2B9ZA

Solution structure of fhv b2, a viral suppressor of rnai
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
GAMPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVGRMVTSLLEKPSVVAYLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the flock house virus B2 protein, a viral suppressor of RNA interference, shows a novel mode of double-stranded RNA recognition.
pubmed doi rcsb
source organism Flock house virus
molecule tags Viral protein
molecule keywords B2 protein
total genus 25
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2b9zA00
4GZRB 4I0XB 3FD9A 3Q4HB 4I0XA 1WA8B 3FAVA 2VS0A 3G80A 1WA8A 3TXQA 4LWSA 2AZ0A 3OGIB 2DE0X 4LWSB 2VRZA 2B9ZA 3HR0A 3ZBHA 3FAVB 2KG7B 3Q4HA 3TXSA 2KG7A 3O9OA 4ABMA 3GVMA 3GWKC 2AZ2A
chains in the Genus database with same CATH superfamily
2ZM6O 4PA9A 4FLYA 4QNHB 1N32B 3AG1C 2YIAA 2QSAA 1FJGO 4GKKB 3MHHC 4KHPB 2HP8A 4MVSA 3ABLC 2JIZG 3SJQC 3ZHSA 1IDSA 4KFMA 3BVOA 1S3JA 4LF6B 1I5YA 1Z2GA 3L72H 4QPKA 2VQFB 2IJKA 4O4JA 3CCUV 4XDKA 2WLLB 3QO8A 4UVCA 4X62B 1PNLA 2W6JG 2PYLA 4NXMB 4I4TB 1YJWV 3K5OA 2GTAA 4CS3A 4RQEA 5LHIA 2F93B 3T1HO 4HZ3A 2IW5A 5LHGA 3A0BZ 2OWOA 3CMEV 1O9HA 1N33O 4J7JA 3A2FA 4DR1B 2QWQB 3NR7A 3JCZA 3X2QC 2ZD9A 1QVFU 1RSOA 2VWJA 1N36B 4LFBB 1WAZA 4JASA 3G4SV 4X89A 4DUZO 1M57C 3IC9A 2LFSA 4KP4A 3K06A 1BQZA 3K5LA 5LA6A 1JA8A 3E86A 1VQ9V 2IU0A 4B3TO 2ZKOA 1JJOA 4CS4A 4DK1A 4HNAB 1RP3B 1S5LZ 1VQNV 2Z3YA 3M7MX 2WSSG 4PA3A 1Q6IA 1M4UA 3FAVB 4LCUC 2CTQA 1OCOB 5JJJB 1DTOA 5IT9N 1TVKB 4J10A 1FPOA 2HVKC 5FLXN 1F4MA 4GUNA 5A2QN 5IYBO 4X1KB 3OTOO 2XTAA 3X2QB 3L74H 1VEWA 2Y4TA 4G28B 5BY1A 3ICXA 5LP6B 4GKJO 5KAIZ 4HAMA 2PI4A 2QM4A 1Y76B 2QTOA 2CTPA 4KHPO 2VQEO 5IWAO 1PPJH 1L1FA 2AGAA 4LF8O 2EIMB 5CA3A 1B3QA 3P3NA 3RYIA 3BA8A 5IDJA 2BCCH 1B06A 2LGWA 4JI6O 3ASNC 3CJHB 1LNQA 4RAIA 2RN9A 4X88A 4GX2A 2UUBB 4O2BA 4R6ZA 4H0LB 5JQGA 1MZEA 1FFXB 3CPWU 1MNGA 4E2LA 4DR4O 2DMXA 1R73A 3RYCB 3A0RA 1JFFB 2A06H 1K33A 3E8GA 3THOA 2Q5ZA 4H37A 1YHQV 2BTQB 2Y69C 3CCLV 3WG7B 3T2MA 4IYHA 4JI3B 1GN4A 1NTZH 1NS1A 2HJFC 3CCSV 2CE4A 4ICGA 2DN9A 1XL6A 4WBNB 2EULA 4TT3G 1PKXA 5AG2A 3KZIZ 5GTIZ 3ZMZA 4DO2A 4B3SO 2BTOA 2Q0OC 4X65O 2WLIB 4GKKO 1NQTA 3N2KB 4L87A 4YJ2A 2HLDG 1Q43A 1HP8A 3RVYA 3T1YO 1FFTB 5KUKA 4TOIA 1O9GA 5KHJA 3JAKB 5IJ9B 1FXHA 3ABLB 4FLTA 4QIWF 1P49A 2ZT9B 1Q86W 4X1IB 1EM1A 5IJ0B 3E8HA 4PA6A 1MMMA 4UUJC 4BR6A 4JI7B 2WLLA 3BFRA 1F4NA 1ROPA 2UXCB 3AG2C 1WPBA 2LGQA 1WP7A 1IBLO 5KHIA 4DR2B 1Y6XA 1MZFA 4PI2A 5J2UB 4MTOA 1NVPB 4TV8A 2YXYA 4CH5A 4FLVA 4LF5B 2QKAA 1XQ8A 3OMAB 3CP1A 3ZN1A 3SJAC 2DYRB 1EN6A 2DQ3A 1EBOA 1S72V 5LGTA 4WFFA 4G2KA 2PF4E 4U3JA 3S3XA 3ZMTA 2UXBB 2HJDA 3HKBB 5CA1B 2HHHB 4DR7O 4X20B 2YXLA 3KG2A 4CC6A 5JQGB 4LF7O 3JAMN 4MTFA 2EJ7A 4DUYB 3EVKA 5HFLA 4TUYB 2WPDG 5LGNA 4J41A 1F7YA 4J9ZB 2PY5A 4JAVA 5B1BC 1CPYA 1EN4A 3HR0A 3IC7A 1VQ6V 3MDSA 4GKJB 1SQQH 1N8RW 3BPZA 2OTJV 5JCOA 1Y76A 1HW7A 4UV8A 2UXDB 1QNMA 3FB7C 5CBFA 2P7TC 4LNUA 1F23A 3EHBB 4JI2O 2R9AA 3LDDA 3E22B 1LUWA 5IYCO 3ZIAG 1TVKA 1V55B 3CYOA 2CDYA 5LXTB 1BQ0A 4WFBV 1NR7A 2YICA 2YUAA 2DWDC 4O2AA 2LFRA 3ZHVA 2H8PC 4JAUA 4JGSA 4MS2A 3CRQA 4LWSA 5H5NA 2P4VA 3B40A 4MTXA 4FMTA 2X6AA 5DEDA 5LYJB 1YIJV 1GAXA 1S0VA 2VQFO 1OCRC 4B7KA 1Q3EA 3E8FA 1U96A 2BTQA 1DF5A 3EXAA 4GZRB 3MD0A 4OPAA 3D36C 1W0JG 4RUEA 4JI1B 4JI3O 3HKEA 3ZRWB 3APQA 1VQMV 1M57B 1Y74B 2FKXA 5JJNB 1KBHA 2X0LA 2ZQMA 3JAKA 3OMNB 3RYHB 4D7TA 2CGNA 4X64O 4X1KA 2L6LA 3ETEA 4D6TH 1KQSU 2CTRA 3IAYA 2V4DA 3JARB 1PNMA 2IH3C 4X20A 2O57A 3ASOB 1N0NA 5TISZ 1I08A 4ZOLA 3H1JH 3CC4V 3L75H 2VQEB 2ARHA 2CUGA 4ABMA 2RDCA 4I55B 2LJ2A 2E3CA 4DV5B 4F6RB 1G1XB 1K7DA 4DW1A 2EIKB 1AJQA 5KHHA 4FFBA 1K4CC 3DXRA 3RW0A 4DV4B 4JYBA 5IY5C 1AROP 2BSKB 4LH7A 2YI8A 2OIEA 3ETDA 3ZRWA 4UCTA 3ZCCA 3VQXA 1IX9A 5LGUA 2VWKA 1Q5OA 2DWEC 1M9NA 2XOKG 2XAHA 4DUYO 4OX9B 1G8MA 4IL6Z 1P4RA 4DR1O 5GTHZ 1T5EA 3UT5B 3WB0A 2WLJA 1M90W 4JTDB 3CCRV 2F95B 3U10A 2OCHA 1VF7A 2XUMA 4JZ2A 2V1DA 1U97A 5J9PC 2YEVB 2EIMC 3SPHA 3QF7A 4YHHB 5EIBD 3CC7V 1YTFD 1YI2V 1SERA 3S3WA 1YXBA 1VQ4V 3B8MA 4LF4O 3T1YB 1WB7A 2P4KA 3JYCA 1SS3A 5EC1C 1QLEC 3L73H 2UU9O 5ITZA 1EZJA 1GKFA 4BW5A 1K4DC 3APOA 3SDLA 5KHGA 3CCQV 3H1IH 1R1BA 4JI2B 4DV3B 4NR1A 1WLEA 2AXTZ 3F5TA 1L8DA 1OHHG 3ASNB 1SQFA 2WWWA 1H2KA 1Y67A 2UXNA 1NBMG 1QLEB 4F6EA 3FD9A 3ZRSA 4I9QA 4PHZA 3ABMC 5E79Z 1WA8A 4GYCB 1L0NH 1AP5A 1SZXA 3OMIB 2H3OA 1XNQO 3UQ8A 1HNXO 4DV4O 2A3QA 4AI8A 1V54C 2Q4PA 4H13B 5BXZA 3LNNA 4CH4A 4U3FH 5LXTA 1QVGU 4DR3O 3Q4HB 1YDXA 3E22A 4LFAB 2A7WA 3DC6A 3CS5A 1YVWA 1XOUA 1ZX3A 1YZBA 2JS3A 3BA9A 2IJJA 5CBGA 1SQXH 4UV9A 2OYQA 2GTSA 3RN4A 2FMLA 1V54B 4B3RO 3CSXA 4PD4F 5FL7G 5JH7A 4XDLA 1SESA 2QE7G 4X65B 4NYKA 5DN6G 5CB4B 4RWUA 1ZL8B 2OTLV 4Z2WA 4CC5A 5EC2C 4UVBA 1AR1B 1I5XA 3SPIA 1VMGA 4K0KB 2MK3A 2CH7B 1J95A 4TQDA 4K8ZA 1PL0A 3G80A 2K1EA 4P30A 4B3MO 1M56B 4OX9O 3RWRD 1YJ9V 1GM9A 2NNUA 4JI5O 4X1YA 5H2FZ 1ZTEA 2HKOA 2XAJA 4FFBB 1UJWB 4BAYA 5L3EA 5EIBC 4ZI7A 1RM1B 5IE9A 4JI6B 3JASA 2GDSA 2JJ1G 1TA8A 2AZ0A 2UUBO 4I55A 5J2UA 2XASA 1GRJA 5B1AC 4DV0B 2OCCB 3H01A 2ADPA 4K0KO 1IBMB 2YIBA 4LR3A 4O2BB 1W2BU 1Q82W 3CCVV 1THZA 4XDJA 4DK0A 4MSWC 3FYIB 4FVMA 3H1KH 2RNBA 4I50B 3ZHRA 1MA1A 4PA4A 1IBKO 5LMUO 2ATKC 4GCZA 4LF7B 3I56V 3K9SA 3CHXA 1OJHA 1XMOB 1QBZA 2XNDG 4OGQB 1MSWD 3DGEA 3M8AA 4DRXA 3DSQA 4JI8B 4XBFA 3K57A 1OCRB 1AI4A 2GSMB 1FKAO 3G71V 5IYDO 4DV5O 2W6IG 2UUAB 1AJNA 5EBMC 3ZMUA 2HR3A 2Q67A 3TXQA 4MTGA 3CXHF 1H8HG 4E4EA 1JMKC 3ABMB 1XMOO 1W59A 3OR6C 4BW9A 1MSDA 1OZ0A 3BHPA 5LMNO 4WCEV 4JI4O 5JJEB 2GBOA 1MOFA 5H9CA 1ENVA 4IT5A 1QQCA 2BE3A 2E5LO 2F43G 1GTOA 4G27B 3UO3A 1M93A 4DR2O 3RFRA 2UUAO 3A0HZ 3QO5A 4LBEC 3BEHA 4R7CA 5F2VO 4BIZA 1AR5A 1XHXA 3AEIA 4YY3O 2DW4A 1N34O 1XMQB 3K79A 3L9DA 5LOVB 3KCYA 2GUZB 2YC0A 2QWNB 3BRCA 2FTKA 4LFAO 4FFKA 1BGYH 1SETA 3JD2A 1BS3A 1QLNA 1BHBA 4MW3A 1J5EO 1N0JA 5B1NA 4ZBMA 2AW9A 3C90A 4OPHA 3BAAA 4ZI7B 3FB6C 1VF5B 1HNWB 4AILC 2JEUA 1Q6UA 4X1YB 3SJCC 2QWRB 3JD1A 2Y0PA 3HKBA 5CA1A 2QWOB 4UFZA 2X7RB 3RVZA 4IIJB 4TWKA 3OUSA 3A8TA 5GW7A 1VF6A 5J2TB 4JI8O 4TV8B 1M1KW 3ZMSA 4WFEA 2ZE6A 4J11A 1NVPD 1I7FA 5B3SC 4DR5B 5KHKA 3W7TA 1P7BA 2QEXV 4NB5A 4YIOA 1HDJA 4PDLA 2CAZC 2WLKA 3JARA 2R9RB 4EB6B 4HBNA 2QGNA 2JS5A 3H9VA 4DV0O 1DF4A 4P9OA 4JYCA 2EILC 2AZ2A 4I50A 1BMFG 1IZ3A 4DV6B 3AG4B 1DLBA 3HB3B 2P67A 2DQ0A 5JH7B 1PL4A 1TUEB 5KA5A 1XDCA 1R3LC 1GN2A 1CXZB 1OCCC 1BZKA 1FJGB 4NTXA 2MW2B 4LFCB 1XNRO 2CK3G 2GUZA 1AP6A 2Q8VA 3QTCA 4YXWG 5CBHA 4DUZB 2EX3A 5B1AB 1ORQC 1SC5B 4X66O 4PA7A 3E2EA 2QR4A 1NH2B 2UXCO 4X64B 1IURA 1VQ7V 1Y4MA 4I9WA 1NT2B 1BCCH 3OUFA 4LWSB 2PYJA 3SJBC 2RMKB 5CMUA 2ZINA 5LMNB 2PTMA 1D5NA 5L3FA 2KG7A 3SYOA 1VQLV 2L35A 3UO2A 3UM7A 1RM1C 2NN4A 5IYZB 1I94O 4EKWA 2Z0AA 1S76D 4FLXA 5KA6A 4J7ZA 5D5PA 4DV7O 2IH1C 1PNKA 4EEQA 1K97A 2UU9B 4Z1MG 2DOSA 3K08A 4DR6O 1GO3F 1R6TA 2YS8A 3G6BA 1XI1A 2PGGA 3DTUB 3O65A 4I0XB 2ITCC 3P32A 3TCUA 3J80N 3ZHTA 5LP6A 1JJ2U 3SPCA 4Z1VA 2G38A 1TGOA 3WB2A 3DC5A 4MT8A 3B2EE 4D7SA 2ZNIA 4JYAB 2W0FC 4UB6Z 3O9OA 2E74B 3T4DA 1IXBA 3GVMA 2LW1A 2KSDA 3W7WA 3K04A 4LF9O 1Y74A 3FAVA 3HKEB 1FXKC 1LUVA 1FXKB 1LR1A 4UCUA 4O4LB 1V9PA 1AR4A 1M5IA 4HNAA 1R3KC 5LOVA 4NXMO 5KX5A 4UCRA 2NLJC 2P22C 3SYCA 2QKCA 3ML0A 4QJFB 3CEIA 1KD1W 2ADQB 2EBOA 3IGAC 3AG3B 3P30A 1P84F 3VOUA 2F1MA 3AG3C 4AQYB 2JJ2G 2ETNA 3I55V 1NJIW 4DYLA 4PDMA 4ZOLB 1YSCA 2Q68A 1SKVA 1PP9H 3LSSA 5C93A 4U7NA 2M7WA 1QR8A 1KUQA 1R6KA 2ZE5A 1US6A 5B1OA 3STZC 1Q90D 2ZXWB 1WPXA 2ZXWC 3VQYA 3QVNA 2YI9A 5EYPA 4FM2A 4O4HB 1N4CA 1PD3A 4GX1A 1NTKH 4MVOA 5FNVA 2RJZA 3FYEB 3W7UA 1NU1H 5KMGA 4B3MB 3MHSC 4YJ3B 2B5UA 1K9MW 2LP7A 1YITV 5LL6Y 1N33B 3OEHG 3K03A 2IJIA 4J7KA 1ZAUA 2QM8A 2N74A 4AHCA 1K3EA 1R3IC 4U3JB 3QO7A 4O4IA 5IWAB 1E1QG 3B4SA 5FPRA 2N05A 1VQOV 2DYSB 3SPGA 3G6EV 3FFQA 3SYPA 4W4KA 2A79B 1N34B 3CE2A 5KX5B 4MVUA 1GK9A 5B5EZ 4JPRA 3VBBA 4O4LA 1RSOB 3EFFK 3CMAV 1G6UA 5EZYA 4JAAA 1QCEA 3BCCH 2ILMA 3K59A 3GB7C 2GHYA 2ODMA 4CH6A 5CB4A 4N21A 3BABA 5KUMA 3R66A 2HHHO 4DR7B 3K5NA 4K35A 2X6CA 1H8EG 5IY5B 2R70A 2Y4UA 2Q69A 4LNUB 2M6YA 5JVDB 4TUYA 2ZCEA 4LF4B 1URFA 5B3SB 1H2NA 2XAQA 2UXBO 2H94A 4QE7A 3CXCU 2EINB 1VQ5V 4J80A 1OCZB 3W7XA 3JSLA 4BWAA 1G4YB 2HVJC 1S5JA 3W7SA 1JQ0A 3LUTB 5EBLC 2EZPA 4ZKIA 2W0XA 4P2ZA 2PZSA 1XUQA 2QKSA 4K3AA 4BIUA 5EK0A 1SQBH 4ZHQB 4MVZA 3D36A 4DR5O 1JFFA 2JGDB 1VQPV 3ASOC 1FXKA 3CRMA 3OE7G 3ZBHA 2AHZA 2KG7B 3TXSA 2AHYA 2N04A 4UCSA 1IVSA 1AB3A 3PN1A 3IFXA 5IJ0A 3JATB 3KKYA 2KB1A 2IM9A 2WA3A 2ZR2A 4LP8A 5H6RA 1AILA 2FL4A 2Y69B 3OR7C 4LFCO 2JGUA 2K9PA 1OV9A 5KMGB 1R3JC 2XAGA 2R9IA 4DRXB 4TSFG 1NR1A 4YJ2B 1TUBA 4YIPA 1E79G 2IJHA 3OT7A 4FM0A 3JAWB 5KLVH 3UKMA 5DECA 1PM9A 1WP8A 2GV9A 2Q0AA 4DV3O 2OIGA 3RYFA 1B6QA 3VQWA 4YY3B 1PV0A 3H1LH 1Q7YW 2LW7A 1A32A 2CH7A 1H2SB 4LF9B 3SR2C 4O4IB 1FAFA 4IYIA 4UCOA 4O2AB 2WLIA 3C3SA 1GH6A 2RCVA 4UB8Z 4CS2A 1I0HA 3B8NA 3JASB 5C8YA 4WFAV 4QGPA 1I94B 1EN5A 5BMVA 3SGIA 2QM7A 5GONB 4H33A 3BY6A 1QHTA 1XNRB 1BHAA 2D3OW 4NXNO 1K34A 1HNWO 4DR6B 4NTWA 4Q6GA 3K3WA 3CRCA 2Z5UA 5B66Z 4UXNA 4JI5B 4IIJA 3HKDA 1P7GA 4H44B 3N2GB 3RYCA 3F5WC 4L8JA 3AK3A 3CB2A 2QWPB 4NTYA 1GM7A 2DYRC 3RBZA 2B1IA 2B9ZA 3WB1A 1XILA 2JVDA 1DK1A 1HWYA 1X59A 4WF9V 1Q8IA 1K92A 4JI0O 1NTMH 3ABKB 1IXMA 1QU7A 2WLMA 4BIOA 2E75B 4GX5A 2XT9A 3ZHQA 3JAWA 3JD0A 4F6RA 3AG2B 2EZOA 1RPRA 3F7VC 4FZ0A 3QNEA 3ZRVA 2X6BA 3D8CA 3K0GA 5LMUB 4FLUA 3ABUA 2JDIG 1YTFB 3HKDB 4MW8A 5JCOC 5BR8B 2NR5A 2FB5A 3CRAA 5CA0B 2WAMA 3ETGA 4AQYO 4DW0A 2YSUB 1K73W 3OFNG 4DR4B 4FJCC 1BE3H 2WA4A 5IYZA 1K5SA 2BOCC 2F4VB 2JRIA 4UCVA 1BT8A 4EFBA 5EBWC 1Q6HA 1HNZO 3KCXA 3J81N 4GX0A 3E8BA 1NZ6A 4QPJA 1DGSA 1WA8B 2JGDA 3TETA 4LF5O 2JEXA 3JALB 5JVDA 1TAEA 1UFIA 2ZE8A 4DV2O 2BSKA 2V7QG 2DYSC 1M56C 1KYOF 3CX5F 4X66B 4PDVA 4B3SB 2UUCB 3RYIB 1VIBA 1H2MA 1MABG 3MAQA 3CCEV 1KECA 5LA6B 3G67A 1WJZA 5K1PA 1AI7A 3WG7C 3NXSA 1K5QA 1RPOA 2Q7EA 4C7UA 3LSUA 4I0XA 4LH6A 1TUBB 1KKDA 2P06A 1X4TA 2Q7GA 3T4ZA 5IJ9A 4WFGA 1V55C 3SPJA 3STLC 1E1RG 4JI7O 3Q4HA 3M99B 3TK1A 4B7EA 3ZX6A 5BZBA 2JK5C 3AK1A 3F7YC 1VARA 1EZVH 3B77A 3CCJV 3JD3A 2QJ1A 2CTWA 2ZDIA 2DE0X 3OW2U 1XBLA 2OT5A 2IU3A 3DXRB 4R8CA 1WB8A 4FM1A 4LF6O 1BL8A 4F4LA 4FIPC 3WU2Z 3K0DA 2YXHA 4X62O 3D3IA 1S5HC 3OTFA 5CA0A 2E76B 2YIDA 2YIBD 3JALA 4Q20A 3TGUH 3WFVA 1GMGA 4UVAA 2F23A 5LP6C 5HFMA 4PV1B 3T1HB 3J7AU 2PI5A 1VP7A 1EFRG 4FPPA 4B3RB 1HNZB 3OM3B 2EIJC 4JF3A 3TJTA 1JX9A 1VQ8V 4FZ1A 4LFBO 1FD9A 4KL1A 3U11A 1JCHA 1RFYA 1FYJA 1H2LA 1J5EB 3JSNA 3CWBH 2A0LA 2ZNJA 3ZRXA 2EIJB 1FXVA 4IHJB 2PUSA 5E1AC 1KP2A 1XHZA 2Q73A 2RQ6A 1SZTA 5BMVB 3VQVA 4X9QA 3AK2A 1HNXB 2C2AA 5KAFZ 1AI6A 1SRYA 3HKCA 3CRRA 4GT1A 3IJ4A 5EZYB 4K8XA 4PJ0Z 4DV1O 1KMIZ 1BSMA 3OGCC 4U7OA 4KUMA 1HR0B 4JV5O 2ZIMA 2E5LB 2F4VO 4IGGA 3LNMB 2YDEA 2KKWA 1ZL8A 4WBNA 2LQTA 3RT3C 5H6QA 4DV2B 1QR9A 4RQFA 3ZHUA 3GWOA 1NH2D 4QE9A 2VRZA 4MVRA 4JI1O 2Q6AA 4LC1A 1YF2A 4YJ3A 4I4TA 1AVMA 4NKGB 2ZR3A 2HFEC 4DV7B 4O4JB 3E35A 4DXWA 1NKDA 1YEWA 1KU9A 5L3CA 3ABKC 1L0LH 4KXRA 5L3DA 4J42A 4W4LA 1KB9F 3OGIB 3K9AA 2DJVA 3OTOB 3K5MA 3JD4A 1FS0G 3RYHA 1XL4A 2EILB 3OEEG 3HPLC 4N23A 2P5OA 4JI4B 4CBCA 3ZS8C 4JYAO 4JYYA 2LO1A 5EYPB 4NXNB 3FB5C 1KKCA 4LF8B 1Z5VA 1UPGA 1CEZA 2XAFA 4GLXA 4TV9A 1Z5WA 4PELA 1ZSPA 1YCIA 3JATA 4TQFA 3CD6V 4MVMA 3L71H 3UT5A 2VS0A 4B3TB 3AG4C 5LYJA 1GN6A 2ZDIC 2A9HA 5A9GA 5C8YB 5D5QA 3C3TA 3B09A 1N32O 4RUFA 3ZJZA 4JI0B 1B04A 2OCCC 4JTAB 1OCCB 1OCOC 3I5DA 3ABTA 1COWG 1ZLZA 4CH3A 3AG7A 3D3QA 1AI5A 1NI8A 1KC8W 4CZZA 1K8AW 2WLHA 1R6NA 2WLNA 4YHHO 2IBZH 3ETQA 2FYUH 4X8AA 4HYOA 2Q9LA 1F51A 1JPXA 5DM6V 5CN0A 3RGBA 1XREA 4IHJA 1ZWIC 5FNVB 1MG1A 3FKSG 1YJNV 4DR3B 4RO2A 4I7ZB 5B1BB 2CGOA 4O4HA 4JZGA 4PDRA 4P9PA 3SYAA 4I5SA 1WNSA 1Q81W 1WN7A 4ZIBA 1SA0B 3E89A 2ZM6B 1S77D 3JCUZ 2QTSA 2B1GA 1SQGA 1SF9A 5LBQA 2UUCO 5L3BA 3ZEDA 4WFHA 3N2GA 3L70H 2F66C 3P3PA 4ZHQA 2UXXA 1SQVH 4DV1B 1SQPH 2KQXA 3K58A 1CP9A 2ZIOA 3HKCB 3LDEA 4A5UB 1HR0O 1XNQB 4JV5B 3SYQA 5GONA 3CCMV 3U0ZA 2Q7HA 1IBLB 4NVPA 2EINC 4FLWA 4B08A 3LSQA 4FLZA 2QA4V 5FPOA 2D2CB 1FFXA 3ZMVA 1AJPA 2XHBA 1W0KG 1VQKV 2EIKC 1H38A 4PI0A 1JOYA 5BR8O 4X1IA 3CJHA 3T1CA 1GN3A 4OXSA 5ITZB 4FK5C 1SA0A 2ITDC 3GWKC 3FB8C 1ZUQA 1VF6C 1JVMA 5L3GA 3RYFB 5K1XA 1N36O 1IBMO 2HG5C 1OCZC 2R72A 1XMQO 3CC2V 3N27A 4EFEA 3H1HH 3ZN0A 1IBKB 1Y66A 3N2KA 2HEPA 5JWPA 2ZE7A 3LDCA 1GM8A 2YEVA 2EJRA 3PJSK 1KP3A 2Y0IA 2BOBC 5LHHA 3UCSC 3OAAG 3AG1B 4TV9B 5J2TA 1XEQA 1H2GA 3OD4A 2UXDO 3FX7A 1JR9A 4EB6A 1D5AA 4R50A 2QDOA 1D2DA 2P6JA 4J9YB 4MVQA 2P90A 3QG5A 4JTCB 3E83A 4ASUG 4DV6O 3R65A 2Y48A
chains in the Genus database with same CATH topology
4GZRB 4I0XB 3FD9A 3Q4HB 4I0XA 1WA8B 3FAVA 2VS0A 3G80A 1WA8A 3TXQA 4LWSA 2AZ0A 3OGIB 2DE0X 4LWSB 2VRZA 2B9ZA 3HR0A 3ZBHA 3FAVB 2KG7B 3Q4HA 3TXSA 2KG7A 3O9OA 4ABMA 3GVMA 3GWKC 2AZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZR B;  4I0X B;  3FD9 A;  3Q4H B;  4I0X A;  1WA8 B;  3FAV A;  2VS0 A;  3G80 A;  1WA8 A;  3TXQ A;  4LWS A;  2AZ0 A;  3OGI B;  2DE0 X;  4LWS B;  2VRZ A;  2B9Z A;  3HR0 A;  3ZBH A;  3FAV B;  2KG7 B;  3Q4H A;  3TXS A;  2KG7 A;  3O9O A;  4ABM A;  3GVM A;  3GWK C;  2AZ2 A; 
#chains in the Genus database with same CATH topology
 2ZM6 O;  4PA9 A;  4FLY A;  4QNH B;  1N32 B;  3AG1 C;  2YIA A;  2QSA A;  1FJG O;  4GKK B;  3MHH C;  4KHP B;  2HP8 A;  4MVS A;  3ABL C;  2JIZ G;  3SJQ C;  3ZHS A;  1IDS A;  4KFM A;  3BVO A;  1S3J A;  4LF6 B;  1I5Y A;  1Z2G A;  3L72 H;  4QPK A;  2VQF B;  2IJK A;  4O4J A;  3CCU V;  4XDK A;  2WLL B;  3QO8 A;  4UVC A;  4X62 B;  1PNL A;  2W6J G;  2PYL A;  4NXM B;  4I4T B;  1YJW V;  3K5O A;  2GTA A;  4CS3 A;  4RQE A;  5LHI A;  2F93 B;  3T1H O;  4HZ3 A;  2IW5 A;  5LHG A;  3A0B Z;  2OWO A;  3CME V;  1O9H A;  1N33 O;  4J7J A;  3A2F A;  4DR1 B;  2QWQ B;  3NR7 A;  3JCZ A;  3X2Q C;  2ZD9 A;  1QVF U;  1RSO A;  2VWJ A;  1N36 B;  4LFB B;  1WAZ A;  4JAS A;  3G4S V;  4X89 A;  4DUZ O;  1M57 C;  3IC9 A;  2LFS A;  4KP4 A;  3K06 A;  1BQZ A;  3K5L A;  5LA6 A;  1JA8 A;  3E86 A;  1VQ9 V;  2IU0 A;  4B3T O;  2ZKO A;  1JJO A;  4CS4 A;  4DK1 A;  4HNA B;  1RP3 B;  1S5L Z;  1VQN V;  2Z3Y A;  3M7M X;  2WSS G;  4PA3 A;  1Q6I A;  1M4U A;  3FAV B;  4LCU C;  2CTQ A;  1OCO B;  5JJJ B;  1DTO A;  5IT9 N;  1TVK B;  4J10 A;  1FPO A;  2HVK C;  5FLX N;  1F4M A;  4GUN A;  5A2Q N;  5IYB O;  4X1K B;  3OTO O;  2XTA A;  3X2Q B;  3L74 H;  1VEW A;  2Y4T A;  4G28 B;  5BY1 A;  3ICX A;  5LP6 B;  4GKJ O;  5KAI Z;  4HAM A;  2PI4 A;  2QM4 A;  1Y76 B;  2QTO A;  2CTP A;  4KHP O;  2VQE O;  5IWA O;  1PPJ H;  1L1F A;  2AGA A;  4LF8 O;  2EIM B;  5CA3 A;  1B3Q A;  3P3N A;  3RYI A;  3BA8 A;  5IDJ A;  2BCC H;  1B06 A;  2LGW A;  4JI6 O;  3ASN C;  3CJH B;  1LNQ A;  4RAI A;  2RN9 A;  4X88 A;  4GX2 A;  2UUB B;  4O2B A;  4R6Z A;  4H0L B;  5JQG A;  1MZE A;  1FFX B;  3CPW U;  1MNG A;  4E2L A;  4DR4 O;  2DMX A;  1R73 A;  3RYC B;  3A0R A;  1JFF B;  2A06 H;  1K33 A;  3E8G A;  3THO A;  2Q5Z A;  4H37 A;  1YHQ V;  2BTQ B;  2Y69 C;  3CCL V;  3WG7 B;  3T2M A;  4IYH A;  4JI3 B;  1GN4 A;  1NTZ H;  1NS1 A;  2HJF C;  3CCS V;  2CE4 A;  4ICG A;  2DN9 A;  1XL6 A;  4WBN B;  2EUL A;  4TT3 G;  1PKX A;  5AG2 A;  3KZI Z;  5GTI Z;  3ZMZ A;  4DO2 A;  4B3S O;  2BTO A;  2Q0O C;  4X65 O;  2WLI B;  4GKK O;  1NQT A;  3N2K B;  4L87 A;  4YJ2 A;  2HLD G;  1Q43 A;  1HP8 A;  3RVY A;  3T1Y O;  1FFT B;  5KUK A;  4TOI A;  1O9G A;  5KHJ A;  3JAK B;  5IJ9 B;  1FXH A;  3ABL B;  4FLT A;  4QIW F;  1P49 A;  2ZT9 B;  1Q86 W;  4X1I B;  1EM1 A;  5IJ0 B;  3E8H A;  4PA6 A;  1MMM A;  4UUJ C;  4BR6 A;  4JI7 B;  2WLL A;  3BFR A;  1F4N A;  1ROP A;  2UXC B;  3AG2 C;  1WPB A;  2LGQ A;  1WP7 A;  1IBL O;  5KHI A;  4DR2 B;  1Y6X A;  1MZF A;  4PI2 A;  5J2U B;  4MTO A;  1NVP B;  4TV8 A;  2YXY A;  4CH5 A;  4FLV A;  4LF5 B;  2QKA A;  1XQ8 A;  3OMA B;  3CP1 A;  3ZN1 A;  3SJA C;  2DYR B;  1EN6 A;  2DQ3 A;  1EBO A;  1S72 V;  5LGT A;  4WFF A;  4G2K A;  2PF4 E;  4U3J A;  3S3X A;  3ZMT A;  2UXB B;  2HJD A;  3HKB B;  5CA1 B;  2HHH B;  4DR7 O;  4X20 B;  2YXL A;  3KG2 A;  4CC6 A;  5JQG B;  4LF7 O;  3JAM N;  4MTF A;  2EJ7 A;  4DUY B;  3EVK A;  5HFL A;  4TUY B;  2WPD G;  5LGN A;  4J41 A;  1F7Y A;  4J9Z B;  2PY5 A;  4JAV A;  5B1B C;  1CPY A;  1EN4 A;  3HR0 A;  3IC7 A;  1VQ6 V;  3MDS A;  4GKJ B;  1SQQ H;  1N8R W;  3BPZ A;  2OTJ V;  5JCO A;  1Y76 A;  1HW7 A;  4UV8 A;  2UXD B;  1QNM A;  3FB7 C;  5CBF A;  2P7T C;  4LNU A;  1F23 A;  3EHB B;  4JI2 O;  2R9A A;  3LDD A;  3E22 B;  1LUW A;  5IYC O;  3ZIA G;  1TVK A;  1V55 B;  3CYO A;  2CDY A;  5LXT B;  1BQ0 A;  4WFB V;  1NR7 A;  2YIC A;  2YUA A;  2DWD C;  4O2A A;  2LFR A;  3ZHV A;  2H8P C;  4JAU A;  4JGS A;  4MS2 A;  3CRQ A;  4LWS A;  5H5N A;  2P4V A;  3B40 A;  4MTX A;  4FMT A;  2X6A A;  5DED A;  5LYJ B;  1YIJ V;  1GAX A;  1S0V A;  2VQF O;  1OCR C;  4B7K A;  1Q3E A;  3E8F A;  1U96 A;  2BTQ A;  1DF5 A;  3EXA A;  4GZR B;  3MD0 A;  4OPA A;  3D36 C;  1W0J G;  4RUE A;  4JI1 B;  4JI3 O;  3HKE A;  3ZRW B;  3APQ A;  1VQM V;  1M57 B;  1Y74 B;  2FKX A;  5JJN B;  1KBH A;  2X0L A;  2ZQM A;  3JAK A;  3OMN B;  3RYH B;  4D7T A;  2CGN A;  4X64 O;  4X1K A;  2L6L A;  3ETE A;  4D6T H;  1KQS U;  2CTR A;  3IAY A;  2V4D A;  3JAR B;  1PNM A;  2IH3 C;  4X20 A;  2O57 A;  3ASO B;  1N0N A;  5TIS Z;  1I08 A;  4ZOL A;  3H1J H;  3CC4 V;  3L75 H;  2VQE B;  2ARH A;  2CUG A;  4ABM A;  2RDC A;  4I55 B;  2LJ2 A;  2E3C A;  4DV5 B;  4F6R B;  1G1X B;  1K7D A;  4DW1 A;  2EIK B;  1AJQ A;  5KHH A;  4FFB A;  1K4C C;  3DXR A;  3RW0 A;  4DV4 B;  4JYB A;  5IY5 C;  1ARO P;  2BSK B;  4LH7 A;  2YI8 A;  2OIE A;  3ETD A;  3ZRW A;  4UCT A;  3ZCC A;  3VQX A;  1IX9 A;  5LGU A;  2VWK A;  1Q5O A;  2DWE C;  1M9N A;  2XOK G;  2XAH A;  4DUY O;  4OX9 B;  1G8M A;  4IL6 Z;  1P4R A;  4DR1 O;  5GTH Z;  1T5E A;  3UT5 B;  3WB0 A;  2WLJ A;  1M90 W;  4JTD B;  3CCR V;  2F95 B;  3U10 A;  2OCH A;  1VF7 A;  2XUM A;  4JZ2 A;  2V1D A;  1U97 A;  5J9P C;  2YEV B;  2EIM C;  3SPH A;  3QF7 A;  4YHH B;  5EIB D;  3CC7 V;  1YTF D;  1YI2 V;  1SER A;  3S3W A;  1YXB A;  1VQ4 V;  3B8M A;  4LF4 O;  3T1Y B;  1WB7 A;  2P4K A;  3JYC A;  1SS3 A;  5EC1 C;  1QLE C;  3L73 H;  2UU9 O;  5ITZ A;  1EZJ A;  1GKF A;  4BW5 A;  1K4D C;  3APO A;  3SDL A;  5KHG A;  3CCQ V;  3H1I H;  1R1B A;  4JI2 B;  4DV3 B;  4NR1 A;  1WLE A;  2AXT Z;  3F5T A;  1L8D A;  1OHH G;  3ASN B;  1SQF A;  2WWW A;  1H2K A;  1Y67 A;  2UXN A;  1NBM G;  1QLE B;  4F6E A;  3FD9 A;  3ZRS A;  4I9Q A;  4PHZ A;  3ABM C;  5E79 Z;  1WA8 A;  4GYC B;  1L0N H;  1AP5 A;  1SZX A;  3OMI B;  2H3O A;  1XNQ O;  3UQ8 A;  1HNX O;  4DV4 O;  2A3Q A;  4AI8 A;  1V54 C;  2Q4P A;  4H13 B;  5BXZ A;  3LNN A;  4CH4 A;  4U3F H;  5LXT A;  1QVG U;  4DR3 O;  3Q4H B;  1YDX A;  3E22 A;  4LFA B;  2A7W A;  3DC6 A;  3CS5 A;  1YVW A;  1XOU A;  1ZX3 A;  1YZB A;  2JS3 A;  3BA9 A;  2IJJ A;  5CBG A;  1SQX H;  4UV9 A;  2OYQ A;  2GTS A;  3RN4 A;  2FML A;  1V54 B;  4B3R O;  3CSX A;  4PD4 F;  5FL7 G;  5JH7 A;  4XDL A;  1SES A;  2QE7 G;  4X65 B;  4NYK A;  5DN6 G;  5CB4 B;  4RWU A;  1ZL8 B;  2OTL V;  4Z2W A;  4CC5 A;  5EC2 C;  4UVB A;  1AR1 B;  1I5X A;  3SPI A;  1VMG A;  4K0K B;  2MK3 A;  2CH7 B;  1J95 A;  4TQD A;  4K8Z A;  1PL0 A;  3G80 A;  2K1E A;  4P30 A;  4B3M O;  1M56 B;  4OX9 O;  3RWR D;  1YJ9 V;  1GM9 A;  2NNU A;  4JI5 O;  4X1Y A;  5H2F Z;  1ZTE A;  2HKO A;  2XAJ A;  4FFB B;  1UJW B;  4BAY A;  5L3E A;  5EIB C;  4ZI7 A;  1RM1 B;  5IE9 A;  4JI6 B;  3JAS A;  2GDS A;  2JJ1 G;  1TA8 A;  2AZ0 A;  2UUB O;  4I55 A;  5J2U A;  2XAS A;  1GRJ A;  5B1A C;  4DV0 B;  2OCC B;  3H01 A;  2ADP A;  4K0K O;  1IBM B;  2YIB A;  4LR3 A;  4O2B B;  1W2B U;  1Q82 W;  3CCV V;  1THZ A;  4XDJ A;  4DK0 A;  4MSW C;  3FYI B;  4FVM A;  3H1K H;  2RNB A;  4I50 B;  3ZHR A;  1MA1 A;  4PA4 A;  1IBK O;  5LMU O;  2ATK C;  4GCZ A;  4LF7 B;  3I56 V;  3K9S A;  3CHX A;  1OJH A;  1XMO B;  1QBZ A;  2XND G;  4OGQ B;  1MSW D;  3DGE A;  3M8A A;  4DRX A;  3DSQ A;  4JI8 B;  4XBF A;  3K57 A;  1OCR B;  1AI4 A;  2GSM B;  1FKA O;  3G71 V;  5IYD O;  4DV5 O;  2W6I G;  2UUA B;  1AJN A;  5EBM C;  3ZMU A;  2HR3 A;  2Q67 A;  3TXQ A;  4MTG A;  3CXH F;  1H8H G;  4E4E A;  1JMK C;  3ABM B;  1XMO O;  1W59 A;  3OR6 C;  4BW9 A;  1MSD A;  1OZ0 A;  3BHP A;  5LMN O;  4WCE V;  4JI4 O;  5JJE B;  2GBO A;  1MOF A;  5H9C A;  1ENV A;  4IT5 A;  1QQC A;  2BE3 A;  2E5L O;  2F43 G;  1GTO A;  4G27 B;  3UO3 A;  1M93 A;  4DR2 O;  3RFR A;  2UUA O;  3A0H Z;  3QO5 A;  4LBE C;  3BEH A;  4R7C A;  5F2V O;  4BIZ A;  1AR5 A;  1XHX A;  3AEI A;  4YY3 O;  2DW4 A;  1N34 O;  1XMQ B;  3K79 A;  3L9D A;  5LOV B;  3KCY A;  2GUZ B;  2YC0 A;  2QWN B;  3BRC A;  2FTK A;  4LFA O;  4FFK A;  1BGY H;  1SET A;  3JD2 A;  1BS3 A;  1QLN A;  1BHB A;  4MW3 A;  1J5E O;  1N0J A;  5B1N A;  4ZBM A;  2AW9 A;  3C90 A;  4OPH A;  3BAA A;  4ZI7 B;  3FB6 C;  1VF5 B;  1HNW B;  4AIL C;  2JEU A;  1Q6U A;  4X1Y B;  3SJC C;  2QWR B;  3JD1 A;  2Y0P A;  3HKB A;  5CA1 A;  2QWO B;  4UFZ A;  2X7R B;  3RVZ A;  4IIJ B;  4TWK A;  3OUS A;  3A8T A;  5GW7 A;  1VF6 A;  5J2T B;  4JI8 O;  4TV8 B;  1M1K W;  3ZMS A;  4WFE A;  2ZE6 A;  4J11 A;  1NVP D;  1I7F A;  5B3S C;  4DR5 B;  5KHK A;  3W7T A;  1P7B A;  2QEX V;  4NB5 A;  4YIO A;  1HDJ A;  4PDL A;  2CAZ C;  2WLK A;  3JAR A;  2R9R B;  4EB6 B;  4HBN A;  2QGN A;  2JS5 A;  3H9V A;  4DV0 O;  1DF4 A;  4P9O A;  4JYC A;  2EIL C;  2AZ2 A;  4I50 A;  1BMF G;  1IZ3 A;  4DV6 B;  3AG4 B;  1DLB A;  3HB3 B;  2P67 A;  2DQ0 A;  5JH7 B;  1PL4 A;  1TUE B;  5KA5 A;  1XDC A;  1R3L C;  1GN2 A;  1CXZ B;  1OCC C;  1BZK A;  1FJG B;  4NTX A;  2MW2 B;  4LFC B;  1XNR O;  2CK3 G;  2GUZ A;  1AP6 A;  2Q8V A;  3QTC A;  4YXW G;  5CBH A;  4DUZ B;  2EX3 A;  5B1A B;  1ORQ C;  1SC5 B;  4X66 O;  4PA7 A;  3E2E A;  2QR4 A;  1NH2 B;  2UXC O;  4X64 B;  1IUR A;  1VQ7 V;  1Y4M A;  4I9W A;  1NT2 B;  1BCC H;  3OUF A;  4LWS B;  2PYJ A;  3SJB C;  2RMK B;  5CMU A;  2ZIN A;  5LMN B;  2PTM A;  1D5N A;  5L3F A;  2KG7 A;  3SYO A;  1VQL V;  2L35 A;  3UO2 A;  3UM7 A;  1RM1 C;  2NN4 A;  5IYZ B;  1I94 O;  4EKW A;  2Z0A A;  1S76 D;  4FLX A;  5KA6 A;  4J7Z A;  5D5P A;  4DV7 O;  2IH1 C;  1PNK A;  4EEQ A;  1K97 A;  2UU9 B;  4Z1M G;  2DOS A;  3K08 A;  4DR6 O;  1GO3 F;  1R6T A;  2YS8 A;  3G6B A;  1XI1 A;  2PGG A;  3DTU B;  3O65 A;  4I0X B;  2ITC C;  3P32 A;  3TCU A;  3J80 N;  3ZHT A;  5LP6 A;  1JJ2 U;  3SPC A;  4Z1V A;  2G38 A;  1TGO A;  3WB2 A;  3DC5 A;  4MT8 A;  3B2E E;  4D7S A;  2ZNI A;  4JYA B;  2W0F C;  4UB6 Z;  3O9O A;  2E74 B;  3T4D A;  1IXB A;  3GVM A;  2LW1 A;  2KSD A;  3W7W A;  3K04 A;  4LF9 O;  1Y74 A;  3FAV A;  3HKE B;  1FXK C;  1LUV A;  1FXK B;  1LR1 A;  4UCU A;  4O4L B;  1V9P A;  1AR4 A;  1M5I A;  4HNA A;  1R3K C;  5LOV A;  4NXM O;  5KX5 A;  4UCR A;  2NLJ C;  2P22 C;  3SYC A;  2QKC A;  3ML0 A;  4QJF B;  3CEI A;  1KD1 W;  2ADQ B;  2EBO A;  3IGA C;  3AG3 B;  3P30 A;  1P84 F;  3VOU A;  2F1M A;  3AG3 C;  4AQY B;  2JJ2 G;  2ETN A;  3I55 V;  1NJI W;  4DYL A;  4PDM A;  4ZOL B;  1YSC A;  2Q68 A;  1SKV A;  1PP9 H;  3LSS A;  5C93 A;  4U7N A;  2M7W A;  1QR8 A;  1KUQ A;  1R6K A;  2ZE5 A;  1US6 A;  5B1O A;  3STZ C;  1Q90 D;  2ZXW B;  1WPX A;  2ZXW C;  3VQY A;  3QVN A;  2YI9 A;  5EYP A;  4FM2 A;  4O4H B;  1N4C A;  1PD3 A;  4GX1 A;  1NTK H;  4MVO A;  5FNV A;  2RJZ A;  3FYE B;  3W7U A;  1NU1 H;  5KMG A;  4B3M B;  3MHS C;  4YJ3 B;  2B5U A;  1K9M W;  2LP7 A;  1YIT V;  5LL6 Y;  1N33 B;  3OEH G;  3K03 A;  2IJI A;  4J7K A;  1ZAU A;  2QM8 A;  2N74 A;  4AHC A;  1K3E A;  1R3I C;  4U3J B;  3QO7 A;  4O4I A;  5IWA B;  1E1Q G;  3B4S A;  5FPR A;  2N05 A;  1VQO V;  2DYS B;  3SPG A;  3G6E V;  3FFQ A;  3SYP A;  4W4K A;  2A79 B;  1N34 B;  3CE2 A;  5KX5 B;  4MVU A;  1GK9 A;  5B5E Z;  4JPR A;  3VBB A;  4O4L A;  1RSO B;  3EFF K;  3CMA V;  1G6U A;  5EZY A;  4JAA A;  1QCE A;  3BCC H;  2ILM A;  3K59 A;  3GB7 C;  2GHY A;  2ODM A;  4CH6 A;  5CB4 A;  4N21 A;  3BAB A;  5KUM A;  3R66 A;  2HHH O;  4DR7 B;  3K5N A;  4K35 A;  2X6C A;  1H8E G;  5IY5 B;  2R70 A;  2Y4U A;  2Q69 A;  4LNU B;  2M6Y A;  5JVD B;  4TUY A;  2ZCE A;  4LF4 B;  1URF A;  5B3S B;  1H2N A;  2XAQ A;  2UXB O;  2H94 A;  4QE7 A;  3CXC U;  2EIN B;  1VQ5 V;  4J80 A;  1OCZ B;  3W7X A;  3JSL A;  4BWA A;  1G4Y B;  2HVJ C;  1S5J A;  3W7S A;  1JQ0 A;  3LUT B;  5EBL C;  2EZP A;  4ZKI A;  2W0X A;  4P2Z A;  2PZS A;  1XUQ A;  2QKS A;  4K3A A;  4BIU A;  5EK0 A;  1SQB H;  4ZHQ B;  4MVZ A;  3D36 A;  4DR5 O;  1JFF A;  2JGD B;  1VQP V;  3ASO C;  1FXK A;  3CRM A;  3OE7 G;  3ZBH A;  2AHZ A;  2KG7 B;  3TXS A;  2AHY A;  2N04 A;  4UCS A;  1IVS A;  1AB3 A;  3PN1 A;  3IFX A;  5IJ0 A;  3JAT B;  3KKY A;  2KB1 A;  2IM9 A;  2WA3 A;  2ZR2 A;  4LP8 A;  5H6R A;  1AIL A;  2FL4 A;  2Y69 B;  3OR7 C;  4LFC O;  2JGU A;  2K9P A;  1OV9 A;  5KMG B;  1R3J C;  2XAG A;  2R9I A;  4DRX B;  4TSF G;  1NR1 A;  4YJ2 B;  1TUB A;  4YIP A;  1E79 G;  2IJH A;  3OT7 A;  4FM0 A;  3JAW B;  5KLV H;  3UKM A;  5DEC A;  1PM9 A;  1WP8 A;  2GV9 A;  2Q0A A;  4DV3 O;  2OIG A;  3RYF A;  1B6Q A;  3VQW A;  4YY3 B;  1PV0 A;  3H1L H;  1Q7Y W;  2LW7 A;  1A32 A;  2CH7 A;  1H2S B;  4LF9 B;  3SR2 C;  4O4I B;  1FAF A;  4IYI A;  4UCO A;  4O2A B;  2WLI A;  3C3S A;  1GH6 A;  2RCV A;  4UB8 Z;  4CS2 A;  1I0H A;  3B8N A;  3JAS B;  5C8Y A;  4WFA V;  4QGP A;  1I94 B;  1EN5 A;  5BMV A;  3SGI A;  2QM7 A;  5GON B;  4H33 A;  3BY6 A;  1QHT A;  1XNR B;  1BHA A;  2D3O W;  4NXN O;  1K34 A;  1HNW O;  4DR6 B;  4NTW A;  4Q6G A;  3K3W A;  3CRC A;  2Z5U A;  5B66 Z;  4UXN A;  4JI5 B;  4IIJ A;  3HKD A;  1P7G A;  4H44 B;  3N2G B;  3RYC A;  3F5W C;  4L8J A;  3AK3 A;  3CB2 A;  2QWP B;  4NTY A;  1GM7 A;  2DYR C;  3RBZ A;  2B1I A;  2B9Z A;  3WB1 A;  1XIL A;  2JVD A;  1DK1 A;  1HWY A;  1X59 A;  4WF9 V;  1Q8I A;  1K92 A;  4JI0 O;  1NTM H;  3ABK B;  1IXM A;  1QU7 A;  2WLM A;  4BIO A;  2E75 B;  4GX5 A;  2XT9 A;  3ZHQ A;  3JAW A;  3JD0 A;  4F6R A;  3AG2 B;  2EZO A;  1RPR A;  3F7V C;  4FZ0 A;  3QNE A;  3ZRV A;  2X6B A;  3D8C A;  3K0G A;  5LMU B;  4FLU A;  3ABU A;  2JDI G;  1YTF B;  3HKD B;  4MW8 A;  5JCO C;  5BR8 B;  2NR5 A;  2FB5 A;  3CRA A;  5CA0 B;  2WAM A;  3ETG A;  4AQY O;  4DW0 A;  2YSU B;  1K73 W;  3OFN G;  4DR4 B;  4FJC C;  1BE3 H;  2WA4 A;  5IYZ A;  1K5S A;  2BOC C;  2F4V B;  2JRI A;  4UCV A;  1BT8 A;  4EFB A;  5EBW C;  1Q6H A;  1HNZ O;  3KCX A;  3J81 N;  4GX0 A;  3E8B A;  1NZ6 A;  4QPJ A;  1DGS A;  1WA8 B;  2JGD A;  3TET A;  4LF5 O;  2JEX A;  3JAL B;  5JVD A;  1TAE A;  1UFI A;  2ZE8 A;  4DV2 O;  2BSK A;  2V7Q G;  2DYS C;  1M56 C;  1KYO F;  3CX5 F;  4X66 B;  4PDV A;  4B3S B;  2UUC B;  3RYI B;  1VIB A;  1H2M A;  1MAB G;  3MAQ A;  3CCE V;  1KEC A;  5LA6 B;  3G67 A;  1WJZ A;  5K1P A;  1AI7 A;  3WG7 C;  3NXS A;  1K5Q A;  1RPO A;  2Q7E A;  4C7U A;  3LSU A;  4I0X A;  4LH6 A;  1TUB B;  1KKD A;  2P06 A;  1X4T A;  2Q7G A;  3T4Z A;  5IJ9 A;  4WFG A;  1V55 C;  3SPJ A;  3STL C;  1E1R G;  4JI7 O;  3Q4H A;  3M99 B;  3TK1 A;  4B7E A;  3ZX6 A;  5BZB A;  2JK5 C;  3AK1 A;  3F7Y C;  1VAR A;  1EZV H;  3B77 A;  3CCJ V;  3JD3 A;  2QJ1 A;  2CTW A;  2ZDI A;  2DE0 X;  3OW2 U;  1XBL A;  2OT5 A;  2IU3 A;  3DXR B;  4R8C A;  1WB8 A;  4FM1 A;  4LF6 O;  1BL8 A;  4F4L A;  4FIP C;  3WU2 Z;  3K0D A;  2YXH A;  4X62 O;  3D3I A;  1S5H C;  3OTF A;  5CA0 A;  2E76 B;  2YID A;  2YIB D;  3JAL A;  4Q20 A;  3TGU H;  3WFV A;  1GMG A;  4UVA A;  2F23 A;  5LP6 C;  5HFM A;  4PV1 B;  3T1H B;  3J7A U;  2PI5 A;  1VP7 A;  1EFR G;  4FPP A;  4B3R B;  1HNZ B;  3OM3 B;  2EIJ C;  4JF3 A;  3TJT A;  1JX9 A;  1VQ8 V;  4FZ1 A;  4LFB O;  1FD9 A;  4KL1 A;  3U11 A;  1JCH A;  1RFY A;  1FYJ A;  1H2L A;  1J5E B;  3JSN A;  3CWB H;  2A0L A;  2ZNJ A;  3ZRX A;  2EIJ B;  1FXV A;  4IHJ B;  2PUS A;  5E1A C;  1KP2 A;  1XHZ A;  2Q73 A;  2RQ6 A;  1SZT A;  5BMV B;  3VQV A;  4X9Q A;  3AK2 A;  1HNX B;  2C2A A;  5KAF Z;  1AI6 A;  1SRY A;  3HKC A;  3CRR A;  4GT1 A;  3IJ4 A;  5EZY B;  4K8X A;  4PJ0 Z;  4DV1 O;  1KMI Z;  1BSM A;  3OGC C;  4U7O A;  4KUM A;  1HR0 B;  4JV5 O;  2ZIM A;  2E5L B;  2F4V O;  4IGG A;  3LNM B;  2YDE A;  2KKW A;  1ZL8 A;  4WBN A;  2LQT A;  3RT3 C;  5H6Q A;  4DV2 B;  1QR9 A;  4RQF A;  3ZHU A;  3GWO A;  1NH2 D;  4QE9 A;  2VRZ A;  4MVR A;  4JI1 O;  2Q6A A;  4LC1 A;  1YF2 A;  4YJ3 A;  4I4T A;  1AVM A;  4NKG B;  2ZR3 A;  2HFE C;  4DV7 B;  4O4J B;  3E35 A;  4DXW A;  1NKD A;  1YEW A;  1KU9 A;  5L3C A;  3ABK C;  1L0L H;  4KXR A;  5L3D A;  4J42 A;  4W4L A;  1KB9 F;  3OGI B;  3K9A A;  2DJV A;  3OTO B;  3K5M A;  3JD4 A;  1FS0 G;  3RYH A;  1XL4 A;  2EIL B;  3OEE G;  3HPL C;  4N23 A;  2P5O A;  4JI4 B;  4CBC A;  3ZS8 C;  4JYA O;  4JYY A;  2LO1 A;  5EYP B;  4NXN B;  3FB5 C;  1KKC A;  4LF8 B;  1Z5V A;  1UPG A;  1CEZ A;  2XAF A;  4GLX A;  4TV9 A;  1Z5W A;  4PEL A;  1ZSP A;  1YCI A;  3JAT A;  4TQF A;  3CD6 V;  4MVM A;  3L71 H;  3UT5 A;  2VS0 A;  4B3T B;  3AG4 C;  5LYJ A;  1GN6 A;  2ZDI C;  2A9H A;  5A9G A;  5C8Y B;  5D5Q A;  3C3T A;  3B09 A;  1N32 O;  4RUF A;  3ZJZ A;  4JI0 B;  1B04 A;  2OCC C;  4JTA B;  1OCC B;  1OCO C;  3I5D A;  3ABT A;  1COW G;  1ZLZ A;  4CH3 A;  3AG7 A;  3D3Q A;  1AI5 A;  1NI8 A;  1KC8 W;  4CZZ A;  1K8A W;  2WLH A;  1R6N A;  2WLN A;  4YHH O;  2IBZ H;  3ETQ A;  2FYU H;  4X8A A;  4HYO A;  2Q9L A;  1F51 A;  1JPX A;  5DM6 V;  5CN0 A;  3RGB A;  1XRE A;  4IHJ A;  1ZWI C;  5FNV B;  1MG1 A;  3FKS G;  1YJN V;  4DR3 B;  4RO2 A;  4I7Z B;  5B1B B;  2CGO A;  4O4H A;  4JZG A;  4PDR A;  4P9P A;  3SYA A;  4I5S A;  1WNS A;  1Q81 W;  1WN7 A;  4ZIB A;  1SA0 B;  3E89 A;  2ZM6 B;  1S77 D;  3JCU Z;  2QTS A;  2B1G A;  1SQG A;  1SF9 A;  5LBQ A;  2UUC O;  5L3B A;  3ZED A;  4WFH A;  3N2G A;  3L70 H;  2F66 C;  3P3P A;  4ZHQ A;  2UXX A;  1SQV H;  4DV1 B;  1SQP H;  2KQX A;  3K58 A;  1CP9 A;  2ZIO A;  3HKC B;  3LDE A;  4A5U B;  1HR0 O;  1XNQ B;  4JV5 B;  3SYQ A;  5GON A;  3CCM V;  3U0Z A;  2Q7H A;  1IBL B;  4NVP A;  2EIN C;  4FLW A;  4B08 A;  3LSQ A;  4FLZ A;  2QA4 V;  5FPO A;  2D2C B;  1FFX A;  3ZMV A;  1AJP A;  2XHB A;  1W0K G;  1VQK V;  2EIK C;  1H38 A;  4PI0 A;  1JOY A;  5BR8 O;  4X1I A;  3CJH A;  3T1C A;  1GN3 A;  4OXS A;  5ITZ B;  4FK5 C;  1SA0 A;  2ITD C;  3GWK C;  3FB8 C;  1ZUQ A;  1VF6 C;  1JVM A;  5L3G A;  3RYF B;  5K1X A;  1N36 O;  1IBM O;  2HG5 C;  1OCZ C;  2R72 A;  1XMQ O;  3CC2 V;  3N27 A;  4EFE A;  3H1H H;  3ZN0 A;  1IBK B;  1Y66 A;  3N2K A;  2HEP A;  5JWP A;  2ZE7 A;  3LDC A;  1GM8 A;  2YEV A;  2EJR A;  3PJS K;  1KP3 A;  2Y0I A;  2BOB C;  5LHH A;  3UCS C;  3OAA G;  3AG1 B;  4TV9 B;  5J2T A;  1XEQ A;  1H2G A;  3OD4 A;  2UXD O;  3FX7 A;  1JR9 A;  4EB6 A;  1D5A A;  4R50 A;  2QDO A;  1D2D A;  2P6J A;  4J9Y B;  4MVQ A;  2P90 A;  3QG5 A;  4JTC B;  3E83 A;  4ASU G;  4DV6 O;  3R65 A;  2Y48 A; 
#chains in the Genus database with same CATH homology
 4GZR B;  4I0X B;  3FD9 A;  3Q4H B;  4I0X A;  1WA8 B;  3FAV A;  2VS0 A;  3G80 A;  1WA8 A;  3TXQ A;  4LWS A;  2AZ0 A;  3OGI B;  2DE0 X;  4LWS B;  2VRZ A;  2B9Z A;  3HR0 A;  3ZBH A;  3FAV B;  2KG7 B;  3Q4H A;  3TXS A;  2KG7 A;  3O9O A;  4ABM A;  3GVM A;  3GWK C;  2AZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...