3UKMA

Crystal structure of the human two pore domain potassium ion channel k2p1 (twik-1)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
252
Chain Sequence
NSATMFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human two-pore domain potassium channel K2P1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Potassium channel subfamily K member 1
total genus 99
structure length 252
sequence length 264
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ukmA01
3AG1C 4MTFA 4PDRA 4JTDB 4R6ZA 3K04A 4F4LA 4QE9A 3E8GA 4QNHB 4MVRA 4P2ZA 3IFXA 2AHZA 3E8FA 4RO2A 3RW0A 4EKWA 3E89A 3K0GA 4JTCB 5B1AC 3T1CA 4MTOA 3TETA 4CBCA 1R3JC 2DWDC 2HG5C 5EBMC 3RBZA 3SYOA 2A0LA 3E86A 4WFFA 1JVMA 4J9YB 3ZRSA 1ZWIC 5CBFA 3KG2A 3FB7C 4G27B 2P7TC 3EFFK 4MSWC 1M56C 2WLLB 3GB7C 3AG2C 3OGCC 3X2QC 4MVUA 3OR6C 4X89A 3AG3C 4P30A 3LUTB 4PA4A 2QKSA 2EIKC 1OCOC 2QTOA 4GX0A 4JTAB 4OXSA 3FB6C 4G28B 2Q6AA 5B1BC 5E1AC 1K4CC 3E83A 3F5WC 4GX1A 2WLIA 4MVZA 4DXWA 3STZC 2Q68A 2DYRC 2EIJC 5CBGA 2WLHA 2KB1A 3SYQA 5IY5C 4J9ZB 4PDMA 4X88A 1R3IC 4ZBMA 3LDDA 4MW3A 4RUEA 2HJFC 3SYAA 4R7CA 5EK0A 3WG7C 2OCCC 2R9RB 2DWEC 1QLEC 1G4YB 2ZXWC 2HFEC 4BW5A 2WLKA 4MVQA 1K4DC 3RVZA 3T4DA 1OCRC 1OCCC 3ASNC 4MS2A 4R8CA 5KUKA 1R3KC 2IH1C 3UM7A 4TWKA 3ZJZA 2Q67A 1XL4A 3OUSA 4GX5A 2EINC 4LBEC 3JYCA 3AG4C 4KFMA 4PA6A 4PDLA 4RAIA 3SPGA 2IH3C 1M57C 4GX2A 4P9OA 3K03A 2ZD9A 4MVOA 3UKMA 4PA3A 5EBLC 3R65A 5EC2C 1BL8A 2X6AA 1P7BA 2Q69A 4PA9A 1ORQC 2ITCC 3K06A 4UUJC 4WFHA 4LCUC 3STLC 5B3SC 1J95A 4R50A 5EBWC 2WLLA 3VOUA 1OCZC 2WLJA 2ITDC 3F7YC 3HPLC 2X6BA 3T2MA 3E8BA 3OR7C 3K08A 4HZ3A 4P9PA 4WFGA 4XDJA 3E8HA 5KUMA 2NLJC 2HVKC 4PA7A 4RUFA 2DYSC 2W0FC 2WLNA 3SYPA 4QE7A 2X6CA 2EIMC 4MTGA 3ABMC 3PJSK 5EC1C 2AHYA 4XDLA 1XL6A 2EILC 3RVYA 4MVSA 3SJQC 2A79B 3FB8C 4LP8A 3SPIA 5CBHA 4WFEA 5J9PC 5BZBA 2H8PC 3K0DA 3F7VC 3SPHA 3OUFA 2JK5C 3ABKC 4H37A 3BEHA 3TCUA 4HYOA 2Y69C 2YEVA 3SYCA 1S5HC 1R3LC 3LDEA 2WLIB 2BOBC 4MVMA 2K1EA 3ASOC 2WLMA 3SPCA 3LNMB 3LDCA 4XDKA 3SPJA 4X8AA 3IGAC 1KKDA 1V55C 1LNQA 2BOCC 2HVJC 2ATKC 4H33A 4I9WA 3FB5C 4PDVA 1V54C 2A9HA 4MW8A 3T4ZA 3ABLC
chains in the Genus database with same CATH superfamily
5LOVA 1KQSU 2ZNIA 4PI2A 3K58A 1OZ0A 2B5UA 4X1YB 5DECA 5B1AC 2DQ0A 1RP3B 1N0JA 3E35A 2DQ3A 2CTRA 3A2FA 1JX9A 2JGUA 4NXMB 5CBFA 2AW9A 2VWKA 2P7TC 2XTAA 4NXNO 4DV6O 1YHQV 5L3DA 3K5MA 4B3RO 4UCVA 1WP8A 2RDCA 2W6JG 1R6TA 4PDMA 1WLEA 2R9AA 3RYHB 3ABKB 1YJWV 4BAYA 1FS0G 2RJZA 3RGBA 2ZCEA 5B66Z 5D5PA 4FZ0A 4X66O 3ABMB 4LBEC 3CB2A 3CJHA 2LJ2A 1GAXA 4CH4A 2P6JA 2QM4A 1J95A 4GT1A 2ADQB 3HB3B 1S5LZ 2W6IG 3CC4V 3K3WA 1VMGA 3CHXA 2JDIG 1KMIZ 4LFCO 5JJEB 1XNRB 3SPIA 3VQYA 3ETEA 2ZDIA 3OUFA 3TCUA 1I5YA 1HR0O 3SPJA 5GTHZ 4PI0A 4ZI7A 4TV8A 4CC5A 4J7KA 4LF4O 1E79G 2Q7EA 2JVDA 4R7CA 3T4ZA 3AK2A 5IDJA 3GVMA 1K8AW 3MHHC 1IBLB 1ROPA 3N27A 3RYFB 2CK3G 3JAKA 3OW2U 1JVMA 2LW7A 4UVAA 5IJ0B 4I5SA 2ZIMA 4X89A 3TJTA 5BR8O 4I7ZB 4DV1O 2BE3A 3FAVA 3FB6C 3CXHF 5B1BC 1XHXA 1AVMA 1QU7A 1XMQB 3F5WC 2EIJC 1DF5A 1VP7A 4AHCA 5F2VO 4GUNA 3ZX6A 2D3OW 2OTJV 2CAZC 2ZXWC 1I08A 2PYJA 2CGOA 1WB8A 3ZRXA 1F7YA 4DV2O 5IJ9A 1BQ0A 2KSDA 4X1IB 1MG1A 1ZSPA 1AP6A 2Q69A 4R50A 2ODMA 4N23A 2WLJA 2QWQB 2KKWA 3OR7C 5LYJB 3WFVA 4RUFA 3AG4B 4EB6A 2H3OA 4YJ2B 5L3EA 4MTGA 1AI7A 1RPOA 2Q73A 3CRAA 4B3TB 3FB8C 3FAVB 3AK3A 4LF5O 3ZEDA 1NS1A 1GTOA 4IL6Z 2CTQA 3BEHA 2BSKB 1R3LC 4JI0O 5DEDA 5IJ0A 4X8AA 4DRXB 2BOCC 4CC6A 5LHHA 4F6EA 4CZZA 3SR2C 1KBHA 1SQPH 3UO3A 4MVRA 1IBMB 4EKWA 4RWUA 5HFLA 1NQTA 1YJ9V 2VQFO 1WPXA 3CMEV 4YJ3B 5KA5A 1S77D 5C8YA 3NR7A 3GWKC 1RM1C 1FFTB 3GB7C 1NI8A 3X2QC 3JSNA 1AB3A 3ZHUA 3JAWA 3BAAA 3K5OA 4DUZB 1DK1A 2QKCA 2Q7HA 2Q68A 2P06A 4DYLA 5B3SB 5IYCO 2QSAA 2E74B 2N05A 4JV5O 5CMUA 3C3TA 3H1IH 4X20B 2YEVB 1XNRO 4EB6B 1G4YB 1K33A 4IT5A 2F93B 1OCOB 3ASNC 3ZN1A 4B3RB 4FM1A 1FXVA 2EINC 1IXMA 2ZR2A 4Z2WA 2ZD9A 3SJBC 4X9QA 2ZKOA 2UXDB 1XMOO 1F23A 1B6QA 3CJHB 2WLLA 4B3SO 1THZA 3F7YC 1Q90D 3E8BA 4JAAA 2HVKC 4DV3B 3OEHG 4UV8A 4XDLA 4AQYB 1XL6A 1MMMA 2UXDO 1H38A 4WFEA 3HR0A 1VQNV 4AI8A 4CH3A 4FPPA 3ZMSA 5FNVB 3OMAB 4DK1A 2WLMA 4E2LA 4LF5B 4O4IA 5FPOA 3DC5A 1VQPV 3JAWB 5FNVA 3H1KH 4MW8A 5KMGB 3ABLB 1NBMG 3E8GA 5IWAB 4JPRA 3T1CA 2HR3A 5KMGA 4CBCA 5EBMC 4DV6B 3T1YB 1M56B 5JWPA 1ZL8B 1BE3H 1ENVA 1VQ9V 4JAVA 2QJ1A 3RWRD 4U3FH 1P7GA 1ZX3A 4O4IB 4LF6B 1OJHA 4LWSB 3ZRWB 2W0XA 1JQ0A 4GKJO 1QVGU 5CN0A 3SYQA 2OIGA 4Z1MG 5IY5C 1IBMO 4X88A 2PY5A 2UUBB 1H8HG 1S0VA 4RUEA 4DR5O 4JI6O 4BW5A 3P32A 5KX5B 2WA3A 3T4DA 2QWOB 4B3SB 1FFXA 2R70A 3O9OA 2EILB 3ZS8C 1B04A 1OCCC 1SERA 4DV1B 1HDJA 1W0JG 2X7RB 1KP3A 1AJQA 3D36C 3APQA 3C90A 4MVOA 2QE7G 5FL7G 4PHZA 5LXTB 1VF6A 4X62O 1AI4A 4UCOA 1Q86W 4JI8O 1ZAUA 5JH7A 4OPHA 4P9PA 3L74H 4U7OA 2AZ0A 5LP6A 1XHZA 3IC9A 3CCSV 1BT8A 4JI3O 3BPZA 1N4CA 4MVSA 2DYSB 1XNQB 3SPHA 4X64B 1FFXB 2YEVA 2K1EA 4DR7B 5ITZA 1YIJV 2DYRB 2IJHA 2BSKA 2WSSG 4FLTA 1U96A 2PI5A 4JI2B 3QTCA 4ZHQB 2Q8VA 2PTMA 2OYQA 1KKCA 2YUAA 4JTCB 5AG2A 3L71H 3K5LA 1D5AA 1RSOA 1XREA 3N2GB 2G38A 3DGEA 1K34A 4H44B 3M7MX 4FFBA 4X1YA 4I4TB 2YIBA 3CS5A 3A0HZ 3EFFK 4LH7A 3OGCC 1UJWB 3ZHSA 5C8YB 4FFBB 1W0KG 1N36O 1GK9A 1XMOB 1V9PA 2IU0A 4HBNA 4O4HA 3RN4A 3W7UA 1J5EO 2HP8A 3CWBH 4DR2B 3RT3C 4JI5O 2EJRA 3ASOB 3HKEB 3D3QA 1GH6A 4L87A 1TUEB 4HAMA 4YIOA 5LYJA 1F51A 5LMUB 4FLWA 2XAFA 1I5XA 2Q4PA 4J7ZA 2RNBA 3HKBA 3CCEV 4DR1B 3K03A 4QPJA 4DR3O 2XNDG 5GONB 4BW9A 4LFCB 1ORQC 3K06A 4NTWA 1QBZA 4GLXA 1QNMA 2EULA 5CA1A 3OT7A 5FLXN 4Q20A 4UV9A 3SYPA 2B1IA 4JZ2A 4J42A 1GM8A 4JYCA 4EFEA 3H1JH 2EILC 1FAFA 2XT9A 5EYPA 5EZYB 2L6LA 5CB4B 2C2AA 3FFQA 1K5SA 2JRIA 4J11A 4DUYB 2Y0IA 4TUYB 4TV9B 1AJPA 3RFRA 1O9GA 5B1AB 1GN4A 2B1GA 3FB5C 4JGSA 2DMXA 3E89A 1S5JA 2N74A 4B7EA 3ZRVA 5A9GA 2AHZA 1SQXH 2CTWA 4DW1A 1M93A 3QO8A 1Q8IA 2YIDA 2XOKG 1FPOA 1YZBA 4XBFA 3CC2V 4G27B 3I56V 1YCIA 3JD4A 1T5EA 4IYHA 4F6RB 2QKSA 1Q82W 3T1HO 1WPBA 4FFKA 3UCSC 3CCLV 4X65B 3CSXA 1PNKA 3BY6A 2E5LO 3T1HB 4YIPA 2JGDB 4IGGA 5L3CA 3EHBB 5LGUA 1GN6A 3LSSA 1M57B 3N2KB 1AR4A 1SRYA 4BIUA 1JMKC 1XNQO 3J81N 1OCRB 1FD9A 3HKCB 2GV9A 4H0LB 2ARHA 3VBBA 2FMLA 3W7WA 1HWYA 4I0XA 2ZR3A 4LFAO 4LF7O 1TGOA 3UKMA 1WAZA 3STLC 4LR3A 4YY3B 2ZE6A 3VOUA 1MSWD 2ILMA 5KUMA 3SGIA 3LSUA 5JJJB 2AZ2A 4TV8B 3B8MA 5CA0B 2AHYA 3CE2A 3JASB 3RVYA 2H8PC 4RQFA 5KX5A 3QNEA 1BMFG 3UT5A 1PL4A 3QO7A 1JFFB 1YEWA 2WLIB 2BOBC 3KCXA 4DO2A 3SPCA 4JI4B 2Q9LA 4TSFG 3K5NA 1LNQA 4J7JA 4DR3B 3K9AA 4U3JA 5EIBD 1FJGB 3QG5A 1KB9F 4CH6A 3DTUB 5CA3A 3R66A 3K04A 1WP7A 4P2ZA 4FLUA 1VARA 1BQZA 5A2QN 3ABUA 4NKGB 3G80A 2IM9A 4ZIBA 2H94A 5LP6C 1P49A 2EZPA 1SZTA 1QHTA 1HR0B 1Q6HA 3OFNG 1EBOA 1TUBA 3MAQA 2P90A 2YIBD 2UU9B 1I7FA 5KAFZ 1MOFA 1WJZA 1EFRG 3E2EA 1H2SB 3CCVV 4K35A 5IE9A 1XUQA 1AILA 3LDDA 3B8NA 3WG7C 1VQLV 2DWEC 4LNUA 2IU3A 3OGIB 3U11A 2IH1C 1KUQA 4O4JA 3ZMUA 2BCCH 2OCCB 3AG4C 3JYCA 4KFMA 3JCUZ 1JFFA 1SESA 3AK1A 3KCYA 4ZKIA 3HPLC 2HLDG 4WFBV 1I94O 1L0LH 5J2TB 2DE0X 2GBOA 2Z0AA 5IJ9B 2ETNA 1HNWB 3JATA 1I0HA 1H2MA 3W7TA 5JCOC 4JI8B 4K3AA 2WAMA 5C93A 2A7WA 3ASOC 3LDCA 3L72H 1NR7A 1V55C 2HVJC 3HKEA 3J80N 3H9VA 4JI3B 3ZMZA 1G1XB 2HHHB 3ABLC 1YVWA 3IC7A 4PDRA 5JVDA 5LHGA 5B1BB 1E1RG 3ETQA 4JI5B 3IFXA 4RO2A 3BA9A 3ZHTA 1CP9A 4FVMA 4UFZA 2XAQA 3ABTA 1QR9A 4KHPB 1KP2A 2NNUA 2QGNA 4FLZA 2Y4TA 3BVOA 3FB7C 1SKVA 5IY5B 1SS3A 4ABMA 2WLLB 3FYIB 4X1IA 4RQEA 4GX0A 5J2TA 4X1KA 3CRMA 4FM0A 4YY3O 4KHPO 2QA4V 1NVPB 4DV2B 2YI9A 3DXRA 3VQXA 1K3EA 5KHKA 4X1KB 1R73A 1X59A 2DYRC 2WLHA 1CXZB 4YJ3A 1SETA 3W7XA 4ZOLB 4X20A 3JAMN 5LGNA 4PV1B 4JZGA 1H8EG 4DRXA 4PA6A 1N0NA 3U10A 4UUJC 5LP6B 5B3SC 4DV7O 4J80A 2UUAB 3T2MA 2X6BA 3OTOO 2E76B 3K08A 2VQFB 4LF9O 2P22C 4PA7A 2JJ1G 2WLNA 3BFRA 5LXTA 4YHHO 1LUVA 4CH5A 1OHHG 1SQVH 3ABMC 3QVNA 1VF7A 4QJFB 2XHBA 4JYBA 4LP8A 2QKAA 4X62B 4HNAA 5J2UA 2V7QG 1NT2B 2UXXA 3SYCA 3JD2A 2UXCO 4CS3A 4E4EA 2XAJA 1KECA 1V54C 3TGUH 3OMIB 1KYOF 3SJCC 2MK3A 2YXLA 3CYOA 2OTLV 3D8CA 5H6RA 5LHIA 4LF6O 1NTMH 2LGQA 3O65A 1VQ6V 3N2KA 1L0NH 1M56C 4MVUA 1Q81W 3LUTB 1P84F 3H1LH 5J2UB 1OCOC 1IXBA 1X4TA 4UVCA 4JI4O 2VRZA 5EZYA 5EYPB 1VIBA 4WFAV 3E83A 1Q6UA 1MZFA 3CCJV 2UXNA 2FYUH 1NU1H 3A0RA 5LOVB 2CGNA 3UO2A 2NN4A 4ZBMA 1YITV 4LF9B 4JI1O 3DC6A 4LF8O 2R9RB 1H2GA 1N32O 3IJ4A 3OMNB 2UUAO 2YS8A 5L3FA 2HJDA 3ZJZA 3UM7A 3P30A 4JI6B 3OUSA 4GX5A 2D2CB 3TK1A 5LBQA 1HP8A 3B77A 1XDCA 4MT8A 4UCTA 1MNGA 2X6AA 5IYBO 4WFHA 4FZ1A 1ZL8A 3FD9A 2EIJB 1SA0B 4NVPA 1TUBB 1Y76A 4I4TA 2B9ZA 1GM7A 1D5NA 1VQ8V 1E1QG 4PELA 3ASNB 1EZJA 5BMVB 4JI7O 4YXWG 3K0DA 1AR1B 4GYCB 2YICA 4FIPC 5B1OA 3HKDA 4FLVA 1FJGO 2ZNJA 1QR8A 3H1HH 4O4JB 3SDLA 1KKDA 2R9IA 3APOA 1IURA 1N34B 3AG1C 4U3JB 1VQMV 3VQWA 1W59A 2RQ6A 1PNLA 3B40A 3QO5A 4MTOA 4ICGA 3AG3B 2YC0A 3X2QB 3ZBHA 4O2BB 3E86A 3SJAC 3CP1A 2CDYA 3KG2A 3D36A 5JH7B 4IHJA 3TXSA 5HFMA 2Q7GA 3CRRA 5IYDO 4DK0A 2PYLA 1Y4MA 2FB5A 2OWOA 3JSLA 1IZ3A 1OV9A 2FL4A 2JS3A 2AGAA 1K92A 1Q6IA 2JEXA 4X66B 1N33B 1SQFA 5LMUO 4U7NA 4MW3A 2YXHA 3RYHA 2VQEO 1XILA 1JCHA 4O2BA 2DJVA 2EIMB 4NTXA 2GDSA 3SPGA 4RAIA 2NR5A 4D7TA 3EXAA 2GUZA 2BTQB 1EZVH 4O4HB 5BXZA 5KHIA 4I55B 1NVPD 1WA8B 1K5QA 2NLJC 1NKDA 1AR5A 1VQ4V 5D5QA 3G6BA 5KLVH 5TISZ 2Z5UA 2EIMC 2XUMA 4WBNB 1CPYA 2A3QA 2CUGA 2PI4A 4A5UB 1I94B 4JF3A 1SF9A 2P4VA 4XDKA 2UXBO 3K79A 1B3QA 3OAAG 4PDVA 2N04A 3OEEG 4JAUA 1VQ7V 4F6RA 3OD4A 4JYYA 1PKXA 1VF6C 3MD0A 2EIKB 5LA6B 2ZDIC 4UCSA 2ZE7A 2F66C 5CB4A 3E22A 5BY1A 1BZKA 3ZRSA 3ETGA 5EIBC 2KQXA 4Q6GA 5IYZA 3AG3C 2IW5A 4P30A 4PA4A 2GHYA 3TXQA 4G28B 4DUYO 4QPKA 3T1YO 2EJ7A 4DR4B 4DR1O 4CS2A 3HKDB 3FKSG 3STZC 5E79Z 3ZMTA 1H2KA 1YDXA 1Z5WA 5DN6G 1AJNA 2QM7A 4D7SA 2JS5A 4IYIA 1WA8A 1N8RW 2ZE8A 3JARB 2EINB 4GZRB 3KZIZ 3M99B 1BHBA 1AI6A 4JI7B 2F1MA 4DV4B 4PJ0Z 3RVZA 1IDSA 4DR6B 2MW2B 3I55V 4TUYA 4TV9A 3L75H 4WF9V 3THOA 3CPWU 1BL8A 2BTQA 4AQYO 1P7BA 4JI0B 1G8MA 4DV3O 1OCZC 4KP4A 1S72V 1TAEA 2P67A 3A8TA 1Q43A 3B2EE 5B1NA 4GCZA 3PJSK 5CA1B 2F95B 1K73W 1N32B 2F43G 2LFRA 5BR8B 3F7VC 1RM1B 2YIAA 2UXCB 3ZHQA 2JK5C 3WB1A 4LH6A 4MVMA 4X65O 4NTYA 1CEZA 2ATKC 1YSCA 5CA0A 3K9SA 4BIOA 5H2FZ 4K8ZA 4OX9B 1TVKA 1EN5A 2L35A 4F4LA 2UUCB 4W4KA 4QE9A 4JYAO 1M4UA 4X64O 1R1BA 1QVFU 1Y76B 1GRJA 1Z2GA 2HHHO 1VQKV 1W2BU 2E75B 3FX7A 4AILC 4DR4O 1KD1W 4WFFA 1VF5B 3AEIA 4G2KA 1ZWIC 2A06H 2CH7A 2YI8A 5H6QA 2VQEB 4O2AA 4DV4O 1YI2V 2LFSA 1DLBA 4UB8Z 1FKAO 5JQGA 5LMNB 2Q6AA 1J5EB 4B7KA 1DF4A 2V4DA 2WA4A 4KL1A 4MVZA 3UT5B 1IBLO 1U97A 2VWJA 1FXKA 1K9MW 1BSMA 4K0KO 3SYAA 1AI5A 3HKCA 1FXKC 3B4SA 2OCCC 2XAHA 1QLEC 4K8XA 4MVQA 1WB7A 4TQFA 1FXHA 3JALB 2OCHA 4MS2A 4R8CA 1LUWA 2Q67A 3J7AU 1D2DA 2EBOA 3JD1A 1RFYA 2YXYA 3E22B 4LF4B 3LNNA 4DV0O 4O4LB 1XMQO 5EC2C 4TQDA 4N21A 4PA9A 1JA8A 2KG7B 4DR2O 4DW0A 3ZHRA 1SA0A 1TVKB 1GN3A 2KG7A 4LF8B 2DYSC 2QEXV 2EZOA 1M5IA 4QE7A 1AP5A 2FTKA 2OIEA 3ZCCA 4LC1A 1SQGA 3ML0A 5DM6V 2IJIA 4UXNA 3JCZA 4GKKB 4KXRA 4PD4F 3QF7A 3JAKB 5L3BA 1YTFB 4B3MO 4LFBO 2OT5A 3H01A 4H37A 5GONA 4BIZA 4DXWA 2JEUA 4LWSA 2Q0OC 3ZRWA 3BA8A 5L3GA 4JI2O 4B3MB 5H5NA 4LF7B 4H33A 1NTZH 1QQCA 5BMVA 1M1KW 2LQTA 5LL6Y 3RW0A 4NR1A 1NTKH 3U0ZA 1R3JC 3RBZA 4JYAB 3D3IA 2GUZB 4QGPA 5IWAO 1QCEA 4EFBA 1ZUQA 2IJJA 2YDEA 1GM9A 2EX3A 2Q5ZA 4MSWC 2K9PA 2QTOA 3VQVA 1URFA 4OXSA 2RMKB 2ZXWB 5E1AC 3Q4HB 4DV0B 2RCVA 2V1DA 1Y67A 3S3WA 1BS3A 4OGQB 5CBGA 2QWNB 2LGWA 2FKXA 2P4KA 4ZI7B 4W4LA 1R3IC 3G71V 3CXCU 2AXTZ 3G67A 2HFEC 2PF4E 2UUBO 1OCRC 2QWRB 4TWKA 1PD3A 3WU2Z 2QDOA 4ZHQA 3G6EV 5EBLC 4O4LA 2ITCC 4DUZO 4O2AB 5LMNO 2IJKA 4NYKA 4TOIA 4I55A 4ZOLA 1IBKB 4XDJA 1RPRA 1IVSA 1KU9A 4L8JA 1Y6XA 3BHPA 3DXRB 1OCCB 3JASA 3L73H 1SZXA 2ZM6O 3DSQA 2Y69B 1ZTEA 5IT9N 1NH2D 1OCZB 4I50B 1S5HC 3IGAC 1PV0A 4I9WA 2UU9O 2A9HA 4FJCC 5KA6A 3K57A 4JTDB 4QNHB 3Q4HA 5KHGA 1V54B 3OTFA 2IBZH 4IHJB 2ZINA 4FM2A 4B3TO 2DWDC 3SYOA 3ZIAG 1FYJA 2HEPA 3BRCA 3RYIA 2QWPB 1N34O 3CRQA 1SQQH 3AG2C 1GN2A 1S76D 1L8DA 3F5TA 3GWOA 3RYCB 1H2LA 4I9QA 1DTOA 2Y48A 2WLIA 4CS4A 3AG2B 4MTXA 3L9DA 2UUCO 4J9ZB 1AROP 4DR6O 4OPAA 2HJFC 2ZE5A 4I50A 3JD0A 5K1XA 2WLKA 1XEQA 2CTPA 4FK5C 2E5LB 4FLXA 1BHAA 1HW7A 4JASA 1PP9H 1R3KC 2ZIOA 3P3PA 2Z3YA 1EN6A 2LP7A 3ZMVA 4P9OA 2ADPA 1YJNV 4KUMA 2GTAA 4UB6Z 4DR7O 4I0XB 3ETDA 2GSMB 3RYCA 1BCCH 4WFGA 3E8HA 5LGTA 2XASA 2W0FC 2BTOA 2X6CA 3CCQV 2XAGA 3LSQA 5EC1C 4NXMO 3JATB 2E3CA 4WCEV 3UQ8A 2A79B 1A32A 3CD6V 1JOYA 4YJ2A 1PL0A 4HYOA 2Y69C 4DV5O 3LDEA 1PNMA 4FMTA 2RN9A 4UVBA 1G6UA 5FPRA 1MSDA 1RSOB 2WPDG 4MTFA 4ASUG 2UXBB 3CEIA 1XQ8A 4DV7B 3HKBB 1QLNA 2LW1A 3E8FA 1EM1A 1XI1A 3K0GA 1IBKO 3KKYA 4IIJA 4EEQA 3TETA 4LNUB 3CCUV 2A0LA 4BR6A 3FYEB 5KAIZ 3EVKA 1GMGA 1P4RA 1ZLZA 3B09A 1M9NA 5GW7A 2ZM6B 3OR6C 3JALA 1SQBH 2R72A 1WN7A 2EIKC 4B08A 1SC5B 3CMAV 1L1FA 1K4CC 1XOUA 2CH7B 4GX1A 1KC8W 1S3JA 2JJ2G 4DR5B 3WB2A 2KB1A 1US6A 1MZEA 1Q7YW 1IX9A 3ZHVA 3CRCA 2M6YA 2DOSA 1K97A 5EK0A 5JQGB 1N33O 2P5OA 5JJNB 3M8AA 1NH2B 3I5DA 3K59A 3CCRV 2JIZG 1FXKB 2IH3C 2QM8A 4GX2A 1GKFA 4PA3A 3R65A 3MHSC 3PN1A 2DN9A 4UCRA 1O9HA 4HZ3A 1NR1A 5KHJA 2VS0A 5ITZB 4IIJB 1JPXA 1BGYH 1V55B 2F4VB 5J9PC 3NXSA 2YSUB 5BZBA 1COWG 3OE7G 1HNWO 2LO1A 2F23A 2Q0AA 2QR4A 4OX9O 5K1PA 4J10A 5JCOA 3CCMV 1HNXB 1Z5VA 1EN4A 5H9CA 3OTOB 3AG7A 3L70H 2HKOA 4TT3G 4R6ZA 1UPGA 3CX5F 4FLYA 5B5EZ 5JVDB 3ICXA 1JR9A 4BWAA 2HG5C 1Y66A 2ZQMA 3OM3B 3N2GA 4JV5B 1YTFD 2WWWA 4J9YB 4Z1VA 1Q3EA 1F4NA 3IAYA 2ZT9B 4J41A 4JTAB 1JJOA 1GO3F 5LA6A 2CE4A 1Q5OA 3AG1B 3WG7B 1WNSA 3WB0A 4K0KB 4JI1B 1LR1A 1VEWA 2JGDA 1R6NA 3MDSA 2Y0PA 3JD3A 4GKJB 1YF2A 2GTSA 1F4MA 4D6TH 4NXNB 1YXBA 1K4DC 1K7DA 3P3NA 4HNAB 1H2NA 3BABA 5KHHA 1TA8A 4DV5B 3W7SA 1N36B 1XL4A 2F4VO 4PDLA 2M7WA 1M57C 1MA1A 1UFIA 4H13B 2PZSA 1B06A 1R6KA 4LCUC 3RYFA 4YHHB 5EBWC 3ZN0A 5IYZB 1NZ6A 3C3SA 4LFBB 2ITDC 1Y74B 4UCUA 2Y4UA 3RYIB 1M90W 4GKKO 1HNZO 1HNXO 4QIWF 5GTIZ 1VQ5V 2DW4A 2PGGA 1Y74A 3CC7V 1PM9A 2PUSA 1JJ2U 3SJQC 1PPJH 5CBHA 4C7UA 1MABG 2O57A 1QLEB 3BCCH 4LFAB 1NJIW 3ABKC 3A0BZ 1XBLA 1DGSA 5KUKA 3JARA 4WBNA 3LNMB 1HNZB 4NB5A 2X0LA 2QTSA 3S3XA 3G4SV 1VQOV
chains in the Genus database with same CATH topology
1KQSU 1M1KW 1OZ0A 2B5UA 3RW0A 2MK3A 4JTCB 2DQ0A 5B1AC 3CYOA 3E35A 2OTLV 1R3JC 2DQ3A 3RBZA 5H6RA 5LHIA 3D3IA 1JX9A 3DGEA 1K34A 1QCEA 1VQ6V 5CBFA 2IJJA 1GM9A 2P7TC 3EFFK 4MSWC 1M56C 3OGCC 1YHQV 5L3DA 1UJWB 4MVUA 1Q81W 3LUTB 1W0KG 1OCOC 2QTOA 1GK9A 4OXSA 4UVCA 2ZXWB 5E1AC 2IU0A 4WFAV 3E83A 3CCJV 2V1DA 2UXNA 2W6JG 3W7UA 5CBGA 3A0RA 4PDMA 2EJRA 3ASOB 1WLEA 1R3IC 4ZBMA 1YITV 3G71V 3CXCU 3ABKB 1YJWV 2R9RB 4BAYA 1H2GA 2HFEC 3OMNB 1FS0G 1OCRC 4L87A 1TUEB 4HAMA 5L3FA 3ZJZA 3UM7A 3ABMB 4TWKA 1F51A 3P30A 1PD3A 3OUSA 4GX5A 4LBEC 2XAFA 3TK1A 5LBQA 3G6EV 1I5XA 3CCEV 3B77A 3K03A 4QPJA 2XNDG 4MT8A 5EBLC 2X6AA 2P6JA 5IYBO 1ORQC 2ITCC 3K06A 4WFHA 1QBZA 1J95A 2IJKA 4GT1A 2EIJB 3HB3B 4XDJA 4Q20A 1RPRA 4UV9A 3SYPA 2B1IA 1GM7A 2W6IG 1VQ8V 3CC4V 3K3WA 1GM8A 1E1QG 4PELA 3ASNB 4JYCA 1OCCB 2JDIG 2EILC 1EZJA 3SPIA 3ETEA 2ZDIA 4YXWG 3K0DA 2C2AA 1K5SA 3OUFA 1AR1B 3TCUA 4FIPC 2Y69B 5B1OA 1I5YA 1NH2D 1OCZB 1S5HC 3SPJA 1QR8A 1AJPA 3IGAC 1KKDA 2R9IA 5B1AB 1E79G 4I9WA 2B1GA 3FB5C 4JGSA 2A9HA 3E89A 4FJCC 4R7CA 3T4ZA 5IDJA 5KA6A 3AG1C 1VQMV 4JTDB 3ZRVA 4QNHB 1K8AW 1V54B 2AHZA 3MHHC 1PNLA 3QO5A 4MTOA 1ROPA 3AG3B 2DWDC 2CK3G 3X2QB 3QO8A 3SYOA 3ZIAG 3OW2U 3E86A 2XOKG 3CP1A 1JVMA 4UVAA 3KG2A 3D36A 4XBFA 3CC2V 4G27B 3I56V 3JD4A 5HFMA 3AG2C 4I5SA 5IYDO 4X89A 2QKSA 1Q82W 1Y4MA 3CCLV 1S76D 3FB6C 3GWOA 1PNKA 5B1BC 3BY6A 1K92A 1DTOA 3F5WC 2Y48A 2WLIA 2EIJC 2JEXA 3AG2B 5L3CA 1DF5A 4MTXA 3EHBB 5LGUA 4J9ZB 1AROP 4U7NA 3LSSA 1M57B 4MW3A 2HJFC 2D3OW 2OTJV 1SRYA 4BIUA 3JD0A 2ZXWC 1JCHA 2WLKA 4FK5C 1BHAA 1OCRB 4JASA 1R3KC 2EIMB 3VBBA 3SPGA 2Z3YA 1HWYA 4RAIA 3W7WA 3ZRXA 2ZR3A 2LP7A 4P9OA 3ZMVA 1YJNV 4KUMA 3UKMA 1MG1A 2Q69A 3STLC 4R50A 3ETDA 4N23A 3VOUA 2WLJA 2GSMB 1NVPD 1MSWD 3OR7C 1K5QA 4WFGA 5KUMA 3E8HA 2NLJC 3WFVA 2XASA 5LGTA 1NKDA 4RUFA 2W0FC 1VQ4V 3AG4B 5L3EA 2X6CA 2Z5UA 2EIMC 4MTGA 3CCQV 2XAGA 3LSQA 5EC1C 3B8MA 2AHYA 1AI7A 4WCEV 1RPOA 1CPYA 3RVYA 2A79B 3FB8C 3CD6V 1JOYA 2PI4A 2H8PC 4RQFA 3QNEA 1GTOA 1PL0A 1BMFG 3QO7A 3BEHA 4JF3A 4HYOA 2Y69C 3LDEA 1R3LC 2WLIB 2BOBC 4DO2A 1PNMA 3SPCA 4XDKA 4X8AA 4TSFG 3K79A 3OAAG 1LNQA 2BOCC 4FMTA 4UVBA 5LHHA 4PDVA 4CZZA 3K9AA 3OEEG 2WPDG 4MTFA 4ASUG 3DTUB 4JAUA 5CA3A 3K04A 1VQ7V 4MVRA 4P2ZA 1QLNA 4EKWA 1PKXA 3E8FA 3ABUA 5HFLA 1NQTA 3K0GA 3MD0A 1YJ9V 2EIKB 1WPXA 3CMEV 3TETA 2ZDIC 5KA5A 2H94A 1S77D 3CCUV 2A0LA 3ZRSA 3ETGA 3FYEB 1RM1C 1GMGA 1P4RA 1FFTB 1M9NA 3GB7C 5GW7A 3X2QC 3OR6C 3AG3C 2IW5A 4P30A 4PA4A 2EZPA 2EIKC 1SZTA 2GHYA 4G28B 4QPKA 3CMAV 3OFNG 1L1FA 1EBOA 1K4CC 2P90A 4GX1A 1KC8W 1S3JA 3FKSG 2Q68A 3STZC 3ZMTA 1MOFA 2JJ2G 1EFRG 5B3SB 2KB1A 5DN6G 5IYCO 1Q7YW 3E2EA 3CCVV 1AJNA 2QM7A 5CMUA 3LDDA 1N8RW 1K97A 3B8NA 5EK0A 3WG7C 1VQLV 2YEVB 2EINB 3M99B 1BHBA 2DWEC 1AI6A 1G4YB 1K33A 2IU3A 3RVZA 1NH2B 1OCOB 3ASNC 3ZN1A 2IH1C 3I55V 3CCRV 1FXVA 3ZMUA 2JIZG 2EINC 4WF9V 2OCCB 3AG4C 1IXMA 1FXKB 3JYCA 4KFMA 2ZR2A 2IH3C 2QM8A 4GX2A 1GKFA 2ZD9A 4PA3A 1SESA 3R65A 3CPWU 1BL8A 1P7BA 3MHSC 1G8MA 1F23A 1B6QA 2WLLA 4ZKIA 1OCZC 4KP4A 1THZA 3F7YC 3HPLC 2HLDG 4WFBV 1S72V 3E8BA 4HZ3A 2HVKC 1NR1A 2P67A 5B1NA 4GCZA 3OEHG 3PJSK 4UV8A 4XDLA 1XL6A 1JPXA 1H38A 1V55B 1K73W 4WFEA 3W7TA 2F43G 3NXSA 2YSUB 2LFRA 1COWG 3OE7G 5BZBA 5J9PC 3F7VC 1RM1B 4FPPA 3ZMSA 1VQNV 2JK5C 2WAMA 5C93A 3OMAB 4MVMA 3ASOC 2WLMA 3CCMV 3LDCA 1NR7A 4E2LA 1V55C 2HVJC 1CEZA 2ATKC 1VQPV 1YSCA 5H9CA 4MW8A 3ZMZA 3ABLC 3IC7A 4PDRA 2HKOA 5LHGA 4TT3G 4R6ZA 4F4LA 5B1BB 1E1RG 1NBMG 3ABLB 3E8GA 4QE9A 3IFXA 4RO2A 4JPRA 1QVFU 1CP9A 3T1CA 2XAQA 2HR3A 3ABTA 1VQKV 1QR9A 1W2BU 2PI5A 4CBCA 2HG5C 5EBMC 1KP2A 1Y66A 2ZQMA 1M56B 3OM3B 1KD1W 4WFFA 2NNUA 1YTFD 2WWWA 3AEIA 4J9YB 4G2KA 1ZWIC 3FB7C 5IY5B 5H6QA 1F4NA 2WLLB 1ENVA 1YI2V 2LFSA 1DLBA 1VQ9V 3FYIB 4RQEA 4GX0A 4JTAB 1GO3F 4JAVA 2Q6AA 1DF4A 2QA4V 1NVPB 3AG1B 3WG7B 1K3EA 3ZRWB 4MVZA 1R73A 1JQ0A 2DYRC 1QVGU 5CN0A 2WLHA 3SYQA 5IY5C 4Z1MG 1SETA 1FXKA 4X88A 3W7XA 1K9MW 1H8HG 1R6NA 1S0VA 4RUEA 3JD3A 3SYAA 1AI5A 1FXKC 2OCCC 2XAHA 5LGNA 1F4MA 1QLEC 4BW5A 4MVQA 3P32A 1K4DC 1K7DA 3T4DA 1FXHA 2EILB 1OCCC 1SERA 3W7SA 4MS2A 4R8CA 2Q67A 1H8EG 1W0JG 1XL4A 2X7RB 1KP3A 1AJQA 4PA6A 2EBOA 4PDLA 2M7WA 3JD1A 1M57C 4MVOA 2QE7G 5EC2C 5FL7G 4N21A 4UUJC 4PA9A 1R6KA 4LCUC 5B3SC 5EBWC 3ZN0A 2ITDC 1AI4A 3T2MA 2X6BA 1Q86W 4P9PA 3K08A 1M90W 4PA7A 2JJ1G 2DYSC 4U7OA 2WLNA 2QEXV 2EZOA 4QIWF 4QE7A 1VQ5V 2FTKA 2DW4A 4LC1A 3ML0A 1OHHG 3ZCCA 3ABMC 2IJIA 4UXNA 5DM6V 3CCSV 3CC7V 4QJFB 3JCZA 1JJ2U 4JYBA 4MVSA 3SJQC 4LP8A 5CBHA 2DYSB 1MABG 1QLEB 3SPHA 5L3BA 1YTFB 2OT5A 1NJIW 3ABKC 3H01A 4H37A 2V7QG 2UXXA 2YEVA 3SYCA 4BIZA 3JD2A 2JEUA 3ZRWA 4DXWA 5KUKA 2K1EA 5L3GA 3LNMB 2X0LA 1YIJV 4H33A 2DYRB 2IJHA 1KECA 2WSSG 1V54C 2XAJA 3G4SV 1VQOV 3OMIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG1 C;  4MTF A;  4PDR A;  4JTD B;  4R6Z A;  3K04 A;  4F4L A;  4QE9 A;  3E8G A;  4QNH B;  4MVR A;  4P2Z A;  3IFX A;  2AHZ A;  3E8F A;  4RO2 A;  3RW0 A;  4EKW A;  3E89 A;  3K0G A;  4JTC B;  5B1A C;  3T1C A;  4MTO A;  3TET A;  4CBC A;  1R3J C;  2DWD C;  2HG5 C;  5EBM C;  3RBZ A;  3SYO A;  2A0L A;  3E86 A;  4WFF A;  1JVM A;  4J9Y B;  3ZRS A;  1ZWI C;  5CBF A;  3KG2 A;  3FB7 C;  4G27 B;  2P7T C;  3EFF K;  4MSW C;  1M56 C;  2WLL B;  3GB7 C;  3AG2 C;  3OGC C;  3X2Q C;  4MVU A;  3OR6 C;  4X89 A;  3AG3 C;  4P30 A;  3LUT B;  4PA4 A;  2QKS A;  2EIK C;  1OCO C;  2QTO A;  4GX0 A;  4JTA B;  4OXS A;  3FB6 C;  4G28 B;  2Q6A A;  5B1B C;  5E1A C;  1K4C C;  3E83 A;  3F5W C;  4GX1 A;  2WLI A;  4MVZ A;  4DXW A;  3STZ C;  2Q68 A;  2DYR C;  2EIJ C;  5CBG A;  2WLH A;  2KB1 A;  3SYQ A;  5IY5 C;  4J9Z B;  4PDM A;  4X88 A;  1R3I C;  4ZBM A;  3LDD A;  4MW3 A;  4RUE A;  2HJF C;  3SYA A;  4R7C A;  5EK0 A;  3WG7 C;  2OCC C;  2R9R B;  2DWE C;  1QLE C;  1G4Y B;  2ZXW C;  2HFE C;  4BW5 A;  2WLK A;  4MVQ A;  1K4D C;  3RVZ A;  3T4D A;  1OCR C;  1OCC C;  3ASN C;  4MS2 A;  4R8C A;  5KUK A;  1R3K C;  2IH1 C;  3UM7 A;  4TWK A;  3ZJZ A;  2Q67 A;  1XL4 A;  3OUS A;  4GX5 A;  2EIN C;  4LBE C;  3JYC A;  3AG4 C;  4KFM A;  4PA6 A;  4PDL A;  4RAI A;  3SPG A;  2IH3 C;  1M57 C;  4GX2 A;  4P9O A;  3K03 A;  2ZD9 A;  4MVO A;  3UKM A;  4PA3 A;  5EBL C;  3R65 A;  5EC2 C;  1BL8 A;  2X6A A;  1P7B A;  2Q69 A;  4PA9 A;  1ORQ C;  2ITC C;  3K06 A;  4UUJ C;  4WFH A;  4LCU C;  3STL C;  5B3S C;  1J95 A;  4R50 A;  5EBW C;  2WLL A;  3VOU A;  1OCZ C;  2WLJ A;  2ITD C;  3F7Y C;  3HPL C;  2X6B A;  3T2M A;  3E8B A;  3OR7 C;  3K08 A;  4HZ3 A;  4P9P A;  4WFG A;  4XDJ A;  3E8H A;  5KUM A;  2NLJ C;  2HVK C;  4PA7 A;  4RUF A;  2DYS C;  2W0F C;  2WLN A;  3SYP A;  4QE7 A;  2X6C A;  2EIM C;  4MTG A;  3ABM C;  3PJS K;  5EC1 C;  2AHY A;  4XDL A;  1XL6 A;  2EIL C;  3RVY A;  4MVS A;  3SJQ C;  2A79 B;  3FB8 C;  4LP8 A;  3SPI A;  5CBH A;  4WFE A;  5J9P C;  5BZB A;  2H8P C;  3K0D A;  3F7V C;  3SPH A;  3OUF A;  2JK5 C;  3ABK C;  4H37 A;  3BEH A;  3TCU A;  4HYO A;  2Y69 C;  2YEV A;  3SYC A;  1S5H C;  1R3L C;  3LDE A;  2WLI B;  2BOB C;  4MVM A;  2K1E A;  3ASO C;  2WLM A;  3SPC A;  3LNM B;  3LDC A;  4XDK A;  3SPJ A;  4X8A A;  3IGA C;  1KKD A;  1V55 C;  1LNQ A;  2BOC C;  2HVJ C;  2ATK C;  4H33 A;  4I9W A;  3FB5 C;  4PDV A;  1V54 C;  2A9H A;  4MW8 A;  3T4Z A;  3ABL C; 
#chains in the Genus database with same CATH topology
 5LOV A;  1KQS U;  2ZNI A;  4PI2 A;  3K58 A;  1OZ0 A;  2B5U A;  4X1Y B;  5DEC A;  5B1A C;  2DQ0 A;  1RP3 B;  1N0J A;  3E35 A;  2DQ3 A;  2CTR A;  3A2F A;  1JX9 A;  2JGU A;  4NXM B;  5CBF A;  2AW9 A;  2VWK A;  2P7T C;  2XTA A;  4NXN O;  4DV6 O;  1YHQ V;  5L3D A;  3K5M A;  4B3R O;  4UCV A;  1WP8 A;  2RDC A;  2W6J G;  1R6T A;  4PDM A;  1WLE A;  2R9A A;  3RYH B;  3ABK B;  1YJW V;  4BAY A;  1FS0 G;  2RJZ A;  3RGB A;  2ZCE A;  5B66 Z;  5D5P A;  4FZ0 A;  4X66 O;  3ABM B;  4LBE C;  3CB2 A;  3CJH A;  2LJ2 A;  1GAX A;  4CH4 A;  2P6J A;  2QM4 A;  1J95 A;  4GT1 A;  2ADQ B;  3HB3 B;  1S5L Z;  2W6I G;  3CC4 V;  3K3W A;  1VMG A;  3CHX A;  2JDI G;  1KMI Z;  4LFC O;  5JJE B;  1XNR B;  3SPI A;  3VQY A;  3ETE A;  2ZDI A;  3OUF A;  3TCU A;  1I5Y A;  1HR0 O;  3SPJ A;  5GTH Z;  4PI0 A;  4ZI7 A;  4TV8 A;  4CC5 A;  4J7K A;  4LF4 O;  1E79 G;  2Q7E A;  2JVD A;  4R7C A;  3T4Z A;  3AK2 A;  5IDJ A;  3GVM A;  1K8A W;  3MHH C;  1IBL B;  1ROP A;  3N27 A;  3RYF B;  2CK3 G;  3JAK A;  3OW2 U;  1JVM A;  2LW7 A;  4UVA A;  5IJ0 B;  4I5S A;  2ZIM A;  4X89 A;  3TJT A;  5BR8 O;  4I7Z B;  4DV1 O;  2BE3 A;  3FAV A;  3FB6 C;  3CXH F;  5B1B C;  1XHX A;  1AVM A;  1QU7 A;  1XMQ B;  3F5W C;  2EIJ C;  1DF5 A;  1VP7 A;  4AHC A;  5F2V O;  4GUN A;  3ZX6 A;  2D3O W;  2OTJ V;  2CAZ C;  2ZXW C;  1I08 A;  2PYJ A;  2CGO A;  1WB8 A;  3ZRX A;  1F7Y A;  4DV2 O;  5IJ9 A;  1BQ0 A;  2KSD A;  4X1I B;  1MG1 A;  1ZSP A;  1AP6 A;  2Q69 A;  4R50 A;  2ODM A;  4N23 A;  2WLJ A;  2QWQ B;  2KKW A;  3OR7 C;  5LYJ B;  3WFV A;  4RUF A;  3AG4 B;  4EB6 A;  2H3O A;  4YJ2 B;  5L3E A;  4MTG A;  1AI7 A;  1RPO A;  2Q73 A;  3CRA A;  4B3T B;  3FB8 C;  3FAV B;  3AK3 A;  4LF5 O;  3ZED A;  1NS1 A;  1GTO A;  4IL6 Z;  2CTQ A;  3BEH A;  2BSK B;  1R3L C;  4JI0 O;  5DED A;  5IJ0 A;  4X8A A;  4DRX B;  2BOC C;  4CC6 A;  5LHH A;  4F6E A;  4CZZ A;  3SR2 C;  1KBH A;  1SQP H;  3UO3 A;  4MVR A;  1IBM B;  4EKW A;  4RWU A;  5HFL A;  1NQT A;  1YJ9 V;  2VQF O;  1WPX A;  3CME V;  4YJ3 B;  5KA5 A;  1S77 D;  5C8Y A;  3NR7 A;  3GWK C;  1RM1 C;  1FFT B;  3GB7 C;  1NI8 A;  3X2Q C;  3JSN A;  1AB3 A;  3ZHU A;  3JAW A;  3BAA A;  3K5O A;  4DUZ B;  1DK1 A;  2QKC A;  2Q7H A;  2Q68 A;  2P06 A;  4DYL A;  5B3S B;  5IYC O;  2QSA A;  2E74 B;  2N05 A;  4JV5 O;  5CMU A;  3C3T A;  3H1I H;  4X20 B;  2YEV B;  1XNR O;  4EB6 B;  1G4Y B;  1K33 A;  4IT5 A;  2F93 B;  1OCO B;  3ASN C;  3ZN1 A;  4B3R B;  4FM1 A;  1FXV A;  2EIN C;  1IXM A;  2ZR2 A;  4Z2W A;  2ZD9 A;  3SJB C;  4X9Q A;  2ZKO A;  2UXD B;  1XMO O;  1F23 A;  1B6Q A;  3CJH B;  2WLL A;  4B3S O;  1THZ A;  3F7Y C;  1Q90 D;  3E8B A;  4JAA A;  2HVK C;  4DV3 B;  3OEH G;  4UV8 A;  4XDL A;  4AQY B;  1XL6 A;  1MMM A;  2UXD O;  1H38 A;  4WFE A;  3HR0 A;  1VQN V;  4AI8 A;  4CH3 A;  4FPP A;  3ZMS A;  5FNV B;  3OMA B;  4DK1 A;  2WLM A;  4E2L A;  4LF5 B;  4O4I A;  5FPO A;  3DC5 A;  1VQP V;  3JAW B;  5FNV A;  3H1K H;  4MW8 A;  5KMG B;  3ABL B;  1NBM G;  3E8G A;  5IWA B;  4JPR A;  3T1C A;  2HR3 A;  5KMG A;  4CBC A;  5EBM C;  4DV6 B;  3T1Y B;  1M56 B;  5JWP A;  1ZL8 B;  1BE3 H;  1ENV A;  1VQ9 V;  4JAV A;  2QJ1 A;  3RWR D;  4U3F H;  1P7G A;  1ZX3 A;  4O4I B;  4LF6 B;  1OJH A;  4LWS B;  3ZRW B;  2W0X A;  1JQ0 A;  4GKJ O;  1QVG U;  5CN0 A;  3SYQ A;  2OIG A;  4Z1M G;  5IY5 C;  1IBM O;  4X88 A;  2PY5 A;  2UUB B;  1H8H G;  1S0V A;  4RUE A;  4DR5 O;  4JI6 O;  4BW5 A;  3P32 A;  5KX5 B;  2WA3 A;  3T4D A;  2QWO B;  4B3S B;  1FFX A;  2R70 A;  3O9O A;  2EIL B;  3ZS8 C;  1B04 A;  1OCC C;  1SER A;  4DV1 B;  1HDJ A;  1W0J G;  2X7R B;  1KP3 A;  1AJQ A;  3D36 C;  3APQ A;  3C90 A;  4MVO A;  2QE7 G;  5FL7 G;  4PHZ A;  5LXT B;  1VF6 A;  4X62 O;  1AI4 A;  4UCO A;  1Q86 W;  4JI8 O;  1ZAU A;  5JH7 A;  4OPH A;  4P9P A;  3L74 H;  4U7O A;  2AZ0 A;  5LP6 A;  1XHZ A;  3IC9 A;  3CCS V;  1BT8 A;  4JI3 O;  3BPZ A;  1N4C A;  4MVS A;  2DYS B;  1XNQ B;  3SPH A;  4X64 B;  1FFX B;  2YEV A;  2K1E A;  4DR7 B;  5ITZ A;  1YIJ V;  2DYR B;  2IJH A;  2BSK A;  2WSS G;  4FLT A;  1U96 A;  2PI5 A;  4JI2 B;  3QTC A;  4ZHQ B;  2Q8V A;  2PTM A;  2OYQ A;  1KKC A;  2YUA A;  4JTC B;  5AG2 A;  3L71 H;  3K5L A;  1D5A A;  1RSO A;  1XRE A;  3N2G B;  2G38 A;  3DGE A;  1K34 A;  4H44 B;  3M7M X;  4FFB A;  4X1Y A;  4I4T B;  2YIB A;  3CS5 A;  3A0H Z;  3EFF K;  4LH7 A;  3OGC C;  1UJW B;  3ZHS A;  5C8Y B;  4FFB B;  1W0K G;  1N36 O;  1GK9 A;  1XMO B;  1V9P A;  2IU0 A;  4HBN A;  4O4H A;  3RN4 A;  3W7U A;  1J5E O;  2HP8 A;  3CWB H;  4DR2 B;  3RT3 C;  4JI5 O;  2EJR A;  3ASO B;  3HKE B;  3D3Q A;  1GH6 A;  4L87 A;  1TUE B;  4HAM A;  4YIO A;  5LYJ A;  1F51 A;  5LMU B;  4FLW A;  2XAF A;  1I5X A;  2Q4P A;  4J7Z A;  2RNB A;  3HKB A;  3CCE V;  4DR1 B;  3K03 A;  4QPJ A;  4DR3 O;  2XND G;  5GON B;  4BW9 A;  4LFC B;  1ORQ C;  3K06 A;  4NTW A;  1QBZ A;  4GLX A;  1QNM A;  2EUL A;  5CA1 A;  3OT7 A;  5FLX N;  4Q20 A;  4UV9 A;  3SYP A;  2B1I A;  4JZ2 A;  4J42 A;  1GM8 A;  4JYC A;  4EFE A;  3H1J H;  2EIL C;  1FAF A;  2XT9 A;  5EYP A;  5EZY B;  2L6L A;  5CB4 B;  2C2A A;  3FFQ A;  1K5S A;  2JRI A;  4J11 A;  4DUY B;  2Y0I A;  4TUY B;  4TV9 B;  1AJP A;  3RFR A;  1O9G A;  5B1A B;  1GN4 A;  2B1G A;  3FB5 C;  4JGS A;  2DMX A;  3E89 A;  1S5J A;  2N74 A;  4B7E A;  3ZRV A;  5A9G A;  2AHZ A;  1SQX H;  2CTW A;  4DW1 A;  1M93 A;  3QO8 A;  1Q8I A;  2YID A;  2XOK G;  1FPO A;  1YZB A;  4XBF A;  3CC2 V;  4G27 B;  3I56 V;  1YCI A;  3JD4 A;  1T5E A;  4IYH A;  4F6R B;  2QKS A;  1Q82 W;  3T1H O;  1WPB A;  4FFK A;  3UCS C;  3CCL V;  4X65 B;  3CSX A;  1PNK A;  3BY6 A;  2E5L O;  3T1H B;  4YIP A;  2JGD B;  4IGG A;  5L3C A;  3EHB B;  5LGU A;  1GN6 A;  3LSS A;  1M57 B;  3N2K B;  1AR4 A;  1SRY A;  4BIU A;  1JMK C;  1XNQ O;  3J81 N;  1OCR B;  1FD9 A;  3HKC B;  2GV9 A;  4H0L B;  2ARH A;  3VBB A;  2FML A;  3W7W A;  1HWY A;  4I0X A;  2ZR3 A;  4LFA O;  4LF7 O;  1TGO A;  3UKM A;  1WAZ A;  3STL C;  4LR3 A;  4YY3 B;  2ZE6 A;  3VOU A;  1MSW D;  2ILM A;  5KUM A;  3SGI A;  3LSU A;  5JJJ B;  2AZ2 A;  4TV8 B;  3B8M A;  5CA0 B;  2AHY A;  3CE2 A;  3JAS B;  3RVY A;  2H8P C;  4RQF A;  5KX5 A;  3QNE A;  1BMF G;  3UT5 A;  1PL4 A;  3QO7 A;  1JFF B;  1YEW A;  2WLI B;  2BOB C;  3KCX A;  4DO2 A;  3SPC A;  4JI4 B;  2Q9L A;  4TSF G;  3K5N A;  1LNQ A;  4J7J A;  4DR3 B;  3K9A A;  4U3J A;  5EIB D;  1FJG B;  3QG5 A;  1KB9 F;  4CH6 A;  3DTU B;  5CA3 A;  3R66 A;  3K04 A;  1WP7 A;  4P2Z A;  4FLU A;  1VAR A;  1BQZ A;  5A2Q N;  3ABU A;  4NKG B;  3G80 A;  2IM9 A;  4ZIB A;  2H94 A;  5LP6 C;  1P49 A;  2EZP A;  1SZT A;  1QHT A;  1HR0 B;  1Q6H A;  3OFN G;  1EBO A;  1TUB A;  3MAQ A;  2P90 A;  2YIB D;  2UU9 B;  1I7F A;  5KAF Z;  1MOF A;  1WJZ A;  1EFR G;  3E2E A;  1H2S B;  3CCV V;  4K35 A;  5IE9 A;  1XUQ A;  1AIL A;  3LDD A;  3B8N A;  3WG7 C;  1VQL V;  2DWE C;  4LNU A;  2IU3 A;  3OGI B;  3U11 A;  2IH1 C;  1KUQ A;  4O4J A;  3ZMU A;  2BCC H;  2OCC B;  3AG4 C;  3JYC A;  4KFM A;  3JCU Z;  1JFF A;  1SES A;  3AK1 A;  3KCY A;  4ZKI A;  3HPL C;  2HLD G;  4WFB V;  1I94 O;  1L0L H;  5J2T B;  2DE0 X;  2GBO A;  2Z0A A;  5IJ9 B;  2ETN A;  1HNW B;  3JAT A;  1I0H A;  1H2M A;  3W7T A;  5JCO C;  4JI8 B;  4K3A A;  2WAM A;  5C93 A;  2A7W A;  3ASO C;  3LDC A;  3L72 H;  1NR7 A;  1V55 C;  2HVJ C;  3HKE A;  3J80 N;  3H9V A;  4JI3 B;  3ZMZ A;  1G1X B;  2HHH B;  3ABL C;  1YVW A;  3IC7 A;  4PDR A;  5JVD A;  5LHG A;  5B1B B;  1E1R G;  3ETQ A;  4JI5 B;  3IFX A;  4RO2 A;  3BA9 A;  3ZHT A;  1CP9 A;  4FVM A;  4UFZ A;  2XAQ A;  3ABT A;  1QR9 A;  4KHP B;  1KP2 A;  2NNU A;  2QGN A;  4FLZ A;  2Y4T A;  3BVO A;  3FB7 C;  1SKV A;  5IY5 B;  1SS3 A;  4ABM A;  2WLL B;  3FYI B;  4X1I A;  4RQE A;  4GX0 A;  5J2T A;  4X1K A;  3CRM A;  4FM0 A;  4YY3 O;  4KHP O;  2QA4 V;  1NVP B;  4DV2 B;  2YI9 A;  3DXR A;  3VQX A;  1K3E A;  5KHK A;  4X1K B;  1R73 A;  1X59 A;  2DYR C;  2WLH A;  1CXZ B;  4YJ3 A;  1SET A;  3W7X A;  4ZOL B;  4X20 A;  3JAM N;  5LGN A;  4PV1 B;  4JZG A;  1H8E G;  4DRX A;  4PA6 A;  1N0N A;  3U10 A;  4UUJ C;  5LP6 B;  5B3S C;  4DV7 O;  4J80 A;  2UUA B;  3T2M A;  2X6B A;  3OTO O;  2E76 B;  3K08 A;  2VQF B;  4LF9 O;  2P22 C;  4PA7 A;  2JJ1 G;  2WLN A;  3BFR A;  5LXT A;  4YHH O;  1LUV A;  4CH5 A;  1OHH G;  1SQV H;  3ABM C;  3QVN A;  1VF7 A;  4QJF B;  2XHB A;  4JYB A;  4LP8 A;  2QKA A;  4X62 B;  4HNA A;  5J2U A;  2V7Q G;  1NT2 B;  2UXX A;  3SYC A;  3JD2 A;  2UXC O;  4CS3 A;  4E4E A;  2XAJ A;  1KEC A;  1V54 C;  3TGU H;  3OMI B;  1KYO F;  3SJC C;  2MK3 A;  2YXL A;  3CYO A;  2OTL V;  3D8C A;  5H6R A;  5LHI A;  4LF6 O;  1NTM H;  2LGQ A;  3O65 A;  1VQ6 V;  3N2K A;  1L0N H;  1M56 C;  4MVU A;  1Q81 W;  3LUT B;  1P84 F;  3H1L H;  5J2U B;  1OCO C;  1IXB A;  1X4T A;  4UVC A;  4JI4 O;  2VRZ A;  5EZY A;  5EYP B;  1VIB A;  4WFA V;  3E83 A;  1Q6U A;  1MZF A;  3CCJ V;  2UXN A;  2FYU H;  1NU1 H;  3A0R A;  5LOV B;  2CGN A;  3UO2 A;  2NN4 A;  4ZBM A;  1YIT V;  4LF9 B;  4JI1 O;  3DC6 A;  4LF8 O;  2R9R B;  1H2G A;  1N32 O;  3IJ4 A;  3OMN B;  2UUA O;  2YS8 A;  5L3F A;  2HJD A;  3ZJZ A;  3UM7 A;  3P30 A;  4JI6 B;  3OUS A;  4GX5 A;  2D2C B;  3TK1 A;  5LBQ A;  1HP8 A;  3B77 A;  1XDC A;  4MT8 A;  4UCT A;  1MNG A;  2X6A A;  5IYB O;  4WFH A;  4FZ1 A;  1ZL8 A;  3FD9 A;  2EIJ B;  1SA0 B;  4NVP A;  1TUB B;  1Y76 A;  4I4T A;  2B9Z A;  1GM7 A;  1D5N A;  1VQ8 V;  1E1Q G;  4PEL A;  3ASN B;  1EZJ A;  5BMV B;  4JI7 O;  4YXW G;  3K0D A;  1AR1 B;  4GYC B;  2YIC A;  4FIP C;  5B1O A;  3HKD A;  4FLV A;  1FJG O;  2ZNJ A;  1QR8 A;  3H1H H;  4O4J B;  3SDL A;  1KKD A;  2R9I A;  3APO A;  1IUR A;  1N34 B;  3AG1 C;  4U3J B;  1VQM V;  3VQW A;  1W59 A;  2RQ6 A;  1PNL A;  3B40 A;  3QO5 A;  4MTO A;  4ICG A;  3AG3 B;  2YC0 A;  3X2Q B;  3ZBH A;  4O2B B;  3E86 A;  3SJA C;  3CP1 A;  2CDY A;  3KG2 A;  3D36 A;  5JH7 B;  4IHJ A;  3TXS A;  5HFM A;  2Q7G A;  3CRR A;  5IYD O;  4DK0 A;  2PYL A;  1Y4M A;  2FB5 A;  2OWO A;  3JSL A;  1IZ3 A;  1OV9 A;  2FL4 A;  2JS3 A;  2AGA A;  1K92 A;  1Q6I A;  2JEX A;  4X66 B;  1N33 B;  1SQF A;  5LMU O;  4U7N A;  4MW3 A;  2YXH A;  3RYH A;  2VQE O;  1XIL A;  1JCH A;  4O2B A;  2DJV A;  2EIM B;  4NTX A;  2GDS A;  3SPG A;  4RAI A;  2NR5 A;  4D7T A;  3EXA A;  2GUZ A;  2BTQ B;  1EZV H;  4O4H B;  5BXZ A;  5KHI A;  4I55 B;  1NVP D;  1WA8 B;  1K5Q A;  2NLJ C;  1NKD A;  1AR5 A;  1VQ4 V;  5D5Q A;  3G6B A;  5KLV H;  5TIS Z;  2Z5U A;  2EIM C;  2XUM A;  4WBN B;  1CPY A;  2A3Q A;  2CUG A;  2PI4 A;  4A5U B;  1I94 B;  4JF3 A;  1SF9 A;  2P4V A;  4XDK A;  2UXB O;  3K79 A;  1B3Q A;  3OAA G;  4PDV A;  2N04 A;  3OEE G;  4JAU A;  1VQ7 V;  4F6R A;  3OD4 A;  4JYY A;  1PKX A;  1VF6 C;  3MD0 A;  2EIK B;  5LA6 B;  2ZDI C;  4UCS A;  2ZE7 A;  2F66 C;  5CB4 A;  3E22 A;  5BY1 A;  1BZK A;  3ZRS A;  3ETG A;  5EIB C;  2KQX A;  4Q6G A;  5IYZ A;  3AG3 C;  2IW5 A;  4P30 A;  4PA4 A;  2GHY A;  3TXQ A;  4G28 B;  4DUY O;  4QPK A;  3T1Y O;  2EJ7 A;  4DR4 B;  4DR1 O;  4CS2 A;  3HKD B;  3FKS G;  3STZ C;  5E79 Z;  3ZMT A;  1H2K A;  1YDX A;  1Z5W A;  5DN6 G;  1AJN A;  2QM7 A;  4D7S A;  2JS5 A;  4IYI A;  1WA8 A;  1N8R W;  2ZE8 A;  3JAR B;  2EIN B;  4GZR B;  3KZI Z;  3M99 B;  1BHB A;  1AI6 A;  4JI7 B;  2F1M A;  4DV4 B;  4PJ0 Z;  3RVZ A;  1IDS A;  4DR6 B;  2MW2 B;  3I55 V;  4TUY A;  4TV9 A;  3L75 H;  4WF9 V;  3THO A;  3CPW U;  1BL8 A;  2BTQ A;  4AQY O;  1P7B A;  4JI0 B;  1G8M A;  4DV3 O;  1OCZ C;  4KP4 A;  1S72 V;  1TAE A;  2P67 A;  3A8T A;  1Q43 A;  3B2E E;  5B1N A;  4GCZ A;  3PJS K;  5CA1 B;  2F95 B;  1K73 W;  1N32 B;  2F43 G;  2LFR A;  5BR8 B;  3F7V C;  1RM1 B;  2YIA A;  2UXC B;  3ZHQ A;  2JK5 C;  3WB1 A;  4LH6 A;  4MVM A;  4X65 O;  4NTY A;  1CEZ A;  2ATK C;  1YSC A;  5CA0 A;  3K9S A;  4BIO A;  5H2F Z;  4K8Z A;  4OX9 B;  1TVK A;  1EN5 A;  2L35 A;  4F4L A;  2UUC B;  4W4K A;  4QE9 A;  4JYA O;  1M4U A;  4X64 O;  1R1B A;  1QVF U;  1Y76 B;  1GRJ A;  1Z2G A;  2HHH O;  1VQK V;  1W2B U;  2E75 B;  3FX7 A;  4AIL C;  4DR4 O;  1KD1 W;  4WFF A;  1VF5 B;  3AEI A;  4G2K A;  1ZWI C;  2A06 H;  2CH7 A;  2YI8 A;  5H6Q A;  2VQE B;  4O2A A;  4DV4 O;  1YI2 V;  2LFS A;  1DLB A;  4UB8 Z;  1FKA O;  5JQG A;  5LMN B;  2Q6A A;  1J5E B;  4B7K A;  1DF4 A;  2V4D A;  2WA4 A;  4KL1 A;  4MVZ A;  3UT5 B;  1IBL O;  1U97 A;  2VWJ A;  1FXK A;  1K9M W;  1BSM A;  4K0K O;  3SYA A;  1AI5 A;  3HKC A;  1FXK C;  3B4S A;  2OCC C;  2XAH A;  1QLE C;  4K8X A;  4MVQ A;  1WB7 A;  4TQF A;  1FXH A;  3JAL B;  2OCH A;  4MS2 A;  4R8C A;  1LUW A;  2Q67 A;  3J7A U;  1D2D A;  2EBO A;  3JD1 A;  1RFY A;  2YXY A;  3E22 B;  4LF4 B;  3LNN A;  4DV0 O;  4O4L B;  1XMQ O;  5EC2 C;  4TQD A;  4N21 A;  4PA9 A;  1JA8 A;  2KG7 B;  4DR2 O;  4DW0 A;  3ZHR A;  1SA0 A;  1TVK B;  1GN3 A;  2KG7 A;  4LF8 B;  2DYS C;  2QEX V;  2EZO A;  1M5I A;  4QE7 A;  1AP5 A;  2FTK A;  2OIE A;  3ZCC A;  4LC1 A;  1SQG A;  3ML0 A;  5DM6 V;  2IJI A;  4UXN A;  3JCZ A;  4GKK B;  4KXR A;  4PD4 F;  3QF7 A;  3JAK B;  5L3B A;  1YTF B;  4B3M O;  4LFB O;  2OT5 A;  3H01 A;  4H37 A;  5GON A;  4BIZ A;  4DXW A;  2JEU A;  4LWS A;  2Q0O C;  3ZRW A;  3BA8 A;  5L3G A;  4JI2 O;  4B3M B;  5H5N A;  4LF7 B;  4H33 A;  1NTZ H;  1QQC A;  5BMV A;  1M1K W;  2LQT A;  5LL6 Y;  3RW0 A;  4NR1 A;  1NTK H;  3U0Z A;  1R3J C;  3RBZ A;  4JYA B;  3D3I A;  2GUZ B;  4QGP A;  5IWA O;  1QCE A;  4EFB A;  1ZUQ A;  2IJJ A;  2YDE A;  1GM9 A;  2EX3 A;  2Q5Z A;  4MSW C;  2K9P A;  2QTO A;  3VQV A;  1URF A;  4OXS A;  2RMK B;  2ZXW B;  5E1A C;  3Q4H B;  4DV0 B;  2RCV A;  2V1D A;  1Y67 A;  3S3W A;  1BS3 A;  4OGQ B;  5CBG A;  2QWN B;  2LGW A;  2FKX A;  2P4K A;  4ZI7 B;  4W4L A;  1R3I C;  3G71 V;  3CXC U;  2AXT Z;  3G67 A;  2HFE C;  2PF4 E;  2UUB O;  1OCR C;  2QWR B;  4TWK A;  1PD3 A;  3WU2 Z;  2QDO A;  4ZHQ A;  3G6E V;  5EBL C;  4O4L A;  2ITC C;  4DUZ O;  4O2A B;  5LMN O;  2IJK A;  4NYK A;  4TOI A;  4I55 A;  4ZOL A;  1IBK B;  4XDJ A;  1RPR A;  1IVS A;  1KU9 A;  4L8J A;  1Y6X A;  3BHP A;  3DXR B;  1OCC B;  3JAS A;  3L73 H;  1SZX A;  2ZM6 O;  3DSQ A;  2Y69 B;  1ZTE A;  5IT9 N;  1NH2 D;  1OCZ B;  4I50 B;  1S5H C;  3IGA C;  1PV0 A;  4I9W A;  2UU9 O;  2A9H A;  4FJC C;  5KA6 A;  3K57 A;  4JTD B;  4QNH B;  3Q4H A;  5KHG A;  1V54 B;  3OTF A;  2IBZ H;  4IHJ B;  2ZIN A;  4FM2 A;  4B3T O;  2DWD C;  3SYO A;  3ZIA G;  1FYJ A;  2HEP A;  3BRC A;  3RYI A;  2QWP B;  1N34 O;  3CRQ A;  1SQQ H;  3AG2 C;  1GN2 A;  1S76 D;  1L8D A;  3F5T A;  3GWO A;  3RYC B;  1H2L A;  4I9Q A;  1DTO A;  2Y48 A;  2WLI A;  4CS4 A;  3AG2 B;  4MTX A;  3L9D A;  2UUC O;  4J9Z B;  1ARO P;  4DR6 O;  4OPA A;  2HJF C;  2ZE5 A;  4I50 A;  3JD0 A;  5K1X A;  2WLK A;  1XEQ A;  2CTP A;  4FK5 C;  2E5L B;  4FLX A;  1BHA A;  1HW7 A;  4JAS A;  1PP9 H;  1R3K C;  2ZIO A;  3P3P A;  2Z3Y A;  1EN6 A;  2LP7 A;  3ZMV A;  4P9O A;  2ADP A;  1YJN V;  4KUM A;  2GTA A;  4UB6 Z;  4DR7 O;  4I0X B;  3ETD A;  2GSM B;  3RYC A;  1BCC H;  4WFG A;  3E8H A;  5LGT A;  2XAS A;  2W0F C;  2BTO A;  2X6C A;  3CCQ V;  2XAG A;  3LSQ A;  5EC1 C;  4NXM O;  3JAT B;  2E3C A;  4WCE V;  3UQ8 A;  2A79 B;  1A32 A;  3CD6 V;  1JOY A;  4YJ2 A;  1PL0 A;  4HYO A;  2Y69 C;  4DV5 O;  3LDE A;  1PNM A;  4FMT A;  2RN9 A;  4UVB A;  1G6U A;  5FPR A;  1MSD A;  1RSO B;  2WPD G;  4MTF A;  4ASU G;  2UXB B;  3CEI A;  1XQ8 A;  4DV7 B;  3HKB B;  1QLN A;  2LW1 A;  3E8F A;  1EM1 A;  1XI1 A;  3K0G A;  1IBK O;  3KKY A;  4IIJ A;  4EEQ A;  3TET A;  4LNU B;  3CCU V;  2A0L A;  4BR6 A;  3FYE B;  5KAI Z;  3EVK A;  1GMG A;  1P4R A;  1ZLZ A;  3B09 A;  1M9N A;  5GW7 A;  2ZM6 B;  3OR6 C;  3JAL A;  1SQB H;  2R72 A;  1WN7 A;  2EIK C;  4B08 A;  1SC5 B;  3CMA V;  1L1F A;  1K4C C;  1XOU A;  2CH7 B;  4GX1 A;  1KC8 W;  1S3J A;  2JJ2 G;  4DR5 B;  3WB2 A;  2KB1 A;  1US6 A;  1MZE A;  1Q7Y W;  1IX9 A;  3ZHV A;  3CRC A;  2M6Y A;  2DOS A;  1K97 A;  5EK0 A;  5JQG B;  1N33 O;  2P5O A;  5JJN B;  3M8A A;  1NH2 B;  3I5D A;  3K59 A;  3CCR V;  2JIZ G;  1FXK B;  2IH3 C;  2QM8 A;  4GX2 A;  1GKF A;  4PA3 A;  3R65 A;  3MHS C;  3PN1 A;  2DN9 A;  4UCR A;  1O9H A;  4HZ3 A;  1NR1 A;  5KHJ A;  2VS0 A;  5ITZ B;  4IIJ B;  1JPX A;  1BGY H;  1V55 B;  2F4V B;  5J9P C;  3NXS A;  2YSU B;  5BZB A;  1COW G;  3OE7 G;  1HNW O;  2LO1 A;  2F23 A;  2Q0A A;  2QR4 A;  4OX9 O;  5K1P A;  4J10 A;  5JCO A;  3CCM V;  1HNX B;  1Z5V A;  1EN4 A;  5H9C A;  3OTO B;  3AG7 A;  3L70 H;  2HKO A;  4TT3 G;  4R6Z A;  1UPG A;  3CX5 F;  4FLY A;  5B5E Z;  5JVD B;  3ICX A;  1JR9 A;  4BWA A;  2HG5 C;  1Y66 A;  2ZQM A;  3OM3 B;  3N2G A;  4JV5 B;  1YTF D;  2WWW A;  4J9Y B;  4Z1V A;  1Q3E A;  1F4N A;  3IAY A;  2ZT9 B;  4J41 A;  4JTA B;  1JJO A;  1GO3 F;  5LA6 A;  2CE4 A;  1Q5O A;  3AG1 B;  3WG7 B;  1WNS A;  3WB0 A;  4K0K B;  4JI1 B;  1LR1 A;  1VEW A;  2JGD A;  1R6N A;  3MDS A;  2Y0P A;  3JD3 A;  4GKJ B;  1YF2 A;  2GTS A;  1F4M A;  4D6T H;  4NXN B;  1YXB A;  1K4D C;  1K7D A;  3P3N A;  4HNA B;  1H2N A;  3BAB A;  5KHH A;  1TA8 A;  4DV5 B;  3W7S A;  1N36 B;  1XL4 A;  2F4V O;  4PDL A;  2M7W A;  1M57 C;  1MA1 A;  1UFI A;  4H13 B;  2PZS A;  1B06 A;  1R6K A;  4LCU C;  3RYF A;  4YHH B;  5EBW C;  3ZN0 A;  5IYZ B;  1NZ6 A;  3C3S A;  4LFB B;  2ITD C;  1Y74 B;  4UCU A;  2Y4U A;  3RYI B;  1M90 W;  4GKK O;  1HNZ O;  1HNX O;  4QIW F;  5GTI Z;  1VQ5 V;  2DW4 A;  2PGG A;  1Y74 A;  3CC7 V;  1PM9 A;  2PUS A;  1JJ2 U;  3SJQ C;  1PPJ H;  5CBH A;  4C7U A;  1MAB G;  2O57 A;  1QLE B;  3BCC H;  4LFA B;  1NJI W;  3ABK C;  3A0B Z;  1XBL A;  1DGS A;  5KUK A;  3JAR A;  4WBN A;  3LNM B;  1HNZ B;  4NB5 A;  2X0L A;  2QTS A;  3S3X A;  3G4S V;  1VQO V; 
#chains in the Genus database with same CATH homology
 1KQS U;  1M1K W;  1OZ0 A;  2B5U A;  3RW0 A;  2MK3 A;  4JTC B;  2DQ0 A;  5B1A C;  3CYO A;  3E35 A;  2OTL V;  1R3J C;  2DQ3 A;  3RBZ A;  5H6R A;  5LHI A;  3D3I A;  1JX9 A;  3DGE A;  1K34 A;  1QCE A;  1VQ6 V;  5CBF A;  2IJJ A;  1GM9 A;  2P7T C;  3EFF K;  4MSW C;  1M56 C;  3OGC C;  1YHQ V;  5L3D A;  1UJW B;  4MVU A;  1Q81 W;  3LUT B;  1W0K G;  1OCO C;  2QTO A;  1GK9 A;  4OXS A;  4UVC A;  2ZXW B;  5E1A C;  2IU0 A;  4WFA V;  3E83 A;  3CCJ V;  2V1D A;  2UXN A;  2W6J G;  3W7U A;  5CBG A;  3A0R A;  4PDM A;  2EJR A;  3ASO B;  1WLE A;  1R3I C;  4ZBM A;  1YIT V;  3G71 V;  3CXC U;  3ABK B;  1YJW V;  2R9R B;  4BAY A;  1H2G A;  2HFE C;  3OMN B;  1FS0 G;  1OCR C;  4L87 A;  1TUE B;  4HAM A;  5L3F A;  3ZJZ A;  3UM7 A;  3ABM B;  4TWK A;  1F51 A;  3P30 A;  1PD3 A;  3OUS A;  4GX5 A;  4LBE C;  2XAF A;  3TK1 A;  5LBQ A;  3G6E V;  1I5X A;  3CCE V;  3B77 A;  3K03 A;  4QPJ A;  2XND G;  4MT8 A;  5EBL C;  2X6A A;  2P6J A;  5IYB O;  1ORQ C;  2ITC C;  3K06 A;  4WFH A;  1QBZ A;  1J95 A;  2IJK A;  4GT1 A;  2EIJ B;  3HB3 B;  4XDJ A;  4Q20 A;  1RPR A;  4UV9 A;  3SYP A;  2B1I A;  1GM7 A;  2W6I G;  1VQ8 V;  3CC4 V;  3K3W A;  1GM8 A;  1E1Q G;  4PEL A;  3ASN B;  4JYC A;  1OCC B;  2JDI G;  2EIL C;  1EZJ A;  3SPI A;  3ETE A;  2ZDI A;  4YXW G;  3K0D A;  2C2A A;  1K5S A;  3OUF A;  1AR1 B;  3TCU A;  4FIP C;  2Y69 B;  5B1O A;  1I5Y A;  1NH2 D;  1OCZ B;  1S5H C;  3SPJ A;  1QR8 A;  1AJP A;  3IGA C;  1KKD A;  2R9I A;  5B1A B;  1E79 G;  4I9W A;  2B1G A;  3FB5 C;  4JGS A;  2A9H A;  3E89 A;  4FJC C;  4R7C A;  3T4Z A;  5IDJ A;  5KA6 A;  3AG1 C;  1VQM V;  4JTD B;  3ZRV A;  4QNH B;  1K8A W;  1V54 B;  2AHZ A;  3MHH C;  1PNL A;  3QO5 A;  4MTO A;  1ROP A;  3AG3 B;  2DWD C;  2CK3 G;  3X2Q B;  3QO8 A;  3SYO A;  3ZIA G;  3OW2 U;  3E86 A;  2XOK G;  3CP1 A;  1JVM A;  4UVA A;  3KG2 A;  3D36 A;  4XBF A;  3CC2 V;  4G27 B;  3I56 V;  3JD4 A;  5HFM A;  3AG2 C;  4I5S A;  5IYD O;  4X89 A;  2QKS A;  1Q82 W;  1Y4M A;  3CCL V;  1S76 D;  3FB6 C;  3GWO A;  1PNK A;  5B1B C;  3BY6 A;  1K92 A;  1DTO A;  3F5W C;  2Y48 A;  2WLI A;  2EIJ C;  2JEX A;  3AG2 B;  5L3C A;  1DF5 A;  4MTX A;  3EHB B;  5LGU A;  4J9Z B;  1ARO P;  4U7N A;  3LSS A;  1M57 B;  4MW3 A;  2HJF C;  2D3O W;  2OTJ V;  1SRY A;  4BIU A;  3JD0 A;  2ZXW C;  1JCH A;  2WLK A;  4FK5 C;  1BHA A;  1OCR B;  4JAS A;  1R3K C;  2EIM B;  3VBB A;  3SPG A;  2Z3Y A;  1HWY A;  4RAI A;  3W7W A;  3ZRX A;  2ZR3 A;  2LP7 A;  4P9O A;  3ZMV A;  1YJN V;  4KUM A;  3UKM A;  1MG1 A;  2Q69 A;  3STL C;  4R50 A;  3ETD A;  4N23 A;  3VOU A;  2WLJ A;  2GSM B;  1NVP D;  1MSW D;  3OR7 C;  1K5Q A;  4WFG A;  5KUM A;  3E8H A;  2NLJ C;  3WFV A;  2XAS A;  5LGT A;  1NKD A;  4RUF A;  2W0F C;  1VQ4 V;  3AG4 B;  5L3E A;  2X6C A;  2Z5U A;  2EIM C;  4MTG A;  3CCQ V;  2XAG A;  3LSQ A;  5EC1 C;  3B8M A;  2AHY A;  1AI7 A;  4WCE V;  1RPO A;  1CPY A;  3RVY A;  2A79 B;  3FB8 C;  3CD6 V;  1JOY A;  2PI4 A;  2H8P C;  4RQF A;  3QNE A;  1GTO A;  1PL0 A;  1BMF G;  3QO7 A;  3BEH A;  4JF3 A;  4HYO A;  2Y69 C;  3LDE A;  1R3L C;  2WLI B;  2BOB C;  4DO2 A;  1PNM A;  3SPC A;  4XDK A;  4X8A A;  4TSF G;  3K79 A;  3OAA G;  1LNQ A;  2BOC C;  4FMT A;  4UVB A;  5LHH A;  4PDV A;  4CZZ A;  3K9A A;  3OEE G;  2WPD G;  4MTF A;  4ASU G;  3DTU B;  4JAU A;  5CA3 A;  3K04 A;  1VQ7 V;  4MVR A;  4P2Z A;  1QLN A;  4EKW A;  1PKX A;  3E8F A;  3ABU A;  5HFL A;  1NQT A;  3K0G A;  3MD0 A;  1YJ9 V;  2EIK B;  1WPX A;  3CME V;  3TET A;  2ZDI C;  5KA5 A;  2H94 A;  1S77 D;  3CCU V;  2A0L A;  3ZRS A;  3ETG A;  3FYE B;  1RM1 C;  1GMG A;  1P4R A;  1FFT B;  1M9N A;  3GB7 C;  5GW7 A;  3X2Q C;  3OR6 C;  3AG3 C;  2IW5 A;  4P30 A;  4PA4 A;  2EZP A;  2EIK C;  1SZT A;  2GHY A;  4G28 B;  4QPK A;  3CMA V;  3OFN G;  1L1F A;  1EBO A;  1K4C C;  2P90 A;  4GX1 A;  1KC8 W;  1S3J A;  3FKS G;  2Q68 A;  3STZ C;  3ZMT A;  1MOF A;  2JJ2 G;  1EFR G;  5B3S B;  2KB1 A;  5DN6 G;  5IYC O;  1Q7Y W;  3E2E A;  3CCV V;  1AJN A;  2QM7 A;  5CMU A;  3LDD A;  1N8R W;  1K97 A;  3B8N A;  5EK0 A;  3WG7 C;  1VQL V;  2YEV B;  2EIN B;  3M99 B;  1BHB A;  2DWE C;  1AI6 A;  1G4Y B;  1K33 A;  2IU3 A;  3RVZ A;  1NH2 B;  1OCO B;  3ASN C;  3ZN1 A;  2IH1 C;  3I55 V;  3CCR V;  1FXV A;  3ZMU A;  2JIZ G;  2EIN C;  4WF9 V;  2OCC B;  3AG4 C;  1IXM A;  1FXK B;  3JYC A;  4KFM A;  2ZR2 A;  2IH3 C;  2QM8 A;  4GX2 A;  1GKF A;  2ZD9 A;  4PA3 A;  1SES A;  3R65 A;  3CPW U;  1BL8 A;  1P7B A;  3MHS C;  1G8M A;  1F23 A;  1B6Q A;  2WLL A;  4ZKI A;  1OCZ C;  4KP4 A;  1THZ A;  3F7Y C;  3HPL C;  2HLD G;  4WFB V;  1S72 V;  3E8B A;  4HZ3 A;  2HVK C;  1NR1 A;  2P67 A;  5B1N A;  4GCZ A;  3OEH G;  3PJS K;  4UV8 A;  4XDL A;  1XL6 A;  1JPX A;  1H38 A;  1V55 B;  1K73 W;  4WFE A;  3W7T A;  2F43 G;  3NXS A;  2YSU B;  2LFR A;  1COW G;  3OE7 G;  5BZB A;  5J9P C;  3F7V C;  1RM1 B;  4FPP A;  3ZMS A;  1VQN V;  2JK5 C;  2WAM A;  5C93 A;  3OMA B;  4MVM A;  3ASO C;  2WLM A;  3CCM V;  3LDC A;  1NR7 A;  4E2L A;  1V55 C;  2HVJ C;  1CEZ A;  2ATK C;  1VQP V;  1YSC A;  5H9C A;  4MW8 A;  3ZMZ A;  3ABL C;  3IC7 A;  4PDR A;  2HKO A;  5LHG A;  4TT3 G;  4R6Z A;  4F4L A;  5B1B B;  1E1R G;  1NBM G;  3ABL B;  3E8G A;  4QE9 A;  3IFX A;  4RO2 A;  4JPR A;  1QVF U;  1CP9 A;  3T1C A;  2XAQ A;  2HR3 A;  3ABT A;  1VQK V;  1QR9 A;  1W2B U;  2PI5 A;  4CBC A;  2HG5 C;  5EBM C;  1KP2 A;  1Y66 A;  2ZQM A;  1M56 B;  3OM3 B;  1KD1 W;  4WFF A;  2NNU A;  1YTF D;  2WWW A;  3AEI A;  4J9Y B;  4G2K A;  1ZWI C;  3FB7 C;  5IY5 B;  5H6Q A;  1F4N A;  2WLL B;  1ENV A;  1YI2 V;  2LFS A;  1DLB A;  1VQ9 V;  3FYI B;  4RQE A;  4GX0 A;  4JTA B;  1GO3 F;  4JAV A;  2Q6A A;  1DF4 A;  2QA4 V;  1NVP B;  3AG1 B;  3WG7 B;  1K3E A;  3ZRW B;  4MVZ A;  1R73 A;  1JQ0 A;  2DYR C;  1QVG U;  5CN0 A;  2WLH A;  3SYQ A;  5IY5 C;  4Z1M G;  1SET A;  1FXK A;  4X88 A;  3W7X A;  1K9M W;  1H8H G;  1R6N A;  1S0V A;  4RUE A;  3JD3 A;  3SYA A;  1AI5 A;  1FXK C;  2OCC C;  2XAH A;  5LGN A;  1F4M A;  1QLE C;  4BW5 A;  4MVQ A;  3P32 A;  1K4D C;  1K7D A;  3T4D A;  1FXH A;  2EIL B;  1OCC C;  1SER A;  3W7S A;  4MS2 A;  4R8C A;  2Q67 A;  1H8E G;  1W0J G;  1XL4 A;  2X7R B;  1KP3 A;  1AJQ A;  4PA6 A;  2EBO A;  4PDL A;  2M7W A;  3JD1 A;  1M57 C;  4MVO A;  2QE7 G;  5EC2 C;  5FL7 G;  4N21 A;  4UUJ C;  4PA9 A;  1R6K A;  4LCU C;  5B3S C;  5EBW C;  3ZN0 A;  2ITD C;  1AI4 A;  3T2M A;  2X6B A;  1Q86 W;  4P9P A;  3K08 A;  1M90 W;  4PA7 A;  2JJ1 G;  2DYS C;  4U7O A;  2WLN A;  2QEX V;  2EZO A;  4QIW F;  4QE7 A;  1VQ5 V;  2FTK A;  2DW4 A;  4LC1 A;  3ML0 A;  1OHH G;  3ZCC A;  3ABM C;  2IJI A;  4UXN A;  5DM6 V;  3CCS V;  3CC7 V;  4QJF B;  3JCZ A;  1JJ2 U;  4JYB A;  4MVS A;  3SJQ C;  4LP8 A;  5CBH A;  2DYS B;  1MAB G;  1QLE B;  3SPH A;  5L3B A;  1YTF B;  2OT5 A;  1NJI W;  3ABK C;  3H01 A;  4H37 A;  2V7Q G;  2UXX A;  2YEV A;  3SYC A;  4BIZ A;  3JD2 A;  2JEU A;  3ZRW A;  4DXW A;  5KUK A;  2K1E A;  5L3G A;  3LNM B;  2X0L A;  1YIJ V;  4H33 A;  2DYR B;  2IJH A;  1KEC A;  2WSS G;  1V54 C;  2XAJ A;  3G4S V;  1VQO V;  3OMI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...