4NXNO

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4nxnO00
4AQYO 2UXCO 1XNQO 1XNRO 5LL6Y 4LF7O 4DUZO 3SDLA 1DK1A 2DJVA 4DR5O 1IBKO 5H5NA 4B3RO 4DV4O 3F5TA 4DV5O 3J7AU 4K0KO 4DUYO 4B3TO 1XEQA 2N74A 2JRIA 2UXBO 3OTOO 1FKAO 4A5UB 1J5EO 4LFAO 2VQEO 5IWAO 3O65A 2HHHO 1NS1A 4X64O 3RT3C 1XMQO 4GKJO 4LFBO 1G1XB 4X62O 1R1BA 2DOSA 4DR2O 2UUCO 1HNXO 4JV5O 4JI1O 1X59A 2F4VO 1HNZO 4LFCO 2ZM6O 4LF6O 3J80N 4YY3O 4DV2O 2E5LO 1KUQA 1YZBA 5BY1A 1HR0O 1AB3A 5IT9N 1FYJA 4LF5O 1IBMO 1D2DA 1A32A 5BXZA 2ZKOA 1HNWO 4JI6O 4DV0O 4B3MO 2LW7A 4JI7O 4GKKO 4JI5O 4OX9O 4JI4O 1IBLO 4DV7O 4DR1O 5LMNO 1N36O 4LF4O 4JYAO 4DR3O 5LMUO 4JI2O 4JI3O 1XMOO 2FKXA 4X65O 4DV6O 2UXDO 4DR6O 4X66O 4DR4O 2UUBO 1I94O 4OPHA 4LF8O 5BR8O 2Z0AA 3J81N 4DV3O 4JI8O 4DR7O 3T1HO 4DV1O 3M8AA 1R6TA 3T1YO 1F7YA 1AILA 1N33O 2UU9O 4LF9O 2UUAO 4OPAA 4B3SO 4JI0O 1FJGO 3JAMN 4NXMO 2AGAA 1N34O 2VQFO 5FLXN 5A2QN 4NXNO 4KHPO 3R66A 1N32O 4YHHO
chains in the Genus database with same CATH superfamily
4AQYO 1E1QG 1OCZC 1SA0A 4RUFA 3CXCU 1SQVH 2PGGA 2ZXWB 2BSKA 4YJ3A 1W0JG 2LJ2A 5KHIA 4U3FH 2RMKB 3AK1A 3OMNB 3CJHB 4K0KO 3CCEV 1SERA 3JASB 4R6ZA 2UUCB 2HVKC 1THZA 1YVWA 3G6BA 5B1BC 3FB8C 4DRXA 4X62O 5CMUA 4DR2O 1CPYA 3G6EV 4GZRB 1D5AA 2LFSA 1YZBA 3ZBHA 1AI4A 4DW0A 4FK5C 3CMEV 4LF5O 3FB6C 1U96A 4ZOLB 3H1LH 5DECA 1WN7A 4UCSA 3BHPA 4NR1A 4U7NA 2ZT9B 3RYIA 4JI7O 3NR7A 4X65B 5JVDB 2HJFC 3QTCA 1VP7A 5IY5B 3OT7A 1I94B 4PI0A 1Q43A 1SQPH 1H2KA 1UJWB 1DF5A 4FJCC 3RGBA 4Z1VA 2P22C 1WAZA 4WFBV 3BFRA 1ZUQA 3LNMB 3CCUV 1GRJA 4LF8O 2WLKA 1SQFA 1GMGA 4IIJB 1NTZH 3OD4A 2R72A 3HB3B 2Y4UA 4X20A 2UXCB 4IT5A 1EN6A 3M99B 3UCSC 4UXNA 2E3CA 3W7WA 1GN2A 5JQGB 2QJ1A 1S77D 4ZI7B 4CS3A 3TETA 3SDLA 4GX0A 5LHGA 1XL6A 2GDSA 2X6CA 1XQ8A 2C2AA 2HLDG 1ORQC 1XMQB 1VQMV 5LGUA 2OIGA 3OR7C 4GX2A 3K5OA 2DWEC 1R6NA 4LFCB 2ILMA 3BVOA 5IWAO 4I9QA 3RYHA 5FPOA 4MTGA 3QO7A 4BIOA 2DQ0A 3ZMUA 3SJQC 3E8BA 3ZRSA 4PJ0Z 3BEHA 2R70A 3FAVA 2F95B 4CS2A 2HKOA 4MT8A 2Y0IA 5L3GA 1KD1W 4ZBMA 3ABKC 2BTQB 4J11A 3E22A 5BXZA 1KBHA 4MTFA 4DV7B 3CMAV 4JAAA 4CH4A 1JMKC 3THOA 2QR4A 1TUEB 1YITV 2AXTZ 1GN4A 1IBMB 1BHAA 2ZE7A 2EIKB 4PD4F 3X2QC 1F23A 1AR1B 4GX1A 2DMXA 2LQTA 3AK2A 4OXSA 1NR7A 2IU0A 1N33B 3W7XA 5IJ0B 4JI8O 5CN0A 3L72H 2YUAA 2GUZB 2RJZA 2IJHA 3BPZA 3ZIAG 3QG5A 1SRYA 4MTOA 4O2BA 3OGIB 2AGAA 4DV1B 1QU7A 1GK9A 1MABG 4TSFG 5LOVB 1N32O 3N2GA 5IYBO 4QPJA 1F51A 2A7WA 4O4LA 5KAFZ 3F5WC 1QNMA 4LH6A 2ZNJA 4DK0A 4HBNA 2EBOA 2EX3A 5JJEB 2NLJC 3K08A 3ML0A 1NT2B 2N74A 3ZHVA 1HNXB 3AG2C 2OTJV 4DO2A 1Q8IA 1HNZB 1VARA 2ZM6B 4LF6B 1L0LH 1NS1A 4FFBB 2B5UA 2UXNA 4NTXA 4K8ZA 1X59A 3D36A 1VQ6V 4YY3O 1JJ2U 1WLEA 2XT9A 4WFEA 5F2VO 4UCOA 3CXHF 4FZ0A 1K7DA 2F4VB 3UQ8A 2XNDG 4PA3A 1TUBA 5LHIA 4MVZA 2EZOA 2ZINA 4OX9O 3OUFA 1R3IC 5H6RA 2EJRA 2DWDC 4X66B 4DR4B 3LNNA 5H2FZ 4DR3O 3ZRWA 3ABTA 4MVMA 3SGIA 2JS5A 2XHBA 2A0LA 2VWJA 2GTAA 1JCHA 2LFRA 2AHYA 5CA0B 2F23A 1BS3A 2H94A 3SPCA 1S3JA 2V1DA 2BTOA 2CAZC 3M8AA 4ASUG 2O57A 4IGGA 4R8CA 4U7OA 5LP6A 1XHZA 1SQGA 3RFRA 3QNEA 5KMGA 1OCRB 1ZSPA 1M5IA 2ZQMA 4AQYB 2RQ6A 3F7YC 4ZHQA 3N2KB 4JAUA 5EYPB 4E4EA 4B7EA 4NXNO 1RSOB 1Q6UA 2D3OW 1KP2A 3CWBH 5KHKA 1K4DC 4K0KB 1US6A 1F4MA 2DJVA 2WLHA 3ZX6A 4DR5O 1IBKO 2G38A 4O4JA 1XI1A 2RN9A 4DUYO 4B3TO 3CCQV 2B1GA 2QWOB 4X62B 2PYJA 4NTYA 4DR2B 5C8YA 3T1CA 1Q90D 4O4IB 2EIJC 3PN1A 1EN4A 2ITDC 3F7VC 3QO8A 4X64O 3MHHC 4GKJO 1VQLV 3SYQA 2DOSA 4LNUA 3HKEA 4IHJB 4LF5B 1TVKA 4F6RB 3A8TA 3TCUA 5B3SB 2ZE6A 4Z1MG 4TUYB 3G67A 3CD6V 1M90W 4JI7B 1SESA 1SQXH 2IM9A 1OCZB 3OMIB 3CCJV 2YI8A 3OEEG 2Q7HA 1YXBA 2Q0OC 2OIEA 3A0HZ 4AHCA 1AVMA 3ZHQA 2KG7B 3AG1C 3G80A 1ENVA 3H1KH 5H6QA 4FLYA 2DYRC 3EFFK 1HW7A 3CPWU 1AI7A 2ZNIA 4LF8B 1FXVA 5B1BB 2R9AA 1IZ3A 1URFA 1MSWD 3IJ4A 4GT1A 2QEXV 1HP8A 1QCEA 3JD1A 3OAAG 2YIBD 4BIUA 3OGCC 3J81N 4DV3O 3RYFA 4YIOA 2LGWA 5D5PA 4I55A 4L87A 1I5YA 1F4NA 4NKGB 4CZZA 4X1IB 3ABLB 1FJGO 2OTLV 5KX5B 4TV8A 1SS3A 3OE7G 4I4TA 3CRAA 1B6QA 1DK1A 2ZIMA 1ZL8B 1KKDA 3ZMZA 1D5NA 3AG4B 3OW2U 5B1OA 1OHHG 2QGNA 1V55B 1Y76B 5IWAB 2JJ1G 3ABMB 5D5QA 3ZMSA 4LCUC 2UXBO 3D36C 3M7MX 1MMMA 1KB9F 2IH1C 3C90A 4YJ2B 1J5EO 4JTAB 3HPLC 1I0HA 4WBNB 2AZ0A 3DSQA 3JARA 2W0FC 5HFLA 2BE3A 1SZTA 1XILA 1YJWV 2YXYA 1PD3A 3WG7B 2XAHA 3JYCA 4HYOA 1SZXA 3Q4HA 2M7WA 5CBHA 4K3AA 2VRZA 2CTQA 4LH7A 3K04A 1Y74A 1B04A 2IJJA 2P7TC 3W7TA 2JGDB 1E1RG 5LA6B 4DV0O 3JATA 5LYJB 1ZAUA 4J42A 4P30A 4JI5O 2JEXA 1I7FA 4PI2A 1JFFA 1NH2D 4LF4O 4E2LA 2HR3A 4MVRA 2Y4TA 3WU2Z 1BQZA 4J7ZA 1YHQV 1BHBA 2YIBA 4JI8B 2Y0PA 2HVJC 5EBLC 5LP6C 1E79G 1V54C 1KMIZ 1QVGU 1IXBA 3K9SA 3SPHA 3HKCB 1FXKA 2ZD9A 5CA3A 1P4RA 5CB4B 1AILA 3JALA 1N32B 2UUAO 1FFXB 3P3NA 4B3SO 4PDMA 1I5XA 3E8HA 4GX5A 4UB6Z 3A0BZ 3CRCA 2GHYA 2CTWA 1V9PA 5J2UA 5J9PC 3HKDA 4Q20A 2PTMA 4PELA 2QKSA 2EIMB 4TWKA 1SETA 1PNMA 4JYBA 2Q6AA 1GKFA 1PP9H 5EZYB 3P32A 2XOKG 1NZ6A 1RP3B 2QM4A 4UCUA 2WA4A 4XDLA 3KCYA 4LFAO 2PF4E 4YY3B 3H1IH 1CP9A 3ZEDA 4HNAA 2DN9A 4J9ZB 1R1BA 3JAWA 3VQXA 1OJHA 5GW7A 2E74B 5IYDO 3KZIZ 3CSXA 3GVMA 1SA0B 1RFYA 4RQFA 1WP7A 1FYJA 2ZR2A 2K1EA 4U3JA 4OX9B 4MVOA 4FFKA 3SYCA 1Y66A 3WFVA 1H2NA 3BAAA 4KP4A 4D7TA 4DR3B 1FFTB 3CJHA 4X1KB 5J2TB 1Q6IA 2FMLA 3JASA 5EBWC 4DR1O 1VQKV 1EN5A 4TOIA 3ZRVA 2PUSA 1Q81W 2JVDA 3E86A 4GLXA 1RPOA 4TV9A 1YJNV 1AI6A 4TQDA 3TK1A 3LDEA 4G27B 3ABUA 5EBMC 3BA9A 1VF7A 3FB7C 4QE7A 1MZEA 4PHZA 4GYCB 4H37A 2Q0AA 1F7YA 3RN4A 3MD0A 4NXNB 3JCZA 3KKYA 2XAQA 1G6UA 1WNSA 2CDYA 4IYIA 1COWG 3ZMTA 2PY5A 4FZ1A 4DR5B 3A2FA 3GWOA 1YI2V 3B8NA 3S3XA 1XNQO 4DUYB 4B3TB 3ZHRA 3ASNC 3OTFA 2X0LA 3CC4V 1KKCA 4UCVA 2NNUA 3SPGA 3BY6A 4DV5B 2YI9A 1Z2GA 2IW5A 1MOFA 3AEIA 1NKDA 3C3SA 4BR6A 1EFRG 4DV2O 5AG2A 3TJTA 3D3IA 2X6BA 2VQEB 1AB3A 5ITZB 4CC5A 1N4CA 4JZGA 4FLZA 1DLBA 1EZJA 1HNWO 3CRQA 2FB5A 4XBFA 4JI6O 2W6JG 5DN6G 4GKKO 4RUEA 5IJ9A 3CHXA 3JAKA 1IBLO 4I9WA 3RYHB 5L3CA 4I50B 2QWPB 3K58A 1R3LC 1L8DA 4JYYA 4FM1A 1N36O 5KHJA 2A06H 2LW1A 2EIJB 1H38A 1JVMA 1W0KG 1BL8A 4DV3B 4WFAV 4QPKA 5KHHA 3APQA 1FXKC 1K4CC 1EM1A 4J7JA 3SR2C 3JD2A 2P06A 3DC5A 3IFXA 2Z0AA 3E22B 2Q69A 5CA1A 2LO1A 3OR6C 4LWSB 3EVKA 4YIPA 2PYLA 2UUBB 1N0NA 1H2LA 1VQOV 2ARHA 4CBCA 5L3FA 1S0VA 4UFZA 3B09A 1XNRO 3CRMA 3FB5C 1UPGA 4X8AA 3BA8A 5B1AB 2Q7GA 4WFFA 3D8CA 2XASA 3EHBB 4F6EA 2UXBB 5IYCO 1OCOC 1J5EB 2QTOA 2WLNA 4CH3A 5CBFA 2WAMA 1XOUA 3U0ZA 5IJ0A 1JQ0A 1VQ5V 1JOYA 4EFBA 2IJIA 3MDSA 2QDOA 2GUZA 1MNGA 3IC9A 5H9CA 4GCZA 1SKVA 1CEZA 3N2GB 1NBMG 3UT5B 5CBGA 3SJAC 5LOVA 4DV0B 3LSQA 2P4KA 3JD0A 4JI5B 3T4ZA 3AG7A 3I5DA 3UKMA 2YS8A 3LDCA 3JSNA 4LF4B 4O4HA 2Q68A 3LSSA 2QM8A 1U97A 3FKSG 4J41A 2ZCEA 3T4DA 3CS5A 1LNQA 5LMNO 3OUSA 3QO5A 4PA7A 1PNKA 5FPRA 1AP5A 3CP1A 4CH5A 1LR1A 2WA3A 2JK5C 1P7GA 1ZLZA 1O9HA 5K1PA 3ASOC 4O2AA 1YSCA 2KQXA 2L6LA 1GM9A 4LF9O 2CH7A 3RBZA 1Q7YW 3ZRWB 1OCCB 1GM8A 1VQ4V 4KHPO 2A3QA 5LL6Y 1R6KA 3D3QA 3TXQA 1PKXA 4NVPA 1RM1B 4B3RO 4DV4O 4LFAB 3L74H 5LP6B 1MSDA 3DTUB 5CA0A 2WLJA 5B1NA 5KHGA 3RW0A 2HHHO 3FD9A 4WCEV 1TGOA 2W6IG 1SF9A 4I0XA 4RO2A 2MK3A 4K8XA 4FLWA 1GN3A 3N2KA 5EYPA 2AZ2A 2H3OA 4R50A 5IT9N 1RSOA 2JEUA 2JGUA 1XHXA 5LXTA 5GTHZ 4PA4A 1TA8A 2YC0A 3MAQA 3OFNG 1XL4A 4DK1A 2CGNA 4FLVA 4DR1B 5A9GA 1M56C 5C8YB 2JJ2G 5DEDA 1AJNA 3ZHUA 5B66Z 3AG3C 1KC8W 4LNUB 4ZIBA 1DF4A 4P2ZA 4CH6A 2WLLA 1TVKB 2LP7A 2X7RB 2Y69C 3SPIA 1IX9A 3WB0A 4PA9A 3DXRA 4IHJA 1PL0A 3SYAA 1Y67A 5FNVB 3B4SA 2IH3C 2XTAA 2Q5ZA 1IXMA 3LUTB 2ZR3A 3ZCCA 1FPOA 2EZPA 1FS0G 1Q86W 2EIKC 1AROP 1XNQB 4FM0A 1CXZB 3K03A 5KUMA 1MA1A 4MVSA 1J95A 5IYZA 1NU1H 4EKWA 4F4LA 2UXDO 3A0RA 2P5OA 4LF7O 2K9PA 1W59A 5H5NA 5TISZ 3K0DA 1R3JC 3RYFB 2XAJA 2VWKA 3LDDA 4AI8A 2DYSC 3GWKC 1YTFD 3BABA 3IGAC 1QR8A 3K5MA 5BZBA 2YIDA 1JJOA 4UVAA 3O65A 4DV2B 3VQWA 3RT3C 4NYKA 4TV8B 4PDLA 4X1IA 1FXHA 4I4TB 2E5LO 1VF5B 4IL6Z 1BMFG 1HNWB 4JI6B 4JTCB 1SQQH 1IBMO 2AHZA 2AW9A 4JAVA 4GKKB 1SQBH 1A32A 5BMVB 1IBLB 3RYCB 5EC2C 1GN6A 3MHSC 1ZL8A 1GH6A 4I5SA 1N36B 3IAYA 5EIBD 3FX7A 2LW7A 5EC1C 1X4TA 1VIBA 4TT3G 4EB6B 2EINC 1NVPD 4X1YB 2YEVB 5HFMA 3L73H 1L1FA 3ETQA 4H0LB 5EK0A 5KAIZ 2OCCC 4RAIA 4WBNA 3SJBC 2Q67A 5GONB 4DR6O 5JH7A 4JGSA 2L35A 1Y74B 4DV1O 1BGYH 3T1YO 2BOCC 3C3TA 3JATB 4FVMA 1P7BA 1XNRB 4JI0O 3JAMN 3OM3B 4PDRA 2DW4A 1N34O 1GO3F 4P9PA 4DYLA 2PI5A 2WWWA 1P84F 4R7CA 5E1AC 1B06A 4EFEA 1SC5B 4JYCA 1K97A 2YICA 3ZHSA 3STZC 1FXKB 3J7AU 3ABKB 3UM7A 1WA8A 3N27A 3HKBB 1OCRC 2JRIA 3JALB 3E83A 3OTOO 1TAEA 1K9MW 1EBOA 3SJCC 3EXAA 1AI5A 5CB4A 4LFBO 4W4LA 1VQNV 2A9HA 2EJ7A 5IDJA 2MW2B 4I7ZB 4UUJC 4JV5O 3X2QB 4AILC 2F4VO 2ETNA 3B2EE 4LR3A 3J80N 1B3QA 4LP8A 4NB5A 2KB1A 2WLIA 4G28B 4OGQB 2GTSA 4FIPC 1ZTEA 1WB8A 1Q3EA 2CTPA 4MS2A 1K33A 5L3EA 4JZ2A 1Q5OA 4J10A 1WJZA 2QTSA 5JCOA 1M57C 3W7UA 1FD9A 4B3MO 1KQSU 2IJKA 2ZDIA 4EEQA 5EZYA 1OZ0A 3P30A 2YIAA 3SYOA 1R3KC 1K92A 2Y48A 2BSKB 4YJ3B 5B3SC 4JTDB 1YF2A 1XMOO 4B08A 4JF3A 3CRRA 4U3JB 3K0GA 4LF9B 4Z2WA 1WPXA 4FM2A 1NTMH 1MG1A 5E79Z 1NH2B 1M93A 4DRXB 2FL4A 1K5QA 2UU9O 4KHPB 2LGQA 3KG2A 3AG2B 3CB2A 1GAXA 2GBOA 3T2MA 1M4UA 2VQFO 2VS0A 4X1KA 5J2TA 3OMAB 4YHHO 4B3RB 2HEPA 3P3PA 4TV9B 4DV4B 3FFQA 4DUZO 3ZN1A 1PM9A 3VQYA 3NXSA 3VBBA 2W0XA 4J7KA 3RYIB 1NI8A 5K1XA 2HHHB 4ZOLA 1BQ0A 1K8AW 2QKAA 1VF6A 3JSLA 1W2BU 3CCSV 3ABLC 1ZX3A 4UV9A 1QQCA 2ZE5A 1JA8A 3JCUZ 1IBKB 1YJ9V 5JVDA 2YXHA 5LGNA 2JDIG 4N21A 4PA6A 3ASOB 4UCTA 1HWYA 1PNLA 3CEIA 2QE7G 3L9DA 4PV1B 3AG4C 1HR0O 4RWUA 1NJIW 4X64B 2X6AA 1V55C 4GKJB 2Q9LA 2F93B 4FMTA 4X20B 3ABMC 1NTKH 1BSMA 4IIJA 1RPRA 4JI4O 5L3BA 3ICXA 5JQGA 5LMUO 2IBZH 4ZI7A 3WG7C 2KSDA 1Q6HA 1UFIA 1Z5WA 1JX9A 2QWRB 4JPRA 1K73W 2P4VA 1R73A 3HR0A 3K59A 3SPJA 3T1HO 2KKWA 5JJJB 1R6TA 1I08A 1H2MA 5ITZA 3FYEB 4D6TH 1H2GA 1QLEC 3QF7A 5IJ9B 2UXDB 3JAKB 3K3WA 2ODMA 3RVZA 4FLXA 4OPAA 2A79B 2V7QG 3K57A 4LF7B 1M56B 1O9GA 2XAGA 3FAVB 3R66A 2RDCA 1N0JA 4I50A 3BCCH 4B7KA 3K79A 3AG3B 3R65A 3ZMVA 1YCIA 4ABMA 1K3EA 1M9NA 2HJDA 1FJGB 1S5JA 1IURA 4ZKIA 2Y69B 4D7SA 2BTQA 4XDJA 4BW5A 3S3WA 5CA1B 2YSUB 4DW1A 1QR9A 5LHHA 3AG1B 2OCHA 2E5LB 3CYOA 1K5SA 3CE2A 3IC7A 3LSUA 4LWSA 1G1XB 2OWOA 2DYRB 2CK3G 1OV9A 4JI1O 2EILC 2EIMC 1MZFA 5EIBC 3TGUH 1KUQA 2GV9A 2R9IA 2QA4V 1VQ7V 5JCOC 1EZVH 3TXSA 4DXWA 2ZDIC 3GB7C 1AP6A 4QJFB 4FPPA 2DQ3A 2OT5A 4O2BB 4KUMA 3U10A 2YDEA 4UVCA 5KLVH 3QVNA 3G4SV 1S5LZ 3ZJZA 2DYSB 4W4KA 3RVYA 2ZXWC 4DR6B 4KXRA 4JYAO 4O4LB 4J9YB 2WSSG 4JI2O 4JI3O 1YEWA 1N8RW 1QLNA 4DV6O 4CC6A 3T1YB 2V4DA 3UT5A 5BR8O 4DR7O 2GSMB 1HDJA 4JI0B 2QM7A 4H44B 2Q73A 4O4HB 3H01A 1N34B 4H33A 1Y6XA 3AK3A 1ROPA 3L71H 4FFBA 3JD3A 1VQPV 4NXMO 3CCVV 5FLXN 3ETGA 1WB7A 1ZWIC 2EINB 2JIZG 4TQFA 1VF6C 2UUAB 4N23A 3E8FA 1LUWA 4B3SB 2PZSA 4XDKA 1TUBB 2IU3A 2Q8VA 2OCCB 3OTOB 4BAYA 3F5TA 2N04A 3E89A 1BCCH 4NTWA 4LFBB 3WB2A 2F43G 1S76D 3ETDA 4O2AB 5IY5C 2OYQA 4JV5B 3I55V 1FKAO 3ZHTA 3VOUA 4A5UB 4HZ3A 4IYHA 2CH7B 2HFEC 2UUCO 2HG5C 3ZS8C 3CC2V 4J80A 3CC7V 4BIZA 3UO3A 2E76B 5BY1A 4MTXA 1LUVA 2ADQB 1XBLA 4WFGA 1V54B 4B3MB 5LGTA 5KMGB 2F66C 1G4YB 3H9VA 4GUNA 5GTIZ 4ZHQB 4QE9A 2FTKA 2ZIOA 5FL7G 2RNBA 1YDXA 1XMOB 4WF9V 1IVSA 4QGPA 4I0XB 2NR5A 2XUMA 2BCCH 2N05A 2FKXA 4X65O 2JS3A 4O4JB 3CCMV 5LXTB 1VMGA 1VQ9V 4PDVA 1KU9A 4MVUA 1I94O 2UU9B 4JASA 2RCVA 2PI4A 2XAFA 2Q7EA 2QWQB 1VEWA 3U11A 2VQFB 3HKEB 3CX5F 4L8JA 4YHHB 4BW9A 1AJPA 4O4IA 2FYUH 2NN4A 1QVFU 4C7UA 5DM6V 1YIJV 4UVBA 4DUZB 1M57B 2P67A 2WLLB 4MVQA 4UV8A 2UXCO 2CTRA 4UB8Z 4F6RA 1FAFA 1T5EA 3DXRB 3G71V 1AR4A 4TUYA 3KCXA 2BOBC 1AR5A 4DV5O 5FNVA 2H8PC 3SYPA 1KECA 3CCLV 1NR1A 2UXXA 3DC6A 4BWAA 2KG7A 4MW8A 2VQEO 2DE0X 4P9OA 2F1MA 1XMQO 3H1JH 4RQEA 5IYZB 1HR0B 1GTOA 3ZRXA 4CS4A 1QBZA 2QWNB 4LFCO 3APOA 1JPXA 3RWRD 1VQ8V 1P49A 2P6JA 5B1AC 4I55B 1D2DA 3K06A 5LBQA 3OEHG 4JI4B 4LC1A 3I56V 1WPBA 2ADPA 5LMUB 4MSWC 4DV7O 4KL1A 1GM7A 1XUQA 5KX5A 4KFMA 3L70H 5JJNB 2D2CB 3T1HB 3B40A 4X88A 4X9QA 4WFHA 1KYOF 2UUBO 3ASNB 3B77A 1Y76A 3JARB 1N33O 5BMVA 3RYCA 3WB1A 5KUKA 4YJ2A 1DGSA 4H13B 2ZE8A 1BE3H 3K5NA 3ETEA 2WLMA 1QHTA 4EB6A 4G2KA 4X1YA 2HP8A 2YEVA 3Q4HB 5IE9A 4QIWF 2CE4A 1PL4A 5JH7B 1WP8A 3E35A 3CCRV 1NQTA 5GONA 1Q82W 1H8EG 1XEQA 2JGDA 1XREA 1JFFB 3E2EA 5LA6A 5KA5A 4JI1B 5LYJA 4X89A 2WPDG 1OCCC 2ITCC 1QLEB 3H1HH 1HNXO 4YXWG 1HNZO 2ZM6O 4LF6O 1Z5VA 1BT8A 1H2SB 1RM1C 3UO2A 3W7SA 1PPJH 1YTFB 3K9AA 3O9OA 4UCRA 1S5HC 2ATKC 1PV0A 1WA8B 2ZKOA 1H8HG 2CUGA 3E8GA 3HKCA 1IDSA 2EULA 3B8MA 4FLUA 4LBEC 3L75H 2B1IA 1S72V 3DGEA 4JYAB 2QKCA 5JWPA 4JI2B 1G8MA 1L0NH 4JI3B 3HKBA 5J2UB 1FFXA 3HKDB 4DV6B 4MW3A 2B9ZA 5BR8B 4DR7B 5KA6A 4K35A 2M6YA 2WLIB 4X66O 4DR4O 3JD4A 1AJQA 1BZKA 1K34A 4ICGA 4OPHA 5LMNB 3STLC 3K5LA 2EILB 5C93A 2P90A 3ZN0A 2Q4PA 1OCOB 2CGOA 2YXLA 2Z5UA 1NVPB 4NXMB 4HNAB 5L3DA 2E75B 2Z3YA 3FYIB 3VQVA 3JAWB 4Q6GA 1KP3A 2R9RB 3BRCA 4QNHB 2QSAA 1DTOA 1M1KW 4HAMA 1XDCA 1JR9A 3PJSK 5A2QN 1Y4MA 4FLTA 5B5EZ
chains in the Genus database with same CATH topology
4AQYO 2UXCO 1XNQO 1XNRO 5LL6Y 4LF7O 4DUZO 3SDLA 1DK1A 2DJVA 4DR5O 1IBKO 5H5NA 4B3RO 4DV4O 3F5TA 4DV5O 3J7AU 4K0KO 4DUYO 4B3TO 1XEQA 2N74A 2JRIA 2UXBO 3OTOO 1FKAO 4A5UB 1J5EO 4LFAO 2VQEO 5IWAO 3O65A 2HHHO 1NS1A 4X64O 3RT3C 1XMQO 4GKJO 4LFBO 1G1XB 4X62O 1R1BA 2DOSA 4DR2O 2UUCO 1HNXO 4JV5O 4JI1O 1X59A 2F4VO 1HNZO 4LFCO 2ZM6O 4LF6O 3J80N 4YY3O 4DV2O 2E5LO 1KUQA 1YZBA 5BY1A 1HR0O 1AB3A 5IT9N 1FYJA 4LF5O 1IBMO 1D2DA 1A32A 5BXZA 2ZKOA 1HNWO 4JI6O 4DV0O 4B3MO 2LW7A 4JI7O 4GKKO 4JI5O 4OX9O 4JI4O 1IBLO 4DV7O 4DR1O 5LMNO 1N36O 4LF4O 4JYAO 4DR3O 5LMUO 4JI2O 4JI3O 1XMOO 2FKXA 4X65O 4DV6O 2UXDO 4DR6O 4X66O 4DR4O 2UUBO 1I94O 4OPHA 4LF8O 5BR8O 2Z0AA 3J81N 4DV3O 4JI8O 4DR7O 3T1HO 4DV1O 3M8AA 1R6TA 3T1YO 1F7YA 1AILA 1N33O 2UU9O 4LF9O 2UUAO 4OPAA 4B3SO 4JI0O 1FJGO 3JAMN 4NXMO 2AGAA 1N34O 2VQFO 5FLXN 5A2QN 4NXNO 4KHPO 3R66A 1N32O 4YHHO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY O;  2UXC O;  1XNQ O;  1XNR O;  5LL6 Y;  4LF7 O;  4DUZ O;  3SDL A;  1DK1 A;  2DJV A;  4DR5 O;  1IBK O;  5H5N A;  4B3R O;  4DV4 O;  3F5T A;  4DV5 O;  3J7A U;  4K0K O;  4DUY O;  4B3T O;  1XEQ A;  2N74 A;  2JRI A;  2UXB O;  3OTO O;  1FKA O;  4A5U B;  1J5E O;  4LFA O;  2VQE O;  5IWA O;  3O65 A;  2HHH O;  1NS1 A;  4X64 O;  3RT3 C;  1XMQ O;  4GKJ O;  4LFB O;  1G1X B;  4X62 O;  1R1B A;  2DOS A;  4DR2 O;  2UUC O;  1HNX O;  4JV5 O;  4JI1 O;  1X59 A;  2F4V O;  1HNZ O;  4LFC O;  2ZM6 O;  4LF6 O;  3J80 N;  4YY3 O;  4DV2 O;  2E5L O;  1KUQ A;  1YZB A;  5BY1 A;  1HR0 O;  1AB3 A;  5IT9 N;  1FYJ A;  4LF5 O;  1IBM O;  1D2D A;  1A32 A;  5BXZ A;  2ZKO A;  1HNW O;  4JI6 O;  4DV0 O;  4B3M O;  2LW7 A;  4JI7 O;  4GKK O;  4JI5 O;  4OX9 O;  4JI4 O;  1IBL O;  4DV7 O;  4DR1 O;  5LMN O;  1N36 O;  4LF4 O;  4JYA O;  4DR3 O;  5LMU O;  4JI2 O;  4JI3 O;  1XMO O;  2FKX A;  4X65 O;  4DV6 O;  2UXD O;  4DR6 O;  4X66 O;  4DR4 O;  2UUB O;  1I94 O;  4OPH A;  4LF8 O;  5BR8 O;  2Z0A A;  3J81 N;  4DV3 O;  4JI8 O;  4DR7 O;  3T1H O;  4DV1 O;  3M8A A;  1R6T A;  3T1Y O;  1F7Y A;  1AIL A;  1N33 O;  2UU9 O;  4LF9 O;  2UUA O;  4OPA A;  4B3S O;  4JI0 O;  1FJG O;  3JAM N;  4NXM O;  2AGA A;  1N34 O;  2VQF O;  5FLX N;  5A2Q N;  4NXN O;  4KHP O;  3R66 A;  1N32 O;  4YHH O; 
#chains in the Genus database with same CATH topology
 4AQY O;  1E1Q G;  1OCZ C;  1SA0 A;  4RUF A;  3CXC U;  1SQV H;  2PGG A;  2ZXW B;  2BSK A;  4YJ3 A;  1W0J G;  2LJ2 A;  5KHI A;  4U3F H;  2RMK B;  3AK1 A;  3OMN B;  3CJH B;  4K0K O;  3CCE V;  1SER A;  3JAS B;  4R6Z A;  2UUC B;  2HVK C;  1THZ A;  1YVW A;  3G6B A;  5B1B C;  3FB8 C;  4DRX A;  4X62 O;  5CMU A;  4DR2 O;  1CPY A;  3G6E V;  4GZR B;  1D5A A;  2LFS A;  1YZB A;  3ZBH A;  1AI4 A;  4DW0 A;  4FK5 C;  3CME V;  4LF5 O;  3FB6 C;  1U96 A;  4ZOL B;  3H1L H;  5DEC A;  1WN7 A;  4UCS A;  3BHP A;  4NR1 A;  4U7N A;  2ZT9 B;  3RYI A;  4JI7 O;  3NR7 A;  4X65 B;  5JVD B;  2HJF C;  3QTC A;  1VP7 A;  5IY5 B;  3OT7 A;  1I94 B;  4PI0 A;  1Q43 A;  1SQP H;  1H2K A;  1UJW B;  1DF5 A;  4FJC C;  3RGB A;  4Z1V A;  2P22 C;  1WAZ A;  4WFB V;  3BFR A;  1ZUQ A;  3LNM B;  3CCU V;  1GRJ A;  4LF8 O;  2WLK A;  1SQF A;  1GMG A;  4IIJ B;  1NTZ H;  3OD4 A;  2R72 A;  3HB3 B;  2Y4U A;  4X20 A;  2UXC B;  4IT5 A;  1EN6 A;  3M99 B;  3UCS C;  4UXN A;  2E3C A;  3W7W A;  1GN2 A;  5JQG B;  2QJ1 A;  1S77 D;  4ZI7 B;  4CS3 A;  3TET A;  3SDL A;  4GX0 A;  5LHG A;  1XL6 A;  2GDS A;  2X6C A;  1XQ8 A;  2C2A A;  2HLD G;  1ORQ C;  1XMQ B;  1VQM V;  5LGU A;  2OIG A;  3OR7 C;  4GX2 A;  3K5O A;  2DWE C;  1R6N A;  4LFC B;  2ILM A;  3BVO A;  5IWA O;  4I9Q A;  3RYH A;  5FPO A;  4MTG A;  3QO7 A;  4BIO A;  2DQ0 A;  3ZMU A;  3SJQ C;  3E8B A;  3ZRS A;  4PJ0 Z;  3BEH A;  2R70 A;  3FAV A;  2F95 B;  4CS2 A;  2HKO A;  4MT8 A;  2Y0I A;  5L3G A;  1KD1 W;  4ZBM A;  3ABK C;  2BTQ B;  4J11 A;  3E22 A;  5BXZ A;  1KBH A;  4MTF A;  4DV7 B;  3CMA V;  4JAA A;  4CH4 A;  1JMK C;  3THO A;  2QR4 A;  1TUE B;  1YIT V;  2AXT Z;  1GN4 A;  1IBM B;  1BHA A;  2ZE7 A;  2EIK B;  4PD4 F;  3X2Q C;  1F23 A;  1AR1 B;  4GX1 A;  2DMX A;  2LQT A;  3AK2 A;  4OXS A;  1NR7 A;  2IU0 A;  1N33 B;  3W7X A;  5IJ0 B;  4JI8 O;  5CN0 A;  3L72 H;  2YUA A;  2GUZ B;  2RJZ A;  2IJH A;  3BPZ A;  3ZIA G;  3QG5 A;  1SRY A;  4MTO A;  4O2B A;  3OGI B;  2AGA A;  4DV1 B;  1QU7 A;  1GK9 A;  1MAB G;  4TSF G;  5LOV B;  1N32 O;  3N2G A;  5IYB O;  4QPJ A;  1F51 A;  2A7W A;  4O4L A;  5KAF Z;  3F5W C;  1QNM A;  4LH6 A;  2ZNJ A;  4DK0 A;  4HBN A;  2EBO A;  2EX3 A;  5JJE B;  2NLJ C;  3K08 A;  3ML0 A;  1NT2 B;  2N74 A;  3ZHV A;  1HNX B;  3AG2 C;  2OTJ V;  4DO2 A;  1Q8I A;  1HNZ B;  1VAR A;  2ZM6 B;  4LF6 B;  1L0L H;  1NS1 A;  4FFB B;  2B5U A;  2UXN A;  4NTX A;  4K8Z A;  1X59 A;  3D36 A;  1VQ6 V;  4YY3 O;  1JJ2 U;  1WLE A;  2XT9 A;  4WFE A;  5F2V O;  4UCO A;  3CXH F;  4FZ0 A;  1K7D A;  2F4V B;  3UQ8 A;  2XND G;  4PA3 A;  1TUB A;  5LHI A;  4MVZ A;  2EZO A;  2ZIN A;  4OX9 O;  3OUF A;  1R3I C;  5H6R A;  2EJR A;  2DWD C;  4X66 B;  4DR4 B;  3LNN A;  5H2F Z;  4DR3 O;  3ZRW A;  3ABT A;  4MVM A;  3SGI A;  2JS5 A;  2XHB A;  2A0L A;  2VWJ A;  2GTA A;  1JCH A;  2LFR A;  2AHY A;  5CA0 B;  2F23 A;  1BS3 A;  2H94 A;  3SPC A;  1S3J A;  2V1D A;  2BTO A;  2CAZ C;  3M8A A;  4ASU G;  2O57 A;  4IGG A;  4R8C A;  4U7O A;  5LP6 A;  1XHZ A;  1SQG A;  3RFR A;  3QNE A;  5KMG A;  1OCR B;  1ZSP A;  1M5I A;  2ZQM A;  4AQY B;  2RQ6 A;  3F7Y C;  4ZHQ A;  3N2K B;  4JAU A;  5EYP B;  4E4E A;  4B7E A;  4NXN O;  1RSO B;  1Q6U A;  2D3O W;  1KP2 A;  3CWB H;  5KHK A;  1K4D C;  4K0K B;  1US6 A;  1F4M A;  2DJV A;  2WLH A;  3ZX6 A;  4DR5 O;  1IBK O;  2G38 A;  4O4J A;  1XI1 A;  2RN9 A;  4DUY O;  4B3T O;  3CCQ V;  2B1G A;  2QWO B;  4X62 B;  2PYJ A;  4NTY A;  4DR2 B;  5C8Y A;  3T1C A;  1Q90 D;  4O4I B;  2EIJ C;  3PN1 A;  1EN4 A;  2ITD C;  3F7V C;  3QO8 A;  4X64 O;  3MHH C;  4GKJ O;  1VQL V;  3SYQ A;  2DOS A;  4LNU A;  3HKE A;  4IHJ B;  4LF5 B;  1TVK A;  4F6R B;  3A8T A;  3TCU A;  5B3S B;  2ZE6 A;  4Z1M G;  4TUY B;  3G67 A;  3CD6 V;  1M90 W;  4JI7 B;  1SES A;  1SQX H;  2IM9 A;  1OCZ B;  3OMI B;  3CCJ V;  2YI8 A;  3OEE G;  2Q7H A;  1YXB A;  2Q0O C;  2OIE A;  3A0H Z;  4AHC A;  1AVM A;  3ZHQ A;  2KG7 B;  3AG1 C;  3G80 A;  1ENV A;  3H1K H;  5H6Q A;  4FLY A;  2DYR C;  3EFF K;  1HW7 A;  3CPW U;  1AI7 A;  2ZNI A;  4LF8 B;  1FXV A;  5B1B B;  2R9A A;  1IZ3 A;  1URF A;  1MSW D;  3IJ4 A;  4GT1 A;  2QEX V;  1HP8 A;  1QCE A;  3JD1 A;  3OAA G;  2YIB D;  4BIU A;  3OGC C;  3J81 N;  4DV3 O;  3RYF A;  4YIO A;  2LGW A;  5D5P A;  4I55 A;  4L87 A;  1I5Y A;  1F4N A;  4NKG B;  4CZZ A;  4X1I B;  3ABL B;  1FJG O;  2OTL V;  5KX5 B;  4TV8 A;  1SS3 A;  3OE7 G;  4I4T A;  3CRA A;  1B6Q A;  1DK1 A;  2ZIM A;  1ZL8 B;  1KKD A;  3ZMZ A;  1D5N A;  3AG4 B;  3OW2 U;  5B1O A;  1OHH G;  2QGN A;  1V55 B;  1Y76 B;  5IWA B;  2JJ1 G;  3ABM B;  5D5Q A;  3ZMS A;  4LCU C;  2UXB O;  3D36 C;  3M7M X;  1MMM A;  1KB9 F;  2IH1 C;  3C90 A;  4YJ2 B;  1J5E O;  4JTA B;  3HPL C;  1I0H A;  4WBN B;  2AZ0 A;  3DSQ A;  3JAR A;  2W0F C;  5HFL A;  2BE3 A;  1SZT A;  1XIL A;  1YJW V;  2YXY A;  1PD3 A;  3WG7 B;  2XAH A;  3JYC A;  4HYO A;  1SZX A;  3Q4H A;  2M7W A;  5CBH A;  4K3A A;  2VRZ A;  2CTQ A;  4LH7 A;  3K04 A;  1Y74 A;  1B04 A;  2IJJ A;  2P7T C;  3W7T A;  2JGD B;  1E1R G;  5LA6 B;  4DV0 O;  3JAT A;  5LYJ B;  1ZAU A;  4J42 A;  4P30 A;  4JI5 O;  2JEX A;  1I7F A;  4PI2 A;  1JFF A;  1NH2 D;  4LF4 O;  4E2L A;  2HR3 A;  4MVR A;  2Y4T A;  3WU2 Z;  1BQZ A;  4J7Z A;  1YHQ V;  1BHB A;  2YIB A;  4JI8 B;  2Y0P A;  2HVJ C;  5EBL C;  5LP6 C;  1E79 G;  1V54 C;  1KMI Z;  1QVG U;  1IXB A;  3K9S A;  3SPH A;  3HKC B;  1FXK A;  2ZD9 A;  5CA3 A;  1P4R A;  5CB4 B;  1AIL A;  3JAL A;  1N32 B;  2UUA O;  1FFX B;  3P3N A;  4B3S O;  4PDM A;  1I5X A;  3E8H A;  4GX5 A;  4UB6 Z;  3A0B Z;  3CRC A;  2GHY A;  2CTW A;  1V9P A;  5J2U A;  5J9P C;  3HKD A;  4Q20 A;  2PTM A;  4PEL A;  2QKS A;  2EIM B;  4TWK A;  1SET A;  1PNM A;  4JYB A;  2Q6A A;  1GKF A;  1PP9 H;  5EZY B;  3P32 A;  2XOK G;  1NZ6 A;  1RP3 B;  2QM4 A;  4UCU A;  2WA4 A;  4XDL A;  3KCY A;  4LFA O;  2PF4 E;  4YY3 B;  3H1I H;  1CP9 A;  3ZED A;  4HNA A;  2DN9 A;  4J9Z B;  1R1B A;  3JAW A;  3VQX A;  1OJH A;  5GW7 A;  2E74 B;  5IYD O;  3KZI Z;  3CSX A;  3GVM A;  1SA0 B;  1RFY A;  4RQF A;  1WP7 A;  1FYJ A;  2ZR2 A;  2K1E A;  4U3J A;  4OX9 B;  4MVO A;  4FFK A;  3SYC A;  1Y66 A;  3WFV A;  1H2N A;  3BAA A;  4KP4 A;  4D7T A;  4DR3 B;  1FFT B;  3CJH A;  4X1K B;  5J2T B;  1Q6I A;  2FML A;  3JAS A;  5EBW C;  4DR1 O;  1VQK V;  1EN5 A;  4TOI A;  3ZRV A;  2PUS A;  1Q81 W;  2JVD A;  3E86 A;  4GLX A;  1RPO A;  4TV9 A;  1YJN V;  1AI6 A;  4TQD A;  3TK1 A;  3LDE A;  4G27 B;  3ABU A;  5EBM C;  3BA9 A;  1VF7 A;  3FB7 C;  4QE7 A;  1MZE A;  4PHZ A;  4GYC B;  4H37 A;  2Q0A A;  1F7Y A;  3RN4 A;  3MD0 A;  4NXN B;  3JCZ A;  3KKY A;  2XAQ A;  1G6U A;  1WNS A;  2CDY A;  4IYI A;  1COW G;  3ZMT A;  2PY5 A;  4FZ1 A;  4DR5 B;  3A2F A;  3GWO A;  1YI2 V;  3B8N A;  3S3X A;  1XNQ O;  4DUY B;  4B3T B;  3ZHR A;  3ASN C;  3OTF A;  2X0L A;  3CC4 V;  1KKC A;  4UCV A;  2NNU A;  3SPG A;  3BY6 A;  4DV5 B;  2YI9 A;  1Z2G A;  2IW5 A;  1MOF A;  3AEI A;  1NKD A;  3C3S A;  4BR6 A;  1EFR G;  4DV2 O;  5AG2 A;  3TJT A;  3D3I A;  2X6B A;  2VQE B;  1AB3 A;  5ITZ B;  4CC5 A;  1N4C A;  4JZG A;  4FLZ A;  1DLB A;  1EZJ A;  1HNW O;  3CRQ A;  2FB5 A;  4XBF A;  4JI6 O;  2W6J G;  5DN6 G;  4GKK O;  4RUE A;  5IJ9 A;  3CHX A;  3JAK A;  1IBL O;  4I9W A;  3RYH B;  5L3C A;  4I50 B;  2QWP B;  3K58 A;  1R3L C;  1L8D A;  4JYY A;  4FM1 A;  1N36 O;  5KHJ A;  2A06 H;  2LW1 A;  2EIJ B;  1H38 A;  1JVM A;  1W0K G;  1BL8 A;  4DV3 B;  4WFA V;  4QPK A;  5KHH A;  3APQ A;  1FXK C;  1K4C C;  1EM1 A;  4J7J A;  3SR2 C;  3JD2 A;  2P06 A;  3DC5 A;  3IFX A;  2Z0A A;  3E22 B;  2Q69 A;  5CA1 A;  2LO1 A;  3OR6 C;  4LWS B;  3EVK A;  4YIP A;  2PYL A;  2UUB B;  1N0N A;  1H2L A;  1VQO V;  2ARH A;  4CBC A;  5L3F A;  1S0V A;  4UFZ A;  3B09 A;  1XNR O;  3CRM A;  3FB5 C;  1UPG A;  4X8A A;  3BA8 A;  5B1A B;  2Q7G A;  4WFF A;  3D8C A;  2XAS A;  3EHB B;  4F6E A;  2UXB B;  5IYC O;  1OCO C;  1J5E B;  2QTO A;  2WLN A;  4CH3 A;  5CBF A;  2WAM A;  1XOU A;  3U0Z A;  5IJ0 A;  1JQ0 A;  1VQ5 V;  1JOY A;  4EFB A;  2IJI A;  3MDS A;  2QDO A;  2GUZ A;  1MNG A;  3IC9 A;  5H9C A;  4GCZ A;  1SKV A;  1CEZ A;  3N2G B;  1NBM G;  3UT5 B;  5CBG A;  3SJA C;  5LOV A;  4DV0 B;  3LSQ A;  2P4K A;  3JD0 A;  4JI5 B;  3T4Z A;  3AG7 A;  3I5D A;  3UKM A;  2YS8 A;  3LDC A;  3JSN A;  4LF4 B;  4O4H A;  2Q68 A;  3LSS A;  2QM8 A;  1U97 A;  3FKS G;  4J41 A;  2ZCE A;  3T4D A;  3CS5 A;  1LNQ A;  5LMN O;  3OUS A;  3QO5 A;  4PA7 A;  1PNK A;  5FPR A;  1AP5 A;  3CP1 A;  4CH5 A;  1LR1 A;  2WA3 A;  2JK5 C;  1P7G A;  1ZLZ A;  1O9H A;  5K1P A;  3ASO C;  4O2A A;  1YSC A;  2KQX A;  2L6L A;  1GM9 A;  4LF9 O;  2CH7 A;  3RBZ A;  1Q7Y W;  3ZRW B;  1OCC B;  1GM8 A;  1VQ4 V;  4KHP O;  2A3Q A;  5LL6 Y;  1R6K A;  3D3Q A;  3TXQ A;  1PKX A;  4NVP A;  1RM1 B;  4B3R O;  4DV4 O;  4LFA B;  3L74 H;  5LP6 B;  1MSD A;  3DTU B;  5CA0 A;  2WLJ A;  5B1N A;  5KHG A;  3RW0 A;  2HHH O;  3FD9 A;  4WCE V;  1TGO A;  2W6I G;  1SF9 A;  4I0X A;  4RO2 A;  2MK3 A;  4K8X A;  4FLW A;  1GN3 A;  3N2K A;  5EYP A;  2AZ2 A;  2H3O A;  4R50 A;  5IT9 N;  1RSO A;  2JEU A;  2JGU A;  1XHX A;  5LXT A;  5GTH Z;  4PA4 A;  1TA8 A;  2YC0 A;  3MAQ A;  3OFN G;  1XL4 A;  4DK1 A;  2CGN A;  4FLV A;  4DR1 B;  5A9G A;  1M56 C;  5C8Y B;  2JJ2 G;  5DED A;  1AJN A;  3ZHU A;  5B66 Z;  3AG3 C;  1KC8 W;  4LNU B;  4ZIB A;  1DF4 A;  4P2Z A;  4CH6 A;  2WLL A;  1TVK B;  2LP7 A;  2X7R B;  2Y69 C;  3SPI A;  1IX9 A;  3WB0 A;  4PA9 A;  3DXR A;  4IHJ A;  1PL0 A;  3SYA A;  1Y67 A;  5FNV B;  3B4S A;  2IH3 C;  2XTA A;  2Q5Z A;  1IXM A;  3LUT B;  2ZR3 A;  3ZCC A;  1FPO A;  2EZP A;  1FS0 G;  1Q86 W;  2EIK C;  1ARO P;  1XNQ B;  4FM0 A;  1CXZ B;  3K03 A;  5KUM A;  1MA1 A;  4MVS A;  1J95 A;  5IYZ A;  1NU1 H;  4EKW A;  4F4L A;  2UXD O;  3A0R A;  2P5O A;  4LF7 O;  2K9P A;  1W59 A;  5H5N A;  5TIS Z;  3K0D A;  1R3J C;  3RYF B;  2XAJ A;  2VWK A;  3LDD A;  4AI8 A;  2DYS C;  3GWK C;  1YTF D;  3BAB A;  3IGA C;  1QR8 A;  3K5M A;  5BZB A;  2YID A;  1JJO A;  4UVA A;  3O65 A;  4DV2 B;  3VQW A;  3RT3 C;  4NYK A;  4TV8 B;  4PDL A;  4X1I A;  1FXH A;  4I4T B;  2E5L O;  1VF5 B;  4IL6 Z;  1BMF G;  1HNW B;  4JI6 B;  4JTC B;  1SQQ H;  1IBM O;  2AHZ A;  2AW9 A;  4JAV A;  4GKK B;  1SQB H;  1A32 A;  5BMV B;  1IBL B;  3RYC B;  5EC2 C;  1GN6 A;  3MHS C;  1ZL8 A;  1GH6 A;  4I5S A;  1N36 B;  3IAY A;  5EIB D;  3FX7 A;  2LW7 A;  5EC1 C;  1X4T A;  1VIB A;  4TT3 G;  4EB6 B;  2EIN C;  1NVP D;  4X1Y B;  2YEV B;  5HFM A;  3L73 H;  1L1F A;  3ETQ A;  4H0L B;  5EK0 A;  5KAI Z;  2OCC C;  4RAI A;  4WBN A;  3SJB C;  2Q67 A;  5GON B;  4DR6 O;  5JH7 A;  4JGS A;  2L35 A;  1Y74 B;  4DV1 O;  1BGY H;  3T1Y O;  2BOC C;  3C3T A;  3JAT B;  4FVM A;  1P7B A;  1XNR B;  4JI0 O;  3JAM N;  3OM3 B;  4PDR A;  2DW4 A;  1N34 O;  1GO3 F;  4P9P A;  4DYL A;  2PI5 A;  2WWW A;  1P84 F;  4R7C A;  5E1A C;  1B06 A;  4EFE A;  1SC5 B;  4JYC A;  1K97 A;  2YIC A;  3ZHS A;  3STZ C;  1FXK B;  3J7A U;  3ABK B;  3UM7 A;  1WA8 A;  3N27 A;  3HKB B;  1OCR C;  2JRI A;  3JAL B;  3E83 A;  3OTO O;  1TAE A;  1K9M W;  1EBO A;  3SJC C;  3EXA A;  1AI5 A;  5CB4 A;  4LFB O;  4W4L A;  1VQN V;  2A9H A;  2EJ7 A;  5IDJ A;  2MW2 B;  4I7Z B;  4UUJ C;  4JV5 O;  3X2Q B;  4AIL C;  2F4V O;  2ETN A;  3B2E E;  4LR3 A;  3J80 N;  1B3Q A;  4LP8 A;  4NB5 A;  2KB1 A;  2WLI A;  4G28 B;  4OGQ B;  2GTS A;  4FIP C;  1ZTE A;  1WB8 A;  1Q3E A;  2CTP A;  4MS2 A;  1K33 A;  5L3E A;  4JZ2 A;  1Q5O A;  4J10 A;  1WJZ A;  2QTS A;  5JCO A;  1M57 C;  3W7U A;  1FD9 A;  4B3M O;  1KQS U;  2IJK A;  2ZDI A;  4EEQ A;  5EZY A;  1OZ0 A;  3P30 A;  2YIA A;  3SYO A;  1R3K C;  1K92 A;  2Y48 A;  2BSK B;  4YJ3 B;  5B3S C;  4JTD B;  1YF2 A;  1XMO O;  4B08 A;  4JF3 A;  3CRR A;  4U3J B;  3K0G A;  4LF9 B;  4Z2W A;  1WPX A;  4FM2 A;  1NTM H;  1MG1 A;  5E79 Z;  1NH2 B;  1M93 A;  4DRX B;  2FL4 A;  1K5Q A;  2UU9 O;  4KHP B;  2LGQ A;  3KG2 A;  3AG2 B;  3CB2 A;  1GAX A;  2GBO A;  3T2M A;  1M4U A;  2VQF O;  2VS0 A;  4X1K A;  5J2T A;  3OMA B;  4YHH O;  4B3R B;  2HEP A;  3P3P A;  4TV9 B;  4DV4 B;  3FFQ A;  4DUZ O;  3ZN1 A;  1PM9 A;  3VQY A;  3NXS A;  3VBB A;  2W0X A;  4J7K A;  3RYI B;  1NI8 A;  5K1X A;  2HHH B;  4ZOL A;  1BQ0 A;  1K8A W;  2QKA A;  1VF6 A;  3JSL A;  1W2B U;  3CCS V;  3ABL C;  1ZX3 A;  4UV9 A;  1QQC A;  2ZE5 A;  1JA8 A;  3JCU Z;  1IBK B;  1YJ9 V;  5JVD A;  2YXH A;  5LGN A;  2JDI G;  4N21 A;  4PA6 A;  3ASO B;  4UCT A;  1HWY A;  1PNL A;  3CEI A;  2QE7 G;  3L9D A;  4PV1 B;  3AG4 C;  1HR0 O;  4RWU A;  1NJI W;  4X64 B;  2X6A A;  1V55 C;  4GKJ B;  2Q9L A;  2F93 B;  4FMT A;  4X20 B;  3ABM C;  1NTK H;  1BSM A;  4IIJ A;  1RPR A;  4JI4 O;  5L3B A;  3ICX A;  5JQG A;  5LMU O;  2IBZ H;  4ZI7 A;  3WG7 C;  2KSD A;  1Q6H A;  1UFI A;  1Z5W A;  1JX9 A;  2QWR B;  4JPR A;  1K73 W;  2P4V A;  1R73 A;  3HR0 A;  3K59 A;  3SPJ A;  3T1H O;  2KKW A;  5JJJ B;  1R6T A;  1I08 A;  1H2M A;  5ITZ A;  3FYE B;  4D6T H;  1H2G A;  1QLE C;  3QF7 A;  5IJ9 B;  2UXD B;  3JAK B;  3K3W A;  2ODM A;  3RVZ A;  4FLX A;  4OPA A;  2A79 B;  2V7Q G;  3K57 A;  4LF7 B;  1M56 B;  1O9G A;  2XAG A;  3FAV B;  3R66 A;  2RDC A;  1N0J A;  4I50 A;  3BCC H;  4B7K A;  3K79 A;  3AG3 B;  3R65 A;  3ZMV A;  1YCI A;  4ABM A;  1K3E A;  1M9N A;  2HJD A;  1FJG B;  1S5J A;  1IUR A;  4ZKI A;  2Y69 B;  4D7S A;  2BTQ A;  4XDJ A;  4BW5 A;  3S3W A;  5CA1 B;  2YSU B;  4DW1 A;  1QR9 A;  5LHH A;  3AG1 B;  2OCH A;  2E5L B;  3CYO A;  1K5S A;  3CE2 A;  3IC7 A;  3LSU A;  4LWS A;  1G1X B;  2OWO A;  2DYR B;  2CK3 G;  1OV9 A;  4JI1 O;  2EIL C;  2EIM C;  1MZF A;  5EIB C;  3TGU H;  1KUQ A;  2GV9 A;  2R9I A;  2QA4 V;  1VQ7 V;  5JCO C;  1EZV H;  3TXS A;  4DXW A;  2ZDI C;  3GB7 C;  1AP6 A;  4QJF B;  4FPP A;  2DQ3 A;  2OT5 A;  4O2B B;  4KUM A;  3U10 A;  2YDE A;  4UVC A;  5KLV H;  3QVN A;  3G4S V;  1S5L Z;  3ZJZ A;  2DYS B;  4W4K A;  3RVY A;  2ZXW C;  4DR6 B;  4KXR A;  4JYA O;  4O4L B;  4J9Y B;  2WSS G;  4JI2 O;  4JI3 O;  1YEW A;  1N8R W;  1QLN A;  4DV6 O;  4CC6 A;  3T1Y B;  2V4D A;  3UT5 A;  5BR8 O;  4DR7 O;  2GSM B;  1HDJ A;  4JI0 B;  2QM7 A;  4H44 B;  2Q73 A;  4O4H B;  3H01 A;  1N34 B;  4H33 A;  1Y6X A;  3AK3 A;  1ROP A;  3L71 H;  4FFB A;  3JD3 A;  1VQP V;  4NXM O;  3CCV V;  5FLX N;  3ETG A;  1WB7 A;  1ZWI C;  2EIN B;  2JIZ G;  4TQF A;  1VF6 C;  2UUA B;  4N23 A;  3E8F A;  1LUW A;  4B3S B;  2PZS A;  4XDK A;  1TUB B;  2IU3 A;  2Q8V A;  2OCC B;  3OTO B;  4BAY A;  3F5T A;  2N04 A;  3E89 A;  1BCC H;  4NTW A;  4LFB B;  3WB2 A;  2F43 G;  1S76 D;  3ETD A;  4O2A B;  5IY5 C;  2OYQ A;  4JV5 B;  3I55 V;  1FKA O;  3ZHT A;  3VOU A;  4A5U B;  4HZ3 A;  4IYH A;  2CH7 B;  2HFE C;  2UUC O;  2HG5 C;  3ZS8 C;  3CC2 V;  4J80 A;  3CC7 V;  4BIZ A;  3UO3 A;  2E76 B;  5BY1 A;  4MTX A;  1LUV A;  2ADQ B;  1XBL A;  4WFG A;  1V54 B;  4B3M B;  5LGT A;  5KMG B;  2F66 C;  1G4Y B;  3H9V A;  4GUN A;  5GTI Z;  4ZHQ B;  4QE9 A;  2FTK A;  2ZIO A;  5FL7 G;  2RNB A;  1YDX A;  1XMO B;  4WF9 V;  1IVS A;  4QGP A;  4I0X B;  2NR5 A;  2XUM A;  2BCC H;  2N05 A;  2FKX A;  4X65 O;  2JS3 A;  4O4J B;  3CCM V;  5LXT B;  1VMG A;  1VQ9 V;  4PDV A;  1KU9 A;  4MVU A;  1I94 O;  2UU9 B;  4JAS A;  2RCV A;  2PI4 A;  2XAF A;  2Q7E A;  2QWQ B;  1VEW A;  3U11 A;  2VQF B;  3HKE B;  3CX5 F;  4L8J A;  4YHH B;  4BW9 A;  1AJP A;  4O4I A;  2FYU H;  2NN4 A;  1QVF U;  4C7U A;  5DM6 V;  1YIJ V;  4UVB A;  4DUZ B;  1M57 B;  2P67 A;  2WLL B;  4MVQ A;  4UV8 A;  2UXC O;  2CTR A;  4UB8 Z;  4F6R A;  1FAF A;  1T5E A;  3DXR B;  3G71 V;  1AR4 A;  4TUY A;  3KCX A;  2BOB C;  1AR5 A;  4DV5 O;  5FNV A;  2H8P C;  3SYP A;  1KEC A;  3CCL V;  1NR1 A;  2UXX A;  3DC6 A;  4BWA A;  2KG7 A;  4MW8 A;  2VQE O;  2DE0 X;  4P9O A;  2F1M A;  1XMQ O;  3H1J H;  4RQE A;  5IYZ B;  1HR0 B;  1GTO A;  3ZRX A;  4CS4 A;  1QBZ A;  2QWN B;  4LFC O;  3APO A;  1JPX A;  3RWR D;  1VQ8 V;  1P49 A;  2P6J A;  5B1A C;  4I55 B;  1D2D A;  3K06 A;  5LBQ A;  3OEH G;  4JI4 B;  4LC1 A;  3I56 V;  1WPB A;  2ADP A;  5LMU B;  4MSW C;  4DV7 O;  4KL1 A;  1GM7 A;  1XUQ A;  5KX5 A;  4KFM A;  3L70 H;  5JJN B;  2D2C B;  3T1H B;  3B40 A;  4X88 A;  4X9Q A;  4WFH A;  1KYO F;  2UUB O;  3ASN B;  3B77 A;  1Y76 A;  3JAR B;  1N33 O;  5BMV A;  3RYC A;  3WB1 A;  5KUK A;  4YJ2 A;  1DGS A;  4H13 B;  2ZE8 A;  1BE3 H;  3K5N A;  3ETE A;  2WLM A;  1QHT A;  4EB6 A;  4G2K A;  4X1Y A;  2HP8 A;  2YEV A;  3Q4H B;  5IE9 A;  4QIW F;  2CE4 A;  1PL4 A;  5JH7 B;  1WP8 A;  3E35 A;  3CCR V;  1NQT A;  5GON A;  1Q82 W;  1H8E G;  1XEQ A;  2JGD A;  1XRE A;  1JFF B;  3E2E A;  5LA6 A;  5KA5 A;  4JI1 B;  5LYJ A;  4X89 A;  2WPD G;  1OCC C;  2ITC C;  1QLE B;  3H1H H;  1HNX O;  4YXW G;  1HNZ O;  2ZM6 O;  4LF6 O;  1Z5V A;  1BT8 A;  1H2S B;  1RM1 C;  3UO2 A;  3W7S A;  1PPJ H;  1YTF B;  3K9A A;  3O9O A;  4UCR A;  1S5H C;  2ATK C;  1PV0 A;  1WA8 B;  2ZKO A;  1H8H G;  2CUG A;  3E8G A;  3HKC A;  1IDS A;  2EUL A;  3B8M A;  4FLU A;  4LBE C;  3L75 H;  2B1I A;  1S72 V;  3DGE A;  4JYA B;  2QKC A;  5JWP A;  4JI2 B;  1G8M A;  1L0N H;  4JI3 B;  3HKB A;  5J2U B;  1FFX A;  3HKD B;  4DV6 B;  4MW3 A;  2B9Z A;  5BR8 B;  4DR7 B;  5KA6 A;  4K35 A;  2M6Y A;  2WLI B;  4X66 O;  4DR4 O;  3JD4 A;  1AJQ A;  1BZK A;  1K34 A;  4ICG A;  4OPH A;  5LMN B;  3STL C;  3K5L A;  2EIL B;  5C93 A;  2P90 A;  3ZN0 A;  2Q4P A;  1OCO B;  2CGO A;  2YXL A;  2Z5U A;  1NVP B;  4NXM B;  4HNA B;  5L3D A;  2E75 B;  2Z3Y A;  3FYI B;  3VQV A;  3JAW B;  4Q6G A;  1KP3 A;  2R9R B;  3BRC A;  4QNH B;  2QSA A;  1DTO A;  1M1K W;  4HAM A;  1XDC A;  1JR9 A;  3PJS K;  5A2Q N;  1Y4M A;  4FLT A;  5B5E Z; 
#chains in the Genus database with same CATH homology
 4AQY O;  2UXC O;  1XNQ O;  1XNR O;  5LL6 Y;  4LF7 O;  4DUZ O;  3SDL A;  1DK1 A;  2DJV A;  4DR5 O;  1IBK O;  5H5N A;  4B3R O;  4DV4 O;  3F5T A;  4DV5 O;  3J7A U;  4K0K O;  4DUY O;  4B3T O;  1XEQ A;  2N74 A;  2JRI A;  2UXB O;  3OTO O;  1FKA O;  4A5U B;  1J5E O;  4LFA O;  2VQE O;  5IWA O;  3O65 A;  2HHH O;  1NS1 A;  4X64 O;  3RT3 C;  1XMQ O;  4GKJ O;  4LFB O;  1G1X B;  4X62 O;  1R1B A;  2DOS A;  4DR2 O;  2UUC O;  1HNX O;  4JV5 O;  4JI1 O;  1X59 A;  2F4V O;  1HNZ O;  4LFC O;  2ZM6 O;  4LF6 O;  3J80 N;  4YY3 O;  4DV2 O;  2E5L O;  1KUQ A;  1YZB A;  5BY1 A;  1HR0 O;  1AB3 A;  5IT9 N;  1FYJ A;  4LF5 O;  1IBM O;  1D2D A;  1A32 A;  5BXZ A;  2ZKO A;  1HNW O;  4JI6 O;  4DV0 O;  4B3M O;  2LW7 A;  4JI7 O;  4GKK O;  4JI5 O;  4OX9 O;  4JI4 O;  1IBL O;  4DV7 O;  4DR1 O;  5LMN O;  1N36 O;  4LF4 O;  4JYA O;  4DR3 O;  5LMU O;  4JI2 O;  4JI3 O;  1XMO O;  2FKX A;  4X65 O;  4DV6 O;  2UXD O;  4DR6 O;  4X66 O;  4DR4 O;  2UUB O;  1I94 O;  4OPH A;  4LF8 O;  5BR8 O;  2Z0A A;  3J81 N;  4DV3 O;  4JI8 O;  4DR7 O;  3T1H O;  4DV1 O;  3M8A A;  1R6T A;  3T1Y O;  1F7Y A;  1AIL A;  1N33 O;  2UU9 O;  4LF9 O;  2UUA O;  4OPA A;  4B3S O;  4JI0 O;  1FJG O;  3JAM N;  4NXM O;  2AGA A;  1N34 O;  2VQF O;  5FLX N;  5A2Q N;  4NXN O;  4KHP O;  3R66 A;  1N32 O;  4YHH O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...