2M7WA

Independently verified structure of gp41-m-mat, a membrane associated mper trimer from hiv-1 gp41
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Envelope glycoprotein
publication title Structure of an HIV-1-neutralizing antibody target, the lipid-bound gp41 envelope membrane proximal region trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 10
structure length 59
sequence length 59
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2m7wA00
4FJCC 2MK3A 4G2KA 2LP7A 1K34A 2OT5A 1DLBA 4JPRA 1I5YA 2EZOA 3CYOA 3K9AA 3B8NA 4FK5C 4JGSA 3MHHC 5H9CA 5HFMA 5KA5A 1F23A 2EBOA 4FIPC 3GWOA 3WFVA 2M7WA 2P6JA 1QCEA 1Y66A 1I5XA 1EBOA 5HFLA 1MG1A 1JQ0A 1JPXA 1DF4A 1ENVA 3M99B 1K33A 3B8MA 1DF5A 3H01A 2EZPA 3CP1A 3P30A 1MOFA 5CN0A 1QBZA 1QR8A 2X7RB 4N23A 1QR9A 1Y4MA 4N21A 1SZTA 3MHSC 4E2LA 3B77A 4JF3A 5CMUA 5KA6A
chains in the Genus database with same CATH superfamily
1QVFU 1GM9A 4ZI7B 3KCXA 2QTSA 2XOKG 5L3CA 2IJIA 3CD6V 4DV7B 2A0LA 3ZHVA 1K73W 5GTHZ 2E74B 1B3QA 1I7FA 1M90W 2HP8A 1YJWV 1NR1A 1K97A 3JALB 2WLLA 4MSWC 3STZC 1XILA 1GK9A 2Y0PA 1K9MW 2N74A 4JAUA 4PDMA 4JYYA 3ZCCA 4HBNA 3WU2Z 3E2EA 4EFEA 5KUMA 4F6RB 4DR7O 3I55V 4UVAA 1L8DA 2WLIA 4AI8A 1P4RA 2IW5A 1FPOA 4TOIA 3ZRWB 2WLMA 1IBKO 1K92A 3H1JH 3N27A 3K58A 1BHAA 4N23A 4IT5A 2OWOA 1V54B 2QWPB 4JF3A 4I55B 3G67A 4UUJC 1KUQA 4IHJA 3T4ZA 2UXCB 5JJEB 4LF8B 3ZBHA 1BT8A 2OIGA 2QKCA 4DV5B 5EIBD 4PDRA 3ZRXA 3VOUA 3STLC 2BSKB 2PZSA 2IJKA 4XBFA 3LNNA 1Q7YW 3F5WC 3ZMZA 2DYRB 2WLKA 3L75H 3U10A 3UO2A 3ZN1A 4KXRA 3ZHUA 4LFBB 3TCUA 3AK1A 2QWQB 3MHHC 2BTQA 3SJCC 4O4HB 1KP3A 2E3CA 2LGWA 5KUKA 2K1EA 1RSOA 4LFCB 3H1LH 2QA4V 4MT8A 2AZ0A 3ABUA 1H2KA 5D5PA 3QO7A 3PJSK 4PA4A 3P3PA 5IYBO 4LP8A 2WLLB 3RWRD 2UU9O 5H6QA 3APQA 1SQPH 2EBOA 4RUEA 3GVMA 1P7BA 3IC7A 2BE3A 3OAAG 4ZHQA 3E8GA 4X66O 3ZN0A 1LR1A 2X6CA 2CGNA 1XI1A 1QLNA 3ZHTA 2WLIB 1F51A 1I5YA 3BY6A 4NYKA 4B3MB 4P9PA 4W4KA 4DV1B 1GMGA 3LSQA 4U3JA 4DR1O 3G80A 4DR4O 4DR5O 1RP3B 1BSMA 1IXMA 4WFAV 1DGSA 4UB6Z 3ASNC 4IHJB 2RJZA 4LF9O 1YF2A 2QWOB 1B6QA 3W7UA 3F7VC 4O2AA 2HVKC 3SJBC 3D3IA 1NTZH 3E8FA 4CBCA 1Q5OA 4DV6B 1SC5B 2GTSA 2ZE5A 1H2NA 3I56V 1J5EB 2HLDG 1ZL8A 4QGPA 1KC8W 1B04A 4DUZB 1SQBH 1PD3A 3CPWU 2BTQB 4I5SA 1WN7A 3ICXA 4K35A 5LGTA 5EBMC 1S5LZ 3RT3C 1RSOB 1V55B 4X88A 1X59A 2IH1C 2FL4A 5B1AC 2XUMA 3MAQA 4KHPO 3ML0A 2ZM6O 1YI2V 1KBHA 4OPHA 1S3JA 3T1HO 5BMVA 2EINB 2A7WA 2ETNA 3CEIA 1AB3A 4P9OA 2P90A 3TGUH 4ZHQB 2QEXV 5C93A 4JI1O 4JI7O 4DV4B 3TETA 2HVJC 5BXZA 4JI0O 3AG3C 1QR9A 1ZSPA 1QVGU 4BW5A 1LUVA 3BAAA 4DV3O 5EBWC 3E35A 1Q8IA 1M4UA 4JTCB 4JI3B 3RW0A 1SS3A 2GDSA 1F23A 3LUTB 4U3JB 2FKXA 4IIJA 1D5NA 1YTFD 2E76B 4JYBA 1HWYA 1KMIZ 3ZEDA 4O2AB 1XNRB 3J80N 4NB5A 1N0NA 4FJCC 1Q90D 3OMNB 1Z2GA 2R9RB 3N2KA 4YHHB 2FTKA 2UXDB 2EX3A 2YI9A 1WPBA 1MA1A 2K9PA 3OMIB 2VQFO 4I4TA 2CAZC 1ZL8B 4JI4B 2DYSC 3K3WA 2KB1A 2HEPA 3PN1A 1YCIA 1Y4MA 2QKSA 4X1YA 3K5LA 3B77A 1KU9A 3RFRA 4FLVA 4R8CA 5DECA 5BZBA 4BW9A 4WCEV 3JD0A 4OPAA 1XHXA 2LFRA 2JGDA 5HFMA 3QNEA 4UVCA 3CRAA 3SYAA 1Y74B 1XMQB 2EILB 1IURA 4YIPA 2H3OA 2ZE7A 4ZKIA 5BMVB 5L3BA 4GKJO 4X64B 1R6TA 2QSAA 2N05A 1NJIW 1AI6A 4QE9A 5B1OA 3J81N 3ZMSA 4DK0A 4GUNA 5J2UA 3OE7G 1N34O 3X2QB 4KUMA 2EIMC 3WFVA 3O9OA 3ETDA 1WP7A 4UFZA 2QKAA 4Q20A 1S5JA 2EIJC 4X20A 1F7YA 3JD2A 2WPDG 1H2SB 4PV1B 4DV0O 2H94A 2WWWA 5JWPA 4FVMA 4WF9V 3RVYA 1GAXA 4NXNB 4IIJB 3SYQA 1LUWA 4MVUA 3BABA 2F4VO 5BY1A 1SERA 2CTQA 1K33A 1YITV 5DEDA 1VEWA 1NH2D 2QJ1A 3R66A 1S0VA 4H44B 3N2KB 1Y67A 4XDLA 1SQGA 3C3TA 4PI2A 1YSCA 4I4TB 5L3FA 3OR7C 1M57C 3SGIA 2F43G 2ZIMA 2XHBA 4LF7B 3E8HA 4WBNA 2PF4E 4JV5B 1XQ8A 1XDCA 5LL6Y 2EZPA 2CK3G 2E75B 1XOUA 3TXQA 3L70H 2JGDB 1B06A 4B3TO 4JPRA 4A5UB 1NTKH 4NKGB 3K9AA 4B3RO 2A3QA 3LDCA 4QJFB 1M5IA 1RM1C 1EBOA 4HAMA 4ASUG 2WAMA 2DE0X 1Q6HA 2R9IA 3E22A 3CCQV 1RPOA 5B1NA 4LF5B 1R1BA 4N21A 3ZRSA 5K1PA 3P3NA 1YJNV 5J2UB 5B3SC 2IBZH 3CHXA 2W6IG 4JI6B 1NI8A 1IBMO 3FD9A 4MW3A 3KCYA 3TJTA 4X20B 2RDCA 2Q8VA 2BCCH 1U97A 1SQQH 3B09A 2ZR3A 1OCRB 2EJRA 1ORQC 4TT3G 4GKKO 1NT2B 1VQ8V 3GWKC 4FPPA 4R6ZA 3CS5A 1BQ0A 4JI2O 4U7OA 2R70A 3JCZA 1BMFG 3OEEG 4TV9A 2ATKC 1W59A 2M7WA 3HKBA 2IU3A 3LDDA 2ZXWC 1S72V 4F4LA 4DV2B 3AK2A 4MVOA 1WP8A 4LFAO 2RNBA 4WFGA 1ZUQA 3CCVV 1QLEC 1HP8A 5JH7A 4O4JA 1FJGO 1OCCC 5FPOA 2Y69C 5LP6C 1HNZB 3L9DA 4WBNB 2CDYA 4PI0A 1VF5B 4HZ3A 2UUAB 2E5LO 3M99B 4LCUC 3ASOC 1N36B 4C7UA 3ASNB 3IJ4A 5KLVH 2YEVA 3MHSC 3JYCA 5JCOC 2CTWA 2ZINA 4YJ3A 5FLXN 2P22C 4MVSA 4PA7A 1KKDA 1VQOV 3HB3B 3B40A 3OGIB 3E22B 4YY3O 4RWUA 2WLJA 3DC6A 1L1FA 4QPJA 3H1IH 2JVDA 3CWBH 5EBLC 1XNQB 5IYCO 1PP9H 1QU7A 2WA4A 1Y76A 4OGQB 3E86A 3CCEV 1KD1W 1VMGA 3BEHA 1SF9A 2XAGA 4CH6A 4DR3O 3CXCU 1NVPD 3K03A 4FM0A 5B1AB 4D6TH 4K0KB 3UQ8A 3JAWA 3OR6C 4I9WA 1ZX3A 3NR7A 1TAEA 3CC4V 1AR4A 4CH4A 2LP7A 1YXBA 4TV9B 4JI5O 3DC5A 1AR1B 2GHYA 3HKBB 2PI4A 1Q43A 4JAAA 4X89A 1I0HA 1Y66A 1XL4A 1HDJA 5EIBC 1PL0A 4FLUA 5LA6A 4GLXA 4DV7O 4IYHA 2WLNA 2FMLA 3SR2C 3SPJA 3RYFA 4F6EA 4JYAB 5JH7B 4O4JB 5H6RA 1N33B 5JJJB 4X62B 3OMAB 3OM3B 2RCVA 3T4DA 5H9CA 3KG2A 1FXKB 2A9HA 1S77D 2GUZA 5IE9A 4DR7B 1AJPA 1GN6A 2YEVB 3W7SA 3WG7C 5LOVA 1FFTB 1VARA 4YJ3B 1GM7A 4GX2A 4RUFA 3SYOA 4LNUA 3UM7A 1XBLA 3P32A 5A2QN 4J42A 2QDOA 2DYSB 3RBZA 3FYIB 4B3SB 1WNSA 1G8MA 1JPXA 3CB2A 2QR4A 4JI8O 1JJOA 1Y76B 5BR8B 1YDXA 3U0ZA 1PL4A 1K4DC 2UXCO 1K5SA 4LF8O 2PGGA 3I5DA 5KA6A 1SKVA 4GT1A 4PJ0Z 3ZMVA 3F5TA 3ZJZA 1AI7A 2LW1A 1YIJV 2VRZA 2XASA 2UXXA 2AHZA 5KHIA 3AG7A 4DK1A 3JAWB 4LFBO 2KSDA 3SPGA 2LFSA 4IGGA 3FKSG 5ITZA 1YZBA 1OHHG 2DN9A 3QF7A 4MTFA 4LFCO 3T2MA 4OX9B 2EIMB 4JGSA 3RGBA 1VQ9V 5LA6B 4Z2WA 1VQPV 4I0XA 2EIJB 1GN4A 4JAVA 4MVZA 4FLXA 3RYFB 3CCLV 4QPKA 5LXTA 3H01A 2UU9B 1TUBA 3E83A 3IFXA 4PD4F 1R3JC 4AHCA 1GM8A 1WPXA 4UV9A 2JJ2G 2LQTA 4PA3A 2VS0A 5CA3A 4J7KA 3FX7A 2RMKB 1Y6XA 2GUZB 4UXNA 5B66Z 4MVQA 1WB7A 5LOVB 3SPCA 4BIOA 4GYCB 1LNQA 2N04A 4B3MO 4I50A 2JEXA 3THOA 4LNUB 1PV0A 4DV1O 2V7QG 4H0LB 4MTGA 4DR1B 1JCHA 1TGOA 2XTAA 1BE3H 3MD0A 3D36C 2A79B 3WB1A 4CH3A 5LP6A 2WSSG 1MG1A 3GB7C 4KL1A 1AILA 2UUCB 4EFBA 4GZRB 4GCZA 3DXRA 4DV6O 1K8AW 4TSFG 4TWKA 2WA3A 2QM7A 1J5EO 1I94O 4R50A 5JCOA 1FXHA 1IVSA 4DRXA 4LWSA 3BCCH 1RM1B 2P6JA 4PDVA 3A0BZ 2A06H 4LF6B 5ITZB 3CRQA 1N32B 2JEUA 1SQVH 1VQKV 2IM9A 1Q6IA 3E89A 5B3SB 2Q7GA 4JYCA 1O9GA 1Q81W 1KQSU 3ABKC 4Z1MG 4I0XB 1L0NH 1CEZA 2IJHA 5LXTB 2NR5A 1VIBA 3T1HB 1TUBB 4DUYO 1GO3F 1K7DA 4CS2A 4DYLA 3ZMTA 5L3GA 3FAVA 5TISZ 3RVZA 5J9PC 5B1BC 1N4CA 1ZWIC 2ZNIA 1S5HC 2ZXWB 3OT7A 2DJVA 2YI8A 3SYPA 4I50B 5F2VO 4JI3O 1DF5A 3TXSA 1EM1A 5KX5A 3VQXA 5AG2A 1JA8A 1HNXB 4ZIBA 1SETA 4DR6B 3OW2U 2P4KA 2MW2B 3T1YB 1QLEB 2ZKOA 3ZHRA 1OCCB 2Y69B 5LP6B 2Q68A 2OTLV 3BA8A 3OTOB 1XMOB 2AHYA 4WFEA 1AI5A 1HR0B 3G4SV 3ASOB 3AG1C 1H2MA 3M8AA 4YHHO 3DXRB 3MDSA 2UXDO 2ZT9B 5LGNA 4KFMA 4JI4O 4DRXB 3DGEA 2XAJA 4LWSB 1FFXA 2DOSA 4NTYA 1ZLZA 3HKEA 1FYJA 3UT5A 3CMEV 4NVPA 1E1RG 1KP2A 3FFQA 1XL6A 2ILMA 2YIAA 3WB2A 5LMNO 3P30A 2UXBO 1JX9A 3Q4HA 1H2GA 5CB4A 4NXMB 3IAYA 4H13B 3FYEB 2LW7A 4XDJA 1HNWB 3A8TA 3HPLC 4FFKA 1E79G 3G6BA 4YXWG 2B9ZA 2ZDIC 4X64O 5E79Z 2FB5A 4UCUA 3ZHQA 3RYIA 4I9QA 3JSLA 2F93B 1N34B 3FAVB 5B5EZ 2H8PC 2ZE6A 2HKOA 1PKXA 4I7ZB 1SESA 4QIWF 3IC9A 4DV0B 5KX5B 4ZBMA 1XEQA 2NLJC 4NXNO 4U3FH 1K3EA 2F95B 4LF4B 2HJDA 2ZNJA 1BZKA 1AVMA 2P7TC 2Z3YA 2YC0A 2M6YA 4E4EA 4X65B 3WG7B 5KHKA 4X1YB 4UVBA 1FFXB 4FLYA 3CCRV 2P06A 4MTXA 3HKEB 4LF7O 3VQVA 3UT5B 4JV5O 1X4TA 1DK1A 3H1KH 1P7GA 4CH5A 1WB8A 1VF7A 3K04A 2B5UA 1I08A 2Q9LA 5LBQA 1OCZC 1N0JA 5FPRA 1FS0G 4Q6GA 4H37A 2LGQA 3Q4HB 1ROPA 5CB4B 2X0LA 3K5NA 5EC2C 1NR7A 2VQEB 2NN4A 4FZ1A 2NNUA 2D3OW 1FAFA 2ZE8A 3OEHG 2HHHB 2KG7A 4O4LA 4MS2A 1UFIA 3FB5C 2VWJA 4LF5O 1RPRA 3GWOA 3JARA 2O57A 3IGAC 4ZOLA 2YSUB 1URFA 4BAYA 1H8HG 4FM2A 4UCVA 3K5OA 2CTPA 2DWDC 4PDLA 5EZYA 2CTRA 3HR0A 2IH3C 4JI6O 4LR3A 4J41A 1AJNA 4DR2B 2Q69A 1IBLB 3DSQA 1NBMG 1SQXH 2OCCC 2PUSA 1G6UA 1VF6C 2JIZG 2LJ2A 4JTDB 3CE2A 4NR1A 1US6A 1FKAO 3CCMV 3C90A 1TA8A 2C2AA 3JD4A 4JZ2A 1Q86W 3JCUZ 2BOBC 3LNMB 2V4DA 3OTFA 4X1IA 3FB6C 2IU0A 1DLBA 4DV2O 2CUGA 2UXNA 4J80A 1DTOA 5H2FZ 2JS3A 4ICGA 2UUBO 2Q6AA 1U96A 3ABLC 1HNZO 1PNKA 5GTIZ 1SZTA 3CCJV 5IWAB 2F66C 2UUAO 4JTAB 3K0DA 1K34A 3E8BA 1VQ7V 1MSWD 5LMUB 1N36O 3OUFA 3B8NA 1WLEA 1KYOF 1EFRG 3ZMUA 1QCEA 5HFLA 2L6LA 1VQLV 1MMMA 2WLHA 3BA9A 4BIUA 1YJ9V 2QE7G 3D3QA 4CC5A 1R6NA 1EZVH 2ODMA 3DTUB 1OZ0A 1VQMV 2KG7B 4O4LB 1JVMA 1R6KA 2GBOA 1D5AA 3HKDA 5CA1A 3JARB 4ZOLB 1XNQO 1D2DA 1MZEA 1COWG 5KAFZ 1K5QA 2Q5ZA 4RQEA 5EZYB 1I5XA 1YTFB 5JQGA 4FZ0A 1EN6A 2EILC 2GTAA 3EXAA 4NTWA 2EIKC 4AQYB 4ABMA 2QWNB 5IYZA 4B08A 3OD4A 3K0GA 4K0KO 3ABKB 2X6AA 2Q67A 1CXZB 3OUSA 3JATA 3CJHA 4J9ZB 4TV8A 1Q82W 1WA8A 3K5MA 1IX9A 2RQ6A 2ZDIA 2R72A 3B2EE 3AG2C 1OV9A 3QTCA 3EFFK 5C8YA 3QG5A 3AG3B 4TUYA 2JK5C 1FXVA 5CN0A 4EEQA 1M56C 2YIBA 3RYHA 4BR6A 4LH7A 2OT5A 3H1HH 3BRCA 5B1BB 1AI4A 3F7YC 1H2LA 4JYAO 4G28B 4B7KA 4PHZA 1N33O 4UV8A 3M7MX 3UCSC 3JAMN 4X62O 1UJWB 4KP4A 3BPZA 3JAKA 3LSUA 4W4LA 3SYCA 3JASA 5E1AC 1IBKB 3AEIA 1AJQA 2ARHA 4K8ZA 3AG1B 2GV9A 4G27B 5IJ9A 2F23A 4JZGA 1R3KC 1SRYA 2KQXA 4FFBA 2VWKA 2D2CB 1BCCH 3VBBA 1QR8A 1NQTA 2ADQB 3OFNG 3W7XA 4B3SO 3HKDB 5CA1B 3ABMC 5FL7G 4DV5O 2Q4PA 2OCHA 2Y0IA 1F4MA 5CBHA 1G4YB 2HJFC 2B1GA 4JI8B 4PA9A 4O2BA 2X6BA 5BR8O 5H5NA 5JQGB 3ETQA 1PM9A 3C3SA 1PPJH 1BL8A 1NH2B 2W0XA 5IYZB 1BQZA 2FYUH 1N8RW 2Y48A 2F1MA 3A0RA 1MZFA 3S3WA 2CE4A 3JATB 5FNVA 3CJHB 4TV8B 1K4CC 1WA8B 1RFYA 2Z0AA 3JD3A 3L74H 4D7SA 4J7ZA 5C8YB 4LH6A 2AXTZ 3ABTA 4TUYB 1IXBA 1OCRC 3RYHB 4OX9O 1EZJA 4DO2A 3SJQC 1R3IC 3JD1A 3EVKA 1KKCA 4PELA 5CBGA 4GX1A 2XAQA 3ZS8C 4X66B 1YEWA 2ITCC 1VQNV 2YUAA 1VF6A 4GX0A 3BHPA 3JAKB 1EN4A 1MSDA 3JASB 4E2LA 2Q73A 4TQDA 4UCTA 2PY5A 2ZCEA 1TVKA 4DXWA 1M57B 4DR4B 4DR5B 1EN5A 3CX5F 5IJ9B 1W2BU 4LF9B 4FFBB 1M93A 1M9NA 2KKWA 1OCOC 4WFBV 3K06A 4CZZA 4YIOA 1SA0A 4UCRA 3SPIA 2JS5A 3W7WA 2RN9A 4J7JA 3K79A 4O2BB 2Q0AA 3APOA 2YICA 4X8AA 2UUCO 2V1DA 2YXHA 1NS1A 2DWEC 4DUZO 1OCZB 4MTOA 5EK0A 2AW9A 4J10A 1O9HA 2LO1A 1I94B 1XREA 1XHZA 4LC1A 3FB7C 2ADPA 4OXSA 1YHQV 1BS3A 4RO2A 5FNVB 4QE7A 3LDEA 4LBEC 1IDSA 1L0LH 4LF6O 1QNMA 1N32O 2P4VA 4KHPB 2QTOA 2ZM6B 4FIPC 4FMTA 1Q6UA 5DN6G 4K3AA 3AG4C 1Y74A 5KHHA 1JMKC 5IY5C 1PNMA 4JI1B 4JI7B 2XNDG 4B7EA 1WJZA 2OCCB 4DV4O 1NU1H 5EYPA 4DUYB 2G38A 2YIDA 4JI0B 4FK5C 3BVOA 2YXLA 4DV3B 2GSMB 1H38A 4IL6Z 2QM4A 3ZRVA 2Q7EA 2AGAA 1TVKB 3VQWA 4U7NA 3LSSA 1NVPB 1HNXO 2ZQMA 4DR6O 1XNRO 5JVDA 1ZTEA 3T1YO 4K8XA 3RYCA 1KB9F 1VP7A 1AP5A 1FXKC 2BOCC 4DW0A 1SA0B 3W7TA 2W0FC 2PTMA 3ABLB 4CS3A 2OYQA 1BHBA 1TUEB 1T5EA 2Y4UA 1NZ6A 1JJ2U 3OTOO 2VQFB 1XMOO 1Q3EA 2Y4TA 1HR0O 1JOYA 1V54C 1VQ5V 3CRRA 4L87A 4UCOA 2XT9A 5DM6V 5LGUA 1ENVA 1Z5WA 1QHTA 5KAIZ 2OTJV 1QQCA 3FB8C 4FM1A 2B1IA 3B4SA 2DYRC 1XUQA 4RAIA 1XMQO 1IZ3A 3CC7V 3CRCA 5LMNB 2UXBB 4X9QA 2HG5C 4NXMO 4GKJB 2AZ2A 3O65A 1VQ4V 1DF4A 3K9SA 1MNGA 1WAZA 2EIKB 1HNWO 1MOFA 5CA0A 2ZIOA 4QNHB 1VQ6V 3UKMA 5L3DA 4O4IA 5EYPB 1A32A 2CH7A 4P30A 1V9PA 4G2KA 2EJ7A 2JRIA 3SPHA 1GRJA 4P2ZA 2PYLA 2CGOA 3CMAV 4FLZA 1H8EG 3ZX6A 1GTOA 3TK1A 3AG2B 4WFHA 4X1KA 4TQFA 2DMXA 4MVMA 1M56B 5IYDO 3OGCC 2IJJA 1THZA 2DW4A 2DQ3A 2F4VB 2EULA 1JR9A 4R7CA 5JVDB 3RYCB 4LF4O 4MVRA 3L71H 3K59A 3G6EV 3SJAC 2PI5A 5IT9N 1Z5VA 2P5OA 4PA6A 4RQFA 1NTMH 1UPGA 2HR3A 4Z1VA 3J7AU 3UO3A 2BTOA 1YVWA 3HKCA 4IYIA 4AILC 1FD9A 1W0KG 2QM8A 3A0HZ 5LHIA 1SQFA 3ETEA 4X65O 3KZIZ 4DW1A 1CP9A 3H9VA 1GKFA 2OIEA 3T1CA 1AP6A 4H33A 2YS8A 3D36A 3VQYA 3WB0A 1MABG 5GONA 3A2FA 1PNLA 2Q0OC 2ZR2A 4B3TB 2YIBD 4B3RB 3ABMB 5LYJA 1AR5A 1CPYA 1GN2A 3R65A 4UB8Z 4J9YB 4J11A 2YXYA 2W6JG 4BIZA 1OJHA 3CYOA 4CS4A 3G71V 2VQEO 1R73A 3CXHF 1S76D 3RYIB 1V55C 3CCSV 2HHHO 5CA0B 4JASA 5KHJA 4YJ2A 4O4IB 2CH7B 3ZIAG 4EB6A 4FLWA 1IBMB 4EKWA 5J2TA 3N2GA 4MW8A 2JDIG 3SDLA 5IJ0A 5KMGA 5IDJA 2EINC 4D7TA 4GKKB 1HW7A 4X1KB 5KA5A 1GN3A 5A9GA 4DR2O 4HNAA 2DQ0A 2XAHA 1IBLO 3CC2V 4JI2B 3CCUV 2Z5UA 3D8CA 1JFFA 1E1QG 2JGUA 4HYOA 1F4NA 4NTXA 1AROP 3BFRA 2YDEA 1BGYH 3L73H 4ZI7A 2ZD9A 4GX5A 5CBFA 4LFAB 4L8JA 2PYJA 2XAFA 3ZHSA 3HKCB 3JALA 3CP1A 1FJGB 3JSNA 5L3EA 1QBZA 1KECA 1SZXA 1R3LC 5GW7A 5CMUA 2UUBB 3RN4A 5K1XA 2E5LB 3NXSA 1G1XB 2QWRB 5GONB 4F6RA 5IWAO 4FLTA 5D5QA 1OCOB 2JJ1G 1GH6A 2QGNA 1J95A 3ETGA 3QVNA 2R9AA 1FXKA 5LMUO 5LYJB 3ZRWA 4YY3B 2MK3A 5LHHA 1ZAUA 3U11A 1W0JG 3AK3A 4I55A 3K57A 2EZOA 3L72H 3K08A 4YJ2B 1P84F 1JQ0A 5LHGA 4WFFA 4EB6B 2Q7HA 3QO5A 3N2GB 3QO8A 5J2TB 5IJ0B 2X7RB 5KMGB 4DR3B 2BSKA 5KHGA 3EHBB 3S3XA 1NKDA 4CC6A 5EC1C 4AQYO 4UCSA 4HNAB 2HFEC 2ITDC 1M1KW 3X2QC 2L35A 2P67A 3AG4B 1JFFB 3KKYA 3B8MA 4JI5B 4BWAA 5JJNB 4O4HA 5IY5B 4XDKA 1P49A 4X1IB 3CSXA 3CRMA
chains in the Genus database with same CATH topology
5B3SC 1QVFU 1GM9A 2XOKG 5L3CA 2IJIA 2W6IG 4DXWA 1K73W 1M57B 2A0LA 3CD6V 3CMEV 1W2BU 4MW3A 1E1RG 1M90W 1YJWV 1NR1A 1K97A 2WLLA 4MSWC 3STZC 1KP2A 1M9NA 1XL6A 1OCOC 2ZR3A 1OCRB 1GK9A 4WFBV 1K9MW 3K06A 2EJRA 4CZZA 1ORQC 4TT3G 3P30A 1JX9A 4JAUA 1H2GA 3SPIA 4PDMA 3W7WA 1VQ8V 3ZCCA 3E2EA 3K79A 3FYEB 4FPPA 4R6ZA 4X8AA 5KUMA 4U7OA 3I55V 3JCZA 4XDJA 2V1DA 1BMFG 3HPLC 3OEEG 4UVAA 2DWEC 2WLIA 1E79G 1OCZB 4MTOA 5EK0A 2ATKC 2ZDIC 4YXWG 1P4RA 2IW5A 2M7WA 3ZRWB 2WLMA 2IU3A 3LDDA 1K92A 2ZXWC 1S72V 4LC1A 4F4LA 3FB7C 1BHAA 4MVOA 4OXSA 1YHQV 4RO2A 4N23A 1V54B 4JF3A 4QE7A 4WFGA 3LDEA 4LBEC 3CCVV 2H8PC 1QLEC 4UUJC 2HKOA 1PKXA 3T4ZA 1OCCC 2QTOA 2Y69C 1SESA 4QIWF 4FIPC 4FMTA 4HZ3A 5DN6G 3M99B 4ZBMA 4LCUC 4PDRA 3ZRXA 3AG4C 3VOUA 3STLC 3ASOC 2NLJC 2IJKA 4XBFA 1Q7YW 1K3EA 3ASNB 3F5WC 3ZMZA 5IY5C 1PNMA 2DYRB 2WLKA 2YEVA 3MHSC 3JYCA 2XNDG 3ZN1A 4MVSA 4PA7A 2OCCB 1KKDA 1VQOV 3HB3B 3TCUA 4FK5C 3MHHC 2P7TC 2Z3YA 1KP3A 2WLJA 2GSMB 1L1FA 1H38A 5KUKA 4QPJA 3WG7B 2K1EA 3ZRVA 5EBLC 2QA4V 4UVBA 4MT8A 5IYCO 3ABUA 3CCRV 4MTXA 3E86A 3CCEV 1KD1W 3QO7A 3PJSK 3BEHA 2XAGA 4PA4A 4U7NA 3LSSA 5IYBO 4LP8A 1NVPB 2ZQMA 2WLLB 3K04A 5H6QA 2B5UA 3CXCU 1NVPD 2EBOA 4RUEA 5LBQA 1OCZC 1P7BA 3IC7A 3K03A 5B1AB 3OAAG 1FXKC 2BOCC 1FS0G 3W7TA 2W0FC 4H37A 3ABLB 3E8GA 1ROPA 2X0LA 1BHBA 1TUEB 3ZN0A 2X6CA 5EC2C 1NR7A 1JJ2U 3OR6C 4I9WA 1JOYA 2D3OW 2NNUA 3CC4V 1V54C 1QLNA 2LP7A 2WLIB 3OEHG 1VQ5V 1AR1B 1F51A 4MS2A 2GHYA 1I5YA 3FB5C 4L87A 3BY6A 2PI4A 1RPRA 4P9PA 4X89A 3GWOA 3IGAC 5DM6V 2YSUB 1Y66A 4BAYA 1XL4A 5LGUA 1H8HG 1ENVA 1PL0A 1GMGA 3LSQA 2DWDC 4PDLA 2OTJV 2WLNA 3FB8C 2IH3C 1IXMA 4WFAV 2B1IA 3SPJA 1AJNA 3ASNC 2DYRC 4RAIA 5H6RA 1B6QA 3W7UA 2Q69A 3F7VC 3CC7V 2HVKC 3D3IA 3E8FA 1NBMG 2OCCC 2HG5C 4CBCA 3OMAB 3OM3B 3T4DA 5H9CA 3KG2A 1FXKB 2A9HA 2JIZG 1VQ4V 1DF4A 3I56V 4JTDB 1S77D 2HLDG 3CCMV 1AJPA 3W7SA 2YEVB 2EIKB 1KC8W 3WG7C 1MOFA 1FFTB 2C2AA 3JD4A 1GM7A 1Q86W 4GX2A 4QNHB 1VQ6V 1PD3A 5L3DA 3UKMA 2BOBC 3LNMB 4RUFA 4P30A 4G2KA 3SYOA 3CPWU 3FB6C 3SPHA 4P2ZA 2IU0A 3CMAV 1DLBA 3UM7A 4I5SA 1H8EG 2UXNA 3P32A 5LGTA 5EBMC 1DTOA 2DYSB 1GTOA 3TK1A 3RBZA 3FYIB 3AG2B 4WFHA 2Q6AA 1V55B 1G8MA 1JPXA 4X88A 2IH1C 5B1AC 3ML0A 4MVMA 3ABLC 1M56B 5IYDO 3OGCC 2IJJA 1THZA 1YI2V 1PNKA 2DW4A 1K4DC 1K5SA 1SZTA 2DQ3A 3CCJV 1S3JA 4JTAB 5KA6A 3K0DA 1K34A 4GT1A 3E8BA 2EINB 4R7CA 3ZMVA 1VQ7V 1MSWD 4P9OA 2P90A 3OUFA 3ZJZA 3B8NA 1AI7A 1WLEA 2QEXV 4MVRA 5C93A 1YIJV 2XASA 2UXXA 2AHZA 1EFRG 3ZMUA 1QCEA 3G6EV 2PI5A 5HFLA 1VQLV 2WLHA 4PA6A 4BIUA 1YJ9V 4RQFA 2HR3A 3SPGA 2QE7G 2LFSA 3TETA 2HVJC 1R6NA 3AG3C 3FKSG 1QR9A 3DTUB 1OZ0A 1W0KG 2QM8A 1QVGU 1VQMV 4BW5A 1OHHG 1JVMA 5LHIA 1R6KA 3ETEA 5EBWC 3E35A 1CP9A 4MTFA 1GKFA 4JTCB 3T2MA 3RW0A 3T1CA 1COWG 2EIMB 4JGSA 1K5QA 4H33A 1VQ9V 1F23A 3LUTB 4RQEA 3D36A 1VQPV 1I5XA 1MABG 2EIJB 1YTFB 1PNLA 4JAVA 4MVZA 2ZR2A 3CCLV 1YTFD 4QPKA 2EILC 3H01A 4JYBA 1HWYA 2EIKC 3ABMB 1CPYA 3E83A 3IFXA 3R65A 4J9YB 4FJCC 3K0GA 1R3JC 1GM8A 3OMNB 1WPXA 4UV9A 3ABKB 2R9RB 2JJ2G 2X6AA 2FTKA 2W6JG 4BIZA 2Q67A 4PA3A 3CYOA 3OUSA 5CA3A 3OMIB 3G71V 1R73A 4J9ZB 1Q82W 2DYSC 4UXNA 1S76D 2ZDIA 4MVQA 3AG2C 3K3WA 1V55C 3CCSV 3EFFK 4JASA 3SPCA 2KB1A 3AG3B 2JK5C 1LNQA 1FXVA 5CN0A 1M56C 3ZIAG 2JEXA 1Y4MA 2QKSA 4EKWA 2V7QG 3B77A 4MW8A 2JDIG 4R8CA 5BZBA 2OT5A 4MTGA 5IDJA 4WCEV 1JCHA 3JD0A 5B1BB 1AI4A 2EINC 2LFRA 3F7YC 3MD0A 2A79B 5HFMA 5KA5A 4G28B 3QNEA 4UVCA 2WSSG 3SYAA 1MG1A 2DQ0A 2XAHA 3GB7C 2EILB 4UV8A 3CC2V 1UJWB 3CCUV 4KP4A 2Z5UA 1E1QG 4ZKIA 5L3BA 4GCZA 1K8AW 4HYOA 4TSFG 3SYCA 1F4NA 4TWKA 2QM7A 1AROP 5E1AC 4R50A 1FXHA 1NJIW 1AI6A 4QE9A 5B1OA 3ZMSA 3OE7G 3AEIA 1AJQA 2ZD9A 4GX5A 3X2QB 1RM1B 4KUMA 2EIMC 3WFVA 2P6JA 5CBFA 3AG1B 4PDVA 3ETDA 2XAFA 4G27B 4Q20A 2EIJC 1R3KC 1SRYA 3JD2A 2JEUA 1VQKV 3CP1A 2WPDG 5L3EA 3E89A 3VBBA 1QBZA 1NQTA 1QR8A 1KECA 3OFNG 3W7XA 2H94A 1R3LC 5B3SB 4JYCA 5GW7A 5CMUA 2WWWA 3ABMC 5FL7G 1F4MA 5CBHA 4WF9V 1G4YB 2HJFC 2B1GA 3NXSA 1Q81W 4PA9A 3RVYA 1KQSU 3ABKC 4Z1MG 2X6BA 3SYQA 1CEZA 4MVUA 2IJHA 1BL8A 1OCOB 2JJ1G 1SERA 1NH2B 1J95A 1K33A 3ETGA 1YITV 1FXKA 1NH2D 3ZRWA 1GO3F 1K7DA 1S0VA 1N8RW 2Y48A 4XDLA 3ZMTA 2MK3A 3A0RA 5L3GA 5LHHA 1YSCA 1W0JG 3RVZA 1K4CC 3OR7C 1M57C 5L3FA 5J9PC 2EZOA 5B1BC 3JD3A 3K08A 1ZWIC 2F43G 1S5HC 2ZXWB 3ABTA 1JQ0A 3SYPA 5LHGA 4WFFA 3E8HA 1OCRC 1DF5A 2EZPA 2CK3G 3QO5A 3QO8A 1EZJA 4DO2A 3SJQC 1R3IC 3JD1A 1SETA 2X7RB 3OW2U 4PELA 5CBGA 1QLEB 3EHBB 4GX1A 1OCCB 1NKDA 2XAQA 2Y69B 2Q68A 4JPRA 3K9AA 5EC1C 2HFEC 2OTLV 2ITDC 3LDCA 4QJFB 2AHYA 4WFEA 1M1KW 3X2QC 1AI5A 1RM1C 2P67A 2ITCC 1EBOA 3G4SV 1VQNV 3AG4B 4HAMA 4ASUG 2WAMA 3AG1C 3ASOB 4GX0A 2R9IA 3B8MA 3CCQV 1RPOA 5B1NA 5IY5B 5LGNA 4XDKA 4KFMA 4E2LA 4N21A 3ZRSA 3DGEA 2XAJA 1YJNV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJC C;  2MK3 A;  4G2K A;  2LP7 A;  1K34 A;  2OT5 A;  1DLB A;  4JPR A;  1I5Y A;  2EZO A;  3CYO A;  3K9A A;  3B8N A;  4FK5 C;  4JGS A;  3MHH C;  5H9C A;  5HFM A;  5KA5 A;  1F23 A;  2EBO A;  4FIP C;  3GWO A;  3WFV A;  2M7W A;  2P6J A;  1QCE A;  1Y66 A;  1I5X A;  1EBO A;  5HFL A;  1MG1 A;  1JQ0 A;  1JPX A;  1DF4 A;  1ENV A;  3M99 B;  1K33 A;  3B8M A;  1DF5 A;  3H01 A;  2EZP A;  3CP1 A;  3P30 A;  1MOF A;  5CN0 A;  1QBZ A;  1QR8 A;  2X7R B;  4N23 A;  1QR9 A;  1Y4M A;  4N21 A;  1SZT A;  3MHS C;  4E2L A;  3B77 A;  4JF3 A;  5CMU A;  5KA6 A; 
#chains in the Genus database with same CATH topology
 1QVF U;  1GM9 A;  4ZI7 B;  3KCX A;  2QTS A;  2XOK G;  5L3C A;  2IJI A;  3CD6 V;  4DV7 B;  2A0L A;  3ZHV A;  1K73 W;  5GTH Z;  2E74 B;  1B3Q A;  1I7F A;  1M90 W;  2HP8 A;  1YJW V;  1NR1 A;  1K97 A;  3JAL B;  2WLL A;  4MSW C;  3STZ C;  1XIL A;  1GK9 A;  2Y0P A;  1K9M W;  2N74 A;  4JAU A;  4PDM A;  4JYY A;  3ZCC A;  4HBN A;  3WU2 Z;  3E2E A;  4EFE A;  5KUM A;  4F6R B;  4DR7 O;  3I55 V;  4UVA A;  1L8D A;  2WLI A;  4AI8 A;  1P4R A;  2IW5 A;  1FPO A;  4TOI A;  3ZRW B;  2WLM A;  1IBK O;  1K92 A;  3H1J H;  3N27 A;  3K58 A;  1BHA A;  4N23 A;  4IT5 A;  2OWO A;  1V54 B;  2QWP B;  4JF3 A;  4I55 B;  3G67 A;  4UUJ C;  1KUQ A;  4IHJ A;  3T4Z A;  2UXC B;  5JJE B;  4LF8 B;  3ZBH A;  1BT8 A;  2OIG A;  2QKC A;  4DV5 B;  5EIB D;  4PDR A;  3ZRX A;  3VOU A;  3STL C;  2BSK B;  2PZS A;  2IJK A;  4XBF A;  3LNN A;  1Q7Y W;  3F5W C;  3ZMZ A;  2DYR B;  2WLK A;  3L75 H;  3U10 A;  3UO2 A;  3ZN1 A;  4KXR A;  3ZHU A;  4LFB B;  3TCU A;  3AK1 A;  2QWQ B;  3MHH C;  2BTQ A;  3SJC C;  4O4H B;  1KP3 A;  2E3C A;  2LGW A;  5KUK A;  2K1E A;  1RSO A;  4LFC B;  3H1L H;  2QA4 V;  4MT8 A;  2AZ0 A;  3ABU A;  1H2K A;  5D5P A;  3QO7 A;  3PJS K;  4PA4 A;  3P3P A;  5IYB O;  4LP8 A;  2WLL B;  3RWR D;  2UU9 O;  5H6Q A;  3APQ A;  1SQP H;  2EBO A;  4RUE A;  3GVM A;  1P7B A;  3IC7 A;  2BE3 A;  3OAA G;  4ZHQ A;  3E8G A;  4X66 O;  3ZN0 A;  1LR1 A;  2X6C A;  2CGN A;  1XI1 A;  1QLN A;  3ZHT A;  2WLI B;  1F51 A;  1I5Y A;  3BY6 A;  4NYK A;  4B3M B;  4P9P A;  4W4K A;  4DV1 B;  1GMG A;  3LSQ A;  4U3J A;  4DR1 O;  3G80 A;  4DR4 O;  4DR5 O;  1RP3 B;  1BSM A;  1IXM A;  4WFA V;  1DGS A;  4UB6 Z;  3ASN C;  4IHJ B;  2RJZ A;  4LF9 O;  1YF2 A;  2QWO B;  1B6Q A;  3W7U A;  3F7V C;  4O2A A;  2HVK C;  3SJB C;  3D3I A;  1NTZ H;  3E8F A;  4CBC A;  1Q5O A;  4DV6 B;  1SC5 B;  2GTS A;  2ZE5 A;  1H2N A;  3I56 V;  1J5E B;  2HLD G;  1ZL8 A;  4QGP A;  1KC8 W;  1B04 A;  4DUZ B;  1SQB H;  1PD3 A;  3CPW U;  2BTQ B;  4I5S A;  1WN7 A;  3ICX A;  4K35 A;  5LGT A;  5EBM C;  1S5L Z;  3RT3 C;  1RSO B;  1V55 B;  4X88 A;  1X59 A;  2IH1 C;  2FL4 A;  5B1A C;  2XUM A;  3MAQ A;  4KHP O;  3ML0 A;  2ZM6 O;  1YI2 V;  1KBH A;  4OPH A;  1S3J A;  3T1H O;  5BMV A;  2EIN B;  2A7W A;  2ETN A;  3CEI A;  1AB3 A;  4P9O A;  2P90 A;  3TGU H;  4ZHQ B;  2QEX V;  5C93 A;  4JI1 O;  4JI7 O;  4DV4 B;  3TET A;  2HVJ C;  5BXZ A;  4JI0 O;  3AG3 C;  1QR9 A;  1ZSP A;  1QVG U;  4BW5 A;  1LUV A;  3BAA A;  4DV3 O;  5EBW C;  3E35 A;  1Q8I A;  1M4U A;  4JTC B;  4JI3 B;  3RW0 A;  1SS3 A;  2GDS A;  1F23 A;  3LUT B;  4U3J B;  2FKX A;  4IIJ A;  1D5N A;  1YTF D;  2E76 B;  4JYB A;  1HWY A;  1KMI Z;  3ZED A;  4O2A B;  1XNR B;  3J80 N;  4NB5 A;  1N0N A;  4FJC C;  1Q90 D;  3OMN B;  1Z2G A;  2R9R B;  3N2K A;  4YHH B;  2FTK A;  2UXD B;  2EX3 A;  2YI9 A;  1WPB A;  1MA1 A;  2K9P A;  3OMI B;  2VQF O;  4I4T A;  2CAZ C;  1ZL8 B;  4JI4 B;  2DYS C;  3K3W A;  2KB1 A;  2HEP A;  3PN1 A;  1YCI A;  1Y4M A;  2QKS A;  4X1Y A;  3K5L A;  3B77 A;  1KU9 A;  3RFR A;  4FLV A;  4R8C A;  5DEC A;  5BZB A;  4BW9 A;  4WCE V;  3JD0 A;  4OPA A;  1XHX A;  2LFR A;  2JGD A;  5HFM A;  3QNE A;  4UVC A;  3CRA A;  3SYA A;  1Y74 B;  1XMQ B;  2EIL B;  1IUR A;  4YIP A;  2H3O A;  2ZE7 A;  4ZKI A;  5BMV B;  5L3B A;  4GKJ O;  4X64 B;  1R6T A;  2QSA A;  2N05 A;  1NJI W;  1AI6 A;  4QE9 A;  5B1O A;  3J81 N;  3ZMS A;  4DK0 A;  4GUN A;  5J2U A;  3OE7 G;  1N34 O;  3X2Q B;  4KUM A;  2EIM C;  3WFV A;  3O9O A;  3ETD A;  1WP7 A;  4UFZ A;  2QKA A;  4Q20 A;  1S5J A;  2EIJ C;  4X20 A;  1F7Y A;  3JD2 A;  2WPD G;  1H2S B;  4PV1 B;  4DV0 O;  2H94 A;  2WWW A;  5JWP A;  4FVM A;  4WF9 V;  3RVY A;  1GAX A;  4NXN B;  4IIJ B;  3SYQ A;  1LUW A;  4MVU A;  3BAB A;  2F4V O;  5BY1 A;  1SER A;  2CTQ A;  1K33 A;  1YIT V;  5DED A;  1VEW A;  1NH2 D;  2QJ1 A;  3R66 A;  1S0V A;  4H44 B;  3N2K B;  1Y67 A;  4XDL A;  1SQG A;  3C3T A;  4PI2 A;  1YSC A;  4I4T B;  5L3F A;  3OR7 C;  1M57 C;  3SGI A;  2F43 G;  2ZIM A;  2XHB A;  4LF7 B;  3E8H A;  4WBN A;  2PF4 E;  4JV5 B;  1XQ8 A;  1XDC A;  5LL6 Y;  2EZP A;  2CK3 G;  2E75 B;  1XOU A;  3TXQ A;  3L70 H;  2JGD B;  1B06 A;  4B3T O;  4JPR A;  4A5U B;  1NTK H;  4NKG B;  3K9A A;  4B3R O;  2A3Q A;  3LDC A;  4QJF B;  1M5I A;  1RM1 C;  1EBO A;  4HAM A;  4ASU G;  2WAM A;  2DE0 X;  1Q6H A;  2R9I A;  3E22 A;  3CCQ V;  1RPO A;  5B1N A;  4LF5 B;  1R1B A;  4N21 A;  3ZRS A;  5K1P A;  3P3N A;  1YJN V;  5J2U B;  5B3S C;  2IBZ H;  3CHX A;  2W6I G;  4JI6 B;  1NI8 A;  1IBM O;  3FD9 A;  4MW3 A;  3KCY A;  3TJT A;  4X20 B;  2RDC A;  2Q8V A;  2BCC H;  1U97 A;  1SQQ H;  3B09 A;  2ZR3 A;  1OCR B;  2EJR A;  1ORQ C;  4TT3 G;  4GKK O;  1NT2 B;  1VQ8 V;  3GWK C;  4FPP A;  4R6Z A;  3CS5 A;  1BQ0 A;  4JI2 O;  4U7O A;  2R70 A;  3JCZ A;  1BMF G;  3OEE G;  4TV9 A;  2ATK C;  1W59 A;  2M7W A;  3HKB A;  2IU3 A;  3LDD A;  2ZXW C;  1S72 V;  4F4L A;  4DV2 B;  3AK2 A;  4MVO A;  1WP8 A;  4LFA O;  2RNB A;  4WFG A;  1ZUQ A;  3CCV V;  1QLE C;  1HP8 A;  5JH7 A;  4O4J A;  1FJG O;  1OCC C;  5FPO A;  2Y69 C;  5LP6 C;  1HNZ B;  3L9D A;  4WBN B;  2CDY A;  4PI0 A;  1VF5 B;  4HZ3 A;  2UUA B;  2E5L O;  3M99 B;  4LCU C;  3ASO C;  1N36 B;  4C7U A;  3ASN B;  3IJ4 A;  5KLV H;  2YEV A;  3MHS C;  3JYC A;  5JCO C;  2CTW A;  2ZIN A;  4YJ3 A;  5FLX N;  2P22 C;  4MVS A;  4PA7 A;  1KKD A;  1VQO V;  3HB3 B;  3B40 A;  3OGI B;  3E22 B;  4YY3 O;  4RWU A;  2WLJ A;  3DC6 A;  1L1F A;  4QPJ A;  3H1I H;  2JVD A;  3CWB H;  5EBL C;  1XNQ B;  5IYC O;  1PP9 H;  1QU7 A;  2WA4 A;  1Y76 A;  4OGQ B;  3E86 A;  3CCE V;  1KD1 W;  1VMG A;  3BEH A;  1SF9 A;  2XAG A;  4CH6 A;  4DR3 O;  3CXC U;  1NVP D;  3K03 A;  4FM0 A;  5B1A B;  4D6T H;  4K0K B;  3UQ8 A;  3JAW A;  3OR6 C;  4I9W A;  1ZX3 A;  3NR7 A;  1TAE A;  3CC4 V;  1AR4 A;  4CH4 A;  2LP7 A;  1YXB A;  4TV9 B;  4JI5 O;  3DC5 A;  1AR1 B;  2GHY A;  3HKB B;  2PI4 A;  1Q43 A;  4JAA A;  4X89 A;  1I0H A;  1Y66 A;  1XL4 A;  1HDJ A;  5EIB C;  1PL0 A;  4FLU A;  5LA6 A;  4GLX A;  4DV7 O;  4IYH A;  2WLN A;  2FML A;  3SR2 C;  3SPJ A;  3RYF A;  4F6E A;  4JYA B;  5JH7 B;  4O4J B;  5H6R A;  1N33 B;  5JJJ B;  4X62 B;  3OMA B;  3OM3 B;  2RCV A;  3T4D A;  5H9C A;  3KG2 A;  1FXK B;  2A9H A;  1S77 D;  2GUZ A;  5IE9 A;  4DR7 B;  1AJP A;  1GN6 A;  2YEV B;  3W7S A;  3WG7 C;  5LOV A;  1FFT B;  1VAR A;  4YJ3 B;  1GM7 A;  4GX2 A;  4RUF A;  3SYO A;  4LNU A;  3UM7 A;  1XBL A;  3P32 A;  5A2Q N;  4J42 A;  2QDO A;  2DYS B;  3RBZ A;  3FYI B;  4B3S B;  1WNS A;  1G8M A;  1JPX A;  3CB2 A;  2QR4 A;  4JI8 O;  1JJO A;  1Y76 B;  5BR8 B;  1YDX A;  3U0Z A;  1PL4 A;  1K4D C;  2UXC O;  1K5S A;  4LF8 O;  2PGG A;  3I5D A;  5KA6 A;  1SKV A;  4GT1 A;  4PJ0 Z;  3ZMV A;  3F5T A;  3ZJZ A;  1AI7 A;  2LW1 A;  1YIJ V;  2VRZ A;  2XAS A;  2UXX A;  2AHZ A;  5KHI A;  3AG7 A;  4DK1 A;  3JAW B;  4LFB O;  2KSD A;  3SPG A;  2LFS A;  4IGG A;  3FKS G;  5ITZ A;  1YZB A;  1OHH G;  2DN9 A;  3QF7 A;  4MTF A;  4LFC O;  3T2M A;  4OX9 B;  2EIM B;  4JGS A;  3RGB A;  1VQ9 V;  5LA6 B;  4Z2W A;  1VQP V;  4I0X A;  2EIJ B;  1GN4 A;  4JAV A;  4MVZ A;  4FLX A;  3RYF B;  3CCL V;  4QPK A;  5LXT A;  3H01 A;  2UU9 B;  1TUB A;  3E83 A;  3IFX A;  4PD4 F;  1R3J C;  4AHC A;  1GM8 A;  1WPX A;  4UV9 A;  2JJ2 G;  2LQT A;  4PA3 A;  2VS0 A;  5CA3 A;  4J7K A;  3FX7 A;  2RMK B;  1Y6X A;  2GUZ B;  4UXN A;  5B66 Z;  4MVQ A;  1WB7 A;  5LOV B;  3SPC A;  4BIO A;  4GYC B;  1LNQ A;  2N04 A;  4B3M O;  4I50 A;  2JEX A;  3THO A;  4LNU B;  1PV0 A;  4DV1 O;  2V7Q G;  4H0L B;  4MTG A;  4DR1 B;  1JCH A;  1TGO A;  2XTA A;  1BE3 H;  3MD0 A;  3D36 C;  2A79 B;  3WB1 A;  4CH3 A;  5LP6 A;  2WSS G;  1MG1 A;  3GB7 C;  4KL1 A;  1AIL A;  2UUC B;  4EFB A;  4GZR B;  4GCZ A;  3DXR A;  4DV6 O;  1K8A W;  4TSF G;  4TWK A;  2WA3 A;  2QM7 A;  1J5E O;  1I94 O;  4R50 A;  5JCO A;  1FXH A;  1IVS A;  4DRX A;  4LWS A;  3BCC H;  1RM1 B;  2P6J A;  4PDV A;  3A0B Z;  2A06 H;  4LF6 B;  5ITZ B;  3CRQ A;  1N32 B;  2JEU A;  1SQV H;  1VQK V;  2IM9 A;  1Q6I A;  3E89 A;  5B3S B;  2Q7G A;  4JYC A;  1O9G A;  1Q81 W;  1KQS U;  3ABK C;  4Z1M G;  4I0X B;  1L0N H;  1CEZ A;  2IJH A;  5LXT B;  2NR5 A;  1VIB A;  3T1H B;  1TUB B;  4DUY O;  1GO3 F;  1K7D A;  4CS2 A;  4DYL A;  3ZMT A;  5L3G A;  3FAV A;  5TIS Z;  3RVZ A;  5J9P C;  5B1B C;  1N4C A;  1ZWI C;  2ZNI A;  1S5H C;  2ZXW B;  3OT7 A;  2DJV A;  2YI8 A;  3SYP A;  4I50 B;  5F2V O;  4JI3 O;  1DF5 A;  3TXS A;  1EM1 A;  5KX5 A;  3VQX A;  5AG2 A;  1JA8 A;  1HNX B;  4ZIB A;  1SET A;  4DR6 B;  3OW2 U;  2P4K A;  2MW2 B;  3T1Y B;  1QLE B;  2ZKO A;  3ZHR A;  1OCC B;  2Y69 B;  5LP6 B;  2Q68 A;  2OTL V;  3BA8 A;  3OTO B;  1XMO B;  2AHY A;  4WFE A;  1AI5 A;  1HR0 B;  3G4S V;  3ASO B;  3AG1 C;  1H2M A;  3M8A A;  4YHH O;  3DXR B;  3MDS A;  2UXD O;  2ZT9 B;  5LGN A;  4KFM A;  4JI4 O;  4DRX B;  3DGE A;  2XAJ A;  4LWS B;  1FFX A;  2DOS A;  4NTY A;  1ZLZ A;  3HKE A;  1FYJ A;  3UT5 A;  3CME V;  4NVP A;  1E1R G;  1KP2 A;  3FFQ A;  1XL6 A;  2ILM A;  2YIA A;  3WB2 A;  5LMN O;  3P30 A;  2UXB O;  1JX9 A;  3Q4H A;  1H2G A;  5CB4 A;  4NXM B;  3IAY A;  4H13 B;  3FYE B;  2LW7 A;  4XDJ A;  1HNW B;  3A8T A;  3HPL C;  4FFK A;  1E79 G;  3G6B A;  4YXW G;  2B9Z A;  2ZDI C;  4X64 O;  5E79 Z;  2FB5 A;  4UCU A;  3ZHQ A;  3RYI A;  4I9Q A;  3JSL A;  2F93 B;  1N34 B;  3FAV B;  5B5E Z;  2H8P C;  2ZE6 A;  2HKO A;  1PKX A;  4I7Z B;  1SES A;  4QIW F;  3IC9 A;  4DV0 B;  5KX5 B;  4ZBM A;  1XEQ A;  2NLJ C;  4NXN O;  4U3F H;  1K3E A;  2F95 B;  4LF4 B;  2HJD A;  2ZNJ A;  1BZK A;  1AVM A;  2P7T C;  2Z3Y A;  2YC0 A;  2M6Y A;  4E4E A;  4X65 B;  3WG7 B;  5KHK A;  4X1Y B;  4UVB A;  1FFX B;  4FLY A;  3CCR V;  2P06 A;  4MTX A;  3HKE B;  4LF7 O;  3VQV A;  3UT5 B;  4JV5 O;  1X4T A;  1DK1 A;  3H1K H;  1P7G A;  4CH5 A;  1WB8 A;  1VF7 A;  3K04 A;  2B5U A;  1I08 A;  2Q9L A;  5LBQ A;  1OCZ C;  1N0J A;  5FPR A;  1FS0 G;  4Q6G A;  4H37 A;  2LGQ A;  3Q4H B;  1ROP A;  5CB4 B;  2X0L A;  3K5N A;  5EC2 C;  1NR7 A;  2VQE B;  2NN4 A;  4FZ1 A;  2NNU A;  2D3O W;  1FAF A;  2ZE8 A;  3OEH G;  2HHH B;  2KG7 A;  4O4L A;  4MS2 A;  1UFI A;  3FB5 C;  2VWJ A;  4LF5 O;  1RPR A;  3GWO A;  3JAR A;  2O57 A;  3IGA C;  4ZOL A;  2YSU B;  1URF A;  4BAY A;  1H8H G;  4FM2 A;  4UCV A;  3K5O A;  2CTP A;  2DWD C;  4PDL A;  5EZY A;  2CTR A;  3HR0 A;  2IH3 C;  4JI6 O;  4LR3 A;  4J41 A;  1AJN A;  4DR2 B;  2Q69 A;  1IBL B;  3DSQ A;  1NBM G;  1SQX H;  2OCC C;  2PUS A;  1G6U A;  1VF6 C;  2JIZ G;  2LJ2 A;  4JTD B;  3CE2 A;  4NR1 A;  1US6 A;  1FKA O;  3CCM V;  3C90 A;  1TA8 A;  2C2A A;  3JD4 A;  4JZ2 A;  1Q86 W;  3JCU Z;  2BOB C;  3LNM B;  2V4D A;  3OTF A;  4X1I A;  3FB6 C;  2IU0 A;  1DLB A;  4DV2 O;  2CUG A;  2UXN A;  4J80 A;  1DTO A;  5H2F Z;  2JS3 A;  4ICG A;  2UUB O;  2Q6A A;  1U96 A;  3ABL C;  1HNZ O;  1PNK A;  5GTI Z;  1SZT A;  3CCJ V;  5IWA B;  2F66 C;  2UUA O;  4JTA B;  3K0D A;  1K34 A;  3E8B A;  1VQ7 V;  1MSW D;  5LMU B;  1N36 O;  3OUF A;  3B8N A;  1WLE A;  1KYO F;  1EFR G;  3ZMU A;  1QCE A;  5HFL A;  2L6L A;  1VQL V;  1MMM A;  2WLH A;  3BA9 A;  4BIU A;  1YJ9 V;  2QE7 G;  3D3Q A;  4CC5 A;  1R6N A;  1EZV H;  2ODM A;  3DTU B;  1OZ0 A;  1VQM V;  2KG7 B;  4O4L B;  1JVM A;  1R6K A;  2GBO A;  1D5A A;  3HKD A;  5CA1 A;  3JAR B;  4ZOL B;  1XNQ O;  1D2D A;  1MZE A;  1COW G;  5KAF Z;  1K5Q A;  2Q5Z A;  4RQE A;  5EZY B;  1I5X A;  1YTF B;  5JQG A;  4FZ0 A;  1EN6 A;  2EIL C;  2GTA A;  3EXA A;  4NTW A;  2EIK C;  4AQY B;  4ABM A;  2QWN B;  5IYZ A;  4B08 A;  3OD4 A;  3K0G A;  4K0K O;  3ABK B;  2X6A A;  2Q67 A;  1CXZ B;  3OUS A;  3JAT A;  3CJH A;  4J9Z B;  4TV8 A;  1Q82 W;  1WA8 A;  3K5M A;  1IX9 A;  2RQ6 A;  2ZDI A;  2R72 A;  3B2E E;  3AG2 C;  1OV9 A;  3QTC A;  3EFF K;  5C8Y A;  3QG5 A;  3AG3 B;  4TUY A;  2JK5 C;  1FXV A;  5CN0 A;  4EEQ A;  1M56 C;  2YIB A;  3RYH A;  4BR6 A;  4LH7 A;  2OT5 A;  3H1H H;  3BRC A;  5B1B B;  1AI4 A;  3F7Y C;  1H2L A;  4JYA O;  4G28 B;  4B7K A;  4PHZ A;  1N33 O;  4UV8 A;  3M7M X;  3UCS C;  3JAM N;  4X62 O;  1UJW B;  4KP4 A;  3BPZ A;  3JAK A;  3LSU A;  4W4L A;  3SYC A;  3JAS A;  5E1A C;  1IBK B;  3AEI A;  1AJQ A;  2ARH A;  4K8Z A;  3AG1 B;  2GV9 A;  4G27 B;  5IJ9 A;  2F23 A;  4JZG A;  1R3K C;  1SRY A;  2KQX A;  4FFB A;  2VWK A;  2D2C B;  1BCC H;  3VBB A;  1QR8 A;  1NQT A;  2ADQ B;  3OFN G;  3W7X A;  4B3S O;  3HKD B;  5CA1 B;  3ABM C;  5FL7 G;  4DV5 O;  2Q4P A;  2OCH A;  2Y0I A;  1F4M A;  5CBH A;  1G4Y B;  2HJF C;  2B1G A;  4JI8 B;  4PA9 A;  4O2B A;  2X6B A;  5BR8 O;  5H5N A;  5JQG B;  3ETQ A;  1PM9 A;  3C3S A;  1PPJ H;  1BL8 A;  1NH2 B;  2W0X A;  5IYZ B;  1BQZ A;  2FYU H;  1N8R W;  2Y48 A;  2F1M A;  3A0R A;  1MZF A;  3S3W A;  2CE4 A;  3JAT B;  5FNV A;  3CJH B;  4TV8 B;  1K4C C;  1WA8 B;  1RFY A;  2Z0A A;  3JD3 A;  3L74 H;  4D7S A;  4J7Z A;  5C8Y B;  4LH6 A;  2AXT Z;  3ABT A;  4TUY B;  1IXB A;  1OCR C;  3RYH B;  4OX9 O;  1EZJ A;  4DO2 A;  3SJQ C;  1R3I C;  3JD1 A;  3EVK A;  1KKC A;  4PEL A;  5CBG A;  4GX1 A;  2XAQ A;  3ZS8 C;  4X66 B;  1YEW A;  2ITC C;  1VQN V;  2YUA A;  1VF6 A;  4GX0 A;  3BHP A;  3JAK B;  1EN4 A;  1MSD A;  3JAS B;  4E2L A;  2Q73 A;  4TQD A;  4UCT A;  2PY5 A;  2ZCE A;  1TVK A;  4DXW A;  1M57 B;  4DR4 B;  4DR5 B;  1EN5 A;  3CX5 F;  5IJ9 B;  1W2B U;  4LF9 B;  4FFB B;  1M93 A;  1M9N A;  2KKW A;  1OCO C;  4WFB V;  3K06 A;  4CZZ A;  4YIO A;  1SA0 A;  4UCR A;  3SPI A;  2JS5 A;  3W7W A;  2RN9 A;  4J7J A;  3K79 A;  4O2B B;  2Q0A A;  3APO A;  2YIC A;  4X8A A;  2UUC O;  2V1D A;  2YXH A;  1NS1 A;  2DWE C;  4DUZ O;  1OCZ B;  4MTO A;  5EK0 A;  2AW9 A;  4J10 A;  1O9H A;  2LO1 A;  1I94 B;  1XRE A;  1XHZ A;  4LC1 A;  3FB7 C;  2ADP A;  4OXS A;  1YHQ V;  1BS3 A;  4RO2 A;  5FNV B;  4QE7 A;  3LDE A;  4LBE C;  1IDS A;  1L0L H;  4LF6 O;  1QNM A;  1N32 O;  2P4V A;  4KHP B;  2QTO A;  2ZM6 B;  4FIP C;  4FMT A;  1Q6U A;  5DN6 G;  4K3A A;  3AG4 C;  1Y74 A;  5KHH A;  1JMK C;  5IY5 C;  1PNM A;  4JI1 B;  4JI7 B;  2XND G;  4B7E A;  1WJZ A;  2OCC B;  4DV4 O;  1NU1 H;  5EYP A;  4DUY B;  2G38 A;  2YID A;  4JI0 B;  4FK5 C;  3BVO A;  2YXL A;  4DV3 B;  2GSM B;  1H38 A;  4IL6 Z;  2QM4 A;  3ZRV A;  2Q7E A;  2AGA A;  1TVK B;  3VQW A;  4U7N A;  3LSS A;  1NVP B;  1HNX O;  2ZQM A;  4DR6 O;  1XNR O;  5JVD A;  1ZTE A;  3T1Y O;  4K8X A;  3RYC A;  1KB9 F;  1VP7 A;  1AP5 A;  1FXK C;  2BOC C;  4DW0 A;  1SA0 B;  3W7T A;  2W0F C;  2PTM A;  3ABL B;  4CS3 A;  2OYQ A;  1BHB A;  1TUE B;  1T5E A;  2Y4U A;  1NZ6 A;  1JJ2 U;  3OTO O;  2VQF B;  1XMO O;  1Q3E A;  2Y4T A;  1HR0 O;  1JOY A;  1V54 C;  1VQ5 V;  3CRR A;  4L87 A;  4UCO A;  2XT9 A;  5DM6 V;  5LGU A;  1ENV A;  1Z5W A;  1QHT A;  5KAI Z;  2OTJ V;  1QQC A;  3FB8 C;  4FM1 A;  2B1I A;  3B4S A;  2DYR C;  1XUQ A;  4RAI A;  1XMQ O;  1IZ3 A;  3CC7 V;  3CRC A;  5LMN B;  2UXB B;  4X9Q A;  2HG5 C;  4NXM O;  4GKJ B;  2AZ2 A;  3O65 A;  1VQ4 V;  1DF4 A;  3K9S A;  1MNG A;  1WAZ A;  2EIK B;  1HNW O;  1MOF A;  5CA0 A;  2ZIO A;  4QNH B;  1VQ6 V;  3UKM A;  5L3D A;  4O4I A;  5EYP B;  1A32 A;  2CH7 A;  4P30 A;  1V9P A;  4G2K A;  2EJ7 A;  2JRI A;  3SPH A;  1GRJ A;  4P2Z A;  2PYL A;  2CGO A;  3CMA V;  4FLZ A;  1H8E G;  3ZX6 A;  1GTO A;  3TK1 A;  3AG2 B;  4WFH A;  4X1K A;  4TQF A;  2DMX A;  4MVM A;  1M56 B;  5IYD O;  3OGC C;  2IJJ A;  1THZ A;  2DW4 A;  2DQ3 A;  2F4V B;  2EUL A;  1JR9 A;  4R7C A;  5JVD B;  3RYC B;  4LF4 O;  4MVR A;  3L71 H;  3K59 A;  3G6E V;  3SJA C;  2PI5 A;  5IT9 N;  1Z5V A;  2P5O A;  4PA6 A;  4RQF A;  1NTM H;  1UPG A;  2HR3 A;  4Z1V A;  3J7A U;  3UO3 A;  2BTO A;  1YVW A;  3HKC A;  4IYI A;  4AIL C;  1FD9 A;  1W0K G;  2QM8 A;  3A0H Z;  5LHI A;  1SQF A;  3ETE A;  4X65 O;  3KZI Z;  4DW1 A;  1CP9 A;  3H9V A;  1GKF A;  2OIE A;  3T1C A;  1AP6 A;  4H33 A;  2YS8 A;  3D36 A;  3VQY A;  3WB0 A;  1MAB G;  5GON A;  3A2F A;  1PNL A;  2Q0O C;  2ZR2 A;  4B3T B;  2YIB D;  4B3R B;  3ABM B;  5LYJ A;  1AR5 A;  1CPY A;  1GN2 A;  3R65 A;  4UB8 Z;  4J9Y B;  4J11 A;  2YXY A;  2W6J G;  4BIZ A;  1OJH A;  3CYO A;  4CS4 A;  3G71 V;  2VQE O;  1R73 A;  3CXH F;  1S76 D;  3RYI B;  1V55 C;  3CCS V;  2HHH O;  5CA0 B;  4JAS A;  5KHJ A;  4YJ2 A;  4O4I B;  2CH7 B;  3ZIA G;  4EB6 A;  4FLW A;  1IBM B;  4EKW A;  5J2T A;  3N2G A;  4MW8 A;  2JDI G;  3SDL A;  5IJ0 A;  5KMG A;  5IDJ A;  2EIN C;  4D7T A;  4GKK B;  1HW7 A;  4X1K B;  5KA5 A;  1GN3 A;  5A9G A;  4DR2 O;  4HNA A;  2DQ0 A;  2XAH A;  1IBL O;  3CC2 V;  4JI2 B;  3CCU V;  2Z5U A;  3D8C A;  1JFF A;  1E1Q G;  2JGU A;  4HYO A;  1F4N A;  4NTX A;  1ARO P;  3BFR A;  2YDE A;  1BGY H;  3L73 H;  4ZI7 A;  2ZD9 A;  4GX5 A;  5CBF A;  4LFA B;  4L8J A;  2PYJ A;  2XAF A;  3ZHS A;  3HKC B;  3JAL A;  3CP1 A;  1FJG B;  3JSN A;  5L3E A;  1QBZ A;  1KEC A;  1SZX A;  1R3L C;  5GW7 A;  5CMU A;  2UUB B;  3RN4 A;  5K1X A;  2E5L B;  3NXS A;  1G1X B;  2QWR B;  5GON B;  4F6R A;  5IWA O;  4FLT A;  5D5Q A;  1OCO B;  2JJ1 G;  1GH6 A;  2QGN A;  1J95 A;  3ETG A;  3QVN A;  2R9A A;  1FXK A;  5LMU O;  5LYJ B;  3ZRW A;  4YY3 B;  2MK3 A;  5LHH A;  1ZAU A;  3U11 A;  1W0J G;  3AK3 A;  4I55 A;  3K57 A;  2EZO A;  3L72 H;  3K08 A;  4YJ2 B;  1P84 F;  1JQ0 A;  5LHG A;  4WFF A;  4EB6 B;  2Q7H A;  3QO5 A;  3N2G B;  3QO8 A;  5J2T B;  5IJ0 B;  2X7R B;  5KMG B;  4DR3 B;  2BSK A;  5KHG A;  3EHB B;  3S3X A;  1NKD A;  4CC6 A;  5EC1 C;  4AQY O;  4UCS A;  4HNA B;  2HFE C;  2ITD C;  1M1K W;  3X2Q C;  2L35 A;  2P67 A;  3AG4 B;  1JFF B;  3KKY A;  3B8M A;  4JI5 B;  4BWA A;  5JJN B;  4O4H A;  5IY5 B;  4XDK A;  1P49 A;  4X1I B;  3CSX A;  3CRM A; 
#chains in the Genus database with same CATH homology
 5B3S C;  1QVF U;  1GM9 A;  2XOK G;  5L3C A;  2IJI A;  2W6I G;  4DXW A;  1K73 W;  1M57 B;  2A0L A;  3CD6 V;  3CME V;  1W2B U;  4MW3 A;  1E1R G;  1M90 W;  1YJW V;  1NR1 A;  1K97 A;  2WLL A;  4MSW C;  3STZ C;  1KP2 A;  1M9N A;  1XL6 A;  1OCO C;  2ZR3 A;  1OCR B;  1GK9 A;  4WFB V;  1K9M W;  3K06 A;  2EJR A;  4CZZ A;  1ORQ C;  4TT3 G;  3P30 A;  1JX9 A;  4JAU A;  1H2G A;  3SPI A;  4PDM A;  3W7W A;  1VQ8 V;  3ZCC A;  3E2E A;  3K79 A;  3FYE B;  4FPP A;  4R6Z A;  4X8A A;  5KUM A;  4U7O A;  3I55 V;  3JCZ A;  4XDJ A;  2V1D A;  1BMF G;  3HPL C;  3OEE G;  4UVA A;  2DWE C;  2WLI A;  1E79 G;  1OCZ B;  4MTO A;  5EK0 A;  2ATK C;  2ZDI C;  4YXW G;  1P4R A;  2IW5 A;  2M7W A;  3ZRW B;  2WLM A;  2IU3 A;  3LDD A;  1K92 A;  2ZXW C;  1S72 V;  4LC1 A;  4F4L A;  3FB7 C;  1BHA A;  4MVO A;  4OXS A;  1YHQ V;  4RO2 A;  4N23 A;  1V54 B;  4JF3 A;  4QE7 A;  4WFG A;  3LDE A;  4LBE C;  3CCV V;  2H8P C;  1QLE C;  4UUJ C;  2HKO A;  1PKX A;  3T4Z A;  1OCC C;  2QTO A;  2Y69 C;  1SES A;  4QIW F;  4FIP C;  4FMT A;  4HZ3 A;  5DN6 G;  3M99 B;  4ZBM A;  4LCU C;  4PDR A;  3ZRX A;  3AG4 C;  3VOU A;  3STL C;  3ASO C;  2NLJ C;  2IJK A;  4XBF A;  1Q7Y W;  1K3E A;  3ASN B;  3F5W C;  3ZMZ A;  5IY5 C;  1PNM A;  2DYR B;  2WLK A;  2YEV A;  3MHS C;  3JYC A;  2XND G;  3ZN1 A;  4MVS A;  4PA7 A;  2OCC B;  1KKD A;  1VQO V;  3HB3 B;  3TCU A;  4FK5 C;  3MHH C;  2P7T C;  2Z3Y A;  1KP3 A;  2WLJ A;  2GSM B;  1L1F A;  1H38 A;  5KUK A;  4QPJ A;  3WG7 B;  2K1E A;  3ZRV A;  5EBL C;  2QA4 V;  4UVB A;  4MT8 A;  5IYC O;  3ABU A;  3CCR V;  4MTX A;  3E86 A;  3CCE V;  1KD1 W;  3QO7 A;  3PJS K;  3BEH A;  2XAG A;  4PA4 A;  4U7N A;  3LSS A;  5IYB O;  4LP8 A;  1NVP B;  2ZQM A;  2WLL B;  3K04 A;  5H6Q A;  2B5U A;  3CXC U;  1NVP D;  2EBO A;  4RUE A;  5LBQ A;  1OCZ C;  1P7B A;  3IC7 A;  3K03 A;  5B1A B;  3OAA G;  1FXK C;  2BOC C;  1FS0 G;  3W7T A;  2W0F C;  4H37 A;  3ABL B;  3E8G A;  1ROP A;  2X0L A;  1BHB A;  1TUE B;  3ZN0 A;  2X6C A;  5EC2 C;  1NR7 A;  1JJ2 U;  3OR6 C;  4I9W A;  1JOY A;  2D3O W;  2NNU A;  3CC4 V;  1V54 C;  1QLN A;  2LP7 A;  2WLI B;  3OEH G;  1VQ5 V;  1AR1 B;  1F51 A;  4MS2 A;  2GHY A;  1I5Y A;  3FB5 C;  4L87 A;  3BY6 A;  2PI4 A;  1RPR A;  4P9P A;  4X89 A;  3GWO A;  3IGA C;  5DM6 V;  2YSU B;  1Y66 A;  4BAY A;  1XL4 A;  5LGU A;  1H8H G;  1ENV A;  1PL0 A;  1GMG A;  3LSQ A;  2DWD C;  4PDL A;  2OTJ V;  2WLN A;  3FB8 C;  2IH3 C;  1IXM A;  4WFA V;  2B1I A;  3SPJ A;  1AJN A;  3ASN C;  2DYR C;  4RAI A;  5H6R A;  1B6Q A;  3W7U A;  2Q69 A;  3F7V C;  3CC7 V;  2HVK C;  3D3I A;  3E8F A;  1NBM G;  2OCC C;  2HG5 C;  4CBC A;  3OMA B;  3OM3 B;  3T4D A;  5H9C A;  3KG2 A;  1FXK B;  2A9H A;  2JIZ G;  1VQ4 V;  1DF4 A;  3I56 V;  4JTD B;  1S77 D;  2HLD G;  3CCM V;  1AJP A;  3W7S A;  2YEV B;  2EIK B;  1KC8 W;  3WG7 C;  1MOF A;  1FFT B;  2C2A A;  3JD4 A;  1GM7 A;  1Q86 W;  4GX2 A;  4QNH B;  1VQ6 V;  1PD3 A;  5L3D A;  3UKM A;  2BOB C;  3LNM B;  4RUF A;  4P30 A;  4G2K A;  3SYO A;  3CPW U;  3FB6 C;  3SPH A;  4P2Z A;  2IU0 A;  3CMA V;  1DLB A;  3UM7 A;  4I5S A;  1H8E G;  2UXN A;  3P32 A;  5LGT A;  5EBM C;  1DTO A;  2DYS B;  1GTO A;  3TK1 A;  3RBZ A;  3FYI B;  3AG2 B;  4WFH A;  2Q6A A;  1V55 B;  1G8M A;  1JPX A;  4X88 A;  2IH1 C;  5B1A C;  3ML0 A;  4MVM A;  3ABL C;  1M56 B;  5IYD O;  3OGC C;  2IJJ A;  1THZ A;  1YI2 V;  1PNK A;  2DW4 A;  1K4D C;  1K5S A;  1SZT A;  2DQ3 A;  3CCJ V;  1S3J A;  4JTA B;  5KA6 A;  3K0D A;  1K34 A;  4GT1 A;  3E8B A;  2EIN B;  4R7C A;  3ZMV A;  1VQ7 V;  1MSW D;  4P9O A;  2P90 A;  3OUF A;  3ZJZ A;  3B8N A;  1AI7 A;  1WLE A;  2QEX V;  4MVR A;  5C93 A;  1YIJ V;  2XAS A;  2UXX A;  2AHZ A;  1EFR G;  3ZMU A;  1QCE A;  3G6E V;  2PI5 A;  5HFL A;  1VQL V;  2WLH A;  4PA6 A;  4BIU A;  1YJ9 V;  4RQF A;  2HR3 A;  3SPG A;  2QE7 G;  2LFS A;  3TET A;  2HVJ C;  1R6N A;  3AG3 C;  3FKS G;  1QR9 A;  3DTU B;  1OZ0 A;  1W0K G;  2QM8 A;  1QVG U;  1VQM V;  4BW5 A;  1OHH G;  1JVM A;  5LHI A;  1R6K A;  3ETE A;  5EBW C;  3E35 A;  1CP9 A;  4MTF A;  1GKF A;  4JTC B;  3T2M A;  3RW0 A;  3T1C A;  1COW G;  2EIM B;  4JGS A;  1K5Q A;  4H33 A;  1VQ9 V;  1F23 A;  3LUT B;  4RQE A;  3D36 A;  1VQP V;  1I5X A;  1MAB G;  2EIJ B;  1YTF B;  1PNL A;  4JAV A;  4MVZ A;  2ZR2 A;  3CCL V;  1YTF D;  4QPK A;  2EIL C;  3H01 A;  4JYB A;  1HWY A;  2EIK C;  3ABM B;  1CPY A;  3E83 A;  3IFX A;  3R65 A;  4J9Y B;  4FJC C;  3K0G A;  1R3J C;  1GM8 A;  3OMN B;  1WPX A;  4UV9 A;  3ABK B;  2R9R B;  2JJ2 G;  2X6A A;  2FTK A;  2W6J G;  4BIZ A;  2Q67 A;  4PA3 A;  3CYO A;  3OUS A;  5CA3 A;  3OMI B;  3G71 V;  1R73 A;  4J9Z B;  1Q82 W;  2DYS C;  4UXN A;  1S76 D;  2ZDI A;  4MVQ A;  3AG2 C;  3K3W A;  1V55 C;  3CCS V;  3EFF K;  4JAS A;  3SPC A;  2KB1 A;  3AG3 B;  2JK5 C;  1LNQ A;  1FXV A;  5CN0 A;  1M56 C;  3ZIA G;  2JEX A;  1Y4M A;  2QKS A;  4EKW A;  2V7Q G;  3B77 A;  4MW8 A;  2JDI G;  4R8C A;  5BZB A;  2OT5 A;  4MTG A;  5IDJ A;  4WCE V;  1JCH A;  3JD0 A;  5B1B B;  1AI4 A;  2EIN C;  2LFR A;  3F7Y C;  3MD0 A;  2A79 B;  5HFM A;  5KA5 A;  4G28 B;  3QNE A;  4UVC A;  2WSS G;  3SYA A;  1MG1 A;  2DQ0 A;  2XAH A;  3GB7 C;  2EIL B;  4UV8 A;  3CC2 V;  1UJW B;  3CCU V;  4KP4 A;  2Z5U A;  1E1Q G;  4ZKI A;  5L3B A;  4GCZ A;  1K8A W;  4HYO A;  4TSF G;  3SYC A;  1F4N A;  4TWK A;  2QM7 A;  1ARO P;  5E1A C;  4R50 A;  1FXH A;  1NJI W;  1AI6 A;  4QE9 A;  5B1O A;  3ZMS A;  3OE7 G;  3AEI A;  1AJQ A;  2ZD9 A;  4GX5 A;  3X2Q B;  1RM1 B;  4KUM A;  2EIM C;  3WFV A;  2P6J A;  5CBF A;  3AG1 B;  4PDV A;  3ETD A;  2XAF A;  4G27 B;  4Q20 A;  2EIJ C;  1R3K C;  1SRY A;  3JD2 A;  2JEU A;  1VQK V;  3CP1 A;  2WPD G;  5L3E A;  3E89 A;  3VBB A;  1QBZ A;  1NQT A;  1QR8 A;  1KEC A;  3OFN G;  3W7X A;  2H94 A;  1R3L C;  5B3S B;  4JYC A;  5GW7 A;  5CMU A;  2WWW A;  3ABM C;  5FL7 G;  1F4M A;  5CBH A;  4WF9 V;  1G4Y B;  2HJF C;  2B1G A;  3NXS A;  1Q81 W;  4PA9 A;  3RVY A;  1KQS U;  3ABK C;  4Z1M G;  2X6B A;  3SYQ A;  1CEZ A;  4MVU A;  2IJH A;  1BL8 A;  1OCO B;  2JJ1 G;  1SER A;  1NH2 B;  1J95 A;  1K33 A;  3ETG A;  1YIT V;  1FXK A;  1NH2 D;  3ZRW A;  1GO3 F;  1K7D A;  1S0V A;  1N8R W;  2Y48 A;  4XDL A;  3ZMT A;  2MK3 A;  3A0R A;  5L3G A;  5LHH A;  1YSC A;  1W0J G;  3RVZ A;  1K4C C;  3OR7 C;  1M57 C;  5L3F A;  5J9P C;  2EZO A;  5B1B C;  3JD3 A;  3K08 A;  1ZWI C;  2F43 G;  1S5H C;  2ZXW B;  3ABT A;  1JQ0 A;  3SYP A;  5LHG A;  4WFF A;  3E8H A;  1OCR C;  1DF5 A;  2EZP A;  2CK3 G;  3QO5 A;  3QO8 A;  1EZJ A;  4DO2 A;  3SJQ C;  1R3I C;  3JD1 A;  1SET A;  2X7R B;  3OW2 U;  4PEL A;  5CBG A;  1QLE B;  3EHB B;  4GX1 A;  1OCC B;  1NKD A;  2XAQ A;  2Y69 B;  2Q68 A;  4JPR A;  3K9A A;  5EC1 C;  2HFE C;  2OTL V;  2ITD C;  3LDC A;  4QJF B;  2AHY A;  4WFE A;  1M1K W;  3X2Q C;  1AI5 A;  1RM1 C;  2P67 A;  2ITC C;  1EBO A;  3G4S V;  1VQN V;  3AG4 B;  4HAM A;  4ASU G;  2WAM A;  3AG1 C;  3ASO B;  4GX0 A;  2R9I A;  3B8M A;  3CCQ V;  1RPO A;  5B1N A;  5IY5 B;  5LGN A;  4XDK A;  4KFM A;  4E2L A;  4N21 A;  3ZRS A;  3DGE A;  2XAJ A;  1YJN V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...