4NXNO

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4nxnO00
2LW7A 2Z0AA 3J81N 4DV3O 4YY3O 4LFAO 1AB3A 4LFBO 4JI4O 1IBKO 4LF6O 4DV2O 2ZM6O 5BR8O 4K0KO 1HNXO 1HR0O 4NXNO 4OPHA 4DUZO 4NXMO 4JV5O 4JI1O 3J80N 1IBMO 3JAMN 4OX9O 4DR3O 4DV0O 4JI0O 4DR2O 4X66O 1XNRO 4B3RO 3T1HO 1N34O 4B3MO 1HNZO 3J7AU 1N33O 4DV6O 1FKAO 2ZKOA 3OTOO 5FLXN 1KUQA 4LF9O 2DOSA 2DJVA 5LMUO 3R66A 5LL6Y 1XMOO 1IBLO 1R1BA 4GKJO 1XEQA 2UUBO 3RT3C 4JI8O 4B3TO 1X59A 4X65O 1FJGO 2JRIA 5A2QN 4JI3O 4OPAA 1N36O 4JI2O 1N32O 4DV4O 3F5TA 4DUYO 2UXBO 1XMQO 1AILA 1I94O 1G1XB 1R6TA 5BY1A 3M8AA 4JYAO 1D2DA 2F4VO 4LF7O 5H5NA 2FKXA 2AGAA 3O65A 4X62O 4DV1O 1DK1A 1NS1A 1YZBA 2E5LO 4DR6O 3SDLA 2UXCO 1J5EO 2UU9O 2VQFO 4B3SO 4DV5O 4LF4O 4LFCO 4AQYO 4JI6O 4JI7O 5IWAO 4KHPO 2HHHO 2VQEO 4YHHO 1XNQO 1HNWO 3T1YO 2UXDO 4LF8O 2UUAO 5BXZA 4JI5O 4DR1O 1FYJA 4GKKO 2UUCO 4A5UB 4DR4O 4DR7O 4DV7O 1A32A 4DR5O 4LF5O 5LMNO 1F7YA 4X64O 5IT9N 2N74A
chains in the Genus database with same CATH superfamily
1B3QA 4PA9A 4IT5A 1K34A 3HKDB 4WBNA 4JYAB 1IURA 5KHHA 5EBWC 3KCYA 1F4MA 2Z5UA 2Y4TA 3GB7C 2YXHA 4DR7B 5K1PA 1PKXA 3TJTA 1I5XA 2ZCEA 4JTDB 3UKMA 5JQGB 4JV5O 4PDVA 4ZI7B 4YY3B 3U11A 3JD3A 2A7WA 1JOYA 1NH2D 1P84F 2QWPB 1FFXA 1P4RA 2Q6AA 1NT2B 1AI7A 3R66A 1EBOA 1OCOB 4RUFA 3CCMV 4FLZA 1EZJA 3JALB 4IYIA 1K73W 1FXKA 3BFRA 4JTAB 1R3JC 1H2NA 3D36C 4O2BB 3C90A 3RVYA 4BW5A 1WNSA 1I0HA 2BTOA 3UT5A 2LGWA 5LHHA 3P32A 4GKJB 5BR8B 3K9AA 4BIUA 2OIGA 3RBZA 2EIKC 5IYZB 2AGAA 1M93A 1XNRB 1N32B 1DK1A 1YHQV 5JJJB 2ZE8A 1Q43A 2IH1C 4DUYB 2X6BA 4IIJA 3TETA 2C2AA 2Y4UA 3OGCC 4LWSA 5B3SB 3QF7A 3AG4C 5L3CA 2LFSA 1LNQA 3FB8C 4QE7A 1U96A 2YEVA 3UQ8A 1QLNA 4FJCC 3T1YO 4DR6B 1NQTA 2Q8VA 3GVMA 4GKKO 5CBFA 2WLNA 1JPXA 5IWAB 3RYHA 4NTXA 2R70A 2HG5C 3H1LH 3HKDA 1K33A 4WFGA 3CRQA 4WCEV 1ZUQA 3ZX6A 1VP7A 4IHJB 3MHSC 1IBKO 3E35A 1XUQA 2XOKG 1QR8A 3P30A 4HBNA 4ZI7A 1GAXA 1K7DA 2Q9LA 4MVZA 4CH3A 1P7GA 5B1BC 3K5LA 1HNZO 4CZZA 3CCQV 4K0KB 5D5QA 4W4LA 1HR0B 1Z2GA 5C8YB 1BMFG 4I4TB 3JARB 4KL1A 3T1CA 5LL6Y 3QG5A 4OX9B 3UCSC 4FLTA 4X89A 1ORQC 2OTLV 2UUBO 2YI9A 4CS2A 5CN0A 2OIEA 4NTYA 4O2BA 3CD6V 4DK1A 4DV6B 3QO5A 2W0XA 2HR3A 1IBLB 1SESA 1D5AA 1H2LA 2E3CA 3BVOA 3FB5C 4QGPA 2ITCC 4TUYB 2A0LA 5IJ9A 3JASB 4FMTA 2UXNA 4DV1O 2QSAA 2P4VA 1TAEA 4IL6Z 3DGEA 1N0NA 1J5EO 4RAIA 4DV5O 2DWEC 3K9SA 4HZ3A 1OCCC 2X6CA 2CE4A 4O4LB 3A0BZ 3ZMUA 4J7ZA 1EM1A 2Q7GA 2VQEO 5B1OA 2Q69A 1AI6A 2BTQB 4LF8O 1GM7A 1AI5A 4JI5O 4MW3A 2R9AA 5A9GA 2W0FC 5JCOC 2CH7B 1SQGA 2Y0IA 4JI6B 4LC1A 4LF5O 2EIKB 4UVAA 3ETDA 5AG2A 2IJJA 3J81N 4IHJA 3QO7A 3OTFA 1NJIW 3ZHTA 4H33A 3SR2C 3ML0A 1FXVA 4LF6O 3AG4B 2QM8A 4MVUA 4GX0A 4UVBA 4HNAA 1Y6XA 3JAKB 2HVJC 2YIBD 4DRXB 2ZE7A 2Y0PA 3ASOC 4JI1O 3J80N 1K3EA 3SYCA 3CXHF 3T1HO 3SJBC 3MD0A 5IYDO 2ZM6B 3CB2A 5KX5A 1L1FA 3JARA 5LMUO 1V55C 3CCUV 2R9RB 1GK9A 2IU0A 1NTKH 3STZC 4XDKA 4MSWC 3ABKC 3RYCB 2JRIA 4KXRA 5K1XA 4CC5A 2BSKB 4OGQB 4EKWA 5KAIZ 4TUYA 5C93A 3ZMSA 4GZRB 5B1BB 1M56C 4JV5B 4UUJC 3WB2A 4U7OA 4DXWA 2P5OA 3OUFA 4G28B 1K92A 3B40A 1YZBA 3F7VC 5DEDA 2UU9O 5BMVA 1R3IC 4YJ2B 2KG7B 1AI4A 2GTSA 2PGGA 1K4CC 4FIPC 1OJHA 3CYOA 3I5DA 1TVKB 4KP4A 5FPOA 4N23A 3RYIA 2BTQA 3EFFK 2GUZB 1XHZA 1VQ6V 4JAVA 2CH7A 3CCSV 2WLHA 1QVGU 3B2EE 2OTJV 4LFCB 4DR7O 1Q5OA 1FPOA 4TSFG 1SA0B 1S5LZ 1Q3EA 3ZRVA 3AG3C 1FXHA 3THOA 5CA3A 4YY3O 4K8ZA 4CC6A 1Y76B 3ZBHA 5LBQA 4TQFA 5CBGA 3TCUA 2QTSA 4PI0A 3JAKA 4CH5A 4UFZA 1SS3A 1IX9A 3R65A 4D6TH 4GYCB 4I7ZB 3O9OA 4LFAB 2B1GA 3K3WA 4CS4A 1CP9A 2XAGA 5KMGB 3J7AU 3E8FA 5H2FZ 1Q6UA 4GKJO 4DV0B 4X66B 1BL8A 4TT3G 1E79G 4PI2A 2FTKA 3OD4A 4JYCA 2KB1A 2OCHA 3H1HH 2YIBA 2BSKA 3APQA 1BSMA 1M4UA 1R6NA 5L3DA 4TV9B 3BEHA 3LDDA 4NYKA 1N32O 5IYCO 2Z3YA 1Y4MA 4DUYO 1BGYH 1WPBA 4X9QA 1HW7A 3ASOB 3SYOA 3RFRA 5IE9A 4ABMA 5H5NA 5CA1A 1JQ0A 3K06A 2ZE5A 3STLC 3VBBA 4DR6O 3HB3B 4DV4B 4YIPA 4YJ2A 2KG7A 1ZLZA 4P9PA 3OE7G 3SPGA 1JX9A 2DQ3A 1LR1A 1V55B 1TVKA 2QJ1A 2AHZA 2WSSG 2IJHA 5IWAO 5L3GA 3ABKB 4ZKIA 3C3TA 2HVKC 4X62B 3H01A 1KD1W 1I5YA 1Z5VA 4FPPA 4A5UB 3HR0A 4BR6A 1MMMA 2LJ2A 1M56B 2XTAA 4FLVA 1HNWB 1D2DA 4K35A 2MW2B 4J42A 1MG1A 1JJOA 2QEXV 3BCCH 4K0KO 2K9PA 3CCRV 2XHBA 1HR0O 4OPHA 5CB4A 4OX9O 2QKAA 2NN4A 3SPHA 4UCUA 1NI8A 2F93B 5KMGA 2V7QG 3MDSA 5JCOA 3A8TA 4DV6O 1FKAO 4J11A 3OGIB 4WBNB 2GBOA 3HKEB 2JGUA 1ROPA 1XMOO 1IBLO 4EFBA 4DR2B 3OEEG 1DF5A 2WPDG 3AG3B 3M99B 4B7EA 3WG7C 3D3IA 3FB7C 4TV9A 2DN9A 1FJGO 1N33B 2CDYA 3FD9A 3K58A 2P6JA 3B8MA 3OM3B 1GKFA 4EFEA 2F43G 1WPXA 1PNLA 1R6TA 3CCEV 3N2KB 2YUAA 4L8JA 3SPJA 4P30A 1XQ8A 1GH6A 3FFQA 1YI2V 4FZ1A 2OWOA 5L3BA 2WLMA 2Q67A 3H9VA 4QIWF 2QWRB 1F51A 4JI6O 2OCCC 3QNEA 5LMUB 1WLEA 4KUMA 1W2BU 1SC5B 3G67A 1WB8A 5L3EA 3PN1A 3JYCA 1TUBB 4H0LB 2Q7HA 3OMAB 3LSQA 2IU3A 1JA8A 3K5MA 4IIJB 3IC7A 2EZPA 1BZKA 4PA3A 1AB3A 2F66C 1YJNV 2PY5A 4I9WA 2HFEC 2ZM6O 1W0JG 1IZ3A 2HJDA 2PF4E 2QDOA 4L87A 2N04A 3LNMB 3L74H 3RYHB 3M7MX 4MT8A 1HP8A 1UPGA 3E22B 3HKEA 2Q0OC 2VS0A 1G4YB 5E79Z 3CCVV 3S3XA 1IBMB 1R1BA 1RSOB 4HAMA 5CBHA 2RMKB 2JGDA 4FM0A 3ZN1A 4FLUA 3ZHVA 1QU7A 4O4IB 3ETGA 4D7TA 4QJFB 4FLWA 4O2AB 1Y74B 4DO2A 1MNGA 1W0KG 1YCIA 3LDCA 3N2KA 1P7BA 2A9HA 4B3TB 3GWOA 4J7JA 4JYBA 3UO2A 1M5IA 4X1YA 3G71V 2YXYA 4JTCB 1D5NA 4X8AA 5KA6A 3CRMA 1ZX3A 5JJNB 4WFBV 4OXSA 4NKGB 3RGBA 4PA4A 1KP2A 3E86A 2EX3A 4LFCO 2F23A 3ZRXA 2Y48A 1N4CA 2B1IA 2R72A 3LNNA 3Q4HA 4YJ3A 3D8CA 2QM4A 3BPZA 3WG7B 5FNVA 3K59A 1NH2B 4JF3A 2WLJA 3FAVA 5IY5C 3VQXA 3CC7V 1VQLV 4MTFA 3CCLV 1TUBA 4DW0A 5IJ9B 3K0DA 1K4DC 2YI8A 2YS8A 5GTHZ 2HHHB 2IM9A 3ZEDA 1MOFA 3T4DA 1FFTB 1BQ0A 1JJ2U 3G6BA 2LW7A 5J9PC 3E2EA 3CS5A 4LFAO 3E8BA 1Z5WA 1JMKC 3BABA 2R9IA 2GDSA 1DLBA 2OCCB 4QPKA 4WFFA 2Q4PA 1YXBA 2VWKA 4O4HA 4DV0O 4X66O 2YC0A 5GTIZ 1MABG 1PPJH 5LA6B 3E22A 5ITZB 2FYUH 1RSOA 2XAFA 3CRRA 4E4EA 1YTFD 2P67A 4MTXA 1PM9A 1MZEA 1JFFA 1N34B 2LQTA 2WAMA 4J7KA 1KMIZ 4HNAB 4O4IA 5IJ0A 1SQBH 2FL4A 4I5SA 4O2AA 4UVCA 1Y74A 5LYJB 3A0RA 3JSNA 4DV4O 5L3FA 2ZNIA 1GM9A 2P06A 2DQ0A 1E1QG 2Q73A 2E75B 2NNUA 2XUMA 5KHIA 5KX5B 2QWNB 3ZHSA 3LUTB 3K79A 1AP6A 2JJ2G 2CTQA 1K97A 5B5EZ 4AHCA 4X62O 1N36B 1YTFB 1XHXA 2UXCO 1QQCA 3ZRWB 4H13B 3FYEB 1XMQB 2L6LA 1Q82W 2OT5A 1FAFA 4J9YB 2QWQB 5J2TB 1EN5A 2EIJC 3W7XA 1Q90D 1XMOB 1NBMG 2IBZH 4JGSA 1HNWO 4K8XA 2YSUB 1QLEC 1FJGB 2X6AA 2PUSA 2ZXWC 1PL0A 1SQVH 1G6UA 1F23A 1S77D 3TXQA 5KA5A 1F7YA 1XNQB 4UCOA 5BMVB 3T2MA 4U7NA 1GM8A 3OMNB 1VIBA 4DR4B 3RYIB 2ZIMA 4WF9V 5E1AC 1HNXO 4CS3A 3ETEA 1HWYA 2AZ2A 5KHGA 4Z1MG 4DV3B 1W59A 3VQYA 5LA6A 4UXNA 4DR2O 3ZJZA 2JEXA 3SGIA 5IY5B 2B5UA 1XILA 5ITZA 4LH6A 1AP5A 5IDJA 1N33O 4RO2A 2X7RB 2G38A 1NTMH 2CK3G 4X88A 1RPOA 1EN6A 1IXMA 1PP9H 2Q7EA 1COWG 3EHBB 3ICXA 1OHHG 1XEQA 2AW9A 1PD3A 3U0ZA 3G6EV 3CHXA 5LYJA 3OTOB 2RNBA 1O9HA 4CH6A 3B77A 3ZHUA 3CMEV 1JVMA 1CPYA 2BOBC 4P9OA 4X1IB 5LHGA 2N05A 3HKCA 3ZRWA 3AG7A 3L70H 4CBCA 3TK1A 3WFVA 5CA0A 5J2TA 3OR6C 1L8DA 1U97A 2W6IG 1QCEA 1UFIA 2ZD9A 5JWPA 2ARHA 4BWAA 3N27A 5EIBC 3CPWU 3HKBA 2EIMC 5EBLC 5CA1B 3DC5A 1TUEB 1S5HC 3ZHRA 3BY6A 1OCZC 2QM7A 4O4JB 1GMGA 4U3FH 5KUMA 2F1MA 4AI8A 4F6RB 3OEHG 2H8PC 1WB7A 1VQ9V 5LOVB 1Y66A 4B7KA 1YVWA 4PA6A 1TGOA 1B06A 2HEPA 2EIJB 3EVKA 5EBMC 2YIAA 2KQXA 1IBMO 1R6KA 3G4SV 4FM2A 1H2GA 4BW9A 1JCHA 1QLEB 1MSWD 2WWWA 4PV1B 3H1KH 2ZXWB 4PHZA 1KUQA 3H1IH 2LP7A 1VMGA 3PJSK 4GUNA 1PV0A 2E76B 1Q6IA 4B3RB 1SQQH 4B3MB 3H1JH 4B3TO 5FL7G 3JAWB 4JASA 1UJWB 1NZ6A 5CB4B 4H37A 4LF9B 3KKYA 4LCUC 2XAJA 3ASNC 1WJZA 3A0HZ 3L71H 4X1IA 4B08A 1BHAA 3SJAC 4PA7A 4X65B 3ABLC 2FKXA 3O65A 2ADPA 2GSMB 3QTCA 4ZHQB 1L0LH 1AVMA 1NS1A 2P22C 2Q0AA 3X2QC 3OAAG 1I94B 2K1EA 3JCUZ 2HLDG 1I08A 2HHHO 4XDLA 1M90W 1XL4A 3LSSA 2JK5C 4GCZA 5GONB 2UUAO 2QWOB 2ZR3A 1V9PA 3CE2A 1FYJA 4K3AA 4UCVA 1KC8W 2ATKC 4BIZA 5EIBD 3RW0A 2QKSA 1P49A 4O4JA 5LXTB 1YF2A 1SRYA 3APOA 5IYBO 4ZOLB 3NR7A 4F6RA 1VEWA 2ZNJA 1XDCA 3AG1C 5LOVA 3OFNG 3ZCCA 2UXCB 2ZE6A 3W7TA 1LUVA 3N2GA 2PYJA 3ETQA 4ZBMA 1K5QA 3OW2U 4DR3O 1AR1B 1N34O 2EIMB 4ICGA 4MVQA 4DV2B 3JSLA 1AROP 4ZIBA 4NXNB 3IGAC 2P90A 1OCZB 2QA4V 2BOCC 4DYLA 2GHYA 5LP6C 3WB1A 3JAWA 1H2MA 2RQ6A 3RYFB 2RJZA 2CTPA 2BE3A 4QPJA 4KFMA 2WLKA 4JAAA 1QNMA 4OPAA 1N36O 4QE9A 3OMIB 1XMQO 4LH7A 1HNXB 1B6QA 2CAZC 2EULA 1GN3A 5B1NA 4ZHQA 1NTZH 3AK3A 1BT8A 5BZBA 2A3QA 1EZVH 2JGDB 4FLYA 1MZFA 2UXBB 3SPCA 4RUEA 2F4VB 4JZGA 4LF7B 3CRAA 5GONA 4X20B 5EZYA 3E8HA 3MHHC 2LFRA 2DMXA 1XNQO 5DECA 5BXZA 2CGOA 2F95B 2O57A 4FFBA 4DR4O 1DTOA 4R8CA 4X1YB 3ASNB 4KHPB 5LXTA 5FPRA 1GN6A 4X64O 4ZOLA 4YHHB 3ABLB 2UXDB 1OV9A 1Q81W 4DV3O 2CUGA 3K08A 1MA1A 2GTAA 3X2QB 3Q4HB 2HP8A 4YJ3B 3W7SA 4FLXA 4YXWG 4ASUG 4DV7B 3E8GA 5FNVB 1YIJV 1H2SB 3FAVB 2YIDA 3QVNA 1KU9A 4R7CA 2JEUA 3SYQA 3W7WA 3BAAA 1VQMV 5EK0A 3OTOO 4RWUA 2EJ7A 3MAQA 5JJEB 1R73A 4LR3A 3JATA 2ZDIC 3FX7A 3RYFA 1KQSU 3RT3C 3AG1B 4JYYA 5H9CA 4RQEA 1BCCH 4GX5A 4MW8A 4MTOA 2JVDA 4O4HB 4UB8Z 2A79B 3OUSA 3U10A 1KKCA 3M8AA 4WFEA 3FB6C 5J2UB 3E89A 2JS5A 1THZA 5KUKA 4JI2B 2JIZG 4E2LA 1JFFB 5HFMA 4MVMA 2EJRA 5LP6B 4X20A 5IJ0B 5LGUA 1I7FA 1SQFA 2E5LB 4TQDA 1AR4A 4DR1O 1F4NA 4I50B 4LF4B 1YITV 2FMLA 4AILC 1IVSA 4NB5A 2JDIG 1M9NA 4X1KB 4MVSA 4I55A 1NR1A 3DSQA 3P3PA 4Z1VA 1H8HG 4XDJA 3B8NA 3CJHB 1KYOF 1VQOV 2EILC 2UUCB 3JD2A 4PJ0Z 2AXTZ 2IJKA 4GX1A 1GTOA 4J41A 3CMAV 3AEIA 1CEZA 1SZTA 1BHBA 4B3RO 4LFBB 3UO3A 1QHTA 1TA8A 2ETNA 3B09A 4B3MO 4JI4B 3DC6A 2UUAB 2Y69C 1Q86W 1ENVA 2DYSC 2PI5A 5FLXN 5H6RA 4LF9O 1WA8B 4NXMB 2VWJA 1KP3A 1CXZB 4DW1A 4JI0B 3NXSA 3I55V 2KSDA 4FFKA 1X59A 3IJ4A 1S3JA 4X65O 1ZTEA 1SKVA 1X4TA 2DYRC 3K57A 1I94O 4GX2A 4JI8B 5J2UA 5BY1A 3BA8A 2OYQA 2CTRA 3ZIAG 4DR3B 2RCVA 2QE7G 3SDLA 3K5OA 3JD1A 3LDEA 3ZS8C 5LP6A 2LW1A 2M6YA 1G8MA 1VQ7V 1XL6A 3ZMZA 4I50A 3ABMC 5KLVH 4UV8A 2XAQA 2VQFB 4B3SB 1US6A 5JQGA 1VF6C 2Q5ZA 4AQYB 3CWBH 3HKCB 4X1KA 4EEQA 1K8AW 1M57C 1NR7A 3C3SA 5KHKA 4LNUB 3BA9A 5CA0B 3CJHA 2XT9A 1RPRA 2Z0AA 2B9ZA 2KKWA 3JD0A 3L75H 1PL4A 1Q7YW 3CC4V 3OR7C 4DV2O 3JALA 4DR5B 1JR9A 5DN6G 3BHPA 3F7YC 3FKSG 1S76D 3HKBB 4NXNO 4PD4F 1Q6HA 2XASA 3AK1A 1SQPH 4J10A 3SYPA 1YJWV 1SETA 4MTGA 2EZOA 4GT1A 5IYZA 1ZL8B 1WA8A 2LGQA 2DOSA 2XNDG 1VF7A 5F2VO 4DUZB 1IXBA 1URFA 1XREA 4RQFA 1AJNA 1H38A 3IAYA 1QVFU 4J9ZB 4X64B 3KZIZ 4NR1A 2EILB 3RWRD 1IDSA 4FM1A 1M1KW 4U3JB 4XBFA 2UXBO 5KAFZ 1DGSA 1G1XB 2F4VO 4LF7O 4J80A 3VOUA 4JI3B 2Y69B 3E83A 2EINC 2DYSB 2QTOA 1B04A 2YICA 4LBEC 4TV8B 1S5JA 2ZDIA 3ABTA 1XBLA 4KHPO 3RVZA 4YIOA 4JPRA 4YHHO 2UXDO 3GWKC 2ILMA 4PDLA 3K5NA 2DYRB 2CTWA 2ADQB 3AK2A 4EB6B 3P3NA 3W7UA 1VARA 4DV7O 4JI7B 1A32A 1RP3B 3FYIB 4LNUA 1T5EA 3I56V 3F5WC 3T4ZA 2MK3A 5LGNA 5C8YA 4I4TA 2D2CB 1VQ4V 4GLXA 3B4SA 3IC9A 4Q6GA 3CC2V 4P2ZA 4BAYA 5LMNB 3ZMTA 1KB9F 4DK0A 1Y67A 1NVPD 5HFLA 2GV9A 3ABMB 3RN4A 2DWDC 4BIOA 2YDEA 1GO3F 1ZL8A 2ITDC 4DR1B 2ZKOA 1OCRC 1V54C 3SPIA 3L9DA 3JASA 1M57B 4TWKA 4PDMA 1MSDA 3AG2C 3BRCA 2WLLB 2EBOA 3K04A 3ZMVA 2HKOA 2V4DA 3JCZA 3N2GB 1YDXA 2H3OA 4O4LA 3D3QA 3CXCU 1NVPB 4JI2O 1VF5B 4U3JA 1XI1A 4MS2A 3D36A 2UXXA 1R3KC 4JYAO 5H6QA 4F4LA 1PNMA 2P4KA 1GN4A 2Q68A 3OT7A 1OZ0A 2IH3C 1RM1C 4G2KA 2E5LO 1ZSPA 2HJFC 3WB0A 4TV8A 3QO8A 4FZ0A 1SQXH 4Z2WA 4R50A 3K03A 4UCTA 4LF4O 4N21A 3CCJV 1NKDA 4EB6A 1OCCB 3CSXA 2IJIA 1SZXA 2UUCO 1SERA 2LO1A 4DRXA 1BQZA 1Q8IA 1S0VA 3A2FA 3T1YB 2ZINA 4HYOA 2FB5A 1VQ5V 5B66Z 4UV9A 2EINB 3G80A 2AZ0A 4GKKB 4D7SA 4JZ2A 4LFBO 1FXKC 1O9GA 4JI4O 5EZYB 5BR8O 1VQ8V 3RYCA 1QBZA 4UCSA 4NXMO 5B1AC 2JJ1G 3L72H 4FFBB 3SJQC 3JAMN 1XNRO 4JI0O 3S3WA 3CP1A 3TGUH 1S72V 5EC1C 1VF6A 5JH7B 1IBKB 2VRZA 1GN2A 2PZSA 2DE0X 2NR5A 1EN4A 3L73H 2WLLA 4R6ZA 1HDJA 5DM6V 2BCCH 4JI8O 1LUWA 1HNZB 1VQNV 2QKCA 3VQVA 1WAZA 2PYLA 5A2QN 2QGNA 3SYAA 4TOIA 1WN7A 3F5TA 1N8RW 5EYPB 2GUZA 2D3OW 4PDRA 2UUBB 3CRCA 2ODMA 5KHJA 1J95A 1BS3A 1SA0A 3DXRB 3CEIA 3JATB 3SJCC 2WA3A 4C7UA 1FS0G 1OCRB 1V54B 1ZAUA 4W4KA 2VQFO 4B3SO 2WA4A 1FD9A 1VQKV 1EFRG 4AQYO 3AG2B 4FK5C 4JAUA 3K0GA 5JVDB 1Y76A 4I9QA 2P7TC 4UCRA 5LGTA 2DW4A 3KCXA 2L35A 4MVOA 4F6EA 4DV1B 2M7WA 2PTMA 2W6JG 1J5EB 2WLIB 4IYHA 4DV5B 1BE3H 1KBHA 3EXAA 4DR5O 4G27B 2VQEB 1DF4A 2ZIOA 2RDCA 4I0XB 1OCOC 4LF8B 4JI5B 1AR5A 1RM1B 2AHYA 2ZT9B 4LF5B 2JS3A 1SF9A 1XOUA 3DTUB 1KKDA 1E1RG 4DUZO 4Q20A 1WP7A 1AJQA 2A06H 5JH7A 1GRJA 1QR9A 2YXLA 1YSCA 3HPLC 4LF6B 4I55B 1L0NH 3UM7A 3TXSA 4CH4A 4NVPA 1FFXB 2DJVA 5B3SC 1YJ9V 4JI1B 2E74B 1R3LC 2PI4A 3T1HB 1AJPA 1NU1H 1N0JA 1K5SA 4IGGA 4WFHA 1FXKB 5GW7A 4MVRA 5LHIA 4JI3O 5EYPA 5EC2C 1H8EG 2X0LA 4UB6Z 3WU2Z 1AILA 2V1DA 3ABUA 3UT5B 3ZN0A 3KG2A 5B1AB 1RFYA 3VQWA 4WFAV 3CX5F 3DXRA 4H44B 2QR4A 4LP8A 2ZQMA 2H94A 1YEWA 1PNKA 2RN9A 4PELA 5JVDA 1K9MW 4LWSB 2ZR2A 5CMUA 1ZWIC 4JI7O 4QNHB 3IFXA 2IW5A 5TISZ 2NLJC 2XAHA 2YEVB 3LSUA 1WP8A 2WLIA 2UU9B 3ZHQA 3ZRSA 1VQPV 1H2KA 2CGNA 4FVMA 1KECA 4NTWA 4I0XA 5D5PA 5LMNO 3JD4A 5IT9N 2N74A
chains in the Genus database with same CATH topology
2LW7A 2Z0AA 3J81N 4DV3O 4YY3O 4LFAO 1AB3A 4LFBO 4JI4O 1IBKO 4LF6O 4DV2O 2ZM6O 5BR8O 4K0KO 1HNXO 1HR0O 4NXNO 4OPHA 4DUZO 4NXMO 4JV5O 4JI1O 3J80N 1IBMO 3JAMN 4OX9O 4DR3O 4DV0O 4JI0O 4DR2O 4X66O 1XNRO 4B3RO 3T1HO 1N34O 4B3MO 1HNZO 3J7AU 1N33O 4DV6O 1FKAO 2ZKOA 3OTOO 5FLXN 1KUQA 4LF9O 2DOSA 2DJVA 5LMUO 3R66A 5LL6Y 1XMOO 1IBLO 1R1BA 4GKJO 1XEQA 2UUBO 3RT3C 4JI8O 4B3TO 1X59A 4X65O 1FJGO 2JRIA 5A2QN 4JI3O 4OPAA 1N36O 4JI2O 1N32O 4DV4O 3F5TA 4DUYO 2UXBO 1XMQO 1AILA 1I94O 1G1XB 1R6TA 5BY1A 3M8AA 4JYAO 1D2DA 2F4VO 4LF7O 5H5NA 2FKXA 2AGAA 3O65A 4X62O 4DV1O 1DK1A 1NS1A 1YZBA 2E5LO 4DR6O 3SDLA 2UXCO 1J5EO 2UU9O 2VQFO 4B3SO 4DV5O 4LF4O 4LFCO 4AQYO 4JI6O 4JI7O 5IWAO 4KHPO 2HHHO 2VQEO 4YHHO 1XNQO 1HNWO 3T1YO 2UXDO 4LF8O 2UUAO 5BXZA 4JI5O 4DR1O 1FYJA 4GKKO 2UUCO 4A5UB 4DR4O 4DR7O 4DV7O 1A32A 4DR5O 4LF5O 5LMNO 1F7YA 4X64O 5IT9N 2N74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LW7 A;  2Z0A A;  3J81 N;  4DV3 O;  4YY3 O;  4LFA O;  1AB3 A;  4LFB O;  4JI4 O;  1IBK O;  4LF6 O;  4DV2 O;  2ZM6 O;  5BR8 O;  4K0K O;  1HNX O;  1HR0 O;  4NXN O;  4OPH A;  4DUZ O;  4NXM O;  4JV5 O;  4JI1 O;  3J80 N;  1IBM O;  3JAM N;  4OX9 O;  4DR3 O;  4DV0 O;  4JI0 O;  4DR2 O;  4X66 O;  1XNR O;  4B3R O;  3T1H O;  1N34 O;  4B3M O;  1HNZ O;  3J7A U;  1N33 O;  4DV6 O;  1FKA O;  2ZKO A;  3OTO O;  5FLX N;  1KUQ A;  4LF9 O;  2DOS A;  2DJV A;  5LMU O;  3R66 A;  5LL6 Y;  1XMO O;  1IBL O;  1R1B A;  4GKJ O;  1XEQ A;  2UUB O;  3RT3 C;  4JI8 O;  4B3T O;  1X59 A;  4X65 O;  1FJG O;  2JRI A;  5A2Q N;  4JI3 O;  4OPA A;  1N36 O;  4JI2 O;  1N32 O;  4DV4 O;  3F5T A;  4DUY O;  2UXB O;  1XMQ O;  1AIL A;  1I94 O;  1G1X B;  1R6T A;  5BY1 A;  3M8A A;  4JYA O;  1D2D A;  2F4V O;  4LF7 O;  5H5N A;  2FKX A;  2AGA A;  3O65 A;  4X62 O;  4DV1 O;  1DK1 A;  1NS1 A;  1YZB A;  2E5L O;  4DR6 O;  3SDL A;  2UXC O;  1J5E O;  2UU9 O;  2VQF O;  4B3S O;  4DV5 O;  4LF4 O;  4LFC O;  4AQY O;  4JI6 O;  4JI7 O;  5IWA O;  4KHP O;  2HHH O;  2VQE O;  4YHH O;  1XNQ O;  1HNW O;  3T1Y O;  2UXD O;  4LF8 O;  2UUA O;  5BXZ A;  4JI5 O;  4DR1 O;  1FYJ A;  4GKK O;  2UUC O;  4A5U B;  4DR4 O;  4DR7 O;  4DV7 O;  1A32 A;  4DR5 O;  4LF5 O;  5LMN O;  1F7Y A;  4X64 O;  5IT9 N;  2N74 A; 
#chains in the Genus database with same CATH topology
 1B3Q A;  4PA9 A;  4IT5 A;  1K34 A;  3HKD B;  4WBN A;  4JYA B;  1IUR A;  5KHH A;  5EBW C;  3KCY A;  1F4M A;  2Z5U A;  2Y4T A;  3GB7 C;  2YXH A;  4DR7 B;  5K1P A;  1PKX A;  3TJT A;  1I5X A;  2ZCE A;  4JTD B;  3UKM A;  5JQG B;  4JV5 O;  4PDV A;  4ZI7 B;  4YY3 B;  3U11 A;  3JD3 A;  2A7W A;  1JOY A;  1NH2 D;  1P84 F;  2QWP B;  1FFX A;  1P4R A;  2Q6A A;  1NT2 B;  1AI7 A;  3R66 A;  1EBO A;  1OCO B;  4RUF A;  3CCM V;  4FLZ A;  1EZJ A;  3JAL B;  4IYI A;  1K73 W;  1FXK A;  3BFR A;  4JTA B;  1R3J C;  1H2N A;  3D36 C;  4O2B B;  3C90 A;  3RVY A;  4BW5 A;  1WNS A;  1I0H A;  2BTO A;  3UT5 A;  2LGW A;  5LHH A;  3P32 A;  4GKJ B;  5BR8 B;  3K9A A;  4BIU A;  2OIG A;  3RBZ A;  2EIK C;  5IYZ B;  2AGA A;  1M93 A;  1XNR B;  1N32 B;  1DK1 A;  1YHQ V;  5JJJ B;  2ZE8 A;  1Q43 A;  2IH1 C;  4DUY B;  2X6B A;  4IIJ A;  3TET A;  2C2A A;  2Y4U A;  3OGC C;  4LWS A;  5B3S B;  3QF7 A;  3AG4 C;  5L3C A;  2LFS A;  1LNQ A;  3FB8 C;  4QE7 A;  1U96 A;  2YEV A;  3UQ8 A;  1QLN A;  4FJC C;  3T1Y O;  4DR6 B;  1NQT A;  2Q8V A;  3GVM A;  4GKK O;  5CBF A;  2WLN A;  1JPX A;  5IWA B;  3RYH A;  4NTX A;  2R70 A;  2HG5 C;  3H1L H;  3HKD A;  1K33 A;  4WFG A;  3CRQ A;  4WCE V;  1ZUQ A;  3ZX6 A;  1VP7 A;  4IHJ B;  3MHS C;  1IBK O;  3E35 A;  1XUQ A;  2XOK G;  1QR8 A;  3P30 A;  4HBN A;  4ZI7 A;  1GAX A;  1K7D A;  2Q9L A;  4MVZ A;  4CH3 A;  1P7G A;  5B1B C;  3K5L A;  1HNZ O;  4CZZ A;  3CCQ V;  4K0K B;  5D5Q A;  4W4L A;  1HR0 B;  1Z2G A;  5C8Y B;  1BMF G;  4I4T B;  3JAR B;  4KL1 A;  3T1C A;  5LL6 Y;  3QG5 A;  4OX9 B;  3UCS C;  4FLT A;  4X89 A;  1ORQ C;  2OTL V;  2UUB O;  2YI9 A;  4CS2 A;  5CN0 A;  2OIE A;  4NTY A;  4O2B A;  3CD6 V;  4DK1 A;  4DV6 B;  3QO5 A;  2W0X A;  2HR3 A;  1IBL B;  1SES A;  1D5A A;  1H2L A;  2E3C A;  3BVO A;  3FB5 C;  4QGP A;  2ITC C;  4TUY B;  2A0L A;  5IJ9 A;  3JAS B;  4FMT A;  2UXN A;  4DV1 O;  2QSA A;  2P4V A;  1TAE A;  4IL6 Z;  3DGE A;  1N0N A;  1J5E O;  4RAI A;  4DV5 O;  2DWE C;  3K9S A;  4HZ3 A;  1OCC C;  2X6C A;  2CE4 A;  4O4L B;  3A0B Z;  3ZMU A;  4J7Z A;  1EM1 A;  2Q7G A;  2VQE O;  5B1O A;  2Q69 A;  1AI6 A;  2BTQ B;  4LF8 O;  1GM7 A;  1AI5 A;  4JI5 O;  4MW3 A;  2R9A A;  5A9G A;  2W0F C;  5JCO C;  2CH7 B;  1SQG A;  2Y0I A;  4JI6 B;  4LC1 A;  4LF5 O;  2EIK B;  4UVA A;  3ETD A;  5AG2 A;  2IJJ A;  3J81 N;  4IHJ A;  3QO7 A;  3OTF A;  1NJI W;  3ZHT A;  4H33 A;  3SR2 C;  3ML0 A;  1FXV A;  4LF6 O;  3AG4 B;  2QM8 A;  4MVU A;  4GX0 A;  4UVB A;  4HNA A;  1Y6X A;  3JAK B;  2HVJ C;  2YIB D;  4DRX B;  2ZE7 A;  2Y0P A;  3ASO C;  4JI1 O;  3J80 N;  1K3E A;  3SYC A;  3CXH F;  3T1H O;  3SJB C;  3MD0 A;  5IYD O;  2ZM6 B;  3CB2 A;  5KX5 A;  1L1F A;  3JAR A;  5LMU O;  1V55 C;  3CCU V;  2R9R B;  1GK9 A;  2IU0 A;  1NTK H;  3STZ C;  4XDK A;  4MSW C;  3ABK C;  3RYC B;  2JRI A;  4KXR A;  5K1X A;  4CC5 A;  2BSK B;  4OGQ B;  4EKW A;  5KAI Z;  4TUY A;  5C93 A;  3ZMS A;  4GZR B;  5B1B B;  1M56 C;  4JV5 B;  4UUJ C;  3WB2 A;  4U7O A;  4DXW A;  2P5O A;  3OUF A;  4G28 B;  1K92 A;  3B40 A;  1YZB A;  3F7V C;  5DED A;  2UU9 O;  5BMV A;  1R3I C;  4YJ2 B;  2KG7 B;  1AI4 A;  2GTS A;  2PGG A;  1K4C C;  4FIP C;  1OJH A;  3CYO A;  3I5D A;  1TVK B;  4KP4 A;  5FPO A;  4N23 A;  3RYI A;  2BTQ A;  3EFF K;  2GUZ B;  1XHZ A;  1VQ6 V;  4JAV A;  2CH7 A;  3CCS V;  2WLH A;  1QVG U;  3B2E E;  2OTJ V;  4LFC B;  4DR7 O;  1Q5O A;  1FPO A;  4TSF G;  1SA0 B;  1S5L Z;  1Q3E A;  3ZRV A;  3AG3 C;  1FXH A;  3THO A;  5CA3 A;  4YY3 O;  4K8Z A;  4CC6 A;  1Y76 B;  3ZBH A;  5LBQ A;  4TQF A;  5CBG A;  3TCU A;  2QTS A;  4PI0 A;  3JAK A;  4CH5 A;  4UFZ A;  1SS3 A;  1IX9 A;  3R65 A;  4D6T H;  4GYC B;  4I7Z B;  3O9O A;  4LFA B;  2B1G A;  3K3W A;  4CS4 A;  1CP9 A;  2XAG A;  5KMG B;  3J7A U;  3E8F A;  5H2F Z;  1Q6U A;  4GKJ O;  4DV0 B;  4X66 B;  1BL8 A;  4TT3 G;  1E79 G;  4PI2 A;  2FTK A;  3OD4 A;  4JYC A;  2KB1 A;  2OCH A;  3H1H H;  2YIB A;  2BSK A;  3APQ A;  1BSM A;  1M4U A;  1R6N A;  5L3D A;  4TV9 B;  3BEH A;  3LDD A;  4NYK A;  1N32 O;  5IYC O;  2Z3Y A;  1Y4M A;  4DUY O;  1BGY H;  1WPB A;  4X9Q A;  1HW7 A;  3ASO B;  3SYO A;  3RFR A;  5IE9 A;  4ABM A;  5H5N A;  5CA1 A;  1JQ0 A;  3K06 A;  2ZE5 A;  3STL C;  3VBB A;  4DR6 O;  3HB3 B;  4DV4 B;  4YIP A;  4YJ2 A;  2KG7 A;  1ZLZ A;  4P9P A;  3OE7 G;  3SPG A;  1JX9 A;  2DQ3 A;  1LR1 A;  1V55 B;  1TVK A;  2QJ1 A;  2AHZ A;  2WSS G;  2IJH A;  5IWA O;  5L3G A;  3ABK B;  4ZKI A;  3C3T A;  2HVK C;  4X62 B;  3H01 A;  1KD1 W;  1I5Y A;  1Z5V A;  4FPP A;  4A5U B;  3HR0 A;  4BR6 A;  1MMM A;  2LJ2 A;  1M56 B;  2XTA A;  4FLV A;  1HNW B;  1D2D A;  4K35 A;  2MW2 B;  4J42 A;  1MG1 A;  1JJO A;  2QEX V;  3BCC H;  4K0K O;  2K9P A;  3CCR V;  2XHB A;  1HR0 O;  4OPH A;  5CB4 A;  4OX9 O;  2QKA A;  2NN4 A;  3SPH A;  4UCU A;  1NI8 A;  2F93 B;  5KMG A;  2V7Q G;  3MDS A;  5JCO A;  3A8T A;  4DV6 O;  1FKA O;  4J11 A;  3OGI B;  4WBN B;  2GBO A;  3HKE B;  2JGU A;  1ROP A;  1XMO O;  1IBL O;  4EFB A;  4DR2 B;  3OEE G;  1DF5 A;  2WPD G;  3AG3 B;  3M99 B;  4B7E A;  3WG7 C;  3D3I A;  3FB7 C;  4TV9 A;  2DN9 A;  1FJG O;  1N33 B;  2CDY A;  3FD9 A;  3K58 A;  2P6J A;  3B8M A;  3OM3 B;  1GKF A;  4EFE A;  2F43 G;  1WPX A;  1PNL A;  1R6T A;  3CCE V;  3N2K B;  2YUA A;  4L8J A;  3SPJ A;  4P30 A;  1XQ8 A;  1GH6 A;  3FFQ A;  1YI2 V;  4FZ1 A;  2OWO A;  5L3B A;  2WLM A;  2Q67 A;  3H9V A;  4QIW F;  2QWR B;  1F51 A;  4JI6 O;  2OCC C;  3QNE A;  5LMU B;  1WLE A;  4KUM A;  1W2B U;  1SC5 B;  3G67 A;  1WB8 A;  5L3E A;  3PN1 A;  3JYC A;  1TUB B;  4H0L B;  2Q7H A;  3OMA B;  3LSQ A;  2IU3 A;  1JA8 A;  3K5M A;  4IIJ B;  3IC7 A;  2EZP A;  1BZK A;  4PA3 A;  1AB3 A;  2F66 C;  1YJN V;  2PY5 A;  4I9W A;  2HFE C;  2ZM6 O;  1W0J G;  1IZ3 A;  2HJD A;  2PF4 E;  2QDO A;  4L87 A;  2N04 A;  3LNM B;  3L74 H;  3RYH B;  3M7M X;  4MT8 A;  1HP8 A;  1UPG A;  3E22 B;  3HKE A;  2Q0O C;  2VS0 A;  1G4Y B;  5E79 Z;  3CCV V;  3S3X A;  1IBM B;  1R1B A;  1RSO B;  4HAM A;  5CBH A;  2RMK B;  2JGD A;  4FM0 A;  3ZN1 A;  4FLU A;  3ZHV A;  1QU7 A;  4O4I B;  3ETG A;  4D7T A;  4QJF B;  4FLW A;  4O2A B;  1Y74 B;  4DO2 A;  1MNG A;  1W0K G;  1YCI A;  3LDC A;  3N2K A;  1P7B A;  2A9H A;  4B3T B;  3GWO A;  4J7J A;  4JYB A;  3UO2 A;  1M5I A;  4X1Y A;  3G71 V;  2YXY A;  4JTC B;  1D5N A;  4X8A A;  5KA6 A;  3CRM A;  1ZX3 A;  5JJN B;  4WFB V;  4OXS A;  4NKG B;  3RGB A;  4PA4 A;  1KP2 A;  3E86 A;  2EX3 A;  4LFC O;  2F23 A;  3ZRX A;  2Y48 A;  1N4C A;  2B1I A;  2R72 A;  3LNN A;  3Q4H A;  4YJ3 A;  3D8C A;  2QM4 A;  3BPZ A;  3WG7 B;  5FNV A;  3K59 A;  1NH2 B;  4JF3 A;  2WLJ A;  3FAV A;  5IY5 C;  3VQX A;  3CC7 V;  1VQL V;  4MTF A;  3CCL V;  1TUB A;  4DW0 A;  5IJ9 B;  3K0D A;  1K4D C;  2YI8 A;  2YS8 A;  5GTH Z;  2HHH B;  2IM9 A;  3ZED A;  1MOF A;  3T4D A;  1FFT B;  1BQ0 A;  1JJ2 U;  3G6B A;  2LW7 A;  5J9P C;  3E2E A;  3CS5 A;  4LFA O;  3E8B A;  1Z5W A;  1JMK C;  3BAB A;  2R9I A;  2GDS A;  1DLB A;  2OCC B;  4QPK A;  4WFF A;  2Q4P A;  1YXB A;  2VWK A;  4O4H A;  4DV0 O;  4X66 O;  2YC0 A;  5GTI Z;  1MAB G;  1PPJ H;  5LA6 B;  3E22 A;  5ITZ B;  2FYU H;  1RSO A;  2XAF A;  3CRR A;  4E4E A;  1YTF D;  2P67 A;  4MTX A;  1PM9 A;  1MZE A;  1JFF A;  1N34 B;  2LQT A;  2WAM A;  4J7K A;  1KMI Z;  4HNA B;  4O4I A;  5IJ0 A;  1SQB H;  2FL4 A;  4I5S A;  4O2A A;  4UVC A;  1Y74 A;  5LYJ B;  3A0R A;  3JSN A;  4DV4 O;  5L3F A;  2ZNI A;  1GM9 A;  2P06 A;  2DQ0 A;  1E1Q G;  2Q73 A;  2E75 B;  2NNU A;  2XUM A;  5KHI A;  5KX5 B;  2QWN B;  3ZHS A;  3LUT B;  3K79 A;  1AP6 A;  2JJ2 G;  2CTQ A;  1K97 A;  5B5E Z;  4AHC A;  4X62 O;  1N36 B;  1YTF B;  1XHX A;  2UXC O;  1QQC A;  3ZRW B;  4H13 B;  3FYE B;  1XMQ B;  2L6L A;  1Q82 W;  2OT5 A;  1FAF A;  4J9Y B;  2QWQ B;  5J2T B;  1EN5 A;  2EIJ C;  3W7X A;  1Q90 D;  1XMO B;  1NBM G;  2IBZ H;  4JGS A;  1HNW O;  4K8X A;  2YSU B;  1QLE C;  1FJG B;  2X6A A;  2PUS A;  2ZXW C;  1PL0 A;  1SQV H;  1G6U A;  1F23 A;  1S77 D;  3TXQ A;  5KA5 A;  1F7Y A;  1XNQ B;  4UCO A;  5BMV B;  3T2M A;  4U7N A;  1GM8 A;  3OMN B;  1VIB A;  4DR4 B;  3RYI B;  2ZIM A;  4WF9 V;  5E1A C;  1HNX O;  4CS3 A;  3ETE A;  1HWY A;  2AZ2 A;  5KHG A;  4Z1M G;  4DV3 B;  1W59 A;  3VQY A;  5LA6 A;  4UXN A;  4DR2 O;  3ZJZ A;  2JEX A;  3SGI A;  5IY5 B;  2B5U A;  1XIL A;  5ITZ A;  4LH6 A;  1AP5 A;  5IDJ A;  1N33 O;  4RO2 A;  2X7R B;  2G38 A;  1NTM H;  2CK3 G;  4X88 A;  1RPO A;  1EN6 A;  1IXM A;  1PP9 H;  2Q7E A;  1COW G;  3EHB B;  3ICX A;  1OHH G;  1XEQ A;  2AW9 A;  1PD3 A;  3U0Z A;  3G6E V;  3CHX A;  5LYJ A;  3OTO B;  2RNB A;  1O9H A;  4CH6 A;  3B77 A;  3ZHU A;  3CME V;  1JVM A;  1CPY A;  2BOB C;  4P9O A;  4X1I B;  5LHG A;  2N05 A;  3HKC A;  3ZRW A;  3AG7 A;  3L70 H;  4CBC A;  3TK1 A;  3WFV A;  5CA0 A;  5J2T A;  3OR6 C;  1L8D A;  1U97 A;  2W6I G;  1QCE A;  1UFI A;  2ZD9 A;  5JWP A;  2ARH A;  4BWA A;  3N27 A;  5EIB C;  3CPW U;  3HKB A;  2EIM C;  5EBL C;  5CA1 B;  3DC5 A;  1TUE B;  1S5H C;  3ZHR A;  3BY6 A;  1OCZ C;  2QM7 A;  4O4J B;  1GMG A;  4U3F H;  5KUM A;  2F1M A;  4AI8 A;  4F6R B;  3OEH G;  2H8P C;  1WB7 A;  1VQ9 V;  5LOV B;  1Y66 A;  4B7K A;  1YVW A;  4PA6 A;  1TGO A;  1B06 A;  2HEP A;  2EIJ B;  3EVK A;  5EBM C;  2YIA A;  2KQX A;  1IBM O;  1R6K A;  3G4S V;  4FM2 A;  1H2G A;  4BW9 A;  1JCH A;  1QLE B;  1MSW D;  2WWW A;  4PV1 B;  3H1K H;  2ZXW B;  4PHZ A;  1KUQ A;  3H1I H;  2LP7 A;  1VMG A;  3PJS K;  4GUN A;  1PV0 A;  2E76 B;  1Q6I A;  4B3R B;  1SQQ H;  4B3M B;  3H1J H;  4B3T O;  5FL7 G;  3JAW B;  4JAS A;  1UJW B;  1NZ6 A;  5CB4 B;  4H37 A;  4LF9 B;  3KKY A;  4LCU C;  2XAJ A;  3ASN C;  1WJZ A;  3A0H Z;  3L71 H;  4X1I A;  4B08 A;  1BHA A;  3SJA C;  4PA7 A;  4X65 B;  3ABL C;  2FKX A;  3O65 A;  2ADP A;  2GSM B;  3QTC A;  4ZHQ B;  1L0L H;  1AVM A;  1NS1 A;  2P22 C;  2Q0A A;  3X2Q C;  3OAA G;  1I94 B;  2K1E A;  3JCU Z;  2HLD G;  1I08 A;  2HHH O;  4XDL A;  1M90 W;  1XL4 A;  3LSS A;  2JK5 C;  4GCZ A;  5GON B;  2UUA O;  2QWO B;  2ZR3 A;  1V9P A;  3CE2 A;  1FYJ A;  4K3A A;  4UCV A;  1KC8 W;  2ATK C;  4BIZ A;  5EIB D;  3RW0 A;  2QKS A;  1P49 A;  4O4J A;  5LXT B;  1YF2 A;  1SRY A;  3APO A;  5IYB O;  4ZOL B;  3NR7 A;  4F6R A;  1VEW A;  2ZNJ A;  1XDC A;  3AG1 C;  5LOV A;  3OFN G;  3ZCC A;  2UXC B;  2ZE6 A;  3W7T A;  1LUV A;  3N2G A;  2PYJ A;  3ETQ A;  4ZBM A;  1K5Q A;  3OW2 U;  4DR3 O;  1AR1 B;  1N34 O;  2EIM B;  4ICG A;  4MVQ A;  4DV2 B;  3JSL A;  1ARO P;  4ZIB A;  4NXN B;  3IGA C;  2P90 A;  1OCZ B;  2QA4 V;  2BOC C;  4DYL A;  2GHY A;  5LP6 C;  3WB1 A;  3JAW A;  1H2M A;  2RQ6 A;  3RYF B;  2RJZ A;  2CTP A;  2BE3 A;  4QPJ A;  4KFM A;  2WLK A;  4JAA A;  1QNM A;  4OPA A;  1N36 O;  4QE9 A;  3OMI B;  1XMQ O;  4LH7 A;  1HNX B;  1B6Q A;  2CAZ C;  2EUL A;  1GN3 A;  5B1N A;  4ZHQ A;  1NTZ H;  3AK3 A;  1BT8 A;  5BZB A;  2A3Q A;  1EZV H;  2JGD B;  4FLY A;  1MZF A;  2UXB B;  3SPC A;  4RUE A;  2F4V B;  4JZG A;  4LF7 B;  3CRA A;  5GON A;  4X20 B;  5EZY A;  3E8H A;  3MHH C;  2LFR A;  2DMX A;  1XNQ O;  5DEC A;  5BXZ A;  2CGO A;  2F95 B;  2O57 A;  4FFB A;  4DR4 O;  1DTO A;  4R8C A;  4X1Y B;  3ASN B;  4KHP B;  5LXT A;  5FPR A;  1GN6 A;  4X64 O;  4ZOL A;  4YHH B;  3ABL B;  2UXD B;  1OV9 A;  1Q81 W;  4DV3 O;  2CUG A;  3K08 A;  1MA1 A;  2GTA A;  3X2Q B;  3Q4H B;  2HP8 A;  4YJ3 B;  3W7S A;  4FLX A;  4YXW G;  4ASU G;  4DV7 B;  3E8G A;  5FNV B;  1YIJ V;  1H2S B;  3FAV B;  2YID A;  3QVN A;  1KU9 A;  4R7C A;  2JEU A;  3SYQ A;  3W7W A;  3BAA A;  1VQM V;  5EK0 A;  3OTO O;  4RWU A;  2EJ7 A;  3MAQ A;  5JJE B;  1R73 A;  4LR3 A;  3JAT A;  2ZDI C;  3FX7 A;  3RYF A;  1KQS U;  3RT3 C;  3AG1 B;  4JYY A;  5H9C A;  4RQE A;  1BCC H;  4GX5 A;  4MW8 A;  4MTO A;  2JVD A;  4O4H B;  4UB8 Z;  2A79 B;  3OUS A;  3U10 A;  1KKC A;  3M8A A;  4WFE A;  3FB6 C;  5J2U B;  3E89 A;  2JS5 A;  1THZ A;  5KUK A;  4JI2 B;  2JIZ G;  4E2L A;  1JFF B;  5HFM A;  4MVM A;  2EJR A;  5LP6 B;  4X20 A;  5IJ0 B;  5LGU A;  1I7F A;  1SQF A;  2E5L B;  4TQD A;  1AR4 A;  4DR1 O;  1F4N A;  4I50 B;  4LF4 B;  1YIT V;  2FML A;  4AIL C;  1IVS A;  4NB5 A;  2JDI G;  1M9N A;  4X1K B;  4MVS A;  4I55 A;  1NR1 A;  3DSQ A;  3P3P A;  4Z1V A;  1H8H G;  4XDJ A;  3B8N A;  3CJH B;  1KYO F;  1VQO V;  2EIL C;  2UUC B;  3JD2 A;  4PJ0 Z;  2AXT Z;  2IJK A;  4GX1 A;  1GTO A;  4J41 A;  3CMA V;  3AEI A;  1CEZ A;  1SZT A;  1BHB A;  4B3R O;  4LFB B;  3UO3 A;  1QHT A;  1TA8 A;  2ETN A;  3B09 A;  4B3M O;  4JI4 B;  3DC6 A;  2UUA B;  2Y69 C;  1Q86 W;  1ENV A;  2DYS C;  2PI5 A;  5FLX N;  5H6R A;  4LF9 O;  1WA8 B;  4NXM B;  2VWJ A;  1KP3 A;  1CXZ B;  4DW1 A;  4JI0 B;  3NXS A;  3I55 V;  2KSD A;  4FFK A;  1X59 A;  3IJ4 A;  1S3J A;  4X65 O;  1ZTE A;  1SKV A;  1X4T A;  2DYR C;  3K57 A;  1I94 O;  4GX2 A;  4JI8 B;  5J2U A;  5BY1 A;  3BA8 A;  2OYQ A;  2CTR A;  3ZIA G;  4DR3 B;  2RCV A;  2QE7 G;  3SDL A;  3K5O A;  3JD1 A;  3LDE A;  3ZS8 C;  5LP6 A;  2LW1 A;  2M6Y A;  1G8M A;  1VQ7 V;  1XL6 A;  3ZMZ A;  4I50 A;  3ABM C;  5KLV H;  4UV8 A;  2XAQ A;  2VQF B;  4B3S B;  1US6 A;  5JQG A;  1VF6 C;  2Q5Z A;  4AQY B;  3CWB H;  3HKC B;  4X1K A;  4EEQ A;  1K8A W;  1M57 C;  1NR7 A;  3C3S A;  5KHK A;  4LNU B;  3BA9 A;  5CA0 B;  3CJH A;  2XT9 A;  1RPR A;  2Z0A A;  2B9Z A;  2KKW A;  3JD0 A;  3L75 H;  1PL4 A;  1Q7Y W;  3CC4 V;  3OR7 C;  4DV2 O;  3JAL A;  4DR5 B;  1JR9 A;  5DN6 G;  3BHP A;  3F7Y C;  3FKS G;  1S76 D;  3HKB B;  4NXN O;  4PD4 F;  1Q6H A;  2XAS A;  3AK1 A;  1SQP H;  4J10 A;  3SYP A;  1YJW V;  1SET A;  4MTG A;  2EZO A;  4GT1 A;  5IYZ A;  1ZL8 B;  1WA8 A;  2LGQ A;  2DOS A;  2XND G;  1VF7 A;  5F2V O;  4DUZ B;  1IXB A;  1URF A;  1XRE A;  4RQF A;  1AJN A;  1H38 A;  3IAY A;  1QVF U;  4J9Z B;  4X64 B;  3KZI Z;  4NR1 A;  2EIL B;  3RWR D;  1IDS A;  4FM1 A;  1M1K W;  4U3J B;  4XBF A;  2UXB O;  5KAF Z;  1DGS A;  1G1X B;  2F4V O;  4LF7 O;  4J80 A;  3VOU A;  4JI3 B;  2Y69 B;  3E83 A;  2EIN C;  2DYS B;  2QTO A;  1B04 A;  2YIC A;  4LBE C;  4TV8 B;  1S5J A;  2ZDI A;  3ABT A;  1XBL A;  4KHP O;  3RVZ A;  4YIO A;  4JPR A;  4YHH O;  2UXD O;  3GWK C;  2ILM A;  4PDL A;  3K5N A;  2DYR B;  2CTW A;  2ADQ B;  3AK2 A;  4EB6 B;  3P3N A;  3W7U A;  1VAR A;  4DV7 O;  4JI7 B;  1A32 A;  1RP3 B;  3FYI B;  4LNU A;  1T5E A;  3I56 V;  3F5W C;  3T4Z A;  2MK3 A;  5LGN A;  5C8Y A;  4I4T A;  2D2C B;  1VQ4 V;  4GLX A;  3B4S A;  3IC9 A;  4Q6G A;  3CC2 V;  4P2Z A;  4BAY A;  5LMN B;  3ZMT A;  1KB9 F;  4DK0 A;  1Y67 A;  1NVP D;  5HFL A;  2GV9 A;  3ABM B;  3RN4 A;  2DWD C;  4BIO A;  2YDE A;  1GO3 F;  1ZL8 A;  2ITD C;  4DR1 B;  2ZKO A;  1OCR C;  1V54 C;  3SPI A;  3L9D A;  3JAS A;  1M57 B;  4TWK A;  4PDM A;  1MSD A;  3AG2 C;  3BRC A;  2WLL B;  2EBO A;  3K04 A;  3ZMV A;  2HKO A;  2V4D A;  3JCZ A;  3N2G B;  1YDX A;  2H3O A;  4O4L A;  3D3Q A;  3CXC U;  1NVP B;  4JI2 O;  1VF5 B;  4U3J A;  1XI1 A;  4MS2 A;  3D36 A;  2UXX A;  1R3K C;  4JYA O;  5H6Q A;  4F4L A;  1PNM A;  2P4K A;  1GN4 A;  2Q68 A;  3OT7 A;  1OZ0 A;  2IH3 C;  1RM1 C;  4G2K A;  2E5L O;  1ZSP A;  2HJF C;  3WB0 A;  4TV8 A;  3QO8 A;  4FZ0 A;  1SQX H;  4Z2W A;  4R50 A;  3K03 A;  4UCT A;  4LF4 O;  4N21 A;  3CCJ V;  1NKD A;  4EB6 A;  1OCC B;  3CSX A;  2IJI A;  1SZX A;  2UUC O;  1SER A;  2LO1 A;  4DRX A;  1BQZ A;  1Q8I A;  1S0V A;  3A2F A;  3T1Y B;  2ZIN A;  4HYO A;  2FB5 A;  1VQ5 V;  5B66 Z;  4UV9 A;  2EIN B;  3G80 A;  2AZ0 A;  4GKK B;  4D7S A;  4JZ2 A;  4LFB O;  1FXK C;  1O9G A;  4JI4 O;  5EZY B;  5BR8 O;  1VQ8 V;  3RYC A;  1QBZ A;  4UCS A;  4NXM O;  5B1A C;  2JJ1 G;  3L72 H;  4FFB B;  3SJQ C;  3JAM N;  1XNR O;  4JI0 O;  3S3W A;  3CP1 A;  3TGU H;  1S72 V;  5EC1 C;  1VF6 A;  5JH7 B;  1IBK B;  2VRZ A;  1GN2 A;  2PZS A;  2DE0 X;  2NR5 A;  1EN4 A;  3L73 H;  2WLL A;  4R6Z A;  1HDJ A;  5DM6 V;  2BCC H;  4JI8 O;  1LUW A;  1HNZ B;  1VQN V;  2QKC A;  3VQV A;  1WAZ A;  2PYL A;  5A2Q N;  2QGN A;  3SYA A;  4TOI A;  1WN7 A;  3F5T A;  1N8R W;  5EYP B;  2GUZ A;  2D3O W;  4PDR A;  2UUB B;  3CRC A;  2ODM A;  5KHJ A;  1J95 A;  1BS3 A;  1SA0 A;  3DXR B;  3CEI A;  3JAT B;  3SJC C;  2WA3 A;  4C7U A;  1FS0 G;  1OCR B;  1V54 B;  1ZAU A;  4W4K A;  2VQF O;  4B3S O;  2WA4 A;  1FD9 A;  1VQK V;  1EFR G;  4AQY O;  3AG2 B;  4FK5 C;  4JAU A;  3K0G A;  5JVD B;  1Y76 A;  4I9Q A;  2P7T C;  4UCR A;  5LGT A;  2DW4 A;  3KCX A;  2L35 A;  4MVO A;  4F6E A;  4DV1 B;  2M7W A;  2PTM A;  2W6J G;  1J5E B;  2WLI B;  4IYH A;  4DV5 B;  1BE3 H;  1KBH A;  3EXA A;  4DR5 O;  4G27 B;  2VQE B;  1DF4 A;  2ZIO A;  2RDC A;  4I0X B;  1OCO C;  4LF8 B;  4JI5 B;  1AR5 A;  1RM1 B;  2AHY A;  2ZT9 B;  4LF5 B;  2JS3 A;  1SF9 A;  1XOU A;  3DTU B;  1KKD A;  1E1R G;  4DUZ O;  4Q20 A;  1WP7 A;  1AJQ A;  2A06 H;  5JH7 A;  1GRJ A;  1QR9 A;  2YXL A;  1YSC A;  3HPL C;  4LF6 B;  4I55 B;  1L0N H;  3UM7 A;  3TXS A;  4CH4 A;  4NVP A;  1FFX B;  2DJV A;  5B3S C;  1YJ9 V;  4JI1 B;  2E74 B;  1R3L C;  2PI4 A;  3T1H B;  1AJP A;  1NU1 H;  1N0J A;  1K5S A;  4IGG A;  4WFH A;  1FXK B;  5GW7 A;  4MVR A;  5LHI A;  4JI3 O;  5EYP A;  5EC2 C;  1H8E G;  2X0L A;  4UB6 Z;  3WU2 Z;  1AIL A;  2V1D A;  3ABU A;  3UT5 B;  3ZN0 A;  3KG2 A;  5B1A B;  1RFY A;  3VQW A;  4WFA V;  3CX5 F;  3DXR A;  4H44 B;  2QR4 A;  4LP8 A;  2ZQM A;  2H94 A;  1YEW A;  1PNK A;  2RN9 A;  4PEL A;  5JVD A;  1K9M W;  4LWS B;  2ZR2 A;  5CMU A;  1ZWI C;  4JI7 O;  4QNH B;  3IFX A;  2IW5 A;  5TIS Z;  2NLJ C;  2XAH A;  2YEV B;  3LSU A;  1WP8 A;  2WLI A;  2UU9 B;  3ZHQ A;  3ZRS A;  1VQP V;  1H2K A;  2CGN A;  4FVM A;  1KEC A;  4NTW A;  4I0X A;  5D5P A;  5LMN O;  3JD4 A;  5IT9 N;  2N74 A; 
#chains in the Genus database with same CATH homology
 2LW7 A;  2Z0A A;  3J81 N;  4DV3 O;  4YY3 O;  4LFA O;  1AB3 A;  4LFB O;  4JI4 O;  1IBK O;  4LF6 O;  4DV2 O;  2ZM6 O;  5BR8 O;  4K0K O;  1HNX O;  1HR0 O;  4NXN O;  4OPH A;  4DUZ O;  4NXM O;  4JV5 O;  4JI1 O;  3J80 N;  1IBM O;  3JAM N;  4OX9 O;  4DR3 O;  4DV0 O;  4JI0 O;  4DR2 O;  4X66 O;  1XNR O;  4B3R O;  3T1H O;  1N34 O;  4B3M O;  1HNZ O;  3J7A U;  1N33 O;  4DV6 O;  1FKA O;  2ZKO A;  3OTO O;  5FLX N;  1KUQ A;  4LF9 O;  2DOS A;  2DJV A;  5LMU O;  3R66 A;  5LL6 Y;  1XMO O;  1IBL O;  1R1B A;  4GKJ O;  1XEQ A;  2UUB O;  3RT3 C;  4JI8 O;  4B3T O;  1X59 A;  4X65 O;  1FJG O;  2JRI A;  5A2Q N;  4JI3 O;  4OPA A;  1N36 O;  4JI2 O;  1N32 O;  4DV4 O;  3F5T A;  4DUY O;  2UXB O;  1XMQ O;  1AIL A;  1I94 O;  1G1X B;  1R6T A;  5BY1 A;  3M8A A;  4JYA O;  1D2D A;  2F4V O;  4LF7 O;  5H5N A;  2FKX A;  2AGA A;  3O65 A;  4X62 O;  4DV1 O;  1DK1 A;  1NS1 A;  1YZB A;  2E5L O;  4DR6 O;  3SDL A;  2UXC O;  1J5E O;  2UU9 O;  2VQF O;  4B3S O;  4DV5 O;  4LF4 O;  4LFC O;  4AQY O;  4JI6 O;  4JI7 O;  5IWA O;  4KHP O;  2HHH O;  2VQE O;  4YHH O;  1XNQ O;  1HNW O;  3T1Y O;  2UXD O;  4LF8 O;  2UUA O;  5BXZ A;  4JI5 O;  4DR1 O;  1FYJ A;  4GKK O;  2UUC O;  4A5U B;  4DR4 O;  4DR7 O;  4DV7 O;  1A32 A;  4DR5 O;  4LF5 O;  5LMN O;  1F7Y A;  4X64 O;  5IT9 N;  2N74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...