3UKMA

Crystal structure of the human two pore domain potassium ion channel k2p1 (twik-1)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
252
Chain Sequence
NSATMFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 1
publication title Crystal structure of the human two-pore domain potassium channel K2P1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 99
structure length 252
sequence length 264
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ukmA01
2A79B 2WLNA 1KKDA 2ATKC 3RVYA 3LUTB 4X88A 4WFFA 2IH1C 2DWEC 4MVMA 5B1AC 2KB1A 2HVKC 3FB5C 2OCCC 4H37A 4HZ3A 4R7CA 4JTAB 3VOUA 3T4DA 4XDJA 3T1CA 4MVQA 4XDKA 4CBCA 2DWDC 3UKMA 3RVZA 3SYAA 4MW8A 4G28B 4MVSA 3LDDA 2WLIA 3ZRSA 2WLKA 3UM7A 1V54C 3IGAC 4R8CA 3E89A 3F5WC 4QNHB 1OCOC 3E86A 1OCZC 2X6CA 5J9PC 5EK0A 2DYSC 3ASNC 2WLLB 2EIJC 2EINC 3OR6C 3ABLC 3R65A 4EKWA 5KUKA 2H8PC 2WLMA 3SPGA 2ITDC 1M57C 4MVZA 3K08A 3AG3C 1R3IC 4OXSA 3E8HA 4PA7A 1S5HC 4RAIA 2IH3C 2YEVA 3SPHA 3ZJZA 2Q6AA 3K0GA 1BL8A 2K1EA 2WLIB 4GX2A 4PA3A 4WFHA 3E8FA 1R3JC 2WLJA 3SYOA 3LDCA 4LP8A 3E83A 4X8AA 5KUMA 2A9HA 3WG7C 3OUFA 4HYOA 3SPIA 3FB8C 4P2ZA 2ZD9A 3TETA 4J9YB 3E8BA 1K4DC 3AG4C 1ZWIC 2BOCC 2X6BA 2Q67A 4JTCB 4UUJC 2EIKC 2Y69C 3ASOC 3FB7C 3K0DA 2BOBC 4P9OA 2HG5C 2W0FC 3OR7C 4MVOA 1R3LC 4ZBMA 2NLJC 2HFEC 5EBLC 4GX5A 3K06A 2AHZA 1K4CC 4MVRA 1JVMA 2DYRC 4WFGA 2X6AA 3RBZA 4PDRA 1XL6A 3IFXA 2WLHA 3T4ZA 4G27B 3SJQC 5EBWC 4PDLA 3SPCA 4XDLA 2JK5C 4MTOA 3F7YC 4MSWC 5E1AC 4I9WA 2ZXWC 4R6ZA 2EIMC 3STZC 1R3KC 4DXWA 1M56C 4MS2A 3X2QC 4BW5A 4PA6A 5BZBA 3T2MA 1OCCC 3RW0A 3E8GA 1ORQC 5CBHA 2Q69A 4H33A 3F7VC 4LCUC 3KG2A 1LNQA 3K03A 2QKSA 2EILC 3PJSK 4TWKA 4RUEA 5EBMC 2A0LA 2R9RB 2WLLA 3AG1C 1V55C 3FB6C 4GX0A 4P30A 4X89A 2ITCC 1QLEC 1G4YB 2HJFC 3EFFK 3K04A 4R50A 2P7TC 3STLC 4PA4A 2AHYA 3GB7C 4MTGA 4MTFA 5EC2C 4P9PA 3LNMB 4MW3A 1J95A 4GX1A 5IY5C 4QE7A 3ABMC 3ABKC 4MVUA 3TCUA 3OUSA 3JYCA 3OGCC 4RO2A 3SPJA 1P7BA 4JTDB 4PDMA 4KFMA 4LBEC 4WFEA 4QE9A 2HVJC 5EC1C 3SYPA 5B3SC 4PA9A 4RUFA 2QTOA 3AG2C 3SYQA 3HPLC 3BEHA 4F4LA 3SYCA 5B1BC 1OCRC 5CBGA 1XL4A 5CBFA 4J9ZB 4PDVA 3LDEA 2Q68A
chains in the Genus database with same CATH superfamily
4TUYA 1PNLA 1AB3A 2HVKC 4H37A 4HZ3A 4IHJB 3D3QA 1E79G 2PYLA 4DV1O 2NR5A 3CC4V 4ZHQB 2QM4A 1I0HA 3ZS8C 1M57B 1PM9A 3IC9A 3IGAC 3CCVV 1NBMG 3M99B 1I7FA 1FFXA 2CTWA 3G6BA 1KMIZ 4LF9B 1YJNV 3ABLC 3E22B 4DUZB 2UXDO 2WWWA 1PL4A 2NN4A 3SJCC 1YHQV 2QM8A 1Q82W 4KXRA 1KQSU 4UVAA 3LSSA 2JVDA 4DR2O 4LWSA 4B08A 2ZD9A 2HHHB 4JZ2A 4UXNA 2Q0AA 4F6RA 3C3SA 3VQWA 2NLJC 4GX5A 4MVRA 5KHGA 1XMQO 2CTRA 4FJCC 3CJHB 4KUMA 4D7SA 3CC7V 5J2UB 1KECA 4U3JA 4DV2B 4MS2A 2WAMA 2QKAA 1PKXA 5KA6A 4WBNB 3OEEG 4LF7B 4OX9O 2ARHA 4X9QA 2UXNA 2R9RB 5BR8O 5CB4B 1XBLA 1M5IA 2LJ2A 4LFCB 4JI6O 1VF7A 1NKDA 1YIJV 3CWBH 5E79Z 3CCUV 4DV7B 3HKDA 4WFEA 5JH7A 2YXLA 1ZLZA 5JCOC 3EHBB 3U10A 4CH3A 1EZJA 1WNSA 2E76B 3ICXA 1FXKA 3ABMB 3LDEA 4DYLA 1JJOA 4IIJB 4OPHA 1AJQA 2P5OA 1EFRG 1P4RA 3FX7A 5B66Z 3KCYA 5LBQA 4K0KB 5CA3A 5HFMA 4DR4B 2MK3A 4MVQA 1AI5A 1BT8A 2YIDA 4MVSA 3LDDA 2WLIA 3O65A 5EIBD 1SESA 3DC5A 3F5WC 4QNHB 4GYCB 1N0JA 1FKAO 1NH2D 3JD4A 4LFBO 3LNNA 3W7UA 5LOVA 2H8PC 3ZHRA 1VQMV 3ZRVA 5BMVA 4DV5B 2CUGA 5FNVB 4BR6A 2QM7A 5FPOA 1R6KA 1Q6UA 3TETA 1Q3EA 3AG4C 1BS3A 5IJ0A 3SJAC 4DR7B 1S77D 3N2KB 4CS2A 2AW9A 1RPOA 1KU9A 4NXNB 1VQOV 1K34A 1SQPH 4YIPA 4X1IB 2Y0IA 1TUBB 2ODMA 1N33O 2EJ7A 3F7YC 1EM1A 1L0LH 3JAKA 4R6ZA 1ZL8A 4I4TB 3BA9A 2ZR2A 2LQTA 3A2FA 3K03A 3K9SA 3PJSK 4LF4B 4O4JB 5AG2A 4LFAB 3TJTA 1VQ9V 4JV5O 2P90A 2P4VA 2ZQMA 1XQ8A 3ML0A 1LUWA 4KFMA 2CH7A 3CP1A 1S5JA 1VQ4V 3D8CA 4GZRB 3QVNA 2IH1C 4LNUB 1GM7A 2GHYA 4B7EA 2KB1A 1IVSA 3E22A 4EEQA 2KKWA 2N05A 3THOA 4XDJA 4Z1MG 3UM7A 4TV9B 2DW4A 3EVKA 2YI9A 4NTWA 3ZEDA 3ZMVA 4DRXB 4DR6O 4MVZA 1AR1B 1QHTA 2IBZH 4IYIA 2QJ1A 3SPHA 2UUAO 3S3WA 4PD4F 2ZINA 2EIKB 4JF3A 4LP8A 1P49A 2DYRB 1K4DC 1I94O 5J2UA 1N34O 3ASOC 1R3LC 2Q4PA 5IYBO 1HNWO 4XBFA 3OTFA 4N21A 1GMGA 1KC8W 5CB4A 4HAMA 1HR0O 4PDLA 4JI1O 3BAAA 4HNAB 1OHHG 5KX5B 1F51A 3OW2U 2AXTZ 4DR3O 3RYFB 4GKJO 4LC1A 3P30A 2UUCB 2PZSA 2WLLA 2GUZA 2QEXV 3CRCA 4ZIBA 5LMNO 3T4ZA 5B3SB 5EC2C 3X2QB 3CE2A 2WPDG 2YDEA 2EX3A 2PYJA 2FMLA 1WP8A 3DGEA 3L72H 2N04A 1XREA 1P7BA 1ENVA 1K5QA 1U97A 1AI4A 5C93A 2P6JA 3T1HO 3JD0A 5CBFA 3JD1A 1K9MW 2A79B 3LUTB 2EBOA 3A0RA 4EFEA 2OCCC 2OIGA 4AI8A 2LP7A 4JI3B 1GKFA 4LF5O 5FNVA 4NXMO 4TQFA 3QO5A 1M90W 1XNRB 2Q9LA 5FLXN 5J9PC 2UXBO 2F43G 1L1FA 1CP9A 1E1QG 3K9AA 1WAZA 3P3PA 1EN5A 3R65A 5KUKA 3M8AA 2DE0X 4O2AB 4FM0A 2HEPA 4X65B 3J81N 1NVPB 2PUSA 3OTOB 2EINB 5JJJB 2ZDIC 4B3MB 1SF9A 3FB8C 3OMIB 4X1IA 1CEZA 5FL7G 4YHHO 2E5LB 4TUYB 1FJGB 4LH6A 4QIWF 4KHPO 2QWRB 2P67A 4BW9A 3H1HH 1GRJA 1M56B 2XT9A 3CCJV 2YIBA 4UV9A 4O4JA 5HFLA 1NTKH 3RN4A 2N74A 2Z0AA 4MTOA 2H94A 2IJIA 1M1KW 2EIMC 1R3KC 4DUYO 2IJKA 1JOYA 3ABKB 2ZIMA 2XUMA 1VMGA 1QCEA 4P9PA 3K57A 4LNUA 1XDCA 1DF4A 3TCUA 3H1LH 4QPKA 1THZA 3K5NA 5B5EZ 1MSDA 1Q90D 2M6YA 3OT7A 2QTOA 1EZVH 4LF6B 2VQEO 3NR7A 1KKDA 1F4MA 3OD4A 1YSCA 3FB5C 2ZIOA 4DRXA 4U3JB 3T4DA 3BRCA 4G28B 4MW8A 2KSDA 1PV0A 4O4IA 4YY3O 2B9ZA 1MA1A 4PI2A 3I56V 4GKKO 4DR5B 1J5EO 3ZBHA 4QPJA 4JI4B 3AG7A 3AG3C 2F95B 3CX5F 4OXSA 1DTOA 1WP7A 2K1EA 4PA3A 3RYHB 2ZR3A 3HKDB 4NB5A 5JCOA 4X66O 5JH7B 4FLVA 1DK1A 3OUFA 5L3GA 1M9NA 3CXCU 4W4KA 1K92A 3L9DA 4P2ZA 2ZE5A 4J9YB 2UUBB 1ZSPA 1ZWIC 4FPPA 4X1KB 1IBLB 4HNAA 5KX5A 4JYAO 2F4VO 4K8XA 1S76D 2LGWA 1LR1A 1GTOA 1Q5OA 1K4CC 1F4NA 3RYFA 4WFGA 1QU7A 4PDRA 4X62O 3ZHUA 3QTCA 3CCMV 1FS0G 3VQYA 1Y76B 3D36A 1HP8A 1SQXH 4J80A 2JJ1G 2XAFA 4GCZA 4J10A 1H2NA 1IBKO 2JJ2G 3RGBA 3JCZA 2EILC 4I5SA 5CA0B 1I5YA 1GK9A 1V55C 4X89A 3OE7G 1JFFA 2ZXWB 1QLEC 4R50A 4DK1A 1GN6A 3FKSG 3ABMC 4DW0A 1FPOA 4JTDB 3AEIA 4ASUG 2YIBD 5D5QA 5IJ9B 2M7WA 2HLDG 5DN6G 1BGYH 3SDLA 3ZHSA 4UCTA 4J11A 1QVGU 3W7WA 2JGUA 1K97A 1TUEB 2CAZC 1TA8A 2DWEC 2JDIG 1YTFB 4R7CA 3CMEV 3CRMA 1SZTA 1XNQB 3JAKB 4O2AA 4JYCA 1XUQA 1WPBA 1GN3A 1V54C 2F1MA 3E89A 4UCRA 1S72V 1H2LA 1JMKC 3TK1A 3G71V 1HNXO 4O2BB 2EIJC 4RQEA 2WLMA 1R1BA 2MW2B 1PL0A 3APQA 2ILMA 3E8FA 1BSMA 3QG5A 1V9PA 3RYCB 2CH7B 4CS3A 1SQQH 1Y4MA 5FPRA 2RMKB 4LF9O 4DUZO 2BOCC 1W0JG 1JPXA 5BXZA 3OR7C 1CXZB 1SQBH 1B3QA 3JATB 1CPYA 2Y4TA 4DV4B 2WLHA 4L8JA 3ABTA 2JRIA 5H5NA 1OCCC 4JYYA 5GTIZ 2Q69A 3CC2V 3F7VC 4LCUC 3KG2A 1LNQA 2QKSA 5LHIA 2CTPA 3WB0A 4P30A 3EFFK 1GM9A 3K04A 1US6A 3Q4HB 2GTSA 1J95A 3FFQA 5L3FA 5B1BB 1OCRB 4DV2O 4FLZA 4BIUA 3CSXA 4LF7O 1RP3B 5EYPB 2AZ2A 4FFBB 1S3JA 1QBZA 2XAJA 5KHIA 4X88A 4FLXA 2OWOA 1QNMA 2ADQB 1N4CA 1ZUQA 2DMXA 1H38A 4X1YA 1IBMB 3RYHA 4PJ0Z 2UXCB 3LSUA 1OCOC 1Z2GA 2WLLB 2GUZB 2QWNB 4K0KO 3SPGA 4X1KA 4DR4O 1AJNA 2JEXA 2W6JG 3MAQA 2GDSA 4JI6B 1N32B 2F23A 5L3DA 1SKVA 5IE9A 2ZM6O 4JTCB 1Y76A 4D7TA 4CZZA 1NVPD 2HG5C 1N36B 2AZ0A 2YI8A 1RSOB 1K3EA 3ETDA 2A06H 2EULA 3B4SA 1TVKA 1VQLV 3A0HZ 4EFBA 5CA0A 1LUVA 4UCVA 4XDLA 2GTAA 1YEWA 2YS8A 4FZ0A 1H8EG 3FAVA 4YXWG 2ZT9B 3SGIA 3X2QC 5K1PA 4PHZA 1XMOB 2IU0A 3A8TA 4H33A 4NXNO 5IJ9A 3JASA 2XTAA 1IX9A 1E1RG 2ITCC 2ADPA 3B40A 3G80A 4N23A 4QE7A 5LXTB 2DQ3A 3GWKC 1H2SB 1SETA 4PDMA 4GLXA 3JARB 4QE9A 3AG1B 1WJZA 3HR0A 1O9GA 2X7RB 2VQFB 4LF4O 4TOIA 1ZX3A 2D3OW 3ABUA 5KLVH 1K73W 5ITZA 4LFAO 1L8DA 4D6TH 3JSNA 1EBOA 4O2BA 4IYHA 5EZYB 4XDKA 5GONB 4X20B 5EIBC 3SR2C 4WCEV 1NTMH 4JAVA 1PPJH 3U11A 1P84F 1AI7A 4CS4A 3RYCA 5LP6C 1VF6A 4FM2A 1H8HG 2EINC 5J2TA 3I55V 4H44B 3K08A 1S0VA 3OMAB 1Q6IA 2Q0OC 3BA8A 5GTHZ 3JATA 3ASNB 5KMGA 1IXBA 3L71H 1A32A 3ZMSA 4FLYA 3SPIA 4UCOA 3CYOA 2LFSA 4FIPC 4HBNA 4BAYA 3CCSV 3G67A 2Y69C 4YJ2A 4JPRA 1Y74A 1B6QA 2Y0PA 3ZMTA 1OZ0A 1XL6A 5TISZ 5JWPA 1WN7A 2F93B 4O4IB 1YJWV 5CMUA 2H3OA 3VBBA 4PI0A 2CE4A 3Q4HA 4PA6A 3FD9A 4K35A 5LA6B 2D2CB 4PELA 2W0XA 4UCUA 2LO1A 5EYPA 1NR1A 4FFBA 1Q7YW 4PA4A 4JAAA 3AK3A 1HNZO 2CGOA 2UUAB 5IY5C 3O9OA 4MVUA 5JVDB 1S5LZ 3OGCC 1M4UA 1UJWB 4WF9V 1EN4A 5DECA 2F66C 4DV6B 3CS5A 2QKCA 2UUCO 3OEHG 1AR4A 2C2AA 1OV9A 4J9ZB 2VWKA 2QA4V 1I94B 1NS1A 4WFFA 1HNWB 3H9VA 4I55A 4Q20A 3AG2B 4JI0B 1QR8A 3KCXA 4CBCA 4JI7B 1VQPV 4DV3B 4QGPA 4X64O 5LGNA 1JFFB 1YTFD 2CDYA 1VP7A 4DR3B 4PA7A 4LF8B 1FXKC 5LHGA 4JI3O 3AG4B 1OCZB 1RSOA 4TT3G 1XNRO 5IWAB 2JS5A 2X6BA 2XHBA 3WFVA 1VIBA 4JI2B 2YEVB 2W0FC 4X65O 4G2KA 4B7KA 2HP8A 3WG7B 3LSQA 2WA3A 1WLEA 2VS0A 4OGQB 4O4HB 1HDJA 4B3MO 5GW7A 2AGAA 1R6TA 3ZRWB 3P32A 1WB8A 2E5LO 4JI8B 2ZXWC 1FJGO 2E74B 5LXTA 4AQYO 4LF5B 4LR3A 2Z3YA 1NTZH 2ZE6A 3JARA 2Q7HA 2XAQA 3CB2A 4UB8Z 4GX0A 4FLUA 2P06A 2HJFC 4ZOLA 4DV0O 1XHXA 3OMNB 1QR9A 1VQKV 4U3FH 4B3RB 3A0BZ 1PD3A 3BVOA 5EZYA 4JI5B 5GONA 1MZFA 4X20A 4PA9A 4J42A 1MOFA 3UT5A 5A2QN 3OGIB 1RM1C 1W2BU 1PNKA 1HW7A 3MHHC 1SERA 4LH7A 1NQTA 3UKMA 2WA4A 4LF6O 2QGNA 3I5DA 3HKBB 3OR6C 4DUYB 1KYOF 3KZIZ 4TSFG 1M57C 3GVMA 1MZEA 3P3NA 1SZXA 1FAFA 3K0GA 1BE3H 1FYJA 2K9PA 1VF5B 2ZE7A 3ASOB 3WB1A 4X8AA 4HYOA 4DR5O 2ZNIA 3J80N 4JI4O 5BY1A 2BTOA 1D5NA 1NR7A 1YCIA 2LW7A 5LA6A 3T1YB 3CXHF 2IJHA 2X6AA 1TAEA 2VRZA 4TV8A 4X1YB 3AK2A 5B1NA 4Z2WA 1IXMA 3D3IA 3K5MA 2UUBO 2PGGA 3BCCH 1T5EA 1F23A 1QQCA 1IBLO 1MABG 5E1AC 2XASA 1B06A 4I9WA 5IDJA 5JVDA 2E75B 3ZHTA 4RUEA 2A0LA 3IC7A 3SJBC 2YC0A 1J5EB 3HKEA 3STLC 3UO3A 2ZE8A 1W59A 2BSKB 1Y67A 2RDCA 3JYCA 3OUSA 2RCVA 2RQ6A 1DLBA 1XEQA 3SYPA 4J7KA 2OCCB 3JALB 2QTSA 4RUFA 3HPLC 4H0LB 4CH5A 1VQ6V 4PDVA 2Q68A 4B3TB 2CK3G 1TVKB 3DXRB 2IJJA 2F4VB 4CC5A 2OIEA 2Y48A 2G38A 4B3SB 3K58A 3FAVB 1GO3F 3T1CA 3RYIA 3E2EA 5LMUB 1GN4A 1SRYA 4J7JA 5B1AB 5IYCO 3JASB 2UU9O 4NVPA 1K33A 3S3XA 1SQFA 2LW1A 4EKWA 4JZGA 4NTXA 1XNQO 1R3IC 2YEVA 3W7SA 4GX2A 2X0LA 2DYSB 2WLJA 5B1OA 4TQDA 4MTXA 3E83A 5KA5A 4FLTA 1KP2A 4O4HA 1OJHA 3CRAA 2LFRA 5ITZB 4U7NA 3K3WA 3ZRWA 2FB5A 4JAUA 4UB6Z 1I5XA 3K0DA 4F6EA 1SA0A 1BCCH 5KAIZ 1YXBA 5JJNB 2EIMB 2QWQB 4FK5C 2EZPA 1AVMA 4FM1A 1YJ9V 4PV1B 4DR1B 4FFKA 1WPXA 1VQNV 3G4SV 4RQFA 1YI2V 3QO7A 5J2TB 2CGNA 3B77A 1SS3A 4DV4O 1U96A 2Q7GA 1SQGA 3ETEA 1HNXB 3AG1C 1QLNA 1NZ6A 1WB7A 5KMGB 3FYIB 1YITV 1YZBA 3K5LA 2HHHO 1VQ8V 4RO2A 1Z5VA 1Q6HA 4J41A 3L70H 1Q8IA 5IT9N 2QSAA 1H2MA 4YJ2B 4ZI7A 5EC1C 4DV1B 3SYQA 4UVCA 5DEDA 4DO2A 3CPWU 3CCQV 4OPAA 1Y74B 1XL4A 1YVWA 3ZRXA 2RN9A 3HKBA 4W4LA 4IL6Z 2XOKG 1XHZA 2UXDB 2RJZA 3AG3B 2B1GA 3JAMN 1N0NA 3WB2A 3E86A 2X6CA 5IYZB 3ASNC 4DR2B 1JCHA 1XI1A 4LFCO 4GT1A 1X4TA 2Q6AA 1BL8A 2KG7A 4DV7O 2QWOB 1BHBA 3L73H 1IBMO 3CCRV 2UXCO 1R3JC 4O4LB 1GN2A 1NT2B 3CRQA 3QO8A 4C7UA 2YXHA 1AI6A 2P22C 1FD9A 1XMQB 3UO2A 1GH6A 3VQXA 4U7OA 5D5PA 3UQ8A 2EIKC 4FMTA 4FLWA 2A3QA 3N2GB 4I55B 4IT5A 1Y66A 3K06A 4OX9B 1N32O 2DYRC 5BR8B 2V7QG 2EILB 4ICGA 5LHHA 1PNMA 3CCLV 4KL1A 3RFRA 1V55B 3W7XA 3STZC 4DXWA 1QLEB 2BSKA 5H6QA 3JAWB 3TXSA 3QF7A 5BZBA 1N36O 1ORQC 5F2VO 3C3TA 4I50A 3H1JH 3DTUB 4DV5O 3JALA 2PY5A 3L74H 4WFBV 1Q86W 1X59A 2YXYA 4EB6B 1K7DA 3IAYA 3DXRA 2FL4A 2YUAA 1I08A 3ZHVA 3SPJA 1XMOO 4DR7O 5B3SC 3D36C 3AG2C 2GBOA 1AILA 5CBGA 3OAAG 4QJFB 3HKCA 2ZM6B 1V54B 2ATKC 4LFBB 3FYEB 4CC6A 2V4DA 1RFYA 3ZN0A 2ZDIA 4CH4A 2EIJB 2RNBA 2BE3A 3SYAA 2VQFO 3ETGA 5KAFZ 1YF2A 3U0ZA 2GV9A 4I7ZB 3CMAV 1YDXA 1OCZC 3BFRA 1WA8A 4ZOLB 2GSMB 2HR3A 1JJ2U 1D2DA 4RAIA 2IH3C 4ZKIA 2R9AA 3K5OA 3LDCA 2E3CA 4Q6GA 3ABLB 2A9HA 3WG7C 5JQGA 5H9CA 3UT5B 1NU1H 4K8ZA 1O9HA 1N33B 3DSQA 4UUJC 2BOBC 1VQ5V 1AP6A 5C8YA 5L3BA 1VQ7V 4GUNA 1H2KA 1JVMA 4BIOA 1OCCB 4JASA 3IFXA 3RWRD 4IHJA 2JK5C 3MHSC 2IM9A 1M56C 4JV5B 4ZHQA 2CTQA 2DJVA 3RW0A 3E8GA 5CBHA 1BZKA 2XAGA 1IDSA 2Y4UA 3FB6C 2DN9A 2BCCH 3WU2Z 2P7TC 1KB9F 3GB7C 4MTGA 4KP4A 1BMFG 4GX1A 3ABKC 1H2GA 1FFTB 2HVJC 1DGSA 1SC5B 2PI4A 5CA1B 3HB3B 5KHHA 3SYCA 2Z5UA 1VEWA 3MD0A 4NTYA 3F5TA 4H13B 4TV8B 2V1DA 5IYZA 3ZMUA 3IJ4A 4MVMA 1OCOB 4DR6B 5DM6V 4JTAB 4AHCA 2YSUB 5K1XA 5LGTA 1ZAUA 2DWDC 4NYKA 3RT3C 4DV6O 3ZRSA 1M93A 3CJHA 4O4LA 1KUQA 3OFNG 4Z1VA 1K5SA 3HKEB 3BY6A 4E2LA 2ITDC 4RWUA 4JI0O 4WBNA 4FZ1A 1N34B 3E8HA 4I0XB 3E35A 2QDOA 3JD3A 4JI7O 1MG1A 2OYQA 4DV3O 1AR5A 3N2GA 2QWPB 4DW1A 1AJPA 1G8MA 3L75H 1JR9A 5LYJB 3ZHQA 1L0NH 1MMMA 1HNZB 1KBHA 4YJ3B 1HR0B 4JI1B 3E8BA 5KHJA 3FB7C 4LF8O 4MVOA 3JAWA 1KD1W 3CRRA 5EBLC 1MSWD 2ETNA 2BTQB 4GKJB 2A7WA 4J7ZA 5IWAO 3RYIB 3TGUH 4IIJA 1XILA 4G27B 3SJQC 1BQ0A 2NNUA 5L3EA 5LMNB 1NI8A 4EB6A 4JI2O 1GM8A 2B1IA 2FKXA 3T2MA 3ZIAG 1JA8A 2OTLV 2Q8VA 2UXXA 4UCSA 3H1IH 4X64B 5A9GA 3UCSC 5EBMC 3N27A 2PI5A 3T1HB 1GAXA 4JYBA 2O57A 1G1XB 2R72A 3OTOO 2WSSG 4JI8O 2L6LA 3J7AU 2QE7G 3GWOA 3ZN1A 1KKCA 3G6EV 4BIZA 2ZCEA 1AP5A 3MDSA 5L3CA 1FXHA 1SA0B 2Q5ZA 3BEHA 1HWYA 2HKOA 4NXMB 2R70A 1KP3A 2L35A 5IYDO 3RVYA 1JX9A 2UXBB 2JGDB 1IURA 1NH2B 1MNGA 3N2KA 3R66A 5B1AC 5LP6B 4B3RO 3BABA 4ABMA 3VOUA 3CCEV 4JI5O 5H2FZ 2Q7EA 4YIOA 2WLKA 2PF4E 1TUBA 4R8CA 2KQXA 3EXAA 4NR1A 5EK0A 2DYSC 4AQYB 2HJDA 4I4TA 4IGGA 5LL6Y 4YHHB 4NKGB 3ZJZA 4KHPB 3QNEA 4WFHA 2YICA 4E4EA 2Y69B 1FXVA 2IW5A 3SYOA 4DV0B 4ZI7B 1FFXB 2PTMA 1TGOA 3CHXA 1PP9H 4K3AA 2Q67A 3B8NA 3NXSA 1VF6C 2EZOA 1G6UA 2AHZA 2XNDG 1EN6A 3RBZA 4LWSB 3TXQA 3K79A 1UPGA 3SPCA 3C90A 2B5UA 4F6RB 3DC6A 3B09A 4BW5A 4UVBA 4TV9A 3T1YO 5IY5B 2DQ0A 4TWKA 3W7TA 1Z5WA 2KG7B 1UFIA 2Q73A 5CA1A 4I9QA 2VQEB 5KHKA 2AHYA 3KKYA 1IZ3A 3LNMB 4MW3A 3ETQA 4UFZA 4UV8A 2JEUA 3BHPA 4LBEC 1W0KG 2XAHA 1P7GA 1Q43A 4F4LA 5B1BC 1OCRC 3OM3B 4YY3B 1RPRA 2ZNJA 2WLNA 4GKKB 1ROPA 3VQVA 2VWJA 2JS3A 1URFA 4I0XA 1NJIW 3RVZA 1DF5A 3APOA 2OCHA 5H6RA 1BHAA 3ZMZA 1FXKB 4X66B 4I50B 5CN0A 5LYJA 4B3TO 1R73A 3ZX6A 2JIZG 2IU3A 3JSLA 4YJ3A 1JQ0A 4WFAV 4BWAA 4B3SO 4AILC 3BPZA 1S5HC 4JYAB 3K59A 3PN1A 2WLIB 5LGUA 5LMUO 4A5UB 2BTQA 1N8RW 3JD2A 5KUMA 3B8MA 3B2EE 3JCUZ 4X62B 4L87A 1AROP 5LOVB 3HKCB 4JGSA 1F7YA 4P9OA 3H1KH 5BMVB 4ZBMA 1IBKB 2HFEC 1B04A 2EJRA 3M7MX 2P4KA 2YIAA 5EBWC 1QVFU 4MT8A 2DOSA 4CH6A 5IJ0B 4DK0A 4MSWC 2FTKA 1Y6XA 3CD6V 1WA8B 1R6NA 3H01A 1COWG 1SQVH 1ZTEA 2UU9B 2OTJV 3AK1A 4DR1O 4FVMA 2LGQA 1G4YB 4MTFA 5JQGB 2QR4A 5JJEB 2OT5A 1ZL8B 2JGDA 3ZCCA 5LP6A 2FYUH 2ZKOA 1Q81W 2R9IA 3CEIA 2W6IG 1RM1B 5C8YB 1VARA 1BQZA 1D5AA 1XOUA 1K8AW
chains in the Genus database with same CATH topology
1PNLA 1KKDA 1V54B 2ATKC 4WFFA 3FYEB 1F4MA 1YSCA 2HVKC 3FB5C 4H37A 4HZ3A 4Q20A 3ZN0A 3AG2B 1QR8A 1E79G 2ZDIA 3T4DA 4CBCA 2EIJB 3CC4V 1VQPV 3SYAA 3ETGA 4MW8A 4G28B 1M57B 3IGAC 3CCVV 1NBMG 3M99B 3CMAV 1OCZC 3I56V 5LGNA 1YJNV 1YTFD 3ABLC 4QPJA 2GSMB 2HR3A 1JJ2U 3AG3C 4OXSA 2WWWA 1DTOA 4PA7A 4RAIA 2IH3C 1FXKC 5LHGA 4ZKIA 3AG4B 2K1EA 4PA3A 1OCZB 4TT3G 2ZR3A 1YHQV 2QM8A 1Q82W 1KQSU 3LDCA 4UVAA 3LSSA 3ABLB 2A9HA 3WG7C 3OUFA 5L3GA 1M9NA 3CXCU 5H9CA 1K92A 4P2ZA 2ZD9A 4J9YB 1ZWIC 4FPPA 2X6BA 4UXNA 4UUJC 3WFVA 2BOBC 2YEVB 1VQ5V 2W0FC 4G2KA 2NLJC 1S76D 3WG7B 5L3BA 3LSQA 4GX5A 1GTOA 1VQ7V 1K4CC 4MVRA 1F4NA 1JVMA 4WFGA 1WLEA 1OCCB 4JASA 4PDRA 3IFXA 5GW7A 4FJCC 4KUMA 3ZRWB 3P32A 3CCMV 3CC7V 1FS0G 2JK5C 3D36A 1KECA 3MHSC 2ZXWC 2JJ1G 1M56C 4MS2A 2WAMA 2XAFA 4GCZA 1PKXA 2JJ2G 5KA6A 3RW0A 3E8GA 5CBHA 3OEEG 2Z3YA 3JCZA 2EILC 2UXNA 2R9RB 2XAGA 4I5SA 2XAQA 1I5YA 1GK9A 1V55C 3FB6C 3OE7G 4GX0A 4X89A 2ZXWB 1QLEC 2HJFC 4R50A 2P7TC 3GB7C 1NKDA 4MTGA 4KP4A 1YIJV 3OMNB 1BMFG 1QR9A 4GX1A 3FKSG 3ABMC 1VQKV 3ABKC 1H2GA 3CCUV 4JTDB 1FFTB 4WFEA 3AEIA 4ASUG 1PD3A 2HVJC 2PI4A 4PA9A 2M7WA 2HLDG 3EHBB 1MOFA 5DN6G 1EZJA 3HB3B 3SYCA 2Z5UA 1FXKA 1QVGU 3ABMB 3LDEA 3W7WA 3MD0A 1K97A 1TUEB 1AJQA 2V1DA 2DWEC 1EFRG 3ZMUA 1P4RA 2JDIG 4MVMA 1OCOB 1YTFB 4R7CA 5LBQA 3CMEV 1RM1C 5CA3A 1W2BU 1PNKA 1SZTA 5HFMA 3MHHC 5DM6V 1SERA 4JTAB 2YSUB 5LGTA 1NQTA 2MK3A 4MVQA 4JYCA 2DWDC 3UKMA 1AI5A 4MVSA 3LDDA 2WLIA 3ZRSA 1V54C 1SESA 3E89A 3F5WC 4QNHB 1S72V 3OFNG 3TK1A 3G71V 1K5SA 1NH2D 3JD4A 2EIJC 3OR6C 3W7UA 3BY6A 4E2LA 2H8PC 2WLMA 4RQEA 4TSFG 1VQMV 2ITDC 1M57C 3E8HA 3ZRVA 3E35A 3JD3A 3K0GA 1MG1A 1PL0A 3ASOB 3E8FA 1AJPA 1G8MA 4X8AA 1Y4MA 2QM7A 4HYOA 1R6KA 3TETA 3E8BA 3AG4C 2BOCC 1W0JG 1JPXA 3FB7C 1S77D 1NR7A 3OR7C 4MVOA 1KD1W 1RPOA 5EBLC 1MSWD 1CPYA 2IJHA 2X6AA 1VQOV 1K34A 2WLHA 4G27B 3SJQC 5B1NA 1IXMA 2NNUA 3D3IA 5L3EA 1F23A 1MABG 3F7YC 2XASA 3ABTA 4I9WA 5E1AC 4R6ZA 5IDJA 1GM8A 2B1IA 3T2MA 1OCCC 3ZIAG 2OTLV 2UXXA 2Q69A 2ZR2A 3CC2V 3F7VC 4LCUC 3KG2A 1LNQA 3K03A 2QKSA 3PJSK 5EBMC 5LHIA 4RUEA 2PI5A 2A0LA 3IC7A 4JYBA 4P30A 3EFFK 1GM9A 3K04A 3STLC 2WSSG 2QE7G 3GWOA 1VQ9V 1J95A 3ZN1A 5L3FA 5B1BB 1OCRB 3G6EV 3OUSA 3JYCA 4BIZA 2P90A 2ZQMA 3ML0A 5L3CA 4KFMA 1DLBA 1FXHA 4BIUA 3SYPA 3CP1A 1VQ4V 2OCCB 4RUFA 3HPLC 3BEHA 1HWYA 2HKOA 1VQ6V 1S3JA 2XAJA 1QBZA 2Q68A 2CK3G 1KP3A 4PDVA 5IYDO 3RVYA 4X88A 1JX9A 2IH1C 2IJJA 1NH2B 1GM7A 2GHYA 5B1AC 2KB1A 2Y48A 3VOUA 1GO3F 4XDJA 3T1CA 3CCEV 1H38A 4Z1MG 3E2EA 2WLKA 3UM7A 1SRYA 2DW4A 4R8CA 1OCOC 5B1AB 5IYCO 5EK0A 1K33A 2DYSC 2WLLB 3ZMVA 4EKWA 3SPGA 4MVZA 1AR1B 1R3IC 1AJNA 2JEXA 2W6JG 2YEVA 3SPHA 3ZJZA 3W7SA 3QNEA 4GX2A 4WFHA 2EIKB 2X0LA 1FXVA 2Y69B 4JF3A 2DYSB 2IW5A 2WLJA 5B1OA 3SYOA 4LP8A 3E83A 4MTXA 5KA5A 1KP2A 5L3DA 2LFRA 4U7NA 2DYRB 3K3WA 3ZRWA 1K4DC 4JAUA 1I5XA 2Q67A 4JTCB 3B8NA 3K0DA 3ASOC 4CZZA 1NVPD 2HG5C 3NXSA 1R3LC 5IYBO 2EZOA 1K3EA 3ETDA 4XBFA 2AHZA 2EIMB 2XNDG 2EZPA 4FK5C 4N21A 3RBZA 1GMGA 1YJ9V 1VQLV 1KC8W 3K79A 4HAMA 4PDLA 3SPCA 1WPXA 4XDLA 2B5UA 1VQNV 3G4SV 1OHHG 1H8EG 4YXWG 4RQFA 1YI2V 1F51A 3QO7A 4BW5A 3X2QC 4UVBA 3OW2U 3B77A 2IU0A 5IY5B 4H33A 2DQ0A 4LC1A 4TWKA 3P30A 3W7TA 3ETEA 2WLLA 3AG1C 2QEXV 1QLNA 1E1RG 2ITCC 3T4ZA 5B3SB 2AHYA 5EC2C 3X2QB 3FYIB 3LNMB 4MW3A 1YITV 2WPDG 4N23A 4QE7A 3DGEA 1VQ8V 2DQ3A 4RO2A 4UV8A 1SETA 1P7BA 1ENVA 1K5QA 1AI4A 2JEUA 4LBEC 4PDMA 1W0KG 4QE9A 3AG1B 5EC1C 5C93A 2XAHA 2X7RB 2P6JA 3SYQA 4UVCA 4DO2A 3CPWU 3CCQV 2D3OW 3ABUA 4F4LA 1K73W 3JD0A 1OCRC 5B1BC 1XL4A 3OM3B 5CBFA 1RPRA 3JD1A 1K9MW 2A79B 2WLNA 3LUTB 1ROPA 2EBOA 3ZRXA 3A0RA 1EBOA 2XOKG 2OCCC 1NJIW 2LP7A 4XDKA 3RVZA 1GKFA 1DF5A 4WCEV 4JAVA 5H6RA 1BHAA 3AG3B 2B1GA 3ZMZA 1AI7A 1FXKB 3QO5A 1M90W 5CN0A 1R73A 3E86A 2X6CA 5J9PC 2F43G 2JIZG 3ASNC 1CP9A 2IU3A 1L1FA 1E1QG 3K9AA 1H8HG 1JCHA 2EINC 3R65A 1JQ0A 5KUKA 3I55V 4WFAV 3K08A 1S0VA 1S5HC 3OMAB 4GT1A 1NVPB 2Q6AA 1BL8A 2WLIB 1BHBA 5LGUA 3CCRV 1R3JC 1N8RW 3ASNB 3JD2A 3QO8A 2EINB 5KUMA 3B8MA 1AI6A 3ZMSA 2ZDIC 3SPIA 4L87A 3FB8C 3OMIB 1AROP 1CEZA 5FL7G 4U7OA 3CYOA 2LFSA 4FIPC 4JGSA 4BAYA 3CCSV 2EIKC 2Y69C 4P9OA 4QIWF 4FMTA 4ZBMA 4JPRA 2HFEC 1Y66A 2P67A 3K06A 1M56B 2EJRA 2DYRC 1B6QA 3CCJV 3ZMTA 4UV9A 1OZ0A 1XL6A 5HFLA 2V7QG 5EBWC 1QVFU 2EILB 1YJWV 5LHHA 1PNMA 4MT8A 5CMUA 4MTOA 2H94A 3VBBA 3CCLV 4MSWC 2IJIA 1V55B 3W7XA 2FTKA 1M1KW 2EIMC 3STZC 1R3KC 1QLEB 4DXWA 3CD6V 1R6NA 5H6QA 4PA6A 3H01A 5BZBA 2IJKA 1COWG 1ORQC 1JOYA 4PELA 3ABKB 3DTUB 2OTJV 4WFBV 1Q86W 1NR1A 1G4YB 1Q7YW 4PA4A 1QCEA 4MTFA 4P9PA 1K7DA 5IY5C 2OT5A 1DF4A 4MVUA 3TCUA 3ZCCA 3OGCC 3SPJA 1Q81W 2R9IA 1UJWB 4QPKA 1THZA 4WF9V 5B3SC 2W6IG 2QTOA 3AG2C 1RM1B 3OEHG 2C2AA 5CBGA 1K8AW 3OAAG 4J9ZB 4QJFB 2QA4V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A79 B;  2WLN A;  1KKD A;  2ATK C;  3RVY A;  3LUT B;  4X88 A;  4WFF A;  2IH1 C;  2DWE C;  4MVM A;  5B1A C;  2KB1 A;  2HVK C;  3FB5 C;  2OCC C;  4H37 A;  4HZ3 A;  4R7C A;  4JTA B;  3VOU A;  3T4D A;  4XDJ A;  3T1C A;  4MVQ A;  4XDK A;  4CBC A;  2DWD C;  3UKM A;  3RVZ A;  3SYA A;  4MW8 A;  4G28 B;  4MVS A;  3LDD A;  2WLI A;  3ZRS A;  2WLK A;  3UM7 A;  1V54 C;  3IGA C;  4R8C A;  3E89 A;  3F5W C;  4QNH B;  1OCO C;  3E86 A;  1OCZ C;  2X6C A;  5J9P C;  5EK0 A;  2DYS C;  3ASN C;  2WLL B;  2EIJ C;  2EIN C;  3OR6 C;  3ABL C;  3R65 A;  4EKW A;  5KUK A;  2H8P C;  2WLM A;  3SPG A;  2ITD C;  1M57 C;  4MVZ A;  3K08 A;  3AG3 C;  1R3I C;  4OXS A;  3E8H A;  4PA7 A;  1S5H C;  4RAI A;  2IH3 C;  2YEV A;  3SPH A;  3ZJZ A;  2Q6A A;  3K0G A;  1BL8 A;  2K1E A;  2WLI B;  4GX2 A;  4PA3 A;  4WFH A;  3E8F A;  1R3J C;  2WLJ A;  3SYO A;  3LDC A;  4LP8 A;  3E83 A;  4X8A A;  5KUM A;  2A9H A;  3WG7 C;  3OUF A;  4HYO A;  3SPI A;  3FB8 C;  4P2Z A;  2ZD9 A;  3TET A;  4J9Y B;  3E8B A;  1K4D C;  3AG4 C;  1ZWI C;  2BOC C;  2X6B A;  2Q67 A;  4JTC B;  4UUJ C;  2EIK C;  2Y69 C;  3ASO C;  3FB7 C;  3K0D A;  2BOB C;  4P9O A;  2HG5 C;  2W0F C;  3OR7 C;  4MVO A;  1R3L C;  4ZBM A;  2NLJ C;  2HFE C;  5EBL C;  4GX5 A;  3K06 A;  2AHZ A;  1K4C C;  4MVR A;  1JVM A;  2DYR C;  4WFG A;  2X6A A;  3RBZ A;  4PDR A;  1XL6 A;  3IFX A;  2WLH A;  3T4Z A;  4G27 B;  3SJQ C;  5EBW C;  4PDL A;  3SPC A;  4XDL A;  2JK5 C;  4MTO A;  3F7Y C;  4MSW C;  5E1A C;  4I9W A;  2ZXW C;  4R6Z A;  2EIM C;  3STZ C;  1R3K C;  4DXW A;  1M56 C;  4MS2 A;  3X2Q C;  4BW5 A;  4PA6 A;  5BZB A;  3T2M A;  1OCC C;  3RW0 A;  3E8G A;  1ORQ C;  5CBH A;  2Q69 A;  4H33 A;  3F7V C;  4LCU C;  3KG2 A;  1LNQ A;  3K03 A;  2QKS A;  2EIL C;  3PJS K;  4TWK A;  4RUE A;  5EBM C;  2A0L A;  2R9R B;  2WLL A;  3AG1 C;  1V55 C;  3FB6 C;  4GX0 A;  4P30 A;  4X89 A;  2ITC C;  1QLE C;  1G4Y B;  2HJF C;  3EFF K;  3K04 A;  4R50 A;  2P7T C;  3STL C;  4PA4 A;  2AHY A;  3GB7 C;  4MTG A;  4MTF A;  5EC2 C;  4P9P A;  3LNM B;  4MW3 A;  1J95 A;  4GX1 A;  5IY5 C;  4QE7 A;  3ABM C;  3ABK C;  4MVU A;  3TCU A;  3OUS A;  3JYC A;  3OGC C;  4RO2 A;  3SPJ A;  1P7B A;  4JTD B;  4PDM A;  4KFM A;  4LBE C;  4WFE A;  4QE9 A;  2HVJ C;  5EC1 C;  3SYP A;  5B3S C;  4PA9 A;  4RUF A;  2QTO A;  3AG2 C;  3SYQ A;  3HPL C;  3BEH A;  4F4L A;  3SYC A;  5B1B C;  1OCR C;  5CBG A;  1XL4 A;  5CBF A;  4J9Z B;  4PDV A;  3LDE A;  2Q68 A; 
#chains in the Genus database with same CATH topology
 4TUY A;  1PNL A;  1AB3 A;  2HVK C;  4H37 A;  4HZ3 A;  4IHJ B;  3D3Q A;  1E79 G;  2PYL A;  4DV1 O;  2NR5 A;  3CC4 V;  4ZHQ B;  2QM4 A;  1I0H A;  3ZS8 C;  1M57 B;  1PM9 A;  3IC9 A;  3IGA C;  3CCV V;  1NBM G;  3M99 B;  1I7F A;  1FFX A;  2CTW A;  3G6B A;  1KMI Z;  4LF9 B;  1YJN V;  3ABL C;  3E22 B;  4DUZ B;  2UXD O;  2WWW A;  1PL4 A;  2NN4 A;  3SJC C;  1YHQ V;  2QM8 A;  1Q82 W;  4KXR A;  1KQS U;  4UVA A;  3LSS A;  2JVD A;  4DR2 O;  4LWS A;  4B08 A;  2ZD9 A;  2HHH B;  4JZ2 A;  4UXN A;  2Q0A A;  4F6R A;  3C3S A;  3VQW A;  2NLJ C;  4GX5 A;  4MVR A;  5KHG A;  1XMQ O;  2CTR A;  4FJC C;  3CJH B;  4KUM A;  4D7S A;  3CC7 V;  5J2U B;  1KEC A;  4U3J A;  4DV2 B;  4MS2 A;  2WAM A;  2QKA A;  1PKX A;  5KA6 A;  4WBN B;  3OEE G;  4LF7 B;  4OX9 O;  2ARH A;  4X9Q A;  2UXN A;  2R9R B;  5BR8 O;  5CB4 B;  1XBL A;  1M5I A;  2LJ2 A;  4LFC B;  4JI6 O;  1VF7 A;  1NKD A;  1YIJ V;  3CWB H;  5E79 Z;  3CCU V;  4DV7 B;  3HKD A;  4WFE A;  5JH7 A;  2YXL A;  1ZLZ A;  5JCO C;  3EHB B;  3U10 A;  4CH3 A;  1EZJ A;  1WNS A;  2E76 B;  3ICX A;  1FXK A;  3ABM B;  3LDE A;  4DYL A;  1JJO A;  4IIJ B;  4OPH A;  1AJQ A;  2P5O A;  1EFR G;  1P4R A;  3FX7 A;  5B66 Z;  3KCY A;  5LBQ A;  4K0K B;  5CA3 A;  5HFM A;  4DR4 B;  2MK3 A;  4MVQ A;  1AI5 A;  1BT8 A;  2YID A;  4MVS A;  3LDD A;  2WLI A;  3O65 A;  5EIB D;  1SES A;  3DC5 A;  3F5W C;  4QNH B;  4GYC B;  1N0J A;  1FKA O;  1NH2 D;  3JD4 A;  4LFB O;  3LNN A;  3W7U A;  5LOV A;  2H8P C;  3ZHR A;  1VQM V;  3ZRV A;  5BMV A;  4DV5 B;  2CUG A;  5FNV B;  4BR6 A;  2QM7 A;  5FPO A;  1R6K A;  1Q6U A;  3TET A;  1Q3E A;  3AG4 C;  1BS3 A;  5IJ0 A;  3SJA C;  4DR7 B;  1S77 D;  3N2K B;  4CS2 A;  2AW9 A;  1RPO A;  1KU9 A;  4NXN B;  1VQO V;  1K34 A;  1SQP H;  4YIP A;  4X1I B;  2Y0I A;  1TUB B;  2ODM A;  1N33 O;  2EJ7 A;  3F7Y C;  1EM1 A;  1L0L H;  3JAK A;  4R6Z A;  1ZL8 A;  4I4T B;  3BA9 A;  2ZR2 A;  2LQT A;  3A2F A;  3K03 A;  3K9S A;  3PJS K;  4LF4 B;  4O4J B;  5AG2 A;  4LFA B;  3TJT A;  1VQ9 V;  4JV5 O;  2P90 A;  2P4V A;  2ZQM A;  1XQ8 A;  3ML0 A;  1LUW A;  4KFM A;  2CH7 A;  3CP1 A;  1S5J A;  1VQ4 V;  3D8C A;  4GZR B;  3QVN A;  2IH1 C;  4LNU B;  1GM7 A;  2GHY A;  4B7E A;  2KB1 A;  1IVS A;  3E22 A;  4EEQ A;  2KKW A;  2N05 A;  3THO A;  4XDJ A;  4Z1M G;  3UM7 A;  4TV9 B;  2DW4 A;  3EVK A;  2YI9 A;  4NTW A;  3ZED A;  3ZMV A;  4DRX B;  4DR6 O;  4MVZ A;  1AR1 B;  1QHT A;  2IBZ H;  4IYI A;  2QJ1 A;  3SPH A;  2UUA O;  3S3W A;  4PD4 F;  2ZIN A;  2EIK B;  4JF3 A;  4LP8 A;  1P49 A;  2DYR B;  1K4D C;  1I94 O;  5J2U A;  1N34 O;  3ASO C;  1R3L C;  2Q4P A;  5IYB O;  1HNW O;  4XBF A;  3OTF A;  4N21 A;  1GMG A;  1KC8 W;  5CB4 A;  4HAM A;  1HR0 O;  4PDL A;  4JI1 O;  3BAA A;  4HNA B;  1OHH G;  5KX5 B;  1F51 A;  3OW2 U;  2AXT Z;  4DR3 O;  3RYF B;  4GKJ O;  4LC1 A;  3P30 A;  2UUC B;  2PZS A;  2WLL A;  2GUZ A;  2QEX V;  3CRC A;  4ZIB A;  5LMN O;  3T4Z A;  5B3S B;  5EC2 C;  3X2Q B;  3CE2 A;  2WPD G;  2YDE A;  2EX3 A;  2PYJ A;  2FML A;  1WP8 A;  3DGE A;  3L72 H;  2N04 A;  1XRE A;  1P7B A;  1ENV A;  1K5Q A;  1U97 A;  1AI4 A;  5C93 A;  2P6J A;  3T1H O;  3JD0 A;  5CBF A;  3JD1 A;  1K9M W;  2A79 B;  3LUT B;  2EBO A;  3A0R A;  4EFE A;  2OCC C;  2OIG A;  4AI8 A;  2LP7 A;  4JI3 B;  1GKF A;  4LF5 O;  5FNV A;  4NXM O;  4TQF A;  3QO5 A;  1M90 W;  1XNR B;  2Q9L A;  5FLX N;  5J9P C;  2UXB O;  2F43 G;  1L1F A;  1CP9 A;  1E1Q G;  3K9A A;  1WAZ A;  3P3P A;  1EN5 A;  3R65 A;  5KUK A;  3M8A A;  2DE0 X;  4O2A B;  4FM0 A;  2HEP A;  4X65 B;  3J81 N;  1NVP B;  2PUS A;  3OTO B;  2EIN B;  5JJJ B;  2ZDI C;  4B3M B;  1SF9 A;  3FB8 C;  3OMI B;  4X1I A;  1CEZ A;  5FL7 G;  4YHH O;  2E5L B;  4TUY B;  1FJG B;  4LH6 A;  4QIW F;  4KHP O;  2QWR B;  2P67 A;  4BW9 A;  3H1H H;  1GRJ A;  1M56 B;  2XT9 A;  3CCJ V;  2YIB A;  4UV9 A;  4O4J A;  5HFL A;  1NTK H;  3RN4 A;  2N74 A;  2Z0A A;  4MTO A;  2H94 A;  2IJI A;  1M1K W;  2EIM C;  1R3K C;  4DUY O;  2IJK A;  1JOY A;  3ABK B;  2ZIM A;  2XUM A;  1VMG A;  1QCE A;  4P9P A;  3K57 A;  4LNU A;  1XDC A;  1DF4 A;  3TCU A;  3H1L H;  4QPK A;  1THZ A;  3K5N A;  5B5E Z;  1MSD A;  1Q90 D;  2M6Y A;  3OT7 A;  2QTO A;  1EZV H;  4LF6 B;  2VQE O;  3NR7 A;  1KKD A;  1F4M A;  3OD4 A;  1YSC A;  3FB5 C;  2ZIO A;  4DRX A;  4U3J B;  3T4D A;  3BRC A;  4G28 B;  4MW8 A;  2KSD A;  1PV0 A;  4O4I A;  4YY3 O;  2B9Z A;  1MA1 A;  4PI2 A;  3I56 V;  4GKK O;  4DR5 B;  1J5E O;  3ZBH A;  4QPJ A;  4JI4 B;  3AG7 A;  3AG3 C;  2F95 B;  3CX5 F;  4OXS A;  1DTO A;  1WP7 A;  2K1E A;  4PA3 A;  3RYH B;  2ZR3 A;  3HKD B;  4NB5 A;  5JCO A;  4X66 O;  5JH7 B;  4FLV A;  1DK1 A;  3OUF A;  5L3G A;  1M9N A;  3CXC U;  4W4K A;  1K92 A;  3L9D A;  4P2Z A;  2ZE5 A;  4J9Y B;  2UUB B;  1ZSP A;  1ZWI C;  4FPP A;  4X1K B;  1IBL B;  4HNA A;  5KX5 A;  4JYA O;  2F4V O;  4K8X A;  1S76 D;  2LGW A;  1LR1 A;  1GTO A;  1Q5O A;  1K4C C;  1F4N A;  3RYF A;  4WFG A;  1QU7 A;  4PDR A;  4X62 O;  3ZHU A;  3QTC A;  3CCM V;  1FS0 G;  3VQY A;  1Y76 B;  3D36 A;  1HP8 A;  1SQX H;  4J80 A;  2JJ1 G;  2XAF A;  4GCZ A;  4J10 A;  1H2N A;  1IBK O;  2JJ2 G;  3RGB A;  3JCZ A;  2EIL C;  4I5S A;  5CA0 B;  1I5Y A;  1GK9 A;  1V55 C;  4X89 A;  3OE7 G;  1JFF A;  2ZXW B;  1QLE C;  4R50 A;  4DK1 A;  1GN6 A;  3FKS G;  3ABM C;  4DW0 A;  1FPO A;  4JTD B;  3AEI A;  4ASU G;  2YIB D;  5D5Q A;  5IJ9 B;  2M7W A;  2HLD G;  5DN6 G;  1BGY H;  3SDL A;  3ZHS A;  4UCT A;  4J11 A;  1QVG U;  3W7W A;  2JGU A;  1K97 A;  1TUE B;  2CAZ C;  1TA8 A;  2DWE C;  2JDI G;  1YTF B;  4R7C A;  3CME V;  3CRM A;  1SZT A;  1XNQ B;  3JAK B;  4O2A A;  4JYC A;  1XUQ A;  1WPB A;  1GN3 A;  1V54 C;  2F1M A;  3E89 A;  4UCR A;  1S72 V;  1H2L A;  1JMK C;  3TK1 A;  3G71 V;  1HNX O;  4O2B B;  2EIJ C;  4RQE A;  2WLM A;  1R1B A;  2MW2 B;  1PL0 A;  3APQ A;  2ILM A;  3E8F A;  1BSM A;  3QG5 A;  1V9P A;  3RYC B;  2CH7 B;  4CS3 A;  1SQQ H;  1Y4M A;  5FPR A;  2RMK B;  4LF9 O;  4DUZ O;  2BOC C;  1W0J G;  1JPX A;  5BXZ A;  3OR7 C;  1CXZ B;  1SQB H;  1B3Q A;  3JAT B;  1CPY A;  2Y4T A;  4DV4 B;  2WLH A;  4L8J A;  3ABT A;  2JRI A;  5H5N A;  1OCC C;  4JYY A;  5GTI Z;  2Q69 A;  3CC2 V;  3F7V C;  4LCU C;  3KG2 A;  1LNQ A;  2QKS A;  5LHI A;  2CTP A;  3WB0 A;  4P30 A;  3EFF K;  1GM9 A;  3K04 A;  1US6 A;  3Q4H B;  2GTS A;  1J95 A;  3FFQ A;  5L3F A;  5B1B B;  1OCR B;  4DV2 O;  4FLZ A;  4BIU A;  3CSX A;  4LF7 O;  1RP3 B;  5EYP B;  2AZ2 A;  4FFB B;  1S3J A;  1QBZ A;  2XAJ A;  5KHI A;  4X88 A;  4FLX A;  2OWO A;  1QNM A;  2ADQ B;  1N4C A;  1ZUQ A;  2DMX A;  1H38 A;  4X1Y A;  1IBM B;  3RYH A;  4PJ0 Z;  2UXC B;  3LSU A;  1OCO C;  1Z2G A;  2WLL B;  2GUZ B;  2QWN B;  4K0K O;  3SPG A;  4X1K A;  4DR4 O;  1AJN A;  2JEX A;  2W6J G;  3MAQ A;  2GDS A;  4JI6 B;  1N32 B;  2F23 A;  5L3D A;  1SKV A;  5IE9 A;  2ZM6 O;  4JTC B;  1Y76 A;  4D7T A;  4CZZ A;  1NVP D;  2HG5 C;  1N36 B;  2AZ0 A;  2YI8 A;  1RSO B;  1K3E A;  3ETD A;  2A06 H;  2EUL A;  3B4S A;  1TVK A;  1VQL V;  3A0H Z;  4EFB A;  5CA0 A;  1LUV A;  4UCV A;  4XDL A;  2GTA A;  1YEW A;  2YS8 A;  4FZ0 A;  1H8E G;  3FAV A;  4YXW G;  2ZT9 B;  3SGI A;  3X2Q C;  5K1P A;  4PHZ A;  1XMO B;  2IU0 A;  3A8T A;  4H33 A;  4NXN O;  5IJ9 A;  3JAS A;  2XTA A;  1IX9 A;  1E1R G;  2ITC C;  2ADP A;  3B40 A;  3G80 A;  4N23 A;  4QE7 A;  5LXT B;  2DQ3 A;  3GWK C;  1H2S B;  1SET A;  4PDM A;  4GLX A;  3JAR B;  4QE9 A;  3AG1 B;  1WJZ A;  3HR0 A;  1O9G A;  2X7R B;  2VQF B;  4LF4 O;  4TOI A;  1ZX3 A;  2D3O W;  3ABU A;  5KLV H;  1K73 W;  5ITZ A;  4LFA O;  1L8D A;  4D6T H;  3JSN A;  1EBO A;  4O2B A;  4IYH A;  5EZY B;  4XDK A;  5GON B;  4X20 B;  5EIB C;  3SR2 C;  4WCE V;  1NTM H;  4JAV A;  1PPJ H;  3U11 A;  1P84 F;  1AI7 A;  4CS4 A;  3RYC A;  5LP6 C;  1VF6 A;  4FM2 A;  1H8H G;  2EIN C;  5J2T A;  3I55 V;  4H44 B;  3K08 A;  1S0V A;  3OMA B;  1Q6I A;  2Q0O C;  3BA8 A;  5GTH Z;  3JAT A;  3ASN B;  5KMG A;  1IXB A;  3L71 H;  1A32 A;  3ZMS A;  4FLY A;  3SPI A;  4UCO A;  3CYO A;  2LFS A;  4FIP C;  4HBN A;  4BAY A;  3CCS V;  3G67 A;  2Y69 C;  4YJ2 A;  4JPR A;  1Y74 A;  1B6Q A;  2Y0P A;  3ZMT A;  1OZ0 A;  1XL6 A;  5TIS Z;  5JWP A;  1WN7 A;  2F93 B;  4O4I B;  1YJW V;  5CMU A;  2H3O A;  3VBB A;  4PI0 A;  2CE4 A;  3Q4H A;  4PA6 A;  3FD9 A;  4K35 A;  5LA6 B;  2D2C B;  4PEL A;  2W0X A;  4UCU A;  2LO1 A;  5EYP A;  1NR1 A;  4FFB A;  1Q7Y W;  4PA4 A;  4JAA A;  3AK3 A;  1HNZ O;  2CGO A;  2UUA B;  5IY5 C;  3O9O A;  4MVU A;  5JVD B;  1S5L Z;  3OGC C;  1M4U A;  1UJW B;  4WF9 V;  1EN4 A;  5DEC A;  2F66 C;  4DV6 B;  3CS5 A;  2QKC A;  2UUC O;  3OEH G;  1AR4 A;  2C2A A;  1OV9 A;  4J9Z B;  2VWK A;  2QA4 V;  1I94 B;  1NS1 A;  4WFF A;  1HNW B;  3H9V A;  4I55 A;  4Q20 A;  3AG2 B;  4JI0 B;  1QR8 A;  3KCX A;  4CBC A;  4JI7 B;  1VQP V;  4DV3 B;  4QGP A;  4X64 O;  5LGN A;  1JFF B;  1YTF D;  2CDY A;  1VP7 A;  4DR3 B;  4PA7 A;  4LF8 B;  1FXK C;  5LHG A;  4JI3 O;  3AG4 B;  1OCZ B;  1RSO A;  4TT3 G;  1XNR O;  5IWA B;  2JS5 A;  2X6B A;  2XHB A;  3WFV A;  1VIB A;  4JI2 B;  2YEV B;  2W0F C;  4X65 O;  4G2K A;  4B7K A;  2HP8 A;  3WG7 B;  3LSQ A;  2WA3 A;  1WLE A;  2VS0 A;  4OGQ B;  4O4H B;  1HDJ A;  4B3M O;  5GW7 A;  2AGA A;  1R6T A;  3ZRW B;  3P32 A;  1WB8 A;  2E5L O;  4JI8 B;  2ZXW C;  1FJG O;  2E74 B;  5LXT A;  4AQY O;  4LF5 B;  4LR3 A;  2Z3Y A;  1NTZ H;  2ZE6 A;  3JAR A;  2Q7H A;  2XAQ A;  3CB2 A;  4UB8 Z;  4GX0 A;  4FLU A;  2P06 A;  2HJF C;  4ZOL A;  4DV0 O;  1XHX A;  3OMN B;  1QR9 A;  1VQK V;  4U3F H;  4B3R B;  3A0B Z;  1PD3 A;  3BVO A;  5EZY A;  4JI5 B;  5GON A;  1MZF A;  4X20 A;  4PA9 A;  4J42 A;  1MOF A;  3UT5 A;  5A2Q N;  3OGI B;  1RM1 C;  1W2B U;  1PNK A;  1HW7 A;  3MHH C;  1SER A;  4LH7 A;  1NQT A;  3UKM A;  2WA4 A;  4LF6 O;  2QGN A;  3I5D A;  3HKB B;  3OR6 C;  4DUY B;  1KYO F;  3KZI Z;  4TSF G;  1M57 C;  3GVM A;  1MZE A;  3P3N A;  1SZX A;  1FAF A;  3K0G A;  1BE3 H;  1FYJ A;  2K9P A;  1VF5 B;  2ZE7 A;  3ASO B;  3WB1 A;  4X8A A;  4HYO A;  4DR5 O;  2ZNI A;  3J80 N;  4JI4 O;  5BY1 A;  2BTO A;  1D5N A;  1NR7 A;  1YCI A;  2LW7 A;  5LA6 A;  3T1Y B;  3CXH F;  2IJH A;  2X6A A;  1TAE A;  2VRZ A;  4TV8 A;  4X1Y B;  3AK2 A;  5B1N A;  4Z2W A;  1IXM A;  3D3I A;  3K5M A;  2UUB O;  2PGG A;  3BCC H;  1T5E A;  1F23 A;  1QQC A;  1IBL O;  1MAB G;  5E1A C;  2XAS A;  1B06 A;  4I9W A;  5IDJ A;  5JVD A;  2E75 B;  3ZHT A;  4RUE A;  2A0L A;  3IC7 A;  3SJB C;  2YC0 A;  1J5E B;  3HKE A;  3STL C;  3UO3 A;  2ZE8 A;  1W59 A;  2BSK B;  1Y67 A;  2RDC A;  3JYC A;  3OUS A;  2RCV A;  2RQ6 A;  1DLB A;  1XEQ A;  3SYP A;  4J7K A;  2OCC B;  3JAL B;  2QTS A;  4RUF A;  3HPL C;  4H0L B;  4CH5 A;  1VQ6 V;  4PDV A;  2Q68 A;  4B3T B;  2CK3 G;  1TVK B;  3DXR B;  2IJJ A;  2F4V B;  4CC5 A;  2OIE A;  2Y48 A;  2G38 A;  4B3S B;  3K58 A;  3FAV B;  1GO3 F;  3T1C A;  3RYI A;  3E2E A;  5LMU B;  1GN4 A;  1SRY A;  4J7J A;  5B1A B;  5IYC O;  3JAS B;  2UU9 O;  4NVP A;  1K33 A;  3S3X A;  1SQF A;  2LW1 A;  4EKW A;  4JZG A;  4NTX A;  1XNQ O;  1R3I C;  2YEV A;  3W7S A;  4GX2 A;  2X0L A;  2DYS B;  2WLJ A;  5B1O A;  4TQD A;  4MTX A;  3E83 A;  5KA5 A;  4FLT A;  1KP2 A;  4O4H A;  1OJH A;  3CRA A;  2LFR A;  5ITZ B;  4U7N A;  3K3W A;  3ZRW A;  2FB5 A;  4JAU A;  4UB6 Z;  1I5X A;  3K0D A;  4F6E A;  1SA0 A;  1BCC H;  5KAI Z;  1YXB A;  5JJN B;  2EIM B;  2QWQ B;  4FK5 C;  2EZP A;  1AVM A;  4FM1 A;  1YJ9 V;  4PV1 B;  4DR1 B;  4FFK A;  1WPX A;  1VQN V;  3G4S V;  4RQF A;  1YI2 V;  3QO7 A;  5J2T B;  2CGN A;  3B77 A;  1SS3 A;  4DV4 O;  1U96 A;  2Q7G A;  1SQG A;  3ETE A;  1HNX B;  3AG1 C;  1QLN A;  1NZ6 A;  1WB7 A;  5KMG B;  3FYI B;  1YIT V;  1YZB A;  3K5L A;  2HHH O;  1VQ8 V;  4RO2 A;  1Z5V A;  1Q6H A;  4J41 A;  3L70 H;  1Q8I A;  5IT9 N;  2QSA A;  1H2M A;  4YJ2 B;  4ZI7 A;  5EC1 C;  4DV1 B;  3SYQ A;  4UVC A;  5DED A;  4DO2 A;  3CPW U;  3CCQ V;  4OPA A;  1Y74 B;  1XL4 A;  1YVW A;  3ZRX A;  2RN9 A;  3HKB A;  4W4L A;  4IL6 Z;  2XOK G;  1XHZ A;  2UXD B;  2RJZ A;  3AG3 B;  2B1G A;  3JAM N;  1N0N A;  3WB2 A;  3E86 A;  2X6C A;  5IYZ B;  3ASN C;  4DR2 B;  1JCH A;  1XI1 A;  4LFC O;  4GT1 A;  1X4T A;  2Q6A A;  1BL8 A;  2KG7 A;  4DV7 O;  2QWO B;  1BHB A;  3L73 H;  1IBM O;  3CCR V;  2UXC O;  1R3J C;  4O4L B;  1GN2 A;  1NT2 B;  3CRQ A;  3QO8 A;  4C7U A;  2YXH A;  1AI6 A;  2P22 C;  1FD9 A;  1XMQ B;  3UO2 A;  1GH6 A;  3VQX A;  4U7O A;  5D5P A;  3UQ8 A;  2EIK C;  4FMT A;  4FLW A;  2A3Q A;  3N2G B;  4I55 B;  4IT5 A;  1Y66 A;  3K06 A;  4OX9 B;  1N32 O;  2DYR C;  5BR8 B;  2V7Q G;  2EIL B;  4ICG A;  5LHH A;  1PNM A;  3CCL V;  4KL1 A;  3RFR A;  1V55 B;  3W7X A;  3STZ C;  4DXW A;  1QLE B;  2BSK A;  5H6Q A;  3JAW B;  3TXS A;  3QF7 A;  5BZB A;  1N36 O;  1ORQ C;  5F2V O;  3C3T A;  4I50 A;  3H1J H;  3DTU B;  4DV5 O;  3JAL A;  2PY5 A;  3L74 H;  4WFB V;  1Q86 W;  1X59 A;  2YXY A;  4EB6 B;  1K7D A;  3IAY A;  3DXR A;  2FL4 A;  2YUA A;  1I08 A;  3ZHV A;  3SPJ A;  1XMO O;  4DR7 O;  5B3S C;  3D36 C;  3AG2 C;  2GBO A;  1AIL A;  5CBG A;  3OAA G;  4QJF B;  3HKC A;  2ZM6 B;  1V54 B;  2ATK C;  4LFB B;  3FYE B;  4CC6 A;  2V4D A;  1RFY A;  3ZN0 A;  2ZDI A;  4CH4 A;  2EIJ B;  2RNB A;  2BE3 A;  3SYA A;  2VQF O;  3ETG A;  5KAF Z;  1YF2 A;  3U0Z A;  2GV9 A;  4I7Z B;  3CMA V;  1YDX A;  1OCZ C;  3BFR A;  1WA8 A;  4ZOL B;  2GSM B;  2HR3 A;  1JJ2 U;  1D2D A;  4RAI A;  2IH3 C;  4ZKI A;  2R9A A;  3K5O A;  3LDC A;  2E3C A;  4Q6G A;  3ABL B;  2A9H A;  3WG7 C;  5JQG A;  5H9C A;  3UT5 B;  1NU1 H;  4K8Z A;  1O9H A;  1N33 B;  3DSQ A;  4UUJ C;  2BOB C;  1VQ5 V;  1AP6 A;  5C8Y A;  5L3B A;  1VQ7 V;  4GUN A;  1H2K A;  1JVM A;  4BIO A;  1OCC B;  4JAS A;  3IFX A;  3RWR D;  4IHJ A;  2JK5 C;  3MHS C;  2IM9 A;  1M56 C;  4JV5 B;  4ZHQ A;  2CTQ A;  2DJV A;  3RW0 A;  3E8G A;  5CBH A;  1BZK A;  2XAG A;  1IDS A;  2Y4U A;  3FB6 C;  2DN9 A;  2BCC H;  3WU2 Z;  2P7T C;  1KB9 F;  3GB7 C;  4MTG A;  4KP4 A;  1BMF G;  4GX1 A;  3ABK C;  1H2G A;  1FFT B;  2HVJ C;  1DGS A;  1SC5 B;  2PI4 A;  5CA1 B;  3HB3 B;  5KHH A;  3SYC A;  2Z5U A;  1VEW A;  3MD0 A;  4NTY A;  3F5T A;  4H13 B;  4TV8 B;  2V1D A;  5IYZ A;  3ZMU A;  3IJ4 A;  4MVM A;  1OCO B;  4DR6 B;  5DM6 V;  4JTA B;  4AHC A;  2YSU B;  5K1X A;  5LGT A;  1ZAU A;  2DWD C;  4NYK A;  3RT3 C;  4DV6 O;  3ZRS A;  1M93 A;  3CJH A;  4O4L A;  1KUQ A;  3OFN G;  4Z1V A;  1K5S A;  3HKE B;  3BY6 A;  4E2L A;  2ITD C;  4RWU A;  4JI0 O;  4WBN A;  4FZ1 A;  1N34 B;  3E8H A;  4I0X B;  3E35 A;  2QDO A;  3JD3 A;  4JI7 O;  1MG1 A;  2OYQ A;  4DV3 O;  1AR5 A;  3N2G A;  2QWP B;  4DW1 A;  1AJP A;  1G8M A;  3L75 H;  1JR9 A;  5LYJ B;  3ZHQ A;  1L0N H;  1MMM A;  1HNZ B;  1KBH A;  4YJ3 B;  1HR0 B;  4JI1 B;  3E8B A;  5KHJ A;  3FB7 C;  4LF8 O;  4MVO A;  3JAW A;  1KD1 W;  3CRR A;  5EBL C;  1MSW D;  2ETN A;  2BTQ B;  4GKJ B;  2A7W A;  4J7Z A;  5IWA O;  3RYI B;  3TGU H;  4IIJ A;  1XIL A;  4G27 B;  3SJQ C;  1BQ0 A;  2NNU A;  5L3E A;  5LMN B;  1NI8 A;  4EB6 A;  4JI2 O;  1GM8 A;  2B1I A;  2FKX A;  3T2M A;  3ZIA G;  1JA8 A;  2OTL V;  2Q8V A;  2UXX A;  4UCS A;  3H1I H;  4X64 B;  5A9G A;  3UCS C;  5EBM C;  3N27 A;  2PI5 A;  3T1H B;  1GAX A;  4JYB A;  2O57 A;  1G1X B;  2R72 A;  3OTO O;  2WSS G;  4JI8 O;  2L6L A;  3J7A U;  2QE7 G;  3GWO A;  3ZN1 A;  1KKC A;  3G6E V;  4BIZ A;  2ZCE A;  1AP5 A;  3MDS A;  5L3C A;  1FXH A;  1SA0 B;  2Q5Z A;  3BEH A;  1HWY A;  2HKO A;  4NXM B;  2R70 A;  1KP3 A;  2L35 A;  5IYD O;  3RVY A;  1JX9 A;  2UXB B;  2JGD B;  1IUR A;  1NH2 B;  1MNG A;  3N2K A;  3R66 A;  5B1A C;  5LP6 B;  4B3R O;  3BAB A;  4ABM A;  3VOU A;  3CCE V;  4JI5 O;  5H2F Z;  2Q7E A;  4YIO A;  2WLK A;  2PF4 E;  1TUB A;  4R8C A;  2KQX A;  3EXA A;  4NR1 A;  5EK0 A;  2DYS C;  4AQY B;  2HJD A;  4I4T A;  4IGG A;  5LL6 Y;  4YHH B;  4NKG B;  3ZJZ A;  4KHP B;  3QNE A;  4WFH A;  2YIC A;  4E4E A;  2Y69 B;  1FXV A;  2IW5 A;  3SYO A;  4DV0 B;  4ZI7 B;  1FFX B;  2PTM A;  1TGO A;  3CHX A;  1PP9 H;  4K3A A;  2Q67 A;  3B8N A;  3NXS A;  1VF6 C;  2EZO A;  1G6U A;  2AHZ A;  2XND G;  1EN6 A;  3RBZ A;  4LWS B;  3TXQ A;  3K79 A;  1UPG A;  3SPC A;  3C90 A;  2B5U A;  4F6R B;  3DC6 A;  3B09 A;  4BW5 A;  4UVB A;  4TV9 A;  3T1Y O;  5IY5 B;  2DQ0 A;  4TWK A;  3W7T A;  1Z5W A;  2KG7 B;  1UFI A;  2Q73 A;  5CA1 A;  4I9Q A;  2VQE B;  5KHK A;  2AHY A;  3KKY A;  1IZ3 A;  3LNM B;  4MW3 A;  3ETQ A;  4UFZ A;  4UV8 A;  2JEU A;  3BHP A;  4LBE C;  1W0K G;  2XAH A;  1P7G A;  1Q43 A;  4F4L A;  5B1B C;  1OCR C;  3OM3 B;  4YY3 B;  1RPR A;  2ZNJ A;  2WLN A;  4GKK B;  1ROP A;  3VQV A;  2VWJ A;  2JS3 A;  1URF A;  4I0X A;  1NJI W;  3RVZ A;  1DF5 A;  3APO A;  2OCH A;  5H6R A;  1BHA A;  3ZMZ A;  1FXK B;  4X66 B;  4I50 B;  5CN0 A;  5LYJ A;  4B3T O;  1R73 A;  3ZX6 A;  2JIZ G;  2IU3 A;  3JSL A;  4YJ3 A;  1JQ0 A;  4WFA V;  4BWA A;  4B3S O;  4AIL C;  3BPZ A;  1S5H C;  4JYA B;  3K59 A;  3PN1 A;  2WLI B;  5LGU A;  5LMU O;  4A5U B;  2BTQ A;  1N8R W;  3JD2 A;  5KUM A;  3B8M A;  3B2E E;  3JCU Z;  4X62 B;  4L87 A;  1ARO P;  5LOV B;  3HKC B;  4JGS A;  1F7Y A;  4P9O A;  3H1K H;  5BMV B;  4ZBM A;  1IBK B;  2HFE C;  1B04 A;  2EJR A;  3M7M X;  2P4K A;  2YIA A;  5EBW C;  1QVF U;  4MT8 A;  2DOS A;  4CH6 A;  5IJ0 B;  4DK0 A;  4MSW C;  2FTK A;  1Y6X A;  3CD6 V;  1WA8 B;  1R6N A;  3H01 A;  1COW G;  1SQV H;  1ZTE A;  2UU9 B;  2OTJ V;  3AK1 A;  4DR1 O;  4FVM A;  2LGQ A;  1G4Y B;  4MTF A;  5JQG B;  2QR4 A;  5JJE B;  2OT5 A;  1ZL8 B;  2JGD A;  3ZCC A;  5LP6 A;  2FYU H;  2ZKO A;  1Q81 W;  2R9I A;  3CEI A;  2W6I G;  1RM1 B;  5C8Y B;  1VAR A;  1BQZ A;  1D5A A;  1XOU A;  1K8A W; 
#chains in the Genus database with same CATH homology
 1PNL A;  1KKD A;  1V54 B;  2ATK C;  4WFF A;  3FYE B;  1F4M A;  1YSC A;  2HVK C;  3FB5 C;  4H37 A;  4HZ3 A;  4Q20 A;  3ZN0 A;  3AG2 B;  1QR8 A;  1E79 G;  2ZDI A;  3T4D A;  4CBC A;  2EIJ B;  3CC4 V;  1VQP V;  3SYA A;  3ETG A;  4MW8 A;  4G28 B;  1M57 B;  3IGA C;  3CCV V;  1NBM G;  3M99 B;  3CMA V;  1OCZ C;  3I56 V;  5LGN A;  1YJN V;  1YTF D;  3ABL C;  4QPJ A;  2GSM B;  2HR3 A;  1JJ2 U;  3AG3 C;  4OXS A;  2WWW A;  1DTO A;  4PA7 A;  4RAI A;  2IH3 C;  1FXK C;  5LHG A;  4ZKI A;  3AG4 B;  2K1E A;  4PA3 A;  1OCZ B;  4TT3 G;  2ZR3 A;  1YHQ V;  2QM8 A;  1Q82 W;  1KQS U;  3LDC A;  4UVA A;  3LSS A;  3ABL B;  2A9H A;  3WG7 C;  3OUF A;  5L3G A;  1M9N A;  3CXC U;  5H9C A;  1K92 A;  4P2Z A;  2ZD9 A;  4J9Y B;  1ZWI C;  4FPP A;  2X6B A;  4UXN A;  4UUJ C;  3WFV A;  2BOB C;  2YEV B;  1VQ5 V;  2W0F C;  4G2K A;  2NLJ C;  1S76 D;  3WG7 B;  5L3B A;  3LSQ A;  4GX5 A;  1GTO A;  1VQ7 V;  1K4C C;  4MVR A;  1F4N A;  1JVM A;  4WFG A;  1WLE A;  1OCC B;  4JAS A;  4PDR A;  3IFX A;  5GW7 A;  4FJC C;  4KUM A;  3ZRW B;  3P32 A;  3CCM V;  3CC7 V;  1FS0 G;  2JK5 C;  3D36 A;  1KEC A;  3MHS C;  2ZXW C;  2JJ1 G;  1M56 C;  4MS2 A;  2WAM A;  2XAF A;  4GCZ A;  1PKX A;  2JJ2 G;  5KA6 A;  3RW0 A;  3E8G A;  5CBH A;  3OEE G;  2Z3Y A;  3JCZ A;  2EIL C;  2UXN A;  2R9R B;  2XAG A;  4I5S A;  2XAQ A;  1I5Y A;  1GK9 A;  1V55 C;  3FB6 C;  3OE7 G;  4GX0 A;  4X89 A;  2ZXW B;  1QLE C;  2HJF C;  4R50 A;  2P7T C;  3GB7 C;  1NKD A;  4MTG A;  4KP4 A;  1YIJ V;  3OMN B;  1BMF G;  1QR9 A;  4GX1 A;  3FKS G;  3ABM C;  1VQK V;  3ABK C;  1H2G A;  3CCU V;  4JTD B;  1FFT B;  4WFE A;  3AEI A;  4ASU G;  1PD3 A;  2HVJ C;  2PI4 A;  4PA9 A;  2M7W A;  2HLD G;  3EHB B;  1MOF A;  5DN6 G;  1EZJ A;  3HB3 B;  3SYC A;  2Z5U A;  1FXK A;  1QVG U;  3ABM B;  3LDE A;  3W7W A;  3MD0 A;  1K97 A;  1TUE B;  1AJQ A;  2V1D A;  2DWE C;  1EFR G;  3ZMU A;  1P4R A;  2JDI G;  4MVM A;  1OCO B;  1YTF B;  4R7C A;  5LBQ A;  3CME V;  1RM1 C;  5CA3 A;  1W2B U;  1PNK A;  1SZT A;  5HFM A;  3MHH C;  5DM6 V;  1SER A;  4JTA B;  2YSU B;  5LGT A;  1NQT A;  2MK3 A;  4MVQ A;  4JYC A;  2DWD C;  3UKM A;  1AI5 A;  4MVS A;  3LDD A;  2WLI A;  3ZRS A;  1V54 C;  1SES A;  3E89 A;  3F5W C;  4QNH B;  1S72 V;  3OFN G;  3TK1 A;  3G71 V;  1K5S A;  1NH2 D;  3JD4 A;  2EIJ C;  3OR6 C;  3W7U A;  3BY6 A;  4E2L A;  2H8P C;  2WLM A;  4RQE A;  4TSF G;  1VQM V;  2ITD C;  1M57 C;  3E8H A;  3ZRV A;  3E35 A;  3JD3 A;  3K0G A;  1MG1 A;  1PL0 A;  3ASO B;  3E8F A;  1AJP A;  1G8M A;  4X8A A;  1Y4M A;  2QM7 A;  4HYO A;  1R6K A;  3TET A;  3E8B A;  3AG4 C;  2BOC C;  1W0J G;  1JPX A;  3FB7 C;  1S77 D;  1NR7 A;  3OR7 C;  4MVO A;  1KD1 W;  1RPO A;  5EBL C;  1MSW D;  1CPY A;  2IJH A;  2X6A A;  1VQO V;  1K34 A;  2WLH A;  4G27 B;  3SJQ C;  5B1N A;  1IXM A;  2NNU A;  3D3I A;  5L3E A;  1F23 A;  1MAB G;  3F7Y C;  2XAS A;  3ABT A;  4I9W A;  5E1A C;  4R6Z A;  5IDJ A;  1GM8 A;  2B1I A;  3T2M A;  1OCC C;  3ZIA G;  2OTL V;  2UXX A;  2Q69 A;  2ZR2 A;  3CC2 V;  3F7V C;  4LCU C;  3KG2 A;  1LNQ A;  3K03 A;  2QKS A;  3PJS K;  5EBM C;  5LHI A;  4RUE A;  2PI5 A;  2A0L A;  3IC7 A;  4JYB A;  4P30 A;  3EFF K;  1GM9 A;  3K04 A;  3STL C;  2WSS G;  2QE7 G;  3GWO A;  1VQ9 V;  1J95 A;  3ZN1 A;  5L3F A;  5B1B B;  1OCR B;  3G6E V;  3OUS A;  3JYC A;  4BIZ A;  2P90 A;  2ZQM A;  3ML0 A;  5L3C A;  4KFM A;  1DLB A;  1FXH A;  4BIU A;  3SYP A;  3CP1 A;  1VQ4 V;  2OCC B;  4RUF A;  3HPL C;  3BEH A;  1HWY A;  2HKO A;  1VQ6 V;  1S3J A;  2XAJ A;  1QBZ A;  2Q68 A;  2CK3 G;  1KP3 A;  4PDV A;  5IYD O;  3RVY A;  4X88 A;  1JX9 A;  2IH1 C;  2IJJ A;  1NH2 B;  1GM7 A;  2GHY A;  5B1A C;  2KB1 A;  2Y48 A;  3VOU A;  1GO3 F;  4XDJ A;  3T1C A;  3CCE V;  1H38 A;  4Z1M G;  3E2E A;  2WLK A;  3UM7 A;  1SRY A;  2DW4 A;  4R8C A;  1OCO C;  5B1A B;  5IYC O;  5EK0 A;  1K33 A;  2DYS C;  2WLL B;  3ZMV A;  4EKW A;  3SPG A;  4MVZ A;  1AR1 B;  1R3I C;  1AJN A;  2JEX A;  2W6J G;  2YEV A;  3SPH A;  3ZJZ A;  3W7S A;  3QNE A;  4GX2 A;  4WFH A;  2EIK B;  2X0L A;  1FXV A;  2Y69 B;  4JF3 A;  2DYS B;  2IW5 A;  2WLJ A;  5B1O A;  3SYO A;  4LP8 A;  3E83 A;  4MTX A;  5KA5 A;  1KP2 A;  5L3D A;  2LFR A;  4U7N A;  2DYR B;  3K3W A;  3ZRW A;  1K4D C;  4JAU A;  1I5X A;  2Q67 A;  4JTC B;  3B8N A;  3K0D A;  3ASO C;  4CZZ A;  1NVP D;  2HG5 C;  3NXS A;  1R3L C;  5IYB O;  2EZO A;  1K3E A;  3ETD A;  4XBF A;  2AHZ A;  2EIM B;  2XND G;  2EZP A;  4FK5 C;  4N21 A;  3RBZ A;  1GMG A;  1YJ9 V;  1VQL V;  1KC8 W;  3K79 A;  4HAM A;  4PDL A;  3SPC A;  1WPX A;  4XDL A;  2B5U A;  1VQN V;  3G4S V;  1OHH G;  1H8E G;  4YXW G;  4RQF A;  1YI2 V;  1F51 A;  3QO7 A;  4BW5 A;  3X2Q C;  4UVB A;  3OW2 U;  3B77 A;  2IU0 A;  5IY5 B;  4H33 A;  2DQ0 A;  4LC1 A;  4TWK A;  3P30 A;  3W7T A;  3ETE A;  2WLL A;  3AG1 C;  2QEX V;  1QLN A;  1E1R G;  2ITC C;  3T4Z A;  5B3S B;  2AHY A;  5EC2 C;  3X2Q B;  3FYI B;  3LNM B;  4MW3 A;  1YIT V;  2WPD G;  4N23 A;  4QE7 A;  3DGE A;  1VQ8 V;  2DQ3 A;  4RO2 A;  4UV8 A;  1SET A;  1P7B A;  1ENV A;  1K5Q A;  1AI4 A;  2JEU A;  4LBE C;  4PDM A;  1W0K G;  4QE9 A;  3AG1 B;  5EC1 C;  5C93 A;  2XAH A;  2X7R B;  2P6J A;  3SYQ A;  4UVC A;  4DO2 A;  3CPW U;  3CCQ V;  2D3O W;  3ABU A;  4F4L A;  1K73 W;  3JD0 A;  1OCR C;  5B1B C;  1XL4 A;  3OM3 B;  5CBF A;  1RPR A;  3JD1 A;  1K9M W;  2A79 B;  2WLN A;  3LUT B;  1ROP A;  2EBO A;  3ZRX A;  3A0R A;  1EBO A;  2XOK G;  2OCC C;  1NJI W;  2LP7 A;  4XDK A;  3RVZ A;  1GKF A;  1DF5 A;  4WCE V;  4JAV A;  5H6R A;  1BHA A;  3AG3 B;  2B1G A;  3ZMZ A;  1AI7 A;  1FXK B;  3QO5 A;  1M90 W;  5CN0 A;  1R73 A;  3E86 A;  2X6C A;  5J9P C;  2F43 G;  2JIZ G;  3ASN C;  1CP9 A;  2IU3 A;  1L1F A;  1E1Q G;  3K9A A;  1H8H G;  1JCH A;  2EIN C;  3R65 A;  1JQ0 A;  5KUK A;  3I55 V;  4WFA V;  3K08 A;  1S0V A;  1S5H C;  3OMA B;  4GT1 A;  1NVP B;  2Q6A A;  1BL8 A;  2WLI B;  1BHB A;  5LGU A;  3CCR V;  1R3J C;  1N8R W;  3ASN B;  3JD2 A;  3QO8 A;  2EIN B;  5KUM A;  3B8M A;  1AI6 A;  3ZMS A;  2ZDI C;  3SPI A;  4L87 A;  3FB8 C;  3OMI B;  1ARO P;  1CEZ A;  5FL7 G;  4U7O A;  3CYO A;  2LFS A;  4FIP C;  4JGS A;  4BAY A;  3CCS V;  2EIK C;  2Y69 C;  4P9O A;  4QIW F;  4FMT A;  4ZBM A;  4JPR A;  2HFE C;  1Y66 A;  2P67 A;  3K06 A;  1M56 B;  2EJR A;  2DYR C;  1B6Q A;  3CCJ V;  3ZMT A;  4UV9 A;  1OZ0 A;  1XL6 A;  5HFL A;  2V7Q G;  5EBW C;  1QVF U;  2EIL B;  1YJW V;  5LHH A;  1PNM A;  4MT8 A;  5CMU A;  4MTO A;  2H94 A;  3VBB A;  3CCL V;  4MSW C;  2IJI A;  1V55 B;  3W7X A;  2FTK A;  1M1K W;  2EIM C;  3STZ C;  1R3K C;  1QLE B;  4DXW A;  3CD6 V;  1R6N A;  5H6Q A;  4PA6 A;  3H01 A;  5BZB A;  2IJK A;  1COW G;  1ORQ C;  1JOY A;  4PEL A;  3ABK B;  3DTU B;  2OTJ V;  4WFB V;  1Q86 W;  1NR1 A;  1G4Y B;  1Q7Y W;  4PA4 A;  1QCE A;  4MTF A;  4P9P A;  1K7D A;  5IY5 C;  2OT5 A;  1DF4 A;  4MVU A;  3TCU A;  3ZCC A;  3OGC C;  3SPJ A;  1Q81 W;  2R9I A;  1UJW B;  4QPK A;  1THZ A;  4WF9 V;  5B3S C;  2W6I G;  2QTO A;  3AG2 C;  1RM1 B;  3OEH G;  2C2A A;  5CBG A;  1K8A W;  3OAA G;  4J9Z B;  4QJF B;  2QA4 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...