4NXNO

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4nxnO00
4JI3O 4DR4O 1I94O 2ZM6O 2AGAA 3J81N 1J5EO 3O65A 2UUBO 4OX9O 1HNZO 3JAMN 4A5UB 1XNRO 1HR0O 1FKAO 4DR6O 1AB3A 3J7AU 2F4VO 4LF9O 1HNXO 1N32O 4DV1O 4X62O 4JV5O 2VQEO 4DUYO 4X64O 1FYJA 5LL6Y 4DV5O 4LF7O 4DR1O 1XNQO 2LW7A 1R6TA 3OTOO 4K0KO 4LF6O 4DR2O 3T1YO 4OPHA 2JRIA 4NXMO 2Z0AA 4DR5O 3M8AA 5A2QN 4NXNO 4KHPO 3J80N 4JI7O 2DOSA 3F5TA 4DV6O 4JI5O 1D2DA 1AILA 2DJVA 5BR8O 5LMNO 2FKXA 2UXBO 4DV2O 1DK1A 2N74A 2HHHO 5BXZA 4X65O 3RT3C 4DR7O 1FJGO 3SDLA 4JI1O 2UXDO 1A32A 4B3RO 2VQFO 3T1HO 4JI4O 4LFAO 1HNWO 4LFCO 4X66O 2ZKOA 4JI2O 4DV3O 4GKKO 1NS1A 4B3TO 4YY3O 1XMQO 4OPAA 1IBLO 5IWAO 4LF4O 1IBMO 5LMUO 2UUAO 4DV0O 1N36O 1F7YA 2UXCO 4GKJO 5H5NA 1X59A 1XMOO 4JYAO 1R1BA 5BY1A 1IBKO 2UUCO 4DR3O 5IT9N 4LF8O 4YHHO 2UU9O 1XEQA 1N34O 1KUQA 4B3SO 4JI0O 4DV4O 4LFBO 4JI6O 4DV7O 1YZBA 4JI8O 4AQYO 2E5LO 4B3MO 1N33O 4LF5O 4DUZO 3R66A 1G1XB 5FLXN
chains in the Genus database with same CATH superfamily
3ZMZA 1LUWA 1OCZB 3CE2A 1O9HA 3CRAA 1I5XA 3LNNA 5EZYA 3LSSA 4RQEA 3RYCB 3J7AU 3CD6V 3HKBB 1ZL8A 1MZFA 4NVPA 4JV5O 3LDCA 4RO2A 5LL6Y 3H1KH 5GONA 4WFHA 1NKDA 4K0KO 5LYJA 4I7ZB 5J2UA 4OPHA 5JVDA 1CXZB 1UFIA 5CA0A 3Q4HB 1M56C 1SS3A 2QWRB 2JJ1G 1Q3EA 3RFRA 2Q67A 1DK1A 1KQSU 1COWG 1THZA 2IM9A 4LNUB 4CH6A 4OGQB 2B1IA 2PI4A 4MS2A 1G8MA 4ICGA 4X89A 2XAJA 3SJCC 2CTPA 1OCOC 3JCUZ 5IDJA 2WLHA 4DUYB 1VEWA 3BPZA 2XHBA 1S76D 1IBLO 1QCEA 5LGTA 4CZZA 5LMUO 3B4SA 2UXCO 5KX5B 2BSKB 3HPLC 4LF6B 4DR2B 2ZNIA 1SA0B 4LH7A 5JH7A 3W7SA 1BQ0A 2DMXA 4ZIBA 4PI0A 4FLVA 4O4LB 2UU9O 3LUTB 3TK1A 5LMNB 1NI8A 2KQXA 1K73W 2UXBB 1F51A 5IJ9B 2KKWA 4JASA 4JI0O 4DV4O 3ZHTA 4DR7B 4PA6A 1BGYH 2PY5A 2BE3A 2CDYA 2Q69A 2Q73A 3QNEA 3MD0A 3AG1B 4GCZA 4JPRA 2GTAA 2ZD9A 5HFLA 1JX9A 4UCOA 3LDDA 1NTMH 3K04A 4O2BA 4GKJB 2E76B 1GN2A 2X7RB 4LC1A 1QR8A 3IGAC 1AI6A 1ZUQA 2JGUA 1CP9A 1SZXA 5H2FZ 2VS0A 3ZHVA 2BTQA 1K7DA 3T1YO 4PDVA 3K08A 4CS4A 3RVYA 1LR1A 1R6NA 2UXXA 3ZMVA 1BT8A 4PI2A 3ABTA 3STLC 1I94B 3VQYA 2IH1C 1AJQA 1YF2A 2A79B 5CBFA 5DN6G 3AG2B 1TGOA 4X20B 3T1HO 2EIMB 4X66O 3AG3B 3JAKA 5L3EA 3OMAB 4PHZA 4X64B 4N23A 5D5PA 4ZI7B 3I5DA 2ETNA 2YEVB 2Q5ZA 1S5LZ 2QJ1A 2UUAO 1KYOF 1N36O 2Y48A 4MVRA 4QPKA 1QLEB 3SPGA 4GKKB 3STZC 4LF8O 4EEQA 5C8YB 1JJ2U 2PUSA 1PNKA 3OEEG 1TAEA 1Q90D 1PL4A 2JIZG 3CJHB 4X88A 3CMEV 3ASNC 1VQPV 5KHHA 5D5QA 4G28B 1B3QA 2OIGA 3IC7A 2LFSA 2DQ3A 1YZBA 3ABKC 3JATA 4J7JA 4KL1A 5KAIZ 4TQDA 4TV9B 3SJQC 2X6CA 2VQFB 3LSUA 3RVZA 1HWYA 4A5UB 4J9YB 3CPWU 2JGDA 1M93A 3F7VC 2IH3C 4QNHB 3EFFK 3BCCH 4X62O 3QTCA 2WLJA 4MTXA 1AI5A 2ZINA 2W6JG 1WB7A 5BMVA 5H9CA 4W4KA 2JK5C 3FB6C 4PD4F 4PA7A 1JQ0A 3K0DA 5DECA 4LFBB 4DV7B 3F5TA 4DV6O 4JI8B 2E5LB 5JCOC 3JAWB 1YHQV 4NTWA 4H33A 4DV2O 3RT3C 1QVGU 3RYFB 1Y67A 5KA5A 4IIJB 3ZMSA 2IBZH 1WPBA 2L6LA 4LFCO 2OCCB 4RUEA 3TXQA 4JV5B 2ZDIC 4PJ0Z 1TVKB 3MHSC 4CC6A 1IXMA 3DGEA 4PDRA 1VARA 3JASA 4DV0O 4J42A 1K33A 4R6ZA 4K0KB 2ZE7A 5BY1A 1IBKO 5EYPB 1PPJH 1EZVH 4DR3O 2PTMA 1MNGA 1S3JA 2RMKB 4E4EA 2ZCEA 1KBHA 2YXLA 3RWRD 4Q6GA 2GV9A 3E86A 4BR6A 3K06A 2Y0PA 3QO8A 3KCXA 1QHTA 3P30A 4PELA 1L8DA 1YJ9V 4CH5A 1OHHG 1W0KG 4UVCA 2LO1A 3K5NA 3X2QC 1WA8B 1AB3A 4DK0A 1IBLB 2HP8A 2DQ0A 4LWSB 1YITV 2QKSA 4JAVA 3TXSA 5A9GA 4K35A 1YJNV 4UV9A 1VQ5V 4I4TB 3OR7C 4H13B 3OM3B 4PDMA 1OCZC 2CGOA 3UT5B 2P4VA 3SYPA 2UU9B 4X1IB 2XASA 4NXMO 3ABMB 1IX9A 1V54C 3UO2A 1K4CC 3CMAV 1AR5A 4JI0B 3A0HZ 4DV4B 3WG7B 1AILA 5J2TB 1MG1A 1DF4A 2DYSB 3WB2A 3SYCA 4RUFA 1XREA 5IYBO 2Y0IA 2K1EA 1RPRA 2VWJA 2F66C 4WBNA 1R3KC 5KHGA 2OCHA 4J11A 3DXRB 1NS1A 1P4RA 2D3OW 4JF3A 3G6EV 2DWDC 2V4DA 1Q6HA 4BIUA 2YICA 3RN4A 4X1KA 2WLLA 3T1YB 4NR1A 1HW7A 1PL0A 2RCVA 3SJAC 4IYIA 3TETA 1Q43A 4GYCB 3MAQA 3L75H 4XDKA 2YXYA 1SKVA 3E2EA 4WFAV 5FPRA 2P22C 5JWPA 5LA6B 1VQ4V 3T2MA 1RM1B 4AQYO 1DLBA 4QIWF 1SQBH 1SQGA 4HBNA 3AK3A 3R66A 4FLTA 3CXCU 1NTZH 4DYLA 4JI3O 4DR4O 2QR4A 2VWKA 3T1HB 4B7KA 1J5EO 3FB5C 4X66B 4I55B 4IYHA 3SYOA 3B09A 1M57B 1N0JA 4UCUA 1BCCH 3JSNA 3L72H 1Y74A 3IJ4A 2F4VO 1HNXO 1T5EA 3QO5A 2UUAB 1VF7A 1N36B 4JYBA 2Q0OC 1NH2B 4NTXA 3AG1C 3FKSG 5JCOA 5LOVB 4LF8B 3JD0A 3T4ZA 2OIEA 2ATKC 4YJ3A 2A7WA 1URFA 3OFNG 3CRQA 4WFEA 3K58A 1XILA 4U3JA 1M4UA 3FX7A 1FJGO 2ZDIA 3FYIB 4B3RO 2EJRA 3CEIA 1JFFA 3BEHA 3JALA 5CA1A 4GKKO 4X62B 1Z5WA 4F6RB 4MVQA 5LHIA 2A3QA 1H2LA 2Q7GA 1ZAUA 2ARHA 3M7MX 1AJNA 5H5NA 3P3PA 3N27A 1KKDA 3K3WA 3AG2C 1AR1B 1O9GA 3GB7C 5IYDO 2E3CA 2AHYA 3WB1A 2EIMC 3P3NA 2XAFA 4DV6B 4YHHO 3AG3C 4I0XA 3HKCA 4U3FH 1XEQA 2ZIMA 2QGNA 4DV2B 3BRCA 4BW9A 4JI6O 1JPXA 4JTAB 1G6UA 2RN9A 2Y69C 3CS5A 3T4DA 4FVMA 1SERA 1QLEC 4AI8A 4LFCB 4HYOA 3VQWA 3VQVA 5ITZA 1M5IA 2JDIG 3ABLB 4NKGB 3ZCCA 1LUVA 2EJ7A 3B77A 4DV0B 1K9MW 1QBZA 1EN6A 2EIKB 3RYCA 4ZOLB 1DF5A 3HKBA 2E74B 1IBKB 1MMMA 2DW4A 4DR3B 3FAVB 3G67A 2EILB 2JS5A 3ZS8C 3CCSV 4AILC 4FFBB 1EZJA 1VP7A 2WPDG 4TV8B 1BHAA 1K34A 2Q6AA 2CTQA 1NT2B 4MT8A 1QQCA 3Q4HA 4X65O 3CWBH 4FPPA 2ZE8A 4PDLA 4UCVA 3N2KB 1ROPA 1YJWV 4ZKIA 4JI4O 4LNUA 5DM6V 2QE7G 3C3TA 3WFVA 2IJIA 3H1IH 2MK3A 3B40A 2YIAA 5L3DA 1X4TA 3B8NA 5FNVA 3A2FA 1BL8A 1AI7A 2BOBC 4Z1MG 5EK0A 2PYLA 1JVMA 4XDLA 4NXMB 1ZLZA 1Y4MA 3H1HH 4NB5A 5IT9N 2OCCC 5KX5A 2BSKA 5B1BB 5FNVB 1JR9A 1SA0A 5B66Z 2IJKA 1RPOA 1VQ8V 1BMFG 4O4LA 3UQ8A 1XI1A 4LF5O 2RDCA 1G1XB 5IJ9A 2BOCC 1QR9A 2ZM6O 3GWKC 1XQ8A 1PD3A 1BZKA 4IHJB 4MVZA 1L0LH 3IFXA 4YXWG 2F43G 4LH6A 2P7TC 2R72A 5JJEB 3NXSA 3O9OA 2OWOA 4XDJA 1OZ0A 4JZ2A 1B06A 1YSCA 3ETGA 1YIJV 1PKXA 2XTAA 3CCMV 4MTGA 3H1JH 4G27B 4NXNO 3JARB 2NLJC 4AQYB 5E79Z 5LP6B 1E1RG 3FYEB 4UB8Z 4OXSA 1P7GA 1VQKV 2R9AA 1S77D 4JI3B 4FK5C 3SGIA 4DR4B 3OEHG 4O2AB 1J5EB 2P67A 1OCCB 5CMUA 3ETEA 1BQZA 1A32A 4ZHQA 2F4VB 1HNXB 1PNMA 4DV3O 3WG7C 1I5YA 2ZXWB 3AK2A 3S3WA 1FXKB 4X20A 4P9OA 2DYSC 5B1OA 2GUZB 5CBGA 4ZHQB 1IURA 1YTFB 1U96A 3OGIB 2EX3A 1H2NA 4ZI7A 3ZHQA 2YEVA 1VMGA 2Q8VA 2H94A 5LGNA 5EBLC 4FMTA 1AJPA 4HNAB 5J9PC 3BAAA 4UV8A 4K3AA 4C7UA 3ZJZA 2WLIB 3ZRWB 1GN4A 1S5HC 5C8YA 1FJGB 1J95A 2P06A 3CJHA 1CPYA 4B3RB 4GT1A 1R73A 3O65A 4OX9O 2W0FC 3LNMB 5GW7A 2OYQA 1M90W 4YIPA 4TV9A 1FKAO 4MW3A 3F7YC 5FL7G 1NTKH 3ICXA 1RM1C 2VQEO 3ZHSA 3JSLA 4R7CA 1Q86W 4DV5O 2HEPA 5IY5B 3L9DA 2LW7A 3A8TA 1HNZB 3CSXA 4YHHB 1M57C 1NH2D 1SC5B 4P9PA 4CH4A 2WA3A 3E8GA 4JI6B 5BR8O 4TUYB 4D6TH 3VOUA 1VF5B 3ASOB 1RP3B 3CP1A 5LXTA 4U7NA 3OMNB 3CCEV 5H6QA 1SZTA 5KLVH 3JAWA 1SQQH 3DC5A 4H0LB 3CCUV 1RFYA 4O4JB 4X9QA 1IDSA 4EKWA 4JZGA 4BWAA 5B1AC 2FL4A 3TJTA 3RYFA 5LXTB 5LHHA 1KP2A 2NR5A 4IIJA 1FXVA 4B3TO 2LJ2A 3UCSC 1Y76B 2ODMA 3RYHB 4DK1A 1XHZA 2QKCA 3PJSK 1XDCA 1V55B 1TVKA 4DXWA 4FLUA 1XMOO 2EINB 1NR1A 4YJ2B 2QM7A 1K5QA 5JQGB 3FB8C 1K3EA 4U7OA 1KP3A 1WP8A 5EYPA 3K9AA 2ADPA 4X65B 2QTSA 3K5OA 4GX5A 1E1QG 4MVUA 3ZRVA 2ZR2A 4DUZO 5FPOA 4JI4B 2MW2B 4LP8A 1NR7A 2X6AA 2YUAA 3SYAA 3KZIZ 1GAXA 4G2KA 2Q68A 3SPJA 4DR6O 2XAHA 1US6A 3EVKA 1WA8A 4DRXB 4LF7O 3IAYA 4LWSA 1XNQO 3D3QA 1KU9A 3SR2C 2B5UA 3APOA 1F4MA 4I4TA 5KUKA 2N05A 3ABLC 5A2QN 1EBOA 4JI7O 4F4LA 1MZEA 1NBMG 1H38A 4RAIA 3UT5A 2DJVA 3W7UA 4X1IA 4LF5B 4MSWC 2EIKC 3DSQA 3CRMA 2ZM6B 5L3GA 5IYCO 5J2TA 1MABG 3OAAG 4QE9A 3HKDB 4AHCA 5EIBD 1PV0A 2HR3A 2W0XA 2P90A 5IWAO 3RYIA 2LFRA 2JS3A 2EIJB 1QLNA 3A0RA 1MOFA 5EC1C 3DXRA 2GDSA 5EIBC 4NYKA 4JYAO 2ZE6A 4CH3A 4X8AA 3E8FA 3BABA 1TA8A 4NXNB 4I9QA 5CB4B 4GX2A 4WCEV 3RYIB 2F93B 1H2SB 2W6IG 1VQ7V 1B6QA 1HDJA 1VQ6V 1SETA 4WFGA 1SESA 4P2ZA 4MTOA 2JVDA 2YDEA 2HVJC 1TUBB 3AG4B 3L71H 5GTIZ 5LA6A 3K57A 3J81N 4DV3B 2PI5A 5B1BC 4CBCA 4GX0A 2ILMA 4I55A 4D7SA 1MA1A 2NN4A 4HAMA 5C93A 1WLEA 1NZ6A 4JAUA 1FPOA 2QSAA 3H1LH 2P4KA 2QM4A 2V1DA 3VQXA 5IYZB 4DR5O 1GM9A 3QO7A 4FFKA 5LOVA 2DOSA 3BVOA 2K9PA 3F5WC 2KG7B 3ZRXA 4OX9B 1XOUA 3G4SV 2FTKA 3ML0A 4FIPC 1UJWB 3K79A 1NVPD 2ZKOA 3K0GA 2WSSG 4J80A 4UCSA 5K1XA 2VQEB 1N0NA 1FFXB 5LP6C 4YY3O 4LBEC 5KMGB 2Y4TA 4J7KA 4DV5B 5B5EZ 2UXDB 1Q5OA 1OCCC 3L74H 4F6RA 3THOA 3ZN0A 2XNDG 1SF9A 4EB6B 1DGSA 2HFEC 1YTFD 2BTOA 4GX1A 5KHKA 3D8CA 5BR8B 1JMKC 2ZXWC 1SQXH 1FXKC 3K59A 2A9HA 1P7BA 5IJ0B 1SQFA 4I50B 1VQNV 4N21A 1V9PA 1HNZO 2IJJA 4O4HB 2EZOA 5K1PA 2OTLV 4B3TB 5LHGA 3E35A 3CRRA 3OD4A 4DW1A 4MVSA 5B1NA 4MVMA 4J41A 2R9RB 1XMOB 4X1YB 3R65A 1WN7A 1W59A 3OTOO 4JYYA 2Q4PA 1EN4A 4ZOLA 4XBFA 3E22B 1H8HG 4JI5O 1Q7YW 1D2DA 3FAVA 1Z5VA 5F2VO 4FZ1A 4DUZB 2CUGA 1D5AA 4UCRA 2N74A 4FFBA 2YIDA 5BXZA 4KXRA 5IY5C 1K8AW 1W0JG 3D36C 3ZIAG 4BIZA 3ETQA 4TV8A 3W7WA 3E8HA 3CCVV 4DR6B 2YC0A 4TSFG 4LFAO 2QTOA 2E75B 1OV9A 3GVMA 4JI2O 3MHHC 3K5MA 3N2KA 1XMQO 4LF7B 3ASOC 2ZE5A 1XNQB 2OTJV 3CB2A 1GN3A 3AG7A 2QWPB 1WJZA 1YCIA 3CXHF 3AEIA 1GKFA 4K8ZA 2Q7HA 4JI7B 1FD9A 1QU7A 3N2GB 1V54B 4TT3G 3B2EE 1N34O 4B3SO 4UB6Z 1QNMA 3ZMUA 4H44B 1N33O 1MSWD 1V55C 2QWOB 2PZSA 5EZYB 4CS2A 3K03A 1UPGA 2EINC 4ASUG 4IL6Z 4Z2WA 3ZN1A 3FB7C 1BSMA 1ZL8B 1VQOV 4QE7A 3RGBA 5IWAB 4LF9O 4IHJA 5GONB 2B9ZA 2ZT9B 1N32O 1Q6UA 3SJBC 1Z2GA 5LYJB 3HB3B 1OCRB 3CC4V 1FYJA 4JYAB 1S5JA 1R3JC 4KFMA 5J2UB 1K92A 5JVDB 4LR3A 3AK1A 1KKCA 5CA0B 2HLDG 5AG2A 4GUNA 1VQ9V 2JRIA 2Z0AA 3KCYA 4QGPA 4TQFA 1VQLV 4TWKA 2YS8A 2AZ0A 1P49A 3CHXA 3OT7A 3PN1A 1JCHA 2P5OA 1KC8W 2FB5A 1QVFU 1VF6C 3JARA 5LP6A 3U11A 2DYRB 4O2AA 4MTFA 3ZRSA 1HNWO 1YDXA 1M9NA 3CCQV 1PNLA 2L35A 2OT5A 3U0ZA 2XUMA 4B7EA 1ZWIC 5JH7B 5B3SB 1IBMO 1AP5A 1Q8IA 1XHXA 2FYUH 3G71V 2RNBA 1KECA 2YSUB 1FXKA 1NVPB 4DR5B 2GBOA 3E83A 2UUCO 2GUZA 2H8PC 2ZNJA 3L73H 3ABMC 2GHYA 5E1AC 1DTOA 3LDEA 2EZPA 1JA8A 1KUQA 4IGGA 4L87A 1KD1W 2EIJC 4HNAA 1K97A 5FLXN 2WLIA 2CTRA 3ZRWA 5CA3A 2RQ6A 3K5LA 1W2BU 2XT9A 2P6JA 3CX5F 3OUFA 4O4IA 2NNUA 4O2BB 1XNRO 4YY3B 2H3OA 2F23A 1GM7A 2AZ2A 3GWOA 1JJOA 1I0HA 1GMGA 2BTQB 3RBZA 3UM7A 4FM0A 3AG4C 1F23A 4O4IB 1LNQA 4WFBV 2IU0A 1FAFA 3SPCA 1WP7A 2LP7A 1B04A 1FFTB 4F6EA 2PF4E 4KHPO 3D36A 1D5NA 2X0LA 2YI9A 2XAGA 3SYQA 1M1KW 3P32A 1GM8A 4RWUA 1N8RW 2Y4UA 2Y69B 3G80A 2A0LA 4DO2A 2HHHO 4P30A 4TUYA 3JAKB 4PA3A 4JI1O 1ZTEA 2UXDO 5CBHA 1PM9A 2A06H 4MW8A 2O57A 3IC9A 1AP6A 5GTHZ 1GN6A 3H9VA 2PGGA 2F1MA 4O4JA 4MVOA 4OPAA 2JJ2G 2Z3YA 3CC7V 2AW9A 4LF4O 2ITCC 2AXTZ 3L70H 1Y6XA 3OTOB 2ADQB 1Y76A 2DE0X 4DW0A 3RYHA 5L3CA 3M99B 3OMIB 4KUMA 2V7QG 1EM1A 4JI5B 2M7WA 3JATB 3EXAA 1NJIW 2VRZA 1IZ3A 4YJ2A 5EBMC 3I56V 2QEXV 3FD9A 5JQGA 1FS0G 5HFMA 4B3MO 3C3SA 3LSQA 4BIOA 2F95B 5L3BA 1H2MA 1KMIZ 1AI4A 2ZQMA 4EFEA 2Z5UA 4LFAB 2JGDB 4JI2B 2UUBO 2JEXA 3CCRV 2RJZA 1XMQB 1HR0O 4K8XA 2LQTA 5JJNB 2KB1A 4WFFA 4DV1O 1M56B 2AHZA 3E8BA 3K9SA 4CC5A 5LGUA 5BMVB 3SPIA 3U10A 1SRYA 4DR1O 5TISZ 1JOYA 3C90A 1R6TA 2QM8A 1XBLA 4JTDB 1AVMA 4DRXA 2Q9LA 2YXHA 3BHPA 3QG5A 5CN0A 1N34B 2IJHA 1VF6A 3CYOA 4B3SB 1OCOB 2ZR3A 3S3XA 5BZBA 3ZEDA 2X6BA 4E2LA 2KSDA 1N33B 4JTCB 4UCTA 4HZ3A 4I9WA 3OUSA 3VBBA 1BS3A 3E89A 1H2GA 3OGCC 2XOKG 2UXNA 2GTSA 1N4CA 1E79G 2ZIOA 4LF9B 1S0VA 1N32B 2QWQB 3JASB 1L0NH 1Y66A 1BHBA 1GK9A 3HKDA 1K4DC 3JD1A 2CH7A 3ZBHA 2YIBD 2LW1A 5KUMA 2C2AA 3BY6A 1X59A 4JGSA 1H8EG 3TCUA 4B08A 2EBOA 3D3IA 1ENVA 2G38A 5DEDA 2HKOA 1NQTA 5L3FA 4J9ZB 3OR6C 4LCUC 1AROP 2EILC 4TOIA 2CH7B 5JJJB 3SPHA 3JD4A 3I55V 1WAZA 2DWEC 5H6RA 5LMUB 1F4NA 1H2KA 1ZX3A 2HG5C 4JYCA 2UXCB 5CB4A 1P84F 4CS3A 3FFQA 2R9IA 4RQFA 3WB0A 1HNWB 1SQVH 1TUBA 2CAZC 3DC6A 3OTFA 3JAMN 1VQMV 3ZHRA 4PA4A 3OW2U 1IBMB 4FLWA 4JAAA 4DUYO 4UXNA 4Z1VA 4BAYA 3ZMTA 5IE9A 2R70A 3CCLV 2QWNB 2UUCB 3QVNA 1AR4A 4LF6O 4DR2O 5EBWC 1RSOA 3QF7A 5KHJA 3M8AA 2QKAA 2Q7EA 2BCCH 5IYZA 2EULA 5LMNO 2GSMB 4GZRB 2UXBO 3ZX6A 1OCRC 4PA9A 4FLZA 4FJCC 1EFRG 1TUEB 1RSOB 4DR7O 1U97A 2WLKA 4WBNB 4BW5A 3CC2V 1XNRB 2KG7A 2XAQA 2IU3A 1GTOA 1VIBA 2LGQA 3UKMA 1NU1H 1Q82W 2YI8A 4X1KB 4J7ZA 3ASNB 2WLLB 3T1CA 1ZSPA 1YXBA 5KAFZ 3ABKB 4Q20A 2CE4A 1Q6IA 1FFXA 4GKJO 5KMGA 1R1BA 4FZ0A 2DYRC 1YEWA 1L1FA 2WAMA 4KHPB 2CTWA 2Q0AA 5LBQA 1YI2V 4R50A 2B1GA 1IXBA 4UVBA 4J10A 4R8CA 1GO3F 3ZHUA 4EB6A 2PYJA 2HHHB 3BFRA 1XL4A 3G6BA 4QJFB 5B3SC 2DN9A 4JI1B 4I5SA 1Q81W 1Y74B 1I94O 2AGAA 2JEUA 3HKEA 3JD2A 5IJ0A 3CRCA 5B1AB 4ABMA 4WF9V 4I50A 5KA6A 1WB8A 3CCJV 2WLNA 4LF4B 1GH6A 3JYCA 3W7XA 1G4YB 1ORQC 4O4HA 3UO3A 3BA9A 4X64O 3HKEB 1HP8A 1BE3H 3RW0A 4KP4A 1FXHA 3H01A 1OJHA 3EHBB 4X1YA 4YJ3B 2HJDA 2WLMA 1EN5A 2HVKC 3MDSA 3J80N 4U3JB 3KKYA 3DTUB 3W7TA 1CEZA 4B3MB 2LGWA 2FKXA 3OE7G 1R3IC 4L8JA 3APQA 3E22A 1GRJA 1SQPH 3HR0A 1JFFB 4FLXA 2QA4V 4IT5A 2UUBB 1S72V 3JALB 1K5SA 3SDLA 5CA1B 1R6KA 2IW5A 2CK3G 3KG2A 1YVWA 1HR0B 1WNSA 2VQFO 1MSDA 5EC2C 4UUJC 4ZBMA 1WPXA 4DV1B 2ITDC 3A0BZ 1KB9F 4H37A 3NR7A 1XUQA 1R3LC 4DR1B 4W4LA 4PV1B 2YIBA 3BA8A 1F7YA 1I7FA 4I0XB 2WA4A 3HKCB 4YIOA 2CGNA 3JD3A 2QDOA 4QPJA 4GLXA 4FM2A 3JCZA 1PP9H 4FLYA 2N04A 4EFBA 2HJFC 5KHIA 3X2QB 3ETDA 4FM1A 2FMLA 4D7TA 1XL6A 4LFBO 3ABUA 4DV7O 3N2GA 3TGUH 1I08A 2M6YA 4JI8O 3WU2Z 2E5LO 1IVSA 4UFZA 4UVAA 2WWWA 2D2CB 4NTYA 3B8MA 5ITZB
chains in the Genus database with same CATH topology
4JI3O 4DR4O 1I94O 2ZM6O 2AGAA 3J81N 1J5EO 3O65A 2UUBO 4OX9O 1HNZO 3JAMN 4A5UB 1XNRO 1HR0O 1FKAO 4DR6O 1AB3A 3J7AU 2F4VO 4LF9O 1HNXO 1N32O 4DV1O 4X62O 4JV5O 2VQEO 4DUYO 4X64O 1FYJA 5LL6Y 4DV5O 4LF7O 4DR1O 1XNQO 2LW7A 1R6TA 3OTOO 4K0KO 4LF6O 4DR2O 3T1YO 4OPHA 2JRIA 4NXMO 2Z0AA 4DR5O 3M8AA 5A2QN 4NXNO 4KHPO 3J80N 4JI7O 2DOSA 3F5TA 4DV6O 4JI5O 1D2DA 1AILA 2DJVA 5BR8O 5LMNO 2FKXA 2UXBO 4DV2O 1DK1A 2N74A 2HHHO 5BXZA 4X65O 3RT3C 4DR7O 1FJGO 3SDLA 4JI1O 2UXDO 1A32A 4B3RO 2VQFO 3T1HO 4JI4O 4LFAO 1HNWO 4LFCO 4X66O 2ZKOA 4JI2O 4DV3O 4GKKO 1NS1A 4B3TO 4YY3O 1XMQO 4OPAA 1IBLO 5IWAO 4LF4O 1IBMO 5LMUO 2UUAO 4DV0O 1N36O 1F7YA 2UXCO 4GKJO 5H5NA 1X59A 1XMOO 4JYAO 1R1BA 5BY1A 1IBKO 2UUCO 4DR3O 5IT9N 4LF8O 4YHHO 2UU9O 1XEQA 1N34O 1KUQA 4B3SO 4JI0O 4DV4O 4LFBO 4JI6O 4DV7O 1YZBA 4JI8O 4AQYO 2E5LO 4B3MO 1N33O 4LF5O 4DUZO 3R66A 1G1XB 5FLXN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 O;  4DR4 O;  1I94 O;  2ZM6 O;  2AGA A;  3J81 N;  1J5E O;  3O65 A;  2UUB O;  4OX9 O;  1HNZ O;  3JAM N;  4A5U B;  1XNR O;  1HR0 O;  1FKA O;  4DR6 O;  1AB3 A;  3J7A U;  2F4V O;  4LF9 O;  1HNX O;  1N32 O;  4DV1 O;  4X62 O;  4JV5 O;  2VQE O;  4DUY O;  4X64 O;  1FYJ A;  5LL6 Y;  4DV5 O;  4LF7 O;  4DR1 O;  1XNQ O;  2LW7 A;  1R6T A;  3OTO O;  4K0K O;  4LF6 O;  4DR2 O;  3T1Y O;  4OPH A;  2JRI A;  4NXM O;  2Z0A A;  4DR5 O;  3M8A A;  5A2Q N;  4NXN O;  4KHP O;  3J80 N;  4JI7 O;  2DOS A;  3F5T A;  4DV6 O;  4JI5 O;  1D2D A;  1AIL A;  2DJV A;  5BR8 O;  5LMN O;  2FKX A;  2UXB O;  4DV2 O;  1DK1 A;  2N74 A;  2HHH O;  5BXZ A;  4X65 O;  3RT3 C;  4DR7 O;  1FJG O;  3SDL A;  4JI1 O;  2UXD O;  1A32 A;  4B3R O;  2VQF O;  3T1H O;  4JI4 O;  4LFA O;  1HNW O;  4LFC O;  4X66 O;  2ZKO A;  4JI2 O;  4DV3 O;  4GKK O;  1NS1 A;  4B3T O;  4YY3 O;  1XMQ O;  4OPA A;  1IBL O;  5IWA O;  4LF4 O;  1IBM O;  5LMU O;  2UUA O;  4DV0 O;  1N36 O;  1F7Y A;  2UXC O;  4GKJ O;  5H5N A;  1X59 A;  1XMO O;  4JYA O;  1R1B A;  5BY1 A;  1IBK O;  2UUC O;  4DR3 O;  5IT9 N;  4LF8 O;  4YHH O;  2UU9 O;  1XEQ A;  1N34 O;  1KUQ A;  4B3S O;  4JI0 O;  4DV4 O;  4LFB O;  4JI6 O;  4DV7 O;  1YZB A;  4JI8 O;  4AQY O;  2E5L O;  4B3M O;  1N33 O;  4LF5 O;  4DUZ O;  3R66 A;  1G1X B;  5FLX N; 
#chains in the Genus database with same CATH topology
 3ZMZ A;  1LUW A;  1OCZ B;  3CE2 A;  1O9H A;  3CRA A;  1I5X A;  3LNN A;  5EZY A;  3LSS A;  4RQE A;  3RYC B;  3J7A U;  3CD6 V;  3HKB B;  1ZL8 A;  1MZF A;  4NVP A;  4JV5 O;  3LDC A;  4RO2 A;  5LL6 Y;  3H1K H;  5GON A;  4WFH A;  1NKD A;  4K0K O;  5LYJ A;  4I7Z B;  5J2U A;  4OPH A;  5JVD A;  1CXZ B;  1UFI A;  5CA0 A;  3Q4H B;  1M56 C;  1SS3 A;  2QWR B;  2JJ1 G;  1Q3E A;  3RFR A;  2Q67 A;  1DK1 A;  1KQS U;  1COW G;  1THZ A;  2IM9 A;  4LNU B;  4CH6 A;  4OGQ B;  2B1I A;  2PI4 A;  4MS2 A;  1G8M A;  4ICG A;  4X89 A;  2XAJ A;  3SJC C;  2CTP A;  1OCO C;  3JCU Z;  5IDJ A;  2WLH A;  4DUY B;  1VEW A;  3BPZ A;  2XHB A;  1S76 D;  1IBL O;  1QCE A;  5LGT A;  4CZZ A;  5LMU O;  3B4S A;  2UXC O;  5KX5 B;  2BSK B;  3HPL C;  4LF6 B;  4DR2 B;  2ZNI A;  1SA0 B;  4LH7 A;  5JH7 A;  3W7S A;  1BQ0 A;  2DMX A;  4ZIB A;  4PI0 A;  4FLV A;  4O4L B;  2UU9 O;  3LUT B;  3TK1 A;  5LMN B;  1NI8 A;  2KQX A;  1K73 W;  2UXB B;  1F51 A;  5IJ9 B;  2KKW A;  4JAS A;  4JI0 O;  4DV4 O;  3ZHT A;  4DR7 B;  4PA6 A;  1BGY H;  2PY5 A;  2BE3 A;  2CDY A;  2Q69 A;  2Q73 A;  3QNE A;  3MD0 A;  3AG1 B;  4GCZ A;  4JPR A;  2GTA A;  2ZD9 A;  5HFL A;  1JX9 A;  4UCO A;  3LDD A;  1NTM H;  3K04 A;  4O2B A;  4GKJ B;  2E76 B;  1GN2 A;  2X7R B;  4LC1 A;  1QR8 A;  3IGA C;  1AI6 A;  1ZUQ A;  2JGU A;  1CP9 A;  1SZX A;  5H2F Z;  2VS0 A;  3ZHV A;  2BTQ A;  1K7D A;  3T1Y O;  4PDV A;  3K08 A;  4CS4 A;  3RVY A;  1LR1 A;  1R6N A;  2UXX A;  3ZMV A;  1BT8 A;  4PI2 A;  3ABT A;  3STL C;  1I94 B;  3VQY A;  2IH1 C;  1AJQ A;  1YF2 A;  2A79 B;  5CBF A;  5DN6 G;  3AG2 B;  1TGO A;  4X20 B;  3T1H O;  2EIM B;  4X66 O;  3AG3 B;  3JAK A;  5L3E A;  3OMA B;  4PHZ A;  4X64 B;  4N23 A;  5D5P A;  4ZI7 B;  3I5D A;  2ETN A;  2YEV B;  2Q5Z A;  1S5L Z;  2QJ1 A;  2UUA O;  1KYO F;  1N36 O;  2Y48 A;  4MVR A;  4QPK A;  1QLE B;  3SPG A;  4GKK B;  3STZ C;  4LF8 O;  4EEQ A;  5C8Y B;  1JJ2 U;  2PUS A;  1PNK A;  3OEE G;  1TAE A;  1Q90 D;  1PL4 A;  2JIZ G;  3CJH B;  4X88 A;  3CME V;  3ASN C;  1VQP V;  5KHH A;  5D5Q A;  4G28 B;  1B3Q A;  2OIG A;  3IC7 A;  2LFS A;  2DQ3 A;  1YZB A;  3ABK C;  3JAT A;  4J7J A;  4KL1 A;  5KAI Z;  4TQD A;  4TV9 B;  3SJQ C;  2X6C A;  2VQF B;  3LSU A;  3RVZ A;  1HWY A;  4A5U B;  4J9Y B;  3CPW U;  2JGD A;  1M93 A;  3F7V C;  2IH3 C;  4QNH B;  3EFF K;  3BCC H;  4X62 O;  3QTC A;  2WLJ A;  4MTX A;  1AI5 A;  2ZIN A;  2W6J G;  1WB7 A;  5BMV A;  5H9C A;  4W4K A;  2JK5 C;  3FB6 C;  4PD4 F;  4PA7 A;  1JQ0 A;  3K0D A;  5DEC A;  4LFB B;  4DV7 B;  3F5T A;  4DV6 O;  4JI8 B;  2E5L B;  5JCO C;  3JAW B;  1YHQ V;  4NTW A;  4H33 A;  4DV2 O;  3RT3 C;  1QVG U;  3RYF B;  1Y67 A;  5KA5 A;  4IIJ B;  3ZMS A;  2IBZ H;  1WPB A;  2L6L A;  4LFC O;  2OCC B;  4RUE A;  3TXQ A;  4JV5 B;  2ZDI C;  4PJ0 Z;  1TVK B;  3MHS C;  4CC6 A;  1IXM A;  3DGE A;  4PDR A;  1VAR A;  3JAS A;  4DV0 O;  4J42 A;  1K33 A;  4R6Z A;  4K0K B;  2ZE7 A;  5BY1 A;  1IBK O;  5EYP B;  1PPJ H;  1EZV H;  4DR3 O;  2PTM A;  1MNG A;  1S3J A;  2RMK B;  4E4E A;  2ZCE A;  1KBH A;  2YXL A;  3RWR D;  4Q6G A;  2GV9 A;  3E86 A;  4BR6 A;  3K06 A;  2Y0P A;  3QO8 A;  3KCX A;  1QHT A;  3P30 A;  4PEL A;  1L8D A;  1YJ9 V;  4CH5 A;  1OHH G;  1W0K G;  4UVC A;  2LO1 A;  3K5N A;  3X2Q C;  1WA8 B;  1AB3 A;  4DK0 A;  1IBL B;  2HP8 A;  2DQ0 A;  4LWS B;  1YIT V;  2QKS A;  4JAV A;  3TXS A;  5A9G A;  4K35 A;  1YJN V;  4UV9 A;  1VQ5 V;  4I4T B;  3OR7 C;  4H13 B;  3OM3 B;  4PDM A;  1OCZ C;  2CGO A;  3UT5 B;  2P4V A;  3SYP A;  2UU9 B;  4X1I B;  2XAS A;  4NXM O;  3ABM B;  1IX9 A;  1V54 C;  3UO2 A;  1K4C C;  3CMA V;  1AR5 A;  4JI0 B;  3A0H Z;  4DV4 B;  3WG7 B;  1AIL A;  5J2T B;  1MG1 A;  1DF4 A;  2DYS B;  3WB2 A;  3SYC A;  4RUF A;  1XRE A;  5IYB O;  2Y0I A;  2K1E A;  1RPR A;  2VWJ A;  2F66 C;  4WBN A;  1R3K C;  5KHG A;  2OCH A;  4J11 A;  3DXR B;  1NS1 A;  1P4R A;  2D3O W;  4JF3 A;  3G6E V;  2DWD C;  2V4D A;  1Q6H A;  4BIU A;  2YIC A;  3RN4 A;  4X1K A;  2WLL A;  3T1Y B;  4NR1 A;  1HW7 A;  1PL0 A;  2RCV A;  3SJA C;  4IYI A;  3TET A;  1Q43 A;  4GYC B;  3MAQ A;  3L75 H;  4XDK A;  2YXY A;  1SKV A;  3E2E A;  4WFA V;  5FPR A;  2P22 C;  5JWP A;  5LA6 B;  1VQ4 V;  3T2M A;  1RM1 B;  4AQY O;  1DLB A;  4QIW F;  1SQB H;  1SQG A;  4HBN A;  3AK3 A;  3R66 A;  4FLT A;  3CXC U;  1NTZ H;  4DYL A;  4JI3 O;  4DR4 O;  2QR4 A;  2VWK A;  3T1H B;  4B7K A;  1J5E O;  3FB5 C;  4X66 B;  4I55 B;  4IYH A;  3SYO A;  3B09 A;  1M57 B;  1N0J A;  4UCU A;  1BCC H;  3JSN A;  3L72 H;  1Y74 A;  3IJ4 A;  2F4V O;  1HNX O;  1T5E A;  3QO5 A;  2UUA B;  1VF7 A;  1N36 B;  4JYB A;  2Q0O C;  1NH2 B;  4NTX A;  3AG1 C;  3FKS G;  5JCO A;  5LOV B;  4LF8 B;  3JD0 A;  3T4Z A;  2OIE A;  2ATK C;  4YJ3 A;  2A7W A;  1URF A;  3OFN G;  3CRQ A;  4WFE A;  3K58 A;  1XIL A;  4U3J A;  1M4U A;  3FX7 A;  1FJG O;  2ZDI A;  3FYI B;  4B3R O;  2EJR A;  3CEI A;  1JFF A;  3BEH A;  3JAL A;  5CA1 A;  4GKK O;  4X62 B;  1Z5W A;  4F6R B;  4MVQ A;  5LHI A;  2A3Q A;  1H2L A;  2Q7G A;  1ZAU A;  2ARH A;  3M7M X;  1AJN A;  5H5N A;  3P3P A;  3N27 A;  1KKD A;  3K3W A;  3AG2 C;  1AR1 B;  1O9G A;  3GB7 C;  5IYD O;  2E3C A;  2AHY A;  3WB1 A;  2EIM C;  3P3N A;  2XAF A;  4DV6 B;  4YHH O;  3AG3 C;  4I0X A;  3HKC A;  4U3F H;  1XEQ A;  2ZIM A;  2QGN A;  4DV2 B;  3BRC A;  4BW9 A;  4JI6 O;  1JPX A;  4JTA B;  1G6U A;  2RN9 A;  2Y69 C;  3CS5 A;  3T4D A;  4FVM A;  1SER A;  1QLE C;  4AI8 A;  4LFC B;  4HYO A;  3VQW A;  3VQV A;  5ITZ A;  1M5I A;  2JDI G;  3ABL B;  4NKG B;  3ZCC A;  1LUV A;  2EJ7 A;  3B77 A;  4DV0 B;  1K9M W;  1QBZ A;  1EN6 A;  2EIK B;  3RYC A;  4ZOL B;  1DF5 A;  3HKB A;  2E74 B;  1IBK B;  1MMM A;  2DW4 A;  4DR3 B;  3FAV B;  3G67 A;  2EIL B;  2JS5 A;  3ZS8 C;  3CCS V;  4AIL C;  4FFB B;  1EZJ A;  1VP7 A;  2WPD G;  4TV8 B;  1BHA A;  1K34 A;  2Q6A A;  2CTQ A;  1NT2 B;  4MT8 A;  1QQC A;  3Q4H A;  4X65 O;  3CWB H;  4FPP A;  2ZE8 A;  4PDL A;  4UCV A;  3N2K B;  1ROP A;  1YJW V;  4ZKI A;  4JI4 O;  4LNU A;  5DM6 V;  2QE7 G;  3C3T A;  3WFV A;  2IJI A;  3H1I H;  2MK3 A;  3B40 A;  2YIA A;  5L3D A;  1X4T A;  3B8N A;  5FNV A;  3A2F A;  1BL8 A;  1AI7 A;  2BOB C;  4Z1M G;  5EK0 A;  2PYL A;  1JVM A;  4XDL A;  4NXM B;  1ZLZ A;  1Y4M A;  3H1H H;  4NB5 A;  5IT9 N;  2OCC C;  5KX5 A;  2BSK A;  5B1B B;  5FNV B;  1JR9 A;  1SA0 A;  5B66 Z;  2IJK A;  1RPO A;  1VQ8 V;  1BMF G;  4O4L A;  3UQ8 A;  1XI1 A;  4LF5 O;  2RDC A;  1G1X B;  5IJ9 A;  2BOC C;  1QR9 A;  2ZM6 O;  3GWK C;  1XQ8 A;  1PD3 A;  1BZK A;  4IHJ B;  4MVZ A;  1L0L H;  3IFX A;  4YXW G;  2F43 G;  4LH6 A;  2P7T C;  2R72 A;  5JJE B;  3NXS A;  3O9O A;  2OWO A;  4XDJ A;  1OZ0 A;  4JZ2 A;  1B06 A;  1YSC A;  3ETG A;  1YIJ V;  1PKX A;  2XTA A;  3CCM V;  4MTG A;  3H1J H;  4G27 B;  4NXN O;  3JAR B;  2NLJ C;  4AQY B;  5E79 Z;  5LP6 B;  1E1R G;  3FYE B;  4UB8 Z;  4OXS A;  1P7G A;  1VQK V;  2R9A A;  1S77 D;  4JI3 B;  4FK5 C;  3SGI A;  4DR4 B;  3OEH G;  4O2A B;  1J5E B;  2P67 A;  1OCC B;  5CMU A;  3ETE A;  1BQZ A;  1A32 A;  4ZHQ A;  2F4V B;  1HNX B;  1PNM A;  4DV3 O;  3WG7 C;  1I5Y A;  2ZXW B;  3AK2 A;  3S3W A;  1FXK B;  4X20 A;  4P9O A;  2DYS C;  5B1O A;  2GUZ B;  5CBG A;  4ZHQ B;  1IUR A;  1YTF B;  1U96 A;  3OGI B;  2EX3 A;  1H2N A;  4ZI7 A;  3ZHQ A;  2YEV A;  1VMG A;  2Q8V A;  2H94 A;  5LGN A;  5EBL C;  4FMT A;  1AJP A;  4HNA B;  5J9P C;  3BAA A;  4UV8 A;  4K3A A;  4C7U A;  3ZJZ A;  2WLI B;  3ZRW B;  1GN4 A;  1S5H C;  5C8Y A;  1FJG B;  1J95 A;  2P06 A;  3CJH A;  1CPY A;  4B3R B;  4GT1 A;  1R73 A;  3O65 A;  4OX9 O;  2W0F C;  3LNM B;  5GW7 A;  2OYQ A;  1M90 W;  4YIP A;  4TV9 A;  1FKA O;  4MW3 A;  3F7Y C;  5FL7 G;  1NTK H;  3ICX A;  1RM1 C;  2VQE O;  3ZHS A;  3JSL A;  4R7C A;  1Q86 W;  4DV5 O;  2HEP A;  5IY5 B;  3L9D A;  2LW7 A;  3A8T A;  1HNZ B;  3CSX A;  4YHH B;  1M57 C;  1NH2 D;  1SC5 B;  4P9P A;  4CH4 A;  2WA3 A;  3E8G A;  4JI6 B;  5BR8 O;  4TUY B;  4D6T H;  3VOU A;  1VF5 B;  3ASO B;  1RP3 B;  3CP1 A;  5LXT A;  4U7N A;  3OMN B;  3CCE V;  5H6Q A;  1SZT A;  5KLV H;  3JAW A;  1SQQ H;  3DC5 A;  4H0L B;  3CCU V;  1RFY A;  4O4J B;  4X9Q A;  1IDS A;  4EKW A;  4JZG A;  4BWA A;  5B1A C;  2FL4 A;  3TJT A;  3RYF A;  5LXT B;  5LHH A;  1KP2 A;  2NR5 A;  4IIJ A;  1FXV A;  4B3T O;  2LJ2 A;  3UCS C;  1Y76 B;  2ODM A;  3RYH B;  4DK1 A;  1XHZ A;  2QKC A;  3PJS K;  1XDC A;  1V55 B;  1TVK A;  4DXW A;  4FLU A;  1XMO O;  2EIN B;  1NR1 A;  4YJ2 B;  2QM7 A;  1K5Q A;  5JQG B;  3FB8 C;  1K3E A;  4U7O A;  1KP3 A;  1WP8 A;  5EYP A;  3K9A A;  2ADP A;  4X65 B;  2QTS A;  3K5O A;  4GX5 A;  1E1Q G;  4MVU A;  3ZRV A;  2ZR2 A;  4DUZ O;  5FPO A;  4JI4 B;  2MW2 B;  4LP8 A;  1NR7 A;  2X6A A;  2YUA A;  3SYA A;  3KZI Z;  1GAX A;  4G2K A;  2Q68 A;  3SPJ A;  4DR6 O;  2XAH A;  1US6 A;  3EVK A;  1WA8 A;  4DRX B;  4LF7 O;  3IAY A;  4LWS A;  1XNQ O;  3D3Q A;  1KU9 A;  3SR2 C;  2B5U A;  3APO A;  1F4M A;  4I4T A;  5KUK A;  2N05 A;  3ABL C;  5A2Q N;  1EBO A;  4JI7 O;  4F4L A;  1MZE A;  1NBM G;  1H38 A;  4RAI A;  3UT5 A;  2DJV A;  3W7U A;  4X1I A;  4LF5 B;  4MSW C;  2EIK C;  3DSQ A;  3CRM A;  2ZM6 B;  5L3G A;  5IYC O;  5J2T A;  1MAB G;  3OAA G;  4QE9 A;  3HKD B;  4AHC A;  5EIB D;  1PV0 A;  2HR3 A;  2W0X A;  2P90 A;  5IWA O;  3RYI A;  2LFR A;  2JS3 A;  2EIJ B;  1QLN A;  3A0R A;  1MOF A;  5EC1 C;  3DXR A;  2GDS A;  5EIB C;  4NYK A;  4JYA O;  2ZE6 A;  4CH3 A;  4X8A A;  3E8F A;  3BAB A;  1TA8 A;  4NXN B;  4I9Q A;  5CB4 B;  4GX2 A;  4WCE V;  3RYI B;  2F93 B;  1H2S B;  2W6I G;  1VQ7 V;  1B6Q A;  1HDJ A;  1VQ6 V;  1SET A;  4WFG A;  1SES A;  4P2Z A;  4MTO A;  2JVD A;  2YDE A;  2HVJ C;  1TUB B;  3AG4 B;  3L71 H;  5GTI Z;  5LA6 A;  3K57 A;  3J81 N;  4DV3 B;  2PI5 A;  5B1B C;  4CBC A;  4GX0 A;  2ILM A;  4I55 A;  4D7S A;  1MA1 A;  2NN4 A;  4HAM A;  5C93 A;  1WLE A;  1NZ6 A;  4JAU A;  1FPO A;  2QSA A;  3H1L H;  2P4K A;  2QM4 A;  2V1D A;  3VQX A;  5IYZ B;  4DR5 O;  1GM9 A;  3QO7 A;  4FFK A;  5LOV A;  2DOS A;  3BVO A;  2K9P A;  3F5W C;  2KG7 B;  3ZRX A;  4OX9 B;  1XOU A;  3G4S V;  2FTK A;  3ML0 A;  4FIP C;  1UJW B;  3K79 A;  1NVP D;  2ZKO A;  3K0G A;  2WSS G;  4J80 A;  4UCS A;  5K1X A;  2VQE B;  1N0N A;  1FFX B;  5LP6 C;  4YY3 O;  4LBE C;  5KMG B;  2Y4T A;  4J7K A;  4DV5 B;  5B5E Z;  2UXD B;  1Q5O A;  1OCC C;  3L74 H;  4F6R A;  3THO A;  3ZN0 A;  2XND G;  1SF9 A;  4EB6 B;  1DGS A;  2HFE C;  1YTF D;  2BTO A;  4GX1 A;  5KHK A;  3D8C A;  5BR8 B;  1JMK C;  2ZXW C;  1SQX H;  1FXK C;  3K59 A;  2A9H A;  1P7B A;  5IJ0 B;  1SQF A;  4I50 B;  1VQN V;  4N21 A;  1V9P A;  1HNZ O;  2IJJ A;  4O4H B;  2EZO A;  5K1P A;  2OTL V;  4B3T B;  5LHG A;  3E35 A;  3CRR A;  3OD4 A;  4DW1 A;  4MVS A;  5B1N A;  4MVM A;  4J41 A;  2R9R B;  1XMO B;  4X1Y B;  3R65 A;  1WN7 A;  1W59 A;  3OTO O;  4JYY A;  2Q4P A;  1EN4 A;  4ZOL A;  4XBF A;  3E22 B;  1H8H G;  4JI5 O;  1Q7Y W;  1D2D A;  3FAV A;  1Z5V A;  5F2V O;  4FZ1 A;  4DUZ B;  2CUG A;  1D5A A;  4UCR A;  2N74 A;  4FFB A;  2YID A;  5BXZ A;  4KXR A;  5IY5 C;  1K8A W;  1W0J G;  3D36 C;  3ZIA G;  4BIZ A;  3ETQ A;  4TV8 A;  3W7W A;  3E8H A;  3CCV V;  4DR6 B;  2YC0 A;  4TSF G;  4LFA O;  2QTO A;  2E75 B;  1OV9 A;  3GVM A;  4JI2 O;  3MHH C;  3K5M A;  3N2K A;  1XMQ O;  4LF7 B;  3ASO C;  2ZE5 A;  1XNQ B;  2OTJ V;  3CB2 A;  1GN3 A;  3AG7 A;  2QWP B;  1WJZ A;  1YCI A;  3CXH F;  3AEI A;  1GKF A;  4K8Z A;  2Q7H A;  4JI7 B;  1FD9 A;  1QU7 A;  3N2G B;  1V54 B;  4TT3 G;  3B2E E;  1N34 O;  4B3S O;  4UB6 Z;  1QNM A;  3ZMU A;  4H44 B;  1N33 O;  1MSW D;  1V55 C;  2QWO B;  2PZS A;  5EZY B;  4CS2 A;  3K03 A;  1UPG A;  2EIN C;  4ASU G;  4IL6 Z;  4Z2W A;  3ZN1 A;  3FB7 C;  1BSM A;  1ZL8 B;  1VQO V;  4QE7 A;  3RGB A;  5IWA B;  4LF9 O;  4IHJ A;  5GON B;  2B9Z A;  2ZT9 B;  1N32 O;  1Q6U A;  3SJB C;  1Z2G A;  5LYJ B;  3HB3 B;  1OCR B;  3CC4 V;  1FYJ A;  4JYA B;  1S5J A;  1R3J C;  4KFM A;  5J2U B;  1K92 A;  5JVD B;  4LR3 A;  3AK1 A;  1KKC A;  5CA0 B;  2HLD G;  5AG2 A;  4GUN A;  1VQ9 V;  2JRI A;  2Z0A A;  3KCY A;  4QGP A;  4TQF A;  1VQL V;  4TWK A;  2YS8 A;  2AZ0 A;  1P49 A;  3CHX A;  3OT7 A;  3PN1 A;  1JCH A;  2P5O A;  1KC8 W;  2FB5 A;  1QVF U;  1VF6 C;  3JAR A;  5LP6 A;  3U11 A;  2DYR B;  4O2A A;  4MTF A;  3ZRS A;  1HNW O;  1YDX A;  1M9N A;  3CCQ V;  1PNL A;  2L35 A;  2OT5 A;  3U0Z A;  2XUM A;  4B7E A;  1ZWI C;  5JH7 B;  5B3S B;  1IBM O;  1AP5 A;  1Q8I A;  1XHX A;  2FYU H;  3G71 V;  2RNB A;  1KEC A;  2YSU B;  1FXK A;  1NVP B;  4DR5 B;  2GBO A;  3E83 A;  2UUC O;  2GUZ A;  2H8P C;  2ZNJ A;  3L73 H;  3ABM C;  2GHY A;  5E1A C;  1DTO A;  3LDE A;  2EZP A;  1JA8 A;  1KUQ A;  4IGG A;  4L87 A;  1KD1 W;  2EIJ C;  4HNA A;  1K97 A;  5FLX N;  2WLI A;  2CTR A;  3ZRW A;  5CA3 A;  2RQ6 A;  3K5L A;  1W2B U;  2XT9 A;  2P6J A;  3CX5 F;  3OUF A;  4O4I A;  2NNU A;  4O2B B;  1XNR O;  4YY3 B;  2H3O A;  2F23 A;  1GM7 A;  2AZ2 A;  3GWO A;  1JJO A;  1I0H A;  1GMG A;  2BTQ B;  3RBZ A;  3UM7 A;  4FM0 A;  3AG4 C;  1F23 A;  4O4I B;  1LNQ A;  4WFB V;  2IU0 A;  1FAF A;  3SPC A;  1WP7 A;  2LP7 A;  1B04 A;  1FFT B;  4F6E A;  2PF4 E;  4KHP O;  3D36 A;  1D5N A;  2X0L A;  2YI9 A;  2XAG A;  3SYQ A;  1M1K W;  3P32 A;  1GM8 A;  4RWU A;  1N8R W;  2Y4U A;  2Y69 B;  3G80 A;  2A0L A;  4DO2 A;  2HHH O;  4P30 A;  4TUY A;  3JAK B;  4PA3 A;  4JI1 O;  1ZTE A;  2UXD O;  5CBH A;  1PM9 A;  2A06 H;  4MW8 A;  2O57 A;  3IC9 A;  1AP6 A;  5GTH Z;  1GN6 A;  3H9V A;  2PGG A;  2F1M A;  4O4J A;  4MVO A;  4OPA A;  2JJ2 G;  2Z3Y A;  3CC7 V;  2AW9 A;  4LF4 O;  2ITC C;  2AXT Z;  3L70 H;  1Y6X A;  3OTO B;  2ADQ B;  1Y76 A;  2DE0 X;  4DW0 A;  3RYH A;  5L3C A;  3M99 B;  3OMI B;  4KUM A;  2V7Q G;  1EM1 A;  4JI5 B;  2M7W A;  3JAT B;  3EXA A;  1NJI W;  2VRZ A;  1IZ3 A;  4YJ2 A;  5EBM C;  3I56 V;  2QEX V;  3FD9 A;  5JQG A;  1FS0 G;  5HFM A;  4B3M O;  3C3S A;  3LSQ A;  4BIO A;  2F95 B;  5L3B A;  1H2M A;  1KMI Z;  1AI4 A;  2ZQM A;  4EFE A;  2Z5U A;  4LFA B;  2JGD B;  4JI2 B;  2UUB O;  2JEX A;  3CCR V;  2RJZ A;  1XMQ B;  1HR0 O;  4K8X A;  2LQT A;  5JJN B;  2KB1 A;  4WFF A;  4DV1 O;  1M56 B;  2AHZ A;  3E8B A;  3K9S A;  4CC5 A;  5LGU A;  5BMV B;  3SPI A;  3U10 A;  1SRY A;  4DR1 O;  5TIS Z;  1JOY A;  3C90 A;  1R6T A;  2QM8 A;  1XBL A;  4JTD B;  1AVM A;  4DRX A;  2Q9L A;  2YXH A;  3BHP A;  3QG5 A;  5CN0 A;  1N34 B;  2IJH A;  1VF6 A;  3CYO A;  4B3S B;  1OCO B;  2ZR3 A;  3S3X A;  5BZB A;  3ZED A;  2X6B A;  4E2L A;  2KSD A;  1N33 B;  4JTC B;  4UCT A;  4HZ3 A;  4I9W A;  3OUS A;  3VBB A;  1BS3 A;  3E89 A;  1H2G A;  3OGC C;  2XOK G;  2UXN A;  2GTS A;  1N4C A;  1E79 G;  2ZIO A;  4LF9 B;  1S0V A;  1N32 B;  2QWQ B;  3JAS B;  1L0N H;  1Y66 A;  1BHB A;  1GK9 A;  3HKD A;  1K4D C;  3JD1 A;  2CH7 A;  3ZBH A;  2YIB D;  2LW1 A;  5KUM A;  2C2A A;  3BY6 A;  1X59 A;  4JGS A;  1H8E G;  3TCU A;  4B08 A;  2EBO A;  3D3I A;  1ENV A;  2G38 A;  5DED A;  2HKO A;  1NQT A;  5L3F A;  4J9Z B;  3OR6 C;  4LCU C;  1ARO P;  2EIL C;  4TOI A;  2CH7 B;  5JJJ B;  3SPH A;  3JD4 A;  3I55 V;  1WAZ A;  2DWE C;  5H6R A;  5LMU B;  1F4N A;  1H2K A;  1ZX3 A;  2HG5 C;  4JYC A;  2UXC B;  5CB4 A;  1P84 F;  4CS3 A;  3FFQ A;  2R9I A;  4RQF A;  3WB0 A;  1HNW B;  1SQV H;  1TUB A;  2CAZ C;  3DC6 A;  3OTF A;  3JAM N;  1VQM V;  3ZHR A;  4PA4 A;  3OW2 U;  1IBM B;  4FLW A;  4JAA A;  4DUY O;  4UXN A;  4Z1V A;  4BAY A;  3ZMT A;  5IE9 A;  2R70 A;  3CCL V;  2QWN B;  2UUC B;  3QVN A;  1AR4 A;  4LF6 O;  4DR2 O;  5EBW C;  1RSO A;  3QF7 A;  5KHJ A;  3M8A A;  2QKA A;  2Q7E A;  2BCC H;  5IYZ A;  2EUL A;  5LMN O;  2GSM B;  4GZR B;  2UXB O;  3ZX6 A;  1OCR C;  4PA9 A;  4FLZ A;  4FJC C;  1EFR G;  1TUE B;  1RSO B;  4DR7 O;  1U97 A;  2WLK A;  4WBN B;  4BW5 A;  3CC2 V;  1XNR B;  2KG7 A;  2XAQ A;  2IU3 A;  1GTO A;  1VIB A;  2LGQ A;  3UKM A;  1NU1 H;  1Q82 W;  2YI8 A;  4X1K B;  4J7Z A;  3ASN B;  2WLL B;  3T1C A;  1ZSP A;  1YXB A;  5KAF Z;  3ABK B;  4Q20 A;  2CE4 A;  1Q6I A;  1FFX A;  4GKJ O;  5KMG A;  1R1B A;  4FZ0 A;  2DYR C;  1YEW A;  1L1F A;  2WAM A;  4KHP B;  2CTW A;  2Q0A A;  5LBQ A;  1YI2 V;  4R50 A;  2B1G A;  1IXB A;  4UVB A;  4J10 A;  4R8C A;  1GO3 F;  3ZHU A;  4EB6 A;  2PYJ A;  2HHH B;  3BFR A;  1XL4 A;  3G6B A;  4QJF B;  5B3S C;  2DN9 A;  4JI1 B;  4I5S A;  1Q81 W;  1Y74 B;  1I94 O;  2AGA A;  2JEU A;  3HKE A;  3JD2 A;  5IJ0 A;  3CRC A;  5B1A B;  4ABM A;  4WF9 V;  4I50 A;  5KA6 A;  1WB8 A;  3CCJ V;  2WLN A;  4LF4 B;  1GH6 A;  3JYC A;  3W7X A;  1G4Y B;  1ORQ C;  4O4H A;  3UO3 A;  3BA9 A;  4X64 O;  3HKE B;  1HP8 A;  1BE3 H;  3RW0 A;  4KP4 A;  1FXH A;  3H01 A;  1OJH A;  3EHB B;  4X1Y A;  4YJ3 B;  2HJD A;  2WLM A;  1EN5 A;  2HVK C;  3MDS A;  3J80 N;  4U3J B;  3KKY A;  3DTU B;  3W7T A;  1CEZ A;  4B3M B;  2LGW A;  2FKX A;  3OE7 G;  1R3I C;  4L8J A;  3APQ A;  3E22 A;  1GRJ A;  1SQP H;  3HR0 A;  1JFF B;  4FLX A;  2QA4 V;  4IT5 A;  2UUB B;  1S72 V;  3JAL B;  1K5S A;  3SDL A;  5CA1 B;  1R6K A;  2IW5 A;  2CK3 G;  3KG2 A;  1YVW A;  1HR0 B;  1WNS A;  2VQF O;  1MSD A;  5EC2 C;  4UUJ C;  4ZBM A;  1WPX A;  4DV1 B;  2ITD C;  3A0B Z;  1KB9 F;  4H37 A;  3NR7 A;  1XUQ A;  1R3L C;  4DR1 B;  4W4L A;  4PV1 B;  2YIB A;  3BA8 A;  1F7Y A;  1I7F A;  4I0X B;  2WA4 A;  3HKC B;  4YIO A;  2CGN A;  3JD3 A;  2QDO A;  4QPJ A;  4GLX A;  4FM2 A;  3JCZ A;  1PP9 H;  4FLY A;  2N04 A;  4EFB A;  2HJF C;  5KHI A;  3X2Q B;  3ETD A;  4FM1 A;  2FML A;  4D7T A;  1XL6 A;  4LFB O;  3ABU A;  4DV7 O;  3N2G A;  3TGU H;  1I08 A;  2M6Y A;  4JI8 O;  3WU2 Z;  2E5L O;  1IVS A;  4UFZ A;  4UVA A;  2WWW A;  2D2C B;  4NTY A;  3B8M A;  5ITZ B; 
#chains in the Genus database with same CATH homology
 4JI3 O;  4DR4 O;  1I94 O;  2ZM6 O;  2AGA A;  3J81 N;  1J5E O;  3O65 A;  2UUB O;  4OX9 O;  1HNZ O;  3JAM N;  4A5U B;  1XNR O;  1HR0 O;  1FKA O;  4DR6 O;  1AB3 A;  3J7A U;  2F4V O;  4LF9 O;  1HNX O;  1N32 O;  4DV1 O;  4X62 O;  4JV5 O;  2VQE O;  4DUY O;  4X64 O;  1FYJ A;  5LL6 Y;  4DV5 O;  4LF7 O;  4DR1 O;  1XNQ O;  2LW7 A;  1R6T A;  3OTO O;  4K0K O;  4LF6 O;  4DR2 O;  3T1Y O;  4OPH A;  2JRI A;  4NXM O;  2Z0A A;  4DR5 O;  3M8A A;  5A2Q N;  4NXN O;  4KHP O;  3J80 N;  4JI7 O;  2DOS A;  3F5T A;  4DV6 O;  4JI5 O;  1D2D A;  1AIL A;  2DJV A;  5BR8 O;  5LMN O;  2FKX A;  2UXB O;  4DV2 O;  1DK1 A;  2N74 A;  2HHH O;  5BXZ A;  4X65 O;  3RT3 C;  4DR7 O;  1FJG O;  3SDL A;  4JI1 O;  2UXD O;  1A32 A;  4B3R O;  2VQF O;  3T1H O;  4JI4 O;  4LFA O;  1HNW O;  4LFC O;  4X66 O;  2ZKO A;  4JI2 O;  4DV3 O;  4GKK O;  1NS1 A;  4B3T O;  4YY3 O;  1XMQ O;  4OPA A;  1IBL O;  5IWA O;  4LF4 O;  1IBM O;  5LMU O;  2UUA O;  4DV0 O;  1N36 O;  1F7Y A;  2UXC O;  4GKJ O;  5H5N A;  1X59 A;  1XMO O;  4JYA O;  1R1B A;  5BY1 A;  1IBK O;  2UUC O;  4DR3 O;  5IT9 N;  4LF8 O;  4YHH O;  2UU9 O;  1XEQ A;  1N34 O;  1KUQ A;  4B3S O;  4JI0 O;  4DV4 O;  4LFB O;  4JI6 O;  4DV7 O;  1YZB A;  4JI8 O;  4AQY O;  2E5L O;  4B3M O;  1N33 O;  4LF5 O;  4DUZ O;  3R66 A;  1G1X B;  5FLX N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...