3UKMA

Crystal structure of the human two pore domain potassium ion channel k2p1 (twik-1)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
252
Chain Sequence
NSATMFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Potassium channel subfamily K member 1
publication title Crystal structure of the human two-pore domain potassium channel K2P1.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 252
sequence length 264
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ukmA01
2BOBC 5CBHA 4X89A 1R3IC 3RBZA 5IY5C 4HYOA 3AG4C 4H33A 3T1CA 3F5WC 1S5HC 2W0FC 5EC2C 3E83A 2BOCC 1OCRC 2X6AA 2HJFC 2WLLA 4PDMA 4MVZA 3T4ZA 4GX1A 2HFEC 1ORQC 1QLEC 3SPGA 4ZBMA 2EINC 2EIKC 2HVKC 3FB8C 2A79B 3OUFA 2ZXWC 3IFXA 3E8BA 1G4YB 4GX2A 3RVZA 3SYCA 3TETA 3LDDA 3ZJZA 3AG1C 1R3KC 3T4DA 2A0LA 4WFGA 5EC1C 2HVJC 1XL6A 3LNMB 4G27B 4R7CA 2YEVA 4MTGA 3SJQC 4R50A 2DYSC 3AG3C 2A9HA 4X8AA 3K06A 3ABLC 1M57C 2ITDC 4WFEA 2QTOA 3FB5C 3E8FA 5E1AC 2WLNA 3SYQA 2HG5C 2R9RB 3BEHA 2X6CA 4MW3A 2X6BA 3WG7C 4MVRA 4LCUC 4XDLA 3K0DA 2Y69C 4PDVA 2AHYA 2WLKA 4LP8A 5CBFA 4H37A 2Q6AA 2H8PC 4MVSA 4MW8A 4RUEA 4MTOA 4QE9A 4RAIA 2IH1C 1P7BA 2EILC 4JTDB 2ATKC 4LBEC 4MVUA 4PA6A 4F4LA 3STZC 3OR6C 3K08A 4PDLA 4QE7A 3PJSK 4EKWA 4GX0A 4PA9A 4J9YB 1XL4A 3JYCA 2WLJA 2OCCC 2QKSA 5KUKA 3SYPA 3ZRSA 4JTCB 4X88A 3HPLC 1JVMA 2K1EA 3KG2A 1K4CC 3RVYA 3SPJA 4BW5A 2IH3C 3SYAA 2WLMA 5EBMC 3E86A 4MS2A 5BZBA 4JTAB 4XDKA 3F7YC 4RUFA 3AG2C 5EBWC 3T2MA 2ZD9A 4MVMA 1OCCC 1OCZC 1R3JC 4PA3A 4PA7A 5B3SC 4PA4A 2JK5C 4MVQA 5EK0A 4DXWA 5J9PC 1V55C 2Q69A 5EBLC 5KUMA 3LDCA 2P7TC 4P9PA 3UM7A 2KB1A 4P9OA 4I9WA 3FB7C 4J9ZB 2NLJC 5B1AC 1BL8A 3K04A 3SPHA 4WFFA 4OXSA 3UKMA 3SPIA 3OUSA 3STLC 2DWEC 3E89A 1ZWIC 3TCUA 3ASNC 2Q68A 3IGAC 3E8GA 1KKDA 4QNHB 3OGCC 3ASOC 4WFHA 3ABKC 2WLLB 4PDRA 1R3LC 4GX5A 1LNQA 4UUJC 5CBGA 2WLIB 2WLIA 1V54C 3ABMC 5B1BC 2Q67A 3EFFK 3FB6C 3RW0A 3R65A 4R6ZA 4CBCA 4R8CA 2EIJC 2DWDC 2AHZA 1J95A 3OR7C 3SPCA 4MVOA 3LDEA 4G28B 4KFMA 3K03A 1OCOC 4P30A 3GB7C 4MTFA 3LUTB 2DYRC 2ITCC 3VOUA 4P2ZA 1M56C 4HZ3A 2EIMC 3SYOA 4TWKA 3F7VC 2WLHA 1K4DC 3X2QC 4XDJA 4MSWC 3K0GA 4RO2A 3E8HA
chains in the Genus database with same CATH superfamily
2CK3G 4X89A 1NR7A 1XOUA 4B7EA 2JGDA 3C3TA 3T1HB 2EIMB 2QGNA 3S3WA 2F93B 3SPGA 1QLEC 3UT5B 3B77A 3OUFA 2PI5A 1I0HA 1S3JA 1VQ5V 2LJ2A 3T4DA 1SQQH 1VMGA 2R9IA 5JCOC 4B08A 4AHCA 4NTXA 3SGIA 1AR5A 1DF4A 4DV1B 2ILMA 2Q8VA 2XASA 2QTOA 4DUYO 5JCOA 5LOVB 1VEWA 4FLUA 3K3WA 4CS2A 3ZRWA 2B9ZA 4X20A 1W59A 1R73A 1K92A 5CBFA 3JSLA 4H0LB 4CH4A 2HHHB 3Q4HB 1IBMB 2IH1C 4TUYB 1IXMA 1VQNV 3NXSA 4L8JA 3CCRV 1L1FA 1OJHA 4UCSA 2L35A 2RMKB 1MA1A 4K3AA 2UUCO 4N23A 2XHBA 3FAVB 5EBLC 2ADQB 1E79G 3WG7B 2GUZA 2W0XA 5H5NA 1VQ4V 2P06A 2CGNA 4LFAO 2XNDG 1P84F 3E8GA 2G38A 3HR0A 1GK9A 4IT5A 3PN1A 2DWDC 4GCZA 4MVOA 1IVSA 4KFMA 3O9OA 4JF3A 5EZYB 1UPGA 5JQGA 3K5MA 3OTOB 4AQYB 3ABMB 1WA8A 4JI1O 4LC1A 1XI1A 1SQGA 4MSWC 4HZ3A 5EIBD 1HNXO 4CH6A 2OIGA 3H1LH 5IYCO 3RBZA 5GTHZ 2BCCH 1I5YA 2ZDIA 5B1NA 2A3QA 3C90A 1PD3A 1FS0G 1SA0A 2HFEC 2BSKB 1WLEA 1TUBB 2WPDG 5FNVA 4FLYA 2EZOA 1NH2D 4JI5O 2WSSG 4HNAB 1ZL8B 1N32B 1OV9A 5C8YA 4O4HB 5IJ9B 1W2BU 3WG7C 2VQFO 1AROP 1US6A 5LHIA 1TVKB 4CC5A 1H2MA 5LGUA 3CCLV 1S5LZ 1GRJA 4JTDB 3K5LA 4KL1A 1YJ9V 2X7RB 1WNSA 3JARA 2QKSA 1VQ9V 2N74A 3TXQA 4DV6B 1JVMA 3SPJA 3N2KB 2O57A 5KX5B 1VQMV 2FYUH 3ABLB 1YEWA 1URFA 1JQ0A 3QVNA 1A32A 4B7KA 1FJGO 3RYFB 4CC6A 5L3CA 2M6YA 3CB2A 2FKXA 3ZMUA 2VQEO 2YXHA 3RYCB 1ROPA 3R66A 1BQ0A 2UXNA 1K5QA 4Z1VA 4K8XA 3K58A 4HAMA 4B3SO 2DOSA 2IJKA 4R6ZA 3D36C 2YIBD 1Y74A 4DUYB 1THZA 3GB7C 3T1YO 3ZHRA 4TSFG 3FX7A 1YJWV 1SQPH 1H8EG 5B1AB 2DYRB 3ZN0A 4UV9A 3H1KH 4IGGA 4FMTA 4PDMA 1NTMH 1JMKC 1Z2GA 4DYLA 3B40A 1QQCA 3AG4B 4J9ZB 2GV9A 5H6QA 1YSCA 3LDDA 3DSQA 5L3DA 1JOYA 2QTSA 1R3KC 2N04A 4JI0O 5B1OA 3OFNG 2QR4A 3K5NA 1B06A 1N0NA 3JSNA 3ABLC 3KCYA 1E1RG 2Z3YA 1VIBA 1AP6A 5IE9A 1VQPV 2R9RB 3CC2V 1SS3A 3D8CA 2P90A 4MW3A 4LCUC 4FFBA 3QO5A 1OHHG 4X1YB 4UCVA 5B66Z 3ZX6A 1BHAA 5EIBC 4I50B 5KLVH 3KKYA 4NVPA 1Q6IA 2DE0X 2EILC 5LYJB 4PA6A 5H6RA 4JI8O 1ZX3A 2MK3A 2V7QG 2PYJA 3K9AA 1GKFA 1Y76B 2HEPA 1QBZA 4QGPA 2EJ7A 1QVFU 4TV9A 3F7YC 5JVDB 4F6EA 4J41A 4PA3A 5C93A 2LFSA 4PA7A 1HNXB 5KUMA 3APOA 5B1AC 1Q90D 3L72H 4FLVA 4O4IB 1AJQA 1XDCA 1HDJA 2YIAA 1XNRO 4O2AB 4U3FH 2LGWA 5CA0A 5J2TA 4IL6Z 4PDRA 1LNQA 3OD4A 1BSMA 2IBZH 4JI5B 4JI2B 2Q67A 3OE7G 4ZOLA 3LDEA 2GHYA 5GW7A 1SKVA 3LUTB 1YF2A 2VQFB 2OWOA 2FB5A 4X65B 3X2QC 1YITV 2BOBC 1G8MA 1SZTA 4UCRA 4B3RB 3HKBB 1IBKO 3ASNB 4GX2A 1GMGA 1KYOF 3OAAG 1BZKA 4H44B 3AG1C 1GN6A 4TOIA 4MTXA 2JEUA 4X8AA 4I9QA 2Q5ZA 3JALB 3QF7A 2DJVA 1BHBA 4DV0O 1FJGB 2NN4A 4FPPA 4WBNB 2XAGA 1Q81W 2WLKA 2OYQA 5JH7B 4XBFA 3ETGA 2QWNB 1NI8A 4BIZA 2YIBA 2VQEB 4UVCA 1BE3H 1TUEB 1FXVA 4NYKA 4PJ0Z 4D7TA 5J2UB 4O4JA 3BRCA 5LP6B 4LFCO 2IH3C 3JAKA 1IDSA 1HNZO 1IZ3A 1VF6C 1XHXA 5FPOA 3T1YB 2GDSA 3THOA 4DR5B 1R3JC 5CN0A 3A2FA 5J9PC 2CH7A 4DV7O 2UU9O 3G6BA 3RYIA 3FB7C 1VF6A 2AZ2A 3SPHA 3T1HO 1NVPD 4K35A 3MHHC 3OUSA 1GN2A 2Y0PA 3H1JH 1EN5A 3ASNC 1YTFB 3N2GB 2ZE5A 5IJ0A 5KHJA 4DV1O 2YXLA 1XMOB 2QWQB 1YCIA 1NBMG 1NZ6A 1R6KA 1OCOC 3TGUH 3CD6V 5B1BB 4TWKA 1SQFA 3K0GA 2ZKOA 4DRXA 1L0LH 5CBHA 1XQ8A 4FK5C 4YXWG 3K59A 4D6TH 2E5LB 5EC2C 2WLLA 4PV1B 4MVZA 4X62O 1XNQO 2EINC 3DXRB 2GTSA 3SYCA 3FD9A 5LP6C 5LHGA 4LF4O 1D5AA 1XBLA 5L3GA 3UO2A 3SDLA 1VQ8V 2QDOA 3K06A 2V1DA 3KCXA 1J5EO 2HJDA 2VWKA 5D5PA 5FL7G 1FFXB 3CMEV 2X6BA 1FKAO 4IHJA 2PY5A 1MSDA 4H13B 3B4SA 4IYIA 4MVSA 2H8PC 1XNRB 2RN9A 2Y69B 4EFBA 3CPWU 3VBBA 1PPJH 2ADPA 2P22C 4LWSA 5KUKA 3BPZA 1FAFA 4BW5A 2OIEA 3SYAA 4I5SA 4JPRA 4DR2O 3E86A 3OTOO 3HKDA 4FIPC 4IIJA 3FFQA 4KXRA 3CJHB 2Y0IA 1QR9A 2DN9A 3ZMSA 3BA8A 2HP8A 3E35A 4X1KB 3VQXA 4I9WA 2V4DA 4O2BB 3UKMA 1I7FA 2QSAA 4I7ZB 4I0XA 2DWEC 1WP8A 1IBKB 1FXKC 1MNGA 1ZWIC 3BAAA 1NU1H 2JGDB 4E4EA 4WFHA 3ABKC 1IX9A 1VARA 2E76B 2WLIA 1Q6HA 3JAWA 1FXKA 2RDCA 3FB6C 3K57A 4C7UA 1N32O 4CBCA 4Q20A 4F6RB 1QLNA 2H3OA 2YDEA 2IJHA 1BMFG 1NS1A 4Z1MG 1P7GA 4OX9O 4YJ3A 1RSOA 4J10A 3G6EV 3E83A 3HKCB 3ZRWB 4X20B 2JJ2G 1DTOA 3JASA 3AEIA 2A79B 3JD3A 4JI3O 3ZMZA 5DM6V 3OGIB 3TETA 4AI8A 2HVJC 3LNMB 2YEVB 1QVGU 1WB8A 1HNZB 3OEHG 3CRRA 1M57C 2ITDC 3CCMV 4PI0A 3E8FA 4JI7O 3ZEDA 3CCUV 2YI9A 4DV7B 2UU9B 3A0RA 4JYAB 3ZRXA 4PD4F 2Q73A 4JAUA 1P7BA 5B5EZ 3BVOA 4F4LA 2F4VB 4B3MB 1YIJV 1F23A 4WFBV 3I5DA 4JTCB 1CPYA 4JI6O 2CAZC 3CCSV 3ABTA 3WU2Z 2W6IG 4G2KA 4CZZA 5IDJA 5GTIZ 3OEEG 2LP7A 1EZJA 4MVMA 3RN4A 4E2LA 1K8AW 3CP1A 2YXYA 5KAIZ 4GKJO 3ZHQA 4P9PA 1IBLB 2KB1A 1M9NA 5LMUO 1I5XA 1TA8A 3SPIA 1VF5B 4J80A 4X62B 3W7SA 1XNQB 2Q68A 4X1IB 4I55B 2N05A 4LF4B 4FVMA 5CBGA 1K97A 1K9MW 1J5EB 2WA4A 2P5OA 4U3JA 1B3QA 2KQXA 2IU0A 2EIMC 5LGNA 1KP2A 2UUAO 3B8MA 2XAHA 1GO3F 4KHPO 3G4SV 3IC9A 1IXBA 4ZHQB 2M7WA 2ZQMA 3UT5A 4GLXA 2UXXA 1WJZA 4R50A 4DR2B 1XUQA 4RWUA 3QO8A 4QJFB 1UFIA 2OT5A 2HG5C 1K34A 3AK1A 1MZEA 5LOVA 4TQFA 1N33O 4PI2A 3HKEB 4NXMB 3MHSC 2XTAA 5GONB 1RFYA 2QWPB 4MTOA 3Q4HA 4WF9V 4TUYA 5A2QN 3BY6A 5BMVB 5LA6B 4JI2O 4JAAA 4OPAA 3LSUA 5EYPB 4U7OA 1SC5B 1SQBH 2LQTA 1N4CA 4XDKA 3T2MA 4X65O 1YZBA 2LGQA 4LF6O 5LBQA 1P49A 5LXTB 4OX9B 2Q69A 1MSWD 3FAVA 1FFTB 1D2DA 2KKWA 2VRZA 4WFFA 4B3RO 1NJIW 5KHIA 3CCQV 1V55B 3TCUA 4JI3B 3SR2C 4LF9B 3LNNA 2QKCA 3MDSA 3CX5F 3ABMC 4KP4A 2KG7B 2HR3A 3ETQA 4L87A 4JI7B 2FMLA 5EZYA 1CEZA 3JD2A 2YIDA 4OGQB 3CS5A 1QR8A 3A8TA 2ODMA 1R3IC 3OT7A 4H33A 1EM1A 3CRAA 2JGUA 4DR4O 1GN3A 1M56B 1I08A 1DGSA 3P30A 5LMNO 3TJTA 1FXHA 2BSKA 4ZBMA 3RVZA 4NTWA 1TUBA 4JI6B 2ZE7A 1MG1A 3ASOB 1RPRA 4MTGA 2QKAA 2JJ1G 4DR5O 1IURA 1XHZA 4HNAA 1P4RA 2EX3A 1ZL8A 4BW9A 3D36A 3EHBB 2D2CB 4O4HA 5IJ9A 3M7MX 4GKJB 4XDLA 2BTQB 2DYSB 5LMUB 1JFFA 1TVKA 4YIPA 2YSUB 4RUEA 1SF9A 1GM7A 5ITZB 3MD0A 3CCVV 4I4TB 1XMOO 2WLJA 2OTJV 4NR1A 4FLWA 1M93A 3WFVA 2OTLV 1NR1A 3IC7A 3N2KA 5KX5A 1R6NA 5BZBA 4LH6A 5CA1B 4K0KO 1Z5WA 4DW0A 5CMUA 3B09A 3CRCA 4LFBO 2E5LO 1LUVA 1M1KW 2UUAB 4P9OA 1BL8A 1K33A 2DQ0A 1KMIZ 4FFKA 4KHPB 1QCEA 3RYCA 4FZ0A 3RGBA 3IGAC 3ASOC 4JYCA 4JV5B 2VS0A 2XAQA 1HP8A 5KA6A 3SPCA 3AG7A 1LR1A 2C2AA 2DYRC 4KUMA 1N33B 2ZNJA 1S0VA 4RO2A 4LNUB 3OM3B 4LF8B 4JYYA 4WCEV 3AG4C 1S5HC 1TAEA 2BOCC 5CB4B 2IJIA 1ORQC 5BR8O 3ML0A 3P3PA 5IY5B 2HVKC 4ZKIA 1G4YB 3FYEB 5BY1A 1H8HG 4YY3O 1U97A 4ZIBA 1UJWB 4WFEA 4LF6B 1SRYA 4J7KA 4ICGA 2Q0AA 3ZS8C 5KMGB 1YTFD 3RYHB 2Q9LA 3VQWA 2IJJA 2YI8A 4X1YA 4TV8B 3H9VA 2QWRB 1VQKV 2Q6AA 4I50A 5L3BA 5LYJA 3TK1A 3STZC 4OPHA 4QE7A 3H1IH 2PZSA 5DEDA 3SYPA 1Y76A 1K4CC 2Q7GA 3U10A 3RVYA 2UUBO 4MS2A 5EBWC 1HW7A 5JVDA 4BIUA 1ZAUA 5L3FA 2A06H 4QIWF 4DR4B 4O4IA 1FD9A 5LMNB 2QEXV 4N21A 3N27A 4O2AA 2H94A 2WLLB 1AR4A 1R3LC 3P32A 2ZM6O 2DW4A 3P3NA 1H38A 4JASA 3ZHVA 3EFFK 3L9DA 1R6TA 1CXZB 3IJ4A 4AILC 4YJ2B 3GWKC 3LSSA 2Q0OC 4GT1A 2Q4PA 3SYOA 4JYAO 5B3SB 2P67A 4GKKB 1I94B 3JATB 1YXBA 1VQLV 3E22B 4DV5B 2EJRA 2F4VO 4B3MO 2X6AA 2HJFC 3HKBA 4GX1A 3L73H 1XEQA 1WP7A 1S5JA 4DR1B 1H2KA 2A0LA 3G80A 1XREA 3SJQC 5IWAB 5IYDO 2EIKB 3JALA 4K0KB 3ZMVA 1H2NA 3CRQA 3HB3B 2RNBA 2WLNA 5KHKA 1N34O 3CWBH 1IBLO 4LFBB 3OMAB 4NXNO 1H2LA 5JJNB 1K7DA 5JJEB 2XAJA 4LF7O 4DK0A 5JH7A 2A7WA 4LH7A 4MW8A 4ZI7B 4RAIA 4EB6B 1Q43A 4PA9A 1WPBA 2ZXWB 2UXBO 1NT2B 5J2UA 5LP6A 3SJCC 3VQYA 3W7WA 1ZUQA 3G71V 2AW9A 3FYIB 1HR0O 1W0JG 1ZTEA 5B3SC 3JD0A 2CTPA 1R1BA 3LDCA 4DV4O 1RM1B 4Z2WA 3AG2B 3CC7V 4DR6O 1H2GA 2PGGA 1GH6A 1NKDA 2Z0AA 1KC8W 2GSMB 2FL4A 1ZSPA 5BR8B 3OW2U 1AP5A 5IYZB 4QNHB 3N2GA 4GZRB 4TQDA 2IM9A 5LL6Y 3VQVA 5B1BC 3CCEV 1Q7YW 4YY3B 3RW0A 4O4LA 4R8CA 3L75H 4QPKA 2R70A 4UFZA 2ITCC 4NXMO 1V54B 4P2ZA 1F51A 1KU9A 2EIJB 4RQEA 3E8HA 4HYOA 1Y6XA 2PI4A 4FM2A 2XAFA 2CTQA 2NR5A 2ZXWC 3IFXA 5JJJB 3DXRA 5K1PA 4DUZB 3CHXA 1AI5A 1YJNV 1XL6A 5LHHA 2UUBB 1GAXA 2K9PA 2KSDA 4EEQA 2ZCEA 2JS5A 3U0ZA 1FFXA 1RM1C 3K0DA 2Y69C 1U96A 1K5SA 2AZ0A 3ZN1A 4LP8A 1G6UA 1E1QG 3K9SA 4W4KA 2QJ1A 4LF9O 4QE9A 4LBEC 4PELA 2JVDA 2WWWA 3GVMA 4EKWA 3ZCCA 3L71H 4DW1A 2ZM6B 1DF5A 1KP3A 3BA9A 3KG2A 4J7ZA 3CJHA 3UO3A 3QNEA 2EZPA 3ETEA 2P7TC 4X1KA 1D5NA 1BGYH 2EULA 2NLJC 1YDXA 2GUZB 4O2BA 4OXSA 3CEIA 1N36B 3WB1A 1PM9A 1KKDA 1XMQO 3WB2A 1JA8A 1O9GA 4BIOA 3OR7C 1M5IA 4G28B 1N34B 2B5UA 4F6RA 4FM0A 5JQGB 3LSQA 4IYHA 2ETNA 3DTUB 2ZR3A 1WA8B 4NXNB 1OCZB 1K4DC 1COWG 4LF7B 4CS3A 2EBOA 4FM1A 3KZIZ 4DR7O 3CXCU 3T1CA 4B3TB 3ZIAG 1AB3A 3HKCA 1SQVH 2Z5UA 1SA0B 3RFRA 3FB8C 1EFRG 1MMMA 2WA3A 2UXBB 2Q7EA 2YC0A 5FNVB 1BS3A 4WFGA 2ARHA 4J11A 2YEVA 2A9HA 3W7UA 1HR0B 2JDIG 1AR1B 5C8YB 4UCOA 1EN4A 2X6CA 2VWJA 4MT8A 4DV4B 4JZGA 4DR6B 1OZ0A 4UXNA 2XT9A 1JCHA 4JV5O 3OR6C 4PDLA 3CE2A 1XL4A 3JARB 3JYCA 3ZRSA 1PNMA 4X64B 4FZ1A 3L74H 3J80N 3ZHUA 1N0JA 1VQOV 1WN7A 2LW7A 1KECA 3ZHSA 3QO7A 5IYBO 4U7NA 1OCZC 3QG5A 1JPXA 1S76D 1MZFA 2IU3A 4LF8O 2JK5C 2X0LA 3EVKA 1FPOA 3W7TA 4A5UB 3ZBHA 4DV3O 2ZDIC 2ZINA 5KHGA 4FLTA 1O9HA 3OTFA 1MABG 5H9CA 2P4VA 4X1IA 4DO2A 3BCCH 4I55A 4JZ2A 5HFLA 2GBOA 1LUWA 3O65A 2QE7G 3R65A 4PHZA 2AHZA 3CC4V 2ZNIA 1Y74B 5BXZA 3D3QA 2CDYA 5JWPA 4JYBA 2B1GA 2E74B 3A0HZ 1OCCB 1F7YA 4X9QA 2WLHA 1JX9A 1WAZA 1Y4MA 2Y4UA 5TISZ 1JFFB 1BCCH 1PL4A 3APQA 4JI4O 1KUQA 3T4ZA 4ZHQA 3NR7A 3U11A 1PNLA 5FLXN 3A0BZ 1K73W 4R7CA 1KQSU 2Y48A 1AI6A 2D3OW 4X66O 5DECA 1GM9A 3SYQA 2ZR2A 4FFBB 3RT3C 1HNWO 3HKEA 4CH5A 5GONA 4DR3O 5AG2A 2Q7HA 4H37A 5CA3A 3CYOA 3UCSC 2ATKC 2UXCO 4MVUA 3I55V 3CSXA 1XMQB 1OCRB 2CTRA 1EN6A 3PJSK 4J9YB 5BMVA 2L6LA 4FJCC 1F4NA 5LA6A 1KBHA 1WB7A 5HFMA 3HPLC 2EILB 5EYPA 4DV2O 4TV9B 2WAMA 3AG3B 4RUFA 1PKXA 4LF5O 3TXSA 1OCCC 3QTCA 4K8ZA 4PA4A 4DXWA 4GKKO 5KHHA 5LXTA 3S3XA 1I94O 1V55C 1VP7A 2UXDO 2ZE8A 3J7AU 4DV5O 1NTZH 4DR7B 3K04A 3H1HH 1NH2B 1M4UA 4LR3A 2JEXA 1AILA 2E75B 1ZLZA 4DR1O 2DQ3A 1KD1W 3RWRD 3DGEA 5CA0B 5J2TB 4BR6A 3I56V 5IWAO 4GX5A 1X4TA 4YHHO 1PNKA 2QA4V 1SERA 4D7SA 2YICA 2KG7A 4ZOLB 1J95A 1KB9F 3RYFA 3H01A 3ICXA 1AJNA 1YHQV 1M56C 3F7VC 4XDJA 2ZIOA 1Q82W 2UUCB 4BAYA 2CTWA 2W0FC 2CUGA 1OCRC 3X2QB 3CCJV 1JJ2U 2CGOA 1GM8A 3E2EA 4LFAB 3ZJZA 1VQ6V 1ENVA 5EC1C 1M90W 3ZHTA 2LFRA 2DYSC 3AG3C 2BTOA 1Z5VA 2ZE6A 3AG1B 2IW5A 3BEHA 4UVAA 1GTOA 2XOKG 2B1IA 2BTQA 1BT8A 4DV3B 2BE3A 1RP3B 2AHYA 2W6JG 1B6QA 4JAVA 4JI1B 2F1MA 1B04A 2RJZA 2JS3A 1PL0A 5H2FZ 4UVBA 4W4LA 3ZRVA 5ITZA 4GX0A 4BWAA 3K5OA 2HKOA 4I4TA 2F43G 3M99B 4HBNA 3CMAV 4X88A 4O4JB 4ASUG 4FLZA 5IT9N 3JAKB 2E3CA 1QHTA 5CA1A 4UB8Z 5EK0A 2CH7B 3AK3A 4MVQA 3RYIB 1NTKH 4WFAV 1W0KG 4EFEA 4JI4B 4NKGB 2R72A 3STLC 2ZIMA 3E89A 4J42A 3ABUA 1AI4A 4DUZO 5IJ0B 5L3EA 1DLBA 2F66C 5DN6G 4RQFA 4X66B 1FYJA 2YS8A 1Y66A 1HNWB 2RQ6A 4DRXB 2P6JA 1X59A 4DR3B 4LNUA 1OCOB 5IY5C 2HLDG 3F5WC 5KA5A 2UXCB 5CB4A 4UV8A 2QM7A 3DC5A 1F4MA 2DMXA 3WB0A 4UB6Z 4ABMA 2F95B 4GYCB 2JIZG 4G27B 4DV2B 3ETDA 5KAFZ 3B8NA 4B3SB 2EINB 5LGTA 4LF5B 3BHPA 1T5EA 5FPRA 1DK1A 3C3SA 5KMGA 2Y4TA 3RYHA 4UCUA 2UXDB 3JCUZ 3GWOA 4IHJB 1N36O 4TV8A 5D5QA 3OMIB 1SESA 4TT3G 4JGSA 2LW1A 2ZT9B 1Q6UA 4LWSB 1H2SB 3BABA 4YHHB 3SJBC 1SZXA 1L8DA 2K1EA 2PTMA 1N8RW 1CP9A 3JD1A 4FLXA 4JI0B 3HKDB 2AGAA 2F23A 3SJAC 4IIJB 4WBNA 2PUSA 1S77D 2P4KA 2ZD9A 4O4LB 2PYLA 3DC6A 3UM7A 4B3TO 2MW2B 1YVWA 2RCVA 1G1XB 3IAYA 4I0XB 2HHHO 2XUMA 4CH3A 1IBMO 3AK2A 1Q5OA 4DK1A 3BFRA 4UUJC 4JI8B 2WLIB 2QM4A 3JAWB 2OCCB 1FXKB 4YIOA 2FTKA 4UCTA 1JJOA 3K79A 2OCHA 3ABKB 4P30A 4YJ2A 2QWOB 5K1XA 1MOFA 1JR9A 4YJ3B 1VQ7V 1RSOB 3D3IA 1WPXA 3JATA 4J7JA 3E22A 2CE4A 1YI2V 3JASB 4X64O 2EIKC 5F2VO 3E8BA 2JRIA 3W7XA 3JD4A 4QPJA 1S72V 1NVPB 3G67A 1NQTA 3FB5C 5E1AC 1AJPA 2YUAA 1KKCA 1PP9H 2QM8A 4AQYO 1Q8IA 2R9AA 4MVRA 3ZMTA 4PDVA 3JAMN 1Q86W 1M57B 1AI7A 4ZI7A 1K3EA 3FKSG 1TGOA 4EB6A 3K08A 1QU7A 1QLEB 2OCCC 3J81N 3OMNB 3B2EE 3M8AA 4NTYA 4CS4A 3JCZA 5A9GA 1BQZA 1SQXH 3UQ8A 2WLMA 5EBMC 1Q3EA 1HWYA 4JTAB 1AVMA 3AG2C 3EXAA 1V9PA 4GUNA 3MAQA 4DV0B 1PV0A 2PF4E 2NNUA 4Q6GA 1L0NH 5IYZA 3OGCC 2AXTZ 4NB5A 3L70H 5E79Z 1V54C 4DV6O 3F5TA 1XILA 2EIJC 1RPOA 4U3JB 4LFCB 3K03A 3CXHF 1QNMA 1VF7A 2LO1A 1EZVH 3VOUA 3CRMA 2GTAA 1GN4A 1Y67A 4MTFA 1EBOA 1SETA
chains in the Genus database with same CATH topology
3OM3B 2CK3G 1JX9A 4X89A 5CBHA 4WCEV 3AG4C 1Y4MA 1NR7A 4FK5C 4YXWG 1S5HC 5EC2C 2BOCC 2EIMB 2WLLA 4MVZA 3T4ZA 2IJIA 3SPGA 1ORQC 1QLEC 3ML0A 5IY5B 2EINC 2HVKC 3B77A 3OUFA 2PI5A 4ZKIA 1S3JA 1G4YB 1PNLA 3SYCA 3FYEB 5LHGA 1VQ5V 5L3GA 3T4DA 2R9IA 1KQSU 1K73W 4R7CA 2Y48A 1AI6A 1VQ8V 1DF4A 1H8HG 3K06A 2V1DA 1UJWB 2D3OW 4WFEA 1SRYA 2QTOA 2XASA 1GM9A 3SYQA 2ZR2A 5FL7G 3CMEV 1YTFD 2X6BA 2IJJA 3K3WA 3ZRWA 1R73A 1K92A 5CBFA 1VQKV 4H37A 2Q6AA 2H8PC 4MVSA 5CA3A 2IH1C 2Y69B 3CYOA 5L3BA 3CPWU 2ATKC 4MVUA 3I55V 3VBBA 3TK1A 3STZC 1OCRB 1IXMA 4QE7A 3PJSK 1VQNV 4J9YB 4FJCC 1F4NA 5KUKA 5HFMA 3SYPA 3HPLC 3NXSA 1K4CC 2EILB 3RVYA 4BW5A 3SYAA 4I5SA 4JPRA 3CCRV 3E86A 2WAMA 4MS2A 1L1FA 3AG3B 4RUFA 1PKXA 4FIPC 5EBWC 1OCCC 1QR9A 3ZMSA 4N23A 4BIUA 4PA4A 4DXWA 1V55C 5EBLC 3E35A 1E79G 3WG7B 4I9WA 5L3FA 3K04A 1NH2B 3UKMA 4QIWF 1VQ4V 2JEXA 2QEXV 2DWEC 1FXKC 4N21A 1ZWIC 2XNDG 2H94A 3E8GA 2DQ3A 1KD1W 3DGEA 4WFHA 3ABKC 3I56V 1GK9A 2WLLB 1R3LC 4GX5A 3P32A 1H38A 2DW4A 1PNKA 2QA4V 2WLIA 4JASA 1FXKA 3EFFK 3FB6C 1SERA 4CBCA 2DWDC 4GCZA 1J95A 4Q20A 4MVOA 4KFMA 4JF3A 1QLNA 3H01A 3LSSA 3ABMB 1AJNA 2IJHA 4GT1A 1YHQV 1M56C 3SYOA 1BMFG 4LC1A 3F7VC 4Z1MG 4XDJA 5B3SB 2P67A 4HZ3A 4MSWC 1Q82W 5IYCO 3RBZA 4BAYA 3G6EV 1I5YA 2ZDIA 1VQLV 2W0FC 2EJRA 3E83A 5B1NA 3ZRWB 1OCRC 2X6AA 2HJFC 3X2QB 1PD3A 1FS0G 2JJ2G 3CCJV 4GX1A 2HFEC 1DTOA 1JJ2U 3AEIA 1GM8A 2A79B 3JD3A 3ZMZA 1WLEA 5DM6V 3E2EA 3TETA 3ZJZA 1VQ6V 2WPDG 1ENVA 2A0LA 5EC1C 2HVJC 3LNMB 2YEVB 3SJQC 1M90W 2LFRA 1QVGU 2EZOA 1NH2D 2DYSC 3AG3C 5IYDO 2WSSG 3OEHG 2EIKB 1M57C 2ITDC 3ZMVA 3CCMV 3HB3B 3E8FA 2WLNA 3AG1B 3CCUV 2IW5A 3BEHA 4UVAA 1GTOA 2XOKG 1W2BU 3WG7C 2B1IA 3OMAB 1AROP 5LHIA 1K7DA 2AHYA 2XAJA 2W6JG 1B6QA 3A0RA 4JAVA 5LGUA 3CCLV 3ZRXA 4MW8A 4JAUA 4RAIA 1P7BA 4JTDB 1PL0A 4UVBA 4F4LA 3ZRVA 4GX0A 4PA9A 1YJ9V 1YIJV 2HKOA 2X7RB 1F23A 4WFBV 2F43G 2QKSA 3M99B 1VQ9V 3CMAV 4JTCB 2ZXWB 1CPYA 4X88A 4ASUG 1JVMA 3CCSV 3ABTA 3SPJA 2W6IG 4G2KA 3W7WA 4CZZA 5IDJA 1VQMV 3OEEG 3G71V 2LP7A 3FYIB 1EZJA 3ABLB 4MVMA 4E2LA 1W0JG 1JQ0A 5B3SC 3JD0A 1K8AW 3CP1A 5EK0A 4MVQA 3LDCA 4P9PA 2KB1A 1RM1B 1M9NA 4WFAV 5L3CA 3AG2B 3CC7V 1H2GA 1I5XA 1NKDA 1W0KG 3SPIA 3ZMUA 3STLC 1KC8W 2GSMB 3E89A 3W7SA 1ROPA 2Q68A 3ABUA 3OW2U 1AI4A 2UXNA 1K5QA 4QNHB 4HAMA 5CBGA 1K97A 5L3EA 1DLBA 5DN6G 5B1BC 3CCEV 1Q7YW 2IJKA 4RQFA 1K9MW 3RW0A 4R6ZA 4R8CA 4QPKA 1THZA 1Y66A 3GB7C 2ITCC 1V54B 4P2ZA 4TSFG 2IU0A 2EIMC 1F51A 1YJWV 4RQEA 2EIJB 2P6JA 3E8HA 5LGNA 1KP2A 1OCOB 4HYOA 5IY5C 1H8EG 5B1AB 3B8MA 2PI4A 2HLDG 2DYRB 3F5WC 3ZN0A 5KA5A 4UV9A 2XAFA 2XAHA 4FMTA 1GO3F 4PDMA 3G4SV 4UV8A 2QM7A 1F4MA 2M7WA 2ZQMA 3AG4B 4J9ZB 2ZXWC 3IFXA 5H6QA 1YSCA 3LDDA 5L3DA 1JOYA 1R3KC 2JIZG 5B1OA 3OFNG 1AI5A 1YJNV 2UXXA 1XL6A 4G27B 3ETDA 5LHHA 4R50A 3B8NA 3ABLC 2EINB 1E1RG 5LGTA 3QO8A 2Z3YA 4QJFB 2OT5A 1VQPV 2HG5C 1K34A 2R9RB 3CC2V 2P90A 4MW3A 1RM1C 4LCUC 3K0DA 2Y69C 1K5SA 3GWOA 1OHHG 3QO5A 3MHSC 3ZN1A 4LP8A 3OMIB 1BHAA 1E1QG 1SESA 4TT3G 4MTOA 4QE9A 4WF9V 4JGSA 2EILC 4LBEC 4PELA 2WWWA 4PA6A 5H6RA 4EKWA 3ZCCA 2MK3A 3BY6A 2V7QG 3K9AA 1GKFA 1DF5A 1KP3A 2K1EA 3KG2A 1N8RW 1QBZA 1CP9A 3JD1A 4U7OA 1QVFU 4XDKA 3F7YC 3T2MA 1S77D 2ZD9A 5LBQA 4PA3A 5C93A 2LFSA 3QNEA 4PA7A 2EZPA 2Q69A 1MSWD 5KUMA 3ETEA 2P7TC 3UM7A 1FFTB 5B1AC 2NLJC 4WFFA 4OXSA 1NJIW 1AJQA 3CCQV 1V55B 3TCUA 1KKDA 4PDRA 1LNQA 4UUJC 2WLIB 2OCCB 1FXKB 3ABMC 4KP4A 2Q67A 2FTKA 3K79A 2HR3A 3OR7C 3OE7G 3LDEA 4G28B 2GHYA 3ABKB 4L87A 2B5UA 4P30A 5GW7A 3LUTB 3LSQA 1CEZA 3DTUB 2ZR3A 1OCZB 3JD2A 3X2QC 1K4DC 1MOFA 1COWG 1QR8A 1VQ7V 2EBOA 2BOBC 1YITV 1R3IC 4H33A 3D3IA 1WPXA 1G8MA 3CXCU 3T1CA 3ZIAG 1SZTA 1M56B 3P30A 2Z5UA 1YI2V 1FXHA 4ZBMA 2EIKC 3FB8C 3RVZA 3ASNB 4GX2A 1GMGA 1EFRG 3E8BA 3OAAG 3AG1C 1MG1A 3ASOB 3W7XA 1RPRA 4WFGA 3JD4A 4MTXA 2YEVA 4MTGA 2JEUA 2JJ1G 4QPJA 1S72V 1NVPB 2A9HA 4X8AA 1P4RA 1NQTA 3W7UA 3FB5C 2JDIG 5E1AC 1AR1B 3D36A 3EHBB 1AJPA 2QM8A 2X6CA 1BHBA 4FPPA 4MVRA 4MT8A 2DYSB 4XDLA 3ZMTA 4PDVA 2XAGA 1Q86W 1Q81W 1M57B 2WLKA 1OZ0A 4XBFA 1AI7A 2YSUB 3ETGA 4UXNA 4BIZA 4UVCA 4RUEA 1K3EA 3FKSG 1JCHA 1TUEB 1GM7A 1FXVA 3OR6C 3K08A 4PDLA 3MD0A 3CCVV 1XL4A 3JYCA 1QLEB 2WLJA 2OCCC 2OTJV 3OMNB 3ZRSA 1PNMA 3WFVA 3JCZA 2OTLV 1NR1A 3IC7A 2IH3C 2WLMA 5EBMC 1R6NA 1VQOV 1HWYA 5BZBA 4JTAB 1KECA 3AG2C 3QO7A 5IYBO 4U7NA 1OCZC 1R3JC 5CN0A 1JPXA 5CMUA 1S76D 2IU3A 2JK5C 5J9PC 2X0LA 3W7TA 1M1KW 4P9OA 3FB7C 2ZDIC 1BL8A 1K33A 2DQ0A 3SPHA 1NVPD 3MHHC 3OUSA 1MABG 1QCEA 5H9CA 3ASNC 3IGAC 1YTFB 2NNUA 4DO2A 3OGCC 3ASOC 4JYCA 5HFLA 2XAQA 1V54C 5KA6A 1NBMG 2QE7G 3R65A 3SPCA 2EIJC 2AHZA 1RPOA 3CC4V 1R6KA 3K03A 1OCOC 2C2AA 2DYRC 4JYBA 4KUMA 3VOUA 3CD6V 2B1GA 5B1BB 1OCCB 4TWKA 2WLHA 1S0VA 4MTFA 3K0GA 1EBOA 1SETA 4RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOB C;  5CBH A;  4X89 A;  1R3I C;  3RBZ A;  5IY5 C;  4HYO A;  3AG4 C;  4H33 A;  3T1C A;  3F5W C;  1S5H C;  2W0F C;  5EC2 C;  3E83 A;  2BOC C;  1OCR C;  2X6A A;  2HJF C;  2WLL A;  4PDM A;  4MVZ A;  3T4Z A;  4GX1 A;  2HFE C;  1ORQ C;  1QLE C;  3SPG A;  4ZBM A;  2EIN C;  2EIK C;  2HVK C;  3FB8 C;  2A79 B;  3OUF A;  2ZXW C;  3IFX A;  3E8B A;  1G4Y B;  4GX2 A;  3RVZ A;  3SYC A;  3TET A;  3LDD A;  3ZJZ A;  3AG1 C;  1R3K C;  3T4D A;  2A0L A;  4WFG A;  5EC1 C;  2HVJ C;  1XL6 A;  3LNM B;  4G27 B;  4R7C A;  2YEV A;  4MTG A;  3SJQ C;  4R50 A;  2DYS C;  3AG3 C;  2A9H A;  4X8A A;  3K06 A;  3ABL C;  1M57 C;  2ITD C;  4WFE A;  2QTO A;  3FB5 C;  3E8F A;  5E1A C;  2WLN A;  3SYQ A;  2HG5 C;  2R9R B;  3BEH A;  2X6C A;  4MW3 A;  2X6B A;  3WG7 C;  4MVR A;  4LCU C;  4XDL A;  3K0D A;  2Y69 C;  4PDV A;  2AHY A;  2WLK A;  4LP8 A;  5CBF A;  4H37 A;  2Q6A A;  2H8P C;  4MVS A;  4MW8 A;  4RUE A;  4MTO A;  4QE9 A;  4RAI A;  2IH1 C;  1P7B A;  2EIL C;  4JTD B;  2ATK C;  4LBE C;  4MVU A;  4PA6 A;  4F4L A;  3STZ C;  3OR6 C;  3K08 A;  4PDL A;  4QE7 A;  3PJS K;  4EKW A;  4GX0 A;  4PA9 A;  4J9Y B;  1XL4 A;  3JYC A;  2WLJ A;  2OCC C;  2QKS A;  5KUK A;  3SYP A;  3ZRS A;  4JTC B;  4X88 A;  3HPL C;  1JVM A;  2K1E A;  3KG2 A;  1K4C C;  3RVY A;  3SPJ A;  4BW5 A;  2IH3 C;  3SYA A;  2WLM A;  5EBM C;  3E86 A;  4MS2 A;  5BZB A;  4JTA B;  4XDK A;  3F7Y C;  4RUF A;  3AG2 C;  5EBW C;  3T2M A;  2ZD9 A;  4MVM A;  1OCC C;  1OCZ C;  1R3J C;  4PA3 A;  4PA7 A;  5B3S C;  4PA4 A;  2JK5 C;  4MVQ A;  5EK0 A;  4DXW A;  5J9P C;  1V55 C;  2Q69 A;  5EBL C;  5KUM A;  3LDC A;  2P7T C;  4P9P A;  3UM7 A;  2KB1 A;  4P9O A;  4I9W A;  3FB7 C;  4J9Z B;  2NLJ C;  5B1A C;  1BL8 A;  3K04 A;  3SPH A;  4WFF A;  4OXS A;  3UKM A;  3SPI A;  3OUS A;  3STL C;  2DWE C;  3E89 A;  1ZWI C;  3TCU A;  3ASN C;  2Q68 A;  3IGA C;  3E8G A;  1KKD A;  4QNH B;  3OGC C;  3ASO C;  4WFH A;  3ABK C;  2WLL B;  4PDR A;  1R3L C;  4GX5 A;  1LNQ A;  4UUJ C;  5CBG A;  2WLI B;  2WLI A;  1V54 C;  3ABM C;  5B1B C;  2Q67 A;  3EFF K;  3FB6 C;  3RW0 A;  3R65 A;  4R6Z A;  4CBC A;  4R8C A;  2EIJ C;  2DWD C;  2AHZ A;  1J95 A;  3OR7 C;  3SPC A;  4MVO A;  3LDE A;  4G28 B;  4KFM A;  3K03 A;  1OCO C;  4P30 A;  3GB7 C;  4MTF A;  3LUT B;  2DYR C;  2ITC C;  3VOU A;  4P2Z A;  1M56 C;  4HZ3 A;  2EIM C;  3SYO A;  4TWK A;  3F7V C;  2WLH A;  1K4D C;  3X2Q C;  4XDJ A;  4MSW C;  3K0G A;  4RO2 A;  3E8H A; 
#chains in the Genus database with same CATH topology
 2CK3 G;  4X89 A;  1NR7 A;  1XOU A;  4B7E A;  2JGD A;  3C3T A;  3T1H B;  2EIM B;  2QGN A;  3S3W A;  2F93 B;  3SPG A;  1QLE C;  3UT5 B;  3B77 A;  3OUF A;  2PI5 A;  1I0H A;  1S3J A;  1VQ5 V;  2LJ2 A;  3T4D A;  1SQQ H;  1VMG A;  2R9I A;  5JCO C;  4B08 A;  4AHC A;  4NTX A;  3SGI A;  1AR5 A;  1DF4 A;  4DV1 B;  2ILM A;  2Q8V A;  2XAS A;  2QTO A;  4DUY O;  5JCO A;  5LOV B;  1VEW A;  4FLU A;  3K3W A;  4CS2 A;  3ZRW A;  2B9Z A;  4X20 A;  1W59 A;  1R73 A;  1K92 A;  5CBF A;  3JSL A;  4H0L B;  4CH4 A;  2HHH B;  3Q4H B;  1IBM B;  2IH1 C;  4TUY B;  1IXM A;  1VQN V;  3NXS A;  4L8J A;  3CCR V;  1L1F A;  1OJH A;  4UCS A;  2L35 A;  2RMK B;  1MA1 A;  4K3A A;  2UUC O;  4N23 A;  2XHB A;  3FAV B;  5EBL C;  2ADQ B;  1E79 G;  3WG7 B;  2GUZ A;  2W0X A;  5H5N A;  1VQ4 V;  2P06 A;  2CGN A;  4LFA O;  2XND G;  1P84 F;  3E8G A;  2G38 A;  3HR0 A;  1GK9 A;  4IT5 A;  3PN1 A;  2DWD C;  4GCZ A;  4MVO A;  1IVS A;  4KFM A;  3O9O A;  4JF3 A;  5EZY B;  1UPG A;  5JQG A;  3K5M A;  3OTO B;  4AQY B;  3ABM B;  1WA8 A;  4JI1 O;  4LC1 A;  1XI1 A;  1SQG A;  4MSW C;  4HZ3 A;  5EIB D;  1HNX O;  4CH6 A;  2OIG A;  3H1L H;  5IYC O;  3RBZ A;  5GTH Z;  2BCC H;  1I5Y A;  2ZDI A;  5B1N A;  2A3Q A;  3C90 A;  1PD3 A;  1FS0 G;  1SA0 A;  2HFE C;  2BSK B;  1WLE A;  1TUB B;  2WPD G;  5FNV A;  4FLY A;  2EZO A;  1NH2 D;  4JI5 O;  2WSS G;  4HNA B;  1ZL8 B;  1N32 B;  1OV9 A;  5C8Y A;  4O4H B;  5IJ9 B;  1W2B U;  3WG7 C;  2VQF O;  1ARO P;  1US6 A;  5LHI A;  1TVK B;  4CC5 A;  1H2M A;  5LGU A;  3CCL V;  1S5L Z;  1GRJ A;  4JTD B;  3K5L A;  4KL1 A;  1YJ9 V;  2X7R B;  1WNS A;  3JAR A;  2QKS A;  1VQ9 V;  2N74 A;  3TXQ A;  4DV6 B;  1JVM A;  3SPJ A;  3N2K B;  2O57 A;  5KX5 B;  1VQM V;  2FYU H;  3ABL B;  1YEW A;  1URF A;  1JQ0 A;  3QVN A;  1A32 A;  4B7K A;  1FJG O;  3RYF B;  4CC6 A;  5L3C A;  2M6Y A;  3CB2 A;  2FKX A;  3ZMU A;  2VQE O;  2YXH A;  3RYC B;  1ROP A;  3R66 A;  1BQ0 A;  2UXN A;  1K5Q A;  4Z1V A;  4K8X A;  3K58 A;  4HAM A;  4B3S O;  2DOS A;  2IJK A;  4R6Z A;  3D36 C;  2YIB D;  1Y74 A;  4DUY B;  1THZ A;  3GB7 C;  3T1Y O;  3ZHR A;  4TSF G;  3FX7 A;  1YJW V;  1SQP H;  1H8E G;  5B1A B;  2DYR B;  3ZN0 A;  4UV9 A;  3H1K H;  4IGG A;  4FMT A;  4PDM A;  1NTM H;  1JMK C;  1Z2G A;  4DYL A;  3B40 A;  1QQC A;  3AG4 B;  4J9Z B;  2GV9 A;  5H6Q A;  1YSC A;  3LDD A;  3DSQ A;  5L3D A;  1JOY A;  2QTS A;  1R3K C;  2N04 A;  4JI0 O;  5B1O A;  3OFN G;  2QR4 A;  3K5N A;  1B06 A;  1N0N A;  3JSN A;  3ABL C;  3KCY A;  1E1R G;  2Z3Y A;  1VIB A;  1AP6 A;  5IE9 A;  1VQP V;  2R9R B;  3CC2 V;  1SS3 A;  3D8C A;  2P90 A;  4MW3 A;  4LCU C;  4FFB A;  3QO5 A;  1OHH G;  4X1Y B;  4UCV A;  5B66 Z;  3ZX6 A;  1BHA A;  5EIB C;  4I50 B;  5KLV H;  3KKY A;  4NVP A;  1Q6I A;  2DE0 X;  2EIL C;  5LYJ B;  4PA6 A;  5H6R A;  4JI8 O;  1ZX3 A;  2MK3 A;  2V7Q G;  2PYJ A;  3K9A A;  1GKF A;  1Y76 B;  2HEP A;  1QBZ A;  4QGP A;  2EJ7 A;  1QVF U;  4TV9 A;  3F7Y C;  5JVD B;  4F6E A;  4J41 A;  4PA3 A;  5C93 A;  2LFS A;  4PA7 A;  1HNX B;  5KUM A;  3APO A;  5B1A C;  1Q90 D;  3L72 H;  4FLV A;  4O4I B;  1AJQ A;  1XDC A;  1HDJ A;  2YIA A;  1XNR O;  4O2A B;  4U3F H;  2LGW A;  5CA0 A;  5J2T A;  4IL6 Z;  4PDR A;  1LNQ A;  3OD4 A;  1BSM A;  2IBZ H;  4JI5 B;  4JI2 B;  2Q67 A;  3OE7 G;  4ZOL A;  3LDE A;  2GHY A;  5GW7 A;  1SKV A;  3LUT B;  1YF2 A;  2VQF B;  2OWO A;  2FB5 A;  4X65 B;  3X2Q C;  1YIT V;  2BOB C;  1G8M A;  1SZT A;  4UCR A;  4B3R B;  3HKB B;  1IBK O;  3ASN B;  4GX2 A;  1GMG A;  1KYO F;  3OAA G;  1BZK A;  4H44 B;  3AG1 C;  1GN6 A;  4TOI A;  4MTX A;  2JEU A;  4X8A A;  4I9Q A;  2Q5Z A;  3JAL B;  3QF7 A;  2DJV A;  1BHB A;  4DV0 O;  1FJG B;  2NN4 A;  4FPP A;  4WBN B;  2XAG A;  1Q81 W;  2WLK A;  2OYQ A;  5JH7 B;  4XBF A;  3ETG A;  2QWN B;  1NI8 A;  4BIZ A;  2YIB A;  2VQE B;  4UVC A;  1BE3 H;  1TUE B;  1FXV A;  4NYK A;  4PJ0 Z;  4D7T A;  5J2U B;  4O4J A;  3BRC A;  5LP6 B;  4LFC O;  2IH3 C;  3JAK A;  1IDS A;  1HNZ O;  1IZ3 A;  1VF6 C;  1XHX A;  5FPO A;  3T1Y B;  2GDS A;  3THO A;  4DR5 B;  1R3J C;  5CN0 A;  3A2F A;  5J9P C;  2CH7 A;  4DV7 O;  2UU9 O;  3G6B A;  3RYI A;  3FB7 C;  1VF6 A;  2AZ2 A;  3SPH A;  3T1H O;  1NVP D;  4K35 A;  3MHH C;  3OUS A;  1GN2 A;  2Y0P A;  3H1J H;  1EN5 A;  3ASN C;  1YTF B;  3N2G B;  2ZE5 A;  5IJ0 A;  5KHJ A;  4DV1 O;  2YXL A;  1XMO B;  2QWQ B;  1YCI A;  1NBM G;  1NZ6 A;  1R6K A;  1OCO C;  3TGU H;  3CD6 V;  5B1B B;  4TWK A;  1SQF A;  3K0G A;  2ZKO A;  4DRX A;  1L0L H;  5CBH A;  1XQ8 A;  4FK5 C;  4YXW G;  3K59 A;  4D6T H;  2E5L B;  5EC2 C;  2WLL A;  4PV1 B;  4MVZ A;  4X62 O;  1XNQ O;  2EIN C;  3DXR B;  2GTS A;  3SYC A;  3FD9 A;  5LP6 C;  5LHG A;  4LF4 O;  1D5A A;  1XBL A;  5L3G A;  3UO2 A;  3SDL A;  1VQ8 V;  2QDO A;  3K06 A;  2V1D A;  3KCX A;  1J5E O;  2HJD A;  2VWK A;  5D5P A;  5FL7 G;  1FFX B;  3CME V;  2X6B A;  1FKA O;  4IHJ A;  2PY5 A;  1MSD A;  4H13 B;  3B4S A;  4IYI A;  4MVS A;  2H8P C;  1XNR B;  2RN9 A;  2Y69 B;  4EFB A;  3CPW U;  3VBB A;  1PPJ H;  2ADP A;  2P22 C;  4LWS A;  5KUK A;  3BPZ A;  1FAF A;  4BW5 A;  2OIE A;  3SYA A;  4I5S A;  4JPR A;  4DR2 O;  3E86 A;  3OTO O;  3HKD A;  4FIP C;  4IIJ A;  3FFQ A;  4KXR A;  3CJH B;  2Y0I A;  1QR9 A;  2DN9 A;  3ZMS A;  3BA8 A;  2HP8 A;  3E35 A;  4X1K B;  3VQX A;  4I9W A;  2V4D A;  4O2B B;  3UKM A;  1I7F A;  2QSA A;  4I7Z B;  4I0X A;  2DWE C;  1WP8 A;  1IBK B;  1FXK C;  1MNG A;  1ZWI C;  3BAA A;  1NU1 H;  2JGD B;  4E4E A;  4WFH A;  3ABK C;  1IX9 A;  1VAR A;  2E76 B;  2WLI A;  1Q6H A;  3JAW A;  1FXK A;  2RDC A;  3FB6 C;  3K57 A;  4C7U A;  1N32 O;  4CBC A;  4Q20 A;  4F6R B;  1QLN A;  2H3O A;  2YDE A;  2IJH A;  1BMF G;  1NS1 A;  4Z1M G;  1P7G A;  4OX9 O;  4YJ3 A;  1RSO A;  4J10 A;  3G6E V;  3E83 A;  3HKC B;  3ZRW B;  4X20 B;  2JJ2 G;  1DTO A;  3JAS A;  3AEI A;  2A79 B;  3JD3 A;  4JI3 O;  3ZMZ A;  5DM6 V;  3OGI B;  3TET A;  4AI8 A;  2HVJ C;  3LNM B;  2YEV B;  1QVG U;  1WB8 A;  1HNZ B;  3OEH G;  3CRR A;  1M57 C;  2ITD C;  3CCM V;  4PI0 A;  3E8F A;  4JI7 O;  3ZED A;  3CCU V;  2YI9 A;  4DV7 B;  2UU9 B;  3A0R A;  4JYA B;  3ZRX A;  4PD4 F;  2Q73 A;  4JAU A;  1P7B A;  5B5E Z;  3BVO A;  4F4L A;  2F4V B;  4B3M B;  1YIJ V;  1F23 A;  4WFB V;  3I5D A;  4JTC B;  1CPY A;  4JI6 O;  2CAZ C;  3CCS V;  3ABT A;  3WU2 Z;  2W6I G;  4G2K A;  4CZZ A;  5IDJ A;  5GTI Z;  3OEE G;  2LP7 A;  1EZJ A;  4MVM A;  3RN4 A;  4E2L A;  1K8A W;  3CP1 A;  2YXY A;  5KAI Z;  4GKJ O;  3ZHQ A;  4P9P A;  1IBL B;  2KB1 A;  1M9N A;  5LMU O;  1I5X A;  1TA8 A;  3SPI A;  1VF5 B;  4J80 A;  4X62 B;  3W7S A;  1XNQ B;  2Q68 A;  4X1I B;  4I55 B;  2N05 A;  4LF4 B;  4FVM A;  5CBG A;  1K97 A;  1K9M W;  1J5E B;  2WA4 A;  2P5O A;  4U3J A;  1B3Q A;  2KQX A;  2IU0 A;  2EIM C;  5LGN A;  1KP2 A;  2UUA O;  3B8M A;  2XAH A;  1GO3 F;  4KHP O;  3G4S V;  3IC9 A;  1IXB A;  4ZHQ B;  2M7W A;  2ZQM A;  3UT5 A;  4GLX A;  2UXX A;  1WJZ A;  4R50 A;  4DR2 B;  1XUQ A;  4RWU A;  3QO8 A;  4QJF B;  1UFI A;  2OT5 A;  2HG5 C;  1K34 A;  3AK1 A;  1MZE A;  5LOV A;  4TQF A;  1N33 O;  4PI2 A;  3HKE B;  4NXM B;  3MHS C;  2XTA A;  5GON B;  1RFY A;  2QWP B;  4MTO A;  3Q4H A;  4WF9 V;  4TUY A;  5A2Q N;  3BY6 A;  5BMV B;  5LA6 B;  4JI2 O;  4JAA A;  4OPA A;  3LSU A;  5EYP B;  4U7O A;  1SC5 B;  1SQB H;  2LQT A;  1N4C A;  4XDK A;  3T2M A;  4X65 O;  1YZB A;  2LGQ A;  4LF6 O;  5LBQ A;  1P49 A;  5LXT B;  4OX9 B;  2Q69 A;  1MSW D;  3FAV A;  1FFT B;  1D2D A;  2KKW A;  2VRZ A;  4WFF A;  4B3R O;  1NJI W;  5KHI A;  3CCQ V;  1V55 B;  3TCU A;  4JI3 B;  3SR2 C;  4LF9 B;  3LNN A;  2QKC A;  3MDS A;  3CX5 F;  3ABM C;  4KP4 A;  2KG7 B;  2HR3 A;  3ETQ A;  4L87 A;  4JI7 B;  2FML A;  5EZY A;  1CEZ A;  3JD2 A;  2YID A;  4OGQ B;  3CS5 A;  1QR8 A;  3A8T A;  2ODM A;  1R3I C;  3OT7 A;  4H33 A;  1EM1 A;  3CRA A;  2JGU A;  4DR4 O;  1GN3 A;  1M56 B;  1I08 A;  1DGS A;  3P30 A;  5LMN O;  3TJT A;  1FXH A;  2BSK A;  4ZBM A;  3RVZ A;  4NTW A;  1TUB A;  4JI6 B;  2ZE7 A;  1MG1 A;  3ASO B;  1RPR A;  4MTG A;  2QKA A;  2JJ1 G;  4DR5 O;  1IUR A;  1XHZ A;  4HNA A;  1P4R A;  2EX3 A;  1ZL8 A;  4BW9 A;  3D36 A;  3EHB B;  2D2C B;  4O4H A;  5IJ9 A;  3M7M X;  4GKJ B;  4XDL A;  2BTQ B;  2DYS B;  5LMU B;  1JFF A;  1TVK A;  4YIP A;  2YSU B;  4RUE A;  1SF9 A;  1GM7 A;  5ITZ B;  3MD0 A;  3CCV V;  4I4T B;  1XMO O;  2WLJ A;  2OTJ V;  4NR1 A;  4FLW A;  1M93 A;  3WFV A;  2OTL V;  1NR1 A;  3IC7 A;  3N2K A;  5KX5 A;  1R6N A;  5BZB A;  4LH6 A;  5CA1 B;  4K0K O;  1Z5W A;  4DW0 A;  5CMU A;  3B09 A;  3CRC A;  4LFB O;  2E5L O;  1LUV A;  1M1K W;  2UUA B;  4P9O A;  1BL8 A;  1K33 A;  2DQ0 A;  1KMI Z;  4FFK A;  4KHP B;  1QCE A;  3RYC A;  4FZ0 A;  3RGB A;  3IGA C;  3ASO C;  4JYC A;  4JV5 B;  2VS0 A;  2XAQ A;  1HP8 A;  5KA6 A;  3SPC A;  3AG7 A;  1LR1 A;  2C2A A;  2DYR C;  4KUM A;  1N33 B;  2ZNJ A;  1S0V A;  4RO2 A;  4LNU B;  3OM3 B;  4LF8 B;  4JYY A;  4WCE V;  3AG4 C;  1S5H C;  1TAE A;  2BOC C;  5CB4 B;  2IJI A;  1ORQ C;  5BR8 O;  3ML0 A;  3P3P A;  5IY5 B;  2HVK C;  4ZKI A;  1G4Y B;  3FYE B;  5BY1 A;  1H8H G;  4YY3 O;  1U97 A;  4ZIB A;  1UJW B;  4WFE A;  4LF6 B;  1SRY A;  4J7K A;  4ICG A;  2Q0A A;  3ZS8 C;  5KMG B;  1YTF D;  3RYH B;  2Q9L A;  3VQW A;  2IJJ A;  2YI8 A;  4X1Y A;  4TV8 B;  3H9V A;  2QWR B;  1VQK V;  2Q6A A;  4I50 A;  5L3B A;  5LYJ A;  3TK1 A;  3STZ C;  4OPH A;  4QE7 A;  3H1I H;  2PZS A;  5DED A;  3SYP A;  1Y76 A;  1K4C C;  2Q7G A;  3U10 A;  3RVY A;  2UUB O;  4MS2 A;  5EBW C;  1HW7 A;  5JVD A;  4BIU A;  1ZAU A;  5L3F A;  2A06 H;  4QIW F;  4DR4 B;  4O4I A;  1FD9 A;  5LMN B;  2QEX V;  4N21 A;  3N27 A;  4O2A A;  2H94 A;  2WLL B;  1AR4 A;  1R3L C;  3P32 A;  2ZM6 O;  2DW4 A;  3P3N A;  1H38 A;  4JAS A;  3ZHV A;  3EFF K;  3L9D A;  1R6T A;  1CXZ B;  3IJ4 A;  4AIL C;  4YJ2 B;  3GWK C;  3LSS A;  2Q0O C;  4GT1 A;  2Q4P A;  3SYO A;  4JYA O;  5B3S B;  2P67 A;  4GKK B;  1I94 B;  3JAT B;  1YXB A;  1VQL V;  3E22 B;  4DV5 B;  2EJR A;  2F4V O;  4B3M O;  2X6A A;  2HJF C;  3HKB A;  4GX1 A;  3L73 H;  1XEQ A;  1WP7 A;  1S5J A;  4DR1 B;  1H2K A;  2A0L A;  3G80 A;  1XRE A;  3SJQ C;  5IWA B;  5IYD O;  2EIK B;  3JAL A;  4K0K B;  3ZMV A;  1H2N A;  3CRQ A;  3HB3 B;  2RNB A;  2WLN A;  5KHK A;  1N34 O;  3CWB H;  1IBL O;  4LFB B;  3OMA B;  4NXN O;  1H2L A;  5JJN B;  1K7D A;  5JJE B;  2XAJ A;  4LF7 O;  4DK0 A;  5JH7 A;  2A7W A;  4LH7 A;  4MW8 A;  4ZI7 B;  4RAI A;  4EB6 B;  1Q43 A;  4PA9 A;  1WPB A;  2ZXW B;  2UXB O;  1NT2 B;  5J2U A;  5LP6 A;  3SJC C;  3VQY A;  3W7W A;  1ZUQ A;  3G71 V;  2AW9 A;  3FYI B;  1HR0 O;  1W0J G;  1ZTE A;  5B3S C;  3JD0 A;  2CTP A;  1R1B A;  3LDC A;  4DV4 O;  1RM1 B;  4Z2W A;  3AG2 B;  3CC7 V;  4DR6 O;  1H2G A;  2PGG A;  1GH6 A;  1NKD A;  2Z0A A;  1KC8 W;  2GSM B;  2FL4 A;  1ZSP A;  5BR8 B;  3OW2 U;  1AP5 A;  5IYZ B;  4QNH B;  3N2G A;  4GZR B;  4TQD A;  2IM9 A;  5LL6 Y;  3VQV A;  5B1B C;  3CCE V;  1Q7Y W;  4YY3 B;  3RW0 A;  4O4L A;  4R8C A;  3L75 H;  4QPK A;  2R70 A;  4UFZ A;  2ITC C;  4NXM O;  1V54 B;  4P2Z A;  1F51 A;  1KU9 A;  2EIJ B;  4RQE A;  3E8H A;  4HYO A;  1Y6X A;  2PI4 A;  4FM2 A;  2XAF A;  2CTQ A;  2NR5 A;  2ZXW C;  3IFX A;  5JJJ B;  3DXR A;  5K1P A;  4DUZ B;  3CHX A;  1AI5 A;  1YJN V;  1XL6 A;  5LHH A;  2UUB B;  1GAX A;  2K9P A;  2KSD A;  4EEQ A;  2ZCE A;  2JS5 A;  3U0Z A;  1FFX A;  1RM1 C;  3K0D A;  2Y69 C;  1U96 A;  1K5S A;  2AZ0 A;  3ZN1 A;  4LP8 A;  1G6U A;  1E1Q G;  3K9S A;  4W4K A;  2QJ1 A;  4LF9 O;  4QE9 A;  4LBE C;  4PEL A;  2JVD A;  2WWW A;  3GVM A;  4EKW A;  3ZCC A;  3L71 H;  4DW1 A;  2ZM6 B;  1DF5 A;  1KP3 A;  3BA9 A;  3KG2 A;  4J7Z A;  3CJH A;  3UO3 A;  3QNE A;  2EZP A;  3ETE A;  2P7T C;  4X1K A;  1D5N A;  1BGY H;  2EUL A;  2NLJ C;  1YDX A;  2GUZ B;  4O2B A;  4OXS A;  3CEI A;  1N36 B;  3WB1 A;  1PM9 A;  1KKD A;  1XMQ O;  3WB2 A;  1JA8 A;  1O9G A;  4BIO A;  3OR7 C;  1M5I A;  4G28 B;  1N34 B;  2B5U A;  4F6R A;  4FM0 A;  5JQG B;  3LSQ A;  4IYH A;  2ETN A;  3DTU B;  2ZR3 A;  1WA8 B;  4NXN B;  1OCZ B;  1K4D C;  1COW G;  4LF7 B;  4CS3 A;  2EBO A;  4FM1 A;  3KZI Z;  4DR7 O;  3CXC U;  3T1C A;  4B3T B;  3ZIA G;  1AB3 A;  3HKC A;  1SQV H;  2Z5U A;  1SA0 B;  3RFR A;  3FB8 C;  1EFR G;  1MMM A;  2WA3 A;  2UXB B;  2Q7E A;  2YC0 A;  5FNV B;  1BS3 A;  4WFG A;  2ARH A;  4J11 A;  2YEV A;  2A9H A;  3W7U A;  1HR0 B;  2JDI G;  1AR1 B;  5C8Y B;  4UCO A;  1EN4 A;  2X6C A;  2VWJ A;  4MT8 A;  4DV4 B;  4JZG A;  4DR6 B;  1OZ0 A;  4UXN A;  2XT9 A;  1JCH A;  4JV5 O;  3OR6 C;  4PDL A;  3CE2 A;  1XL4 A;  3JAR B;  3JYC A;  3ZRS A;  1PNM A;  4X64 B;  4FZ1 A;  3L74 H;  3J80 N;  3ZHU A;  1N0J A;  1VQO V;  1WN7 A;  2LW7 A;  1KEC A;  3ZHS A;  3QO7 A;  5IYB O;  4U7N A;  1OCZ C;  3QG5 A;  1JPX A;  1S76 D;  1MZF A;  2IU3 A;  4LF8 O;  2JK5 C;  2X0L A;  3EVK A;  1FPO A;  3W7T A;  4A5U B;  3ZBH A;  4DV3 O;  2ZDI C;  2ZIN A;  5KHG A;  4FLT A;  1O9H A;  3OTF A;  1MAB G;  5H9C A;  2P4V A;  4X1I A;  4DO2 A;  3BCC H;  4I55 A;  4JZ2 A;  5HFL A;  2GBO A;  1LUW A;  3O65 A;  2QE7 G;  3R65 A;  4PHZ A;  2AHZ A;  3CC4 V;  2ZNI A;  1Y74 B;  5BXZ A;  3D3Q A;  2CDY A;  5JWP A;  4JYB A;  2B1G A;  2E74 B;  3A0H Z;  1OCC B;  1F7Y A;  4X9Q A;  2WLH A;  1JX9 A;  1WAZ A;  1Y4M A;  2Y4U A;  5TIS Z;  1JFF B;  1BCC H;  1PL4 A;  3APQ A;  4JI4 O;  1KUQ A;  3T4Z A;  4ZHQ A;  3NR7 A;  3U11 A;  1PNL A;  5FLX N;  3A0B Z;  1K73 W;  4R7C A;  1KQS U;  2Y48 A;  1AI6 A;  2D3O W;  4X66 O;  5DEC A;  1GM9 A;  3SYQ A;  2ZR2 A;  4FFB B;  3RT3 C;  1HNW O;  3HKE A;  4CH5 A;  5GON A;  4DR3 O;  5AG2 A;  2Q7H A;  4H37 A;  5CA3 A;  3CYO A;  3UCS C;  2ATK C;  2UXC O;  4MVU A;  3I55 V;  3CSX A;  1XMQ B;  1OCR B;  2CTR A;  1EN6 A;  3PJS K;  4J9Y B;  5BMV A;  2L6L A;  4FJC C;  1F4N A;  5LA6 A;  1KBH A;  1WB7 A;  5HFM A;  3HPL C;  2EIL B;  5EYP A;  4DV2 O;  4TV9 B;  2WAM A;  3AG3 B;  4RUF A;  1PKX A;  4LF5 O;  3TXS A;  1OCC C;  3QTC A;  4K8Z A;  4PA4 A;  4DXW A;  4GKK O;  5KHH A;  5LXT A;  3S3X A;  1I94 O;  1V55 C;  1VP7 A;  2UXD O;  2ZE8 A;  3J7A U;  4DV5 O;  1NTZ H;  4DR7 B;  3K04 A;  3H1H H;  1NH2 B;  1M4U A;  4LR3 A;  2JEX A;  1AIL A;  2E75 B;  1ZLZ A;  4DR1 O;  2DQ3 A;  1KD1 W;  3RWR D;  3DGE A;  5CA0 B;  5J2T B;  4BR6 A;  3I56 V;  5IWA O;  4GX5 A;  1X4T A;  4YHH O;  1PNK A;  2QA4 V;  1SER A;  4D7S A;  2YIC A;  2KG7 A;  4ZOL B;  1J95 A;  1KB9 F;  3RYF A;  3H01 A;  3ICX A;  1AJN A;  1YHQ V;  1M56 C;  3F7V C;  4XDJ A;  2ZIO A;  1Q82 W;  2UUC B;  4BAY A;  2CTW A;  2W0F C;  2CUG A;  1OCR C;  3X2Q B;  3CCJ V;  1JJ2 U;  2CGO A;  1GM8 A;  3E2E A;  4LFA B;  3ZJZ A;  1VQ6 V;  1ENV A;  5EC1 C;  1M90 W;  3ZHT A;  2LFR A;  2DYS C;  3AG3 C;  2BTO A;  1Z5V A;  2ZE6 A;  3AG1 B;  2IW5 A;  3BEH A;  4UVA A;  1GTO A;  2XOK G;  2B1I A;  2BTQ A;  1BT8 A;  4DV3 B;  2BE3 A;  1RP3 B;  2AHY A;  2W6J G;  1B6Q A;  4JAV A;  4JI1 B;  2F1M A;  1B04 A;  2RJZ A;  2JS3 A;  1PL0 A;  5H2F Z;  4UVB A;  4W4L A;  3ZRV A;  5ITZ A;  4GX0 A;  4BWA A;  3K5O A;  2HKO A;  4I4T A;  2F43 G;  3M99 B;  4HBN A;  3CMA V;  4X88 A;  4O4J B;  4ASU G;  4FLZ A;  5IT9 N;  3JAK B;  2E3C A;  1QHT A;  5CA1 A;  4UB8 Z;  5EK0 A;  2CH7 B;  3AK3 A;  4MVQ A;  3RYI B;  1NTK H;  4WFA V;  1W0K G;  4EFE A;  4JI4 B;  4NKG B;  2R72 A;  3STL C;  2ZIM A;  3E89 A;  4J42 A;  3ABU A;  1AI4 A;  4DUZ O;  5IJ0 B;  5L3E A;  1DLB A;  2F66 C;  5DN6 G;  4RQF A;  4X66 B;  1FYJ A;  2YS8 A;  1Y66 A;  1HNW B;  2RQ6 A;  4DRX B;  2P6J A;  1X59 A;  4DR3 B;  4LNU A;  1OCO B;  5IY5 C;  2HLD G;  3F5W C;  5KA5 A;  2UXC B;  5CB4 A;  4UV8 A;  2QM7 A;  3DC5 A;  1F4M A;  2DMX A;  3WB0 A;  4UB6 Z;  4ABM A;  2F95 B;  4GYC B;  2JIZ G;  4G27 B;  4DV2 B;  3ETD A;  5KAF Z;  3B8N A;  4B3S B;  2EIN B;  5LGT A;  4LF5 B;  3BHP A;  1T5E A;  5FPR A;  1DK1 A;  3C3S A;  5KMG A;  2Y4T A;  3RYH A;  4UCU A;  2UXD B;  3JCU Z;  3GWO A;  4IHJ B;  1N36 O;  4TV8 A;  5D5Q A;  3OMI B;  1SES A;  4TT3 G;  4JGS A;  2LW1 A;  2ZT9 B;  1Q6U A;  4LWS B;  1H2S B;  3BAB A;  4YHH B;  3SJB C;  1SZX A;  1L8D A;  2K1E A;  2PTM A;  1N8R W;  1CP9 A;  3JD1 A;  4FLX A;  4JI0 B;  3HKD B;  2AGA A;  2F23 A;  3SJA C;  4IIJ B;  4WBN A;  2PUS A;  1S77 D;  2P4K A;  2ZD9 A;  4O4L B;  2PYL A;  3DC6 A;  3UM7 A;  4B3T O;  2MW2 B;  1YVW A;  2RCV A;  1G1X B;  3IAY A;  4I0X B;  2HHH O;  2XUM A;  4CH3 A;  1IBM O;  3AK2 A;  1Q5O A;  4DK1 A;  3BFR A;  4UUJ C;  4JI8 B;  2WLI B;  2QM4 A;  3JAW B;  2OCC B;  1FXK B;  4YIO A;  2FTK A;  4UCT A;  1JJO A;  3K79 A;  2OCH A;  3ABK B;  4P30 A;  4YJ2 A;  2QWO B;  5K1X A;  1MOF A;  1JR9 A;  4YJ3 B;  1VQ7 V;  1RSO B;  3D3I A;  1WPX A;  3JAT A;  4J7J A;  3E22 A;  2CE4 A;  1YI2 V;  3JAS B;  4X64 O;  2EIK C;  5F2V O;  3E8B A;  2JRI A;  3W7X A;  3JD4 A;  4QPJ A;  1S72 V;  1NVP B;  3G67 A;  1NQT A;  3FB5 C;  5E1A C;  1AJP A;  2YUA A;  1KKC A;  1PP9 H;  2QM8 A;  4AQY O;  1Q8I A;  2R9A A;  4MVR A;  3ZMT A;  4PDV A;  3JAM N;  1Q86 W;  1M57 B;  1AI7 A;  4ZI7 A;  1K3E A;  3FKS G;  1TGO A;  4EB6 A;  3K08 A;  1QU7 A;  1QLE B;  2OCC C;  3J81 N;  3OMN B;  3B2E E;  3M8A A;  4NTY A;  4CS4 A;  3JCZ A;  5A9G A;  1BQZ A;  1SQX H;  3UQ8 A;  2WLM A;  5EBM C;  1Q3E A;  1HWY A;  4JTA B;  1AVM A;  3AG2 C;  3EXA A;  1V9P A;  4GUN A;  3MAQ A;  4DV0 B;  1PV0 A;  2PF4 E;  2NNU A;  4Q6G A;  1L0N H;  5IYZ A;  3OGC C;  2AXT Z;  4NB5 A;  3L70 H;  5E79 Z;  1V54 C;  4DV6 O;  3F5T A;  1XIL A;  2EIJ C;  1RPO A;  4U3J B;  4LFC B;  3K03 A;  3CXH F;  1QNM A;  1VF7 A;  2LO1 A;  1EZV H;  3VOU A;  3CRM A;  2GTA A;  1GN4 A;  1Y67 A;  4MTF A;  1EBO A;  1SET A; 
#chains in the Genus database with same CATH homology
 3OM3 B;  2CK3 G;  1JX9 A;  4X89 A;  5CBH A;  4WCE V;  3AG4 C;  1Y4M A;  1NR7 A;  4FK5 C;  4YXW G;  1S5H C;  5EC2 C;  2BOC C;  2EIM B;  2WLL A;  4MVZ A;  3T4Z A;  2IJI A;  3SPG A;  1ORQ C;  1QLE C;  3ML0 A;  5IY5 B;  2EIN C;  2HVK C;  3B77 A;  3OUF A;  2PI5 A;  4ZKI A;  1S3J A;  1G4Y B;  1PNL A;  3SYC A;  3FYE B;  5LHG A;  1VQ5 V;  5L3G A;  3T4D A;  2R9I A;  1KQS U;  1K73 W;  4R7C A;  2Y48 A;  1AI6 A;  1VQ8 V;  1DF4 A;  1H8H G;  3K06 A;  2V1D A;  1UJW B;  2D3O W;  4WFE A;  1SRY A;  2QTO A;  2XAS A;  1GM9 A;  3SYQ A;  2ZR2 A;  5FL7 G;  3CME V;  1YTF D;  2X6B A;  2IJJ A;  3K3W A;  3ZRW A;  1R73 A;  1K92 A;  5CBF A;  1VQK V;  4H37 A;  2Q6A A;  2H8P C;  4MVS A;  5CA3 A;  2IH1 C;  2Y69 B;  3CYO A;  5L3B A;  3CPW U;  2ATK C;  4MVU A;  3I55 V;  3VBB A;  3TK1 A;  3STZ C;  1OCR B;  1IXM A;  4QE7 A;  3PJS K;  1VQN V;  4J9Y B;  4FJC C;  1F4N A;  5KUK A;  5HFM A;  3SYP A;  3HPL C;  3NXS A;  1K4C C;  2EIL B;  3RVY A;  4BW5 A;  3SYA A;  4I5S A;  4JPR A;  3CCR V;  3E86 A;  2WAM A;  4MS2 A;  1L1F A;  3AG3 B;  4RUF A;  1PKX A;  4FIP C;  5EBW C;  1OCC C;  1QR9 A;  3ZMS A;  4N23 A;  4BIU A;  4PA4 A;  4DXW A;  1V55 C;  5EBL C;  3E35 A;  1E79 G;  3WG7 B;  4I9W A;  5L3F A;  3K04 A;  1NH2 B;  3UKM A;  4QIW F;  1VQ4 V;  2JEX A;  2QEX V;  2DWE C;  1FXK C;  4N21 A;  1ZWI C;  2XND G;  2H94 A;  3E8G A;  2DQ3 A;  1KD1 W;  3DGE A;  4WFH A;  3ABK C;  3I56 V;  1GK9 A;  2WLL B;  1R3L C;  4GX5 A;  3P32 A;  1H38 A;  2DW4 A;  1PNK A;  2QA4 V;  2WLI A;  4JAS A;  1FXK A;  3EFF K;  3FB6 C;  1SER A;  4CBC A;  2DWD C;  4GCZ A;  1J95 A;  4Q20 A;  4MVO A;  4KFM A;  4JF3 A;  1QLN A;  3H01 A;  3LSS A;  3ABM B;  1AJN A;  2IJH A;  4GT1 A;  1YHQ V;  1M56 C;  3SYO A;  1BMF G;  4LC1 A;  3F7V C;  4Z1M G;  4XDJ A;  5B3S B;  2P67 A;  4HZ3 A;  4MSW C;  1Q82 W;  5IYC O;  3RBZ A;  4BAY A;  3G6E V;  1I5Y A;  2ZDI A;  1VQL V;  2W0F C;  2EJR A;  3E83 A;  5B1N A;  3ZRW B;  1OCR C;  2X6A A;  2HJF C;  3X2Q B;  1PD3 A;  1FS0 G;  2JJ2 G;  3CCJ V;  4GX1 A;  2HFE C;  1DTO A;  1JJ2 U;  3AEI A;  1GM8 A;  2A79 B;  3JD3 A;  3ZMZ A;  1WLE A;  5DM6 V;  3E2E A;  3TET A;  3ZJZ A;  1VQ6 V;  2WPD G;  1ENV A;  2A0L A;  5EC1 C;  2HVJ C;  3LNM B;  2YEV B;  3SJQ C;  1M90 W;  2LFR A;  1QVG U;  2EZO A;  1NH2 D;  2DYS C;  3AG3 C;  5IYD O;  2WSS G;  3OEH G;  2EIK B;  1M57 C;  2ITD C;  3ZMV A;  3CCM V;  3HB3 B;  3E8F A;  2WLN A;  3AG1 B;  3CCU V;  2IW5 A;  3BEH A;  4UVA A;  1GTO A;  2XOK G;  1W2B U;  3WG7 C;  2B1I A;  3OMA B;  1ARO P;  5LHI A;  1K7D A;  2AHY A;  2XAJ A;  2W6J G;  1B6Q A;  3A0R A;  4JAV A;  5LGU A;  3CCL V;  3ZRX A;  4MW8 A;  4JAU A;  4RAI A;  1P7B A;  4JTD B;  1PL0 A;  4UVB A;  4F4L A;  3ZRV A;  4GX0 A;  4PA9 A;  1YJ9 V;  1YIJ V;  2HKO A;  2X7R B;  1F23 A;  4WFB V;  2F43 G;  2QKS A;  3M99 B;  1VQ9 V;  3CMA V;  4JTC B;  2ZXW B;  1CPY A;  4X88 A;  4ASU G;  1JVM A;  3CCS V;  3ABT A;  3SPJ A;  2W6I G;  4G2K A;  3W7W A;  4CZZ A;  5IDJ A;  1VQM V;  3OEE G;  3G71 V;  2LP7 A;  3FYI B;  1EZJ A;  3ABL B;  4MVM A;  4E2L A;  1W0J G;  1JQ0 A;  5B3S C;  3JD0 A;  1K8A W;  3CP1 A;  5EK0 A;  4MVQ A;  3LDC A;  4P9P A;  2KB1 A;  1RM1 B;  1M9N A;  4WFA V;  5L3C A;  3AG2 B;  3CC7 V;  1H2G A;  1I5X A;  1NKD A;  1W0K G;  3SPI A;  3ZMU A;  3STL C;  1KC8 W;  2GSM B;  3E89 A;  3W7S A;  1ROP A;  2Q68 A;  3ABU A;  3OW2 U;  1AI4 A;  2UXN A;  1K5Q A;  4QNH B;  4HAM A;  5CBG A;  1K97 A;  5L3E A;  1DLB A;  5DN6 G;  5B1B C;  3CCE V;  1Q7Y W;  2IJK A;  4RQF A;  1K9M W;  3RW0 A;  4R6Z A;  4R8C A;  4QPK A;  1THZ A;  1Y66 A;  3GB7 C;  2ITC C;  1V54 B;  4P2Z A;  4TSF G;  2IU0 A;  2EIM C;  1F51 A;  1YJW V;  4RQE A;  2EIJ B;  2P6J A;  3E8H A;  5LGN A;  1KP2 A;  1OCO B;  4HYO A;  5IY5 C;  1H8E G;  5B1A B;  3B8M A;  2PI4 A;  2HLD G;  2DYR B;  3F5W C;  3ZN0 A;  5KA5 A;  4UV9 A;  2XAF A;  2XAH A;  4FMT A;  1GO3 F;  4PDM A;  3G4S V;  4UV8 A;  2QM7 A;  1F4M A;  2M7W A;  2ZQM A;  3AG4 B;  4J9Z B;  2ZXW C;  3IFX A;  5H6Q A;  1YSC A;  3LDD A;  5L3D A;  1JOY A;  1R3K C;  2JIZ G;  5B1O A;  3OFN G;  1AI5 A;  1YJN V;  2UXX A;  1XL6 A;  4G27 B;  3ETD A;  5LHH A;  4R50 A;  3B8N A;  3ABL C;  2EIN B;  1E1R G;  5LGT A;  3QO8 A;  2Z3Y A;  4QJF B;  2OT5 A;  1VQP V;  2HG5 C;  1K34 A;  2R9R B;  3CC2 V;  2P90 A;  4MW3 A;  1RM1 C;  4LCU C;  3K0D A;  2Y69 C;  1K5S A;  3GWO A;  1OHH G;  3QO5 A;  3MHS C;  3ZN1 A;  4LP8 A;  3OMI B;  1BHA A;  1E1Q G;  1SES A;  4TT3 G;  4MTO A;  4QE9 A;  4WF9 V;  4JGS A;  2EIL C;  4LBE C;  4PEL A;  2WWW A;  4PA6 A;  5H6R A;  4EKW A;  3ZCC A;  2MK3 A;  3BY6 A;  2V7Q G;  3K9A A;  1GKF A;  1DF5 A;  1KP3 A;  2K1E A;  3KG2 A;  1N8R W;  1QBZ A;  1CP9 A;  3JD1 A;  4U7O A;  1QVF U;  4XDK A;  3F7Y C;  3T2M A;  1S77 D;  2ZD9 A;  5LBQ A;  4PA3 A;  5C93 A;  2LFS A;  3QNE A;  4PA7 A;  2EZP A;  2Q69 A;  1MSW D;  5KUM A;  3ETE A;  2P7T C;  3UM7 A;  1FFT B;  5B1A C;  2NLJ C;  4WFF A;  4OXS A;  1NJI W;  1AJQ A;  3CCQ V;  1V55 B;  3TCU A;  1KKD A;  4PDR A;  1LNQ A;  4UUJ C;  2WLI B;  2OCC B;  1FXK B;  3ABM C;  4KP4 A;  2Q67 A;  2FTK A;  3K79 A;  2HR3 A;  3OR7 C;  3OE7 G;  3LDE A;  4G28 B;  2GHY A;  3ABK B;  4L87 A;  2B5U A;  4P30 A;  5GW7 A;  3LUT B;  3LSQ A;  1CEZ A;  3DTU B;  2ZR3 A;  1OCZ B;  3JD2 A;  3X2Q C;  1K4D C;  1MOF A;  1COW G;  1QR8 A;  1VQ7 V;  2EBO A;  2BOB C;  1YIT V;  1R3I C;  4H33 A;  3D3I A;  1WPX A;  1G8M A;  3CXC U;  3T1C A;  3ZIA G;  1SZT A;  1M56 B;  3P30 A;  2Z5U A;  1YI2 V;  1FXH A;  4ZBM A;  2EIK C;  3FB8 C;  3RVZ A;  3ASN B;  4GX2 A;  1GMG A;  1EFR G;  3E8B A;  3OAA G;  3AG1 C;  1MG1 A;  3ASO B;  3W7X A;  1RPR A;  4WFG A;  3JD4 A;  4MTX A;  2YEV A;  4MTG A;  2JEU A;  2JJ1 G;  4QPJ A;  1S72 V;  1NVP B;  2A9H A;  4X8A A;  1P4R A;  1NQT A;  3W7U A;  3FB5 C;  2JDI G;  5E1A C;  1AR1 B;  3D36 A;  3EHB B;  1AJP A;  2QM8 A;  2X6C A;  1BHB A;  4FPP A;  4MVR A;  4MT8 A;  2DYS B;  4XDL A;  3ZMT A;  4PDV A;  2XAG A;  1Q86 W;  1Q81 W;  1M57 B;  2WLK A;  1OZ0 A;  4XBF A;  1AI7 A;  2YSU B;  3ETG A;  4UXN A;  4BIZ A;  4UVC A;  4RUE A;  1K3E A;  3FKS G;  1JCH A;  1TUE B;  1GM7 A;  1FXV A;  3OR6 C;  3K08 A;  4PDL A;  3MD0 A;  3CCV V;  1XL4 A;  3JYC A;  1QLE B;  2WLJ A;  2OCC C;  2OTJ V;  3OMN B;  3ZRS A;  1PNM A;  3WFV A;  3JCZ A;  2OTL V;  1NR1 A;  3IC7 A;  2IH3 C;  2WLM A;  5EBM C;  1R6N A;  1VQO V;  1HWY A;  5BZB A;  4JTA B;  1KEC A;  3AG2 C;  3QO7 A;  5IYB O;  4U7N A;  1OCZ C;  1R3J C;  5CN0 A;  1JPX A;  5CMU A;  1S76 D;  2IU3 A;  2JK5 C;  5J9P C;  2X0L A;  3W7T A;  1M1K W;  4P9O A;  3FB7 C;  2ZDI C;  1BL8 A;  1K33 A;  2DQ0 A;  3SPH A;  1NVP D;  3MHH C;  3OUS A;  1MAB G;  1QCE A;  5H9C A;  3ASN C;  3IGA C;  1YTF B;  2NNU A;  4DO2 A;  3OGC C;  3ASO C;  4JYC A;  5HFL A;  2XAQ A;  1V54 C;  5KA6 A;  1NBM G;  2QE7 G;  3R65 A;  3SPC A;  2EIJ C;  2AHZ A;  1RPO A;  3CC4 V;  1R6K A;  3K03 A;  1OCO C;  2C2A A;  2DYR C;  4JYB A;  4KUM A;  3VOU A;  3CD6 V;  2B1G A;  5B1B B;  1OCC B;  4TWK A;  2WLH A;  1S0V A;  4MTF A;  3K0G A;  1EBO A;  1SET A;  4RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...