2B9ZA

Solution structure of fhv b2, a viral suppressor of rnai
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
GAMPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVGRMVTSLLEKPSVVAYLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B2 protein
publication title The structure of the flock house virus B2 protein, a viral suppressor of RNA interference, shows a novel mode of double-stranded RNA recognition.
pubmed doi rcsb
source organism Flock house virus
molecule tags Viral protein
total genus 25
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2b9zA00
3TXQA 4ABMA 3Q4HB 3TXSA 3G80A 2B9ZA 4GZRB 3OGIB 2VS0A 1WA8B 3Q4HA 3FD9A 3HR0A 1WA8A 3FAVB 3O9OA 4LWSB 2AZ2A 2VRZA 3FAVA 4LWSA 2KG7B 2AZ0A 4I0XB 3GVMA 2KG7A 3GWKC 4I0XA 2DE0X 3ZBHA
chains in the Genus database with same CATH superfamily
4O4LA 1XOUA 4B3SB 1XQ8A 3BABA 3CE2A 3T1HB 2ZE6A 3ABLB 1Q90D 2ZT9B 1QR9A 2IJHA 3BEHA 1H8EG 1IVSA 3G6EV 4DUYB 3CRRA 1GM7A 3GB7C 2DQ3A 3FB7C 4O4IA 4X20B 4GCZA 1AI4A 1WN7A 1P4RA 4K3AA 4WBNB 5LHGA 1WP7A 5LMNB 3SYOA 5IYDO 1DGSA 5EIBC 2LQTA 1U96A 2DN9A 4TUYA 2EIJC 5H6QA 3T1HO 4JTDB 3K57A 5JJJB 1UPGA 2O57A 2NLJC 4JI8O 1T5EA 2JS3A 3C3TA 1N32B 2ZXWB 5KX5B 1FXKC 5J2UB 1SQXH 4LFAO 3HKCB 3ASNC 2CH7A 2CGNA 4EB6B 1GN2A 2QWNB 2ITDC 2RMKB 1OZ0A 4YY3O 4GYCB 3L71H 2EIKC 1XUQA 2PI5A 1W0KG 1V55C 3P30A 2R70A 4KUMA 4DR5O 3OAAG 5GONA 4KFMA 2DYRB 5GW7A 4LF8O 1BE3H 2FB5A 4PDVA 1LUVA 3RBZA 2WLIB 2A0LA 3D3IA 2HEPA 1M57C 1W0JG 4UV9A 5LGUA 1XI1A 2Q67A 4J10A 3C90A 1K8AW 4AILC 2L6LA 4UVCA 4W4KA 4B7EA 2GDSA 1VMGA 3OD4A 2Q5ZA 3ZCCA 4JAAA 1EBOA 2UXNA 1IXBA 4D6TH 1JJ2U 2YC0A 2VQEO 2F66C 3JSNA 1I08A 3T1YO 4B08A 3RYCA 1RSOA 4XDJA 2IW5A 1OCZB 5BMVA 4RUFA 5CA1B 1CP9A 1QLEC 4YJ3B 1SESA 3OEHG 2A79B 2WWWA 1IZ3A 2X7RB 1Y66A 3P32A 2EINC 1QHTA 3MD0A 1Q86W 1CEZA 4X65B 4GX0A 4DW1A 4RAIA 3K59A 3ABUA 4DW0A 1H2MA 3ICXA 2Y4UA 2PUSA 2W6JG 3STZC 1XL4A 3UT5A 2HHHO 4NVPA 1K73W 1D5AA 2QWQB 1YVWA 3BA9A 4ZOLA 4F6EA 1EZJA 2KQXA 2BSKA 3MDSA 2Q69A 2F4VO 1YEWA 4PDMA 3HKEA 1JQ0A 3OMIB 1XMOO 4JI7B 3CXCU 1BSMA 3X2QB 1AVMA 4UCOA 1SQPH 3BA8A 5JVDB 4GKJO 4JYBA 4EKWA 2FL4A 3JARB 3ZRSA 4QE7A 1ZTEA 1ZWIC 3DTUB 4YHHO 2B1IA 1WP8A 3JASB 5DN6G 1BS3A 2RNBA 5LP6A 1QBZA 5KHGA 3K9AA 1QU7A 1VIBA 2UUCB 2JGUA 1IBMB 1NT2B 4UFZA 3K0GA 4IHJB 3MAQA 4MVQA 1S3JA 2ZM6O 5F2VO 1K3EA 3ZMZA 2ZCEA 5KAFZ 2CE4A 4NTWA 4JF3A 2Q0OC 3U10A 3JD3A 3RFRA 2R9IA 1CPYA 2N05A 2OCHA 4X1KB 2JGDA 4CS3A 2UUCO 4JV5B 4DV6B 3IC9A 5B66Z 3Q4HA 2BTQB 4EFEA 1VF6A 4DR2O 2KKWA 1BQZA 5LL6Y 4CH5A 5E1AC 4DK1A 3B40A 4LF6B 1ZL8A 4B3TB 3K79A 2GUZA 2VQFB 4GX2A 2P90A 1J5EO 1OCOC 3JCZA 2HJDA 1KU9A 2JVDA 4U3JA 4JV5O 1NVPD 5IY5B 4UB8Z 5IYZB 4IYHA 5LGNA 4IGGA 4WFBV 1VQOV 4PA9A 5EYPB 3A0HZ 2YEVB 2H8PC 1XBLA 1YTFD 1OCCB 2RCVA 3M99B 3AG2C 4TWKA 1V54C 1R6NA 2FYUH 5HFLA 2AHYA 3SPJA 1FAFA 2DW4A 4K0KB 3B77A 4O2AA 1WJZA 5LOVB 2N74A 3N27A 1L8DA 4FM1A 1F4MA 2UUAO 3ZMTA 2P4VA 1RPOA 4IYIA 1JFFB 1NS1A 3VBBA 4TV9B 2DOSA 2Y0IA 4FLZA 3L73H 3WB0A 2BTOA 2EULA 3RWRD 3AG1C 3TJTA 1BGYH 3SGIA 3E86A 1GAXA 4I55B 4H37A 5KUKA 1QVFU 3K08A 2OCCC 4J9YB 3CMAV 4UVBA 2KG7B 4X1YA 3WG7B 1GRJA 1JCHA 1NI8A 5IJ9A 1ZAUA 4DV2B 3OTFA 4GT1A 5IT9N 1FD9A 4O4HB 1P49A 1AILA 1D5NA 3K0DA 1FFXA 2YIBA 3MHHC 1ROPA 2IM9A 4I5SA 2ETNA 3ZHUA 4N23A 4QGPA 2EBOA 2Q8VA 4MVRA 1O9HA 2P5OA 5EC2C 1QNMA 1PNKA 3ASOB 3B2EE 1QQCA 4H44B 4JI1B 4QIWF 5FL7G 4WF9V 2WA3A 3GWOA 1L0LH 3ABTA 2ITCC 4J7JA 3KKYA 3H1LH 1JOYA 1NVPB 2NNUA 2LGWA 1I7FA 2QKAA 2ZE7A 2HP8A 4DV5B 4TSFG 5KX5A 5J2UA 2ADQB 4UXNA 3THOA 1TAEA 2UU9O 4JI6B 2CGOA 3IGAC 4FIPC 2JDIG 2BCCH 1YTFB 1GN6A 3FKSG 5B3SB 4DR4B 1WA8A 2UUBB 5BR8B 4YIPA 4I9QA 3M8AA 2YXHA 1I0HA 5IJ0B 4J11A 4K8XA 4DV5O 4UCUA 1MZEA 4JI2B 2PF4E 1Q82W 3TXQA 3JD1A 2DWEC 3CCMV 3AG3C 4GZRB 5B1AB 1S5LZ 3KCXA 1EN5A 1URFA 5CBGA 3E2EA 4LFBO 1WLEA 4G27B 1MMMA 2GV9A 1K5SA 2AHZA 1HNWB 2F1MA 3T4DA 3ZN0A 4MTFA 3BY6A 5LP6C 2QWOB 3OT7A 2IU0A 3ZRXA 1KB9F 4H13B 3J7AU 4MVUA 5B1OA 4JI3O 4NTYA 4JI2O 4NXNO 2A9HA 2QR4A 3N2KB 4PI0A 2ZR3A 4DK0A 2WA4A 1RFYA 4CH6A 1GO3F 1YXBA 3SDLA 1PD3A 3G67A 1K4CC 3U11A 4LWSA 2YXLA 1JR9A 2XUMA 3BAAA 4G28B 3LDDA 2UXBB 4F6RA 4D7TA 4X88A 3R66A 1VF6C 2QKSA 4U7NA 2A7WA 2R9AA 3FYEB 3LUTB 1KKDA 3TGUH 3A0BZ 1ENVA 3ABMB 2WLHA 5CBHA 3OEEG 1DF4A 4ZBMA 4I0XA 1XHZA 2ZE5A 3EVKA 4JI0B 1PL4A 2JRIA 3K06A 1US6A 3ZHQA 3RT3C 1SETA 5H2FZ 4DV0B 2R9RB 4PA7A 5A2QN 3TCUA 4ZHQA 5EK0A 1YZBA 2CUGA 2PGGA 2P67A 2YSUB 2P7TC 4X1IB 4LFCB 1SF9A 2EIMC 2X6CA 2PY5A 4FLXA 4DR7O 2XAGA 1A32A 2LFRA 3VQYA 5ITZA 1MABG 2HVKC 3SYQA 1K7DA 2YIAA 5DEDA 4J7KA 1G6UA 4XBFA 1Z5VA 2WAMA 4LF9O 3K3WA 3FFQA 1KBHA 3F5TA 1DLBA 1EM1A 1W59A 4FLUA 1RPRA 3H1KH 1AR1B 1Y74A 2RN9A 1HP8A 3G80A 1VQ7V 3IAYA 2Y48A 4FLWA 4PD4F 3QVNA 3ETEA 3LSQA 3RN4A 4JI8B 4BR6A 4AHCA 4MTXA 1EN4A 1IBKO 2QA4V 4LNUB 2QTOA 2PYLA 4O2BB 3RYHA 1RP3B 4LFAB 4DV4O 1UJWB 1M93A 3LNNA 1GKFA 2GHYA 3ZRWA 4YY3B 2Z5UA 4CH3A 5L3BA 1KD1W 3ABLC 4X62O 1S5JA 4DR5B 3H1HH 3JATA 1S76D 4KXRA 3CMEV 1AR5A 2VRZA 4MVMA 4LF8B 5CB4A 1FXKB 1TUEB 3ASNB 1BQ0A 2K9PA 1Q3EA 1HNZO 4HBNA 1K33A 1N33B 4FFBB 3OGIB 2EIKB 4MW3A 1LUWA 1V55B 3D3QA 5GTHZ 1SQFA 4JI4O 1F7YA 4TQDA 2ZXWC 3JSLA 2AZ0A 2E76B 3HKBA 3CCQV 3G6BA 2QWRB 4QPKA 1E79G 5EBWC 3JYCA 2E3CA 3SPCA 5H5NA 5KHKA 5IYCO 2VQEB 5GTIZ 4U7OA 4KL1A 2HKOA 2Q68A 1N33O 4YJ2B 3T1YB 1ZUQA 5LXTB 2DYRC 5LGTA 5L3FA 1M5IA 4R50A 4GX1A 5EBMC 1RM1C 4BW9A 2LGQA 2K1EA 4MS2A 2HLDG 3CRAA 5LMUO 3BCCH 1LNQA 2DJVA 2Q9LA 3L72H 3T1CA 1GN4A 1SZTA 3I55V 3N2GA 5C8YB 1WNSA 5H9CA 3K03A 2WLJA 4PA4A 3CWBH 4W4LA 1KYOF 4P2ZA 3ZMSA 1H38A 1QVGU 1Q6UA 1GH6A 4FVMA 2HHHB 3E35A 2P06A 1AJNA 1V9PA 1ZSPA 3UCSC 5EZYA 4X89A 3WB2A 1OCZC 1VQPV 1WB8A 3O9OA 2ZINA 2EINB 2KB1A 4JASA 1H2SB 2DYSB 2F4VB 4IL6Z 3E8HA 3AK1A 1XMOB 2N04A 4KP4A 3KZIZ 4F4LA 3C3SA 4GKJB 3K5NA 1ZX3A 3ZHTA 4B7KA 4NYKA 5TISZ 4YHHB 3OE7G 4GLXA 2WLLA 2OIEA 3ETQA 1KUQA 1NTZH 1Y76B 4XDKA 1NU1H 2XHBA 1N0NA 5BY1A 1VQKV 4LF4B 1K9MW 4Z1MG 1VQNV 3SPGA 1G4YB 2ZM6B 4O4JA 4C7UA 1AI5A 1VQ9V 2H94A 5FNVA 1YSCA 3JAWA 3QTCA 2YUAA 3AG4C 2PTMA 2QWPB 4YXWG 3JALA 5J2TA 3E8BA 3LDCA 4LP8A 3X2QC 1F51A 3ZEDA 3OR7C 4RWUA 3LDEA 3S3WA 3NR7A 4FPPA 4LF4O 1VF7A 1FS0G 3CC4V 1BHAA 4IIJB 3JAKA 1HWYA 4DR2B 5JH7B 2YXYA 1F4NA 1Q6HA 1OHHG 3CB2A 2ZNIA 1KKCA 5LYJA 4ASUG 3T2MA 3E8GA 2QKCA 2UXDO 5JJEB 4JPRA 4WCEV 4O4LB 1J5EB 3EXAA 4GX5A 1XILA 4ABMA 4FJCC 1KQSU 2OYQA 1AJPA 1SQVH 1HNXO 2JEUA 2JK5C 3VQXA 2WLKA 2ZKOA 2GTSA 5L3CA 3H1IH 3CXHF 4Q20A 5FPOA 4FM2A 4O4IB 4DR1O 2WPDG 1QR8A 3LSSA 5IWAB 1VP7A 4I50A 3UKMA 2ZDIA 2AW9A 2QJ1A 1BL8A 1COWG 1PV0A 3BRCA 1R3JC 1X4TA 5B5EZ 2VWKA 2P22C 4X66O 4E4EA 1B3QA 4TV8B 2UUAB 1FJGB 4RO2A 1NKDA 2Y69C 1WAZA 3FB6C 3P3PA 4JZ2A 5IWAO 2VWJA 1R3LC 3ABKC 1V54B 1MOFA 5IY5C 1IURA 1AJQA 2PYJA 2CAZC 1Q81W 4HNAB 3J80N 1FYJA 4DRXB 4QJFB 3ZMVA 4X1IA 3FAVA 1MSDA 2RJZA 3FB5C 3ZX6A 3NXSA 1FJGO 5LA6B 3RVYA 2JJ1G 3RVZA 2MW2B 4R7CA 4JZGA 2F43G 3JD2A 4LF7O 3AEIA 1N0JA 4BW5A 4X64O 4CBCA 3VQVA 4ZI7A 2OCCB 2R72A 4CH4A 5B1BB 3CC7V 1UFIA 1E1RG 4LCUC 3ZS8C 1Q8IA 1BCCH 1G1XB 3UM7A 3ZHSA 1F23A 3BHPA 1SS3A 2CK3G 1GMGA 5JQGA 2ZIOA 3SPIA 3RYCB 3SPHA 1JA8A 1RSOB 1GM9A 2OTJV 3SJQC 3I5DA 2ZD9A 1DK1A 2IH1C 4MVZA 2LO1A 5B1NA 1JX9A 4PA3A 4NXMB 3F7VC 1FXVA 2V1DA 3E22B 4DR3O 2D2CB 4H0LB 4D7SA 4JYAO 4X20A 3AK2A 3KCYA 4WFHA 2UU9B 1FKAO 2WSSG 4WBNA 3W7WA 3ETGA 4J7ZA 4J41A 3JD4A 1DF5A 2IJIA 3CRCA 3L70H 5CA3A 2EZPA 4NXMO 4FK5C 4NTXA 4CC5A 3UT5B 4LR3A 3ZBHA 3CD6V 3VOUA 3HKCA 3ASOC 3CRMA 1XREA 4EB6A 3CCEV 2M7WA 5KLVH 4LFBB 2BSKB 3ZHVA 3TETA 2Q0AA 4JI3B 3OTOO 2IBZH 2F23A 2WLIA 4MVOA 4NXNB 1E1QG 4R6ZA 5KUMA 1R6KA 4UCVA 3AG3B 1K5QA 3W7SA 4TT3G 5B3SC 4WFGA 4FMTA 4YJ2A 2AXTZ 2Y4TA 1M56B 1TA8A 2V7QG 1S72V 2RDCA 3TK1A 2OIGA 3WU2Z 1EN6A 2V4DA 5H6RA 3L75H 3I56V 4DR6O 5B1AC 2QM7A 1KMIZ 1P84F 2JS5A 1OCRC 5IDJA 2E74B 1U97A 3P3NA 1H2KA 2W6IG 5LHIA 1Y67A 3GVMA 5EIBD 4JGSA 4FZ1A 4GUNA 2JGDB 5CA1A 4WFAV 1VQ4V 1YF2A 2Q73A 4QPJA 3Q4HB 4YJ3A 2QDOA 2XAFA 3G71V 3DSQA 3FD9A 1XMQB 3HR0A 1S0VA 4FM0A 1BT8A 4JAVA 1ZL8B 4UCTA 4DV3O 3QF7A 2GUZB 2YS8A 2AGAA 2ZDIC 4DR7B 4FFKA 4L8JA 1AR4A 3LNMB 1VQ6V 1R3KC 4U3JB 4PDLA 1NH2B 4DUZO 3HKDB 1JJOA 3CPWU 1SQGA 3WFVA 4H33A 4X9QA 1YJNV 1Y6XA 4P30A 2OT5A 1XMQO 1AB3A 2P6JA 2OTLV 1I5YA 1THZA 5L3GA 3EFFK 2F93B 2B1GA 4U3FH 1WB7A 4LF9B 3JCUZ 3APQA 3SYPA 4P9OA 3IFXA 2FTKA 3CCUV 1PNMA 5JVDA 4O2AB 5DECA 2XNDG 1YCIA 5K1PA 3JARA 4GKKO 2JJ2G 1OJHA 4EFBA 1KP2A 1GTOA 3CJHB 1IBKB 4DV7O 1BHBA 4B3MO 2EILB 3JASA 3J81N 1NBMG 4Q6GA 1PL0A 3RW0A 4DV4B 3IJ4A 3K9SA 1Q7YW 2HVJC 4HYOA 4RQEA 1QLNA 1SERA 4IHJA 3OMAB 4X62B 4L87A 1TVKB 4X1YB 4KHPO 2UXCO 3AK3A 3CHXA 5L3DA 3FB8C 3PN1A 3CRQA 1XNRO 2E5LO 2ADPA 1HNZB 2YIDA 4X1KA 1FFXB 3RGBA 2BTQA 2EIJB 5CBFA 4JI4B 1L1FA 2A06H 3CYOA 5IYBO 1NR1A 1H2NA 2YI8A 2IJKA 1PP9H 4PI2A 3ZN1A 3H9VA 4NR1A 4NKGB 4ICGA 1Q6IA 4BAYA 3TXSA 4PDRA 1AP5A 4B3SO 2QE7G 3U0ZA 1FXHA 2BOBC 4BIOA 2IU3A 3SJAC 4PHZA 4LF5B 2E75B 4WFEA 2XASA 5CN0A 2EX3A 4TV8A 4DUYO 4JTAB 5L3EA 5IYZA 1XDCA 5EYPA 2YEVA 4UUJC 5JWPA 5LMUB 4FLVA 5LMNO 1M57B 1NTMH 2W0FC 1N36B 2IJJA 3CCVV 4TQFA 1WA8B 2ATKC 2CTQA 4ZIBA 4LF5O 4HNAA 5CA0B 4DRXA 5LOVA 2Q4PA 2AZ2A 3H01A 1MG1A 1N32O 1K97A 4FLYA 3DC5A 1RM1B 3K5OA 1Z5WA 4ZKIA 4G2KA 5LA6A 3HB3B 2JEXA 5CMUA 1JFFA 3E83A 4TV9A 1TUBB 1MA1A 1YI2V 4AI8A 4DO2A 1S5HC 1N36O 3O65A 1OV9A 2WLNA 4I55A 5D5PA 2X0LA 4CS2A 3RYIB 2ZQMA 3A2FA 1SA0B 3APOA 1H2LA 2KG7A 1YJWV 2L35A 1NR7A 4B3RB 3OGCC 3STLC 2DQ0A 4EEQA 3BFRA 2XTAA 1QLEB 1Z2GA 3W7UA 4O4HA 5E79Z 5DM6V 3D36A 5FPRA 3QO5A 5BXZA 4LWSB 3DXRB 1H8HG 4JYYA 5FLXN 3A0RA 1HDJA 4LH7A 4DYLA 3GWKC 3E22A 2Y0PA 4B3RO 4OGQB 4F6RB 2Q6AA 3A8TA 2EJRA 1SZXA 4K8ZA 3QO7A 1VARA 4MT8A 1D2DA 2YDEA 2ZE8A 2DYSC 3MHSC 1M9NA 5HFMA 4I0XB 3ZMUA 1YIJV 2BOCC 1MNGA 4ZHQB 1X59A 2W0XA 1VQMV 1JPXA 2CTRA 3RYFB 2MK3A 4X65O 3AG4B 4N21A 4JAUA 5ITZB 2UXDB 4PELA 4MVSA 5IJ0A 2QM8A 1Q5OA 4X8AA 4UVAA 1JMKC 4DXWA 4FLTA 3K5LA 2YICA 1HNXB 1CXZB 2FMLA 5KMGB 4DR1B 4I4TB 1YITV 4JI7O 1K4DC 1NTKH 3E8FA 3CS5A 1FFTB 3CCJV 1SQBH 1Y74B 2Q7GA 1N8RW 2ZR2A 1AP6A 3N2KA 1J95A 4UB6Z 2FKXA 2P4KA 4X66B 3CX5F 1PKXA 2YI9A 1P7BA 1WPXA 3PJSK 3RYHB 4DV1B 1VF5B 2LJ2A 1VQ8V 4MSWC 1MZFA 1K92A 4OPAA 3EHBB 3D8CA 3ZRWB 3UQ8A 5KA5A 1OCOB 5JCOA 1IBMO 2PI4A 2GBOA 2PZSA 3OUSA 4TUYB 3M7MX 2LP7A 1KECA 3JAMN 4K35A 3JATB 5K1XA 1FPOA 1BMFG 5A9GA 3ZIAG 2ZIMA 3W7XA 4UCRA 1NZ6A 5CB4B 1AI7A 1I5XA 2UXXA 2Y69B 1AROP 2CTPA 4DV1O 3SYCA 1B6QA 2CH7B 3HPLC 1XL6A 2NN4A 3AG2B 3ABKB 3F5WC 2NR5A 1PPJH 4DV6O 1PM9A 3H1JH 4RQFA 3HKDA 1XNQB 3UO3A 4LF7B 3BVOA 5KAIZ 5D5QA 5GONB 4QNHB 4X64B 2LW1A 3KG2A 3L9DA 4JI5B 4LF6O 3HKBB 2XOKG 4B3TO 1Y4MA 2GSMB 1I94B 2VQFO 4CS4A 1OCCC 4PA6A 1W2BU 2QEXV 3CCSV 1G8MA 2EZOA 5KHIA 3B4SA 2X6AA 3AG1B 1XNQO 2WLMA 4NB5A 4OX9B 3ZRVA 3OW2U 1DTOA 4JI5O 3AG7A 2KSDA 1IBLB 2EJ7A 1AI6A 1H2GA 3CJHA 1I94O 4DR3B 3BPZA 3S3XA 1HR0B 1SC5B 4WFFA 2G38A 2QM4A 4JYAB 4BWAA 2LFSA 4CZZA 3QG5A 5C93A 3N2GB 4K0KO 1GM8A 2M6YA 1M1KW 1MSWD 4OX9O 5B1BC 5BMVB 3B8MA 5LHHA 1L0NH 1TVKA 1IX9A 3ETDA 5EBLC 4UCSA 1IBLO 4J9ZB 3WG7C 3SJCC 2A3QA 1IXMA 5JJNB 3CSXA 4R8CA 4LNUA 1HR0O 4O2BA 2HR3A 5EZYB 3DGEA 3D36C 5IE9A 4YIOA 1R3IC 1XHXA 4I9WA 2XAQA 1B06A 1NH2D 4JTCB 2QTSA 3SYAA 2HFEC 3OUFA 2ODMA 1EZVH 4DV2O 3OTOB 2XT9A 2D3OW 4J80A 1FXKA 1NQTA 4BIZA 3ZHRA 1LR1A 2C2AA 3T4ZA 3W7TA 1YJ9V 1GK9A 4OXSA 2Q7EA 4FFBA 2RQ6A 2WLLB 4ZOLB 1KP3A 3HKEB 1P7GA 4LH6A 3CCRV 1GN3A 1R6TA 3ML0A 4A5UB 1Q43A 4LBEC 4PV1B 3CCLV 2IH3C 4DR6B 1M4UA 5EC1C 4JI1O 4TOIA 4O4JB 4RUEA 1PNLA 1XEQA 1IDSA 5LXTA 5FNVB 3JAWB 3ZJZA 2QSAA 5CA0A 4E2LA 3JALB 5J2TB 5LP6B 3VQWA 3FYIB 1EFRG 4JI6O 4HZ3A 1TUBA 3JAKB 2LW7A 4MW8A 1B04A 1M56C 2ILMA 3JD0A 4OPHA 4DR4O 2UUBO 5BR8O 1JVMA 2ZNJA 1WPBA 4DV3B 4LC1A 5LYJB 1OCRB 4FZ0A 5C8YA 1R1BA 4BIUA 3K04A 3RYIA 1VQLV 2YIBD 2X6BA 2F95B 1SA0A 4MTOA 1N34B 1S77D 2HG5C 1SQQH 4DUZB 4MTGA 3LSUA 2Z3YA 4QE9A 1YDXA 1BZKA 1ZLZA 3L74H 1HNWO 2ARHA 3OFNG 3DXRA 4J42A 4JYCA 4IT5A 2HJFC 5KHHA 4I50B 1VEWA 4PJ0Z 3FX7A 5JCOC 3WB1A 1N34O 1N4CA 4Z1VA 3OM3B 2CTWA 2XAJA 1HW7A 3CEIA 5AG2A 3UO2A 2Z0AA 1NJIW 3QO8A 3QNEA 3R65A 4GKKB 3CP1A 5J9PC 2DMXA 4HAMA 2EIMB 3ABMC 2JIZG 3SR2C 2CDYA 4DV7B 3G4SV 4B3MB 5BZBA 1YHQV 3SJBC 5LBQA 2DE0X 1Y76A 3IC7A 4P9PA 1M90W 3DC6A 2UXBO 2B5UA 1K34A 2BE3A 3F7YC 2QGNA 1ORQC 4XDLA 2GTAA 2Q7HA 1QCEA 4CC6A 3K5MA 3FAVB 5KA6A 3E89A 3RYFA 4KHPB 2OWOA 2UXCB 4I7ZB 3B8NA 3OR6C 1XNRB 4AQYB 1R73A 1TGOA 2E5LB 4JI0O 4Z2WA 4DV0O 2B9ZA 3CC2V 2XAHA 2VS0A 1VQ5V 1SRYA 4ZI7B 4IIJA 4LFCO 4UV8A 2H3OA 5JH7A 5KMGA 3B09A 5KHJA 5IJ9B 2EILC 2DWDC 3K58A 1SKVA 1O9GA 4I4TA 5JQGB 3OMNB 4AQYO 1KC8W
chains in the Genus database with same CATH topology
3TXQA 4ABMA 3Q4HB 3TXSA 3G80A 2B9ZA 4GZRB 3OGIB 2VS0A 1WA8B 3Q4HA 3FD9A 3HR0A 1WA8A 3FAVB 3O9OA 4LWSB 2AZ2A 2VRZA 3FAVA 4LWSA 2KG7B 2AZ0A 4I0XB 3GVMA 2KG7A 3GWKC 4I0XA 2DE0X 3ZBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TXQ A;  4ABM A;  3Q4H B;  3TXS A;  3G80 A;  2B9Z A;  4GZR B;  3OGI B;  2VS0 A;  1WA8 B;  3Q4H A;  3FD9 A;  3HR0 A;  1WA8 A;  3FAV B;  3O9O A;  4LWS B;  2AZ2 A;  2VRZ A;  3FAV A;  4LWS A;  2KG7 B;  2AZ0 A;  4I0X B;  3GVM A;  2KG7 A;  3GWK C;  4I0X A;  2DE0 X;  3ZBH A; 
#chains in the Genus database with same CATH topology
 4O4L A;  1XOU A;  4B3S B;  1XQ8 A;  3BAB A;  3CE2 A;  3T1H B;  2ZE6 A;  3ABL B;  1Q90 D;  2ZT9 B;  1QR9 A;  2IJH A;  3BEH A;  1H8E G;  1IVS A;  3G6E V;  4DUY B;  3CRR A;  1GM7 A;  3GB7 C;  2DQ3 A;  3FB7 C;  4O4I A;  4X20 B;  4GCZ A;  1AI4 A;  1WN7 A;  1P4R A;  4K3A A;  4WBN B;  5LHG A;  1WP7 A;  5LMN B;  3SYO A;  5IYD O;  1DGS A;  5EIB C;  2LQT A;  1U96 A;  2DN9 A;  4TUY A;  2EIJ C;  5H6Q A;  3T1H O;  4JTD B;  3K57 A;  5JJJ B;  1UPG A;  2O57 A;  2NLJ C;  4JI8 O;  1T5E A;  2JS3 A;  3C3T A;  1N32 B;  2ZXW B;  5KX5 B;  1FXK C;  5J2U B;  1SQX H;  4LFA O;  3HKC B;  3ASN C;  2CH7 A;  2CGN A;  4EB6 B;  1GN2 A;  2QWN B;  2ITD C;  2RMK B;  1OZ0 A;  4YY3 O;  4GYC B;  3L71 H;  2EIK C;  1XUQ A;  2PI5 A;  1W0K G;  1V55 C;  3P30 A;  2R70 A;  4KUM A;  4DR5 O;  3OAA G;  5GON A;  4KFM A;  2DYR B;  5GW7 A;  4LF8 O;  1BE3 H;  2FB5 A;  4PDV A;  1LUV A;  3RBZ A;  2WLI B;  2A0L A;  3D3I A;  2HEP A;  1M57 C;  1W0J G;  4UV9 A;  5LGU A;  1XI1 A;  2Q67 A;  4J10 A;  3C90 A;  1K8A W;  4AIL C;  2L6L A;  4UVC A;  4W4K A;  4B7E A;  2GDS A;  1VMG A;  3OD4 A;  2Q5Z A;  3ZCC A;  4JAA A;  1EBO A;  2UXN A;  1IXB A;  4D6T H;  1JJ2 U;  2YC0 A;  2VQE O;  2F66 C;  3JSN A;  1I08 A;  3T1Y O;  4B08 A;  3RYC A;  1RSO A;  4XDJ A;  2IW5 A;  1OCZ B;  5BMV A;  4RUF A;  5CA1 B;  1CP9 A;  1QLE C;  4YJ3 B;  1SES A;  3OEH G;  2A79 B;  2WWW A;  1IZ3 A;  2X7R B;  1Y66 A;  3P32 A;  2EIN C;  1QHT A;  3MD0 A;  1Q86 W;  1CEZ A;  4X65 B;  4GX0 A;  4DW1 A;  4RAI A;  3K59 A;  3ABU A;  4DW0 A;  1H2M A;  3ICX A;  2Y4U A;  2PUS A;  2W6J G;  3STZ C;  1XL4 A;  3UT5 A;  2HHH O;  4NVP A;  1K73 W;  1D5A A;  2QWQ B;  1YVW A;  3BA9 A;  4ZOL A;  4F6E A;  1EZJ A;  2KQX A;  2BSK A;  3MDS A;  2Q69 A;  2F4V O;  1YEW A;  4PDM A;  3HKE A;  1JQ0 A;  3OMI B;  1XMO O;  4JI7 B;  3CXC U;  1BSM A;  3X2Q B;  1AVM A;  4UCO A;  1SQP H;  3BA8 A;  5JVD B;  4GKJ O;  4JYB A;  4EKW A;  2FL4 A;  3JAR B;  3ZRS A;  4QE7 A;  1ZTE A;  1ZWI C;  3DTU B;  4YHH O;  2B1I A;  1WP8 A;  3JAS B;  5DN6 G;  1BS3 A;  2RNB A;  5LP6 A;  1QBZ A;  5KHG A;  3K9A A;  1QU7 A;  1VIB A;  2UUC B;  2JGU A;  1IBM B;  1NT2 B;  4UFZ A;  3K0G A;  4IHJ B;  3MAQ A;  4MVQ A;  1S3J A;  2ZM6 O;  5F2V O;  1K3E A;  3ZMZ A;  2ZCE A;  5KAF Z;  2CE4 A;  4NTW A;  4JF3 A;  2Q0O C;  3U10 A;  3JD3 A;  3RFR A;  2R9I A;  1CPY A;  2N05 A;  2OCH A;  4X1K B;  2JGD A;  4CS3 A;  2UUC O;  4JV5 B;  4DV6 B;  3IC9 A;  5B66 Z;  3Q4H A;  2BTQ B;  4EFE A;  1VF6 A;  4DR2 O;  2KKW A;  1BQZ A;  5LL6 Y;  4CH5 A;  5E1A C;  4DK1 A;  3B40 A;  4LF6 B;  1ZL8 A;  4B3T B;  3K79 A;  2GUZ A;  2VQF B;  4GX2 A;  2P90 A;  1J5E O;  1OCO C;  3JCZ A;  2HJD A;  1KU9 A;  2JVD A;  4U3J A;  4JV5 O;  1NVP D;  5IY5 B;  4UB8 Z;  5IYZ B;  4IYH A;  5LGN A;  4IGG A;  4WFB V;  1VQO V;  4PA9 A;  5EYP B;  3A0H Z;  2YEV B;  2H8P C;  1XBL A;  1YTF D;  1OCC B;  2RCV A;  3M99 B;  3AG2 C;  4TWK A;  1V54 C;  1R6N A;  2FYU H;  5HFL A;  2AHY A;  3SPJ A;  1FAF A;  2DW4 A;  4K0K B;  3B77 A;  4O2A A;  1WJZ A;  5LOV B;  2N74 A;  3N27 A;  1L8D A;  4FM1 A;  1F4M A;  2UUA O;  3ZMT A;  2P4V A;  1RPO A;  4IYI A;  1JFF B;  1NS1 A;  3VBB A;  4TV9 B;  2DOS A;  2Y0I A;  4FLZ A;  3L73 H;  3WB0 A;  2BTO A;  2EUL A;  3RWR D;  3AG1 C;  3TJT A;  1BGY H;  3SGI A;  3E86 A;  1GAX A;  4I55 B;  4H37 A;  5KUK A;  1QVF U;  3K08 A;  2OCC C;  4J9Y B;  3CMA V;  4UVB A;  2KG7 B;  4X1Y A;  3WG7 B;  1GRJ A;  1JCH A;  1NI8 A;  5IJ9 A;  1ZAU A;  4DV2 B;  3OTF A;  4GT1 A;  5IT9 N;  1FD9 A;  4O4H B;  1P49 A;  1AIL A;  1D5N A;  3K0D A;  1FFX A;  2YIB A;  3MHH C;  1ROP A;  2IM9 A;  4I5S A;  2ETN A;  3ZHU A;  4N23 A;  4QGP A;  2EBO A;  2Q8V A;  4MVR A;  1O9H A;  2P5O A;  5EC2 C;  1QNM A;  1PNK A;  3ASO B;  3B2E E;  1QQC A;  4H44 B;  4JI1 B;  4QIW F;  5FL7 G;  4WF9 V;  2WA3 A;  3GWO A;  1L0L H;  3ABT A;  2ITC C;  4J7J A;  3KKY A;  3H1L H;  1JOY A;  1NVP B;  2NNU A;  2LGW A;  1I7F A;  2QKA A;  2ZE7 A;  2HP8 A;  4DV5 B;  4TSF G;  5KX5 A;  5J2U A;  2ADQ B;  4UXN A;  3THO A;  1TAE A;  2UU9 O;  4JI6 B;  2CGO A;  3IGA C;  4FIP C;  2JDI G;  2BCC H;  1YTF B;  1GN6 A;  3FKS G;  5B3S B;  4DR4 B;  1WA8 A;  2UUB B;  5BR8 B;  4YIP A;  4I9Q A;  3M8A A;  2YXH A;  1I0H A;  5IJ0 B;  4J11 A;  4K8X A;  4DV5 O;  4UCU A;  1MZE A;  4JI2 B;  2PF4 E;  1Q82 W;  3TXQ A;  3JD1 A;  2DWE C;  3CCM V;  3AG3 C;  4GZR B;  5B1A B;  1S5L Z;  3KCX A;  1EN5 A;  1URF A;  5CBG A;  3E2E A;  4LFB O;  1WLE A;  4G27 B;  1MMM A;  2GV9 A;  1K5S A;  2AHZ A;  1HNW B;  2F1M A;  3T4D A;  3ZN0 A;  4MTF A;  3BY6 A;  5LP6 C;  2QWO B;  3OT7 A;  2IU0 A;  3ZRX A;  1KB9 F;  4H13 B;  3J7A U;  4MVU A;  5B1O A;  4JI3 O;  4NTY A;  4JI2 O;  4NXN O;  2A9H A;  2QR4 A;  3N2K B;  4PI0 A;  2ZR3 A;  4DK0 A;  2WA4 A;  1RFY A;  4CH6 A;  1GO3 F;  1YXB A;  3SDL A;  1PD3 A;  3G67 A;  1K4C C;  3U11 A;  4LWS A;  2YXL A;  1JR9 A;  2XUM A;  3BAA A;  4G28 B;  3LDD A;  2UXB B;  4F6R A;  4D7T A;  4X88 A;  3R66 A;  1VF6 C;  2QKS A;  4U7N A;  2A7W A;  2R9A A;  3FYE B;  3LUT B;  1KKD A;  3TGU H;  3A0B Z;  1ENV A;  3ABM B;  2WLH A;  5CBH A;  3OEE G;  1DF4 A;  4ZBM A;  4I0X A;  1XHZ A;  2ZE5 A;  3EVK A;  4JI0 B;  1PL4 A;  2JRI A;  3K06 A;  1US6 A;  3ZHQ A;  3RT3 C;  1SET A;  5H2F Z;  4DV0 B;  2R9R B;  4PA7 A;  5A2Q N;  3TCU A;  4ZHQ A;  5EK0 A;  1YZB A;  2CUG A;  2PGG A;  2P67 A;  2YSU B;  2P7T C;  4X1I B;  4LFC B;  1SF9 A;  2EIM C;  2X6C A;  2PY5 A;  4FLX A;  4DR7 O;  2XAG A;  1A32 A;  2LFR A;  3VQY A;  5ITZ A;  1MAB G;  2HVK C;  3SYQ A;  1K7D A;  2YIA A;  5DED A;  4J7K A;  1G6U A;  4XBF A;  1Z5V A;  2WAM A;  4LF9 O;  3K3W A;  3FFQ A;  1KBH A;  3F5T A;  1DLB A;  1EM1 A;  1W59 A;  4FLU A;  1RPR A;  3H1K H;  1AR1 B;  1Y74 A;  2RN9 A;  1HP8 A;  3G80 A;  1VQ7 V;  3IAY A;  2Y48 A;  4FLW A;  4PD4 F;  3QVN A;  3ETE A;  3LSQ A;  3RN4 A;  4JI8 B;  4BR6 A;  4AHC A;  4MTX A;  1EN4 A;  1IBK O;  2QA4 V;  4LNU B;  2QTO A;  2PYL A;  4O2B B;  3RYH A;  1RP3 B;  4LFA B;  4DV4 O;  1UJW B;  1M93 A;  3LNN A;  1GKF A;  2GHY A;  3ZRW A;  4YY3 B;  2Z5U A;  4CH3 A;  5L3B A;  1KD1 W;  3ABL C;  4X62 O;  1S5J A;  4DR5 B;  3H1H H;  3JAT A;  1S76 D;  4KXR A;  3CME V;  1AR5 A;  2VRZ A;  4MVM A;  4LF8 B;  5CB4 A;  1FXK B;  1TUE B;  3ASN B;  1BQ0 A;  2K9P A;  1Q3E A;  1HNZ O;  4HBN A;  1K33 A;  1N33 B;  4FFB B;  3OGI B;  2EIK B;  4MW3 A;  1LUW A;  1V55 B;  3D3Q A;  5GTH Z;  1SQF A;  4JI4 O;  1F7Y A;  4TQD A;  2ZXW C;  3JSL A;  2AZ0 A;  2E76 B;  3HKB A;  3CCQ V;  3G6B A;  2QWR B;  4QPK A;  1E79 G;  5EBW C;  3JYC A;  2E3C A;  3SPC A;  5H5N A;  5KHK A;  5IYC O;  2VQE B;  5GTI Z;  4U7O A;  4KL1 A;  2HKO A;  2Q68 A;  1N33 O;  4YJ2 B;  3T1Y B;  1ZUQ A;  5LXT B;  2DYR C;  5LGT A;  5L3F A;  1M5I A;  4R50 A;  4GX1 A;  5EBM C;  1RM1 C;  4BW9 A;  2LGQ A;  2K1E A;  4MS2 A;  2HLD G;  3CRA A;  5LMU O;  3BCC H;  1LNQ A;  2DJV A;  2Q9L A;  3L72 H;  3T1C A;  1GN4 A;  1SZT A;  3I55 V;  3N2G A;  5C8Y B;  1WNS A;  5H9C A;  3K03 A;  2WLJ A;  4PA4 A;  3CWB H;  4W4L A;  1KYO F;  4P2Z A;  3ZMS A;  1H38 A;  1QVG U;  1Q6U A;  1GH6 A;  4FVM A;  2HHH B;  3E35 A;  2P06 A;  1AJN A;  1V9P A;  1ZSP A;  3UCS C;  5EZY A;  4X89 A;  3WB2 A;  1OCZ C;  1VQP V;  1WB8 A;  3O9O A;  2ZIN A;  2EIN B;  2KB1 A;  4JAS A;  1H2S B;  2DYS B;  2F4V B;  4IL6 Z;  3E8H A;  3AK1 A;  1XMO B;  2N04 A;  4KP4 A;  3KZI Z;  4F4L A;  3C3S A;  4GKJ B;  3K5N A;  1ZX3 A;  3ZHT A;  4B7K A;  4NYK A;  5TIS Z;  4YHH B;  3OE7 G;  4GLX A;  2WLL A;  2OIE A;  3ETQ A;  1KUQ A;  1NTZ H;  1Y76 B;  4XDK A;  1NU1 H;  2XHB A;  1N0N A;  5BY1 A;  1VQK V;  4LF4 B;  1K9M W;  4Z1M G;  1VQN V;  3SPG A;  1G4Y B;  2ZM6 B;  4O4J A;  4C7U A;  1AI5 A;  1VQ9 V;  2H94 A;  5FNV A;  1YSC A;  3JAW A;  3QTC A;  2YUA A;  3AG4 C;  2PTM A;  2QWP B;  4YXW G;  3JAL A;  5J2T A;  3E8B A;  3LDC A;  4LP8 A;  3X2Q C;  1F51 A;  3ZED A;  3OR7 C;  4RWU A;  3LDE A;  3S3W A;  3NR7 A;  4FPP A;  4LF4 O;  1VF7 A;  1FS0 G;  3CC4 V;  1BHA A;  4IIJ B;  3JAK A;  1HWY A;  4DR2 B;  5JH7 B;  2YXY A;  1F4N A;  1Q6H A;  1OHH G;  3CB2 A;  2ZNI A;  1KKC A;  5LYJ A;  4ASU G;  3T2M A;  3E8G A;  2QKC A;  2UXD O;  5JJE B;  4JPR A;  4WCE V;  4O4L B;  1J5E B;  3EXA A;  4GX5 A;  1XIL A;  4ABM A;  4FJC C;  1KQS U;  2OYQ A;  1AJP A;  1SQV H;  1HNX O;  2JEU A;  2JK5 C;  3VQX A;  2WLK A;  2ZKO A;  2GTS A;  5L3C A;  3H1I H;  3CXH F;  4Q20 A;  5FPO A;  4FM2 A;  4O4I B;  4DR1 O;  2WPD G;  1QR8 A;  3LSS A;  5IWA B;  1VP7 A;  4I50 A;  3UKM A;  2ZDI A;  2AW9 A;  2QJ1 A;  1BL8 A;  1COW G;  1PV0 A;  3BRC A;  1R3J C;  1X4T A;  5B5E Z;  2VWK A;  2P22 C;  4X66 O;  4E4E A;  1B3Q A;  4TV8 B;  2UUA B;  1FJG B;  4RO2 A;  1NKD A;  2Y69 C;  1WAZ A;  3FB6 C;  3P3P A;  4JZ2 A;  5IWA O;  2VWJ A;  1R3L C;  3ABK C;  1V54 B;  1MOF A;  5IY5 C;  1IUR A;  1AJQ A;  2PYJ A;  2CAZ C;  1Q81 W;  4HNA B;  3J80 N;  1FYJ A;  4DRX B;  4QJF B;  3ZMV A;  4X1I A;  3FAV A;  1MSD A;  2RJZ A;  3FB5 C;  3ZX6 A;  3NXS A;  1FJG O;  5LA6 B;  3RVY A;  2JJ1 G;  3RVZ A;  2MW2 B;  4R7C A;  4JZG A;  2F43 G;  3JD2 A;  4LF7 O;  3AEI A;  1N0J A;  4BW5 A;  4X64 O;  4CBC A;  3VQV A;  4ZI7 A;  2OCC B;  2R72 A;  4CH4 A;  5B1B B;  3CC7 V;  1UFI A;  1E1R G;  4LCU C;  3ZS8 C;  1Q8I A;  1BCC H;  1G1X B;  3UM7 A;  3ZHS A;  1F23 A;  3BHP A;  1SS3 A;  2CK3 G;  1GMG A;  5JQG A;  2ZIO A;  3SPI A;  3RYC B;  3SPH A;  1JA8 A;  1RSO B;  1GM9 A;  2OTJ V;  3SJQ C;  3I5D A;  2ZD9 A;  1DK1 A;  2IH1 C;  4MVZ A;  2LO1 A;  5B1N A;  1JX9 A;  4PA3 A;  4NXM B;  3F7V C;  1FXV A;  2V1D A;  3E22 B;  4DR3 O;  2D2C B;  4H0L B;  4D7S A;  4JYA O;  4X20 A;  3AK2 A;  3KCY A;  4WFH A;  2UU9 B;  1FKA O;  2WSS G;  4WBN A;  3W7W A;  3ETG A;  4J7Z A;  4J41 A;  3JD4 A;  1DF5 A;  2IJI A;  3CRC A;  3L70 H;  5CA3 A;  2EZP A;  4NXM O;  4FK5 C;  4NTX A;  4CC5 A;  3UT5 B;  4LR3 A;  3ZBH A;  3CD6 V;  3VOU A;  3HKC A;  3ASO C;  3CRM A;  1XRE A;  4EB6 A;  3CCE V;  2M7W A;  5KLV H;  4LFB B;  2BSK B;  3ZHV A;  3TET A;  2Q0A A;  4JI3 B;  3OTO O;  2IBZ H;  2F23 A;  2WLI A;  4MVO A;  4NXN B;  1E1Q G;  4R6Z A;  5KUM A;  1R6K A;  4UCV A;  3AG3 B;  1K5Q A;  3W7S A;  4TT3 G;  5B3S C;  4WFG A;  4FMT A;  4YJ2 A;  2AXT Z;  2Y4T A;  1M56 B;  1TA8 A;  2V7Q G;  1S72 V;  2RDC A;  3TK1 A;  2OIG A;  3WU2 Z;  1EN6 A;  2V4D A;  5H6R A;  3L75 H;  3I56 V;  4DR6 O;  5B1A C;  2QM7 A;  1KMI Z;  1P84 F;  2JS5 A;  1OCR C;  5IDJ A;  2E74 B;  1U97 A;  3P3N A;  1H2K A;  2W6I G;  5LHI A;  1Y67 A;  3GVM A;  5EIB D;  4JGS A;  4FZ1 A;  4GUN A;  2JGD B;  5CA1 A;  4WFA V;  1VQ4 V;  1YF2 A;  2Q73 A;  4QPJ A;  3Q4H B;  4YJ3 A;  2QDO A;  2XAF A;  3G71 V;  3DSQ A;  3FD9 A;  1XMQ B;  3HR0 A;  1S0V A;  4FM0 A;  1BT8 A;  4JAV A;  1ZL8 B;  4UCT A;  4DV3 O;  3QF7 A;  2GUZ B;  2YS8 A;  2AGA A;  2ZDI C;  4DR7 B;  4FFK A;  4L8J A;  1AR4 A;  3LNM B;  1VQ6 V;  1R3K C;  4U3J B;  4PDL A;  1NH2 B;  4DUZ O;  3HKD B;  1JJO A;  3CPW U;  1SQG A;  3WFV A;  4H33 A;  4X9Q A;  1YJN V;  1Y6X A;  4P30 A;  2OT5 A;  1XMQ O;  1AB3 A;  2P6J A;  2OTL V;  1I5Y A;  1THZ A;  5L3G A;  3EFF K;  2F93 B;  2B1G A;  4U3F H;  1WB7 A;  4LF9 B;  3JCU Z;  3APQ A;  3SYP A;  4P9O A;  3IFX A;  2FTK A;  3CCU V;  1PNM A;  5JVD A;  4O2A B;  5DEC A;  2XND G;  1YCI A;  5K1P A;  3JAR A;  4GKK O;  2JJ2 G;  1OJH A;  4EFB A;  1KP2 A;  1GTO A;  3CJH B;  1IBK B;  4DV7 O;  1BHB A;  4B3M O;  2EIL B;  3JAS A;  3J81 N;  1NBM G;  4Q6G A;  1PL0 A;  3RW0 A;  4DV4 B;  3IJ4 A;  3K9S A;  1Q7Y W;  2HVJ C;  4HYO A;  4RQE A;  1QLN A;  1SER A;  4IHJ A;  3OMA B;  4X62 B;  4L87 A;  1TVK B;  4X1Y B;  4KHP O;  2UXC O;  3AK3 A;  3CHX A;  5L3D A;  3FB8 C;  3PN1 A;  3CRQ A;  1XNR O;  2E5L O;  2ADP A;  1HNZ B;  2YID A;  4X1K A;  1FFX B;  3RGB A;  2BTQ A;  2EIJ B;  5CBF A;  4JI4 B;  1L1F A;  2A06 H;  3CYO A;  5IYB O;  1NR1 A;  1H2N A;  2YI8 A;  2IJK A;  1PP9 H;  4PI2 A;  3ZN1 A;  3H9V A;  4NR1 A;  4NKG B;  4ICG A;  1Q6I A;  4BAY A;  3TXS A;  4PDR A;  1AP5 A;  4B3S O;  2QE7 G;  3U0Z A;  1FXH A;  2BOB C;  4BIO A;  2IU3 A;  3SJA C;  4PHZ A;  4LF5 B;  2E75 B;  4WFE A;  2XAS A;  5CN0 A;  2EX3 A;  4TV8 A;  4DUY O;  4JTA B;  5L3E A;  5IYZ A;  1XDC A;  5EYP A;  2YEV A;  4UUJ C;  5JWP A;  5LMU B;  4FLV A;  5LMN O;  1M57 B;  1NTM H;  2W0F C;  1N36 B;  2IJJ A;  3CCV V;  4TQF A;  1WA8 B;  2ATK C;  2CTQ A;  4ZIB A;  4LF5 O;  4HNA A;  5CA0 B;  4DRX A;  5LOV A;  2Q4P A;  2AZ2 A;  3H01 A;  1MG1 A;  1N32 O;  1K97 A;  4FLY A;  3DC5 A;  1RM1 B;  3K5O A;  1Z5W A;  4ZKI A;  4G2K A;  5LA6 A;  3HB3 B;  2JEX A;  5CMU A;  1JFF A;  3E83 A;  4TV9 A;  1TUB B;  1MA1 A;  1YI2 V;  4AI8 A;  4DO2 A;  1S5H C;  1N36 O;  3O65 A;  1OV9 A;  2WLN A;  4I55 A;  5D5P A;  2X0L A;  4CS2 A;  3RYI B;  2ZQM A;  3A2F A;  1SA0 B;  3APO A;  1H2L A;  2KG7 A;  1YJW V;  2L35 A;  1NR7 A;  4B3R B;  3OGC C;  3STL C;  2DQ0 A;  4EEQ A;  3BFR A;  2XTA A;  1QLE B;  1Z2G A;  3W7U A;  4O4H A;  5E79 Z;  5DM6 V;  3D36 A;  5FPR A;  3QO5 A;  5BXZ A;  4LWS B;  3DXR B;  1H8H G;  4JYY A;  5FLX N;  3A0R A;  1HDJ A;  4LH7 A;  4DYL A;  3GWK C;  3E22 A;  2Y0P A;  4B3R O;  4OGQ B;  4F6R B;  2Q6A A;  3A8T A;  2EJR A;  1SZX A;  4K8Z A;  3QO7 A;  1VAR A;  4MT8 A;  1D2D A;  2YDE A;  2ZE8 A;  2DYS C;  3MHS C;  1M9N A;  5HFM A;  4I0X B;  3ZMU A;  1YIJ V;  2BOC C;  1MNG A;  4ZHQ B;  1X59 A;  2W0X A;  1VQM V;  1JPX A;  2CTR A;  3RYF B;  2MK3 A;  4X65 O;  3AG4 B;  4N21 A;  4JAU A;  5ITZ B;  2UXD B;  4PEL A;  4MVS A;  5IJ0 A;  2QM8 A;  1Q5O A;  4X8A A;  4UVA A;  1JMK C;  4DXW A;  4FLT A;  3K5L A;  2YIC A;  1HNX B;  1CXZ B;  2FML A;  5KMG B;  4DR1 B;  4I4T B;  1YIT V;  4JI7 O;  1K4D C;  1NTK H;  3E8F A;  3CS5 A;  1FFT B;  3CCJ V;  1SQB H;  1Y74 B;  2Q7G A;  1N8R W;  2ZR2 A;  1AP6 A;  3N2K A;  1J95 A;  4UB6 Z;  2FKX A;  2P4K A;  4X66 B;  3CX5 F;  1PKX A;  2YI9 A;  1P7B A;  1WPX A;  3PJS K;  3RYH B;  4DV1 B;  1VF5 B;  2LJ2 A;  1VQ8 V;  4MSW C;  1MZF A;  1K92 A;  4OPA A;  3EHB B;  3D8C A;  3ZRW B;  3UQ8 A;  5KA5 A;  1OCO B;  5JCO A;  1IBM O;  2PI4 A;  2GBO A;  2PZS A;  3OUS A;  4TUY B;  3M7M X;  2LP7 A;  1KEC A;  3JAM N;  4K35 A;  3JAT B;  5K1X A;  1FPO A;  1BMF G;  5A9G A;  3ZIA G;  2ZIM A;  3W7X A;  4UCR A;  1NZ6 A;  5CB4 B;  1AI7 A;  1I5X A;  2UXX A;  2Y69 B;  1ARO P;  2CTP A;  4DV1 O;  3SYC A;  1B6Q A;  2CH7 B;  3HPL C;  1XL6 A;  2NN4 A;  3AG2 B;  3ABK B;  3F5W C;  2NR5 A;  1PPJ H;  4DV6 O;  1PM9 A;  3H1J H;  4RQF A;  3HKD A;  1XNQ B;  3UO3 A;  4LF7 B;  3BVO A;  5KAI Z;  5D5Q A;  5GON B;  4QNH B;  4X64 B;  2LW1 A;  3KG2 A;  3L9D A;  4JI5 B;  4LF6 O;  3HKB B;  2XOK G;  4B3T O;  1Y4M A;  2GSM B;  1I94 B;  2VQF O;  4CS4 A;  1OCC C;  4PA6 A;  1W2B U;  2QEX V;  3CCS V;  1G8M A;  2EZO A;  5KHI A;  3B4S A;  2X6A A;  3AG1 B;  1XNQ O;  2WLM A;  4NB5 A;  4OX9 B;  3ZRV A;  3OW2 U;  1DTO A;  4JI5 O;  3AG7 A;  2KSD A;  1IBL B;  2EJ7 A;  1AI6 A;  1H2G A;  3CJH A;  1I94 O;  4DR3 B;  3BPZ A;  3S3X A;  1HR0 B;  1SC5 B;  4WFF A;  2G38 A;  2QM4 A;  4JYA B;  4BWA A;  2LFS A;  4CZZ A;  3QG5 A;  5C93 A;  3N2G B;  4K0K O;  1GM8 A;  2M6Y A;  1M1K W;  1MSW D;  4OX9 O;  5B1B C;  5BMV B;  3B8M A;  5LHH A;  1L0N H;  1TVK A;  1IX9 A;  3ETD A;  5EBL C;  4UCS A;  1IBL O;  4J9Z B;  3WG7 C;  3SJC C;  2A3Q A;  1IXM A;  5JJN B;  3CSX A;  4R8C A;  4LNU A;  1HR0 O;  4O2B A;  2HR3 A;  5EZY B;  3DGE A;  3D36 C;  5IE9 A;  4YIO A;  1R3I C;  1XHX A;  4I9W A;  2XAQ A;  1B06 A;  1NH2 D;  4JTC B;  2QTS A;  3SYA A;  2HFE C;  3OUF A;  2ODM A;  1EZV H;  4DV2 O;  3OTO B;  2XT9 A;  2D3O W;  4J80 A;  1FXK A;  1NQT A;  4BIZ A;  3ZHR A;  1LR1 A;  2C2A A;  3T4Z A;  3W7T A;  1YJ9 V;  1GK9 A;  4OXS A;  2Q7E A;  4FFB A;  2RQ6 A;  2WLL B;  4ZOL B;  1KP3 A;  3HKE B;  1P7G A;  4LH6 A;  3CCR V;  1GN3 A;  1R6T A;  3ML0 A;  4A5U B;  1Q43 A;  4LBE C;  4PV1 B;  3CCL V;  2IH3 C;  4DR6 B;  1M4U A;  5EC1 C;  4JI1 O;  4TOI A;  4O4J B;  4RUE A;  1PNL A;  1XEQ A;  1IDS A;  5LXT A;  5FNV B;  3JAW B;  3ZJZ A;  2QSA A;  5CA0 A;  4E2L A;  3JAL B;  5J2T B;  5LP6 B;  3VQW A;  3FYI B;  1EFR G;  4JI6 O;  4HZ3 A;  1TUB A;  3JAK B;  2LW7 A;  4MW8 A;  1B04 A;  1M56 C;  2ILM A;  3JD0 A;  4OPH A;  4DR4 O;  2UUB O;  5BR8 O;  1JVM A;  2ZNJ A;  1WPB A;  4DV3 B;  4LC1 A;  5LYJ B;  1OCR B;  4FZ0 A;  5C8Y A;  1R1B A;  4BIU A;  3K04 A;  3RYI A;  1VQL V;  2YIB D;  2X6B A;  2F95 B;  1SA0 A;  4MTO A;  1N34 B;  1S77 D;  2HG5 C;  1SQQ H;  4DUZ B;  4MTG A;  3LSU A;  2Z3Y A;  4QE9 A;  1YDX A;  1BZK A;  1ZLZ A;  3L74 H;  1HNW O;  2ARH A;  3OFN G;  3DXR A;  4J42 A;  4JYC A;  4IT5 A;  2HJF C;  5KHH A;  4I50 B;  1VEW A;  4PJ0 Z;  3FX7 A;  5JCO C;  3WB1 A;  1N34 O;  1N4C A;  4Z1V A;  3OM3 B;  2CTW A;  2XAJ A;  1HW7 A;  3CEI A;  5AG2 A;  3UO2 A;  2Z0A A;  1NJI W;  3QO8 A;  3QNE A;  3R65 A;  4GKK B;  3CP1 A;  5J9P C;  2DMX A;  4HAM A;  2EIM B;  3ABM C;  2JIZ G;  3SR2 C;  2CDY A;  4DV7 B;  3G4S V;  4B3M B;  5BZB A;  1YHQ V;  3SJB C;  5LBQ A;  2DE0 X;  1Y76 A;  3IC7 A;  4P9P A;  1M90 W;  3DC6 A;  2UXB O;  2B5U A;  1K34 A;  2BE3 A;  3F7Y C;  2QGN A;  1ORQ C;  4XDL A;  2GTA A;  2Q7H A;  1QCE A;  4CC6 A;  3K5M A;  3FAV B;  5KA6 A;  3E89 A;  3RYF A;  4KHP B;  2OWO A;  2UXC B;  4I7Z B;  3B8N A;  3OR6 C;  1XNR B;  4AQY B;  1R73 A;  1TGO A;  2E5L B;  4JI0 O;  4Z2W A;  4DV0 O;  2B9Z A;  3CC2 V;  2XAH A;  2VS0 A;  1VQ5 V;  1SRY A;  4ZI7 B;  4IIJ A;  4LFC O;  4UV8 A;  2H3O A;  5JH7 A;  5KMG A;  3B09 A;  5KHJ A;  5IJ9 B;  2EIL C;  2DWD C;  3K58 A;  1SKV A;  1O9G A;  4I4T A;  5JQG B;  3OMN B;  4AQY O;  1KC8 W; 
#chains in the Genus database with same CATH homology
 3TXQ A;  4ABM A;  3Q4H B;  3TXS A;  3G80 A;  2B9Z A;  4GZR B;  3OGI B;  2VS0 A;  1WA8 B;  3Q4H A;  3FD9 A;  3HR0 A;  1WA8 A;  3FAV B;  3O9O A;  4LWS B;  2AZ2 A;  2VRZ A;  3FAV A;  4LWS A;  2KG7 B;  2AZ0 A;  4I0X B;  3GVM A;  2KG7 A;  3GWK C;  4I0X A;  2DE0 X;  3ZBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...