1IZ3A

Dimeric structure of fih (factor inhibiting hif)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
338
structure length
338
Chain Sequence
GSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGGKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords FIH
publication title Structure of human FIH-1 reveals a unique active site pocket and interaction sites for HIF-1 and von Hippel-Lindau.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 338
sequence length 338
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1iz3A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1iz3A01
2CGOA 3KCXA 1MZEA 2XUMA 4B7KA 2ILMA 1H2LA 4Z2WA 3OD4A 4NR1A 1IZ3A 1MZFA 2Y0IA 1H2NA 1H2KA 2YDEA 2WA3A 1H2MA 4JAAA 4Z1VA 4AI8A 2W0XA 3P3PA 2WA4A 2YC0A 3D8CA 2CGNA 3P3NA 1YCIA 4BIOA 5JWPA 4QU2A 3KCYA 4B7EA
chains in the Genus database with same CATH superfamily
4U3FH 1AR61 3MGUA 4JTAB 2EICA 2ZIOA 3ZMNA 1PNLA 2ZDIA 1IGOA 5FP7A 1ZX5A 4L92A 2WFPA 4Z1VA 1IDSA 1HV1A 4AEMA 3X29B 1YC61 5K0UC 5IJ9A 5FLIA 4O4JA 2A3QA 2ADPA 3PVOA 3EHKA 3ZYJB 4JYYA 1J84A 4JGZC 2AREA 4NVPA 2WFF2 3AL5A 4AVCA 4O4HA 2VCAA 2G4IA 3FD9A 1SQGA 1KD1W 2A1XA 3WP6A 1HXS3 1YI2V 1CAWA 4QQLA 3AJYA 1PM4A 2C0ZA 2WWJA 2PUSA 2V5YA 4RGGA 2XASA 4WFAV 2JIJA 4GT1A 4J1WA 5JOWA 4TUYA 2EXHA 2OX0A 1QLEC 1N32O 2JD9A 2UWBA 5K0UA 2B5HA 3RI9A 3C7OA 2YZ4A 1H2KA 4QMAA 3N9MA 1DCSA 4CEWB 2GSMB 2C6SA 2E7AA 4MT8A 3FUQA 1V6NA 1PGL1 3GGLA 1QHDA 1RUC1 4YY3B 1W2OA 2P3JA 3VV1A 1ND2B 1IPKA 4FCAA 2Y34A 3CL1A 1VB2A 3S57A 5LGUA 2WLHA 4Q29A 4UFKA 1RUNA 4QE7A 4RR3B 4SLIA 3BY6A 4X9QA 2JEMA 4DV2B 2ZMLA 3JBG2 1XBFA 3AEIA 5FMOS 1U5XA 5LATA 3H8UA 3ZHSA 5JXHA 4LIVA 2DUPA 3BRCA 2BFUL 2ZD9A 3DGTA 2C4XA 4FPGA 5L19A 5GJ6A 2M6YA 1SLLA 1XNBA 3WW3A 3TB0A 4XMAA 4BQWA 2HWE2 3PU8A 2Z2SB 1EV12 4OUMA 1Q8VA 4YGDA 1S0GA 1MQTA 1XJAA 3SC7X 2DN9A 5GALA 3CD6V 3U1XA 2ZINA 2P37A 1FXKB 1RJ7A 2UYAA 2HWB2 1JQ0A 4IV3C 5J98B 3Q4HA 3CMAV 2OTLV 3B9IA 3F95A 1AYM2 3FYIB 1F4MA 1OQEA 4IGOA 2YUEA 3LEIA 5D1IA 4GXLA 1LHVA 1O4YA 1WZXA 3ASNC 3KV5A 2R1DA 3UO3A 1EPWA 1X4TA 1KJLA 2TBVA 5KC6A 2R16A 5EZWA 5CFDA 1VQ9V 4W6WA 4E4ZA 1VMGA 1S0DA 4XJ8A 1W39A 1FD9A 4LBKA 3UGGA 2DCJA 3UKMA 4OQ9A 1DP0A 1NZCA 1ZZ6A 1SQFA 5FWJA 2PAEA 1IG3A 5FZCA 1DQ0A 3KV4A 2OKXA 1GZ9A 2ZTNA 1AJKA 3BVCA 3QVNA 2JGDB 2ZS6B 2WNUB 2DURA 1KB9F 3IC9A 1G9CA 4MX3A 2CHHA 1YI9A 2QDOA 2VPVA 5FZKA 4YJ2A 4LF6O 2XWBB 3BOPA 5JXIA 5GZEA 4IHJA 3Q8CA 4QJFB 2QWQB 1Z78A 3FLTA 2E7QA 4GWJA 4FM1A 2QTWB 3L9JT 3ZYIB 3VHPA 2ZGOA 1W6QB 3AVSA 1REFA 2Q68A 1MS4A 1V0AA 3QOPA 5BZBA 4JI7O 1NCRB 3AJZA 4E27A 4AHCA 3FC0A 1UW8A 5L9RA 1M4UA 5KA5A 1JN2P 4FO9A 2FMYA 1S0CA 3ABLB 1LGNA 2CTVA 1H6XA 1Y9QA 4XILA 2KR2A 1K5SA 1DFQA 3QG5A 2VTXJ 5J2UA 5JH7A 4E4HA 4LBQA 3VBHA 4QGMA 4K0KO 3DTUB 5DAPA 1UYYA 2RS12 4FTBA 2G9ZA 3SCHA 1Y3TA 3B8NA 1HRI2 1UMZA 3H50A 5ACA3 4DV1O 2NYYA 1G8MA 3AP6A 1FKAO 1C57A 5FTTC 3V0AA 1ZL8A 4X65O 3TN91 4YZ2A 3GWKC 1SLCA 4BDVB 3KF5A 3W7SA 1VQLV 1LOEA 2VMHA 1POV0 4NTXA 1KYOF 4WM8C 5D8AC 5BPXA 4LFBO 1UF2C 5FY4A 1Q6UA 3C2UA 3WDXA 4A6SA 2BGCA 1GNYA 5FY7A 1N4CA 1YDXA 4HT1T 2RMU3 5C3PA 3JD1A 5E1AC 3ZFGC 3VBUB 1K8AW 2HWD1 3J26N 1IS5A 3ZN1A 5FJHA 3JCZA 3AG1C 3LWCA 5IFPA 4CH4A 4AHWA 5FCCA 3DYMA 2WT2A 4CEYC 4NRMA 4BQ5A 3N4MA 1VQ7V 4DR6B 3ABKB 2IJKA 3AG3C 5CVRA 1NA1A 4H7LA 2LQTA 3LPFA 4MTFA 4CU9A 4I0WB 3LSSA 1OJHA 3K3WA 4XDQA 1CR7A 4OI0A 2ARBA 1BK1A 4DR3O 5K1PA 1G86A 3FAVA 1QY4A 3EFFK 4LBQD 4OQ8A 3RVYA 3CP1A 2OS2A 3ZJZA 3T1LA 1KP2A 2AH2A 1SBDA 2HWD3 3HOBA 4IEZA 1OCRB 3J7NA 2BNMA 5KAIZ 3AVRA 3MUY1 4N90A 2FYUH 2O0OA 1C4RA 3ZFGA 4YVWA 3UETA 3CRAA 1ST8A 1S72V 4KP4A 2D6KA 3POSA 3DYPA 5IJ9B 4CEYA 4E2GA 4MSWC 4O4JB 4RYDA 1URXA 4OI2A 1YZBA 4B08A 4W6YA 1AF9A 3K03A 2XUEA 1RUD2 2CTWA 2DWEC 3E6DA 2EALA 1LOFC 4MW3A 4C1XA 3LPGA 2XJQA 1W9YA 3LA7A 4IGGA 1UZWA 4ARYA 1O8PA 4XJZA 1BQ0A 3BAAA 4HL0A 4WVVA 2TUNA 1ZWIC 2QBXA 1WW4A 1SCSA 3RZMA 1M9NA 1Z5VA 5HXMA 4TUYB 2EAKA 1K3IA 2VBDA 4IE4A 4NO4A 3BOWA 2W91A 2GTSA 5DXDA 1NJIW 4IW3A 1OC1A 2WQ4A 2NNUA 1FAFA 4Q4V2 4I3PA 1ALYA 4L9BA 3PJQA 1LEDA 4YYOA 3CMEV 1LJ7A 2FCVA 3RZZA 1VBA3 3NR7A 4LUMA 5L3CA 1W8FA 4PA3A 2ZX0A 5KHHA 3CX5F 1X82A 3B40A 1VQ4V 4Y20B 1Y43B 4QPGC 3N7MA 1XU1A 4DR7O 1P84F 2X0LA 1XU2A 4YLZA 3E86A 4XF0A 4AQ2A 4YGBA 4MG2A 1VBC3 2EILC 1HNXB 1AI5A 4J42A 2QA4V 1TUBA 5IVVA 1W8NA 2VMGA 3I3DA 2WN3A 1VARA 2J1TA 4IDZA 1BMV2 5HCFA 3B77A 5A3UA 2E32A 1X50A 5JIUA 3KT1A 4FPFA 4LF4O 2YC0A 2ZNIA 2BGPA 5HPOA 4BE3A 2VAUA 4XUOA 1MQTB 4DEQA 4U3JA 3I2HA 3CQOA 2A6ZA 3Q8BA 1Q7YW 2EIBA 4G28B 3G71V 1GN2A 1RMU1 4Q2FA 4XMIA 2EIGA 4QPGA 2XJSA 3HD8B 1NLRA 5IWAO 5A70A 2VBBA 3Q4HB 2DCTA 1JYWA 2RVAA 4ZU4A 2GH8A 2IXJA 3ZS8C 5IUQA 4H3WA 1XNKA 2JG8A 4MGTA 3FB5C 3WB1A 3LDBA 4DUXA 4FPHA 4BCUA 3NKGA 4ZS3A 1PMHX 5CFDB 1EFRG 2FL4A 4B4PA 2ZIMA 3UGHA 1TZOA 3ZMSA 2VZ1A 4L99A 2TNFA 4Y1ZA 4QPWA 4Q0VA 2ARHA 2EF6A 5EJ3A 1I08A 3MDSA 4UW5A 1QNWA 5F6KA 1KKDA 4UXAA 4A45A 4TOIA 3IAYA 3SJAC 1N32B 5CIRA 2PHXA 2WO3A 3LA3A 4UCOA 1ORQC 1WP7A 4YJ2B 4YM2A 5C8WA 1Q82W 1OCCC 2NN4A 3K4ZA 2D40A 1CD3G 1TA8A 1QVGU 3CMGA 3OGIB 4GMP3 3ASNB 5F3IA 3LNMB 4HKWA 1G9FA 1F31A 4FPYA 1UL9A 4KH9A 1OLME 1UX6A 2D98A 5L7OC 2VTXA 3JD71 1LU2A 2ILMA 4F7ZA 3I55V 1OV9A 5JOZA 4W50A 4NYKA 5E8AA 1LR5A 1C1FA 4NPMA 2ORZA 1NZ6A 4HONA 1GSLA 5JVVA 5LEJA 1Y9MA 1AYN1 2VOKA 4ASKA 2RHPA 5J2UB 1CEZA 5JH7B 2VUJA 3C8XA 1L1FA 3JXSA 3MF6A 5FUIA 3VBHB 1DGWA 1RTVA 4RS5A 4YSFA 1H1MA 4IEOA 5FPUA 1ULGA 2ZKOA 4GWMA 3LSQA 3LDEA 1VALA 2VE1A 3IWZA 1HV0A 2JB8A 3B02A 2ZNJA 4GCZA 5C8CC 3I7DA 4PIZA 1QJU3 4X8PA 1PO21 5FZBA 3V0AB 4HN1A 1CQ9A 4Q8LA 1AR82 1ZL8B 4DV0B 1F4HA 2BDRA 4LHSA 2R063 2WWUA 4Q4X2 2Q30A 4XF4A 3NAPC 1WJZA 5DEDA 4LBEC 1RVF3 4COWA 2ZZQA 4LHKA 4ZKTB 4EZHA 2A79B 1RUF3 3AP9A 3NQHA 1F5FA 2GC1A 1JZ6A 2WLIB 4FFKA 2V1DA 3H8XA 4RFRB 4QM8A 2BNOA 5H9CA 4Z2WA 4TYSA 2ODMA 4PI2A 5AFBA 1NA1B 5EV7A 4UB8Z 1DYPA 5LP6C 1FMD1 1UAIA 4Q6GA 1P7GA 1CAUA 5LA1A 2GN3A 1AR71 2R1BA 3FAVB 1AL22 2UUAO 1J58A 5IVEA 4MXWA 1C8NA 1UY2A 3RYRA 3P3PA 4KU8A 1YXWA 4LLOA 3WHTA 4HAMA 1N3QA 4Y4YA 4DINB 4UCUA 1SPPA 4LF6B 4YVWB 4P9IA 1Y7BA 4BYYA 2PGGA 1AR4A 1IS4A 1SKVA 3M3OA 1OKOA 4FPLA 3JALA 1C5HA 4CUCA 1A34A 2WAMA 3FLPA 4RD7A 3ASOB 4N8MA 2BRTA 3WVJA 4JI7B 1JZ7A 2SBAA 1YYNA 5LP6A 4M4RA 5KC5A 4I0XA 3QBQA 2K9ZA 5F2WA 1T6GC 5F5AA 3SH5A 3TNQA 3OM3B 4BZ4A 3RN4A 1AP5A 5DUVA 2ZABA 4QGLA 2W9XA 5ABJC 4KWUA 4GKJO 3SITA 4K0KB 2WT0A 4DR1B 4XETA 3ZRSA 1H9PA 2R042 3N2GA 5JOYA 3THTA 3HKCB 1Q8SA 4LO8A 1W9FA 4TSFG 2CSGA 4DV1B 2MEV2 2Y64A 3UKTA 1OMIA 3IAPA 2XLFA 2ATFA 3TRSB 3VD3A 4DV6O 2WZR1 1BHGA 4ZXKA 2F23A 4AE2A 1NVPD 1UXXX 2WINB 1VMFA 3MLLA 4UYBA 3JAMN 2WSSG 1W06A 3P1IA 1Q86W 4MADA 1UYPA 4LFBB 3HPLC 3PMEA 4QGPA 2F4VO 1H4GA 2IWGB 2ZEZA 2WR9A 2X7RB 3ZDSA 3CJXA 2RM23 5LK7B 5FY8A 3IDAA 4NPLA 4A7YA 4FJCC 2WSVA 3CS5A 1J59A 1RHI2 3IJ4A 4LKEA 5GONA 4WBNA 1RUE2 3S30A 3WT3A 1JI6A 2YFZA 1EN5A 1LCLA 1UXZA 4Q1PA 3G6JB 2BOCC 2D5HA 3RYIA 1TUBB 4GQ7A 1FOD3 5FYIA 1CPNA 3OBRA 5FP4A 2NM1A 1FI2A 2Q8EA 1AI4A 3VZLA 1E1QG 3FFQA 4Q4W2 3AP7A 1W8UA 4XOGA 1LESA 5JMOA 2ZA9A 1NR1A 1B35C 2CYFA 5I0UA 1WW5A 4F6RA 3D3QA 3O1SA 1GMGA 1TGOA 4U3JB 3AMPA 4Z8BA 1KDKA 1EAH3 1BQPA 2P06A 5B1AB 4DUWA 1NOVA 1IQDC 2DVDA 5D21A 1WB8A 3IFXA 4AG4A 4QD2A 4GUNA 3HKDA 5JOXA 3FBYA 1CGPA 4PDWB 2JG8B 1HW7A 2P1BA 4OFGA 5EYYA 2YI8A 4ZIBA 1VLNA 2Z4FA 3RT3C 5LBFA 5LMUO 1UX7A 5BNOA 4R6ZA 3C7HA 2EZOA 4E8DA 3VBSC 2PF4E 4EN9B 5FYHA 5FMDA 1E57A 4HN0A 5F3GA 1GH6A 3OUIA 2W87A 5B1BB 4CZZA 1QNMA 1PNGA 4H14A 2Q7EA 2L35A 2UUBB 3FFZA 4KWKA 3HWJA 2W5FA 4Q0SA 3DXTA 4DXRA 3CCVV 4Y1YA 1F15A 1FPN1 1O3QA 1OOPC 2ORXA 2Y0OA 2BP6A 5CN0A 3WP5A 1F2NA 1R64A 5A33A 2UU9O 5M0TA 5JR7B 2QQVA 1YJ9V 3CIHA 1WMFA 1FAYA 2YU2A 2MNGA 1YUDA 3PJYA 3PUQA 1QJY1 1JH5A 4GB31 1GTOA 1ZRRA 4DR7B 1W6MB 1UD1A 3APQA 1KBHA 1STMA 2VNOA 4BQYA 3B3QE 1KGYA 3AK2A 2PZSA 4XHXA 2HLEA 2YI9A 4JI6O 1O3RA 4RS5B 1JPXA 2GNTA 3VQVA 3UYJA 2VQFO 3JQXA 1CZVA 1MZEA 2DYSB 1RUH3 4XQ4A 2F6BA 5IK5A 4ATFA 2V7QG 1V9U1 1OOPA 2YPDA 3POEA 1APNA 1H30A 3VKMA 3J80N 3DCQA 1KFXL 2BJSA 2FDKA 4FFBA 2Q8OA 4GB33 4B29A 1BBT3 4JI1O 1HKDA 1WGPA 3K5OA 5IWAB 4DUYB 4B4RA 4B4QA 1OVPA 2CAUA 2DVFA 4MSVA 4FM0A 4CTEA 1R081 3U07A 1GKBA 5CNAA 5FZGA 3IDCB 1YHQV 2Z3YA 1MVEA 2WS91 2GBOA 2EIEA 3E22A 3V56A 2XONA 4PA4A 4LIUA 3NNGA 2Y4TA 4LH6A 4EQVA 2QKAA 5F3EA 5EPAA 2BVBA 1LEMA 4LXLA 2KXLA 2E7TA 2AZ2A 3J8F1 1GUIA 4JZRA 2ADEA 2V09A 1CAUB 3K4DA 4P9GA 1OA2A 4F3JA 1XQNA 4I02A 1TME2 3E2EA 1Q56A 1KU9A 4JHTA 2UURA 4CP2A 1YFXA 1XBLA 2Y6FA 4LKDA 3RMYA 1FXHA 1SPPB 2RS51 2WFF3 2KKWA 4BWAA 5C6CA 1DQ4A 5FXZA 5JXGA 3JALB 4LOSA 1G6NA 2XXZA 4OUSA 5CA3A 5EBMC 4MTOA 2WNEA 2ADDA 1O9GA 3EMRA 4MGQA 2DCZA 1WA8B 3RZJA 5LP6B 1M5IA 2QR4A 1AL0G 1GOFA 2DYRB 4I0XB 1SFYA 5FY5A 4OHZA 1IBMO 5D5PA 1K5JA 2AACA 2TEPA 4QB1A 5DABA 4CDQC 1K45A 1S3JA 3FX3A 3SPIA 5C3RA 4GZ9A 3ILRA 3THPA 3N2GB 1NY71 5E88A 3B09A 5FFOC 1D2DA 2HYXA 3RYHA 3USUA 2DW4A 3L71H 1HN1A 2A6YA 1DG6A 3POJA 5JR2A 3DECA 5FPVA 1MMMA 3RWRD 4HVOA 1POV1 2VMEA 3ENRA 1R093 1TNFA 3HPNA 5A6YA 2WUHA 4NHLA 4QKFA 5CA0A 4JX0A 2B4KA 2XB6C 5IHRA 3KLSA 2CDPA 1W2UA 1XPWA 1KUQA 3I3QA 3LIGA 3ZVXA 1IS6A 4FFGA 1DK1A 4QXBA 2HWE3 4BIFA 2C24A 1JHJA 1FATA 3IGAC 4MVOA 3PL0A 1COV1 1EV13 4UFIA 3LUTB 2BWCA 3QO8A 5C5UA 2WSUA 3H1HH 3H1WA 4J7ZA 1C3HA 3RYIB 2QM8A 1AI7A 3T2TA 2PQSA 2F66C 2OWOA 4YVSC 1ODMA 3ZXKA 2HWF2 1W0OA 3AC0A 4DB5A 4QM9A 3AXDA 1UKGA 2UUAB 1C5IA 1Y9GA 2D43A 3W7WA 1W05A 2OQ6A 3CKHA 2XLGA 3VD7A 2YU1A 1HDKA 5KXBA 4F6RB 1PZ8A 1NQTA 3DPRC 2DCYA 2V73A 1LKNA 1R3LC 1XE0A 1WCUA 1OZ0A 3BU7A 3KSCA 3FUOA 2GP5A 2DTWA 2GH2A 4CCJA 2FHRA 3G4SV 2PQQA 2VOTA 1V6OA 3CRMA 2WZPP 2B1GA 3K3OA 5JCTA 3AG7A 4PA9A 1K73W 3HKDB 2VMCA 1J3RA 2HWC1 2YGMA 1HQNA 3I4IA 3E1F1 1G6UA 2VZPA 1W28A 4B7KA 2W92A 2ZGNA 1G4YB 4AWDA 4BXSV 4H55A 2E6VA 4YWAA 4YW7A 3SJQC 5H6RA 4YVSA 4ES8A 1SACA 5EWSA 5BNOB 1AX2A 3ZRWA 5F39A 3AKRA 5HV4A 5GZGA 1LUWA 4AQYO 1UNBA 1AJOA 2HJFC 1WNSA 3K4AA 3IPVA 1W9SA 1ONAA 3NNJA 5FIXA 1M06G 4DV4O 5J3UA 4MVSA 3E5QA 3U14A 3UCSC 2GALA 3AK3A 4K40A 4XFCA 3ZYHA 2WLMA 4COVA 4AFBA 1NH2B 4LEJA 4DV6B 4TT3G 1QOOA 5GLTA 4BPZA 4TWKA 3T1HO 1KQSU 4S2HA 2C5DA 4JV4A 4IL6Z 1E1RG 4U7OA 2OYQA 1XL6A 1R3IC 3GNEA 5A33B 2CDOA 3VDBA 1MSWD 2ZE5A 3RRDA 4E2SA 1OH3A 4DO0A 3N7JA 1CWPA 2RS13 2F4VB 2Z0AA 3ORJA 2F4PA 4LKFA 1OT5A 1HRI3 5KR7A 1WPBA 3TEWA 3T4DA 2WYSA 2QWRB 1QJX1 1EBOA 4GH4B 2WLJA 4EJRA 1RUJ1 5DAQA 3O1TA 3SEEA 2VG9A 1JW6A 1JZ5A 5JCOC 5LXTA 4AI0A 5LBBA 4RN5A 2P6CA 4J80A 3E89A 1AR62 2GMMA 4QIWF 4UF0B 4P9LA 4JDOA 1CN1A 1TVGA 1HXS2 4BJ0A 1TMF1 5J9PC 2VOXA 3OUJA 3LSUA 4ISQA 1YNAA 1OOPB 2PYJA 3WF2A 5CKNA 1KECA 1UKRA 1BCCH 3SYQA 3BEHA 4FFBB 1KQRA 2KB1A 2Y48A 2IXKA 4GKKB 2HH9A 1Q8PA 4DIQA 3ZMTA 3B94A 3IDBB 4Y26A 1ZBE1 5IFTA 4DV3B 2JGUA 3HMYA 2VQAA 1WN7A 4N9IA 4WVMA 3M7MX 4AHYA 4HVQA 2B1IA 1JZ2A 4QXCA 2QJVA 5JSPA 1PVC1 2DDUA 1E5HA 2CTQA 2GP3A 3N7LA 5LEKA 4KFMA 2L9LA 3QH7A 3WDYA 3E22B 4BIOA 1BT8A 3FHAA 5EK0A 1GZWB 3MO4A 4RAIA 1Y74A 5LMUB 2BYVE 1DLLA 2P3YA 3A0HZ 5FZ8A 3NNLA 1FYJA 1J3QA 1OF3A 2XAQA 4JQRA 3ABZA 3VZJA 1WLWA 3DSQA 3CRRA 4YHHO 1R1BA 4LK7A 4AFMA 4RUEA 4JASA 1FYUA 3OGJA 2Y0PA 2H8PC 4LCUC 4F4LA 1RUC2 2UUCO 3KHBA 1UMIA 3P30A 3WCSA 5CBHA 4TXWA 1GQGA 3K59A 5AG2A 3BA9A 4L0PA 1XB9A 1YXBA 3VDDA 1QNYA 3K46A 3CRCA 1YFUA 2LM3A 1WUVA 2WYFA 5KXEA 5C70A 2UU9B 1B09A 2YPJA 4UAPA 2ENRA 1FX5A 1ZBA1 1ZZ7A 2OW4A 5BNPA 3D8CA 2GV9A 4LORA 3O0XA 3KMHA 4OI4A 4IEXA 1VRH1 1DGWX 3ZXJA 3ETGA 1XQ8A 2RQ6A 1PK6C 1GN4A 1IQAA 3S5AA 4AEJA 4NPRA 3ZFEA 4JI6B 4D6SA 1RUG3 5FYYA 5L9VA 2VQFB 1ZZ9A 3T08A 3BVOA 1SLBA 3RYHB 1PNMA 4NE9A 2ZR2A 4DW1A 2CAZC 1NTMH 2QVSB 3LEGA 1DZRA 5FNVA 4PDRA 5J2TA 2RS33 5LGTA 2LUWA 2XVLA 4OI1A 1V55B 2PY5A 3OTOB 4JI1B 4WVZA 1PV0A 2GZWA 2WWWA 3SPJA 5IK4A 5CA0B 1ENXA 1VF7A 1JZ3A 3CCEV 1W59A 3D0JA 2GUZA 1PK6A 3RJ2X 3VKFC 3SYPA 3WP3A 3SKJE 2BPA2 3S3WA 1N33B 2AHZA 2ZM6O 5G05L 1VQOV 4ICGA 3RG0A 2JVDA 4Q0QA 5IVFA 1J5EO 4GX2A 3A2FA 2CL2A 2EBOA 4PLMA 1GKFA 2KA3A 2PHLA 1C28A 1GNHA 2ZXWC 2QQOA 5L3DA 3W7UA 1GP6A 4D69A 3JSLA 2D6PA 4PQQA 5ACA2 1V54C 1CVNA 3VUOA 2ETNA 2RV9A 1UZ0A 5LHHA 5EJ1B 3OD4A 2R32A 4R7CA 3C90A 5A7PA 4X89A 4BK4A 4BQ2A 4UCSA 2RDQA 1NCQB 3WG4A 1GQHA 4JF3A 2E53A 4K3UA 4G27B 4NXMO 4KG8A 1YJWV 1XI1A 2D2CB 4Y1UA 3VD9A 2AUYA 1DF5A 1CPYA 2XL7A 4FLUA 4YVSB 3OOXA 3TXSA 2WLQA 4F8AA 3KF3A 1UPGA 3ZRWB 4R9BA 4XJAA 3K08A 3WV6A 3R65A 3M4FA 5IK7A 1H2LA 1LNQA 2GNMA 1IBLB 2CGPA 4GA9A 3TN92 3I97A 4EWDA 3ACFA 2EA7A 4PJYA 2QGNA 2VMFA 1M56C 3QD6A 5TSWA 4DYLA 3SEPA 4JI0B 3K58A 4E8CA 5FKBA 2CNAA 3ZLIA 4NIGA 3NXSA 5JDBA 1ZREA 2P6HA 5H9SA 2IXHA 1D5AA 4JV5O 2JICA 1UN1A 1MNGA 2HWD2 1AJPA 1JJOA 4CH3A 1WD4A 3A0BZ 4IE6A 1EN4A 4JGSA 2IXIA 2WZEA 1US3A 4AGRA 3T0BA 3BPSA 3I8TA 1FXVA 4P2ZA 1XE7A 3WW4A 2ARAA 5J7MA 4GX1A 3W5NA 1P8JA 2J7MA 4PBPA 1H1IA 2XBO3 3TEZA 2YIDA 4D6QA 3K51A 2QQPA 5LYJA 4C8DA 3LDDA 4FK5C 1YO8A 5LXTB 1J83A 4D8MA 1GWMA 3RYCB 3FX7A 4JDMA 3VBFC 1PX3A 2Q8DA 2JE9A 3W7TA 3LQCA 1UIJA 4XDLA 4UXNA 3PU3A 1QDCA 3GZTB 1WWYA 2Q69A 5FPBA 4PIXA 1XDCA 4OHVA 4R8HA 1ZZCA 4DQAA 2VL4A 4XF3A 1SERA 2DUQA 4C7UA 1QQP1 4XPVA 1GLHA 3ZSEA 1ENSA 4WVMB 4OZOA 1VBA2 1C8M3 2R9IA 2HJIA 4MVMA 3CCJV 3AG2C 1AL23 3CE2A 1UCXA 3ROUA 5FPRA 3VBFA 4ZOLA 3AG4B 3WF0A 4XHBA 4OLLA 4K7JA 4A2UA 5CBGA 4J7KA 1VBC2 1PL0A 1UY3A 1LULA 3ZKUA 1EN6A 1G8WA 4AQYB 1MS9A 1N34O 3JAKA 3MIGA 1XC6A 2JDAA 1JU4A 2G9FA 3QACA 3EB7A 2FDFA 4AF9A 4J7JA 2ET1A 1FV3A 1A6CA 2NMNA 4GLXA 1B3QA 1XHZA 1IOAA 5J36A 2IJHA 2XH6A 2Q7GA 4GKXA 2J42A 1A32A 5FXWA 1JXNA 3B2EE 3RGBA 3SHRA 3MW2A 3VDDB 3T1HB 1THZA 3CXHF 1UYZA 1I3HA 4HETA 3GDBA 4A3ZA 1AVMA 4QPIA 2E5LO 2EAAA 2ZGLA 2GU9A 5BNPB 2JECA 1ZUQA 4UW3A 3CXCU 3ZBHA 2I07B 3FBMA 3OTFA 3HQRA 2LW1A 4CVUA 1VBE1 3J4UH 3STLC 3ETDA 5A3MA 3QCWA 4HZ3A 4UOJA 4UWDA 1QVFU 3ZFEB 4JI5O 4IV1C 2QQJA 5CB4A 2AXTZ 1RM1C 1G1XB 2AENA 1K97A 4LF7O 1VAVA 2OIGA 3WF4A 5FOBB 4B1MA 1RMU2 3ML0A 1SCRA 4G9SB 3JATB 2RDNA 1L0NH 2PLV3 4CXYA 4Y4RA 3FB8C 3KZ4C 2KM2A 5J2TB 2VM9A 4INDA 3EO6A 1RHI3 4WBBA 2IJJA 1RUE3 3OGCC 2A3XA 2W68A 5FZAA 5C3SA 1AX1A 5FZ9A 4NRQA 3CCMV 3MZHA 3UNPA 2D3OW 2GUZB 1PK6B 5BY5A 4Q4W3 5B66Z 1IBKB 3WDUA 3ZSMA 3CJIC 4I7ZB 3CEWA 3IMMA 1ULEA 4GKYA 1J1TA 3SCGA 3KQ4B 3ZMZA 3V65A 2ZT9B 1UJWB 1WMDA 1PO11 4D7TA 1PIV1 3A23A 2LW8A 4ZU5A 4YHHB 3S7EA 4XAAA 2RR11 4ONUA 4M3CE 1FFXA 1REDA 2UY9A 1ENRA 1K34A 1AXKA 3N9PA 4NIAA 3JD72 2EJ7A 3A8TA 2E9QA 1K12A 1JOBA 3KQRA 4O61A 2ZX3A 4AVBA 1AXZA 2D6NA 3AYAA 3O1UA 1GR3A 2HKOA 4KBZA 1AYN2 5GLUA 1Z2GA 2R062 4I4TB 1YHFA 3EHBB 2A9HA 2CH7A 4TZDA 2QQWA 5L3EA 1V6JA 3WP4A 1DQ1A 1RUF2 2FCTA 4DV7B 4M00A 3MAQA 3VQWA 5BNQA 3SH3A 3SYOA 4PBOA 4YM1A 4G3YC 3ZYFA 2ADQB 1PO22 3LDRA 3IC7A 3CF6E 2IJIA 5LA6B 2G38A 4EE2A 2VECA 3AZXA 4U36A 1JBCA 1Y67A 3QTCA 1SESA 4L97A 4FOVA 2DU1A 4Q4Y1 3I3MA 1WLDA 3SQOA 1GU3A 3UGFA 4LBNA 4D6TH 5FR3A 1ND2C 2W39A 4BOWA 4V1PA 2O57A 1VJ2A 2FTKA 1NE4A 4ZS2A 3NRUA 5C5TA 4CDWA 4QQOA 5B4XA 1FMD2 2EIDA 2Q1FA 2VOWA 2EIKB 1K92A 4RR3C 5GLWA 1MEC3 5EC2C 1AR72 3JBG1 3TWIA 1ULFA 3BB6A 4CS3A 1DHKB 3B4SA 4G4FA 2ZM6B 5HFMA 5LYJB 4CSWA 5A1AA 1DQ5A 3ZEDA 1J5EB 1ZRDA 1OCZB 4JRAA 3OCPA 1VBD1 1W9WA 1V6KA 1VBB1 4GALA 2F43G 4IEUA 1NAEA 4PI0A 1OHFA 2JDYA 3MLJA 1UZVA 2V4DA 3R4SA 3W5MA 2P67A 5C9AA 4QB2A 1FXKC 2HWB1 2IH1C 3WD5A 4FLYA 1Y6XA 1OLQA 3K77A 4GZRB 3LD8A 4P00B 2WRAA 1YTFB 1AYM1 4RR3A 3UO2A 1U12A 1EY2A 1CESA 3KM5A 5FO7B 3C7FA 5B5EZ 5IJ0A 3VL9A 3IIAA 3RYPA 1X33A 4NHYA 3P5BA 2VVDA 3ZMUA 1PGW2 5C3QA 2RM22 2QJ1A 2Y0IA 1A8MA 1QXRA 4FPJA 3CWBH 4X88A 4X66B 2PELA 2A7AA 4HKOA 3PVNA 4ZOLB 1BZWA 4K6BA 1BSMA 1Q43A 4N7IA 1SQXH 2FMDA 4PT6A 5FK7A 4R4XA 2R30A 1Z0HA 5FQ0A 2WL1A 3E6CC 5LCWL 1VF6A 1SDWA 3HR0A 3I54A 3G6EV 3O1PA 1IXBA 1W2NA 4JV5B 3MIHA 4DV5B 3LA2A 3VKOA 1OKQA 3NWKA 3THOA 4MVQA 5E6HA 5CAZA 1NXD1 1K5MA 4XTPA 4DR6O 1SG3A 2BTOA 3LGRA 5D5QA 4DY3A 2JDIG 1EAH2 1NCRC 3L2YA 1X8MA 1YQ2A 4DK0A 1QHTA 2RJKA 1VP7A 1F7YA 3ABLC 4QPIB 1RPOA 1WLCA 2P90A 5CBLA 4UFHA 3CC4V 4LBMA 5DN2A 2VS0A 4YW1A 5E16A 2GHYA 4MGIE 2JGDA 3RYFA 3WQ0A 2JKXA 5A7OA 5FPLA 4M0NA 3H1IH 1N1TA 4O4IA 3LSDA 3G7DA 5FY1A 2QQLA 4PLNA 3N36A 1BEV3 3E8GA 2QTOA 2FDJA 4AAXA 4K20A 4JZGA 1Q6IA 3ZX7A 1JCHA 5T5JA 3BKZA 5CMUA 2ZGPA 1XSQA 3MIEA 4KBBA 3OGGA 2D6OX 2JS3A 1GRJA 2AC1A 1IVSA 4XQWA 2W0XA 2FB5A 2WA4A 4Z07A 1J1LA 2ZGSA 3KVAA 1YVWA 1Q8IA 2CWSA 1WCQA 2R7EB 2JENA 5F2SA 2YXSA 3HN3A 5DDJ1 4PDVA 2ZQMA 1CIWA 1SQVH 4DK1A 3UT5A 5CFCA 5A7SA 2HWF3 3ZDVA 4FXGB 4FFFA 3ABKC 1WLEA 3I2FA 1S0EA 4BH9A 2NQYA 1Y4WA 3HT2A 2BOIA 3BCCH 1NKGA 3SYAA 4N43A 2B5UA 4YW6A 1SLAA 3AFKA 2PI4A 2ZEYA 3ZIXA 4LOTA 4XJWA 2BBVA 1DLCA 4N53C 2XJRA 1FPN2 4AW7A 3JB4C 3OD0A 1N34B 3OBTA 1RUH2 3Q8EA 1OCRC 4JYBA 1FFXB 1E79G 2PXJA 5F1RA 5IVBA 3AXEA 1KC8W 4ZBMA 2ZDIC 5ANNA 4MYEA 5IWFA 2ITDC 2ZR3A 2BZDA 4J9YB 4UCVA 3RPQA 1QJY2 3J7LA 3JARA 5FZIA 4GB32 2VWKA 5IAXA 1BBT2 1U5YA 3OG2A 1HNXO 4Z2AA 1RUD1 3NV2A 4Z1MG 2RE9A 3POFA 2CH7B 4RO2A 4HLTA 2E5LB 1N3PA 3R66A 1XNTA 1SBFA 3VHOA 2BOJA 1JS9A 3BGAA 1L7LA 3T1MA 2Q1ZB 4XEZA 5FO8B 5APAA 4N53A 4ZU7A 3NJZA 3GJBA 1QJFA 5C93A 4LO7A 4FIPC 2Y6HA 1MABG 4JI5B 3AK0A 2YUAA 1UOBA 4QHBA 3D36A 4LF7B 4DR5B 3M8AA 3O65A 5EP9A 1RUOA 3FKSG 4AI8A 4MVUA 3NVCA 3MIDA 4Q4V1 1EUTA 2UXDB 5CBFA 4NHMA 2EIJB 1VB4A 4AI9A 1OPOA 1R082 4CDXB 1DGLA 2WS92 2RN9A 1W6OA 4IGPA 3GHMA 5JIAA 3ES4A 3ABMB 5L3FA 4CDWB 5LY1A 1AR63 4UUJC 3J8F2 5CA6A 4YG0A 5JXJA 1VMHA 3ZM8A 3FHQA 4Y5SA 3VZMA 3CRQA 4CCLA 1HRV1 1UOGA 3ZXAC 3I2GA 5EQUA 3HKEA 1JOPA 4IYHA 2DWDC 4FSJA 3T4ZA 5JSRA 5DECA 4YXWG 4I30A 4BU2A 4JTDB 2YV8A 1XEQA 4M01A 2ZMKA 4TSVA 3VZKA 2J1UA 5B1OA 4NHKA 2RS52 5CA1A 2YHJA 4E9KA 2VWJA 1B06A 4AOCA 2YXLA 1HW5A 1MQTC 4AQSA 3F7VC 4LF9O 1H0BA 5C9AB 4NIDA 4Y20A 2JK5C 5I0TA 1QQCA 2EXKA 5CG9A 5FYSA 2QKDA 2OCCC 1BS3A 2Q67A 3UKNA 3C7GA 2P22C 2WLLA 1R092 2VUAA 1GFF2 3PDQA 4YM0A 5IJ0B 3ZMOA 1ZLZA 5FP8A 4FM2A 2OIIA 4LQRA 1FPOA 3MIFA 1DQ6A 1NY72 4H13B 3L73H 5IY5B 3ZN5A 5CFDC 4LA3A 1KEXA 1WBFA 1RUC3 4XACA 4KI5M 1LOCA 1QH7A 4MHRA 4P08A 3E8HA 4LPLA 4EKWA 3W59A 3GWOA 2CY6A 3RVHA 3A0RA 4CP9A 4DV0O 3UT0A 1XXNA 5JZGA 4H44B 2VU9A 5LBCA 4TLFA 1HB4A 1KKCA 1ZSPA 2XJVA 5FQ0B 3ZRXA 1E5IA 4LNVA 1RSOA 2Q4PA 4WFHA 3U4XA 4JAAA 3PJSK 1QCEA 3CPWU 3ACLA 5C8YA 4BMBA 1K42A 2ZHMA 4XIKA 3RS6A 4PJ0Z 1NI8A 4LHNA 4UVBA 4KXRA 4B7EA 4KU7A 1L7RA 4Q20A 1K5MB 3R4UA 4RGAA 5IDJA 4ZZ8A 3UJQA 2VCMA 5FREA 1G7YA 5HCAA 2JG9B 4JRLA 3ZSKA 3NV4A 2D7FA 1HP8A 5DAWA 2YG0A 2VO5A 4XF9A 4R4ZA 3IBMA 2XHBA 4GIQA 5CG8A 3PIJA 4XQDA 2AEZA 2ZGQA 4HSLA 2ES3A 3VBHC 4D6RA 3RYFB 4ZPIA 2Q8VA 2MPFA 3NO8A 1XYNA 4FFHA 4O4IB 3DEMA 2VZUA 4ZONA 2XT9A 3JYCA 1AI6A 3AFGA 3TEYA 4BLJA 4K21A 2ZE7A 2ZACA 3GF6A 4A44A 4BQ4A 2J1SA 5FZOA 1X8EA 1OD3A 2KQXA 3IDEA 2F1MA 4A4AA 2ZHKA 3UK9A 4Q4X1 1OH4A 2F93B 3B00A 3T0AA 2OUHA 1BQZA 2PMWB 5C7GA 4HNAA 2XHKA 4X8NA 2NPIA 4C90A 2BTVC 1H8TC 4ASLA 4QHOA 1SF9A 4DR1O 2E31A 1HJFA 1YIFA 4AFAA 5KWRA 2OYZA 3UT5B 1MACA 5CFCB 1AXYA 3DUIA 2YBSA 1NA1C 4R52A 5ERLA 3LAGA 4COYA 5LA9A 3VBOC 4B3SO 1SQBH 1SMVA 2B7YA 4N43B 2YXYA 3UL2A 1LUVA 3HNMA 4LH7A 5FMCA 4RSUA 3NNMA 4JI3O 1QEXA 2OQ7A 4X62O 3N9OA 5BNNA 4LWSA 4G2KA 3WF3A 2Z79A 3HNBM 3OPZA 1XRUA 4X1IA 1H8TA 4YVWC 3LNNA 1YQCA 4ABMA 1TVKA 1JZ4A 2WLIA 1OA3A 2F17A 3WEZA 3SPCA 3JARB 3TOJA 1H38A 5A6QA 4AGGA 2JS5A 2B9UA 2QNKA 3ASOC 3WG2A 5JPMB 1YCIA 1RUJ2 4JI4B 5T5OA 4TLGA 4LF8B 5JJNB 5A3WA 2XJTA 4DEVA 3VBOA 3TN93 5ISLA 1PZ7A 3DYOA 1RUI1 1AB3A 1UPIA 4KGGA 4YFWA 1R3JC 1S5LZ 2XOMA 3THDA 3K2OA 1TMF2 3C3SA 1XOYA 4XABA 1R3KC 3SYCA 4CUGA 4FPEA 4D0QA 4N53B 2R041 1WBLA 4K35A 1LGBA 2Q1MA 1UWWA 3WQ1A 4AQTA 1GM7A 5EIYB 4P9XA 3SR2C 1T6BX 5A7QA 4WFBV 1UIKA 1ZBE2 2P5OA 4LO4B 4M3CA 2Y6KA 4QDSA 1D5NA 3OFNG 3I2JA 3N7KA 5JI7A 1O3TA 1BMFG 4TV8B 1PVC2 4XBNA 3O12A 1I7FA 1W6OB 3MHZA 4S2FA 4AEDA 4S2DA 1QOTA 3B01A 3W7XA 1E5SA 2HBTA 1BCXA 2ZX4A 3CO2A 1R1A1 5KXCA 2VXJA 1RYYA 1HQWA 3OR7C 3HKCA 4NIIA 2BE3A 4W65A 3HKEB 3AK1A 4AFDA 2UUBO 4QWNA 2OT7A 1C1LA 3KT4A 2X10A 1MZFA 5I0SA 1H8HG 4QPKA 3WSOA 4XUNA 2A71A 1DYKA 4R9DA 1Q5OA 4EFEA 5CA1B 3LEKA 1RUG2 1R73A 2ZMNA 5EIBC 3JCUZ 1S0VA 4M4PA 1RXGA 3Q8FA 2HP8A 3PHMA 4DR2O 4J11A 4K1ZA 5B1AC 4AI3A 5I91A 1VQPV 2RS32 1XUQA 4UVAA 1VRH2 2WLLB 3W20A 3SH4A 4IYIA 4PDWC 2VTFA 2FQPA 2JG8C 2LFSA 4X20B 2VRZA 5F32A 3KZIZ 1W8WA 1OURA 2ATKC 4BA6A 5DUWA 4X6QB 2LFRA 4LP8A 4QDRA 3KGZA 3WFVA 1OI6A 3A21A 4P9YA 1WD3A 4CP9B 1TE1B 3R0RA 1OSGA 1QMJA 5B1BC 5JZGB 2CGOA 2C2AA 2B9VA 2D5FA 1VF5B 1VQKV 4WM7A 1RSOB 1ASJ1 4DUYO 2OCCB 2HFEC 3BIEA 3SPGA 5C8YB 4PDWA 1M57B 5FZDA 1Y4MA 4F6EA 3U11A 3I49A 1WW6A 5AVAA 2PAKA 2WNOA 1O59A 3SJBC 1EZJA 1W6NA 1AR91 4RHV1 2QQIA 3B69A 2HHHB 1L3JA 2K0GA 4D94A 4QU2A 1H8VA 2MW2B 2LS6A 3SCFA 4HOOA 1EYBA 2JRIA 2QZ3A 1RMU3 2OPWA 5FYTA 3N2KA 2ZJCA 4BM8A 4RQFA 4Q8KA 4OPHA 4RS5C 3N27A 4QQHA 3ETEA 3GZUC 1FS0G 3DGEA 3OUHA 4FZ0A 2DYSC 3WHUA 2DFCA 4Y3OA 2Y6LA 4L8JA 3RWKX 4LFCB 5LOVA 4YW4A 2VOVA 1GOHA 2P3IA 3N9QA 5FZOB 4FOWA 4RQEA 1T5EA 3V64A 5EIBD 5KHJA 1N1YA 5EYPB 5FZMA 4DW0A 4LF9B 1REEA 1GM9A 3IZOA 4D7YA 4GMP0 4HNAB 1QU7A 4Y22B 1W6MA 3MW3A 4GJYA 1ZA7A 2G9GA 4QX3A 2D44A 4QPYA 3HNYM 2AEYA 2HYKA 4GJZA 2JXAA 1XMOB 4EN6B 3T1YB 1ZTEA 4AI2A 1LTEA 5IE9A 3NKTA 5I93A 4KNCA 2VW2A 2XBO2 2D93A 1PPJH 1FNZA 3JD73 5FDBA 2JJ2G 2WO2A 3OMNB 1BVVA 4OHWA 1TME1 2VQEO 2PYTA 2HVJC 1UU4A 3VBRA 5BY1A 1AYN3 1QU0A 2WIIB 4P5YA 4A6OA 4N9HA 4UFJA 5L73A 5BNNB 4LWSB 3H1LH 4Y1XA 2XGXA 5LK5A 4L11A 4Y33A 3K5NA 3VQXA 5FJKA 1I5XA 1KITA 5FZ3A 1JR9A 2JDHA 5A3PA 5FUNA 4FVMA 4X1IB 5KUKA 1SHWB 3IT8A 1PM9A 1H8TB 1D4M1 1NR7A 1ULCA 2ZX1A 1P7BA 4AHXA 1TVKB 3WUDA 5LMNO 3CCSV 2RNBA 1W8HA 4CDUA 1GN3A 4MGYE 5SV8A 4J10A 4HXCA 1ZM1A 3AP4A 3H3LA 1PO23 3STZC 4JYAO 1VP6A 1MSDA 3CCUV 3VBOB 2DYRC 1C8M2 1GZCA 2VD7A 4XDOA 1OCOB 3RQ0A 3BN6A 3AKPA 3VZOA 4QX5A 4Y5Z0 4W8JA 4C0BA 5B2GB 5AC91 2VMIA 2VJXA 3JD2A 5L36A 4YZ5A 4PD4F 2QSAA 3UJOA 4FZ1A 5JPNB 4X1YA 4HPKB 2R071 4V2VA 3VN4A 1HNWO 1F9KA 4MV2A 4LF5O 3J7HA 4MVTA 4Z92B 1CAXA 1OBNA 2PHDA 4M3CB 1FMD3 1VMJA 1JUHA 3CC2V 1H6YA 1OVSA 1W04A 4IE7A 3JASA 4TV9B 2GC2A 1AR73 1DQ2A 4QAWA 1WA8A 1LENA 3WG1A 5KHGA 1N0NA 5IVCA 3OUFA 2E74B 3WDTA 4H7MA 5DG1A 2AW9A 4AYUA 3DL3A 4KG0A 4JHZA 2DF7A 2WLNA 3JCIA 1I5YA 4AEDB 3PNAA 2WAAA 1WKYA 4C1WA 5C4WB 1GO3F 2XAGA 3O1OA 5KHIA 3B7MA 3KV9A 3UV9A 1TUEB 1BL8A 2LP7A 1Q3EA 4B1LA 4B3SB 2WNVA 3VOUA 2N7GA 4H33A 2HEWF 2YIBA 3O5SA 3ATGA 2WDBA 5HFLA 4XC9A 3M3EA 4JI3B 3IIIA 1IURA 3AB0A 4ZI7A 4X62B 1H8EG 2WJSA 1ZRFA 3IAQA 3H3ZA 1XNRO 5J37A 4QKNA 2X5IA 2UXBO 2PLV2 4XFIA 1NKDA 5LA0A 4CH5A 3JSNA 3RI8A 5LHGA 3MYXA 4MGZE 1S55A 2E51A 1WMEA 2YYOA 1SZXA 5JAXA 2XAHA 1D0GA 1VBE2 2WZR3 1WCDJ 1PGSA 4HANA 2QKSA 2OVUA 1GN6A 2NZ9A 1ZNPA 2OZ6A 5BNOC 3T3YA 1LHWA 2DFBA 1D4VB 3JB8A 3ZXFA 4W6XA 4LMFA 4LR3A 5DAXA 2R0FA 3WUCA 3DXRA 5IYBO 2GDFA 1JODA 1KRIA 2VVEA 3KS7A 1UZYA 4W4ZA 1HX6A 1SLIA 4GKKO 3O0VA 4P5HA 1XHXA 3GALA 1PNFA 4DV3O 2DTYA 3H01A 4WM7B 1PKXA 4AZZA 2KG7A 5F6LB 3T2OA 1SZBA 3AYEA 1ZAUA 2PAMA 3ZFFB 2CDYA 3U78A 4NWWA 1N0JA 3I5DA 2J1VA 2X53S 2DBNA 4OYUA 2YGLA 4NAMA 1W6NB 3K48A 5K8SA 1LODA 1YITV 3L74H 2RCVA 1TEIA 1PO12 4E2QA 5ANQA 1PIV2 4GH4C 1COWG 2WT1A 4U2AA 3N2KB 2ZGKA 3LDKA 5A80A 5FL7G 2ZOEB 1WB7A 4P02B 4Y5TA 3DC6A 3TXQA 2V72A 2ZBJA 1HXS1 4FLTA 2WLPA 4JGYA 3M3IA 4CCEA 5A3TA 1HNZO 3RZHA 4EROA 3OMIB 4BQXA 3GBWA 5LOVB 3ES1A 1QXJA 3OGSA 3BPZA 1V9PA 4IXLA 3FWEA 2PTMA 1YWKA 5H2FZ 1W8ZA 5DG2A 2ETEA 1ZVFA 3N35A 4DR2B 2VNGA 4N21A 1YFYA 3ACGA 4BISA 4JQTA 4GH4A 1AHSA 4Q26A 2P6JA 1GP5A 5F37A 1ZA4A 1YEWA 2R72A 3LF7A 3T2MA 4NXNB 2BFUS 1FPN3 3OEAA 1US6A 3BTZA 5IYZA 4UF0A 4QT6A 3KKYA 2QKCA 3VHNA 3I2KA 5B1NA 1MEC2 3OYWA 3O9OA 1O91A 3N9NA 2AHYA 2UWCA 5FZEA 4TN7A 5B3SB 4Q4Y2 1QJY3 3R05A 1VR3A 4AL9A 2VY0A 2IU3A 4JGZA 3LB9A 5H5NA 3VBRB 3RZGA 1WMXA 3OTOO 1TQ5A 2UWAA 3E83A 1LNSA 2WBKA 2P5BA 1DU3D 1NH2D 2XVKA 1ZZ8A 5IYYA 4Y1VA 1NX9A 3H42B 3ZXEA 1N33O 4XDKA 4CDUB 1V9U3 4MGSA 5F2VO 1GZWA 1VQ6V 4KHPB 3GZEA 3AZVA 2N74A 3CLPA 3MD0A 2Y69B 3TGUH 3OAAG 3PIGA 3EBRA 3MHHC 4QQPA 1VBD2 4PA7A 2QCSB 2IM9A 1VBB2 3CBNA 1ZRCA 1HJGA 2IBZH 3WZ1A 5A6ZA 3SDLA 4FT8A 3K3NA 5T54A 2LO1A 4JAVA 1VE0A 2FDHA 1X9PA 3I56V 1R083 1UU6A 4MUVA 1UMHA 2H0VA 3WLUA 2WS93 3RMXA 4X1YB 4CU6A 4EN7B 1IPJA 1NTZH 4IE5A 4BB3A 1ACCA 4AVVA 1CAXB 1CZSA 3J8F3 4Q27A 4GWNA 3JASB 4YGCA 1PNKA 2V4AA 1V55C 3WCRA 4R9CA 3WNOA 2Q0AA 3EVKA 2ZKNA 2H3OA 5EZYB 1O9HA 5F5QA 4DOUA 4JKMA 1OFNA 2VZRA 4A42A 2X05A 2K1EA 2HG5C 3ZPYA 3S7IA 1W0JG 2DVGA 3T2QA 5CEHA 4OGQB 5A7WA 2QEXV 1IBLO 2Z42A 2RS53 3H1YA 4RQPB 5FPOA 3OB8A 3E8FA 4JI0O 4LE4A 4GWIA 4MGKE 4IV3A 2A5ZA 4ASMB 4YG3A 1G9BA 2BTQA 2WNVB 1YJLA 3O0WA 4AI1A 3D3AA 2LRPA 1CAVA 2VQEB 3VGIA 5DM6V 5ACA1 1BEV2 3B93A 3T30A 3OY8B 4JTNA 2VCBA 4YPJA 2GAUA 4CC5A 3PTYA 2ZZJA 5JSOA 4ZI7B 4S2GA 2VUCA 3SPHA 1O3SA 2XG3A 3GM8A 1VIWB 2X5IB 1MZ5A 1DBNA 3VKLA 2OXBA 2FDIA 4QDQA 1NCQC 5LMNB 5DUXA 2ZX2A 2CTPA 5J1XA 4NWVA 4QPJA 2RMU1 4LBOA 2A6VA 3WDVA 1NXMA 4UV8A 4JYAB 3HAGA 4I09A 3TK1A 1Z7S1 1QH6A 3CDZB 1POV3 3JQWA 1B04A 1O5UA 4DRRA 3H1MA 3ON7A 2VQTA 1LOGA 5K9YA 2XKOA 1PD3A 1EZVH 3SXWA 3AL6A 2XDVA 1XYPA 4HMZA 3DXRB 1AX0A 2GC0A 3VBBA 4B3MB 2A6WA 4AVSA 1T2XA 1K4CC 1COV3 2JE7A 4CYDA 2CK3G 2DV9A 3VLBB 4CXWA 1HNWB 4EV0A 4DRXA 3H7YA 4LF5B 2VZVA 5T5LA 1N47A 5DDJ2 1MOFA 5LHIA 1NCQA 2JDNA 2BCCH 1N3OA 1W0NA 2JX9A 1Q90D 4ORFA 2EINB 2KG7B 1Z7S3 3WG7B 2VZSA 3M3QA 5FUPA 3Q9OA 4BK5A 1NS1A 2YS8A 2P3KA 4QX2A 2EIMB 4P9WA 1PHMA 3ECQA 2B39A 5FZFA 4FLWA 1LHNA 1H2NA 5I8SA 4LJHA 2YC2A 1BHAA 3KV6A 4MXVA 4MVZA 1ND3C 2VZOA 3VL8A 1H2SB 3X2QB 4EWEA 1JTZX 1W6PA 4E4SA 3GJAA 4WM8A 5D8AA 4ISRA 1I9RA 3PMSA 1MG1A 2XAFA 1S5HC 1QLNA 2HWC3 5FYMA 3WB2A 3LSEA 1FT9A 4JGYB 3H1KH 2LJ2A 2R0HA 4DR4O 4PF1A 1JYTA 2EULA 3GCWA 2D3PA 4XFFA 3H8RA 5DMYA 2SLIA 2RJZA 3KT7A 4L8QA 3FB7C 1BYHA 5EXOA 1UOJA 1UY4A 4AHZA 1XNRB 2K2SA 2VZ3A 1HR0O 2UXBB 3KB5A 1ND3A 5FKCA 4O4HB 1KS5A 1XNQB 3QF7A 3BA8A 1VBA1 4LT5A 3POIA 4HG6B 1CAWB 1JOYA 2UXNA 4JI2O 1IKQA 3RYCA 4OX9O 4P9JA 4HYOA 5IW0A 5IYZB 1F23A 4UCRA 4PV1B 3AG4C 2QE3A 5FZ0A 2I45A 3OYWB 4RWUA 1VBC1 1FJGO 2Y8KA 4FLVA 5FYBA 5K0UB 2W1SA 1EM1A 3ZN0A 1MR5A 3ZHVA 1EP0A 3BUCA 3LKJA 2J1EA 2CE4A 1QJX3 4EB6A 4JGZB 1QWRA 1LOFA 2N05A 1RUJ3 2H6CA 1DIWA 2LGWA 1OLMA 5DZEA 4ASUG 4GAZA 1K9MW 3T4VA 1CJDA 5K7PA 3VDDC 4XUPA 1TMF3 1IBKO 1KFUL 1WPXA 2R9RB 1HRV2 4YFZA 5JQGA 1S0BA 1QLEB 5IVYA 2VBPA 4UBHA 4WFFA 5BNPC 1SS3A 2A3YA 1G9AA 5C33A 3G67A 1SQQH 2P34A 3NJXA 4FXKB 2QZ2A 5FLHA 4TQFA 4GX0A 3CCLV 3USSA 1ZBE3 3ILFA 1PGL2 2C9AA 3W9AA 3ZFEC 5DZGA 1RC6A 4URTA 5CKQA 3P6BA 5F8PA 5D2AA 5IVJA 1PVC3 2O1QA 1QOSA 2NN8A 1SDDB 1BHBA 1B6QA 1I0HA 1HNZB 4LFAO 5E1RA 1EUUA 4FI9A 2YSUB 5EJZB 1O5LA 4LK6A 5T52A 4XF1A 4QXKA 2E76B 3J7AU 1L8DA 4GMP1 1QKQA 1YIPA 4DV7O 1JYVA 2OPKA 4AILC 3W58A 5JVDA 3CCQV 4PELA 2OIEA 4BQ1A 3H3UA 2W95A 3QLQA 5A7WB 5FBJA 4B3NA 5EBWC 4XBLA 1HB1A 4IEPA 1RXFA 1F35A 1UO9A 2AGSA 3ZR5A 4J41A 4JTOA 1U0AA 3O1RA 2GC3A 2VUDA 4CPBA 1ZYBA 1YF2A 2VGDA 4IV3B 3JATA 3K0GA 2ZHLA 3MUZ1 1I5PA 4IHJB 4FPOB 2BTQB 1ZBA3 4IEVA 5FK8A 3WU2Z 4NOTA 1JYIA 1AR5A 4OXSA 3N3HA 4CA9A 1YQ6A 3ZYBA 2QQKA 4NAOA 2RJ2A 5H9RA 4WZCA 1CAVB 4QKBA 3AP5A 1VRH3 1GWLA 1AR1B 2KSDA 2KD7A 3EXAA 2W46A 5IYDO 1HLCA 1H2MA 1QJU1 3E5XA 2Y4UA 2ZHNA 1O4TA 5HCHA 4I01A 2P4KA 1GBGA 1DGSA 2YFUA 2R061 1P49A 3POYA 4LBQB 4PCRA 5HXVA 2ZE8A 5GLVA 2H6BA 3DV8A 4XDPA 2FKXA 2QQNA 1VAKA 2WQZC 5A3NA 1RVF1 4B3TO 2WO7A 3OGRA 1U5IA 1RUF1 4HFSA 1YQ8A 4AAPA 4EYUA 2QWOB 3FE5A 3FL7A 1W99A 5FPXA 3BU0A 4KGQA 4C0HA 3I59A 4JI8O 1S2EA 3F2ZA 3E97A 3ZSJA 4AR2A 2B45X 5L7OA 3P32A 2IXLA 2W47A 2DMXA 5FZ7A 2LALA 1ULOA 3RJRA 3EQEA 1KP3A 2CTRA 3WQ7A 4CPBD 3K5LA 2Y6GA 1W0PA 1SA0A 5IATA 4DRXB 3MW4A 1XNDA 3HJRA 5DAVA 1ZRIA 2PYLA 4YW2A 1UFIA 3APBA 4I4TA 4MW8A 4BW9A 2QWNB 4HBNA 2Y26A 2A3WA 4L2NA 5F9TA 2JDKA 2XUMA 1EPZA 5CADA 5AFEA 4HZFA 5IT9N 1MPXA 4LHLA 4X66O 3AMMA 5JJJB 4LA2A 3AMHA 4P9OA 2HVKC 4XURA 3CYOA 4BR6A 5C8CA 2EIKC 1WP8A 1NBMG 1NTKH 2WO1A 1WCKA 2PHTA 3LOIA 5LA6A 1W6PB 2BV4A 2WLKA 4XFAA 4WFEA 2DJVA 2BBAA 2ZCWA 4H0LB 4JZ2A 1R6NA 4WM8B 1IG0A 5D8AB 3M2MA 3ZYRA 3NAPA 1IS3A 1OCZC 3ZXDA 1VQ5V 1CX4A 4XE9A 3CZUA 3ZFGB 4QGNA 4DUZO 4DV5O 3TYJA 1F5JA 4IGQA 4XJUA 4FP2A 4QX0A 5E79Z 2DVAA 3AG1B 3BODA 1SFNA 4CEYB 2B46X 3MFAA 1JYNA 3AG3B 3MV11 2QQMA 2Y6JA 1XE8A 4AGVA 1CJPA 5FBZA 1JX9A 4HVRA 1RUI2 2PA7A 3WNNA 1H4HA 4DO2A 1ND3B 1HN0A 3WR0A 1OA4A 2QM4A 2A73B 4X6RB 1NYWA 2YC4A 4HK8A 3S3XA 1US2A 4IIJA 2XQXA 1W2TA 5T5PA 3FJSA 1PGW1 1A8DA 2RM21 3MI8A 1KJRA 4OCTA 1QGLA 3ZXLA 5G04L 5CISA 4IQPA 4LLFA 2YXHA 3HR9A 3ELNA 5KA6A 1FOD1 3KWVA 4X65B 2X09A 5I8YA 4CUAA 4JAUA 4XCBA 3OEBA 3LFIA 4KWLA 4EB6B 1V00A 4D3WA 1N1SA 5CU1A 3LE0A 2HEYF 4ZHNA 2R49A 3GVMA 3BFRA 1JFFA 5KBFA 2ZE6A 4O4LA 2ARXA 4QE9A 1VQ8V 5ABJA 2YBPA 3H1JH 2IW5A 5FXVA 1R1A2 1WA4A 1POQA 1QXPA 1EAH1 5FOJB 2Z5UA 4NJ4A 1D0HA 5JQGB 4BIZA 4QPIC 4FTSA 3OMAB 4EFBA 2ZAAA 2GNBA 4N7UA 3JAWA 3EXUA 4DR3B 4EEQA 2EXIA 1IPSA 1PMJX 1PMIA 4FVVA 4RL7A 3FB6C 1ODNA 1QQP3 2E33A 2JD4A 3U37A 5FZ4A 1S76D 3M7AA 1SZTA 2V4VA 3GXUA 5FZ1A 3VB9A 3FYEB 1I5ZA 2W94A 4ZHQA 3RW0A 3QH6A 3URFA 2JDUA 4QPGB 3M70A 2DU0A 3MFCA 4DR4B 4UCTA 3BABA 4IERA 1UOFA 2Y60A 1JU3A 2EILB 1QR8A 4TWTA 2PHFA 2E75B 1HR0B 3WY6A 4FFIA 3FLRA 1YTFD 4BLIA 2A0LA 3HIFA 5LRRA 4B8EA 3OEHG 4C91A 3OF1A 3UQ8A 5JVDB 3L70H 5A3LA 2D6LX 3VD4A 2VW0A 3KVBA 4MLOA 5HI0A 1QR9A 1B35A 5LB6A 2Q7HA 4DY5A 4MTGA 3B8MA 3IM0A 4BWOA 3TAYA 2BSKA 5GTIZ 2ITCC 1S5JA 1YIJV 4JI2B 1NLSA 4OX9B 4K8FA 4DR5O 1BXHA 4YG6A 4CXXA 4MOAA 3JD3A 2CUGA 2QQUA 2PN5A 2UXDO 1FJGB 1ASJ2 5H6QA 4DXWA 3HKBA 3INAA 1SETA 1W90A 2K46A 3FN9A 4WVWA 1RUH1 3G6BA 1UPSA 2RJLA 3NJYA 2AZ0A 2UXXA 4QU1A 3GBFA 3HT1A 4O2AA 2BU9A 4ES9A 1TNRA 1VBE3 2QTSA 1X36A 3VBSA 1AR92 2XJPA 4RHV2 2RDCA 3ZN4A 3L72H 1W8OA 1K4DC 2Y33A 4JKKA 1BBT1 1J3PA 4XYXA 4DMIA 5F3CA 3AZWA 3AX4A 1VQMV 4QX1A 3FHIB 3POGA 1AP6A 5HBAA 4KL1A 3TBDA 3UESA 1OCCB 2RDRA 4A3XA 5J09A 3D3IA 3ABTA 4LF4B 3THCA 2EJRA 2VR4A 3I59B 1N8RW 1S77D 5JWPA 4UBGA 4J1XA 3LOBA 5L7OB 3Q8AA 3T1CA 2C9KA 3QO5A 3IB3A 4XTMA 2ARCA 2GN7A 4EWAA 1N36O 3T4HB 1JZ8A 1RFYA 3ZHUA 5AVPA 3ABUA 2D3SA 2VZTA 3KGLA 4LFAB 4DZGA 5FY9A 3K57A 4RFT0 1SA0B 3RWNA 5EYXA 3WNPA 2EIJC 5T50A 4OMCA 2BEOA 4P9PA 3OSDA 4CDXC 1PO13 5I0RA 1QJZA 4LKSA 1PIV3 2J1RA 3PURA 2WFF1 2UU8A 3WQBA 2DYCA 5FWEA 3IKWA 3BYWA 3U10A 2W1WA 4AVAA 2RR13 3ABMC 1DZTA 2Q6AA 4CDWC 3BTAA 2WPDG 5DN6G 5C8CB 1BZKA 2P17A 4MTXA 3BIWE 1JMKC 5B4NA 4CCNA 1NVPB 2LTNA 4YJ3A 3D5OA 3M3CA 3DXUA 1KDMA 1V70A 4MXWB 4IEYA 3WW2A 4I3GA 1BGYH 4I2OA 4UFZA 5ITZA 3NAPB 1N1VA 4XAEA 1Q8OA 3CCRV 4YGEA 5LGNA 1D4M2 4CDXA 1M4WA 1RGSA 3TEXA 4V2WA 3ZR6A 3FZ3A 4EN8B 3ME2A 3CC7V 4EN0A 2ZEWA 4W4KA 4QKDA 5C9AC 3BHPA 4DPNA 5FZLA 4LUKA 2PHUA 4BXFA 5GKAC 1R091 3GBGA 4UVCA 1BJQA 1OQ1A 2Y38A 4P30A 1AVBA 1L0LH 3N9LA 1M1KW 4IIJB 4ATEA 4DNYA 4Q4Y3 5AC92 3ILNA 2IZWA 4B3TB 4XJ9A 4OHYA 3K79A 5IY5C 1JYCA 2IC1A 1XMQO 2HWE1 2ERFA 2JIZG 3PUIA 5KUMA 4YARA 2HLDG 4HSJA 3AM2A 5LW9A 2M7WA 1EV11 1YJKA 2R072 1YSCA 4JI8B 3I2OA 3E6BA 1MS5A 4I9WA 1GWKA 3RFRA 2P4EA 3JBG3 2VZQA 5I0DA 1VF6C 1ZX3A 1LGCA 3D6EA 3CB2A 3G80A 5IYCO 1BE3H 1OLRA 2H94A 1VEWA 1JFFB 4O4LB 2QFEA 4B3RO 2F95B 2IUWA 2IH3C 4CDQA 5ABJB 3CEIA 1VBD3 1R1ZA 4YIOA 1JUIA 4O9GA 3KCXA 1VBB3 1K5MC 4GYCB 1VRBA 5GONB 4WBNB 2MHFA 2P2KA 3C3VA 3U75A 3CNAA 4O9EA 4AK3A 2JG9C 4COUA 4J6GA 3SJCC 3JU9A 1RL3A 2CU5A 2X29A 4I50A 2HWB3 4UI9L 4UFMA 4PIYA 3JAWB 2BNNA 2WZR2 1CZTA 3ZIAG 2L6LA 1AYM3 3JZVA 4O7XA 3DKWA 1SLTA 3ZXGA 3UM7A 4AQ6A 3QNEA 4XBQA 1YI7A 3ZCCA 3AZZA 3LFMA 4PHZA 1UQXA 4ZHQB 3MHSC 4DUZB 3JUUA 1JA8A 1BK0A 3B9CA 2EVXA 1MS0A 1GM8A 4OHXA 5A3OA 2EXJA 4XDJA 4JI4O 5BXXA 2PI5A 4LF8O 2JJ6A 2JG9A 2XVGA 4YW5A 2E63A 2HBUA 4YNIA 2QUOA 1MZ6A 3OPWA 4ARXA 4ZKIA 2N04A 2MK3A 4NUBA 5FLJA 4GKJB 2RS11 1B35B 5CFCC 4CE8A 4W4LA 3DPRA 2WQ8A 1HRI1 2VQ0A 5KAFZ 4WCEV 2BSKB 5FP3A 5FMBA 5LWBA 1NT0A 1W8TA 3MF9A 4K9SA 4N43C 3L75H 2VCCA 2UXCO 1DYOA 3WDWA 3K04A 2OA2A 3K75B 5A1FA 3HKBB 1Q8QA 5FYCA 4NIHA 5A2QN 5EHDA 5CZKA 4CCOA 2LROA 1D2SA 3RBZA 2I2SA 2DQ3A 2UYBA 3CJHA 4O2AB 2LW7A 2EZPA 1NZIA 4DUVA 5A6XA 1FNYA 2X6AA 3VBSB 2HJDA 3J7MA 1GK9A 2YDEA 4GD4A 2R9AA 1GV9A 3UKVA 4NTYA 4CCKA 3SGIA 4BHPA 1QDOA 1LR1A 1ZZBA 1H9WA 3GYDA 5KX5A 2P7TC 5A32A 2C1FA 3ZRVA 1W3VA 2XLAA 5KHKA 2FZ2A 4QNHB 3ALQA 3W21A 3WNXA 5DDJ3 3CU7A 3M1HA 2YY1A 4DRVA 4AFCA 4MHUA 5HV0A 4A7KA 2QM7A 3MBWA 3RYKA 1XNCA 4XIOA 3AMNA 5FO9B 3D36C 3WINE 4OPAA 5C71A 2YROA 1Q81W 4FPPA 2XHNA 4E4EA 1YFWA 4MO3M 3I2DA 1NUKA 3MPPG 5JCOA 5FYZA 2P4VA 3VHRA 1R6KA 3ZYPA 1YRZA 4NMIA 1OF4A 1QF3A 1SC5B 3OUSA 1YLLA 4CRQA 1GOGA 1SQ4A 3VKNA 4Y24A 4RA0A 4IETA 1V9U2 4A41A 4K8XA 4OVEA 1FXZA 2D6MA 1O6UA 2ZAHA 5FPZA 3WB0A 3DN7A 4YJ3B 3H7JA 2W6JG 2W08A 1SEFA 1GANA 4YW3A 3K0DA 2XOKG 1IXMA 5IAVA 1OHHG 3CZJA 5ITZB 2BERA 4X1KA 1W2BU 4LE3A 1RUD3 3ZHRA 1NG0A 2DWRA 2XQRA 1RUG1 1MA1A 4KQ7A 5LASA 5BUVA 1D2QA 2AZ5A 4TV8A 1ULDA 2JE8A 4JPRA 1Y66A 2DVBA 3VQYA 4Q0PA 4I55A 2PFWA 4A7ZA 5BMVA 5T3NA 4SBVA 2HHHO 5GLZA 4Q0UA 5JLVA 5LBQA 3ACHA 4ZZ5A 2H0BA 2XAJA 1RINA 2RS31 2VMDA 4FTEA 4Q5OA 4XZPA 3PUAA 2A7WA 2NR5A 4L87A 3DKQA 1PZ9A 3CSXA 5H9QA 3U4SA 4Q4V3 3OGVA 2JEXA 4MH0E 5GZCA 1F4NA 3SLIA 1WLTA 3ZHQA 4OULA 4DFSA 3H9AA 1O7FA 1BMV1 3EJKA 3IN9A 1W3XA 3B5LB 3LEMA 4AXOA 3KD4A 1MS8A 3TNPB 4LFCO 3USUB 4D7SA 4N23A 4XUTA 1I6XA 2WN2A 5JZGC 2CAVA 1BLZA 5HCBA 1LB2A 3RZLA 1HRV3 4LBLA 1JHNA 4RUFA 3M99B 1N36B 4FOQA 2EX3A 3LZZA 2J22A 3WOGA 4CC6A 4DXZA 4KWJA 4LO5B 5JUVA 3JD0A 1GP4A 3WX5A 3KCYA 4CS4A 3O1VA 1M57C 5L3GA 5E89A 4X20A 4CDQB 4BMEA 1X9TA 4XFGA 2GNDA 2OTJV 4IT5A 1XMOO 3T1YO 4FP3A 2WC2A 2AGAA 1DF0A 1AJQA 1XL4A 4LC1A 2B9ZA 3I2IA 3GCXA 3O1MA 5EFUA 3R6SA 4I50B 2E3CA 2W1UA 4IEWA 3TCUA 3AKQA 1XILA 1GICA 3ETQA 4X64O 3P3NA 3NL1A 1UU5A 4COZA 2G1MA 1XYOA 2QE7G 2CWMA 4CU8A 2E26A 3PN1A 1D7PM 3AKSA 4FPCA 1O4ZA 2FD8A 2A06H 3OT7A 4BW5A 1Y76A 4K1YA 5DPNA 2IFRA 1HDJA 3MPBA 3APOA 5FMOL 1RP3B 1COV2 2JIGA 4IESA 2RMU2 1OUSA 1W03A 4LTAA 4KMQA 3ZYGA 3WNLA 1Z7S2 3MV01 2ET7A 1IBMB 2RDSA 3POBA 3L9DA 3MDPA 2BOBC 1F51A 4PF5A 4PQ9A 3SNMA 2DQ0A 3D82A 1S2BA 5FRAA 5GM0A 3DPRB 2ZEXA 3IPVB 4YRDA 1XMQB 4NB5A 4BAYA 2XBO1 1SRYA 2YBKA 3POWA 5GTHZ 2BQPA 2VVFA 2W6IG 1AR81 1MVQA 5EYPA 3A4UA 1XNAA 1KMIZ 2HWC2 4CCMA 3ZN6A 5BNNC 3RDIA 4Y22A 3CJHB 1SFPA 5BR8O 1HIXA 3T2PA 3WNKA 2DE0X 5FZHA 2VNRA 4B3RB 4XCAA 3K9SA 3HB3B 2JKBA 1JYXA 1DF4A 1RITA 4XFHA 3PVBB 1I1EA 1DDLA 1CPMA 5K1XA 1HWYA 1AR83 3OW2U 2NLJC 3JD4A 3BTXA 1XSRA 2IXCA 4ET7A 5KX5B 1C8M1 2CGNA 1WAZA 4LNUA 4CUBA 5A9GA 1LECA 4Q4X3 3NMBA 5A32B 1OCOC 1QIQA 1S2KA 1RB8G 3O14A 1AL21 3H9VA 4IEQA 4FPKA 3K5MA 2R6QA 4WZFA 3ZOIA 1K33A 3U0ZA 3AZYA 1URFA 4XUQA 5CKMA 4FQZA 1NE6A 1I94O 2RG4A 1IX9A 2A6XA 3FMGA 2WAOA 1OPMA 1G9DA 4QHZA 3HQXA 1BVP1 1MS3A 3J81N 2IFWA 2VC9A 4NR1A 1QJX2 4FAGA 3HEIA 2W52A 1A78A 3H0OA 4XXPA 4K8ZA 2X8KA 1NT2B 2BW8A 4FQ4A 4FAHA 5BXZA 3ITQA 3LCPA 4TQDA 4I0AA 5J96B 1QJEA 3PTRB 4TTGA 3V0BA 5LA2A 5LRSA 4AEDC 2BGOA 1Y74B 1CX1A 1FV2A 1NU1H 5C4WC 2X6CA 4CH6A 5JMCA 2YB7A 3K06A 2Z69A 1DGRN 3WXPA 4QXHA 2VNVA 4ZY9A 1VQNV 4DV4B 4HPKA 1OFSA 3M8LA 1HQLA 2MEV1 3VD5A 1P4RA 4WF9V 1UY1A 5FLXN 5KXDA 3ZPOA 2UXCB 1SBEA 2XR4A 4X1KB 5C3OA 3LDCA 1RUI3 4TV9A 4FBFA 3DC5A 4QX8A 3OBZA 3OE7G 2ZCEA 2FDGA 2QWPB 1XOUA 5CB7A 1E5RA 3HVDA 2R043 4UV9A 3GZAA 4I55B 4META 4FLXA 1OQDA 2PLV1 5BMVB 4YIPA 3RVZA 4JYCA 2FMLA 2XWJB 1M90W 5C4WA 1PL4A 2XPJA 2MEV3 4CU7A 1RHI1 2GTAA 1OXCA 3DF0A 1UYXA 1RUE1 4E2LA 5LL6Y 1O8SA 2YEVA 1VIBA 2OZJA 2Q0OC 2ZXQA 1UY0A 3MEPA 3I3BA 3ZKYA 2B8MA 3A0KA 4Q4W1 1IKPA 4CBCA 1GAXA 5DZFA 3O7OA 2VXRA 3MIBA 2RMKB 5K4LA 1MS1A 4NHXA 1CIYA 4OUEA 5IK8A 4AEKA 5FNVB 4O65A 1R1A3 4O2BA 2ZGRA 2XJUA 4UW6A 2YMZA 1U96A 2ZGTA 1ZBA2 2JDZA 3A0NA 3NV3A 1K7DA 4WM7C 3EYPA 1A3KA 4RGKA 3HBZA 2JB4A 1ULPA 5F5CA 4XZUG 5JI9A 3AKTA 5KMGA 3ZFFC 5IJRA 2Q5TA 1LOBA 3BALA 2W1QA 4XFBA 1W2AX 2O8OA 4NRPA 4IV1A 4NXNO 4P14A 4QQ2A 4AVTA 2XTAA 1F8VA 2JDMA 4LITA 1K5QA 1DZQA 3OPTA 2NLRA 3RSJA 4WV8A 1IZ3A 3PUHA 4PA6A 5LZ6A 1LOAA 4GULA 3TETA 2QDRA 5IT6A 3AMQA 3T0DA 4YY3O 3HN1A 1JVMA 3I3EA 1RIRA 1XREA 3SISA 2UUCB 4OZXA 1QBZA 1GNZA 3CHXA 4JVAA 2R70A 3NSTA 2Q9LA 4UW4A 3KHCA 1QJU2 2BWAA 1L7QA 3MICA 3H8OA 2AYHA 3ZFFA 1Y76B 1W9TA 4J25A 4DV2O 3C3TA 3VDAA 3ZMVA 3CJIA 3S6PA 4HK9A 1DLBA 4KHPO 1RVF2 2JEUA 1H1AA 3HBKA 3ZX6A 2JWPA 3VDCA 1S0FA 3OBAA 3OJBA 3MLKA 1KS4A 4MVRA 2ZXWB 1J95A 4YZ1A 1ASJ3 2UY8A 5FP9A 4E4DX 3AYDA 4GX5A 2HR3A 1V54B 1S0JA 1M93A 1ENQA 1JJ2U 3TJTA 1MEC1 2JDPA 2A70A 2Q5ZA 1S1AA 2HEPA 1FFTB 2B42B 4LBJA 4H2AA 2WA3A 1GQPA 3RNSA 4JTCB 4CP1A 4CEWC 3S0MA 1AR93 3A7QA 4RHV3 5B3SC 3D4KA 4QX7A 2FZ1A 4H37A 4JCKA 3BI3A 3VBRC 5H9PA 2XKPA 1YQ5A 1OUXA 4NKGB 3F5TA 3ZN6B 3KCCA 4MS2A 1LAJA 4IL7A 1VAMA 3R4DB 4F83A 1V6IA 2BVVA 1IHMA 4A5UB 2IU0A 4NTWA 4UB6Z 4CDUC 2PHWA 5A1LA 1PP9H 4R50A 1M56B 2W0FC 2XL9A 1AILA 3OEEG 5FYUA 5GZDA 2WKKA 4UFLA 2Y69C 4CS2A 4I5SA 3ASIA 1DTOA 4R8CA 3GHNA 4HKLA 4CEWA 4LNUB 2ID4A 1LRHA 5DQ0A 2WZ8A 1H2GA 3PVEA 2D97A 2ZGUA 1ND2A 2IVIB 3NJVA 1GZTA 1JOJA 1RJ8A 4WFGA 4X64B 4XXAA 5FXXA 5J48A 2CV6A 3K9AA 3S5QA 3PLQA 5FY0A 5LY2A 1S4CA 5KLVH 4PDLA 2OCHA 4LO6B 4X8AA 5F5IA 5GW7A 3ZSLA 3L2HA 3ST7A 1VPHA 4IE0A 3GB7C 5SV5A 4R9AA 4FOYA 2WWSA 3IMNA 2WABA 4NXMB 5A7NA 4BIUA 4PDMA 4CP0A 3ZHTA 1R6TA 1PVXA 1TME3 3HQUA 4ITCA 3SMHA 2DCKA 4NROA 1KXGA 3VBFB 4JKLA 1LHOA 3V0BB 2GMEA 5FZ6A 2Q8CA 3RZKA 4LULA 3ETPA 4XW3A 5FPAA 1NLQA 3BCWA 4OMDA 1PX4A 4M0HA 3T09A 5FYVA 4FLZA 1FOD2 4RQPC 2WNUC 1D4M3 1HB2A 1FXKA 4B3MO 1UZZA 4CCCA 2FBEA 3JAKB 5I8TA 1DGRA 2O14A 4IUGA 2GMPA 3J9SA 2V5DA 2I74A 1CXZB 4K3AA 2ZGMA 2IVJA 1JMUB 4K8RB 5LBEA 2WNVC 3OR6C 2Z5WA 1LU1A 3AYCA 2J1AA 1X7NA 2Q4SA 3WW1A 1QQP2 2OUJA 1BEV1 4DXSA 4PLOA 5DUUA 1AJNA 2ZPXA 4XBFA 4FMTA 1SQPH 3AG2B 2HEVF 3D0SA 5EZYA 3QO7A 1U97A 1W0KG 2G19A 1YJNV 5AC93 2D3RA 5L3BA 3KG2A 5BR8B 2X5IC 3C7EA 5EBLC 2NMOA 4DS0A 2O8QA 3F5WC 4JDNA 2HKXA 2R073 2YIAA 1WCSA 4RQPA 2WNUA 2A75A 3ZO0B 1GYKA 2YEVB 4J9ZB 2DBIA 4I0BA 3NW4A 2X6BA 1AZDA 5CB4B 2XMLA 1AROP 1CP9A 3BTYA 2GSYA 1WW7A 2VW1A 2ZKLA 2HWF1 2OT5A 1OD5A 2PHRA 2W3JA 2W2IA 4DXTA 1KD7A 1W6QA 3OY8A 4UT5A 5FAXA 1NCRA 4U7NA 1S0IA 4XVHA 1ROPA 1I94B 1HB3A 3A22A 4O2BB 4CZSA 1RPRA 1TAEA 3NNFA 1XNQO 3VBUC 5BYNA 3WG3A 4CCDA 3ZIWA 2EINC 1CONA 1PM7A 3WG7C 3SKVA 5BV6A 5KMGB 4M3CF 3VZNA 4YM3A 4ZXEA 4IV1B 5TISZ 1RM1B 2EIMC 1U5ZA 2DOSA 3ACIA 3F7YC 1GMMA 1Q6HA 2F4LA 4Z82A 4BQ3A 3PUSA 2Q73A 5T55A 3E5UA 4Q1RA 3X2QC 3E35A 1X59A 2VULA 2GDSA 4YZ4A 4LR4A 5EC1C 2FCUA 1V6MA 4EZ4A 2QDNA 5CYYA 5JJEB 4QB6A 3VBUA 1NQDA 3LIHA 2DUOA 4YZ3A 4JGYC 2K9PA 1ENVA 1V6LA 5F7UA 2YIBD 4I9QA 1Z5WA 4MZUA 5L9BA 2AR6A 3CJIB 5FV3A 2C26A 2VQUA 5GZFA 2XNDG 3ICXA 1K3EA 2LGQA 2NP0A 4KUMA 3WNMA 1BKZA 3E8BA 4NN0A 2JJ1G 2YICA 4URAA 3WF1A 4JC1A 1TG7A 1WA6X 1LHUA 1NQJA 3NV1A 2RR12 2VH9A 1F4AA 1AUYA 2BUKA
chains in the Genus database with same CATH topology
1AR61 2RS32 3MGUA 2BYVE 4WVWA 1RUH1 1DLLA 3ZMNA 1IGOA 1UPSA 2RJLA 1VRH2 1J3QA 1ZX5A 3SH4A 4JQRA 4L92A 2WFPA 3GBFA 3HT1A 4Z1VA 4PDWC 3VZJA 1WLWA 2FQPA 1HV1A 2JG8C 4AEMA 4ES9A 3X29B 1TNRA 1VBE3 5K0UC 1X36A 4AFMA 3VBSA 1AR92 2XJPA 4RHV2 5FLIA 3ZN4A 1FYUA 3OGJA 1RUC2 5DUWA 4X6QB 4BA6A 3PVOA 1BBT1 3EHKA 3WCSA 3ZYJB 1J3PA 4JGZC 4XYXA 2AREA 3KGZA 4DMIA 1GQGA 4NVPA 2WFF2 1OI6A 3AZWA 3AX4A 4AVCA 4P9YA 1WD3A 2G4IA 1TE1B 3R0RA 3VDDA 1OSGA 1QMJA 3FHIB 1QNYA 5JZGB 1YFUA 2CGOA 2LM3A 1WUVA 5HBAA 4KL1A 3WP6A 1HXS3 1CAWA 5KXEA 4QQLA 3AJYA 4BGKA 3TBDA 1B09A 2YPJA 2C0ZA 2D5FA 2ENRA 4A3XA 2V5YA 4RGGA 4WM7A 1FX5A 5J09A 1ASJ1 1ZBA1 4J1WA 1ZZ7A 2OW4A 5BNPA 5JOWA 3D8CA 2EXHA 3I59B 3O0XA 3KMHA 5JWPA 4UBGA 4FFAA 4J1XA 3LOBA 4OI4A 4IEXA 4PDWA 5L7OB 1VRH1 2UWBA 5K0UA 1DGWX 2B5HA 3ZXJA 3RI9A 3U11A 2YZ4A 1PK6C 4XTMA 1WW6A 1H2KA 5AVAA 2PAKA 4QMAA 2GN7A 4EWAA 1IQAA 4CEWB 4AEJA 4NPRA 3ZFEA 2E7AA 1W6NA 1AR91 3FUQA 2D3SA 4RHV1 3KGLA 1V6NA 5AVPA 1PGL1 4DZGA 3B69A 4RFT0 1L3JA 1QHDA 1RUC1 1RUG3 2K0GA 3RWNA 4D94A 5EYXA 2P3JA 3VV1A 1ND2B 4QU2A 1H8VA 5T50A 1ZZ9A 1IPKA 2BEOA 3SCFA 4FCAA 4CDXC 1EYBA 1PO13 5I0RA 1QJZA 2QZ3A 1RMU3 3CL1A 2ZJCA 1PIV3 1VB2A 1SLBA 2WFF1 4BM8A 2UU8A 4Q29A 3O2GA 2DYCA 4Q8KA 3IKWA 3U10A 1RUNA 4RS5C 3PVJA 4AVAA 2QVSB 2RR13 1DZTA 4QQHA 4RR3B 4SLIA 3GZUC 1DZRA 2RS33 4CDWC 3BTAA 2JEMA 2LUWA 2ZMLA 3JBG2 2XVLA 3WHUA 5FMOS 1U5XA 2DFCA 4OI1A 5C8CB 3H8UA 2P17A 2DUPA 4WVZA 3BIWE 2GZWA 2BFUL 5IK4A 1ENXA 2LTNA 1OIJC 3DGTA 3D5OA 4FPGA 3M3CA 5L19A 4YW4A 2VOVA 5GJ6A 1KDMA 2P3IA 1SLLA 1V70A 1XNBA 3WW3A 3TB0A 4FOWA 4MXWB 4XMAA 4BGMA 3D0JA 4IEYA 1PK6A 3V64A 2HWE2 3RJ2X 3WW2A 5KHJA 3VKFC 3R1JA 4I3GA 3WP3A 2BPA2 1N1YA 2Z2SB 4I2OA 1EV12 3NAPB 1N1VA 1REEA 4OUMA 1Q8VA 1Q8OA 4YGDA 1S0GA 3RG0A 1MQTA 4YGEA 4GMP0 4Q0QA 4D7YA 5GALA 1D4M2 4Y22B 4CDXA 1M4WA 1RGSA 1W6MA 3MW3A 2CL2A 3FZ3A 4PLMA 2P37A 4EN8B 2KA3A 2PHLA 1RJ7A 2UYAA 2HWB2 3ME2A 1C28A 4M27A 4EN0A 2G9GA 2D44A 4IV3C 5J98B 5C9AC 4QPYA 1GNHA 3B9IA 2HYKA 1DS0A 1AYM2 2JXAA 4D69A 2D6PA 4EN6B 1OQEA 4AI2A 2YUEA 4DPNA 1LTEA 5D1IA 3NKTA 4LUKA 4GXLA 2PHUA 1LHVA 1O4YA 5ACA2 5I93A 5GKAC 1CVNA 4KNCA 2R1DA 2VW2A 3VUOA 1R091 3GBGA 1EPWA 2XBO2 2D93A 2OG7A 1BJQA 1OQ1A 2Y38A 1KJLA 1FNZA 2TBVA 3JD73 5KC6A 1AVBA 2R16A 5EZWA 5FDBA 3OD4A 5CFDA 4W6WA 4ATEA 4E4ZA 1S0DA 4XJ8A 1W39A 2R32A 4DNYA 4LBKA 4Q4Y3 5AC92 1BVVA 3ILNA