A;  4MT8 A;  1XOU A;  3K0D A;  4O2B A;  5CA0 A;  3JD0 A;  4O2A B;  2BOC C;  3CCU V;  4NTY A;  4DYL A;  2UUC O;  4Q6G A;  3F7Y C;  1FXK A;  4JI4 B;  2A0L A;  3EVK A;  4YY3 O;  3SYO A;  2N74 A;  3K03 A;  4EFB A;  3D3Q A;  3JAL A;  4AQY O;  1IBM B;  2BCC H;  3S3X A;  1ZLZ A;  2NN4 A;  2UXB O;  1YF2 A;  3ZHT A;  5GON B;  3DSQ A;  4DV6 B;  4KL1 A;  1VQK V;  1HNZ O;  1Y66 A;  4UV9 A;  2UUB B;  5L3B A;  1VEW A;  1V9P A;  2XAG A;  3DC5 A;  2UXN A;  5KHJ A;  4QGP A;  1J5E O;  3PJS K;  2IU3 A;  2Q7E A;  2WSS G;  2XND G;  5JVD B;  2UUC B;  3T1H O;  1N8R W;  2DWD C;  3CCS V;  2Q6A A;  2WAM A;  1QBZ A;  1EN5 A;  5IYZ B;  2OT5 A;  4LF7 B;  2XAS A;  1U96 A;  3CCJ V;  1COW G;  1XBL A;  4DW0 A;  1NTZ H;  5LL6 Y;  1H2N A;  4UFZ A;  5C8Y B;  4LF6 B;  1XMO O;  2JEU A;  1OCR C;  1TUB B;  4NTW A;  4CH3 A;  1J5E B;  3BHP A;  4XDJ A;  4ABM A;  3Q4H A;  4W4K A;  2DYS B;  2Q69 A;  3T1H B;  5EZY B;  2E3C A;  1LR1 A;  5B1O A;  5C8Y A;  3A0H Z;  1P4R A;  3QF7 A;  1EN6 A;  3W7U A;  3H9V A;  1NKD A;  1TUB A;  4FPP A;  2F43 G;  2P22 C;  2WA4 A;  5EZY A;  4B3S B;  1S5H C;  3FB7 C;  2ZM6 O;  2OWO A;  1R3J C;  2BSK B;  1VQP V;  3LNM B;  1XMO B;  4X8A A;  3IGA C;  1B04 A;  4AHC A;  5EC1 C;  2PUS A;  1VQ5 V;  1S0V A;  1EFR G;  2AGA A;  3D8C A;  2BSK A;  5KA6 A;  4MTG A;  1KD1 W;  1SET A;  1ZTE A;  5HFL A;  4R7C A;  1VAR A;  4NXM B;  2FKX A;  2WLL A;  1FFX B;  1XEQ A;  5DED A;  4NTX A;  5LXT B;  4IHJ B;  4JI2 O;  3QVN A;  2ZXW B;  5IYC O;  2RDC A;  3AG3 B;  2CTR A;  1FFX A;  4X89 A;  4BWA A;  3JAT B;  2JK5 C;  4D7T A;  2KB1 A;  5LXT A;  3RN4 A;  2V1D A;  3ZHR A;  4IHJ A;  3RW0 A;  3O65 A;  3FB6 C;  2KSD A;  1QQC A;  1HWY A;  1AI5 A;  1IX9 A;  3AK1 A;  2XUM A;  3JAT A;  1IXB A;  3SYQ A;  1X4T A;  2ZIO A;  4NYK A;  3RYH B;  2XAJ A;  4H13 B;  2YEV A;  1BQ0 A;  3AK3 A;  2JRI A;  5H9C A;  3RYI A;  3GB7 C;  3K59 A;  4K0K B;  2X6A A;  5FLX N;  1F51 A;  3MAQ A;  3JAM N;  1JA8 A;  1KKC A;  4NB5 A;  4DV0 B;  4RO2 A;  4DXW A;  1RPR A;  2ZIM A;  3RYH A;  3E35 A;  1GM7 A;  2F4V B;  3SR2 C;  2Y69 C;  5CBH A;  4J9Z B;  3CJH B;  2DQ0 A;  4JV5 B;  3CCE V;  4JI0 O;  3P3N A;  4QE9 A;  3P32 A;  4XBF A;  2EBO A;  1LNQ A;  2YS8 A;  1RPO A;  2R9I A;  1VQ8 V;  3CJH A;  4DR6 O;  3OEE G;  3BVO A;  1PPJ H;  2ZKO A;  4FZ0 A;  5CBF A;  1KMI Z;  3OMI B;  4UVB A;  4UVC A;  2GV9 A;  2C2A A;  1K8A W;  1CPY A;  1SF9 A;  2A06 H;  5CN0 A;  2Z3Y A;  4RUE A;  3A0R A;  3A8T A;  3ZJZ A;  3AK2 A;  4X1K A;  4Z1M G;  1R3K C;  3ZN1 A;  1XNQ O;  2IW5 A;  4UUJ C;  4JI6 O;  3E86 A;  4DR2 B;  2QEX V;  2EIN B;  5KMG A;  1N33 O;  3BY6 A;  3FX7 A;  4J7J A;  5LOV B;  1HNX O;  2GUZ B;  2Y0I A;  1H2S B;  2QWP B;  2CGN A;  1K97 A;  1H2K A;  3RT3 C;  3LDC A;  3B77 A;  2JEX A;  1SZT A;  2MK3 A;  4K8Z A;  2PI5 A;  1HR0 O;  1RP3 B;  5LOV A;  1SZX A;  3C3S A;  2GUZ A;  4UV8 A;  4ZKI A;  2OTJ V;  2DN9 A;  1I5X A;  4B08 A;  4DR7 B;  4PDV A;  1XNQ B;  2Q0A A;  4GCZ A;  4UB8 Z;  2EIJ C;  1AR1 B;  2PF4 E;  4IYH A;  1CXZ B;  4JTC B;  1VQO V;  4GZR B;  4JI8 B;  1E1R G;  1SQV H;  1NU1 H;  4DUY B;  1EBO A;  2UU9 B;  4NR1 A;  4OXS A;  2AZ2 A;  3K08 A;  2BOB C;  3B8M A;  4LNU B;  1N36 B;  1M56 C;  1YSC A;  5FNV A;  1HR0 B;  3E22 B;  1N0N A;  2ILM A;  1M93 A;  4QPJ A;  5BR8 B;  1AIL A;  4LNU A;  5D5Q A;  1SQB H;  1IBK O;  1WNS A;  1KC8 W;  2FML A;  5JCO A;  2Y0P A;  3E22 A;  4TUY B;  3K5N A;  2P6J A;  1K73 W;  4HBN A;  2V7Q G;  4I9Q A;  2YSU B;  2JDI G;  3QNE A;  1BZK A;  3CMA V;  2VWJ A;  3BAB A;  4TUY A;  1OCZ B;  3ETE A;  5KAF Z;  2UUA B;  3R66 A;  2LP7 A;  4QJF B;  2EIM B;  3FYE B;  4PHZ A;  4WCE V;  3FAV B;  5B1N A;  2ODM A;  1GAX A;  1QVF U;  4MSW C;  2QWR B;  3BAA A;  3ASO C;  3JAS B;  1IBK B;  3NR7 A;  1GH6 A;  3K3W A;  4GT1 A;  3ZMV A;  4DR1 O;  1XMQ O;  4DR4 B;  1S5J A;  4DUZ O;  1K3E A;  3FAV A;  2QA4 V;  3ZRX A;  3JAS A;  4DV1 O;  1I08 A;  1S3J A;  3VBB A;  1PNK A;  4JTA B;  5J2T B;  4DK1 A;  1S77 D;  4B3M O;  1YJ9 V;  1R6N A;  2EIK C;  4PI2 A;  2QTS A;  2A7W A;  2DW4 A;  4LH6 A;  2LJ2 A;  2DQ3 A;  2A9H A;  3OGI B;  1K92 A;  5J2T A;  5H6R A;  1M1K W;  5KA5 A;  4DR1 B;  4HNA B;  2EJR A;  1XMQ B;  4DUZ B;  2N04 A;  2HR3 A;  4J7Z A;  4PA6 A;  1KB9 F;  3PN1 A;  3QTC A;  2IJI A;  1AJN A;  3TXS A;  4CC6 A;  2CUG A;  4LF8 B;  5IJ0 A;  4LF5 B;  2ZDI C;  4HNA A;  2IU0 A;  3JAK B;  1Q86 W;  4B3M B;  1P84 F;  1BE3 H;  1NT2 B;  5BZB A;  1NZ6 A;  4PA4 A;  1YTF B;  1Q7Y W;  2Q73 A;  1XUQ A;  3CPW U;  2ZE5 A;  5B1A C;  1SA0 A;  5EIB C;  2Q7G A;  3T2M A;  4GLX A;  3JCZ A;  3KZI Z;  3ZS8 C;  4X66 O;  3AG1 C;  2WLJ A;  4FM2 A;  1R3I C;  3CE2 A;  5ITZ A;  1BHA A;  4X65 O;  5E79 Z;  3ZRV A;  4JAA A;  3CCV V;  1J95 A;  4U3F H;  3K5O A;  1Q43 A;  1RM1 C;  5EIB D;  1Q5O A;  2QM7 A;  2AZ0 A;  1WB7 A;  1I0H A;  3TJT A;  3D36 C;  2B9Z A;  2ZE6 A;  1RFY A;  1W0J G;  1M57 B;  3B2E E;  1EN4 A;  1OCC C;  4X66 B;  1NH2 D;  4ZI7 B;  1MSW D;  5BXZ A;  1IXM A;  3JAR B;  4CS4 A;  4X88 A;  3HKE A;  3JCU Z;  1IBL O;  4TQD A;  4PDL A;  3UKM A;  4ZI7 A;  1FJG B;  4OX9 O;  1YXB A;  3JAR A;  3L71 H;  2QGN A;  4RUF A;  3T1Y O;  2EIL C;  2ZCE A;  4PA9 A;  1WAZ A;  5J2U B;  5L3E A;  5LHH A;  1G1X B;  2LGW A;  4CZZ A;  4H37 A;  1QLE B;  3B09 A;  2ZDI A;  3AG2 B;  4PD4 F;  3CC2 V;  5J2U A;  2CH7 B;  1JR9 A;  3N2K B;  5HFM A;  3RGB A;  3UQ8 A;  3P3P A;  3VQY A;  2EZO A;  4JI4 O;  4O4I B;  2EJ7 A;  1JMK C;  3G80 A;  3T4Z A;  2B5U A;  2CH7 A;  3T1Y B;  4LP8 A;  4FMT A;  4BIO A;  4FJC C;  3SJC C;  1IBM O;  5CA0 B;  4OGQ B;  3GWK C;  3STZ C;  4UCU A;  1QU7 A;  1R73 A;  1THZ A;  5EBM C;  4DV6 O;  4IYI A;  1OCC B;  4MS2 A;  5J9P C;  1XDC A;  2XT9 A;  2ZNJ A;  4HAM A;  2UUB O;  4N21 A;  5IE9 A;  3JAL B;  5KX5 B;  3ASN B;  1L1F A;  4E4E A;  3ABK C;  1JOY A;  1AJQ A;  1ZSP A;  4TOI A;  4EKW A;  1FS0 G;  1KEC A;  1WN7 A;  2YIA A;  1NVP D;  3CYO A;  1HP8 A;  2RN9 A;  4LF7 O;  4TT3 G;  4MTX A;  1N4C A;  2QKA A;  3X2Q B;  5KX5 A;  3T1C A;  5IDJ A;  4LF4 B;  2EIL B;  4MVO A;  1MOF A;  2YID A;  5DM6 V;  2ZE7 A;  3HR0 A;  2ZE8 A;  1K5S A;  5D5P A;  3J7A U;  2A3Q A;  4LF6 O;  1IDS A;  3CCR V;  3GWO A;  2X6B A;  2E75 B;  1VQM V;  3SJB C;  1R1B A;  1O9H A;  1VF7 A;  3IC9 A;  1WPX A;  2BTQ B;  5KHI A;  2G38 A;  4G2K A;  3EXA A;  1BQZ A;  2WLK A;  4GKK B;  2QDO A;  4B3S O;  3Q4H B;  4UB6 Z;  3ZMT A;  1QLN A;  2BTQ A;  2LFS A;  2YUA A;  4BIZ A;  1H38 A;  2ZT9 B;  4MTF A;  4WFA V;  3MHS C;  1NBM G;  1LUV A;  1SC5 B;  2CAZ C;  4AI8 A;  3CSX A;  3D3I A;  4ZIB A;  3STL C;  4JYA B;  3SYC A;  4LWS A;  1TAE A;  3ABK B;  5KHK A;  3FKS G;  3LDE A;  2QWQ B;  1N34 B;  2RCV A;  1PKX A;  3HB3 B;  3K5L A;  3CME V;  3U10 A;  4NXM O;  3E2E A;  5CB4 B;  1DTO A;  2Q9L A;  2IH1 C;  5BMV A;  1KU9 A;  1GM8 A;  1MMM A;  4LFB B;  4NXN B;  1ZWI C;  4EB6 B;  1KUQ A;  5CB4 A;  3SGI A;  2WLL B;  1N32 O;  2F1M A;  3ABU A;  3ZHS A;  4WF9 V;  1YVW A;  3MDS A;  4WFB V;  3B8N A;  1F4M A;  4F4L A;  1V54 C;  3L73 H;  1US6 A;  1GK9 A;  4DRX B;  3E89 A;  1NJI W;  2X6C A;  2UXD O;  3AEI A;  4EB6 A;  3A0B Z;  3OUS A;  4DK0 A;  4UCS A;  5CMU A;  5A9G A;  1GRJ A;  3O9O A;  1G4Y B;  2CTW A;  1GN4 A;  3VQV A;  4DR5 B;  4GYC B;  3UT5 A;  3G6B A;  4K0K O;  1SQG A;  4DRX A;  2MW2 B;  2WLH A;  3I5D A;  3OD4 A;  3ZHV A;  4QNH B;  4DV0 O;  1OCR B;  1TUE B;  2Q8V A;  3M99 B;  4YIP A;  5AG2 A;  4CH5 A;  3OUF A;  1D2D A;  1N32 B;  2F4V O;  1BS3 A;  3M7M X;  5E1A C;  3U11 A;  4K8X A;  3DC6 A;  3G71 V;  1DK1 A;  2YEV B;  3VQX A;  1UFI A;  3RYI B;  3K5M A;  4MW3 A;  1K5Q A;  3QO5 A;  4JV5 O;  4PJ0 Z;  2UXD B;  2VWK A;  5IYB O;  4CS3 A;  2GTA A;  2H3O A;  4N23 A;  1QNM A;  5KHH A;  1SQP H;  3I56 V;  4J7K A;  1VF5 B;  3J81 N;  3R65 A;  1DF4 A;  3QO8 A;  2AHZ A;  5LGN A;  5EC2 C;  2LW7 A;  2FTK A;  4JAS A;  1Z5V A;  1Y6X A;  4YJ3 B;  3JD3 A;  1PP9 H;  2ZQM A;  4UCV A;  1NR1 A;  3HKB B;  1R6T A;  3CB2 A;  3IC7 A;  4PV1 B;  2H94 A;  2P67 A;  1MZF A;  2JVD A;  4ZOL B;  2XTA A;  3E8H A;  4YJ3 A;  4DR2 O;  2O57 A;  3KKY A;  3HKB A;  1Q6U A;  1XRE A;  4FVM A;  4IL6 Z;  4X1K B;  4FLU A;  4ZOL A;  2ARH A;  2HVJ C;  4UCR A;  3IFX A;  3ABL C;  4WFG A;  3J80 N;  5KMG B;  1WB8 A;  4C7U A;  2CE4 A;  5K1P A;  4DR7 O;  5LHG A;  4JI3 B;  3BPZ A;  4DV7 B;  3FFQ A;  3L74 H;  3E8F A;  4PDM A;  1K4D C;  4LFA B;  2P4K A;  3JSN A;  4JI8 O;  2E5L O;  3C90 A;  1NTK H;  4U7N A;  3JYC A;  4DUY O;  1Q3E A;  1W0K G;  1TA8 A;  2UU9 O;  2WLM A;  4LBE C;  3TCU A;  3APQ A;  2W0F C;  4R8C A;  2OIE A;  2XAQ A;  1HW7 A;  3K04 A;  5LMN B;  1N36 O;  2RJZ A;  5JJJ B;  2VQF B;  4X62 B;  4B7K A;  2VRZ A;  2Y69 B;  3JSL A;  2WLI A;  1H2L A;  3CWB H;  5BR8 O;  1XNR B;  3CX5 F;  4PDR A;  1OZ0 A;  1P7B A;  1M4U A;  2E5L B;  5FNV B;  3I55 V;  1M5I A;  1MZE A;  1ORQ C;  1E79 G;  1P7G A;  1MG1 A;  1FFT B;  1PL0 A;  5B3S C;  2Q5Z A;  1Q6I A;  3CXC U;  5CA3 A;  4YJ2 B;  3CEI A;  3QO7 A;  4DR3 O;  2JIZ G;  1VQN V;  2UUA O;  1JPX A;  1PD3 A;  3U0Z A;  4KFM A;  1OCO C;  3GVM A;  1VQ4 V;  4I9W A;  4LC1 A;  5TIS Z;  4YJ2 A;  1UJW B;  5CBG A;  4P9O A;  2QWN B;  4GKJ B;  4KHP B;  1AR5 A;  4DR4 O;  4QPK A;  1NS1 A;  4J10 A;  4DV4 B;  2WWW A;  4RQF A;  1M9N A;  4DR3 B;  3F5T A;  3ML0 A;  3FB5 C;  2ITD C;  2CK3 G;  4P2Z A;  2W6J G;  3LSU A;  3CRM A;  2QE7 G;  4I5S A;  3NXS A;  2QR4 A;  4ZBM A;  1YEW A;  3LDD A;  3MHH C;  3ICX A;  1KBH A;  3E8G A;  4R50 A;  5FPO A;  3M8A A;  2EIJ B;  1WP8 A;  1VQ9 V;  2Q67 A;  2LFR A;  3WFV A;  1URF A;  4ASU G;  5C93 A;  2JJ2 G;  5IY5 C;  4LFC B;  3BRC A;  4LF8 O;  3RVZ A;  4TQF A;  4UCO A;  4LF5 O;  1BMF G;  3G67 A;  4YXW G;  2P5O A;  2FYU H;  4BW9 A;  3ZBH A;  1M56 B;  3HPL C;  1V55 C;  1OV9 A;  3CP1 A;  4RQE A;  5KHG A;  2L35 A;  1Z2G A;  5H6Q A;  1VIB A;  5IJ0 B;  4CC5 A;  4JGS A;  2NNU A;  1JCH A;  4EFE A;  1SRY A;  3TET A;  1T5E A;  3H1H H;  4LCU C;  4I4T B;  1BSM A;  2CTP A;  1ZX3 A;  3TGU H;  2DYR C;  1SA0 B;  5A2Q N;  5LP6 C;  1B3Q A;  4JI7 B;  2AHY A;  1WPB A;  1IVS A;  4I4T A;  4TV8 A;  3LSS A;  2LO1 A;  2UXX A;  5ITZ B;  2YC0 A;  3TXQ A;  4FLW A;  4O4H B;  4JYY A;  1XIL A;  2R9R B;  4UVA A;  4CH4 A;  3ASO B;  5GW7 A;  2E74 B;  3W7S A;  1EZJ A;  3SPI A;  1R6K A;  3APO A;  2A79 B;  4FLT A;  4BAY A;  2LGQ A;  4JI5 B;  2P06 A;  1MA1 A;  1R3L C;  4O4H A;  2IH3 C;  2H8P C;  1PNM A;  4B3R B;  2ETN A;  4GX0 A;  3OMA B;  4IGG A;  1DLB A;  3L75 H;  1FJG O;  4CBC A;  2HFE C;  3SYP A;  3VOU A;  3OTO O;  4B3T B;  3AG4 C;  3WG7 C;  1KP2 A;  1HNW B;  3HKE B;  2EIK B;  5JH7 A;  4G28 B;  3ZRS A;  5B1B C;  1ZAU A;  2Q0O C;  1FXH A;  4J80 A;  3OAA G;  1TVK B;  4X9Q A;  1I7F A;  2YDE A;  5JQG A;  1DF5 A;  1PNL A;  2IJH A;  3L72 H;  2YIB D;  2OCC C;  1FXK C;  4F6R A;  3ZRW B;  1TVK A;  3H1L H;  1Q82 W;  1NR7 A;  3DXR B;  3CRQ A;  3OTO B;  1Z5W A;  4K35 A;  2CDY A;  4DW1 A;  1BCC H;  2Z5U A;  2OTL V;  1Q81 W;  2X0L A;  3ZRW A;  4ZHQ B;  1VQ7 V;  1VMG A;  3DXR A;  1GM9 A;  3LSQ A;  4P9P A;  2VS0 A;  5B1A B;  4LF9 B;  1JFF A;  4HZ3 A;  5LP6 A;  3AG1 B;  3SYA A;  2OCH A;  1VF6 C;  3B4S A;  2AW9 A;  5EBL C;  3ZMZ A;  3ABT A;  3HKD B;  4ZHQ A;  2K9P A;  4PI0 A;  4GX5 A;  3WB0 A;  1H8E G;  1BL8 A;  5GTI Z;  1JX9 A;  4I55 B;  2IBZ H;  4KP4 A;  2QM4 A;  4QIW F;  1NH2 B;  4JZG A;  4O4J A;  2PGG A;  1CP9 A;  2QM8 A;  5LGU A;  1RM1 B;  1SES A;  3HKD A;  3LNN A;  2WLN A;  4LF4 O;  1WLE A;  4LR3 A;  1NI8 A;  4I55 A;  4H33 A;  2Y4T A;  3N27 A;  1KP3 A;  3SPC A;  1JJ2 U;  4MVS A;  3D36 A;  4XDL A;  1AI4 A;  2ZR3 A;  3BEH A;  3DGE A;  3KG2 A;  2LW1 A;  3S3W A;  2JGD B;  4PA3 A;  3OGC C;  1LUW A;  2GHY A;  1VQL V;  2OCC B;  4CS2 A;  3OTF A;  2IJK A;  2F95 B;  1JJO A;  1O9G A;  4YHH B;  3K79 A;  3MD0 A;  1XL6 A;  4DO2 A;  4GKK O;  2DYS C;  1Q8I A;  2JGD A;  5IYD O;  3OFN G;  5IWA B;  1FPO A;  1K9M W;  3ETQ A;  1U97 A;  3AG7 A;  3UO2 A;  4O2A A;  4FZ1 A;  5LYJ B;  2HJF C;  4JAV A;  4JYA O;  3G4S V;  4J11 A;  1GN6 A;  1SKV A;  3TK1 A;  2E76 B;  5EK0 A;  1N34 O;  2BE3 A;  4RWU A;  4X64 B;  1BHB A;  4WFH A;  1EZV H;  2F93 B;  1F4N A;  5LYJ A;  1VF6 A;  1Q90 D;  3WU2 Z;  3EFF K;  1G8M A;  3K06 A;  1M90 W;  5GON A;  4LWS B;  1NVP B;  2QWO B;  1FKA O;  2YXY A;  1ROP A;  1ZUQ A;  4YY3 B;  4LFB O;  4U3J B;  1XL4 A;  2HP8 A;  2Y48 A;  3ZX6 A;  2PZS A;  4NXN O;  2F23 A;  5F2V O;  5JVD A;  2DWE C;  2WPD G;  4AQY B;  1K34 A;  2PI4 A;  2UXB B;  2YXH A;  5IYZ A;  4U3J A;  1H2M A;  3BA8 A;  5BMV B;  1HNZ B;  4WFF A;  2ZXW C;  3DTU B;  3P30 A;  3OW2 U;  2EX3 A;  3FB8 C;  3AG3 C;  5L3F A;  4FIP C;  1L8D A;  4PEL A;  1XI1 A;  1VP7 A;  4DR5 O;  3RBZ A;  1K33 A;  3THO A;  3K58 A;  4UCT A;  3CC4 V;  1AP6 A;  1TGO A;  1SS3 A;  3W7T A;  2PYJ A;  1JQ0 A;  4JAU A;  3OMN B;  3ZHU A;  2L6L A;  1BGY H;  4JYB A;  3UT5 B;  2RQ6 A;  4GX2 A;  4J42 A;  4CH6 A;  1K4C C;  2HHH O;  1IUR A;  5H2F Z;  2GSM B;  2GDS A;  2BTO A;  1AP5 A;  2ADP A;  1FYJ A;  1B06 A;  4QE7 A;  1W59 A;  3OR6 C;  2DMX A;  2IM9 A;  2FL4 A;  4GX1 A;  4MVR A;  1ZL8 B;  1AI6 A;  5EBW C;  3CD6 V;  2OYQ A;  2PY5 A;  4I7Z B;  1GO3 F;  5LGT A;  2ZM6 B;  5GTH Z;  3LUT B;  1YJW V;  2XHB A;  3IAY A;  4FM1 A;  2F66 C;  1ZL8 A;  2ATK C;  3E8B A;  2DOS A;  4X1I B;  2B1G A;  3SPG A;  3CRA A;  2HHH B;  1MNG A;  2OIG A;  3VQW A;  4K3A A;  3UCS C;  2Q4P A;  1GN3 A;  4JZ2 A;  1AB3 A;  2QTO A;  4X1I A;  4E2L A;  5JWP A;  1F23 A;  2YI8 A;  1PV0 A;  2K1E A;  3UM7 A;  1JVM A;  4JI1 O;  2AXT Z;  3CHX A;  4MVQ A;  3CCM V;  3B40 A;  3OM3 B;  2EIN C;  4RAI A;  2GBO A;  4JI2 B;  1V54 B;  2HG5 C;  3RYF B;  4LH7 A;  4JI3 O;  4DV7 O;  1FXV A;  2HEP A;  4WFE A;  5LMU O;  4HYO A;  4LFA O;  3BA9 A;  3ZN0 A;  4MW8 A;  5JJN B;  2HJD A;  1Y67 A;  5DEC A;  4JYC A;  3RYF A;  1ENV A;  4JI1 B;  1H2G A;  2R70 A;  2RMK B;  3K9S A;  5LMN O;  1QVG U;  1GTO A;  1YCI A;  5LBQ A;  2VQF O;  1YDX A;  4X62 O;  4FLV A;  3KCX A;  2XOK G;  1ARO P;  4KUM A;  1XNR O;  3ZMU A;  5LMU B;  3H1I H;  5JCO C;  4FK5 C;  2P90 A;  2EZP A;  2V4D A;  1NQT A;  3OR7 C;  5FL7 G;  2KG7 B;  4L8J A;  5H5N A;  2RNB A;  5CA1 B;  4A5U B;  3RYC B;  2WLI B;  5DN6 G;  3CXH F;  4JI0 B;  2ZIN A;  2ZR2 A;  2HLD G;  5IT9 N;  1FD9 A;  3CCL V;  5LHI A;  2QKC A;  2KG7 A;  4MVM A;  5L3C A;  4DR6 B;  5CA1 A;  3SJA C;  3QG5 A;  3RYC A;  1WA8 B;  3ZMS A;  4G27 B;  4J41 A;  1RSO B;  4FLX A;  1Y76 B;  1I94 O;  4MTO A;  4J9Y B;  4I0X B;  1OCZ C;  4GKJ O;  2PYL A;  4I50 B;  4KHP O;  2VQE O;  1YHQ V;  1PL4 A;  2EIM C;  1WA8 A;  3F5W C;  1RSO A;  4D7S A;  1MAB G;  1Y76 A;  5EYP B;  4DV4 O;  1MSD A;  4I0X A;  2ZD9 A;  1YI2 V;  4JTD B;  4I50 A;  4XDK A;  2PTM A;  4O4L B;  4JI6 B;  4TV9 B;  1NTM H;  1N33 B;  3ABL B;  1AR4 A;  2XAH A;  5EYP A;  4MVU A;  1HNX B;  4WBN B;  3RFR A;  4X20 B;  1I94 B;  1DGS A;  1X59 A;  4F6E A;  2ITC C;  4O4L A;  2VQE B;  3HKC B;  4TV9 A;  2GTS A;  3K0G A;  1GKF A;  2XAF A;  4WBN A;  4X20 A;  4GUN A;  3JD2 A;  1WP7 A;  4LFC O;  2UXC O;  3W7W A;  1SQF A;  1EM1 A; 
#chains in the Genus database with same CATH homology
 1PNL A;  2IJH A;  3E35 A;  1GM7 A;  2P7T C;  3ZMT A;  1QLN A;  2LFS A;  4BIZ A;  2Y69 C;  5CBH A;  2OCC C;  1FXK C;  4J9Z B;  4Q20 A;  3ZRW B;  1H38 A;  3K9A A;  1Q82 W;  1NR7 A;  2DQ0 A;  4MTF A;  4TWK A;  3CCE V;  4WFA V;  3MHS C;  1NBM G;  1CEZ A;  2X7R B;  1SER A;  1YIT V;  4QE9 A;  3P32 A;  3D3I A;  4XBF A;  2EBO A;  1LNQ A;  1RPO A;  3STL C;  3SYC A;  2R9I A;  2Z5U A;  2HKO A;  1VQ8 V;  1Q81 W;  2OTL V;  3ABK B;  2X0L A;  1E1Q G;  3ZRW A;  3FKS G;  2M7W A;  3LDE A;  3OEE G;  1VQ7 V;  2HVK C;  1GM9 A;  1PKX A;  3LSQ A;  5CBF A;  4P9P A;  3OMI B;  4UVB A;  5B3S B;  3HB3 B;  5B1A B;  4UVC A;  3CME V;  4HZ3 A;  3AG1 B;  2C2A A;  3SYA A;  5L3G A;  1K8A W;  3E2E A;  1CPY A;  5EBL C;  3ZMZ A;  3ABT A;  5CN0 A;  2Z3Y A;  3ABM C;  1AJP A;  4RUE A;  1DTO A;  3A0R A;  4GX5 A;  1H8E G;  1BL8 A;  1OCO B;  2IH1 C;  1JX9 A;  1YTF D;  3JD1 A;  3ZJZ A;  1GM8 A;  4KP4 A;  1NH2 B;  4QIW F;  3JD4 A;  1CP9 A;  2QM8 A;  4Z1M G;  5LGU A;  1R3K C;  1ZWI C;  3ZN1 A;  1RM1 B;  2IW5 A;  4UUJ C;  1SES A;  1K7D A;  4P30 A;  2JJ1 G;  2WLN A;  1WLE A;  3E86 A;  2WLL B;  2QEX V;  3ABU A;  1M57 C;  1QR8 A;  4PA7 A;  4WF9 V;  2EIN B;  4WFB V;  3B8N A;  4H33 A;  1F4M A;  3BY6 A;  3ETD A;  4F4L A;  1V54 C;  1KP3 A;  3SPC A;  1GK9 A;  1JJ2 U;  2IJJ A;  2QKS A;  1NJI W;  3E89 A;  4MVS A;  2X6C A;  3D36 A;  3AEI A;  1AI4 A;  4XDL A;  3SPH A;  1K97 A;  2ZR3 A;  3BEH A;  3OUS A;  3DGE A;  3KG2 A;  5CMU A;  3LDC A;  1OHH G;  2JEX A;  3B77 A;  1SZT A;  2MK3 A;  3SJQ C;  1G4Y B;  4MVZ A;  1YJN V;  4PA3 A;  3OGC C;  2PI5 A;  2GHY A;  1VQL V;  2OCC B;  4BW5 A;  4UV8 A;  2IJK A;  4ZKI A;  2OTJ V;  2WLH A;  1I5X A;  4PDV A;  4QNH B;  1W2B U;  1OCR B;  3K79 A;  1TUE B;  3MD0 A;  1XL6 A;  3M99 B;  4GCZ A;  4DO2 A;  2EIJ C;  2DYS C;  3OUF A;  1AR1 B;  4JTC B;  1VQO V;  2Q68 A;  5IYD O;  4UXN A;  5E1A C;  3G71 V;  2YEV B;  4BIU A;  1E1R G;  3OFN G;  5IY5 B;  1QLE C;  1H8H G;  2W6I G;  1EBO A;  1K9M W;  4MW3 A;  1K5Q A;  3QO5 A;  3AG2 C;  4OXS A;  5IYB O;  3K08 A;  2BOB C;  3B8M A;  2HJF C;  4JAV A;  1M56 C;  1YSC A;  1S76 D;  4TSF G;  3G4S V;  3CCQ V;  3ABM B;  1V55 B;  3TK1 A;  1QCE A;  5EK0 A;  4N23 A;  4QPJ A;  3G6E V;  1BHB A;  4WFH A;  3I56 V;  1F4N A;  3R65 A;  1KC8 W;  1DF4 A;  3QO8 A;  2AHZ A;  3EFF K;  1G8M A;  2P6J A;  3K06 A;  5LGN A;  1K73 W;  5EC2 C;  4R6Z A;  2FTK A;  1M90 W;  3OE7 G;  1GMG A;  4JAS A;  3W7X A;  1NVP B;  3JD3 A;  2ZQM A;  2V7Q G;  2YSU B;  2JDI G;  1NR1 A;  1ROP A;  3E83 A;  3IC7 A;  3QNE A;  1XL4 A;  2DYR B;  2H94 A;  2P67 A;  2Y48 A;  3CMA V;  1VQ6 V;  1OCZ B;  2DWE C;  2WPD G;  3ASN C;  1K34 A;  3ETE A;  2PI4 A;  3E8H A;  2LP7 A;  4QJF B;  3T4D A;  4JF3 A;  2EIM B;  3CC7 V;  3FYE B;  4WCE V;  5B1N A;  1Y4M A;  1QVF U;  4WFF A;  4MSW C;  2ZXW C;  3ASO C;  3DTU B;  3P30 A;  2NLJ C;  3X2Q C;  3K3W A;  3OW2 U;  4GT1 A;  3FB8 C;  3AG3 C;  3ZCC A;  3H01 A;  4U7O A;  4FIP C;  3ZMV A;  5L3F A;  3FYI B;  2HVJ C;  5KUM A;  4PEL A;  1K3E A;  3IFX A;  3ABL C;  4WFG A;  2QA4 V;  3RBZ A;  3ZRX A;  1K33 A;  1AI7 A;  3OEH G;  3ETG A;  1S3J A;  3CC4 V;  4JPR A;  3VBB A;  1B6Q A;  5LHG A;  1PNK A;  1QR9 A;  5KUK A;  1YIJ V;  4JTA B;  3W7T A;  1I5Y A;  3EHB B;  3RVY A;  3E8F A;  1S77 D;  3AG4 B;  4PDM A;  1K4D C;  1JQ0 A;  3WG7 B;  1YJ9 V;  1R6N A;  4JAU A;  2EIK C;  3OMN B;  4L87 A;  5B1B B;  1KQS U;  4U7N A;  2DW4 A;  2B1I A;  3JYC A;  4JYB A;  2DQ3 A;  2A9H A;  1W0K G;  4GX2 A;  5L3D A;  2WLM A;  1S72 V;  1K92 A;  4LBE C;  3TCU A;  1M1K W;  5H6R A;  5KA5 A;  2W0F C;  4R8C A;  1K4C C;  2XAQ A;  2EJR A;  3K04 A;  2GSM B;  2HR3 A;  4QE7 A;  2Y69 B;  4PA6 A;  3OR6 C;  1FXK B;  2WLI A;  3F7V C;  4GX1 A;  4MVR A;  2IJI A;  3ZIA G;  1AJN A;  1AI6 A;  2D3O W;  5EBW C;  3SPJ A;  3CD6 V;  1KKD A;  4MT8 A;  2ZDI C;  4PDR A;  1GO3 F;  2IU0 A;  1OZ0 A;  3K0D A;  1P7B A;  5LGT A;  1Q86 W;  3JD0 A;  2BOC C;  3LUT B;  3CCU V;  1YJW V;  5BZB A;  3F7Y C;  4PA4 A;  1YTF B;  1FXK A;  1Q7Y W;  3I55 V;  1ORQ C;  2ATK C;  3E8B A;  3CPW U;  1E79 G;  2A0L A;  1MG1 A;  1FFT B;  1PL0 A;  2B1G A;  5B1A C;  5B3S C;  3SPG A;  3SYO A;  3JCZ A;  3K03 A;  3T2M A;  3CXC U;  3AG1 C;  2WLJ A;  5CA3 A;  3QO7 A;  2JIZ G;  1VQN V;  1R3I C;  1BHA A;  1JPX A;  1PD3 A;  2QTO A;  4KFM A;  1OCO C;  4E2L A;  1VQK V;  3ZRV A;  1F23 A;  3CCV V;  1VQ4 V;  1J95 A;  4I9W A;  4LC1 A;  2K1E A;  1Y66 A;  1JVM A;  4UV9 A;  3UM7 A;  2QM7 A;  5L3B A;  1UJW B;  2XAG A;  1RM1 C;  2UXN A;  5CBG A;  4P9O A;  3PJS K;  2IU3 A;  2WSS G;  2XND G;  4MVQ A;  3CCM V;  1N8R W;  2DWD C;  3OM3 B;  3CCS V;  1W0J G;  1M57 B;  2EIN C;  2Q6A A;  4QPK A;  2WAM A;  4RAI A;  1OCC C;  1QBZ A;  2OT5 A;  1V54 B;  2HG5 C;  2WWW A;  2XAS A;  1NH2 D;  4RQF A;  1M9N A;  1MSW D;  3CCJ V;  1COW G;  1IXM A;  1FXV A;  4WFE A;  3ML0 A;  4HYO A;  3FB5 C;  4X88 A;  2ITD C;  2CK3 G;  4P2Z A;  3ZN0 A;  2W6J G;  2QE7 G;  4MW8 A;  4I5S A;  3NXS A;  4ZBM A;  1DF5 A;  4PDL A;  3LDD A;  3MHH C;  3UKM A;  4JYC A;  2JEU A;  1ENV A;  1H2G A;  1OCR C;  3E8G A;  4R50 A;  4XDJ A;  4RUF A;  2EIL C;  2EIJ B;  4PA9 A;  2DYS B;  2Q69 A;  1VQ9 V;  2Q67 A;  2LFR A;  1QVG U;  1GTO A;  5B1O A;  5L3E A;  5LBQ A;  5LHH A;  3WFV A;  1P4R A;  3W7U A;  4ASU G;  5C93 A;  2JJ2 G;  5IY5 C;  4CZZ A;  4H37 A;  2XOK G;  1NKD A;  1QLE B;  3RVZ A;  1ARO P;  2ZDI A;  4FPP A;  4KUM A;  2F43 G;  3AG2 B;  3ZMU A;  3CC2 V;  1BMF G;  4YXW G;  1S5H C;  3FB7 C;  4FK5 C;  5HFM A;  1M56 B;  2P90 A;  1V55 C;  3HPL C;  2EZP A;  1R3J C;  3CP1 A;  1NQT A;  3OR7 C;  4RQE A;  5FL7 G;  2EZO A;  1VQP V;  3LNM B;  4X8A A;  3IGA C;  2WLI B;  5DN6 G;  5EC1 C;  5H6Q A;  2ZR2 A;  3T4Z A;  2B5U A;  2HLD G;  4LP8 A;  3CCL V;  4JGS A;  4FMT A;  5LHI A;  2NNU A;  1VQ5 V;  1S0V A;  1EFR G;  1JCH A;  4FJC C;  1SRY A;  3TET A;  3STZ C;  4MVM A;  5L3C A;  5KA6 A;  1R73 A;  4LCU C;  1THZ A;  5EBM C;  4MTG A;  3ZMS A;  1OCC B;  4G27 B;  1KD1 W;  1SET A;  4MS2 A;  5J9P C;  5HFL A;  2DYR C;  4R7C A;  4MTO A;  4HAM A;  4J9Y B;  1OCZ C;  4N21 A;  2AHY A;  2WLL A;  3ASN B;  1L1F A;  3ABK C;  1JOY A;  3LSS A;  1AJQ A;  2UXX A;  1YHQ V;  4EKW A;  2EIM C;  1FS0 G;  1KEC A;  3F5W C;  1MAB G;  1NVP D;  3CYO A;  2R9R B;  4UVA A;  4TT3 G;  4MTX A;  2ZXW B;  3ASO B;  5GW7 A;  2ZD9 A;  3W7S A;  3X2Q B;  3T1C A;  5IYC O;  1EZJ A;  1YI2 V;  4JTD B;  3AG3 B;  3SPI A;  4XDK A;  1R6K A;  5IDJ A;  4X89 A;  2EIL B;  4MVO A;  2JK5 C;  1MOF A;  2A79 B;  2KB1 A;  4BAY A;  5DM6 V;  1R3L C;  2V1D A;  3RW0 A;  2IH3 C;  3ABL B;  2H8P C;  3FB6 C;  1K5S A;  1PNM A;  2XAH A;  4MVU A;  4GX0 A;  3OMA B;  3CCR V;  1HWY A;  3GWO A;  1DLB A;  1AI5 A;  2HFE C;  2ITC C;  3SYP A;  3VOU A;  4CBC A;  2X6B A;  3AG4 C;  3SYQ A;  1VQM V;  3WG7 C;  2XAJ A;  1KP2 A;  2YEV A;  3K0G A;  2EIK B;  1GKF A;  5H9C A;  4G28 B;  1WPX A;  2XAF A;  3ZRS A;  5B1B C;  3GB7 C;  3JD2 A;  2X6A A;  4G2K A;  1FXH A;  1F51 A;  3OAA G;  3W7W A;  4RO2 A;  2WLK A;  4DXW A;  1RPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...