2M7WA

Independently verified structure of gp41-m-mat, a membrane associated mper trimer from hiv-1 gp41
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an HIV-1-neutralizing antibody target, the lipid-bound gp41 envelope membrane proximal region trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Envelope glycoprotein
total genus 10
structure length 59
sequence length 59
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2m7wA00
4N21A 2LP7A 4FK5C 5H9CA 1QCEA 3H01A 2EBOA 3WFVA 1Y66A 3P30A 4E2LA 3B77A 1K34A 1JPXA 1F23A 3M99B 5HFMA 2MK3A 1JQ0A 3MHHC 2X7RB 3MHSC 3CP1A 1QR8A 1K33A 1SZTA 3GWOA 1DLBA 4G2KA 3B8NA 2EZOA 5KA5A 3K9AA 4FIPC 1MG1A 5CMUA 1DF4A 4JF3A 2OT5A 2EZPA 2M7WA 1QBZA 5CN0A 5KA6A 2P6JA 4FJCC 1MOFA 1EBOA 4JPRA 4N23A 4JGSA 1Y4MA 3B8MA 1ENVA 1QR9A 5HFLA 3CYOA 1I5XA 1DF5A 1I5YA
chains in the Genus database with same CATH superfamily
3RWRD 5IT9N 4DRXA 2WA4A 3ASNC 1GKFA 1GRJA 1GN3A 1R3LC 2QKSA 4MW3A 1KD1W 2ZIOA 3HR0A 5K1XA 2Q69A 3SYCA 2UXCB 3HPLC 5GONB 2VWKA 2CE4A 3JD3A 1RM1B 4YJ3B 1HNXO 4H13B 5B1AB 1M9NA 2EINB 3SPHA 1YIJV 5DEDA 2OIGA 1YTFD 1OCZC 3L73H 1KP2A 1OCCB 2CGNA 1NS1A 3ZJZA 2CGOA 3W7UA 1OCCC 4LFAB 4ASUG 4JYAB 3B8MA 2YEVB 1DK1A 1M4UA 1AI5A 2QDOA 3JD4A 1PP9H 1A32A 1XNRB 4X66B 2N04A 1Y66A 4R50A 3R65A 3VBBA 1YF2A 2WSSG 3CCRV 2EIMB 1SQQH 4HNAA 3BRCA 1IX9A 2CTPA 4JI8B 4I55A 2F1MA 2P6JA 4DV3B 2ODMA 5E1AC 1WLEA 3RN4A 3M8AA 4OXSA 4UVAA 1HP8A 4I4TA 3SYPA 4P2ZA 1FXVA 3ZMZA 3RYFB 1O9GA 3U11A 4X64O 4W4LA 1SA0B 1V54C 4JI2O 3T1HB 1S76D 3CCVV 2EIKB 1KMIZ 3DC5A 5IJ0B 1BCCH 3FKSG 4X88A 1ZAUA 1SERA 3L9DA 3HKDA 1YXBA 4TWKA 4YIOA 1OV9A 2CDYA 4GKKO 3T1YO 3ZRXA 5KA5A 3U0ZA 1PNMA 1HR0B 1JA8A 2EZPA 4NXNO 4R7CA 1VQPV 2E75B 2VQFB 3A8TA 5H5NA 1URFA 2F43G 2FTKA 1EN6A 2JRIA 4QIWF 1H8HG 1ZTEA 4GYCB 1T5EA 4FMTA 2ZDIC 4B08A 4WFAV 4O2BA 4X1YA 5L3BA 3K9SA 4I50B 1NKDA 4LF4O 4QPKA 1G6UA 1AR1B 4O4LA 1U97A 1MNGA 2Q6AA 3CJHB 4PI0A 2QKAA 3TXQA 3CCJV 4MTXA 3WFVA 1YI2V 2ZE8A 3K0GA 3I56V 4NKGB 2UUBB 3D36A 4FM1A 4YY3B 1VARA 4FM0A 2CK3G 1XL6A 3QO5A 3JAKA 2DMXA 3CCQV 4GCZA 3T4ZA 1VF7A 1SKVA 3WB1A 1MMMA 1WNSA 1XOUA 4O4JB 2Q73A 2AZ2A 2DYRC 5GTHZ 4PELA 1D5NA 3B77A 3R66A 1K34A 4UB8Z 1WA8A 4JYCA 4PHZA 3A0BZ 4HBNA 2UUCO 1OZ0A 3G71V 3DGEA 2EIJB 4ZOLA 5TISZ 4KUMA 2ZE5A 2W6IG 1WB8A 2OYQA 1S0VA 2PGGA 1S77D 1K9MW 4X1IA 3OMAB 2A7WA 3FYIB 4FLXA 2QE7G 5L3CA 2ATKC 1JX9A 4Z1VA 1N36B 4JI7O 3NXSA 3CEIA 2Q7EA 1NZ6A 2Y4TA 2EILB 3MDSA 1KB9F 1PL0A 3KCYA 4WBNB 2JVDA 4X1KA 3RVZA 1MSWD 1M93A 4JTDB 2DW4A 3ZRSA 4LF8B 1K8AW 4WFHA 3CCSV 3Q4HA 2JJ1G 1W0KG 2P22C 1WB7A 3ETGA 4KP4A 4OPAA 5EIBC 1BQ0A 3UO2A 3X2QC 5GTIZ 5ITZA 3STLC 1LUWA 3QO8A 3J80N 2FB5A 4J7KA 1HW7A 2ZD9A 1S5HC 1IBKO 4UCRA 5JVDA 3FB7C 2RJZA 4H0LB 4E4EA 5GW7A 3JYCA 3ABMB 1LNQA 2EILC 2BOBC 4IL6Z 2CUGA 4MSWC 3E83A 1Q6IA 3F7YC 4X8AA 2PYLA 1L0LH 2Q8VA 2HLDG 3K59A 4FZ1A 3JAKB 4CS3A 1VP7A 4UCOA 2AHYA 4B7KA 3DSQA 4DV5O 2QJ1A 1EZJA 2IM9A 4YY3O 2KG7A 2WWWA 4U7OA 3RVYA 4R6ZA 4CH4A 5CB4A 3VQYA 3CX5F 3CRCA 1QCEA 4TV9B 5LMUB 4AQYO 1H2GA 3STZC 4I0XA 2ZM6O 2XNDG 1N33O 2XAJA 1WJZA 4O2AB 2QSAA 2OCHA 4O4LB 4LFAO 3HKEB 1IXBA 1YSCA 1K73W 3DXRA 2XAQA 4DV6O 4FK5C 5IDJA 3IC7A 1YHQV 4ZI7B 4J9YB 2BOCC 5C8YB 4DXWA 1HNZO 1GTOA 3BFRA 4DV0O 1XEQA 5CA0B 2EIMC 2RN9A 5KHHA 4LH6A 5CN0A 3HKDB 5IYZA 2F4VB 3P3NA 1QNMA 2HHHO 2N05A 3ABKB 5IJ9A 1R1BA 1XBLA 2EULA 2EBOA 3I5DA 2R9IA 2BTQA 4K3AA 3SJAC 1AI7A 3ICXA 4DW0A 3K08A 5LA6A 2E76B 2YICA 3E22B 2D3OW 5B5EZ 3E22A 4DUYB 4LF7O 2NLJC 4DUZB 2Z5UA 4BW5A 3OFNG 1MA1A 3T1HO 2Y4UA 2RDCA 2WLLB 4J41A 1H38A 4OX9O 4JYBA 3E89A 1KKDA 1RFYA 3VQWA 3SYAA 1F7YA 5EC1C 3N2GB 1XI1A 1EN4A 1JQ0A 3HKBB 4FFBA 2R9RB 3T1YB 3CXCU 5CBFA 4RQFA 1QBZA 4FJCC 4JI6O 5CBHA 4LWSA 2XAGA 4TOIA 1TA8A 1S5LZ 1YITV 1XMOB 2OTJV 4AQYB 1V55B 5KHIA 2GBOA 4BW9A 2E3CA 3H1IH 5EZYB 4WFBV 2NN4A 5C8YA 3FX7A 3UKMA 3OR7C 1NQTA 2D2CB 4B3MO 2HP8A 2YS8A 2YXHA 1ZL8B 5J9PC 1Q7YW 4HNAB 1NU1H 1JR9A 5J2UB 1IDSA 1I7FA 4ZKIA 3TJTA 2YEVA 4RAIA 2DYSB 2OWOA 3ZMTA 1IURA 3H1JH 1M1KW 2KSDA 1K92A 1YEWA 3ZN0A 1JOYA 3K04A 1R6KA 2H8PC 2LGQA 1ZL8A 1RPRA 1YTFB 4B3SO 4LP8A 1GN4A 3ZRWB 4QE9A 4JAAA 5JVDB 4UB6Z 2E5LO 2IJJA 3SPCA 1XMQO 4NTWA 5KLVH 3A0RA 4TSFG 3CB2A 4J10A 3C3TA 3AG1B 2E74B 4TT3G 3RYCA 2OTLV 4X62O 3OM3B 3ZIAG 3EHBB 1AI6A 3M99B 2LO1A 2DE0X 3RT3C 1TGOA 2R9AA 5CB4B 3SYQA 1P4RA 2ZCEA 3ML0A 5AG2A 4NXMB 3I55V 4X65B 1QR9A 1BS3A 1VF6C 2Q5ZA 3K57A 1Y76A 2ZE7A 4ZIBA 3CRAA 3ABLC 1NH2D 1N34O 1NH2B 5LHIA 1K4DC 3HKBA 3BA9A 1TUBB 2RQ6A 1FJGO 1XREA 4OGQB 3GWKC 4TUYA 3OE7G 4LF4B 2LFRA 5CA0A 4EEQA 1ROPA 1I94B 1ENVA 5BMVA 1GM7A 1AJQA 1FXHA 4WFEA 4DR3B 4U3FH 4UVBA 2QKCA 3KZIZ 5H9CA 2XAHA 1HNWB 4WCEV 3L72H 3FAVA 1SZXA 1VQ4V 4D6TH 4WFFA 1TVKB 1CXZB 2EZOA 3AEIA 2DWDC 4TQDA 5JJEB 2CTRA 3B4SA 2B1IA 2IH3C 2XASA 4EFEA 3JAMN 5KUKA 3AG1C 2LFSA 1Q86W 2EINC 4Z2WA 4JI5O 1X59A 1SS3A 5KAIZ 1PD3A 5C93A 1IBLB 4P30A 3OUFA 4XDKA 3F5WC 1P84F 1OCRB 2XAFA 3G67A 2R70A 2QWNB 2YUAA 2BE3A 4DV7B 2K1EA 4O4JA 1SRYA 2A0LA 2YC0A 4DR6O 4F4LA 1YJ9V 4JYAO 4YJ2B 4KHPO 2YSUB 4JI0B 5BR8O 3CCLV 1X4TA 4TUYB 2RCVA 4JZGA 4EB6B 3MAQA 1XNRO 3K5MA 3J7AU 3LDDA 4PDVA 5FLXN 1H2SB 5BMVB 1BGYH 1BE3H 3ZHSA 2K9PA 1QHTA 1P7BA 4IHJB 3B40A 2WA3A 4CBCA 3OW2U 4DV4B 2EX3A 1K97A 4X65O 2HHHB 2P06A 4I50A 4DV1O 4UV9A 1L1FA 5B1OA 2YDEA 1G4YB 4GX0A 2WLNA 5B66Z 1NTZH 5JJJB 3FB8C 2UXBO 2JGDB 2XTAA 1N32B 1EZVH 1WPXA 1YZBA 1HWYA 2BTOA 2BTQB 1RPOA 4K8ZA 5LMNO 2GUZA 1Q3EA 1VQLV 4HAMA 2FL4A 5L3EA 4RQEA 4MW8A 1BQZA 1BSMA 4XDLA 4B3TO 2JS5A 4QGPA 3ZMSA 4UUJC 2KB1A 3IC9A 2VQFO 3L74H 2PI4A 3H1KH 3MHSC 3QTCA 5JQGA 1TAEA 3D3QA 4PA7A 2OIEA 2L6LA 4CH6A 3T4DA 1YJWV 1P49A 4YHHB 1AI4A 3SJBC 3VOUA 1GM9A 2XT9A 4KHPB 3RGBA 5BR8B 4UVCA 3JCUZ 5IYBO 1Q90D 5KUMA 3JD0A 1NR7A 2X6CA 1XUQA 1K5SA 4CC6A 2KG7B 4CS4A 2GV9A 2IBZH 1S3JA 2YXYA 3JAWB 3SR2C 2HR3A 4KFMA 5J2UA 3DC6A 4DR4O 3AK3A 3CCEV 1NJIW 4LFCB 5EBWC 3CMEV 1AB3A 1RP3B 2F95B 2B9ZA 3HKCA 4IGGA 2VWJA 1FAFA 2VQEO 2EIJC 3FFQA 4O4IB 3CC7V 5EZYA 2EIKC 2YI8A 2P90A 3AG4B 3O9OA 5H6RA 4MVZA 3OR6C 2Q0AA 4EFBA 1JFFB 5JQGB 4PA6A 2P67A 2F66C 3OGIB 3SDLA 5B3SB 3ETEA 3LDCA 1AJNA 5F2VO 5LGTA 2QM4A 3E35A 1H8EG 3LDEA 2LW1A 5IJ0A 4DW1A 1SQXH 3H9VA 4YXWG 1QVFU 4KXRA 1FFTB 3ASOB 2PYJA 1M90W 3GB7C 5KHGA 5EIBD 1FD9A 2QWRB 1VQ7V 2AXTZ 4I4TB 1MZFA 1KYOF 3QVNA 4G27B 2MK3A 1SQGA 4MT8A 1QR8A 1FJGB 5EYPB 1WN7A 4LF5B 1E79G 1R3KC 3OEHG 2PUSA 3NR7A 1GH6A 5L3GA 5JJNB 5LOVA 2W6JG 4YHHO 4RWUA 1V9PA 4O4HB 1QVGU 4JV5B 4GX2A 4W4KA 2A3QA 2ETNA 1OCOC 4JTCB 2HJFC 3P32A 3W7WA 2HJDA 3DXRB 3WG7C 1ORQC 3F7VC 2JS3A 4IIJB 5KA6A 4PDLA 2JEXA 2QEXV 4FM2A 3J81N 4B3SB 1YVWA 1M5IA 4NB5A 3AG2C 4JI5B 2EJ7A 1GK9A 4X20A 4DR5B 2Z0AA 1F51A 3JD1A 1VQKV 4U7NA 2Q9LA 3KCXA 4DV7O 4WFGA 1DGSA 2PTMA 1GMGA 4P9PA 1W2BU 5BZBA 3O65A 5IYDO 3JD2A 4H44B 2CH7A 1F4MA 2ZIMA 4RUFA 3ZHTA 4H33A 3ZN1A 5J2TA 4G28B 4GKJO 4NVPA 4K8XA 1EBOA 4NXNB 3WG7B 2UXDB 5CA1B 1Z5VA 5IYCO 3G4SV 1I5XA 2HVJC 1FXKA 1J95A 3P30A 4DV1B 1R6NA 4WF9V 1BZKA 1JPXA 2DQ0A 2ADQB 2GDSA 3N2KB 2IJIA 4JI1B 4JI2B 4LF9O 2P7TC 5B1AC 2G38A 4L87A 1FXKC 4LH7A 4DR2B 3SPJA 5FL7G 4I7ZB 2WLKA 4QPJA 3UT5B 1F4NA 4JI4O 1OHHG 2IJHA 3BAAA 1FFXA 1YCIA 3TCUA 3EXAA 3CC2V 4DR7O 1XNQO 3N2KA 1GM8A 5KMGA 4B3TB 1E1QG 3ABTA 3LUTB 3H1LH 4LF6O 1VQ8V 3BCCH 1Y4MA 1R6TA 4JI6B 2QWOB 1E1RG 2Q68A 5K1PA 4DR1O 5IJ9B 3CWBH 3FB5C 5B3SC 1V55C 1R73A 4JAUA 3ZMVA 4DYLA 1SQBH 3E8HA 3ZRWA 1K7DA 4B3RO 1M56B 2CH7B 2UUAO 3E2EA 1G8MA 3JATB 4F6RB 4GT1A 3SJQC 3K58A 1WPBA 4TV8A 2XUMA 3K0DA 4JAVA 4BIZA 5FNVA 2GTSA 5BXZA 3ZHRA 5IWAB 3HKEA 4K0KB 5LP6B 3SPGA 4X20B 5KAFZ 4PDMA 4Z1MG 4IYIA 1CP9A 1GO3F 1OCRC 3WB2A 4I0XB 2QTOA 2QTSA 1W59A 1Q6HA 3ZHVA 2UUCB 2L35A 3QO7A 5KHKA 1JJ2U 3K5OA 1OCZB 4Q6GA 4PI2A 1N0JA 1VIBA 4FVMA 4BAYA 1N8RW 3AG3B 5LP6C 3W7XA 2X0LA 2Q4PA 1VF6A 2NNUA 4N21A 4JTAB 3CCMV 3CSXA 5CBGA 2DJVA 5H6QA 5L3DA 4X9QA 1N36O 1HNZB 4GKKB 4DV0B 1AP6A 3JASB 4ZHQA 2Z3YA 1US6A 1N4CA 4PA3A 1DTOA 3ZS8C 3UCSC 2DN9A 2F4VO 2A06H 2LW7A 1N34B 2ZNJA 2ZE6A 4B7EA 1M57B 5LA6B 3N2GA 5LXTA 1BL8A 4OPHA 1GN6A 2ZM6B 3BHPA 1DLBA 3B8NA 2GTAA 3JSLA 5LBQA 1PV0A 4DK1A 4PD4F 1I94O 1Q5OA 5EK0A 5A9GA 2WLMA 1KP3A 4X66O 1J5EO 4DV6B 3OT7A 4E2LA 1Q43A 1HDJA 3OGCC 4J11A 4JV5O 3K79A 1BHBA 3L71H 2WLJA 1VQ6V 4PA4A 4ZOLB 4DV3O 1R3IC 1QLEC 5A2QN 1LUVA 4J7JA 3CMAV 3JATA 2JGUA 1H2NA 3E8GA 3C3SA 4O4IA 2HVKC 3OAAG 5FNVB 1PKXA 2YIBA 3BEHA 1F23A 3KG2A 1PPJH 5LGUA 2ZINA 3CC4V 2LGWA 3A2FA 3K3WA 3CS5A 4TV9A 3G6BA 1ZLZA 3W7TA 1Y74A 2ZDIA 3N27A 1QLEB 3ZBHA 2IH1C 2QWQB 3ABUA 1O9HA 5KX5A 3BY6A 2V7QG 2XHBA 1AR5A 1KBHA 2DWEC 4UCSA 1NTKH 2W0XA 1U96A 3OUSA 3JASA 3AG7A 4ZHQB 2DOSA 1LR1A 3UT5A 3ZEDA 4DO2A 4DRXB 1AP5A 2HEPA 2ZXWB 4LF8O 5JH7A 3U10A 4J7ZA 3ASNB 4CS2A 3JARB 2JDIG 3UQ8A 3ZRVA 3OMNB 3HB3B 3CXHF 1WAZA 1WP8A 3CE2A 5GONA 3T1CA 1SZTA 1M57C 4FLVA 4DUYO 4LF7B 4LFBB 2JIZG 2VS0A 3SPIA 2GUZB 2HKOA 4IT5A 3SJCC 2CTQA 4JASA 1J5EB 1EM1A 3TK1A 3K5LA 4BIOA 2CTWA 1S5JA 3MHHC 2X7RB 1IBMB 4UXNA 3RYIA 1JCHA 1KC8W 4WBNA 4DV5B 1GAXA 2YXLA 1HNXB 3K5NA 1JJOA 5IYZB 3JSNA 4JGSA 3QG5A 1JFFA 5LYJB 2AW9A 2B5UA 1XMOO 2ZR2A 2V1DA 3PN1A 3CD6V 4MTGA 3APQA 5IY5C 4ABMA 1THZA 3RFRA 4I5SA 2A9HA 1WA8B 4PV1B 3F5TA 1K33A 3GWOA 3ETDA 1D5AA 3TETA 4MVSA 1PM9A 5BY1A 4MS2A 4JI3O 1DF4A 1IBKB 2UUAB 2OCCC 4N23A 3THOA 1JVMA 2JEUA 2UXXA 4IHJA 4MVMA 3RW0A 1COWG 4BR6A 1PNKA 3FAVB 4UFZA 1H2LA 4PDRA 2X6AA 4J9ZB 4C7UA 1KQSU 4EKWA 2BCCH 5LL6Y 4JI8O 4LNUA 2UU9B 2UXDO 1XDCA 5DECA 1GN2A 4UCVA 4NXMO 3BABA 3ZCCA 3E8BA 4MVOA 5KMGB 3H01A 3FD9A 1KU9A 1XHXA 3QF7A 1UFIA 2LJ2A 1NR1A 4O4HA 4AHCA 4UCTA 1TVKA 4XDJA 4IYHA 4FLYA 2VQEB 4I9WA 2QR4A 3MD0A 2OT5A 3AG4C 3C90A 1ZSPA 3KKYA 4GUNA 1MOFA 2Y69C 2ZR3A 4I9QA 1QU7A 1NI8A 1KKCA 1BT8A 2AZ0A 4UV8A 3B2EE 5CA1A 3P3PA 1B3QA 1FYJA 3E86A 2Q7HA 1AVMA 1YJNV 1HNWO 2IJKA 1MZEA 3A0HZ 4GLXA 2PY5A 1VMGA 2RNBA 3VQXA 4AILC 1L8DA 3X2QB 4LBEC 1NT2B 2ZKOA 1XL4A 5ITZB 2ZT9B 4DV4O 2Y48A 4DR1B 1IXMA 5LHGA 5KX5B 2QGNA 2IU3A 1FXKB 2F23A 1Q8IA 1Y74B 4LNUB 3IJ4A 1FPOA 5JCOA 1OJHA 2YIDA 4X1KB 2ZNIA 4JF3A 4JI3B 4X89A 4X1IB 5KHJA 2UXBB 4J42A 2WLHA 5J2TB 2FYUH 3D8CA 2R72A 2GHYA 1CEZA 4YJ2A 5LMNB 3CJHA 3EFFK 1JMKC 2DYSC 2P5OA 5EBMC 3OEEG 4CZZA 2UXCO 3TXSA 3AK1A 4BIUA 2H3OA 4JPRA 3RYCB 3UM7A 1S72V 3CRMA 3IGAC 3RYHB 1K3EA 4GZRB 2ARHA 1UJWB 3OD4A 5FPRA 1MG1A 4RUEA 2EJRA 2GSMB 4UCUA 2X6BA 1YDXA 4AI8A 1I08A 2BSKB 4QNHB 1N32O 5LOVB 5DM6V 4X62B 1QLNA 3CRRA 1B6QA 2Y0IA 3E8FA 4DK0A 1TUEB 4O2BB 4X1YB 3LSQA 3ZMUA 4DV2B 1MSDA 3FB6C 3CCUV 4D7SA 1L0NH 3L70H 2XOKG 3TGUH 3JALA 2JK5C 1SA0A 1UPGA 4MTOA 2AGAA 2HG5C 1PNLA 3VQVA 4F6EA 3M7MX 5EYPA 4MVRA 4MVQA 3ABMC 5LGNA 4R8CA 2OCCB 4LFCO 1XMQB 4PA9A 3AG3C 1R3JC 4JZ2A 2Y0PA 2JGDA 2P4VA 4LF9B 3D3IA 1SF9A 2Q7GA 3RYFA 4DR2O 2YI9A 4B3MB 3EVKA 5B1BB 1RM1C 1RSOB 2VRZA 2B1GA 5H2FZ 3LSUA 1XHZA 1KUQA 1SQPH 5D5QA 5CA3A 1EN5A 2QWPB 1VQNV 5JH7B 3AK2A 1H2KA 1BHAA 2V4DA 5L3FA 2M7WA 1NVPD 4A5UB 5LP6A 3OTOO 2Y69B 1Z5WA 1ZWIC 2HFEC 2ZQMA 3BPZA 1NVPB 4O2AA 4GX5A 4H37A 3BVOA 1SETA 1VEWA 4GX1A 5LMUO 4EB6A 4NYKA 3JALB 2BSKA 4CC5A 2W0FC 2E5LB 2WLIA 5IE9A 4FZ0A 2LQTA 3CP1A 1Z2GA 4G2KA 4B3RB 2CAZC 4TQFA 1KECA 2PZSA 1B04A 3HKCB 1M56C 4I55B 1ZX3A 2UXNA 3B09A 3SYOA 1Q82W 3IFXA 4DR6B 1V54B 3ZHUA 1I5YA 3RYHA 4FLUA 2FKXA 4YJ3A 3JAWA 1OCOB 4K0KO 4LC1A 4FPPA 3LNNA 4CH3A 4KL1A 5JCOC 1Q81W 2N74A 1D2DA 5FPOA 1W0JG 1WP7A 3DTUB 2UU9O 2JJ2G 3RYIB 3IAYA 4DR4B 1NTMH 1SQFA 1MABG 2QA4V 4TV8B 1FKAO 4YIPA 4HYOA 1IVSA 1BMFG 4LFBO 2IW5A 1G1XB 1N0NA 2O57A 3BA8A 4LF5O 4DR5O 5LXTB 5E79Z 4FFBB 2PI5A 3CRQA 1K4CC 5DN6G 4OX9B 3ZHQA 5HFLA 2H94A 5CMUA 3ASOC 3K03A 3Q4HB 5EC2C 4HZ3A 2MW2B 1QQCA 5B1NA 1IBMO 2WLLA 4U3JA 2WAMA 4U3JB 2WPDG 1Y67A 3ETQA 1CPYA 4JI7B 1FFXB 2YIAA 1HR0O 4ICGA 2QM7A 1Y6XA 3T2MA 3UO3A 3OTOB 4LCUC 3QNEA 3PJSK 2LP7A 2ZXWC 3L75H 1I0HA 2Q67A 1IBLO 1VF5B 4CH5A 2YIBD 1EFRG 1SESA 5LHHA 1ZUQA 2KKWA 3H1HH 1SQVH 1AJPA 1VQ9V 4FLZA 3K06A 4MTFA 1AROP 5JWPA 4JI0O 2DYRB 4JYYA 3CYOA 4ZI7A 1DF5A 2P4KA 4QE7A 1XILA 3ABLB 2FMLA 2A79B 4Q20A 4F6RA 2UUBO 3APOA 4P9OA 4RO2A 2M6YA 1XQ8A 2ADPA 4BWAA 4NR1A 4L8JA 1XNQB 1NBMG 4D7TA 5LYJA 3W7SA 2DQ3A 4FLTA 5B1BC 2F93B 1VQOV 3ZX6A 3WU2Z 1AILA 1K5QA 1IZ3A 2KQXA 4NTYA 3ABKC 2WLIB 1FS0G 3OMIB 4FLWA 3LNMB 4LR3A 1Q6UA 2QM8A 3RBZA 1PL4A 4FIPC 1N33B 4JI1O 3S3WA 4QJFB 4FFKA 1VQMV 1SC5B 1Y76B 4MVUA 4XBFA 3GVMA 1AR4A 5IY5B 3G6EV 4JI4B 2C2AA 4ZBMA 2ITCC 3CHXA 3LSSA 1TUBA 4PJ0Z 4DV2O 4J80A 5EBLC 5IWAO 2RMKB 1H2MA 2ILMA 4DR7B 4GKJB 4LWSB 4IIJA 2PF4E 2IU0A 4LF6B 3D36C 3WB0A 2NR5A 2AHZA 2ITDC 3FYEB 4X64B 4NTXA 5HFMA 2Q0OC 3SGIA 3JCZA 3K9AA 1P7GA 1RSOA 1VQ5V 4K35A 3AG2B 3S3XA 1B06A 4DUZO 4DR3O 3JARA 3CPWU 3OTFA 3G80A 5D5PA
chains in the Genus database with same CATH topology
5IYDO 3E86A 3ASNC 3JD2A 1GKFA 1YJNV 1R3LC 2QKSA 2IJKA 1F4MA 4MW3A 4RUFA 4ZKIA 1KD1W 4H33A 3ZN1A 2Q69A 3SYCA 3HPLC 2YEVA 4G28B 4RAIA 2DYSB 3JD3A 3ZMTA 1M1KW 1K92A 3ZN0A 1RM1B 3X2QB 1EBOA 4LBEC 1JOYA 3WG7B 3K04A 1R6KA 2H8PC 1XL4A 5IYCO 5B1AB 3G4SV 1I5XA 2Y48A 1M9NA 1RPRA 2HVJC 1YTFB 2EINB 3SPHA 1FXKA 4LP8A 1YIJV 3ZRWB 1IXMA 5LHGA 1YTFD 4QE9A 1J95A 3P30A 1OCZC 2IU3A 1R6NA 1KP2A 1OCCB 1JPXA 4WF9V 2DQ0A 1FXKB 2IJIA 2IJJA 3SPCA 3ZJZA 2P7TC 4JF3A 4L87A 5B1AC 1FXKC 3W7UA 3A0RA 4TSFG 4X89A 1OCCC 3AG1B 4TT3G 3SPJA 5FL7G 4ASUG 3B8MA 2WLKA 2OTLV 2WLHA 2YEVB 4QPJA 3OM3B 1AI5A 3JD4A 1F4NA 3ZIAG 1OHHG 2IJHA 2GHYA 1CEZA 3EHBB 1Y66A 4R50A 3R65A 3TCUA 3VBBA 2WSSG 1AI6A 3M99B 3CC2V 3EFFK 2DYSC 3CCRV 2EIMB 5EBMC 3OEEG 3SYQA 1GM8A 1P4RA 4CZZA 3ML0A 1E1QG 3ABTA 2P6JA 4BIUA 3LUTB 5E1AC 1WLEA 4JPRA 4UVAA 4OXSA 3I55V 1S72V 3UM7A 1Y4MA 1VQ8V 1QR9A 1E1RG 3IGAC 2Q68A 3ABLC 1NH2D 1K3EA 3SYPA 4P2ZA 1FXVA 3ZMZA 1NH2B 3FB5C 5LHIA 5B3SC 1K4DC 1V55C 1R73A 4JAUA 3ZMVA 1UJWB 1V54C 3E8HA 3OE7G 3ZRWA 1K7DA 1MG1A 2EJRA 2GSMB 2LFRA 4RUEA 1M56B 1S76D 1ROPA 3CCVV 2X6BA 2EIKB 3E2EA 1G8MA 3FKSG 4X88A 1ENVA 4QNHB 1GM7A 1AJQA 1FXHA 4WFEA 1SERA 5DM6V 4UVBA 4GT1A 1QLNA 1B6QA 5H9CA 3SJQC 3E8FA 1TUEB 2XAHA 4WCEV 4JAVA 3K0DA 3LSQA 4TWKA 3ZMUA 4BIZA 1VQ4V 4WFFA 3FB6C 3SPGA 3ZRXA 3CCUV 2EZOA 5KA5A 3AEIA 2DWDC 4PDMA 1PNMA 2XOKG 4Z1MG 2JK5C 2EZPA 2B1IA 2IH3C 1CP9A 1GO3F 4R7CA 2XASA 1OCRC 5KUKA 4MTOA 1VQPV 2HG5C 3AG1C 1PNLA 2QTOA 2F43G 2FTKA 4MVRA 4MVQA 3ABMC 2LFSA 5LGNA 4QIWF 1H8HG 1Q86W 4R8CA 2EINC 2OCCB 4FMTA 2ZDIC 1PD3A 3QO7A 5C93A 4P30A 1JJ2U 3OUFA 4XDKA 3F5WC 1OCZB 1OCRB 2XAFA 4WFAV 4PA9A 3AG3C 1R3JC 5L3BA 3D3IA 1NKDA 2K1EA 4QPKA 1SRYA 2A0LA 5B1BB 4BAYA 1RM1C 1N8RW 3AG3B 1AR1B 4F4LA 2Q6AA 3W7XA 1YJ9V 3CCJV 2X0LA 4MTXA 2B1GA 2YSUB 2NNUA 4N21A 3CCLV 4JTAB 3WFVA 3CCMV 1YI2V 3K0GA 5CBGA 3I56V 5H6QA 3LDDA 4PDVA 5L3DA 5CA3A 1VQNV 3D36A 2CK3G 1XL6A 3QO5A 1BHAA 3CCQV 2Z3YA 4GCZA 3T4ZA 1P7BA 4PA3A 5L3FA 2M7WA 1NVPD 1DTOA 4CBCA 3OW2U 2Y69B 2HFEC 1ZWIC 1NVPB 2ZQMA 1K97A 4GX5A 4H37A 1SETA 2DYRC 1M57B 4GX1A 4UV9A 1L1FA 4PELA 1BL8A 3B77A 1K34A 4JYCA 2W0FC 2WLIA 5B1OA 1OZ0A 3G71V 3CP1A 3DGEA 2EIJB 1DLBA 4G2KA 3B8NA 1G4YB 5LBQA 1KECA 4KUMA 4GX0A 2WLNA 2W6IG 1M56C 3FB8C 2UXNA 3SYOA 1Q82W 3IFXA 1S0VA 1WPXA 1S77D 5EK0A 1K9MW 1V54B 2WLMA 1KP3A 1HWYA 3OMAB 1I5YA 3FYIB 1RPOA 2QE7G 4E2LA 1VQLV 1OCOB 3OGCC 4HAMA 4FPPA 4LC1A 5L3CA 2ATKC 3K79A 1BHBA 1JX9A 5L3EA 3NXSA 4RQEA 2WLJA 1VQ6V 4MW8A 4XDLA 2EILB 1Q81W 4PA4A 1R3IC 1W0JG 1QLEC 1PL0A 3CMAV 3ZMSA 3DTUB 4UUJC 3RVZA 2KB1A 2JJ2G 1MSWD 3E8GA 4JTDB 2DW4A 3ZRSA 2PI4A 1K8AW 4WFHA 3CCSV 2JJ1G 2HVKC 3OAAG 1MABG 1PKXA 1W0KG 3ETGA 4KP4A 2QA4V 3BEHA 1F23A 3KG2A 3MHSC 4HYOA 5LGUA 3CC4V 3X2QC 4PA7A 1BMFG 3K3WA 3STLC 2IW5A 3QO8A 3W7TA 2ZD9A 1S5HC 3T4DA 2PI5A 1YJWV 2ZDIA 3FB7C 1K4CC 1AI4A 5DN6G 1QLEB 5GW7A 2IH1C 3JYCA 3ABUA 5HFLA 3ABMB 3VOUA 2H94A 5CMUA 1GM9A 3ASOC 3BY6A 1LNQA 2EILC 2V7QG 3K03A 5EC2C 2BOBC 2DWEC 4MSWC 4HZ3A 3E83A 3F7YC 4UVCA 5IYBO 4X8AA 5B1NA 2WLLA 2HLDG 5KUMA 2WAMA 3JD0A 3OUSA 1NR7A 2WPDG 2X6CA 2AHYA 1CPYA 1EZJA 2WWWA 4U7OA 1K5SA 2QM7A 3RVYA 4R6ZA 4DO2A 3T2MA 1S3JA 2HR3A 4LCUC 3QNEA 4KFMA 3PJSK 2LP7A 1QCEA 2ZXWC 2ZXWB 2Q67A 3CCEV 3ASNB 1H2GA 1NJIW 2JDIG 3STZC 5EBWC 3ZRVA 2XNDG 3CMEV 3OMNB 3HB3B 3T1CA 1SZTA 1EFRG 1SESA 5LHHA 1M57C 2XAJA 2EIJC 3CC7V 2JIZG 2EIKC 1AJPA 1VQ9V 2P90A 3SPIA 3AG4B 2HKOA 5H6RA 3K06A 3OR6C 4MVZA 4MTFA 1AROP 1YSCA 1K73W 2DYRB 3CYOA 1DF5A 2XAQA 4PA6A 2P67A 4FK5C 4JASA 5B3SB 3ETEA 3LDCA 5IDJA 3IC7A 1AJNA 4QE7A 5LGTA 1YHQV 3E35A 3TK1A 4J9YB 2BOCC 3ABLB 1H8EG 2A79B 3LDEA 4Q20A 4DXWA 3MHHC 2X7RB 1GTOA 4P9OA 4YXWG 1QVFU 4RO2A 4UXNA 1JCHA 2EIMC 1KC8W 1FFTB 3ASOB 1NBMG 1M90W 5CN0A 3W7SA 3GB7C 2DQ3A 5B1BC 4JGSA 1VQOV 1VQ7V 3ABKB 2B5UA 1K5QA 2ZR2A 2EBOA 2V1DA 3CD6V 4MTGA 2R9IA 5IY5C 1THZA 3ABKC 4G27B 2WLIB 4I5SA 2MK3A 1FS0G 2A9HA 1AI7A 3OMIB 3LNMB 4MT8A 2QM8A 3RBZA 1QR8A 1K33A 3GWOA 3K08A 3ETDA 3TETA 4MVSA 4FIPC 1E79G 1R3KC 4MS2A 2D3OW 1DF4A 3OEHG 5L3GA 2NLJC 2Z5UA 4QJFB 4BW5A 3OFNG 2W6JG 1VQMV 2OCCC 4N23A 1JVMA 2JEUA 2WLLB 1H38A 2UXXA 4JYBA 3E89A 4MVUA 4XBFA 1KKDA 1QVGU 4MVMA 3RW0A 5IY5B 3SYAA 1COWG 3G6EV 1PNKA 2C2AA 2ITCC 4GX2A 4ZBMA 3LSSA 5EC1C 3W7WA 1OCOC 4JTCB 2HJFC 1JQ0A 3P32A 4PDRA 2X6AA 5EBLC 4J9ZB 2R9RB 3WG7C 5CBFA 3CXCU 4RQFA 1ORQC 3F7VC 1KQSU 4EKWA 1QBZA 5KA6A 4FJCC 4PDLA 5CBHA 2JEXA 2XAGA 2IU0A 2QEXV 3ZCCA 3E8BA 4MVOA 3H01A 2AHZA 1YITV 2ITDC 3FYEB 3AG2C 2OTJV 5HFMA 1V55B 1NR1A 1GK9A 3JCZA 3K9AA 4XDJA 4WFBV 1VQ5V 4I9WA 1F51A 3JD1A 2OT5A 3AG4C 3MD0A 1VQKV 4U7NA 3UKMA 3OR7C 3AG2B 1MOFA 1NQTA 2Y69C 2ZR3A 4WFGA 4UV8A 1GMGA 5J9PC 4P9PA 3CPWU 1Q7YW 1W2BU 5BZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N21 A;  2LP7 A;  4FK5 C;  5H9C A;  1QCE A;  3H01 A;  2EBO A;  3WFV A;  1Y66 A;  3P30 A;  4E2L A;  3B77 A;  1K34 A;  1JPX A;  1F23 A;  3M99 B;  5HFM A;  2MK3 A;  1JQ0 A;  3MHH C;  2X7R B;  3MHS C;  3CP1 A;  1QR8 A;  1K33 A;  1SZT A;  3GWO A;  1DLB A;  4G2K A;  3B8N A;  2EZO A;  5KA5 A;  3K9A A;  4FIP C;  1MG1 A;  5CMU A;  1DF4 A;  4JF3 A;  2OT5 A;  2EZP A;  2M7W A;  1QBZ A;  5CN0 A;  5KA6 A;  2P6J A;  4FJC C;  1MOF A;  1EBO A;  4JPR A;  4N23 A;  4JGS A;  1Y4M A;  3B8M A;  1ENV A;  1QR9 A;  5HFL A;  3CYO A;  1I5X A;  1DF5 A;  1I5Y A; 
#chains in the Genus database with same CATH topology
 3RWR D;  5IT9 N;  4DRX A;  2WA4 A;  3ASN C;  1GKF A;  1GRJ A;  1GN3 A;  1R3L C;  2QKS A;  4MW3 A;  1KD1 W;  2ZIO A;  3HR0 A;  5K1X A;  2Q69 A;  3SYC A;  2UXC B;  3HPL C;  5GON B;  2VWK A;  2CE4 A;  3JD3 A;  1RM1 B;  4YJ3 B;  1HNX O;  4H13 B;  5B1A B;  1M9N A;  2EIN B;  3SPH A;  1YIJ V;  5DED A;  2OIG A;  1YTF D;  1OCZ C;  3L73 H;  1KP2 A;  1OCC B;  2CGN A;  1NS1 A;  3ZJZ A;  2CGO A;  3W7U A;  1OCC C;  4LFA B;  4ASU G;  4JYA B;  3B8M A;  2YEV B;  1DK1 A;  1M4U A;  1AI5 A;  2QDO A;  3JD4 A;  1PP9 H;  1A32 A;  1XNR B;  4X66 B;  2N04 A;  1Y66 A;  4R50 A;  3R65 A;  3VBB A;  1YF2 A;  2WSS G;  3CCR V;  2EIM B;  1SQQ H;  4HNA A;  3BRC A;  1IX9 A;  2CTP A;  4JI8 B;  4I55 A;  2F1M A;  2P6J A;  4DV3 B;  2ODM A;  5E1A C;  1WLE A;  3RN4 A;  3M8A A;  4OXS A;  4UVA A;  1HP8 A;  4I4T A;  3SYP A;  4P2Z A;  1FXV A;  3ZMZ A;  3RYF B;  1O9G A;  3U11 A;  4X64 O;  4W4L A;  1SA0 B;  1V54 C;  4JI2 O;  3T1H B;  1S76 D;  3CCV V;  2EIK B;  1KMI Z;  3DC5 A;  5IJ0 B;  1BCC H;  3FKS G;  4X88 A;  1ZAU A;  1SER A;  3L9D A;  3HKD A;  1YXB A;  4TWK A;  4YIO A;  1OV9 A;  2CDY A;  4GKK O;  3T1Y O;  3ZRX A;  5KA5 A;  3U0Z A;  1PNM A;  1HR0 B;  1JA8 A;  2EZP A;  4NXN O;  4R7C A;  1VQP V;  2E75 B;  2VQF B;  3A8T A;  5H5N A;  1URF A;  2F43 G;  2FTK A;  1EN6 A;  2JRI A;  4QIW F;  1H8H G;  1ZTE A;  4GYC B;  1T5E A;  4FMT A;  2ZDI C;  4B08 A;  4WFA V;  4O2B A;  4X1Y A;  5L3B A;  3K9S A;  4I50 B;  1NKD A;  4LF4 O;  4QPK A;  1G6U A;  1AR1 B;  4O4L A;  1U97 A;  1MNG A;  2Q6A A;  3CJH B;  4PI0 A;  2QKA A;  3TXQ A;  3CCJ V;  4MTX A;  3WFV A;  1YI2 V;  2ZE8 A;  3K0G A;  3I56 V;  4NKG B;  2UUB B;  3D36 A;  4FM1 A;  4YY3 B;  1VAR A;  4FM0 A;  2CK3 G;  1XL6 A;  3QO5 A;  3JAK A;  2DMX A;  3CCQ V;  4GCZ A;  3T4Z A;  1VF7 A;  1SKV A;  3WB1 A;  1MMM A;  1WNS A;  1XOU A;  4O4J B;  2Q73 A;  2AZ2 A;  2DYR C;  5GTH Z;  4PEL A;  1D5N A;  3B77 A;  3R66 A;  1K34 A;  4UB8 Z;  1WA8 A;  4JYC A;  4PHZ A;  3A0B Z;  4HBN A;  2UUC O;  1OZ0 A;  3G71 V;  3DGE A;  2EIJ B;  4ZOL A;  5TIS Z;  4KUM A;  2ZE5 A;  2W6I G;  1WB8 A;  2OYQ A;  1S0V A;  2PGG A;  1S77 D;  1K9M W;  4X1I A;  3OMA B;  2A7W A;  3FYI B;  4FLX A;  2QE7 G;  5L3C A;  2ATK C;  1JX9 A;  4Z1V A;  1N36 B;  4JI7 O;  3NXS A;  3CEI A;  2Q7E A;  1NZ6 A;  2Y4T A;  2EIL B;  3MDS A;  1KB9 F;  1PL0 A;  3KCY A;  4WBN B;  2JVD A;  4X1K A;  3RVZ A;  1MSW D;  1M93 A;  4JTD B;  2DW4 A;  3ZRS A;  4LF8 B;  1K8A W;  4WFH A;  3CCS V;  3Q4H A;  2JJ1 G;  1W0K G;  2P22 C;  1WB7 A;  3ETG A;  4KP4 A;  4OPA A;  5EIB C;  1BQ0 A;  3UO2 A;  3X2Q C;  5GTI Z;  5ITZ A;  3STL C;  1LUW A;  3QO8 A;  3J80 N;  2FB5 A;  4J7K A;  1HW7 A;  2ZD9 A;  1S5H C;  1IBK O;  4UCR A;  5JVD A;  3FB7 C;  2RJZ A;  4H0L B;  4E4E A;  5GW7 A;  3JYC A;  3ABM B;  1LNQ A;  2EIL C;  2BOB C;  4IL6 Z;  2CUG A;  4MSW C;  3E83 A;  1Q6I A;  3F7Y C;  4X8A A;  2PYL A;  1L0L H;  2Q8V A;  2HLD G;  3K59 A;  4FZ1 A;  3JAK B;  4CS3 A;  1VP7 A;  4UCO A;  2AHY A;  4B7K A;  3DSQ A;  4DV5 O;  2QJ1 A;  1EZJ A;  2IM9 A;  4YY3 O;  2KG7 A;  2WWW A;  4U7O A;  3RVY A;  4R6Z A;  4CH4 A;  5CB4 A;  3VQY A;  3CX5 F;  3CRC A;  1QCE A;  4TV9 B;  5LMU B;  4AQY O;  1H2G A;  3STZ C;  4I0X A;  2ZM6 O;  2XND G;  1N33 O;  2XAJ A;  1WJZ A;  4O2A B;  2QSA A;  2OCH A;  4O4L B;  4LFA O;  3HKE B;  1IXB A;  1YSC A;  1K73 W;  3DXR A;  2XAQ A;  4DV6 O;  4FK5 C;  5IDJ A;  3IC7 A;  1YHQ V;  4ZI7 B;  4J9Y B;  2BOC C;  5C8Y B;  4DXW A;  1HNZ O;  1GTO A;  3BFR A;  4DV0 O;  1XEQ A;  5CA0 B;  2EIM C;  2RN9 A;  5KHH A;  4LH6 A;  5CN0 A;  3HKD B;  5IYZ A;  2F4V B;  3P3N A;  1QNM A;  2HHH O;  2N05 A;  3ABK B;  5IJ9 A;  1R1B A;  1XBL A;  2EUL A;  2EBO A;  3I5D A;  2R9I A;  2BTQ A;  4K3A A;  3SJA C;  1AI7 A;  3ICX A;  4DW0 A;  3K08 A;  5LA6 A;  2E76 B;  2YIC A;  3E22 B;  2D3O W;  5B5E Z;  3E22 A;  4DUY B;  4LF7 O;  2NLJ C;  4DUZ B;  2Z5U A;  4BW5 A;  3OFN G;  1MA1 A;  3T1H O;  2Y4U A;  2RDC A;  2WLL B;  4J41 A;  1H38 A;  4OX9 O;  4JYB A;  3E89 A;  1KKD A;  1RFY A;  3VQW A;  3SYA A;  1F7Y A;  5EC1 C;  3N2G B;  1XI1 A;  1EN4 A;  1JQ0 A;  3HKB B;  4FFB A;  2R9R B;  3T1Y B;  3CXC U;  5CBF A;  4RQF A;  1QBZ A;  4FJC C;  4JI6 O;  5CBH A;  4LWS A;  2XAG A;  4TOI A;  1TA8 A;  1S5L Z;  1YIT V;  1XMO B;  2OTJ V;  4AQY B;  1V55 B;  5KHI A;  2GBO A;  4BW9 A;  2E3C A;  3H1I H;  5EZY B;  4WFB V;  2NN4 A;  5C8Y A;  3FX7 A;  3UKM A;  3OR7 C;  1NQT A;  2D2C B;  4B3M O;  2HP8 A;  2YS8 A;  2YXH A;  1ZL8 B;  5J9P C;  1Q7Y W;  4HNA B;  1NU1 H;  1JR9 A;  5J2U B;  1IDS A;  1I7F A;  4ZKI A;  3TJT A;  2YEV A;  4RAI A;  2DYS B;  2OWO A;  3ZMT A;  1IUR A;  3H1J H;  1M1K W;  2KSD A;  1K92 A;  1YEW A;  3ZN0 A;  1JOY A;  3K04 A;  1R6K A;  2H8P C;  2LGQ A;  1ZL8 A;  1RPR A;  1YTF B;  4B3S O;  4LP8 A;  1GN4 A;  3ZRW B;  4QE9 A;  4JAA A;  5JVD B;  4UB6 Z;  2E5L O;  2IJJ A;  3SPC A;  1XMQ O;  4NTW A;  5KLV H;  3A0R A;  4TSF G;  3CB2 A;  4J10 A;  3C3T A;  3AG1 B;  2E74 B;  4TT3 G;  3RYC A;  2OTL V;  4X62 O;  3OM3 B;  3ZIA G;  3EHB B;  1AI6 A;  3M99 B;  2LO1 A;  2DE0 X;  3RT3 C;  1TGO A;  2R9A A;  5CB4 B;  3SYQ A;  1P4R A;  2ZCE A;  3ML0 A;  5AG2 A;  4NXM B;  3I55 V;  4X65 B;  1QR9 A;  1BS3 A;  1VF6 C;  2Q5Z A;  3K57 A;  1Y76 A;  2ZE7 A;  4ZIB A;  3CRA A;  3ABL C;  1NH2 D;  1N34 O;  1NH2 B;  5LHI A;  1K4D C;  3HKB A;  3BA9 A;  1TUB B;  2RQ6 A;  1FJG O;  1XRE A;  4OGQ B;  3GWK C;  4TUY A;  3OE7 G;  4LF4 B;  2LFR A;  5CA0 A;  4EEQ A;  1ROP A;  1I94 B;  1ENV A;  5BMV A;  1GM7 A;  1AJQ A;  1FXH A;  4WFE A;  4DR3 B;  4U3F H;  4UVB A;  2QKC A;  3KZI Z;  5H9C A;  2XAH A;  1HNW B;  4WCE V;  3L72 H;  3FAV A;  1SZX A;  1VQ4 V;  4D6T H;  4WFF A;  1TVK B;  1CXZ B;  2EZO A;  3AEI A;  2DWD C;  4TQD A;  5JJE B;  2CTR A;  3B4S A;  2B1I A;  2IH3 C;  2XAS A;  4EFE A;  3JAM N;  5KUK A;  3AG1 C;  2LFS A;  1Q86 W;  2EIN C;  4Z2W A;  4JI5 O;  1X59 A;  1SS3 A;  5KAI Z;  1PD3 A;  5C93 A;  1IBL B;  4P30 A;  3OUF A;  4XDK A;  3F5W C;  1P84 F;  1OCR B;  2XAF A;  3G67 A;  2R70 A;  2QWN B;  2YUA A;  2BE3 A;  4DV7 B;  2K1E A;  4O4J A;  1SRY A;  2A0L A;  2YC0 A;  4DR6 O;  4F4L A;  1YJ9 V;  4JYA O;  4YJ2 B;  4KHP O;  2YSU B;  4JI0 B;  5BR8 O;  3CCL V;  1X4T A;  4TUY B;  2RCV A;  4JZG A;  4EB6 B;  3MAQ A;  1XNR O;  3K5M A;  3J7A U;  3LDD A;  4PDV A;  5FLX N;  1H2S B;  5BMV B;  1BGY H;  1BE3 H;  3ZHS A;  2K9P A;  1QHT A;  1P7B A;  4IHJ B;  3B40 A;  2WA3 A;  4CBC A;  3OW2 U;  4DV4 B;  2EX3 A;  1K97 A;  4X65 O;  2HHH B;  2P06 A;  4I50 A;  4DV1 O;  4UV9 A;  1L1F A;  5B1O A;  2YDE A;  1G4Y B;  4GX0 A;  2WLN A;  5B66 Z;  1NTZ H;  5JJJ B;  3FB8 C;  2UXB O;  2JGD B;  2XTA A;  1N32 B;  1EZV H;  1WPX A;  1YZB A;  1HWY A;  2BTO A;  2BTQ B;  1RPO A;  4K8Z A;  5LMN O;  2GUZ A;  1Q3E A;  1VQL V;  4HAM A;  2FL4 A;  5L3E A;  4RQE A;  4MW8 A;  1BQZ A;  1BSM A;  4XDL A;  4B3T O;  2JS5 A;  4QGP A;  3ZMS A;  4UUJ C;  2KB1 A;  3IC9 A;  2VQF O;  3L74 H;  2PI4 A;  3H1K H;  3MHS C;  3QTC A;  5JQG A;  1TAE A;  3D3Q A;  4PA7 A;  2OIE A;  2L6L A;  4CH6 A;  3T4D A;  1YJW V;  1P49 A;  4YHH B;  1AI4 A;  3SJB C;  3VOU A;  1GM9 A;  2XT9 A;  4KHP B;  3RGB A;  5BR8 B;  4UVC A;  3JCU Z;  5IYB O;  1Q90 D;  5KUM A;  3JD0 A;  1NR7 A;  2X6C A;  1XUQ A;  1K5S A;  4CC6 A;  2KG7 B;  4CS4 A;  2GV9 A;  2IBZ H;  1S3J A;  2YXY A;  3JAW B;  3SR2 C;  2HR3 A;  4KFM A;  5J2U A;  3DC6 A;  4DR4 O;  3AK3 A;  3CCE V;  1NJI W;  4LFC B;  5EBW C;  3CME V;  1AB3 A;  1RP3 B;  2F95 B;  2B9Z A;  3HKC A;  4IGG A;  2VWJ A;  1FAF A;  2VQE O;  2EIJ C;  3FFQ A;  4O4I B;  3CC7 V;  5EZY A;  2EIK C;  2YI8 A;  2P90 A;  3AG4 B;  3O9O A;  5H6R A;  4MVZ A;  3OR6 C;  2Q0A A;  4EFB A;  1JFF B;  5JQG B;  4PA6 A;  2P67 A;  2F66 C;  3OGI B;  3SDL A;  5B3S B;  3ETE A;  3LDC A;  1AJN A;  5F2V O;  5LGT A;  2QM4 A;  3E35 A;  1H8E G;  3LDE A;  2LW1 A;  5IJ0 A;  4DW1 A;  1SQX H;  3H9V A;  4YXW G;  1QVF U;  4KXR A;  1FFT B;  3ASO B;  2PYJ A;  1M90 W;  3GB7 C;  5KHG A;  5EIB D;  1FD9 A;  2QWR B;  1VQ7 V;  2AXT Z;  4I4T B;  1MZF A;  1KYO F;  3QVN A;  4G27 B;  2MK3 A;  1SQG A;  4MT8 A;  1QR8 A;  1FJG B;  5EYP B;  1WN7 A;  4LF5 B;  1E79 G;  1R3K C;  3OEH G;  2PUS A;  3NR7 A;  1GH6 A;  5L3G A;  5JJN B;  5LOV A;  2W6J G;  4YHH O;  4RWU A;  1V9P A;  4O4H B;  1QVG U;  4JV5 B;  4GX2 A;  4W4K A;  2A3Q A;  2ETN A;  1OCO C;  4JTC B;  2HJF C;  3P32 A;  3W7W A;  2HJD A;  3DXR B;  3WG7 C;  1ORQ C;  3F7V C;  2JS3 A;  4IIJ B;  5KA6 A;  4PDL A;  2JEX A;  2QEX V;  4FM2 A;  3J81 N;  4B3S B;  1YVW A;  1M5I A;  4NB5 A;  3AG2 C;  4JI5 B;  2EJ7 A;  1GK9 A;  4X20 A;  4DR5 B;  2Z0A A;  1F51 A;  3JD1 A;  1VQK V;  4U7N A;  2Q9L A;  3KCX A;  4DV7 O;  4WFG A;  1DGS A;  2PTM A;  1GMG A;  4P9P A;  1W2B U;  5BZB A;  3O65 A;  5IYD O;  3JD2 A;  4H44 B;  2CH7 A;  1F4M A;  2ZIM A;  4RUF A;  3ZHT A;  4H33 A;  3ZN1 A;  5J2T A;  4G28 B;  4GKJ O;  4NVP A;  4K8X A;  1EBO A;  4NXN B;  3WG7 B;  2UXD B;  5CA1 B;  1Z5V A;  5IYC O;  3G4S V;  1I5X A;  2HVJ C;  1FXK A;  1J95 A;  3P30 A;  4DV1 B;  1R6N A;  4WF9 V;  1BZK A;  1JPX A;  2DQ0 A;  2ADQ B;  2GDS A;  3N2K B;  2IJI A;  4JI1 B;  4JI2 B;  4LF9 O;  2P7T C;  5B1A C;  2G38 A;  4L87 A;  1FXK C;  4LH7 A;  4DR2 B;  3SPJ A;  5FL7 G;  4I7Z B;  2WLK A;  4QPJ A;  3UT5 B;  1F4N A;  4JI4 O;  1OHH G;  2IJH A;  3BAA A;  1FFX A;  1YCI A;  3TCU A;  3EXA A;  3CC2 V;  4DR7 O;  1XNQ O;  3N2K A;  1GM8 A;  5KMG A;  4B3T B;  1E1Q G;  3ABT A;  3LUT B;  3H1L H;  4LF6 O;  1VQ8 V;  3BCC H;  1Y4M A;  1R6T A;  4JI6 B;  2QWO B;  1E1R G;  2Q68 A;  5K1P A;  4DR1 O;  5IJ9 B;  3CWB H;  3FB5 C;  5B3S C;  1V55 C;  1R73 A;  4JAU A;  3ZMV A;  4DYL A;  1SQB H;  3E8H A;  3ZRW A;  1K7D A;  4B3R O;  1M56 B;  2CH7 B;  2UUA O;  3E2E A;  1G8M A;  3JAT B;  4F6R B;  4GT1 A;  3SJQ C;  3K58 A;  1WPB A;  4TV8 A;  2XUM A;  3K0D A;  4JAV A;  4BIZ A;  5FNV A;  2GTS A;  5BXZ A;  3ZHR A;  5IWA B;  3HKE A;  4K0K B;  5LP6 B;  3SPG A;  4X20 B;  5KAF Z;  4PDM A;  4Z1M G;  4IYI A;  1CP9 A;  1GO3 F;  1OCR C;  3WB2 A;  4I0X B;  2QTO A;  2QTS A;  1W59 A;  1Q6H A;  3ZHV A;  2UUC B;  2L35 A;  3QO7 A;  5KHK A;  1JJ2 U;  3K5O A;  1OCZ B;  4Q6G A;  4PI2 A;  1N0J A;  1VIB A;  4FVM A;  4BAY A;  1N8R W;  3AG3 B;  5LP6 C;  3W7X A;  2X0L A;  2Q4P A;  1VF6 A;  2NNU A;  4N21 A;  4JTA B;  3CCM V;  3CSX A;  5CBG A;  2DJV A;  5H6Q A;  5L3D A;  4X9Q A;  1N36 O;  1HNZ B;  4GKK B;  4DV0 B;  1AP6 A;  3JAS B;  4ZHQ A;  2Z3Y A;  1US6 A;  1N4C A;  4PA3 A;  1DTO A;  3ZS8 C;  3UCS C;  2DN9 A;  2F4V O;  2A06 H;  2LW7 A;  1N34 B;  2ZNJ A;  2ZE6 A;  4B7E A;  1M57 B;  5LA6 B;  3N2G A;  5LXT A;  1BL8 A;  4OPH A;  1GN6 A;  2ZM6 B;  3BHP A;  1DLB A;  3B8N A;  2GTA A;  3JSL A;  5LBQ A;  1PV0 A;  4DK1 A;  4PD4 F;  1I94 O;  1Q5O A;  5EK0 A;  5A9G A;  2WLM A;  1KP3 A;  4X66 O;  1J5E O;  4DV6 B;  3OT7 A;  4E2L A;  1Q43 A;  1HDJ A;  3OGC C;  4J11 A;  4JV5 O;  3K79 A;  1BHB A;  3L71 H;  2WLJ A;  1VQ6 V;  4PA4 A;  4ZOL B;  4DV3 O;  1R3I C;  1QLE C;  5A2Q N;  1LUV A;  4J7J A;  3CMA V;  3JAT A;  2JGU A;  1H2N A;  3E8G A;  3C3S A;  4O4I A;  2HVK C;  3OAA G;  5FNV B;  1PKX A;  2YIB A;  3BEH A;  1F23 A;  3KG2 A;  1PPJ H;  5LGU A;  2ZIN A;  3CC4 V;  2LGW A;  3A2F A;  3K3W A;  3CS5 A;  4TV9 A;  3G6B A;  1ZLZ A;  3W7T A;  1Y74 A;  2ZDI A;  3N27 A;  1QLE B;  3ZBH A;  2IH1 C;  2QWQ B;  3ABU A;  1O9H A;  5KX5 A;  3BY6 A;  2V7Q G;  2XHB A;  1AR5 A;  1KBH A;  2DWE C;  4UCS A;  1NTK H;  2W0X A;  1U96 A;  3OUS A;  3JAS A;  3AG7 A;  4ZHQ B;  2DOS A;  1LR1 A;  3UT5 A;  3ZED A;  4DO2 A;  4DRX B;  1AP5 A;  2HEP A;  2ZXW B;  4LF8 O;  5JH7 A;  3U10 A;  4J7Z A;  3ASN B;  4CS2 A;  3JAR B;  2JDI G;  3UQ8 A;  3ZRV A;  3OMN B;  3HB3 B;  3CXH F;  1WAZ A;  1WP8 A;  3CE2 A;  5GON A;  3T1C A;  1SZT A;  1M57 C;  4FLV A;  4DUY O;  4LF7 B;  4LFB B;  2JIZ G;  2VS0 A;  3SPI A;  2GUZ B;  2HKO A;  4IT5 A;  3SJC C;  2CTQ A;  4JAS A;  1J5E B;  1EM1 A;  3TK1 A;  3K5L A;  4BIO A;  2CTW A;  1S5J A;  3MHH C;  2X7R B;  1IBM B;  4UXN A;  3RYI A;  1JCH A;  1KC8 W;  4WBN A;  4DV5 B;  1GAX A;  2YXL A;  1HNX B;  3K5N A;  1JJO A;  5IYZ B;  3JSN A;  4JGS A;  3QG5 A;  1JFF A;  5LYJ B;  2AW9 A;  2B5U A;  1XMO O;  2ZR2 A;  2V1D A;  3PN1 A;  3CD6 V;  4MTG A;  3APQ A;  5IY5 C;  4ABM A;  1THZ A;  3RFR A;  4I5S A;  2A9H A;  1WA8 B;  4PV1 B;  3F5T A;  1K33 A;  3GWO A;  3ETD A;  1D5A A;  3TET A;  4MVS A;  1PM9 A;  5BY1 A;  4MS2 A;  4JI3 O;  1DF4 A;  1IBK B;  2UUA B;  2OCC C;  4N23 A;  3THO A;  1JVM A;  2JEU A;  2UXX A;  4IHJ A;  4MVM A;  3RW0 A;  1COW G;  4BR6 A;  1PNK A;  3FAV B;  4UFZ A;  1H2L A;  4PDR A;  2X6A A;  4J9Z B;  4C7U A;  1KQS U;  4EKW A;  2BCC H;  5LL6 Y;  4JI8 O;  4LNU A;  2UU9 B;  2UXD O;  1XDC A;  5DEC A;  1GN2 A;  4UCV A;  4NXM O;  3BAB A;  3ZCC A;  3E8B A;  4MVO A;  5KMG B;  3H01 A;  3FD9 A;  1KU9 A;  1XHX A;  3QF7 A;  1UFI A;  2LJ2 A;  1NR1 A;  4O4H A;  4AHC A;  4UCT A;  1TVK A;  4XDJ A;  4IYH A;  4FLY A;  2VQE B;  4I9W A;  2QR4 A;  3MD0 A;  2OT5 A;  3AG4 C;  3C90 A;  1ZSP A;  3KKY A;  4GUN A;  1MOF A;  2Y69 C;  2ZR3 A;  4I9Q A;  1QU7 A;  1NI8 A;  1KKC A;  1BT8 A;  2AZ0 A;  4UV8 A;  3B2E E;  5CA1 A;  3P3P A;  1B3Q A;  1FYJ A;  3E86 A;  2Q7H A;  1AVM A;  1YJN V;  1HNW O;  2IJK A;  1MZE A;  3A0H Z;  4GLX A;  2PY5 A;  1VMG A;  2RNB A;  3VQX A;  4AIL C;  1L8D A;  3X2Q B;  4LBE C;  1NT2 B;  2ZKO A;  1XL4 A;  5ITZ B;  2ZT9 B;  4DV4 O;  2Y48 A;  4DR1 B;  1IXM A;  5LHG A;  5KX5 B;  2QGN A;  2IU3 A;  1FXK B;  2F23 A;  1Q8I A;  1Y74 B;  4LNU B;  3IJ4 A;  1FPO A;  5JCO A;  1OJH A;  2YID A;  4X1K B;  2ZNI A;  4JF3 A;  4JI3 B;  4X89 A;  4X1I B;  5KHJ A;  2UXB B;  4J42 A;  2WLH A;  5J2T B;  2FYU H;  3D8C A;  2R72 A;  2GHY A;  1CEZ A;  4YJ2 A;  5LMN B;  3CJH A;  3EFF K;  1JMK C;  2DYS C;  2P5O A;  5EBM C;  3OEE G;  4CZZ A;  2UXC O;  3TXS A;  3AK1 A;  4BIU A;  2H3O A;  4JPR A;  3RYC B;  3UM7 A;  1S72 V;  3CRM A;  3IGA C;  3RYH B;  1K3E A;  4GZR B;  2ARH A;  1UJW B;  3OD4 A;  5FPR A;  1MG1 A;  4RUE A;  2EJR A;  2GSM B;  4UCU A;  2X6B A;  1YDX A;  4AI8 A;  1I08 A;  2BSK B;  4QNH B;  1N32 O;  5LOV B;  5DM6 V;  4X62 B;  1QLN A;  3CRR A;  1B6Q A;  2Y0I A;  3E8F A;  4DK0 A;  1TUE B;  4O2B B;  4X1Y B;  3LSQ A;  3ZMU A;  4DV2 B;  1MSD A;  3FB6 C;  3CCU V;  4D7S A;  1L0N H;  3L70 H;  2XOK G;  3TGU H;  3JAL A;  2JK5 C;  1SA0 A;  1UPG A;  4MTO A;  2AGA A;  2HG5 C;  1PNL A;  3VQV A;  4F6E A;  3M7M X;  5EYP A;  4MVR A;  4MVQ A;  3ABM C;  5LGN A;  4R8C A;  2OCC B;  4LFC O;  1XMQ B;  4PA9 A;  3AG3 C;  1R3J C;  4JZ2 A;  2Y0P A;  2JGD A;  2P4V A;  4LF9 B;  3D3I A;  1SF9 A;  2Q7G A;  3RYF A;  4DR2 O;  2YI9 A;  4B3M B;  3EVK A;  5B1B B;  1RM1 C;  1RSO B;  2VRZ A;  2B1G A;  5H2F Z;  3LSU A;  1XHZ A;  1KUQ A;  1SQP H;  5D5Q A;  5CA3 A;  1EN5 A;  2QWP B;  1VQN V;  5JH7 B;  3AK2 A;  1H2K A;  1BHA A;  2V4D A;  5L3F A;  2M7W A;  1NVP D;  4A5U B;  5LP6 A;  3OTO O;  2Y69 B;  1Z5W A;  1ZWI C;  2HFE C;  2ZQM A;  3BPZ A;  1NVP B;  4O2A A;  4GX5 A;  4H37 A;  3BVO A;  1SET A;  1VEW A;  4GX1 A;  5LMU O;  4EB6 A;  4NYK A;  3JAL B;  2BSK A;  4CC5 A;  2W0F C;  2E5L B;  2WLI A;  5IE9 A;  4FZ0 A;  2LQT A;  3CP1 A;  1Z2G A;  4G2K A;  4B3R B;  2CAZ C;  4TQF A;  1KEC A;  2PZS A;  1B04 A;  3HKC B;  1M56 C;  4I55 B;  1ZX3 A;  2UXN A;  3B09 A;  3SYO A;  1Q82 W;  3IFX A;  4DR6 B;  1V54 B;  3ZHU A;  1I5Y A;  3RYH A;  4FLU A;  2FKX A;  4YJ3 A;  3JAW A;  1OCO B;  4K0K O;  4LC1 A;  4FPP A;  3LNN A;  4CH3 A;  4KL1 A;  5JCO C;  1Q81 W;  2N74 A;  1D2D A;  5FPO A;  1W0J G;  1WP7 A;  3DTU B;  2UU9 O;  2JJ2 G;  3RYI B;  3IAY A;  4DR4 B;  1NTM H;  1SQF A;  1MAB G;  2QA4 V;  4TV8 B;  1FKA O;  4YIP A;  4HYO A;  1IVS A;  1BMF G;  4LFB O;  2IW5 A;  1G1X B;  1N0N A;  2O57 A;  3BA8 A;  4LF5 O;  4DR5 O;  5LXT B;  5E79 Z;  4FFB B;  2PI5 A;  3CRQ A;  1K4C C;  5DN6 G;  4OX9 B;  3ZHQ A;  5HFL A;  2H94 A;  5CMU A;  3ASO C;  3K03 A;  3Q4H B;  5EC2 C;  4HZ3 A;  2MW2 B;  1QQC A;  5B1N A;  1IBM O;  2WLL A;  4U3J A;  2WAM A;  4U3J B;  2WPD G;  1Y67 A;  3ETQ A;  1CPY A;  4JI7 B;  1FFX B;  2YIA A;  1HR0 O;  4ICG A;  2QM7 A;  1Y6X A;  3T2M A;  3UO3 A;  3OTO B;  4LCU C;  3QNE A;  3PJS K;  2LP7 A;  2ZXW C;  3L75 H;  1I0H A;  2Q67 A;  1IBL O;  1VF5 B;  4CH5 A;  2YIB D;  1EFR G;  1SES A;  5LHH A;  1ZUQ A;  2KKW A;  3H1H H;  1SQV H;  1AJP A;  1VQ9 V;  4FLZ A;  3K06 A;  4MTF A;  1ARO P;  5JWP A;  4JI0 O;  2DYR B;  4JYY A;  3CYO A;  4ZI7 A;  1DF5 A;  2P4K A;  4QE7 A;  1XIL A;  3ABL B;  2FML A;  2A79 B;  4Q20 A;  4F6R A;  2UUB O;  3APO A;  4P9O A;  4RO2 A;  2M6Y A;  1XQ8 A;  2ADP A;  4BWA A;  4NR1 A;  4L8J A;  1XNQ B;  1NBM G;  4D7T A;  5LYJ A;  3W7S A;  2DQ3 A;  4FLT A;  5B1B C;  2F93 B;  1VQO V;  3ZX6 A;  3WU2 Z;  1AIL A;  1K5Q A;  1IZ3 A;  2KQX A;  4NTY A;  3ABK C;  2WLI B;  1FS0 G;  3OMI B;  4FLW A;  3LNM B;  4LR3 A;  1Q6U A;  2QM8 A;  3RBZ A;  1PL4 A;  4FIP C;  1N33 B;  4JI1 O;  3S3W A;  4QJF B;  4FFK A;  1VQM V;  1SC5 B;  1Y76 B;  4MVU A;  4XBF A;  3GVM A;  1AR4 A;  5IY5 B;  3G6E V;  4JI4 B;  2C2A A;  4ZBM A;  2ITC C;  3CHX A;  3LSS A;  1TUB A;  4PJ0 Z;  4DV2 O;  4J80 A;  5EBL C;  5IWA O;  2RMK B;  1H2M A;  2ILM A;  4DR7 B;  4GKJ B;  4LWS B;  4IIJ A;  2PF4 E;  2IU0 A;  4LF6 B;  3D36 C;  3WB0 A;  2NR5 A;  2AHZ A;  2ITD C;  3FYE B;  4X64 B;  4NTX A;  5HFM A;  2Q0O C;  3SGI A;  3JCZ A;  3K9A A;  1P7G A;  1RSO A;  1VQ5 V;  4K35 A;  3AG2 B;  3S3X A;  1B06 A;  4DUZ O;  4DR3 O;  3JAR A;  3CPW U;  3OTF A;  3G80 A;  5D5P A; 
#chains in the Genus database with same CATH homology
 5IYD O;  3E86 A;  3ASN C;  3JD2 A;  1GKF A;  1YJN V;  1R3L C;  2QKS A;  2IJK A;  1F4M A;  4MW3 A;  4RUF A;  4ZKI A;  1KD1 W;  4H33 A;  3ZN1 A;  2Q69 A;  3SYC A;  3HPL C;  2YEV A;  4G28 B;  4RAI A;  2DYS B;  3JD3 A;  3ZMT A;  1M1K W;  1K92 A;  3ZN0 A;  1RM1 B;  3X2Q B;  1EBO A;  4LBE C;  1JOY A;  3WG7 B;  3K04 A;  1R6K A;  2H8P C;  1XL4 A;  5IYC O;  5B1A B;  3G4S V;  1I5X A;  2Y48 A;  1M9N A;  1RPR A;  2HVJ C;  1YTF B;  2EIN B;  3SPH A;  1FXK A;  4LP8 A;  1YIJ V;  3ZRW B;  1IXM A;  5LHG A;  1YTF D;  4QE9 A;  1J95 A;  3P30 A;  1OCZ C;  2IU3 A;  1R6N A;  1KP2 A;  1OCC B;  1JPX A;  4WF9 V;  2DQ0 A;  1FXK B;  2IJI A;  2IJJ A;  3SPC A;  3ZJZ A;  2P7T C;  4JF3 A;  4L87 A;  5B1A C;  1FXK C;  3W7U A;  3A0R A;  4TSF G;  4X89 A;  1OCC C;  3AG1 B;  4TT3 G;  3SPJ A;  5FL7 G;  4ASU G;  3B8M A;  2WLK A;  2OTL V;  2WLH A;  2YEV B;  4QPJ A;  3OM3 B;  1AI5 A;  3JD4 A;  1F4N A;  3ZIA G;  1OHH G;  2IJH A;  2GHY A;  1CEZ A;  3EHB B;  1Y66 A;  4R50 A;  3R65 A;  3TCU A;  3VBB A;  2WSS G;  1AI6 A;  3M99 B;  3CC2 V;  3EFF K;  2DYS C;  3CCR V;  2EIM B;  5EBM C;  3OEE G;  3SYQ A;  1GM8 A;  1P4R A;  4CZZ A;  3ML0 A;  1E1Q G;  3ABT A;  2P6J A;  4BIU A;  3LUT B;  5E1A C;  1WLE A;  4JPR A;  4UVA A;  4OXS A;  3I55 V;  1S72 V;  3UM7 A;  1Y4M A;  1VQ8 V;  1QR9 A;  1E1R G;  3IGA C;  2Q68 A;  3ABL C;  1NH2 D;  1K3E A;  3SYP A;  4P2Z A;  1FXV A;  3ZMZ A;  1NH2 B;  3FB5 C;  5LHI A;  5B3S C;  1K4D C;  1V55 C;  1R73 A;  4JAU A;  3ZMV A;  1UJW B;  1V54 C;  3E8H A;  3OE7 G;  3ZRW A;  1K7D A;  1MG1 A;  2EJR A;  2GSM B;  2LFR A;  4RUE A;  1M56 B;  1S76 D;  1ROP A;  3CCV V;  2X6B A;  2EIK B;  3E2E A;  1G8M A;  3FKS G;  4X88 A;  1ENV A;  4QNH B;  1GM7 A;  1AJQ A;  1FXH A;  4WFE A;  1SER A;  5DM6 V;  4UVB A;  4GT1 A;  1QLN A;  1B6Q A;  5H9C A;  3SJQ C;  3E8F A;  1TUE B;  2XAH A;  4WCE V;  4JAV A;  3K0D A;  3LSQ A;  4TWK A;  3ZMU A;  4BIZ A;  1VQ4 V;  4WFF A;  3FB6 C;  3SPG A;  3ZRX A;  3CCU V;  2EZO A;  5KA5 A;  3AEI A;  2DWD C;  4PDM A;  1PNM A;  2XOK G;  4Z1M G;  2JK5 C;  2EZP A;  2B1I A;  2IH3 C;  1CP9 A;  1GO3 F;  4R7C A;  2XAS A;  1OCR C;  5KUK A;  4MTO A;  1VQP V;  2HG5 C;  3AG1 C;  1PNL A;  2QTO A;  2F43 G;  2FTK A;  4MVR A;  4MVQ A;  3ABM C;  2LFS A;  5LGN A;  4QIW F;  1H8H G;  1Q86 W;  4R8C A;  2EIN C;  2OCC B;  4FMT A;  2ZDI C;  1PD3 A;  3QO7 A;  5C93 A;  4P30 A;  1JJ2 U;  3OUF A;  4XDK A;  3F5W C;  1OCZ B;  1OCR B;  2XAF A;  4WFA V;  4PA9 A;  3AG3 C;  1R3J C;  5L3B A;  3D3I A;  1NKD A;  2K1E A;  4QPK A;  1SRY A;  2A0L A;  5B1B B;  4BAY A;  1RM1 C;  1N8R W;  3AG3 B;  1AR1 B;  4F4L A;  2Q6A A;  3W7X A;  1YJ9 V;  3CCJ V;  2X0L A;  4MTX A;  2B1G A;  2YSU B;  2NNU A;  4N21 A;  3CCL V;  4JTA B;  3WFV A;  3CCM V;  1YI2 V;  3K0G A;  5CBG A;  3I56 V;  5H6Q A;  3LDD A;  4PDV A;  5L3D A;  5CA3 A;  1VQN V;  3D36 A;  2CK3 G;  1XL6 A;  3QO5 A;  1BHA A;  3CCQ V;  2Z3Y A;  4GCZ A;  3T4Z A;  1P7B A;  4PA3 A;  5L3F A;  2M7W A;  1NVP D;  1DTO A;  4CBC A;  3OW2 U;  2Y69 B;  2HFE C;  1ZWI C;  1NVP B;  2ZQM A;  1K97 A;  4GX5 A;  4H37 A;  1SET A;  2DYR C;  1M57 B;  4GX1 A;  4UV9 A;  1L1F A;  4PEL A;  1BL8 A;  3B77 A;  1K34 A;  4JYC A;  2W0F C;  2WLI A;  5B1O A;  1OZ0 A;  3G71 V;  3CP1 A;  3DGE A;  2EIJ B;  1DLB A;  4G2K A;  3B8N A;  1G4Y B;  5LBQ A;  1KEC A;  4KUM A;  4GX0 A;  2WLN A;  2W6I G;  1M56 C;  3FB8 C;  2UXN A;  3SYO A;  1Q82 W;  3IFX A;  1S0V A;  1WPX A;  1S77 D;  5EK0 A;  1K9M W;  1V54 B;  2WLM A;  1KP3 A;  1HWY A;  3OMA B;  1I5Y A;  3FYI B;  1RPO A;  2QE7 G;  4E2L A;  1VQL V;  1OCO B;  3OGC C;  4HAM A;  4FPP A;  4LC1 A;  5L3C A;  2ATK C;  3K79 A;  1BHB A;  1JX9 A;  5L3E A;  3NXS A;  4RQE A;  2WLJ A;  1VQ6 V;  4MW8 A;  4XDL A;  2EIL B;  1Q81 W;  4PA4 A;  1R3I C;  1W0J G;  1QLE C;  1PL0 A;  3CMA V;  3ZMS A;  3DTU B;  4UUJ C;  3RVZ A;  2KB1 A;  2JJ2 G;  1MSW D;  3E8G A;  4JTD B;  2DW4 A;  3ZRS A;  2PI4 A;  1K8A W;  4WFH A;  3CCS V;  2JJ1 G;  2HVK C;  3OAA G;  1MAB G;  1PKX A;  1W0K G;  3ETG A;  4KP4 A;  2QA4 V;  3BEH A;  1F23 A;  3KG2 A;  3MHS C;  4HYO A;  5LGU A;  3CC4 V;  3X2Q C;  4PA7 A;  1BMF G;  3K3W A;  3STL C;  2IW5 A;  3QO8 A;  3W7T A;  2ZD9 A;  1S5H C;  3T4D A;  2PI5 A;  1YJW V;  2ZDI A;  3FB7 C;  1K4C C;  1AI4 A;  5DN6 G;  1QLE B;  5GW7 A;  2IH1 C;  3JYC A;  3ABU A;  5HFL A;  3ABM B;  3VOU A;  2H94 A;  5CMU A;  1GM9 A;  3ASO C;  3BY6 A;  1LNQ A;  2EIL C;  2V7Q G;  3K03 A;  5EC2 C;  2BOB C;  2DWE C;  4MSW C;  4HZ3 A;  3E83 A;  3F7Y C;  4UVC A;  5IYB O;  4X8A A;  5B1N A;  2WLL A;  2HLD G;  5KUM A;  2WAM A;  3JD0 A;  3OUS A;  1NR7 A;  2WPD G;  2X6C A;  2AHY A;  1CPY A;  1EZJ A;  2WWW A;  4U7O A;  1K5S A;  2QM7 A;  3RVY A;  4R6Z A;  4DO2 A;  3T2M A;  1S3J A;  2HR3 A;  4LCU C;  3QNE A;  4KFM A;  3PJS K;  2LP7 A;  1QCE A;  2ZXW C;  2ZXW B;  2Q67 A;  3CCE V;  3ASN B;  1H2G A;  1NJI W;  2JDI G;  3STZ C;  5EBW C;  3ZRV A;  2XND G;  3CME V;  3OMN B;  3HB3 B;  3T1C A;  1SZT A;  1EFR G;  1SES A;  5LHH A;  1M57 C;  2XAJ A;  2EIJ C;  3CC7 V;  2JIZ G;  2EIK C;  1AJP A;  1VQ9 V;  2P90 A;  3SPI A;  3AG4 B;  2HKO A;  5H6R A;  3K06 A;  3OR6 C;  4MVZ A;  4MTF A;  1ARO P;  1YSC A;  1K73 W;  2DYR B;  3CYO A;  1DF5 A;  2XAQ A;  4PA6 A;  2P67 A;  4FK5 C;  4JAS A;  5B3S B;  3ETE A;  3LDC A;  5IDJ A;  3IC7 A;  1AJN A;  4QE7 A;  5LGT A;  1YHQ V;  3E35 A;  3TK1 A;  4J9Y B;  2BOC C;  3ABL B;  1H8E G;  2A79 B;  3LDE A;  4Q20 A;  4DXW A;  3MHH C;  2X7R B;  1GTO A;  4P9O A;  4YXW G;  1QVF U;  4RO2 A;  4UXN A;  1JCH A;  2EIM C;  1KC8 W;  1FFT B;  3ASO B;  1NBM G;  1M90 W;  5CN0 A;  3W7S A;  3GB7 C;  2DQ3 A;  5B1B C;  4JGS A;  1VQO V;  1VQ7 V;  3ABK B;  2B5U A;  1K5Q A;  2ZR2 A;  2EBO A;  2V1D A;  3CD6 V;  4MTG A;  2R9I A;  5IY5 C;  1THZ A;  3ABK C;  4G27 B;  2WLI B;  4I5S A;  2MK3 A;  1FS0 G;  2A9H A;  1AI7 A;  3OMI B;  3LNM B;  4MT8 A;  2QM8 A;  3RBZ A;  1QR8 A;  1K33 A;  3GWO A;  3K08 A;  3ETD A;  3TET A;  4MVS A;  4FIP C;  1E79 G;  1R3K C;  4MS2 A;  2D3O W;  1DF4 A;  3OEH G;  5L3G A;  2NLJ C;  2Z5U A;  4QJF B;  4BW5 A;  3OFN G;  2W6J G;  1VQM V;  2OCC C;  4N23 A;  1JVM A;  2JEU A;  2WLL B;  1H38 A;  2UXX A;  4JYB A;  3E89 A;  4MVU A;  4XBF A;  1KKD A;  1QVG U;  4MVM A;  3RW0 A;  5IY5 B;  3SYA A;  1COW G;  3G6E V;  1PNK A;  2C2A A;  2ITC C;  4GX2 A;  4ZBM A;  3LSS A;  5EC1 C;  3W7W A;  1OCO C;  4JTC B;  2HJF C;  1JQ0 A;  3P32 A;  4PDR A;  2X6A A;  5EBL C;  4J9Z B;  2R9R B;  3WG7 C;  5CBF A;  3CXC U;  4RQF A;  1ORQ C;  3F7V C;  1KQS U;  4EKW A;  1QBZ A;  5KA6 A;  4FJC C;  4PDL A;  5CBH A;  2JEX A;  2XAG A;  2IU0 A;  2QEX V;  3ZCC A;  3E8B A;  4MVO A;  3H01 A;  2AHZ A;  1YIT V;  2ITD C;  3FYE B;  3AG2 C;  2OTJ V;  5HFM A;  1V55 B;  1NR1 A;  1GK9 A;  3JCZ A;  3K9A A;  4XDJ A;  4WFB V;  1VQ5 V;  4I9W A;  1F51 A;  3JD1 A;  2OT5 A;  3AG4 C;  3MD0 A;  1VQK V;  4U7N A;  3UKM A;  3OR7 C;  3AG2 B;  1MOF A;  1NQT A;  2Y69 C;  2ZR3 A;  4WFG A;  4UV8 A;  1GMG A;  5J9P C;  4P9P A;  3CPW U;  1Q7Y W;  1W2B U;  5BZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...