2B9ZA

Solution structure of fhv b2, a viral suppressor of rnai
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
b'GAMPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVGRMVTSLLEKPSVVAYLEGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B2 protein
publication title The structure of the flock house virus B2 protein, a viral suppressor of RNA interference, shows a novel mode of double-stranded RNA recognition.
pubmed doi rcsb
source organism Flock house virus
molecule tags Viral protein
total genus 25
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2b9zA00
3FD9A 2DE0X 1WA8B 2AZ2A 1WA8A 2B9ZA 3FAVB 4LWSB 3Q4HB 3FAVA 4GZRB 3Q4HA 3GVMA 4LWSA 2VRZA 3HR0A 4I0XB 4I0XA 3O9OA 2KG7B 4ABMA 2KG7A 3GWKC 3OGIB 2VS0A 3ZBHA 3G80A 3TXQA 3TXSA 2AZ0A
chains in the Genus database with same CATH superfamily
1RFYA 2A06H 4LF9O 4DW1A 4LWSA 1Q5OA 3HR0A 1JJ2U 1BE3H 3DXRA 2ZKOA 3MHSC 2B5UA 2JIZG 1Q8IA 1QR8A 2HR3A 2V1DA 4MS2A 4YY3O 4FLUA 2IM9A 4QPKA 5IWAB 4H0LB 1SQBH 5KHGA 1VIBA 2HLDG 5KAFZ 2ILMA 3BFRA 1GN2A 2RN9A 4JI5O 4DR4O 1Q86W 4X1YB 5TISZ 2Q5ZA 1V9PA 2YUAA 2H8PC 2XAHA 5BZBA 1VQ9V 5H6QA 2CGNA 2BTQA 1YF2A 2DMXA 1OCOB 2JGUA 4ICGA 2JK5C 3X2QB 1PPJH 3LDCA 3ZHSA 2OT5A 2EIMC 1XMOB 3CMAV 4B3MB 3M99B 1G4YB 4JGSA 1OHHG 4I9WA 1SA0B 3M7MX 1ROPA 3ZHTA 1TUBA 4ZHQA 3U11A 3OTOO 5LXTA 4TUYB 1SERA 4DV0B 4LF5O 4A5UB 1MZFA 3CC2V 4IT5A 1XHZA 1JA8A 2L6LA 4ZKIA 3OE7G 1FFTB 1EZJA 1Y6XA 2IJJA 3OMNB 4YIPA 4FVMA 4GKKB 4X65O 3SPJA 1N0JA 4UVAA 4IGGA 3FX7A 4EB6A 1KUQA 1XDCA 1JOYA 3JALA 1I0HA 1OCCB 4TOIA 1PNLA 3RYHA 1GAXA 3E8HA 5A9GA 2PYJA 2NNUA 5B1NA 4DRXA 2UXBO 5J2UB 4NTWA 4ZI7A 2NR5A 3FYEB 4Q6GA 4G28B 2QKAA 3N2GA 4I55A 4MVZA 2YXYA 4DV3O 1H2KA 1YXBA 4DV7B 1VF5B 4FM2A 3IGAC 3JATA 2ZT9B 5EBWC 4H44B 4JI7O 2L35A 5IJ9B 2UUBO 3RBZA 4KHPB 1FJGB 5LBQA 3JAKA 4LP8A 1KP2A 4G2KA 1Q90D 1VQ8V 1S5HC 2WLJA 1VQMV 2LW7A 2PYLA 4GZRB 1BQ0A 1AR1B 2DYRC 2LJ2A 4X1KA 1R6NA 5IY5C 1IBLB 2GV9A 4BW9A 4LFCB 2H3OA 3BRCA 4LF4O 2CTWA 1L0LH 1OCZB 1Q43A 3VQWA 3RFRA 4O4HA 5CBHA 4YJ2A 2GTSA 3UT5B 4KL1A 4JI3B 3GWOA 3JSLA 3MDSA 3GWKC 4CS4A 1HNWO 3B77A 1PL4A 2E75B 3B09A 4CZZA 3E8FA 3KCYA 2YC0A 3LDDA 4O4LA 4JASA 1GH6A 2HFEC 5LP6A 4Z1VA 3E2EA 4PA7A 3W7UA 2QWRB 2ZE8A 2ZD9A 2EJRA 3K5LA 1VF6C 4GLXA 1R3LC 4CC5A 5KX5A 1TUEB 3ZMVA 5IYCO 2MK3A 4LNUA 3JSNA 3SR2C 2Q73A 4CH5A 2F4VB 5JJEB 4D7SA 4FFBA 4PA6A 4K0KO 4AI8A 5D5QA 4WFFA 5ITZB 4DV6O 4QE7A 1N33O 3BHPA 4R6ZA 1VQ5V 5IYDO 4JYAO 5GONB 2Q8VA 4FLTA 4GX1A 3JAWB 5LGTA 1XMQB 2UXXA 2JJ2G 1NS1A 5IDJA 4UCRA 1F23A 3AG7A 2MW2B 4B3TO 1N4CA 3ASNC 1XQ8A 1F51A 2H94A 1TVKB 4RQFA 1ZL8A 2RQ6A 4JF3A 1GN3A 1FXKB 5LGNA 4JTDB 4U3JB 3HPLC 1AVMA 4QIWF 5D5PA 3BVOA 3STLC 5EYPB 2QGNA 1K4CC 2DN9A 2M6YA 4DR1B 3TETA 2JGDA 4NTYA 4WFBV 2YEVA 3K04A 3L73H 4JTCB 4ZOLA 3SPHA 1YJWV 1E1RG 4IL6Z 1J5EO 4DR3B 2Q7HA 1V54B 3J81N 1NBMG 2HP8A 4J10A 2EIKC 3UO2A 1SQXH 1KB9F 4BR6A 5JJJB 4PD4F 1XOUA 3KKYA 4LWSB 1AI7A 2QM7A 1GM7A 1KECA 1L8DA 5EBMC 4YJ3B 1I08A 3CXCU 1RPRA 4O4JB 5IT9N 3JD3A 1FFXB 3SGIA 4X8AA 2AHYA 3AG4B 4EFEA 3P3NA 3K5NA 1GMGA 3ETDA 2WLIB 1T5EA 4JI1B 3E22B 1GO3F 1BGYH 2YICA 1YZBA 2OCHA 2F66C 4DR5O 2IJIA 3APQA 4UCUA 1AP5A 1Q82W 2UXDO 1R3KC 1XL6A 1FXVA 2QE7G 3L74H 1M9NA 4JZ2A 1VQOV 1D5AA 3O65A 4EFBA 5EZYA 2ITDC 4LF8B 1IZ3A 1B6QA 2R70A 2F95B 3TK1A 1XNQB 4PELA 3LSSA 2ZXWC 1PV0A 3K0GA 4UV9A 2BTOA 2ZM6B 5FL7G 2DYSC 5IYZA 2PGGA 2IJKA 1S5JA 3HKEB 4QE9A 4DR6B 3F7VC 1HR0B 1HNXO 4O2AB 3B2EE 2HKOA 3RYCA 3ZHUA 5LXTB 3N2KA 3T1CA 4UCTA 2JS3A 4LC1A 2YIAA 4H37A 5KMGB 1PD3A 5LMNO 1G8MA 5J2TA 2ETNA 3GB7C 5B3SC 3CD6V 2K1EA 2RNBA 4N21A 3ASOB 2FB5A 5CB4A 3F7YC 2DW4A 1P7BA 4B3RO 1CEZA 2LQTA 2A79B 3RYHB 2DJVA 2PI5A 3CHXA 4XBFA 2P22C 1H38A 1N32B 1SS3A 5KA5A 1MNGA 4ZI7B 4LF7B 2X6AA 2A3QA 1AP6A 5GTHZ 4EEQA 1OV9A 1BT8A 5JH7A 5GW7A 4DK1A 4J7JA 5LOVA 3OTFA 2VQFB 4JI8B 2EINB 2F23A 2Y69C 4FFKA 1AJQA 4MW8A 2AW9A 3WFVA 3CCEV 5EC2C 3BAAA 1QLNA 4XDKA 1AILA 3JAKB 4BIZA 4D7TA 2ARHA 5CMUA 5BR8B 4U7NA 1XBLA 4W4KA 3OAAG 4TSFG 3K57A 3ZMZA 2WA4A 3EXAA 5B1AB 5E79Z 2KG7A 1ZTEA 5DM6V 4O2BA 1BHBA 4P2ZA 1IXMA 1Y76B 2LFRA 4FLYA 3JD0A 1VF6A 1GKFA 2HJDA 4FZ0A 5C8YA 1PM9A 5JCOC 1YSCA 1QLEB 5L3DA 3CSXA 4B08A 4YHHB 3JD2A 2OIGA 1KMIZ 1SF9A 4ABMA 4OXSA 3BABA 3OEEG 3VBBA 2YDEA 3AG3B 3W7XA 3LDEA 4O4LB 3AG2C 2K9PA 3G67A 1NTKH 3IAYA 1P84F 4J7ZA 4R50A 3JAMN 1MZEA 3T1YB 1BZKA 1VQKV 2IU3A 4DV0O 3RWRD 1IBMO 3FB7C 1XILA 2IW5A 1XI1A 1P49A 4K3AA 1N8RW 5LGUA 3EHBB 1MSDA 4ASUG 2QTSA 4FFBB 1K8AW 4O4IA 2XAFA 2KB1A 3CX5F 2Y0PA 3RW0A 5BMVB 1M90W 1Y67A 5CA1A 5L3CA 3UQ8A 2G38A 3SJAC 1P7GA 4X64B 3ZMTA 3CCLV 4DUYO 4LFBB 4UCSA 4FLXA 1THZA 2QSAA 1AJPA 4RUEA 2BSKA 2QWPB 3WG7B 4PDRA 2WSSG 2KKWA 1RM1B 3SYPA 5FPOA 4DV2B 3QVNA 4G27B 1V55B 2JRIA 5EC1C 4PV1B 3CCVV 1YITV 3ZRWB 2UUCO 1SQVH 4I4TB 1L0NH 1ZL8B 2GSMB 4NXMO 3P30A 2OWOA 1R73A 3HKBB 4DUZO 4NXNO 2CK3G 2HEPA 3L70H 1Y74A 1US6A 1IBKB 5DN6G 4LFAB 3A2FA 1UFIA 1K5QA 3JARB 3ETGA 4I50B 1AR4A 1UJWB 3CRMA 1MSWD 2ZNJA 1IX9A 2BOBC 2W6JG 2GUZB 1K9MW 2B1IA 1EN4A 2EJ7A 1X59A 3B4SA 2ITCC 1XNRB 4PA9A 4ZOLB 4I0XA 3N27A 3CWBH 4DV5B 1HNZB 4P9PA 1H2GA 4CBCA 2UXCO 1VQNV 3ZMUA 5B66Z 5LMUO 1FAFA 3QNEA 4E4EA 2JEXA 1KKCA 4FZ1A 4TQDA 3SJQC 2AGAA 2GTAA 1WA8A 2XUMA 5KUMA 1QVFU 2ATKC 3K79A 3G71V 3ZS8C 1RP3B 5EIBC 2WLLA 3HKCA 1N36B 2AHZA 2VS0A 5FNVA 3CRCA 2EIMB 2QTOA 3S3XA 3WB2A 3KCXA 2UU9B 4MVSA 2P4KA 2YSUB 5LHHA 4GKJB 1JX9A 2E3CA 3VQXA 1FD9A 4HAMA 2OIEA 3ZJZA 4JAUA 1TAEA 4JI2O 1DLBA 4F6RA 4RWUA 5EZYB 4MVUA 3QG5A 5B1BC 3CCJV 4LF9B 1YJNV 3M8AA 1H8EG 3T4ZA 2D3OW 2E5LO 4J80A 1NTZH 1PP9H 2JS5A 3C90A 4DW0A 3CMEV 4F4LA 4X66O 4JI6O 5IYZB 2Z3YA 1PNMA 4X89A 3ZHQA 2N05A 1BSMA 3RYCB 4UV8A 5LHGA 2PF4E 1PNKA 5JVDA 4IYHA 2VQEO 3U0ZA 1H2LA 4JI5B 2XNDG 4DR4B 4MTOA 3MD0A 2Q4PA 4MT8A 2NN4A 5KAIZ 2XHBA 4E2LA 2EILB 2ODMA 3OW2U 3AG1C 2PUSA 2EIJB 4HNAB 4U7OA 3IFXA 1UPGA 3AK3A 1K34A 4KP4A 4PDLA 3CE2A 3SYCA 2CAZC 2OYQA 5CA0B 3ZRXA 4QGPA 5HFLA 2X0LA 1DF5A 3ABMC 3FAVA 1MA1A 2IJHA 4WFHA 3JASB 2Q9LA 3DGEA 5LL6Y 4J9ZB 4X20B 5L3BA 4C7UA 2IBZH 4R7CA 3P32A 4CS2A 1VQPV 5LOVB 4LF5B 3JCZA 4BW5A 1H2SB 1YJ9V 1EFRG 4DR7O 5HFMA 5IY5B 1FXHA 2D2CB 2Q0AA 4PJ0Z 4K35A 3T2MA 4X65B 3A0HZ 3RYIA 4TV8B 5IJ0A 4AQYO 4FLZA 3HKDB 2ZR3A 5JCOA 4P9OA 3G80A 1W59A 4DR2O 5FLXN 4WFGA 4J41A 4ZBMA 2OTJV 4JI0O 1YEWA 4B7EA 4FMTA 5EBLC 2UXBB 4TV9A 2F43G 4NKGB 1YIJV 4O2BB 3D8CA 5FPRA 1O9HA 1B04A 4GCZA 3RVZA 3E8BA 1I5YA 1R6KA 3CS5A 1K7DA 2V4DA 1FXKC 4DV3B 1S77D 1M57B 2YS8A 3Q4HB 2AXTZ 4JI7B 1M5IA 2UUBB 2CH7A 5CA3A 3JD1A 3T1HO 4FPPA 1WAZA 4YIOA 4DR6O 3CCSV 3A8TA 5JQGA 3K9SA 4DO2A 4FLWA 1V54C 4MTFA 3OEHG 3DC5A 2Q0OC 4N23A 2W0XA 2R72A 4X1YA 3VQYA 4CH4A 4IIJA 1F7YA 3BY6A 3G4SV 1EN6A 3ASNB 2DOSA 4LF4B 1JPXA 3JYCA 4O4IB 2GHYA 1M56C 2RDCA 3LNNA 1WJZA 2DQ0A 4HBNA 3AG4C 1QR9A 4IHJA 1NR7A 5H2FZ 1FYJA 3ABKC 2CTRA 3CRRA 1JFFA 3DXRB 1XL4A 1G6UA 4JYYA 4GX0A 3OUSA 5DECA 2DWDC 3AEIA 3OFNG 4CS3A 1P4RA 2Y4UA 2ZR2A 3ZRVA 1Y66A 1WB8A 4BIOA 3S3WA 3QO7A 5LYJA 3TXSA 2YXLA 3ETQA 3E35A 1XUQA 2EZPA 3SPGA 3C3TA 1NVPB 1JR9A 3CP1A 3H9VA 2W6IG 3MAQA 1DK1A 2P90A 3CPWU 2ZDIC 1ZX3A 2Q67A 4Z2WA 1Y74B 2P4VA 1Q6HA 1XREA 2WPDG 3D36C 4I9QA 4K0KB 3PN1A 4DV4O 1WLEA 4DV6B 3OT7A 2BTQB 1N33B 2WAMA 2XT9A 5KHHA 4DV1O 2OTLV 1KBHA 4JYAB 4Z1MG 1AR5A 2ZQMA 4RO2A 1OCRB 1SQQH 3ABLC 4L8JA 1WP7A 2EULA 1YDXA 3J80N 3LSQA 3VOUA 4JPRA 4JYBA 1TUBB 2JEUA 3ABTA 4ZHQB 4B3TB 5L3EA 2LP7A 2QR4A 1W0JG 4LH6A 4W4LA 4F6EA 2ZCEA 1QU7A 4U3FH 2NLJC 2UUAO 1G1XB 1KKDA 1AB3A 1QNMA 4TT3G 2W0FC 3AK1A 3K9AA 1SETA 1MABG 4LF6B 1LR1A 2HJFC 3OMAB 3L75H 5CBGA 4EB6B 4X62B 4X1IA 2ZXWB 2HHHO 3FB8C 3JALB 4CH6A 2QJ1A 4FK5C 4OX9O 4JTAB 1SC5B 2DYSB 1Q3EA 1I94O 1COWG 1D5NA 4RQEA 4OPHA 1GN6A 2CGOA 1J5EB 3GVMA 2UXNA 1AI6A 5KHKA 3T1YO 4XDJA 1Q6UA 4F6RB 4DRXB 5IE9A 2BCCH 3OR7C 2EINC 3U10A 3N2GB 4I55B 1SKVA 5B3SB 2F1MA 3CCUV 1WPXA 3CC4V 1F4MA 1I5XA 3H1HH 5K1XA 2CTPA 1OJHA 2XOKG 4PHZA 2FYUH 2Q7EA 3JATB 3ABUA 5F2VO 4JAAA 4LCUC 4X64O 4DYLA 2EBOA 1R1BA 2X7RB 4PI2A 5JVDB 1LNQA 2A0LA 2P06A 5B1AC 4FM1A 2P7TC 4WFAV 2ZNIA 3E86A 4DR5B 1QHTA 2PZSA 4GT1A 1O9GA 2CDYA 2ZIOA 5EK0A 4PDVA 2UXDB 5IWAO 4JYCA 3O9OA 2LO1A 2YIBA 1QCEA 1Y4MA 4X1KB 1QLEC 5H5NA 4IYIA 3WU2Z 3MHHC 1YI2V 1KQSU 5C93A 4UB6Z 2R9RB 3AG3C 2OCCC 1VARA 1CPYA 4O4HB 1HW7A 2KQXA 4GX2A 4YJ2B 1A32A 1XMOO 1CP9A 1ZSPA 4B3MO 1IDSA 1GTOA 4RAIA 1HNXB 3NR7A 3BCCH 3K3WA 3JAWA 1ENVA 1EZVH 3G6BA 3SPIA 4H13B 2EZOA 5LP6B 1VMGA 4DK0A 3ZEDA 2QWQB 3EVKA 5L3GA 1SESA 4MTGA 4BWAA 4MTXA 4FJCC 5KX5B 2ZIMA 5IJ0B 4LNUB 1EBOA 5B1OA 1FXKA 3K08A 1N36O 1QBZA 4B3RB 4GKKO 3CEIA 3K03A 2F93B 3ZHVA 4LBEC 4JI4B 2ADPA 1KD1W 2UU9O 5L3FA 1NH2D 1BQZA 1DGSA 4TV9B 3ZN0A 4R8CA 3AG2B 4TWKA 2QA4V 2CUGA 3UM7A 1BL8A 1RM1C 1TA8A 3B8NA 3CCMV 3RYFA 1S3JA 5JWPA 3F5TA 4JV5B 4MW3A 3P3PA 2CE4A 1FKAO 1F4NA 3SDLA 4YXWG 3QO5A 4UVBA 3OGCC 3CCRV 3A0RA 1SQGA 2Q68A 1W0KG 1VQ4V 1XEQA 2R9AA 4UUJC 4YJ3A 2CH7B 2GBOA 2IH1C 4O4JA 1OCOC 1FFXA 1M1KW 1YVWA 3OUFA 3X2QC 4DV7O 1AJNA 3ZBHA 4LR3A 5LA6A 2YXHA 2N04A 2HG5C 1ZLZA 1K73W 2WLIA 5JQGB 3E22A 3SPCA 2FTKA 4KHPO 1FJGO 1EN5A 5BXZA 5A2QN 2YIBD 2ZE7A 4KUMA 2FMLA 4MSWC 2JGDB 2A7WA 2YEVB 3B40A 4IIJB 3ML0A 4ZIBA 3SJCC 2YIDA 4B3SB 3F5WC 2XTAA 3BA8A 4Q20A 1Q81W 1U96A 4GUNA 2ZDIA 4IHJB 3RVYA 1N34B 1IBLO 1ZUQA 1YCIA 4LFCO 3CCQV 2B9ZA 2ZE6A 3G6EV 3D36A 1JFFB 2DWEC 1OCCC 1K3EA 1KYOF 3OGIB 4JAVA 4JI3O 3HKEA 4MVRA 2PTMA 4K8XA 5LYJB 4O2AA 1K33A 4PI0A 3VQVA 3DSQA 4AHCA 5KMGA 3ETEA 1IBMB 3E89A 1GK9A 2CTQA 3ZHRA 1VQ6V 1YTFB 3K59A 3CJHA 2VRZA 2VWJA 2WA3A 1HDJA 1SZTA 4OGQB 4MVQA 4NTXA 3H01A 4MVOA 1CXZB 4NYKA 1HP8A 3DTUB 1JMKC 2F4VO 2FL4A 3FB5C 2DE0X 3A0BZ 4K8ZA 4QJFB 3KG2A 4DUYB 2YI8A 1QVGU 3SYAA 3L72H 1KC8W 3QF7A 2Z5UA 2EILC 4YY3B 4JZGA 4AILC 3UKMA 2LFSA 3LSUA 3N2KB 3TGUH 2EIJC 4WF9V 2AZ0A 1NVPD 3E8GA 1XMQO 5AG2A 2UUCB 1BCCH 2GDSA 5J2TB 2P6JA 4NXMB 5B1BB 4DUZB 2QKSA 4NXNB 2LW1A 1DF4A 1MMMA 3SYQA 1OCZC 1VF7A 4LH7A 4XDLA 4X1IB 3BEHA 5CB4B 1IVSA 4GYCB 3UCSC 1S76D 3WB1A 3BPZA 3R66A 1S0VA 3L71H 2WLHA 3JCUZ 4DR1O 1NH2B 2UXCB 3J7AU 5LMUB 3TJTA 1Y76A 1EM1A 5JH7B 3W7SA 3OTOB 4DR3O 2DYRB 4H33A 3AG1B 1W2BU 1VQ7V 1ORQC 4QPJA 1JVMA 1GM8A 1Q7YW 1K4DC 2ZINA 2QWOB 3ZN1A 4NB5A 1SQFA 3QO8A 1RSOA 3I56V 1H8HG 1VQLV 5B5EZ 3ABMB 1NKDA 1NTMH 5LHIA 2P67A 2LGWA 3UO3A 5K1PA 4WFEA 1NQTA 2A9HA 4JI1O 3ZMSA 3K5MA 3FYIB 4GX5A 4UCVA 4JI2B 1S5LZ 2KG7B 2Q6AA 2QWNB 1WN7A 1M57C 1IURA 2YI9A 2QEXV 1URFA 2E5LB 2M7WA 1FPOA 4WBNA 1Z2GA 4NR1A 5C8YB 3KZIZ 5BMVA 1H2NA 2E74B 4X66B 4JI6B 2P5OA 3I55V 3PJSK 4LF8O 1GN4A 4D6TH 2Y4TA 3RN4A 4QNHB 4KXRA 1XNQO 4RUFA 1LUVA 1AROP 2QDOA 2Q7GA 3D3QA 3R65A 2VQEB 1LUWA 3ZRSA 2ZM6O 3CB2A 2EX3A 1E79G 1M93A 2XASA 2Z0AA 4TQFA 1HR0O 3FD9A 4NVPA 1TGOA 1NT2B 3LNMB 1JQ0A 4B7KA 1NJIW 3ZRWA 4J42A 1B3QA 4I4TA 2Y0IA 1MOFA 1R3JC 3HKBA 1WPBA 3W7WA 2QM4A 4LF6O 4CH3A 2IH3C 3JARA 3WB0A 4X62O 4P30A 2QM8A 4I50A 2LGQA 4FIPC 5J9PC 3IJ4A 2GUZA 1ZAUA 5CA1B 3RT3C 4HZ3A 4DXWA 2V7QG 1PL0A 1HNWB 1SZXA 3RYFB 3OR6C 5CN0A 1K92A 2ADQB 3AK2A 1SA0A 1N32O 2BSKB 4DR7B 2C2AA 3EFFK 3ZIAG 4LF7O 1MG1A 1PKXA 2XAQA 3H1IH 4UXNA 4TUYA 2N74A 3LUTB 2VQFO 4JI8O 3IC9A 4AQYB 2RJZA 1SQPH 2EIKB 4UVCA 1M56B 2E76B 2O57A 1Q6IA 5LA6B 1DTOA 4DR2B 1BMFG 1L1FA 3ABKB 3TXQA 3L9DA 3ZX6A 1OCRC 4JI0B 3K06A 3STZC 4J7KA 1GRJA 1FS0G 4J11A 1GM9A 3E83A 3H1LH 3APOA 5JJNB 4X9QA 5BR8O 1D2DA 1WP8A 1YHQV 1NI8A 4I0XB 4UB8Z 4FLVA 4L87A 1QQCA 5J2UA 3FKSG 2HVJC 4HYOA 3FB6C 3NXSA 4OPAA 1WA8B 2AZ2A 1S72V 1SRYA 1R3IC 1KP3A 4BAYA 3ASOC 2HVKC 2WLLB 1U97A 2X6CA 1K5SA 3HKCB 2DQ3A 5E1AC 3T1HB 4YHHO 2WLMA 5FNVB 5KUKA 3H1KH 2JJ1G 5IJ9A 1VEWA 1IXBA 4I5SA 3ICXA 5CBFA 3T4DA 5GTIZ 2RMKB 4J9YB 2PY5A 3CYOA 3ABLB 1KU9A 3K58A 3CJHB 2R9IA 3BA9A 5DEDA 3W7TA 3OD4A 1RPOA 3C3SA 1H2MA 4HNAA 4CC6A 1R6TA 2RCVA 1BS3A 3THOA 3K5OA 3CRQA 3I5DA 5CA0A 3JD4A 4KFMA 3OMIB 2BOCC 2XAJA 4JI4O 5BY1A 3UT5A 3JASA 2FKXA 3RGBA 4X20A 4LFBO 1XHXA 3FFQA 4JV5O 2KSDA 3QTCA 1YTFD 2Y48A 4FM0A 1NR1A 4DV2O 2WLKA 2BE3A 2Q69A 4DV4B 1NZ6A 4TV8A 3D3IA 1M4UA 3HKDA 5EIBD 3IC7A 1JJOA 2Y69B 1IBKO 3DC6A 4LFAO 4DV1B 1OZ0A 1X4TA 5KHIA 4MVMA 4UFZA 5ITZA 2XAGA 1Z5VA 2JDIG 3FAVB 2ZE5A 5KLVH 2IU0A 3ZCCA 5IYBO 5LP6C 1AI5A 1NU1H 1N0NA 1XNRO 2QKCA 5GONA 1J95A 2PI4A 3CRAA 2VWKA 4DV5O 4B3SO 1HNZO 1BHAA 3CC7V 1JCHA 5LMNB 2UUAB 1ZWIC 1K97A 3TCUA 3SYOA 2X6BA 3Q4HA 1N34O 2WLNA 3OM3B 1RSOB 1E1QG 5H6RA 1HWYA 3SJBC 4PDMA 3RYIB 4WCEV 1TVKA 2OCCB 2HHHB 4OX9B 1AI4A 4PA4A 4U3JA 1I94B 2JVDA 3HB3B 1WB7A 4PA3A 4BIUA 5EYPA 4I7ZB 3B8MA 4EKWA 3H1JH 1B06A 3WG7C 1Z5WA 4GKJO 3CXHF 4X88A 1I7FA 1V55C 2B1GA 2WWWA 1WNSA 5KHJA 3K0DA 4UCOA 4WBNB 5KA6A 5H9CA 1VP7A
chains in the Genus database with same CATH topology
3FD9A 2DE0X 1WA8B 2AZ2A 1WA8A 2B9ZA 3FAVB 4LWSB 3Q4HB 3FAVA 4GZRB 3Q4HA 3GVMA 4LWSA 2VRZA 3HR0A 4I0XB 4I0XA 3O9OA 2KG7B 4ABMA 2KG7A 3GWKC 3OGIB 2VS0A 3ZBHA 3G80A 3TXQA 3TXSA 2AZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FD9 A;  2DE0 X;  1WA8 B;  2AZ2 A;  1WA8 A;  2B9Z A;  3FAV B;  4LWS B;  3Q4H B;  3FAV A;  4GZR B;  3Q4H A;  3GVM A;  4LWS A;  2VRZ A;  3HR0 A;  4I0X B;  4I0X A;  3O9O A;  2KG7 B;  4ABM A;  2KG7 A;  3GWK C;  3OGI B;  2VS0 A;  3ZBH A;  3G80 A;  3TXQ A;  3TXS A;  2AZ0 A; 
#chains in the Genus database with same CATH topology
 1RFY A;  2A06 H;  4LF9 O;  4DW1 A;  4LWS A;  1Q5O A;  3HR0 A;  1JJ2 U;  1BE3 H;  3DXR A;  2ZKO A;  3MHS C;  2B5U A;  2JIZ G;  1Q8I A;  1QR8 A;  2HR3 A;  2V1D A;  4MS2 A;  4YY3 O;  4FLU A;  2IM9 A;  4QPK A;  5IWA B;  4H0L B;  1SQB H;  5KHG A;  1VIB A;  2HLD G;  5KAF Z;  2ILM A;  3BFR A;  1GN2 A;  2RN9 A;  4JI5 O;  4DR4 O;  1Q86 W;  4X1Y B;  5TIS Z;  2Q5Z A;  1V9P A;  2YUA A;  2H8P C;  2XAH A;  5BZB A;  1VQ9 V;  5H6Q A;  2CGN A;  2BTQ A;  1YF2 A;  2DMX A;  1OCO B;  2JGU A;  4ICG A;  2JK5 C;  3X2Q B;  1PPJ H;  3LDC A;  3ZHS A;  2OT5 A;  2EIM C;  1XMO B;  3CMA V;  4B3M B;  3M99 B;  1G4Y B;  4JGS A;  1OHH G;  4I9W A;  1SA0 B;  3M7M X;  1ROP A;  3ZHT A;  1TUB A;  4ZHQ A;  3U11 A;  3OTO O;  5LXT A;  4TUY B;  1SER A;  4DV0 B;  4LF5 O;  4A5U B;  1MZF A;  3CC2 V;  4IT5 A;  1XHZ A;  1JA8 A;  2L6L A;  4ZKI A;  3OE7 G;  1FFT B;  1EZJ A;  1Y6X A;  2IJJ A;  3OMN B;  4YIP A;  4FVM A;  4GKK B;  4X65 O;  3SPJ A;  1N0J A;  4UVA A;  4IGG A;  3FX7 A;  4EB6 A;  1KUQ A;  1XDC A;  1JOY A;  3JAL A;  1I0H A;  1OCC B;  4TOI A;  1PNL A;  3RYH A;  1GAX A;  3E8H A;  5A9G A;  2PYJ A;  2NNU A;  5B1N A;  4DRX A;  2UXB O;  5J2U B;  4NTW A;  4ZI7 A;  2NR5 A;  3FYE B;  4Q6G A;  4G28 B;  2QKA A;  3N2G A;  4I55 A;  4MVZ A;  2YXY A;  4DV3 O;  1H2K A;  1YXB A;  4DV7 B;  1VF5 B;  4FM2 A;  3IGA C;  3JAT A;  2ZT9 B;  5EBW C;  4H44 B;  4JI7 O;  2L35 A;  5IJ9 B;  2UUB O;  3RBZ A;  4KHP B;  1FJG B;  5LBQ A;  3JAK A;  4LP8 A;  1KP2 A;  4G2K A;  1Q90 D;  1VQ8 V;  1S5H C;  2WLJ A;  1VQM V;  2LW7 A;  2PYL A;  4GZR B;  1BQ0 A;  1AR1 B;  2DYR C;  2LJ2 A;  4X1K A;  1R6N A;  5IY5 C;  1IBL B;  2GV9 A;  4BW9 A;  4LFC B;  2H3O A;  3BRC A;  4LF4 O;  2CTW A;  1L0L H;  1OCZ B;  1Q43 A;  3VQW A;  3RFR A;  4O4H A;  5CBH A;  4YJ2 A;  2GTS A;  3UT5 B;  4KL1 A;  4JI3 B;  3GWO A;  3JSL A;  3MDS A;  3GWK C;  4CS4 A;  1HNW O;  3B77 A;  1PL4 A;  2E75 B;  3B09 A;  4CZZ A;  3E8F A;  3KCY A;  2YC0 A;  3LDD A;  4O4L A;  4JAS A;  1GH6 A;  2HFE C;  5LP6 A;  4Z1V A;  3E2E A;  4PA7 A;  3W7U A;  2QWR B;  2ZE8 A;  2ZD9 A;  2EJR A;  3K5L A;  1VF6 C;  4GLX A;  1R3L C;  4CC5 A;  5KX5 A;  1TUE B;  3ZMV A;  5IYC O;  2MK3 A;  4LNU A;  3JSN A;  3SR2 C;  2Q73 A;  4CH5 A;  2F4V B;  5JJE B;  4D7S A;  4FFB A;  4PA6 A;  4K0K O;  4AI8 A;  5D5Q A;  4WFF A;  5ITZ B;  4DV6 O;  4QE7 A;  1N33 O;  3BHP A;  4R6Z A;  1VQ5 V;  5IYD O;  4JYA O;  5GON B;  2Q8V A;  4FLT A;  4GX1 A;  3JAW B;  5LGT A;  1XMQ B;  2UXX A;  2JJ2 G;  1NS1 A;  5IDJ A;  4UCR A;  1F23 A;  3AG7 A;  2MW2 B;  4B3T O;  1N4C A;  3ASN C;  1XQ8 A;  1F51 A;  2H94 A;  1TVK B;  4RQF A;  1ZL8 A;  2RQ6 A;  4JF3 A;  1GN3 A;  1FXK B;  5LGN A;  4JTD B;  4U3J B;  3HPL C;  1AVM A;  4QIW F;  5D5P A;  3BVO A;  3STL C;  5EYP B;  2QGN A;  1K4C C;  2DN9 A;  2M6Y A;  4DR1 B;  3TET A;  2JGD A;  4NTY A;  4WFB V;  2YEV A;  3K04 A;  3L73 H;  4JTC B;  4ZOL A;  3SPH A;  1YJW V;  1E1R G;  4IL6 Z;  1J5E O;  4DR3 B;  2Q7H A;  1V54 B;  3J81 N;  1NBM G;  2HP8 A;  4J10 A;  2EIK C;  3UO2 A;  1SQX H;  1KB9 F;  4BR6 A;  5JJJ B;  4PD4 F;  1XOU A;  3KKY A;  4LWS B;  1AI7 A;  2QM7 A;  1GM7 A;  1KEC A;  1L8D A;  5EBM C;  4YJ3 B;  1I08 A;  3CXC U;  1RPR A;  4O4J B;  5IT9 N;  3JD3 A;  1FFX B;  3SGI A;  4X8A A;  2AHY A;  3AG4 B;  4EFE A;  3P3N A;  3K5N A;  1GMG A;  3ETD A;  2WLI B;  1T5E A;  4JI1 B;  3E22 B;  1GO3 F;  1BGY H;  2YIC A;  1YZB A;  2OCH A;  2F66 C;  4DR5 O;  2IJI A;  3APQ A;  4UCU A;  1AP5 A;  1Q82 W;  2UXD O;  1R3K C;  1XL6 A;  1FXV A;  2QE7 G;  3L74 H;  1M9N A;  4JZ2 A;  1VQO V;  1D5A A;  3O65 A;  4EFB A;  5EZY A;  2ITD C;  4LF8 B;  1IZ3 A;  1B6Q A;  2R70 A;  2F95 B;  3TK1 A;  1XNQ B;  4PEL A;  3LSS A;  2ZXW C;  1PV0 A;  3K0G A;  4UV9 A;  2BTO A;  2ZM6 B;  5FL7 G;  2DYS C;  5IYZ A;  2PGG A;  2IJK A;  1S5J A;  3HKE B;  4QE9 A;  4DR6 B;  3F7V C;  1HR0 B;  1HNX O;  4O2A B;  3B2E E;  2HKO A;  3RYC A;  3ZHU A;  5LXT B;  3N2K A;  3T1C A;  4UCT A;  2JS3 A;  4LC1 A;  2YIA A;  4H37 A;  5KMG B;  1PD3 A;  5LMN O;  1G8M A;  5J2T A;  2ETN A;  3GB7 C;  5B3S C;  3CD6 V;  2K1E A;  2RNB A;  4N21 A;  3ASO B;  2FB5 A;  5CB4 A;  3F7Y C;  2DW4 A;  1P7B A;  4B3R O;  1CEZ A;  2LQT A;  2A79 B;  3RYH B;  2DJV A;  2PI5 A;  3CHX A;  4XBF A;  2P22 C;  1H38 A;  1N32 B;  1SS3 A;  5KA5 A;  1MNG A;  4ZI7 B;  4LF7 B;  2X6A A;  2A3Q A;  1AP6 A;  5GTH Z;  4EEQ A;  1OV9 A;  1BT8 A;  5JH7 A;  5GW7 A;  4DK1 A;  4J7J A;  5LOV A;  3OTF A;  2VQF B;  4JI8 B;  2EIN B;  2F23 A;  2Y69 C;  4FFK A;  1AJQ A;  4MW8 A;  2AW9 A;  3WFV A;  3CCE V;  5EC2 C;  3BAA A;  1QLN A;  4XDK A;  1AIL A;  3JAK B;  4BIZ A;  4D7T A;  2ARH A;  5CMU A;  5BR8 B;  4U7N A;  1XBL A;  4W4K A;  3OAA G;  4TSF G;  3K57 A;  3ZMZ A;  2WA4 A;  3EXA A;  5B1A B;  5E79 Z;  2KG7 A;  1ZTE A;  5DM6 V;  4O2B A;  1BHB A;  4P2Z A;  1IXM A;  1Y76 B;  2LFR A;  4FLY A;  3JD0 A;  1VF6 A;  1GKF A;  2HJD A;  4FZ0 A;  5C8Y A;  1PM9 A;  5JCO C;  1YSC A;  1QLE B;  5L3D A;  3CSX A;  4B08 A;  4YHH B;  3JD2 A;  2OIG A;  1KMI Z;  1SF9 A;  4ABM A;  4OXS A;  3BAB A;  3OEE G;  3VBB A;  2YDE A;  3AG3 B;  3W7X A;  3LDE A;  4O4L B;  3AG2 C;  2K9P A;  3G67 A;  1NTK H;  3IAY A;  1P84 F;  4J7Z A;  4R50 A;  3JAM N;  1MZE A;  3T1Y B;  1BZK A;  1VQK V;  2IU3 A;  4DV0 O;  3RWR D;  1IBM O;  3FB7 C;  1XIL A;  2IW5 A;  1XI1 A;  1P49 A;  4K3A A;  1N8R W;  5LGU A;  3EHB B;  1MSD A;  4ASU G;  2QTS A;  4FFB B;  1K8A W;  4O4I A;  2XAF A;  2KB1 A;  3CX5 F;  2Y0P A;  3RW0 A;  5BMV B;  1M90 W;  1Y67 A;  5CA1 A;  5L3C A;  3UQ8 A;  2G38 A;  3SJA C;  1P7G A;  4X64 B;  3ZMT A;  3CCL V;  4DUY O;  4LFB B;  4UCS A;  4FLX A;  1THZ A;  2QSA A;  1AJP A;  4RUE A;  2BSK A;  2QWP B;  3WG7 B;  4PDR A;  2WSS G;  2KKW A;  1RM1 B;  3SYP A;  5FPO A;  4DV2 B;  3QVN A;  4G27 B;  1V55 B;  2JRI A;  5EC1 C;  4PV1 B;  3CCV V;  1YIT V;  3ZRW B;  2UUC O;  1SQV H;  4I4T B;  1L0N H;  1ZL8 B;  2GSM B;  4NXM O;  3P30 A;  2OWO A;  1R73 A;  3HKB B;  4DUZ O;  4NXN O;  2CK3 G;  2HEP A;  3L70 H;  1Y74 A;  1US6 A;  1IBK B;  5DN6 G;  4LFA B;  3A2F A;  1UFI A;  1K5Q A;  3JAR B;  3ETG A;  4I50 B;  1AR4 A;  1UJW B;  3CRM A;  1MSW D;  2ZNJ A;  1IX9 A;  2BOB C;  2W6J G;  2GUZ B;  1K9M W;  2B1I A;  1EN4 A;  2EJ7 A;  1X59 A;  3B4S A;  2ITC C;  1XNR B;  4PA9 A;  4ZOL B;  4I0X A;  3N27 A;  3CWB H;  4DV5 B;  1HNZ B;  4P9P A;  1H2G A;  4CBC A;  2UXC O;  1VQN V;  3ZMU A;  5B66 Z;  5LMU O;  1FAF A;  3QNE A;  4E4E A;  2JEX A;  1KKC A;  4FZ1 A;  4TQD A;  3SJQ C;  2AGA A;  2GTA A;  1WA8 A;  2XUM A;  5KUM A;  1QVF U;  2ATK C;  3K79 A;  3G71 V;  3ZS8 C;  1RP3 B;  5EIB C;  2WLL A;  3HKC A;  1N36 B;  2AHZ A;  2VS0 A;  5FNV A;  3CRC A;  2EIM B;  2QTO A;  3S3X A;  3WB2 A;  3KCX A;  2UU9 B;  4MVS A;  2P4K A;  2YSU B;  5LHH A;  4GKJ B;  1JX9 A;  2E3C A;  3VQX A;  1FD9 A;  4HAM A;  2OIE A;  3ZJZ A;  4JAU A;  1TAE A;  4JI2 O;  1DLB A;  4F6R A;  4RWU A;  5EZY B;  4MVU A;  3QG5 A;  5B1B C;  3CCJ V;  4LF9 B;  1YJN V;  3M8A A;  1H8E G;  3T4Z A;  2D3O W;  2E5L O;  4J80 A;  1NTZ H;  1PP9 H;  2JS5 A;  3C90 A;  4DW0 A;  3CME V;  4F4L A;  4X66 O;  4JI6 O;  5IYZ B;  2Z3Y A;  1PNM A;  4X89 A;  3ZHQ A;  2N05 A;  1BSM A;  3RYC B;  4UV8 A;  5LHG A;  2PF4 E;  1PNK A;  5JVD A;  4IYH A;  2VQE O;  3U0Z A;  1H2L A;  4JI5 B;  2XND G;  4DR4 B;  4MTO A;  3MD0 A;  2Q4P A;  4MT8 A;  2NN4 A;  5KAI Z;  2XHB A;  4E2L A;  2EIL B;  2ODM A;  3OW2 U;  3AG1 C;  2PUS A;  2EIJ B;  4HNA B;  4U7O A;  3IFX A;  1UPG A;  3AK3 A;  1K34 A;  4KP4 A;  4PDL A;  3CE2 A;  3SYC A;  2CAZ C;  2OYQ A;  5CA0 B;  3ZRX A;  4QGP A;  5HFL A;  2X0L A;  1DF5 A;  3ABM C;  3FAV A;  1MA1 A;  2IJH A;  4WFH A;  3JAS B;  2Q9L A;  3DGE A;  5LL6 Y;  4J9Z B;  4X20 B;  5L3B A;  4C7U A;  2IBZ H;  4R7C A;  3P32 A;  4CS2 A;  1VQP V;  5LOV B;  4LF5 B;  3JCZ A;  4BW5 A;  1H2S B;  1YJ9 V;  1EFR G;  4DR7 O;  5HFM A;  5IY5 B;  1FXH A;  2D2C B;  2Q0A A;  4PJ0 Z;  4K35 A;  3T2M A;  4X65 B;  3A0H Z;  3RYI A;  4TV8 B;  5IJ0 A;  4AQY O;  4FLZ A;  3HKD B;  2ZR3 A;  5JCO A;  4P9O A;  3G80 A;  1W59 A;  4DR2 O;  5FLX N;  4WFG A;  4J41 A;  4ZBM A;  2OTJ V;  4JI0 O;  1YEW A;  4B7E A;  4FMT A;  5EBL C;  2UXB B;  4TV9 A;  2F43 G;  4NKG B;  1YIJ V;  4O2B B;  3D8C A;  5FPR A;  1O9H A;  1B04 A;  4GCZ A;  3RVZ A;  3E8B A;  1I5Y A;  1R6K A;  3CS5 A;  1K7D A;  2V4D A;  1FXK C;  4DV3 B;  1S77 D;  1M57 B;  2YS8 A;  3Q4H B;  2AXT Z;  4JI7 B;  1M5I A;  2UUB B;  2CH7 A;  5CA3 A;  3JD1 A;  3T1H O;  4FPP A;  1WAZ A;  4YIO A;  4DR6 O;  3CCS V;  3A8T A;  5JQG A;  3K9S A;  4DO2 A;  4FLW A;  1V54 C;  4MTF A;  3OEH G;  3DC5 A;  2Q0O C;  4N23 A;  2W0X A;  2R72 A;  4X1Y A;  3VQY A;  4CH4 A;  4IIJ A;  1F7Y A;  3BY6 A;  3G4S V;  1EN6 A;  3ASN B;  2DOS A;  4LF4 B;  1JPX A;  3JYC A;  4O4I B;  2GHY A;  1M56 C;  2RDC A;  3LNN A;  1WJZ A;  2DQ0 A;  4HBN A;  3AG4 C;  1QR9 A;  4IHJ A;  1NR7 A;  5H2F Z;  1FYJ A;  3ABK C;  2CTR A;  3CRR A;  1JFF A;  3DXR B;  1XL4 A;  1G6U A;  4JYY A;  4GX0 A;  3OUS A;  5DEC A;  2DWD C;  3AEI A;  3OFN G;  4CS3 A;  1P4R A;  2Y4U A;  2ZR2 A;  3ZRV A;  1Y66 A;  1WB8 A;  4BIO A;  3S3W A;  3QO7 A;  5LYJ A;  3TXS A;  2YXL A;  3ETQ A;  3E35 A;  1XUQ A;  2EZP A;  3SPG A;  3C3T A;  1NVP B;  1JR9 A;  3CP1 A;  3H9V A;  2W6I G;  3MAQ A;  1DK1 A;  2P90 A;  3CPW U;  2ZDI C;  1ZX3 A;  2Q67 A;  4Z2W A;  1Y74 B;  2P4V A;  1Q6H A;  1XRE A;  2WPD G;  3D36 C;  4I9Q A;  4K0K B;  3PN1 A;  4DV4 O;  1WLE A;  4DV6 B;  3OT7 A;  2BTQ B;  1N33 B;  2WAM A;  2XT9 A;  5KHH A;  4DV1 O;  2OTL V;  1KBH A;  4JYA B;  4Z1M G;  1AR5 A;  2ZQM A;  4RO2 A;  1OCR B;  1SQQ H;  3ABL C;  4L8J A;  1WP7 A;  2EUL A;  1YDX A;  3J80 N;  3LSQ A;  3VOU A;  4JPR A;  4JYB A;  1TUB B;  2JEU A;  3ABT A;  4ZHQ B;  4B3T B;  5L3E A;  2LP7 A;  2QR4 A;  1W0J G;  4LH6 A;  4W4L A;  4F6E A;  2ZCE A;  1QU7 A;  4U3F H;  2NLJ C;  2UUA O;  1G1X B;  1KKD A;  1AB3 A;  1QNM A;  4TT3 G;  2W0F C;  3AK1 A;  3K9A A;  1SET A;  1MAB G;  4LF6 B;  1LR1 A;  2HJF C;  3OMA B;  3L75 H;  5CBG A;  4EB6 B;  4X62 B;  4X1I A;  2ZXW B;  2HHH O;  3FB8 C;  3JAL B;  4CH6 A;  2QJ1 A;  4FK5 C;  4OX9 O;  4JTA B;  1SC5 B;  2DYS B;  1Q3E A;  1I94 O;  1COW G;  1D5N A;  4RQE A;  4OPH A;  1GN6 A;  2CGO A;  1J5E B;  3GVM A;  2UXN A;  1AI6 A;  5KHK A;  3T1Y O;  4XDJ A;  1Q6U A;  4F6R B;  4DRX B;  5IE9 A;  2BCC H;  3OR7 C;  2EIN C;  3U10 A;  3N2G B;  4I55 B;  1SKV A;  5B3S B;  2F1M A;  3CCU V;  1WPX A;  3CC4 V;  1F4M A;  1I5X A;  3H1H H;  5K1X A;  2CTP A;  1OJH A;  2XOK G;  4PHZ A;  2FYU H;  2Q7E A;  3JAT B;  3ABU A;  5F2V O;  4JAA A;  4LCU C;  4X64 O;  4DYL A;  2EBO A;  1R1B A;  2X7R B;  4PI2 A;  5JVD B;  1LNQ A;  2A0L A;  2P06 A;  5B1A C;  4FM1 A;  2P7T C;  4WFA V;  2ZNI A;  3E86 A;  4DR5 B;  1QHT A;  2PZS A;  4GT1 A;  1O9G A;  2CDY A;  2ZIO A;  5EK0 A;  4PDV A;  2UXD B;  5IWA O;  4JYC A;  3O9O A;  2LO1 A;  2YIB A;  1QCE A;  1Y4M A;  4X1K B;  1QLE C;  5H5N A;  4IYI A;  3WU2 Z;  3MHH C;  1YI2 V;  1KQS U;  5C93 A;  4UB6 Z;  2R9R B;  3AG3 C;  2OCC C;  1VAR A;  1CPY A;  4O4H B;  1HW7 A;  2KQX A;  4GX2 A;  4YJ2 B;  1A32 A;  1XMO O;  1CP9 A;  1ZSP A;  4B3M O;  1IDS A;  1GTO A;  4RAI A;  1HNX B;  3NR7 A;  3BCC H;  3K3W A;  3JAW A;  1ENV A;  1EZV H;  3G6B A;  3SPI A;  4H13 B;  2EZO A;  5LP6 B;  1VMG A;  4DK0 A;  3ZED A;  2QWQ B;  3EVK A;  5L3G A;  1SES A;  4MTG A;  4BWA A;  4MTX A;  4FJC C;  5KX5 B;  2ZIM A;  5IJ0 B;  4LNU B;  1EBO A;  5B1O A;  1FXK A;  3K08 A;  1N36 O;  1QBZ A;  4B3R B;  4GKK O;  3CEI A;  3K03 A;  2F93 B;  3ZHV A;  4LBE C;  4JI4 B;  2ADP A;  1KD1 W;  2UU9 O;  5L3F A;  1NH2 D;  1BQZ A;  1DGS A;  4TV9 B;  3ZN0 A;  4R8C A;  3AG2 B;  4TWK A;  2QA4 V;  2CUG A;  3UM7 A;  1BL8 A;  1RM1 C;  1TA8 A;  3B8N A;  3CCM V;  3RYF A;  1S3J A;  5JWP A;  3F5T A;  4JV5 B;  4MW3 A;  3P3P A;  2CE4 A;  1FKA O;  1F4N A;  3SDL A;  4YXW G;  3QO5 A;  4UVB A;  3OGC C;  3CCR V;  3A0R A;  1SQG A;  2Q68 A;  1W0K G;  1VQ4 V;  1XEQ A;  2R9A A;  4UUJ C;  4YJ3 A;  2CH7 B;  2GBO A;  2IH1 C;  4O4J A;  1OCO C;  1FFX A;  1M1K W;  1YVW A;  3OUF A;  3X2Q C;  4DV7 O;  1AJN A;  3ZBH A;  4LR3 A;  5LA6 A;  2YXH A;  2N04 A;  2HG5 C;  1ZLZ A;  1K73 W;  2WLI A;  5JQG B;  3E22 A;  3SPC A;  2FTK A;  4KHP O;  1FJG O;  1EN5 A;  5BXZ A;  5A2Q N;  2YIB D;  2ZE7 A;  4KUM A;  2FML A;  4MSW C;  2JGD B;  2A7W A;  2YEV B;  3B40 A;  4IIJ B;  3ML0 A;  4ZIB A;  3SJC C;  2YID A;  4B3S B;  3F5W C;  2XTA A;  3BA8 A;  4Q20 A;  1Q81 W;  1U96 A;  4GUN A;  2ZDI A;  4IHJ B;  3RVY A;  1N34 B;  1IBL O;  1ZUQ A;  1YCI A;  4LFC O;  3CCQ V;  2B9Z A;  2ZE6 A;  3G6E V;  3D36 A;  1JFF B;  2DWE C;  1OCC C;  1K3E A;  1KYO F;  3OGI B;  4JAV A;  4JI3 O;  3HKE A;  4MVR A;  2PTM A;  4K8X A;  5LYJ B;  4O2A A;  1K33 A;  4PI0 A;  3VQV A;  3DSQ A;  4AHC A;  5KMG A;  3ETE A;  1IBM B;  3E89 A;  1GK9 A;  2CTQ A;  3ZHR A;  1VQ6 V;  1YTF B;  3K59 A;  3CJH A;  2VRZ A;  2VWJ A;  2WA3 A;  1HDJ A;  1SZT A;  4OGQ B;  4MVQ A;  4NTX A;  3H01 A;  4MVO A;  1CXZ B;  4NYK A;  1HP8 A;  3DTU B;  1JMK C;  2F4V O;  2FL4 A;  3FB5 C;  2DE0 X;  3A0B Z;  4K8Z A;  4QJF B;  3KG2 A;  4DUY B;  2YI8 A;  1QVG U;  3SYA A;  3L72 H;  1KC8 W;  3QF7 A;  2Z5U A;  2EIL C;  4YY3 B;  4JZG A;  4AIL C;  3UKM A;  2LFS A;  3LSU A;  3N2K B;  3TGU H;  2EIJ C;  4WF9 V;  2AZ0 A;  1NVP D;  3E8G A;  1XMQ O;  5AG2 A;  2UUC B;  1BCC H;  2GDS A;  5J2T B;  2P6J A;  4NXM B;  5B1B B;  4DUZ B;  2QKS A;  4NXN B;  2LW1 A;  1DF4 A;  1MMM A;  3SYQ A;  1OCZ C;  1VF7 A;  4LH7 A;  4XDL A;  4X1I B;  3BEH A;  5CB4 B;  1IVS A;  4GYC B;  3UCS C;  1S76 D;  3WB1 A;  3BPZ A;  3R66 A;  1S0V A;  3L71 H;  2WLH A;  3JCU Z;  4DR1 O;  1NH2 B;  2UXC B;  3J7A U;  5LMU B;  3TJT A;  1Y76 A;  1EM1 A;  5JH7 B;  3W7S A;  3OTO B;  4DR3 O;  2DYR B;  4H33 A;  3AG1 B;  1W2B U;  1VQ7 V;  1ORQ C;  4QPJ A;  1JVM A;  1GM8 A;  1Q7Y W;  1K4D C;  2ZIN A;  2QWO B;  3ZN1 A;  4NB5 A;  1SQF A;  3QO8 A;  1RSO A;  3I56 V;  1H8H G;  1VQL V;  5B5E Z;  3ABM B;  1NKD A;  1NTM H;  5LHI A;  2P67 A;  2LGW A;  3UO3 A;  5K1P A;  4WFE A;  1NQT A;  2A9H A;  4JI1 O;  3ZMS A;  3K5M A;  3FYI B;  4GX5 A;  4UCV A;  4JI2 B;  1S5L Z;  2KG7 B;  2Q6A A;  2QWN B;  1WN7 A;  1M57 C;  1IUR A;  2YI9 A;  2QEX V;  1URF A;  2E5L B;  2M7W A;  1FPO A;  4WBN A;  1Z2G A;  4NR1 A;  5C8Y B;  3KZI Z;  5BMV A;  1H2N A;  2E74 B;  4X66 B;  4JI6 B;  2P5O A;  3I55 V;  3PJS K;  4LF8 O;  1GN4 A;  4D6T H;  2Y4T A;  3RN4 A;  4QNH B;  4KXR A;  1XNQ O;  4RUF A;  1LUV A;  1ARO P;  2QDO A;  2Q7G A;  3D3Q A;  3R65 A;  2VQE B;  1LUW A;  3ZRS A;  2ZM6 O;  3CB2 A;  2EX3 A;  1E79 G;  1M93 A;  2XAS A;  2Z0A A;  4TQF A;  1HR0 O;  3FD9 A;  4NVP A;  1TGO A;  1NT2 B;  3LNM B;  1JQ0 A;  4B7K A;  1NJI W;  3ZRW A;  4J42 A;  1B3Q A;  4I4T A;  2Y0I A;  1MOF A;  1R3J C;  3HKB A;  1WPB A;  3W7W A;  2QM4 A;  4LF6 O;  4CH3 A;  2IH3 C;  3JAR A;  3WB0 A;  4X62 O;  4P30 A;  2QM8 A;  4I50 A;  2LGQ A;  4FIP C;  5J9P C;  3IJ4 A;  2GUZ A;  1ZAU A;  5CA1 B;  3RT3 C;  4HZ3 A;  4DXW A;  2V7Q G;  1PL0 A;  1HNW B;  1SZX A;  3RYF B;  3OR6 C;  5CN0 A;  1K92 A;  2ADQ B;  3AK2 A;  1SA0 A;  1N32 O;  2BSK B;  4DR7 B;  2C2A A;  3EFF K;  3ZIA G;  4LF7 O;  1MG1 A;  1PKX A;  2XAQ A;  3H1I H;  4UXN A;  4TUY A;  2N74 A;  3LUT B;  2VQF O;  4JI8 O;  3IC9 A;  4AQY B;  2RJZ A;  1SQP H;  2EIK B;  4UVC A;  1M56 B;  2E76 B;  2O57 A;  1Q6I A;  5LA6 B;  1DTO A;  4DR2 B;  1BMF G;  1L1F A;  3ABK B;  3TXQ A;  3L9D A;  3ZX6 A;  1OCR C;  4JI0 B;  3K06 A;  3STZ C;  4J7K A;  1GRJ A;  1FS0 G;  4J11 A;  1GM9 A;  3E83 A;  3H1L H;  3APO A;  5JJN B;  4X9Q A;  5BR8 O;  1D2D A;  1WP8 A;  1YHQ V;  1NI8 A;  4I0X B;  4UB8 Z;  4FLV A;  4L87 A;  1QQC A;  5J2U A;  3FKS G;  2HVJ C;  4HYO A;  3FB6 C;  3NXS A;  4OPA A;  1WA8 B;  2AZ2 A;  1S72 V;  1SRY A;  1R3I C;  1KP3 A;  4BAY A;  3ASO C;  2HVK C;  2WLL B;  1U97 A;  2X6C A;  1K5S A;  3HKC B;  2DQ3 A;  5E1A C;  3T1H B;  4YHH O;  2WLM A;  5FNV B;  5KUK A;  3H1K H;  2JJ1 G;  5IJ9 A;  1VEW A;  1IXB A;  4I5S A;  3ICX A;  5CBF A;  3T4D A;  5GTI Z;  2RMK B;  4J9Y B;  2PY5 A;  3CYO A;  3ABL B;  1KU9 A;  3K58 A;  3CJH B;  2R9I A;  3BA9 A;  5DED A;  3W7T A;  3OD4 A;  1RPO A;  3C3S A;  1H2M A;  4HNA A;  4CC6 A;  1R6T A;  2RCV A;  1BS3 A;  3THO A;  3K5O A;  3CRQ A;  3I5D A;  5CA0 A;  3JD4 A;  4KFM A;  3OMI B;  2BOC C;  2XAJ A;  4JI4 O;  5BY1 A;  3UT5 A;  3JAS A;  2FKX A;  3RGB A;  4X20 A;  4LFB O;  1XHX A;  3FFQ A;  4JV5 O;  2KSD A;  3QTC A;  1YTF D;  2Y48 A;  4FM0 A;  1NR1 A;  4DV2 O;  2WLK A;  2BE3 A;  2Q69 A;  4DV4 B;  1NZ6 A;  4TV8 A;  3D3I A;  1M4U A;  3HKD A;  5EIB D;  3IC7 A;  1JJO A;  2Y69 B;  1IBK O;  3DC6 A;  4LFA O;  4DV1 B;  1OZ0 A;  1X4T A;  5KHI A;  4MVM A;  4UFZ A;  5ITZ A;  2XAG A;  1Z5V A;  2JDI G;  3FAV B;  2ZE5 A;  5KLV H;  2IU0 A;  3ZCC A;  5IYB O;  5LP6 C;  1AI5 A;  1NU1 H;  1N0N A;  1XNR O;  2QKC A;  5GON A;  1J95 A;  2PI4 A;  3CRA A;  2VWK A;  4DV5 O;  4B3S O;  1HNZ O;  1BHA A;  3CC7 V;  1JCH A;  5LMN B;  2UUA B;  1ZWI C;  1K97 A;  3TCU A;  3SYO A;  2X6B A;  3Q4H A;  1N34 O;  2WLN A;  3OM3 B;  1RSO B;  1E1Q G;  5H6R A;  1HWY A;  3SJB C;  4PDM A;  3RYI B;  4WCE V;  1TVK A;  2OCC B;  2HHH B;  4OX9 B;  1AI4 A;  4PA4 A;  4U3J A;  1I94 B;  2JVD A;  3HB3 B;  1WB7 A;  4PA3 A;  4BIU A;  5EYP A;  4I7Z B;  3B8M A;  4EKW A;  3H1J H;  1B06 A;  3WG7 C;  1Z5W A;  4GKJ O;  3CXH F;  4X88 A;  1I7F A;  1V55 C;  2B1G A;  2WWW A;  1WNS A;  5KHJ A;  3K0D A;  4UCO A;  4WBN B;  5KA6 A;  5H9C A;  1VP7 A; 
#chains in the Genus database with same CATH homology
 3FD9 A;  2DE0 X;  1WA8 B;  2AZ2 A;  1WA8 A;  2B9Z A;  3FAV B;  4LWS B;  3Q4H B;  3FAV A;  4GZR B;  3Q4H A;  3GVM A;  4LWS A;  2VRZ A;  3HR0 A;  4I0X B;  4I0X A;  3O9O A;  2KG7 B;  4ABM A;  2KG7 A;  3GWK C;  3OGI B;  2VS0 A;  3ZBH A;  3G80 A;  3TXQ A;  3TXS A;  2AZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...