2B9ZA

Solution structure of fhv b2, a viral suppressor of rnai
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
GAMPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVGRMVTSLLEKPSVVAYLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords B2 protein
publication title The structure of the flock house virus B2 protein, a viral suppressor of RNA interference, shows a novel mode of double-stranded RNA recognition.
pubmed doi rcsb
source organism Flock house virus
total genus 25
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2b9zA00
3GVMA 3FD9A 2VS0A 3TXQA 4LWSB 1WA8A 3O9OA 4I0XA 2KG7B 3FAVA 2VRZA 3Q4HB 3G80A 3HR0A 4GZRB 3ZBHA 4LWSA 1WA8B 2DE0X 4I0XB 2KG7A 3GWKC 2AZ2A 3TXSA 3FAVB 2AZ0A 4ABMA 3Q4HA 3OGIB 2B9ZA
chains in the Genus database with same CATH superfamily
4J42A 4PDMA 2WAMA 3SPJA 4X62O 1B3QA 4TV8A 1QLEC 4FLUA 3BVOA 1DF4A 3C3TA 4BWAA 1VQKV 2GDSA 1I5YA 1LNQA 2GSMB 2HJFC 2R9AA 1NTZH 3AG7A 3JCZA 1XOUA 4WFBV 2XAHA 1N0JA 3Q4HA 4MTGA 1VF5B 1KKCA 1Q86W 1Q81W 3HKCA 1OCOB 1P7BA 1XBLA 1P49A 4JTAB 3SPIA 4XDJA 3DXRB 4MW3A 1ZL8A 2UUBO 1F7YA 1FXKC 2EX3A 3LNNA 4R50A 4ABMA 4DK1A 4WFHA 1KYOF 1F4NA 2JIZG 3STZC 1YTFD 2F1MA 4D7SA 5F2VO 1K5QA 1X4TA 5KLVH 2DOSA 5JWPA 2QJ1A 2UXDB 1GAXA 1CXZB 4DV0O 1SZTA 5LOVA 3JAKA 3JALA 3A2FA 2JGDB 4KP4A 3FB5C 5EK0A 4JI8O 2CTPA 1ENVA 3JATB 4B7KA 4I5SA 2BOCC 2G38A 1WP8A 2QTSA 5LOVB 4JYBA 3NR7A 4KUMA 4O2BA 2JJ2G 3QVNA 2OIEA 3CMEV 3BY6A 5EZYB 2V1DA 2QM7A 4X20A 3A0RA 4JZGA 1OV9A 4F6RB 1JMKC 1H2SB 3VQXA 1ZLZA 1QBZA 3U11A 5FLXN 1MABG 4YJ2A 4JI5B 4TQDA 3N2KA 3HKDB 2UXXA 2QM8A 2IJHA 4FFBA 5JQGA 4I4TA 3SYPA 5H6QA 1H38A 1Y74A 2K1EA 4EB6A 3KG2A 4N21A 5EYPA 4ICGA 2EIJC 3K5OA 4NTXA 4AI8A 2QEXV 4Z2WA 4DW0A 4LWSA 5BMVA 2DE0X 4W4KA 2UUBB 1JA8A 4PELA 5C8YB 1GN4A 5K1PA 1QLEB 4FLVA 1N32O 4LF4O 2ZDIC 4JAAA 4UCTA 2B1GA 1NS1A 4WFGA 3STLC 4LF5B 4JI2O 4MW8A 4GCZA 4H0LB 3HB3B 2IH1C 3MAQA 3CCEV 5J2TB 3ZHQA 2QKAA 1FXHA 5IJ9B 2OTLV 1SC5B 2OCHA 2BSKA 2VWJA 1N36O 4I7ZB 3AG4B 4U7OA 1GKFA 2JS5A 1I5XA 1FXKB 2PUSA 3E86A 2PYJA 1Q90D 2QDOA 4LFBO 2BSKB 4DR5O 4LFAO 3JASA 5JJJB 2JJ1G 1FPOA 4UB8Z 3LDEA 2MK3A 1BZKA 1AI6A 4MVSA 2JDIG 3CRQA 4KHPB 4X1YA 5JJNB 2YIAA 4E2LA 2JGUA 4LR3A 1HNWO 1XMOO 4UV8A 2LGQA 3QF7A 2NR5A 1V55C 2A7WA 1E1QG 1ROPA 4B3SO 3K58A 1BCCH 2UXCO 3B77A 4OGQB 3QO7A 1K5SA 2BCCH 1BQZA 4JYCA 1JR9A 4O4HB 1FS0G 1PM9A 2RJZA 1O9HA 2MW2B 4LF6B 3SJCC 3RYIB 4R8CA 2VQFO 2VQEO 1VQ9V 3D8CA 3K06A 4KFMA 5EBWC 3W7TA 3ZRXA 4D6TH 1XNQB 1BL8A 2YC0A 3CE2A 3CHXA 4J41A 4I0XB 4QIWF 1TA8A 2FB5A 1YIJV 1TVKA 1J5EB 1FJGO 1UJWB 3CEIA 3RVYA 3L74H 3WFVA 5GONB 3JD0A 2ZIOA 3JD1A 5B5EZ 2HJDA 1PD3A 5B66Z 4DRXA 3SGIA 1L8DA 1VQNV 2CTQA 5J9PC 2XHBA 3OAAG 3D36A 5H5NA 4LF7O 5IDJA 1FFXA 1I08A 1HNXO 4NVPA 3WB0A 4FJCC 2WWWA 4PD4F 4DR3O 5CA3A 1VF6A 2ZE6A 1FYJA 3CB2A 1BGYH 4UUJC 1K92A 4YJ3A 1Q82W 5JCOC 4RAIA 1IBKO 2YXYA 1OCCC 3F5WC 4JAVA 3OMAB 3CD6V 3B40A 2CGOA 5EC1C 1MSDA 1Q43A 4LH6A 3G6BA 4DR1O 1KP3A 1BSMA 4GX5A 4DR2O 4IIJA 1GM7A 4NXNB 4GKKB 4OXSA 3JAMN 3ZRWA 4EFEA 3K79A 2VQFB 5GW7A 3T4ZA 1TGOA 3EVKA 3QO5A 2JEXA 2KG7A 2Q7EA 4TUYB 5C93A 2JEUA 3HPLC 2ODMA 3K08A 4J9YB 1V55B 1XL6A 3CX5F 3E8BA 4YIOA 3RFRA 2FTKA 2Y0IA 2EINB 1H2NA 4L8JA 4K3AA 1AJPA 2GHYA 4O4JB 1R6TA 1IDSA 1S77D 3FB8C 4FM2A 1AILA 5LHHA 1AI7A 4X1KA 2CUGA 5IYBO 3SPGA 3ZEDA 5LMNO 3H1HH 2QGNA 3TJTA 1PL0A 2PF4E 4O4LA 2ZXWC 3UM7A 2Q4PA 4PA9A 5KHHA 5ITZB 4YY3O 4JV5O 4DR6O 1IBKB 2QWNB 2CH7A 3H1KH 3RYFB 2LJ2A 4IHJA 3FAVB 4BIUA 3K3WA 4LNUB 2LO1A 1HP8A 1SQFA 2CH7B 4GX0A 2Z3YA 1S0VA 1Y66A 3A0HZ 3H1LH 3T2MA 5GTIZ 3CCJV 4P30A 1B06A 2QSAA 3OMNB 2HR3A 3IC9A 5LBQA 4G27B 3EXAA 5LP6A 3C90A 4FLXA 1TUEB 2UXBO 4GX2A 2OTJV 3E22B 4DUYB 3UO3A 4I50B 1OJHA 3D3IA 3CCLV 2A3QA 5HFLA 5KX5A 2IU3A 3PJSK 1VQ8V 2QKSA 2ZE7A 2H8PC 2O57A 4UCVA 4JI7O 1F51A 2UUAO 1M57B 1MA1A 3AK3A 3G4SV 1Q6IA 4PI0A 3QNEA 4DV4B 1JCHA 4YHHO 4DR7B 4D7TA 2IJKA 5L3EA 2HHHB 2PI5A 5A9GA 2HFEC 1ZUQA 3HKEB 5KUKA 4J9ZB 3H1IH 4AQYO 3U10A 3CYOA 3K5NA 4YIPA 1XMQB 3E8HA 4DV6O 4XDLA 1GN6A 5KAIZ 4ZHQB 1SZXA 3AG3C 1VQ6V 4JASA 4U7NA 3ZMTA 1EN5A 2Q0OC 3K0DA 3R65A 2F23A 1W2BU 3FYEB 2RMKB 3CC4V 3ETQA 4GZRB 2N05A 1TUBA 5LYJB 4C7UA 2CE4A 1VQ5V 3W7WA 2H3OA 4DV1B 2WLLA 2ZXWB 3GVMA 3QG5A 3BA8A 1I94B 2OYQA 4X1IB 3T4DA 5LXTB 2LP7A 1NKDA 1IBMB 2LFRA 3ZMVA 1QVGU 2YUAA 3QTCA 4JI7B 3BA9A 2WLJA 3CC7V 1XQ8A 4B3TO 3CCVV 5IY5C 1IURA 2X6BA 5EBMC 4GKJB 4NTWA 2UXDO 4QPKA 4WF9V 3I55V 3LSSA 4EFBA 2ITCC 5EIBC 4BAYA 3E35A 5E79Z 2WPDG 2P90A 2YI9A 2PI4A 2B1IA 1IXBA 2Q6AA 5CA1A 2C2AA 1F4MA 2ARHA 2BE3A 1IX9A 3FFQA 1MOFA 2WLKA 4IGGA 4F4LA 3FD9A 3OW2U 3CMAV 2E75B 3B8NA 2LW1A 4IYIA 1QQCA 1THZA 2IW5A 1NJIW 1D2DA 3CCRV 2R9RB 1GN2A 5A2QN 1SS3A 4WBNA 5KMGA 4JI5O 1Q7YW 4H37A 4TV8B 2A06H 1WPXA 3CXHF 4MVQA 4EEQA 2DWDC 4X66B 3CCQV 1QLNA 1D5NA 1XREA 1FAFA 1KECA 3AG1B 2VRZA 3SPHA 4NTYA 3Q4HB 2PY5A 3CCUV 3ZRSA 1V54C 3AG3B 3AG4C 2YIBA 3HKCB 1K4CC 1RSOA 2X6AA 2XAGA 2ZKOA 4LF8B 4B3TB 1ZL8B 4W4LA 1L1FA 1P4RA 3UT5A 1AB3A 3L70H 1VARA 2QWQB 4LF5O 2NN4A 3JYCA 5FPRA 1G8MA 2HLDG 2L35A 3OTOB 3VQWA 1ZTEA 2CGNA 1HR0B 1XNRO 3JAKB 3JALB 2QWRB 5B1OA 1Q5OA 2YXHA 2OT5A 1SRYA 1KC8W 4PDRA 2ZM6B 4ASUG 4O2BB 1JJOA 1PNMA 5KA6A 1Y76A 4JTCB 2OWOA 5IY5B 3N2GA 3QO8A 4X20B 1YJWV 1PPJH 4J7JA 1BS3A 3OR7C 1VP7A 2KKWA 2WLIA 3J80N 1VMGA 2A9HA 3THOA 1AP6A 4JZ2A 4YJ2B 3CCSV 2F95B 5IWAB 4P9PA 3N2KB 2Z0AA 4FFBB 3VQVA 4RWUA 4I4TB 5JQGB 4KHPO 4CBCA 3LDCA 2XUMA 3ETGA 1Y74B 4EB6B 4CZZA 2GV9A 4H13B 3SJBC 2YSUB 5EYPB 5HFMA 1YEWA 1DLBA 4O2AA 2Q67A 4LWSB 2DQ3A 3WG7C 1AI5A 2DWEC 5BMVB 1LUVA 2ZQMA 1K8AW 3B09A 2X0LA 3JAWA 4BR6A 2YICA 2Q0AA 3OUSA 2IJIA 3SYCA 1QCEA 1GM9A 2JK5C 3C3SA 1M1KW 1ZWIC 4LF6O 1R73A 1WP7A 1XNRB 1QHTA 4X9QA 1H8EG 3ZX6A 4RQFA 2P4VA 5KA5A 1XNQO 1V54B 1KUQA 3OMIB 3D36C 4DXWA 1K97A 5L3DA 3OEHG 1VQPV 1J5EO 3JSLA 1VF6C 2A0LA 2ZD9A 2E5LO 1E1RG 2BTQA 3CSXA 3ABTA 3M7MX 1U97A 1K33A 4IT5A 3L75H 1SQGA 2H94A 3JASB 1QVFU 2EZOA 4AILC 1HW7A 2BTQB 1DTOA 4RUEA 1CP9A 3ABKB 4H33A 3BEHA 1QU7A 1SF9A 2IH3C 4JI1B 3RYCA 4G2KA 4JGSA 5EIBD 4X1YB 4X64B 1NTMH 5CA0A 3OT7A 3F7VC 1H2MA 4UVAA 4Z1VA 1VQMV 2EINC 4K8XA 5K1XA 4DV5O 5LHIA 3ZMUA 1PV0A 1PKXA 5EC2C 4NXNO 4GKKO 1EZJA 2UU9O 4JI0B 4UCUA 4UFZA 2GUZA 4CC6A 1KP2A 3LUTB 1ZX3A 2EJRA 1FKAO 4LF9B 2JRIA 3WG7B 3T1CA 1AROP 4YXWG 1WJZA 2FL4A 1N33B 1DK1A 4WFEA 3I56V 4B08A 5LMUB 3E83A 2E5LB 4XDKA 4X65B 5EBLC 3TGUH 1FXVA 1TVKB 5FNVA 1EN6A 4OX9B 1XHZA 3K57A 5IT9N 3ETDA 1L0LH 4I9WA 2IM9A 4CH6A 5LA6A 4RQEA 1JJ2U 4DRXB 4DUZB 1WPBA 3I5DA 4PA7A 2F4VB 2WLMA 4AHCA 1K7DA 1FFXB 5CBGA 4BIOA 4R7CA 2Y4TA 5LP6C 2P06A 3SDLA 2Y4UA 1W0KG 5DEDA 2W0XA 1JOYA 4YJ3B 1M57C 4O4IA 1H2LA 2R70A 4UV9A 4DV5B 2UXNA 2YS8A 4WFAV 1M9NA 3CRRA 4HNAA 4U3JA 1SA0A 3D3QA 2RCVA 5CBFA 4DR4B 5IYDO 1IBLB 2UU9B 1PP9H 4X8AA 2EBOA 5L3GA 4R6ZA 4DUYO 3LNMB 4IIJB 4U3JB 3APOA 3ZRWB 2ZCEA 5BZBA 2ETNA 5L3CA 1WNSA 2KG7B 5LGTA 3CWBH 5FPOA 1AR5A 1NH2B 4JI4B 4LCUC 3ASOC 3E89A 5BR8B 5FL7G 3L73H 4PI2A 3ABUA 4DV4O 1IVSA 4DR7O 3TK1A 1OCRC 2HHHO 4HAMA 2GTAA 4UVBA 1GK9A 1VEWA 2YEVA 1BT8A 5DN6G 4UVCA 2Q9LA 1VF7A 4G28B 2JVDA 1QR9A 1XMQO 4X1KB 4FM1A 5BXZA 2ZNIA 1SQPH 4FIPC 1K34A 5H2FZ 3WB2A 2QWPB 3A8TA 2OCCC 1BMFG 4UXNA 4O4LB 4N23A 3H1JH 3K9SA 2ITDC 2EZPA 3F7YC 2PZSA 1XHXA 4IHJB 3CRAA 1G1XB 3W7XA 3AEIA 4JPRA 3SYOA 4LC1A 1G6UA 3CJHA 4GUNA 4DV1O 4B7EA 1R1BA 1K4DC 1I94O 3E2EA 2YXLA 5LP6B 3B2EE 4NKGB 1IBMO 4DK0A 4NXMB 1H8HG 4FPPA 4PA4A 5JJEB 1GTOA 2BOBC 5JCOA 2DMXA 3E8FA 4JF3A 2EIMC 4QJFB 2QWOB 5KX5B 3GWKC 3T1HB 4E4EA 2ADQB 4L87A 4JI6B 4GKJO 1NZ6A 1JPXA 3RYHA 2CDYA 4BW5A 3OD4A 2QM4A 4A5UB 1QNMA 2M6YA 1R6NA 2ZT9B 1NH2D 2RQ6A 3APQA 3U0ZA 4UB6Z 4GLXA 3AG2B 4K0KO 1O9GA 3IFXA 5CB4A 5DECA 3AG1C 2HP8A 2Q69A 1M4UA 5B1BC 3JARA 1AJNA 1F23A 3N27A 1HDJA 2XT9A 3EHBB 4FZ0A 1PNKA 3P3PA 2VS0A 3ASOB 3O9OA 1SQXH 3AK1A 5CN0A 1S5JA 1RM1B 3FB7C 3K04A 4ZI7A 2GBOA 3K03A 5KUMA 5IJ0A 4ZOLA 1OCRB 4DV7B 3JCUZ 3RW0A 1R3KC 4H44B 3UKMA 1HNZB 4DV3O 3ML0A 1Q6UA 2XOKG 4X66O 2XNDG 3AK2A 3P32A 4HYOA 3SR2C 2CTRA 3HKBA 5D5QA 2HVJC 3H01A 1TUBB 1EZVH 4I55A 2OCCB 2WLLB 5IYZA 4RUFA 3G6EV 2QKCA 1A32A 2W6JG 3E8GA 5JH7A 4LF8O 2P6JA 2XASA 3S3WA 3J7AU 1I7FA 5JH7B 2XAJA 1JFFA 1MZEA 3EFFK 3OTOO 2X7RB 1SESA 4B3RB 3LSUA 1HR0O 4K0KB 3FKSG 1E79G 4LH7A 4U3FH 4TV9A 3R66A 3JSNA 5JVDA 2E74B 2Y48A 2UUCB 1Q6HA 5KAFZ 1WA8A 2N04A 2ZM6O 3ABMB 5CA1B 4JYAB 2EIMB 1ORQC 2EIKC 4ZKIA 2CTWA 3HR0A 1AJQA 1EBOA 3B4SA 1S5LZ 2LGWA 3ASNC 1V9PA 2NLJC 4TSFG 4DV3B 1R3LC 1WLEA 4WBNB 5KMGB 3BAAA 4QGPA 2HG5C 5IWAO 3L9DA 3BABA 1N0NA 4K8ZA 1H2KA 5B1BB 1WB7A 2OIGA 3K5LA 4B3MB 1RP3B 3OEEG 3ZHUA 5H9CA 1MNGA 4LFCB 3IC7A 3T1YB 1K3EA 3BFRA 3LDDA 1XEQA 2B9ZA 3DXRA 3CC2V 4CS4A 2BTOA 2RN9A 1GMGA 2K9PA 1RSOB 2YDEA 3W7SA 1PL4A 1OZ0A 5H6RA 3UT5B 5L3FA 1BE3H 2IU0A 3ZN0A 3OGIB 2JGDA 1I0HA 4JI3B 4FM0A 2RDCA 3ABKC 3MHSC 4PJ0Z 3ZHSA 2LW7A 5KHIA 3JATA 4J7ZA 4FLYA 1SQVH 2IJJA 1VIBA 1P7GA 3OM3B 4FLZA 2AHYA 2XAFA 1EM1A 5EZYA 2ZR3A 3GWOA 4JAUA 4CS3A 3IAYA 3UQ8A 3TXSA 4F6RA 4UCSA 1M56C 1Y76B 4OPAA 3K5MA 3N2GB 1VQ4V 3P3NA 4X62B 3HKDA 1OHHG 3DGEA 1RFYA 3L71H 2WLIB 3F5TA 3J81N 3LSQA 2IBZH 2X6CA 4X89A 2AZ2A 4GYCB 3CCMV 1S76D 4P9OA 4JI1O 3OR6C 3RVZA 1SKVA 4BW9A 2EIKB 2PTMA 4JTDB 4X64O 1Q8IA 1EN4A 2HKOA 5LGNA 4CH3A 5C8YA 3ASNB 4O2AB 1OCZB 3ZHVA 4TT3G 1UFIA 1QR8A 4TOIA 3JAWB 3KZIZ 4K35A 1Q3EA 5GTHZ 1NI8A 1KKDA 3ZMSA 3OFNG 3TXQA 2QA4V 2NNUA 1W0JG 2DYSC 2KQXA 5KHGA 4JI0O 2ILMA 1WN7A 2YIBD 1US6A 4FLTA 4DV0B 3OE7G 1JQ0A 3OGCC 5J2TA 1NR1A 1DF5A 1URFA 1AR4A 4QE7A 2DJVA 4DYLA 4LF9O 5IE9A 5IJ9A 4JI8B 3BRCA 3O65A 4CC5A 1N33O 2R72A 4TWKA 5L3BA 3SJAC 1L0NH 1CEZA 1FXKA 5LMUO 4P2ZA 1GRJA 1MSWD 1K9MW 1GH6A 3BHPA 3MD0A 4X65O 4X88A 5LL6Y 4MVZA 1NR7A 2AHZA 3WB1A 3UCSC 4OX9O 3G80A 3L72H 3ZBHA 4FK5C 4TQFA 2XAQA 3ABLC 2N74A 1SERA 3DC5A 4DUZO 2WA4A 2R9IA 4DV2O 2A79B 2F4VO 1AR1B 3VOUA 1VQLV 4FFKA 4NR1A 1VQ7V 3K9AA 2EJ7A 3RYCB 1RPOA 2FYUH 2P7TC 4MS2A 1M56B 3TCUA 3CRCA 2DYRC 3S3XA 5CA0B 2PGGA 1ZSPA 1M93A 5B1AC 2Q5ZA 3OUFA 3VQYA 2B5UA 1Y4MA 2FKXA 3ETEA 4Q20A 1GN3A 5LGUA 2P5OA 3A0BZ 1N32B 1N8RW 2E76B 4LF4B 4O4HA 4DR4O 1IBLO 1NBMG 4CH5A 4I9QA 4Z1MG 3RYIA 1COWG 2F43G 4JI2B 1NU1H 4KL1A 2JS3A 4BIZA 3MDSA 4UCRA 2GUZB 1CPYA 3ZRVA 3X2QC 1JVMA 2EIJB 3CS5A 2P22C 4PDLA 4HBNA 3ZHTA 4I0XA 4PA6A 4JI4O 5TISZ 4CH4A 4QE9A 2E3CA 5CBHA 2V4DA 2ZDIA 5BR8O 1N36B 2ZINA 3K59A 3M99B 2D3OW 2EULA 5D5PA 1SQQH 5GONA 4MSWC 1YDXA 4QNHB 4LFBB 2DYSB 2ZNJA 4MTFA 4DR5B 5FNVB 1YVWA 1JX9A 4J10A 3ZJZA 4LFAB 1KB9F 4DV2B 3CXCU 1AI4A 1PNLA 4MTXA 1SETA 5LA6B 2LQTA 1YI2V 4FMTA 1YJNV 1P84F 1S3JA 3P30A 1LUWA 5E1AC 2EILC 4CS2A 5B3SC 1T5EA 4WCEV 3JD2A 1HNWB 4LBEC 1AVMA 3JD4A 1XMOB 3SYQA 2VWKA 4J80A 4J11A 3ABLB 4NYKA 4O4IB 1FFTB 4B3SB 1RPRA 4F6EA 1YZBA 1U96A 4ZIBA 2UXCB 2F66C 1FD9A 1DGSA 4HNAB 1S5HC 3AG2C 2QE7G 1SA0B 3CP1A 1Y67A 4IL6Z 4PDVA 2Q73A 5BY1A 2W0FC 3PN1A 4NXMO 4TUYA 4MVOA 2VQEB 2ZIMA 2P4KA 2DYRB 1B6QA 3G67A 1RM1C 1WB8A 5B1AB 2Q68A 4QPJA 3T1HO 4JI6O 1R3JC 1YSCA 3ZIAG 2WLHA 3K0GA 1M5IA 1FJGB 2W6IG 4O4JA 3CPWU 3G71V 3ZCCA 3MHHC 5IYCO 2YEVB 5J2UA 4XBFA 1M90W 1NVPB 1K73W 1R3IC 1ZAUA 2AXTZ 2ATKC 3DSQA 1W59A 3X2QB 1KBHA 3BPZA 3ZN1A 3IJ4A 4LF7B 1HNXB 3BCCH 3DC6A 5J2UB 3FB6C 5ITZA 4DR3B 2ADPA 3RYFA 1VQOV 5CMUA 3W7UA 4EKWA 3FAVA 1R6KA 2Y69C 4HZ3A 1YXBA 2LFSA 1NTKH 4DV7O 4LNUA 1HNZO 2FMLA 1YF2A 1BHBA 2F93B 2WLNA 4KXRA 4Q6GA 1KQSU 3FYIB 3CRMA 1YITV 4DR1B 3CJHB 1N34O 2DQ0A 2WA3A 2EILB 4DR2B 1XI1A 3E22A 5B3SB 4I50A 4OPHA 1AP5A 3ABMC 2KSDA 3SYAA 1XILA 1HWYA 3KCYA 4WFFA 3ZS8C 2PYLA 4IYHA 4NB5A 2CAZC 3M8AA 1UPGA 2ZE5A 1N4CA 2AW9A 1OCCB 1NQTA 3NXSA 2XTAA 4B3RO 3JD3A 4GX1A 1Z2GA 1TAEA 3RYHB 4FVMA 3HKEA 1KU9A 1YHQV 4FZ1A 4PV1B 2V7QG 3RWRD 2UUCO 4LP8A 2Y0PA 4JYYA 5KHJA 1MG1A 5CB4B 4RO2A 1X59A 4GT1A 5B1NA 4JYAO 3JARB 4MVRA 4PHZA 5LMNB 2AGAA 4ZHQA 2Q8VA 3ZHRA 3H9VA 2QR4A 3TETA 1Z5VA 3GB7C 2D2CB 2KB1A 1OCOC 1NVPD 4ZBMA 4UCOA 5KHKA 4YY3B 4JV5B 4DR6B 4ZI7B 3ZMZA 2Q7HA 5IJ0B 4ZOLB 5LHGA 1XUQA 3VBBA 1S72V 1EFRG 5LYJA 2L6LA 1XL4A 1N34B 3RN4A 2DN9A 4B3MO 4MT8A 1Y6XA 4LFCO 3HKBB 3KKYA 1Z5WA 2HEPA 3T1YO 4X1IA 5LXTA 2YIDA 2CK3G 2UXBB 1KMIZ 4I55B 2AZ0A 1GM8A 4FLWA 5IYZB 1YTFB 1WAZA 2Z5UA 3RBZA 2Y69B 1BQ0A 1J95A 1KD1W 3DTUB 2RNBA 5AG2A 1MMMA 4J7KA 1IZ3A 1IXMA 3RGBA 2QTOA 1XDCA 2P67A 1LR1A 2UUAB 2ZE8A 4DO2A 1YJ9V 1MZFA 4DW1A 1JFFB 3KCXA 4YHHB 5DM6V 4JI3O 1NT2B 3ICXA 4MTOA 1H2GA 1G4YB 3B8MA 3UO2A 2DW4A 2GTSA 2WSSG 3FX7A 3IGAC 1D5AA 1BHAA 3OTFA 3SJQC 1YCIA 4PA3A 4TV9B 3WU2Z 1SQBH 2M7WA 5JVDB 4AQYB 4MVUA 1B04A 3SPCA 4DV6B 1GO3F 2YI8A 3RT3C 1WA8B 4MVMA 1OCZC 2HVKC 2ZR2A 2Q7GA
chains in the Genus database with same CATH topology
3GVMA 3FD9A 2VS0A 3TXQA 4LWSB 1WA8A 3O9OA 4I0XA 2KG7B 3FAVA 2VRZA 3Q4HB 3G80A 3HR0A 4GZRB 3ZBHA 4LWSA 1WA8B 2DE0X 4I0XB 2KG7A 3GWKC 2AZ2A 3TXSA 3FAVB 2AZ0A 4ABMA 3Q4HA 3OGIB 2B9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVM A;  3FD9 A;  2VS0 A;  3TXQ A;  4LWS B;  1WA8 A;  3O9O A;  4I0X A;  2KG7 B;  3FAV A;  2VRZ A;  3Q4H B;  3G80 A;  3HR0 A;  4GZR B;  3ZBH A;  4LWS A;  1WA8 B;  2DE0 X;  4I0X B;  2KG7 A;  3GWK C;  2AZ2 A;  3TXS A;  3FAV B;  2AZ0 A;  4ABM A;  3Q4H A;  3OGI B;  2B9Z A; 
#chains in the Genus database with same CATH topology
 4J42 A;  4PDM A;  2WAM A;  3SPJ A;  4X62 O;  1B3Q A;  4TV8 A;  1QLE C;  4FLU A;  3BVO A;  1DF4 A;  3C3T A;  4BWA A;  1VQK V;  2GDS A;  1I5Y A;  1LNQ A;  2GSM B;  2HJF C;  2R9A A;  1NTZ H;  3AG7 A;  3JCZ A;  1XOU A;  4WFB V;  2XAH A;  1N0J A;  3Q4H A;  4MTG A;  1VF5 B;  1KKC A;  1Q86 W;  1Q81 W;  3HKC A;  1OCO B;  1P7B A;  1XBL A;  1P49 A;  4JTA B;  3SPI A;  4XDJ A;  3DXR B;  4MW3 A;  1ZL8 A;  2UUB O;  1F7Y A;  1FXK C;  2EX3 A;  3LNN A;  4R50 A;  4ABM A;  4DK1 A;  4WFH A;  1KYO F;  1F4N A;  2JIZ G;  3STZ C;  1YTF D;  2F1M A;  4D7S A;  5F2V O;  1K5Q A;  1X4T A;  5KLV H;  2DOS A;  5JWP A;  2QJ1 A;  2UXD B;  1GAX A;  1CXZ B;  4DV0 O;  1SZT A;  5LOV A;  3JAK A;  3JAL A;  3A2F A;  2JGD B;  4KP4 A;  3FB5 C;  5EK0 A;  4JI8 O;  2CTP A;  1ENV A;  3JAT B;  4B7K A;  4I5S A;  2BOC C;  2G38 A;  1WP8 A;  2QTS A;  5LOV B;  4JYB A;  3NR7 A;  4KUM A;  4O2B A;  2JJ2 G;  3QVN A;  2OIE A;  3CME V;  3BY6 A;  5EZY B;  2V1D A;  2QM7 A;  4X20 A;  3A0R A;  4JZG A;  1OV9 A;  4F6R B;  1JMK C;  1H2S B;  3VQX A;  1ZLZ A;  1QBZ A;  3U11 A;  5FLX N;  1MAB G;  4YJ2 A;  4JI5 B;  4TQD A;  3N2K A;  3HKD B;  2UXX A;  2QM8 A;  2IJH A;  4FFB A;  5JQG A;  4I4T A;  3SYP A;  5H6Q A;  1H38 A;  1Y74 A;  2K1E A;  4EB6 A;  3KG2 A;  4N21 A;  5EYP A;  4ICG A;  2EIJ C;  3K5O A;  4NTX A;  4AI8 A;  2QEX V;  4Z2W A;  4DW0 A;  4LWS A;  5BMV A;  2DE0 X;  4W4K A;  2UUB B;  1JA8 A;  4PEL A;  5C8Y B;  1GN4 A;  5K1P A;  1QLE B;  4FLV A;  1N32 O;  4LF4 O;  2ZDI C;  4JAA A;  4UCT A;  2B1G A;  1NS1 A;  4WFG A;  3STL C;  4LF5 B;  4JI2 O;  4MW8 A;  4GCZ A;  4H0L B;  3HB3 B;  2IH1 C;  3MAQ A;  3CCE V;  5J2T B;  3ZHQ A;  2QKA A;  1FXH A;  5IJ9 B;  2OTL V;  1SC5 B;  2OCH A;  2BSK A;  2VWJ A;  1N36 O;  4I7Z B;  3AG4 B;  4U7O A;  1GKF A;  2JS5 A;  1I5X A;  1FXK B;  2PUS A;  3E86 A;  2PYJ A;  1Q90 D;  2QDO A;  4LFB O;  2BSK B;  4DR5 O;  4LFA O;  3JAS A;  5JJJ B;  2JJ1 G;  1FPO A;  4UB8 Z;  3LDE A;  2MK3 A;  1BZK A;  1AI6 A;  4MVS A;  2JDI G;  3CRQ A;  4KHP B;  4X1Y A;  5JJN B;  2YIA A;  4E2L A;  2JGU A;  4LR3 A;  1HNW O;  1XMO O;  4UV8 A;  2LGQ A;  3QF7 A;  2NR5 A;  1V55 C;  2A7W A;  1E1Q G;  1ROP A;  4B3S O;  3K58 A;  1BCC H;  2UXC O;  3B77 A;  4OGQ B;  3QO7 A;  1K5S A;  2BCC H;  1BQZ A;  4JYC A;  1JR9 A;  4O4H B;  1FS0 G;  1PM9 A;  2RJZ A;  1O9H A;  2MW2 B;  4LF6 B;  3SJC C;  3RYI B;  4R8C A;  2VQF O;  2VQE O;  1VQ9 V;  3D8C A;  3K06 A;  4KFM A;  5EBW C;  3W7T A;  3ZRX A;  4D6T H;  1XNQ B;  1BL8 A;  2YC0 A;  3CE2 A;  3CHX A;  4J41 A;  4I0X B;  4QIW F;  1TA8 A;  2FB5 A;  1YIJ V;  1TVK A;  1J5E B;  1FJG O;  1UJW B;  3CEI A;  3RVY A;  3L74 H;  3WFV A;  5GON B;  3JD0 A;  2ZIO A;  3JD1 A;  5B5E Z;  2HJD A;  1PD3 A;  5B66 Z;  4DRX A;  3SGI A;  1L8D A;  1VQN V;  2CTQ A;  5J9P C;  2XHB A;  3OAA G;  3D36 A;  5H5N A;  4LF7 O;  5IDJ A;  1FFX A;  1I08 A;  1HNX O;  4NVP A;  3WB0 A;  4FJC C;  2WWW A;  4PD4 F;  4DR3 O;  5CA3 A;  1VF6 A;  2ZE6 A;  1FYJ A;  3CB2 A;  1BGY H;  4UUJ C;  1K92 A;  4YJ3 A;  1Q82 W;  5JCO C;  4RAI A;  1IBK O;  2YXY A;  1OCC C;  3F5W C;  4JAV A;  3OMA B;  3CD6 V;  3B40 A;  2CGO A;  5EC1 C;  1MSD A;  1Q43 A;  4LH6 A;  3G6B A;  4DR1 O;  1KP3 A;  1BSM A;  4GX5 A;  4DR2 O;  4IIJ A;  1GM7 A;  4NXN B;  4GKK B;  4OXS A;  3JAM N;  3ZRW A;  4EFE A;  3K79 A;  2VQF B;  5GW7 A;  3T4Z A;  1TGO A;  3EVK A;  3QO5 A;  2JEX A;  2KG7 A;  2Q7E A;  4TUY B;  5C93 A;  2JEU A;  3HPL C;  2ODM A;  3K08 A;  4J9Y B;  1V55 B;  1XL6 A;  3CX5 F;  3E8B A;  4YIO A;  3RFR A;  2FTK A;  2Y0I A;  2EIN B;  1H2N A;  4L8J A;  4K3A A;  1AJP A;  2GHY A;  4O4J B;  1R6T A;  1IDS A;  1S77 D;  3FB8 C;  4FM2 A;  1AIL A;  5LHH A;  1AI7 A;  4X1K A;  2CUG A;  5IYB O;  3SPG A;  3ZED A;  5LMN O;  3H1H H;  2QGN A;  3TJT A;  1PL0 A;  2PF4 E;  4O4L A;  2ZXW C;  3UM7 A;  2Q4P A;  4PA9 A;  5KHH A;  5ITZ B;  4YY3 O;  4JV5 O;  4DR6 O;  1IBK B;  2QWN B;  2CH7 A;  3H1K H;  3RYF B;  2LJ2 A;  4IHJ A;  3FAV B;  4BIU A;  3K3W A;  4LNU B;  2LO1 A;  1HP8 A;  1SQF A;  2CH7 B;  4GX0 A;  2Z3Y A;  1S0V A;  1Y66 A;  3A0H Z;  3H1L H;  3T2M A;  5GTI Z;  3CCJ V;  4P30 A;  1B06 A;  2QSA A;  3OMN B;  2HR3 A;  3IC9 A;  5LBQ A;  4G27 B;  3EXA A;  5LP6 A;  3C90 A;  4FLX A;  1TUE B;  2UXB O;  4GX2 A;  2OTJ V;  3E22 B;  4DUY B;  3UO3 A;  4I50 B;  1OJH A;  3D3I A;  3CCL V;  2A3Q A;  5HFL A;  5KX5 A;  2IU3 A;  3PJS K;  1VQ8 V;  2QKS A;  2ZE7 A;  2H8P C;  2O57 A;  4UCV A;  4JI7 O;  1F51 A;  2UUA O;  1M57 B;  1MA1 A;  3AK3 A;  3G4S V;  1Q6I A;  4PI0 A;  3QNE A;  4DV4 B;  1JCH A;  4YHH O;  4DR7 B;  4D7T A;  2IJK A;  5L3E A;  2HHH B;  2PI5 A;  5A9G A;  2HFE C;  1ZUQ A;  3HKE B;  5KUK A;  4J9Z B;  3H1I H;  4AQY O;  3U10 A;  3CYO A;  3K5N A;  4YIP A;  1XMQ B;  3E8H A;  4DV6 O;  4XDL A;  1GN6 A;  5KAI Z;  4ZHQ B;  1SZX A;  3AG3 C;  1VQ6 V;  4JAS A;  4U7N A;  3ZMT A;  1EN5 A;  2Q0O C;  3K0D A;  3R65 A;  2F23 A;  1W2B U;  3FYE B;  2RMK B;  3CC4 V;  3ETQ A;  4GZR B;  2N05 A;  1TUB A;  5LYJ B;  4C7U A;  2CE4 A;  1VQ5 V;  3W7W A;  2H3O A;  4DV1 B;  2WLL A;  2ZXW B;  3GVM A;  3QG5 A;  3BA8 A;  1I94 B;  2OYQ A;  4X1I B;  3T4D A;  5LXT B;  2LP7 A;  1NKD A;  1IBM B;  2LFR A;  3ZMV A;  1QVG U;  2YUA A;  3QTC A;  4JI7 B;  3BA9 A;  2WLJ A;  3CC7 V;  1XQ8 A;  4B3T O;  3CCV V;  5IY5 C;  1IUR A;  2X6B A;  5EBM C;  4GKJ B;  4NTW A;  2UXD O;  4QPK A;  4WF9 V;  3I55 V;  3LSS A;  4EFB A;  2ITC C;  5EIB C;  4BAY A;  3E35 A;  5E79 Z;  2WPD G;  2P90 A;  2YI9 A;  2PI4 A;  2B1I A;  1IXB A;  2Q6A A;  5CA1 A;  2C2A A;  1F4M A;  2ARH A;  2BE3 A;  1IX9 A;  3FFQ A;  1MOF A;  2WLK A;  4IGG A;  4F4L A;  3FD9 A;  3OW2 U;  3CMA V;  2E75 B;  3B8N A;  2LW1 A;  4IYI A;  1QQC A;  1THZ A;  2IW5 A;  1NJI W;  1D2D A;  3CCR V;  2R9R B;  1GN2 A;  5A2Q N;  1SS3 A;  4WBN A;  5KMG A;  4JI5 O;  1Q7Y W;  4H37 A;  4TV8 B;  2A06 H;  1WPX A;  3CXH F;  4MVQ A;  4EEQ A;  2DWD C;  4X66 B;  3CCQ V;  1QLN A;  1D5N A;  1XRE A;  1FAF A;  1KEC A;  3AG1 B;  2VRZ A;  3SPH A;  4NTY A;  3Q4H B;  2PY5 A;  3CCU V;  3ZRS A;  1V54 C;  3AG3 B;  3AG4 C;  2YIB A;  3HKC B;  1K4C C;  1RSO A;  2X6A A;  2XAG A;  2ZKO A;  4LF8 B;  4B3T B;  1ZL8 B;  4W4L A;  1L1F A;  1P4R A;  3UT5 A;  1AB3 A;  3L70 H;  1VAR A;  2QWQ B;  4LF5 O;  2NN4 A;  3JYC A;  5FPR A;  1G8M A;  2HLD G;  2L35 A;  3OTO B;  3VQW A;  1ZTE A;  2CGN A;  1HR0 B;  1XNR O;  3JAK B;  3JAL B;  2QWR B;  5B1O A;  1Q5O A;  2YXH A;  2OT5 A;  1SRY A;  1KC8 W;  4PDR A;  2ZM6 B;  4ASU G;  4O2B B;  1JJO A;  1PNM A;  5KA6 A;  1Y76 A;  4JTC B;  2OWO A;  5IY5 B;  3N2G A;  3QO8 A;  4X20 B;  1YJW V;  1PPJ H;  4J7J A;  1BS3 A;  3OR7 C;  1VP7 A;  2KKW A;  2WLI A;  3J80 N;  1VMG A;  2A9H A;  3THO A;  1AP6 A;  4JZ2 A;  4YJ2 B;  3CCS V;  2F95 B;  5IWA B;  4P9P A;  3N2K B;  2Z0A A;  4FFB B;  3VQV A;  4RWU A;  4I4T B;  5JQG B;  4KHP O;  4CBC A;  3LDC A;  2XUM A;  3ETG A;  1Y74 B;  4EB6 B;  4CZZ A;  2GV9 A;  4H13 B;  3SJB C;  2YSU B;  5EYP B;  5HFM A;  1YEW A;  1DLB A;  4O2A A;  2Q67 A;  4LWS B;  2DQ3 A;  3WG7 C;  1AI5 A;  2DWE C;  5BMV B;  1LUV A;  2ZQM A;  1K8A W;  3B09 A;  2X0L A;  3JAW A;  4BR6 A;  2YIC A;  2Q0A A;  3OUS A;  2IJI A;  3SYC A;  1QCE A;  1GM9 A;  2JK5 C;  3C3S A;  1M1K W;  1ZWI C;  4LF6 O;  1R73 A;  1WP7 A;  1XNR B;  1QHT A;  4X9Q A;  1H8E G;  3ZX6 A;  4RQF A;  2P4V A;  5KA5 A;  1XNQ O;  1V54 B;  1KUQ A;  3OMI B;  3D36 C;  4DXW A;  1K97 A;  5L3D A;  3OEH G;  1VQP V;  1J5E O;  3JSL A;  1VF6 C;  2A0L A;  2ZD9 A;  2E5L O;  1E1R G;  2BTQ A;  3CSX A;  3ABT A;  3M7M X;  1U97 A;  1K33 A;  4IT5 A;  3L75 H;  1SQG A;  2H94 A;  3JAS B;  1QVF U;  2EZO A;  4AIL C;  1HW7 A;  2BTQ B;  1DTO A;  4RUE A;  1CP9 A;  3ABK B;  4H33 A;  3BEH A;  1QU7 A;  1SF9 A;  2IH3 C;  4JI1 B;  3RYC A;  4G2K A;  4JGS A;  5EIB D;  4X1Y B;  4X64 B;  1NTM H;  5CA0 A;  3OT7 A;  3F7V C;  1H2M A;  4UVA A;  4Z1V A;  1VQM V;  2EIN C;  4K8X A;  5K1X A;  4DV5 O;  5LHI A;  3ZMU A;  1PV0 A;  1PKX A;  5EC2 C;  4NXN O;  4GKK O;  1EZJ A;  2UU9 O;  4JI0 B;  4UCU A;  4UFZ A;  2GUZ A;  4CC6 A;  1KP2 A;  3LUT B;  1ZX3 A;  2EJR A;  1FKA O;  4LF9 B;  2JRI A;  3WG7 B;  3T1C A;  1ARO P;  4YXW G;  1WJZ A;  2FL4 A;  1N33 B;  1DK1 A;  4WFE A;  3I56 V;  4B08 A;  5LMU B;  3E83 A;  2E5L B;  4XDK A;  4X65 B;  5EBL C;  3TGU H;  1FXV A;  1TVK B;  5FNV A;  1EN6 A;  4OX9 B;  1XHZ A;  3K57 A;  5IT9 N;  3ETD A;  1L0L H;  4I9W A;  2IM9 A;  4CH6 A;  5LA6 A;  4RQE A;  1JJ2 U;  4DRX B;  4DUZ B;  1WPB A;  3I5D A;  4PA7 A;  2F4V B;  2WLM A;  4AHC A;  1K7D A;  1FFX B;  5CBG A;  4BIO A;  4R7C A;  2Y4T A;  5LP6 C;  2P06 A;  3SDL A;  2Y4U A;  1W0K G;  5DED A;  2W0X A;  1JOY A;  4YJ3 B;  1M57 C;  4O4I A;  1H2L A;  2R70 A;  4UV9 A;  4DV5 B;  2UXN A;  2YS8 A;  4WFA V;  1M9N A;  3CRR A;  4HNA A;  4U3J A;  1SA0 A;  3D3Q A;  2RCV A;  5CBF A;  4DR4 B;  5IYD O;  1IBL B;  2UU9 B;  1PP9 H;  4X8A A;  2EBO A;  5L3G A;  4R6Z A;  4DUY O;  3LNM B;  4IIJ B;  4U3J B;  3APO A;  3ZRW B;  2ZCE A;  5BZB A;  2ETN A;  5L3C A;  1WNS A;  2KG7 B;  5LGT A;  3CWB H;  5FPO A;  1AR5 A;  1NH2 B;  4JI4 B;  4LCU C;  3ASO C;  3E89 A;  5BR8 B;  5FL7 G;  3L73 H;  4PI2 A;  3ABU A;  4DV4 O;  1IVS A;  4DR7 O;  3TK1 A;  1OCR C;  2HHH O;  4HAM A;  2GTA A;  4UVB A;  1GK9 A;  1VEW A;  2YEV A;  1BT8 A;  5DN6 G;  4UVC A;  2Q9L A;  1VF7 A;  4G28 B;  2JVD A;  1QR9 A;  1XMQ O;  4X1K B;  4FM1 A;  5BXZ A;  2ZNI A;  1SQP H;  4FIP C;  1K34 A;  5H2F Z;  3WB2 A;  2QWP B;  3A8T A;  2OCC C;  1BMF G;  4UXN A;  4O4L B;  4N23 A;  3H1J H;  3K9S A;  2ITD C;  2EZP A;  3F7Y C;  2PZS A;  1XHX A;  4IHJ B;  3CRA A;  1G1X B;  3W7X A;  3AEI A;  4JPR A;  3SYO A;  4LC1 A;  1G6U A;  3CJH A;  4GUN A;  4DV1 O;  4B7E A;  1R1B A;  1K4D C;  1I94 O;  3E2E A;  2YXL A;  5LP6 B;  3B2E E;  4NKG B;  1IBM O;  4DK0 A;  4NXM B;  1H8H G;  4FPP A;  4PA4 A;  5JJE B;  1GTO A;  2BOB C;  5JCO A;  2DMX A;  3E8F A;  4JF3 A;  2EIM C;  4QJF B;  2QWO B;  5KX5 B;  3GWK C;  3T1H B;  4E4E A;  2ADQ B;  4L87 A;  4JI6 B;  4GKJ O;  1NZ6 A;  1JPX A;  3RYH A;  2CDY A;  4BW5 A;  3OD4 A;  2QM4 A;  4A5U B;  1QNM A;  2M6Y A;  1R6N A;  2ZT9 B;  1NH2 D;  2RQ6 A;  3APQ A;  3U0Z A;  4UB6 Z;  4GLX A;  3AG2 B;  4K0K O;  1O9G A;  3IFX A;  5CB4 A;  5DEC A;  3AG1 C;  2HP8 A;  2Q69 A;  1M4U A;  5B1B C;  3JAR A;  1AJN A;  1F23 A;  3N27 A;  1HDJ A;  2XT9 A;  3EHB B;  4FZ0 A;  1PNK A;  3P3P A;  2VS0 A;  3ASO B;  3O9O A;  1SQX H;  3AK1 A;  5CN0 A;  1S5J A;  1RM1 B;  3FB7 C;  3K04 A;  4ZI7 A;  2GBO A;  3K03 A;  5KUM A;  5IJ0 A;  4ZOL A;  1OCR B;  4DV7 B;  3JCU Z;  3RW0 A;  1R3K C;  4H44 B;  3UKM A;  1HNZ B;  4DV3 O;  3ML0 A;  1Q6U A;  2XOK G;  4X66 O;  2XND G;  3AK2 A;  3P32 A;  4HYO A;  3SR2 C;  2CTR A;  3HKB A;  5D5Q A;  2HVJ C;  3H01 A;  1TUB B;  1EZV H;  4I55 A;  2OCC B;  2WLL B;  5IYZ A;  4RUF A;  3G6E V;  2QKC A;  1A32 A;  2W6J G;  3E8G A;  5JH7 A;  4LF8 O;  2P6J A;  2XAS A;  3S3W A;  3J7A U;  1I7F A;  5JH7 B;  2XAJ A;  1JFF A;  1MZE A;  3EFF K;  3OTO O;  2X7R B;  1SES A;  4B3R B;  3LSU A;  1HR0 O;  4K0K B;  3FKS G;  1E79 G;  4LH7 A;  4U3F H;  4TV9 A;  3R66 A;  3JSN A;  5JVD A;  2E74 B;  2Y48 A;  2UUC B;  1Q6H A;  5KAF Z;  1WA8 A;  2N04 A;  2ZM6 O;  3ABM B;  5CA1 B;  4JYA B;  2EIM B;  1ORQ C;  2EIK C;  4ZKI A;  2CTW A;  3HR0 A;  1AJQ A;  1EBO A;  3B4S A;  1S5L Z;  2LGW A;  3ASN C;  1V9P A;  2NLJ C;  4TSF G;  4DV3 B;  1R3L C;  1WLE A;  4WBN B;  5KMG B;  3BAA A;  4QGP A;  2HG5 C;  5IWA O;  3L9D A;  3BAB A;  1N0N A;  4K8Z A;  1H2K A;  5B1B B;  1WB7 A;  2OIG A;  3K5L A;  4B3M B;  1RP3 B;  3OEE G;  3ZHU A;  5H9C A;  1MNG A;  4LFC B;  3IC7 A;  3T1Y B;  1K3E A;  3BFR A;  3LDD A;  1XEQ A;  2B9Z A;  3DXR A;  3CC2 V;  4CS4 A;  2BTO A;  2RN9 A;  1GMG A;  2K9P A;  1RSO B;  2YDE A;  3W7S A;  1PL4 A;  1OZ0 A;  5H6R A;  3UT5 B;  5L3F A;  1BE3 H;  2IU0 A;  3ZN0 A;  3OGI B;  2JGD A;  1I0H A;  4JI3 B;  4FM0 A;  2RDC A;  3ABK C;  3MHS C;  4PJ0 Z;  3ZHS A;  2LW7 A;  5KHI A;  3JAT A;  4J7Z A;  4FLY A;  1SQV H;  2IJJ A;  1VIB A;  1P7G A;  3OM3 B;  4FLZ A;  2AHY A;  2XAF A;  1EM1 A;  5EZY A;  2ZR3 A;  3GWO A;  4JAU A;  4CS3 A;  3IAY A;  3UQ8 A;  3TXS A;  4F6R A;  4UCS A;  1M56 C;  1Y76 B;  4OPA A;  3K5M A;  3N2G B;  1VQ4 V;  3P3N A;  4X62 B;  3HKD A;  1OHH G;  3DGE A;  1RFY A;  3L71 H;  2WLI B;  3F5T A;  3J81 N;  3LSQ A;  2IBZ H;  2X6C A;  4X89 A;  2AZ2 A;  4GYC B;  3CCM V;  1S76 D;  4P9O A;  4JI1 O;  3OR6 C;  3RVZ A;  1SKV A;  4BW9 A;  2EIK B;  2PTM A;  4JTD B;  4X64 O;  1Q8I A;  1EN4 A;  2HKO A;  5LGN A;  4CH3 A;  5C8Y A;  3ASN B;  4O2A B;  1OCZ B;  3ZHV A;  4TT3 G;  1UFI A;  1QR8 A;  4TOI A;  3JAW B;  3KZI Z;  4K35 A;  1Q3E A;  5GTH Z;  1NI8 A;  1KKD A;  3ZMS A;  3OFN G;  3TXQ A;  2QA4 V;  2NNU A;  1W0J G;  2DYS C;  2KQX A;  5KHG A;  4JI0 O;  2ILM A;  1WN7 A;  2YIB D;  1US6 A;  4FLT A;  4DV0 B;  3OE7 G;  1JQ0 A;  3OGC C;  5J2T A;  1NR1 A;  1DF5 A;  1URF A;  1AR4 A;  4QE7 A;  2DJV A;  4DYL A;  4LF9 O;  5IE9 A;  5IJ9 A;  4JI8 B;  3BRC A;  3O65 A;  4CC5 A;  1N33 O;  2R72 A;  4TWK A;  5L3B A;  3SJA C;  1L0N H;  1CEZ A;  1FXK A;  5LMU O;  4P2Z A;  1GRJ A;  1MSW D;  1K9M W;  1GH6 A;  3BHP A;  3MD0 A;  4X65 O;  4X88 A;  5LL6 Y;  4MVZ A;  1NR7 A;  2AHZ A;  3WB1 A;  3UCS C;  4OX9 O;  3G80 A;  3L72 H;  3ZBH A;  4FK5 C;  4TQF A;  2XAQ A;  3ABL C;  2N74 A;  1SER A;  3DC5 A;  4DUZ O;  2WA4 A;  2R9I A;  4DV2 O;  2A79 B;  2F4V O;  1AR1 B;  3VOU A;  1VQL V;  4FFK A;  4NR1 A;  1VQ7 V;  3K9A A;  2EJ7 A;  3RYC B;  1RPO A;  2FYU H;  2P7T C;  4MS2 A;  1M56 B;  3TCU A;  3CRC A;  2DYR C;  3S3X A;  5CA0 B;  2PGG A;  1ZSP A;  1M93 A;  5B1A C;  2Q5Z A;  3OUF A;  3VQY A;  2B5U A;  1Y4M A;  2FKX A;  3ETE A;  4Q20 A;  1GN3 A;  5LGU A;  2P5O A;  3A0B Z;  1N32 B;  1N8R W;  2E76 B;  4LF4 B;  4O4H A;  4DR4 O;  1IBL O;  1NBM G;  4CH5 A;  4I9Q A;  4Z1M G;  3RYI A;  1COW G;  2F43 G;  4JI2 B;  1NU1 H;  4KL1 A;  2JS3 A;  4BIZ A;  3MDS A;  4UCR A;  2GUZ B;  1CPY A;  3ZRV A;  3X2Q C;  1JVM A;  2EIJ B;  3CS5 A;  2P22 C;  4PDL A;  4HBN A;  3ZHT A;  4I0X A;  4PA6 A;  4JI4 O;  5TIS Z;  4CH4 A;  4QE9 A;  2E3C A;  5CBH A;  2V4D A;  2ZDI A;  5BR8 O;  1N36 B;  2ZIN A;  3K59 A;  3M99 B;  2D3O W;  2EUL A;  5D5P A;  1SQQ H;  5GON A;  4MSW C;  1YDX A;  4QNH B;  4LFB B;  2DYS B;  2ZNJ A;  4MTF A;  4DR5 B;  5FNV B;  1YVW A;  1JX9 A;  4J10 A;  3ZJZ A;  4LFA B;  1KB9 F;  4DV2 B;  3CXC U;  1AI4 A;  1PNL A;  4MTX A;  1SET A;  5LA6 B;  2LQT A;  1YI2 V;  4FMT A;  1YJN V;  1P84 F;  1S3J A;  3P30 A;  1LUW A;  5E1A C;  2EIL C;  4CS2 A;  5B3S C;  1T5E A;  4WCE V;  3JD2 A;  1HNW B;  4LBE C;  1AVM A;  3JD4 A;  1XMO B;  3SYQ A;  2VWK A;  4J80 A;  4J11 A;  3ABL B;  4NYK A;  4O4I B;  1FFT B;  4B3S B;  1RPR A;  4F6E A;  1YZB A;  1U96 A;  4ZIB A;  2UXC B;  2F66 C;  1FD9 A;  1DGS A;  4HNA B;  1S5H C;  3AG2 C;  2QE7 G;  1SA0 B;  3CP1 A;  1Y67 A;  4IL6 Z;  4PDV A;  2Q73 A;  5BY1 A;  2W0F C;  3PN1 A;  4NXM O;  4TUY A;  4MVO A;  2VQE B;  2ZIM A;  2P4K A;  2DYR B;  1B6Q A;  3G67 A;  1RM1 C;  1WB8 A;  5B1A B;  2Q68 A;  4QPJ A;  3T1H O;  4JI6 O;  1R3J C;  1YSC A;  3ZIA G;  2WLH A;  3K0G A;  1M5I A;  1FJG B;  2W6I G;  4O4J A;  3CPW U;  3G71 V;  3ZCC A;  3MHH C;  5IYC O;  2YEV B;  5J2U A;  4XBF A;  1M90 W;  1NVP B;  1K73 W;  1R3I C;  1ZAU A;  2AXT Z;  2ATK C;  3DSQ A;  1W59 A;  3X2Q B;  1KBH A;  3BPZ A;  3ZN1 A;  3IJ4 A;  4LF7 B;  1HNX B;  3BCC H;  3DC6 A;  5J2U B;  3FB6 C;  5ITZ A;  4DR3 B;  2ADP A;  3RYF A;  1VQO V;  5CMU A;  3W7U A;  4EKW A;  3FAV A;  1R6K A;  2Y69 C;  4HZ3 A;  1YXB A;  2LFS A;  1NTK H;  4DV7 O;  4LNU A;  1HNZ O;  2FML A;  1YF2 A;  1BHB A;  2F93 B;  2WLN A;  4KXR A;  4Q6G A;  1KQS U;  3FYI B;  3CRM A;  1YIT V;  4DR1 B;  3CJH B;  1N34 O;  2DQ0 A;  2WA3 A;  2EIL B;  4DR2 B;  1XI1 A;  3E22 A;  5B3S B;  4I50 A;  4OPH A;  1AP5 A;  3ABM C;  2KSD A;  3SYA A;  1XIL A;  1HWY A;  3KCY A;  4WFF A;  3ZS8 C;  2PYL A;  4IYH A;  4NB5 A;  2CAZ C;  3M8A A;  1UPG A;  2ZE5 A;  1N4C A;  2AW9 A;  1OCC B;  1NQT A;  3NXS A;  2XTA A;  4B3R O;  3JD3 A;  4GX1 A;  1Z2G A;  1TAE A;  3RYH B;  4FVM A;  3HKE A;  1KU9 A;  1YHQ V;  4FZ1 A;  4PV1 B;  2V7Q G;  3RWR D;  2UUC O;  4LP8 A;  2Y0P A;  4JYY A;  5KHJ A;  1MG1 A;  5CB4 B;  4RO2 A;  1X59 A;  4GT1 A;  5B1N A;  4JYA O;  3JAR B;  4MVR A;  4PHZ A;  5LMN B;  2AGA A;  4ZHQ A;  2Q8V A;  3ZHR A;  3H9V A;  2QR4 A;  3TET A;  1Z5V A;  3GB7 C;  2D2C B;  2KB1 A;  1OCO C;  1NVP D;  4ZBM A;  4UCO A;  5KHK A;  4YY3 B;  4JV5 B;  4DR6 B;  4ZI7 B;  3ZMZ A;  2Q7H A;  5IJ0 B;  4ZOL B;  5LHG A;  1XUQ A;  3VBB A;  1S72 V;  1EFR G;  5LYJ A;  2L6L A;  1XL4 A;  1N34 B;  3RN4 A;  2DN9 A;  4B3M O;  4MT8 A;  1Y6X A;  4LFC O;  3HKB B;  3KKY A;  1Z5W A;  2HEP A;  3T1Y O;  4X1I A;  5LXT A;  2YID A;  2CK3 G;  2UXB B;  1KMI Z;  4I55 B;  2AZ0 A;  1GM8 A;  4FLW A;  5IYZ B;  1YTF B;  1WAZ A;  2Z5U A;  3RBZ A;  2Y69 B;  1BQ0 A;  1J95 A;  1KD1 W;  3DTU B;  2RNB A;  5AG2 A;  1MMM A;  4J7K A;  1IZ3 A;  1IXM A;  3RGB A;  2QTO A;  1XDC A;  2P67 A;  1LR1 A;  2UUA B;  2ZE8 A;  4DO2 A;  1YJ9 V;  1MZF A;  4DW1 A;  1JFF B;  3KCX A;  4YHH B;  5DM6 V;  4JI3 O;  1NT2 B;  3ICX A;  4MTO A;  1H2G A;  1G4Y B;  3B8M A;  3UO2 A;  2DW4 A;  2GTS A;  2WSS G;  3FX7 A;  3IGA C;  1D5A A;  1BHA A;  3OTF A;  3SJQ C;  1YCI A;  4PA3 A;  4TV9 B;  3WU2 Z;  1SQB H;  2M7W A;  5JVD B;  4AQY B;  4MVU A;  1B04 A;  3SPC A;  4DV6 B;  1GO3 F;  2YI8 A;  3RT3 C;  1WA8 B;  4MVM A;  1OCZ C;  2HVK C;  2ZR2 A;  2Q7G A; 
#chains in the Genus database with same CATH homology
 3GVM A;  3FD9 A;  2VS0 A;  3TXQ A;  4LWS B;  1WA8 A;  3O9O A;  4I0X A;  2KG7 B;  3FAV A;  2VRZ A;  3Q4H B;  3G80 A;  3HR0 A;  4GZR B;  3ZBH A;  4LWS A;  1WA8 B;  2DE0 X;  4I0X B;  2KG7 A;  3GWK C;  2AZ2 A;  3TXS A;  3FAV B;  2AZ0 A;  4ABM A;  3Q4H A;  3OGI B;  2B9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...