1IZ3A

Dimeric structure of fih (factor inhibiting hif)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
338
structure length
338
Chain Sequence
b'GSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGGKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIH
publication title Structure of human FIH-1 reveals a unique active site pocket and interaction sites for HIF-1 and von Hippel-Lindau.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 83
structure length 338
sequence length 338
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1iz3A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1iz3A01
2YDEA 1YCIA 3P3PA 4B7EA 4BIOA 3D8CA 2CGNA 4JAAA 1H2NA 4QU2A 1H2KA 5JWPA 4NR1A 2WA4A 1MZFA 4B7KA 2Y0IA 3KCXA 2CGOA 1H2MA 2W0XA 2WA3A 3KCYA 2XUMA 2ILMA 4Z2WA 4Z1VA 1H2LA 1MZEA 4AI8A 3OD4A 2YC0A 3P3NA 1IZ3A
chains in the Genus database with same CATH superfamily
1FATA 3U0ZA 3KT4A 1YCIA 1ZZBA 3S7IA 4AE2A 3JAWB 1XNQB 2I2SA 3H50A 2OUHA 3C3SA 1VRH2 1GMGA 1UIJA 1QQP1 3LPFA 4CU9A 3JBG2 4CP1A 5GLVA 1OCRB 1J5EO 2QKCA 5FJHA 4I9QA 5ACA1 5HXVA 1AROP 3E5QA 4JYAO 4NIHA 3DYMA 5F3GA 1CWPA 3PUSA 4XFBA 2FMYA 1N34O 4CYDA 3K3NA 4FLZA 1XDCA 4FPCA 1H8VA 2NQYA 4NYKA 2HBUA 4DZGA 4JRAA 4AQYO 2ENRA 3T09A 2R9RB 2ZA9A 1HXS3 1YWKA 5F1RA 4IE6A 4IE0A 2VAUA 4WBNA 4NWVA 4A6OA 1LOFC 1T2XA 1VE0A 4P9LA 2JDKA 1IQAA 1NYWA 1WMXA 1XXNA 4LMFA 4BIFA 2WO2A 3K4AA 1UY1A 2X6BA 4OUEA 2GTAA 2XLAA 5J48A 4ZHQA 1GM7A 1NCRC 1MS8A 4YVWB 5FK8A 3GHMA 5FMDA 1DGSA 1CAUB 2ZACA 5BXXA 2UUAO 2W9XA 1KU9A 4L92A 1ACCA 4GLXA 2WS93 3ZPOA 2XJUA 1U5YA 4EV0A 4KG8A 4IEUA 4JYYA 4HNAB 1Q90D 1TE1B 3JD73 4B3MB 3UGGA 4RHV1 5B1BB 2N05A 1EN6A 1AX1A 4B8EA 3RZKA 3OCPA 1XQNA 4GMP1 4JDOA 1K5QA 4AFAA 1ZZ9A 3OOXA 5EC1C 1BQZA 1DLCA 2JG8A 4WBBA 2UXXA 3BRCA 1OXCA 1CZSA 1A32A 4B4PA 1WN7A 1VBA1 4DUXA 4JGYC 5C8CC 5FY1A 1PNLA 3VBSC 1JHNA 2D6NA 4NHMA 2Y4UA 3WD5A 1AR91 1FMD1 5H9CA 2R041 3G71V 4PJYA 1I3HA 3OAAG 2CV6A 3DCQA 1Z5WA 3WG2A 3CCEV 4YZ2A 3JASA 2ITDC 2CTWA 1V6KA 5FO7B 2VH9A 2ARCA 2UXBO 4BQYA 5KMGA 3ELNA 4DXRA 1IX9A 3I55V 4AFDA 5FXVA 5A6XA 1F2NA 3DV8A 2FDKA 1JVMA 4K7JA 4WVMB 3SH5A 5JAXA 2Q0OC 5A6ZA 5CKNA 5FQ0A 1T6GC 4QPIB 3ZHVA 3KSCA 3OGCC 3IC7A 1PM7A 1WKYA 2QUOA 3HMYA 2Z5WA 1A8DA 2D40A 1NJIW 1UO9A 3PVNA 4YM0A 3IAPA 1RPRA 2R7EB 3W7TA 1CIYA 1QXRA 3VB9A 2PAKA 3ABTA 4I5SA 2R70A 1XILA 3HR0A 3DKQA 5FZ9A 5J3UA 1YI7A 1PVC1 1R092 2O57A 4MVUA 5LW9A 4P08A 1UZ0A 4LIUA 4OCTA 4CDUB 2ZZQA 4LE3A 3EVKA 1GOGA 1S0GA 2Y6FA 3FFQA 1YUDA 2BWAA 1JOPA 3RVYA 2XHBA 3EFFK 1F7YA 2OCCC 1KKDA 4N43C 2Y69B 2R0HA 3C7GA 4LTAA 3T4ZA 5JI9A 1YTFB 4JKKA 3CJIC 3BGAA 3ZX6A 2RG4A 3CYOA 4IEYA 2GUZA 1AF9A 2XQRA 3J9SA 3KQRA 1RGSA 1AXZA 1QQP3 4MX3A 3I2KA 2UXDO 1QGLA 3ASNC 2DWDC 2EIDA 5GW7A 5FRAA 2VW0A 2OTJV 2A75A 5IWAB 1GO3F 2WLJA 4O9GA 1N1TA 2VGDA 2JJ6A 5ACA3 2KA3A 2L6LA 4YXWG 1VBD2 1SMVA 3OB8A 4JI7O 1HW5A 1ENRA 1U96A 1D0HA 4AEDB 4M3CA 1LR1A 4GWIA 1SS3A 1CGPA 4NIGA 3T0AA 2RM21 5FBZA 3CCVV 4H3WA 4GIQA 1PO22 5IFTA 1UF2C 2GH8A 4D7YA 4YGDA 3AG2B 1O7FA 1ZBE1 2Q1MA 3RZJA 1HB2A 2JICA 4ZKTB 2XL7A 4E4DX 3SPGA 3CB2A 2RN9A 1C5IA 3FC0A 3D0SA 5CEHA 4L99A 1RXGA 1L7LA 2Y6LA 2A73B 4WV8A 4CPBA 5GZDA 2OZ6A 1K9MW 2RMKB 4MTOA 5D5PA 1UYXA 1W8ZA 3FZ3A 1AXYA 1DGWX 4WVZA 1MEC2 3I2FA 1SQFA 1Q3EA 4Z1VA 4YG6A 1AUYA 3K5LA 5E88A 1IXBA 1HB3A 4QIWF 3R4SA 2YBKA 3NQHA 4F83A 4OULA 1NZCA 4UFLA 3PIGA 1DFQA 4K1ZA 2WZPP 5IWFA 2PI4A 5BNNB 2EIJC 5FLIA 1O9HA 1PL4A 5JMOA 1XNRB 4E4HA 2P3JA 1FNZA 5B2GB 1W6PA 4CE8A 1RPOA 1RHI1 3ACLA 5K1XA 3THPA 4CP9B 2ZCWA 2MPFA 4RHV3 5LATA 2WFF1 3H1MA 3IT8A 5FP3A 2YS8A 1G7YA 4E27A 4WFFA 2RDRA 3FLRA 2IJIA 5EYXA 1O8PA 3LSUA 4HONA 1L8DA 4GMP3 5I8TA 4UF0A 4OGQB 1VF7A 3HBZA 3P3NA 4DV2O 4LF4O 1LOFA 1NA1B 4NTXA 4G3YC 4LULA 4FPLA 4CCMA 3DGTA 1FS0G 3FJSA 1Q8VA 4IEXA 2BJSA 4KGQA 3MAQA 3RJ2X 1QHTA 1YXWA 4DV4B 1VBA3 5CA1A 2QQMA 4KU7A 4OYUA 2NN4A 4XBNA 1AR93 3R4UA 1NCRA 2CAUA 1OA2A 1VMGA 1FMD3 2RJ2A 1AR1B 1N32B 1PK6C 5L36A 4OPAA 2R043 4K20A 4LBQB 2B39A 4OQ8A 1PGW1 3FL7A 4Z82A 1QLEC 4TQDA 1R6KA 1N1SA 3WDWA 1YQ5A 1CAWA 4XOGA 1MS5A 2RDSA 4B1MA 1K7DA 3J8F2 5IJ0B 1WAZA 2F66C 3CS5A 1OA4A 2G9GA 2C9KA 2XKPA 5K9YA 4MTXA 4KUMA 3KVAA 3ABUA 4URTA 3OW2U 2ZX1A 1WD3A 2Q0AA 3UO3A 3RI9A 4NXMO 1AVBA 4JGYA 5C8CA 3VBSA 4LK6A 3AP6A 3JUUA 1FT9A 3ATGA 4I4TA 5BR8O 3KD4A 4META 2VUDA 2BNMA 3NKTA 3K59A 3Q8AA 4K40A 1PVC3 3SMHA 4Q8KA 4DR7B 4XTMA 3HT1A 3E2EA 3IDCB 4BDVB 3STLC 4ZS2A 1KFXL 5DPNA 5T5OA 1Y6XA 4DR5O 4S2HA 1G9DA 1Z7S2 5HFLA 4W4ZA 1H6XA 3RGBA 1W03A 1FV3A 4DR1O 1BMV2 2P2KA 3N2GB 4ORFA 3P1IA 4QX3A 4F8AA 5IVCA 2O1QA 3LAGA 5CB7A 1TQ5A 3VLBB 3OUJA 2VBBA 4FQ4A 1KD7A 2WNUC 5F37A 2AXTZ 1J3PA 3TETA 4AEMA 3DUIA 2P06A 1QEXA 3WW1A 4CEWC 1UYPA 1J83A 2WLHA 2BU9A 2UXCB 2EIMC 3KKYA 2RM23 3FB8C 4PI2A 3OYWB 5J09A 5DECA 1AB3A 2EXKA 5F9TA 5A3OA 4OZXA 4N43A 3ZHTA 3B2EE 4A5UB 1ZBE3 3H1IH 2Y34A 4XIOA 3B77A 2O8OA 3CJIA 2AR6A 4TOIA 4B3SO 5CNAA 2Z42A 4ES8A 3MUZ1 4YYOA 3QNEA 4LC1A 4YZ1A 3JBG1 3CHXA 4CH3A 3RDIA 3SPCA 4XFCA 3Q8FA 2IXCA 4CC5A 5ANNA 5A33B 3ITQA 5FV3A 2ZKLA 4Y22A 1RUD2 2GP3A 3AYDA 4RWUA 2C1FA 1DF5A 2QZ2A 4Q26A 2H6BA 4JV4A 2ZBJA 3BFRA 2XHKA 1TA8A 3D0JA 3WG7C 4FLTA 1VALA 3A4UA 3VHOA 1OLMA 4BQXA 4AOCA 1L7QA 3OBRA 4XF1A 4UVAA 4QAWA 2WLPA 3L2YA 4RGGA 4PJ0Z 1H6YA 3UM7A 1LODA 3AYEA 4QB6A 5A7OA 1RHI3 1NT2B 5T50A 2Y6HA 4R50A 3ZMVA 3JAKA 4JV5B 2WFF3 1XMQB 3ZHUA 4ZI7A 2YUAA 1OJHA 3OBZA 4AWDA 5CA0A 4TUYB 1JYXA 2VZOA 1I08A 4IEQA 2KG7A 1I5ZA 3B02A 1S0IA 4FPGA 3CSXA 1QMJA 4EQVA 4FM0A 5JH7A 2HG5C 4QB1A 4Q2FA 1QHDA 5E1AC 4I09A 3A0KA 3B09A 5FP9A 1US2A 5FY0A 2OWOA 4ZU5A 1M06G 2R071 3C3VA 3RNSA 5I8SA 4P00B 4BW9A 1FXVA 4YW5A 1YJWV 1XU2A 3RMXA 1ODNA 2XL9A 4OX9B 4KHPB 1WPXA 4LXLA 5DDJ1 1AJKA 3OE7G 3RYIA 3JAMN 4LBLA 2CGOA 2BDRA 2P17A 4FOVA 4QHOA 4PD4F 2ZOEB 1PM4A 4LF6B 4JI1B 4DV3B 4AAXA 1PGSA 1VIBA 3AK0A 4FVVA 4H14A 2EILC 4XDQA 4XJ8A 1W2NA 2Q8OA 4ZU7A 4E4SA 1ULGA 3ZRSA 2EZPA 4CXXA 3LDDA 1PK6A 4TN7A 1BBT2 1IS6A 2VJXA 5JSPA 2DE0X 1ZZCA 3I3BA 3AZWA 3FB5C 2Q4PA 2QCSB 4AQ2A 1AI6A 2G9ZA 2QTSA 1W8FA 4BR6A 2QDOA 3RRDA 4D69A 2VULA 3I3DA 4J1XA 4Z92B 1F31A 1GN6A 1KS4A 3TB0A 1T5EA 1OPOA 3L72H 5IY5B 1JJ2U 3VBOB 2VMEA 2G1MA 3B00A 3BOPA 2JEMA 2HWE1 3RYPA 5FJKA 3X2QB 1OCCB 1FXKC 5JOXA 4BE3A 3BIWE 4B4QA 1AR81 1UKGA 4H37A 1RUG2 4CDQB 1NX9A 4CS4A 2VMDA 3BPSA 1MPXA 2UYBA 5DEDA 3W59A 3ILNA 4LR3A 1PV0A 1I5PA 4J7ZA 5IT6A 1FNYA 2H0BA 4M4RA 5CA3A 4LF5B 1K12A 1KQRA 1HN1A 2EICA 4X1KB 4NIDA 1GZWB 1RUH1 4L2NA 1W6QA 1TMF2 3UCSC 3JB8A 5BXZA 3WG3A 5IK4A 2W47A 1R082 3VBHC 4G4FA 3RZLA 2B7YA 5BY5A 1UFIA 3OMNB 1NCQB 2A06H 3BVCA 3JBG3 3AK1A 4UCSA 5JCTA 5B5EZ 4BISA 2EXIA 1OV9A 4GKKB 2E53A 1JYNA 3AM2A 1O3QA 4C0HA 4GWNA 1HJGA 3CRRA 1PGL2 4QPJA 4DV5O 4CPBD 4NKGB 1NLQA 2BOCC 2VC9A 4GX1A 1P7GA 1GOHA 2BQPA 1FXHA 1BYHA 3E1F1 5FZOB 3ETEA 4FM2A 3PJQA 2DF7A 3HQUA 3WUDA 4S2DA 4Q4W1 4DFSA 2FZ1A 2PHFA 4XVHA 1D0GA 4XUOA 3T08A 4QM9A 3ON7A 4LKEA 2HWB2 1U5XA 1E5IA 2JB4A 2Q8VA 2VZ3A 3S5AA 4X20A 4AVVA 4Q8LA 4DR6B 5CFCC 5KBFA 2XAHA 3SYQA 1K33A 2R073 4I3GA 2W46A 3T4VA 4Q4X2 1AL21 1RMU1 2AYHA 4X88A 2RHPA 1ZNPA 1H30A 1OFSA 4AI2A 4EJRA 3MD0A 3QBQA 4D7SA 4DV6B 1XRUA 4RD7A 3AG3C 4HPKA 5DDJ3 5DAPA 1OLQA 1ZVFA 2B1IA 4NR1A 3S7EA 3OY8A 4ICGA 4K3UA 4NOTA 3ASOB 4DMIA 3SQOA 4LF8O 1ASJ1 4ZHQB 2WN3A 4FTEA 2TBVA 1OURA 2ZNIA 3WX5A 1C8M1 1RJ7A 1EUUA 3AG1C 2JDNA 3H0OA 2DCJA 1HDJA 1DGWA 1ULCA 4F6EA 1W28A 2ZD9A 4NJ4A 5KXDA 4H7MA 2FB5A 3T4DA 1OLME 5L9RA 3ZKUA 4XFFA 2Q9LA 4MGSA 2XB6C 4X1YB 1IBMB 3ETPA 2D6KA 1XJAA 2JS5A 4XF3A 3CPWU 3SPIA 3CCRV 1PX3A 5FR3A 3HKEA 3H1WA 1QVFU 4D6TH 4CCDA 3K4DA 3PLQA 3H1JH 3TN92 1AYM1 2HWE3 2WAAA 3K51A 4PLNA 1K45A 4LOTA 1UZWA 4UBHA 4QPWA 3W7SA 4CDXC 4L97A 3LSQA 5FOBB 4ZPIA 1QJX2 3ABKC 1X9TA 1YI9A 5ABJB 3OF1A 2C24A 4O4LA 3T1HB 2DBIA 5FXZA 3KV9A 5LHIA 1SESA 2YEVA 3CCUV 2DCTA 2YXYA 3CRMA 3BIEA 2A0LA 5B3SB 4RFT0 4CCJA 2YV8A 4R4XA 5DUXA 1EPWA 5GZGA 2W3JA 5ERLA 1H38A 1RUH3 5LYJA 4AEKA 1W0OA 3OTOO 1OCZB 4YFZA 3URFA 3C7EA 4DXZA 5LRSA 2BZDA 5AVAA 1UX6A 3FYEB 2BOBC 1QJY1 1CESA 3E22A 3K0DA 4PHZA 1SFPA 2CHHA 2FDFA 1A6CA 1PNGA 1GICA 1FXKA 3WDTA 1VBC2 2XAGA 5JIUA 4EE2A 1Q8OA 4FFKA 2OT5A 4K8XA 2EJRA 3USUB 1YO8A 3KCXA 3MEPA 5A3WA 1HIXA 2JG9C 4PIYA 1F4HA 2VTFA 1AYN1 3MLJA 4IETA 3GWOA 1IZ3A 4A7ZA 2VCBA 1W6NA 3KZIZ 1ZLZA 4HLTA 1POV0 5CA6A 5TISZ 2HEYF 3PJYA 2VXRA 4H13B 1DHKB 4NAMA 5APAA 3SEPA 4NIAA 2WLLA 1I94O 5A7QA 1S3JA 4XDOA 2A71A 1TNRA 1RM1C 3J4UH 4Q4W3 3E89A 3WW3A 4NMIA 1S0BA 3VBHA 5FDBA 1FD9A 4XFGA 2DURA 3M7MX 2HWF1 3ZN5A 5HI0A 5JR2A 2JX9A 2WLMA 3F7VC 3MIHA 3THOA 1MEC3 1GWLA 2WWWA 5GLTA 5JUVA 3F5TA 2BYVE 2EXHA 2UUBO 1IURA 1JZ8A 4ITCA 1WCQA 4BQ2A 1XE7A 1C1LA 2BUKA 4B4RA 1OCOC 3PTRB 2HKXA 2WAMA 1AXKA 1YFUA 3ZYJB 1UY0A 4X6RB 4XETA 1AL23 2ADEA 1QY4A 1RMU3 1AR71 3JD1A 5LXTB 2CU5A 4FLVA 5GM0A 1T6BX 4OVEA 4JI6B 4P30A 1N3PA 4FXGB 4FTBA 3B93A 4MHUA 4JI4O 4W4KA 3M7AA 1KGYA 5LY2A 1I7FA 1VQLV 4Q4V1 4UI9L 1AR4A 5A9GA 4HSJA 1V9U2 5DUWA 2CH7A 1NQTA 3K08A 4XF0A 4Y20B 1K5SA 2WLKA 3T2OA 4LF7O 1C8M3 2X53S 5A7NA 3NV3A 4BWAA 5CFCA 1QBZA 2PLV2 5KWRA 4LO7A 4XHXA 4B3RO 4OI4A 3ACFA 1W0JG 1G6UA 3CQOA 4LFCB 2BRTA 4HK8A 1ROPA 5LGNA 4XEZA 4IW3A 4JI0B 3ZMNA 2JECA 4PQQA 2HBTA 2JKBA 2JDPA 3ZFGC 4IEVA 4NTYA 3LOIA 4UF0B 2R9AA 5A3TA 3JD4A 4IGOA 1N33B 5FO9B 4X8PA 3PU8A 2JS3A 3ZRVA 1W6OA 2I07B 1G9BA 4YY3B 1E5SA 1D5NA 2VQTA 4BYYA 4EN9B 4EWDA 5CA1B 1MQTB 1NCRB 5BNPC 4FMTA 3O1PA 3LA7A 4Q0PA 2LUWA 3UKMA 3VZLA 4JI3O 1BK1A 5IE9A 2W95A 1H9PA 4G2KA 4BMEA 2XVLA 2QVSB 2ZS6B 4LFAO 1CZVA 2IXLA 1B3QA 3CP1A 3VBBA 3N4MA 5B1NA 2Q5ZA 3TEZA 2ADQB 1JXNA 4XIKA 2V5YA 4J25A 5C9AC 4PQ9A 1CZTA 1UAIA 5EYPA 3BCWA 3HKCA 4XBQA 4CDWB 3VD4A 2V09A 4QQLA 5FZLA 1OI6A 1ZRDA 3TEWA 5F8PA 3JATA 2ETEA 1QJY3 4JGYB 4DXTA 3VBSB 1V70A 1HLCA 4XDJA 4Z2AA 2VOXA 5EBLC 5A6YA 4CDXA 2AEZA 2QFEA 1Q8QA 3O5SA 4D94A 2QDRA 1IHMA 4UW4A 1EV11 1ND3B 1W8TA 2ZXQA 2Q73A 5K0UB 2YMZA 1ULDA 2VZVA 3ZMTA 1AYN3 3SJBC 3C3TA 3H8RA 2YC4A 1JU3A 3WQ7A 1QR9A 1JI6A 4A41A 2W6JG 1BE3H 2PHDA 2Q7EA 3OBTA 2D3RA 4FLUA 1DK1A 2ZGLA 1FX5A 2B4KA 2RDQA 3BUCA 3S3XA 3GJBA 3H7JA 3POSA 2YROA 3T3YA 4XILA 3LWCA 2ZEWA 3M4FA 3ZX7A 2HWF3 4DR2B 5FFOC 5T52A 4JI5B 1EN5A 5JR7B 1NS1A 3LCPA 4FQZA 1N36O 2ZZJA 2EIKC 4DK1A 1R1ZA 4FOWA 2JG9A 3W7WA 3FHIB 2WSUA 4K35A 3HNBM 4WF9V 4DNYA 2OCCB 2VCAA 1WCDJ 3KCCA 5C8YA 1OT5A 1BK0A 4O61A 4Y5TA 4LHKA 5FZ1A 3ZIWA 1AR73 4WFBV 1SLLA 5F32A 3QVNA 3GCXA 3ML0A 3FE5A 5FCCA 2VQEB 1HX6A 2JDUA 2DCKA 5FMOS 1P84F 1NTKH 5JQGA 4Q27A 1QNMA 3RWNA 2MK3A 3DPRA 2FDGA 1YJKA 2PXJA 2ZGSA 4EYUA 4Q4V3 4XUNA 2HJIA 4LLFA 3UGHA 4L8QA 1LHWA 1SLAA 2X09A 3O1UA 1QIQA 3POEA 5C5UA 4ZS3A 5LMNO 2YC2A 4O2AA 2JDHA 1EY2A 3IAYA 1FJGB 3BODA 1NH2B 1W8UA 5EIYB 2ZE6A 5C3OA 4DRRA 5LB6A 1W6MA 2UWCA 3C7FA 4IV1C 1Q43A 3ZMZA 5F39A 5FZCA 3DYPA 1GUIA 3O1OA 2JEXA 1VBE1 3MICA 5F7UA 3B9IA 5LHGA 4JAUA 1BEV1 1EP0A 4EN7B 3WOGA 4YHHB 3RG0A 4LO5B 4EWAA 2XBO1 2WZR2 4C1WA 3NJYA 3NAPC 5FZ8A 3WT3A 4ASUG 5EJ3A 2D98A 3K4ZA 3JQWA 4MVMA 2RS12 5E89A 1LHNA 5JJNB 4FLXA 2ES3A 2OIGA 3VBUC 2R30A 1S5JA 5KLVH 2IXJA 2NZ9A 4PCRA 3D5OA 4IV3C 2YB7A 5KXCA 3IBMA 3AG4C 5GONB 2W6IG 2VMFA 4FVMA 1X50A 2D44A 5FYIA 5DAWA 3DC6A 4WVWA 3SPJA 3ZMOA 4DR3O 4JI2B 2HWD1 1M4UA 1W2TA 1SFYA 1KMIZ 2WWJA 1O9GA 3NRUA 4WFHA 4GB32 1IBLO 1GNHA 3B8MA 3ZFGA 1JMUB 5IYZA 4Y4RA 4XDKA 3SPHA 4UFIA 3O1VA 2P22C 1V55C 4CBCA 1C4RA 3CJHA 3RYHB 4MSVA 3N2KB 4MXVA 3AJZA 3F95A 2A79B 4FIPC 4W6YA 4CU7A 5CB4A 2EIGA 2WWSA 2EULA 1VQPV 3EHBB 3PN1A 2Y64A 3KV6A 5BNPA 4JHTA 2D6OX 2XASA 5FUIA 1HV1A 1SBFA 1SZXA 2W87A 1YHQV 4IT5A 2IC1A 2EVXA 4HXCA 2ITCC 2QQPA 2FQPA 2EIBA 5GZFA 1EV13 2BSKB 4I30A 1O4ZA 1QLEB 4QU1A 1O5UA 3SXWA 4F4LA 4ET7A 5FP7A 2WIIB 2GBOA 1DG6A 4QPGC 5FLHA 4PBPA 3VDDB 5F6LB 2DVGA 3I59A 1AJNA 1QJZA 2AZ5A 5C9AA 4K0KO 1WZXA 2VVDA 3E5XA 2BVVA 4QGNA 2JGDA 1JZ5A 4MLOA 1Y9QA 3RYCA 2DFBA 3AL5A 3B4SA 2Q8CA 3FLTA 5KHHA 2BW8A 1OOPB 2PFWA 4NHLA 3TWIA 3N9NA 4MVTA 2Z2SB 3WW4A 4D6SA 4UCUA 3TEXA 4BCUA 3GBFA 1MNGA 2ADDA 5DABA 5IUQA 4MYEA 3WEZA 1KDKA 5LHHA 5FZMA 1US3A 4YW7A 4XAAA 1RB8G 4XURA 4AHCA 4J41A 3O1RA 4X65O 1W3VA 3AVRA 1KFUL 1G6NA 2OXBA 1G8MA 2ZXWC 1HNWO 1YRZA 3IPVB 4BIOA 5C5TA 1GFF2 4O2BA 2ZM6B 1LEMA 3WFVA 2VQUA 3IDBB 4QX8A 2PUSA 5C3RA 4GXLA 1SC5B 3QACA 4MGKE 4P9WA 1V6JA 3VGIA 4TLGA 1DF0A 3O1TA 1W8OA 5I91A 4CUAA 2DQ0A 4UCOA 2HLEA 5L3EA 5BMVB 4NVPA 2WNUB 3WHUA 2ARHA 3ZEDA 2QQNA 3Q8CA 2J1TA 4FK5C 1DBNA 3ZBHA 4CEWB 4LE4A 4MW3A 3HAGA 4QJFB 4NIIA 1LAJA 2EIMB 3V64A 3BVOA 3WUCA 1J3QA 3B3QE 2Q5TA 1GZ9A 4YG0A 1RUC1 2VG9A 1L3JA 2Q68A 4HOOA 4M4PA 4COVA 2WRAA 1YIPA 4DS0A 1YQ6A 2NNUA 1VBE3 2IWGB 3SJAC 4LBNA 1X9PA 4J7JA 2X8KA 1BEV3 1SPPB 3ST7A 3V0AA 5ITZB 1CPNA 3KGLA 4IUGA 5KAIZ 1NXMA 1HW7A 2XBO3 4AQ6A 4QQ2A 2D6PA 4JTAB 1S77D 2D3OW 1DQ4A 4E4ZA 2PGGA 3BALA 1V9U1 1WW5A 1GZCA 4WM8B 3NV2A 1IOAA 4FPFA 4DV0O 2F4VO 1KXGA 4PDVA 2I45A 4UFMA 4FFBA 1VF6C 5LA0A 1NTMH 4GMP0 1YC61 4KWUA 3VBFC 5J1XA 3WG7B 1JOJA 2BOIA 3K9SA 4P9OA 3POWA 1JYIA 2XJSA 4ES9A 5FYZA 4IV1A 2BWCA 5FPXA 4IE5A 1JFFB 2VZPA 2LGQA 2HWD3 4HPKB 1MACA 1AI5A 1BCCH 4PDWC 2DFCA 3H7YA 1AILA 1E5RA 3O7OA 3V0BA 1QVGU 1XSRA 2DJVA 4YJ2B 1Y43B 4ZIBA 3WW2A 5IHRA 4AI1A 3IIIA 3HQRA 3H8OA 2ZMKA 2K2SA 2UUCO 3I2DA 3X29B 3NAPA 3ZFFB 4QT6A 5HPOA 1GQGA 3OUHA 4LWSA 3KZ4C 3VKNA 3CRCA 1XNQO 1GP5A 1BT8A 4I50B 2ADPA 5EXOA 1P49A 3Q4HA 2V1DA 4U3FH 3IMNA 3VBUA 5A3LA 1FYUA 3ME2A 4R9DA 4O4IA 4I02A 1EBOA 3U07A 4IV3A 3THDA 3M3EA 1NOVA 2WINB 1JUHA 5A7WB 1YF2A 3WCSA 1WGPA 2JIZG 4ONUA 1COV2 1WJZA 2ET7A 4AFBA 5DAVA 1U12A 5JXIA 4M00A 4TSVA 4TTGA 4GH4C 2ODMA 1QOSA 2RS32 3RYFB 5D1IA 1FOD1 1ORQC 3ZYPA 2G4IA 1AP6A 4UB6Z 3ZSKA 2RNBA 4WFAV 3E8FA 4XFIA 5EZYB 1R64A 4JGZC 4P14A 1FPN2 5KHJA 1UW8A 1QJU1 5JPMB 3KMHA 3ZN6A 3UKVA 2EILB 5EK0A 5J37A 3ZHQA 2IBZH 1OBNA 1B35C 3O0XA 4G28B 4C7UA 2F1MA 2VCMA 4O4LB 2QQIA 1V6NA 5JXHA 1SETA 4UFZA 3K3OA 5J2TA 2YEVB 2BBAA 3CMEV 3CWBH 4V2WA 4KFMA 1MS0A 3ABZA 3J7HA 1KJRA 2RR11 1M90W 2X5IB 5D8AC 3ZRWA 4QPGA 2ZE5A 4O4JB 4BK5A 2WWUA 3TEYA 1Y74B 1VIWB 4YSFA 4CA9A 5H2FZ 1VAVA 1OD5A 2ZEYA 4CP2A 2PYLA 2E74B 3K0GA 3JARA 3P32A 4INDA 3FHQA 1Y4MA 2P3IA 4B3MO 1TAEA 2HEWF 2ZX4A 1IKPA 2ZGPA 1UN1A 1A3KA 4MTGA 3RN4A 3LDCA 2VL4A 5CBFA 1DQ2A 4MVZA 1XNBA 3RVHA 3CC7V 2R1DA 1YJLA 4JCKA 4I0BA 2GHYA 4K6BA 3WVJA 2VQ0A 1DDLA 3ZXEA 1XREA 4BQ1A 1X7NA 4IEWA 2VTXA 1HWYA 3B7MA 4IEOA 3BA8A 2HP8A 3I8TA 5LP6C 3K03A 4IGQA 1RUC3 5DUVA 2PF4E 3H1LH 5LA6A 1UMHA 3M3QA 2J22A 4RQEA 4I55B 3G6JB 3S6PA 1JZ4A 1I1EA 4B3SB 3OGSA 3GF6A 4CCLA 3VBHB 1VR3A 1BXHA 1XE8A 3ABLC 4ZKIA 4JF3A 2Z3YA 3ORJA 3ROUA 4ISQA 4I9WA 3R05A 1NTZH 2Q7HA 2NP0A 3UT5B 1V9U3 5LMUB 1MVQA 4GCZA 1SA0B 1GTOA 3WV6A 1DU3D 4Q0SA 3VZKA 1URXA 2ZNJA 2AACA 4J1WA 4BWOA 4AVBA 4MVRA 3GCWA 1GN4A 5LEKA 3CKHA 2NM1A 2EXJA 1RVF1 2LM3A 1BZWA 1QR8A 4XDLA 2JE7A 2VNGA 5F5AA 4JDNA 3AKQA 2HHHB 1LU2A 3PDQA 2HEPA 4PDLA 1NI8A 4AXOA 4BIUA 1N3QA 4KWLA 5I0TA 4P9GA 2XTAA 2FD8A 2PMWB 2WR9A 3O12A 1TZOA 4IYHA 4OHVA 4WZFA 1QOTA 4NAOA 5B1AB 1WNSA 2WLIB 3D8CA 4FAHA 4IGGA 1GWMA 2A5ZA 5CFCB 4JHZA 2AW9A 2J1SA 5DAXA 3I3EA 4FFFA 1VF6A 4ASLA 2XJPA 1OCRC 5GZCA 4PDRA 2Y26A 5IWAO 1N4CA 3I54A 3GHNA 2DQ3A 1ZYBA 4FT8A 4XQWA 3FAVA 2FHRA 4Q4Y2 3DSQA 5FY5A 3FX3A 4JQTA 2VBPA 3AMQA 2O0OA 1JYVA 2VU9A 4PDWA 5FZBA 4DUVA 1NAEA 4AG4A 2Q8DA 5AG2A 4U3JA 4CEYB 1FOD3 1RINA 3T30A 4TV9B 2MEV1 1W6OB 3MHHC 2CWMA 1NQJA 2D6MA 1DQ5A 3KG2A 3BU7A 5LK7B 1EAH1 4XF9A 3ZN0A 1JX9A 4DPNA 4Y24A 2BVBA 4BQ3A 2ZINA 2YI8A 1QJU3 5IVFA 2NMNA 1ZX3A 1H1MA 3GZEA 1AR62 1W2AX 2Y6GA 1F4NA 3G80A 3OR7C 1B6QA 3PVOA 4DUYB 3RZHA 1IXMA 3FLPA 4PF5A 4BQ4A 1CX1A 1MOFA 3EB7A 5FMCA 4W50A 3ACHA 2JG8C 4Y1UA 3BTYA 2A3YA 3N9PA 2UU9B 5GJ6A 1GRJA 1RUI2 2LO1A 5LBFA 3ES1A 1UPGA 1D2SA 2Q1ZB 3IDAA 2RR13 3IMMA 4YJ3B 1K3EA 5IYCO 3NJVA 3CMGA 4GH4A 3IC9A 2BGCA 2HYKA 1XNRO 5LGUA 4C1XA 1S0DA 4LIVA 4MVOA 3M3OA 3TYJA 1VMHA 1H0BA 1LB2A 4JKMA 4JGZA 5B1BC 1QKQA 3SEEA 4W6XA 3K06A 1NY71 3MW2A 1TME2 4BA6A 1WWYA 1S0CA 2KQXA 3SNMA 4MGQA 1RUE1 1O3SA 4GA9A 4LR4A 3T2MA 5LRRA 4YW3A 1GN2A 1B35A 4QGLA 3ABKB 2PHUA 1ZWIC 2XXZA 1PNKA 3VDAA 1ZZ6A 3T0BA 2IU3A 3ZSJA 1D4M2 1BKZA 5E1RA 4DV4O 2C9AA 5BNOC 1IKQA 5LA9A 1U5IA 4BZ4A 5CBGA 3QH6A 5JZGB 5FYSA 2WYFA 2MNGA 1N32O 5D8AA 1UU5A 5L73A 5T5LA 3MIFA 5FZGA 3ZVXA 3IJ4A 1LOCA 2ZGQA 1NVPD 4JKLA 1ZL8B 1RFYA 1G8WA 2Y38A 2R6QA 2WSSG 3GBWA 3ILRA 3HB3B 3OJBA 1BJQA 4DRXB 1GANA 1UXZA 4AAPA 2R16A 1ULEA 3CRAA 3MIBA 1EUTA 4I0XB 4ARXA 1X8EA 4WM7C 1APNA 4HFSA 2J1UA 4TV8A 4QPIC 3I2HA 3OFNG 4IIJB 1SZBA 2IJJA 1H2SB 2RDCA 3AKTA 3WDXA 2XR4A 4XMIA 2ZDIC 1M9NA 2VUCA 4TXWA 1WLEA 3AZVA 2XOMA 3J81N 3UESA 3RT3C 1RVF3 5LP6A 1SG3A 3WLUA 1H8TA 1POQA 5EV7A 5IT9N 1BHBA 1TUBA 2C26A 1RM1B 1A78A 4DR7O 4MH0E 5JQGB 5LGTA 1JTZX 3GGLA 3HT2A 1GYKA 4FPJA 3ZPYA 2LFRA 4CCOA 2Y69C 1Q81W 3D3AA 2HWC2 3ZO0B 2FCVA 1NLRA 3SJCC 2P4EA 1R1A1 1AHSA 5ANQA 5FMBA 5T54A 3J7MA 4XFAA 4SLIA 1J58A 2WKKA 3MI8A 4HZ3A 2BERA 2NMOA 1WMDA 2OZJA 3WP3A 2C4XA 1CJDA 1X59A 4QQOA 2E5LB 1I6XA 1W6MB 4GAZA 2VWKA 2GP5A 5H6QA 4LO6B 4CUBA 3H9AA 3GJAA 3MIEA 1NLSA 2VUAA 5AC91 5GLWA 4AFMA 2PELA 2J1RA 1AJQA 2BTQB 4X8NA 4K8FA 2GNMA 1UQXA 4AEDC 4X1IA 3GXUA 2ZCEA 2UXCO 1PIV2 2PA7A 4QX7A 4XC9A 2MEV3 2LTNA 2CGNA 4J80A 1W8HA 3BB6A 3PTYA 3AG2C 1EAH3 3DKWA 4AYUA 1W0NA 5DN6G 2UURA 5FPBA 4QXBA 1HQLA 3JAWA 4UW6A 2YG0A 3MFCA 3E6DA 3WQ0A 5JSOA 3LD8A 4WVVA 1ZBA1 1JOBA 2QM7A 1VQKV 1C5HA 3SH3A 4GKJB 3FHAA 3IAQA 4LNUB 2LROA 3VOUA 1YIJV 2XJTA 2OPKA 3MIGA 2PI5A 2WQZC 5IAXA 3VD5A 3ZFGB 5A6QA 1GSLA 2B1GA 4N9IA 1PP9H 1UJWB 2R061 2PHWA 5BNNC 1HNZB 4A2UA 5JDBA 4P9YA 1F15A 4D6QA 2WNVB 3UKNA 3NJXA 2E9QA 3CJHB 2EJ7A 4MHRA 2RS51 3IB3A 1P4RA 1PL0A 1W0PA 2W52A 2WA3A 3RBZA 4JV5O 2RMU1 5JSRA 5J36A 1RUE3 1HKDA 3GNEA 2B9UA 2QR4A 1LUWA 5L9BA 4AHXA 1FFXB 4R4ZA 3AKPA 3EXAA 5FBJA 3ZSEA 5J96B 2MHFA 4NUBA 1MZFA 3LA2A 5LOVB 2RCVA 3OT7A 1ULFA 3WNPA 1YXBA 4EZHA 2VZSA 5T5JA 5FTTC 2VS0A 4YVWA 3RYKA 1SCRA 1CAUA 1CN1A 1XSQA 3ZHSA 5J2UB 1CAXB 4CS2A 3FBMA 4WCEV 3SCHA 2ZX2A 1B06A 1W06A 2JGDB 3O1MA 2YPJA 3KCYA 1RP3B 2XUMA 1US6A 3IZOA 1HXS2 3F7YC 4B08A 4HNAA 2E32A 4OX9O 4KHPO 5I0UA 2HJFC 1KKCA 3CEIA 2Y0PA 3CCQV 4LQRA 1XOUA 1NT0A 1H2KA 1QNWA 2NYYA 4QKDA 2Q1FA 1DTOA 3LFIA 1S76D 1ONAA 3L70H 5FXXA 3QO5A 5LEJA 4LF6O 4JI1O 4DV3O 2J7MA 4JQRA 3OM3B 1ZRFA 1RUOA 4CXWA 3OUSA 2YGLA 1VP7A 2F95B 4H0LB 1AP5A 2CTPA 1Q6HA 1RUJ1 3MHZA 2E63A 1OD3A 3AXDA 4JC1A 2F17A 5C4WC 3PMEA 5BNOA 2WS92 1EFRG 4MADA 1DLBA 4KL1A 4Q0UA 1QOOA 5GTIZ 1DLLA 3SJQC 1LU1A 3JD72 4DRVA 3MGUA 2QTWB 1S0JA 2J42A 1VQ7V 4AQTA 1V6MA 2KXLA 3VDCA 4GT1A 1LNSA 1O3RA 3CO2A 4FPPA 2QKSA 1Q8IA 4OUSA 5FYYA 4RGKA 4WVMA 1R1A3 4AHZA 5L19A 4WM7A 1SZTA 5HFMA 1TUEB 1G86A 4QPIA 3VZOA 4N7UA 3JD0A 1Q56A 3WDVA 3N9LA 3VBRB 1LHUA 2Y8KA 2ZDIA 3IM0A 3H8XA 1WA6X 3CEWA 2ZR3A 4Q29A 5CADA 3O9OA 1NE4A 5AC93 3K5OA 4HKOA 2IFRA 4EWEA 2WJSA 2EAKA 2FBEA 3ZMSA 2VMCA 1HB4A 4QWNA 3W9AA 1XB9A 4LH6A 4C0BA 3HKBA 1Y9GA 3IN9A 4BQ5A 1UL9A 3T1CA 5KA5A 1MVEA 4F6RB 4DY5A 2LP7A 4CUGA 3QCWA 3D3IA 2A3XA 2QWPB 3A0NA 3N7LA 4CC6A 2A3WA 3WQ1A 4A45A 2DBNA 2BCCH 1ZBA3 4XTPA 2A6ZA 4QGMA 1JUIA 3PUAA 4QE7A 3BOWA 3JCIA 3TCUA 4TZDA 3VD3A 1DCSA 4GKKO 3MDPA 2KKWA 2E76B 3V0BB 3OUIA 5LA2A 3L74H 2JDMA 1D4VB 1QDOA 4XABA 5FYBA 4AEDA 2R063 1KC8W 3NNLA 2GDSA 3H3UA 1C3HA 1S2BA 3FN9A 2ZHMA 3EXUA 1PO11 2DYSB 5A1LA 2VNRA 3U1XA 4Q1PA 4UVBA 2RS53 1GH6A 4LFBB 3NVCA 3MZHA 1QQP2 4DO2A 4PA4A 2M7WA 3O0VA 4WFGA 4O4IB 2EX3A 1GU3A 2WDBA 4Z1MG 3FB7C 2RMU3 4YLZA 3OR6C 4XZUG 4E2SA 5KHGA 5ACA2 3T1LA 1DZRA 5DQ0A 3GWKC 4LKSA 2Z79A 4UUJC 3AMMA 3W20A 3I7DA 4DB5A 1PMIA 1CJPA 2VZ1A 4UV9A 1LHOA 2Q8EA 3ZR6A 3SCGA 4DR4B 4QPYA 4DR6O 1Z5VA 3ABMB 2EZOA 1QJFA 3APOA 3VQWA 4GKXA 4OPHA 4QX2A 3BABA 5BNNA 3ZDSA 3OGIB 2VR4A 4QM8A 4K21A 5A32B 2Y33A 2C5DA 2NLJC 1V55B 1G1XB 1W9FA 4COZA 4EN6B 1LHVA 3WZ1A 2OYZA 4GYCB 4DV6O 4AILC 5F2WA 3CNAA 4CP9A 1HRV2 5EJ1B 4UFHA 2XUEA 5A3MA 3JALB 4B7EA 4EKWA 2Q67A 2R9IA 5KXBA 1YDXA 2YXSA 2SBAA 3CRQA 4AI3A 2P4VA 2BE3A 5IJ9A 1NA1A 5FY9A 4LA2A 3OUFA 1RC6A 4P5YA 5LWBA 1RUF1 4NXNB 1ZA4A 2LW1A 1RUJ3 5FPLA 3APQA 3ZRWB 2JD4A 4QPGB 3T4HB 1JZ2A 1UKRA 2D97A 1VQOV 4NE9A 4R8HA 5CFDB 2WNEA 2ATKC 5IDJA 3PURA 2CGPA 1WUVA 4LBQA 3WB0A 1XUQA 1OMIA 4S2GA 4RHV2 2W92A 1M1KW 4UW3A 2A70A 3GZAA 4RQFA 1IBMO 2XAJA 4ZBMA 3N7MA 5EJZB 3OEBA 3NNGA 2GC3A 5IJ0A 1KD1W 2RJLA 1TVGA 3VBOC 5JMCA 4SBVA 5FMOL 1VBA2 1GQPA 3DF0A 3RMYA 4URAA 3DC5A 1Y7BA 2JIGA 4RQPB 3X2QC 5LA1A 1O4TA 4AL9A 1OCCC 1BHAA 1AR92 1FMD2 2W94A 5HCAA 2R042 4IL7A 3OD0A 4N90A 4BW5A 1YQ2A 4CDQC 5C4WA 2J1AA 2ZXWB 3K04A 4XQDA 5F3CA 3SYOA 3THTA 5DG2A 3UYJA 4ARYA 1FAYA 4L9BA 4LBOA 4Y4YA 1ZX5A 1Y76A 4J9YB 5DAQA 5K4LA 3T1HO 1UPIA 1XYOA 5FNVB 1BCXA 2V4VA 4RS5B 1GNZA 1OVSA 4X9QA 1LCLA 1FXZA 5CIRA 4OQ9A 1MG1A 4EZ4A 1DYPA 1FPOA 2HVJC 3ZKYA 4PLMA 2D7FA 3VHNA 2B8MA 5T5PA 2V5DA 4PI0A 4TSFG 2OTLV 1UZVA 1E5HA 5A3UA 1NCQC 5IVVA 3N2GA 4NROA 1VRH1 2WBKA 5BZBA 3KLSA 2EINC 3RW0A 1PVC2 5KHKA 4LCUC 1GM9A 4CCNA 1PMHX 2PQSA 5SV5A 5A80A 5FY4A 1NU1H 2H0VA 2DVFA 2GH2A 2CSGA 1KBHA 3PL0A 5F3EA 4FZ0A 3MW3A 4JTCB 4NPMA 1H1IA 3PUQA 3NNMA 2HEVF 2ZAAA 5JLVA 4KBZA 4GWMA 1SKVA 4LBKA 1PO13 1Q86W 5EPAA 4FPOB 4FFHA 2K1EA 4X66B 2PAMA 3VBFB 1AR63 1YNAA 2RJKA 2DYRC 3KV5A 5J7MA 2VMIA 1AI7A 3L73H 3E83A 2F4PA 2ZPXA 2G19A 1JJOA 1S5LZ 4BJ0A 1BHGA 1ENSA 3PHMA 4EB6B 5A33A 3M8LA 2GALA 4PDWB 1P7BA 3UETA 3OD4A 1SF9A 5FPOA 4YZ4A 4DO0A 4ISRA 4U3JB 2RM22 1VARA 5JJEB 2YIBA 4PA9A 2VTXJ 3ZYIB 2UWAA 4OUMA 1R6TA 2DVBA 2GMPA 1H8HG 2HLDG 1AZDA 1ZBE2 3QLQA 1W39A 3AKSA 3LF7A 3WR0A 1SQ4A 4M3CE 5DZFA 5FZFA 4QDRA 1PM9A 4QHBA 4JI6O 4IESA 1SBDA 4AGRA 5C6CA 3OG2A 4QMAA 1GKFA 4B7KA 1HR0B 3T1MA 1TME3 1K34A 4KGGA 1KECA 2W5FA 4Q0QA 3WB2A 4FAGA 5I0RA 1M56B 3P3PA 2BFUS 3SYAA 1DGLA 5EP9A 5IK8A 1RUF3 5FZKA 3R66A 2WT2A 5IVBA 5IJRA 1JR9A 2XGXA 2DTWA 5C33A 3BHPA 3DXTA 4MW8A 3HN1A 1MS4A 2VZTA 4DV7B 3KQ4B 2YXHA 1RHI2 1VB2A 3IIAA 1H2NA 4LFCO 4QD2A 1ZZ7A 3MLKA 2YGMA 4JI0O 4DV1B 2WFF2 2JENA 4PBOA 1UY3A 1SERA 5DMYA 1A34A 2QWRB 4IERA 4XDPA 1K42A 4MG2A 4PDMA 1Q5OA 3IGAC 5FK7A 5L7OB 1BLZA 1N33O 4IDZA 4UVCA 5FWEA 5KR7A 1LESA 4B3TB 2Q4SA 4GD4A 3HR9A 2W0XA 4CH6A 5FYTA 4YY3O 1WA8B 1W9WA 3ZFEB 5T3NA 4YZ5A 5EHDA 5EWSA 3ZXGA 4UW5A 5KUKA 5D8AB 2QE3A 4HMZA 3E97A 3DXRB 1F4MA 3WDYA 1PGW2 4KQ7A 4O9EA 1M4WA 4JTNA 5ABJC 1YHFA 4KWJA 2XWJB 4FFGA 3AFGA 1BZKA 2AC1A 4Y33A 4BLIA 2PTMA 4OMCA 5EZWA 2WC2A 3RJRA 5B3SC 5C7GA 1GR3A 1R091 1ZAUA 1OVPA 5FZDA 4OMDA 1WP8A 2FCUA 4TV8B 2F93B 2P6JA 3FYIB 1OCZC 3VBOA 1UMZA 4YRDA 4QX5A 4CRQA 3Q9OA 3WY6A 1JOYA 1W9SA 2QKAA 4AK3A 3ZOIA 1VRH3 5LP6B 1V00A 1YTFD 1JW6A 4CDQA 2P1BA 1K5MB 1MS1A 1ZZ8A 3BU0A 1TUBB 4N53B 2VMHA 1GLHA 5JOWA 1HN0A 4PT6A 4OHZA 3KT1A 2J1VA 1L0LH 3RWKX 4I0WB 1YVWA 2QTOA 1VBD1 2VW1A 4UXNA 2CYFA 4NRQA 3DTUB 4JI8B 2P34A 2LW7A 3S3WA 1MS9A 4G27B 3BTZA 1PO21 1OQEA 2VECA 2DOSA 1O59A 2R72A 4CU6A 1J1TA 1R1BA 3NWKA 1LECA 2LALA 1ND2C 2BOJA 2DUQA 1NCQA 1QDCA 1REFA 5FZ0A 1WBLA 5FPVA 5FXWA 4NHKA 4UXAA 2Z0AA 4JI5O 4CZSA 1PX4A 3MF9A 3O0WA 2WABA 3S30A 3RFRA 2AHZA 3A8TA 1ENQA 1MEC1 3NXSA 1GZTA 4DXWA 5FPRA 1N0JA 3LNMB 4Y26A 3R6SA 1M57C 4IL6Z 2XHNA 1BSMA 2ZEXA 1LENA 3A0HZ 5DZEA 3W5NA 2GTSA 1IBKB 3ZMUA 4G9SB 1K3IA 3W7UA 1VAMA 5FZOA 2BNNA 1HQNA 2VQEO 3BPZA 1CVNA 1SQVH 4CS3A 1S72V 1XPWA 2QE7G 5FP4A 1ALYA 4WBNB 5CG9A 3PJSK 4K3AA 5JPNB 1COWG 2ARBA 2QGNA 2R1BA 4EROA 3AXEA 1J3RA 3B94A 3LIHA 3DXUA 1RSOA 2XQXA 3H3ZA 4YGCA 2D5FA 3DECA 3NJZA 4IHJA 1FJGO 2JB8A 1HJFA 1N8RW 4D7TA 2B46X 1Q82W 3CMAV 2P5BA 1Y4WA 1FFTB 1ULOA 3CU7A 1VQ8V 2VQFO 3CCJV 1YLLA 2LRPA 2E26A 1JA8A 3H1YA 1UYYA 2Y0IA 3JB4C 4BHPA 4YHHO 1HRV1 5IVEA 4CH4A 4X62B 3K48A 4LBQD 2PAEA 3LNNA 4GJYA 1VF5B 1C57A 3J8F1 4LK7A 4S2FA 5FUPA 1VMFA 5CISA 1MQTC 2JG8B 2K46A 5FZIA 1EM1A 3N9OA 3ZXKA 2B45X 1PNFA 2R072 3E5UA 1W9TA 1BVVA 1UWWA 2D2CB 1HRI2 4PA7A 3EHKA 2JD9A 2WT0A 5AFBA 4D6RA 1RYYA 2VWJA 3JASB 1NUKA 1R3JC 2ZMLA 5BY1A 5DDJ2 4JI2O 3AP5A 3ECQA 5KMGB 2E31A 2QSAA 4CUCA 1UNBA 1N1VA 4X1YA 4FLYA 3BN6A 4YGBA 1R093 4FCAA 3VN4A 5A1AA 4M0NA 1W90A 4AHWA 4CDWC 4FZ1A 5FQ0B 2VRZA 5CBHA 1LOEA 3KWVA 4X64B 2DMXA 5FKCA 5FYMA 3CC4V 1KITA 1Z7S1 4AI9A 1BL8A 5BNOB 2H3OA 5JI7A 4R7CA 4ZY9A 2E7AA 1PHMA 1BMV1 2IZWA 2LS6A 3ZIXA 2WZ8A 4AI8A 2JKXA 5FLXN 4JTOA 2I74A 1PKXA 4AF9A 5ABJA 1ND3C 4Y1ZA 4E2QA 2W91A 5K0UC 5KC5A 4LHLA 5FO8B 1H2GA 1DP0A 1VBD3 3AMHA 3K2OA 4YARA 3VQVA 1MZ5A 2IUWA 2HWE2 4WM7B 2F4LA 4UCRA 3ILFA 1D2DA 3KVBA 3R4DB 4XUPA 2KB1A 3T2TA 2YXLA 1W2OA 2PN5A 1PO23 2QEXV 2Z69A 3V56A 3K57A 2ZGTA 2GUZB 1YJNV 4MGTA 4CH5A 1AR82 1UX7A 1Q6UA 2Y0OA 5LZ6A 5LBEA 1L1FA 3WXPA 4YM2A 3SR2C 1NR7A 3DPRC 4OLLA 3OEAA 3CLPA 3SCFA 5F2SA 3OGGA 1S2EA 3ZYGA 4FLWA 2VY0A 4XJWA 1TVKA 3USUA 4HKWA 1G4YB 3LIGA 1SFNA 4M01A 4YVSC 3TBDA 4QHZA 1RUD1 1S0VA 2XDVA 4N9HA 4M3CB 3HKBB 2QNKA 1RUH2 1CPYA 1OFNA 1MMMA 4GZRB 4C90A 3LEGA 2OX0A 1UXXX 1GAXA 4FXKB 4YGEA 1KRIA 2YDEA 1LRHA 1DQ1A 2ZM6O 5JXGA 2O14A 4Q20A 3J26N 2YIBD 3LSDA 1G9AA 5IVYA 1VB4A 1F23A 3KF3A 2IVIB 4LF9B 4U7OA 5KC6A 1I5XA 1I5YA 3ZN4A 2FDJA 3HQXA 1ND2A 3TJTA 2CE4A 3ZXDA 3ZXJA 1W04A 1DGRN 3CCSV 1F5JA 2VD7A 4U7NA 2ZKOA 4B1LA 3C8XA 2OIIA 5H9PA 1YIFA 3MW4A 3E8HA 2YI9A 3SDLA 4D3WA 3AZZA 3UV9A 1W6PB 3BKZA 1SLTA 4Q4W2 1BMFG 2Y48A 2NLRA 5LXTA 4P2ZA 4YM3A 3I2JA 2D93A 4DUZB 1XBFA 1HRV3 3K3WA 3J8F3 3I2OA 5EQUA 2X6AA 4JZ2A 3ENRA 4YW2A 4Y20A 1Z2GA 2VOKA 1F5FA 5FKBA 4H44B 2HJDA 3VKMA 3M99B 4KMQA 4NHYA 3VV1A 2FDHA 1HNXB 1AL22 5CG8A 1BVP1 1RMU2 2QM8A 4LT5A 3G6BA 4MV2A 4R9AA 3TAYA 1V54C 3WF2A 1K92A 4BLJA 1YI2V 4JZGA 1BBT1 1BGYH 1CAWB 1QXPA 4HN0A 4J10A 4IEZA 1CX4A 2QQKA 3SISA 5IJ9B 1ASJ2 3H8UA 4BPZA 2BGOA 2L9LA 5F5QA 2FKXA 4PV1B 2W1QA 4TQFA 1AX0A 1C8M2 3T1YB 4KP4A 1VQNV 5DZGA 1SQBH 1SRYA 5I93A 2EIEA 1XMOB 1MQTA 1Z7S3 2XJRA 1XE0A 3RZGA 1XNKA 4Z8BA 5C8CB 3CZJA 1W8NA 2B5HA 3OMIB 4ZXKA 4I4TB 1ZA7A 4J11A 3U75A 1NZIA 2DU1A 1D2QA 2DVDA 5HCFA 1W8WA 2JDYA 4DEQA 4DINB 2G38A 1RUG1 2K0GA 5FY8A 2X05A 3B8NA 3QF7A 3MYXA 3VDDC 3NL1A 3D36C 5C93A 1JH5A 1JCHA 1D7PM 3LA3A 4CSWA 2W1SA 1UOFA 1N1YA 1AYM2 5KUMA 4GALA 4CDWA 1UU4A 2LJ2A 1XOYA 2TNFA 2DCYA 4XBFA 2H8PC 3APBA 2NR5A 4MO3M 4FPHA 2VE1A 4AW7A 1OC1A 1TMF1 3I5DA 1UZZA 1O6UA 2PZSA 1OOPC 1R081 5C4WB 2A6WA 2QQUA 2VQAA 3AEIA 2AHYA 2F43G 2K9ZA 1XNTA 2YUEA 1Y76B 2EBOA 2ORXA 4LA3A 2W1UA 1ND3A 2X0LA 1QH7A 3VZMA 5K0UA 3WSOA 1ZTEA 3HNYM 1KB9F 1RUD3 1MZEA 4V1PA 4XJAA 3U11A 2VOVA 3FUOA 1PGL1 2CWSA 2WQ8A 5ISLA 1JBCA 3WNLA 5CYYA 2WUHA 4N43B 2DVAA 1OH3A 4X8AA 1QJY2 2B5UA 4TWKA 4XUQA 1DYOA 3CJIB 1SQQH 3HJRA 2YIDA 2YYOA 3KS7A 3ASNB 2A6XA 4NPRA 2VUJA 1J5EB 1AR5A 2R32A 2CNAA 1I0HA 3DEMA 3ZLIA 4AI0A 4BIZA 2HWB1 5KHIA 3FUQA 3LEMA 2XMLA 4Y22B 1AYN2 4XBLA 4LUMA 3POYA 4JYAB 4E8CA 1JZ3A 5K8SA 2B42B 3CBNA 1JYWA 4YVSA 4PA3A 2WSVA 1N34B 3D6EA 4J9ZB 3QO8A 3HWJA 3LEIA 1O5LA 2VVFA 2B9ZA 4P9JA 1JMKC 3Q8BA 1NKDA 2XAQA 4Q4X1 3K9AA 1PMJX 2ORZA 4I0AA 4AQYB 5E8AA 2OQ7A 2VXJA 2TUNA 3EMRA 5B4NA 3JAKB 2BPA2 3J7NA 1UZYA 1XU1A 2Y60A 4ZI7B 2DCZA 2Q6AA 5FPAA 2HWF2 3I97A 5CA0B 1WCSA 3NSTA 4K8RB 2JDZA 4RFRB 4FM1A 2D43A 4WM8C 2KG7B 3K46A 5LMUO 2E33A 5JH7B 3CXCU 1LR5A 1FYJA 4XAEA 3GVMA 2XVGA 2CDOA 4QPKA 1X33A 1KYOF 2GC0A 1X82A 2XVKA 4QX1A 2P4KA 1W3XA 3N7KA 3NR7A 3GZUC 1QNYA 1AR72 2YU2A 1LEDA 2UUAB 3K5NA 2EIJB 4OHYA 5BYNA 4KH9A 4AVAA 2HHHO 5J9PC 4FBFA 2ZAHA 1CPMA 3POJA 2HKOA 1VQ4V 2VZQA 3CF6E 4YPJA 1VBB2 1BBT3 3RYIB 4QNHB 1PVXA 4Q4V2 2P3KA 3JSNA 3TK1A 1QJEA 4OZOA 2UYAA 1P8JA 1K4DC 3A7QA 4Y1VA 3ZFFC 1JYCA 3J7AU 4L87A 1UU6A 3SYCA 2WQ4A 3M1HA 3DYOA 2PHXA 1QCEA 4A4AA 3TN91 1WLWA 2VNVA 2QQWA 2QQOA 2D3PA 1OZ0A 1HRI1 3P5BA 1V6IA 4FP3A 4A7KA 2QWOB 5GONA 1UOGA 1SDWA 1PK6B 1ENXA 3G6EV 4IQPA 2O8QA 1HQWA 2GU9A 1RUG3 4OI0A 1DF4A 4YW1A 3UGFA 3VQXA 2AZ0A 1QH6A 3TGUH 1QJX1 3JCZA 3PNAA 2UXBB 2GNDA 2W2IA 4LH7A 1SCSA 1SBEA 4RL7A 1B04A 3UL2A 5CBLA 2DYCA 1OF4A 5F5CA 1XC6A 2JWPA 1Q6IA 4QU2A 4NO4A 2GMEA 1KP2A 4LLOA 1AJOA 1NE6A 2QQLA 4ZZ8A 3RYHA 3N2KA 5JOYA 1TMF3 5BNQA 4OI1A 3WNKA 2QA4V 4DUYO 5A70A 1R083 1GN3A 2Y4TA 3G67A 2W08A 2G9FA 2CDYA 4P9XA 1TG7A 4COYA 5K7PA 4J6GA 4PA6A 1GWKA 1KEXA 4HAMA 4W8JA 1VBC1 5A3NA 2FTKA 4XHBA 3B01A 2YU1A 2BSKA 1TNFA 2UU9O 2DWEC 5L3DA 5FZ6A 4GX0A 2XOKG 2X5IC 3IKWA 5H9SA 3VDDA 1OKOA 5GALA 2XLFA 3D36A 1O8SA 4LHSA 2JVDA 2QBXA 1W6QB 1E1RG 2OCHA 3RQ0A 3WNNA 3ES4A 2WO7A 2XWBB 4LHNA 3AMPA 3HPLC 2BV4A 4BXSV 1H8EG 3OPZA 3N9MA 5FYHA 4HYOA 4CCEA 1C8NA 2UXDB 3E6BA 4AVCA 1LJ7A 1OOPA 1CEZA 5KA6A 3ASIA 5G04L 1EV12 2HWB3 2BNOA 3NV4A 5HCHA 2GSMB 3QOPA 1ZM1A 4UOJA 4R6ZA 4JI7B 2GNTA 4YWAA 1F35A 1R3IC 5DUUA 4NRMA 2OIEA 3DL3A 2ZGOA 4DW1A 5LBQA 2AEYA 1OF3A 5FZ7A 3AP9A 3IPVA 5EC2C 3GM8A 3H01A 2JJ2G 4Q4X3 2IH1C 2V73A 3S5QA 1WB7A 4CXYA 2A9HA 4DOUA 1B09A 3E6CC 4MSWC 1O91A 3AL6A 4Q0VA 3ZIAG 5B4XA 5EYYA 4IEPA 2VVEA 3U4XA 2QQVA 2ZHLA 1KJLA 1LNQA 2EINB 2Y6KA 1F9KA 3POBA 1WCUA 1Q8SA 3VHPA 5BMVA 4X20B 2F6BA 2WNUA 5FZ3A 1JU4A 5A1FA 2JE9A 4A3XA 4HSLA 4CEWA 4ZOLA 3ZCCA 4ABMA 3WDUA 5FIXA 4KWKA 4XW3A 1WD4A 3VZJA 5EIBC 1RUNA 4K8ZA 2PLV1 2LW8A 3L9DA 1HB1A 1WMFA 4RO2A 3UKTA 1EPZA 3WNMA 4Q5OA 1OHHG 1NR1A 4MVSA 1DQ0A 3HIFA 4Y5SA 1SLIA 2SLIA 2DYRB 1SPPA 5G05L 5ITZA 3OY8B 3BYWA 5B1AC 3AX4A 3HD8B 2ZGMA 4DV2B 4LF4B 1RSOB 1UMIA 1XYNA 3M3IA 4WM8A 4LBJA 4O4HA 4DK0A 4QKNA 4IHJB 5B1OA 3TN93 3H1KH 2HH9A 2E5LO 3D4KA 1K5JA 2VPVA 2XJVA 2YBPA 3KB5A 1HRI3 3E8GA 4J42A 3MUY1 2DDUA 1WB8A 2JEUA 2WLNA 2E51A 2KSDA 3WF0A 1VBE2 4BOWA 3R65A 5DXDA 1W0KG 1JFFA 3AYAA 1QJX3 2QJ1A 1BEV2 5FYUA 3B40A 1F4AA 1EYBA 4BK4A 3CC2V 2XBO2 2CTRA 1X8MA 4CEYC 5LBCA 4XJUA 4YJ2A 3HKEB 4IXLA 2IM9A 1G9CA 4MTFA 3CE2A 1JZ6A 3ZFFA 1IQDC 4YFWA 3K58A 4RN5A 5FZAA 5IK7A 2VZRA 4FO9A 5H6RA 1NXD1 5JWPA 3ACGA 4HANA 4I50A 3S0MA 1KUQA 3NO8A 4NXMB 2ZEZA 2F23A 4XUTA 2GSYA 3ZS8C 3AKRA 1QWRA 3QTCA 5BR8B 4GKJO 3UT0A 3WNOA 3LDEA 2HWD2 1SQPH 2X29A 2IH3C 3FBYA 1SACA 1VBC3 2EAAA 5BPXA 4B29A 5A7WA 2XPJA 4X89A 3TOJA 3WG1A 4GQ7A 4FOYA 2DWRA 3KGZA 1H1AA 3RYFA 3SKVA 1HNZO 1OA3A 4JTDB 2R0FA 5L3GA 3I49A 2Q30A 3LE0A 4DR5B 5LYJB 4XACA 3UJOA 1JPXA 2PHLA 4P9IA 5EZYA 5GLZA 2OYQA 3NW4A 4BM8A 5JOZA 5KAFZ 2XAFA 2BTOA 4EEQA 2N74A 4DR1B 3E22B 1YFWA 3SH4A 3ZHRA 2BGPA 3RWRD 1AR83 1FXKB 1TGOA 1VAKA 3FKSG 1Y9MA 1N0NA 4PELA 1FV2A 2YFZA 5D5QA 2AREA 1IGOA 2N7GA 2GAUA 3VDBA 2W68A 1LTEA 3FB6C 1DGRA 1BQ0A 3BCCH 5HCBA 2WO1A 1F8VA 4NRPA 1LUVA 5FPZA 5JZGC 4N21A 1AJPA 2X5IA 1W6NB 1THZA 4AFCA 4C91A 4HL0A 3UK9A 4JGSA 2PY5A 3OEHG 4O4JA 4MZUA 1Y74A 2YHJA 2D3SA 4HK9A 1H8TC 1SDDB 2AZ2A 4PLOA 2WLLB 4NN0A 4OFGA 2HVKC 4Z07A 2NN8A 2BTVC 2W1WA 4GWJA 1KP3A 4COWA 1ZRCA 4JDMA 1K97A 3C90A 5JVVA 5GTHZ 3BI3A 2LGWA 1SQGA 1E1QG 1CAVA 4MOAA 2ZQMA 1CD3G 2CL2A 2TEPA 3LB9A 3M8AA 3M70A 4DY3A 2CTQA 3LDBA 5C70A 4LJHA 5FUNA 1TVKB 2A7WA 2LFSA 3W21A 4GKYA 5JXJA 1ULPA 4HG6B 3VD7A 4I2OA 2YFUA 1MSWD 3AG7A 4AHYA 4RUFA 3KHCA 1V0AA 3RYRA 1YITV 4NPLA 1NZ6A 2PLV3 2GN3A 1IVSA 1UD1A 3BTAA 3GBGA 4GUNA 4I55A 2FL4A 1NH2D 4NB5A 4RR3C 4L0PA 4MXWA 1URFA 2Z5UA 2FCTA 3VD9A 2D6LX 1XNCA 1ND2B 4ZU4A 3PU3A 1JQ0A 3BEHA 2CH7B 5FZ4A 1VLNA 2WLQA 2WZR1 4XCAA 4ZZ5A 3UT5A 1WCKA 3CCMV 1SA0A 2WYSA 2QWNB 3FD9A 2ZMNA 1MZ6A 4BMBA 4UCVA 2RS11 4Y1XA 4Z2WA 1RUC2 3KT7A 4LO4B 1M57B 4UB8Z 5FREA 2BFUL 4C8DA 1VRBA 4XXAA 1WLTA 3FFZA 1GBGA 5IVJA 4CCKA 2P7TC 1CIWA 2DTYA 1XEQA 4LITA 3ACIA 1X36A 3AG3B 1VBB1 1LOBA 1O3TA 5CMUA 4GB31 3SHRA 5CVRA 1ASJ3 2WLIA 4CVUA 1W2UA 3WHTA 3OTFA 1GNYA 2P5OA 3W7XA 4CTEA 1Y67A 3A22A 3MLLA 2WPDG 5C3PA 1XHZA 4R9CA 3VZNA 1XL6A 3WQBA 1UOBA 3EYPA 2OKXA 4BXFA 3AG1B 4EFEA 5F2VO 2VOWA 1CONA 4RGAA 2ZTNA 1EZVH 2JGUA 4HVQA 1UY4A 1S5HC 1FAFA 3D3QA 1YJ9V 1K8AW 2JXAA 2X10A 4M3CF 1QU0A 3TXQA 3K5MA 4D8MA 4LUKA 4AR2A 5T55A 4YVWC 2VM9A 5H9RA 3RS6A 3S57A 4L8JA 5IATA 4ASMB 4ZHNA 4CEYA 2WNVC 2P67A 3RI8A 4JAVA 5EYPB 4TV9A 3NKGA 3HKCB 1LGBA 4TYSA 3CL1A 3F2ZA 1NG0A 5IYBO 4UBGA 1AYM3 1V6OA 4LFBO 3JATB 4TWTA 3NMBA 4JRLA 3IDEA 1QU7A 4QE9A 3U14A 5C71A 1ST8A 1XQ8A 3LOBA 5LY1A 1L0NH 4CDXB 4LKFA 3HKDA 3M3CA 3QO7A 2PQQA 1JS9A 3AFKA 3LZZA 3OPWA 2RDNA 2ETNA 1SLCA 3JU9A 1S4CA 3TNQA 1VQ6V 2QDNA 3H3LA 1Z0HA 4DR4O 1FOD2 1O4YA 3K79A 1MS3A 1C1FA 4YJ3A 1REDA 2R49A 2QWQB 5LCWL 2RVAA 3TNPB 3B69A 1WLCA 1QJU2 2D5HA 4LBMA 5LASA 3VL9A 1UYZA 2P90A 1S2KA 5I0SA 4KXRA 3FWEA 3LKJA 1R3KC 4PIZA 3KV4A 1AI4A 4K9SA 1H2LA 1VQ9V 2GV9A 2AGSA 1SLBA 2BEOA 3ZDVA 1DZTA 4FTSA 2RR12 3A23A 4NXNO 2EALA 2JG9B 3BA9A 1S1AA 4DV5B 1SEFA 5FLJA 3ZYFA 2E3CA 5JZGA 4NHXA 3SKJE 5C8YB 4A3ZA 3AK3A 1LKNA 2WT1A 4JVAA 3A0BZ 4MGIE 1ZL8A 3BAAA 3ICXA 2VMGA 3F5WC 1XBLA 3WU2Z 2CY6A 4A42A 4CDUC 3J7LA 3AB0A 1UY2A 3CXHF 4DRXA 1KQSU 2RJZA 3DPRB 2WL1A 3HEIA 1J95A 1Q7YW 4I0XA 1STMA 2L35A 4GZ9A 2ZX0A 1WW7A 2WZR3 4FSJA 3SYPA 2V72A 4XFHA 2OT7A 4NWWA 4IIJA 5JVDA 1IPSA 4O2AB 5KX5A 4RSUA 3DGEA 4LKDA 4YVSB 2RS13 2QQJA 4ATEA 4DIQA 4ASKA 1VEWA 1K4CC 2FYUH 3VBRC 4OXSA 2UU8A 1CQ9A 3VL8A 4CU8A 1OCOB 2VO5A 4K1YA 4QDQA 3RZMA 4JPRA 1LULA 4R52A 3V65A 4U36A 3SITA 3E8BA 3C7OA 4A44A 2OUJA 2RQ6A 3MPPG 5CZKA 3LEKA 4RR3A 1YYNA 1VBB3 2GDFA 3EQEA 4UAPA 1IDSA 3VKLA 3OSDA 4GB33 3H42B 1GP6A 2LQTA 2CTVA 3JCUZ 4XJZA 3PUHA 4PF1A 4LF8B 1IS4A 1GV9A 3OBAA 1REEA 1NQDA 1N3OA 1HP8A 2CAVA 4BU2A 3U37A 2CUGA 2XKOA 1RVF2 2BP6A 2YIAA 3I56V 2AGAA 5E6HA 5I0DA 2PHTA 1EZJA 3DN7A 4F7ZA 1JYTA 1W05A 3A0RA 3LPGA 5FPUA 2VQFB 2HR3A 4QQPA 2ET1A 2UWBA 1XNAA 5C3SA 1UCXA 3JXSA 2BTQA 4ZXEA 4JASA 1COV1 5CKMA 3NNFA 1GM8A 2OW4A 2IFWA 2AENA 2VW2A 5IYZB 3T0DA 5H9QA 2RS31 2XH6A 4W65A 2IXKA 2DYSC 3Q8EA 4HKLA 1OLRA 2PYTA 2A1XA 2E7QA 3ALQA 4YW6A 4GX2A 4U2AA 2XLGA 4L11A 4CCCA 4HT1T 3ZSMA 5CB4B 3NNJA 1FPN1 4X66O 3UNPA 3KF5A 5BNPB 1YQCA 4IGPA 1XMQO 4I7ZB 1NKGA 4UWDA 1PZ7A 4EN8B 5JJJB 4KI5M 5EFUA 4ATFA 3RZZA 1NA1C 5FWJA 1V54B 3USSA 3WF4A 1OH4A 3L2HA 4Y1YA 4LNUA 5JIAA 3ZYHA 5HXMA 4YIOA 1CP9A 4OHWA 1W2BU 2YSUB 3ABMC 4GULA 2C2AA 2MEV2 5BUVA 1D5AA 3SGIA 2OA2A 1EAH2 1L7RA 3I59B 3T2PA 5C9AB 1PZ8A 4LOSA 2WNVA 4AZZA 4XZPA 4JYBA 2ZGKA 3MV01 3OTOB 3D82A 1Q8PA 1QQCA 3HVDA 4HBNA 2BBVA 3IFXA 1UPSA 5HV4A 3RYCB 4YM1A 1J59A 2DW4A 3PMSA 4P9PA 1HR0O 1YZBA 3TXSA 2IXIA 4CZZA 2GC1A 2YY1A 4E4EA 3POFA 1XNDA 3L75H 1FFXA 4XPVA 1YSCA 3WG4A 2H94A 1VQ5V 4QKFA 2XJQA 3HN3A 5LK5A 4COUA 5LOVA 4H2AA 2EF6A 4UCTA 2JDAA 1RTVA 2WO3A 5CFDC 2DU0A 4FPKA 2OPWA 3MV11 5A3PA 2VBDA 3N9QA 5L3BA 1ZSPA 4AEJA 2H6CA 1RITA 4DV7O 2IJKA 3ETDA 3UJQA 5J2UA 1CAXA 2ZIMA 2UY9A 4O2BB 3W58A 4O65A 2C0ZA 1I94B 5F5IA 4H33A 4DV1O 2ZHKA 4XYXA 4F3JA 1NY72 1OQ1A 5D2AA 4JZRA 2GNBA 4CP0A 1RUE2 4W6WA 4DQAA 3N35A 2ZGRA 3E35A 3JQXA 1Y3TA 2JK5C 1LOAA 1JZ7A 4B3TO 3LFMA 5EBMC 1S0FA 3MIDA 3THCA 1M5IA 4RQPC 1WMEA 3GYDA 1NVPB 5AFEA 5E79Z 2IXHA 2A6YA 3I2GA 3MHSC 3P6BA 4FOQA 3OEEG 4I3PA 2P3YA 2UUBB 1IPJA 4XCBA 2EIKB 2QJVA 5B66Z 1Y66A 2CDPA 5L3CA 2ZIOA 2WA4A 2IU0A 3QH7A 1DZQA 2Q7GA 3B5LB 5J98B 1H2MA 1J1LA 4R9BA 2GZWA 1SQXH 4IE7A 2E7TA 3WF1A 2VCCA 5GZEA 1H4HA 4RS5C 1OKQA 2VNOA 3O65A 4YIPA 3V0AB 4CDUA 4JI4B 3QG5A 5H5NA 3ZR5A 5EIBD 2AH2A 4NTWA 2DUOA 4LF5O 2XG3A 3KM5A 1BS3A 2W0FC 2WFPA 3L9JT 5SV8A 4LF7B 4ZOLB 4FFBB 1UIKA 1MR5A 3M2MA 2ZGNA 3U10A 5IW0A 1ODMA 2C6SA 2FZ2A 3I3QA 1R6NA 1GQHA 3VBRA 5DG1A 4B3RB 2WN2A 4IV1B 2ZT9B 2OVUA 2P6CA 3EBRA 1PPJH 4ZONA 3VKFC 4Q4Y1 1ENVA 4QQHA 1COV3 3H1HH 3RVZA 1OSGA 1ZRRA 2PYJA 4RUEA 2YZ4A 4Y5Z0 1R1A2 4JI8O 1AL0G 2RS33 2VZUA 3NAPB 1C28A 5C3QA 2MW2B 1MSDA 4O4HB 4TLFA 2A3QA 4F6RA 4LWSB 3C2UA 3OGJA 5C8WA 3OGRA 5F3IA 1YFYA 2ZX3A 2ILMA 1V6LA 3LSEA 3ZM8A 3Q4HB 1GK9A 1FPN3 4N8MA 3VBUB 4FFIA 3LQCA 1JHJA 2PHRA 1AR61 2IW5A 1V9PA 2X7RB 4IV3B 4JI3B 3AG4B 4HN1A 1U0AA 5AC92 4QDSA 4YNIA 2ZABA 5IK5A 3G4SV 1POV1 1DYKA 4LFAB 4J7KA 3HOBA 4LBEC 3WF3A 4QXHA 3WP5A 4MUVA 2HYXA 2YICA 3STZC 2ZR2A 3W5MA 1YFXA 1PZ9A 4UV8A 5GKAC 1RUI1 1ZRIA 1XI1A 1IBKO 4V2VA 1R73A 3GZTB 3FX7A 2DN9A 3B9CA 5JCOC 5HBAA 2A7AA 3PIJA 5F6KA 1ZBA2 2JRIA 1ZUQA 4AQSA 3ZN6B 2P37A 5FP8A 1E79G 3N36A 3MO4A 3WP6A 3LDRA 1TME1 4Q1RA 1M56C 2ZE7A 4LNVA 5J2TB 4UYBA 1BQPA 3JYCA 2R062 3MDSA 4JX0A 4RAIA 3CJXA 1D4M1 1WA4A 1KS5A 3EO6A 2A6VA 2X6CA 3LGRA 3TRSB 3LDKA 2CK3G 4MT8A 1VPHA 3CD6V 2RS52 1WLDA 4RYDA 4RA0A 4FJCC 5A32A 1Z78A 2XNDG 3AYCA 5A2QN 3ZYRA 3JARB 1QF3A 5HV0A 1HV0A 2QKDA 2RMU2 3INAA 5IYDO 3I2IA 5FL7G 3NV1A 5CAZA 3WB1A 4XQ4A 4XXPA 1I9RA 3AP7A 1HDKA 5L7OC 4UFKA 4X62O 1CXZB 2V7QG 1JODA 3JALA 5FYVA 4BQWA 3N3HA 5IY5C 3ZFEC 4UFJA 5EBWC 3R0RA 3VUOA 4WZCA 2HFEC 1M93A 1NBMG 1N36B 3PVEA 4I01A 1VMJA 1AVMA 5TSWA 5AVPA 5CFDA 1U97A 1RXFA 5LA6B 3UQ8A 3SC7X 4BB3A 2ARXA 3WCRA 3ZJZA 3PUIA 2M6YA 2YPDA 3ZXFA 1CAVB 1S55A 4XJ9A 4YW4A 3H9VA 4FPEA 4E9KA 4MVQA 4HVRA 3IWZA 3SLIA 1RUJ2 4LPLA 4X64O 4BAYA 2HWC1 4GJZA 3RPQA 5LMNB 4RQPA 2XT9A 5L9VA 4DXSA 2GN7A 1MABG 3BY6A 4LORA 4QKBA 4E8DA 2N04A 1WW4A 1XHXA 3OMAB 1WPBA 3U4SA 1IG0A 2ZE8A 1K5MC 4FP2A 3VKOA 4MGYE 4N53C 3UO2A 1ZREA 3I4IA 1IS3A 4W4LA 3N7JA 5FAXA 3I3MA 5CU1A 2GC2A 2YC0A 2QZ3A 4MXWB 2JIJA 4Q4Y3 5FNVA 1OUXA 2Z4FA 3FMGA 1FKAO 4RS5A 4HVOA 1LOGA 3JZVA 1TEIA 1PD3A 3QD6A 2V4DA 3N27A 1F51A 4LO8A 1PIV1 3ZRXA 3JD3A 2RV9A 3CX5F 3AZYA 3OYWA 3AJYA 4KBBA 3POIA 3GDBA 3JD2A 1N47A 3LUTB 3KHBA 3O14A 1LGCA 2V4AA 5L3FA 5GLUA 2Y6JA 2YBSA 3K75B 5M0TA 4BH9A 1H9WA 2E75B 2DV9A 2EA7A 3G7DA 1OUSA 3MBWA 5DN2A 3FAVB 4AGVA 4B3NA 2WAOA 1POV3 4QXKA 2KD7A 4P02B 4DR3B 3CDZB 1U5ZA 3U78A 5LBBA 1H4GA 3MFAA 3ZN1A 1IBLB 3WINE 4IYIA 1RUI3 1DIWA 4KNCA 1G9FA 4E2GA 3E86A 2UY8A 1RJ8A 3AMNA 5BV6A 4N23A 1GOFA 1PNMA 4DEVA 3L71H 4MS2A 3J80N 3CCLV 4LF9O 3MPBA 3VBFA 2OS2A 2QM4A 2UXNA 1OQDA 4DW0A 4H7LA 2J1EA 4FI9A 3ASOC 1J84A 3EJKA 4DUWA 4TUYA 2DUPA 2CAZC 1GKBA 2P6HA 4EB6A 1GMMA 5IFPA 2GMMA 4AVTA 1WP7A 4IE4A 5K1PA 1D4M3 3OGVA 1GP4A 4GH4B 3LSSA 4JYCA 2XONA 2ERFA 1PO12 5IAVA 4K0KB 4FPYA 3GB7C 3ZSLA 1DQ6A 4KG0A 1LGNA 4JGZB 3O1SA 4A6SA 4QXCA 2ZJCA 5JCOA 1HXS1 3AK2A 1OHFA 5FY7A 4DUZO 4LP8A 4DYLA 3ZYBA 1JN2P 1A8MA 3HKDB 1IPKA 4HZFA 4QX0A 2FDIA 4LEJA 1B35B 5FYCA 1XL4A 2ATFA 1W59A 4YZ3A 4QGPA 4Q6GA 2IJHA 1SHWB 1UOJA 4X65B 2JDIG 3POGA 1HNXO 4WFEA 3WNXA 5I8YA 3AP4A 1VP6A 1HNWB 2WS91 4P5HA 4D0QA 4AVSA 5FOJB 3AC0A 1WBFA 3PVBB 3JD71 1VQMV 2JJ1G 5IYYA 1CR7A 3HPNA 2JE8A 2Q69A 3VQYA 1W9YA 5E16A 2ZKNA 2NPIA 2FMDA 2KM2A 1R3LC 5L7OA 1AX2A 2ZHNA 1QXJA 1RUF2 1WA8A 3T1YO 2AUYA 2HWC3 3ETGA 2RE9A 3ZFEA 5FZEA 1XMOO 4TT3G 3K77A 2B9VA 1VJ2A 3ETQA 4YG3A 3HBKA 2K9PA 4R8CA 5CKQA 2E6VA 4XMAA 1RIRA 3DXRA 4UT5A 2IVJA 1X4TA 2ARAA 1H8TB 3AVSA 5CN0A 2WNOA 4X6QB 1W99A 2FMLA 3CIHA 3A21A 4KU8A 5A7SA 1YEWA 4GX5A 3ABLB 4OI2A 4JAAA 3VHRA 1PIV3 5FZHA 4M0HA 5JVDB 4AGGA 1EN4A 3BTXA 4X1KA 5KX5B 1QLNA 1GZWA 2W39A 3OPTA 4DV0B 1E57A 4XE9A 2F4VB 4A7YA 1IS5A 3P30A 1WW6A 4PIXA 3ZXAC 4EFBA 2ZGUA 5D21A 3WP4A 3ZXLA 1MA1A 2VOTA 1OPMA 2ID4A 1XYPA 3RSJA 1KDMA 2WZEA 4MGZE 1K5MA 4N53A 4N7IA 4DR2O 4QB2A 1K73W 5A7PA 4E2LA 3GALA 4Y3OA 4EN0A 1FI2A 4H55A 4HETA 4RR3B 3JSLA 5LL6Y 3MF6A 4X1IB 4O7XA 3HNMA 1IG3A 4OHXA 1S0EA 1YQ8A 3T2QA 3CZUA 4XF4A 3A2FA 5DM6V 3AZXA 2UUCB 2OQ6A 2KR2A 5KXEA 3C7HA 1RL3A
chains in the Genus database with same CATH topology
1RUJ3 3AYAA 1QJX3 1BEV2 2JD4A 4QPGB 1FATA 3LWCA 3U0ZA 3KT4A 1YCIA 1ZZBA 3S7IA 3M4FA 1EYBA 1UKRA 4AE2A 2D97A 2XBO2 3ZX7A 4R8HA 5CFDB 2WNEA 2HWF3 5T52A 5FFOC 1X8MA 2I2SA 4CEYC 3H50A 2OUHA 4XJUA 1VRH2 5JR7B 3LCPA 2CGPA 1UIJA 1WUVA 1QQP1 4LBQA 4FQZA 1OMIA 4IXLA 4S2GA 2ZZJA 3JBG2 1G9CA 4RHV2 1R1ZA 4FOWA 4CP1A 2JG9A 3FHIB 3ZFFA 5GLVA 4UW3A 4YFWA 2A70A 2WSUA 3GZAA 5IK7A 4FO9A 1NXD1 5JWPA 4DNYA 3N7MA 3KCCA 1WCDJ 4HANA 2OG5A 5ACA1 2GC3A 5HXVA 4LHKA 2RJLA 3ZIWA 3S0MA 1AR73 3E5QA 3NO8A 1SLLA 4XILA 3VBOC 2GSYA 3AKRA 5JMCA 4SBVA 1QWRA 3FE5A 4XFBA 5FCCA 5FMOL 1HX6A 2FMYA 1VBA2 3DF0A 3RMYA 2DCKA 2HWD2 5FMOS 2X29A 1Y7BA 4CYDA 3FBYA 4RQPB 1SACA 1O4TA 1VBC3 1AR92 2EAAA 5BPXA 4B29A 2XPJA 4Q27A 1FMD2 3RWNA 3DPRA 5HCAA 3TOJA 1YJKA 3WG1A 2ZGSA 4GQ7A 4Q4V3 2R042 4IL7A 4FOYA 3OD0A 4FPCA 2HJIA 1H8VA 2DWRA 2NQYA 4LLFA 3KGZA 4N90A 4DZGA 4L8QA 4CDQC 4JRAA 5C4WA 2ENRA 1LHWA 1H1AA 4XQDA 1SLAA 2ZA9A 3THTA 1HXS3 1YWKA 5DG2A 5F1RA 4M26A 1OA3A 1FAYA 2R0FA 4L9BA 1EY2A 4LBOA 1VZ5A 4Y4YA 1ZX5A 2Q30A 4NWVA 1LOFC 3BODA 3UJOA 1UPIA 2PHLA 1XYOA 4P9LA 4P9IA 1BCXA 1IQAA 1NYWA 5GLZA 3NW4A 4DRRA 4RS5B 1XXNA 1W6MA 2UWCA 4IV1C 4BIFA 1GNZA 4BM8A 1Q43A 5JOZA 1LCLA 2XLAA 1FXZA 1YFWA 3SH4A 5J48A 5CIRA 1AR83 1VAKA 1DYPA 1NCRC 1VBE1 3MICA 1MS8A 4YVWB 4PLMA 3GHMA 2D7FA 1CAUB 1FV2A 3B9IA 2ZACA 5BXXA 3VHNA 1BEV1 1EP0A 2B8MA 2AREA 5HSXA 1IGOA 5T5PA 4EN7B 2N7GA 3WOGA 2GAUA 2W68A 4L92A 1LTEA 3RG0A 4LO5B 4EWAA 2WS93 1DGRA 2XBO1 2WZR2 2XJUA 4C1WA 3NAPC 1U5YA 1NCQC 4EV0A 4KG8A 3WT3A 5HCBA 4IEUA 1VRH1 1F8VA 5EJ3A 2D98A 5FPZA 5JZGC 1TE1B 3JD73 2X5IA 3JQWA 1W6NB 3KLSA 4AFCA 2RS12 4RHV1 5E89A 4C91A 4HL0A 3UK9A 1PVC2 1LHNA 5KHKA 2ES3A 4MZUA 1AX1A 4B8EA 2YHJA 3VBUC 2D3SA 3OCPA 2R30A 5SV5A 4HK9A 1H8TC 1XQNA 4GMP1 4JDOA 4PLOA 2IXJA 4NN0A 2H0VA 2NZ9A 2DVFA 2GH2A 4OFGA 4PCRA 3D5OA 4IV3C 4Z07A 5KXCA 3IBMA 2NN8A 4AFAA 2BTVC 3EATX 3MW3A 1ZZ9A 1H1IA 4COWA 1ZRCA 5J92A 4JDMA 2HEVF 1X50A 2ZAAA 2D44A 2JG8A 4WBBA 5JVVA 5JLVA 4WVWA 3ZMOA 4GWMA 4B4PA 1VBA1 2HWD1 1CAVA 1SFYA 4LBKA 4JGYC 5C8CC 1CD3G 3VBSC 2CL2A 1JHNA 2D6NA 2TEPA 1PO13 4NHMA 3LB9A 3WD5A 1AR91 3M70A 4DY3A 4FPOB 1FMD1 4GB32 1GNHA 2R041 3ZFGA 4PJYA 1I3HA 4GKYA 2CV6A 2PAMA 1DS1A 3WG2A 4YZ2A 3VBFB 1AR63 1YNAA 2RJKA 5J7MA 5FO7B 1V6KA 2VH9A 2VMIA 4I2OA 2F4PA 1C4RA 3ELNA 2ZPXA 4MSVA 4AHYA 4MXVA 3AJZA 1ENSA 3RYRA 3PHMA 4W6YA 4AFDA 2EIGA