4NXNO

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4nxnO00
4OPAA 4DV0O 5BY1A 4DV3O 1N34O 3JAMN 1XMOO 4DUZO 4JI4O 4DR6O 4JI3O 3J80N 4DV1O 1FKAO 3R66A 3SDLA 4LF7O 4GKKO 4X66O 5IT9N 3F5TA 1FJGO 2Z0AA 1YZBA 4YY3O 2UUBO 1HR0O 2JRIA 2LW7A 4DR4O 4NXNO 4JI1O 5A2QN 4X65O 4B3TO 2ZKOA 2DOSA 2UXCO 1R1BA 3RT3C 1FYJA 4LF9O 4LF4O 1AILA 1IBMO 2UXDO 2ZM6O 2UU9O 4JI0O 1X59A 4JI2O 2FKXA 5LL6Y 5LMNO 4JV5O 4DV7O 1DK1A 1NS1A 5IWAO 1R6TA 4DV5O 4DR1O 1J5EO 4GKJO 2E5LO 2UXBO 4K0KO 1N36O 4B3MO 1I94O 1KUQA 2N74A 2HHHO 5H5NA 4OPHA 5BR8O 1XNRO 2F4VO 4X64O 4OX9O 4JI6O 1HNWO 2UUAO 4JI5O 4LFCO 2DJVA 4DV4O 1AB3A 2VQFO 4X62O 4DV6O 3OTOO 4KHPO 1IBLO 4JI8O 5LMUO 4DV2O 1D2DA 1N32O 4LF5O 1G1XB 5BXZA 1HNZO 4LFBO 3J7AU 1HNXO 2AGAA 4DR2O 2UUCO 1XMQO 1XNQO 4AQYO 4NXMO 1A32A 1F7YA 3J81N 1N33O 4B3RO 4JI7O 4B3SO 3M8AA 4DR5O 4DR7O 4YHHO 4JYAO 4A5UB 4LF8O 4LFAO 3O65A 4LF6O 3T1HO 2VQEO 1XEQA 4DR3O 5FLXN 4DUYO 1IBKO 3T1YO
chains in the Genus database with same CATH superfamily
1RPRA 3SYQA 4F6RB 3W7UA 2RMKB 2P7TC 4U3FH 3FD9A 1S5HC 2EIMC 4DV1O 3K5OA 1FKAO 3UM7A 3G80A 2EZPA 1S76D 4MVSA 3Q4HB 2EIJB 1GN4A 4IT5A 1N0JA 3RYHA 4LF6B 4CZZA 2WLIB 4CH6A 2HP8A 2YC0A 3E22B 4FPPA 1E1RG 2JEXA 5GONB 5LP6C 1M57B 2ADQB 1T5EA 1HNZB 3ZHTA 4JGSA 2F93B 3LSUA 3M7MX 2E5LB 2DYSC 4KUMA 3CP1A 2QSAA 4KFMA 4F6EA 1R3IC 3AK2A 4TOIA 4BIOA 4OPHA 3AG2C 1VQMV 3E89A 1Q3EA 1I94B 1OCCB 3OEEG 1CPYA 2WPDG 3WG7C 5IJ9A 3G6EV 1RM1C 4JI5O 2ZDIC 2JJ1G 3JAKA 1H8EG 3BEHA 4JI8O 4BAYA 3CC4V 1FXHA 3JD4A 1NI8A 1YJNV 3JCZA 4MVMA 1QVFU 1MZFA 3T2MA 1XNQO 1BQZA 1PKXA 1XI1A 2WLNA 1F7YA 2JGUA 2ZCEA 4DR7O 3AG3C 2NR5A 3SPIA 4K8XA 2A0LA 3SYPA 2YIAA 1OHHG 4PA9A 1HNWB 4FM0A 3L71H 3P3NA 4JAAA 3CB2A 1U97A 3K3WA 2EJRA 1I5XA 4U7NA 1O9GA 3E86A 4JI4B 2X6AA 4JI2B 4DR6O 1GO3F 4JYCA 3R66A 1TGOA 3P3PA 3E8GA 4O4JB 1GKFA 3OMIB 4MTOA 5IYDO 4GKKO 2WLHA 3K03A 1VF5B 3JD3A 3LNMB 4JI5B 4PA7A 5C93A 1ZL8B 3H01A 3CJHB 4TUYB 3ZN1A 1Q90D 3K57A 1G6UA 1R1BA 3FFQA 4ZI7A 4WFAV 5IY5B 2YXLA 4XDLA 5J9PC 2ZM6O 1XMQB 4I50A 2Y0IA 4X1KB 2UXBB 1AI4A 3SPGA 1HW7A 4W4KA 1TVKA 2IM9A 5L3GA 5KHJA 1EZVH 2CGNA 1JJOA 1YJ9V 4WBNA 1H2KA 5C8YA 4Z1MG 1U96A 1KKDA 3ABKC 1WAZA 3DC6A 3OGCC 3VOUA 3ICXA 4DRXB 5GW7A 1K97A 4FIPC 3JSNA 2H94A 2F66C 4C7UA 3MHSC 1UFIA 2HJDA 2WLMA 4UFZA 1XDCA 2AW9A 4DR5O 3JD0A 1WP7A 2WSSG 3O65A 5DECA 3E2EA 2B5UA 5FNVB 2UUAB 5FLXN 4DO2A 1H2LA 2IH1C 3ETGA 3ABMB 2QDOA 1RSOB 3B40A 5L3FA 4JI6B 1L8DA 3UO3A 2XAGA 2AXTZ 1AJNA 4YIOA 3CCQV 1MMMA 2YICA 1JCHA 4PELA 3H1KH 1GM7A 4BW5A 3QO7A 2LFSA 5H2FZ 3K5MA 4ZI7B 1HP8A 2WAMA 1NVPD 3AK3A 1Q81W 5KA6A 2XAHA 4ZHQB 2E75B 1SS3A 1FJGO 3JD2A 2Z0AA 3N27A 1UPGA 4O4JA 1KYOF 1JX9A 1M5IA 2ZKOA 1S72V 2Q6AA 2R72A 4LBEC 1V55C 5LOVA 2E76B 1ZWIC 5DN6G 2K1EA 2QE7G 4I9WA 2B9ZA 3JSLA 2EIKB 4QJFB 5JVDB 4JV5O 5IWAO 1S3JA 5EYPA 4E2LA 1L0NH 1BHAA 3CC7V 2ZNIA 1DLBA 3ZIAG 4AILC 1K33A 2GV9A 3CMEV 4WCEV 2UU9B 3RBZA 3OR6C 4NTXA 3B2EE 4MW3A 4BR6A 3ZHVA 3SPHA 2AHZA 2NN4A 3VQVA 1AB3A 1OCOB 3QF7A 1J95A 4W4LA 1J5EB 1Z2GA 1NT2B 4QE7A 3E8HA 2DWDC 2ZIOA 4LC1A 1ZUQA 1SA0A 3THOA 4QPJA 3HKBB 1F23A 1XEQA 2UXXA 4O4IB 1KUQA 2LGQA 5LXTB 3T1YO 3K08A 2QWQB 3W7XA 3AG3B 3L70H 2CTWA 2WLJA 3CEIA 3HKEB 2CUGA 3CXHF 3ZHQA 1NU1H 5LP6B 4UB6Z 4B7KA 3VQXA 1CP9A 1N36B 1P7GA 4U3JA 3OTFA 5LOVB 1SESA 2Q73A 2IU0A 3A0BZ 2DYRC 5CN0A 2YIDA 2EILB 4GYCB 2DOSA 5BR8B 1I08A 2ZDIA 3CD6V 4WFHA 5KUMA 2MW2B 1SF9A 5EIBC 1SQGA 2KB1A 1P49A 1KU9A 5FPOA 1WP8A 1KP3A 5EC1C 4NR1A 5GONA 2PZSA 2FB5A 3CCRV 4FM2A 1QNMA 3G6BA 3SGIA 3ZHSA 3ETQA 4JAVA 4LF7B 4AQYB 2P06A 4J42A 3ZRXA 3RYIB 1DTOA 1LNQA 1VQ9V 4G2KA 1DGSA 4QPKA 3ZMSA 3D8CA 4LF8B 5EC2C 3EXAA 4DR3B 1TAEA 5HFLA 4LF5O 5K1PA 3ABKB 1WB7A 5JQGA 2IW5A 4K8ZA 4GKKB 4LFBO 2MK3A 4JI3B 1G4YB 4DR2O 3ZMUA 1OCRB 5KMGA 1XNRB 1FXKC 1PPJH 4LH6A 4J41A 4ZIBA 2Q5ZA 2DYSB 3UQ8A 4AHCA 2PUSA 1OZ0A 2HKOA 3APQA 3X2QC 4JZGA 2YI9A 1P4RA 4CC6A 3K04A 4I55B 4LWSA 4PDMA 3SJQC 4DV3O 4MSWC 2WLLB 3UO2A 2BSKB 5L3EA 3B8NA 3G4SV 1SETA 3JARB 2OT5A 4IHJA 1M9NA 2GTSA 2XNDG 3I55V 1FS0G 4FLTA 1WN7A 3N2KB 1BE3H 5GTIZ 4FFBA 4JI1O 1EN5A 4NKGB 1FD9A 3RVZA 3CJHA 4TUYA 2UXCO 2IH3C 3X2QB 4I55A 1W0KG 4O4LB 4LWSB 3QO5A 4JI7B 1Z5WA 3SYCA 2GUZB 5JWPA 3MDSA 4B3TB 3HR0A 3JAWA 3CCVV 2GHYA 4MTGA 3HKBA 3Q4HA 1I94O 4IIJA 4R7CA 3CCJV 1CEZA 1NH2B 1BSMA 3STLC 4MVOA 3W7WA 2EINC 5JJJB 3A0RA 4X64O 1IURA 1SQFA 4FLUA 4N21A 3H1HH 3K5LA 5CMUA 1M93A 3B77A 3OTOO 1YSCA 5LMUO 4J9YB 2X7RB 4QNHB 1XQ8A 3BHPA 3TGUH 3ZJZA 3BCCH 2N05A 1BQ0A 1OCOC 4G28B 5L3CA 4X65B 4GZRB 4P30A 5IJ9B 5IE9A 4WF9V 1VQNV 1D5AA 4DUYB 4LCUC 5LHIA 2KKWA 2Q68A 4FLZA 4GKJB 2UXNA 1SKVA 3TJTA 4WFBV 1NR1A 4JI0B 4TV9A 4WFFA 1OV9A 3RYIA 1N32B 1CXZB 1GN3A 2D2CB 1IBKB 4RWUA 1OCCC 3G67A 3IJ4A 4PDRA 2BTOA 4NTWA 2IJHA 5B66Z 4LNUB 4QIWF 4EB6B 5LGUA 2VRZA 4O4HA 2Q7GA 1KBHA 2W6JG 4DR6B 3OFNG 4NYKA 2F43G 3T4ZA 3CXCU 2FKXA 2EBOA 3CWBH 3CPWU 4UCUA 2P6JA 1PL4A 1FJGB 1VIBA 2R9RB 5FNVA 4RO2A 3HKCB 1QHTA 2A79B 1XNQB 1LUWA 2N74A 2YUAA 2B1IA 2LW1A 2F4VO 5B3SC 4HAMA 2EX3A 4OX9O 4YJ3A 4YY3B 2QWRB 3ASNB 2DJVA 3FAVA 2QWOB 5KHGA 1IBLB 3SR2C 1R73A 1V55B 3OE7G 1Q43A 3A8TA 3OMAB 3ABTA 2PF4E 4DR5B 3B09A 4NB5A 5KAFZ 2A06H 1R6NA 4NXMO 3L72H 1N33O 2Z3YA 3OW2U 5EYPB 2HHHB 4X1IB 1BMFG 1ROPA 3CRAA 2GSMB 5JVDA 2X0LA 4LF6O 4IYHA 2EIMB 4IYIA 5B1OA 1QVGU 4YXWG 1IBKO 2R70A 4DV0O 3ABLC 3DXRB 1N4CA 2ILMA 4O4IA 1UJWB 4OX9B 3JAMN 2ZE7A 4GLXA 2Y0PA 4Q6GA 1XMOB 1K34A 1VQ6V 4I4TA 4IGGA 3OT7A 5B1NA 3SJCC 3FKSG 1Z5VA 4UVCA 1F51A 2HFEC 1XL4A 5LA6B 2LW7A 3E8FA 1NVPB 4NXNO 3CRMA 3LDCA 1H2MA 2QR4A 4XDKA 1W59A 4JYYA 5LGNA 3ETDA 4LF9O 1JA8A 1SQXH 1IBMO 4D7TA 4JI2O 1JFFB 1KB9F 5LL6Y 5H6RA 2IU3A 4B3MB 1NQTA 1SZTA 1RPOA 4UCOA 5JJEB 1WA8A 4DV5O 1MZEA 3AG2B 4MT8A 4UCSA 4H0LB 3WG7B 3K59A 5ITZA 5B1AC 1YDXA 2H8PC 4NXMB 2QM4A 3ZN0A 1K3EA 4KL1A 1K92A 1VQ4V 4X8AA 4DRXA 3JALA 3FYIB 4JTCB 2QJ1A 1VQOV 3JCUZ 2O57A 4YJ3B 1HNWO 3WB2A 5J2UB 1AROP 2QKSA 3I56V 5C8YB 4ABMA 1XREA 1M1KW 1K8AW 1G1XB 4UVAA 4GT1A 5BXZA 1VF7A 3SYAA 1COWG 4CH3A 4X1KA 1V54B 3K0GA 2KQXA 3A2FA 1NTKH 4A5UB 4R6ZA 4AI8A 1BHBA 5H6QA 4O2AA 4L87A 2ITCC 1B6QA 3D3IA 1NJIW 1H2NA 4WFEA 1LR1A 3QNEA 2Q69A 4RAIA 4O4HB 3OUFA 2QWNB 4LNUA 4MW8A 3ZRSA 3J80N 2JK5C 2D3OW 2H3OA 4H44B 3KZIZ 1ZSPA 5IJ0B 1MABG 3F5TA 1TVKB 2M6YA 1HR0O 1YJWV 3ZCCA 4B3TO 3CSXA 1Y66A 4RUFA 1ZLZA 4X89A 5BZBA 4LF4O 1AILA 1YCIA 3S3XA 3LUTB 4GX1A 3KCYA 5CBFA 3AG4B 2IJKA 2OWOA 3TXSA 1QLNA 3ABUA 5B1BC 1Q6HA 1NBMG 2A9HA 1Q86W 2UXBO 5KUKA 1F4NA 4DV4B 4X20B 3U11A 3K0DA 4JASA 3UT5A 2X6CA 5JH7A 1I0HA 3C90A 2ZE6A 3JAKB 1YHQV 4UXNA 3BAAA 2EIKC 1NTMH 1XL6A 4PA3A 4TV8B 1QBZA 1W0JG 3ZHRA 2UUAO 5KHIA 2VQFO 4X62O 1M56B 3LSQA 4KHPO 1IBLO 4P9OA 5L3BA 1EN4A 4LFCB 4LR3A 4CS2A 2P22C 2JGDA 4I9QA 1S77D 1N33B 2CTQA 4IIJB 1ZL8A 2Y69C 4HNAB 2F95B 3IC7A 2ZT9B 1H2GA 3J81N 4JI7O 1N8RW 1QR8A 3BRCA 2W0FC 2VQEO 2PYLA 2YIBA 4Z2WA 1IXBA 4MVQA 2YDEA 5IYZB 3RW0A 3MAQA 2P5OA 4B7EA 1GM8A 1Y4MA 4CH4A 1WPXA 1OCZB 2V7QG 3JD1A 4DXWA 3RN4A 2WA4A 3OGIB 2JDIG 3FYEB 2Y69B 3HPLC 4KP4A 1I7FA 3ZX6A 5FL7G 2LFRA 1AR5A 3OUSA 3IAYA 1NKDA 2F4VB 1FFXA 3CCMV 1K73W 4I7ZB 3BA8A 2PGGA 4I5SA 2PYJA 3C3TA 2ATKC 4BIZA 3B4SA 2QEXV 1N34B 1XHXA 1OCZC 4JI0O 1X59A 3ZBHA 4DUZB 2PI5A 5LMNO 2RN9A 1FFTB 1EFRG 1GM9A 1PV0A 2ZD9A 4FM1A 1OJHA 5DM6V 3CYOA 1N36O 4DV5B 4LH7A 1URFA 2FMLA 5KLVH 1IX9A 5H9CA 1ORQC 2ZXWB 2KSDA 4DR2B 3LNNA 3MHHC 5IJ0A 5BMVB 4FLWA 4LF9B 4FFKA 4EB6A 4I0XB 2DQ0A 3JATA 1IXMA 4O4LA 1F4MA 1TUEB 5GTHZ 1Q8IA 2BE3A 3F7VC 1K4DC 3L73H 3GWOA 1K7DA 4AQYO 3RFRA 3WB1A 1AI5A 4J7KA 4YHHO 1IDSA 4XBFA 4IL6Z 2KG7B 3KG2A 1FXVA 3OM3B 5LMUB 3CRRA 2HR3A 3L74H 4MVZA 5D5QA 2R9IA 3W7SA 1R6KA 1QCEA 2Y4UA 1XMOO 4DUZO 5LHHA 5KX5B 3ASNC 4PHZA 4RQEA 1BL8A 3T1CA 2UUCB 4LP8A 2EILC 4X1YB 2RQ6A 3NXSA 2YXHA 2YS8A 1Y74B 2ITDC 3APOA 5IT9N 3AG7A 3K58A 1YITV 3HKDB 2B1GA 2ZIMA 4PJ0Z 2LJ2A 5A2QN 4QGPA 3CCSV 1ZTEA 4UV9A 4UB8Z 4B08A 2W0XA 2ZQMA 4X9QA 5K1XA 3IGAC 2G38A 1VQPV 4KXRA 2RNBA 4TT3G 4DV6B 1R6TA 3ZRWA 1YIJV 4J11A 2DMXA 3IFXA 2OIEA 4WFGA 1DF4A 1M90W 4X88A 4NVPA 5LGTA 3SPCA 2CE4A 4CS4A 2GBOA 5IYZA 5CB4B 1YTFB 2UXCB 5CA1B 1AVMA 1JMKC 4I4TB 3VQYA 2CTPA 4LFCO 4F4LA 1L0LH 3F7YC 2Q0OC 3H1IH 3N2KA 1FXKB 3AG1C 5CBHA 1YI2V 4KHPB 1JVMA 2HEPA 1TUBB 1I5YA 2C2AA 1HNZO 2V1DA 1Q6UA 2UUCO 2E3CA 2EINB 1M56C 2Q67A 1A32A 3ZMVA 4H37A 1YTFD 2CDYA 3CS5A 4JYAO 1QLEB 3HKEA 4K3AA 1Q82W 4RQFA 5J2UA 3OD4A 1AI6A 3P32A 1BS3A 4DK0A 4DR3O 2JEUA 2P90A 4FZ0A 2VQFB 1AJPA 1EBOA 3OAAG 4X20A 1N34O 2JS3A 2ZE8A 2R9AA 3HB3B 1FXKA 4B3RB 4JI3O 5KMGB 4RUEA 2E74B 4LF5B 3TCUA 1GTOA 1R3JC 4O2BA 4PDVA 4LF7O 1ENVA 2CAZC 4DV0B 5LHGA 1VP7A 3DTUB 1KECA 1WA8B 1KKCA 5EZYB 1JFFA 4X65O 2HVJC 1QQCA 2EIJC 4MTXA 3CX5F 4GCZA 2EZOA 4YJ2A 2FL4A 2ZE5A 3ZMZA 2ARHA 4JI8B 2BTQA 1NS1A 4JPRA 4DR1O 3T1YB 5F2VO 3ZHUA 4K0KO 2KG7A 1SQPH 3FB7C 3EFFK 4UV8A 5IYBO 4BWAA 4EFBA 1GN6A 3CCEV 4J80A 4O2AB 4DW1A 2JS5A 1AR1B 2GTAA 1VQLV 1Y74A 1RP3B 1PL0A 2QTSA 1SQVH 3C3SA 5LYJB 1Y67A 2LGWA 4X62B 4EFEA 1WJZA 4UCVA 5AG2A 4X1IA 2OYQA 5D5PA 3RYCB 5BMVA 1HNXO 1SQQH 3N2GB 3CCUV 5B1BB 3FB5C 5FPRA 4OXSA 1PNMA 1Y6XA 4H33A 4ZHQA 4B3RO 5EIBD 3VBBA 2XOKG 2OTLV 4PDLA 2LQTA 2DYRB 1VEWA 4ICGA 3LSSA 2W6IG 2A3QA 3QO8A 5IDJA 2QKAA 1V9PA 5BY1A 2ZM6B 3ASOB 5DEDA 5CB4A 4TSFG 2P4KA 2Y4TA 1M57C 1KD1W 5LMNB 3ZRWB 5IWAB 1YEWA 3OEHG 2LO1A 2ZXWC 1K9MW 4LFBB 4PV1B 4QE9A 2Q9LA 2Q8VA 4DV7O 1QU7A 3ZS8C 1YVWA 2BOBC 3PN1A 3BFRA 2VQEB 4DR7B 3JYCA 1VF6C 4DK1A 1FFXB 3DXRA 2PTMA 3CHXA 3E8BA 4ZBMA 3B8MA 2HHHO 1WB8A 2CK3G 1HNXB 1KQSU 4I50B 4HNAA 2YEVA 1D5NA 1JPXA 1YXBA 4JI6O 1GRJA 3BPZA 2Z5UA 4XDJA 1US6A 3ZRVA 1G8MA 3GWKC 1BT8A 5LA6A 4DV6O 2A7WA 3L9DA 3MD0A 1L1FA 2AZ0A 4JTDB 2WLLA 2CH7B 4TV8A 3FB6C 2DE0X 2AGAA 1NH2D 2V4DA 4FLVA 2Q7HA 3RVYA 1EN6A 1HDJA 3UT5B 3M8AA 4FLYA 3ABLB 3A0HZ 1O9HA 2DW4A 2CTRA 2DN9A 2NNUA 3FB8C 4LFAO 2NLJC 4DR4B 3T1HO 5B5EZ 2VWKA 4TWKA 1DF5A 3STZC 1MNGA 1P84F 3PJSK 4FVMA 2ZR2A 5EBMC 1V54C 1Q7YW 3U0ZA 1GMGA 1X4TA 3U10A 1PP9H 4EEQA 1MG1A 3JAWB 5JH7B 1YZBA 1XILA 2HG5C 5TISZ 2P4VA 1MOFA 1VF6A 1H8HG 3ETEA 3HKDA 1E79G 4F6RA 2JVDA 1H38A 1B04A 4WBNB 4UCTA 4MVUA 5KA5A 1QR9A 1SZXA 2UU9O 3TK1A 2UXDB 3H1JH 1MA1A 4U7OA 1HR0B 4X1YA 5B1AB 3RWRD 4GX0A 5HFMA 3D36A 4GKJO 2XASA 2YSUB 4GX5A 5CA0A 1NR7A 4FK5C 3VQWA 2F1MA 5KHHA 5LBQA 4B3MO 3BABA 3I5DA 3QTCA 1SQBH 1Y76A 1BCCH 5CA0B 4IHJB 2CH7A 1XOUA 3FX7A 5H5NA 4P2ZA 2VWJA 3CE2A 4OGQB 3SYOA 5JJNB 3S3WA 2QM7A 2LP7A 1EZJA 1ZAUA 2BOCC 2OCHA 2QKCA 2ZR3A 1TA8A 2GDSA 1VQ8V 1SERA 2Q0AA 1D2DA 1N32O 2WLIA 3O9OA 3K9SA 3RYHB 1XHZA 5LXTA 2XHBA 4X64B 3J7AU 3F5WC 1S0VA 1SC5B 3ML0A 1M4UA 3LDDA 4B3SO 1IVSA 5ITZB 5KHKA 2ZNJA 5EBLC 3NR7A 2JJ2G 4TQDA 1SRYA 4ZOLB 2XAJA 4DR1B 1Q6IA 4X66B 2EJ7A 1AJQA 3W7TA 2L6LA 2QM8A 4YJ2B 1FAFA 3CC2V 2YEVB 2Q7EA 4HBNA 2IBZH 1RFYA 2FTKA 2QTOA 2OCCC 3OTOB 3H9VA 1EM1A 1JQ0A 4X66O 4ZKIA 1K4CC 2YXYA 2RCVA 2JRIA 2RDCA 1AP5A 1RM1B 4PD4F 2PY5A 1WNSA 4BW9A 3RT3C 2FYUH 4CS3A 1FYJA 3CRCA 4CBCA 5EK0A 3IC9A 2HLDG 4NTYA 4FLXA 4YIPA 3EHBB 3OR7C 4Q20A 2PI4A 1VQ5V 3ABMC 2OCCB 3JASA 1WPBA 1J5EO 2WWWA 2BCCH 4JZ2A 5L3DA 2DWEC 5IYCO 1GN2A 3K06A 3RYCA 3BY6A 2EULA 2XTAA 1NTZH 1S5LZ 3TETA 2XUMA 2AZ2A 4P9PA 2VS0A 4TQFA 1XNRO 4G27B 1PM9A 4LF4B 5J2TA 3QG5A 3E35A 4JTAB 4DYLA 4FFBB 4CH5A 4LFAB 4DV7B 3FAVB 4JYAB 4JYBA 1SA0B 1KMIZ 4GX2A 1RSOA 5JQGB 4DV1B 3WFVA 4MS2A 3JARA 4PA4A 3SJBC 3K79A 3ZMTA 4K35A 3DC5A 4D6TH 5CA3A 3DGEA 4J7JA 4HYOA 4MTFA 4Z1VA 4EKWA 1DK1A 4OPAA 1VARA 4BIUA 4PI0A 5EZYA 5CBGA 4JI4O 4H13B 1VQKV 3JALB 2QA4V 1BGYH 3KKYA 3G71V 4O2BB 1K5SA 3N2GA 4DW0A 1P7BA 5E79Z 2DQ3A 4YY3O 1K5QA 4D7SA 4DR4O 2WLKA 4B3SB 4N23A 1KP2A 3HKCA 2M7WA 4UVBA 1B3QA 2XAFA 5LYJA 4HZ3A 3R65A 3RYFA 5LP6A 3GB7C 1GK9A 2YIBD 3DSQA 4J10A 1THZA 3CCLV 3ZEDA 2UUBB 2E5LO 1QLEC 2AHYA 5A9GA 3D3QA 1JJ2U 3CMAV 1H2SB 1S5JA 2ADPA 5IY5C 4CC5A 5BR8O 4FJCC 2BTQB 2F23A 3K5NA 3RYFB 4K0KB 3CRQA 1BZKA 4DV4O 1R3LC 4NXNB 4FZ1A 1FPOA 4U3JB 1XUQA 3JATB 2HJFC 1LUVA 4DV2O 1MSWD 2N04A 2XT9A 1IBMB 5EBWC 3T4DA 5JCOA 1XMQO 3QVNA 3RGBA 1NZ6A 3OMNB 1AI7A 3GVMA 2ODMA 1VMGA 3AEIA 4DV2B 3UCSC 4YHHB 5J2TB 3K9AA 3P30A 2IJIA 3AG4C 2GUZA 4L8JA 1JR9A 5CA1A 3LDEA 1E1QG 3SDLA 3H1LH 3SPJA 1AP6A 4J9ZB 1ZX3A 4JAUA 3T1HB 3TXQA 3UKMA 4JI1B 3JASB 1WLEA 2OTJV 2YI8A 1PNKA 1OCRC 1MSDA 2UUBO 1B06A 1YF2A 3EVKA 3L75H 4FMTA 1TUBA 3SJAC 2K9PA 1GAXA 3M99B 4GUNA 2OIGA 3WU2Z 2UXDO 4J7ZA 2Q4PA 3WB0A 4UCRA 2ZINA 1XBLA 2IJJA 2X6BA 4R8CA 1PD3A 3AK1A 4JV5B 1HWYA 1AR4A 1Q5OA 1R3KC 3E22A 2ETNA 2P67A 2Y48A 1JOYA 2CGOA 3AG1B 4TV9B 2HVKC 2RJZA 5KX5A 3ASOC 2JGDB 4JF3A 2JIZG 2L35A 4I0XA 2WA3A 4ZOLA 4MVRA 3E83A 1GH6A 4PA6A 2XAQA 2QWPB 4PI2A 1W2BU 2BSKA 3BA9A 4UUJC 1PNLA 5B3SB 1Y76B 4E4EA 3KCXA 5E1AC 4DV3B 4R50A 1N0NA 1KC8W 1IZ3A 3D36C 4LF8O 1VQ7V 5KAIZ 5JCOC 2QGNA 4DUYO 3BVOA 4ASUG
chains in the Genus database with same CATH topology
4OPAA 4DV0O 5BY1A 4DV3O 1N34O 3JAMN 1XMOO 4DUZO 4JI4O 4DR6O 4JI3O 3J80N 4DV1O 1FKAO 3R66A 3SDLA 4LF7O 4GKKO 4X66O 5IT9N 3F5TA 1FJGO 2Z0AA 1YZBA 4YY3O 2UUBO 1HR0O 2JRIA 2LW7A 4DR4O 4NXNO 4JI1O 5A2QN 4X65O 4B3TO 2ZKOA 2DOSA 2UXCO 1R1BA 3RT3C 1FYJA 4LF9O 4LF4O 1AILA 1IBMO 2UXDO 2ZM6O 2UU9O 4JI0O 1X59A 4JI2O 2FKXA 5LL6Y 5LMNO 4JV5O 4DV7O 1DK1A 1NS1A 5IWAO 1R6TA 4DV5O 4DR1O 1J5EO 4GKJO 2E5LO 2UXBO 4K0KO 1N36O 4B3MO 1I94O 1KUQA 2N74A 2HHHO 5H5NA 4OPHA 5BR8O 1XNRO 2F4VO 4X64O 4OX9O 4JI6O 1HNWO 2UUAO 4JI5O 4LFCO 2DJVA 4DV4O 1AB3A 2VQFO 4X62O 4DV6O 3OTOO 4KHPO 1IBLO 4JI8O 5LMUO 4DV2O 1D2DA 1N32O 4LF5O 1G1XB 5BXZA 1HNZO 4LFBO 3J7AU 1HNXO 2AGAA 4DR2O 2UUCO 1XMQO 1XNQO 4AQYO 4NXMO 1A32A 1F7YA 3J81N 1N33O 4B3RO 4JI7O 4B3SO 3M8AA 4DR5O 4DR7O 4YHHO 4JYAO 4A5UB 4LF8O 4LFAO 3O65A 4LF6O 3T1HO 2VQEO 1XEQA 4DR3O 5FLXN 4DUYO 1IBKO 3T1YO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPA A;  4DV0 O;  5BY1 A;  4DV3 O;  1N34 O;  3JAM N;  1XMO O;  4DUZ O;  4JI4 O;  4DR6 O;  4JI3 O;  3J80 N;  4DV1 O;  1FKA O;  3R66 A;  3SDL A;  4LF7 O;  4GKK O;  4X66 O;  5IT9 N;  3F5T A;  1FJG O;  2Z0A A;  1YZB A;  4YY3 O;  2UUB O;  1HR0 O;  2JRI A;  2LW7 A;  4DR4 O;  4NXN O;  4JI1 O;  5A2Q N;  4X65 O;  4B3T O;  2ZKO A;  2DOS A;  2UXC O;  1R1B A;  3RT3 C;  1FYJ A;  4LF9 O;  4LF4 O;  1AIL A;  1IBM O;  2UXD O;  2ZM6 O;  2UU9 O;  4JI0 O;  1X59 A;  4JI2 O;  2FKX A;  5LL6 Y;  5LMN O;  4JV5 O;  4DV7 O;  1DK1 A;  1NS1 A;  5IWA O;  1R6T A;  4DV5 O;  4DR1 O;  1J5E O;  4GKJ O;  2E5L O;  2UXB O;  4K0K O;  1N36 O;  4B3M O;  1I94 O;  1KUQ A;  2N74 A;  2HHH O;  5H5N A;  4OPH A;  5BR8 O;  1XNR O;  2F4V O;  4X64 O;  4OX9 O;  4JI6 O;  1HNW O;  2UUA O;  4JI5 O;  4LFC O;  2DJV A;  4DV4 O;  1AB3 A;  2VQF O;  4X62 O;  4DV6 O;  3OTO O;  4KHP O;  1IBL O;  4JI8 O;  5LMU O;  4DV2 O;  1D2D A;  1N32 O;  4LF5 O;  1G1X B;  5BXZ A;  1HNZ O;  4LFB O;  3J7A U;  1HNX O;  2AGA A;  4DR2 O;  2UUC O;  1XMQ O;  1XNQ O;  4AQY O;  4NXM O;  1A32 A;  1F7Y A;  3J81 N;  1N33 O;  4B3R O;  4JI7 O;  4B3S O;  3M8A A;  4DR5 O;  4DR7 O;  4YHH O;  4JYA O;  4A5U B;  4LF8 O;  4LFA O;  3O65 A;  4LF6 O;  3T1H O;  2VQE O;  1XEQ A;  4DR3 O;  5FLX N;  4DUY O;  1IBK O;  3T1Y O; 
#chains in the Genus database with same CATH topology
 1RPR A;  3SYQ A;  4F6R B;  3W7U A;  2RMK B;  2P7T C;  4U3F H;  3FD9 A;  1S5H C;  2EIM C;  4DV1 O;  3K5O A;  1FKA O;  3UM7 A;  3G80 A;  2EZP A;  1S76 D;  4MVS A;  3Q4H B;  2EIJ B;  1GN4 A;  4IT5 A;  1N0J A;  3RYH A;  4LF6 B;  4CZZ A;  2WLI B;  4CH6 A;  2HP8 A;  2YC0 A;  3E22 B;  4FPP A;  1E1R G;  2JEX A;  5GON B;  5LP6 C;  1M57 B;  2ADQ B;  1T5E A;  1HNZ B;  3ZHT A;  4JGS A;  2F93 B;  3LSU A;  3M7M X;  2E5L B;  2DYS C;  4KUM A;  3CP1 A;  2QSA A;  4KFM A;  4F6E A;  1R3I C;  3AK2 A;  4TOI A;  4BIO A;  4OPH A;  3AG2 C;  1VQM V;  3E89 A;  1Q3E A;  1I94 B;  1OCC B;  3OEE G;  1CPY A;  2WPD G;  3WG7 C;  5IJ9 A;  3G6E V;  1RM1 C;  4JI5 O;  2ZDI C;  2JJ1 G;  3JAK A;  1H8E G;  3BEH A;  4JI8 O;  4BAY A;  3CC4 V;  1FXH A;  3JD4 A;  1NI8 A;  1YJN V;  3JCZ A;  4MVM A;  1QVF U;  1MZF A;  3T2M A;  1XNQ O;  1BQZ A;  1PKX A;  1XI1 A;  2WLN A;  1F7Y A;  2JGU A;  2ZCE A;  4DR7 O;  3AG3 C;  2NR5 A;  3SPI A;  4K8X A;  2A0L A;  3SYP A;  2YIA A;  1OHH G;  4PA9 A;  1HNW B;  4FM0 A;  3L71 H;  3P3N A;  4JAA A;  3CB2 A;  1U97 A;  3K3W A;  2EJR A;  1I5X A;  4U7N A;  1O9G A;  3E86 A;  4JI4 B;  2X6A A;  4JI2 B;  4DR6 O;  1GO3 F;  4JYC A;  3R66 A;  1TGO A;  3P3P A;  3E8G A;  4O4J B;  1GKF A;  3OMI B;  4MTO A;  5IYD O;  4GKK O;  2WLH A;  3K03 A;  1VF5 B;  3JD3 A;  3LNM B;  4JI5 B;  4PA7 A;  5C93 A;  1ZL8 B;  3H01 A;  3CJH B;  4TUY B;  3ZN1 A;  1Q90 D;  3K57 A;  1G6U A;  1R1B A;  3FFQ A;  4ZI7 A;  4WFA V;  5IY5 B;  2YXL A;  4XDL A;  5J9P C;  2ZM6 O;  1XMQ B;  4I50 A;  2Y0I A;  4X1K B;  2UXB B;  1AI4 A;  3SPG A;  1HW7 A;  4W4K A;  1TVK A;  2IM9 A;  5L3G A;  5KHJ A;  1EZV H;  2CGN A;  1JJO A;  1YJ9 V;  4WBN A;  1H2K A;  5C8Y A;  4Z1M G;  1U96 A;  1KKD A;  3ABK C;  1WAZ A;  3DC6 A;  3OGC C;  3VOU A;  3ICX A;  4DRX B;  5GW7 A;  1K97 A;  4FIP C;  3JSN A;  2H94 A;  2F66 C;  4C7U A;  3MHS C;  1UFI A;  2HJD A;  2WLM A;  4UFZ A;  1XDC A;  2AW9 A;  4DR5 O;  3JD0 A;  1WP7 A;  2WSS G;  3O65 A;  5DEC A;  3E2E A;  2B5U A;  5FNV B;  2UUA B;  5FLX N;  4DO2 A;  1H2L A;  2IH1 C;  3ETG A;  3ABM B;  2QDO A;  1RSO B;  3B40 A;  5L3F A;  4JI6 B;  1L8D A;  3UO3 A;  2XAG A;  2AXT Z;  1AJN A;  4YIO A;  3CCQ V;  1MMM A;  2YIC A;  1JCH A;  4PEL A;  3H1K H;  1GM7 A;  4BW5 A;  3QO7 A;  2LFS A;  5H2F Z;  3K5M A;  4ZI7 B;  1HP8 A;  2WAM A;  1NVP D;  3AK3 A;  1Q81 W;  5KA6 A;  2XAH A;  4ZHQ B;  2E75 B;  1SS3 A;  1FJG O;  3JD2 A;  2Z0A A;  3N27 A;  1UPG A;  4O4J A;  1KYO F;  1JX9 A;  1M5I A;  2ZKO A;  1S72 V;  2Q6A A;  2R72 A;  4LBE C;  1V55 C;  5LOV A;  2E76 B;  1ZWI C;  5DN6 G;  2K1E A;  2QE7 G;  4I9W A;  2B9Z A;  3JSL A;  2EIK B;  4QJF B;  5JVD B;  4JV5 O;  5IWA O;  1S3J A;  5EYP A;  4E2L A;  1L0N H;  1BHA A;  3CC7 V;  2ZNI A;  1DLB A;  3ZIA G;  4AIL C;  1K33 A;  2GV9 A;  3CME V;  4WCE V;  2UU9 B;  3RBZ A;  3OR6 C;  4NTX A;  3B2E E;  4MW3 A;  4BR6 A;  3ZHV A;  3SPH A;  2AHZ A;  2NN4 A;  3VQV A;  1AB3 A;  1OCO B;  3QF7 A;  1J95 A;  4W4L A;  1J5E B;  1Z2G A;  1NT2 B;  4QE7 A;  3E8H A;  2DWD C;  2ZIO A;  4LC1 A;  1ZUQ A;  1SA0 A;  3THO A;  4QPJ A;  3HKB B;  1F23 A;  1XEQ A;  2UXX A;  4O4I B;  1KUQ A;  2LGQ A;  5LXT B;  3T1Y O;  3K08 A;  2QWQ B;  3W7X A;  3AG3 B;  3L70 H;  2CTW A;  2WLJ A;  3CEI A;  3HKE B;  2CUG A;  3CXH F;  3ZHQ A;  1NU1 H;  5LP6 B;  4UB6 Z;  4B7K A;  3VQX A;  1CP9 A;  1N36 B;  1P7G A;  4U3J A;  3OTF A;  5LOV B;  1SES A;  2Q73 A;  2IU0 A;  3A0B Z;  2DYR C;  5CN0 A;  2YID A;  2EIL B;  4GYC B;  2DOS A;  5BR8 B;  1I08 A;  2ZDI A;  3CD6 V;  4WFH A;  5KUM A;  2MW2 B;  1SF9 A;  5EIB C;  1SQG A;  2KB1 A;  1P49 A;  1KU9 A;  5FPO A;  1WP8 A;  1KP3 A;  5EC1 C;  4NR1 A;  5GON A;  2PZS A;  2FB5 A;  3CCR V;  4FM2 A;  1QNM A;  3G6B A;  3SGI A;  3ZHS A;  3ETQ A;  4JAV A;  4LF7 B;  4AQY B;  2P06 A;  4J42 A;  3ZRX A;  3RYI B;  1DTO A;  1LNQ A;  1VQ9 V;  4G2K A;  1DGS A;  4QPK A;  3ZMS A;  3D8C A;  4LF8 B;  5EC2 C;  3EXA A;  4DR3 B;  1TAE A;  5HFL A;  4LF5 O;  5K1P A;  3ABK B;  1WB7 A;  5JQG A;  2IW5 A;  4K8Z A;  4GKK B;  4LFB O;  2MK3 A;  4JI3 B;  1G4Y B;  4DR2 O;  3ZMU A;  1OCR B;  5KMG A;  1XNR B;  1FXK C;  1PPJ H;  4LH6 A;  4J41 A;  4ZIB A;  2Q5Z A;  2DYS B;  3UQ8 A;  4AHC A;  2PUS A;  1OZ0 A;  2HKO A;  3APQ A;  3X2Q C;  4JZG A;  2YI9 A;  1P4R A;  4CC6 A;  3K04 A;  4I55 B;  4LWS A;  4PDM A;  3SJQ C;  4DV3 O;  4MSW C;  2WLL B;  3UO2 A;  2BSK B;  5L3E A;  3B8N A;  3G4S V;  1SET A;  3JAR B;  2OT5 A;  4IHJ A;  1M9N A;  2GTS A;  2XND G;  3I55 V;  1FS0 G;  4FLT A;  1WN7 A;  3N2K B;  1BE3 H;  5GTI Z;  4FFB A;  4JI1 O;  1EN5 A;  4NKG B;  1FD9 A;  3RVZ A;  3CJH A;  4TUY A;  2UXC O;  2IH3 C;  3X2Q B;  4I55 A;  1W0K G;  4O4L B;  4LWS B;  3QO5 A;  4JI7 B;  1Z5W A;  3SYC A;  2GUZ B;  5JWP A;  3MDS A;  4B3T B;  3HR0 A;  3JAW A;  3CCV V;  2GHY A;  4MTG A;  3HKB A;  3Q4H A;  1I94 O;  4IIJ A;  4R7C A;  3CCJ V;  1CEZ A;  1NH2 B;  1BSM A;  3STL C;  4MVO A;  3W7W A;  2EIN C;  5JJJ B;  3A0R A;  4X64 O;  1IUR A;  1SQF A;  4FLU A;  4N21 A;  3H1H H;  3K5L A;  5CMU A;  1M93 A;  3B77 A;  3OTO O;  1YSC A;  5LMU O;  4J9Y B;  2X7R B;  4QNH B;  1XQ8 A;  3BHP A;  3TGU H;  3ZJZ A;  3BCC H;  2N05 A;  1BQ0 A;  1OCO C;  4G28 B;  5L3C A;  4X65 B;  4GZR B;  4P30 A;  5IJ9 B;  5IE9 A;  4WF9 V;  1VQN V;  1D5A A;  4DUY B;  4LCU C;  5LHI A;  2KKW A;  2Q68 A;  4FLZ A;  4GKJ B;  2UXN A;  1SKV A;  3TJT A;  4WFB V;  1NR1 A;  4JI0 B;  4TV9 A;  4WFF A;  1OV9 A;  3RYI A;  1N32 B;  1CXZ B;  1GN3 A;  2D2C B;  1IBK B;  4RWU A;  1OCC C;  3G67 A;  3IJ4 A;  4PDR A;  2BTO A;  4NTW A;  2IJH A;  5B66 Z;  4LNU B;  4QIW F;  4EB6 B;  5LGU A;  2VRZ A;  4O4H A;  2Q7G A;  1KBH A;  2W6J G;  4DR6 B;  3OFN G;  4NYK A;  2F43 G;  3T4Z A;  3CXC U;  2FKX A;  2EBO A;  3CWB H;  3CPW U;  4UCU A;  2P6J A;  1PL4 A;  1FJG B;  1VIB A;  2R9R B;  5FNV A;  4RO2 A;  3HKC B;  1QHT A;  2A79 B;  1XNQ B;  1LUW A;  2N74 A;  2YUA A;  2B1I A;  2LW1 A;  2F4V O;  5B3S C;  4HAM A;  2EX3 A;  4OX9 O;  4YJ3 A;  4YY3 B;  2QWR B;  3ASN B;  2DJV A;  3FAV A;  2QWO B;  5KHG A;  1IBL B;  3SR2 C;  1R73 A;  1V55 B;  3OE7 G;  1Q43 A;  3A8T A;  3OMA B;  3ABT A;  2PF4 E;  4DR5 B;  3B09 A;  4NB5 A;  5KAF Z;  2A06 H;  1R6N A;  4NXM O;  3L72 H;  1N33 O;  2Z3Y A;  3OW2 U;  5EYP B;  2HHH B;  4X1I B;  1BMF G;  1ROP A;  3CRA A;  2GSM B;  5JVD A;  2X0L A;  4LF6 O;  4IYH A;  2EIM B;  4IYI A;  5B1O A;  1QVG U;  4YXW G;  1IBK O;  2R70 A;  4DV0 O;  3ABL C;  3DXR B;  1N4C A;  2ILM A;  4O4I A;  1UJW B;  4OX9 B;  3JAM N;  2ZE7 A;  4GLX A;  2Y0P A;  4Q6G A;  1XMO B;  1K34 A;  1VQ6 V;  4I4T A;  4IGG A;  3OT7 A;  5B1N A;  3SJC C;  3FKS G;  1Z5V A;  4UVC A;  1F51 A;  2HFE C;  1XL4 A;  5LA6 B;  2LW7 A;  3E8F A;  1NVP B;  4NXN O;  3CRM A;  3LDC A;  1H2M A;  2QR4 A;  4XDK A;  1W59 A;  4JYY A;  5LGN A;  3ETD A;  4LF9 O;  1JA8 A;  1SQX H;  1IBM O;  4D7T A;  4JI2 O;  1JFF B;  1KB9 F;  5LL6 Y;  5H6R A;  2IU3 A;  4B3M B;  1NQT A;  1SZT A;  1RPO A;  4UCO A;  5JJE B;  1WA8 A;  4DV5 O;  1MZE A;  3AG2 B;  4MT8 A;  4UCS A;  4H0L B;  3WG7 B;  3K59 A;  5ITZ A;  5B1A C;  1YDX A;  2H8P C;  4NXM B;  2QM4 A;  3ZN0 A;  1K3E A;  4KL1 A;  1K92 A;  1VQ4 V;  4X8A A;  4DRX A;  3JAL A;  3FYI B;  4JTC B;  2QJ1 A;  1VQO V;  3JCU Z;  2O57 A;  4YJ3 B;  1HNW O;  3WB2 A;  5J2U B;  1ARO P;  2QKS A;  3I56 V;  5C8Y B;  4ABM A;  1XRE A;  1M1K W;  1K8A W;  1G1X B;  4UVA A;  4GT1 A;  5BXZ A;  1VF7 A;  3SYA A;  1COW G;  4CH3 A;  4X1K A;  1V54 B;  3K0G A;  2KQX A;  3A2F A;  1NTK H;  4A5U B;  4R6Z A;  4AI8 A;  1BHB A;  5H6Q A;  4O2A A;  4L87 A;  2ITC C;  1B6Q A;  3D3I A;  1NJI W;  1H2N A;  4WFE A;  1LR1 A;  3QNE A;  2Q69 A;  4RAI A;  4O4H B;  3OUF A;  2QWN B;  4LNU A;  4MW8 A;  3ZRS A;  3J80 N;  2JK5 C;  2D3O W;  2H3O A;  4H44 B;  3KZI Z;  1ZSP A;  5IJ0 B;  1MAB G;  3F5T A;  1TVK B;  2M6Y A;  1HR0 O;  1YJW V;  3ZCC A;  4B3T O;  3CSX A;  1Y66 A;  4RUF A;  1ZLZ A;  4X89 A;  5BZB A;  4LF4 O;  1AIL A;  1YCI A;  3S3X A;  3LUT B;  4GX1 A;  3KCY A;  5CBF A;  3AG4 B;  2IJK A;  2OWO A;  3TXS A;  1QLN A;  3ABU A;  5B1B C;  1Q6H A;  1NBM G;  2A9H A;  1Q86 W;  2UXB O;  5KUK A;  1F4N A;  4DV4 B;  4X20 B;  3U11 A;  3K0D A;  4JAS A;  3UT5 A;  2X6C A;  5JH7 A;  1I0H A;  3C90 A;  2ZE6 A;  3JAK B;  1YHQ V;  4UXN A;  3BAA A;  2EIK C;  1NTM H;  1XL6 A;  4PA3 A;  4TV8 B;  1QBZ A;  1W0J G;  3ZHR A;  2UUA O;  5KHI A;  2VQF O;  4X62 O;  1M56 B;  3LSQ A;  4KHP O;  1IBL O;  4P9O A;  5L3B A;  1EN4 A;  4LFC B;  4LR3 A;  4CS2 A;  2P22 C;  2JGD A;  4I9Q A;  1S77 D;  1N33 B;  2CTQ A;  4IIJ B;  1ZL8 A;  2Y69 C;  4HNA B;  2F95 B;  3IC7 A;  2ZT9 B;  1H2G A;  3J81 N;  4JI7 O;  1N8R W;  1QR8 A;  3BRC A;  2W0F C;  2VQE O;  2PYL A;  2YIB A;  4Z2W A;  1IXB A;  4MVQ A;  2YDE A;  5IYZ B;  3RW0 A;  3MAQ A;  2P5O A;  4B7E A;  1GM8 A;  1Y4M A;  4CH4 A;  1WPX A;  1OCZ B;  2V7Q G;  3JD1 A;  4DXW A;  3RN4 A;  2WA4 A;  3OGI B;  2JDI G;  3FYE B;  2Y69 B;  3HPL C;  4KP4 A;  1I7F A;  3ZX6 A;  5FL7 G;  2LFR A;  1AR5 A;  3OUS A;  3IAY A;  1NKD A;  2F4V B;  1FFX A;  3CCM V;  1K73 W;  4I7Z B;  3BA8 A;  2PGG A;  4I5S A;  2PYJ A;  3C3T A;  2ATK C;  4BIZ A;  3B4S A;  2QEX V;  1N34 B;  1XHX A;  1OCZ C;  4JI0 O;  1X59 A;  3ZBH A;  4DUZ B;  2PI5 A;  5LMN O;  2RN9 A;  1FFT B;  1EFR G;  1GM9 A;  1PV0 A;  2ZD9 A;  4FM1 A;  1OJH A;  5DM6 V;  3CYO A;  1N36 O;  4DV5 B;  4LH7 A;  1URF A;  2FML A;  5KLV H;  1IX9 A;  5H9C A;  1ORQ C;  2ZXW B;  2KSD A;  4DR2 B;  3LNN A;  3MHH C;  5IJ0 A;  5BMV B;  4FLW A;  4LF9 B;  4FFK A;  4EB6 A;  4I0X B;  2DQ0 A;  3JAT A;  1IXM A;  4O4L A;  1F4M A;  1TUE B;  5GTH Z;  1Q8I A;  2BE3 A;  3F7V C;  1K4D C;  3L73 H;  3GWO A;  1K7D A;  4AQY O;  3RFR A;  3WB1 A;  1AI5 A;  4J7K A;  4YHH O;  1IDS A;  4XBF A;  4IL6 Z;  2KG7 B;  3KG2 A;  1FXV A;  3OM3 B;  5LMU B;  3CRR A;  2HR3 A;  3L74 H;  4MVZ A;  5D5Q A;  2R9I A;  3W7S A;  1R6K A;  1QCE A;  2Y4U A;  1XMO O;  4DUZ O;  5LHH A;  5KX5 B;  3ASN C;  4PHZ A;  4RQE A;  1BL8 A;  3T1C A;  2UUC B;  4LP8 A;  2EIL C;  4X1Y B;  2RQ6 A;  3NXS A;  2YXH A;  2YS8 A;  1Y74 B;  2ITD C;  3APO A;  5IT9 N;  3AG7 A;  3K58 A;  1YIT V;  3HKD B;  2B1G A;  2ZIM A;  4PJ0 Z;  2LJ2 A;  5A2Q N;  4QGP A;  3CCS V;  1ZTE A;  4UV9 A;  4UB8 Z;  4B08 A;  2W0X A;  2ZQM A;  4X9Q A;  5K1X A;  3IGA C;  2G38 A;  1VQP V;  4KXR A;  2RNB A;  4TT3 G;  4DV6 B;  1R6T A;  3ZRW A;  1YIJ V;  4J11 A;  2DMX A;  3IFX A;  2OIE A;  4WFG A;  1DF4 A;  1M90 W;  4X88 A;  4NVP A;  5LGT A;  3SPC A;  2CE4 A;  4CS4 A;  2GBO A;  5IYZ A;  5CB4 B;  1YTF B;  2UXC B;  5CA1 B;  1AVM A;  1JMK C;  4I4T B;  3VQY A;  2CTP A;  4LFC O;  4F4L A;  1L0L H;  3F7Y C;  2Q0O C;  3H1I H;  3N2K A;  1FXK B;  3AG1 C;  5CBH A;  1YI2 V;  4KHP B;  1JVM A;  2HEP A;  1TUB B;  1I5Y A;  2C2A A;  1HNZ O;  2V1D A;  1Q6U A;  2UUC O;  2E3C A;  2EIN B;  1M56 C;  2Q67 A;  1A32 A;  3ZMV A;  4H37 A;  1YTF D;  2CDY A;  3CS5 A;  4JYA O;  1QLE B;  3HKE A;  4K3A A;  1Q82 W;  4RQF A;  5J2U A;  3OD4 A;  1AI6 A;  3P32 A;  1BS3 A;  4DK0 A;  4DR3 O;  2JEU A;  2P90 A;  4FZ0 A;  2VQF B;  1AJP A;  1EBO A;  3OAA G;  4X20 A;  1N34 O;  2JS3 A;  2ZE8 A;  2R9A A;  3HB3 B;  1FXK A;  4B3R B;  4JI3 O;  5KMG B;  4RUE A;  2E74 B;  4LF5 B;  3TCU A;  1GTO A;  1R3J C;  4O2B A;  4PDV A;  4LF7 O;  1ENV A;  2CAZ C;  4DV0 B;  5LHG A;  1VP7 A;  3DTU B;  1KEC A;  1WA8 B;  1KKC A;  5EZY B;  1JFF A;  4X65 O;  2HVJ C;  1QQC A;  2EIJ C;  4MTX A;  3CX5 F;  4GCZ A;  2EZO A;  4YJ2 A;  2FL4 A;  2ZE5 A;  3ZMZ A;  2ARH A;  4JI8 B;  2BTQ A;  1NS1 A;  4JPR A;  4DR1 O;  3T1Y B;  5F2V O;  3ZHU A;  4K0K O;  2KG7 A;  1SQP H;  3FB7 C;  3EFF K;  4UV8 A;  5IYB O;  4BWA A;  4EFB A;  1GN6 A;  3CCE V;  4J80 A;  4O2A B;  4DW1 A;  2JS5 A;  1AR1 B;  2GTA A;  1VQL V;  1Y74 A;  1RP3 B;  1PL0 A;  2QTS A;  1SQV H;  3C3S A;  5LYJ B;  1Y67 A;  2LGW A;  4X62 B;  4EFE A;  1WJZ A;  4UCV A;  5AG2 A;  4X1I A;  2OYQ A;  5D5P A;  3RYC B;  5BMV A;  1HNX O;  1SQQ H;  3N2G B;  3CCU V;  5B1B B;  3FB5 C;  5FPR A;  4OXS A;  1PNM A;  1Y6X A;  4H33 A;  4ZHQ A;  4B3R O;  5EIB D;  3VBB A;  2XOK G;  2OTL V;  4PDL A;  2LQT A;  2DYR B;  1VEW A;  4ICG A;  3LSS A;  2W6I G;  2A3Q A;  3QO8 A;  5IDJ A;  2QKA A;  1V9P A;  5BY1 A;  2ZM6 B;  3ASO B;  5DED A;  5CB4 A;  4TSF G;  2P4K A;  2Y4T A;  1M57 C;  1KD1 W;  5LMN B;  3ZRW B;  5IWA B;  1YEW A;  3OEH G;  2LO1 A;  2ZXW C;  1K9M W;  4LFB B;  4PV1 B;  4QE9 A;  2Q9L A;  2Q8V A;  4DV7 O;  1QU7 A;  3ZS8 C;  1YVW A;  2BOB C;  3PN1 A;  3BFR A;  2VQE B;  4DR7 B;  3JYC A;  1VF6 C;  4DK1 A;  1FFX B;  3DXR A;  2PTM A;  3CHX A;  3E8B A;  4ZBM A;  3B8M A;  2HHH O;  1WB8 A;  2CK3 G;  1HNX B;  1KQS U;  4I50 B;  4HNA A;  2YEV A;  1D5N A;  1JPX A;  1YXB A;  4JI6 O;  1GRJ A;  3BPZ A;  2Z5U A;  4XDJ A;  1US6 A;  3ZRV A;  1G8M A;  3GWK C;  1BT8 A;  5LA6 A;  4DV6 O;  2A7W A;  3L9D A;  3MD0 A;  1L1F A;  2AZ0 A;  4JTD B;  2WLL A;  2CH7 B;  4TV8 A;  3FB6 C;  2DE0 X;  2AGA A;  1NH2 D;  2V4D A;  4FLV A;  2Q7H A;  3RVY A;  1EN6 A;  1HDJ A;  3UT5 B;  3M8A A;  4FLY A;  3ABL B;  3A0H Z;  1O9H A;  2DW4 A;  2CTR A;  2DN9 A;  2NNU A;  3FB8 C;  4LFA O;  2NLJ C;  4DR4 B;  3T1H O;  5B5E Z;  2VWK A;  4TWK A;  1DF5 A;  3STZ C;  1MNG A;  1P84 F;  3PJS K;  4FVM A;  2ZR2 A;  5EBM C;  1V54 C;  1Q7Y W;  3U0Z A;  1GMG A;  1X4T A;  3U10 A;  1PP9 H;  4EEQ A;  1MG1 A;  3JAW B;  5JH7 B;  1YZB A;  1XIL A;  2HG5 C;  5TIS Z;  2P4V A;  1MOF A;  1VF6 A;  1H8H G;  3ETE A;  3HKD A;  1E79 G;  4F6R A;  2JVD A;  1H38 A;  1B04 A;  4WBN B;  4UCT A;  4MVU A;  5KA5 A;  1QR9 A;  1SZX A;  2UU9 O;  3TK1 A;  2UXD B;  3H1J H;  1MA1 A;  4U7O A;  1HR0 B;  4X1Y A;  5B1A B;  3RWR D;  4GX0 A;  5HFM A;  3D36 A;  4GKJ O;  2XAS A;  2YSU B;  4GX5 A;  5CA0 A;  1NR7 A;  4FK5 C;  3VQW A;  2F1M A;  5KHH A;  5LBQ A;  4B3M O;  3BAB A;  3I5D A;  3QTC A;  1SQB H;  1Y76 A;  1BCC H;  5CA0 B;  4IHJ B;  2CH7 A;  1XOU A;  3FX7 A;  5H5N A;  4P2Z A;  2VWJ A;  3CE2 A;  4OGQ B;  3SYO A;  5JJN B;  3S3W A;  2QM7 A;  2LP7 A;  1EZJ A;  1ZAU A;  2BOC C;  2OCH A;  2QKC A;  2ZR3 A;  1TA8 A;  2GDS A;  1VQ8 V;  1SER A;  2Q0A A;  1D2D A;  1N32 O;  2WLI A;  3O9O A;  3K9S A;  3RYH B;  1XHZ A;  5LXT A;  2XHB A;  4X64 B;  3J7A U;  3F5W C;  1S0V A;  1SC5 B;  3ML0 A;  1M4U A;  3LDD A;  4B3S O;  1IVS A;  5ITZ B;  5KHK A;  2ZNJ A;  5EBL C;  3NR7 A;  2JJ2 G;  4TQD A;  1SRY A;  4ZOL B;  2XAJ A;  4DR1 B;  1Q6I A;  4X66 B;  2EJ7 A;  1AJQ A;  3W7T A;  2L6L A;  2QM8 A;  4YJ2 B;  1FAF A;  3CC2 V;  2YEV B;  2Q7E A;  4HBN A;  2IBZ H;  1RFY A;  2FTK A;  2QTO A;  2OCC C;  3OTO B;  3H9V A;  1EM1 A;  1JQ0 A;  4X66 O;  4ZKI A;  1K4C C;  2YXY A;  2RCV A;  2JRI A;  2RDC A;  1AP5 A;  1RM1 B;  4PD4 F;  2PY5 A;  1WNS A;  4BW9 A;  3RT3 C;  2FYU H;  4CS3 A;  1FYJ A;  3CRC A;  4CBC A;  5EK0 A;  3IC9 A;  2HLD G;  4NTY A;  4FLX A;  4YIP A;  3EHB B;  3OR7 C;  4Q20 A;  2PI4 A;  1VQ5 V;  3ABM C;  2OCC B;  3JAS A;  1WPB A;  1J5E O;  2WWW A;  2BCC H;  4JZ2 A;  5L3D A;  2DWE C;  5IYC O;  1GN2 A;  3K06 A;  3RYC A;  3BY6 A;  2EUL A;  2XTA A;  1NTZ H;  1S5L Z;  3TET A;  2XUM A;  2AZ2 A;  4P9P A;  2VS0 A;  4TQF A;  1XNR O;  4G27 B;  1PM9 A;  4LF4 B;  5J2T A;  3QG5 A;  3E35 A;  4JTA B;  4DYL A;  4FFB B;  4CH5 A;  4LFA B;  4DV7 B;  3FAV B;  4JYA B;  4JYB A;  1SA0 B;  1KMI Z;  4GX2 A;  1RSO A;  5JQG B;  4DV1 B;  3WFV A;  4MS2 A;  3JAR A;  4PA4 A;  3SJB C;  3K79 A;  3ZMT A;  4K35 A;  3DC5 A;  4D6T H;  5CA3 A;  3DGE A;  4J7J A;  4HYO A;  4MTF A;  4Z1V A;  4EKW A;  1DK1 A;  4OPA A;  1VAR A;  4BIU A;  4PI0 A;  5EZY A;  5CBG A;  4JI4 O;  4H13 B;  1VQK V;  3JAL B;  2QA4 V;  1BGY H;  3KKY A;  3G71 V;  4O2B B;  1K5S A;  3N2G A;  4DW0 A;  1P7B A;  5E79 Z;  2DQ3 A;  4YY3 O;  1K5Q A;  4D7S A;  4DR4 O;  2WLK A;  4B3S B;  4N23 A;  1KP2 A;  3HKC A;  2M7W A;  4UVB A;  1B3Q A;  2XAF A;  5LYJ A;  4HZ3 A;  3R65 A;  3RYF A;  5LP6 A;  3GB7 C;  1GK9 A;  2YIB D;  3DSQ A;  4J10 A;  1THZ A;  3CCL V;  3ZED A;  2UUB B;  2E5L O;  1QLE C;  2AHY A;  5A9G A;  3D3Q A;  1JJ2 U;  3CMA V;  1H2S B;  1S5J A;  2ADP A;  5IY5 C;  4CC5 A;  5BR8 O;  4FJC C;  2BTQ B;  2F23 A;  3K5N A;  3RYF B;  4K0K B;  3CRQ A;  1BZK A;  4DV4 O;  1R3L C;  4NXN B;  4FZ1 A;  1FPO A;  4U3J B;  1XUQ A;  3JAT B;  2HJF C;  1LUV A;  4DV2 O;  1MSW D;  2N04 A;  2XT9 A;  1IBM B;  5EBW C;  3T4D A;  5JCO A;  1XMQ O;  3QVN A;  3RGB A;  1NZ6 A;  3OMN B;  1AI7 A;  3GVM A;  2ODM A;  1VMG A;  3AEI A;  4DV2 B;  3UCS C;  4YHH B;  5J2T B;  3K9A A;  3P30 A;  2IJI A;  3AG4 C;  2GUZ A;  4L8J A;  1JR9 A;  5CA1 A;  3LDE A;  1E1Q G;  3SDL A;  3H1L H;  3SPJ A;  1AP6 A;  4J9Z B;  1ZX3 A;  4JAU A;  3T1H B;  3TXQ A;  3UKM A;  4JI1 B;  3JAS B;  1WLE A;  2OTJ V;  2YI8 A;  1PNK A;  1OCR C;  1MSD A;  2UUB O;  1B06 A;  1YF2 A;  3EVK A;  3L75 H;  4FMT A;  1TUB A;  3SJA C;  2K9P A;  1GAX A;  3M99 B;  4GUN A;  2OIG A;  3WU2 Z;  2UXD O;  4J7Z A;  2Q4P A;  3WB0 A;  4UCR A;  2ZIN A;  1XBL A;  2IJJ A;  2X6B A;  4R8C A;  1PD3 A;  3AK1 A;  4JV5 B;  1HWY A;  1AR4 A;  1Q5O A;  1R3K C;  3E22 A;  2ETN A;  2P67 A;  2Y48 A;  1JOY A;  2CGO A;  3AG1 B;  4TV9 B;  2HVK C;  2RJZ A;  5KX5 A;  3ASO C;  2JGD B;  4JF3 A;  2JIZ G;  2L35 A;  4I0X A;  2WA3 A;  4ZOL A;  4MVR A;  3E83 A;  1GH6 A;  4PA6 A;  2XAQ A;  2QWP B;  4PI2 A;  1W2B U;  2BSK A;  3BA9 A;  4UUJ C;  1PNL A;  5B3S B;  1Y76 B;  4E4E A;  3KCX A;  5E1A C;  4DV3 B;  4R50 A;  1N0N A;  1KC8 W;  1IZ3 A;  3D36 C;  4LF8 O;  1VQ7 V;  5KAI Z;  5JCO C;  2QGN A;  4DUY O;  3BVO A;  4ASU G; 
#chains in the Genus database with same CATH homology
 4OPA A;  4DV0 O;  5BY1 A;  4DV3 O;  1N34 O;  3JAM N;  1XMO O;  4DUZ O;  4JI4 O;  4DR6 O;  4JI3 O;  3J80 N;  4DV1 O;  1FKA O;  3R66 A;  3SDL A;  4LF7 O;  4GKK O;  4X66 O;  5IT9 N;  3F5T A;  1FJG O;  2Z0A A;  1YZB A;  4YY3 O;  2UUB O;  1HR0 O;  2JRI A;  2LW7 A;  4DR4 O;  4NXN O;  4JI1 O;  5A2Q N;  4X65 O;  4B3T O;  2ZKO A;  2DOS A;  2UXC O;  1R1B A;  3RT3 C;  1FYJ A;  4LF9 O;  4LF4 O;  1AIL A;  1IBM O;  2UXD O;  2ZM6 O;  2UU9 O;  4JI0 O;  1X59 A;  4JI2 O;  2FKX A;  5LL6 Y;  5LMN O;  4JV5 O;  4DV7 O;  1DK1 A;  1NS1 A;  5IWA O;  1R6T A;  4DV5 O;  4DR1 O;  1J5E O;  4GKJ O;  2E5L O;  2UXB O;  4K0K O;  1N36 O;  4B3M O;  1I94 O;  1KUQ A;  2N74 A;  2HHH O;  5H5N A;  4OPH A;  5BR8 O;  1XNR O;  2F4V O;  4X64 O;  4OX9 O;  4JI6 O;  1HNW O;  2UUA O;  4JI5 O;  4LFC O;  2DJV A;  4DV4 O;  1AB3 A;  2VQF O;  4X62 O;  4DV6 O;  3OTO O;  4KHP O;  1IBL O;  4JI8 O;  5LMU O;  4DV2 O;  1D2D A;  1N32 O;  4LF5 O;  1G1X B;  5BXZ A;  1HNZ O;  4LFB O;  3J7A U;  1HNX O;  2AGA A;  4DR2 O;  2UUC O;  1XMQ O;  1XNQ O;  4AQY O;  4NXM O;  1A32 A;  1F7Y A;  3J81 N;  1N33 O;  4B3R O;  4JI7 O;  4B3S O;  3M8A A;  4DR5 O;  4DR7 O;  4YHH O;  4JYA O;  4A5U B;  4LF8 O;  4LFA O;  3O65 A;  4LF6 O;  3T1H O;  2VQE O;  1XEQ A;  4DR3 O;  5FLX N;  4DUY O;  1IBK O;  3T1Y O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...