3UKMA

Crystal structure of the human two pore domain potassium ion channel k2p1 (twik-1)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
252
Chain Sequence
b'NSATMFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 1
publication title Crystal structure of the human two-pore domain potassium channel K2P1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 99
structure length 252
sequence length 264
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ukmA01
2WLIA 1M57C 4F4LA 3KG2A 1R3IC 4H33A 4PA3A 2WLJA 4MTGA 4RUEA 4WFHA 4JTCB 5B1AC 4EKWA 4I9WA 3K0DA 2W0FC 2X6BA 4QNHB 3T4ZA 3HPLC 5EBWC 5EC2C 3E86A 4PDVA 5J9PC 4TWKA 4R7CA 3TCUA 2WLHA 1OCOC 4G27B 1R3KC 4HYOA 4P30A 4PA9A 4RUFA 5EC1C 3T2MA 4JTDB 2Q6AA 3SYPA 4OXSA 4WFFA 5EBMC 2QTOA 1QLEC 1R3LC 3F7YC 1ORQC 2X6CA 4J9ZB 4MVZA 2QKSA 4MVOA 4X89A 2KB1A 2WLKA 3SPCA 4MVQA 4LBEC 4X8AA 2ITCC 4JTAB 4H37A 1XL4A 2ZD9A 4MTFA 3RVZA 1XL6A 3PJSK 4PDLA 4PDMA 2EIJC 4MTOA 4R8CA 3ZRSA 3TETA 4GX0A 2Q69A 3OUSA 4ZBMA 2NLJC 3SPIA 2HVKC 3OR6C 2ITDC 4MW3A 4WFGA 3LDCA 1M56C 4RAIA 4MVMA 4XDKA 2ZXWC 2WLLB 3SPGA 2YEVA 2DYSC 4PA6A 4R6ZA 3F7VC 1OCZC 3ABLC 3WG7C 3AG2C 3T1CA 2DWEC 3K0GA 4PA7A 2DWDC 3K03A 2ATKC 4QE9A 5BZBA 3E89A 3AG4C 4UUJC 3BEHA 2BOCC 2A9HA 3FB6C 3RBZA 4MVSA 1S5HC 4BW5A 4QE7A 3F5WC 3JYCA 4P2ZA 4P9PA 1V54C 2Q68A 2IH3C 4MS2A 3RVYA 3LUTB 4CBCA 4HZ3A 3IFXA 4XDJA 4LP8A 5B1BC 5KUKA 3E83A 3K06A 2WLNA 3ASNC 2EINC 3STZC 5E1AC 2R9RB 2EIMC 2HG5C 3FB8C 3E8GA 5CBFA 2JK5C 3STLC 3SJQC 4DXWA 1KKDA 2Y69C 2BOBC 2AHYA 3K04A 2WLLA 5B3SC 3R65A 3X2QC 5KUMA 1K4DC 2HFEC 3OR7C 5CBHA 2Q67A 2IH1C 3UKMA 2DYRC 2AHZA 4MSWC 5EBLC 1V55C 3E8BA 1G4YB 1OCCC 4G28B 2HJFC 3FB7C 3T4DA 2P7TC 2A0LA 1P7BA 1ZWIC 4RO2A 1JVMA 4MW8A 3ZJZA 3IGAC 4MVUA 5CBGA 3ASOC 4LCUC 4KFMA 1LNQA 3ABKC 3OUFA 4PA4A 3SPHA 3ABMC 4R50A 2HVJC 4X88A 3SYAA 1K4CC 1BL8A 3SYOA 3VOUA 3LDDA 2WLIB 3EFFK 3FB5C 4J9YB 2K1EA 3AG3C 2EILC 4WFEA 3RW0A 4PDRA 3SYCA 1J95A 3SYQA 3UM7A 4P9OA 4MVRA 1OCRC 2A79B 2H8PC 2OCCC 2WLMA 3LDEA 3E8FA 4GX2A 4GX1A 3K08A 3GB7C 3SPJA 3LNMB 3AG1C 5IY5C 1R3JC 4XDLA 5EK0A 3E8HA 2X6AA 4GX5A 3OGCC 2EIKC
chains in the Genus database with same CATH superfamily
2WLIA 4O2BB 3OEHG 4DV6B 2HHHO 1SQGA 1FPOA 4OGQB 4HNAB 4YY3B 1GK9A 1DGSA 2Q6AA 4IGGA 2IJHA 1JJ2U 3UO2A 3K5LA 2LO1A 1XBLA 2QTSA 3CX5F 1MOFA 1ROPA 2CTRA 3BHPA 1OJHA 4DK1A 3ABTA 1XQ8A 4X8AA 1Q82W 1JJOA 1V9PA 1YJ9V 1GM9A 4JI7B 4MTOA 3ZRSA 4K0KB 1N4CA 1XOUA 2LP7A 4I50B 3G4SV 2YEVA 2FTKA 2V1DA 3C3SA 5IJ0A 2HP8A 1S3JA 4LFCO 5IYZB 4B7EA 2DYRB 1V55B 2Q68A 1Y74B 2ZT9B 4LP8A 1LUWA 2F23A 4CS2A 2JK5C 1KKDA 2JS5A 4Z2WA 2CAZC 3CCRV 1N34B 3QG5A 3JARA 2ZM6B 2HJFC 1BQZA 4DUYB 2A0LA 5LMUO 1H38A 4YJ2A 1NU1H 3VQVA 4DR5O 5KHGA 3DC6A 1SKVA 1PV0A 3G71V 1HNXO 5JCOC 3CC7V 3SYOA 2WLIB 4JI1B 1CEZA 1BHAA 1SESA 4U3FH 2E75B 3U0ZA 4X66B 2E76B 4FM0A 4Q6GA 2XHBA 3CCJV 4N23A 1R1BA 1IDSA 5H9CA 4NYKA 3K5NA 1F23A 5KHKA 1NT2B 1I08A 1W0JG 1GTOA 1FXKC 2O57A 4LF9B 5BXZA 1YEWA 1HNZB 2LFSA 3ETDA 4PDVA 4B3MO 4YHHO 5AG2A 5IT9N 2DW4A 2YEVB 4HYOA 5LYJB 4OXSA 5EBMC 2PI4A 4DR2O 4NTXA 4QIWF 2OTJV 4X1YA 5IJ0B 1TUEB 3F7YC 1MG1A 3ZMVA 4FK5C 2F95B 1N8RW 4ZIBA 3DGEA 2ZXWC 1COWG 3H1JH 4UCRA 5B3SB 2N05A 4O4HA 3JARB 3RBZA 1F51A 4BW5A 3ZBHA 2CTPA 1YVWA 4AHCA 5LHHA 4YJ2B 2QM7A 1VQLV 4LWSA 2R9RB 1JX9A 4NXMB 3U11A 1BSMA 2EILB 5LXTA 2UUBO 3T4DA 1AR5A 1NH2D 2M7WA 3H1KH 1XNQB 2QR4A 4J7ZA 5JJNB 2UUCO 1RPRA 5DEDA 1EZVH 2E3CA 2AZ0A 3CSXA 3U10A 2YIAA 2VRZA 4JV5O 4TT3G 5FPOA 3IC7A 5KA5A 3QO7A 3WU2Z 1FKAO 2OCCC 2EBOA 1VF6A 1G1XB 3CE2A 1OCOB 1IBMB 4B3RB 4X1YB 1XNRB 2PTMA 1QLEB 4B08A 1PL4A 3G80A 1VQOV 4BWAA 1LUVA 3UO3A 3T1HO 1M57C 3KG2A 4JZ2A 3RFRA 3HKCB 3CXCU 4UB6Z 3K0DA 1HW7A 3RT3C 1NTKH 2Q73A 2ZINA 4WFBV 3JCZA 3SYPA 1NQTA 2D3OW 3G6EV 1BCCH 4H37A 4UVBA 5L3EA 4JI6O 4JI2B 3OE7G 1WP7A 3B8MA 4GX0A 4PI2A 4FLYA 4XDKA 1SQQH 1D2DA 4GT1A 3TGUH 1OCZC 1RSOA 2KKWA 1YTFD 3A2FA 2GBOA 4DYLA 2P4VA 3J80N 1XMQO 3RVYA 4I0XA 1L0NH 4JI8O 4YIPA 4GYCB 5KAIZ 2PGGA 1ZUQA 2A3QA 2Y69C 2QKAA 4J41A 5JWPA 1Q90D 1H8HG 5EBLC 3SDLA 2UXDB 1QVGU 1P7BA 1JVMA 2QWNB 5LHGA 4LCUC 4CH4A 5ITZA 1I5XA 4GLXA 3A8TA 3K79A 4NB5A 4JI4B 1WLEA 4J10A 4UXNA 1NR1A 2OTLV 4P9OA 4MVRA 1Y76A 4GUNA 2WLMA 3ZHSA 5BR8B 3K08A 4TUYA 5L3GA 3B77A 4TV8A 1F4MA 5EYPA 4X65B 1S76D 3CMEV 3FYEB 1BGYH 5CBHA 2LQTA 4ABMA 4DV6O 3JAWA 1GKFA 1TA8A 3DTUB 4JYYA 5JQGA 2WLHA 4RUFA 4DR1O 4LNUA 1RSOB 4FZ0A 4IYHA 3EHBB 1R3LC 5LBQA 4ICGA 2B9ZA 4MVQA 2FMLA 3OT7A 3E35A 2JS3A 4I0XB 4UCUA 5FNVB 1Q81W 1XL6A 5B1BB 4JI7O 4X9QA 3SPGA 3JATA 3K0GA 4ASUG 1EM1A 3E89A 1FXHA 2LW1A 1V54C 1B04A 3CB2A 4X1IB 2LW7A 2WLNA 5ITZB 2EIMC 1D5NA 1R6KA 3H01A 5J2UA 3STLC 3K04A 3LSQA 4LH7A 5DM6V 4YJ3B 2IW5A 5FLXN 1N34O 2E5LB 3WFVA 5GONA 1Y76B 2ZM6O 4EFBA 5CA1A 1R6NA 4KHPB 4DUYO 3ZX6A 3H1HH 4TUYB 5HFLA 4BIUA 5B5EZ 4KFMA 2GUZA 4C7UA 3RYCA 4DR7B 4TV8B 1S72V 5EYPB 1YHQV 5B1NA 5JCOA 5JVDA 1PP9H 3CC2V 2EIKB 4LF8B 4JI1O 2P06A 3D36C 1HNWB 1N33B 1IBLO 4X66O 4BIOA 3E8FA 5DECA 4WCEV 1KUQA 4NVPA 2OT5A 2VQEB 5LP6C 4NR1A 1AJPA 2JGUA 3OGCC 4F4LA 1R3IC 4RUEA 5CMUA 4CH3A 4NXNB 1CP9A 4LF9O 1I7FA 5B66Z 4JPRA 3K57A 1QNMA 1XEQA 1R3KC 3JATB 2DMXA 5GTHZ 1B3QA 2ZE6A 4D7SA 1F7YA 1NTMH 3HKDB 4MTFA 1KU9A 1R73A 1XMOB 1IURA 2EIJC 5L3DA 5J2UB 1XREA 4RAIA 3QNEA 4J11A 4WBNA 4DR4B 2DYSC 2Y48A 3ETQA 2YDEA 3K9AA 4JAVA 2BOCC 3MD0A 5LHIA 5GONB 3JYCA 5CA1B 1F4NA 1WN7A 2RNBA 4AI8A 4HZ3A 4NTWA 5H6QA 2Q0OC 1AJNA 3SJQC 4NXMO 4KP4A 3N2KB 3THOA 1K33A 1LR1A 2QM4A 2ZNJA 2Q67A 1ZLZA 4QJFB 2AHZA 4YXWG 2RDCA 3FB7C 3O65A 5K1PA 1ZWIC 2JVDA 3IGAC 1XNQO 3ASOC 2AW9A 3OFNG 2KG7A 4FJCC 4Z1MG 1AI4A 2X7RB 4I50A 1FXKB 4WFEA 2EJ7A 3UM7A 2Y0IA 1VQPV 1IX9A 3OTOB 2R70A 4FPPA 4B3TB 1IBMO 4B3RO 2CGNA 3JAKA 1FJGB 3ZN1A 4CC5A 3CRRA 4DV0B 2CGOA 3DC5A 4H0LB 4GKKB 3E86A 2BE3A 3SGIA 1NBMG 4G27B 2ZXWB 3ZHVA 4QGPA 4DW1A 4WFFA 4O4IB 4PJ0Z 1W2BU 3SPCA 2DN9A 1CPYA 3RYFA 3K59A 1TUBB 4UVCA 5KA6A 1Y6XA 4JI0B 4JI2O 5IYCO 1MSWD 4ZBMA 4LF6B 2Y4UA 4MW3A 3ZMTA 1EN4A 3B8NA 4JAAA 5KHHA 2N04A 4RQEA 1OHHG 1YIJV 5FL7G 2EZPA 3A0HZ 1MSDA 1MZFA 3IC9A 4K35A 3IFXA 3E83A 3K06A 1DF5A 3FD9A 2KG7B 3DXRB 3MDSA 2M6YA 1VF7A 2Q5ZA 3APQA 4ZOLA 4CS4A 4LFAB 2WWWA 5LYJA 2Y4TA 4BR6A 1G4YB 3M99B 2UXDO 2OCCB 5KLVH 3W7XA 3FAVA 3W7WA 2GHYA 1G8MA 1W59A 3ABKC 4PA4A 5KMGB 3JAKB 1YSCA 1RP3B 2L6LA 2ZR2A 1M93A 1M1KW 3AG3C 1M57B 3R66A 3ZMUA 3UQ8A 1EFRG 1OCRC 3B40A 3CXHF 5BR8O 4LF7B 1XUQA 1KBHA 1VQ4V 3RYFB 2QWPB 4DR6B 2RMKB 5IDJA 4X65O 2BCCH 2VS0A 3CJHB 2WLJA 4MTGA 1SQXH 1BMFG 3JALB 5CA0B 4JI5O 4QNHB 4LF4B 3T4ZA 4X20B 2JEXA 3JSNA 3T2MA 2PUSA 4JTDB 2IBZH 1OCZB 1ORQC 5IYBO 3T1YB 1MA1A 2HLDG 5KHJA 1ZSPA 3N2GB 5CN0A 5BY1A 4FLZA 4FM1A 2NLJC 5JJJB 1M56C 2WPDG 1AJQA 4ZOLB 1GN6A 4FMTA 2Y69B 1MZEA 3CCEV 4H13B 1HP8A 4JYBA 3HKEA 2BTQB 1AP5A 1IVSA 3FAVB 5A2QN 5FPRA 3VQXA 3HKCA 4O4JA 5C8YA 2UUAB 1Q5OA 2Y0PA 4FLXA 2WLLA 2FKXA 5LOVB 4K3AA 3OR7C 4UB8Z 1SZTA 3E8BA 4WF9V 2E5LO 2XAFA 1WPBA 4KHPO 1AI7A 3BAAA 1FD9A 2Q7EA 3BY6A 3BABA 2X0LA 5TISZ 1K3EA 3FB5C 4Z1VA 4J9YB 3RW0A 4LF8O 1Y66A 3EXAA 3SYQA 3D36A 1HNWO 1N33O 3P3NA 4JAUA 1SQPH 1J5EB 3K5MA 3AG1C 2VQEO 1QQCA 3CCQV 1XDCA 4TV9A 2WA3A 3BPZA 3TXQA 5LGNA 3QO8A 4PA3A 4JTCB 4EKWA 3K5OA 4I9WA 1P4RA 5EC2C 4NXNO 2K9PA 5EC1C 1MABG 3ETEA 3K58A 3EVKA 2ZKOA 4E2LA 1H2LA 2X6CA 3HKEB 2GTAA 3BA9A 4D7TA 3AG7A 4X64B 1V54B 3B09A 1PNMA 1XMOO 1FYJA 5J2TA 4O4JB 2EIMB 5C8YB 2WLLB 5IJ9B 1URFA 4CH5A 2PZSA 2GV9A 4DR4O 2UXNA 3Q4HB 2DWDC 1RPOA 3RGBA 1K92A 1S5HC 1PNKA 2H3OA 1X4TA 2HG5C 1M90W 1NKDA 1QLNA 1B6QA 2R9IA 3R65A 4FM2A 3JCUZ 1MMMA 3OMIB 3G67A 4UCVA 2XAGA 2UU9B 5KAFZ 2MK3A 1AILA 3OAAG 4Q20A 1N0JA 3BA8A 4IYIA 5FNVA 5LP6B 4JGSA 3W7UA 2P6JA 4TV9B 2XT9A 3B4SA 4JYAB 3CCSV 2DE0X 3RYIB 2VQFB 3JD0A 2P5OA 3H1IH 3KZIZ 2JEUA 1S5JA 5EIBD 2ARHA 1AI5A 2CK3G 1BE3H 2R72A 4W4KA 4X1IA 4DUZB 3OTOO 3LNMB 4A5UB 3ZS8C 1L8DA 4B3TO 3LSUA 5EK0A 4L8JA 4GX5A 1M5IA 2A7WA 4WFHA 4DV0O 2UXCB 5J2TB 5IWAB 5EBWC 4GKKO 1DLBA 1YJWV 4LF5B 4YJ3A 3OEEG 2QM8A 4LFCB 1RFYA 4ZHQA 2DYSB 4YIOA 1NVPB 2FB5A 4UCTA 1IXMA 2C2AA 4X89A 4MVZA 3OGIB 2ZIMA 2KB1A 4LBEC 2YC0A 1KKCA 1PPJH 3O9OA 2GSMB 4JI0O 1N0NA 5KHIA 4PV1B 1OV9A 3OM3B 2GDSA 4FFBA 4JI3B 3CWBH 1ZAUA 3T1CA 4YY3O 2ATKC 3AG4C 3FB6C 3ABLB 1N32B 2BSKA 4P9PA 2DQ3A 4GCZA 3LUTB 1ZTEA 1BZKA 1WB8A 3ASOB 1E79G 1GN4A 2Q8VA 2ZDIC 4K0KO 3AK2A 3X2QC 2QSAA 2CTWA 3TK1A 4LFAO 4DW0A 3JD2A 2F93B 4EEQA 5KX5B 4DV7B 4MSWC 1H2GA 5GTIZ 3NR7A 4DR3B 3ZJZA 4MTXA 1QVFU 3HKDA 2F4VB 2Z3YA 2JJ1G 3ABMC 4JF3A 3IAYA 3L75H 4UVAA 1BT8A 1YZBA 2VWKA 4FLUA 3CC4V 2PF4E 1T5EA 4FFKA 4H44B 4L87A 4YHHB 1SZXA 2YS8A 1GRJA 3MAQA 4DR2B 2A79B 1Q86W 2PYJA 3LDEA 5CB4A 4LFBB 4ZHQB 4DV4B 4LF7O 4DV1B 2ZE8A 5IY5C 2OIGA 3E8HA 4DR6O 4W4LA 4AILC 3M7MX 2CH7B 3CP1A 3N2KA 5B1AC 1H8EG 1P49A 4IIJA 4FFBB 4LF4O 4DRXA 1H2SB 1Q8IA 1H2MA 2CUGA 1XI1A 4TSFG 4TQDA 3WB1A 2ADPA 2QKSA 1YJNV 2BSKB 2ITCC 3T1YO 5L3CA 1TAEA 2ZD9A 1P7GA 4EB6B 2YI8A 4PDLA 4PDMA 3K9SA 1FXKA 3CD6V 1W0KG 4DV3B 4F6RA 1KP2A 1EN6A 1S77D 1HNZO 3ETGA 2UUBB 4UUJC 5CA3A 4GKJB 4KXRA 4QE7A 3ZMSA 2QDOA 3NXSA 1SA0B 3ASNC 2EINC 2QA4V 4U3JA 3E22A 3ABKB 4DXWA 1CXZB 5LGUA 2P22C 3CPWU 2UUAO 1R6TA 1AP6A 4JZGA 2IH1C 1VF6C 3AG3B 1FAFA 2UXBB 2HJDA 1YCIA 4O4IA 1OCCC 4G28B 2RQ6A 1KB9F 4GZRB 1OCRB 5CB4B 5CBGA 1NZ6A 1TUBA 1SS3A 1UJWB 3T1HB 1LNQA 2P90A 3C90A 3OUFA 4I4TA 3SPHA 3KCYA 2HVJC 2FL4A 1JCHA 3SYAA 3VBBA 1K34A 1SETA 2H94A 3L73H 3SYCA 1J95A 4IIJB 1H2NA 4DRXB 1VIBA 4FIPC 2B5UA 1S0VA 4CC6A 3GB7C 1Z5WA 1XILA 1J5EO 3CRCA 3BFRA 1R3JC 3OW2U 3QF7A 3DXRA 4I55A 4J7KA 4N21A 2DOSA 1ENVA 2XNDG 2YXYA 3HB3B 2ZCEA 3CCUV 4DO2A 4ZKIA 3FYIB 4TQFA 1U97A 2N74A 4F6RB 3JASB 4KL1A 1JR9A 1M56B 3ZHUA 4FLWA 1DF4A 1PL0A 1Q6UA 3LSSA 1DTOA 1D5AA 2YICA 1K9MW 5KMGA 3ZN0A 1XNRO 2ADQB 2XTAA 3P32A 1PNLA 3AK3A 1XHXA 1P84F 3OUSA 4U3JB 3E22B 3JSLA 4WFGA 3ZRWB 4DK0A 3SR2C 3CCLV 1K7DA 3AG2C 1BHBA 5BMVB 4PA7A 3K03A 1KP3A 1WB7A 2XUMA 3D8CA 3CJHA 4I4TB 1H2KA 4IHJB 4PHZA 3JALA 5CA0A 1L0LH 1WA8B 2W0XA 2WAMA 2YXHA 4X20A 2QE7G 1QBZA 3HKBB 4FVMA 3VQYA 4UV8A 3ICXA 1Q43A 3I55V 2OWOA 1WJZA 1THZA 2Q7GA 1ZX3A 2UU9O 5EZYA 3BRCA 2KQXA 1GM7A 3AG1B 3N2GA 4I55B 1BL8A 3VOUA 2HKOA 1YF2A 4JASA 4JYAO 1UFIA 1EBOA 1VQMV 2VQFO 4DR1B 2HR3A 2YIBD 1YXBA 2G38A 2BTQA 3VQWA 3ZRXA 3P30A 2YIBA 4DUZO 3ZHQA 4LR3A 1NTZH 2IJKA 1Y4MA 1OZ0A 3L71H 1NI8A 2WA4A 4H33A 3HR0A 4JI4O 2YIDA 5LOVA 2UXCO 3UT5A 5IWAO 5J9PC 4RQFA 4LF5O 4AQYB 1GH6A 1TVKB 4J42A 1HDJA 1G6UA 4J9ZB 2QWOB 2WLKA 2NNUA 3RWRD 1JQ0A 1XL4A 1IBKB 1QR9A 3H1LH 3PJSK 2HEPA 1VARA 2ITDC 1GO3F 3BVOA 4JI3O 5LL6Y 3WG7C 4BIZA 4I5SA 2NR5A 3BEHA 4B3SB 3F5WC 1N32O 2YUAA 4XDJA 4HBNA 5EZYB 5E1AC 4U7OA 5B1OA 5CBFA 4DV5B 4OPHA 2RN9A 3JD4A 1IBLB 2ZDIA 5KUMA 2HFEC 2ZR3A 4DV7O 2FYUH 1I94B 2LGWA 4DR3O 1Q6IA 3AEIA 5IE9A 2F4VO 4FZ1A 3WB2A 1SC5B 1JA8A 4I7ZB 4OX9B 1PM9A 2ZNIA 2QKCA 5IJ9A 3KKYA 2LFRA 2ZIOA 2CTQA 2BTOA 1PKXA 2Z5UA 3UT5B 3Q4HA 1VEWA 1RM1C 4GX1A 4FLVA 4TOIA 4LFBO 2P67A 5LGTA 4LC1A 1EN5A 4UCSA 4DV4O 4EFEA 4DV1O 4PD4F 1E1RG 3CCVV 5H5NA 3FFQA 4DR7O 1AB3A 3FKSG 2W0FC 3HPLC 4E4EA 1JOYA 4PA9A 5LMNB 2Q4PA 1IXBA 2IJIA 2QTOA 5H2FZ 1AI6A 1I5YA 1HR0B 3AG4B 1Z2GA 3CS5A 3OMNB 1KD1W 2B1GA 5LP6A 1QU7A 2W6IG 3M8AA 1Y67A 2RJZA 4U7NA 1KQSU 4UV9A 4CS3A 3RYIA 1K5SA 4DV3O 4R6ZA 3QVNA 1DK1A 3P3PA 3CCMV 3X2QB 4QE9A 2ODMA 2WSSG 2MW2B 3BCCH 1JFFA 1VP7A 1O9GA 4GKJO 4X62B 2IH3C 4F6EA 5C93A 3ZHTA 3OD4A 1YDXA 1K8AW 1AR4A 1VMGA 4DV2B 3ABMB 2AHYA 1SERA 1NVPD 1K4DC 3ABUA 3OTFA 2EX3A 2DYRC 2GTSA 1V55C 2UXBO 1EZJA 2P7TC 4MW8A 4MVUA 2E74B 1K73W 4BW9A 2JGDA 1M4UA 1I0HA 1N36B 5IY5B 4X88A 1VQ9V 3EFFK 4ZI7A 5B1AB 1UPGA 5L3FA 1KC8W 2F66C 4O4HB 4G2KA 2YSUB 3ZRVA 4I9QA 3J7AU 1QCEA 3ZHRA 1FFTB 4LWSB 2JRIA 4OPAA 2HHHB 3RN4A 5LA6A 5KX5A 4TWKA 3TCUA 2XASA 3C3TA 4XBFA 4P30A 4UCOA 1GM8A 5LXTB 4O4LA 2IU0A 5L3BA 3CHXA 1WP8A 1JFFB 2XOKG 1S5LZ 3W7TA 3PN1A 3L74H 1NH2B 2CE4A 1FJGO 1JMKC 3ASNB 3SPIA 1Q6HA 1FXVA 2EINB 3LDCA 2EJRA 3CRAA 3E2EA 4MVMA 2QJ1A 2EIJB 1BQ0A 4MT8A 3LNNA 1KECA 3F7VC 3B2EE 3JD1A 3L70H 3S3WA 2QWRB 2YXLA 5JH7A 1Q7YW 1Q3EA 4MS2A 1OCCB 1M9NA 1GN3A 4CBCA 1Z5VA 3STZC 2IJJA 1K97A 2CH7A 2JGDB 2R9AA 2BOBC 5B3SC 4LF6O 3L72H 4NTYA 2PI5A 1WPXA 2DJVA 3UKMA 4ZI7B 4D6TH 5LMUB 3SJBC 4DR5B 5F2VO 3DSQA 3APOA 1HNXB 4EB6A 1AROP 3D3IA 1QHTA 4JI5B 1X59A 3SJCC 2EILC 2OIEA 1K5QA 5LA6B 2ZE5A 2RCVA 1VQ6V 4X1KA 3JD3A 2F1MA 4O4LB 4NKGB 5DN6G 4JYCA 1SA0A 4IL6Z 3RYHA 2V7QG 4K8XA 3S3XA 3J81N 1YTFB 5IYDO 2X6AA 3W7SA 4CH6A 1QR8A 1IZ3A 2X6BA 4B3MB 4IT5A 2V4DA 1AVMA 4R7CA 3TJTA 1OCOC 1TGOA 4AQYO 1SF9A 2ZE7A 3SJAC 3MHHC 5A9GA 5K1XA 3AG2B 5GW7A 1QLEC 2OCHA 3TETA 2W6JG 2D2CB 1YI2V 5JH7B 4JTAB 2ZQMA 2QEXV 4RWUA 3RVZA 1IBKO 3CYOA 4PI0A 4R8CA 3I5DA 1SQFA 2ETNA 2Q69A 3OR6C 3TXSA 1KMIZ 4PA6A 2QGNA 1NR7A 2JIZG 3CRMA 4J7JA 4MVSA 4B3SO 1MNGA 4P2ZA 2QWQB 2XAQA 2Q7HA 3CMAV 1E1QG 1WNSA 3ZCCA 2L35A 2CDYA 1YITV 3MHSC 2EZOA 2AGAA 3A0RA 4DV5O 1SRYA 2AZ2A 3GWKC 3GVMA 3JASA 2Z0AA 3JAWB 5JQGB 3H9VA 4LNUB 1I94O 3N27A 1GN2A 4RO2A 4X1KB 2IM9A 4UFZA 5HFMA 2YI9A 4BAYA 2UUCB 4KUMA 4K8ZA 3RYHB 4R50A 1PD3A 1VQ5V 1NJIW 3LDDA 3ZRWA 2UXXA 4JV5B 4OX9O 2K1EA 4HAMA 1GMGA 4LH6A 3ZEDA 3L9DA 1ZL8A 2NN4A 5BMVA 2IU3A 2H8PC 4FLTA 1FFXA 3SPJA 2Q9LA 3F5TA 2LJ2A 3UCSC 3CEIA 1VQ7V 2JJ2G 2A06H 2PY5A 1VQ8V 4IHJA 1WA8A 2P4KA 2B1IA 5JJEB 2AXTZ 3HKBA 2Q0AA 3GWOA 1NS1A 4QPKA 5LMNO 3D3QA 4CZZA 3WG7B 3ML0A 3QTCA 1HR0O 4MVOA 4O2AA 1HWYA 4JI6B 1SQVH 2VWJA 1VQNV 2ILMA 2GUZB 4O2BA 1O9HA 2XAJA 3RYCB 1BS3A 1JPXA 2F43G 2EULA 5JVDB 1U96A 2HVKC 4HNAA 1A32A 3OMAB 5E79Z 2DQ0A 3ABLC 2DWEC 5BZBA 4PELA 2A9HA 3G6BA 1XMQB 1VF5B 3QO5A 4X62O 4JI8B 3IJ4A 3K3WA 4J80A 5B1BC 5KUKA 3WB0A 3KCXA 4X64O 3FB8C 3E8GA 4QPJA 4DV2O 1US6A 1FS0G 2JDIG 3ZIAG 1XHZA 2LGQA 1TVKA 5IYZA 1ZL8B 5H6RA 5D5QA 5EIBC 1AR1B 2OYQA 1FFXB 1Y74A 1RM1B 2XAHA 1VQKV 2PYLA 1K4CC 1N36O 3CRQA 3FX7A 1B06A 2KSDA 4PDRA 4WBNB 3JAMN 4WFAV 1WAZA 4GX2A 5D5PA 3A0BZ 1SQBH 1GAXA 3I56V 1KYOF 3AK1A 4O2AB 3ZMZA 4XDLA 1L1FA 4B7KA 2EIKC
chains in the Genus database with same CATH topology
2WLIA 4F4LA 1R3IC 3OEHG 4RUEA 4WFHA 3FKSG 5CMUA 2W0FC 1CP9A 3HPLC 5EBWC 1DLBA 1JOYA 1YJWV 1GK9A 4JPRA 3OEEG 2QM8A 4PA9A 1R3KC 2Q6AA 2DYSB 2IJHA 2IJIA 1NVPB 1JJ2U 2QTOA 1AI6A 1I5YA 1MOFA 1IXMA 1ROPA 2C2AA 4MVZA 4X89A 3AG4B 2KB1A 3ABTA 3OMNB 4LBEC 4X8AA 1Q82W 2B1GA 1KD1W 1YJ9V 4MTFA 1GM9A 2W6IG 1R73A 2GSMB 4U7NA 1KQSU 2EIJC 4MTOA 3ZRSA 4UV9A 5L3DA 3OM3B 1K5SA 4RAIA 2LP7A 3QNEA 3G4SV 2YEVA 2DYSC 2Y48A 2FTKA 3K9AA 4R6ZA 3T1CA 4JAVA 3X2QB 4QE9A 3CCMV 2V1DA 2ATKC 3AG4C 1S3JA 2BOCC 2WSSG 3MD0A 3FB6C 5LHIA 2DYRB 3ABLB 1V55B 3JYCA 4P9PA 2DQ3A 2Q68A 2IH3C 1F4NA 5C93A 4GCZA 3LUTB 4HZ3A 4LP8A 1K8AW 3ASOB 1E79G 5H6QA 2JK5C 1AJNA 3SJQC 3ABMB 1KKDA 4KP4A 2ZDIC 2AHYA 1SERA 1NVPD 3X2QC 1K33A 3TK1A 1K4DC 3ABUA 3JD2A 2Q67A 3CCRV 2DYRC 4QJFB 2AHZA 4MSWC 4YXWG 1V55C 1H2GA 2HJFC 3FB7C 1EZJA 2P7TC 2A0LA 1ZWIC 3ZJZA 4MW8A 4MTXA 3IGAC 4MVUA 1H38A 1QVFU 3ASOC 1K73W 2Z3YA 3OFNG 4FJCC 4Z1MG 1AI4A 2JJ1G 3ABMC 4JF3A 3G71V 5IY5B 4X88A 3CC7V 4UVAA 3SYOA 2X7RB 1VQ9V 2WLIB 3EFFK 1CEZA 3CC4V 1BHAA 1SESA 4L87A 1FXKB 4WFEA 5B1AB 3UM7A 5L3FA 1KC8W 2A79B 3CCJV 1Q86W 4N23A 1VQPV 3LDEA 4G2KA 5H9CA 2YSUB 3ZRVA 4FPPA 1QCEA 1F23A 5IY5C 1W0JG 1GTOA 1FFTB 3E8HA 3ZN1A 1FXKC 3CP1A 5B1AC 1H8EG 2LFSA 3E86A 3ETDA 4PDVA 2DW4A 4TWKA 3TCUA 2XASA 4XBFA 1NBMG 2YEVB 4G27B 4HYOA 4P30A 2ZXWB 1GM8A 4TSFG 4OXSA 4WFFA 5EBMC 2PI4A 2OTJV 4QIWF 1W2BU 1TUEB 3F7YC 3SPCA 2IU0A 5L3BA 1CPYA 1MG1A 2QKSA 3ZMVA 1YJNV 2XOKG 2ITCC 4FK5C 4UVCA 5KA6A 3W7TA 5L3CA 2ZD9A 1NH2B 5IYCO 1MSWD 4PDLA 4PDMA 1N8RW 4ZBMA 3ASNB 3SPIA 1FXVA 2EINB 1FXKA 3CD6V 4MW3A 1W0KG 3LDCA 2EJRA 3ZMTA 4MVMA 1KP2A 3DGEA 3E2EA 2EIJB 2ZXWC 3B8NA 1S77D 1COWG 4MT8A 1KECA 1OHHG 3F7VC 3ETGA 5B3SB 4RQEA 1YIJV 3JD1A 5FL7G 2EZPA 4UUJC 5CA3A 3RBZA 1F51A 4BW5A 4QE7A 1Q7YW 4MS2A 1OCCB 3ZMSA 1M9NA 5LHHA 3NXSA 4CBCA 3IFXA 3E83A 3K06A 1DF5A 2QM7A 3ASNC 1VQLV 2EINC 3STZC 2QA4V 2R9RB 2IJJA 1K97A 1JX9A 3ABKB 4DXWA 5LGUA 2BOBC 3CPWU 5B3SC 2PI5A 1WPXA 2WWWA 2IH1C 3AG3B 2EILB 3UKMA 1G4YB 1OCCC 4G28B 3T4DA 1NH2D 3M99B 2M7WA 1OCRB 2OCCB 3W7XA 5CBGA 3W7WA 2GHYA 1RPRA 1UJWB 1G8MA 1LNQA 2P90A 3ABKC 3OUFA 4PA4A 3SPHA 1YSCA 1AROP 2HVJC 3D3IA 1JCHA 3SYAA 2ZR2A 3VBBA 1K34A 1SETA 1M1KW 3AG3C 1M57B 2EILC 4TT3G 3ZMUA 2H94A 3IC7A 3SYCA 1J95A 3QO7A 5KA5A 1EFRG 1K5QA 1OCRC 2OCCC 4FIPC 1VQ6V 2EBOA 2B5UA 3JD3A 1S0VA 3GB7C 1OCOB 5DN6G 4JYCA 1VQ4V 1QLEB 2V7QG 1R3JC 3OW2U 1YTFB 5IYDO 1VQOV 2X6AA 3W7SA 5IDJA 1M57C 3KG2A 4N21A 1ENVA 2WLJA 2XNDG 4MTGA 1BMFG 3HB3B 3CXCU 1QR8A 3K0DA 2X6BA 3CCUV 4QNHB 3T4ZA 4DO2A 4ZKIA 3FYIB 4R7CA 1OCOC 1M56B 2JEXA 3T2MA 4JTDB 4WFBV 3JCZA 3MHHC 3SYPA 1DF4A 1OCZB 1NQTA 2D3OW 3AG2B 5GW7A 1PL0A 1QLEC 3G6EV 1ORQC 3TETA 2W6JG 3LSSA 1YI2V 1DTOA 5IYBO 4JTAB 4H37A 2ZQMA 4UVBA 2HLDG 5L3EA 3OE7G 1K9MW 3ZN0A 2QEXV 3RVZA 3P32A 3CYOA 1PNLA 3B8MA 5CN0A 4R8CA 4GX0A 2Q69A 3OUSA 2NLJC 3OR6C 4WFGA 3ZRWB 1M56C 2WPDG 1AJQA 4XDKA 3CCLV 4FMTA 4GT1A 2Y69B 4PA6A 1OCZC 3CCEV 1K7DA 3AG2C 1BHBA 4PA7A 3K03A 1NR7A 2JIZG 1YTFD 4JYBA 4MVSA 1KP3A 4P2ZA 3RVYA 2XAQA 3CMAV 1E1QG 3ZCCA 1YITV 3MHSC 2EZOA 3A0RA 2Y69C 2WAMA 1SRYA 2WLLA 2QE7G 1QBZA 3OR7C 4UV8A 1H8HG 5EBLC 1SZTA 3E8BA 4WF9V 3I55V 1QVGU 1P7BA 2XAFA 4RO2A 1JVMA 1AI7A 5HFMA 5LHGA 4BAYA 1THZA 4KUMA 4LCUC 3BY6A 1I5XA 4R50A 2X0LA 1GM7A 3AG1B 1PD3A 3K79A 1BL8A 1VQ5V 1NJIW 3VOUA 1K3EA 3LDDA 2HKOA 4JASA 1WLEA 2UXXA 3FB5C 3ZRWA 4J9YB 1EBOA 2K1EA 4HAMA 4UXNA 1VQMV 1GMGA 3RW0A 1Y66A 3SYQA 1NR1A 2OTLV 4P9OA 3D36A 4MVRA 2HR3A 2IU3A 2H8PC 4JAUA 2WLMA 3K08A 3SPJA 3ZRXA 5L3GA 3P30A 3B77A 3AG1C 1VQ7V 2JJ2G 1F4MA 3CCQV 2IJKA 1Y4MA 1S76D 1VQ8V 1OZ0A 3CMEV 3FYEB 5LGNA 5CBHA 3QO8A 4H33A 4PA3A 4JTCB 4EKWA 4I9WA 2B1IA 1P4RA 3GWOA 5EC2C 1GKFA 3DTUB 5J9PC 4RQFA 2WLHA 4RUFA 5EC1C 1MABG 3ETEA 4QPKA 4CZZA 3EHBB 3WG7B 3ML0A 4E2LA 1R3LC 5LBQA 4J9ZB 2X6CA 4MVOA 2WLKA 2NNUA 4MVQA 1HWYA 3E35A 1VQNV 1JQ0A 1XL4A 1V54B 1QR9A 1Q81W 1XL6A 2XAJA 3PJSK 1PNMA 5B1BB 1JPXA 2F43G 2HVKC 2ITDC 1GO3F 2EIMB 3OMAB 2DQ0A 2WLLB 3SPGA 3ABLC 3WG7C 2UXNA 4I5SA 4BIZA 2DWEC 3K0GA 2DWDC 4ASUG 5BZBA 1RPOA 3E89A 1K92A 4PELA 3BEHA 2A9HA 1FXHA 1S5HC 3F5WC 1PNKA 1V54C 3QO5A 4XDJA 3K3WA 5B1BC 5KUKA 2WLNA 5E1AC 2HG5C 2EIMC 3FB8C 4U7OA 3E8GA 5B1OA 5CBFA 1R6KA 3H01A 1M90W 3STLC 1NKDA 4QPJA 1QLNA 3JD4A 3K04A 1B6QA 2R9IA 3LSQA 3R65A 1FS0G 2ZDIA 5KUMA 2HFEC 5DM6V 2JDIG 3ZIAG 2IW5A 2ZR3A 3WFVA 3OMIB 5H6RA 1AR1B 1R6NA 1RM1B 2XAHA 2XAGA 2MK3A 3AEIA 3OAAG 5HFLA 4BIUA 1VQKV 4Q20A 4KFMA 4JGSA 3W7UA 1S72V 2P6JA 1YHQV 5B1NA 1K4CC 3CCSV 3CC2V 2EIKB 3JD0A 2LFRA 4PDRA 1PKXA 2JEUA 2Z5UA 4WFAV 1RM1C 3E8FA 4GX2A 1AI5A 2CK3G 4GX1A 4WCEV 2P67A 5LGTA 4LC1A 3I56V 2OT5A 3LNMB 1E1RG 3ZMZA 4XDLA 5EK0A 3CCVV 1AJPA 1L1FA 4GX5A 3OGCC 2EIKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLI A;  1M57 C;  4F4L A;  3KG2 A;  1R3I C;  4H33 A;  4PA3 A;  2WLJ A;  4MTG A;  4RUE A;  4WFH A;  4JTC B;  5B1A C;  4EKW A;  4I9W A;  3K0D A;  2W0F C;  2X6B A;  4QNH B;  3T4Z A;  3HPL C;  5EBW C;  5EC2 C;  3E86 A;  4PDV A;  5J9P C;  4TWK A;  4R7C A;  3TCU A;  2WLH A;  1OCO C;  4G27 B;  1R3K C;  4HYO A;  4P30 A;  4PA9 A;  4RUF A;  5EC1 C;  3T2M A;  4JTD B;  2Q6A A;  3SYP A;  4OXS A;  4WFF A;  5EBM C;  2QTO A;  1QLE C;  1R3L C;  3F7Y C;  1ORQ C;  2X6C A;  4J9Z B;  4MVZ A;  2QKS A;  4MVO A;  4X89 A;  2KB1 A;  2WLK A;  3SPC A;  4MVQ A;  4LBE C;  4X8A A;  2ITC C;  4JTA B;  4H37 A;  1XL4 A;  2ZD9 A;  4MTF A;  3RVZ A;  1XL6 A;  3PJS K;  4PDL A;  4PDM A;  2EIJ C;  4MTO A;  4R8C A;  3ZRS A;  3TET A;  4GX0 A;  2Q69 A;  3OUS A;  4ZBM A;  2NLJ C;  3SPI A;  2HVK C;  3OR6 C;  2ITD C;  4MW3 A;  4WFG A;  3LDC A;  1M56 C;  4RAI A;  4MVM A;  4XDK A;  2ZXW C;  2WLL B;  3SPG A;  2YEV A;  2DYS C;  4PA6 A;  4R6Z A;  3F7V C;  1OCZ C;  3ABL C;  3WG7 C;  3AG2 C;  3T1C A;  2DWE C;  3K0G A;  4PA7 A;  2DWD C;  3K03 A;  2ATK C;  4QE9 A;  5BZB A;  3E89 A;  3AG4 C;  4UUJ C;  3BEH A;  2BOC C;  2A9H A;  3FB6 C;  3RBZ A;  4MVS A;  1S5H C;  4BW5 A;  4QE7 A;  3F5W C;  3JYC A;  4P2Z A;  4P9P A;  1V54 C;  2Q68 A;  2IH3 C;  4MS2 A;  3RVY A;  3LUT B;  4CBC A;  4HZ3 A;  3IFX A;  4XDJ A;  4LP8 A;  5B1B C;  5KUK A;  3E83 A;  3K06 A;  2WLN A;  3ASN C;  2EIN C;  3STZ C;  5E1A C;  2R9R B;  2EIM C;  2HG5 C;  3FB8 C;  3E8G A;  5CBF A;  2JK5 C;  3STL C;  3SJQ C;  4DXW A;  1KKD A;  2Y69 C;  2BOB C;  2AHY A;  3K04 A;  2WLL A;  5B3S C;  3R65 A;  3X2Q C;  5KUM A;  1K4D C;  2HFE C;  3OR7 C;  5CBH A;  2Q67 A;  2IH1 C;  3UKM A;  2DYR C;  2AHZ A;  4MSW C;  5EBL C;  1V55 C;  3E8B A;  1G4Y B;  1OCC C;  4G28 B;  2HJF C;  3FB7 C;  3T4D A;  2P7T C;  2A0L A;  1P7B A;  1ZWI C;  4RO2 A;  1JVM A;  4MW8 A;  3ZJZ A;  3IGA C;  4MVU A;  5CBG A;  3ASO C;  4LCU C;  4KFM A;  1LNQ A;  3ABK C;  3OUF A;  4PA4 A;  3SPH A;  3ABM C;  4R50 A;  2HVJ C;  4X88 A;  3SYA A;  1K4C C;  1BL8 A;  3SYO A;  3VOU A;  3LDD A;  2WLI B;  3EFF K;  3FB5 C;  4J9Y B;  2K1E A;  3AG3 C;  2EIL C;  4WFE A;  3RW0 A;  4PDR A;  3SYC A;  1J95 A;  3SYQ A;  3UM7 A;  4P9O A;  4MVR A;  1OCR C;  2A79 B;  2H8P C;  2OCC C;  2WLM A;  3LDE A;  3E8F A;  4GX2 A;  4GX1 A;  3K08 A;  3GB7 C;  3SPJ A;  3LNM B;  3AG1 C;  5IY5 C;  1R3J C;  4XDL A;  5EK0 A;  3E8H A;  2X6A A;  4GX5 A;  3OGC C;  2EIK C; 
#chains in the Genus database with same CATH topology
 2WLI A;  4O2B B;  3OEH G;  4DV6 B;  2HHH O;  1SQG A;  1FPO A;  4OGQ B;  4HNA B;  4YY3 B;  1GK9 A;  1DGS A;  2Q6A A;  4IGG A;  2IJH A;  1JJ2 U;  3UO2 A;  3K5L A;  2LO1 A;  1XBL A;  2QTS A;  3CX5 F;  1MOF A;  1ROP A;  2CTR A;  3BHP A;  1OJH A;  4DK1 A;  3ABT A;  1XQ8 A;  4X8A A;  1Q82 W;  1JJO A;  1V9P A;  1YJ9 V;  1GM9 A;  4JI7 B;  4MTO A;  3ZRS A;  4K0K B;  1N4C A;  1XOU A;  2LP7 A;  4I50 B;  3G4S V;  2YEV A;  2FTK A;  2V1D A;  3C3S A;  5IJ0 A;  2HP8 A;  1S3J A;  4LFC O;  5IYZ B;  4B7E A;  2DYR B;  1V55 B;  2Q68 A;  1Y74 B;  2ZT9 B;  4LP8 A;  1LUW A;  2F23 A;  4CS2 A;  2JK5 C;  1KKD A;  2JS5 A;  4Z2W A;  2CAZ C;  3CCR V;  1N34 B;  3QG5 A;  3JAR A;  2ZM6 B;  2HJF C;  1BQZ A;  4DUY B;  2A0L A;  5LMU O;  1H38 A;  4YJ2 A;  1NU1 H;  3VQV A;  4DR5 O;  5KHG A;  3DC6 A;  1SKV A;  1PV0 A;  3G71 V;  1HNX O;  5JCO C;  3CC7 V;  3SYO A;  2WLI B;  4JI1 B;  1CEZ A;  1BHA A;  1SES A;  4U3F H;  2E75 B;  3U0Z A;  4X66 B;  2E76 B;  4FM0 A;  4Q6G A;  2XHB A;  3CCJ V;  4N23 A;  1R1B A;  1IDS A;  5H9C A;  4NYK A;  3K5N A;  1F23 A;  5KHK A;  1NT2 B;  1I08 A;  1W0J G;  1GTO A;  1FXK C;  2O57 A;  4LF9 B;  5BXZ A;  1YEW A;  1HNZ B;  2LFS A;  3ETD A;  4PDV A;  4B3M O;  4YHH O;  5AG2 A;  5IT9 N;  2DW4 A;  2YEV B;  4HYO A;  5LYJ B;  4OXS A;  5EBM C;  2PI4 A;  4DR2 O;  4NTX A;  4QIW F;  2OTJ V;  4X1Y A;  5IJ0 B;  1TUE B;  3F7Y C;  1MG1 A;  3ZMV A;  4FK5 C;  2F95 B;  1N8R W;  4ZIB A;  3DGE A;  2ZXW C;  1COW G;  3H1J H;  4UCR A;  5B3S B;  2N05 A;  4O4H A;  3JAR B;  3RBZ A;  1F51 A;  4BW5 A;  3ZBH A;  2CTP A;  1YVW A;  4AHC A;  5LHH A;  4YJ2 B;  2QM7 A;  1VQL V;  4LWS A;  2R9R B;  1JX9 A;  4NXM B;  3U11 A;  1BSM A;  2EIL B;  5LXT A;  2UUB O;  3T4D A;  1AR5 A;  1NH2 D;  2M7W A;  3H1K H;  1XNQ B;  2QR4 A;  4J7Z A;  5JJN B;  2UUC O;  1RPR A;  5DED A;  1EZV H;  2E3C A;  2AZ0 A;  3CSX A;  3U10 A;  2YIA A;  2VRZ A;  4JV5 O;  4TT3 G;  5FPO A;  3IC7 A;  5KA5 A;  3QO7 A;  3WU2 Z;  1FKA O;  2OCC C;  2EBO A;  1VF6 A;  1G1X B;  3CE2 A;  1OCO B;  1IBM B;  4B3R B;  4X1Y B;  1XNR B;  2PTM A;  1QLE B;  4B08 A;  1PL4 A;  3G80 A;  1VQO V;  4BWA A;  1LUV A;  3UO3 A;  3T1H O;  1M57 C;  3KG2 A;  4JZ2 A;  3RFR A;  3HKC B;  3CXC U;  4UB6 Z;  3K0D A;  1HW7 A;  3RT3 C;  1NTK H;  2Q73 A;  2ZIN A;  4WFB V;  3JCZ A;  3SYP A;  1NQT A;  2D3O W;  3G6E V;  1BCC H;  4H37 A;  4UVB A;  5L3E A;  4JI6 O;  4JI2 B;  3OE7 G;  1WP7 A;  3B8M A;  4GX0 A;  4PI2 A;  4FLY A;  4XDK A;  1SQQ H;  1D2D A;  4GT1 A;  3TGU H;  1OCZ C;  1RSO A;  2KKW A;  1YTF D;  3A2F A;  2GBO A;  4DYL A;  2P4V A;  3J80 N;  1XMQ O;  3RVY A;  4I0X A;  1L0N H;  4JI8 O;  4YIP A;  4GYC B;  5KAI Z;  2PGG A;  1ZUQ A;  2A3Q A;  2Y69 C;  2QKA A;  4J41 A;  5JWP A;  1Q90 D;  1H8H G;  5EBL C;  3SDL A;  2UXD B;  1QVG U;  1P7B A;  1JVM A;  2QWN B;  5LHG A;  4LCU C;  4CH4 A;  5ITZ A;  1I5X A;  4GLX A;  3A8T A;  3K79 A;  4NB5 A;  4JI4 B;  1WLE A;  4J10 A;  4UXN A;  1NR1 A;  2OTL V;  4P9O A;  4MVR A;  1Y76 A;  4GUN A;  2WLM A;  3ZHS A;  5BR8 B;  3K08 A;  4TUY A;  5L3G A;  3B77 A;  4TV8 A;  1F4M A;  5EYP A;  4X65 B;  1S76 D;  3CME V;  3FYE B;  1BGY H;  5CBH A;  2LQT A;  4ABM A;  4DV6 O;  3JAW A;  1GKF A;  1TA8 A;  3DTU B;  4JYY A;  5JQG A;  2WLH A;  4RUF A;  4DR1 O;  4LNU A;  1RSO B;  4FZ0 A;  4IYH A;  3EHB B;  1R3L C;  5LBQ A;  4ICG A;  2B9Z A;  4MVQ A;  2FML A;  3OT7 A;  3E35 A;  2JS3 A;  4I0X B;  4UCU A;  5FNV B;  1Q81 W;  1XL6 A;  5B1B B;  4JI7 O;  4X9Q A;  3SPG A;  3JAT A;  3K0G A;  4ASU G;  1EM1 A;  3E89 A;  1FXH A;  2LW1 A;  1V54 C;  1B04 A;  3CB2 A;  4X1I B;  2LW7 A;  2WLN A;  5ITZ B;  2EIM C;  1D5N A;  1R6K A;  3H01 A;  5J2U A;  3STL C;  3K04 A;  3LSQ A;  4LH7 A;  5DM6 V;  4YJ3 B;  2IW5 A;  5FLX N;  1N34 O;  2E5L B;  3WFV A;  5GON A;  1Y76 B;  2ZM6 O;  4EFB A;  5CA1 A;  1R6N A;  4KHP B;  4DUY O;  3ZX6 A;  3H1H H;  4TUY B;  5HFL A;  4BIU A;  5B5E Z;  4KFM A;  2GUZ A;  4C7U A;  3RYC A;  4DR7 B;  4TV8 B;  1S72 V;  5EYP B;  1YHQ V;  5B1N A;  5JCO A;  5JVD A;  1PP9 H;  3CC2 V;  2EIK B;  4LF8 B;  4JI1 O;  2P06 A;  3D36 C;  1HNW B;  1N33 B;  1IBL O;  4X66 O;  4BIO A;  3E8F A;  5DEC A;  4WCE V;  1KUQ A;  4NVP A;  2OT5 A;  2VQE B;  5LP6 C;  4NR1 A;  1AJP A;  2JGU A;  3OGC C;  4F4L A;  1R3I C;  4RUE A;  5CMU A;  4CH3 A;  4NXN B;  1CP9 A;  4LF9 O;  1I7F A;  5B66 Z;  4JPR A;  3K57 A;  1QNM A;  1XEQ A;  1R3K C;  3JAT B;  2DMX A;  5GTH Z;  1B3Q A;  2ZE6 A;  4D7S A;  1F7Y A;  1NTM H;  3HKD B;  4MTF A;  1KU9 A;  1R73 A;  1XMO B;  1IUR A;  2EIJ C;  5L3D A;  5J2U B;  1XRE A;  4RAI A;  3QNE A;  4J11 A;  4WBN A;  4DR4 B;  2DYS C;  2Y48 A;  3ETQ A;  2YDE A;  3K9A A;  4JAV A;  2BOC C;  3MD0 A;  5LHI A;  5GON B;  3JYC A;  5CA1 B;  1F4N A;  1WN7 A;  2RNB A;  4AI8 A;  4HZ3 A;  4NTW A;  5H6Q A;  2Q0O C;  1AJN A;  3SJQ C;  4NXM O;  4KP4 A;  3N2K B;  3THO A;  1K33 A;  1LR1 A;  2QM4 A;  2ZNJ A;  2Q67 A;  1ZLZ A;  4QJF B;  2AHZ A;  4YXW G;  2RDC A;  3FB7 C;  3O65 A;  5K1P A;  1ZWI C;  2JVD A;  3IGA C;  1XNQ O;  3ASO C;  2AW9 A;  3OFN G;  2KG7 A;  4FJC C;  4Z1M G;  1AI4 A;  2X7R B;  4I50 A;  1FXK B;  4WFE A;  2EJ7 A;  3UM7 A;  2Y0I A;  1VQP V;  1IX9 A;  3OTO B;  2R70 A;  4FPP A;  4B3T B;  1IBM O;  4B3R O;  2CGN A;  3JAK A;  1FJG B;  3ZN1 A;  4CC5 A;  3CRR A;  4DV0 B;  2CGO A;  3DC5 A;  4H0L B;  4GKK B;  3E86 A;  2BE3 A;  3SGI A;  1NBM G;  4G27 B;  2ZXW B;  3ZHV A;  4QGP A;  4DW1 A;  4WFF A;  4O4I B;  4PJ0 Z;  1W2B U;  3SPC A;  2DN9 A;  1CPY A;  3RYF A;  3K59 A;  1TUB B;  4UVC A;  5KA6 A;  1Y6X A;  4JI0 B;  4JI2 O;  5IYC O;  1MSW D;  4ZBM A;  4LF6 B;  2Y4U A;  4MW3 A;  3ZMT A;  1EN4 A;  3B8N A;  4JAA A;  5KHH A;  2N04 A;  4RQE A;  1OHH G;  1YIJ V;  5FL7 G;  2EZP A;  3A0H Z;  1MSD A;  1MZF A;  3IC9 A;  4K35 A;  3IFX A;  3E83 A;  3K06 A;  1DF5 A;  3FD9 A;  2KG7 B;  3DXR B;  3MDS A;  2M6Y A;  1VF7 A;  2Q5Z A;  3APQ A;  4ZOL A;  4CS4 A;  4LFA B;  2WWW A;  5LYJ A;  2Y4T A;  4BR6 A;  1G4Y B;  3M99 B;  2UXD O;  2OCC B;  5KLV H;  3W7X A;  3FAV A;  3W7W A;  2GHY A;  1G8M A;  1W59 A;  3ABK C;  4PA4 A;  5KMG B;  3JAK B;  1YSC A;  1RP3 B;  2L6L A;  2ZR2 A;  1M93 A;  1M1K W;  3AG3 C;  1M57 B;  3R66 A;  3ZMU A;  3UQ8 A;  1EFR G;  1OCR C;  3B40 A;  3CXH F;  5BR8 O;  4LF7 B;  1XUQ A;  1KBH A;  1VQ4 V;  3RYF B;  2QWP B;  4DR6 B;  2RMK B;  5IDJ A;  4X65 O;  2BCC H;  2VS0 A;  3CJH B;  2WLJ A;  4MTG A;  1SQX H;  1BMF G;  3JAL B;  5CA0 B;  4JI5 O;  4QNH B;  4LF4 B;  3T4Z A;  4X20 B;  2JEX A;  3JSN A;  3T2M A;  2PUS A;  4JTD B;  2IBZ H;  1OCZ B;  1ORQ C;  5IYB O;  3T1Y B;  1MA1 A;  2HLD G;  5KHJ A;  1ZSP A;  3N2G B;  5CN0 A;  5BY1 A;  4FLZ A;  4FM1 A;  2NLJ C;  5JJJ B;  1M56 C;  2WPD G;  1AJQ A;  4ZOL B;  1GN6 A;  4FMT A;  2Y69 B;  1MZE A;  3CCE V;  4H13 B;  1HP8 A;  4JYB A;  3HKE A;  2BTQ B;  1AP5 A;  1IVS A;  3FAV B;  5A2Q N;  5FPR A;  3VQX A;  3HKC A;  4O4J A;  5C8Y A;  2UUA B;  1Q5O A;  2Y0P A;  4FLX A;  2WLL A;  2FKX A;  5LOV B;  4K3A A;  3OR7 C;  4UB8 Z;  1SZT A;  3E8B A;  4WF9 V;  2E5L O;  2XAF A;  1WPB A;  4KHP O;  1AI7 A;  3BAA A;  1FD9 A;  2Q7E A;  3BY6 A;  3BAB A;  2X0L A;  5TIS Z;  1K3E A;  3FB5 C;  4Z1V A;  4J9Y B;  3RW0 A;  4LF8 O;  1Y66 A;  3EXA A;  3SYQ A;  3D36 A;  1HNW O;  1N33 O;  3P3N A;  4JAU A;  1SQP H;  1J5E B;  3K5M A;  3AG1 C;  2VQE O;  1QQC A;  3CCQ V;  1XDC A;  4TV9 A;  2WA3 A;  3BPZ A;  3TXQ A;  5LGN A;  3QO8 A;  4PA3 A;  4JTC B;  4EKW A;  3K5O A;  4I9W A;  1P4R A;  5EC2 C;  4NXN O;  2K9P A;  5EC1 C;  1MAB G;  3ETE A;  3K58 A;  3EVK A;  2ZKO A;  4E2L A;  1H2L A;  2X6C A;  3HKE B;  2GTA A;  3BA9 A;  4D7T A;  3AG7 A;  4X64 B;  1V54 B;  3B09 A;  1PNM A;  1XMO O;  1FYJ A;  5J2T A;  4O4J B;  2EIM B;  5C8Y B;  2WLL B;  5IJ9 B;  1URF A;  4CH5 A;  2PZS A;  2GV9 A;  4DR4 O;  2UXN A;  3Q4H B;  2DWD C;  1RPO A;  3RGB A;  1K92 A;  1S5H C;  1PNK A;  2H3O A;  1X4T A;  2HG5 C;  1M90 W;  1NKD A;  1QLN A;  1B6Q A;  2R9I A;  3R65 A;  4FM2 A;  3JCU Z;  1MMM A;  3OMI B;  3G67 A;  4UCV A;  2XAG A;  2UU9 B;  5KAF Z;  2MK3 A;  1AIL A;  3OAA G;  4Q20 A;  1N0J A;  3BA8 A;  4IYI A;  5FNV A;  5LP6 B;  4JGS A;  3W7U A;  2P6J A;  4TV9 B;  2XT9 A;  3B4S A;  4JYA B;  3CCS V;  2DE0 X;  3RYI B;  2VQF B;  3JD0 A;  2P5O A;  3H1I H;  3KZI Z;  2JEU A;  1S5J A;  5EIB D;  2ARH A;  1AI5 A;  2CK3 G;  1BE3 H;  2R72 A;  4W4K A;  4X1I A;  4DUZ B;  3OTO O;  3LNM B;  4A5U B;  3ZS8 C;  1L8D A;  4B3T O;  3LSU A;  5EK0 A;  4L8J A;  4GX5 A;  1M5I A;  2A7W A;  4WFH A;  4DV0 O;  2UXC B;  5J2T B;  5IWA B;  5EBW C;  4GKK O;  1DLB A;  1YJW V;  4LF5 B;  4YJ3 A;  3OEE G;  2QM8 A;  4LFC B;  1RFY A;  4ZHQ A;  2DYS B;  4YIO A;  1NVP B;  2FB5 A;  4UCT A;  1IXM A;  2C2A A;  4X89 A;  4MVZ A;  3OGI B;  2ZIM A;  2KB1 A;  4LBE C;  2YC0 A;  1KKC A;  1PPJ H;  3O9O A;  2GSM B;  4JI0 O;  1N0N A;  5KHI A;  4PV1 B;  1OV9 A;  3OM3 B;  2GDS A;  4FFB A;  4JI3 B;  3CWB H;  1ZAU A;  3T1C A;  4YY3 O;  2ATK C;  3AG4 C;  3FB6 C;  3ABL B;  1N32 B;  2BSK A;  4P9P A;  2DQ3 A;  4GCZ A;  3LUT B;  1ZTE A;  1BZK A;  1WB8 A;  3ASO B;  1E79 G;  1GN4 A;  2Q8V A;  2ZDI C;  4K0K O;  3AK2 A;  3X2Q C;  2QSA A;  2CTW A;  3TK1 A;  4LFA O;  4DW0 A;  3JD2 A;  2F93 B;  4EEQ A;  5KX5 B;  4DV7 B;  4MSW C;  1H2G A;  5GTI Z;  3NR7 A;  4DR3 B;  3ZJZ A;  4MTX A;  1QVF U;  3HKD A;  2F4V B;  2Z3Y A;  2JJ1 G;  3ABM C;  4JF3 A;  3IAY A;  3L75 H;  4UVA A;  1BT8 A;  1YZB A;  2VWK A;  4FLU A;  3CC4 V;  2PF4 E;  1T5E A;  4FFK A;  4H44 B;  4L87 A;  4YHH B;  1SZX A;  2YS8 A;  1GRJ A;  3MAQ A;  4DR2 B;  2A79 B;  1Q86 W;  2PYJ A;  3LDE A;  5CB4 A;  4LFB B;  4ZHQ B;  4DV4 B;  4LF7 O;  4DV1 B;  2ZE8 A;  5IY5 C;  2OIG A;  3E8H A;  4DR6 O;  4W4L A;  4AIL C;  3M7M X;  2CH7 B;  3CP1 A;  3N2K A;  5B1A C;  1H8E G;  1P49 A;  4IIJ A;  4FFB B;  4LF4 O;  4DRX A;  1H2S B;  1Q8I A;  1H2M A;  2CUG A;  1XI1 A;  4TSF G;  4TQD A;  3WB1 A;  2ADP A;  2QKS A;  1YJN V;  2BSK B;  2ITC C;  3T1Y O;  5L3C A;  1TAE A;  2ZD9 A;  1P7G A;  4EB6 B;  2YI8 A;  4PDL A;  4PDM A;  3K9S A;  1FXK A;  3CD6 V;  1W0K G;  4DV3 B;  4F6R A;  1KP2 A;  1EN6 A;  1S77 D;  1HNZ O;  3ETG A;  2UUB B;  4UUJ C;  5CA3 A;  4GKJ B;  4KXR A;  4QE7 A;  3ZMS A;  2QDO A;  3NXS A;  1SA0 B;  3ASN C;  2EIN C;  2QA4 V;  4U3J A;  3E22 A;  3ABK B;  4DXW A;  1CXZ B;  5LGU A;  2P22 C;  3CPW U;  2UUA O;  1R6T A;  1AP6 A;  4JZG A;  2IH1 C;  1VF6 C;  3AG3 B;  1FAF A;  2UXB B;  2HJD A;  1YCI A;  4O4I A;  1OCC C;  4G28 B;  2RQ6 A;  1KB9 F;  4GZR B;  1OCR B;  5CB4 B;  5CBG A;  1NZ6 A;  1TUB A;  1SS3 A;  1UJW B;  3T1H B;  1LNQ A;  2P90 A;  3C90 A;  3OUF A;  4I4T A;  3SPH A;  3KCY A;  2HVJ C;  2FL4 A;  1JCH A;  3SYA A;  3VBB A;  1K34 A;  1SET A;  2H94 A;  3L73 H;  3SYC A;  1J95 A;  4IIJ B;  1H2N A;  4DRX B;  1VIB A;  4FIP C;  2B5U A;  1S0V A;  4CC6 A;  3GB7 C;  1Z5W A;  1XIL A;  1J5E O;  3CRC A;  3BFR A;  1R3J C;  3OW2 U;  3QF7 A;  3DXR A;  4I55 A;  4J7K A;  4N21 A;  2DOS A;  1ENV A;  2XND G;  2YXY A;  3HB3 B;  2ZCE A;  3CCU V;  4DO2 A;  4ZKI A;  3FYI B;  4TQF A;  1U97 A;  2N74 A;  4F6R B;  3JAS B;  4KL1 A;  1JR9 A;  1M56 B;  3ZHU A;  4FLW A;  1DF4 A;  1PL0 A;  1Q6U A;  3LSS A;  1DTO A;  1D5A A;  2YIC A;  1K9M W;  5KMG A;  3ZN0 A;  1XNR O;  2ADQ B;  2XTA A;  3P32 A;  1PNL A;  3AK3 A;  1XHX A;  1P84 F;  3OUS A;  4U3J B;  3E22 B;  3JSL A;  4WFG A;  3ZRW B;  4DK0 A;  3SR2 C;  3CCL V;  1K7D A;  3AG2 C;  1BHB A;  5BMV B;  4PA7 A;  3K03 A;  1KP3 A;  1WB7 A;  2XUM A;  3D8C A;  3CJH A;  4I4T B;  1H2K A;  4IHJ B;  4PHZ A;  3JAL A;  5CA0 A;  1L0L H;  1WA8 B;  2W0X A;  2WAM A;  2YXH A;  4X20 A;  2QE7 G;  1QBZ A;  3HKB B;  4FVM A;  3VQY A;  4UV8 A;  3ICX A;  1Q43 A;  3I55 V;  2OWO A;  1WJZ A;  1THZ A;  2Q7G A;  1ZX3 A;  2UU9 O;  5EZY A;  3BRC A;  2KQX A;  1GM7 A;  3AG1 B;  3N2G A;  4I55 B;  1BL8 A;  3VOU A;  2HKO A;  1YF2 A;  4JAS A;  4JYA O;  1UFI A;  1EBO A;  1VQM V;  2VQF O;  4DR1 B;  2HR3 A;  2YIB D;  1YXB A;  2G38 A;  2BTQ A;  3VQW A;  3ZRX A;  3P30 A;  2YIB A;  4DUZ O;  3ZHQ A;  4LR3 A;  1NTZ H;  2IJK A;  1Y4M A;  1OZ0 A;  3L71 H;  1NI8 A;  2WA4 A;  4H33 A;  3HR0 A;  4JI4 O;  2YID A;  5LOV A;  2UXC O;  3UT5 A;  5IWA O;  5J9P C;  4RQF A;  4LF5 O;  4AQY B;  1GH6 A;  1TVK B;  4J42 A;  1HDJ A;  1G6U A;  4J9Z B;  2QWO B;  2WLK A;  2NNU A;  3RWR D;  1JQ0 A;  1XL4 A;  1IBK B;  1QR9 A;  3H1L H;  3PJS K;  2HEP A;  1VAR A;  2ITD C;  1GO3 F;  3BVO A;  4JI3 O;  5LL6 Y;  3WG7 C;  4BIZ A;  4I5S A;  2NR5 A;  3BEH A;  4B3S B;  3F5W C;  1N32 O;  2YUA A;  4XDJ A;  4HBN A;  5EZY B;  5E1A C;  4U7O A;  5B1O A;  5CBF A;  4DV5 B;  4OPH A;  2RN9 A;  3JD4 A;  1IBL B;  2ZDI A;  5KUM A;  2HFE C;  2ZR3 A;  4DV7 O;  2FYU H;  1I94 B;  2LGW A;  4DR3 O;  1Q6I A;  3AEI A;  5IE9 A;  2F4V O;  4FZ1 A;  3WB2 A;  1SC5 B;  1JA8 A;  4I7Z B;  4OX9 B;  1PM9 A;  2ZNI A;  2QKC A;  5IJ9 A;  3KKY A;  2LFR A;  2ZIO A;  2CTQ A;  2BTO A;  1PKX A;  2Z5U A;  3UT5 B;  3Q4H A;  1VEW A;  1RM1 C;  4GX1 A;  4FLV A;  4TOI A;  4LFB O;  2P67 A;  5LGT A;  4LC1 A;  1EN5 A;  4UCS A;  4DV4 O;  4EFE A;  4DV1 O;  4PD4 F;  1E1R G;  3CCV V;  5H5N A;  3FFQ A;  4DR7 O;  1AB3 A;  3FKS G;  2W0F C;  3HPL C;  4E4E A;  1JOY A;  4PA9 A;  5LMN B;  2Q4P A;  1IXB A;  2IJI A;  2QTO A;  5H2F Z;  1AI6 A;  1I5Y A;  1HR0 B;  3AG4 B;  1Z2G A;  3CS5 A;  3OMN B;  1KD1 W;  2B1G A;  5LP6 A;  1QU7 A;  2W6I G;  3M8A A;  1Y67 A;  2RJZ A;  4U7N A;  1KQS U;  4UV9 A;  4CS3 A;  3RYI A;  1K5S A;  4DV3 O;  4R6Z A;  3QVN A;  1DK1 A;  3P3P A;  3CCM V;  3X2Q B;  4QE9 A;  2ODM A;  2WSS G;  2MW2 B;  3BCC H;  1JFF A;  1VP7 A;  1O9G A;  4GKJ O;  4X62 B;  2IH3 C;  4F6E A;  5C93 A;  3ZHT A;  3OD4 A;  1YDX A;  1K8A W;  1AR4 A;  1VMG A;  4DV2 B;  3ABM B;  2AHY A;  1SER A;  1NVP D;  1K4D C;  3ABU A;  3OTF A;  2EX3 A;  2DYR C;  2GTS A;  1V55 C;  2UXB O;  1EZJ A;  2P7T C;  4MW8 A;  4MVU A;  2E74 B;  1K73 W;  4BW9 A;  2JGD A;  1M4U A;  1I0H A;  1N36 B;  5IY5 B;  4X88 A;  1VQ9 V;  3EFF K;  4ZI7 A;  5B1A B;  1UPG A;  5L3F A;  1KC8 W;  2F66 C;  4O4H B;  4G2K A;  2YSU B;  3ZRV A;  4I9Q A;  3J7A U;  1QCE A;  3ZHR A;  1FFT B;  4LWS B;  2JRI A;  4OPA A;  2HHH B;  3RN4 A;  5LA6 A;  5KX5 A;  4TWK A;  3TCU A;  2XAS A;  3C3T A;  4XBF A;  4P30 A;  4UCO A;  1GM8 A;  5LXT B;  4O4L A;  2IU0 A;  5L3B A;  3CHX A;  1WP8 A;  1JFF B;  2XOK G;  1S5L Z;  3W7T A;  3PN1 A;  3L74 H;  1NH2 B;  2CE4 A;  1FJG O;  1JMK C;  3ASN B;  3SPI A;  1Q6H A;  1FXV A;  2EIN B;  3LDC A;  2EJR A;  3CRA A;  3E2E A;  4MVM A;  2QJ1 A;  2EIJ B;  1BQ0 A;  4MT8 A;  3LNN A;  1KEC A;  3F7V C;  3B2E E;  3JD1 A;  3L70 H;  3S3W A;  2QWR B;  2YXL A;  5JH7 A;  1Q7Y W;  1Q3E A;  4MS2 A;  1OCC B;  1M9N A;  1GN3 A;  4CBC A;  1Z5V A;  3STZ C;  2IJJ A;  1K97 A;  2CH7 A;  2JGD B;  2R9A A;  2BOB C;  5B3S C;  4LF6 O;  3L72 H;  4NTY A;  2PI5 A;  1WPX A;  2DJV A;  3UKM A;  4ZI7 B;  4D6T H;  5LMU B;  3SJB C;  4DR5 B;  5F2V O;  3DSQ A;  3APO A;  1HNX B;  4EB6 A;  1ARO P;  3D3I A;  1QHT A;  4JI5 B;  1X59 A;  3SJC C;  2EIL C;  2OIE A;  1K5Q A;  5LA6 B;  2ZE5 A;  2RCV A;  1VQ6 V;  4X1K A;  3JD3 A;  2F1M A;  4O4L B;  4NKG B;  5DN6 G;  4JYC A;  1SA0 A;  4IL6 Z;  3RYH A;  2V7Q G;  4K8X A;  3S3X A;  3J81 N;  1YTF B;  5IYD O;  2X6A A;  3W7S A;  4CH6 A;  1QR8 A;  1IZ3 A;  2X6B A;  4B3M B;  4IT5 A;  2V4D A;  1AVM A;  4R7C A;  3TJT A;  1OCO C;  1TGO A;  4AQY O;  1SF9 A;  2ZE7 A;  3SJA C;  3MHH C;  5A9G A;  5K1X A;  3AG2 B;  5GW7 A;  1QLE C;  2OCH A;  3TET A;  2W6J G;  2D2C B;  1YI2 V;  5JH7 B;  4JTA B;  2ZQM A;  2QEX V;  4RWU A;  3RVZ A;  1IBK O;  3CYO A;  4PI0 A;  4R8C A;  3I5D A;  1SQF A;  2ETN A;  2Q69 A;  3OR6 C;  3TXS A;  1KMI Z;  4PA6 A;  2QGN A;  1NR7 A;  2JIZ G;  3CRM A;  4J7J A;  4MVS A;  4B3S O;  1MNG A;  4P2Z A;  2QWQ B;  2XAQ A;  2Q7H A;  3CMA V;  1E1Q G;  1WNS A;  3ZCC A;  2L35 A;  2CDY A;  1YIT V;  3MHS C;  2EZO A;  2AGA A;  3A0R A;  4DV5 O;  1SRY A;  2AZ2 A;  3GWK C;  3GVM A;  3JAS A;  2Z0A A;  3JAW B;  5JQG B;  3H9V A;  4LNU B;  1I94 O;  3N27 A;  1GN2 A;  4RO2 A;  4X1K B;  2IM9 A;  4UFZ A;  5HFM A;  2YI9 A;  4BAY A;  2UUC B;  4KUM A;  4K8Z A;  3RYH B;  4R50 A;  1PD3 A;  1VQ5 V;  1NJI W;  3LDD A;  3ZRW A;  2UXX A;  4JV5 B;  4OX9 O;  2K1E A;  4HAM A;  1GMG A;  4LH6 A;  3ZED A;  3L9D A;  1ZL8 A;  2NN4 A;  5BMV A;  2IU3 A;  2H8P C;  4FLT A;  1FFX A;  3SPJ A;  2Q9L A;  3F5T A;  2LJ2 A;  3UCS C;  3CEI A;  1VQ7 V;  2JJ2 G;  2A06 H;  2PY5 A;  1VQ8 V;  4IHJ A;  1WA8 A;  2P4K A;  2B1I A;  5JJE B;  2AXT Z;  3HKB A;  2Q0A A;  3GWO A;  1NS1 A;  4QPK A;  5LMN O;  3D3Q A;  4CZZ A;  3WG7 B;  3ML0 A;  3QTC A;  1HR0 O;  4MVO A;  4O2A A;  1HWY A;  4JI6 B;  1SQV H;  2VWJ A;  1VQN V;  2ILM A;  2GUZ B;  4O2B A;  1O9H A;  2XAJ A;  3RYC B;  1BS3 A;  1JPX A;  2F43 G;  2EUL A;  5JVD B;  1U96 A;  2HVK C;  4HNA A;  1A32 A;  3OMA B;  5E79 Z;  2DQ0 A;  3ABL C;  2DWE C;  5BZB A;  4PEL A;  2A9H A;  3G6B A;  1XMQ B;  1VF5 B;  3QO5 A;  4X62 O;  4JI8 B;  3IJ4 A;  3K3W A;  4J80 A;  5B1B C;  5KUK A;  3WB0 A;  3KCX A;  4X64 O;  3FB8 C;  3E8G A;  4QPJ A;  4DV2 O;  1US6 A;  1FS0 G;  2JDI G;  3ZIA G;  1XHZ A;  2LGQ A;  1TVK A;  5IYZ A;  1ZL8 B;  5H6R A;  5D5Q A;  5EIB C;  1AR1 B;  2OYQ A;  1FFX B;  1Y74 A;  1RM1 B;  2XAH A;  1VQK V;  2PYL A;  1K4C C;  1N36 O;  3CRQ A;  3FX7 A;  1B06 A;  2KSD A;  4PDR A;  4WBN B;  3JAM N;  4WFA V;  1WAZ A;  4GX2 A;  5D5P A;  3A0B Z;  1SQB H;  1GAX A;  3I56 V;  1KYO F;  3AK1 A;  4O2A B;  3ZMZ A;  4XDL A;  1L1F A;  4B7K A;  2EIK C; 
#chains in the Genus database with same CATH homology
 2WLI A;  4F4L A;  1R3I C;  3OEH G;  4RUE A;  4WFH A;  3FKS G;  5CMU A;  2W0F C;  1CP9 A;  3HPL C;  5EBW C;  1DLB A;  1JOY A;  1YJW V;  1GK9 A;  4JPR A;  3OEE G;  2QM8 A;  4PA9 A;  1R3K C;  2Q6A A;  2DYS B;  2IJH A;  2IJI A;  1NVP B;  1JJ2 U;  2QTO A;  1AI6 A;  1I5Y A;  1MOF A;  1IXM A;  1ROP A;  2C2A A;  4MVZ A;  4X89 A;  3AG4 B;  2KB1 A;  3ABT A;  3OMN B;  4LBE C;  4X8A A;  1Q82 W;  2B1G A;  1KD1 W;  1YJ9 V;  4MTF A;  1GM9 A;  2W6I G;  1R73 A;  2GSM B;  4U7N A;  1KQS U;  2EIJ C;  4MTO A;  3ZRS A;  4UV9 A;  5L3D A;  3OM3 B;  1K5S A;  4RAI A;  2LP7 A;  3QNE A;  3G4S V;  2YEV A;  2DYS C;  2Y48 A;  2FTK A;  3K9A A;  4R6Z A;  3T1C A;  4JAV A;  3X2Q B;  4QE9 A;  3CCM V;  2V1D A;  2ATK C;  3AG4 C;  1S3J A;  2BOC C;  2WSS G;  3MD0 A;  3FB6 C;  5LHI A;  2DYR B;  3ABL B;  1V55 B;  3JYC A;  4P9P A;  2DQ3 A;  2Q68 A;  2IH3 C;  1F4N A;  5C93 A;  4GCZ A;  3LUT B;  4HZ3 A;  4LP8 A;  1K8A W;  3ASO B;  1E79 G;  5H6Q A;  2JK5 C;  1AJN A;  3SJQ C;  3ABM B;  1KKD A;  4KP4 A;  2ZDI C;  2AHY A;  1SER A;  1NVP D;  3X2Q C;  1K33 A;  3TK1 A;  1K4D C;  3ABU A;  3JD2 A;  2Q67 A;  3CCR V;  2DYR C;  4QJF B;  2AHZ A;  4MSW C;  4YXW G;  1V55 C;  1H2G A;  2HJF C;  3FB7 C;  1EZJ A;  2P7T C;  2A0L A;  1ZWI C;  3ZJZ A;  4MW8 A;  4MTX A;  3IGA C;  4MVU A;  1H38 A;  1QVF U;  3ASO C;  1K73 W;  2Z3Y A;  3OFN G;  4FJC C;  4Z1M G;  1AI4 A;  2JJ1 G;  3ABM C;  4JF3 A;  3G71 V;  5IY5 B;  4X88 A;  3CC7 V;  4UVA A;  3SYO A;  2X7R B;  1VQ9 V;  2WLI B;  3EFF K;  1CEZ A;  3CC4 V;  1BHA A;  1SES A;  4L87 A;  1FXK B;  4WFE A;  5B1A B;  3UM7 A;  5L3F A;  1KC8 W;  2A79 B;  3CCJ V;  1Q86 W;  4N23 A;  1VQP V;  3LDE A;  4G2K A;  5H9C A;  2YSU B;  3ZRV A;  4FPP A;  1QCE A;  1F23 A;  5IY5 C;  1W0J G;  1GTO A;  1FFT B;  3E8H A;  3ZN1 A;  1FXK C;  3CP1 A;  5B1A C;  1H8E G;  2LFS A;  3E86 A;  3ETD A;  4PDV A;  2DW4 A;  4TWK A;  3TCU A;  2XAS A;  4XBF A;  1NBM G;  2YEV B;  4G27 B;  4HYO A;  4P30 A;  2ZXW B;  1GM8 A;  4TSF G;  4OXS A;  4WFF A;  5EBM C;  2PI4 A;  2OTJ V;  4QIW F;  1W2B U;  1TUE B;  3F7Y C;  3SPC A;  2IU0 A;  5L3B A;  1CPY A;  1MG1 A;  2QKS A;  3ZMV A;  1YJN V;  2XOK G;  2ITC C;  4FK5 C;  4UVC A;  5KA6 A;  3W7T A;  5L3C A;  2ZD9 A;  1NH2 B;  5IYC O;  1MSW D;  4PDL A;  4PDM A;  1N8R W;  4ZBM A;  3ASN B;  3SPI A;  1FXV A;  2EIN B;  1FXK A;  3CD6 V;  4MW3 A;  1W0K G;  3LDC A;  2EJR A;  3ZMT A;  4MVM A;  1KP2 A;  3DGE A;  3E2E A;  2EIJ B;  2ZXW C;  3B8N A;  1S77 D;  1COW G;  4MT8 A;  1KEC A;  1OHH G;  3F7V C;  3ETG A;  5B3S B;  4RQE A;  1YIJ V;  3JD1 A;  5FL7 G;  2EZP A;  4UUJ C;  5CA3 A;  3RBZ A;  1F51 A;  4BW5 A;  4QE7 A;  1Q7Y W;  4MS2 A;  1OCC B;  3ZMS A;  1M9N A;  5LHH A;  3NXS A;  4CBC A;  3IFX A;  3E83 A;  3K06 A;  1DF5 A;  2QM7 A;  3ASN C;  1VQL V;  2EIN C;  3STZ C;  2QA4 V;  2R9R B;  2IJJ A;  1K97 A;  1JX9 A;  3ABK B;  4DXW A;  5LGU A;  2BOB C;  3CPW U;  5B3S C;  2PI5 A;  1WPX A;  2WWW A;  2IH1 C;  3AG3 B;  2EIL B;  3UKM A;  1G4Y B;  1OCC C;  4G28 B;  3T4D A;  1NH2 D;  3M99 B;  2M7W A;  1OCR B;  2OCC B;  3W7X A;  5CBG A;  3W7W A;  2GHY A;  1RPR A;  1UJW B;  1G8M A;  1LNQ A;  2P90 A;  3ABK C;  3OUF A;  4PA4 A;  3SPH A;  1YSC A;  1ARO P;  2HVJ C;  3D3I A;  1JCH A;  3SYA A;  2ZR2 A;  3VBB A;  1K34 A;  1SET A;  1M1K W;  3AG3 C;  1M57 B;  2EIL C;  4TT3 G;  3ZMU A;  2H94 A;  3IC7 A;  3SYC A;  1J95 A;  3QO7 A;  5KA5 A;  1EFR G;  1K5Q A;  1OCR C;  2OCC C;  4FIP C;  1VQ6 V;  2EBO A;  2B5U A;  3JD3 A;  1S0V A;  3GB7 C;  1OCO B;  5DN6 G;  4JYC A;  1VQ4 V;  1QLE B;  2V7Q G;  1R3J C;  3OW2 U;  1YTF B;  5IYD O;  1VQO V;  2X6A A;  3W7S A;  5IDJ A;  1M57 C;  3KG2 A;  4N21 A;  1ENV A;  2WLJ A;  2XND G;  4MTG A;  1BMF G;  3HB3 B;  3CXC U;  1QR8 A;  3K0D A;  2X6B A;  3CCU V;  4QNH B;  3T4Z A;  4DO2 A;  4ZKI A;  3FYI B;  4R7C A;  1OCO C;  1M56 B;  2JEX A;  3T2M A;  4JTD B;  4WFB V;  3JCZ A;  3MHH C;  3SYP A;  1DF4 A;  1OCZ B;  1NQT A;  2D3O W;  3AG2 B;  5GW7 A;  1PL0 A;  1QLE C;  3G6E V;  1ORQ C;  3TET A;  2W6J G;  3LSS A;  1YI2 V;  1DTO A;  5IYB O;  4JTA B;  4H37 A;  2ZQM A;  4UVB A;  2HLD G;  5L3E A;  3OE7 G;  1K9M W;  3ZN0 A;  2QEX V;  3RVZ A;  3P32 A;  3CYO A;  1PNL A;  3B8M A;  5CN0 A;  4R8C A;  4GX0 A;  2Q69 A;  3OUS A;  2NLJ C;  3OR6 C;  4WFG A;  3ZRW B;  1M56 C;  2WPD G;  1AJQ A;  4XDK A;  3CCL V;  4FMT A;  4GT1 A;  2Y69 B;  4PA6 A;  1OCZ C;  3CCE V;  1K7D A;  3AG2 C;  1BHB A;  4PA7 A;  3K03 A;  1NR7 A;  2JIZ G;  1YTF D;  4JYB A;  4MVS A;  1KP3 A;  4P2Z A;  3RVY A;  2XAQ A;  3CMA V;  1E1Q G;  3ZCC A;  1YIT V;  3MHS C;  2EZO A;  3A0R A;  2Y69 C;  2WAM A;  1SRY A;  2WLL A;  2QE7 G;  1QBZ A;  3OR7 C;  4UV8 A;  1H8H G;  5EBL C;  1SZT A;  3E8B A;  4WF9 V;  3I55 V;  1QVG U;  1P7B A;  2XAF A;  4RO2 A;  1JVM A;  1AI7 A;  5HFM A;  5LHG A;  4BAY A;  1THZ A;  4KUM A;  4LCU C;  3BY6 A;  1I5X A;  4R50 A;  2X0L A;  1GM7 A;  3AG1 B;  1PD3 A;  3K79 A;  1BL8 A;  1VQ5 V;  1NJI W;  3VOU A;  1K3E A;  3LDD A;  2HKO A;  4JAS A;  1WLE A;  2UXX A;  3FB5 C;  3ZRW A;  4J9Y B;  1EBO A;  2K1E A;  4HAM A;  4UXN A;  1VQM V;  1GMG A;  3RW0 A;  1Y66 A;  3SYQ A;  1NR1 A;  2OTL V;  4P9O A;  3D36 A;  4MVR A;  2HR3 A;  2IU3 A;  2H8P C;  4JAU A;  2WLM A;  3K08 A;  3SPJ A;  3ZRX A;  5L3G A;  3P30 A;  3B77 A;  3AG1 C;  1VQ7 V;  2JJ2 G;  1F4M A;  3CCQ V;  2IJK A;  1Y4M A;  1S76 D;  1VQ8 V;  1OZ0 A;  3CME V;  3FYE B;  5LGN A;  5CBH A;  3QO8 A;  4H33 A;  4PA3 A;  4JTC B;  4EKW A;  4I9W A;  2B1I A;  1P4R A;  3GWO A;  5EC2 C;  1GKF A;  3DTU B;  5J9P C;  4RQF A;  2WLH A;  4RUF A;  5EC1 C;  1MAB G;  3ETE A;  4QPK A;  4CZZ A;  3EHB B;  3WG7 B;  3ML0 A;  4E2L A;  1R3L C;  5LBQ A;  4J9Z B;  2X6C A;  4MVO A;  2WLK A;  2NNU A;  4MVQ A;  1HWY A;  3E35 A;  1VQN V;  1JQ0 A;  1XL4 A;  1V54 B;  1QR9 A;  1Q81 W;  1XL6 A;  2XAJ A;  3PJS K;  1PNM A;  5B1B B;  1JPX A;  2F43 G;  2HVK C;  2ITD C;  1GO3 F;  2EIM B;  3OMA B;  2DQ0 A;  2WLL B;  3SPG A;  3ABL C;  3WG7 C;  2UXN A;  4I5S A;  4BIZ A;  2DWE C;  3K0G A;  2DWD C;  4ASU G;  5BZB A;  1RPO A;  3E89 A;  1K92 A;  4PEL A;  3BEH A;  2A9H A;  1FXH A;  1S5H C;  3F5W C;  1PNK A;  1V54 C;  3QO5 A;  4XDJ A;  3K3W A;  5B1B C;  5KUK A;  2WLN A;  5E1A C;  2HG5 C;  2EIM C;  3FB8 C;  4U7O A;  3E8G A;  5B1O A;  5CBF A;  1R6K A;  3H01 A;  1M90 W;  3STL C;  1NKD A;  4QPJ A;  1QLN A;  3JD4 A;  3K04 A;  1B6Q A;  2R9I A;  3LSQ A;  3R65 A;  1FS0 G;  2ZDI A;  5KUM A;  2HFE C;  5DM6 V;  2JDI G;  3ZIA G;  2IW5 A;  2ZR3 A;  3WFV A;  3OMI B;  5H6R A;  1AR1 B;  1R6N A;  1RM1 B;  2XAH A;  2XAG A;  2MK3 A;  3AEI A;  3OAA G;  5HFL A;  4BIU A;  1VQK V;  4Q20 A;  4KFM A;  4JGS A;  3W7U A;  1S72 V;  2P6J A;  1YHQ V;  5B1N A;  1K4C C;  3CCS V;  3CC2 V;  2EIK B;  3JD0 A;  2LFR A;  4PDR A;  1PKX A;  2JEU A;  2Z5U A;  4WFA V;  1RM1 C;  3E8F A;  4GX2 A;  1AI5 A;  2CK3 G;  4GX1 A;  4WCE V;  2P67 A;  5LGT A;  4LC1 A;  3I56 V;  2OT5 A;  3LNM B;  1E1R G;  3ZMZ A;  4XDL A;  5EK0 A;  3CCV V;  1AJP A;  1L1F A;  4GX5 A;  3OGC C;  2EIK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...