4NXNO

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4nxnO00
4B3SO 1XNRO 1XEQA 2UUCO 4JI2O 1I94O 4JYAO 4JI7O 1XMOO 2Z0AA 1G1XB 4JI0O 1IBMO 5IT9N 4X66O 5LMUO 2UXDO 4JI6O 1R6TA 4GKJO 2E5LO 4DR4O 2FKXA 3M8AA 1AILA 4LF9O 4GKKO 4JI3O 4X64O 4LFCO 1HR0O 1AB3A 1A32A 4DR7O 4LF8O 3OTOO 4A5UB 2F4VO 4DV7O 4X62O 4B3MO 4DR1O 1N33O 1KUQA 4NXMO 3O65A 4LF7O 4JV5O 1NS1A 3T1HO 2AGAA 1HNXO 4LF5O 5H5NA 4DV1O 4LF4O 1HNWO 2DJVA 2UU9O 4K0KO 3JAMN 2VQFO 2LW7A 1D2DA 1XNQO 4JI5O 4DV6O 3RT3C 4B3RO 4OPAA 4DR6O 4OPHA 2N74A 4AQYO 5FLXN 4YY3O 1XMQO 1IBLO 2UUBO 4JI8O 1N32O 4DR5O 1N36O 3J80N 1J5EO 1F7YA 4KHPO 1YZBA 4LF6O 4LFAO 5IWAO 5BR8O 5A2QN 3J81N 4DUYO 3F5TA 3SDLA 4B3TO 5LL6Y 1DK1A 3R66A 4DV0O 5BXZA 4LFBO 2UXCO 4DV4O 4DUZO 1FJGO 4NXNO 4X65O 4OX9O 1X59A 2ZKOA 2VQEO 2ZM6O 1HNZO 3J7AU 2DOSA 1FKAO 4YHHO 1FYJA 1N34O 4DV5O 2UUAO 4DR3O 4DR2O 4DV3O 2HHHO 2JRIA 4DV2O 1R1BA 1IBKO 5BY1A 4JI4O 2UXBO 5LMNO 3T1YO 4JI1O
chains in the Genus database with same CATH superfamily
5JQGB 4JASA 3WG7B 1ZL8B 4GX5A 2EIJB 4MVMA 4X1YB 5FNVA 1N32B 2WLLB 2BOCC 4GKJO 4PHZA 1VQNV 2EIMC 3OTOB 1MA1A 4LWSB 1P49A 4NYKA 1S3JA 4XDLA 1FPOA 1OHHG 5GTHZ 1V9PA 3K9AA 4B08A 3ZHQA 5CA0A 4I50B 1NI8A 1IBMB 1PM9A 3ML0A 3SPJA 2NN4A 3W7SA 1HP8A 5KA6A 4K0KO 3W7TA 1KP2A 3LDEA 5IY5C 1VP7A 1NVPD 5L3GA 1ZUQA 2Q5ZA 4IT5A 4K8ZA 4YJ2B 3G71V 2YEVA 4CC6A 3SYPA 1GRJA 1L0LH 2JS3A 4FM0A 2N74A 5EIBC 4OX9B 5CBGA 3SYOA 4DR5O 3OW2U 1SQFA 2OWOA 4IGGA 1NJIW 5B1BC 3P32A 1Y6XA 4IYHA 3W7XA 5DN6G 3FFQA 4WBNA 4LF9B 4JTCB 2CH7A 3ABTA 2ADPA 1XUQA 3WB2A 2PTMA 1S5JA 3JAWB 4DR3O 3I5DA 2OCCC 3CRMA 3C90A 3GVMA 5F2VO 4KL1A 2F66C 1IBKB 1WP7A 2WA3A 3EVKA 3JASA 2GDSA 3FB8C 4EB6B 3AG1B 3AG2B 5JH7B 2IH1C 1U97A 3Q4HB 4YY3B 2QKAA 1L0NH 1H2GA 2Q9LA 1AI5A 2YI9A 1AB3A 1A32A 3ABKC 1RP3B 4ZHQB 1XI1A 4LF7O 1ZSPA 2XAJA 4MVRA 1XBLA 2MW2B 4JI7B 1OCRB 3CXHF 5BMVB 1ZL8A 1GM9A 5B1BB 4K35A 1YJ9V 4BIOA 2LFRA 3CC4V 1QCEA 1FXKA 2P67A 3B8MA 4PELA 5LA6B 1ZWIC 4I7ZB 4KFMA 2DQ0A 1HNWB 3OD4A 4MS2A 4LF5B 2Q0AA 3CX5F 1Q6HA 1K5SA 2QWQB 5LGUA 1LUWA 3GWOA 1KB9F 1BZKA 3K9SA 2CK3G 2V7QG 4FFKA 4IHJA 5KMGB 1WJZA 1Q6IA 1FJGO 1Y74A 1AI4A 1XHZA 2NLJC 2UUBB 5KUMA 2ITDC 5J2TA 3T2MA 5EBWC 3K3WA 2CTQA 4UV9A 4G2KA 5JWPA 4NXMB 3APQA 3B09A 3W7UA 2HHHO 3E89A 3ETQA 1BCCH 5KX5A 1O9GA 1RSOB 1MABG 3L75H 1OCCB 4FM1A 1G4YB 5EIBD 1U96A 1M57B 3CD6V 1B06A 5IWAB 1XMOO 1G1XB 3KCXA 4TQDA 2UXDO 2W6IG 1XQ8A 2E5LO 2PUSA 3E8FA 3E8HA 1JQ0A 1V55C 2YC0A 1MNGA 1BSMA 3HR0A 1Y76B 4RUFA 3K58A 4WFFA 4DV7O 4DV1B 4X62O 4DR1O 1WA8B 3CP1A 4NXMO 1HDJA 1TGOA 3CSXA 1ENVA 1Q7YW 1FAFA 1FFXB 1HNXB 4JI0B 1GN4A 1WAZA 1HWYA 1SA0B 2DJVA 5CB4A 1VQOV 4B3RB 3L72H 4YJ3B 2YXHA 5DM6V 5K1XA 3BY6A 4GT1A 1JJ2U 2DWDC 4DV6O 5B1NA 2AZ0A 4UB6Z 5LXTA 3OAAG 4LF6B 2YXYA 4GZRB 3UT5A 2DE0X 3A0RA 3AG4B 5B3SC 2DYSC 2Y69C 1IZ3A 1WLEA 4RWUA 3HKBB 3BA9A 3WFVA 2P06A 4FLZA 4Q6GA 4YIPA 4I4TB 4DUYO 3TETA 3P30A 1Y76A 2VS0A 1EZVH 1IX9A 4JF3A 1OCZC 2L35A 2LW1A 5JVDA 1MSDA 3B8NA 3UKMA 3B4SA 5H2FZ 4O4HA 3E83A 5C8YB 3ABLC 5K1PA 2CUGA 1V55B 4UCTA 4NKGB 3STZC 3B2EE 4F6RA 3CCVV 1TVKA 3S3XA 4I55B 3RFRA 4BWAA 1AROP 3LSQA 5LMNO 3JAKA 4X20B 2RQ6A 3ASOB 2P6JA 4DR2B 1QR9A 5LYJA 2GV9A 4GKJB 4JI0O 1VQ4V 1AP6A 3HKCA 2ADQB 1QLEC 3HKEB 4JI8B 3OMNB 4JI6O 1V54C 3A0BZ 2JVDA 1I94B 3KZIZ 1VQ7V 3GB7C 2YSUB 3JSLA 4GKKO 1H8EG 2R9AA 3ZIAG 3ETDA 4DV2B 4FLUA 2YIBD 1N33O 4JV5O 3E22B 5LBQA 2GUZA 3T1HO 1YJWV 2N04A 1I7FA 5IJ0B 3IGAC 3K5MA 1FFXA 1IBLB 1P84F 1PL0A 3MDSA 5EBMC 3TJTA 1K3EA 2ITCC 2JEXA 2KQXA 3FAVA 3N2KA 4I0XA 2XAQA 1JX9A 1BQZA 1VEWA 4DW0A 4ZI7A 1GTOA 1M9NA 2EINB 4U3JB 2DN9A 1VQ5V 4JI8O 4PDLA 3M7MX 3CS5A 4I50A 2CH7B 2Q7HA 4FLWA 4QNHB 2UXCB 2Q69A 4GUNA 4O2BA 4TV9A 1K34A 3R66A 4DV0O 4LFBO 3QF7A 1AP5A 2QM8A 3X2QB 3THOA 3VQWA 4O4HB 3UQ8A 1BGYH 2P7TC 2JJ2G 3ZJZA 4UCOA 3RYIB 1SQPH 3JARB 4H13B 4PA9A 3STLC 2BOBC 4AI8A 1H2KA 4WCEV 4UB8Z 5B1AC 4JI2O 1QVFU 3RYHA 3H1KH 2LJ2A 4E2LA 4J7JA 3SR2C 1OZ0A 4JYAB 2BTOA 1K97A 4TV9B 3OUSA 5LP6B 1YDXA 4DV6B 4J11A 1L1FA 4UV8A 1K92A 4X9QA 3K06A 1GK9A 1TUBA 1KUQA 4O4IB 2JJ1G 1Z5VA 1X4TA 2WLIA 3BPZA 3RBZA 3A8TA 2PGGA 2E74B 2OYQA 3BEHA 4FJCC 2IJIA 1AJQA 3QNEA 3LUTB 3SPCA 5IYCO 4FZ1A 4J80A 4PJ0Z 3ASNC 2WLHA 1N34B 1Q43A 4KHPB 4OPHA 4R8CA 3U11A 2F1MA 2EIKC 4PA7A 1PL4A 2ZQMA 1UPGA 1KBHA 4X65B 2DYRC 1F7YA 2KG7A 4XDKA 4EFBA 5J2UB 2ZXWB 2HR3A 3B77A 2UXCO 2HKOA 1Y74B 1NR7A 2F23A 3VBBA 4QPJA 1NH2B 1Y66A 4P30A 2CAZC 2CGOA 1GN2A 1R6KA 2AHZA 4LH7A 3N27A 2Q7GA 1QBZA 4QE7A 5BY1A 3CPWU 3OR7C 4WFHA 1JVMA 2Z0AA 1IBMO 2IJJA 2HFEC 1AJNA 3JD3A 2AXTZ 5IE9A 1BQ0A 2ZM6B 3HKDA 2HLDG 3ZCCA 2X6AA 3CC7V 3U10A 1XL6A 2WLJA 3IC9A 3ZRVA 5EBLC 4TSFG 3OTOO 5EC2C 1DLBA 4NB5A 1RPRA 4B3MO 1FS0G 4YJ2A 3LSUA 4UVAA 2B1GA 1KKDA 3ABUA 2YIBA 4I9WA 3JD2A 2ZXWC 5TISZ 4EFEA 5JJEB 3RVZA 1YJNV 3NR7A 2JGDA 3CWBH 4IL6Z 4MVOA 3RT3C 3AG3C 1IURA 3I56V 3RW0A 4CBCA 3JATB 4C7UA 2QE7G 3DXRB 2F95B 4YXWG 4HBNA 3VQYA 4FLXA 3ETEA 2R9RB 3QO7A 4TUYA 5LHHA 5BZBA 4FMTA 4D7TA 3FB7C 3JASB 5LXTB 2W0XA 5KUKA 1SQXH 2Q0OC 2QWRB 3JD1A 5B3SB 2LGQA 4YJ3A 4LH6A 1BT8A 3ZBHA 5FPRA 2GTAA 2ZM6O 2HP8A 4DW1A 4JAVA 4AQYB 1JFFB 3OR6C 1SQVH 4DV5O 1FXVA 1YTFB 1VQ9V 3SYQA 3ZRXA 1S5LZ 1RFYA 1URFA 4R6ZA 5IY5B 4DR4B 2QEXV 4X20A 2HHHB 1I94O 2KB1A 4NVPA 4BIUA 1KQSU 4CZZA 5IT9N 5LMUO 1VQLV 3BA8A 4K3AA 5KLVH 2WWWA 5FL7G 3JSNA 2VQEB 1K4CC 4ZHQA 4P9PA 3SJBC 3M8AA 5JJJB 5LMNB 1L8DA 4Z1MG 3C3TA 2M7WA 4MW3A 5IJ9A 3OEEG 1HR0O 4DR7O 4H37A 1SZXA 1K73W 1VF6C 5JH7A 3BABA 2A7WA 1COWG 4P2ZA 1Q6UA 2QWOB 4CC5A 3JAKB 1BHBA 4NTWA 1LUVA 4LR3A 3AG7A 2ODMA 2ZR2A 2ETNA 5LA6A 1PD3A 2EJRA 1HW7A 4TT3G 2ZDIA 1SC5B 2K9PA 3E8BA 2R70A 3QG5A 4O2BB 4OGQB 1QU7A 2QKCA 3RYCA 3FKSG 2CE4A 3P3NA 4PDMA 1LR1A 3PN1A 3ZMSA 3FAVB 5CA3A 3G4SV 5KHGA 4DUZB 4LF6O 3H01A 4NXNB 4JZ2A 3L73H 2ZIMA 5A2QN 1F4NA 3AG2C 5IJ9B 4TOIA 5EK0A 4H33A 2XHBA 1DK1A 5KAFZ 5B1OA 1W2BU 2Y0IA 2AHYA 5HFMA 4JAAA 2F93B 2VQEO 3CCLV 3HPLC 2QA4V 2IU3A 5LMUB 4JYBA 3WB0A 1JOYA 4FK5C 4FLTA 1S77D 4CH6A 4U3JA 5KX5B 4UVBA 2LO1A 3X2QC 4JTAB 1NU1H 2P4KA 3L70H 3H9VA 1IBKO 2LQTA 4GX1A 3LDCA 4JI3B 3T1YO 1XNRO 1J5EB 5LP6A 2UUCO 1S0VA 2Q67A 3JALA 1YI2V 2BTQA 1MMMA 4X88A 2WLLA 1PNKA 1WNSA 4RUEA 4K8XA 3D36C 4JV5B 4KP4A 2QGNA 4NR1A 4GLXA 2EBOA 3FB6C 1M93A 2ZE8A 3U0ZA 1VF6A 1JR9A 4WF9V 2B1IA 2LP7A 4A5UB 2F4VO 4FLVA 3RYIA 4ZKIA 5CBFA 3QO5A 4B7EA 4J42A 4UXNA 2XNDG 2WLKA 5JJNB 4LF5O 4DV1O 4LF4O 3SJCC 2Q68A 3CCUV 1UFIA 1OV9A 1FXKC 3IFXA 1SESA 3ABMC 1K4DC 1KU9A 4QGPA 1SERA 4ZBMA 5IYDO 4I9QA 4JI5O 3APOA 1MOFA 4DR3B 2KSDA 1IVSA 4OPAA 4OXSA 3JAWA 1IBLO 3RYFA 2BE3A 3SYCA 2B5UA 5FNVB 3CJHA 3OFNG 2EILB 4I4TA 5IWAO 1CPYA 2KG7B 2A79B 3FX7A 1TVKB 2DYRB 3F7YC 1AR5A 4HAMA 3J7AU 1GH6A 5E1AC 2WA4A 2HJDA 1QNMA 1GM7A 3HB3B 2ZCEA 4I55A 2QTOA 2YIAA 2ZNIA 4AHCA 4JI4O 1Q82W 2PYJA 3SYAA 2X6BA 4J9YB 2QWNB 4JYCA 3ZN1A 5A9GA 1XEQA 3DTUB 2HEPA 5AG2A 3RYFB 4X66O 1XMQB 3CCEV 2EIMB 3MHHC 1FXKB 3BHPA 1CXZB 4TV8B 1K33A 3FYEB 4JI2B 5GTIZ 5CA1B 3VQVA 1K5QA 4FFBB 1BL8A 2EZOA 2EJ7A 1BHAA 2FB5A 2RN9A 3O65A 2ARHA 3OMIB 2RDCA 3OUFA 5H9CA 3E86A 1PV0A 3JCUZ 2CDYA 1N8RW 1FJGB 3R65A 2Q8VA 3ABLB 3ZS8C 3KKYA 5JQGA 4EKWA 1VQ6V 2OIGA 1SQQH 4F4LA 4DR6O 3ZHSA 5EYPA 1WB8A 1Q81W 4G28B 2QTSA 3CE2A 1R73A 1KYOF 5KAIZ 2RJZA 2X0LA 3ASOC 1QVGU 4O4JA 4XBFA 4L87A 1VF7A 1AJPA 5KMGA 1QLEB 3OGIB 4FFBA 4H44B 1DF5A 4YIOA 5HFLA 5LL6Y 1TA8A 4X1KA 1XDCA 4UFZA 5CA0B 5LHIA 1OCOB 4O4LB 1AR4A 1PP9H 4X65O 1J95A 2PY5A 1TUEB 1GO3F 2IW5A 1SQBH 1FYJA 4HYOA 2IJHA 5JCOA 1M1KW 1WN7A 1H2LA 5J9PC 2CTRA 4GX0A 1YXBA 3DC5A 2ATKC 5C93A 3ZMZA 2UXBO 4DK1A 1DF4A 2ZIOA 4PA6A 4JI1O 3ZHVA 2Q4PA 2YXLA 3OE7G 4X1IB 2E5LB 1VIBA 1WB7A 1YIJV 1NKDA 2FTKA 1P7BA 3IC7A 3KG2A 4LF7B 1TUBB 2XASA 3AG1C 2C2AA 3TGUH 4R7CA 1H2NA 1YTFD 5GONB 1M90W 4X1KB 1GM8A 1JFFA 5JCOC 5CA1A 4J7ZA 1NBMG 2NR5A 2PZSA 2YICA 4J41A 4DYLA 3FD9A 4LP8A 2D3OW 2H3OA 2QM4A 3CRAA 1HNWO 2R9IA 4UCRA 3MAQA 2UXBB 2CGNA 4JI1B 1QR8A 1M56C 3BVOA 2IBZH 1W0KG 3LSSA 1OCOC 5DECA 1JCHA 3CCQV 4D6TH 1XREA 3N2GB 3ZHRA 2X6CA 3HKCB 2BCCH 1Q3EA 4GCZA 4XDJA 1BMFG 3CCMV 2GSMB 3SJQC 5B1AB 4J10A 3G6BA 2QJ1A 4TV8A 4JI4B 1I0HA 3CCRV 4PDVA 4LWSA 3SDLA 2JDIG 3WB1A 1XL4A 3OMAB 4O2AA 4CS3A 4B3TB 2B9ZA 2X7RB 4MTOA 1KP3A 2QKSA 2IH3C 3RWRD 1X59A 3SPIA 5L3EA 4PD4F 3PJSK 1P7GA 4R50A 1N4CA 4FM2A 3D3IA 2WPDG 1NZ6A 1R3JC 2A3QA 2UUCB 4MVSA 4WFEA 2VWJA 3K08A 1AR1B 1R3IC 1M57C 3ICXA 4K0KB 4MTGA 2G38A 2H8PC 2JK5C 4MTXA 1XOUA 4U3FH 3HKEA 1SF9A 2YUAA 4DXWA 4U7OA 2O57A 2NNUA 2AW9A 1R3KC 1GKFA 2FKXA 2QWPB 1AILA 4O4JB 4LF9O 2Y0PA 3D3QA 5L3BA 4JI3O 4N21A 1VF5B 4FIPC 5GONA 1M5IA 2RNBA 1SZTA 1XHXA 1H2MA 3JATA 3E2EA 2DMXA 2P22C 5JVDB 3SGIA 4CH4A 4ZIBA 3K5NA 1FD9A 3K5LA 1EN6A 1QHTA 5H5NA 2A06H 4X1IA 4CS2A 4B7KA 2WLMA 3WG7C 3CMEV 1SQGA 5IYZA 2VQFO 2JGDB 2EIJC 4HZ3A 4IIJB 2F4VB 4ASUG 1Q5OA 2XUMA 2UXNA 4B3RO 2Y48A 4MTFA 4NTYA 4LFAB 4YY3O 2FL4A 2ZD9A 4NTXA 3K0GA 3P3PA 4RAIA 3CCJV 3ABMB 2GTSA 1G8MA 2QDOA 1DTOA 3AG4C 2XAGA 1H2SB 2Q73A 5BR8O 2ZE7A 1US6A 4UUJC 4JI5B 1CEZA 4MVUA 4D7SA 3T1CA 1NTMH 5H6RA 1D5NA 2Q6AA 3F5WC 4HNAB 1K8AW 2WAMA 3CC2V 4PI0A 2PI4A 3OTFA 3L74H 1EBOA 1ZAUA 5B66Z 2OT5A 5IJ0A 1H38A 1NTZH 1N34O 5L3DA 2P4VA 3CYOA 3CHXA 4LFCB 3K79A 2E76B 3L9DA 1SRYA 4DR7B 3RGBA 4DV4B 5KA5A 4I0XB 4B3SO 2H94A 3CXCU 1SS3A 3E35A 4JYAO 3OGCC 4IYIA 4JPRA 4X1YA 5IYBO 3AG3B 1N0JA 1R6TA 3IAYA 4RQEA 4RO2A 5J2UA 3T4DA 3A0HZ 3L71H 1QQCA 3VOUA 1E1QG 3T1YB 1S76D 4X64O 3QTCA 3AEIA 5D5PA 2OCHA 2FMLA 3BCCH 3LNNA 4BR6A 1YEWA 3O9OA 4FZ0A 5J2TB 4X66B 4L8JA 1RM1B 1O9HA 1HNZB 5IDJA 2L6LA 3H1JH 4WFBV 3NXSA 1GMGA 1MZEA 4DO2A 3JAMN 2CTPA 2ZE6A 1XNQO 3ZHUA 3TXSA 3CEIA 2VQFB 4MVQA 4WFAV 2FYUH 1K9MW 1I5XA 1IDSA 2AZ2A 4DK0A 1N32O 4LNUB 1F4MA 4I5SA 1Q86W 4CS4A 3W7WA 2W6JG 2YS8A 4DR1B 2E75B 4B3TO 4B3SB 1S5HC 1MSWD 4DV4O 4NXNO 1OCRC 3SPGA 2GUZB 4MVZA 4LF4B 1N36B 4IIJA 1YSCA 2RMKB 4O4IA 4J9ZB 4TWKA 1YITV 1HNZO 1KC8W 3UO2A 3K57A 3UO3A 4X62B 1LNQA 4KUMA 5EZYA 5KHKA 3ZMVA 1NR1A 5IYZB 5E79Z 4WFGA 5ITZA 4X64B 3HKBA 1PNLA 4JI7O 1SETA 3ZRWA 3ZRSA 1Y4MA 5LOVB 1ZLZA 3UT5B 1D5AA 4WBNB 4EB6A 2RCVA 1YF2A 5C8YA 1NTKH 4QIWF 1F51A 1ZX3A 3G6EV 2Y4TA 3MD0A 5LP6C 5LGNA 1E79G 1ZTEA 2QM7A 2CTWA 3UCSC 2JEUA 4TUYB 3ZN0A 1EN4A 2Y4UA 2AGAA 2VWKA 2EZPA 3LNMB 1I08A 1W59A 1HNXO 2P90A 1E1RG 2YI8A 5EZYB 1Z2GA 2WLNA 2GBOA 1EN5A 3EHBB 4X89A 4PV1B 4BW9A 3GWKC 3DGEA 3F7VC 3IJ4A 3K04A 1WPXA 1PNMA 1T5EA 4DV5B 3Q4HA 5EC1C 1IXMA 1QLNA 1TAEA 4AQYO 5FLXN 4O2AB 3ASNB 1XMQO 4ZI7B 3TCUA 2P5OA 1DGSA 4PA3A 4CH3A 2VRZA 1B3QA 1J5EO 3T1HB 4KHPO 1YCIA 1XMOB 1FXHA 5GW7A 2K1EA 1N33B 1ORQC 4E4EA 1JJOA 4QJFB 1XNRB 4UCUA 3B40A 1H8HG 2PI5A 3AK1A 4EEQA 2ZDIC 2M6YA 1FFTB 3CJHB 4DR5B 2EX3A 4ABMA 2XOKG 5DEDA 4UCSA 4YHHO 1VMGA 1CP9A 2ILMA 1VQPV 3TK1A 3LDDA 2DWEC 2ZINA 4X8AA 1NVPB 4PA4A 1R1BA 2KKWA 4J7KA 1AI7A 2DYSB 2UU9O 3S3WA 2Y69B 4LCUC 2ZT9B 3SPHA 1K7DA 1RPOA 1VQMV 3WU2Z 2Q7EA 3CRCA 2MK3A 3RVYA 1RSOA 1EM1A 4LNUA 3RYCB 4JGSA 1GN3A 1R3LC 3C3SA 4UVCA 1XNQB 4LF8O 2EILC 1THZA 2JS5A 3ZX6A 3I55V 1NS1A 5B5EZ 2ZNJA 1WP8A 4DRXA 3OT7A 3RYHB 4BW5A 2UU9B 3EXAA 1W0JG 1D2DA 2UXXA 3JARA 2W0FC 3JALB 5EYPB 2ZE5A 2Z3YA 1V54B 1F23A 4GYCB 2UUBO 1KECA 1PPJH 1G6UA 1PKXA 1P4RA 3J81N 1MG1A 3BFRA 4Q20A 1GAXA 3F5TA 2IU0A 4ICGA 5BXZA 3D36A 4CH5A 2OCCB 1ROPA 1KD1W 2IJKA 4KXRA 4QE9A 2V1DA 2XAFA 4DRXB 1FKAO 2PYLA 3ZMUA 2UXDB 3DC6A 2F43G 3MHSC 1NH2D 3K0DA 2JRIA 2HVKC 3AK2A 4U7NA 4RQFA 3CRQA 2EINC 4LC1A 4DV0B 3T4ZA 3DSQA 3M99B 1VQKV 4BAYA 2WSSG 5LYJB 1I5YA 2A0LA 3ABKB 3VQXA 1JMKC 4PDRA 1NQTA 2LFSA 3G67A 4DR4O 2D2CB 1XILA 4LFCO 3CMAV 5L3FA 4DUYB 4GX2A 1AVMA 4UCVA 3EFFK 2OTLV 1HR0B 4W4LA 2HG5C 3G80A 2LW7A 4DV7B 5CBHA 4GKKB 3D8CA 2EULA 3HKDB 5BR8B 1RM1C 4DV3B 1VARA 5D5QA 1MZFA 5BMVA 3QO8A 4MT8A 1GN6A 5KHJA 3FB5C 2BSKB 1KKCA 2YDEA 1Q8IA 4PI2A 4P9OA 1SKVA 3A2FA 3E8GA 1YZBA 3E22A 3H1IH 4Z1VA 4LFAO 4LFBB 2GHYA 2HJFC 2DQ3A 4IHJB 3ZEDA 3N2GA 4Z2WA 2PF4E 2QR4A 1KMIZ 5CMUA 3JCZA 3K5OA 4G27B 4DUZO 3KCYA 3RN4A 3K03A 2Z5UA 3N2KB 3UM7A 4OX9O 2UUAB 2XTAA 1S72V 1OCCC 2DOSA 3AK3A 4YHHB 1R6NA 3JYCA 4BIZA 4B3MB 3ZRWB 4H0LB 3OEHG 5H6QA 2JIZG 4DV3O 4DR2O 2A9HA 4LF8B 2LGWA 4JAUA 2EIKB 2V4DA 4FLYA 1VQ8V 2E3CA 3H1HH 1M56B 1SA0A 3JD0A 5LGTA 3H1LH 1EFRG 2N05A 4MW8A 5LOVA 1B6QA 3DXRA 1B04A 2OIEA 3CCSV 3CB2A 2R72A 1EZJA 1Z5WA 3OM3B 4FPPA 4FVMA 3SJAC 1UJWB 2QSAA 4O4LA 1Q90D 1WA8A 4TQFA 2JGUA 4ZOLA 5KHHA 3K59A 5ITZB 4N23A 2YIDA 5KHIA 1N0NA 5CN0A 1AI6A 4DR6B 1IXBA 2YEVB 2OTJV 3JD4A 2WLIB 4AILC 2BTQB 2XAHA 4W4KA 4F6EA 3ETGA 4JZGA 5CB4B 2DW4A 4QPKA 3BAAA 4JYYA 3ZMTA 1OCZB 2BSKA 1N36O 3CRRA 4HNAA 4MSWC 3J80N 3QVNA 2HVJC 4LBEC 5LHGA 1JA8A 1YHQV 5L3CA 2XT9A 4ZOLB 3ZHTA 1BS3A 2ZKOA 1OJHA 3TXQA 1YVWA 4JI6B 2ZR3A 1M4UA 1Y67A 1NT2B 1WPBA 4F6RB 2UUAO 4JTDB 4DV2O 1BE3H 1JPXA 5FPOA 3FYIB 3BRCA 2IM9A
chains in the Genus database with same CATH topology
4B3SO 1XNRO 1XEQA 2UUCO 4JI2O 1I94O 4JYAO 4JI7O 1XMOO 2Z0AA 1G1XB 4JI0O 1IBMO 5IT9N 4X66O 5LMUO 2UXDO 4JI6O 1R6TA 4GKJO 2E5LO 4DR4O 2FKXA 3M8AA 1AILA 4LF9O 4GKKO 4JI3O 4X64O 4LFCO 1HR0O 1AB3A 1A32A 4DR7O 4LF8O 3OTOO 4A5UB 2F4VO 4DV7O 4X62O 4B3MO 4DR1O 1N33O 1KUQA 4NXMO 3O65A 4LF7O 4JV5O 1NS1A 3T1HO 2AGAA 1HNXO 4LF5O 5H5NA 4DV1O 4LF4O 1HNWO 2DJVA 2UU9O 4K0KO 3JAMN 2VQFO 2LW7A 1D2DA 1XNQO 4JI5O 4DV6O 3RT3C 4B3RO 4OPAA 4DR6O 4OPHA 2N74A 4AQYO 5FLXN 4YY3O 1XMQO 1IBLO 2UUBO 4JI8O 1N32O 4DR5O 1N36O 3J80N 1J5EO 1F7YA 4KHPO 1YZBA 4LF6O 4LFAO 5IWAO 5BR8O 5A2QN 3J81N 4DUYO 3F5TA 3SDLA 4B3TO 5LL6Y 1DK1A 3R66A 4DV0O 5BXZA 4LFBO 2UXCO 4DV4O 4DUZO 1FJGO 4NXNO 4X65O 4OX9O 1X59A 2ZKOA 2VQEO 2ZM6O 1HNZO 3J7AU 2DOSA 1FKAO 4YHHO 1FYJA 1N34O 4DV5O 2UUAO 4DR3O 4DR2O 4DV3O 2HHHO 2JRIA 4DV2O 1R1BA 1IBKO 5BY1A 4JI4O 2UXBO 5LMNO 3T1YO 4JI1O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S O;  1XNR O;  1XEQ A;  2UUC O;  4JI2 O;  1I94 O;  4JYA O;  4JI7 O;  1XMO O;  2Z0A A;  1G1X B;  4JI0 O;  1IBM O;  5IT9 N;  4X66 O;  5LMU O;  2UXD O;  4JI6 O;  1R6T A;  4GKJ O;  2E5L O;  4DR4 O;  2FKX A;  3M8A A;  1AIL A;  4LF9 O;  4GKK O;  4JI3 O;  4X64 O;  4LFC O;  1HR0 O;  1AB3 A;  1A32 A;  4DR7 O;  4LF8 O;  3OTO O;  4A5U B;  2F4V O;  4DV7 O;  4X62 O;  4B3M O;  4DR1 O;  1N33 O;  1KUQ A;  4NXM O;  3O65 A;  4LF7 O;  4JV5 O;  1NS1 A;  3T1H O;  2AGA A;  1HNX O;  4LF5 O;  5H5N A;  4DV1 O;  4LF4 O;  1HNW O;  2DJV A;  2UU9 O;  4K0K O;  3JAM N;  2VQF O;  2LW7 A;  1D2D A;  1XNQ O;  4JI5 O;  4DV6 O;  3RT3 C;  4B3R O;  4OPA A;  4DR6 O;  4OPH A;  2N74 A;  4AQY O;  5FLX N;  4YY3 O;  1XMQ O;  1IBL O;  2UUB O;  4JI8 O;  1N32 O;  4DR5 O;  1N36 O;  3J80 N;  1J5E O;  1F7Y A;  4KHP O;  1YZB A;  4LF6 O;  4LFA O;  5IWA O;  5BR8 O;  5A2Q N;  3J81 N;  4DUY O;  3F5T A;  3SDL A;  4B3T O;  5LL6 Y;  1DK1 A;  3R66 A;  4DV0 O;  5BXZ A;  4LFB O;  2UXC O;  4DV4 O;  4DUZ O;  1FJG O;  4NXN O;  4X65 O;  4OX9 O;  1X59 A;  2ZKO A;  2VQE O;  2ZM6 O;  1HNZ O;  3J7A U;  2DOS A;  1FKA O;  4YHH O;  1FYJ A;  1N34 O;  4DV5 O;  2UUA O;  4DR3 O;  4DR2 O;  4DV3 O;  2HHH O;  2JRI A;  4DV2 O;  1R1B A;  1IBK O;  5BY1 A;  4JI4 O;  2UXB O;  5LMN O;  3T1Y O;  4JI1 O; 
#chains in the Genus database with same CATH topology
 5JQG B;  4JAS A;  3WG7 B;  1ZL8 B;  4GX5 A;  2EIJ B;  4MVM A;  4X1Y B;  5FNV A;  1N32 B;  2WLL B;  2BOC C;  4GKJ O;  4PHZ A;  1VQN V;  2EIM C;  3OTO B;  1MA1 A;  4LWS B;  1P49 A;  4NYK A;  1S3J A;  4XDL A;  1FPO A;  1OHH G;  5GTH Z;  1V9P A;  3K9A A;  4B08 A;  3ZHQ A;  5CA0 A;  4I50 B;  1NI8 A;  1IBM B;  1PM9 A;  3ML0 A;  3SPJ A;  2NN4 A;  3W7S A;  1HP8 A;  5KA6 A;  4K0K O;  3W7T A;  1KP2 A;  3LDE A;  5IY5 C;  1VP7 A;  1NVP D;  5L3G A;  1ZUQ A;  2Q5Z A;  4IT5 A;  4K8Z A;  4YJ2 B;  3G71 V;  2YEV A;  4CC6 A;  3SYP A;  1GRJ A;  1L0L H;  2JS3 A;  4FM0 A;  2N74 A;  5EIB C;  4OX9 B;  5CBG A;  3SYO A;  4DR5 O;  3OW2 U;  1SQF A;  2OWO A;  4IGG A;  1NJI W;  5B1B C;  3P32 A;  1Y6X A;  4IYH A;  3W7X A;  5DN6 G;  3FFQ A;  4WBN A;  4LF9 B;  4JTC B;  2CH7 A;  3ABT A;  2ADP A;  1XUQ A;  3WB2 A;  2PTM A;  1S5J A;  3JAW B;  4DR3 O;  3I5D A;  2OCC C;  3CRM A;  3C90 A;  3GVM A;  5F2V O;  4KL1 A;  2F66 C;  1IBK B;  1WP7 A;  2WA3 A;  3EVK A;  3JAS A;  2GDS A;  3FB8 C;  4EB6 B;  3AG1 B;  3AG2 B;  5JH7 B;  2IH1 C;  1U97 A;  3Q4H B;  4YY3 B;  2QKA A;  1L0N H;  1H2G A;  2Q9L A;  1AI5 A;  2YI9 A;  1AB3 A;  1A32 A;  3ABK C;  1RP3 B;  4ZHQ B;  1XI1 A;  4LF7 O;  1ZSP A;  2XAJ A;  4MVR A;  1XBL A;  2MW2 B;  4JI7 B;  1OCR B;  3CXH F;  5BMV B;  1ZL8 A;  1GM9 A;  5B1B B;  4K35 A;  1YJ9 V;  4BIO A;  2LFR A;  3CC4 V;  1QCE A;  1FXK A;  2P67 A;  3B8M A;  4PEL A;  5LA6 B;  1ZWI C;  4I7Z B;  4KFM A;  2DQ0 A;  1HNW B;  3OD4 A;  4MS2 A;  4LF5 B;  2Q0A A;  3CX5 F;  1Q6H A;  1K5S A;  2QWQ B;  5LGU A;  1LUW A;  3GWO A;  1KB9 F;  1BZK A;  3K9S A;  2CK3 G;  2V7Q G;  4FFK A;  4IHJ A;  5KMG B;  1WJZ A;  1Q6I A;  1FJG O;  1Y74 A;  1AI4 A;  1XHZ A;  2NLJ C;  2UUB B;  5KUM A;  2ITD C;  5J2T A;  3T2M A;  5EBW C;  3K3W A;  2CTQ A;  4UV9 A;  4G2K A;  5JWP A;  4NXM B;  3APQ A;  3B09 A;  3W7U A;  2HHH O;  3E89 A;  3ETQ A;  1BCC H;  5KX5 A;  1O9G A;  1RSO B;  1MAB G;  3L75 H;  1OCC B;  4FM1 A;  1G4Y B;  5EIB D;  1U96 A;  1M57 B;  3CD6 V;  1B06 A;  5IWA B;  1XMO O;  1G1X B;  3KCX A;  4TQD A;  2UXD O;  2W6I G;  1XQ8 A;  2E5L O;  2PUS A;  3E8F A;  3E8H A;  1JQ0 A;  1V55 C;  2YC0 A;  1MNG A;  1BSM A;  3HR0 A;  1Y76 B;  4RUF A;  3K58 A;  4WFF A;  4DV7 O;  4DV1 B;  4X62 O;  4DR1 O;  1WA8 B;  3CP1 A;  4NXM O;  1HDJ A;  1TGO A;  3CSX A;  1ENV A;  1Q7Y W;  1FAF A;  1FFX B;  1HNX B;  4JI0 B;  1GN4 A;  1WAZ A;  1HWY A;  1SA0 B;  2DJV A;  5CB4 A;  1VQO V;  4B3R B;  3L72 H;  4YJ3 B;  2YXH A;  5DM6 V;  5K1X A;  3BY6 A;  4GT1 A;  1JJ2 U;  2DWD C;  4DV6 O;  5B1N A;  2AZ0 A;  4UB6 Z;  5LXT A;  3OAA G;  4LF6 B;  2YXY A;  4GZR B;  3UT5 A;  2DE0 X;  3A0R A;  3AG4 B;  5B3S C;  2DYS C;  2Y69 C;  1IZ3 A;  1WLE A;  4RWU A;  3HKB B;  3BA9 A;  3WFV A;  2P06 A;  4FLZ A;  4Q6G A;  4YIP A;  4I4T B;  4DUY O;  3TET A;  3P30 A;  1Y76 A;  2VS0 A;  1EZV H;  1IX9 A;  4JF3 A;  1OCZ C;  2L35 A;  2LW1 A;  5JVD A;  1MSD A;  3B8N A;  3UKM A;  3B4S A;  5H2F Z;  4O4H A;  3E83 A;  5C8Y B;  3ABL C;  5K1P A;  2CUG A;  1V55 B;  4UCT A;  4NKG B;  3STZ C;  3B2E E;  4F6R A;  3CCV V;  1TVK A;  3S3X A;  4I55 B;  3RFR A;  4BWA A;  1ARO P;  3LSQ A;  5LMN O;  3JAK A;  4X20 B;  2RQ6 A;  3ASO B;  2P6J A;  4DR2 B;  1QR9 A;  5LYJ A;  2GV9 A;  4GKJ B;  4JI0 O;  1VQ4 V;  1AP6 A;  3HKC A;  2ADQ B;  1QLE C;  3HKE B;  4JI8 B;  3OMN B;  4JI6 O;  1V54 C;  3A0B Z;  2JVD A;  1I94 B;  3KZI Z;  1VQ7 V;  3GB7 C;  2YSU B;  3JSL A;  4GKK O;  1H8E G;  2R9A A;  3ZIA G;  3ETD A;  4DV2 B;  4FLU A;  2YIB D;  1N33 O;  4JV5 O;  3E22 B;  5LBQ A;  2GUZ A;  3T1H O;  1YJW V;  2N04 A;  1I7F A;  5IJ0 B;  3IGA C;  3K5M A;  1FFX A;  1IBL B;  1P84 F;  1PL0 A;  3MDS A;  5EBM C;  3TJT A;  1K3E A;  2ITC C;  2JEX A;  2KQX A;  3FAV A;  3N2K A;  4I0X A;  2XAQ A;  1JX9 A;  1BQZ A;  1VEW A;  4DW0 A;  4ZI7 A;  1GTO A;  1M9N A;  2EIN B;  4U3J B;  2DN9 A;  1VQ5 V;  4JI8 O;  4PDL A;  3M7M X;  3CS5 A;  4I50 A;  2CH7 B;  2Q7H A;  4FLW A;  4QNH B;  2UXC B;  2Q69 A;  4GUN A;  4O2B A;  4TV9 A;  1K34 A;  3R66 A;  4DV0 O;  4LFB O;  3QF7 A;  1AP5 A;  2QM8 A;  3X2Q B;  3THO A;  3VQW A;  4O4H B;  3UQ8 A;  1BGY H;  2P7T C;  2JJ2 G;  3ZJZ A;  4UCO A;  3RYI B;  1SQP H;  3JAR B;  4H13 B;  4PA9 A;  3STL C;  2BOB C;  4AI8 A;  1H2K A;  4WCE V;  4UB8 Z;  5B1A C;  4JI2 O;  1QVF U;  3RYH A;  3H1K H;  2LJ2 A;  4E2L A;  4J7J A;  3SR2 C;  1OZ0 A;  4JYA B;  2BTO A;  1K97 A;  4TV9 B;  3OUS A;  5LP6 B;  1YDX A;  4DV6 B;  4J11 A;  1L1F A;  4UV8 A;  1K92 A;  4X9Q A;  3K06 A;  1GK9 A;  1TUB A;  1KUQ A;  4O4I B;  2JJ1 G;  1Z5V A;  1X4T A;  2WLI A;  3BPZ A;  3RBZ A;  3A8T A;  2PGG A;  2E74 B;  2OYQ A;  3BEH A;  4FJC C;  2IJI A;  1AJQ A;  3QNE A;  3LUT B;  3SPC A;  5IYC O;  4FZ1 A;  4J80 A;  4PJ0 Z;  3ASN C;  2WLH A;  1N34 B;  1Q43 A;  4KHP B;  4OPH A;  4R8C A;  3U11 A;  2F1M A;  2EIK C;  4PA7 A;  1PL4 A;  2ZQM A;  1UPG A;  1KBH A;  4X65 B;  2DYR C;  1F7Y A;  2KG7 A;  4XDK A;  4EFB A;  5J2U B;  2ZXW B;  2HR3 A;  3B77 A;  2UXC O;  2HKO A;  1Y74 B;  1NR7 A;  2F23 A;  3VBB A;  4QPJ A;  1NH2 B;  1Y66 A;  4P30 A;  2CAZ C;  2CGO A;  1GN2 A;  1R6K A;  2AHZ A;  4LH7 A;  3N27 A;  2Q7G A;  1QBZ A;  4QE7 A;  5BY1 A;  3CPW U;  3OR7 C;  4WFH A;  1JVM A;  2Z0A A;  1IBM O;  2IJJ A;  2HFE C;  1AJN A;  3JD3 A;  2AXT Z;  5IE9 A;  1BQ0 A;  2ZM6 B;  3HKD A;  2HLD G;  3ZCC A;  2X6A A;  3CC7 V;  3U10 A;  1XL6 A;  2WLJ A;  3IC9 A;  3ZRV A;  5EBL C;  4TSF G;  3OTO O;  5EC2 C;  1DLB A;  4NB5 A;  1RPR A;  4B3M O;  1FS0 G;  4YJ2 A;  3LSU A;  4UVA A;  2B1G A;  1KKD A;  3ABU A;  2YIB A;  4I9W A;  3JD2 A;  2ZXW C;  5TIS Z;  4EFE A;  5JJE B;  3RVZ A;  1YJN V;  3NR7 A;  2JGD A;  3CWB H;  4IL6 Z;  4MVO A;  3RT3 C;  3AG3 C;  1IUR A;  3I56 V;  3RW0 A;  4CBC A;  3JAT B;  4C7U A;  2QE7 G;  3DXR B;  2F95 B;  4YXW G;  4HBN A;  3VQY A;  4FLX A;  3ETE A;  2R9R B;  3QO7 A;  4TUY A;  5LHH A;  5BZB A;  4FMT A;  4D7T A;  3FB7 C;  3JAS B;  5LXT B;  2W0X A;  5KUK A;  1SQX H;  2Q0O C;  2QWR B;  3JD1 A;  5B3S B;  2LGQ A;  4YJ3 A;  4LH6 A;  1BT8 A;  3ZBH A;  5FPR A;  2GTA A;  2ZM6 O;  2HP8 A;  4DW1 A;  4JAV A;  4AQY B;  1JFF B;  3OR6 C;  1SQV H;  4DV5 O;  1FXV A;  1YTF B;  1VQ9 V;  3SYQ A;  3ZRX A;  1S5L Z;  1RFY A;  1URF A;  4R6Z A;  5IY5 B;  4DR4 B;  2QEX V;  4X20 A;  2HHH B;  1I94 O;  2KB1 A;  4NVP A;  4BIU A;  1KQS U;  4CZZ A;  5IT9 N;  5LMU O;  1VQL V;  3BA8 A;  4K3A A;  5KLV H;  2WWW A;  5FL7 G;  3JSN A;  2VQE B;  1K4C C;  4ZHQ A;  4P9P A;  3SJB C;  3M8A A;  5JJJ B;  5LMN B;  1L8D A;  4Z1M G;  3C3T A;  2M7W A;  4MW3 A;  5IJ9 A;  3OEE G;  1HR0 O;  4DR7 O;  4H37 A;  1SZX A;  1K73 W;  1VF6 C;  5JH7 A;  3BAB A;  2A7W A;  1COW G;  4P2Z A;  1Q6U A;  2QWO B;  4CC5 A;  3JAK B;  1BHB A;  4NTW A;  1LUV A;  4LR3 A;  3AG7 A;  2ODM A;  2ZR2 A;  2ETN A;  5LA6 A;  1PD3 A;  2EJR A;  1HW7 A;  4TT3 G;  2ZDI A;  1SC5 B;  2K9P A;  3E8B A;  2R70 A;  3QG5 A;  4O2B B;  4OGQ B;  1QU7 A;  2QKC A;  3RYC A;  3FKS G;  2CE4 A;  3P3N A;  4PDM A;  1LR1 A;  3PN1 A;  3ZMS A;  3FAV B;  5CA3 A;  3G4S V;  5KHG A;  4DUZ B;  4LF6 O;  3H01 A;  4NXN B;  4JZ2 A;  3L73 H;  2ZIM A;  5A2Q N;  1F4N A;  3AG2 C;  5IJ9 B;  4TOI A;  5EK0 A;  4H33 A;  2XHB A;  1DK1 A;  5KAF Z;  5B1O A;  1W2B U;  2Y0I A;  2AHY A;  5HFM A;  4JAA A;  2F93 B;  2VQE O;  3CCL V;  3HPL C;  2QA4 V;  2IU3 A;  5LMU B;  4JYB A;  3WB0 A;  1JOY A;  4FK5 C;  4FLT A;  1S77 D;  4CH6 A;  4U3J A;  5KX5 B;  4UVB A;  2LO1 A;  3X2Q C;  4JTA B;  1NU1 H;  2P4K A;  3L70 H;  3H9V A;  1IBK O;  2LQT A;  4GX1 A;  3LDC A;  4JI3 B;  3T1Y O;  1XNR O;  1J5E B;  5LP6 A;  2UUC O;  1S0V A;  2Q67 A;  3JAL A;  1YI2 V;  2BTQ A;  1MMM A;  4X88 A;  2WLL A;  1PNK A;  1WNS A;  4RUE A;  4K8X A;  3D36 C;  4JV5 B;  4KP4 A;  2QGN A;  4NR1 A;  4GLX A;  2EBO A;  3FB6 C;  1M93 A;  2ZE8 A;  3U0Z A;  1VF6 A;  1JR9 A;  4WF9 V;  2B1I A;  2LP7 A;  4A5U B;  2F4V O;  4FLV A;  3RYI A;  4ZKI A;  5CBF A;  3QO5 A;  4B7E A;  4J42 A;  4UXN A;  2XND G;  2WLK A;  5JJN B;  4LF5 O;  4DV1 O;  4LF4 O;  3SJC C;  2Q68 A;  3CCU V;  1UFI A;  1OV9 A;  1FXK C;  3IFX A;  1SES A;  3ABM C;  1K4D C;  1KU9 A;  4QGP A;  1SER A;  4ZBM A;  5IYD O;  4I9Q A;  4JI5 O;  3APO A;  1MOF A;  4DR3 B;  2KSD A;  1IVS A;  4OPA A;  4OXS A;  3JAW A;  1IBL O;  3RYF A;  2BE3 A;  3SYC A;  2B5U A;  5FNV B;  3CJH A;  3OFN G;  2EIL B;  4I4T A;  5IWA O;  1CPY A;  2KG7 B;  2A79 B;  3FX7 A;  1TVK B;  2DYR B;  3F7Y C;  1AR5 A;  4HAM A;  3J7A U;  1GH6 A;  5E1A C;  2WA4 A;  2HJD A;  1QNM A;  1GM7 A;  3HB3 B;  2ZCE A;  4I55 A;  2QTO A;  2YIA A;  2ZNI A;  4AHC A;  4JI4 O;  1Q82 W;  2PYJ A;  3SYA A;  2X6B A;  4J9Y B;  2QWN B;  4JYC A;  3ZN1 A;  5A9G A;  1XEQ A;  3DTU B;  2HEP A;  5AG2 A;  3RYF B;  4X66 O;  1XMQ B;  3CCE V;  2EIM B;  3MHH C;  1FXK B;  3BHP A;  1CXZ B;  4TV8 B;  1K33 A;  3FYE B;  4JI2 B;  5GTI Z;  5CA1 B;  3VQV A;  1K5Q A;  4FFB B;  1BL8 A;  2EZO A;  2EJ7 A;  1BHA A;  2FB5 A;  2RN9 A;  3O65 A;  2ARH A;  3OMI B;  2RDC A;  3OUF A;  5H9C A;  3E86 A;  1PV0 A;  3JCU Z;  2CDY A;  1N8R W;  1FJG B;  3R65 A;  2Q8V A;  3ABL B;  3ZS8 C;  3KKY A;  5JQG A;  4EKW A;  1VQ6 V;  2OIG A;  1SQQ H;  4F4L A;  4DR6 O;  3ZHS A;  5EYP A;  1WB8 A;  1Q81 W;  4G28 B;  2QTS A;  3CE2 A;  1R73 A;  1KYO F;  5KAI Z;  2RJZ A;  2X0L A;  3ASO C;  1QVG U;  4O4J A;  4XBF A;  4L87 A;  1VF7 A;  1AJP A;  5KMG A;  1QLE B;  3OGI B;  4FFB A;  4H44 B;  1DF5 A;  4YIO A;  5HFL A;  5LL6 Y;  1TA8 A;  4X1K A;  1XDC A;  4UFZ A;  5CA0 B;  5LHI A;  1OCO B;  4O4L B;  1AR4 A;  1PP9 H;  4X65 O;  1J95 A;  2PY5 A;  1TUE B;  1GO3 F;  2IW5 A;  1SQB H;  1FYJ A;  4HYO A;  2IJH A;  5JCO A;  1M1K W;  1WN7 A;  1H2L A;  5J9P C;  2CTR A;  4GX0 A;  1YXB A;  3DC5 A;  2ATK C;  5C93 A;  3ZMZ A;  2UXB O;  4DK1 A;  1DF4 A;  2ZIO A;  4PA6 A;  4JI1 O;  3ZHV A;  2Q4P A;  2YXL A;  3OE7 G;  4X1I B;  2E5L B;  1VIB A;  1WB7 A;  1YIJ V;  1NKD A;  2FTK A;  1P7B A;  3IC7 A;  3KG2 A;  4LF7 B;  1TUB B;  2XAS A;  3AG1 C;  2C2A A;  3TGU H;  4R7C A;  1H2N A;  1YTF D;  5GON B;  1M90 W;  4X1K B;  1GM8 A;  1JFF A;  5JCO C;  5CA1 A;  4J7Z A;  1NBM G;  2NR5 A;  2PZS A;  2YIC A;  4J41 A;  4DYL A;  3FD9 A;  4LP8 A;  2D3O W;  2H3O A;  2QM4 A;  3CRA A;  1HNW O;  2R9I A;  4UCR A;  3MAQ A;  2UXB B;  2CGN A;  4JI1 B;  1QR8 A;  1M56 C;  3BVO A;  2IBZ H;  1W0K G;  3LSS A;  1OCO C;  5DEC A;  1JCH A;  3CCQ V;  4D6T H;  1XRE A;  3N2G B;  3ZHR A;  2X6C A;  3HKC B;  2BCC H;  1Q3E A;  4GCZ A;  4XDJ A;  1BMF G;  3CCM V;  2GSM B;  3SJQ C;  5B1A B;  4J10 A;  3G6B A;  2QJ1 A;  4TV8 A;  4JI4 B;  1I0H A;  3CCR V;  4PDV A;  4LWS A;  3SDL A;  2JDI G;  3WB1 A;  1XL4 A;  3OMA B;  4O2A A;  4CS3 A;  4B3T B;  2B9Z A;  2X7R B;  4MTO A;  1KP3 A;  2QKS A;  2IH3 C;  3RWR D;  1X59 A;  3SPI A;  5L3E A;  4PD4 F;  3PJS K;  1P7G A;  4R50 A;  1N4C A;  4FM2 A;  3D3I A;  2WPD G;  1NZ6 A;  1R3J C;  2A3Q A;  2UUC B;  4MVS A;  4WFE A;  2VWJ A;  3K08 A;  1AR1 B;  1R3I C;  1M57 C;  3ICX A;  4K0K B;  4MTG A;  2G38 A;  2H8P C;  2JK5 C;  4MTX A;  1XOU A;  4U3F H;  3HKE A;  1SF9 A;  2YUA A;  4DXW A;  4U7O A;  2O57 A;  2NNU A;  2AW9 A;  1R3K C;  1GKF A;  2FKX A;  2QWP B;  1AIL A;  4O4J B;  4LF9 O;  2Y0P A;  3D3Q A;  5L3B A;  4JI3 O;  4N21 A;  1VF5 B;  4FIP C;  5GON A;  1M5I A;  2RNB A;  1SZT A;  1XHX A;  1H2M A;  3JAT A;  3E2E A;  2DMX A;  2P22 C;  5JVD B;  3SGI A;  4CH4 A;  4ZIB A;  3K5N A;  1FD9 A;  3K5L A;  1EN6 A;  1QHT A;  5H5N A;  2A06 H;  4X1I A;  4CS2 A;  4B7K A;  2WLM A;  3WG7 C;  3CME V;  1SQG A;  5IYZ A;  2VQF O;  2JGD B;  2EIJ C;  4HZ3 A;  4IIJ B;  2F4V B;  4ASU G;  1Q5O A;  2XUM A;  2UXN A;  4B3R O;  2Y48 A;  4MTF A;  4NTY A;  4LFA B;  4YY3 O;  2FL4 A;  2ZD9 A;  4NTX A;  3K0G A;  3P3P A;  4RAI A;  3CCJ V;  3ABM B;  2GTS A;  1G8M A;  2QDO A;  1DTO A;  3AG4 C;  2XAG A;  1H2S B;  2Q73 A;  5BR8 O;  2ZE7 A;  1US6 A;  4UUJ C;  4JI5 B;  1CEZ A;  4MVU A;  4D7S A;  3T1C A;  1NTM H;  5H6R A;  1D5N A;  2Q6A A;  3F5W C;  4HNA B;  1K8A W;  2WAM A;  3CC2 V;  4PI0 A;  2PI4 A;  3OTF A;  3L74 H;  1EBO A;  1ZAU A;  5B66 Z;  2OT5 A;  5IJ0 A;  1H38 A;  1NTZ H;  1N34 O;  5L3D A;  2P4V A;  3CYO A;  3CHX A;  4LFC B;  3K79 A;  2E76 B;  3L9D A;  1SRY A;  4DR7 B;  3RGB A;  4DV4 B;  5KA5 A;  4I0X B;  4B3S O;  2H94 A;  3CXC U;  1SS3 A;  3E35 A;  4JYA O;  3OGC C;  4IYI A;  4JPR A;  4X1Y A;  5IYB O;  3AG3 B;  1N0J A;  1R6T A;  3IAY A;  4RQE A;  4RO2 A;  5J2U A;  3T4D A;  3A0H Z;  3L71 H;  1QQC A;  3VOU A;  1E1Q G;  3T1Y B;  1S76 D;  4X64 O;  3QTC A;  3AEI A;  5D5P A;  2OCH A;  2FML A;  3BCC H;  3LNN A;  4BR6 A;  1YEW A;  3O9O A;  4FZ0 A;  5J2T B;  4X66 B;  4L8J A;  1RM1 B;  1O9H A;  1HNZ B;  5IDJ A;  2L6L A;  3H1J H;  4WFB V;  3NXS A;  1GMG A;  1MZE A;  4DO2 A;  3JAM N;  2CTP A;  2ZE6 A;  1XNQ O;  3ZHU A;  3TXS A;  3CEI A;  2VQF B;  4MVQ A;  4WFA V;  2FYU H;  1K9M W;  1I5X A;  1IDS A;  2AZ2 A;  4DK0 A;  1N32 O;  4LNU B;  1F4M A;  4I5S A;  1Q86 W;  4CS4 A;  3W7W A;  2W6J G;  2YS8 A;  4DR1 B;  2E75 B;  4B3T O;  4B3S B;  1S5H C;  1MSW D;  4DV4 O;  4NXN O;  1OCR C;  3SPG A;  2GUZ B;  4MVZ A;  4LF4 B;  1N36 B;  4IIJ A;  1YSC A;  2RMK B;  4O4I A;  4J9Z B;  4TWK A;  1YIT V;  1HNZ O;  1KC8 W;  3UO2 A;  3K57 A;  3UO3 A;  4X62 B;  1LNQ A;  4KUM A;  5EZY A;  5KHK A;  3ZMV A;  1NR1 A;  5IYZ B;  5E79 Z;  4WFG A;  5ITZ A;  4X64 B;  3HKB A;  1PNL A;  4JI7 O;  1SET A;  3ZRW A;  3ZRS A;  1Y4M A;  5LOV B;  1ZLZ A;  3UT5 B;  1D5A A;  4WBN B;  4EB6 A;  2RCV A;  1YF2 A;  5C8Y A;  1NTK H;  4QIW F;  1F51 A;  1ZX3 A;  3G6E V;  2Y4T A;  3MD0 A;  5LP6 C;  5LGN A;  1E79 G;  1ZTE A;  2QM7 A;  2CTW A;  3UCS C;  2JEU A;  4TUY B;  3ZN0 A;  1EN4 A;  2Y4U A;  2AGA A;  2VWK A;  2EZP A;  3LNM B;  1I08 A;  1W59 A;  1HNX O;  2P90 A;  1E1R G;  2YI8 A;  5EZY B;  1Z2G A;  2WLN A;  2GBO A;  1EN5 A;  3EHB B;  4X89 A;  4PV1 B;  4BW9 A;  3GWK C;  3DGE A;  3F7V C;  3IJ4 A;  3K04 A;  1WPX A;  1PNM A;  1T5E A;  4DV5 B;  3Q4H A;  5EC1 C;  1IXM A;  1QLN A;  1TAE A;  4AQY O;  5FLX N;  4O2A B;  3ASN B;  1XMQ O;  4ZI7 B;  3TCU A;  2P5O A;  1DGS A;  4PA3 A;  4CH3 A;  2VRZ A;  1B3Q A;  1J5E O;  3T1H B;  4KHP O;  1YCI A;  1XMO B;  1FXH A;  5GW7 A;  2K1E A;  1N33 B;  1ORQ C;  4E4E A;  1JJO A;  4QJF B;  1XNR B;  4UCU A;  3B40 A;  1H8H G;  2PI5 A;  3AK1 A;  4EEQ A;  2ZDI C;  2M6Y A;  1FFT B;  3CJH B;  4DR5 B;  2EX3 A;  4ABM A;  2XOK G;  5DED A;  4UCS A;  4YHH O;  1VMG A;  1CP9 A;  2ILM A;  1VQP V;  3TK1 A;  3LDD A;  2DWE C;  2ZIN A;  4X8A A;  1NVP B;  4PA4 A;  1R1B A;  2KKW A;  4J7K A;  1AI7 A;  2DYS B;  2UU9 O;  3S3W A;  2Y69 B;  4LCU C;  2ZT9 B;  3SPH A;  1K7D A;  1RPO A;  1VQM V;  3WU2 Z;  2Q7E A;  3CRC A;  2MK3 A;  3RVY A;  1RSO A;  1EM1 A;  4LNU A;  3RYC B;  4JGS A;  1GN3 A;  1R3L C;  3C3S A;  4UVC A;  1XNQ B;  4LF8 O;  2EIL C;  1THZ A;  2JS5 A;  3ZX6 A;  3I55 V;  1NS1 A;  5B5E Z;  2ZNJ A;  1WP8 A;  4DRX A;  3OT7 A;  3RYH B;  4BW5 A;  2UU9 B;  3EXA A;  1W0J G;  1D2D A;  2UXX A;  3JAR A;  2W0F C;  3JAL B;  5EYP B;  2ZE5 A;  2Z3Y A;  1V54 B;  1F23 A;  4GYC B;  2UUB O;  1KEC A;  1PPJ H;  1G6U A;  1PKX A;  1P4R A;  3J81 N;  1MG1 A;  3BFR A;  4Q20 A;  1GAX A;  3F5T A;  2IU0 A;  4ICG A;  5BXZ A;  3D36 A;  4CH5 A;  2OCC B;  1ROP A;  1KD1 W;  2IJK A;  4KXR A;  4QE9 A;  2V1D A;  2XAF A;  4DRX B;  1FKA O;  2PYL A;  3ZMU A;  2UXD B;  3DC6 A;  2F43 G;  3MHS C;  1NH2 D;  3K0D A;  2JRI A;  2HVK C;  3AK2 A;  4U7N A;  4RQF A;  3CRQ A;  2EIN C;  4LC1 A;  4DV0 B;  3T4Z A;  3DSQ A;  3M99 B;  1VQK V;  4BAY A;  2WSS G;  5LYJ B;  1I5Y A;  2A0L A;  3ABK B;  3VQX A;  1JMK C;  4PDR A;  1NQT A;  2LFS A;  3G67 A;  4DR4 O;  2D2C B;  1XIL A;  4LFC O;  3CMA V;  5L3F A;  4DUY B;  4GX2 A;  1AVM A;  4UCV A;  3EFF K;  2OTL V;  1HR0 B;  4W4L A;  2HG5 C;  3G80 A;  2LW7 A;  4DV7 B;  5CBH A;  4GKK B;  3D8C A;  2EUL A;  3HKD B;  5BR8 B;  1RM1 C;  4DV3 B;  1VAR A;  5D5Q A;  1MZF A;  5BMV A;  3QO8 A;  4MT8 A;  1GN6 A;  5KHJ A;  3FB5 C;  2BSK B;  1KKC A;  2YDE A;  1Q8I A;  4PI2 A;  4P9O A;  1SKV A;  3A2F A;  3E8G A;  1YZB A;  3E22 A;  3H1I H;  4Z1V A;  4LFA O;  4LFB B;  2GHY A;  2HJF C;  2DQ3 A;  4IHJ B;  3ZED A;  3N2G A;  4Z2W A;  2PF4 E;  2QR4 A;  1KMI Z;  5CMU A;  3JCZ A;  3K5O A;  4G27 B;  4DUZ O;  3KCY A;  3RN4 A;  3K03 A;  2Z5U A;  3N2K B;  3UM7 A;  4OX9 O;  2UUA B;  2XTA A;  1S72 V;  1OCC C;  2DOS A;  3AK3 A;  4YHH B;  1R6N A;  3JYC A;  4BIZ A;  4B3M B;  3ZRW B;  4H0L B;  3OEH G;  5H6Q A;  2JIZ G;  4DV3 O;  4DR2 O;  2A9H A;  4LF8 B;  2LGW A;  4JAU A;  2EIK B;  2V4D A;  4FLY A;  1VQ8 V;  2E3C A;  3H1H H;  1M56 B;  1SA0 A;  3JD0 A;  5LGT A;  3H1L H;  1EFR G;  2N05 A;  4MW8 A;  5LOV A;  1B6Q A;  3DXR A;  1B04 A;  2OIE A;  3CCS V;  3CB2 A;  2R72 A;  1EZJ A;  1Z5W A;  3OM3 B;  4FPP A;  4FVM A;  3SJA C;  1UJW B;  2QSA A;  4O4L A;  1Q90 D;  1WA8 A;  4TQF A;  2JGU A;  4ZOL A;  5KHH A;  3K59 A;  5ITZ B;  4N23 A;  2YID A;  5KHI A;  1N0N A;  5CN0 A;  1AI6 A;  4DR6 B;  1IXB A;  2YEV B;  2OTJ V;  3JD4 A;  2WLI B;  4AIL C;  2BTQ B;  2XAH A;  4W4K A;  4F6E A;  3ETG A;  4JZG A;  5CB4 B;  2DW4 A;  4QPK A;  3BAA A;  4JYY A;  3ZMT A;  1OCZ B;  2BSK A;  1N36 O;  3CRR A;  4HNA A;  4MSW C;  3J80 N;  3QVN A;  2HVJ C;  4LBE C;  5LHG A;  1JA8 A;  1YHQ V;  5L3C A;  2XT9 A;  4ZOL B;  3ZHT A;  1BS3 A;  2ZKO A;  1OJH A;  3TXQ A;  1YVW A;  4JI6 B;  2ZR3 A;  1M4U A;  1Y67 A;  1NT2 B;  1WPB A;  4F6R B;  2UUA O;  4JTD B;  4DV2 O;  1BE3 H;  1JPX A;  5FPO A;  3FYI B;  3BRC A;  2IM9 A; 
#chains in the Genus database with same CATH homology
 4B3S O;  1XNR O;  1XEQ A;  2UUC O;  4JI2 O;  1I94 O;  4JYA O;  4JI7 O;  1XMO O;  2Z0A A;  1G1X B;  4JI0 O;  1IBM O;  5IT9 N;  4X66 O;  5LMU O;  2UXD O;  4JI6 O;  1R6T A;  4GKJ O;  2E5L O;  4DR4 O;  2FKX A;  3M8A A;  1AIL A;  4LF9 O;  4GKK O;  4JI3 O;  4X64 O;  4LFC O;  1HR0 O;  1AB3 A;  1A32 A;  4DR7 O;  4LF8 O;  3OTO O;  4A5U B;  2F4V O;  4DV7 O;  4X62 O;  4B3M O;  4DR1 O;  1N33 O;  1KUQ A;  4NXM O;  3O65 A;  4LF7 O;  4JV5 O;  1NS1 A;  3T1H O;  2AGA A;  1HNX O;  4LF5 O;  5H5N A;  4DV1 O;  4LF4 O;  1HNW O;  2DJV A;  2UU9 O;  4K0K O;  3JAM N;  2VQF O;  2LW7 A;  1D2D A;  1XNQ O;  4JI5 O;  4DV6 O;  3RT3 C;  4B3R O;  4OPA A;  4DR6 O;  4OPH A;  2N74 A;  4AQY O;  5FLX N;  4YY3 O;  1XMQ O;  1IBL O;  2UUB O;  4JI8 O;  1N32 O;  4DR5 O;  1N36 O;  3J80 N;  1J5E O;  1F7Y A;  4KHP O;  1YZB A;  4LF6 O;  4LFA O;  5IWA O;  5BR8 O;  5A2Q N;  3J81 N;  4DUY O;  3F5T A;  3SDL A;  4B3T O;  5LL6 Y;  1DK1 A;  3R66 A;  4DV0 O;  5BXZ A;  4LFB O;  2UXC O;  4DV4 O;  4DUZ O;  1FJG O;  4NXN O;  4X65 O;  4OX9 O;  1X59 A;  2ZKO A;  2VQE O;  2ZM6 O;  1HNZ O;  3J7A U;  2DOS A;  1FKA O;  4YHH O;  1FYJ A;  1N34 O;  4DV5 O;  2UUA O;  4DR3 O;  4DR2 O;  4DV3 O;  2HHH O;  2JRI A;  4DV2 O;  1R1B A;  1IBK O;  5BY1 A;  4JI4 O;  2UXB O;  5LMN O;  3T1Y O;  4JI1 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...