2M7WA

Independently verified structure of gp41-m-mat, a membrane associated mper trimer from hiv-1 gp41
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an HIV-1-neutralizing antibody target, the lipid-bound gp41 envelope membrane proximal region trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Envelope glycoprotein
total genus 10
structure length 59
sequence length 59
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2m7wA00
1JQ0A 1F23A 1DF5A 4FJCC 1ENVA 2X7RB 5KA5A 3M99B 1EBOA 1SZTA 1QR9A 2EZPA 1MOFA 5CN0A 2P6JA 3WFVA 4FIPC 4JF3A 2MK3A 5HFMA 3P30A 4E2LA 1QR8A 3H01A 5H9CA 3CYOA 3MHHC 2OT5A 3B77A 1I5XA 2LP7A 1Y66A 2M7WA 1K33A 1I5YA 4JPRA 3B8NA 3MHSC 4N23A 4JGSA 5KA6A 3CP1A 4G2KA 5CMUA 2EZOA 1QCEA 1MG1A 3K9AA 3B8MA 1JPXA 3GWOA 1K34A 4N21A 1DF4A 1DLBA 5HFLA 2EBOA 1QBZA 1Y4MA 4FK5C
chains in the Genus database with same CATH superfamily
1FFXB 3CJHB 1Q6IA 5CA3A 3QO5A 4GYCB 1AVMA 2D2CB 3ZN0A 3RBZA 3W7TA 4YY3O 3CJHA 5KHHA 1GM8A 1UJWB 1K8AW 1RPRA 1F4MA 1SQPH 4JTDB 4JYBA 3DTUB 3SYQA 1DGSA 1MG1A 2NNUA 1TAEA 2EIJB 1J95A 5LP6A 4LH7A 1HP8A 1R73A 5L3DA 2AGAA 1QLEC 3L72H 2JGDB 5KMGB 2UXCB 2VS0A 4F6EA 4UV9A 1WB7A 4NVPA 1OCZB 3CMAV 1J5EO 1M9NA 5LMNO 4DUZO 3EXAA 4LFCB 3E83A 3E22A 4O4IA 3CSXA 1BHBA 4B3TB 1FJGO 1JMKC 4TQDA 2WLIA 2YIDA 3OMAB 4I55A 1YIJV 4UXNA 3QVNA 4D6TH 2UXDO 4K3AA 1N4CA 3OM3B 1S0VA 2DYSB 2VWJA 1ZLZA 2EULA 4FM0A 1XNQB 3UT5B 3H1IH 2DN9A 1GTOA 4FPPA 5C8YA 2GUZA 3ABMC 3IJ4A 1FS0G 4C7UA 2YEVB 4AI8A 1VQ5V 2YXHA 4DV0O 2YI9A 2ZE6A 2WA4A 1TVKB 1BL8A 1UPGA 1SZXA 2ZM6O 3STLC 1N36O 1IZ3A 4ZI7B 2YEVA 2XAHA 3JAMN 4AILC 5JJEB 1R6TA 2RNBA 1K5SA 1IBKO 1SERA 1RM1C 5LGTA 4DV7B 1AP6A 1GK9A 4LCUC 1Y76B 2ZXWB 2ZM6B 1N36B 1GKFA 2YIBA 4PI0A 1D2DA 1YTFB 4CC5A 4PDRA 4DR1B 2JIZG 2C2AA 1HNWO 4HAMA 1ZUQA 4DV0B 4YIPA 1HR0O 2PTMA 4BWAA 2EILB 4FLWA 1KKCA 4I50A 5B1BB 2Q7EA 4O4IB 4CS3A 3HKBB 1Z2GA 1AR5A 3K0DA 4H13B 2N04A 3BY6A 3K06A 2AZ2A 1JCHA 5C93A 2BTQB 3WFVA 4DV5B 1XEQA 2YSUB 1M4UA 1H2KA 2DQ3A 1OCOC 3H1KH 3WB1A 1S76D 3OAAG 2JGUA 4FLYA 1N0NA 1HNZB 2OIGA 1NU1H 3BHPA 3HR0A 1AJQA 2Z3YA 4GX0A 2Y0IA 5B1AC 2JK5C 4ZI7A 3CRQA 2VWKA 3RYFB 1NVPB 2UXCO 2E75B 4CC6A 2Z5UA 2LP7A 2QWQB 1AI7A 1SESA 2E3CA 1YHQV 5LMUB 2L6LA 1FXKC 5LXTA 1OCCB 5LMUO 4XDKA 1R3IC 3RYCA 1WPBA 1SQFA 3JYCA 2UXNA 1HW7A 2OCCC 2UXXA 3OR6C 1HNZO 5BMVB 4R50A 1ZWIC 1THZA 4OXSA 1GN3A 4BIZA 5L3FA 3NXSA 3AK2A 4UCVA 4G28B 2P6JA 5E1AC 4JI4O 5KHKA 2L35A 3RVZA 2R9IA 2ZDIA 4DV5O 1G8MA 4JTCB 3ZHRA 5IJ9A 4NXNB 1HWYA 4JZGA 2ZR3A 1EZVH 5B3SB 5IE9A 3MAQA 4X88A 4OPAA 1HR0B 1D5NA 5B1AB 3RGBA 1OCZC 1HNWB 1EFRG 4IL6Z 3MDSA 4DR1O 5C8YB 1S5HC 1BMFG 2QKCA 3E35A 1LUWA 4F6RA 1NJIW 1PNMA 2BE3A 2IJHA 3D36A 4DR5O 1NH2B 1WPXA 3JAWB 4O4HB 1PPJH 1V54C 1NKDA 1P4RA 4DV7O 4L8JA 1H2LA 2OYQA 3ML0A 5LYJA 1K34A 4LF7O 2F4VO 4KL1A 2VQFB 3LSSA 1IBKB 4UVCA 5LOVA 3THOA 3ZHTA 1GO3F 1VF6A 4P9PA 3OTOO 5CN0A 1H2SB 1YJWV 2LW1A 3A8TA 4CBCA 1GH6A 1IXBA 3JASA 3FYIB 2DJVA 2WLHA 2IH1C 2PYLA 1XNQO 2WLMA 1H38A 1Q86W 1M56B 2K1EA 1OCRC 4UCRA 2AW9A 3OEHG 4ZKIA 2UXDB 2A79B 5H9CA 3EHBB 1XMOB 4U3JB 2F23A 2M7WA 2H94A 1PKXA 2KSDA 1FJGB 4B3TO 2IU3A 1SQXH 5GTIZ 2OCHA 4J7KA 1YXBA 5LP6C 1L8DA 4HNAB 1MSWD 1RP3B 4LFCO 3X2QB 1K4DC 4A5UB 1L0NH 4DUZB 5IJ0A 5LMNB 4KP4A 1J5EB 4B7KA 3DC6A 4KUMA 5F2VO 1O9HA 2BTOA 2LGQA 1Q3EA 2CK3G 1LR1A 1R3KC 1IBLO 2JGDA 5B66Z 3SJQC 4HZ3A 2CTQA 2XASA 3APOA 1AILA 2D3OW 3HKBA 3LUTB 3K79A 3CCJV 4J9ZB 4FLVA 1SC5B 4TV8A 1GN4A 3F5WC 4YY3B 1OCOB 3BVOA 4PELA 5J9PC 5EBLC 2Q68A 3FB7C 2JVDA 1PD3A 2JJ1G 4ICGA 1W2BU 4FLZA 1FXKB 1IXMA 4GKJO 1P49A 3LDEA 3WB2A 1TUEB 5LA6A 3HB3B 3F5TA 2IM9A 3CCRV 4JZ2A 3CXCU 1R3JC 1NR1A 4RO2A 3I55V 1Q6UA 3BRCA 1SQQH 2QSAA 3B77A 3A0HZ 2DE0X 1VQNV 1SF9A 3JCZA 4WCEV 3H1LH 2EZOA 5EYPA 3K5OA 3OUFA 3ZEDA 4LF8O 1VQ4V 4DV3O 3T1HB 1CPYA 4PJ0Z 5LGNA 1XHXA 1F23A 4Q6GA 3VQYA 3B09A 1N0JA 4GX2A 3A0RA 2CH7A 1N33O 2ZQMA 3J7AU 3OEEG 1Q82W 4LFAO 3AG4B 4MT8A 1ZL8B 4BIUA 1D5AA 2CTPA 3B8MA 3DSQA 3WG7B 2EIMB 3U10A 5KHJA 2QKAA 3BPZA 2Q7HA 2Q0AA 4P2ZA 4UCSA 3SYAA 2Z0AA 1PV0A 4GZRB 3JD4A 2MK3A 1Q81W 3JALB 3APQA 2ETNA 1SS3A 4FFKA 4YIOA 3R65A 4O2AA 4LF9O 3HKCA 2WAMA 1K33A 2Q0OC 2UU9B 1EZJA 4GX1A 4H33A 3C3TA 4BW9A 5B3SC 2Y48A 1GM7A 4MTFA 2OTLV 2DWDC 2LFRA 3H1HH 1VEWA 1WN7A 4X64O 3SPCA 5J2TA 4JYCA 1N8RW 2K9PA 1LNQA 1H2GA 5CB4A 4B3MO 5IDJA 3ZMVA 2VQEO 4JI0B 4DR2B 2X7RB 3JAKB 4P9OA 4NXMO 4X1YA 5CA1B 4NTYA 4DR6B 3EFFK 4QE7A 4MW3A 3BEHA 5CB4B 4JI3O 4P30A 2AZ0A 3JATA 5JCOC 1V55C 3X2QC 3ETEA 4DXWA 5L3EA 4PDLA 4YXWG 4DYLA 4PHZA 3OTFA 5LOVB 1YJNV 4K0KO 2QWOB 4OGQB 2QM4A 1MZFA 1HDJA 2R9RB 3CRMA 1RPOA 1PP9H 1U97A 3FB8C 4WF9V 4YJ3A 4LF6O 4MVUA 1ZSPA 2UUCB 5BZBA 5LHGA 4KHPO 2XHBA 1L0LH 1Y6XA 5A2QN 3RYHB 3DGEA 2KQXA 4PDVA 4MVSA 4F4LA 1P84F 4CH5A 4JAAA 1JX9A 4DV1O 5IYCO 2WLNA 3JCUZ 3E2EA 3LDCA 1N34O 1VF6C 1KKDA 3ABKC 3Q4HA 4YJ2B 4QPJA 5FL7G 2F95B 3C3SA 1AB3A 4X62B 1LUVA 1DF4A 1FAFA 1FFXA 5EBMC 2LGWA 2A06H 3G67A 2R9AA 2WA3A 1TGOA 2XAQA 1XNRB 2PF4E 2GTAA 4Z2WA 2QWRB 1CXZB 3W7WA 2W0FC 3BA8A 2XT9A 1EM1A 4PI2A 2P90A 3SPJA 1FYJA 1NVPD 2ZINA 3LDDA 4YHHB 3B4SA 2IBZH 4IYHA 4I9QA 4DV6B 4J7JA 4L87A 3HKCB 2N05A 5KMGA 1FKAO 4DUYB 1K9MW 3R66A 1ZTEA 4X65B 3BFRA 2WLJA 1NQTA 4WFHA 3T1YO 4OX9O 1YF2A 3QG5A 2LO1A 3WG7C 4LWSA 2ZE8A 4FFBA 2Y4UA 4N21A 2G38A 2GUZB 4H37A 2WLIB 4I55B 2ZNIA 3RFRA 5IWAO 3ABMB 1JOYA 1JFFB 2CTWA 3JD2A 5LP6B 3MHHC 5CBFA 4BAYA 1XHZA 1M57C 3UM7A 4DV4B 5EBWC 4EB6B 1ZL8A 1K97A 3RYIB 4UB8Z 5LYJB 2A7WA 1XOUA 4DR7B 4IT5A 1KB9F 2ZT9B 4QE9A 2P5OA 4U3FH 2M6YA 3T1CA 3OFNG 1VARA 5KUMA 3UCSC 4NKGB 2NLJC 4O2AB 2VRZA 2EIJC 2QM7A 1YITV 5KA6A 2Q69A 1XDCA 3OE7G 3SPIA 2PYJA 3FB6C 1IDSA 2XTAA 1KP3A 5B1BC 4OPHA 2EINC 2RCVA 3LSQA 1GN6A 5JQGA 4FZ0A 2QDOA 3HKDA 4PA4A 4FMTA 5EIBD 1F4NA 1M93A 1IBMB 3CC4V 3ZMUA 3IGAC 1SA0A 2FMLA 2GBOA 2B1IA 3H9VA 1XI1A 1ZX3A 1JQ0A 4LF4B 3Q4HB 1S72V 4I7ZB 4QNHB 5DN6G 3SJAC 3IFXA 1SA0B 3CRRA 2UUAB 3CCSV 1W0JG 2HVJC 3JD3A 3AG2B 3O65A 4ZIBA 3KCYA 1TVKA 1K3EA 4NB5A 4Z1MG 2DMXA 3KKYA 2QWNB 3L75H 2F1MA 2W0XA 1V55B 4FJCC 5J2UA 4B3RO 1WLEA 3RYFA 1F7YA 1AROP 2ZCEA 4I5SA 3N2GB 2UUBB 1PM9A 3ZJZA 5JH7B 1SQBH 4FM2A 2AHYA 2BCCH 2F43G 3SYPA 3VQVA 4WFAV 1I94B 1N32O 3FD9A 4U7OA 2ATKC 2HJFC 4B08A 3BAAA 1H8HG 2CGOA 4AQYB 4YJ2A 4DV2B 3JD0A 5KUKA 3O9OA 5D5PA 1Q7YW 2MW2B 1Z5VA 1KUQA 1WAZA 1KYOF 1R6NA 1UFIA 3SR2C 3ZMSA 4LC1A 2YXYA 2WPDG 4E2LA 1QR8A 2W6JG 5IJ9B 4MVZA 1US6A 2GHYA 4TOIA 1BZKA 1YEWA 3VOUA 2E5LB 4GKKB 3OT7A 3PJSK 3TCUA 4LFBB 3K04A 5CA0A 3AG3C 3JD1A 2ILMA 1DLBA 1JA8A 4LF5O 2NR5A 3LNNA 3SPHA 1YJ9V 1K5QA 5EC1C 1BSMA 5IYZA 1JJ2U 3E8FA 4JF3A 1S77D 4TV9A 2YI8A 2ZIMA 3K5LA 2IJJA 1BE3H 3JASB 4CH3A 3G80A 3IC9A 4MVRA 5JH7A 3L71H 1RSOB 4X20A 5FPOA 2WLKA 5FNVA 4J10A 1NS1A 4JI7O 1YCIA 4QPKA 4I4TB 1SZTA 1YSCA 4J80A 1Z5WA 1XILA 1BCCH 1AP5A 4O4LA 3STZC 3LSUA 2RDCA 4I4TA 2HEPA 2OT5A 2PY5A 1NZ6A 3K58A 2QGNA 3ETDA 5L3BA 2YIBD 2FKXA 2R70A 1OJHA 1M57B 2HHHO 2B9ZA 1AR1B 3A0BZ 3SDLA 4J41A 3JAWA 2PI4A 4UVAA 4X1YB 5AG2A 2EILC 3K3WA 3E89A 1SKVA 5KLVH 3VQXA 3SJBC 2OCCB 4RQEA 3PN1A 3ZRVA 2FYUH 3K03A 3TK1A 4JI2B 4ABMA 1RM1B 4UV8A 4LBEC 4B3SO 1MOFA 3T4DA 3UQ8A 5LBQA 3ASNB 5BR8O 5LHHA 3FX7A 4JI8B 4YJ3B 1RFYA 1JVMA 1QU7A 1AI6A 4TWKA 2LJ2A 4IHJB 2HLDG 4JAUA 4FVMA 2LW7A 3ABUA 3A2FA 1ENVA 4O4JB 4JI6B 3G71V 3QO7A 5KHGA 4W4KA 2FB5A 4O4LB 3OMNB 2RJZA 2JJ2G 3CHXA 3AK3A 1KBHA 5H6QA 4X1IA 3K59A 4JV5O 5IJ0B 4FM1A 1M56C 1ROPA 4PDMA 5IY5B 4DR3O 2AXTZ 3C90A 4JI1B 5A9GA 4FZ1A 3CC2V 1S3JA 4EFBA 3U11A 4WBNA 2IH3C 2EIKC 1NTZH 4WFFA 4RUFA 2B5UA 5GTHZ 4DR4B 1OCRB 5CA0B 2EJRA 1VQ7V 4WBNB 2UXBB 4H44B 3QF7A 5GONA 4R6ZA 1ORQC 4G2KA 1HNXB 3SPGA 5LHIA 1Q90D 1QLEB 1I0HA 3EVKA 1HNXO 2P67A 4RQFA 2WLLA 4LNUB 1JJOA 4G27B 2GDSA 4QIWF 3WB0A 3DXRA 1FD9A 2FL4A 1WA8B 5L3CA 5DEDA 3HPLC 5ITZB 1TA8A 3K9AA 3D8CA 4LWSB 1URFA 4FFBB 5JJNB 4FK5C 1YDXA 1K7DA 4JYAB 2Q73A 1K4CC 1YZBA 3AG7A 4TUYA 1K73W 4JI6O 3LNMB 4JI5O 4NTWA 4UB6Z 3ABLC 3MHSC 2KG7A 2JS5A 1XMQO 1QHTA 5K1XA 3ZRSA 1AI4A 4X66O 3CCLV 3D3QA 4F6RB 1FFTB 1MZEA 3SGIA 5K1PA 5KA5A 5FLXN 1JR9A 4HBNA 1OV9A 1YTFD 4JI8O 4FIPC 5BR8B 3AG2C 3ASOC 3TJTA 2YIAA 1AR4A 4UUJC 4HYOA 4RUEA 4I0XB 3JATB 2IU0A 2QEXV 4JI2O 2ITDC 1TUBA 3ZS8C 1FXHA 1NR7A 1G4YB 2DYSC 3AEIA 4PA7A 5B1OA 5L3GA 1NH2D 2DYRB 5JQGB 1T5EA 5IYBO 3B40A 1YI2V 1S5JA 2ARHA 4R8CA 1WA8A 3S3XA 2EIMC 2QWPB 4UFZA 5FNVB 5JCOA 4X66B 1WP8A 3ZHVA 2QJ1A 1XMQB 4U7NA 3HKEA 1VQ8V 4O2BB 4MTXA 4JI5B 4IHJA 3TXSA 4I50B 1OZ0A 1BQZA 3BABA 1Q5OA 4DW0A 3TGUH 4GX5A 5EK0A 4JYAO 2XOKG 4JI7B 3JAKA 4GT1A 2HFEC 3GWKC 3CC7V 4I9WA 2CTRA 4R7CA 3WU2Z 4X1IB 2QKSA 2V7QG 1A32A 5J2UB 1YVWA 2YDEA 2Q4PA 2WWWA 4WFGA 5JJJB 1O9GA 2HP8A 3CYOA 2QTSA 2JEXA 5KX5A 2GV9A 3K0GA 2JS3A 1GM9A 4KFMA 3CCUV 1Y4MA 5KX5B 2E5LO 2DOSA 2UXBO 2XAJA 1R6KA 5BMVA 4EKWA 5LXTB 4DR4O 2P4KA 3E22B 3CXHF 3N2KB 3ZX6A 2P06A 4JGSA 1NTMH 1PL0A 4JI1O 3W7XA 1Q43A 2B1GA 4DR3B 3RW0A 3HKEB 1VQPV 3OW2U 1IURA 2LQTA 2F93B 4JV5B 3K08A 2QR4A 1QR9A 1OCCC 2ZNJA 5LL6Y 4MVQA 4GCZA 2EJ7A 1R1BA 1GRJA 1KC8W 2JRIA 3ZRXA 5D5QA 1E1RG 1MNGA 2BSKB 1FXVA 3CCVV 4CH6A 4MTOA 3L74H 2XUMA 4GLXA 4JYYA 5GW7A 4ZBMA 5IYZB 4K35A 4DRXA 1KQSU 4FLUA 2EIKB 3FB5C 3H01A 4NR1A 5JVDA 3CE2A 3BA9A 4B3SB 3SYCA 3CEIA 3KG2A 4B3RB 4EB6A 3B8NA 3ZHQA 4K8XA 4PV1B 3B2EE 3ABKB 1VQ6V 2V1DA 3AG4C 2CH7B 2JEUA 4IIJA 2OIEA 4I0XA 2RQ6A 3CD6V 2WLLB 4LNUA 3I56V 1KECA 4MS2A 4NTXA 1L1FA 4XBFA 2P7TC 1KMIZ 3RVYA 2H3OA 1MA1A 5DM6V 2IJKA 2WSSG 4LF4O 2HHHB 3VBBA 2LFSA 3M8AA 3CPWU 1KD1W 1QVFU 2ADQB 1VQ9V 2F66C 3CS5A 1BHAA 4U3JA 3QO8A 5KAFZ 4UCOA 2ZE5A 2X6BA 1BQ0A 4CS2A 3ICXA 1WJZA 2KG7B 4Z1VA 4ZHQA 1EN4A 1MMMA 1CEZA 1M90W 2YXLA 4UCUA 4MSWC 1SQGA 4DRXB 1COWG 1Q6HA 2RN9A 5H5NA 1H8EG 4RAIA 4AHCA 2BOBC 2HJDA 3RN4A 1Q8IA 4JASA 1AJNA 2X6AA 4O4HA 1Y66A 2E74B 4DR7O 4TV8B 4TQFA 4LF5B 1BS3A 1X59A 1I08A 3HKDB 4LFBO 3JARA 1PNKA 3N2KA 4GKKO 4KXRA 3TXQA 1SETA 2XNDG 3OMIB 3P3PA 1IVSA 3RYHA 1Y74A 1V54B 5IWAB 1E1QG 3QTCA 2ZIOA 3AG3B 4GUNA 1P7BA 1JPXA 3T2MA 3D36C 5EC2C 2FTKA 2V4DA 4DV2O 4BW5A 4AQYO 1FXKA 3ETQA 3W7UA 4BIOA 4OX9B 1G6UA 3T1YB 4J9YB 3L9DA 4X65O 5LA6B 5JWPA 4DUYO 2QE7G 1I94O 1N32B 2YS8A 5CBGA 1WB8A 5IYDO 1F51A 2H8PC 1M5IA 3RYIA 1H2MA 1GAXA 2Q7GA 3CRCA 2HR3A 3ZBHA 2UUBO 4XDLA 3ZRWB 2KB1A 3E8HA 2NN4A 2Y69B 2EINB 1TUBB 4JTAB 3G6EV 2X0LA 2ZE7A 3ZCCA 1XNRO 3J80N 2Q67A 1W0KG 4X1KA 3AK1A 3KCXA 2DYRC 3RYCB 3DC5A 4PA6A 1VF7A 2PUSA 3P32A 1NTKH 3G4SV 3UO2A 2CGNA 2UUAO 2A3QA 4ZOLA 3OGCC 2P22C 1N34B 2CAZC 3ZMZA 2IW5A 4DV1B 4N23A 5ITZA 1QCEA 3ABTA 3UT5A 2R72A 4DW1A 5KHIA 4DO2A 1SRYA 3W7SA 4KHPB 1IBMO 2UUCO 4BR6A 3NR7A 1BGYH 3I5DA 4FLTA 1V9PA 4X89A 5HFMA 1SQVH 3P3NA 5FPRA 4DK1A 3U0ZA 2AHZA 3E8BA 1R3LC 5BY1A 1B04A 3MD0A 3H1JH 2OTJV 4B7EA 3CX5F 1JFFA 3GWOA 4LH6A 4IIJB 3CB2A 3T4ZA 3SJCC 3BCCH 5E79Z 4JI3B 1W59A 3QNEA 4NYKA 1VQKV 4HNAA 3GVMA 1NI8A 3F7VC 5JVDB 1VMGA 3VQWA 5CBHA 3CWBH 2Q9LA 4NXMB 1QNMA 3OGIB 2VQEB 4B3MB 5EZYB 1XUQA 3J81N 1VIBA 3ETGA 5HFLA 3E86A 4FLXA 5TISZ 4DV4O 2QA4V 2ADPA 1RSOA 4X20B 1B6QA 4XDJA 4X9QA 3K9SA 3K5NA 4MVMA 1FPOA 3CP1A 3KZIZ 3L70H 5CMUA 2HVKC 2UU9O 1QBZA 2E76B 4O4JA 4E4EA 1DK1A 1M1KW 4LF9B 1CP9A 4IYIA 1B3QA 2W6IG 1VP7A 1P7GA 1Y67A 3JSNA 1XQ8A 1KU9A 2ZDIC 2OWOA 4JPRA 4DV6O 1VQMV 1NT2B 2DQ0A 4YHHO 1KP2A 2GTSA 3AG1C 1NBMG 1K92A 3ZHSA 4J11A 4X8AA 4WFEA 3E8GA 3ASNC 4X1KB 1ZAUA 1EN6A 4TV9B 3K5MA 3L73H 3N27A 5GONB 1AJPA 3CRAA 2CE4A 3T1HO 4LR3A 3CMEV 2Q8VA 3JALA 4X62O 4D7SA 4PA9A 1PNLA 2CDYA 4W4LA 3UO3A 1Y74B 2JDIG 4K8ZA 2X6CA 4TUYB 2A0LA 5BXZA 1IX9A 1VQLV 1MABG 1XBLA 3K57A 2ODMA 1E79G 1BT8A 2A9HA 2EX3A 1AI5A 3S3WA 4CZZA 4PA3A 2PI5A 2KKWA 2N74A 3ABLB 3FFQA 3M7MX 3OD4A 4GKJB 3OR7C 3IC7A 3ZRWA 1GMGA 4LF6B 4EEQA 3UKMA 1I5XA 4WFBV 1I5YA 2ZR2A 4MW8A 4K0KB 3AG1B 3ZIAG 1IBLB 1S5LZ 3DXRB 4LP8A 5IT9N 5IY5C 1XREA 1EBOA 3G6BA 2GSMB 4H0LB 1WNSA 5EZYA 4ZOLB 4DR6O 1DTOA 4Q20A 2Y69C 1PL4A 5EIBC 1VQOV 4DR2O 4JI0O 4DK0A 1QQCA 4UVBA 1MSDA 2XAFA 4QGPA 2EBOA 3FAVB 1H2NA 4TT3G 4X64B 3F7YC 3CCEV 4CS4A 1XMOO 4O2BA 2EZPA 2Q5ZA 1I7FA 3IAYA 2O57A 4CH4A 2Q6AA 5H6RA 3RWRD 2ZXWC 2DW4A 4ASUG 2RMKB 4ZHQB 5J2TB 3ZMTA 1GN2A 2ITCC 3M99B 3ZHUA 3JSLA 1B06A 3P30A 3OTOB 4PD4F 2PZSA 2XAGA 1XL6A 4EFEA 3GB7C 1EN5A 2VQFO 2F4VB 2ZD9A 2HKOA 4LF7B 2QTOA 1OHHG 3ASOB 3JARB 1DF5A 4LFAB 5KAIZ 4DR5B 5DECA 3RT3C 1N33B 5CA1A 1VF5B 3TETA 1QLNA 3FYEB 3SYOA 4IGGA 4MTGA 2CUGA 5LGUA 2ZKOA 5B5EZ 4JAVA 1XL4A 1Y76A 4QJFB 2DWEC 4DV3B 1WP7A 4LF8B 2YICA 3FAVA 4TSFG 3N2GA 1QVGU 2YUAA 3CCMV 3ZN1A 1X4TA 1U96A 2IJIA 4NXNO 1G1XB 3OUSA 4D7TA 3CCQV 4JI4B 2YC0A 2PGGA 4MVOA 2HG5C 2Y0PA 2BOCC 2BTQA 5B1NA 3D3IA 2QM8A 3FKSG 2P4VA 2BSKA 4J42A 4UCTA 5EYPB 5H2FZ 2Y4TA 4RWUA 4J7ZA
chains in the Genus database with same CATH topology
1AR1B 4P2ZA 3SYAA 1SETA 2PI4A 2XNDG 5CA3A 3QO5A 4UVAA 3JD4A 2MK3A 1Q81W 3ZN0A 3OMIB 3RBZA 3W7TA 2EILC 3K3WA 3R65A 3E89A 1V54B 1GM8A 2WAMA 1E1QG 1UJWB 1K33A 3AG3B 1RPRA 2OCCB 1K8AW 4RQEA 1F4MA 1P7BA 4JTDB 4JYBA 3DTUB 3SYQA 1MG1A 2NNUA 1JPXA 3T2MA 1EZJA 4GX1A 4H33A 5EC2C 3ZRVA 2EIJB 1J95A 2FTKA 3K03A 3TK1A 4BW5A 1R73A 5L3DA 1FXKA 1QLEC 3W7UA 1RM1B 5B3SC 4UV8A 4LBEC 4J9YB 1MOFA 3T4DA 2Y48A 1GM7A 4UV9A 5LBQA 3ASNB 5LHHA 2QE7G 4MTFA 2OTLV 2DWDC 1OCZB 1JVMA 3CMAV 2LFRA 1AI6A 1M9NA 4TWKA 5CBGA 5IYDO 3SPCA 2HLDG 4JAUA 1F51A 2H8PC 3E83A 4JYCA 1N8RW 1LNQA 1H2GA 3ABUA 1BHBA 5IDJA 3ZMVA 2HR3A 1ENVA 2X7RB 4XDLA 3ZRWB 2WLIA 2KB1A 3OMAB 3E8HA 4P9OA 3QO7A 3G71V 1YIJV 4UXNA 2Y69B 3EFFK 2EINB 4JTAB 4MW3A 4QE7A 3G6EV 3BEHA 3OMNB 2X0LA 2JJ2G 4P30A 3OM3B 5H6QA 3ZCCA 2DYSB 1S0VA 2Q67A 1W0KG 1M56C 1V55C 3X2QC 1ROPA 4PDMA 3ETEA 5IY5B 1GTOA 4FPPA 4DXWA 5L3EA 4PDLA 2DYRC 3ABMC 4YXWG 4PA6A 1YJNV 1FS0G 3CC2V 1S3JA 3P32A 2YEVB 3G4SV 2IH3C 1VQ5V 2EIKC 2R9RB 4WFFA 4RUFA 1BL8A 1RPOA 3OGCC 2B5UA 1OCRB 3FB8C 3STLC 4WF9V 2EJRA 4MVUA 1VQ7V 2YEVA 3ZMZA 2IW5A 2XAHA 5BZBA 4R6ZA 1ORQC 4N23A 5LHGA 1K5SA 4G2KA 3SPGA 1QCEA 1SERA 3DGEA 3ABTA 4PDVA 4MVSA 4F4LA 5LHIA 1QLEB 1RM1C 5LGTA 4DO2A 1SRYA 3W7SA 1JX9A 1GK9A 2P67A 4RQFA 5IYCO 2WLLA 2WLNA 3E2EA 3LDCA 4LCUC 4G27B 2ZXWB 4QIWF 1GKFA 4X89A 5HFMA 1KKDA 1YTFB 4PDRA 2JIZG 2C2AA 4HAMA 3ABKC 2AHZA 4QPJA 3E8BA 1R3LC 5L3CA 2EILB 5FL7G 3MD0A 3HPLC 2OTJV 5B1BB 3K9AA 3GWOA 1DF4A 4FK5C 5EBMC 1K7DA 3K0DA 3T4ZA 3BY6A 2XAQA 3K06A 1JCHA 1K4CC 5C93A 3WFVA 3QNEA 1VQKV 2YSUB 3F7VC 5CBHA 3W7WA 2W0FC 1K73W 2DQ3A 3LNMB 1OCOC 2P90A 3SPJA 3ABLC 3MHSC 1NVPD 1S76D 3ETGA 3LDDA 3ZRSA 1AI4A 5HFLA 3OAAG 3CCLV 3E86A 1FFTB 4L87A 5KA5A 2QA4V 1YTFD 1K9MW 4FIPC 3AG2C 1AJQA 1B6QA 2Z3YA 3ASOC 4GX0A 4XDJA 5B1AC 2JK5C 2WLJA 1NQTA 1NVPB 4UUJC 4WFHA 4HYOA 4RUEA 2Z5UA 4MVMA 2IU0A 2QEXV 2LP7A 1AI7A 3WG7C 1SESA 2ITDC 3CP1A 5CMUA 1YHQV 1FXHA 1NR7A 1FXKC 1G4YB 2DYSC 3AEIA 1OCCB 2HVKC 4N21A 1QBZA 4XDKA 1R3IC 4PA7A 5B1OA 4H37A 2WLIB 5L3GA 1M1KW 1NH2D 3JYCA 1CP9A 2DYRB 3ABMB 2UXNA 2W6IG 5IYBO 1JOYA 1YI2V 4R8CA 2OCCC 2UXXA 3JD2A 3OR6C 3MHHC 5CBFA 2ZDIC 4BAYA 2EIMC 1M57C 4JPRA 3UM7A 4R50A 1ZWIC 5EBWC 1VQMV 1THZA 1K97A 2DQ0A 4OXSA 1KP2A 3AG1C 1NBMG 4U7NA 4BIZA 5L3FA 3NXSA 1K92A 1VQ8V 4MTXA 4WFEA 4X8AA 3E8GA 4QE9A 4G28B 3ASNC 1OZ0A 2P6JA 5E1AC 3T1CA 3OFNG 3RVZA 5KUMA 2R9IA 2ZDIA 1G8MA 4JTCB 4GX5A 2NLJC 1HWYA 5EK0A 2EIJC 1AJPA 2QM7A 2XOKG 1YITV 2ZR3A 5KA6A 2Q69A 4GT1A 2HFEC 3CC7V 3CMEV 3OE7G 5B3SB 4I9WA 3SPIA 4R7CA 3FB6C 2QKSA 4X88A 2V7QG 1KP3A 5B1BC 2EINC 3LSQA 5B1AB 4PA9A 1OCZC 1EFRG 1PNLA 2WWWA 1S5HC 1BMFG 4WFGA 2JDIG 4PA4A 3E35A 2X6CA 2A0LA 3CYOA 4FMTA 1VQLV 1MABG 1NJIW 1PNMA 1F4NA 1E79G 2JEXA 2IJHA 3D36A 1NH2B 1WPXA 3K0GA 1GM9A 1V54C 3CC4V 1NKDA 3ZMUA 4KFMA 1P4RA 2A9HA 3IGAC 3CCUV 1AI5A 3ML0A 1K34A 4CZZA 4PA3A 2PI5A 1Y4MA 3LSSA 3ABLB 2B1IA 4UVCA 1JQ0A 1GO3F 2XAJA 1S72V 1R6KA 3OR7C 3IC7A 3ZRWA 1GMGA 4P9PA 5CN0A 4QNHB 5DN6G 1YJWV 4EKWA 3IFXA 4CBCA 3UKMA 3CCSV 1W0JG 2HVJC 3JD3A 1I5XA 3AG2B 3FYIB 4WFBV 1I5YA 2ZR2A 4JGSA 4MW8A 3AG1B 1K3EA 1PL0A 4Z1MG 3ZIAG 3W7XA 2WLHA 2IH1C 2B1GA 3RW0A 2WLMA 1VQPV 3OW2U 1H38A 4LP8A 1M56B 1V55B 1Q86W 4FJCC 2K1EA 1OCRC 5IY5C 3K08A 1EBOA 1QR9A 1OCCC 2GSMB 3OEHG 4ZKIA 4MVQA 4GCZA 1WLEA 1DTOA 4Q20A 2A79B 2Y69C 1AROP 5H9CA 1KC8W 4I5SA 3ZRXA 3EHBB 1E1RG 1VQOV 2M7WA 2H94A 1PKXA 3ZJZA 2IU3A 1FXVA 4UVBA 1MSWD 2XAFA 2EBOA 3X2QB 1K4DC 3CCVV 2AHYA 4MTOA 2F43G 4TT3G 3SYPA 3F7YC 3CCEV 4KP4A 4WFAV 2EZPA 5GW7A 4ZBMA 4U7OA 4KUMA 1KQSU 2EIKB 2Q6AA 2ATKC 3FB5C 5H6RA 3H01A 2HJFC 3SYCA 1H8HG 2CK3G 2ZXWC 3KG2A 3B8NA 1R3KC 3JD0A 2DW4A 4ASUG 5KUKA 3ABKB 3SJQC 1VQ6V 2V1DA 3AG4C 4HZ3A 2JEUA 1Q7YW 2XASA 2D3OW 3LUTB 3ZMTA 3K79A 3CD6V 2ITCC 2WLLB 3CCJV 3M99B 3I56V 1KECA 4J9ZB 1R6NA 4MS2A 4LC1A 3F5WC 1L1FA 1OCOB 3ZMSA 4XBFA 2WPDG 4PELA 2P7TC 5J9PC 3P30A 2Q68A 5EBLC 4E2LA 1QR8A 2W6JG 3FB7C 4MVZA 2GHYA 3RVYA 5DM6V 2XAGA 1XL6A 1PD3A 2IJKA 2JJ1G 2WSSG 3GB7C 3VOUA 1W2BU 1FXKB 1IXMA 3PJSK 3VBBA 3LDEA 2LFSA 3TCUA 3K04A 3CPWU 2ZD9A 1KD1W 2HKOA 1QVFU 3AG3C 2QTOA 3JD1A 1DLBA 1TUEB 1OHHG 3ASOB 3SPHA 1VQ9V 1DF5A 3HB3B 1BHAA 1YJ9V 1K5QA 3QO8A 5EC1C 1JJ2U 3E8FA 3CCRV 4JF3A 3TETA 3CXCU 1S77D 1R3JC 1QLNA 3FYEB 1NR1A 4RO2A 2X6BA 3SYOA 3I55V 4MTGA 2IJJA 3B77A 5LGUA 3JCZA 1VQNV 4WCEV 4JAVA 1XL4A 4MVRA 4QJFB 2DWEC 2EZOA 3OUFA 2WLKA 1CEZA 1M90W 1VQ4V 4TSFG 1QVGU 1CPYA 5LGNA 3CCMV 1F23A 3ZN1A 4QPKA 4MSWC 2IJIA 1SZTA 1YSCA 3OUSA 4GX2A 1COWG 3A0RA 1H8EG 4RAIA 3CCQV 2BOBC 3STZC 4JASA 1AJNA 2X6AA 2OT5A 2ZQMA 3OEEG 1Q82W 1Y66A 2HG5C 4MVOA 3AG4B 2BOCC 4MT8A 4BIUA 5B1NA 3D3IA 3ETDA 2QM8A 3FKSG 5L3BA 3B8MA 3WG7B 2EIMB 1M57B 1PNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQ0 A;  1F23 A;  1DF5 A;  4FJC C;  1ENV A;  2X7R B;  5KA5 A;  3M99 B;  1EBO A;  1SZT A;  1QR9 A;  2EZP A;  1MOF A;  5CN0 A;  2P6J A;  3WFV A;  4FIP C;  4JF3 A;  2MK3 A;  5HFM A;  3P30 A;  4E2L A;  1QR8 A;  3H01 A;  5H9C A;  3CYO A;  3MHH C;  2OT5 A;  3B77 A;  1I5X A;  2LP7 A;  1Y66 A;  2M7W A;  1K33 A;  1I5Y A;  4JPR A;  3B8N A;  3MHS C;  4N23 A;  4JGS A;  5KA6 A;  3CP1 A;  4G2K A;  5CMU A;  2EZO A;  1QCE A;  1MG1 A;  3K9A A;  3B8M A;  1JPX A;  3GWO A;  1K34 A;  4N21 A;  1DF4 A;  1DLB A;  5HFL A;  2EBO A;  1QBZ A;  1Y4M A;  4FK5 C; 
#chains in the Genus database with same CATH topology
 1FFX B;  3CJH B;  1Q6I A;  5CA3 A;  3QO5 A;  4GYC B;  1AVM A;  2D2C B;  3ZN0 A;  3RBZ A;  3W7T A;  4YY3 O;  3CJH A;  5KHH A;  1GM8 A;  1UJW B;  1K8A W;  1RPR A;  1F4M A;  1SQP H;  4JTD B;  4JYB A;  3DTU B;  3SYQ A;  1DGS A;  1MG1 A;  2NNU A;  1TAE A;  2EIJ B;  1J95 A;  5LP6 A;  4LH7 A;  1HP8 A;  1R73 A;  5L3D A;  2AGA A;  1QLE C;  3L72 H;  2JGD B;  5KMG B;  2UXC B;  2VS0 A;  4F6E A;  4UV9 A;  1WB7 A;  4NVP A;  1OCZ B;  3CMA V;  1J5E O;  1M9N A;  5LMN O;  4DUZ O;  3EXA A;  4LFC B;  3E83 A;  3E22 A;  4O4I A;  3CSX A;  1BHB A;  4B3T B;  1FJG O;  1JMK C;  4TQD A;  2WLI A;  2YID A;  3OMA B;  4I55 A;  1YIJ V;  4UXN A;  3QVN A;  4D6T H;  2UXD O;  4K3A A;  1N4C A;  3OM3 B;  1S0V A;  2DYS B;  2VWJ A;  1ZLZ A;  2EUL A;  4FM0 A;  1XNQ B;  3UT5 B;  3H1I H;  2DN9 A;  1GTO A;  4FPP A;  5C8Y A;  2GUZ A;  3ABM C;  3IJ4 A;  1FS0 G;  4C7U A;  2YEV B;  4AI8 A;  1VQ5 V;  2YXH A;  4DV0 O;  2YI9 A;  2ZE6 A;  2WA4 A;  1TVK B;  1BL8 A;  1UPG A;  1SZX A;  2ZM6 O;  3STL C;  1N36 O;  1IZ3 A;  4ZI7 B;  2YEV A;  2XAH A;  3JAM N;  4AIL C;  5JJE B;  1R6T A;  2RNB A;  1K5S A;  1IBK O;  1SER A;  1RM1 C;  5LGT A;  4DV7 B;  1AP6 A;  1GK9 A;  4LCU C;  1Y76 B;  2ZXW B;  2ZM6 B;  1N36 B;  1GKF A;  2YIB A;  4PI0 A;  1D2D A;  1YTF B;  4CC5 A;  4PDR A;  4DR1 B;  2JIZ G;  2C2A A;  1HNW O;  4HAM A;  1ZUQ A;  4DV0 B;  4YIP A;  1HR0 O;  2PTM A;  4BWA A;  2EIL B;  4FLW A;  1KKC A;  4I50 A;  5B1B B;  2Q7E A;  4O4I B;  4CS3 A;  3HKB B;  1Z2G A;  1AR5 A;  3K0D A;  4H13 B;  2N04 A;  3BY6 A;  3K06 A;  2AZ2 A;  1JCH A;  5C93 A;  2BTQ B;  3WFV A;  4DV5 B;  1XEQ A;  2YSU B;  1M4U A;  1H2K A;  2DQ3 A;  1OCO C;  3H1K H;  3WB1 A;  1S76 D;  3OAA G;  2JGU A;  4FLY A;  1N0N A;  1HNZ B;  2OIG A;  1NU1 H;  3BHP A;  3HR0 A;  1AJQ A;  2Z3Y A;  4GX0 A;  2Y0I A;  5B1A C;  2JK5 C;  4ZI7 A;  3CRQ A;  2VWK A;  3RYF B;  1NVP B;  2UXC O;  2E75 B;  4CC6 A;  2Z5U A;  2LP7 A;  2QWQ B;  1AI7 A;  1SES A;  2E3C A;  1YHQ V;  5LMU B;  2L6L A;  1FXK C;  5LXT A;  1OCC B;  5LMU O;  4XDK A;  1R3I C;  3RYC A;  1WPB A;  1SQF A;  3JYC A;  2UXN A;  1HW7 A;  2OCC C;  2UXX A;  3OR6 C;  1HNZ O;  5BMV B;  4R50 A;  1ZWI C;  1THZ A;  4OXS A;  1GN3 A;  4BIZ A;  5L3F A;  3NXS A;  3AK2 A;  4UCV A;  4G28 B;  2P6J A;  5E1A C;  4JI4 O;  5KHK A;  2L35 A;  3RVZ A;  2R9I A;  2ZDI A;  4DV5 O;  1G8M A;  4JTC B;  3ZHR A;  5IJ9 A;  4NXN B;  1HWY A;  4JZG A;  2ZR3 A;  1EZV H;  5B3S B;  5IE9 A;  3MAQ A;  4X88 A;  4OPA A;  1HR0 B;  1D5N A;  5B1A B;  3RGB A;  1OCZ C;  1HNW B;  1EFR G;  4IL6 Z;  3MDS A;  4DR1 O;  5C8Y B;  1S5H C;  1BMF G;  2QKC A;  3E35 A;  1LUW A;  4F6R A;  1NJI W;  1PNM A;  2BE3 A;  2IJH A;  3D36 A;  4DR5 O;  1NH2 B;  1WPX A;  3JAW B;  4O4H B;  1PPJ H;  1V54 C;  1NKD A;  1P4R A;  4DV7 O;  4L8J A;  1H2L A;  2OYQ A;  3ML0 A;  5LYJ A;  1K34 A;  4LF7 O;  2F4V O;  4KL1 A;  2VQF B;  3LSS A;  1IBK B;  4UVC A;  5LOV A;  3THO A;  3ZHT A;  1GO3 F;  1VF6 A;  4P9P A;  3OTO O;  5CN0 A;  1H2S B;  1YJW V;  2LW1 A;  3A8T A;  4CBC A;  1GH6 A;  1IXB A;  3JAS A;  3FYI B;  2DJV A;  2WLH A;  2IH1 C;  2PYL A;  1XNQ O;  2WLM A;  1H38 A;  1Q86 W;  1M56 B;  2K1E A;  1OCR C;  4UCR A;  2AW9 A;  3OEH G;  4ZKI A;  2UXD B;  2A79 B;  5H9C A;  3EHB B;  1XMO B;  4U3J B;  2F23 A;  2M7W A;  2H94 A;  1PKX A;  2KSD A;  1FJG B;  4B3T O;  2IU3 A;  1SQX H;  5GTI Z;  2OCH A;  4J7K A;  1YXB A;  5LP6 C;  1L8D A;  4HNA B;  1MSW D;  1RP3 B;  4LFC O;  3X2Q B;  1K4D C;  4A5U B;  1L0N H;  4DUZ B;  5IJ0 A;  5LMN B;  4KP4 A;  1J5E B;  4B7K A;  3DC6 A;  4KUM A;  5F2V O;  1O9H A;  2BTO A;  2LGQ A;  1Q3E A;  2CK3 G;  1LR1 A;  1R3K C;  1IBL O;  2JGD A;  5B66 Z;  3SJQ C;  4HZ3 A;  2CTQ A;  2XAS A;  3APO A;  1AIL A;  2D3O W;  3HKB A;  3LUT B;  3K79 A;  3CCJ V;  4J9Z B;  4FLV A;  1SC5 B;  4TV8 A;  1GN4 A;  3F5W C;  4YY3 B;  1OCO B;  3BVO A;  4PEL A;  5J9P C;  5EBL C;  2Q68 A;  3FB7 C;  2JVD A;  1PD3 A;  2JJ1 G;  4ICG A;  1W2B U;  4FLZ A;  1FXK B;  1IXM A;  4GKJ O;  1P49 A;  3LDE A;  3WB2 A;  1TUE B;  5LA6 A;  3HB3 B;  3F5T A;  2IM9 A;  3CCR V;  4JZ2 A;  3CXC U;  1R3J C;  1NR1 A;  4RO2 A;  3I55 V;  1Q6U A;  3BRC A;  1SQQ H;  2QSA A;  3B77 A;  3A0H Z;  2DE0 X;  1VQN V;  1SF9 A;  3JCZ A;  4WCE V;  3H1L H;  2EZO A;  5EYP A;  3K5O A;  3OUF A;  3ZED A;  4LF8 O;  1VQ4 V;  4DV3 O;  3T1H B;  1CPY A;  4PJ0 Z;  5LGN A;  1XHX A;  1F23 A;  4Q6G A;  3VQY A;  3B09 A;  1N0J A;  4GX2 A;  3A0R A;  2CH7 A;  1N33 O;  2ZQM A;  3J7A U;  3OEE G;  1Q82 W;  4LFA O;  3AG4 B;  4MT8 A;  1ZL8 B;  4BIU A;  1D5A A;  2CTP A;  3B8M A;  3DSQ A;  3WG7 B;  2EIM B;  3U10 A;  5KHJ A;  2QKA A;  3BPZ A;  2Q7H A;  2Q0A A;  4P2Z A;  4UCS A;  3SYA A;  2Z0A A;  1PV0 A;  4GZR B;  3JD4 A;  2MK3 A;  1Q81 W;  3JAL B;  3APQ A;  2ETN A;  1SS3 A;  4FFK A;  4YIO A;  3R65 A;  4O2A A;  4LF9 O;  3HKC A;  2WAM A;  1K33 A;  2Q0O C;  2UU9 B;  1EZJ A;  4GX1 A;  4H33 A;  3C3T A;  4BW9 A;  5B3S C;  2Y48 A;  1GM7 A;  4MTF A;  2OTL V;  2DWD C;  2LFR A;  3H1H H;  1VEW A;  1WN7 A;  4X64 O;  3SPC A;  5J2T A;  4JYC A;  1N8R W;  2K9P A;  1LNQ A;  1H2G A;  5CB4 A;  4B3M O;  5IDJ A;  3ZMV A;  2VQE O;  4JI0 B;  4DR2 B;  2X7R B;  3JAK B;  4P9O A;  4NXM O;  4X1Y A;  5CA1 B;  4NTY A;  4DR6 B;  3EFF K;  4QE7 A;  4MW3 A;  3BEH A;  5CB4 B;  4JI3 O;  4P30 A;  2AZ0 A;  3JAT A;  5JCO C;  1V55 C;  3X2Q C;  3ETE A;  4DXW A;  5L3E A;  4PDL A;  4YXW G;  4DYL A;  4PHZ A;  3OTF A;  5LOV B;  1YJN V;  4K0K O;  2QWO B;  4OGQ B;  2QM4 A;  1MZF A;  1HDJ A;  2R9R B;  3CRM A;  1RPO A;  1PP9 H;  1U97 A;  3FB8 C;  4WF9 V;  4YJ3 A;  4LF6 O;  4MVU A;  1ZSP A;  2UUC B;  5BZB A;  5LHG A;  4KHP O;  2XHB A;  1L0L H;  1Y6X A;  5A2Q N;  3RYH B;  3DGE A;  2KQX A;  4PDV A;  4MVS A;  4F4L A;  1P84 F;  4CH5 A;  4JAA A;  1JX9 A;  4DV1 O;  5IYC O;  2WLN A;  3JCU Z;  3E2E A;  3LDC A;  1N34 O;  1VF6 C;  1KKD A;  3ABK C;  3Q4H A;  4YJ2 B;  4QPJ A;  5FL7 G;  2F95 B;  3C3S A;  1AB3 A;  4X62 B;  1LUV A;  1DF4 A;  1FAF A;  1FFX A;  5EBM C;  2LGW A;  2A06 H;  3G67 A;  2R9A A;  2WA3 A;  1TGO A;  2XAQ A;  1XNR B;  2PF4 E;  2GTA A;  4Z2W A;  2QWR B;  1CXZ B;  3W7W A;  2W0F C;  3BA8 A;  2XT9 A;  1EM1 A;  4PI2 A;  2P90 A;  3SPJ A;  1FYJ A;  1NVP D;  2ZIN A;  3LDD A;  4YHH B;  3B4S A;  2IBZ H;  4IYH A;  4I9Q A;  4DV6 B;  4J7J A;  4L87 A;  3HKC B;  2N05 A;  5KMG A;  1FKA O;  4DUY B;  1K9M W;  3R66 A;  1ZTE A;  4X65 B;  3BFR A;  2WLJ A;  1NQT A;  4WFH A;  3T1Y O;  4OX9 O;  1YF2 A;  3QG5 A;  2LO1 A;  3WG7 C;  4LWS A;  2ZE8 A;  4FFB A;  2Y4U A;  4N21 A;  2G38 A;  2GUZ B;  4H37 A;  2WLI B;  4I55 B;  2ZNI A;  3RFR A;  5IWA O;  3ABM B;  1JOY A;  1JFF B;  2CTW A;  3JD2 A;  5LP6 B;  3MHH C;  5CBF A;  4BAY A;  1XHZ A;  1M57 C;  3UM7 A;  4DV4 B;  5EBW C;  4EB6 B;  1ZL8 A;  1K97 A;  3RYI B;  4UB8 Z;  5LYJ B;  2A7W A;  1XOU A;  4DR7 B;  4IT5 A;  1KB9 F;  2ZT9 B;  4QE9 A;  2P5O A;  4U3F H;  2M6Y A;  3T1C A;  3OFN G;  1VAR A;  5KUM A;  3UCS C;  4NKG B;  2NLJ C;  4O2A B;  2VRZ A;  2EIJ C;  2QM7 A;  1YIT V;  5KA6 A;  2Q69 A;  1XDC A;  3OE7 G;  3SPI A;  2PYJ A;  3FB6 C;  1IDS A;  2XTA A;  1KP3 A;  5B1B C;  4OPH A;  2EIN C;  2RCV A;  3LSQ A;  1GN6 A;  5JQG A;  4FZ0 A;  2QDO A;  3HKD A;  4PA4 A;  4FMT A;  5EIB D;  1F4N A;  1M93 A;  1IBM B;  3CC4 V;  3ZMU A;  3IGA C;  1SA0 A;  2FML A;  2GBO A;  2B1I A;  3H9V A;  1XI1 A;  1ZX3 A;  1JQ0 A;  4LF4 B;  3Q4H B;  1S72 V;  4I7Z B;  4QNH B;  5DN6 G;  3SJA C;  3IFX A;  1SA0 B;  3CRR A;  2UUA B;  3CCS V;  1W0J G;  2HVJ C;  3JD3 A;  3AG2 B;  3O65 A;  4ZIB A;  3KCY A;  1TVK A;  1K3E A;  4NB5 A;  4Z1M G;  2DMX A;  3KKY A;  2QWN B;  3L75 H;  2F1M A;  2W0X A;  1V55 B;  4FJC C;  5J2U A;  4B3R O;  1WLE A;  3RYF A;  1F7Y A;  1ARO P;  2ZCE A;  4I5S A;  3N2G B;  2UUB B;  1PM9 A;  3ZJZ A;  5JH7 B;  1SQB H;  4FM2 A;  2AHY A;  2BCC H;  2F43 G;  3SYP A;  3VQV A;  4WFA V;  1I94 B;  1N32 O;  3FD9 A;  4U7O A;  2ATK C;  2HJF C;  4B08 A;  3BAA A;  1H8H G;  2CGO A;  4AQY B;  4YJ2 A;  4DV2 B;  3JD0 A;  5KUK A;  3O9O A;  5D5P A;  1Q7Y W;  2MW2 B;  1Z5V A;  1KUQ A;  1WAZ A;  1KYO F;  1R6N A;  1UFI A;  3SR2 C;  3ZMS A;  4LC1 A;  2YXY A;  2WPD G;  4E2L A;  1QR8 A;  2W6J G;  5IJ9 B;  4MVZ A;  1US6 A;  2GHY A;  4TOI A;  1BZK A;  1YEW A;  3VOU A;  2E5L B;  4GKK B;  3OT7 A;  3PJS K;  3TCU A;  4LFB B;  3K04 A;  5CA0 A;  3AG3 C;  3JD1 A;  2ILM A;  1DLB A;  1JA8 A;  4LF5 O;  2NR5 A;  3LNN A;  3SPH A;  1YJ9 V;  1K5Q A;  5EC1 C;  1BSM A;  5IYZ A;  1JJ2 U;  3E8F A;  4JF3 A;  1S77 D;  4TV9 A;  2YI8 A;  2ZIM A;  3K5L A;  2IJJ A;  1BE3 H;  3JAS B;  4CH3 A;  3G80 A;  3IC9 A;  4MVR A;  5JH7 A;  3L71 H;  1RSO B;  4X20 A;  5FPO A;  2WLK A;  5FNV A;  4J10 A;  1NS1 A;  4JI7 O;  1YCI A;  4QPK A;  4I4T B;  1SZT A;  1YSC A;  4J80 A;  1Z5W A;  1XIL A;  1BCC H;  1AP5 A;  4O4L A;  3STZ C;  3LSU A;  2RDC A;  4I4T A;  2HEP A;  2OT5 A;  2PY5 A;  1NZ6 A;  3K58 A;  2QGN A;  3ETD A;  5L3B A;  2YIB D;  2FKX A;  2R70 A;  1OJH A;  1M57 B;  2HHH O;  2B9Z A;  1AR1 B;  3A0B Z;  3SDL A;  4J41 A;  3JAW A;  2PI4 A;  4UVA A;  4X1Y B;  5AG2 A;  2EIL C;  3K3W A;  3E89 A;  1SKV A;  5KLV H;  3VQX A;  3SJB C;  2OCC B;  4RQE A;  3PN1 A;  3ZRV A;  2FYU H;  3K03 A;  3TK1 A;  4JI2 B;  4ABM A;  1RM1 B;  4UV8 A;  4LBE C;  4B3S O;  1MOF A;  3T4D A;  3UQ8 A;  5LBQ A;  3ASN B;  5BR8 O;  5LHH A;  3FX7 A;  4JI8 B;  4YJ3 B;  1RFY A;  1JVM A;  1QU7 A;  1AI6 A;  4TWK A;  2LJ2 A;  4IHJ B;  2HLD G;  4JAU A;  4FVM A;  2LW7 A;  3ABU A;  3A2F A;  1ENV A;  4O4J B;  4JI6 B;  3G71 V;  3QO7 A;  5KHG A;  4W4K A;  2FB5 A;  4O4L B;  3OMN B;  2RJZ A;  2JJ2 G;  3CHX A;  3AK3 A;  1KBH A;  5H6Q A;  4X1I A;  3K59 A;  4JV5 O;  5IJ0 B;  4FM1 A;  1M56 C;  1ROP A;  4PDM A;  5IY5 B;  4DR3 O;  2AXT Z;  3C90 A;  4JI1 B;  5A9G A;  4FZ1 A;  3CC2 V;  1S3J A;  4EFB A;  3U11 A;  4WBN A;  2IH3 C;  2EIK C;  1NTZ H;  4WFF A;  4RUF A;  2B5U A;  5GTH Z;  4DR4 B;  1OCR B;  5CA0 B;  2EJR A;  1VQ7 V;  4WBN B;  2UXB B;  4H44 B;  3QF7 A;  5GON A;  4R6Z A;  1ORQ C;  4G2K A;  1HNX B;  3SPG A;  5LHI A;  1Q90 D;  1QLE B;  1I0H A;  3EVK A;  1HNX O;  2P67 A;  4RQF A;  2WLL A;  4LNU B;  1JJO A;  4G27 B;  2GDS A;  4QIW F;  3WB0 A;  3DXR A;  1FD9 A;  2FL4 A;  1WA8 B;  5L3C A;  5DED A;  3HPL C;  5ITZ B;  1TA8 A;  3K9A A;  3D8C A;  4LWS B;  1URF A;  4FFB B;  5JJN B;  4FK5 C;  1YDX A;  1K7D A;  4JYA B;  2Q73 A;  1K4C C;  1YZB A;  3AG7 A;  4TUY A;  1K73 W;  4JI6 O;  3LNM B;  4JI5 O;  4NTW A;  4UB6 Z;  3ABL C;  3MHS C;  2KG7 A;  2JS5 A;  1XMQ O;  1QHT A;  5K1X A;  3ZRS A;  1AI4 A;  4X66 O;  3CCL V;  3D3Q A;  4F6R B;  1FFT B;  1MZE A;  3SGI A;  5K1P A;  5KA5 A;  5FLX N;  1JR9 A;  4HBN A;  1OV9 A;  1YTF D;  4JI8 O;  4FIP C;  5BR8 B;  3AG2 C;  3ASO C;  3TJT A;  2YIA A;  1AR4 A;  4UUJ C;  4HYO A;  4RUE A;  4I0X B;  3JAT B;  2IU0 A;  2QEX V;  4JI2 O;  2ITD C;  1TUB A;  3ZS8 C;  1FXH A;  1NR7 A;  1G4Y B;  2DYS C;  3AEI A;  4PA7 A;  5B1O A;  5L3G A;  1NH2 D;  2DYR B;  5JQG B;  1T5E A;  5IYB O;  3B40 A;  1YI2 V;  1S5J A;  2ARH A;  4R8C A;  1WA8 A;  3S3X A;  2EIM C;  2QWP B;  4UFZ A;  5FNV B;  5JCO A;  4X66 B;  1WP8 A;  3ZHV A;  2QJ1 A;  1XMQ B;  4U7N A;  3HKE A;  1VQ8 V;  4O2B B;  4MTX A;  4JI5 B;  4IHJ A;  3TXS A;  4I50 B;  1OZ0 A;  1BQZ A;  3BAB A;  1Q5O A;  4DW0 A;  3TGU H;  4GX5 A;  5EK0 A;  4JYA O;  2XOK G;  4JI7 B;  3JAK A;  4GT1 A;  2HFE C;  3GWK C;  3CC7 V;  4I9W A;  2CTR A;  4R7C A;  3WU2 Z;  4X1I B;  2QKS A;  2V7Q G;  1A32 A;  5J2U B;  1YVW A;  2YDE A;  2Q4P A;  2WWW A;  4WFG A;  5JJJ B;  1O9G A;  2HP8 A;  3CYO A;  2QTS A;  2JEX A;  5KX5 A;  2GV9 A;  3K0G A;  2JS3 A;  1GM9 A;  4KFM A;  3CCU V;  1Y4M A;  5KX5 B;  2E5L O;  2DOS A;  2UXB O;  2XAJ A;  1R6K A;  5BMV A;  4EKW A;  5LXT B;  4DR4 O;  2P4K A;  3E22 B;  3CXH F;  3N2K B;  3ZX6 A;  2P06 A;  4JGS A;  1NTM H;  1PL0 A;  4JI1 O;  3W7X A;  1Q43 A;  2B1G A;  4DR3 B;  3RW0 A;  3HKE B;  1VQP V;  3OW2 U;  1IUR A;  2LQT A;  2F93 B;  4JV5 B;  3K08 A;  2QR4 A;  1QR9 A;  1OCC C;  2ZNJ A;  5LL6 Y;  4MVQ A;  4GCZ A;  2EJ7 A;  1R1B A;  1GRJ A;  1KC8 W;  2JRI A;  3ZRX A;  5D5Q A;  1E1R G;  1MNG A;  2BSK B;  1FXV A;  3CCV V;  4CH6 A;  4MTO A;  3L74 H;  2XUM A;  4GLX A;  4JYY A;  5GW7 A;  4ZBM A;  5IYZ B;  4K35 A;  4DRX A;  1KQS U;  4FLU A;  2EIK B;  3FB5 C;  3H01 A;  4NR1 A;  5JVD A;  3CE2 A;  3BA9 A;  4B3S B;  3SYC A;  3CEI A;  3KG2 A;  4B3R B;  4EB6 A;  3B8N A;  3ZHQ A;  4K8X A;  4PV1 B;  3B2E E;  3ABK B;  1VQ6 V;  2V1D A;  3AG4 C;  2CH7 B;  2JEU A;  4IIJ A;  2OIE A;  4I0X A;  2RQ6 A;  3CD6 V;  2WLL B;  4LNU A;  3I56 V;  1KEC A;  4MS2 A;  4NTX A;  1L1F A;  4XBF A;  2P7T C;  1KMI Z;  3RVY A;  2H3O A;  1MA1 A;  5DM6 V;  2IJK A;  2WSS G;  4LF4 O;  2HHH B;  3VBB A;  2LFS A;  3M8A A;  3CPW U;  1KD1 W;  1QVF U;  2ADQ B;  1VQ9 V;  2F66 C;  3CS5 A;  1BHA A;  4U3J A;  3QO8 A;  5KAF Z;  4UCO A;  2ZE5 A;  2X6B A;  1BQ0 A;  4CS2 A;  3ICX A;  1WJZ A;  2KG7 B;  4Z1V A;  4ZHQ A;  1EN4 A;  1MMM A;  1CEZ A;  1M90 W;  2YXL A;  4UCU A;  4MSW C;  1SQG A;  4DRX B;  1COW G;  1Q6H A;  2RN9 A;  5H5N A;  1H8E G;  4RAI A;  4AHC A;  2BOB C;  2HJD A;  3RN4 A;  1Q8I A;  4JAS A;  1AJN A;  2X6A A;  4O4H A;  1Y66 A;  2E74 B;  4DR7 O;  4TV8 B;  4TQF A;  4LF5 B;  1BS3 A;  1X59 A;  1I08 A;  3HKD B;  4LFB O;  3JAR A;  1PNK A;  3N2K A;  4GKK O;  4KXR A;  3TXQ A;  1SET A;  2XND G;  3OMI B;  3P3P A;  1IVS A;  3RYH A;  1Y74 A;  1V54 B;  5IWA B;  1E1Q G;  3QTC A;  2ZIO A;  3AG3 B;  4GUN A;  1P7B A;  1JPX A;  3T2M A;  3D36 C;  5EC2 C;  2FTK A;  2V4D A;  4DV2 O;  4BW5 A;  4AQY O;  1FXK A;  3ETQ A;  3W7U A;  4BIO A;  4OX9 B;  1G6U A;  3T1Y B;  4J9Y B;  3L9D A;  4X65 O;  5LA6 B;  5JWP A;  4DUY O;  2QE7 G;  1I94 O;  1N32 B;  2YS8 A;  5CBG A;  1WB8 A;  5IYD O;  1F51 A;  2H8P C;  1M5I A;  3RYI A;  1H2M A;  1GAX A;  2Q7G A;  3CRC A;  2HR3 A;  3ZBH A;  2UUB O;  4XDL A;  3ZRW B;  2KB1 A;  3E8H A;  2NN4 A;  2Y69 B;  2EIN B;  1TUB B;  4JTA B;  3G6E V;  2X0L A;  2ZE7 A;  3ZCC A;  1XNR O;  3J80 N;  2Q67 A;  1W0K G;  4X1K A;  3AK1 A;  3KCX A;  2DYR C;  3RYC B;  3DC5 A;  4PA6 A;  1VF7 A;  2PUS A;  3P32 A;  1NTK H;  3G4S V;  3UO2 A;  2CGN A;  2UUA O;  2A3Q A;  4ZOL A;  3OGC C;  2P22 C;  1N34 B;  2CAZ C;  3ZMZ A;  2IW5 A;  4DV1 B;  4N23 A;  5ITZ A;  1QCE A;  3ABT A;  3UT5 A;  2R72 A;  4DW1 A;  5KHI A;  4DO2 A;  1SRY A;  3W7S A;  4KHP B;  1IBM O;  2UUC O;  4BR6 A;  3NR7 A;  1BGY H;  3I5D A;  4FLT A;  1V9P A;  4X89 A;  5HFM A;  1SQV H;  3P3N A;  5FPR A;  4DK1 A;  3U0Z A;  2AHZ A;  3E8B A;  1R3L C;  5BY1 A;  1B04 A;  3MD0 A;  3H1J H;  2OTJ V;  4B7E A;  3CX5 F;  1JFF A;  3GWO A;  4LH6 A;  4IIJ B;  3CB2 A;  3T4Z A;  3SJC C;  3BCC H;  5E79 Z;  4JI3 B;  1W59 A;  3QNE A;  4NYK A;  1VQK V;  4HNA A;  3GVM A;  1NI8 A;  3F7V C;  5JVD B;  1VMG A;  3VQW A;  5CBH A;  3CWB H;  2Q9L A;  4NXM B;  1QNM A;  3OGI B;  2VQE B;  4B3M B;  5EZY B;  1XUQ A;  3J81 N;  1VIB A;  3ETG A;  5HFL A;  3E86 A;  4FLX A;  5TIS Z;  4DV4 O;  2QA4 V;  2ADP A;  1RSO A;  4X20 B;  1B6Q A;  4XDJ A;  4X9Q A;  3K9S A;  3K5N A;  4MVM A;  1FPO A;  3CP1 A;  3KZI Z;  3L70 H;  5CMU A;  2HVK C;  2UU9 O;  1QBZ A;  2E76 B;  4O4J A;  4E4E A;  1DK1 A;  1M1K W;  4LF9 B;  1CP9 A;  4IYI A;  1B3Q A;  2W6I G;  1VP7 A;  1P7G A;  1Y67 A;  3JSN A;  1XQ8 A;  1KU9 A;  2ZDI C;  2OWO A;  4JPR A;  4DV6 O;  1VQM V;  1NT2 B;  2DQ0 A;  4YHH O;  1KP2 A;  2GTS A;  3AG1 C;  1NBM G;  1K92 A;  3ZHS A;  4J11 A;  4X8A A;  4WFE A;  3E8G A;  3ASN C;  4X1K B;  1ZAU A;  1EN6 A;  4TV9 B;  3K5M A;  3L73 H;  3N27 A;  5GON B;  1AJP A;  3CRA A;  2CE4 A;  3T1H O;  4LR3 A;  3CME V;  2Q8V A;  3JAL A;  4X62 O;  4D7S A;  4PA9 A;  1PNL A;  2CDY A;  4W4L A;  3UO3 A;  1Y74 B;  2JDI G;  4K8Z A;  2X6C A;  4TUY B;  2A0L A;  5BXZ A;  1IX9 A;  1VQL V;  1MAB G;  1XBL A;  3K57 A;  2ODM A;  1E79 G;  1BT8 A;  2A9H A;  2EX3 A;  1AI5 A;  3S3W A;  4CZZ A;  4PA3 A;  2PI5 A;  2KKW A;  2N74 A;  3ABL B;  3FFQ A;  3M7M X;  3OD4 A;  4GKJ B;  3OR7 C;  3IC7 A;  3ZRW A;  1GMG A;  4LF6 B;  4EEQ A;  3UKM A;  1I5X A;  4WFB V;  1I5Y A;  2ZR2 A;  4MW8 A;  4K0K B;  3AG1 B;  3ZIA G;  1IBL B;  1S5L Z;  3DXR B;  4LP8 A;  5IT9 N;  5IY5 C;  1XRE A;  1EBO A;  3G6B A;  2GSM B;  4H0L B;  1WNS A;  5EZY A;  4ZOL B;  4DR6 O;  1DTO A;  4Q20 A;  2Y69 C;  1PL4 A;  5EIB C;  1VQO V;  4DR2 O;  4JI0 O;  4DK0 A;  1QQC A;  4UVB A;  1MSD A;  2XAF A;  4QGP A;  2EBO A;  3FAV B;  1H2N A;  4TT3 G;  4X64 B;  3F7Y C;  3CCE V;  4CS4 A;  1XMO O;  4O2B A;  2EZP A;  2Q5Z A;  1I7F A;  3IAY A;  2O57 A;  4CH4 A;  2Q6A A;  5H6R A;  3RWR D;  2ZXW C;  2DW4 A;  4ASU G;  2RMK B;  4ZHQ B;  5J2T B;  3ZMT A;  1GN2 A;  2ITC C;  3M99 B;  3ZHU A;  3JSL A;  1B06 A;  3P30 A;  3OTO B;  4PD4 F;  2PZS A;  2XAG A;  1XL6 A;  4EFE A;  3GB7 C;  1EN5 A;  2VQF O;  2F4V B;  2ZD9 A;  2HKO A;  4LF7 B;  2QTO A;  1OHH G;  3ASO B;  3JAR B;  1DF5 A;  4LFA B;  5KAI Z;  4DR5 B;  5DEC A;  3RT3 C;  1N33 B;  5CA1 A;  1VF5 B;  3TET A;  1QLN A;  3FYE B;  3SYO A;  4IGG A;  4MTG A;  2CUG A;  5LGU A;  2ZKO A;  5B5E Z;  4JAV A;  1XL4 A;  1Y76 A;  4QJF B;  2DWE C;  4DV3 B;  1WP7 A;  4LF8 B;  2YIC A;  3FAV A;  4TSF G;  3N2G A;  1QVG U;  2YUA A;  3CCM V;  3ZN1 A;  1X4T A;  1U96 A;  2IJI A;  4NXN O;  1G1X B;  3OUS A;  4D7T A;  3CCQ V;  4JI4 B;  2YC0 A;  2PGG A;  4MVO A;  2HG5 C;  2Y0P A;  2BOC C;  2BTQ A;  5B1N A;  3D3I A;  2QM8 A;  3FKS G;  2P4V A;  2BSK A;  4J42 A;  4UCT A;  5EYP B;  5H2F Z;  2Y4T A;  4RWU A;  4J7Z A; 
#chains in the Genus database with same CATH homology
 1AR1 B;  4P2Z A;  3SYA A;  1SET A;  2PI4 A;  2XND G;  5CA3 A;  3QO5 A;  4UVA A;  3JD4 A;  2MK3 A;  1Q81 W;  3ZN0 A;  3OMI B;  3RBZ A;  3W7T A;  2EIL C;  3K3W A;  3R65 A;  3E89 A;  1V54 B;  1GM8 A;  2WAM A;  1E1Q G;  1UJW B;  1K33 A;  3AG3 B;  1RPR A;  2OCC B;  1K8A W;  4RQE A;  1F4M A;  1P7B A;  4JTD B;  4JYB A;  3DTU B;  3SYQ A;  1MG1 A;  2NNU A;  1JPX A;  3T2M A;  1EZJ A;  4GX1 A;  4H33 A;  5EC2 C;  3ZRV A;  2EIJ B;  1J95 A;  2FTK A;  3K03 A;  3TK1 A;  4BW5 A;  1R73 A;  5L3D A;  1FXK A;  1QLE C;  3W7U A;  1RM1 B;  5B3S C;  4UV8 A;  4LBE C;  4J9Y B;  1MOF A;  3T4D A;  2Y48 A;  1GM7 A;  4UV9 A;  5LBQ A;  3ASN B;  5LHH A;  2QE7 G;  4MTF A;  2OTL V;  2DWD C;  1OCZ B;  1JVM A;  3CMA V;  2LFR A;  1AI6 A;  1M9N A;  4TWK A;  5CBG A;  5IYD O;  3SPC A;  2HLD G;  4JAU A;  1F51 A;  2H8P C;  3E83 A;  4JYC A;  1N8R W;  1LNQ A;  1H2G A;  3ABU A;  1BHB A;  5IDJ A;  3ZMV A;  2HR3 A;  1ENV A;  2X7R B;  4XDL A;  3ZRW B;  2WLI A;  2KB1 A;  3OMA B;  3E8H A;  4P9O A;  3QO7 A;  3G71 V;  1YIJ V;  4UXN A;  2Y69 B;  3EFF K;  2EIN B;  4JTA B;  4MW3 A;  4QE7 A;  3G6E V;  3BEH A;  3OMN B;  2X0L A;  2JJ2 G;  4P30 A;  3OM3 B;  5H6Q A;  3ZCC A;  2DYS B;  1S0V A;  2Q67 A;  1W0K G;  1M56 C;  1V55 C;  3X2Q C;  1ROP A;  4PDM A;  3ETE A;  5IY5 B;  1GTO A;  4FPP A;  4DXW A;  5L3E A;  4PDL A;  2DYR C;  3ABM C;  4YXW G;  4PA6 A;  1YJN V;  1FS0 G;  3CC2 V;  1S3J A;  3P32 A;  2YEV B;  3G4S V;  2IH3 C;  1VQ5 V;  2EIK C;  2R9R B;  4WFF A;  4RUF A;  1BL8 A;  1RPO A;  3OGC C;  2B5U A;  1OCR B;  3FB8 C;  3STL C;  4WF9 V;  2EJR A;  4MVU A;  1VQ7 V;  2YEV A;  3ZMZ A;  2IW5 A;  2XAH A;  5BZB A;  4R6Z A;  1ORQ C;  4N23 A;  5LHG A;  1K5S A;  4G2K A;  3SPG A;  1QCE A;  1SER A;  3DGE A;  3ABT A;  4PDV A;  4MVS A;  4F4L A;  5LHI A;  1QLE B;  1RM1 C;  5LGT A;  4DO2 A;  1SRY A;  3W7S A;  1JX9 A;  1GK9 A;  2P67 A;  4RQF A;  5IYC O;  2WLL A;  2WLN A;  3E2E A;  3LDC A;  4LCU C;  4G27 B;  2ZXW B;  4QIW F;  1GKF A;  4X89 A;  5HFM A;  1KKD A;  1YTF B;  4PDR A;  2JIZ G;  2C2A A;  4HAM A;  3ABK C;  2AHZ A;  4QPJ A;  3E8B A;  1R3L C;  5L3C A;  2EIL B;  5FL7 G;  3MD0 A;  3HPL C;  2OTJ V;  5B1B B;  3K9A A;  3GWO A;  1DF4 A;  4FK5 C;  5EBM C;  1K7D A;  3K0D A;  3T4Z A;  3BY6 A;  2XAQ A;  3K06 A;  1JCH A;  1K4C C;  5C93 A;  3WFV A;  3QNE A;  1VQK V;  2YSU B;  3F7V C;  5CBH A;  3W7W A;  2W0F C;  1K73 W;  2DQ3 A;  3LNM B;  1OCO C;  2P90 A;  3SPJ A;  3ABL C;  3MHS C;  1NVP D;  1S76 D;  3ETG A;  3LDD A;  3ZRS A;  1AI4 A;  5HFL A;  3OAA G;  3CCL V;  3E86 A;  1FFT B;  4L87 A;  5KA5 A;  2QA4 V;  1YTF D;  1K9M W;  4FIP C;  3AG2 C;  1AJQ A;  1B6Q A;  2Z3Y A;  3ASO C;  4GX0 A;  4XDJ A;  5B1A C;  2JK5 C;  2WLJ A;  1NQT A;  1NVP B;  4UUJ C;  4WFH A;  4HYO A;  4RUE A;  2Z5U A;  4MVM A;  2IU0 A;  2QEX V;  2LP7 A;  1AI7 A;  3WG7 C;  1SES A;  2ITD C;  3CP1 A;  5CMU A;  1YHQ V;  1FXH A;  1NR7 A;  1FXK C;  1G4Y B;  2DYS C;  3AEI A;  1OCC B;  2HVK C;  4N21 A;  1QBZ A;  4XDK A;  1R3I C;  4PA7 A;  5B1O A;  4H37 A;  2WLI B;  5L3G A;  1M1K W;  1NH2 D;  3JYC A;  1CP9 A;  2DYR B;  3ABM B;  2UXN A;  2W6I G;  5IYB O;  1JOY A;  1YI2 V;  4R8C A;  2OCC C;  2UXX A;  3JD2 A;  3OR6 C;  3MHH C;  5CBF A;  2ZDI C;  4BAY A;  2EIM C;  1M57 C;  4JPR A;  3UM7 A;  4R50 A;  1ZWI C;  5EBW C;  1VQM V;  1THZ A;  1K97 A;  2DQ0 A;  4OXS A;  1KP2 A;  3AG1 C;  1NBM G;  4U7N A;  4BIZ A;  5L3F A;  3NXS A;  1K92 A;  1VQ8 V;  4MTX A;  4WFE A;  4X8A A;  3E8G A;  4QE9 A;  4G28 B;  3ASN C;  1OZ0 A;  2P6J A;  5E1A C;  3T1C A;  3OFN G;  3RVZ A;  5KUM A;  2R9I A;  2ZDI A;  1G8M A;  4JTC B;  4GX5 A;  2NLJ C;  1HWY A;  5EK0 A;  2EIJ C;  1AJP A;  2QM7 A;  2XOK G;  1YIT V;  2ZR3 A;  5KA6 A;  2Q69 A;  4GT1 A;  2HFE C;  3CC7 V;  3CME V;  3OE7 G;  5B3S B;  4I9W A;  3SPI A;  4R7C A;  3FB6 C;  2QKS A;  4X88 A;  2V7Q G;  1KP3 A;  5B1B C;  2EIN C;  3LSQ A;  5B1A B;  4PA9 A;  1OCZ C;  1EFR G;  1PNL A;  2WWW A;  1S5H C;  1BMF G;  4WFG A;  2JDI G;  4PA4 A;  3E35 A;  2X6C A;  2A0L A;  3CYO A;  4FMT A;  1VQL V;  1MAB G;  1NJI W;  1PNM A;  1F4N A;  1E79 G;  2JEX A;  2IJH A;  3D36 A;  1NH2 B;  1WPX A;  3K0G A;  1GM9 A;  1V54 C;  3CC4 V;  1NKD A;  3ZMU A;  4KFM A;  1P4R A;  2A9H A;  3IGA C;  3CCU V;  1AI5 A;  3ML0 A;  1K34 A;  4CZZ A;  4PA3 A;  2PI5 A;  1Y4M A;  3LSS A;  3ABL B;  2B1I A;  4UVC A;  1JQ0 A;  1GO3 F;  2XAJ A;  1S72 V;  1R6K A;  3OR7 C;  3IC7 A;  3ZRW A;  1GMG A;  4P9P A;  5CN0 A;  4QNH B;  5DN6 G;  1YJW V;  4EKW A;  3IFX A;  4CBC A;  3UKM A;  3CCS V;  1W0J G;  2HVJ C;  3JD3 A;  1I5X A;  3AG2 B;  3FYI B;  4WFB V;  1I5Y A;  2ZR2 A;  4JGS A;  4MW8 A;  3AG1 B;  1K3E A;  1PL0 A;  4Z1M G;  3ZIA G;  3W7X A;  2WLH A;  2IH1 C;  2B1G A;  3RW0 A;  2WLM A;  1VQP V;  3OW2 U;  1H38 A;  4LP8 A;  1M56 B;  1V55 B;  1Q86 W;  4FJC C;  2K1E A;  1OCR C;  5IY5 C;  3K08 A;  1EBO A;  1QR9 A;  1OCC C;  2GSM B;  3OEH G;  4ZKI A;  4MVQ A;  4GCZ A;  1WLE A;  1DTO A;  4Q20 A;  2A79 B;  2Y69 C;  1ARO P;  5H9C A;  1KC8 W;  4I5S A;  3ZRX A;  3EHB B;  1E1R G;  1VQO V;  2M7W A;  2H94 A;  1PKX A;  3ZJZ A;  2IU3 A;  1FXV A;  4UVB A;  1MSW D;  2XAF A;  2EBO A;  3X2Q B;  1K4D C;  3CCV V;  2AHY A;  4MTO A;  2F43 G;  4TT3 G;  3SYP A;  3F7Y C;  3CCE V;  4KP4 A;  4WFA V;  2EZP A;  5GW7 A;  4ZBM A;  4U7O A;  4KUM A;  1KQS U;  2EIK B;  2Q6A A;  2ATK C;  3FB5 C;  5H6R A;  3H01 A;  2HJF C;  3SYC A;  1H8H G;  2CK3 G;  2ZXW C;  3KG2 A;  3B8N A;  1R3K C;  3JD0 A;  2DW4 A;  4ASU G;  5KUK A;  3ABK B;  3SJQ C;  1VQ6 V;  2V1D A;  3AG4 C;  4HZ3 A;  2JEU A;  1Q7Y W;  2XAS A;  2D3O W;  3LUT B;  3ZMT A;  3K79 A;  3CD6 V;  2ITC C;  2WLL B;  3CCJ V;  3M99 B;  3I56 V;  1KEC A;  4J9Z B;  1R6N A;  4MS2 A;  4LC1 A;  3F5W C;  1L1F A;  1OCO B;  3ZMS A;  4XBF A;  2WPD G;  4PEL A;  2P7T C;  5J9P C;  3P30 A;  2Q68 A;  5EBL C;  4E2L A;  1QR8 A;  2W6J G;  3FB7 C;  4MVZ A;  2GHY A;  3RVY A;  5DM6 V;  2XAG A;  1XL6 A;  1PD3 A;  2IJK A;  2JJ1 G;  2WSS G;  3GB7 C;  3VOU A;  1W2B U;  1FXK B;  1IXM A;  3PJS K;  3VBB A;  3LDE A;  2LFS A;  3TCU A;  3K04 A;  3CPW U;  2ZD9 A;  1KD1 W;  2HKO A;  1QVF U;  3AG3 C;  2QTO A;  3JD1 A;  1DLB A;  1TUE B;  1OHH G;  3ASO B;  3SPH A;  1VQ9 V;  1DF5 A;  3HB3 B;  1BHA A;  1YJ9 V;  1K5Q A;  3QO8 A;  5EC1 C;  1JJ2 U;  3E8F A;  3CCR V;  4JF3 A;  3TET A;  3CXC U;  1S77 D;  1R3J C;  1QLN A;  3FYE B;  1NR1 A;  4RO2 A;  2X6B A;  3SYO A;  3I55 V;  4MTG A;  2IJJ A;  3B77 A;  5LGU A;  3JCZ A;  1VQN V;  4WCE V;  4JAV A;  1XL4 A;  4MVR A;  4QJF B;  2DWE C;  2EZO A;  3OUF A;  2WLK A;  1CEZ A;  1M90 W;  1VQ4 V;  4TSF G;  1QVG U;  1CPY A;  5LGN A;  3CCM V;  1F23 A;  3ZN1 A;  4QPK A;  4MSW C;  2IJI A;  1SZT A;  1YSC A;  3OUS A;  4GX2 A;  1COW G;  3A0R A;  1H8E G;  4RAI A;  3CCQ V;  2BOB C;  3STZ C;  4JAS A;  1AJN A;  2X6A A;  2OT5 A;  2ZQM A;  3OEE G;  1Q82 W;  1Y66 A;  2HG5 C;  4MVO A;  3AG4 B;  2BOC C;  4MT8 A;  4BIU A;  5B1N A;  3D3I A;  3ETD A;  2QM8 A;  3FKS G;  5L3B A;  3B8M A;  3WG7 B;  2EIM B;  1M57 B;  1PNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...