2B9ZA

Solution structure of fhv b2, a viral suppressor of rnai
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
GAMPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVGRMVTSLLEKPSVVAYLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B2 protein
publication title The structure of the flock house virus B2 protein, a viral suppressor of RNA interference, shows a novel mode of double-stranded RNA recognition.
pubmed doi rcsb
source organism Flock house virus
molecule tags Viral protein
total genus 25
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2b9zA00
2KG7B 3GWKC 4GZRB 3OGIB 3FAVA 3ZBHA 3FAVB 2B9ZA 3GVMA 3TXSA 3O9OA 3G80A 2AZ2A 4ABMA 4LWSA 4LWSB 2VRZA 3TXQA 3HR0A 2AZ0A 1WA8A 2DE0X 1WA8B 4I0XA 2VS0A 4I0XB 3Q4HA 2KG7A 3FD9A 3Q4HB
chains in the Genus database with same CATH superfamily
3EVKA 3OUFA 4IYHA 3BPZA 5EC2C 4X62O 3SJAC 3K03A 4CC6A 4CZZA 1XUQA 4DV0B 1AB3A 2M7WA 1SQPH 3L73H 4DR5O 4BWAA 4EB6B 1D5AA 1EN6A 4QNHB 1GO3F 1QQCA 3LSUA 1IDSA 5FNVA 4JI6B 5H6QA 3GB7C 4FLYA 1OCZB 1TUBB 2F43G 2WLJA 2DN9A 4WFFA 3EHBB 3SYQA 1AR4A 1Z5WA 1K92A 3FB5C 1S0VA 4LC1A 1RSOA 4MS2A 1N32B 4MSWC 5LP6B 2V7QG 1YI2V 3CC4V 3VQWA 2ITDC 1YJ9V 1J5EO 3DXRA 4WFBV 2F95B 5LHHA 1WP7A 1Z2GA 4B3RO 1X59A 1TAEA 4JYBA 3B09A 3CC2V 5GTHZ 1FFXB 2EIMC 4NTWA 4DR1B 4UCTA 1XBLA 1K34A 1XL4A 5JH7A 3O65A 2HG5C 1BT8A 2R72A 5KUMA 3LNNA 1QBZA 4GYCB 3E8HA 2WLKA 1L0LH 1EM1A 2G38A 4NVPA 3AG3B 4JI2O 2OTJV 2JVDA 1H2NA 3R65A 4LF4O 1I94B 1MZEA 1OCCB 1XNRO 1FKAO 1VQMV 3FD9A 3SDLA 3RYFB 1K8AW 1BMFG 3B8MA 4CH5A 2PUSA 1VF5B 1Y74A 3VOUA 3DC5A 2RMKB 1H8HG 3HKCB 3IC7A 3IAYA 4K8XA 1VQKV 2EZPA 3SJQC 5KHJA 2WLIA 1AJNA 2DQ0A 3OUSA 1D5NA 1NVPB 1BHAA 2A9HA 3ASNB 4X89A 2PF4E 4RQEA 4G27B 2ODMA 1Y76B 5EK0A 1R3LC 1TVKB 4DR6O 3SPCA 4J9YB 4DV5B 4B08A 1VQLV 5LYJB 5J2UA 1V54B 3FX7A 1NI8A 5L3CA 1M93A 1BE3H 4X20A 3OD4A 3T1HO 3AK2A 3AG2C 5FL7G 4AILC 2YI9A 3H1KH 1MSWD 1B3QA 1OCRC 4F4LA 2VWKA 3APOA 2NNUA 1KMIZ 5ITZA 5JJJB 1V55C 2DYSB 2QWOB 1PL4A 3K0DA 4IHJA 4J7KA 1IBLO 4UCOA 1YIJV 4ZI7B 1RPRA 4DV3O 4NXNB 2P7TC 4HNAB 1VQ6V 1IXBA 1AI5A 2UXNA 2DJVA 1W0KG 1XQ8A 4I9WA 1SZTA 1HNZB 5KUKA 4LF9B 4X64B 1DLBA 3RVYA 2XTAA 1ZUQA 2DYRB 2RJZA 2E76B 3K3WA 1H2LA 4E4EA 3A0BZ 1LUVA 5B1OA 5CBHA 2BSKA 4PDRA 2W6IG 2EILB 3M8AA 4I5SA 1XMQO 1N8RW 1YJNV 2N04A 4YY3O 4FLWA 2F4VB 3ZN0A 1IURA 5CBGA 3ETEA 3AG4C 1VQ7V 2IM9A 2YEVB 2UXXA 4TV9B 3BFRA 1K7DA 3W7UA 4BIZA 5FLXN 3G67A 3CCUV 3HKBB 4ZIBA 1U97A 3SGIA 2FKXA 1AR5A 1KUQA 5BY1A 4LBEC 2QEXV 4ZHQB 2RCVA 2OIEA 4F6EA 2UUCB 1G1XB 4IT5A 4DV4B 5IT9N 1L0NH 1XHXA 4WFAV 3PJSK 3CPWU 3FAVB 4JI5B 4X1KA 1N36O 1S5LZ 2JJ1G 2UU9O 5B1NA 1W2BU 1N4CA 1URFA 4I4TB 1Q6HA 4J7JA 4X66O 1DF4A 2NN4A 3K5NA 2CTPA 4FLUA 3F7VC 2AW9A 1LUWA 4FFBA 1Y66A 3T2MA 1S72V 4O4HB 1F4MA 1NZ6A 2PYLA 2RQ6A 3RN4A 2XOKG 1YHQV 4PDLA 1VQNV 4UV8A 2PI5A 3E2EA 2QM4A 3L72H 2VS0A 1BGYH 1HNXO 1T5EA 2DWEC 1WB7A 4NR1A 2E5LB 4DR3B 1QVFU 4JYCA 1SQFA 4AQYO 5JQGA 3E86A 2ZDIC 4K3AA 5LOVB 3TGUH 2WLMA 4FPPA 3CMEV 4UVCA 1QLEB 2P4KA 1HR0B 3E89A 3OT7A 4UXNA 3OGCC 3AEIA 4ICGA 4MVOA 4F6RA 2CE4A 5BR8O 4OPAA 1QR9A 1ZAUA 4UFZA 3LUTB 2QTSA 4O2AA 4JI7B 4YXWG 1PP9H 4O4IA 2PGGA 3KCXA 4TWKA 3E8GA 5IY5C 2E75B 3HKEA 3T1CA 1NKDA 3A0HZ 3ABMC 2ETNA 4KHPB 3HB3B 4JI1O 2QWQB 4GKJO 4PA9A 2QSAA 5LGUA 5IWAB 5EZYB 4HZ3A 5JJNB 2UXBO 2VQFO 4X8AA 3JCZA 3STLC 4JAAA 2X6BA 3CX5F 5H9CA 3E22B 2Q68A 4O4JA 3JAMN 1Q7YW 1PNKA 4O4LB 4ZKIA 2ZIOA 2N74A 4DV6B 2VQEO 3JD3A 1SESA 3IGAC 1K97A 3RYHA 3H1HH 1NQTA 4B3MO 2UUBB 3D36C 1B04A 1SERA 4DR7B 3JATB 4GKKO 1SQVH 1OCOB 3JAWB 1JR9A 1FD9A 3K9AA 5FPOA 1Z5VA 3PN1A 2LGWA 3T4DA 4GX0A 4I0XA 1HNWB 4JV5B 1R3KC 1RPOA 3ZMZA 1WLEA 2Y48A 4KP4A 2YDEA 1UPGA 3CSXA 2Q7EA 3ZRXA 1R6TA 5IJ0B 3JARB 5BZBA 4U3JB 1ZL8B 5LGTA 1CPYA 4JYAB 4ABMA 3I56V 4IL6Z 1NR1A 4GCZA 1V9PA 4RQFA 2FTKA 2GHYA 2A79B 2F1MA 1CEZA 4X65B 2A0LA 3EFFK 1O9GA 3WB1A 1SQXH 1YTFD 2JGDA 1RM1C 1DTOA 4JASA 4CS2A 1KC8W 1US6A 2ZNIA 4HAMA 3CYOA 1OHHG 1M90W 3D8CA 1KQSU 5LHIA 5LBQA 1G8MA 3DSQA 1K73W 4LF6B 3JASA 1DGSA 3SJBC 3CEIA 2XAFA 3TCUA 4NXMO 1H2MA 4H0LB 1MG1A 1FXKC 1PNMA 2OWOA 5FNVB 3BY6A 1S77D 3E8FA 2Z5UA 3ZX6A 3EXAA 4YJ2A 4RO2A 3SYCA 2ZIMA 4K0KB 3WG7B 4LFAB 4OXSA 5GONA 4MVSA 4I55A 1RSOB 2R70A 2YS8A 1GK9A 4QIWF 2EJ7A 2AZ0A 4X62B 2JS5A 5EBWC 2JEUA 3ABLC 3AG3C 2QDOA 3RFRA 1R3IC 2EIJC 3DXRB 4X1IA 3K9SA 4R50A 1XDCA 2BCCH 2H8PC 3A8TA 1J95A 2ZR2A 2HP8A 4DR5B 1I0HA 2IU3A 4UCUA 5EC1C 3I55V 1ZLZA 1W0JG 3B40A 1Y6XA 3N27A 2Q0AA 3KCYA 4FFKA 3JD4A 5B1BC 2YXHA 1NJIW 3HKDB 2ZDIA 4N23A 5JH7B 3DC6A 2D2CB 5EIBC 4IYIA 2B1GA 4GX5A 1ZTEA 1YZBA 1VMGA 5JJEB 4Q20A 1XOUA 2CK3G 1J5EB 2IU0A 2D3OW 4LNUA 2YXLA 4DXWA 3ASOC 1PD3A 3T1YB 3JCUZ 4B3RB 3CCJV 4X9QA 1K5SA 3QO8A 2WA4A 2KG7A 5LGNA 1XHZA 2Y4UA 3WB2A 1V54C 5BMVA 2UXCO 3VQVA 2OT5A 1QLNA 2FYUH 3BEHA 1Y74B 3CCVV 4G2KA 2EX3A 4LF5O 5B1AC 2WWWA 4PA7A 1PPJH 4DR2O 1I08A 1KKCA 1MABG 2WLIB 1N0JA 3UKMA 4DK1A 3SYAA 2ZD9A 2JRIA 2KKWA 4JI2B 5EIBD 2H3OA 1GM7A 2IBZH 4J7ZA 3ZIAG 2JS3A 4CS3A 1N34O 1XNRB 1HWYA 3MHSC 3JD2A 4U7NA 3P3PA 1K5QA 2F23A 2L6LA 1NVPD 1WPXA 4MVUA 5J2UB 2QTOA 2XNDG 2Q5ZA 1JJOA 3MDSA 4QPKA 5GW7A 4LH7A 1IX9A 2E74B 5CA1A 4LFCO 2Q7GA 1SQQH 5KAFZ 2P67A 5KA6A 4DUYO 4DV2O 3N2KA 4U3FH 3RVZA 1S5HC 4X1YA 2EILC 1H38A 2HVJC 3HR0A 2X0LA 5A9GA 5ITZB 3CJHA 1VF7A 1N0NA 1N32O 2PTMA 3K5MA 3K04A 4IHJB 2QM8A 5DECA 4AI8A 3AG1B 3IFXA 3C3SA 5J9PC 2CGNA 2ZE8A 3KZIZ 5HFMA 4J11A 4CS4A 4J80A 3T1HB 3SR2C 1JFFA 5CA0A 5L3EA 1Y67A 4JZ2A 4JI3O 4LF7O 2W0XA 3ZHUA 1FPOA 2BTQA 2A06H 1F7YA 2BSKB 3OMNB 3C3TA 2OCCB 3NR7A 4YJ3A 1AJPA 2ZM6O 1YCIA 1U96A 2YSUB 3O9OA 1PL0A 1GN2A 3J7AU 3B77A 2IH3C 1GN4A 2VRZA 4JI0B 4L87A 2F66C 1COWG 2HLDG 5C8YA 1WJZA 2V4DA 2HHHO 1M5IA 2BTOA 5GTIZ 2EBOA 4D7TA 3OMAB 1OZ0A 4FM0A 4HBNA 2Y0IA 2EIKB 1I94O 4DW0A 2WSSG 3ZMTA 1E79G 2WAMA 2ZT9B 3A2FA 1FXKA 3BRCA 4B3TO 2X7RB 1M56C 4LWSA 1KB9F 2HVKC 3VBBA 2C2AA 2P06A 2DE0X 1XMQB 1Q43A 4YY3B 2ILMA 5IYBO 4LF8O 1JX9A 2JEXA 3SPJA 4PJ0Z 3CRCA 4ZBMA 4X1KB 2AHYA 5L3BA 3LDEA 1VP7A 4PA6A 3OTOO 3QNEA 4B3SO 1SKVA 1BS3A 4K35A 3C90A 2Y0PA 2ARHA 3F5TA 5A2QN 1HW7A 2KSDA 4Z1VA 4DV5O 3ETQA 1YF2A 1L8DA 4FFBB 3ABKC 1IBMO 1SA0A 2Q6AA 2OYQA 1R1BA 4ZOLA 4L8JA 1LR1A 3F5WC 3G4SV 5K1PA 1E1QG 4YIOA 2LW7A 1QR8A 5IE9A 1AP6A 1JA8A 4D7SA 1THZA 1N36B 4FMTA 2UU9B 5LMUO 4H37A 2ZINA 3FYEB 4XDJA 3K5OA 4WF9V 1A32A 5JQGB 3X2QC 4X66B 3SYPA 1VQ5V 3K0GA 3CWBH 4J42A 4YIPA 2GTSA 3VQYA 3OR7C 4DV1B 1NH2B 1GN3A 4TV8A 2PI4A 1BHBA 2CTRA 4F6RB 1CXZB 1VF6C 3RYIA 3CHXA 2CH7A 4WFHA 2X6AA 2N05A 4O2AB 1CP9A 3W7SA 3CRQA 5TISZ 3ML0A 1HNXB 2L35A 4H33A 4JTDB 4O4IB 4UUJC 2YIDA 5JVDA 4AQYB 3ABTA 3J81N 3HKEB 1H2GA 2JGUA 1OCOC 4GT1A 3MHHC 3BA8A 4YHHO 1VQ8V 1TA8A 4R8CA 1GAXA 3K59A 3OE7G 4FZ0A 3LNMB 1I5YA 2GSMB 4TUYA 5LMNB 1R3JC 1NTMH 1YITV 4OX9B 4MW3A 3AG2B 2K9PA 2PYJA 4JZGA 4U7OA 4FLZA 4WBNA 3THOA 1AJQA 1OCRB 2ZR3A 3CCRV 3BVOA 3APQA 2XAJA 2W0FC 2YXYA 3P3NA 3MD0A 2O57A 3RYHB 4KXRA 1XNQB 1M57B 2YICA 5L3FA 1Y4MA 3P30A 3H1IH 4JI1B 3CRAA 4GKJB 2M6YA 1R6NA 1P7GA 1GKFA 4I50A 1SS3A 4I0XB 4JAUA 2F93B 5KHIA 1VARA 3CXCU 2UXBB 3JYCA 2VQFB 3JSNA 3ZHRA 4DRXA 1PV0A 1FXVA 4JTAB 1IXMA 3UCSC 4E2LA 3UO3A 4NKGB 5LXTA 3RT3C 5CA3A 2GV9A 3JALB 1NT2B 3CD6V 5C93A 3RGBA 2WLHA 4RAIA 1OV9A 4B3MB 2YIBD 2RN9A 4DUZO 5LA6A 3L70H 3ZRWB 2K1EA 4GKKB 5KX5A 3OTFA 2QWPB 3AG4B 4P2ZA 1IBKO 2HFEC 2JGDB 1F4NA 1EZJA 4J9ZB 3ZS8C 3CCQV 5EBMC 3FYIB 4H13B 4GLXA 4TOIA 2DMXA 2QWNB 3WG7C 2WA3A 5B3SC 2LO1A 2CAZC 3BAAA 5CBFA 1SETA 2QA4V 3GWOA 2BE3A 1FYJA 4FLVA 2YC0A 2YI8A 2RNBA 1EN4A 1N33O 1PM9A 1EZVH 4BIOA 1P4RA 5IYZA 2ZXWB 4JPRA 4LFBO 2LGQA 2X6CA 4TQDA 1NR7A 3OEHG 1S5JA 4JI8O 2XHBA 3FFQA 4KUMA 3RYCA 2IJHA 4YJ2B 1P84F 2QKSA 3QO5A 4TQFA 2ATKC 5GONB 2KQXA 2R9AA 4I55B 1VQ9V 4MTOA 1FJGB 3CXHF 4PA4A 3ZHVA 5FPRA 1VQPV 4N21A 3ZN1A 4X1IB 3GWKC 3H1LH 1MSDA 3CRMA 3UM7A 3OEEG 2Q4PA 2EJRA 4BIUA 1Q3EA 1OCZC 4IGGA 3DTUB 2XAQA 1WA8A 1ORQC 1M9NA 3Q4HA 1WPBA 4UCRA 1SC5B 5LP6C 4XDLA 3JD1A 4B7KA 2UUAO 2R9RB 4LCUC 4IIJA 3B4SA 2HKOA 3CRRA 3SJCC 1TGOA 1HNWO 4LNUB 3JAKA 4I9QA 2Y69B 2W6JG 4JI4O 2UXDO 4UB8Z 3ZJZA 2P6JA 1K9MW 1EFRG 1XILA 4TT3G 1ROPA 4DR4O 3KKYA 1PNLA 5BMVB 2GUZA 4EFBA 4QJFB 2Q69A 5IY5B 3N2GA 2DWDC 4Q6GA 5KMGA 3S3WA 1KD1W 4J41A 2IJIA 1GTOA 4PELA 1SQGA 1AI6A 3BCCH 1AVMA 3ZEDA 4FIPC 1OCCC 5J2TA 3ETDA 3QTCA 2P4VA 5LL6Y 2DQ3A 2YIBA 3ZRVA 1XREA 3CMAV 4PDMA 5EYPA 2WLNA 1FS0G 1VEWA 4QE7A 4RUFA 1DF5A 1SRYA 4TSFG 2QKCA 2UXCB 5F2VO 5EBLC 2A7WA 1H8EG 4QPJA 2ZKOA 3H1JH 4DV7O 5CA1B 4LF5B 2OTLV 4JTCB 2FL4A 3ABUA 1Q6IA 3N2KB 1XMOO 2B1IA 3ICXA 4X1YB 3ASNC 5BXZA 4PV1B 1SQBH 5E79Z 1R6KA 1JVMA 3UT5A 5DM6V 1MNGA 3CJHB 1IZ3A 4QGPA 1MOFA 2QGNA 3E35A 3LDCA 3QG5A 4RWUA 1P49A 2R9IA 3ZHTA 5KHKA 2B5UA 1VIBA 4GX2A 3TXSA 4JYYA 4D6TH 2EIKC 2LQTA 4O2BA 4MW8A 4LFCB 4NTYA 1OJHA 3CCEV 1JFFB 4DUYB 1ZX3A 5CA0B 4B7EA 4DV2B 2WLLA 3SPIA 2ADPA 2P5OA 1KBHA 1RM1B 1G4YB 3CP1A 3K06A 2BTQB 3L9DA 2EINB 1H2SB 5CB4A 4LF4B 1UFIA 4YJ3B 4UV9A 5IJ9A 3JD0A 4FVMA 2DYSC 1BQZA 1WP8A 1XI1A 3RWRD 3MAQA 2IJKA 4DV0O 5C8YB 4KL1A 3CB2A 3ZRSA 4FZ1A 2LJ2A 3D36A 3JSLA 4X20B 3T1YO 3E8BA 2ZQMA 2B9ZA 1NU1H 4JI6O 2DYRC 1FXKB 5HFLA 4JI3B 1JJ2U 4J10A 4CH4A 4LF7B 2LFRA 4LWSB 3K58A 3HKDA 4UCVA 1VQOV 4BW5A 1QHTA 1AI4A 4UB6Z 3DGEA 2ZM6B 2XAGA 2JDIG 4DR6B 1R73A 2JJ2G 1WNSA 3D3QA 2RDCA 1IVSA 3GVMA 4DYLA 2HHHB 3ABLB 2EIJB 3CS5A 4EB6A 3CCLV 2EULA 2GBOA 2HEPA 1DK1A 1NBMG 3BHPA 4I7ZB 1TUBA 3IJ4A 2EZOA 5KA5A 4B3TB 4DR1O 4MVQA 5B1BB 3OFNG 3NXSA 3L75H 1SA0B 4WFEA 5DN6G 2CDYA 4CC5A 4OPHA 4ZOLB 4WCEV 2PY5A 1D2DA 1Q6UA 5LP6A 4CBCA 4LF8B 3TXQA 3ZCCA 1QCEA 1IBLB 1NTKH 4DV3B 3W7XA 3HPLC 2OIGA 1Q90D 2CGOA 1AR1B 3OTOB 5E1AC 2IH1C 4B3SB 2IJJA 3ASOB 3LSSA 3K57A 2V1DA 1MA1A 1FFXA 4C7UA 3G6EV 4WFGA 1KECA 1K4DC 2QWRB 4FM2A 4MVZA 1YVWA 1IBMB 4TV8B 2QJ1A 2JIZG 1GM9A 4BR6A 2HJDA 5B5EZ 3OGIB 4FM1A 1NH2D 1ENVA 1QVGU 3RYIB 5KLVH 5B1AB 3RBZA 2CH7B 3D3IA 2IW5A 4A5UB 5LMUB 4UCSA 4Z2WA 2AGAA 5JVDB 1AILA 3OM3B 1X4TA 1SF9A 1M57C 5AG2A 3CCMV 3ZMVA 1LNQA 1WN7A 3RYFA 1I5XA 1QLEC 1MMMA 4JI0O 2EIMB 3KG2A 1E1RG 1HP8A 4NB5A 1P7BA 4DK0A 2NLJC 1GRJA 2BOBC 3U0ZA 5K1XA 3M99B 1HDJA 4EFEA 3HKCA 3W7WA 4TUYB 4H44B 3U10A 4EEQA 2ZNJA 2E3CA 5D5PA 1K33A 4WBNB 2ZCEA 2Q9LA 4MT8A 1GMGA 1Y76A 2H94A 4LH6A 5DEDA 1TVKA 1M1KW 1G6UA 5LYJA 2P90A 4YHHB 2Z3YA 2VWJA 1EBOA 4NXNO 4MVRA 4I50B 4P9PA 3K08A 1HNZO 4LF9O 4X64O 5B66Z 4DRXB 3B2EE 2QR4A 1JPXA 4FLXA 3UO2A 4GX1A 4PA3A 4P30A 1AP5A 5LXTB 3CE2A 3FB8C 1F23A 3I5DA 3R66A 2F4VO 1NS1A 3OMIB 1KKDA 5LA6B 2ZXWC 2AXTZ 1JQ0A 2A3QA 4ZI7A 5JCOC 5KX5B 3ZBHA 4HNAA 2DW4A 4MTXA 4DW1A 3WU2Z 2AZ2A 1GM8A 1I7FA 1Q82W 5BR8B 1BZKA 3J80N 3AK1A 2WPDG 4GUNA 2Y4TA 3RW0A 4O4JB 4DV1O 1JMKC 1KYOF 1M56B 2UUCO 4CH6A 3OW2U 2XUMA 4DV4O 4BW9A 3QVNA 4X88A 2YIAA 2ZE6A 4BAYA 4MTGA 3BABA 4DUZB 1V55B 3S3XA 1KP2A 2YEVA 4Z1MG 1Q81W 4W4KA 4JI5O 4QE9A 2LP7A 4TV9A 5IYZB 3UQ8A 1IBKB 2HJFC 5H5NA 1K4CC 4FJCC 4JAVA 2XASA 3HKBA 3K5LA 2XT9A 3RYCB 3B8NA 3L71H 1MZFA 5LHGA 4ZHQA 2GDSA 2KB1A 4PD4F 5H6RA 1TUEB 1VQ4V 2Q73A 1GH6A 3A0RA 5CMUA 5H2FZ 4LP8A 2VQEB 1BL8A 1AI7A 3ABKB 3P32A 2Z0AA 1BCCH 2LW1A 3LDDA 1N33B 2Y69C 3ZHSA 3WB0A 5LMNO 3FAVA 4OX9O 3QO7A 3TK1A 5IYCO 4LFBB 1XL6A 3G80A 5JWPA 2PZSA 2Q0OC 2P22C 4CH3A 4JI8B 2E5LO 4DR3O 2ZE5A 3ETGA 4I4TA 1AROP 4HYOA 1WA8B 4NTXA 3ZHQA 4UVAA 3H9VA 3X2QB 1XNQO 3Q4HB 2BOCC 1W59A 2ITCC 4DO2A 1YEWA 1HR0O 4O4HA 4IIJB 4R6ZA 3JASB 3L74H 1FFTB 1H2KA 2FB5A 3LSQA 1FAFA 1WAZA 2QE7G 3JAKB 1YSCA 3ZMUA 4R7CA 4JI7O 1K3EA 2Q67A 1YDXA 1GN6A 2LFSA 3AK3A 2MK3A 3OR6C 4P9OA 3TETA 4MVMA 2GUZB 1ZWIC 3H01A 3VQXA 5LOVA 3N2GB 3FB6C 5L3GA 3CCSV 4KHPO 2GTAA 1SZXA 1WB8A 5KMGB 2UUAB 1RFYA 3G6BA 5IWAO 5KHHA 4JGSA 5D5QA 4K8ZA 4PI2A 4KFMA 4PHZA 1Q5OA 2CUGA 1YXBA 2Q8VA 3FB7C 4NXMB 5J2TB 1UJWB 3WFVA 3IC9A 4JI4B 3K79A 2UXDB 2DOSA 1FXHA 3FKSG 2ZE7A 3E83A 3STZC 5EYPB 2HR3A 3JALA 1XEQA 4DV6O 4DR4B 1JCHA 4MTFA 5L3DA 2UUBO 3ZRWA 4NYKA 4ASUG 4DR7O 1BQ0A 3T4ZA 3U11A 2FMLA 4FLTA 1QU7A 5EZYA 2JK5C 4G28B 4JV5O 2EINC 4XDKA 4OGQB 2YUAA 4AHCA 1BSMA 1VF6A 4PDVA 3E22A 3UT5B 4JYAO 4O4LA 2KG7B 1QNMA 1PKXA 1FJGO 1Q8IA 4UVBA 3AG7A 4LR3A 2CTWA 5IYDO 3G71V 1S3JA 2Q7HA 4W4LA 3W7TA 1NTZH 3JATA 4X65O 3SPGA 1M4UA 1KU9A 3JAWA 3ABMB 3M7MX 1YJWV 4DV7B 4O2BB 5JCOA 5IDJA 1B06A 3QF7A 1B6QA 2WLLB 1XMOB 1RP3B 1L1FA 1S76D 5CB4B 5IJ0A 5B3SB 3JARA 2XAHA 4U3JA 5IJ9B 1ZL8A 3SYOA 3BA9A 4FK5C 1ZSPA 2QM7A 4RUEA 3AG1C 4LF6O 1KP3A 1YTFB 3OAAG 4PI0A 5KAIZ 4EKWA 2ADQB 4GZRB 1EN5A 4JF3A 1JOYA 2NR5A 5CN0A 4DR2B 3F7YC 3SPHA 1Q86W 3ZMSA 1F51A 5KHGA 3CC7V 2OCCC 1O9HA 2AHZA 2MW2B 4K0KO 4XBFA 4LFAO 2QKAA 2CTQA 2OCHA 1N34B 3TJTA
chains in the Genus database with same CATH topology
2KG7B 3GWKC 4GZRB 3OGIB 3FAVA 3ZBHA 3FAVB 2B9ZA 3GVMA 3TXSA 3O9OA 3G80A 2AZ2A 4ABMA 4LWSA 4LWSB 2VRZA 3TXQA 3HR0A 2AZ0A 1WA8A 2DE0X 1WA8B 4I0XA 2VS0A 4I0XB 3Q4HA 2KG7A 3FD9A 3Q4HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG7 B;  3GWK C;  4GZR B;  3OGI B;  3FAV A;  3ZBH A;  3FAV B;  2B9Z A;  3GVM A;  3TXS A;  3O9O A;  3G80 A;  2AZ2 A;  4ABM A;  4LWS A;  4LWS B;  2VRZ A;  3TXQ A;  3HR0 A;  2AZ0 A;  1WA8 A;  2DE0 X;  1WA8 B;  4I0X A;  2VS0 A;  4I0X B;  3Q4H A;  2KG7 A;  3FD9 A;  3Q4H B; 
#chains in the Genus database with same CATH topology
 3EVK A;  3OUF A;  4IYH A;  3BPZ A;  5EC2 C;  4X62 O;  3SJA C;  3K03 A;  4CC6 A;  4CZZ A;  1XUQ A;  4DV0 B;  1AB3 A;  2M7W A;  1SQP H;  3L73 H;  4DR5 O;  4BWA A;  4EB6 B;  1D5A A;  1EN6 A;  4QNH B;  1GO3 F;  1QQC A;  3LSU A;  1IDS A;  5FNV A;  4JI6 B;  5H6Q A;  3GB7 C;  4FLY A;  1OCZ B;  1TUB B;  2F43 G;  2WLJ A;  2DN9 A;  4WFF A;  3EHB B;  3SYQ A;  1AR4 A;  1Z5W A;  1K92 A;  3FB5 C;  1S0V A;  4LC1 A;  1RSO A;  4MS2 A;  1N32 B;  4MSW C;  5LP6 B;  2V7Q G;  1YI2 V;  3CC4 V;  3VQW A;  2ITD C;  1YJ9 V;  1J5E O;  3DXR A;  4WFB V;  2F95 B;  5LHH A;  1WP7 A;  1Z2G A;  4B3R O;  1X59 A;  1TAE A;  4JYB A;  3B09 A;  3CC2 V;  5GTH Z;  1FFX B;  2EIM C;  4NTW A;  4DR1 B;  4UCT A;  1XBL A;  1K34 A;  1XL4 A;  5JH7 A;  3O65 A;  2HG5 C;  1BT8 A;  2R72 A;  5KUM A;  3LNN A;  1QBZ A;  4GYC B;  3E8H A;  2WLK A;  1L0L H;  1EM1 A;  2G38 A;  4NVP A;  3AG3 B;  4JI2 O;  2OTJ V;  2JVD A;  1H2N A;  3R65 A;  4LF4 O;  1I94 B;  1MZE A;  1OCC B;  1XNR O;  1FKA O;  1VQM V;  3FD9 A;  3SDL A;  3RYF B;  1K8A W;  1BMF G;  3B8M A;  4CH5 A;  2PUS A;  1VF5 B;  1Y74 A;  3VOU A;  3DC5 A;  2RMK B;  1H8H G;  3HKC B;  3IC7 A;  3IAY A;  4K8X A;  1VQK V;  2EZP A;  3SJQ C;  5KHJ A;  2WLI A;  1AJN A;  2DQ0 A;  3OUS A;  1D5N A;  1NVP B;  1BHA A;  2A9H A;  3ASN B;  4X89 A;  2PF4 E;  4RQE A;  4G27 B;  2ODM A;  1Y76 B;  5EK0 A;  1R3L C;  1TVK B;  4DR6 O;  3SPC A;  4J9Y B;  4DV5 B;  4B08 A;  1VQL V;  5LYJ B;  5J2U A;  1V54 B;  3FX7 A;  1NI8 A;  5L3C A;  1M93 A;  1BE3 H;  4X20 A;  3OD4 A;  3T1H O;  3AK2 A;  3AG2 C;  5FL7 G;  4AIL C;  2YI9 A;  3H1K H;  1MSW D;  1B3Q A;  1OCR C;  4F4L A;  2VWK A;  3APO A;  2NNU A;  1KMI Z;  5ITZ A;  5JJJ B;  1V55 C;  2DYS B;  2QWO B;  1PL4 A;  3K0D A;  4IHJ A;  4J7K A;  1IBL O;  4UCO A;  1YIJ V;  4ZI7 B;  1RPR A;  4DV3 O;  4NXN B;  2P7T C;  4HNA B;  1VQ6 V;  1IXB A;  1AI5 A;  2UXN A;  2DJV A;  1W0K G;  1XQ8 A;  4I9W A;  1SZT A;  1HNZ B;  5KUK A;  4LF9 B;  4X64 B;  1DLB A;  3RVY A;  2XTA A;  1ZUQ A;  2DYR B;  2RJZ A;  2E76 B;  3K3W A;  1H2L A;  4E4E A;  3A0B Z;  1LUV A;  5B1O A;  5CBH A;  2BSK A;  4PDR A;  2W6I G;  2EIL B;  3M8A A;  4I5S A;  1XMQ O;  1N8R W;  1YJN V;  2N04 A;  4YY3 O;  4FLW A;  2F4V B;  3ZN0 A;  1IUR A;  5CBG A;  3ETE A;  3AG4 C;  1VQ7 V;  2IM9 A;  2YEV B;  2UXX A;  4TV9 B;  3BFR A;  1K7D A;  3W7U A;  4BIZ A;  5FLX N;  3G67 A;  3CCU V;  3HKB B;  4ZIB A;  1U97 A;  3SGI A;  2FKX A;  1AR5 A;  1KUQ A;  5BY1 A;  4LBE C;  2QEX V;  4ZHQ B;  2RCV A;  2OIE A;  4F6E A;  2UUC B;  1G1X B;  4IT5 A;  4DV4 B;  5IT9 N;  1L0N H;  1XHX A;  4WFA V;  3PJS K;  3CPW U;  3FAV B;  4JI5 B;  4X1K A;  1N36 O;  1S5L Z;  2JJ1 G;  2UU9 O;  5B1N A;  1W2B U;  1N4C A;  1URF A;  4I4T B;  1Q6H A;  4J7J A;  4X66 O;  1DF4 A;  2NN4 A;  3K5N A;  2CTP A;  4FLU A;  3F7V C;  2AW9 A;  1LUW A;  4FFB A;  1Y66 A;  3T2M A;  1S72 V;  4O4H B;  1F4M A;  1NZ6 A;  2PYL A;  2RQ6 A;  3RN4 A;  2XOK G;  1YHQ V;  4PDL A;  1VQN V;  4UV8 A;  2PI5 A;  3E2E A;  2QM4 A;  3L72 H;  2VS0 A;  1BGY H;  1HNX O;  1T5E A;  2DWE C;  1WB7 A;  4NR1 A;  2E5L B;  4DR3 B;  1QVF U;  4JYC A;  1SQF A;  4AQY O;  5JQG A;  3E86 A;  2ZDI C;  4K3A A;  5LOV B;  3TGU H;  2WLM A;  4FPP A;  3CME V;  4UVC A;  1QLE B;  2P4K A;  1HR0 B;  3E89 A;  3OT7 A;  4UXN A;  3OGC C;  3AEI A;  4ICG A;  4MVO A;  4F6R A;  2CE4 A;  5BR8 O;  4OPA A;  1QR9 A;  1ZAU A;  4UFZ A;  3LUT B;  2QTS A;  4O2A A;  4JI7 B;  4YXW G;  1PP9 H;  4O4I A;  2PGG A;  3KCX A;  4TWK A;  3E8G A;  5IY5 C;  2E75 B;  3HKE A;  3T1C A;  1NKD A;  3A0H Z;  3ABM C;  2ETN A;  4KHP B;  3HB3 B;  4JI1 O;  2QWQ B;  4GKJ O;  4PA9 A;  2QSA A;  5LGU A;  5IWA B;  5EZY B;  4HZ3 A;  5JJN B;  2UXB O;  2VQF O;  4X8A A;  3JCZ A;  3STL C;  4JAA A;  2X6B A;  3CX5 F;  5H9C A;  3E22 B;  2Q68 A;  4O4J A;  3JAM N;  1Q7Y W;  1PNK A;  4O4L B;  4ZKI A;  2ZIO A;  2N74 A;  4DV6 B;  2VQE O;  3JD3 A;  1SES A;  3IGA C;  1K97 A;  3RYH A;  3H1H H;  1NQT A;  4B3M O;  2UUB B;  3D36 C;  1B04 A;  1SER A;  4DR7 B;  3JAT B;  4GKK O;  1SQV H;  1OCO B;  3JAW B;  1JR9 A;  1FD9 A;  3K9A A;  5FPO A;  1Z5V A;  3PN1 A;  2LGW A;  3T4D A;  4GX0 A;  4I0X A;  1HNW B;  4JV5 B;  1R3K C;  1RPO A;  3ZMZ A;  1WLE A;  2Y48 A;  4KP4 A;  2YDE A;  1UPG A;  3CSX A;  2Q7E A;  3ZRX A;  1R6T A;  5IJ0 B;  3JAR B;  5BZB A;  4U3J B;  1ZL8 B;  5LGT A;  1CPY A;  4JYA B;  4ABM A;  3I56 V;  4IL6 Z;  1NR1 A;  4GCZ A;  1V9P A;  4RQF A;  2FTK A;  2GHY A;  2A79 B;  2F1M A;  1CEZ A;  4X65 B;  2A0L A;  3EFF K;  1O9G A;  3WB1 A;  1SQX H;  1YTF D;  2JGD A;  1RM1 C;  1DTO A;  4JAS A;  4CS2 A;  1KC8 W;  1US6 A;  2ZNI A;  4HAM A;  3CYO A;  1OHH G;  1M90 W;  3D8C A;  1KQS U;  5LHI A;  5LBQ A;  1G8M A;  3DSQ A;  1K73 W;  4LF6 B;  3JAS A;  1DGS A;  3SJB C;  3CEI A;  2XAF A;  3TCU A;  4NXM O;  1H2M A;  4H0L B;  1MG1 A;  1FXK C;  1PNM A;  2OWO A;  5FNV B;  3BY6 A;  1S77 D;  3E8F A;  2Z5U A;  3ZX6 A;  3EXA A;  4YJ2 A;  4RO2 A;  3SYC A;  2ZIM A;  4K0K B;  3WG7 B;  4LFA B;  4OXS A;  5GON A;  4MVS A;  4I55 A;  1RSO B;  2R70 A;  2YS8 A;  1GK9 A;  4QIW F;  2EJ7 A;  2AZ0 A;  4X62 B;  2JS5 A;  5EBW C;  2JEU A;  3ABL C;  3AG3 C;  2QDO A;  3RFR A;  1R3I C;  2EIJ C;  3DXR B;  4X1I A;  3K9S A;  4R50 A;  1XDC A;  2BCC H;  2H8P C;  3A8T A;  1J95 A;  2ZR2 A;  2HP8 A;  4DR5 B;  1I0H A;  2IU3 A;  4UCU A;  5EC1 C;  3I55 V;  1ZLZ A;  1W0J G;  3B40 A;  1Y6X A;  3N27 A;  2Q0A A;  3KCY A;  4FFK A;  3JD4 A;  5B1B C;  2YXH A;  1NJI W;  3HKD B;  2ZDI A;  4N23 A;  5JH7 B;  3DC6 A;  2D2C B;  5EIB C;  4IYI A;  2B1G A;  4GX5 A;  1ZTE A;  1YZB A;  1VMG A;  5JJE B;  4Q20 A;  1XOU A;  2CK3 G;  1J5E B;  2IU0 A;  2D3O W;  4LNU A;  2YXL A;  4DXW A;  3ASO C;  1PD3 A;  3T1Y B;  3JCU Z;  4B3R B;  3CCJ V;  4X9Q A;  1K5S A;  3QO8 A;  2WA4 A;  2KG7 A;  5LGN A;  1XHZ A;  2Y4U A;  3WB2 A;  1V54 C;  5BMV A;  2UXC O;  3VQV A;  2OT5 A;  1QLN A;  2FYU H;  3BEH A;  1Y74 B;  3CCV V;  4G2K A;  2EX3 A;  4LF5 O;  5B1A C;  2WWW A;  4PA7 A;  1PPJ H;  4DR2 O;  1I08 A;  1KKC A;  1MAB G;  2WLI B;  1N0J A;  3UKM A;  4DK1 A;  3SYA A;  2ZD9 A;  2JRI A;  2KKW A;  4JI2 B;  5EIB D;  2H3O A;  1GM7 A;  2IBZ H;  4J7Z A;  3ZIA G;  2JS3 A;  4CS3 A;  1N34 O;  1XNR B;  1HWY A;  3MHS C;  3JD2 A;  4U7N A;  3P3P A;  1K5Q A;  2F23 A;  2L6L A;  1NVP D;  1WPX A;  4MVU A;  5J2U B;  2QTO A;  2XND G;  2Q5Z A;  1JJO A;  3MDS A;  4QPK A;  5GW7 A;  4LH7 A;  1IX9 A;  2E74 B;  5CA1 A;  4LFC O;  2Q7G A;  1SQQ H;  5KAF Z;  2P67 A;  5KA6 A;  4DUY O;  4DV2 O;  3N2K A;  4U3F H;  3RVZ A;  1S5H C;  4X1Y A;  2EIL C;  1H38 A;  2HVJ C;  3HR0 A;  2X0L A;  5A9G A;  5ITZ B;  3CJH A;  1VF7 A;  1N0N A;  1N32 O;  2PTM A;  3K5M A;  3K04 A;  4IHJ B;  2QM8 A;  5DEC A;  4AI8 A;  3AG1 B;  3IFX A;  3C3S A;  5J9P C;  2CGN A;  2ZE8 A;  3KZI Z;  5HFM A;  4J11 A;  4CS4 A;  4J80 A;  3T1H B;  3SR2 C;  1JFF A;  5CA0 A;  5L3E A;  1Y67 A;  4JZ2 A;  4JI3 O;  4LF7 O;  2W0X A;  3ZHU A;  1FPO A;  2BTQ A;  2A06 H;  1F7Y A;  2BSK B;  3OMN B;  3C3T A;  2OCC B;  3NR7 A;  4YJ3 A;  1AJP A;  2ZM6 O;  1YCI A;  1U96 A;  2YSU B;  3O9O A;  1PL0 A;  1GN2 A;  3J7A U;  3B77 A;  2IH3 C;  1GN4 A;  2VRZ A;  4JI0 B;  4L87 A;  2F66 C;  1COW G;  2HLD G;  5C8Y A;  1WJZ A;  2V4D A;  2HHH O;  1M5I A;  2BTO A;  5GTI Z;  2EBO A;  4D7T A;  3OMA B;  1OZ0 A;  4FM0 A;  4HBN A;  2Y0I A;  2EIK B;  1I94 O;  4DW0 A;  2WSS G;  3ZMT A;  1E79 G;  2WAM A;  2ZT9 B;  3A2F A;  1FXK A;  3BRC A;  4B3T O;  2X7R B;  1M56 C;  4LWS A;  1KB9 F;  2HVK C;  3VBB A;  2C2A A;  2P06 A;  2DE0 X;  1XMQ B;  1Q43 A;  4YY3 B;  2ILM A;  5IYB O;  4LF8 O;  1JX9 A;  2JEX A;  3SPJ A;  4PJ0 Z;  3CRC A;  4ZBM A;  4X1K B;  2AHY A;  5L3B A;  3LDE A;  1VP7 A;  4PA6 A;  3OTO O;  3QNE A;  4B3S O;  1SKV A;  1BS3 A;  4K35 A;  3C90 A;  2Y0P A;  2ARH A;  3F5T A;  5A2Q N;  1HW7 A;  2KSD A;  4Z1V A;  4DV5 O;  3ETQ A;  1YF2 A;  1L8D A;  4FFB B;  3ABK C;  1IBM O;  1SA0 A;  2Q6A A;  2OYQ A;  1R1B A;  4ZOL A;  4L8J A;  1LR1 A;  3F5W C;  3G4S V;  5K1P A;  1E1Q G;  4YIO A;  2LW7 A;  1QR8 A;  5IE9 A;  1AP6 A;  1JA8 A;  4D7S A;  1THZ A;  1N36 B;  4FMT A;  2UU9 B;  5LMU O;  4H37 A;  2ZIN A;  3FYE B;  4XDJ A;  3K5O A;  4WF9 V;  1A32 A;  5JQG B;  3X2Q C;  4X66 B;  3SYP A;  1VQ5 V;  3K0G A;  3CWB H;  4J42 A;  4YIP A;  2GTS A;  3VQY A;  3OR7 C;  4DV1 B;  1NH2 B;  1GN3 A;  4TV8 A;  2PI4 A;  1BHB A;  2CTR A;  4F6R B;  1CXZ B;  1VF6 C;  3RYI A;  3CHX A;  2CH7 A;  4WFH A;  2X6A A;  2N05 A;  4O2A B;  1CP9 A;  3W7S A;  3CRQ A;  5TIS Z;  3ML0 A;  1HNX B;  2L35 A;  4H33 A;  4JTD B;  4O4I B;  4UUJ C;  2YID A;  5JVD A;  4AQY B;  3ABT A;  3J81 N;  3HKE B;  1H2G A;  2JGU A;  1OCO C;  4GT1 A;  3MHH C;  3BA8 A;  4YHH O;  1VQ8 V;  1TA8 A;  4R8C A;  1GAX A;  3K59 A;  3OE7 G;  4FZ0 A;  3LNM B;  1I5Y A;  2GSM B;  4TUY A;  5LMN B;  1R3J C;  1NTM H;  1YIT V;  4OX9 B;  4MW3 A;  3AG2 B;  2K9P A;  2PYJ A;  4JZG A;  4U7O A;  4FLZ A;  4WBN A;  3THO A;  1AJQ A;  1OCR B;  2ZR3 A;  3CCR V;  3BVO A;  3APQ A;  2XAJ A;  2W0F C;  2YXY A;  3P3N A;  3MD0 A;  2O57 A;  3RYH B;  4KXR A;  1XNQ B;  1M57 B;  2YIC A;  5L3F A;  1Y4M A;  3P30 A;  3H1I H;  4JI1 B;  3CRA A;  4GKJ B;  2M6Y A;  1R6N A;  1P7G A;  1GKF A;  4I50 A;  1SS3 A;  4I0X B;  4JAU A;  2F93 B;  5KHI A;  1VAR A;  3CXC U;  2UXB B;  3JYC A;  2VQF B;  3JSN A;  3ZHR A;  4DRX A;  1PV0 A;  1FXV A;  4JTA B;  1IXM A;  3UCS C;  4E2L A;  3UO3 A;  4NKG B;  5LXT A;  3RT3 C;  5CA3 A;  2GV9 A;  3JAL B;  1NT2 B;  3CD6 V;  5C93 A;  3RGB A;  2WLH A;  4RAI A;  1OV9 A;  4B3M B;  2YIB D;  2RN9 A;  4DUZ O;  5LA6 A;  3L70 H;  3ZRW B;  2K1E A;  4GKK B;  5KX5 A;  3OTF A;  2QWP B;  3AG4 B;  4P2Z A;  1IBK O;  2HFE C;  2JGD B;  1F4N A;  1EZJ A;  4J9Z B;  3ZS8 C;  3CCQ V;  5EBM C;  3FYI B;  4H13 B;  4GLX A;  4TOI A;  2DMX A;  2QWN B;  3WG7 C;  2WA3 A;  5B3S C;  2LO1 A;  2CAZ C;  3BAA A;  5CBF A;  1SET A;  2QA4 V;  3GWO A;  2BE3 A;  1FYJ A;  4FLV A;  2YC0 A;  2YI8 A;  2RNB A;  1EN4 A;  1N33 O;  1PM9 A;  1EZV H;  4BIO A;  1P4R A;  5IYZ A;  2ZXW B;  4JPR A;  4LFB O;  2LGQ A;  2X6C A;  4TQD A;  1NR7 A;  3OEH G;  1S5J A;  4JI8 O;  2XHB A;  3FFQ A;  4KUM A;  3RYC A;  2IJH A;  4YJ2 B;  1P84 F;  2QKS A;  3QO5 A;  4TQF A;  2ATK C;  5GON B;  2KQX A;  2R9A A;  4I55 B;  1VQ9 V;  4MTO A;  1FJG B;  3CXH F;  4PA4 A;  3ZHV A;  5FPR A;  1VQP V;  4N21 A;  3ZN1 A;  4X1I B;  3GWK C;  3H1L H;  1MSD A;  3CRM A;  3UM7 A;  3OEE G;  2Q4P A;  2EJR A;  4BIU A;  1Q3E A;  1OCZ C;  4IGG A;  3DTU B;  2XAQ A;  1WA8 A;  1ORQ C;  1M9N A;  3Q4H A;  1WPB A;  4UCR A;  1SC5 B;  5LP6 C;  4XDL A;  3JD1 A;  4B7K A;  2UUA O;  2R9R B;  4LCU C;  4IIJ A;  3B4S A;  2HKO A;  3CRR A;  3SJC C;  1TGO A;  1HNW O;  4LNU B;  3JAK A;  4I9Q A;  2Y69 B;  2W6J G;  4JI4 O;  2UXD O;  4UB8 Z;  3ZJZ A;  2P6J A;  1K9M W;  1EFR G;  1XIL A;  4TT3 G;  1ROP A;  4DR4 O;  3KKY A;  1PNL A;  5BMV B;  2GUZ A;  4EFB A;  4QJF B;  2Q69 A;  5IY5 B;  3N2G A;  2DWD C;  4Q6G A;  5KMG A;  3S3W A;  1KD1 W;  4J41 A;  2IJI A;  1GTO A;  4PEL A;  1SQG A;  1AI6 A;  3BCC H;  1AVM A;  3ZED A;  4FIP C;  1OCC C;  5J2T A;  3ETD A;  3QTC A;  2P4V A;  5LL6 Y;  2DQ3 A;  2YIB A;  3ZRV A;  1XRE A;  3CMA V;  4PDM A;  5EYP A;  2WLN A;  1FS0 G;  1VEW A;  4QE7 A;  4RUF A;  1DF5 A;  1SRY A;  4TSF G;  2QKC A;  2UXC B;  5F2V O;  5EBL C;  2A7W A;  1H8E G;  4QPJ A;  2ZKO A;  3H1J H;  4DV7 O;  5CA1 B;  4LF5 B;  2OTL V;  4JTC B;  2FL4 A;  3ABU A;  1Q6I A;  3N2K B;  1XMO O;  2B1I A;  3ICX A;  4X1Y B;  3ASN C;  5BXZ A;  4PV1 B;  1SQB H;  5E79 Z;  1R6K A;  1JVM A;  3UT5 A;  5DM6 V;  1MNG A;  3CJH B;  1IZ3 A;  4QGP A;  1MOF A;  2QGN A;  3E35 A;  3LDC A;  3QG5 A;  4RWU A;  1P49 A;  2R9I A;  3ZHT A;  5KHK A;  2B5U A;  1VIB A;  4GX2 A;  3TXS A;  4JYY A;  4D6T H;  2EIK C;  2LQT A;  4O2B A;  4MW8 A;  4LFC B;  4NTY A;  1OJH A;  3CCE V;  1JFF B;  4DUY B;  1ZX3 A;  5CA0 B;  4B7E A;  4DV2 B;  2WLL A;  3SPI A;  2ADP A;  2P5O A;  1KBH A;  1RM1 B;  1G4Y B;  3CP1 A;  3K06 A;  2BTQ B;  3L9D A;  2EIN B;  1H2S B;  5CB4 A;  4LF4 B;  1UFI A;  4YJ3 B;  4UV9 A;  5IJ9 A;  3JD0 A;  4FVM A;  2DYS C;  1BQZ A;  1WP8 A;  1XI1 A;  3RWR D;  3MAQ A;  2IJK A;  4DV0 O;  5C8Y B;  4KL1 A;  3CB2 A;  3ZRS A;  4FZ1 A;  2LJ2 A;  3D36 A;  3JSL A;  4X20 B;  3T1Y O;  3E8B A;  2ZQM A;  2B9Z A;  1NU1 H;  4JI6 O;  2DYR C;  1FXK B;  5HFL A;  4JI3 B;  1JJ2 U;  4J10 A;  4CH4 A;  4LF7 B;  2LFR A;  4LWS B;  3K58 A;  3HKD A;  4UCV A;  1VQO V;  4BW5 A;  1QHT A;  1AI4 A;  4UB6 Z;  3DGE A;  2ZM6 B;  2XAG A;  2JDI G;  4DR6 B;  1R73 A;  2JJ2 G;  1WNS A;  3D3Q A;  2RDC A;  1IVS A;  3GVM A;  4DYL A;  2HHH B;  3ABL B;  2EIJ B;  3CS5 A;  4EB6 A;  3CCL V;  2EUL A;  2GBO A;  2HEP A;  1DK1 A;  1NBM G;  3BHP A;  4I7Z B;  1TUB A;  3IJ4 A;  2EZO A;  5KA5 A;  4B3T B;  4DR1 O;  4MVQ A;  5B1B B;  3OFN G;  3NXS A;  3L75 H;  1SA0 B;  4WFE A;  5DN6 G;  2CDY A;  4CC5 A;  4OPH A;  4ZOL B;  4WCE V;  2PY5 A;  1D2D A;  1Q6U A;  5LP6 A;  4CBC A;  4LF8 B;  3TXQ A;  3ZCC A;  1QCE A;  1IBL B;  1NTK H;  4DV3 B;  3W7X A;  3HPL C;  2OIG A;  1Q90 D;  2CGO A;  1AR1 B;  3OTO B;  5E1A C;  2IH1 C;  4B3S B;  2IJJ A;  3ASO B;  3LSS A;  3K57 A;  2V1D A;  1MA1 A;  1FFX A;  4C7U A;  3G6E V;  4WFG A;  1KEC A;  1K4D C;  2QWR B;  4FM2 A;  4MVZ A;  1YVW A;  1IBM B;  4TV8 B;  2QJ1 A;  2JIZ G;  1GM9 A;  4BR6 A;  2HJD A;  5B5E Z;  3OGI B;  4FM1 A;  1NH2 D;  1ENV A;  1QVG U;  3RYI B;  5KLV H;  5B1A B;  3RBZ A;  2CH7 B;  3D3I A;  2IW5 A;  4A5U B;  5LMU B;  4UCS A;  4Z2W A;  2AGA A;  5JVD B;  1AIL A;  3OM3 B;  1X4T A;  1SF9 A;  1M57 C;  5AG2 A;  3CCM V;  3ZMV A;  1LNQ A;  1WN7 A;  3RYF A;  1I5X A;  1QLE C;  1MMM A;  4JI0 O;  2EIM B;  3KG2 A;  1E1R G;  1HP8 A;  4NB5 A;  1P7B A;  4DK0 A;  2NLJ C;  1GRJ A;  2BOB C;  3U0Z A;  5K1X A;  3M99 B;  1HDJ A;  4EFE A;  3HKC A;  3W7W A;  4TUY B;  4H44 B;  3U10 A;  4EEQ A;  2ZNJ A;  2E3C A;  5D5P A;  1K33 A;  4WBN B;  2ZCE A;  2Q9L A;  4MT8 A;  1GMG A;  1Y76 A;  2H94 A;  4LH6 A;  5DED A;  1TVK A;  1M1K W;  1G6U A;  5LYJ A;  2P90 A;  4YHH B;  2Z3Y A;  2VWJ A;  1EBO A;  4NXN O;  4MVR A;  4I50 B;  4P9P A;  3K08 A;  1HNZ O;  4LF9 O;  4X64 O;  5B66 Z;  4DRX B;  3B2E E;  2QR4 A;  1JPX A;  4FLX A;  3UO2 A;  4GX1 A;  4PA3 A;  4P30 A;  1AP5 A;  5LXT B;  3CE2 A;  3FB8 C;  1F23 A;  3I5D A;  3R66 A;  2F4V O;  1NS1 A;  3OMI B;  1KKD A;  5LA6 B;  2ZXW C;  2AXT Z;  1JQ0 A;  2A3Q A;  4ZI7 A;  5JCO C;  5KX5 B;  3ZBH A;  4HNA A;  2DW4 A;  4MTX A;  4DW1 A;  3WU2 Z;  2AZ2 A;  1GM8 A;  1I7F A;  1Q82 W;  5BR8 B;  1BZK A;  3J80 N;  3AK1 A;  2WPD G;  4GUN A;  2Y4T A;  3RW0 A;  4O4J B;  4DV1 O;  1JMK C;  1KYO F;  1M56 B;  2UUC O;  4CH6 A;  3OW2 U;  2XUM A;  4DV4 O;  4BW9 A;  3QVN A;  4X88 A;  2YIA A;  2ZE6 A;  4BAY A;  4MTG A;  3BAB A;  4DUZ B;  1V55 B;  3S3X A;  1KP2 A;  2YEV A;  4Z1M G;  1Q81 W;  4W4K A;  4JI5 O;  4QE9 A;  2LP7 A;  4TV9 A;  5IYZ B;  3UQ8 A;  1IBK B;  2HJF C;  5H5N A;  1K4C C;  4FJC C;  4JAV A;  2XAS A;  3HKB A;  3K5L A;  2XT9 A;  3RYC B;  3B8N A;  3L71 H;  1MZF A;  5LHG A;  4ZHQ A;  2GDS A;  2KB1 A;  4PD4 F;  5H6R A;  1TUE B;  1VQ4 V;  2Q73 A;  1GH6 A;  3A0R A;  5CMU A;  5H2F Z;  4LP8 A;  2VQE B;  1BL8 A;  1AI7 A;  3ABK B;  3P32 A;  2Z0A A;  1BCC H;  2LW1 A;  3LDD A;  1N33 B;  2Y69 C;  3ZHS A;  3WB0 A;  5LMN O;  3FAV A;  4OX9 O;  3QO7 A;  3TK1 A;  5IYC O;  4LFB B;  1XL6 A;  3G80 A;  5JWP A;  2PZS A;  2Q0O C;  2P22 C;  4CH3 A;  4JI8 B;  2E5L O;  4DR3 O;  2ZE5 A;  3ETG A;  4I4T A;  1ARO P;  4HYO A;  1WA8 B;  4NTX A;  3ZHQ A;  4UVA A;  3H9V A;  3X2Q B;  1XNQ O;  3Q4H B;  2BOC C;  1W59 A;  2ITC C;  4DO2 A;  1YEW A;  1HR0 O;  4O4H A;  4IIJ B;  4R6Z A;  3JAS B;  3L74 H;  1FFT B;  1H2K A;  2FB5 A;  3LSQ A;  1FAF A;  1WAZ A;  2QE7 G;  3JAK B;  1YSC A;  3ZMU A;  4R7C A;  4JI7 O;  1K3E A;  2Q67 A;  1YDX A;  1GN6 A;  2LFS A;  3AK3 A;  2MK3 A;  3OR6 C;  4P9O A;  3TET A;  4MVM A;  2GUZ B;  1ZWI C;  3H01 A;  3VQX A;  5LOV A;  3N2G B;  3FB6 C;  5L3G A;  3CCS V;  4KHP O;  2GTA A;  1SZX A;  1WB8 A;  5KMG B;  2UUA B;  1RFY A;  3G6B A;  5IWA O;  5KHH A;  4JGS A;  5D5Q A;  4K8Z A;  4PI2 A;  4KFM A;  4PHZ A;  1Q5O A;  2CUG A;  1YXB A;  2Q8V A;  3FB7 C;  4NXM B;  5J2T B;  1UJW B;  3WFV A;  3IC9 A;  4JI4 B;  3K79 A;  2UXD B;  2DOS A;  1FXH A;  3FKS G;  2ZE7 A;  3E83 A;  3STZ C;  5EYP B;  2HR3 A;  3JAL A;  1XEQ A;  4DV6 O;  4DR4 B;  1JCH A;  4MTF A;  5L3D A;  2UUB O;  3ZRW A;  4NYK A;  4ASU G;  4DR7 O;  1BQ0 A;  3T4Z A;  3U11 A;  2FML A;  4FLT A;  1QU7 A;  5EZY A;  2JK5 C;  4G28 B;  4JV5 O;  2EIN C;  4XDK A;  4OGQ B;  2YUA A;  4AHC A;  1BSM A;  1VF6 A;  4PDV A;  3E22 A;  3UT5 B;  4JYA O;  4O4L A;  2KG7 B;  1QNM A;  1PKX A;  1FJG O;  1Q8I A;  4UVB A;  3AG7 A;  4LR3 A;  2CTW A;  5IYD O;  3G71 V;  1S3J A;  2Q7H A;  4W4L A;  3W7T A;  1NTZ H;  3JAT A;  4X65 O;  3SPG A;  1M4U A;  1KU9 A;  3JAW A;  3ABM B;  3M7M X;  1YJW V;  4DV7 B;  4O2B B;  5JCO A;  5IDJ A;  1B06 A;  3QF7 A;  1B6Q A;  2WLL B;  1XMO B;  1RP3 B;  1L1F A;  1S76 D;  5CB4 B;  5IJ0 A;  5B3S B;  3JAR A;  2XAH A;  4U3J A;  5IJ9 B;  1ZL8 A;  3SYO A;  3BA9 A;  4FK5 C;  1ZSP A;  2QM7 A;  4RUE A;  3AG1 C;  4LF6 O;  1KP3 A;  1YTF B;  3OAA G;  4PI0 A;  5KAI Z;  4EKW A;  2ADQ B;  4GZR B;  1EN5 A;  4JF3 A;  1JOY A;  2NR5 A;  5CN0 A;  4DR2 B;  3F7Y C;  3SPH A;  1Q86 W;  3ZMS A;  1F51 A;  5KHG A;  3CC7 V;  2OCC C;  1O9H A;  2AHZ A;  2MW2 B;  4K0K O;  4XBF A;  4LFA O;  2QKA A;  2CTQ A;  2OCH A;  1N34 B;  3TJT A; 
#chains in the Genus database with same CATH homology
 2KG7 B;  3GWK C;  4GZR B;  3OGI B;  3FAV A;  3ZBH A;  3FAV B;  2B9Z A;  3GVM A;  3TXS A;  3O9O A;  3G80 A;  2AZ2 A;  4ABM A;  4LWS A;  4LWS B;  2VRZ A;  3TXQ A;  3HR0 A;  2AZ0 A;  1WA8 A;  2DE0 X;  1WA8 B;  4I0X A;  2VS0 A;  4I0X B;  3Q4H A;  2KG7 A;  3FD9 A;  3Q4H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...