2B9ZA

Solution structure of fhv b2, a viral suppressor of rnai
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
GAMPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVGRMVTSLLEKPSVVAYLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the flock house virus B2 protein, a viral suppressor of RNA interference, shows a novel mode of double-stranded RNA recognition.
pubmed doi rcsb
source organism Flock house virus
molecule tags Viral protein
molecule keywords B2 protein
total genus 25
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2b9zA00
2B9ZA 4LWSA 4ABMA 3FAVB 3HR0A 3GWKC 4GZRB 4I0XB 2AZ0A 2DE0X 3ZBHA 1WA8A 3O9OA 2VS0A 2KG7A 3TXSA 3Q4HA 3Q4HB 4LWSB 3OGIB 3G80A 2AZ2A 2KG7B 2VRZA 4I0XA 1WA8B 3GVMA 3FD9A 3FAVA 3TXQA
chains in the Genus database with same CATH superfamily
3ETGA 1Q43A 1BL8A 5J2UA 3OUSA 3MD0A 4MVMA 1YIJV 2QWRB 4O2AB 3K79A 3RYCA 1WP8A 2DYSC 4LR3A 1AB3A 3THOA 4DR1B 2ZDIA 4JYBA 5IYCO 1P84F 4PHZA 1YJNV 3E8HA 4BR6A 3BEHA 5DEDA 4O4HB 4MVUA 4NVPA 3ABLB 3TJTA 3JSLA 5EYPA 2XASA 4AI8A 1SQBH 4QPJA 1N32O 4ZI7B 5LA6A 4O2BB 2PYJA 5IT9N 2AXTZ 2IJJA 3RW0A 5L3FA 2OYQA 1YVWA 1F4MA 2F4VB 3OFNG 3GWOA 4CS4A 2P06A 5FLXN 4O4LB 5LMUO 4R50A 1AR1B 1M57B 3RYHA 2RQ6A 3AEIA 2M6YA 3SYPA 3ZIAG 3N2GB 2EIJC 2QWQB 3RVYA 4BW5A 1K7DA 1NTMH 4DO2A 3CCUV 1OCCB 5IJ0A 4KP4A 2CK3G 5F2VO 4UXNA 5LGTA 1WPBA 1CPYA 4CC5A 2LW1A 4LFAO 3D36C 3LUTB 1TUEB 5B1AB 1B04A 2ZE5A 4WBNB 3JATB 2QWPB 1JJOA 1X59A 1ROPA 2B9ZA 4YY3O 5J2TA 4DR7O 4G27B 1ZLZA 4HBNA 3E86A 1Q6HA 5E79Z 4UFZA 1HNXO 4YHHB 4CS3A 3W7SA 4PA7A 4CC6A 5EC1C 1R3IC 2QKAA 5EBWC 4LF9O 4RAIA 3ABUA 3DSQA 3WB1A 1R6KA 4LFCO 5EIBD 5L3BA 4BAYA 3N2GA 4NYKA 5JVDB 4X64O 2UUAO 2QE7G 5H6QA 3ASOC 4OPAA 4TUYA 2PGGA 2WLNA 3WG7B 4PJ0Z 2UUCO 1HNWB 4AQYO 3I56V 2EILB 1S5LZ 1K5QA 1KB9F 2Y48A 3CCSV 2N05A 4K3AA 1J95A 4I50B 3U10A 4UCVA 2FTKA 1LUVA 4ZHQB 1NJIW 1VIBA 2HVJC 3JATA 4X66O 5CBHA 3ZBHA 1KYOF 3PJSK 5GONA 3AG7A 1XUQA 3LDCA 5BXZA 1MABG 3E8BA 3UT5B 4B3MB 3F5WC 5EBMC 1Y6XA 3SPJA 2C2AA 5JCOA 1NQTA 1JFFA 2A06H 1Y76A 4Q20A 2KSDA 1K4CC 1LNQA 2WLLB 2YIAA 4YJ2A 1KKCA 1WLEA 1L0NH 2UXDB 4N23A 4W4LA 2W6JG 1SA0A 2W6IG 1K8AW 3S3XA 2ZE6A 4LFBO 2CGOA 3FB5C 2Q8VA 4ZKIA 2ZCEA 2FMLA 4F6RA 5KHKA 4X20B 4MTGA 4J11A 3OEEG 1S76D 1PP9H 4JV5O 2YXHA 1AILA 4ZHQA 4UV9A 1DK1A 4FK5C 4LF7B 3SJCC 5GONB 4J80A 4AHCA 4DV4O 4BIUA 4DR6O 3E83A 3CB2A 3IC9A 4O2BA 3UT5A 1VQ8V 5JQGA 1ZSPA 3FAVB 5LP6B 4L8JA 5LP6C 1BQZA 4JAUA 1XI1A 1P7BA 2JRIA 1TVKB 2ZM6O 2KG7A 4YJ2B 1Y67A 5BR8B 2ZM6B 4FLZA 3FB8C 1J5EO 1BS3A 1H2KA 4I55A 2WLKA 4JTCB 4QIWF 1AROP 5GTIZ 3CRRA 4U7OA 4FZ0A 1JA8A 1JMKC 4JI4O 4MW8A 5H6RA 4LF4B 2YI9A 4MS2A 4UB8Z 1KD1W 3OEHG 2ZQMA 3P3PA 1SQFA 1ZTEA 4MTXA 5LL6Y 5B1BC 2E5LB 4TV8B 4NXNO 5JJEB 1K5SA 3JASA 4MVQA 2W0FC 4TV9B 2ZKOA 5IYDO 2XNDG 3B40A 1YJWV 4TT3G 5CN0A 1NT2B 3O9OA 4GKJB 3JAWA 3OMAB 1NU1H 3KCXA 3VQVA 1RP3B 2P67A 1TVKA 2UU9O 2KG7B 3CRCA 1GO3F 3H9VA 3OTOB 1SS3A 1V55B 2ETNA 2LW7A 5KX5B 3H1JH 5D5QA 3ZRSA 2WA3A 2Y0IA 2M7WA 3HR0A 4DR5O 2XUMA 1VQPV 4B3MO 4WF9V 3CX5F 4FFKA 4PDRA 1N33B 3RFRA 3ZHQA 1IBLO 3CRMA 1YTFB 1EZVH 3SPCA 4AILC 5BMVB 1B06A 1VQNV 2EJRA 4LBEC 2H94A 5B1NA 3MDSA 1AP5A 4CH5A 1Y74B 3DXRB 4MTOA 3T1YB 3AK3A 3BPZA 3S3WA 2OTJV 2Q0AA 1S5HC 3T1YO 2JJ2G 3OAAG 3J7AU 1R6TA 5GW7A 2EINC 1R3KC 5KHHA 2CGNA 1BGYH 4IIJA 5LYJB 2IBZH 5LXTB 4LF8O 1M4UA 1N33O 4FM1A 4DV1B 5IYBO 4DR4B 1AI4A 2Y4TA 1R1BA 1PNMA 1FXKA 5JJNB 4IHJB 5B1AC 4ABMA 2LO1A 1E79G 1PL4A 4R7CA 1OCZB 2JS3A 3ZX6A 3APQA 3R65A 4GKKB 1D2DA 3D8CA 3SGIA 5A9GA 3CP1A 3HKBA 1FXVA 1Q3EA 1VQ4V 3T1HO 1H2GA 2DJVA 4BWAA 4JI7O 1AI7A 4X20A 2EZPA 4BIOA 2EIMB 5LMNO 1QBZA 3DGEA 1WN7A 3CXHF 4JI4B 3R66A 4PA6A 4NXNB 3D3QA 4YJ3A 2YC0A 4EEQA 2E5LO 4OX9O 2IJHA 3SJBC 3BFRA 2JJ1G 1AVMA 1Q90D 2EIKC 1E1RG 2IH1C 2LJ2A 3ICXA 2CTRA 5JQGB 4JAAA 3JALA 4J9ZB 5BR8O 4IIJB 2WLIA 2EZOA 2H8PC 1TAEA 1RFYA 3QVNA 1FXKB 5BZBA 4WFHA 2JS5A 1SQQH 4UUJC 2DQ0A 1Y4MA 2KB1A 4TQFA 1SERA 1NZ6A 5J9PC 2N04A 2YSUB 4E2LA 1Q82W 1WA8A 2GHYA 3L70H 5FL7G 3ABLC 1MOFA 3A2FA 3CCJV 3W7UA 1N32B 1G6UA 2V1DA 4NXMO 1JOYA 1GKFA 1GRJA 3FYIB 1S5JA 3BHPA 2DYSB 1KKDA 4O4HA 4LNUB 1N36B 2L35A 4DV4B 3TCUA 3BA8A 3ML0A 3FB7C 1ORQC 3JARB 3M8AA 5B5EZ 4UCSA 4XDJA 4PV1B 2A79B 5LMNB 2JGUA 4ZI7A 3ZRVA 3T1HB 3CSXA 4J42A 1YTFD 2QTOA 4IYIA 1VQMV 3JALB 3JD2A 5CBFA 1QR8A 3ZCCA 4DV0B 1EBOA 3JCZA 1OCZC 2WLMA 1IURA 2XTAA 1KMIZ 2UXNA 2Y4UA 1SESA 1VP7A 5KA5A 2EIJB 2ILMA 2WPDG 1JR9A 3CWBH 2OIGA 4PA9A 2H3OA 1QVGU 2HJFC 1AP6A 3VQYA 2XAJA 5IJ0B 3ZRXA 2BTOA 3UO2A 1M93A 2QTSA 5BMVA 4GLXA 1FS0G 2Q7EA 1QR9A 4LNUA 3Q4HA 3E89A 2QWOB 3ZEDA 4JZGA 4JAVA 3JARA 2AHYA 4FFBB 1NVPD 1KP3A 2QDOA 5H9CA 2ODMA 5B3SB 1MSDA 1NKDA 1FPOA 4X64B 3SJQC 2QKCA 2VWJA 4JI6O 1FXKC 1KP2A 1YDXA 2IU3A 1OCRC 4JYCA 5DECA 1IBLB 2Z5UA 5JWPA 3TETA 1HNWO 3K04A 1WNSA 2A3QA 1PKXA 2NN4A 1QHTA 2DWEC 5LYJA 1RPRA 4X62O 5EZYB 3K9SA 1F23A 4J9YB 4J10A 2ATKC 1A32A 4G2KA 4DR7B 3L9DA 4H0LB 1G8MA 4IHJA 2DN9A 4PDMA 4TUYB 4X65O 5B66Z 1FJGO 3K0GA 2ZIMA 1OV9A 3AG1C 5EBLC 2Z3YA 4J7JA 3QF7A 1HDJA 3JD0A 3HKEA 3ZN0A 4PA4A 4B3RO 5KUKA 1K34A 2P4KA 1GMGA 5BY1A 4JI1B 1MA1A 1M56B 3I55V 5IJ9A 2DYRB 3BRCA 1VQ6V 4I7ZB 1XOUA 4J7KA 3M99B 4DR3B 1QCEA 2IH3C 2UXCO 1FYJA 1ZWIC 4YIOA 1KU9A 4WFBV 1NS1A 1SZXA 2LGWA 2YXYA 4DV5O 4FPPA 1Q86W 4HNAA 2Q9LA 1JFFB 1GTOA 2BCCH 2HR3A 4IL6Z 4JI3O 1RM1B 3OUFA 4NKGB 3RN4A 3AG3C 1WA8B 4DW0A 2HG5C 1FFXA 2QKSA 2OWOA 4KFMA 2F4VO 3ETDA 4B08A 4KUMA 3CD6V 2E74B 4IGGA 1CXZB 1OZ0A 3OM3B 1UPGA 1WPXA 3WG7C 4UVAA 4K0KB 1VF7A 4X9QA 1E1QG 5IJ9B 2RDCA 2O57A 3E35A 4X1YA 3N27A 4JV5B 5L3CA 3W7WA 3JD4A 2R70A 4JYAB 2R9AA 1F4NA 3JD1A 3UO3A 4DRXB 3T1CA 3K58A 2JGDB 2AZ0A 2Q67A 1YCIA 2ZNJA 3L71H 1UJWB 2P22C 2P7TC 4DR1O 1MNGA 1NBMG 2YIBA 1XMOB 1Y66A 3H01A 4UB6Z 4UCOA 5GTHZ 4MW3A 3VBBA 4B3SO 1PD3A 3P3NA 3RVZA 3O65A 4I55B 1FFXB 4GZRB 1I5XA 1N4CA 5H5NA 4O2AA 3ZHSA 3K9AA 4CH6A 1Q6IA 1LUWA 4JI0B 1BCCH 4JI2O 1W2BU 2ZIOA 1H2MA 4EKWA 1JJ2U 2OT5A 3QNEA 3F7VC 1BT8A 1GN6A 4EB6A 4JTAB 3HKCB 1H2NA 5LHHA 1R3JC 3OMNB 4KL1A 2PI5A 2VQEB 5EYPB 2CTQA 2X6CA 4TV8A 1VEWA 3NXSA 3DC5A 4ZOLA 3T4ZA 2UXBO 4TQDA 1JQ0A 2HLDG 5LA6B 2HKOA 1YEWA 3JSNA 5HFLA 1HR0B 3ZMTA 1VMGA 3WFVA 1SC5B 1KECA 1K9MW 4KXRA 3A8TA 5KX5A 1EM1A 3AK2A 3CCQV 3CCLV 3SPHA 3CCVV 2Q4PA 1DLBA 1NI8A 2XAHA 2QWNB 3RYHB 2PF4E 1GN4A 3G80A 1HP8A 2GDSA 2QR4A 3ASOB 4ASUG 3GVMA 5KMGA 1NR7A 3K59A 2NLJC 1AJPA 4UV8A 2IJIA 1M5IA 4D7SA 1LR1A 4WCEV 5CA0B 4F4LA 3OR6C 2AW9A 3OTFA 1I08A 1MZEA 2P6JA 1QLEC 3JYCA 2VQEO 2XAFA 2DYRC 4CBCA 3FYEB 3ZN1A 1YZBA 4MSWC 1P7GA 5CA1A 4FLTA 2MK3A 2ZR2A 3JCUZ 5L3GA 2P4VA 5IY5B 2Q7HA 3K03A 4H44B 1OCCC 4UCUA 4DV0O 4DR2O 5B1OA 4N21A 4P9PA 1XDCA 3CCMV 2K1EA 1QNMA 1PNLA 4B3SB 5JVDA 3K5NA 1I0HA 4O4JB 2RN9A 2YDEA 4W4KA 2X0LA 3F5TA 3CC7V 1XMOO 1V9PA 4X1IA 5EK0A 3G4SV 5KLVH 1VF6A 2DOSA 1Q81W 4K0KO 4RQEA 1BHAA 1XL6A 1IVSA 1YJ9V 4I0XA 1L0LH 3LSQA 2JK5C 3UQ8A 2EILC 4JYAO 2OIEA 1OHHG 5IE9A 2EX3A 2JVDA 2HJDA 4TOIA 4BW9A 4NXMB 3ETQA 1THZA 4R8CA 3ZHUA 2Q6AA 4JZ2A 4ZBMA 4HYOA 5EIBC 4IYHA 2HP8A 4U3JA 1Y76B 1EN6A 2XAGA 1H38A 3IJ4A 4JF3A 4DV7B 1I5YA 4O4JA 2YIDA 1HWYA 2R9RB 3CYOA 4DR3O 1BMFG 3ZHVA 3APOA 3CCRV 4TWKA 2EIMC 1AJNA 3D3IA 1XILA 5FPRA 1SZTA 2GV9A 5H2FZ 3ABKB 4DV5B 4TSFG 1T5EA 1IX9A 1RPOA 2NR5A 4F6RB 3J81N 4JI5O 2OCCB 4J41A 1YSCA 2BTQA 1IBMO 3JD3A 2DQ3A 2F23A 1BE3H 4YIPA 4DXWA 5CB4A 1FJGB 4K8XA 4Z2WA 3FD9A 2IU0A 4GKKO 4GCZA 3K06A 2GSMB 3ZRWA 1DF4A 3HB3B 1SQPH 1V54C 4EFBA 2EINB 2LQTA 3OW2U 3W7TA 5TISZ 1YI2V 2EULA 1YHQV 3MHSC 2GUZB 3STZC 4D6TH 2PI4A 4FLWA 2YICA 3B09A 3T2MA 1L1FA 4FLXA 2KKWA 5KMGB 3FKSG 1MSWD 1HR0O 1P49A 4JASA 3RYIB 3CPWU 1KUQA 4GYCB 5ITZA 2IM9A 1XQ8A 2YUAA 4CH3A 1XNQB 4MVZA 2BTQB 1R3LC 1W0KG 3IGAC 3SYQA 3ABTA 1MG1A 4G28B 4FZ1A 4U3FH 4FFBA 4K35A 4I9QA 2GTAA 1Z2GA 1CP9A 5KHJA 1IDSA 3T4DA 3JAWB 5CA1B 4DR5B 2AHZA 2ZDIC 4MVOA 1COWG 2V7QG 5JH7A 3CXCU 2B5UA 3K08A 2GUZA 4DK1A 4JI8B 3EXAA 2EJ7A 2UU9B 3E2EA 3CRQA 1US6A 1UFIA 4XDLA 3FB6C 4DYLA 5L3EA 1GM7A 1QLNA 1S77D 3AG4B 2ITCC 4X1KA 1EZJA 4DV6B 3SJAC 2VRZA 3CC4V 1DTOA 4DV3B 2ZE8A 2BSKB 4ICGA 3ZHRA 2Q73A 5ITZB 5IWAO 1I94O 1N36O 4CS2A 5CA3A 4I0XB 2Q7GA 2Q68A 4CZZA 3CE2A 1OCOB 3DXRA 3CC2V 1QVFU 1F7YA 5AG2A 4WFGA 1D5AA 1PPJH 4LP8A 1IBKB 4UCTA 4WBNA 3LSUA 3H1IH 1NVPB 3NR7A 2WLJA 4FLVA 1RSOB 2Q69A 2YXLA 1SRYA 2F66C 2L6LA 1EFRG 2BOBC 2BE3A 4HNAB 3QG5A 4QNHB 2FKXA 3B2EE 2R9IA 3CRAA 2ZNIA 2WA4A 1Q6UA 1FXHA 3CJHA 4X1KB 1AR5A 1N0NA 1RM1C 4KHPO 2OCHA 4FM2A 2BSKA 3AG3B 3ASNB 3CHXA 1YXBA 1KQSU 3HKBB 3JAKB 1QU7A 3KZIZ 1V55C 3L75H 4FVMA 4FLUA 1K92A 2LFRA 3RGBA 4JI7B 1VF6C 4QPKA 2Y69B 1ENVA 5DN6G 5IWAB 4X8AA 1R73A 2WSSG 3W7XA 4X1YB 4B3RB 3CCEV 3AG4C 4NTYA 2ZR3A 4DV6O 4DRXA 4XDKA 3L73H 4B7KA 4GUNA 4DR4O 3FFQA 2AZ2A 1N0JA 2Y0PA 1F51A 4LF8B 4H33A 3ASNC 2X7RB 1ZUQA 1PM9A 3SPGA 2XAQA 4F6EA 3WB0A 3GB7C 4HAMA 2QGNA 3JAKA 4UVBA 1NTKH 1GAXA 3SYOA 1XBLA 1HNZB 2QSAA 2QJ1A 1O9GA 2KQXA 2Q0OC 3RYIA 3X2QB 1ZL8B 2DWDC 2F1MA 4RUEA 1XHXA 2P90A 5L3DA 1HNZO 3U0ZA 3WB2A 4ZOLB 3QO8A 1M1KW 5K1XA 1QQCA 1WB8A 5CMUA 2GTSA 4FM0A 1FD9A 3L74H 1WJZA 4LFCB 4MVSA 1VQ7V 4LF5B 5LHIA 1NTZH 1P4RA 4RWUA 5JH7B 1Z5VA 2VS0A 2PTMA 3OGCC 3UM7A 1BZKA 1CEZA 3P30A 3LDEA 4DW1A 4GKJO 1VQ9V 3H1LH 4Z1VA 3ZJZA 3ZMSA 3RT3C 1TGOA 2NNUA 5DM6V 4NTXA 2IW5A 3OTOO 3A0BZ 3J80N 3K5MA 1VQLV 2YS8A 2EBOA 2CDYA 5KAIZ 1EN5A 3OMIB 3Q4HB 4MT8A 3VOUA 3E22B 3OGIB 2DW4A 5CA0A 3B8NA 3OE7G 3C3SA 5HFMA 1QLEB 1M57C 2GBOA 3PN1A 4DUZB 2UUBB 3U11A 1DGSA 5KHIA 2RJZA 4FLYA 3TK1A 5K1PA 4H37A 1WP7A 4MVRA 1B6QA 1ZX3A 2QM8A 1RSOA 4NTWA 1O9HA 4R6ZA 3C3TA 2YI8A 2YEVB 4BIZA 1DF5A 4KHPB 4GX2A 1OCRB 4QGPA 4RQFA 1VQOV 1Q5OA 4WFAV 5LOVB 3SDLA 3RYFA 1J5EB 1OJHA 1K3EA 5B3SC 4PD4F 5C93A 4D7TA 3B8MA 2RNBA 1IBKO 3TGUH 4LC1A 3A0HZ 4X1IB 3X2QC 1D5NA 3H1KH 3ZS8C 3CS5A 1SQXH 2JEUA 3E22A 4OX9B 3HKEB 3K57A 4GX0A 3CEIA 1I94B 4DUZO 2UUBO 4LF7O 4JTDB 5IYZB 3BY6A 2EIKB 3G6EV 1ZAUA 3MAQA 3STLC 1H2SB 1SKVA 1U96A 2QA4V 2V4DA 1BQ0A 4DV3O 2YEVA 3GWKC 1FFTB 5LXTA 4NB5A 1S3JA 1YITV 3K5OA 5LOVA 2HVKC 3CMEV 3RYFB 5LGUA 1S72V 1H2LA 4P9OA 5LGNA 1JX9A 3WU2Z 4GX5A 3BA9A 3BVOA 3UCSC 2PY5A 4DV1O 1AI5A 4XBFA 2UXDO 3G67A 4JI8O 3M7MX 4YXWG 2DMXA 2VWKA 4LF5O 3D36A 5B1BB 4A5UB 2ADQB 1EN4A 4MTFA 3OR7C 3L72H 4EFEA 1U97A 2ZE7A 3N2KA 2JDIG 4OPHA 1GM9A 1M9NA 3IFXA 1ZL8A 4Z1MG 1GM8A 5JJJB 3C90A 2WWWA 4X66B 4CH4A 1SQVH 3I5DA 2ADPA 4B3TO 1GN2A 5A2QN 5CB4B 3OT7A 4YJ3B 5FPOA 4DUYB 1R6NA 1XL4A 2JGDA 1K33A 1XREA 2JIZG 1AI6A 1K4DC 2E75B 4FMTA 1MMMA 2XOKG 4I5SA 3EFFK 2MW2B 4PI0A 4AQYB 1NR1A 2CTWA 4P30A 5LBQA 2HEPA 4LF9B 2D2CB 3HKDB 4UCRA 3ABMC 4O4IB 2WLLA 1MZFA 4I4TB 1H8EG 2UUAB 2PZSA 3IC7A 3QO5A 4H13B 1B3QA 4PI2A 1SA0B 2QM4A 4RUFA 1AJQA 4E4EA 2E3CA 3E8FA 2W0XA 1WAZA 4JPRA 4J7ZA 4LH6A 1URFA 4LWSB 5CBGA 1VQKV 3ZHTA 2RCVA 1AR4A 1IXMA 4EB6B 3HKCA 2VQFB 2B1IA 1JPXA 2CE4A 3UKMA 5KHGA 2N74A 1G4YB 3SR2C 2LP7A 3AG2B 5E1AC 3ETEA 1GN3A 4DK0A 3EHBB 3FX7A 4U7NA 4JI0O 1IBMB 3B4SA 2QM7A 1SETA 4B7EA 3AG2C 1K97A 4JYYA 3BAAA 4LF4O 4DV7O 2A0LA 3FAVA 3TXQA 5LP6A 4Q6GA 2F95B 1GK9A 1G1XB 5FNVB 5C8YA 2OTLV 4OGQB 2LGQA 3G6BA 3E8GA 2CAZC 2ZINA 4I4TA 2E76B 1SQGA 1XNRO 4PELA 3RBZA 4X88A 3TXSA 2LFSA 4PDLA 4RO2A 2JEXA 4FJCC 1YF2A 2IJKA 5LMUB 2Z0AA 3K5LA 1K73W 4LWSA 3LSSA 4LCUC 3B77A 3K3WA 2DE0X 5KUMA 1IZ3A 2HHHO 2WLHA 2X6BA 4DR6B 4I9WA 3KG2A 1KC8W 1N8RW 2WAMA 3LNMB 2Q5ZA 3JASB 3DC6A 4NR1A 2HHHB 1I7FA 4TV9A 1W59A 2B1GA 2ZD9A 4JGSA 5IYZA 4X89A 2BOCC 2CH7A 2ZXWC 1KBHA 2F93B 3LNNA 1V54B 1L8DA 1OCOC 4P2ZA 4LH7A 4FIPC 4LFBB 1XNRB 3F7YC 4HZ3A 2RMKB 1Q7YW 4JI3B 2P5OA 1SF9A 3VQXA 5EZYA 3ZMZA 1VARA 5KA6A 1Z5WA 1W0JG 5D5PA 5EC2C 2A7WA 3CJHB 1BHBA 1PL0A 1BSMA 2UXCB 1N34B 4DR2B 5IDJA 1M56C 4ZIBA 1IXBA 2Y69C 5KAFZ 3LDDA 2CUGA 2A9HA 1JVMA 2FB5A 3AG1B 2X6AA 3N2KB 4JI1O 3ABKC 3G71V 3H1HH 3HPLC 4PA3A 3SYAA 3ZMUA 1PNKA 1Y74A 2ITDC 2VQFO 4L87A 4K8ZA 3BCCH 1XEQA 4WFEA 2CH7B 2AGAA 2K9PA 2ZXWB 2XT9A 4DV2O 2ARHA 1M90W 1NH2D 2PYLA 1X4TA 5J2TB 4X65B 3ABMB 2ZT9B 1XNQO 2CTPA 1GH6A 1NH2B 1FAFA 1VF5B 2G38A 3K0DA 3QO7A 3OD4A 4UVCA 4LF6B 2QEXV 1TUBA 2UUCB 3KCYA 1VQ5V 4QJFB 4U3JB 1XMQB 4X62B 3MHHC 1FKAO 2UXXA 2R72A 3IAYA 3HKDA 4O4IA 3JAMN 4LF6O 3A0RA 4JI6B 3AK1A 3QTCA 5J2UB 3VQWA 3CMAV 1XMQO 4DUYO 3RYCB 3ZMVA 4YHHO 4QE7A 2FYUH 1HNXB 2F43G 2HFEC 2PUSA 3DTUB 4B3TB 1WB7A 4YY3B 1TA8A 2YIBD 3EVKA 4PDVA 4QE9A 5JCOC 4GT1A 2UXBB 1JCHA 4I50A 3RWRD 4DV2B 4JI2B 1Q8IA 1H8HG 4WFFA 1XHZA 4LFAB 5LHGA 4JI5B 4C7UA 3ZRWB 1HW7A 1TUBB 2FL4A 3P32A 2D3OW 5IY5C 1PV0A 2WLIB 5FNVA 5C8YB 4GX1A 2OCCC 3KKYA 1N34O 2XHBA 4OXSA 3SPIA 3SYCA 1S0VA 4IT5A 4O4LA 3BABA
chains in the Genus database with same CATH topology
2B9ZA 4LWSA 4ABMA 3FAVB 3HR0A 3GWKC 4GZRB 4I0XB 2AZ0A 2DE0X 3ZBHA 1WA8A 3O9OA 2VS0A 2KG7A 3TXSA 3Q4HA 3Q4HB 4LWSB 3OGIB 3G80A 2AZ2A 2KG7B 2VRZA 4I0XA 1WA8B 3GVMA 3FD9A 3FAVA 3TXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B9Z A;  4LWS A;  4ABM A;  3FAV B;  3HR0 A;  3GWK C;  4GZR B;  4I0X B;  2AZ0 A;  2DE0 X;  3ZBH A;  1WA8 A;  3O9O A;  2VS0 A;  2KG7 A;  3TXS A;  3Q4H A;  3Q4H B;  4LWS B;  3OGI B;  3G80 A;  2AZ2 A;  2KG7 B;  2VRZ A;  4I0X A;  1WA8 B;  3GVM A;  3FD9 A;  3FAV A;  3TXQ A; 
#chains in the Genus database with same CATH topology
 3ETG A;  1Q43 A;  1BL8 A;  5J2U A;  3OUS A;  3MD0 A;  4MVM A;  1YIJ V;  2QWR B;  4O2A B;  3K79 A;  3RYC A;  1WP8 A;  2DYS C;  4LR3 A;  1AB3 A;  3THO A;  4DR1 B;  2ZDI A;  4JYB A;  5IYC O;  1P84 F;  4PHZ A;  1YJN V;  3E8H A;  4BR6 A;  3BEH A;  5DED A;  4O4H B;  4MVU A;  4NVP A;  3ABL B;  3TJT A;  3JSL A;  5EYP A;  2XAS A;  4AI8 A;  1SQB H;  4QPJ A;  1N32 O;  4ZI7 B;  5LA6 A;  4O2B B;  2PYJ A;  5IT9 N;  2AXT Z;  2IJJ A;  3RW0 A;  5L3F A;  2OYQ A;  1YVW A;  1F4M A;  2F4V B;  3OFN G;  3GWO A;  4CS4 A;  2P06 A;  5FLX N;  4O4L B;  5LMU O;  4R50 A;  1AR1 B;  1M57 B;  3RYH A;  2RQ6 A;  3AEI A;  2M6Y A;  3SYP A;  3ZIA G;  3N2G B;  2EIJ C;  2QWQ B;  3RVY A;  4BW5 A;  1K7D A;  1NTM H;  4DO2 A;  3CCU V;  1OCC B;  5IJ0 A;  4KP4 A;  2CK3 G;  5F2V O;  4UXN A;  5LGT A;  1WPB A;  1CPY A;  4CC5 A;  2LW1 A;  4LFA O;  3D36 C;  3LUT B;  1TUE B;  5B1A B;  1B04 A;  2ZE5 A;  4WBN B;  3JAT B;  2QWP B;  1JJO A;  1X59 A;  1ROP A;  2B9Z A;  4YY3 O;  5J2T A;  4DR7 O;  4G27 B;  1ZLZ A;  4HBN A;  3E86 A;  1Q6H A;  5E79 Z;  4UFZ A;  1HNX O;  4YHH B;  4CS3 A;  3W7S A;  4PA7 A;  4CC6 A;  5EC1 C;  1R3I C;  2QKA A;  5EBW C;  4LF9 O;  4RAI A;  3ABU A;  3DSQ A;  3WB1 A;  1R6K A;  4LFC O;  5EIB D;  5L3B A;  4BAY A;  3N2G A;  4NYK A;  5JVD B;  4X64 O;  2UUA O;  2QE7 G;  5H6Q A;  3ASO C;  4OPA A;  4TUY A;  2PGG A;  2WLN A;  3WG7 B;  4PJ0 Z;  2UUC O;  1HNW B;  4AQY O;  3I56 V;  2EIL B;  1S5L Z;  1K5Q A;  1KB9 F;  2Y48 A;  3CCS V;  2N05 A;  4K3A A;  1J95 A;  4I50 B;  3U10 A;  4UCV A;  2FTK A;  1LUV A;  4ZHQ B;  1NJI W;  1VIB A;  2HVJ C;  3JAT A;  4X66 O;  5CBH A;  3ZBH A;  1KYO F;  3PJS K;  5GON A;  3AG7 A;  1XUQ A;  3LDC A;  5BXZ A;  1MAB G;  3E8B A;  3UT5 B;  4B3M B;  3F5W C;  5EBM C;  1Y6X A;  3SPJ A;  2C2A A;  5JCO A;  1NQT A;  1JFF A;  2A06 H;  1Y76 A;  4Q20 A;  2KSD A;  1K4C C;  1LNQ A;  2WLL B;  2YIA A;  4YJ2 A;  1KKC A;  1WLE A;  1L0N H;  2UXD B;  4N23 A;  4W4L A;  2W6J G;  1SA0 A;  2W6I G;  1K8A W;  3S3X A;  2ZE6 A;  4LFB O;  2CGO A;  3FB5 C;  2Q8V A;  4ZKI A;  2ZCE A;  2FML A;  4F6R A;  5KHK A;  4X20 B;  4MTG A;  4J11 A;  3OEE G;  1S76 D;  1PP9 H;  4JV5 O;  2YXH A;  1AIL A;  4ZHQ A;  4UV9 A;  1DK1 A;  4FK5 C;  4LF7 B;  3SJC C;  5GON B;  4J80 A;  4AHC A;  4DV4 O;  4BIU A;  4DR6 O;  3E83 A;  3CB2 A;  3IC9 A;  4O2B A;  3UT5 A;  1VQ8 V;  5JQG A;  1ZSP A;  3FAV B;  5LP6 B;  4L8J A;  5LP6 C;  1BQZ A;  4JAU A;  1XI1 A;  1P7B A;  2JRI A;  1TVK B;  2ZM6 O;  2KG7 A;  4YJ2 B;  1Y67 A;  5BR8 B;  2ZM6 B;  4FLZ A;  3FB8 C;  1J5E O;  1BS3 A;  1H2K A;  4I55 A;  2WLK A;  4JTC B;  4QIW F;  1ARO P;  5GTI Z;  3CRR A;  4U7O A;  4FZ0 A;  1JA8 A;  1JMK C;  4JI4 O;  4MW8 A;  5H6R A;  4LF4 B;  2YI9 A;  4MS2 A;  4UB8 Z;  1KD1 W;  3OEH G;  2ZQM A;  3P3P A;  1SQF A;  1ZTE A;  4MTX A;  5LL6 Y;  5B1B C;  2E5L B;  4TV8 B;  4NXN O;  5JJE B;  1K5S A;  3JAS A;  4MVQ A;  2W0F C;  4TV9 B;  2ZKO A;  5IYD O;  2XND G;  3B40 A;  1YJW V;  4TT3 G;  5CN0 A;  1NT2 B;  3O9O A;  4GKJ B;  3JAW A;  3OMA B;  1NU1 H;  3KCX A;  3VQV A;  1RP3 B;  2P67 A;  1TVK A;  2UU9 O;  2KG7 B;  3CRC A;  1GO3 F;  3H9V A;  3OTO B;  1SS3 A;  1V55 B;  2ETN A;  2LW7 A;  5KX5 B;  3H1J H;  5D5Q A;  3ZRS A;  2WA3 A;  2Y0I A;  2M7W A;  3HR0 A;  4DR5 O;  2XUM A;  1VQP V;  4B3M O;  4WF9 V;  3CX5 F;  4FFK A;  4PDR A;  1N33 B;  3RFR A;  3ZHQ A;  1IBL O;  3CRM A;  1YTF B;  1EZV H;  3SPC A;  4AIL C;  5BMV B;  1B06 A;  1VQN V;  2EJR A;  4LBE C;  2H94 A;  5B1N A;  3MDS A;  1AP5 A;  4CH5 A;  1Y74 B;  3DXR B;  4MTO A;  3T1Y B;  3AK3 A;  3BPZ A;  3S3W A;  2OTJ V;  2Q0A A;  1S5H C;  3T1Y O;  2JJ2 G;  3OAA G;  3J7A U;  1R6T A;  5GW7 A;  2EIN C;  1R3K C;  5KHH A;  2CGN A;  1BGY H;  4IIJ A;  5LYJ B;  2IBZ H;  5LXT B;  4LF8 O;  1M4U A;  1N33 O;  4FM1 A;  4DV1 B;  5IYB O;  4DR4 B;  1AI4 A;  2Y4T A;  1R1B A;  1PNM A;  1FXK A;  5JJN B;  4IHJ B;  5B1A C;  4ABM A;  2LO1 A;  1E79 G;  1PL4 A;  4R7C A;  1OCZ B;  2JS3 A;  3ZX6 A;  3APQ A;  3R65 A;  4GKK B;  1D2D A;  3D8C A;  3SGI A;  5A9G A;  3CP1 A;  3HKB A;  1FXV A;  1Q3E A;  1VQ4 V;  3T1H O;  1H2G A;  2DJV A;  4BWA A;  4JI7 O;  1AI7 A;  4X20 A;  2EZP A;  4BIO A;  2EIM B;  5LMN O;  1QBZ A;  3DGE A;  1WN7 A;  3CXH F;  4JI4 B;  3R66 A;  4PA6 A;  4NXN B;  3D3Q A;  4YJ3 A;  2YC0 A;  4EEQ A;  2E5L O;  4OX9 O;  2IJH A;  3SJB C;  3BFR A;  2JJ1 G;  1AVM A;  1Q90 D;  2EIK C;  1E1R G;  2IH1 C;  2LJ2 A;  3ICX A;  2CTR A;  5JQG B;  4JAA A;  3JAL A;  4J9Z B;  5BR8 O;  4IIJ B;  2WLI A;  2EZO A;  2H8P C;  1TAE A;  1RFY A;  3QVN A;  1FXK B;  5BZB A;  4WFH A;  2JS5 A;  1SQQ H;  4UUJ C;  2DQ0 A;  1Y4M A;  2KB1 A;  4TQF A;  1SER A;  1NZ6 A;  5J9P C;  2N04 A;  2YSU B;  4E2L A;  1Q82 W;  1WA8 A;  2GHY A;  3L70 H;  5FL7 G;  3ABL C;  1MOF A;  3A2F A;  3CCJ V;  3W7U A;  1N32 B;  1G6U A;  2V1D A;  4NXM O;  1JOY A;  1GKF A;  1GRJ A;  3FYI B;  1S5J A;  3BHP A;  2DYS B;  1KKD A;  4O4H A;  4LNU B;  1N36 B;  2L35 A;  4DV4 B;  3TCU A;  3BA8 A;  3ML0 A;  3FB7 C;  1ORQ C;  3JAR B;  3M8A A;  5B5E Z;  4UCS A;  4XDJ A;  4PV1 B;  2A79 B;  5LMN B;  2JGU A;  4ZI7 A;  3ZRV A;  3T1H B;  3CSX A;  4J42 A;  1YTF D;  2QTO A;  4IYI A;  1VQM V;  3JAL B;  3JD2 A;  5CBF A;  1QR8 A;  3ZCC A;  4DV0 B;  1EBO A;  3JCZ A;  1OCZ C;  2WLM A;  1IUR A;  2XTA A;  1KMI Z;  2UXN A;  2Y4U A;  1SES A;  1VP7 A;  5KA5 A;  2EIJ B;  2ILM A;  2WPD G;  1JR9 A;  3CWB H;  2OIG A;  4PA9 A;  2H3O A;  1QVG U;  2HJF C;  1AP6 A;  3VQY A;  2XAJ A;  5IJ0 B;  3ZRX A;  2BTO A;  3UO2 A;  1M93 A;  2QTS A;  5BMV A;  4GLX A;  1FS0 G;  2Q7E A;  1QR9 A;  4LNU A;  3Q4H A;  3E89 A;  2QWO B;  3ZED A;  4JZG A;  4JAV A;  3JAR A;  2AHY A;  4FFB B;  1NVP D;  1KP3 A;  2QDO A;  5H9C A;  2ODM A;  5B3S B;  1MSD A;  1NKD A;  1FPO A;  4X64 B;  3SJQ C;  2QKC A;  2VWJ A;  4JI6 O;  1FXK C;  1KP2 A;  1YDX A;  2IU3 A;  1OCR C;  4JYC A;  5DEC A;  1IBL B;  2Z5U A;  5JWP A;  3TET A;  1HNW O;  3K04 A;  1WNS A;  2A3Q A;  1PKX A;  2NN4 A;  1QHT A;  2DWE C;  5LYJ A;  1RPR A;  4X62 O;  5EZY B;  3K9S A;  1F23 A;  4J9Y B;  4J10 A;  2ATK C;  1A32 A;  4G2K A;  4DR7 B;  3L9D A;  4H0L B;  1G8M A;  4IHJ A;  2DN9 A;  4PDM A;  4TUY B;  4X65 O;  5B66 Z;  1FJG O;  3K0G A;  2ZIM A;  1OV9 A;  3AG1 C;  5EBL C;  2Z3Y A;  4J7J A;  3QF7 A;  1HDJ A;  3JD0 A;  3HKE A;  3ZN0 A;  4PA4 A;  4B3R O;  5KUK A;  1K34 A;  2P4K A;  1GMG A;  5BY1 A;  4JI1 B;  1MA1 A;  1M56 B;  3I55 V;  5IJ9 A;  2DYR B;  3BRC A;  1VQ6 V;  4I7Z B;  1XOU A;  4J7K A;  3M99 B;  4DR3 B;  1QCE A;  2IH3 C;  2UXC O;  1FYJ A;  1ZWI C;  4YIO A;  1KU9 A;  4WFB V;  1NS1 A;  1SZX A;  2LGW A;  2YXY A;  4DV5 O;  4FPP A;  1Q86 W;  4HNA A;  2Q9L A;  1JFF B;  1GTO A;  2BCC H;  2HR3 A;  4IL6 Z;  4JI3 O;  1RM1 B;  3OUF A;  4NKG B;  3RN4 A;  3AG3 C;  1WA8 B;  4DW0 A;  2HG5 C;  1FFX A;  2QKS A;  2OWO A;  4KFM A;  2F4V O;  3ETD A;  4B08 A;  4KUM A;  3CD6 V;  2E74 B;  4IGG A;  1CXZ B;  1OZ0 A;  3OM3 B;  1UPG A;  1WPX A;  3WG7 C;  4UVA A;  4K0K B;  1VF7 A;  4X9Q A;  1E1Q G;  5IJ9 B;  2RDC A;  2O57 A;  3E35 A;  4X1Y A;  3N27 A;  4JV5 B;  5L3C A;  3W7W A;  3JD4 A;  2R70 A;  4JYA B;  2R9A A;  1F4N A;  3JD1 A;  3UO3 A;  4DRX B;  3T1C A;  3K58 A;  2JGD B;  2AZ0 A;  2Q67 A;  1YCI A;  2ZNJ A;  3L71 H;  1UJW B;  2P22 C;  2P7T C;  4DR1 O;  1MNG A;  1NBM G;  2YIB A;  1XMO B;  1Y66 A;  3H01 A;  4UB6 Z;  4UCO A;  5GTH Z;  4MW3 A;  3VBB A;  4B3S O;  1PD3 A;  3P3N A;  3RVZ A;  3O65 A;  4I55 B;  1FFX B;  4GZR B;  1I5X A;  1N4C A;  5H5N A;  4O2A A;  3ZHS A;  3K9A A;  4CH6 A;  1Q6I A;  1LUW A;  4JI0 B;  1BCC H;  4JI2 O;  1W2B U;  2ZIO A;  1H2M A;  4EKW A;  1JJ2 U;  2OT5 A;  3QNE A;  3F7V C;  1BT8 A;  1GN6 A;  4EB6 A;  4JTA B;  3HKC B;  1H2N A;  5LHH A;  1R3J C;  3OMN B;  4KL1 A;  2PI5 A;  2VQE B;  5EYP B;  2CTQ A;  2X6C A;  4TV8 A;  1VEW A;  3NXS A;  3DC5 A;  4ZOL A;  3T4Z A;  2UXB O;  4TQD A;  1JQ0 A;  2HLD G;  5LA6 B;  2HKO A;  1YEW A;  3JSN A;  5HFL A;  1HR0 B;  3ZMT A;  1VMG A;  3WFV A;  1SC5 B;  1KEC A;  1K9M W;  4KXR A;  3A8T A;  5KX5 A;  1EM1 A;  3AK2 A;  3CCQ V;  3CCL V;  3SPH A;  3CCV V;  2Q4P A;  1DLB A;  1NI8 A;  2XAH A;  2QWN B;  3RYH B;  2PF4 E;  1GN4 A;  3G80 A;  1HP8 A;  2GDS A;  2QR4 A;  3ASO B;  4ASU G;  3GVM A;  5KMG A;  1NR7 A;  3K59 A;  2NLJ C;  1AJP A;  4UV8 A;  2IJI A;  1M5I A;  4D7S A;  1LR1 A;  4WCE V;  5CA0 B;  4F4L A;  3OR6 C;  2AW9 A;  3OTF A;  1I08 A;  1MZE A;  2P6J A;  1QLE C;  3JYC A;  2VQE O;  2XAF A;  2DYR C;  4CBC A;  3FYE B;  3ZN1 A;  1YZB A;  4MSW C;  1P7G A;  5CA1 A;  4FLT A;  2MK3 A;  2ZR2 A;  3JCU Z;  5L3G A;  2P4V A;  5IY5 B;  2Q7H A;  3K03 A;  4H44 B;  1OCC C;  4UCU A;  4DV0 O;  4DR2 O;  5B1O A;  4N21 A;  4P9P A;  1XDC A;  3CCM V;  2K1E A;  1QNM A;  1PNL A;  4B3S B;  5JVD A;  3K5N A;  1I0H A;  4O4J B;  2RN9 A;  2YDE A;  4W4K A;  2X0L A;  3F5T A;  3CC7 V;  1XMO O;  1V9P A;  4X1I A;  5EK0 A;  3G4S V;  5KLV H;  1VF6 A;  2DOS A;  1Q81 W;  4K0K O;  4RQE A;  1BHA A;  1XL6 A;  1IVS A;  1YJ9 V;  4I0X A;  1L0L H;  3LSQ A;  2JK5 C;  3UQ8 A;  2EIL C;  4JYA O;  2OIE A;  1OHH G;  5IE9 A;  2EX3 A;  2JVD A;  2HJD A;  4TOI A;  4BW9 A;  4NXM B;  3ETQ A;  1THZ A;  4R8C A;  3ZHU A;  2Q6A A;  4JZ2 A;  4ZBM A;  4HYO A;  5EIB C;  4IYH A;  2HP8 A;  4U3J A;  1Y76 B;  1EN6 A;  2XAG A;  1H38 A;  3IJ4 A;  4JF3 A;  4DV7 B;  1I5Y A;  4O4J A;  2YID A;  1HWY A;  2R9R B;  3CYO A;  4DR3 O;  1BMF G;  3ZHV A;  3APO A;  3CCR V;  4TWK A;  2EIM C;  1AJN A;  3D3I A;  1XIL A;  5FPR A;  1SZT A;  2GV9 A;  5H2F Z;  3ABK B;  4DV5 B;  4TSF G;  1T5E A;  1IX9 A;  1RPO A;  2NR5 A;  4F6R B;  3J81 N;  4JI5 O;  2OCC B;  4J41 A;  1YSC A;  2BTQ A;  1IBM O;  3JD3 A;  2DQ3 A;  2F23 A;  1BE3 H;  4YIP A;  4DXW A;  5CB4 A;  1FJG B;  4K8X A;  4Z2W A;  3FD9 A;  2IU0 A;  4GKK O;  4GCZ A;  3K06 A;  2GSM B;  3ZRW A;  1DF4 A;  3HB3 B;  1SQP H;  1V54 C;  4EFB A;  2EIN B;  2LQT A;  3OW2 U;  3W7T A;  5TIS Z;  1YI2 V;  2EUL A;  1YHQ V;  3MHS C;  2GUZ B;  3STZ C;  4D6T H;  2PI4 A;  4FLW A;  2YIC A;  3B09 A;  3T2M A;  1L1F A;  4FLX A;  2KKW A;  5KMG B;  3FKS G;  1MSW D;  1HR0 O;  1P49 A;  4JAS A;  3RYI B;  3CPW U;  1KUQ A;  4GYC B;  5ITZ A;  2IM9 A;  1XQ8 A;  2YUA A;  4CH3 A;  1XNQ B;  4MVZ A;  2BTQ B;  1R3L C;  1W0K G;  3IGA C;  3SYQ A;  3ABT A;  1MG1 A;  4G28 B;  4FZ1 A;  4U3F H;  4FFB A;  4K35 A;  4I9Q A;  2GTA A;  1Z2G A;  1CP9 A;  5KHJ A;  1IDS A;  3T4D A;  3JAW B;  5CA1 B;  4DR5 B;  2AHZ A;  2ZDI C;  4MVO A;  1COW G;  2V7Q G;  5JH7 A;  3CXC U;  2B5U A;  3K08 A;  2GUZ A;  4DK1 A;  4JI8 B;  3EXA A;  2EJ7 A;  2UU9 B;  3E2E A;  3CRQ A;  1US6 A;  1UFI A;  4XDL A;  3FB6 C;  4DYL A;  5L3E A;  1GM7 A;  1QLN A;  1S77 D;  3AG4 B;  2ITC C;  4X1K A;  1EZJ A;  4DV6 B;  3SJA C;  2VRZ A;  3CC4 V;  1DTO A;  4DV3 B;  2ZE8 A;  2BSK B;  4ICG A;  3ZHR A;  2Q73 A;  5ITZ B;  5IWA O;  1I94 O;  1N36 O;  4CS2 A;  5CA3 A;  4I0X B;  2Q7G A;  2Q68 A;  4CZZ A;  3CE2 A;  1OCO B;  3DXR A;  3CC2 V;  1QVF U;  1F7Y A;  5AG2 A;  4WFG A;  1D5A A;  1PPJ H;  4LP8 A;  1IBK B;  4UCT A;  4WBN A;  3LSU A;  3H1I H;  1NVP B;  3NR7 A;  2WLJ A;  4FLV A;  1RSO B;  2Q69 A;  2YXL A;  1SRY A;  2F66 C;  2L6L A;  1EFR G;  2BOB C;  2BE3 A;  4HNA B;  3QG5 A;  4QNH B;  2FKX A;  3B2E E;  2R9I A;  3CRA A;  2ZNI A;  2WA4 A;  1Q6U A;  1FXH A;  3CJH A;  4X1K B;  1AR5 A;  1N0N A;  1RM1 C;  4KHP O;  2OCH A;  4FM2 A;  2BSK A;  3AG3 B;  3ASN B;  3CHX A;  1YXB A;  1KQS U;  3HKB B;  3JAK B;  1QU7 A;  3KZI Z;  1V55 C;  3L75 H;  4FVM A;  4FLU A;  1K92 A;  2LFR A;  3RGB A;  4JI7 B;  1VF6 C;  4QPK A;  2Y69 B;  1ENV A;  5DN6 G;  5IWA B;  4X8A A;  1R73 A;  2WSS G;  3W7X A;  4X1Y B;  4B3R B;  3CCE V;  3AG4 C;  4NTY A;  2ZR3 A;  4DV6 O;  4DRX A;  4XDK A;  3L73 H;  4B7K A;  4GUN A;  4DR4 O;  3FFQ A;  2AZ2 A;  1N0J A;  2Y0P A;  1F51 A;  4LF8 B;  4H33 A;  3ASN C;  2X7R B;  1ZUQ A;  1PM9 A;  3SPG A;  2XAQ A;  4F6E A;  3WB0 A;  3GB7 C;  4HAM A;  2QGN A;  3JAK A;  4UVB A;  1NTK H;  1GAX A;  3SYO A;  1XBL A;  1HNZ B;  2QSA A;  2QJ1 A;  1O9G A;  2KQX A;  2Q0O C;  3RYI A;  3X2Q B;  1ZL8 B;  2DWD C;  2F1M A;  4RUE A;  1XHX A;  2P90 A;  5L3D A;  1HNZ O;  3U0Z A;  3WB2 A;  4ZOL B;  3QO8 A;  1M1K W;  5K1X A;  1QQC A;  1WB8 A;  5CMU A;  2GTS A;  4FM0 A;  1FD9 A;  3L74 H;  1WJZ A;  4LFC B;  4MVS A;  1VQ7 V;  4LF5 B;  5LHI A;  1NTZ H;  1P4R A;  4RWU A;  5JH7 B;  1Z5V A;  2VS0 A;  2PTM A;  3OGC C;  3UM7 A;  1BZK A;  1CEZ A;  3P30 A;  3LDE A;  4DW1 A;  4GKJ O;  1VQ9 V;  3H1L H;  4Z1V A;  3ZJZ A;  3ZMS A;  3RT3 C;  1TGO A;  2NNU A;  5DM6 V;  4NTX A;  2IW5 A;  3OTO O;  3A0B Z;  3J80 N;  3K5M A;  1VQL V;  2YS8 A;  2EBO A;  2CDY A;  5KAI Z;  1EN5 A;  3OMI B;  3Q4H B;  4MT8 A;  3VOU A;  3E22 B;  3OGI B;  2DW4 A;  5CA0 A;  3B8N A;  3OE7 G;  3C3S A;  5HFM A;  1QLE B;  1M57 C;  2GBO A;  3PN1 A;  4DUZ B;  2UUB B;  3U11 A;  1DGS A;  5KHI A;  2RJZ A;  4FLY A;  3TK1 A;  5K1P A;  4H37 A;  1WP7 A;  4MVR A;  1B6Q A;  1ZX3 A;  2QM8 A;  1RSO A;  4NTW A;  1O9H A;  4R6Z A;  3C3T A;  2YI8 A;  2YEV B;  4BIZ A;  1DF5 A;  4KHP B;  4GX2 A;  1OCR B;  4QGP A;  4RQF A;  1VQO V;  1Q5O A;  4WFA V;  5LOV B;  3SDL A;  3RYF A;  1J5E B;  1OJH A;  1K3E A;  5B3S C;  4PD4 F;  5C93 A;  4D7T A;  3B8M A;  2RNB A;  1IBK O;  3TGU H;  4LC1 A;  3A0H Z;  4X1I B;  3X2Q C;  1D5N A;  3H1K H;  3ZS8 C;  3CS5 A;  1SQX H;  2JEU A;  3E22 A;  4OX9 B;  3HKE B;  3K57 A;  4GX0 A;  3CEI A;  1I94 B;  4DUZ O;  2UUB O;  4LF7 O;  4JTD B;  5IYZ B;  3BY6 A;  2EIK B;  3G6E V;  1ZAU A;  3MAQ A;  3STL C;  1H2S B;  1SKV A;  1U96 A;  2QA4 V;  2V4D A;  1BQ0 A;  4DV3 O;  2YEV A;  3GWK C;  1FFT B;  5LXT A;  4NB5 A;  1S3J A;  1YIT V;  3K5O A;  5LOV A;  2HVK C;  3CME V;  3RYF B;  5LGU A;  1S72 V;  1H2L A;  4P9O A;  5LGN A;  1JX9 A;  3WU2 Z;  4GX5 A;  3BA9 A;  3BVO A;  3UCS C;  2PY5 A;  4DV1 O;  1AI5 A;  4XBF A;  2UXD O;  3G67 A;  4JI8 O;  3M7M X;  4YXW G;  2DMX A;  2VWK A;  4LF5 O;  3D36 A;  5B1B B;  4A5U B;  2ADQ B;  1EN4 A;  4MTF A;  3OR7 C;  3L72 H;  4EFE A;  1U97 A;  2ZE7 A;  3N2K A;  2JDI G;  4OPH A;  1GM9 A;  1M9N A;  3IFX A;  1ZL8 A;  4Z1M G;  1GM8 A;  5JJJ B;  3C90 A;  2WWW A;  4X66 B;  4CH4 A;  1SQV H;  3I5D A;  2ADP A;  4B3T O;  1GN2 A;  5A2Q N;  5CB4 B;  3OT7 A;  4YJ3 B;  5FPO A;  4DUY B;  1R6N A;  1XL4 A;  2JGD A;  1K33 A;  1XRE A;  2JIZ G;  1AI6 A;  1K4D C;  2E75 B;  4FMT A;  1MMM A;  2XOK G;  4I5S A;  3EFF K;  2MW2 B;  4PI0 A;  4AQY B;  1NR1 A;  2CTW A;  4P30 A;  5LBQ A;  2HEP A;  4LF9 B;  2D2C B;  3HKD B;  4UCR A;  3ABM C;  4O4I B;  2WLL A;  1MZF A;  4I4T B;  1H8E G;  2UUA B;  2PZS A;  3IC7 A;  3QO5 A;  4H13 B;  1B3Q A;  4PI2 A;  1SA0 B;  2QM4 A;  4RUF A;  1AJQ A;  4E4E A;  2E3C A;  3E8F A;  2W0X A;  1WAZ A;  4JPR A;  4J7Z A;  4LH6 A;  1URF A;  4LWS B;  5CBG A;  1VQK V;  3ZHT A;  2RCV A;  1AR4 A;  1IXM A;  4EB6 B;  3HKC A;  2VQF B;  2B1I A;  1JPX A;  2CE4 A;  3UKM A;  5KHG A;  2N74 A;  1G4Y B;  3SR2 C;  2LP7 A;  3AG2 B;  5E1A C;  3ETE A;  1GN3 A;  4DK0 A;  3EHB B;  3FX7 A;  4U7N A;  4JI0 O;  1IBM B;  3B4S A;  2QM7 A;  1SET A;  4B7E A;  3AG2 C;  1K97 A;  4JYY A;  3BAA A;  4LF4 O;  4DV7 O;  2A0L A;  3FAV A;  3TXQ A;  5LP6 A;  4Q6G A;  2F95 B;  1GK9 A;  1G1X B;  5FNV B;  5C8Y A;  2OTL V;  4OGQ B;  2LGQ A;  3G6B A;  3E8G A;  2CAZ C;  2ZIN A;  4I4T A;  2E76 B;  1SQG A;  1XNR O;  4PEL A;  3RBZ A;  4X88 A;  3TXS A;  2LFS A;  4PDL A;  4RO2 A;  2JEX A;  4FJC C;  1YF2 A;  2IJK A;  5LMU B;  2Z0A A;  3K5L A;  1K73 W;  4LWS A;  3LSS A;  4LCU C;  3B77 A;  3K3W A;  2DE0 X;  5KUM A;  1IZ3 A;  2HHH O;  2WLH A;  2X6B A;  4DR6 B;  4I9W A;  3KG2 A;  1KC8 W;  1N8R W;  2WAM A;  3LNM B;  2Q5Z A;  3JAS B;  3DC6 A;  4NR1 A;  2HHH B;  1I7F A;  4TV9 A;  1W59 A;  2B1G A;  2ZD9 A;  4JGS A;  5IYZ A;  4X89 A;  2BOC C;  2CH7 A;  2ZXW C;  1KBH A;  2F93 B;  3LNN A;  1V54 B;  1L8D A;  1OCO C;  4P2Z A;  4LH7 A;  4FIP C;  4LFB B;  1XNR B;  3F7Y C;  4HZ3 A;  2RMK B;  1Q7Y W;  4JI3 B;  2P5O A;  1SF9 A;  3VQX A;  5EZY A;  3ZMZ A;  1VAR A;  5KA6 A;  1Z5W A;  1W0J G;  5D5P A;  5EC2 C;  2A7W A;  3CJH B;  1BHB A;  1PL0 A;  1BSM A;  2UXC B;  1N34 B;  4DR2 B;  5IDJ A;  1M56 C;  4ZIB A;  1IXB A;  2Y69 C;  5KAF Z;  3LDD A;  2CUG A;  2A9H A;  1JVM A;  2FB5 A;  3AG1 B;  2X6A A;  3N2K B;  4JI1 O;  3ABK C;  3G71 V;  3H1H H;  3HPL C;  4PA3 A;  3SYA A;  3ZMU A;  1PNK A;  1Y74 A;  2ITD C;  2VQF O;  4L87 A;  4K8Z A;  3BCC H;  1XEQ A;  4WFE A;  2CH7 B;  2AGA A;  2K9P A;  2ZXW B;  2XT9 A;  4DV2 O;  2ARH A;  1M90 W;  1NH2 D;  2PYL A;  1X4T A;  5J2T B;  4X65 B;  3ABM B;  2ZT9 B;  1XNQ O;  2CTP A;  1GH6 A;  1NH2 B;  1FAF A;  1VF5 B;  2G38 A;  3K0D A;  3QO7 A;  3OD4 A;  4UVC A;  4LF6 B;  2QEX V;  1TUB A;  2UUC B;  3KCY A;  1VQ5 V;  4QJF B;  4U3J B;  1XMQ B;  4X62 B;  3MHH C;  1FKA O;  2UXX A;  2R72 A;  3IAY A;  3HKD A;  4O4I A;  3JAM N;  4LF6 O;  3A0R A;  4JI6 B;  3AK1 A;  3QTC A;  5J2U B;  3VQW A;  3CMA V;  1XMQ O;  4DUY O;  3RYC B;  3ZMV A;  4YHH O;  4QE7 A;  2FYU H;  1HNX B;  2F43 G;  2HFE C;  2PUS A;  3DTU B;  4B3T B;  1WB7 A;  4YY3 B;  1TA8 A;  2YIB D;  3EVK A;  4PDV A;  4QE9 A;  5JCO C;  4GT1 A;  2UXB B;  1JCH A;  4I50 A;  3RWR D;  4DV2 B;  4JI2 B;  1Q8I A;  1H8H G;  4WFF A;  1XHZ A;  4LFA B;  5LHG A;  4JI5 B;  4C7U A;  3ZRW B;  1HW7 A;  1TUB B;  2FL4 A;  3P32 A;  2D3O W;  5IY5 C;  1PV0 A;  2WLI B;  5FNV A;  5C8Y B;  4GX1 A;  2OCC C;  3KKY A;  1N34 O;  2XHB A;  4OXS A;  3SPI A;  3SYC A;  1S0V A;  4IT5 A;  4O4L A;  3BAB A; 
#chains in the Genus database with same CATH homology
 2B9Z A;  4LWS A;  4ABM A;  3FAV B;  3HR0 A;  3GWK C;  4GZR B;  4I0X B;  2AZ0 A;  2DE0 X;  3ZBH A;  1WA8 A;  3O9O A;  2VS0 A;  2KG7 A;  3TXS A;  3Q4H A;  3Q4H B;  4LWS B;  3OGI B;  3G80 A;  2AZ2 A;  2KG7 B;  2VRZ A;  4I0X A;  1WA8 B;  3GVM A;  3FD9 A;  3FAV A;  3TXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...