2M7WA

Independently verified structure of gp41-m-mat, a membrane associated mper trimer from hiv-1 gp41
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an HIV-1-neutralizing antibody target, the lipid-bound gp41 envelope membrane proximal region trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Envelope glycoprotein
total genus 10
structure length 59
sequence length 59
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2m7wA00
1F23A 4FIPC 4E2LA 1SZTA 1Y4MA 5KA6A 3CP1A 1K33A 4G2KA 2P6JA 1QCEA 1I5XA 4N23A 3H01A 3K9AA 1QBZA 5HFLA 3GWOA 1JQ0A 4JF3A 3CYOA 1QR9A 2M7WA 1ENVA 2MK3A 4JPRA 1MG1A 1I5YA 1MOFA 2OT5A 4FK5C 5CMUA 3MHSC 3P30A 3MHHC 5CN0A 1DLBA 2EBOA 1DF5A 2EZPA 4FJCC 2EZOA 2LP7A 3B77A 3WFVA 5HFMA 1JPXA 5H9CA 4JGSA 4N21A 1QR8A 3M99B 1DF4A 3B8MA 2X7RB 3B8NA 1Y66A 1EBOA 1K34A 5KA5A
chains in the Genus database with same CATH superfamily
3EXAA 3STLC 2NR5A 3O9OA 2UXNA 2QM7A 3H1LH 4LF5B 2O57A 4LBEC 4DV6B 2PGGA 1FJGB 5H6RA 3OD4A 2YICA 4B3SO 4AI8A 3VQYA 5EC1C 4NTYA 1XDCA 5IYZA 3T2MA 4CS2A 1MMMA 3ZMSA 5DEDA 5EYPB 1JMKC 4DV4O 4JF3A 1I7FA 1H2MA 1S5LZ 4DW1A 1NH2B 1N34B 2ZXWC 4ASUG 3CE2A 1H38A 2Z0AA 3RYIA 5B5EZ 4DV6O 4KL1A 1VQ4V 4X65B 5LP6B 5ITZA 4MT8A 4IIJA 5LOVB 5DN6G 1LUWA 1D5NA 1N0NA 1YDXA 4PDLA 5TISZ 1WJZA 2E74B 4JZGA 3N2GB 4EFBA 1OCOC 1Q6UA 1B06A 5FPOA 5JVDA 1PPJH 5LL6Y 4I9WA 1E1RG 3CSXA 3BABA 4KP4A 1R6NA 1YTFD 2QTSA 3E35A 5LA6B 4FZ1A 5KAIZ 4TOIA 2VRZA 5EC2C 1XREA 1H8HG 4LCUC 4NTXA 2UUBO 1OCZB 2JS5A 3APQA 4MVOA 1QVFU 3RFRA 1TUBA 3QNEA 4LC1A 1W59A 2OTLV 5LHGA 4UVBA 1OCRB 1Q5OA 5GTHZ 4UB8Z 2IJJA 3JARB 4YJ2B 1CPYA 4JI3B 4CC5A 3JALA 4NXMB 2RQ6A 5GONA 3HR0A 2LFSA 3ZN0A 3CCSV 1M57C 2UXBO 5KAFZ 2F93B 3L71H 3CCUV 1IXMA 1YHQV 2LQTA 5FPRA 3H1KH 4I50A 4R8CA 4PJ0Z 3OM3B 3KCYA 1ZL8A 3SR2C 2CE4A 4B7KA 4P30A 3D3IA 4N21A 3JAKB 1NTKH 2R9IA 1R3IC 2Y69B 4XDJA 3BEHA 4CH6A 1X59A 1VQ7V 1WPXA 2FB5A 4DV4B 3JALB 2IH1C 1QLEB 4WFBV 5C8YB 3LDEA 3CHXA 3NR7A 5KHIA 4KFMA 4QE7A 4L87A 3IAYA 4B3SB 4LNUB 1KECA 2PZSA 1R6TA 4JTAB 2ZINA 1XOUA 1W0JG 3SYAA 1J5EO 1IBMB 1ZTEA 4WFHA 3FB6C 1Y74A 5IYCO 3OAAG 5CA1B 3QVNA 3UCSC 4W4KA 1W0KG 2QKSA 2JEUA 4UCRA 1K34A 3AG7A 3LUTB 3ZHTA 4R6ZA 2PI4A 3I55V 3R66A 2XAQA 2ZNJA 4FLTA 1FXKB 1UPGA 2OCCC 3APOA 2IW5A 2HG5C 2KG7B 2ARHA 4ZIBA 2HVJC 3T1HO 1PV0A 4IYHA 2EINC 5LA6A 3OUFA 5K1XA 3RYHA 3AG1C 4X9QA 5KA6A 2P7TC 3E8BA 1GN3A 2P67A 3K59A 2IBZH 1R3KC 1FFTB 1XMOB 4PA6A 1AB3A 2CTPA 4LFBO 3LSQA 1NU1H 3O65A 5LHHA 3ETDA 3OGIB 5IDJA 4U3FH 3FX7A 1IX9A 2LGQA 1TUEB 4UVCA 1K73W 4QPJA 4JTDB 1SERA 4GKKB 2Y4TA 4K3AA 4X88A 4FLUA 3CCQV 3VQWA 5F2VO 4FK5C 3DSQA 4LWSB 2UUCB 1JPXA 4JI1O 4OGQB 2Q69A 2F66C 2OYQA 1QQCA 3ASOB 2IJIA 2DE0X 5KMGB 2ZDIA 1WLEA 5B1AC 3BCCH 2WLIA 5K1PA 4AQYB 2LFRA 3HB3B 4TQDA 1PKXA 1Y74B 3CCRV 1QHTA 3ZHUA 1I5YA 5B1AB 1BHBA 1B04A 1NR1A 3QO7A 1DLBA 3WFVA 4H13B 3BA8A 3OFNG 3RVYA 2WAMA 1NKDA 3UT5B 2UUAO 1Q3EA 3CMEV 3HKCB 1XI1A 1XILA 4GUNA 3B09A 3E8HA 2UU9B 4LF4O 3L9DA 2XAGA 2QM8A 2WA4A 5C8YA 4YIPA 4F6RB 1R1BA 4FM2A 1AR5A 3HKBA 3LNNA 2IJKA 3JD0A 3M99B 5IYZB 5IJ0B 1MA1A 1P7BA 1NS1A 4LF7O 4Z2WA 3DTUB 1H2SB 3K5LA 4BR6A 4CH4A 3J7AU 3ZHQA 1WB8A 5BY1A 3ASOC 2YC0A 1B3QA 1J5EB 4ZHQB 2BTQB 2ZE8A 4JI3O 3OMAB 2EZOA 2E75B 3AG1B 4DRXB 3IGAC 2VWKA 5KUKA 1IBLO 3ZIAG 4UCVA 3OEHG 4OX9B 4TV8A 4JI5B 1O9HA 2UUBB 2GTAA 4GYCB 2Q67A 5KHJA 2CDYA 1I0HA 3STZC 2OT5A 3BAAA 4WFGA 3OGCC 1E1QG 2GSMB 3B4SA 2P90A 1S5JA 5BR8O 4LFCB 5CA3A 1H8EG 4IIJB 4FPPA 3CRQA 4JI0O 3NXSA 1K4DC 2DQ0A 5JJJB 1N0JA 3IFXA 2B5UA 3JCZA 1MABG 1VQNV 3ABLC 3FAVB 1DF4A 4G27B 1DGSA 1AJQA 1NTMH 4DUZB 4P9OA 4UCTA 3SJAC 3HKEB 3AG3B 1BQ0A 2CUGA 4PI2A 3ZX6A 1GN4A 4DR1B 2HR3A 4LF9B 1YEWA 2RCVA 1HR0B 1AVMA 1TVKB 2EZPA 3CRAA 2ZIMA 2CK3G 4NB5A 3CCVV 1VQ6V 4DUZO 4RAIA 3B8NA 2ZDIC 4FLZA 1Q81W 3ZRWA 2DYSB 1NQTA 2EIJC 3P3PA 2ETNA 4OXSA 3ZN1A 2Z5UA 5EBMC 1YIJV 2LW7A 3JD4A 2P22C 5KHKA 2YXLA 2DMXA 2H3OA 3MHSC 1WAZA 2ZKOA 5LP6A 2L35A 1ZLZA 2GTSA 4TUYA 5EIBC 2F23A 5JWPA 4UXNA 5LBQA 1SZTA 3G71V 5LMNO 5L3GA 3CC4V 2JDIG 2HVKC 2FYUH 5BZBA 2BTOA 2A0LA 5L3EA 3CRRA 4J10A 1QVGU 1KYOF 5L3DA 1ZSPA 4FFBA 3OMNB 4LR3A 3B77A 4B08A 3CB2A 4DV5O 1M9NA 2BSKA 4OPAA 4NR1A 3Q4HB 2Q7HA 2IU3A 3E22B 1AR4A 4WFEA 1XNRO 1SZXA 4N23A 3H01A 4OX9O 2IH3C 5H5NA 4B3RB 4I0XA 1JFFA 2Z3YA 1XMOO 3ABKC 5B3SB 4J7KA 1B6QA 2ITCC 2MK3A 3LNMB 3BY6A 4YY3B 3CS5A 1KP3A 1MSWD 5AG2A 1ZX3A 1FD9A 3JAWB 3GWOA 1RM1B 1VF7A 2P06A 2OTJV 3F7YC 1UFIA 1YITV 4O4LB 3ZRSA 1EN5A 4BWAA 1AI5A 1IURA 4ZI7B 3FAVA 1KMIZ 4F4LA 1DTOA 2Q0AA 1AP5A 2V4DA 4HBNA 1BHAA 4JI8O 1KC8W 3RYCA 4DR6O 2AHYA 3IC7A 1YZBA 3BRCA 4KXRA 4JI7O 1OCRC 5FL7G 4EEQA 4X20A 2UXXA 2RN9A 1FXHA 3LDDA 2XTAA 4XDLA 5CMUA 1Z5VA 3SDLA 2QA4V 3VOUA 1L0NH 5B1OA 4BW5A 4LF5O 1PL4A 1I08A 4Q6GA 1SETA 1FFXA 2W6IG 2EJ7A 3RBZA 3CMAV 5EBWC 1I94O 3SPGA 3MDSA 3TK1A 4K0KB 2DN9A 1Y76A 1FYJA 2HKOA 2OCHA 2GUZB 3JSNA 1NVPB 2M6YA 1WA8B 2LP7A 1UJWB 2WLKA 3A8TA 2JJ2G 1P7GA 4X66B 1XNQO 5L3CA 1XUQA 1M57B 3K04A 2OIEA 1XL4A 5EIBD 3W7WA 3K9SA 4ZOLB 2QTOA 2UU9O 5H2FZ 3WG7B 1SQVH 2HJFC 4I0XB 3H1IH 2E76B 3QG5A 2CGNA 2VQEB 2E5LO 3SPJA 1WB7A 2X6BA 5J2TA 4HYOA 4XBFA 5KHGA 2YI9A 5B66Z 4AHCA 4JYYA 2AZ0A 4KUMA 4OPHA 4E4EA 4WFAV 4JI4O 4X8AA 1DF5A 3DXRA 4LFAO 1GH6A 3HKBB 1HR0O 2YS8A 1OCCC 2PTMA 4NYKA 1OHHG 3ZMZA 4DR1O 1IDSA 3MD0A 1VQ9V 5HFLA 2N04A 1GK9A 5C93A 3R65A 4K0KO 4B7EA 3JASA 1HNWB 2EINB 2WLJA 4DO2A 3KKYA 1WNSA 1NTZH 1K8AW 4J7JA 1M90W 1H2NA 3DC5A 1YJ9V 4NKGB 4IGGA 4I55A 4MW3A 2YEVB 1MZFA 2ZE6A 3PJSK 4YY3O 3LSUA 4LF8B 4FZ0A 2KB1A 3ZBHA 5IJ9A 1VP7A 1WPBA 4B3MO 2WLHA 3J81N 1XL6A 3CJHB 4DV0B 2HEPA 4FM1A 5HFMA 3CCEV 5KHHA 4U7NA 4DV2B 4CC6A 5CBHA 1EN4A 4F6RA 1U97A 3CCJV 4MTFA 1FXVA 1FJGO 3CRCA 4DV1O 1JQ0A 2DWEC 3K06A 3K57A 1SA0A 4PI0A 4TT3G 4CBCA 4ZOLA 1M5IA 5L3FA 1R73A 2ZE7A 5EBLC 1FS0G 4AILC 1LNQA 5LYJB 5LMNB 3UQ8A 2N74A 3FB8C 5KLVH 4JI6B 1PNLA 5JJNB 4EKWA 4PDRA 1KQSU 1BL8A 3SPCA 1N32B 1YJWV 1HNXO 4KHPO 2ZM6B 1OCOB 1VF5B 4LFCO 2Y0PA 2XAJA 2PI5A 1M4UA 4ICGA 1HNZO 4WCEV 4ZBMA 4YHHB 1TGOA 4WFFA 2F4VB 1HNZB 3F7VC 3OTOO 3CWBH 3I5DA 3DXRB 3JAKA 1M93A 1V55C 1EZJA 2FL4A 1SQXH 1R3JC 4I4TA 4O4IA 3H1JH 3JD3A 5DECA 4JI2O 2ZM6O 1BS3A 1N33O 4MSWC 3TXSA 1F23A 1PD3A 1G1XB 4MVSA 2WLLB 2QJ1A 5LXTA 1H2LA 1HWYA 4ZHQA 1LUVA 2EIKC 2JEXA 1OJHA 1JR9A 3B40A 4EB6B 2VQFB 4CS3A 1K9MW 2JGDB 2W0FC 3U10A 5EZYA 4DV1B 1U96A 3FKSG 1Y66A 3K5OA 2BCCH 2W0XA 1IXBA 4JAVA 1JJOA 5KX5B 4DV3O 1GN6A 5E79Z 1MSDA 1PP9H 1RPOA 3FB5C 2QKAA 2Q7GA 3TETA 4RUEA 5J2UA 4YJ3A 4DV2O 1S72V 5LP6C 4P2ZA 4O4LA 4Z1MG 4QIWF 4DR5O 5FNVB 1Q8IA 2Q6AA 1OCCB 1SQQH 3L74H 2KQXA 2JRIA 4MTXA 1GM8A 3CX5F 1TUBB 4J41A 2A7WA 4DUYB 1QLEC 4JV5B 4H44B 5E1AC 4FFBB 2B1IA 4O2BB 1Y67A 1SKVA 3RYFB 1ORQC 2BOCC 2F1MA 4DR2B 1PL0A 5CN0A 1KBHA 3AG2C 1KKCA 4O2AB 4UUJC 3IC9A 2ZR2A 4I55B 4CH3A 4JI4B 4LF7B 3F5WC 5CB4B 4X89A 1N34O 5KMGA 1YF2A 2BE3A 2CTWA 4R7CA 4BAYA 3AEIA 5JH7B 2PF4E 2QKCA 2CH7A 1EFRG 2EIJB 4DK1A 5IY5B 2AZ2A 5D5QA 2G38A 2VQEO 3AG2B 4YJ3B 2P4KA 3S3WA 1IBLB 3ZMVA 3A0BZ 1EBOA 4JASA 1M56B 1SESA 4LWSA 1H2GA 1SS3A 5A9GA 1BCCH 4FMTA 3M8AA 3AG3C 3IJ4A 4MVMA 3EVKA 4X64O 2L6LA 4A5UB 1WP8A 4O4IB 3H1HH 2GHYA 1YCIA 4X20B 2A9HA 2UUCO 5IWAO 1EN6A 2ILMA 2PYJA 2D2CB 1YVWA 3SPIA 4O4HA 2NNUA 3K3WA 3ABUA 3P3NA 4K8XA 3GB7C 3RYHB 4YIOA 4BIOA 1VQLV 2ZXWB 2GV9A 2Y4UA 1D2DA 1N36B 2Q7EA 1QCEA 2WSSG 4P9PA 1BT8A 3ICXA 5ITZB 4B3TO 3ETGA 2E5LB 4FLWA 2ZT9B 1CP9A 2YIAA 2E3CA 1L8DA 1XNRB 1NBMG 2XUMA 4JI1B 2BTQA 5KA5A 3AK1A 4IT5A 1HDJA 3CP1A 2YDEA 3OR6C 4PELA 3T1HB 4U3JB 4MTGA 5D5PA 3RWRD 3WB2A 4J42A 2EILC 1RFYA 1K97A 4LNUA 4TV8B 3JYCA 3SPHA 3ASNB 4TQFA 2JJ1G 4J11A 1KD1W 1N32O 3BFRA 4JV5O 5BR8B 1K92A 4O2BA 2M7WA 4NTWA 4QGPA 5KUMA 3KG2A 5IJ9B 1IBMO 1BZKA 4DUYO 2A06H 1XMQO 3D8CA 5JQGA 4GKJO 4DV5B 4IL6Z 1N4CA 2LJ2A 4R50A 4UV8A 1FFXB 3C3TA 2EIMC 3JD1A 3WU2Z 4TUYB 1K4CC 3QO5A 3BPZA 1AR1B 3CC2V 1XMQB 3UM7A 1MOFA 3K0DA 1KUQA 1AP6A 2UXDB 1HNXB 4KHPB 4NVPA 1QLNA 3ZEDA 1T5EA 4EFEA 1X4TA 1F4MA 3UO2A 2QE7G 4QPKA 2D3OW 4LF8O 2GDSA 1FKAO 1NVPD 4LH6A 1JVMA 2KKWA 3ETEA 3K08A 3G4SV 1ENVA 3RW0A 2Y48A 1VEWA 2DJVA 1CEZA 3BVOA 4QNHB 2EBOA 1JFFB 1BE3H 4NXMO 4DR4B 1P84F 1JOYA 1URFA 3JATA 4JZ2A 4DR5B 3RN4A 1Q7YW 1K5SA 3UKMA 2DW4A 3OW2U 1FAFA 1GRJA 2YUAA 1S76D 4B3RO 3A0RA 4PHZA 5CB4A 3CXCU 2CAZC 4O4HB 3ZRXA 4UVAA 2FTKA 2R9RB 3D36C 3T1YB 1P4RA 1A32A 2WLLA 4MW8A 3ZJZA 2PY5A 3QTCA 2C2AA 4B3TB 2JVDA 2R9AA 1VQKV 3U11A 1FXKA 4K35A 3ABLB 3HKCA 4MVRA 1N36O 4YJ2A 3E22A 2Q4PA 3JSLA 1OV9A 2YIDA 3HPLC 5BMVA 2BSKB 2ZCEA 5B1BB 1QNMA 3KCXA 3K5MA 4DYLA 3SGIA 1Z5WA 1QU7A 3T4DA 1ZAUA 4JI2B 2ATKC 1COWG 2VWJA 2MW2B 1K33A 2CTQA 1I5XA 3B2EE 3K9AA 1BSMA 4XDKA 2EULA 1VQ5V 3G67A 4GZRB 2AW9A 5CA0B 1Q86W 4X1KB 4X62B 1Y6XA 3SJQC 3K03A 4JGSA 1SQFA 4I5SA 3H9VA 4GLXA 3ZHRA 2XAFA 3RYFA 1YSCA 2WLNA 4B3MB 3ABKB 1K3EA 5CA1A 3KZIZ 4QJFB 1MZEA 2QWOB 2ZR3A 1SA0B 1JA8A 1NI8A 1Q6HA 2LW1A 2HP8A 2ODMA 4U3JA 3A0HZ 4WBNA 2ZE5A 2GUZA 2LGWA 3ZHSA 1SQPH 1NJIW 2ZD9A 5JH7A 1K7DA 4PA4A 2X0LA 3AG4C 3ASNC 4I50B 1KP2A 4EB6A 3ML0A 5B3SC 4JI8B 5LMUB 4PA9A 1G8MA 4LP8A 4DXWA 4LH7A 2IM9A 5KX5A 1WA8A 2X6CA 1RSOB 5EK0A 3OE7G 5GONB 1BQZA 4X1KA 4X64B 3SYQA 3ZMTA 4G2KA 2JS3A 4YXWG 1V54C 3FYIB 1OCZC 2DWDC 3E89A 1PNKA 1XQ8A 2ADQB 1WP7A 2CTRA 4JI7B 1AROP 5DM6V 3OUSA 5IYDO 3WG7C 3E86A 3FYEB 2EJRA 3L73H 1VQPV 1Y76B 1J95A 3JAMN 2QWNB 2Q5ZA 1Q6IA 3ZS8C 3JARA 3HKEA 1K5QA 2XASA 3E8GA 4ZKIA 4RQFA 4J9YB 3FD9A 3RYCB 1GMGA 1MG1A 1NT2B 4I9QA 3F5TA 2Y0IA 3ABMC 3W7XA 4DR7O 3X2QC 2ZQMA 4FM0A 1G6UA 2HFEC 4U7OA 5JCOA 2UXCB 5IE9A 3G6BA 3G80A 2QM4A 3OMIB 4GX5A 4LF4B 2FKXA 3I56V 1I94B 4PV1B 2BOBC 3CCLV 2B1GA 3CCMV 4UCUA 2QGNA 3DC6A 3W7SA 1DK1A 3THOA 1P49A 3ABMB 2W6JG 4JAAA 1NR7A 5LYJA 3JASB 1AI7A 3SYOA 3OTOB 1Q43A 3RGBA 4Q20A 4MVQA 4AQYO 3UT5A 4IHJB 4YHHO 3E8FA 1QR9A 1IZ3A 4HNAA 4X1YB 4BIUA 4D6TH 3HKDA 1RSOA 1XHZA 5BMVB 1GM7A 3TCUA 4LF9O 2RMKB 4HAMA 1XBLA 2F95B 3A2FA 4GX0A 2OWOA 1IBKB 2DQ3A 3T1CA 1E79G 2WLMA 2P4VA 1M1KW 1GO3F 1SQBH 2XNDG 2ITDC 3CYOA 2LO1A 4DR3O 3S3XA 3P30A 1Q82W 1RM1C 3TJTA 1EZVH 1F4NA 2WPDG 1BMFG 4O2AA 2X7RB 3DGEA 4UFZA 2Q73A 2Q68A 1S0VA 4PA7A 2ZIOA 4TV9A 5LGNA 2UXBB 2P6JA 5L3BA 3L75H 5JJEB 2KG7A 3GVMA 2CH7B 2JK5C 1VMGA 4DV0O 1PM9A 1S77D 1XEQA 1WN7A 4DV7O 4RO2A 4MVUA 1O9GA 3Q4HA 3B8MA 2HJDA 4Z1VA 1SQGA 4L8JA 1YXBA 4NXNO 1XNQB 1V54B 5EZYB 1JJ2U 3E2EA 1TA8A 4LF6B 3CRMA 1FXKC 1R3LC 3G6EV 2YXYA 5IT9N 3RVZA 4GT1A 4BIZA 2YSUB 1JX9A 3N2GA 3SYCA 2N05A 3N2KA 3TXQA 4IYIA 1L0LH 4LF6O 1V55B 4X62O 3JATB 4PDVA 1NZ6A 3C3SA 3RYIB 5IYBO 1XHXA 2F4VO 4PA3A 2YI8A 3EHBB 2YXHA 2DYSC 4FLXA 4JAUA 4UB6Z 3RT3C 3OT7A 1VARA 3LSSA 4JI5O 5H9CA 2R70A 3CEIA 3SJCC 2RDCA 4GX2A 1MNGA 2XT9A 4E2LA 4HNAB 5FLXN 1TVKA 2JGDA 1TAEA 2XAHA 4CS4A 5B1BC 3MAQA 4FVMA 4PDMA 4DV3B 3WB0A 3VQXA 2WA3A 4DR2O 2NN4A 2ZNIA 3X2QB 3AG4B 2Y69C 4H0LB 4WF9V 4CZZA 2XHBA 4PD4F 4UV9A 2PYLA 1US6A 4X1IA 1Y4MA 3EFFK 5CBGA 4TWKA 2EIKB 1VF6C 1S3JA 1HW7A 4BW9A 2OCCB 3CD6V 1N33B 4DK0A 1AI6A 4NXNB 3AK2A 4C7UA 5CBFA 4RUFA 3CPWU 4D7TA 5B1NA 4H33A 1FPOA 3OR7C 4DRXA 4DW0A 4LFAB 1VQOV 2B9ZA 2UUAB 4JTCB 4WBNB 3L70H 3WB1A 5GW7A 2YIBD 3ZHVA 1R6KA 4GCZA 2EIMB 1GTOA 4GKJB 1ROPA 2WWWA 4DR4O 2GBOA 3BA9A 4JPRA 4DR3B 3QF7A 2Q0OC 1KB9F 3M7MX 5JQGB 3C90A 1AJPA 1KU9A 2AHZA 2RNBA 4JI6O 5H6QA 1V9PA 4JI0B 4DR6B 2DYRC 3K0GA 2UXDO 4UCOA 3FFQA 2RJZA 3ZCCA 2Q8VA 3ZRWB 1BGYH 4DR7B 1EM1A 5IWAB 3ETQA 4X65O 1KKDA 3SJBC 3K5NA 1AJNA 2OIGA 3CXHF 4F6EA 4FIPC 2VS0A 4O4JA 2V7QG 1CXZB 1LR1A 4LFBB 1VIBA 2F43G 1NH2D 1SRYA 3MHHC 4FJCC 3VQVA 4JYCA 3K58A 3D3QA 2HHHO 4FLVA 1D5AA 2UXCO 1VF6A 2QR4A 1OZ0A 1GM9A 2XOKG 3P32A 4TSFG 2EILB 5LGTA 1SF9A 2QWRB 4FLYA 3BHPA 3J80N 4ABMA 4X66O 1GN2A 2CGOA 2K1EA 1YJNV 3QO8A 1Q90D 1F7YA 2P5OA 4X1IB 3L72H 4J7ZA 2YEVA 5LGUA 1IBKO 2QWPB 4RQEA 4DV7B 1YI2V 4GKKO 3CC7V 3ABTA 1GAXA 2DYRB 2QEXV 3VBBA 4X1YA 2H94A 5J2TB 2QWQB 3W7UA 3K79A 5LXTB 2K9PA 2EX3A 2FMLA 3FB7C 4J9ZB 4D7SA 4FFKA 2HHHB 1VQMV 4ZI7A 5LHIA 4UCSA 4MTOA 5LOVA 5EYPA 4IHJA 1ZL8B 1HNWO 1JCHA 3ZMUA 4I7ZB 3PN1A 1RPRA 3JD2A 2V1DA 1N8RW 4JYAO 1G4YB 3U0ZA 3TGUH 2X6AA 5J2UB 5GTIZ 4HZ3A 2VQFO 1GKFA 1RP3B 3W7TA 1S5HC 1VQ8V 5IJ0A 2JIZG 4GX1A 2AGAA 5IY5C 3LDCA 2IJHA 1IVSA 4TV9B 2YIBA 3E83A 1H2KA 2PUSA 3ZRVA 4JYBA 2QSAA 2IU0A 4JYAB 5FNVA 4O4JB 1Z2GA 1QR8A 3D36A 2DOSA 4QE9A 1PNMA 1THZA 3JAWA 3CJHA 3T4ZA 2WLIB 4H37A 1F51A 1ZUQA 3GWKC 3AK3A 2KSDA 2JGUA 4W4LA 1HP8A 2AXTZ 1ZWIC 4MS2A 2ADPA 4G28B 4K8ZA 2HLDG 4I4TB 2H8PC 5JVDB 2NLJC 1AILA 4J80A 3UO3A 3N2KB 3N27A 3T1YO 3HKDB 2A79B 5BXZA 3JCUZ 4RWUA 1AI4A 1QBZA 2QDOA 1M56C 2Q9LA 1SC5B 1L1FA 5J9PC 2A3QA 4MVZA 3OTFA 4CH5A 3SYPA 1W2BU 5LMUO 5A2QN 5JCOC 1YTFB 2R72A 5CA0A 3OEEG
chains in the Genus database with same CATH topology
2ZR2A 1AI7A 1Q81W 3ZRWA 2DYSB 3STLC 3SYOA 1NQTA 3F5WC 2UXNA 4X89A 2EIJC 4MVQA 4Q20A 4OXSA 3ZN1A 4BAYA 2Z5UA 4R7CA 5EBMC 2QM7A 3AEIA 4LBEC 1YIJV 3E8FA 1QR9A 1EFRG 2EIJB 3JD4A 5IY5B 5H6RA 4BIUA 3MHSC 3AG2B 1GM7A 3TCUA 5EC1C 4HAMA 3ZMVA 1EBOA 3T2MA 4GX0A 4UXNA 2DQ3A 3T1CA 5LBQA 1SZTA 3G71V 1E79G 4JASA 2WLMA 5L3GA 1M56B 3ZMSA 3CC4V 2JDIG 1M1KW 1SESA 1H2GA 1GO3F 2XNDG 2HVKC 2ITDC 4FMTA 4JF3A 3AG3C 3CYOA 5BZBA 4MVMA 2A0LA 5L3EA 1QVGU 5L3DA 3P30A 1NH2B 3OMNB 1Q82W 2ZXWC 1RM1C 4ASUG 1F4NA 3B77A 2GHYA 1BMFG 2WPDG 1H38A 1M9NA 2X7RB 3DGEA 2Q68A 1S0VA 4PA7A 2A9HA 1VQ4V 2IU3A 4MT8A 5LGNA 2P6JA 5L3BA 4WFEA 4N23A 3H01A 5DN6G 2IH3C 2Z3YA 3SPIA 2JK5C 3ABKC 4PDLA 2NNUA 5B3SB 1B6QA 1OCOC 2ITCC 3K3WA 2MK3A 3ABUA 3LNMB 1S77D 3BY6A 4I9WA 3GB7C 1E1RG 4KP4A 1KP3A 1R6NA 4RO2A 4MVUA 1YTFD 1MSWD 3E35A 3B8MA 3GWOA 1VQLV 2ZXWB 1RM1B 5EC2C 1H8HG 4LCUC 1V54B 2OTJV 3F7YC 1QCEA 1JJ2U 1OCZB 3E2EA 1FXKC 1YITV 4MVOA 2WSSG 4P9PA 1QVFU 1R3LC 3ZRSA 3QNEA 4LC1A 3ETGA 2OTLV 5LHGA 4UVBA 1AI5A 1OCRB 1CP9A 3G6EV 2IJJA 4F4LA 1DTOA 1CPYA 4GT1A 1NBMG 3RVZA 4BIZA 2YSUB 1JX9A 1BHAA 3SYCA 1KC8W 5KA5A 2AHYA 2LFSA 3IC7A 3ZN0A 3CCSV 1M57C 3CP1A 1V55B 3OR6C 4PELA 3CCUV 1IXMA 1OCRC 4PDVA 5FL7G 5IYBO 2UXXA 4MTGA 1FXHA 1YHQV 2EILC 3LDDA 4R8CA 4PA3A 1K97A 3OM3B 3EHBB 4XDLA 3JYCA 5CMUA 3SPHA 3ASNB 2DYSC 2QA4V 3VOUA 4JAUA 2JJ1G 5B1OA 4BW5A 3LSSA 5H9CA 4P30A 3D3IA 4N21A 1KD1W 4GX2A 4E2LA 1SETA 2R9IA 1R3IC 2XAHA 2Y69B 4XDJA 3BEHA 5B1BC 4PDMA 1VQ7V 1WPXA 2W6IG 3RBZA 3CMAV 5EBWC 1K92A 2IH1C 1QLEB 2M7WA 3SPGA 4WFBV 5KUMA 3TK1A 3KG2A 3LDEA 2HKOA 4KFMA 4QE7A 1NVPB 4L87A 3X2QB 3AG4B 2LP7A 2Y69C 1UJWB 2WLKA 4WF9V 2JJ2G 4CZZA 4R50A 4UV8A 4UV9A 1KECA 2EIMC 3JD1A 1Y4MA 3EFFK 5CBGA 4TWKA 5L3CA 4JTAB 1K4CC 2EIKB 3QO5A 1S3JA 1AR1B 1M57B 2OCCB 3CC2V 3K04A 3CD6V 1XL4A 1W0JG 3SYAA 4WFHA 3W7WA 1AI6A 3UM7A 3FB6C 1MOFA 3K0DA 2QTOA 5CBFA 5IYCO 3OAAG 4RUFA 3CPWU 5B1NA 4H33A 3WG7B 3OR7C 2HJFC 1W0KG 1QLNA 2QKSA 2JEUA 1K34A 1VQOV 1F4MA 3LUTB 4JTCB 2QE7G 4QPKA 2D3OW 4R6ZA 3SPJA 2PI4A 1NVPD 5GW7A 2X6BA 3I55V 4HYOA 4XBFA 1JVMA 1R6KA 4GCZA 2EIMB 3ETEA 1GTOA 3K08A 3G4SV 1ROPA 2WWWA 2XAQA 4KUMA 1ENVA 4WFAV 3RW0A 1FXKB 2OCCC 4JPRA 2Y48A 4X8AA 1CEZA 2IW5A 4QNHB 2EBOA 1DF5A 2HG5C 2HVJC 1AJPA 2AHZA 2EINC 1OCCC 3OUFA 1JOYA 1OHHG 5H6QA 3ZMZA 3AG1C 5KA6A 2DYRC 1Q7YW 1K5SA 2P7TC 3E8BA 3K0GA 3UKMA 2DW4A 2P67A 3OW2U 3MD0A 1VQ9V 5HFLA 1S76D 1R3KC 1FFTB 1GK9A 3A0RA 3R65A 5C93A 3CXCU 3ZCCA 4PA6A 3ZRXA 4UVAA 2FTKA 2R9RB 3ZRWB 1P4RA 2WLLA 4MW8A 3ZJZA 2EINB 2WLJA 3LSQA 1KKDA 4DO2A 2C2AA 1K8AW 5LHHA 3ETDA 1M90W 5IDJA 1YJ9V 1VQKV 1FXKA 1AJNA 4FIPC 4MW3A 2YEVB 3ABLB 4MVRA 1TUEB 3PJSK 4UVCA 1K73W 4QPJA 4JTDB 1SERA 2KB1A 3HPLC 4X88A 2V7QG 3CCQV 2WLHA 5B1BB 2F43G 4FK5C 1XL6A 1NH2D 1SRYA 3MHHC 5HFMA 4FJCC 3CCEV 4U7NA 1JPXA 3T4DA 4JYCA 5CBHA 2Q69A 2ATKC 1COWG 3CCJV 4MTFA 1OZ0A 1FXVA 1K33A 1GM9A 1I5XA 2XOKG 3ASOB 2EILB 2IJIA 3P32A 3K9AA 2ZDIA 4TSFG 5LGTA 1WLEA 5B1AC 1JQ0A 2WLIA 2DWEC 3K06A 2LFRA 3HB3B 4TT3G 4XDKA 1PKXA 4CBCA 5L3FA 3CCRV 1VQ5V 1R73A 5EBLC 1FS0G 2K1EA 1LNQA 1Q86W 1I5YA 5B1AB 1YJNV 3QO8A 1BHBA 1NR1A 3QO7A 1DLBA 3SJQC 3WFVA 3K03A 4JGSA 3FB8C 3OFNG 4I5SA 3RVYA 2WAMA 1NKDA 1PNLA 2XAFA 1YSCA 2WLNA 4EKWA 3CMEV 4PDRA 3ABKB 2YEVA 1BL8A 1K3EA 3SPCA 1KQSU 5LGUA 4QJFB 1YJWV 4RQEA 1YI2V 3E8HA 2ZR3A 3CC7V 3ABTA 1OCOB 2XAGA 2QM8A 2DYRB 2QEXV 2XAJA 3VBBA 2PI5A 2H94A 1NJIW 2ZD9A 3W7UA 1K7DA 3K79A 4WCEV 4ZBMA 2IJKA 3JD0A 3M99B 3FB7C 4PA4A 4J9ZB 3AG4C 2X0LA 3ASNC 1VQMV 4WFFA 1P7BA 1KP2A 3F7VC 5LHIA 3DTUB 4MTOA 3ML0A 5B3SC 4PA9A 3ASOC 1G8MA 4LP8A 1V55C 1EZJA 4DXWA 1JCHA 1R3JC 3ZMUA 3JD3A 3OMAB 1RPRA 2EZOA 3JD2A 3AG1B 2X6CA 2V1DA 1N8RW 3IGAC 1G4YB 4MSWC 2X6AA 5EK0A 5KUKA 3OE7G 3ZIAG 1F23A 1PD3A 4MVSA 4HZ3A 3OEHG 2WLLB 3SYQA 3ZMTA 4G2KA 1GKFA 3W7TA 1S5HC 1HWYA 1VQ8V 4YXWG 1V54C 2JIZG 4GX1A 2Q67A 2EIKC 3FYIB 5IY5C 1OCZC 2JEXA 3LDCA 2DWDC 2IJHA 3E89A 3STZC 1PNKA 2OT5A 3E83A 1K9MW 4WFGA 3OGCC 1E1QG 4JYBA 3ZRVA 2IU0A 1AROP 2GSMB 2W0FC 5DM6V 3OUSA 1QR8A 3D36A 3FKSG 5IYDO 3WG7C 3E86A 1Y66A 3FYEB 4QE9A 2EJRA 1VQPV 1PNMA 2P90A 1THZA 4JAVA 3T4ZA 2WLIB 1J95A 1RPOA 4H37A 1F51A 3FB5C 3TETA 4RUEA 5CA3A 1H8EG 1S72V 4P2ZA 4Z1MG 4FPPA 3E8GA 1K5QA 2XASA 4QIWF 4ZKIA 1ZWIC 4RQFA 3NXSA 4MS2A 4J9YB 1K4DC 4G28B 1GMGA 1MG1A 2DQ0A 2HLDG 2H8PC 2Q6AA 1OCCB 3IFXA 2NLJC 2B5UA 3JCZA 1MABG 1VQNV 4MTXA 1GM8A 3ABLC 1DF4A 3ABMC 4G27B 3W7XA 1AJQA 3X2QC 2ZQMA 2A79B 2HFEC 4P9OA 4U7OA 1AI4A 3AG3B 1QLEC 1QBZA 5E1AC 1M56C 3OMIB 2HR3A 4GX5A 2B1IA 3I56V 1L1FA 5J9PC 2BOBC 4MVZA 1ORQC 2B1GA 2BOCC 3CCLV 3CCMV 1PL0A 5CN0A 3W7SA 3SYPA 2EZPA 1W2BU 3AG2C 3ABMB 2W6JG 2CK3G 1YTFB 1NR7A 3CCVV 1VQ6V 4UUJC 4RAIA 3B8NA 3OEEG 2ZDIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F23 A;  4FIP C;  4E2L A;  1SZT A;  1Y4M A;  5KA6 A;  3CP1 A;  1K33 A;  4G2K A;  2P6J A;  1QCE A;  1I5X A;  4N23 A;  3H01 A;  3K9A A;  1QBZ A;  5HFL A;  3GWO A;  1JQ0 A;  4JF3 A;  3CYO A;  1QR9 A;  2M7W A;  1ENV A;  2MK3 A;  4JPR A;  1MG1 A;  1I5Y A;  1MOF A;  2OT5 A;  4FK5 C;  5CMU A;  3MHS C;  3P30 A;  3MHH C;  5CN0 A;  1DLB A;  2EBO A;  1DF5 A;  2EZP A;  4FJC C;  2EZO A;  2LP7 A;  3B77 A;  3WFV A;  5HFM A;  1JPX A;  5H9C A;  4JGS A;  4N21 A;  1QR8 A;  3M99 B;  1DF4 A;  3B8M A;  2X7R B;  3B8N A;  1Y66 A;  1EBO A;  1K34 A;  5KA5 A; 
#chains in the Genus database with same CATH topology
 3EXA A;  3STL C;  2NR5 A;  3O9O A;  2UXN A;  2QM7 A;  3H1L H;  4LF5 B;  2O57 A;  4LBE C;  4DV6 B;  2PGG A;  1FJG B;  5H6R A;  3OD4 A;  2YIC A;  4B3S O;  4AI8 A;  3VQY A;  5EC1 C;  4NTY A;  1XDC A;  5IYZ A;  3T2M A;  4CS2 A;  1MMM A;  3ZMS A;  5DED A;  5EYP B;  1JMK C;  4DV4 O;  4JF3 A;  1I7F A;  1H2M A;  1S5L Z;  4DW1 A;  1NH2 B;  1N34 B;  2ZXW C;  4ASU G;  3CE2 A;  1H38 A;  2Z0A A;  3RYI A;  5B5E Z;  4DV6 O;  4KL1 A;  1VQ4 V;  4X65 B;  5LP6 B;  5ITZ A;  4MT8 A;  4IIJ A;  5LOV B;  5DN6 G;  1LUW A;  1D5N A;  1N0N A;  1YDX A;  4PDL A;  5TIS Z;  1WJZ A;  2E74 B;  4JZG A;  3N2G B;  4EFB A;  1OCO C;  1Q6U A;  1B06 A;  5FPO A;  5JVD A;  1PPJ H;  5LL6 Y;  4I9W A;  1E1R G;  3CSX A;  3BAB A;  4KP4 A;  1R6N A;  1YTF D;  2QTS A;  3E35 A;  5LA6 B;  4FZ1 A;  5KAI Z;  4TOI A;  2VRZ A;  5EC2 C;  1XRE A;  1H8H G;  4LCU C;  4NTX A;  2UUB O;  1OCZ B;  2JS5 A;  3APQ A;  4MVO A;  1QVF U;  3RFR A;  1TUB A;  3QNE A;  4LC1 A;  1W59 A;  2OTL V;  5LHG A;  4UVB A;  1OCR B;  1Q5O A;  5GTH Z;  4UB8 Z;  2IJJ A;  3JAR B;  4YJ2 B;  1CPY A;  4JI3 B;  4CC5 A;  3JAL A;  4NXM B;  2RQ6 A;  5GON A;  3HR0 A;  2LFS A;  3ZN0 A;  3CCS V;  1M57 C;  2UXB O;  5KAF Z;  2F93 B;  3L71 H;  3CCU V;  1IXM A;  1YHQ V;  2LQT A;  5FPR A;  3H1K H;  4I50 A;  4R8C A;  4PJ0 Z;  3OM3 B;  3KCY A;  1ZL8 A;  3SR2 C;  2CE4 A;  4B7K A;  4P30 A;  3D3I A;  4N21 A;  3JAK B;  1NTK H;  2R9I A;  1R3I C;  2Y69 B;  4XDJ A;  3BEH A;  4CH6 A;  1X59 A;  1VQ7 V;  1WPX A;  2FB5 A;  4DV4 B;  3JAL B;  2IH1 C;  1QLE B;  4WFB V;  5C8Y B;  3LDE A;  3CHX A;  3NR7 A;  5KHI A;  4KFM A;  4QE7 A;  4L87 A;  3IAY A;  4B3S B;  4LNU B;  1KEC A;  2PZS A;  1R6T A;  4JTA B;  2ZIN A;  1XOU A;  1W0J G;  3SYA A;  1J5E O;  1IBM B;  1ZTE A;  4WFH A;  3FB6 C;  1Y74 A;  5IYC O;  3OAA G;  5CA1 B;  3QVN A;  3UCS C;  4W4K A;  1W0K G;  2QKS A;  2JEU A;  4UCR A;  1K34 A;  3AG7 A;  3LUT B;  3ZHT A;  4R6Z A;  2PI4 A;  3I55 V;  3R66 A;  2XAQ A;  2ZNJ A;  4FLT A;  1FXK B;  1UPG A;  2OCC C;  3APO A;  2IW5 A;  2HG5 C;  2KG7 B;  2ARH A;  4ZIB A;  2HVJ C;  3T1H O;  1PV0 A;  4IYH A;  2EIN C;  5LA6 A;  3OUF A;  5K1X A;  3RYH A;  3AG1 C;  4X9Q A;  5KA6 A;  2P7T C;  3E8B A;  1GN3 A;  2P67 A;  3K59 A;  2IBZ H;  1R3K C;  1FFT B;  1XMO B;  4PA6 A;  1AB3 A;  2CTP A;  4LFB O;  3LSQ A;  1NU1 H;  3O65 A;  5LHH A;  3ETD A;  3OGI B;  5IDJ A;  4U3F H;  3FX7 A;  1IX9 A;  2LGQ A;  1TUE B;  4UVC A;  1K73 W;  4QPJ A;  4JTD B;  1SER A;  4GKK B;  2Y4T A;  4K3A A;  4X88 A;  4FLU A;  3CCQ V;  3VQW A;  5F2V O;  4FK5 C;  3DSQ A;  4LWS B;  2UUC B;  1JPX A;  4JI1 O;  4OGQ B;  2Q69 A;  2F66 C;  2OYQ A;  1QQC A;  3ASO B;  2IJI A;  2DE0 X;  5KMG B;  2ZDI A;  1WLE A;  5B1A C;  3BCC H;  2WLI A;  5K1P A;  4AQY B;  2LFR A;  3HB3 B;  4TQD A;  1PKX A;  1Y74 B;  3CCR V;  1QHT A;  3ZHU A;  1I5Y A;  5B1A B;  1BHB A;  1B04 A;  1NR1 A;  3QO7 A;  1DLB A;  3WFV A;  4H13 B;  3BA8 A;  3OFN G;  3RVY A;  2WAM A;  1NKD A;  3UT5 B;  2UUA O;  1Q3E A;  3CME V;  3HKC B;  1XI1 A;  1XIL A;  4GUN A;  3B09 A;  3E8H A;  2UU9 B;  4LF4 O;  3L9D A;  2XAG A;  2QM8 A;  2WA4 A;  5C8Y A;  4YIP A;  4F6R B;  1R1B A;  4FM2 A;  1AR5 A;  3HKB A;  3LNN A;  2IJK A;  3JD0 A;  3M99 B;  5IYZ B;  5IJ0 B;  1MA1 A;  1P7B A;  1NS1 A;  4LF7 O;  4Z2W A;  3DTU B;  1H2S B;  3K5L A;  4BR6 A;  4CH4 A;  3J7A U;  3ZHQ A;  1WB8 A;  5BY1 A;  3ASO C;  2YC0 A;  1B3Q A;  1J5E B;  4ZHQ B;  2BTQ B;  2ZE8 A;  4JI3 O;  3OMA B;  2EZO A;  2E75 B;  3AG1 B;  4DRX B;  3IGA C;  2VWK A;  5KUK A;  1IBL O;  3ZIA G;  4UCV A;  3OEH G;  4OX9 B;  4TV8 A;  4JI5 B;  1O9H A;  2UUB B;  2GTA A;  4GYC B;  2Q67 A;  5KHJ A;  2CDY A;  1I0H A;  3STZ C;  2OT5 A;  3BAA A;  4WFG A;  3OGC C;  1E1Q G;  2GSM B;  3B4S A;  2P90 A;  1S5J A;  5BR8 O;  4LFC B;  5CA3 A;  1H8E G;  4IIJ B;  4FPP A;  3CRQ A;  4JI0 O;  3NXS A;  1K4D C;  2DQ0 A;  5JJJ B;  1N0J A;  3IFX A;  2B5U A;  3JCZ A;  1MAB G;  1VQN V;  3ABL C;  3FAV B;  1DF4 A;  4G27 B;  1DGS A;  1AJQ A;  1NTM H;  4DUZ B;  4P9O A;  4UCT A;  3SJA C;  3HKE B;  3AG3 B;  1BQ0 A;  2CUG A;  4PI2 A;  3ZX6 A;  1GN4 A;  4DR1 B;  2HR3 A;  4LF9 B;  1YEW A;  2RCV A;  1HR0 B;  1AVM A;  1TVK B;  2EZP A;  3CRA A;  2ZIM A;  2CK3 G;  4NB5 A;  3CCV V;  1VQ6 V;  4DUZ O;  4RAI A;  3B8N A;  2ZDI C;  4FLZ A;  1Q81 W;  3ZRW A;  2DYS B;  1NQT A;  2EIJ C;  3P3P A;  2ETN A;  4OXS A;  3ZN1 A;  2Z5U A;  5EBM C;  1YIJ V;  2LW7 A;  3JD4 A;  2P22 C;  5KHK A;  2YXL A;  2DMX A;  2H3O A;  3MHS C;  1WAZ A;  2ZKO A;  5LP6 A;  2L35 A;  1ZLZ A;  2GTS A;  4TUY A;  5EIB C;  2F23 A;  5JWP A;  4UXN A;  5LBQ A;  1SZT A;  3G71 V;  5LMN O;  5L3G A;  3CC4 V;  2JDI G;  2HVK C;  2FYU H;  5BZB A;  2BTO A;  2A0L A;  5L3E A;  3CRR A;  4J10 A;  1QVG U;  1KYO F;  5L3D A;  1ZSP A;  4FFB A;  3OMN B;  4LR3 A;  3B77 A;  4B08 A;  3CB2 A;  4DV5 O;  1M9N A;  2BSK A;  4OPA A;  4NR1 A;  3Q4H B;  2Q7H A;  2IU3 A;  3E22 B;  1AR4 A;  4WFE A;  1XNR O;  1SZX A;  4N23 A;  3H01 A;  4OX9 O;  2IH3 C;  5H5N A;  4B3R B;  4I0X A;  1JFF A;  2Z3Y A;  1XMO O;  3ABK C;  5B3S B;  4J7K A;  1B6Q A;  2ITC C;  2MK3 A;  3LNM B;  3BY6 A;  4YY3 B;  3CS5 A;  1KP3 A;  1MSW D;  5AG2 A;  1ZX3 A;  1FD9 A;  3JAW B;  3GWO A;  1RM1 B;  1VF7 A;  2P06 A;  2OTJ V;  3F7Y C;  1UFI A;  1YIT V;  4O4L B;  3ZRS A;  1EN5 A;  4BWA A;  1AI5 A;  1IUR A;  4ZI7 B;  3FAV A;  1KMI Z;  4F4L A;  1DTO A;  2Q0A A;  1AP5 A;  2V4D A;  4HBN A;  1BHA A;  4JI8 O;  1KC8 W;  3RYC A;  4DR6 O;  2AHY A;  3IC7 A;  1YZB A;  3BRC A;  4KXR A;  4JI7 O;  1OCR C;  5FL7 G;  4EEQ A;  4X20 A;  2UXX A;  2RN9 A;  1FXH A;  3LDD A;  2XTA A;  4XDL A;  5CMU A;  1Z5V A;  3SDL A;  2QA4 V;  3VOU A;  1L0N H;  5B1O A;  4BW5 A;  4LF5 O;  1PL4 A;  1I08 A;  4Q6G A;  1SET A;  1FFX A;  2W6I G;  2EJ7 A;  3RBZ A;  3CMA V;  5EBW C;  1I94 O;  3SPG A;  3MDS A;  3TK1 A;  4K0K B;  2DN9 A;  1Y76 A;  1FYJ A;  2HKO A;  2OCH A;  2GUZ B;  3JSN A;  1NVP B;  2M6Y A;  1WA8 B;  2LP7 A;  1UJW B;  2WLK A;  3A8T A;  2JJ2 G;  1P7G A;  4X66 B;  1XNQ O;  5L3C A;  1XUQ A;  1M57 B;  3K04 A;  2OIE A;  1XL4 A;  5EIB D;  3W7W A;  3K9S A;  4ZOL B;  2QTO A;  2UU9 O;  5H2F Z;  3WG7 B;  1SQV H;  2HJF C;  4I0X B;  3H1I H;  2E76 B;  3QG5 A;  2CGN A;  2VQE B;  2E5L O;  3SPJ A;  1WB7 A;  2X6B A;  5J2T A;  4HYO A;  4XBF A;  5KHG A;  2YI9 A;  5B66 Z;  4AHC A;  4JYY A;  2AZ0 A;  4KUM A;  4OPH A;  4E4E A;  4WFA V;  4JI4 O;  4X8A A;  1DF5 A;  3DXR A;  4LFA O;  1GH6 A;  3HKB B;  1HR0 O;  2YS8 A;  1OCC C;  2PTM A;  4NYK A;  1OHH G;  3ZMZ A;  4DR1 O;  1IDS A;  3MD0 A;  1VQ9 V;  5HFL A;  2N04 A;  1GK9 A;  5C93 A;  3R65 A;  4K0K O;  4B7E A;  3JAS A;  1HNW B;  2EIN B;  2WLJ A;  4DO2 A;  3KKY A;  1WNS A;  1NTZ H;  1K8A W;  4J7J A;  1M90 W;  1H2N A;  3DC5 A;  1YJ9 V;  4NKG B;  4IGG A;  4I55 A;  4MW3 A;  2YEV B;  1MZF A;  2ZE6 A;  3PJS K;  4YY3 O;  3LSU A;  4LF8 B;  4FZ0 A;  2KB1 A;  3ZBH A;  5IJ9 A;  1VP7 A;  1WPB A;  4B3M O;  2WLH A;  3J81 N;  1XL6 A;  3CJH B;  4DV0 B;  2HEP A;  4FM1 A;  5HFM A;  3CCE V;  5KHH A;  4U7N A;  4DV2 B;  4CC6 A;  5CBH A;  1EN4 A;  4F6R A;  1U97 A;  3CCJ V;  4MTF A;  1FXV A;  1FJG O;  3CRC A;  4DV1 O;  1JQ0 A;  2DWE C;  3K06 A;  3K57 A;  1SA0 A;  4PI0 A;  4TT3 G;  4CBC A;  4ZOL A;  1M5I A;  5L3F A;  1R73 A;  2ZE7 A;  5EBL C;  1FS0 G;  4AIL C;  1LNQ A;  5LYJ B;  5LMN B;  3UQ8 A;  2N74 A;  3FB8 C;  5KLV H;  4JI6 B;  1PNL A;  5JJN B;  4EKW A;  4PDR A;  1KQS U;  1BL8 A;  3SPC A;  1N32 B;  1YJW V;  1HNX O;  4KHP O;  2ZM6 B;  1OCO B;  1VF5 B;  4LFC O;  2Y0P A;  2XAJ A;  2PI5 A;  1M4U A;  4ICG A;  1HNZ O;  4WCE V;  4ZBM A;  4YHH B;  1TGO A;  4WFF A;  2F4V B;  1HNZ B;  3F7V C;  3OTO O;  3CWB H;  3I5D A;  3DXR B;  3JAK A;  1M93 A;  1V55 C;  1EZJ A;  2FL4 A;  1SQX H;  1R3J C;  4I4T A;  4O4I A;  3H1J H;  3JD3 A;  5DEC A;  4JI2 O;  2ZM6 O;  1BS3 A;  1N33 O;  4MSW C;  3TXS A;  1F23 A;  1PD3 A;  1G1X B;  4MVS A;  2WLL B;  2QJ1 A;  5LXT A;  1H2L A;  1HWY A;  4ZHQ A;  1LUV A;  2EIK C;  2JEX A;  1OJH A;  1JR9 A;  3B40 A;  4EB6 B;  2VQF B;  4CS3 A;  1K9M W;  2JGD B;  2W0F C;  3U10 A;  5EZY A;  4DV1 B;  1U96 A;  3FKS G;  1Y66 A;  3K5O A;  2BCC H;  2W0X A;  1IXB A;  4JAV A;  1JJO A;  5KX5 B;  4DV3 O;  1GN6 A;  5E79 Z;  1MSD A;  1PP9 H;  1RPO A;  3FB5 C;  2QKA A;  2Q7G A;  3TET A;  4RUE A;  5J2U A;  4YJ3 A;  4DV2 O;  1S72 V;  5LP6 C;  4P2Z A;  4O4L A;  4Z1M G;  4QIW F;  4DR5 O;  5FNV B;  1Q8I A;  2Q6A A;  1OCC B;  1SQQ H;  3L74 H;  2KQX A;  2JRI A;  4MTX A;  1GM8 A;  3CX5 F;  1TUB B;  4J41 A;  2A7W A;  4DUY B;  1QLE C;  4JV5 B;  4H44 B;  5E1A C;  4FFB B;  2B1I A;  4O2B B;  1Y67 A;  1SKV A;  3RYF B;  1ORQ C;  2BOC C;  2F1M A;  4DR2 B;  1PL0 A;  5CN0 A;  1KBH A;  3AG2 C;  1KKC A;  4O2A B;  4UUJ C;  3IC9 A;  2ZR2 A;  4I55 B;  4CH3 A;  4JI4 B;  4LF7 B;  3F5W C;  5CB4 B;  4X89 A;  1N34 O;  5KMG A;  1YF2 A;  2BE3 A;  2CTW A;  4R7C A;  4BAY A;  3AEI A;  5JH7 B;  2PF4 E;  2QKC A;  2CH7 A;  1EFR G;  2EIJ B;  4DK1 A;  5IY5 B;  2AZ2 A;  5D5Q A;  2G38 A;  2VQE O;  3AG2 B;  4YJ3 B;  2P4K A;  3S3W A;  1IBL B;  3ZMV A;  3A0B Z;  1EBO A;  4JAS A;  1M56 B;  1SES A;  4LWS A;  1H2G A;  1SS3 A;  5A9G A;  1BCC H;  4FMT A;  3M8A A;  3AG3 C;  3IJ4 A;  4MVM A;  3EVK A;  4X64 O;  2L6L A;  4A5U B;  1WP8 A;  4O4I B;  3H1H H;  2GHY A;  1YCI A;  4X20 B;  2A9H A;  2UUC O;  5IWA O;  1EN6 A;  2ILM A;  2PYJ A;  2D2C B;  1YVW A;  3SPI A;  4O4H A;  2NNU A;  3K3W A;  3ABU A;  3P3N A;  4K8X A;  3GB7 C;  3RYH B;  4YIO A;  4BIO A;  1VQL V;  2ZXW B;  2GV9 A;  2Y4U A;  1D2D A;  1N36 B;  2Q7E A;  1QCE A;  2WSS G;  4P9P A;  1BT8 A;  3ICX A;  5ITZ B;  4B3T O;  3ETG A;  2E5L B;  4FLW A;  2ZT9 B;  1CP9 A;  2YIA A;  2E3C A;  1L8D A;  1XNR B;  1NBM G;  2XUM A;  4JI1 B;  2BTQ A;  5KA5 A;  3AK1 A;  4IT5 A;  1HDJ A;  3CP1 A;  2YDE A;  3OR6 C;  4PEL A;  3T1H B;  4U3J B;  4MTG A;  5D5P A;  3RWR D;  3WB2 A;  4J42 A;  2EIL C;  1RFY A;  1K97 A;  4LNU A;  4TV8 B;  3JYC A;  3SPH A;  3ASN B;  4TQF A;  2JJ1 G;  4J11 A;  1KD1 W;  1N32 O;  3BFR A;  4JV5 O;  5BR8 B;  1K92 A;  4O2B A;  2M7W A;  4NTW A;  4QGP A;  5KUM A;  3KG2 A;  5IJ9 B;  1IBM O;  1BZK A;  4DUY O;  2A06 H;  1XMQ O;  3D8C A;  5JQG A;  4GKJ O;  4DV5 B;  4IL6 Z;  1N4C A;  2LJ2 A;  4R50 A;  4UV8 A;  1FFX B;  3C3T A;  2EIM C;  3JD1 A;  3WU2 Z;  4TUY B;  1K4C C;  3QO5 A;  3BPZ A;  1AR1 B;  3CC2 V;  1XMQ B;  3UM7 A;  1MOF A;  3K0D A;  1KUQ A;  1AP6 A;  2UXD B;  1HNX B;  4KHP B;  4NVP A;  1QLN A;  3ZED A;  1T5E A;  4EFE A;  1X4T A;  1F4M A;  3UO2 A;  2QE7 G;  4QPK A;  2D3O W;  4LF8 O;  2GDS A;  1FKA O;  1NVP D;  4LH6 A;  1JVM A;  2KKW A;  3ETE A;  3K08 A;  3G4S V;  1ENV A;  3RW0 A;  2Y48 A;  1VEW A;  2DJV A;  1CEZ A;  3BVO A;  4QNH B;  2EBO A;  1JFF B;  1BE3 H;  4NXM O;  4DR4 B;  1P84 F;  1JOY A;  1URF A;  3JAT A;  4JZ2 A;  4DR5 B;  3RN4 A;  1Q7Y W;  1K5S A;  3UKM A;  2DW4 A;  3OW2 U;  1FAF A;  1GRJ A;  2YUA A;  1S76 D;  4B3R O;  3A0R A;  4PHZ A;  5CB4 A;  3CXC U;  2CAZ C;  4O4H B;  3ZRX A;  4UVA A;  2FTK A;  2R9R B;  3D36 C;  3T1Y B;  1P4R A;  1A32 A;  2WLL A;  4MW8 A;  3ZJZ A;  2PY5 A;  3QTC A;  2C2A A;  4B3T B;  2JVD A;  2R9A A;  1VQK V;  3U11 A;  1FXK A;  4K35 A;  3ABL B;  3HKC A;  4MVR A;  1N36 O;  4YJ2 A;  3E22 A;  2Q4P A;  3JSL A;  1OV9 A;  2YID A;  3HPL C;  5BMV A;  2BSK B;  2ZCE A;  5B1B B;  1QNM A;  3KCX A;  3K5M A;  4DYL A;  3SGI A;  1Z5W A;  1QU7 A;  3T4D A;  1ZAU A;  4JI2 B;  2ATK C;  1COW G;  2VWJ A;  2MW2 B;  1K33 A;  2CTQ A;  1I5X A;  3B2E E;  3K9A A;  1BSM A;  4XDK A;  2EUL A;  1VQ5 V;  3G67 A;  4GZR B;  2AW9 A;  5CA0 B;  1Q86 W;  4X1K B;  4X62 B;  1Y6X A;  3SJQ C;  3K03 A;  4JGS A;  1SQF A;  4I5S A;  3H9V A;  4GLX A;  3ZHR A;  2XAF A;  3RYF A;  1YSC A;  2WLN A;  4B3M B;  3ABK B;  1K3E A;  5CA1 A;  3KZI Z;  4QJF B;  1MZE A;  2QWO B;  2ZR3 A;  1SA0 B;  1JA8 A;  1NI8 A;  1Q6H A;  2LW1 A;  2HP8 A;  2ODM A;  4U3J A;  3A0H Z;  4WBN A;  2ZE5 A;  2GUZ A;  2LGW A;  3ZHS A;  1SQP H;  1NJI W;  2ZD9 A;  5JH7 A;  1K7D A;  4PA4 A;  2X0L A;  3AG4 C;  3ASN C;  4I50 B;  1KP2 A;  4EB6 A;  3ML0 A;  5B3S C;  4JI8 B;  5LMU B;  4PA9 A;  1G8M A;  4LP8 A;  4DXW A;  4LH7 A;  2IM9 A;  5KX5 A;  1WA8 A;  2X6C A;  1RSO B;  5EK0 A;  3OE7 G;  5GON B;  1BQZ A;  4X1K A;  4X64 B;  3SYQ A;  3ZMT A;  4G2K A;  2JS3 A;  4YXW G;  1V54 C;  3FYI B;  1OCZ C;  2DWD C;  3E89 A;  1PNK A;  1XQ8 A;  2ADQ B;  1WP7 A;  2CTR A;  4JI7 B;  1ARO P;  5DM6 V;  3OUS A;  5IYD O;  3WG7 C;  3E86 A;  3FYE B;  2EJR A;  3L73 H;  1VQP V;  1Y76 B;  1J95 A;  3JAM N;  2QWN B;  2Q5Z A;  1Q6I A;  3ZS8 C;  3JAR A;  3HKE A;  1K5Q A;  2XAS A;  3E8G A;  4ZKI A;  4RQF A;  4J9Y B;  3FD9 A;  3RYC B;  1GMG A;  1MG1 A;  1NT2 B;  4I9Q A;  3F5T A;  2Y0I A;  3ABM C;  3W7X A;  4DR7 O;  3X2Q C;  2ZQM A;  4FM0 A;  1G6U A;  2HFE C;  4U7O A;  5JCO A;  2UXC B;  5IE9 A;  3G6B A;  3G80 A;  2QM4 A;  3OMI B;  4GX5 A;  4LF4 B;  2FKX A;  3I56 V;  1I94 B;  4PV1 B;  2BOB C;  3CCL V;  2B1G A;  3CCM V;  4UCU A;  2QGN A;  3DC6 A;  3W7S A;  1DK1 A;  3THO A;  1P49 A;  3ABM B;  2W6J G;  4JAA A;  1NR7 A;  5LYJ A;  3JAS B;  1AI7 A;  3SYO A;  3OTO B;  1Q43 A;  3RGB A;  4Q20 A;  4MVQ A;  4AQY O;  3UT5 A;  4IHJ B;  4YHH O;  3E8F A;  1QR9 A;  1IZ3 A;  4HNA A;  4X1Y B;  4BIU A;  4D6T H;  3HKD A;  1RSO A;  1XHZ A;  5BMV B;  1GM7 A;  3TCU A;  4LF9 O;  2RMK B;  4HAM A;  1XBL A;  2F95 B;  3A2F A;  4GX0 A;  2OWO A;  1IBK B;  2DQ3 A;  3T1C A;  1E79 G;  2WLM A;  2P4V A;  1M1K W;  1GO3 F;  1SQB H;  2XND G;  2ITD C;  3CYO A;  2LO1 A;  4DR3 O;  3S3X A;  3P30 A;  1Q82 W;  1RM1 C;  3TJT A;  1EZV H;  1F4N A;  2WPD G;  1BMF G;  4O2A A;  2X7R B;  3DGE A;  4UFZ A;  2Q73 A;  2Q68 A;  1S0V A;  4PA7 A;  2ZIO A;  4TV9 A;  5LGN A;  2UXB B;  2P6J A;  5L3B A;  3L75 H;  5JJE B;  2KG7 A;  3GVM A;  2CH7 B;  2JK5 C;  1VMG A;  4DV0 O;  1PM9 A;  1S77 D;  1XEQ A;  1WN7 A;  4DV7 O;  4RO2 A;  4MVU A;  1O9G A;  3Q4H A;  3B8M A;  2HJD A;  4Z1V A;  1SQG A;  4L8J A;  1YXB A;  4NXN O;  1XNQ B;  1V54 B;  5EZY B;  1JJ2 U;  3E2E A;  1TA8 A;  4LF6 B;  3CRM A;  1FXK C;  1R3L C;  3G6E V;  2YXY A;  5IT9 N;  3RVZ A;  4GT1 A;  4BIZ A;  2YSU B;  1JX9 A;  3N2G A;  3SYC A;  2N05 A;  3N2K A;  3TXQ A;  4IYI A;  1L0L H;  4LF6 O;  1V55 B;  4X62 O;  3JAT B;  4PDV A;  1NZ6 A;  3C3S A;  3RYI B;  5IYB O;  1XHX A;  2F4V O;  4PA3 A;  2YI8 A;  3EHB B;  2YXH A;  2DYS C;  4FLX A;  4JAU A;  4UB6 Z;  3RT3 C;  3OT7 A;  1VAR A;  3LSS A;  4JI5 O;  5H9C A;  2R70 A;  3CEI A;  3SJC C;  2RDC A;  4GX2 A;  1MNG A;  2XT9 A;  4E2L A;  4HNA B;  5FLX N;  1TVK A;  2JGD A;  1TAE A;  2XAH A;  4CS4 A;  5B1B C;  3MAQ A;  4FVM A;  4PDM A;  4DV3 B;  3WB0 A;  3VQX A;  2WA3 A;  4DR2 O;  2NN4 A;  2ZNI A;  3X2Q B;  3AG4 B;  2Y69 C;  4H0L B;  4WF9 V;  4CZZ A;  2XHB A;  4PD4 F;  4UV9 A;  2PYL A;  1US6 A;  4X1I A;  1Y4M A;  3EFF K;  5CBG A;  4TWK A;  2EIK B;  1VF6 C;  1S3J A;  1HW7 A;  4BW9 A;  2OCC B;  3CD6 V;  1N33 B;  4DK0 A;  1AI6 A;  4NXN B;  3AK2 A;  4C7U A;  5CBF A;  4RUF A;  3CPW U;  4D7T A;  5B1N A;  4H33 A;  1FPO A;  3OR7 C;  4DRX A;  4DW0 A;  4LFA B;  1VQO V;  2B9Z A;  2UUA B;  4JTC B;  4WBN B;  3L70 H;  3WB1 A;  5GW7 A;  2YIB D;  3ZHV A;  1R6K A;  4GCZ A;  2EIM B;  1GTO A;  4GKJ B;  1ROP A;  2WWW A;  4DR4 O;  2GBO A;  3BA9 A;  4JPR A;  4DR3 B;  3QF7 A;  2Q0O C;  1KB9 F;  3M7M X;  5JQG B;  3C90 A;  1AJP A;  1KU9 A;  2AHZ A;  2RNB A;  4JI6 O;  5H6Q A;  1V9P A;  4JI0 B;  4DR6 B;  2DYR C;  3K0G A;  2UXD O;  4UCO A;  3FFQ A;  2RJZ A;  3ZCC A;  2Q8V A;  3ZRW B;  1BGY H;  4DR7 B;  1EM1 A;  5IWA B;  3ETQ A;  4X65 O;  1KKD A;  3SJB C;  3K5N A;  1AJN A;  2OIG A;  3CXH F;  4F6E A;  4FIP C;  2VS0 A;  4O4J A;  2V7Q G;  1CXZ B;  1LR1 A;  4LFB B;  1VIB A;  2F43 G;  1NH2 D;  1SRY A;  3MHH C;  4FJC C;  3VQV A;  4JYC A;  3K58 A;  3D3Q A;  2HHH O;  4FLV A;  1D5A A;  2UXC O;  1VF6 A;  2QR4 A;  1OZ0 A;  1GM9 A;  2XOK G;  3P32 A;  4TSF G;  2EIL B;  5LGT A;  1SF9 A;  2QWR B;  4FLY A;  3BHP A;  3J80 N;  4ABM A;  4X66 O;  1GN2 A;  2CGO A;  2K1E A;  1YJN V;  3QO8 A;  1Q90 D;  1F7Y A;  2P5O A;  4X1I B;  3L72 H;  4J7Z A;  2YEV A;  5LGU A;  1IBK O;  2QWP B;  4RQE A;  4DV7 B;  1YI2 V;  4GKK O;  3CC7 V;  3ABT A;  1GAX A;  2DYR B;  2QEX V;  3VBB A;  4X1Y A;  2H94 A;  5J2T B;  2QWQ B;  3W7U A;  3K79 A;  5LXT B;  2K9P A;  2EX3 A;  2FML A;  3FB7 C;  4J9Z B;  4D7S A;  4FFK A;  2HHH B;  1VQM V;  4ZI7 A;  5LHI A;  4UCS A;  4MTO A;  5LOV A;  5EYP A;  4IHJ A;  1ZL8 B;  1HNW O;  1JCH A;  3ZMU A;  4I7Z B;  3PN1 A;  1RPR A;  3JD2 A;  2V1D A;  1N8R W;  4JYA O;  1G4Y B;  3U0Z A;  3TGU H;  2X6A A;  5J2U B;  5GTI Z;  4HZ3 A;  2VQF O;  1GKF A;  1RP3 B;  3W7T A;  1S5H C;  1VQ8 V;  5IJ0 A;  2JIZ G;  4GX1 A;  2AGA A;  5IY5 C;  3LDC A;  2IJH A;  1IVS A;  4TV9 B;  2YIB A;  3E83 A;  1H2K A;  2PUS A;  3ZRV A;  4JYB A;  2QSA A;  2IU0 A;  4JYA B;  5FNV A;  4O4J B;  1Z2G A;  1QR8 A;  3D36 A;  2DOS A;  4QE9 A;  1PNM A;  1THZ A;  3JAW A;  3CJH A;  3T4Z A;  2WLI B;  4H37 A;  1F51 A;  1ZUQ A;  3GWK C;  3AK3 A;  2KSD A;  2JGU A;  4W4L A;  1HP8 A;  2AXT Z;  1ZWI C;  4MS2 A;  2ADP A;  4G28 B;  4K8Z A;  2HLD G;  4I4T B;  2H8P C;  5JVD B;  2NLJ C;  1AIL A;  4J80 A;  3UO3 A;  3N2K B;  3N27 A;  3T1Y O;  3HKD B;  2A79 B;  5BXZ A;  3JCU Z;  4RWU A;  1AI4 A;  1QBZ A;  2QDO A;  1M56 C;  2Q9L A;  1SC5 B;  1L1F A;  5J9P C;  2A3Q A;  4MVZ A;  3OTF A;  4CH5 A;  3SYP A;  1W2B U;  5LMU O;  5A2Q N;  5JCO C;  1YTF B;  2R72 A;  5CA0 A;  3OEE G; 
#chains in the Genus database with same CATH homology
 2ZR2 A;  1AI7 A;  1Q81 W;  3ZRW A;  2DYS B;  3STL C;  3SYO A;  1NQT A;  3F5W C;  2UXN A;  4X89 A;  2EIJ C;  4MVQ A;  4Q20 A;  4OXS A;  3ZN1 A;  4BAY A;  2Z5U A;  4R7C A;  5EBM C;  2QM7 A;  3AEI A;  4LBE C;  1YIJ V;  3E8F A;  1QR9 A;  1EFR G;  2EIJ B;  3JD4 A;  5IY5 B;  5H6R A;  4BIU A;  3MHS C;  3AG2 B;  1GM7 A;  3TCU A;  5EC1 C;  4HAM A;  3ZMV A;  1EBO A;  3T2M A;  4GX0 A;  4UXN A;  2DQ3 A;  3T1C A;  5LBQ A;  1SZT A;  3G71 V;  1E79 G;  4JAS A;  2WLM A;  5L3G A;  1M56 B;  3ZMS A;  3CC4 V;  2JDI G;  1M1K W;  1SES A;  1H2G A;  1GO3 F;  2XND G;  2HVK C;  2ITD C;  4FMT A;  4JF3 A;  3AG3 C;  3CYO A;  5BZB A;  4MVM A;  2A0L A;  5L3E A;  1QVG U;  5L3D A;  3P30 A;  1NH2 B;  3OMN B;  1Q82 W;  2ZXW C;  1RM1 C;  4ASU G;  1F4N A;  3B77 A;  2GHY A;  1BMF G;  2WPD G;  1H38 A;  1M9N A;  2X7R B;  3DGE A;  2Q68 A;  1S0V A;  4PA7 A;  2A9H A;  1VQ4 V;  2IU3 A;  4MT8 A;  5LGN A;  2P6J A;  5L3B A;  4WFE A;  4N23 A;  3H01 A;  5DN6 G;  2IH3 C;  2Z3Y A;  3SPI A;  2JK5 C;  3ABK C;  4PDL A;  2NNU A;  5B3S B;  1B6Q A;  1OCO C;  2ITC C;  3K3W A;  2MK3 A;  3ABU A;  3LNM B;  1S77 D;  3BY6 A;  4I9W A;  3GB7 C;  1E1R G;  4KP4 A;  1KP3 A;  1R6N A;  4RO2 A;  4MVU A;  1YTF D;  1MSW D;  3E35 A;  3B8M A;  3GWO A;  1VQL V;  2ZXW B;  1RM1 B;  5EC2 C;  1H8H G;  4LCU C;  1V54 B;  2OTJ V;  3F7Y C;  1QCE A;  1JJ2 U;  1OCZ B;  3E2E A;  1FXK C;  1YIT V;  4MVO A;  2WSS G;  4P9P A;  1QVF U;  1R3L C;  3ZRS A;  3QNE A;  4LC1 A;  3ETG A;  2OTL V;  5LHG A;  4UVB A;  1AI5 A;  1OCR B;  1CP9 A;  3G6E V;  2IJJ A;  4F4L A;  1DTO A;  1CPY A;  4GT1 A;  1NBM G;  3RVZ A;  4BIZ A;  2YSU B;  1JX9 A;  1BHA A;  3SYC A;  1KC8 W;  5KA5 A;  2AHY A;  2LFS A;  3IC7 A;  3ZN0 A;  3CCS V;  1M57 C;  3CP1 A;  1V55 B;  3OR6 C;  4PEL A;  3CCU V;  1IXM A;  1OCR C;  4PDV A;  5FL7 G;  5IYB O;  2UXX A;  4MTG A;  1FXH A;  1YHQ V;  2EIL C;  3LDD A;  4R8C A;  4PA3 A;  1K97 A;  3OM3 B;  3EHB B;  4XDL A;  3JYC A;  5CMU A;  3SPH A;  3ASN B;  2DYS C;  2QA4 V;  3VOU A;  4JAU A;  2JJ1 G;  5B1O A;  4BW5 A;  3LSS A;  5H9C A;  4P30 A;  3D3I A;  4N21 A;  1KD1 W;  4GX2 A;  4E2L A;  1SET A;  2R9I A;  1R3I C;  2XAH A;  2Y69 B;  4XDJ A;  3BEH A;  5B1B C;  4PDM A;  1VQ7 V;  1WPX A;  2W6I G;  3RBZ A;  3CMA V;  5EBW C;  1K92 A;  2IH1 C;  1QLE B;  2M7W A;  3SPG A;  4WFB V;  5KUM A;  3TK1 A;  3KG2 A;  3LDE A;  2HKO A;  4KFM A;  4QE7 A;  1NVP B;  4L87 A;  3X2Q B;  3AG4 B;  2LP7 A;  2Y69 C;  1UJW B;  2WLK A;  4WF9 V;  2JJ2 G;  4CZZ A;  4R50 A;  4UV8 A;  4UV9 A;  1KEC A;  2EIM C;  3JD1 A;  1Y4M A;  3EFF K;  5CBG A;  4TWK A;  5L3C A;  4JTA B;  1K4C C;  2EIK B;  3QO5 A;  1S3J A;  1AR1 B;  1M57 B;  2OCC B;  3CC2 V;  3K04 A;  3CD6 V;  1XL4 A;  1W0J G;  3SYA A;  4WFH A;  3W7W A;  1AI6 A;  3UM7 A;  3FB6 C;  1MOF A;  3K0D A;  2QTO A;  5CBF A;  5IYC O;  3OAA G;  4RUF A;  3CPW U;  5B1N A;  4H33 A;  3WG7 B;  3OR7 C;  2HJF C;  1W0K G;  1QLN A;  2QKS A;  2JEU A;  1K34 A;  1VQO V;  1F4M A;  3LUT B;  4JTC B;  2QE7 G;  4QPK A;  2D3O W;  4R6Z A;  3SPJ A;  2PI4 A;  1NVP D;  5GW7 A;  2X6B A;  3I55 V;  4HYO A;  4XBF A;  1JVM A;  1R6K A;  4GCZ A;  2EIM B;  3ETE A;  1GTO A;  3K08 A;  3G4S V;  1ROP A;  2WWW A;  2XAQ A;  4KUM A;  1ENV A;  4WFA V;  3RW0 A;  1FXK B;  2OCC C;  4JPR A;  2Y48 A;  4X8A A;  1CEZ A;  2IW5 A;  4QNH B;  2EBO A;  1DF5 A;  2HG5 C;  2HVJ C;  1AJP A;  2AHZ A;  2EIN C;  1OCC C;  3OUF A;  1JOY A;  1OHH G;  5H6Q A;  3ZMZ A;  3AG1 C;  5KA6 A;  2DYR C;  1Q7Y W;  1K5S A;  2P7T C;  3E8B A;  3K0G A;  3UKM A;  2DW4 A;  2P67 A;  3OW2 U;  3MD0 A;  1VQ9 V;  5HFL A;  1S76 D;  1R3K C;  1FFT B;  1GK9 A;  3A0R A;  3R65 A;  5C93 A;  3CXC U;  3ZCC A;  4PA6 A;  3ZRX A;  4UVA A;  2FTK A;  2R9R B;  3ZRW B;  1P4R A;  2WLL A;  4MW8 A;  3ZJZ A;  2EIN B;  2WLJ A;  3LSQ A;  1KKD A;  4DO2 A;  2C2A A;  1K8A W;  5LHH A;  3ETD A;  1M90 W;  5IDJ A;  1YJ9 V;  1VQK V;  1FXK A;  1AJN A;  4FIP C;  4MW3 A;  2YEV B;  3ABL B;  4MVR A;  1TUE B;  3PJS K;  4UVC A;  1K73 W;  4QPJ A;  4JTD B;  1SER A;  2KB1 A;  3HPL C;  4X88 A;  2V7Q G;  3CCQ V;  2WLH A;  5B1B B;  2F43 G;  4FK5 C;  1XL6 A;  1NH2 D;  1SRY A;  3MHH C;  5HFM A;  4FJC C;  3CCE V;  4U7N A;  1JPX A;  3T4D A;  4JYC A;  5CBH A;  2Q69 A;  2ATK C;  1COW G;  3CCJ V;  4MTF A;  1OZ0 A;  1FXV A;  1K33 A;  1GM9 A;  1I5X A;  2XOK G;  3ASO B;  2EIL B;  2IJI A;  3P32 A;  3K9A A;  2ZDI A;  4TSF G;  5LGT A;  1WLE A;  5B1A C;  1JQ0 A;  2WLI A;  2DWE C;  3K06 A;  2LFR A;  3HB3 B;  4TT3 G;  4XDK A;  1PKX A;  4CBC A;  5L3F A;  3CCR V;  1VQ5 V;  1R73 A;  5EBL C;  1FS0 G;  2K1E A;  1LNQ A;  1Q86 W;  1I5Y A;  5B1A B;  1YJN V;  3QO8 A;  1BHB A;  1NR1 A;  3QO7 A;  1DLB A;  3SJQ C;  3WFV A;  3K03 A;  4JGS A;  3FB8 C;  3OFN G;  4I5S A;  3RVY A;  2WAM A;  1NKD A;  1PNL A;  2XAF A;  1YSC A;  2WLN A;  4EKW A;  3CME V;  4PDR A;  3ABK B;  2YEV A;  1BL8 A;  1K3E A;  3SPC A;  1KQS U;  5LGU A;  4QJF B;  1YJW V;  4RQE A;  1YI2 V;  3E8H A;  2ZR3 A;  3CC7 V;  3ABT A;  1OCO B;  2XAG A;  2QM8 A;  2DYR B;  2QEX V;  2XAJ A;  3VBB A;  2PI5 A;  2H94 A;  1NJI W;  2ZD9 A;  3W7U A;  1K7D A;  3K79 A;  4WCE V;  4ZBM A;  2IJK A;  3JD0 A;  3M99 B;  3FB7 C;  4PA4 A;  4J9Z B;  3AG4 C;  2X0L A;  3ASN C;  1VQM V;  4WFF A;  1P7B A;  1KP2 A;  3F7V C;  5LHI A;  3DTU B;  4MTO A;  3ML0 A;  5B3S C;  4PA9 A;  3ASO C;  1G8M A;  4LP8 A;  1V55 C;  1EZJ A;  4DXW A;  1JCH A;  1R3J C;  3ZMU A;  3JD3 A;  3OMA B;  1RPR A;  2EZO A;  3JD2 A;  3AG1 B;  2X6C A;  2V1D A;  1N8R W;  3IGA C;  1G4Y B;  4MSW C;  2X6A A;  5EK0 A;  5KUK A;  3OE7 G;  3ZIA G;  1F23 A;  1PD3 A;  4MVS A;  4HZ3 A;  3OEH G;  2WLL B;  3SYQ A;  3ZMT A;  4G2K A;  1GKF A;  3W7T A;  1S5H C;  1HWY A;  1VQ8 V;  4YXW G;  1V54 C;  2JIZ G;  4GX1 A;  2Q67 A;  2EIK C;  3FYI B;  5IY5 C;  1OCZ C;  2JEX A;  3LDC A;  2DWD C;  2IJH A;  3E89 A;  3STZ C;  1PNK A;  2OT5 A;  3E83 A;  1K9M W;  4WFG A;  3OGC C;  1E1Q G;  4JYB A;  3ZRV A;  2IU0 A;  1ARO P;  2GSM B;  2W0F C;  5DM6 V;  3OUS A;  1QR8 A;  3D36 A;  3FKS G;  5IYD O;  3WG7 C;  3E86 A;  1Y66 A;  3FYE B;  4QE9 A;  2EJR A;  1VQP V;  1PNM A;  2P90 A;  1THZ A;  4JAV A;  3T4Z A;  2WLI B;  1J95 A;  1RPO A;  4H37 A;  1F51 A;  3FB5 C;  3TET A;  4RUE A;  5CA3 A;  1H8E G;  1S72 V;  4P2Z A;  4Z1M G;  4FPP A;  3E8G A;  1K5Q A;  2XAS A;  4QIW F;  4ZKI A;  1ZWI C;  4RQF A;  3NXS A;  4MS2 A;  4J9Y B;  1K4D C;  4G28 B;  1GMG A;  1MG1 A;  2DQ0 A;  2HLD G;  2H8P C;  2Q6A A;  1OCC B;  3IFX A;  2NLJ C;  2B5U A;  3JCZ A;  1MAB G;  1VQN V;  4MTX A;  1GM8 A;  3ABL C;  1DF4 A;  3ABM C;  4G27 B;  3W7X A;  1AJQ A;  3X2Q C;  2ZQM A;  2A79 B;  2HFE C;  4P9O A;  4U7O A;  1AI4 A;  3AG3 B;  1QLE C;  1QBZ A;  5E1A C;  1M56 C;  3OMI B;  2HR3 A;  4GX5 A;  2B1I A;  3I56 V;  1L1F A;  5J9P C;  2BOB C;  4MVZ A;  1ORQ C;  2B1G A;  2BOC C;  3CCL V;  3CCM V;  1PL0 A;  5CN0 A;  3W7S A;  3SYP A;  2EZP A;  1W2B U;  3AG2 C;  3ABM B;  2W6J G;  2CK3 G;  1YTF B;  1NR7 A;  3CCV V;  1VQ6 V;  4UUJ C;  4RAI A;  3B8N A;  3OEE G;  2ZDI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...