1IZ3A

Dimeric structure of fih (factor inhibiting hif)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
338
structure length
338
Chain Sequence
b'GSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGGKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIH
publication title Structure of human FIH-1 reveals a unique active site pocket and interaction sites for HIF-1 and von Hippel-Lindau.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 83
structure length 338
sequence length 338
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1iz3A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1iz3A01
4Z1VA 2ILMA 2WA3A 1MZEA 4B7EA 4JAAA 1MZFA 2CGOA 3D8CA 3KCYA 4QU2A 2WA4A 3KCXA 4NR1A 1IZ3A 1H2KA 4Z2WA 4AI8A 4BIOA 2YDEA 5JWPA 1H2MA 1H2LA 2XUMA 4B7KA 2Y0IA 2W0XA 3OD4A 1YCIA 1H2NA 2CGNA 3P3NA 3P3PA 2YC0A
chains in the Genus database with same CATH superfamily
5LRSA 3ZVXA 4DINB 4NJ4A 4ORFA 1N32B 2M7WA 4XBLA 5FMDA 1LEDA 2CDPA 1AJOA 4GT1A 2RJZA 3AP6A 2ZPXA 1QIQA 2A79B 3RWKX 3DECA 3SCGA 2ERFA 3I2FA 4LF9O 1MS4A 2UU9B 5JCOA 3IMMA 1LU1A 3ZDSA 1O5LA 1COV3 4KHPB 2X7RB 2YIAA 2DYCA 1UY4A 3JYCA 5FCCA 4L87A 1H1IA 2H3OA 1YHQV 5ITZB 3N7JA 4Y4RA 3JATB 2VECA 3QCWA 4FOYA 2XXZA 4HKWA 5E6HA 4NO4A 4H55A 1YF2A 3CJHB 1DZRA 3I4IA 1YJ9V 1BT8A 1CAWB 5DABA 3GNEA 4NMIA 4HZ3A 1OUSA 1BEV3 4L2NA 4COYA 4AFDA 3C7HA 4UB6Z 4P9LA 5K4LA 3ILFA 2X6CA 2O8OA 3CRMA 1B35B 3I3MA 3ZFGB 4CCCA 1QBZA 1NCRB 2PTMA 4YIPA 2XASA 1ZWIC 3E22B 1H8TC 4CS3A 3S5AA 3L73H 4JAAA 5FO7B 4ZOLB 1H8VA 3TWIA 1C8M3 3E8HA 1GAXA 1GNYA 2CWMA 1N0JA 4DV0B 5F37A 3POYA 4O4HA 3N9PA 1FXKA 1AX2A 1YCIA 1VP6A 4FPKA 3DTUB 4O4IA 3USUA 2XAJA 4NXNB 3N9MA 1CZVA 1UL9A 2F93B 4MG2A 1Z7S1 3GCXA 1SPPB 5JVDB 1TA8A 2YDEA 3VD4A 3DPRA 3ME2A 3RYRA 5LP6C 3VBOA 3GZUC 1Z2GA 4BQXA 3AXDA 3ZPOA 2VZSA 4ZHNA 2JICA 4PIYA 3VZLA 1SF9A 3GB7C 5LASA 1VBC3 1PK6B 3AMHA 1L7LA 1POV3 4JRAA 4Q1PA 3PVBB 5LY2A 2JE7A 4KI5M 2VCCA 2EA7A 4IGGA 1SESA 3WG2A 3K48A 4AHYA 1YI2V 4H37A 3PVOA 3K51A 4BCUA 1UKGA 3ZIAG 4K40A 1RVF2 3WV6A 4NTXA 1BCCH 1RUE1 2R041 4DV6B 4ATFA 1ZBE1 5FYHA 3H1HH 1KYOF 4LBEC 1FKAO 3OD4A 1QQP1 2Y26A 1GOGA 3ZYBA 3BA9A 1DP0A 3HWJA 1OCRB 1N3OA 1XBFA 2CHHA 2N05A 4QE9A 1JCHA 5FZ8A 2V4VA 4HT1T 1N36B 5LZ6A 3SPJA 1ULCA 2N7GA 3WF0A 1JZ2A 5FWEA 1MNGA 4YJ3A 4MTFA 1ULGA 1W04A 2Y34A 2EZOA 1LKNA 3HKEB 5HCAA 5LCWL 3JALB 2DV9A 4FSJA 3PNAA 1US3A 1KBHA 4KGQA 2EICA 3L9DA 5JWPA 5I0RA 3KV5A 5LA2A 1VMJA 3CCEV 3IKWA 3I55V 3KVBA 1UX7A 5F39A 2WL1A 3CJXA 2R071 5EPAA 4BR6A 2N74A 3DC5A 2VQEO 1F5FA 4LFCO 4AZZA 1BBT1 3FJSA 1N33B 3U0ZA 5I91A 1QJU1 1HDKA 1JYCA 3QACA 3THTA 4KWUA 4XJZA 2YXHA 2JENA 3ZMZA 2WLQA 1JUIA 1MG1A 5IJ0B 1YTFB 3ZPYA 5IAVA 2Z79A 1AR4A 4NYKA 2NMNA 3POWA 3LEGA 3ML0A 3HKBA 4O61A 1WA6X 3MHZA 1COV2 2LW1A 2ADEA 4PQQA 1GRJA 3W7TA 1CEZA 3I3EA 2OX0A 4AVTA 4OI4A 1WD4A 2OTLV 1S5JA 1UF2C 2DFCA 5FMOS 4NTYA 5IVBA 4YW7A 4HK8A 1VARA 4XHXA 4AILC 3H0OA 4NVPA 3ZHRA 3E5XA 4R9CA 2R49A 3MUZ1 4XUTA 5K0UC 4M00A 2F4VB 3S30A 3MFCA 2UWAA 4B29A 1SFYA 2OCHA 4K7JA 3EHBB 1J5EB 4MUVA 3WDWA 5FUPA 3GVMA 3KF3A 4ZKTB 2HWB3 5L3BA 2HVKC 4B4PA 1O8PA 4PF5A 4QGMA 1S72V 3WDUA 3G7DA 4G4FA 1GQPA 4TLGA 4GKKB 3PUSA 5GZFA 4QQPA 4BQ5A 4RSUA 2PHWA 4Y22A 3RT3C 1C8M2 3ZHQA 3BY6A 3VOUA 2SBAA 1TAEA 4LF6O 4OQ9A 1IX9A 3AK0A 2IU0A 5A3TA 1AR91 1VBA1 2PN5A 1UJWB 3K4AA 5F7UA 1X4TA 2V7QG 1BQZA 1WW7A 2Y0OA 4X64O 5EC2C 3HQRA 5JCTA 1FXKB 5B3SB 2HEVF 3AK1A 3PIJA 4O4IB 3USUB 2ZKNA 3L74H 5CFDA 1AXKA 1PGL1 2JKBA 4DUZB 2E31A 4FQ4A 5F9TA 4PA6A 1MS0A 4KL1A 1QXJA 5DAPA 4LJHA 3O12A 3CP1A 3DPRB 3VBOB 4WZCA 1A6CA 5FV3A 1YJKA 3AP5A 1RPRA 5EYPB 3H1LH 1QDOA 1W8ZA 4Q0QA 3WHTA 4MVOA 3R0RA 2GALA 5LK7B 4JTCB 1WP7A 4CH5A 4XFFA 5FUNA 3NW4A 4IEQA 1YSCA 2BNMA 2OPKA 4DV5B 4P9OA 2Z69A 1K33A 4FTEA 5A2QN 1EAH2 2XGXA 1R083 3O14A 5FZEA 2VTXA 3H3ZA 1YQ5A 4AI2A 1AJNA 4I01A 1SQFA 3GZEA 1FXHA 1FT9A 3WCSA 2YC4A 1YC61 1UU4A 4JDMA 1LTEA 1AX0A 1AR83 2WZR3 2W1WA 4DO2A 4GJYA 2AHZA 3GHMA 1Q8IA 3UV9A 4N23A 2EVXA 1FNYA 2VQ0A 2BTVC 4AEDA 3ZXGA 4FCAA 2UUBB 4YJ3B 5DUVA 1VF7A 3ZO0B 4XZUG 4UVAA 2UXCO 1IPJA 2J1UA 1UMHA 5FZ9A 5T52A 2ARHA 4P9JA 2B5HA 1JTZX 1DDLA 4CCMA 2ZM6O 5FZLA 1O8SA 4JKKA 4XFCA 2PGGA 3WB2A 2R1BA 2C9AA 3AYDA 5BXZA 4K20A 3WZ1A 1VQ8V 3MD0A 2ZKOA 5LYJA 3JAMN 5GZGA 2HKOA 3NAPA 2QBXA 2JG8C 4EKWA 1SACA 2ZGUA 4DR1B 4QX3A 1M06G 4JC1A 3TN91 1ZZBA 2RS12 4YVWC 1MZEA 4LO4B 3WCRA 3AKSA 4XEZA 1OXCA 2WABA 3QO8A 2WNVA 3I2HA 4FOVA 2I2SA 4QU1A 3K75B 3RVHA 3HKBB 5APAA 2P22C 3W9AA 4FAHA 2DYRB 1I94B 2FCUA 4EV0A 3VLBB 3KCXA 4WF9V 2EIJC 1R1A1 2P67A 3HN1A 2UXDB 2FZ2A 1AZDA 4X6QB 3JXSA 2F95B 1ULOA 2ZX3A 1WAZA 3I3QA 1C3HA 4OI0A 1WPBA 4AGGA 4RHV1 4NXMO 3TNQA 1QOOA 4R9BA 3QF7A 2HWE1 3JB4C 1R093 4NIIA 5GLUA 3AMPA 3SKJE 1W99A 5DAWA 2IXKA 4QQ2A 3CKHA 2ARAA 4QDRA 2VZPA 1IHMA 1CPNA 4IL7A 3ZLIA 1J59A 1D5NA 3BPSA 4GKJO 2C1FA 1Q43A 1YITV 5FZCA 1JZ3A 4JQRA 5FYMA 1OT5A 2A3XA 3FMGA 4Y22B 2BWCA 4Q0UA 1GV9A 3ZN0A 3JBG3 2D6MA 4JCKA 1QXRA 3FFZA 1OHHG 1V0AA 1JOBA 1LU2A 2Y48A 1RUI3 1Q81W 5IYZA 2QM4A 2R062 1VEWA 4XJ9A 2WO7A 4C0HA 3E89A 1M57C 4MV2A 5F8PA 2XKOA 4I0WB 2D43A 3TOJA 2Q73A 4IV1A 1HIXA 4UXNA 5FZOA 3H7JA 1K34A 3N9LA 3MPBA 2QQNA 5CFDB 1YRZA 4RFT0 1FPN2 3J8F2 3FLRA 4OX9O 2L6LA 4K0KB 1O3TA 2PAMA 4O4JB 3WNKA 1ASJ3 4MT8A 2CTVA 4WVZA 2FB5A 2GDSA 1SLBA 3ZBHA 3MW3A 2A6XA 5EBMC 5L3GA 3IC9A 4ZZ5A 1K3IA 2PFWA 3L75H 3D0JA 3HPLC 4XZPA 4AI9A 1AR82 2VG9A 2WZR2 3HOBA 4PV1B 3HB3B 3D3AA 5FZ0A 5J98B 2G38A 2WA4A 2RMKB 2YUAA 2ZX0A 4AEMA 2NPIA 3WT3A 1EZJA 3CRAA 1LOFC 4I9WA 1JA8A 2YROA 2JDHA 2XB6C 4JX0A 4JGZA 2VVFA 5C3RA 1O9GA 1VRBA 2MK3A 1JS9A 1BYHA 3D36A 3LA2A 3ZRSA 4YM2A 3PMSA 4L8QA 4Y3OA 2ZE7A 1V55C 3QLQA 3W7UA 5LOVA 3LSSA 2DCZA 3ZRXA 4D7YA 2UU8A 1GICA 2Q9LA 3E6CC 1URFA 1YI9A 5CZKA 5HI0A 2GBOA 2VWJA 1OLME 3LIHA 2VO5A 1JFFA 2X10A 4QHBA 4ZI7A 3LSDA 3N3HA 3FX3A 2VZ3A 1I5PA 5DUXA 2D7FA 4LBMA 5LYJB 1Z7S3 3NAPB 2AENA 4RUEA 2HWC1 2CTPA 3B09A 4QE7A 4GALA 3OOXA 4D6QA 4IT5A 1UPIA 2AGSA 5LBCA 4AFCA 2HWF1 4XF9A 2ZBJA 4JV5B 3HD8B 4BYYA 1U96A 1FXZA 1HV1A 3POFA 2DVAA 2YS8A 1AYM1 4UW6A 2PQQA 2RMU2 4YRDA 2WNVB 3EBRA 3SYPA 4DV1O 1SHWB 2QQUA 4M4RA 2YB7A 4WFEA 2P3IA 1AI6A 3AKPA 4FPFA 3IIAA 4FPLA 4BXSV 4W4KA 2BFUS 3RFRA 1HNWO 1KS5A 2QQLA 1B09A 4NPRA 1RUE3 1XREA 4XUPA 3H01A 2R043 3WINE 5LMNB 4X8PA 2J1SA 1YVWA 4Z82A 1ZBE3 3K59A 1MS3A 4OUSA 4J1XA 1QQP3 3D4KA 3ZSMA 3J4UH 4H13B 4IV3C 5B66Z 3WG1A 4DR5B 1UO9A 3OFNG 1F9KA 5A1FA 5CA0B 4KXRA 2HVJC 1KJLA 1S0DA 2Q8VA 4JDNA 2YMZA 2RM22 3OEAA 4YGDA 5A3LA 4LULA 1K92A 4YZ5A 3NJYA 2QQIA 3EHKA 4DZGA 5JOYA 2F4PA 4A44A 1VIBA 4CCJA 2W1SA 2W46A 3QTCA 2MW2B 3E5UA 5G04L 2Y6JA 5L9VA 3FWEA 2QDRA 3ST7A 4AAPA 1N34O 5FOJB 1SRYA 3JBG2 1TMF1 3R6SA 2RV9A 3N2GA 2WS93 2IFRA 3AG1C 1QNYA 3F7VC 4LR3A 4IYIA 4X62B 2R073 5IT6A 1QLEC 2VNOA 3LWCA 1YEWA 4RQFA 2QFEA 3CDZB 1W2OA 1BBT3 3N9OA 1QJU3 4MVMA 4BE3A 4NHXA 1J83A 2HP8A 1ODNA 4B4QA 5IYZB 4Z2WA 4N9IA 4WFHA 5E88A 2EINC 1NOVA 2RHPA 3VL9A 5KMGB 1WLTA 4IV1B 4Z1VA 3AVSA 5FZOB 3LDCA 4YZ4A 3FC0A 1VF6A 4KBBA 2ZGLA 4WM8C 1WB8A 1UZWA 4JKMA 3UK9A 1BHGA 4W50A 3HIFA 3I59B 2B4KA 4AQYO 3VKOA 4XDPA 1P7GA 3WUDA 2VAUA 5FPOA 1XXNA 4GZRB 2QM8A 2X05A 3S7IA 3KF5A 3BN6A 3ZXEA 2Q6AA 3LQCA 1IGOA 4BJ0A 3W58A 3FAVA 5I93A 1YNAA 3EVKA 3K4ZA 5LBEA 3FYIB 3VKFC 2Q30A 4B1LA 1W6NA 5ABJC 4DW1A 2Q0AA 3BGAA 5T5OA 1QJEA 5CA1A 4O9GA 4XHBA 1GK9A 3A0KA 1C8NA 1ZX5A 3FUQA 5EC1C 1RTVA 3CC4V 4I02A 3GDBA 3N36A 5G05L 3U78A 5AFEA 1OLQA 3K0GA 1NUKA 1YWKA 3DN7A 4LO6B 4I55A 3VZNA 4P30A 1OH4A 2GNBA 3DXRA 1KITA 1L8DA 5BNOB 1FD9A 1AR93 5LOVB 1VQ7V 2GP3A 1XL6A 4XDKA 4PF1A 3VBSA 2ZQMA 3L2HA 4Q2FA 4X1IA 2LW7A 1W05A 1DLBA 5C8CA 1PNLA 4MXWA 3OB8A 1JFFB 2P90A 1UXXX 4ZI7B 2IJJA 1LCLA 4DS0A 4OGQB 4AOCA 4UCUA 5JH7A 1V00A 4FLTA 2LGQA 2ZT9B 4FLVA 4IHJB 2XT9A 5L7OC 4NWWA 3VDAA 5FP3A 4AR2A 4XQWA 2JD4A 2QUOA 1IKPA 2Y8KA 4CUBA 3J7MA 3FHQA 3HEIA 3OGGA 1OOPA 5LEJA 4YGEA 2FZ1A 2XMLA 3T4ZA 2R042 1SCSA 2ZAAA 1HP8A 2ZGOA 1UYXA 1ZBE2 4NWVA 2HEYF 3IPVA 1QQP2 4JI4B 4O9EA 1UNBA 3EYPA 3RI9A 3WVJA 4FLZA 1ZA4A 5KAIZ 4CP9A 4RGAA 1DZTA 2BPA2 1CAUB 2UWCA 3NJVA 3HJRA 2RDRA 2W52A 2VL4A 2K46A 4DR3B 5FLHA 5HFMA 3ZSKA 1JN2P 2AW9A 1LR1A 2ZGMA 3OBAA 4Z1MG 4WM7B 1WCDJ 1FXVA 1XNDA 1WCSA 5JJEB 1JYVA 4CCOA 4QAWA 3P6BA 5L19A 4JRLA 4EEQA 1QGLA 1BGYH 1RUOA 1F5JA 4QDSA 4L9BA 2DU1A 1EUTA 4LHLA 4DPNA 2CL2A 1YQCA 1D4M1 1X8MA 1B35C 5KUKA 3WOGA 4P9PA 4YW3A 2F23A 5DAXA 3ZFGC 1G86A 1NCRC 4Q1RA 1BBT2 1KGYA 1IXBA 3N2GB 1NZCA 3I3BA 3G4SV 4XYXA 4A6SA 1PVXA 4CCEA 4JHTA 5KXBA 2VNGA 1KU9A 4CC5A 1VQ9V 2R9IA 2EF6A 3ZYFA 3AK3A 1ZRFA 2WRAA 2WSUA 3WW3A 2QKDA 4RS5A 3TN93 2GDFA 2RQ6A 2ZGNA 2ZTNA 4QX0A 4LFBO 1CX4A 5LBQA 5JAXA 5D5PA 3C90A 2VJXA 1LGBA 4YVSC 2K0GA 1GP6A 2UY9A 4P5HA 2H94A 1EFRG 1EYBA 2DWEC 3FYEB 4UYBA 1JYTA 1SS3A 5IYCO 3NNMA 3VDDA 2CYFA 2D3PA 1EN6A 1FATA 2OPWA 2JG9A 4MZUA 3CSXA 1Q82W 3A7QA 4JTNA 4YNIA 2OA2A 1UWWA 2EULA 4WFBV 4AHZA 3LIGA 1IBKO 5K1XA 3OPWA 3ZCCA 3FHIB 3W21A 5DMYA 2YU2A 1T5EA 3O9OA 3RPQA 4RHV3 2NNUA 5AC91 3M7MX 2D5FA 5DAVA 4TZDA 2HWE3 1GMMA 3GCWA 3QH6A 3FAVB 1HRI1 1OCRC 4V2VA 1FPOA 1XHZA 1W6NB 3U75A 4LHKA 4LO7A 2ZGPA 4FLWA 3SHRA 1HQNA 5CA1B 2BGOA 5LY1A 5EIYB 3P32A 4LBQD 1SQBH 3WNLA 3I2IA 4G27B 5FQ0A 5FPXA 2P6HA 3ZN6B 2BGPA 3AM2A 1VBA2 1YI7A 4OQ8A 5FPZA 1MABG 2PLV2 3C8XA 1PD3A 2W0XA 2VCBA 1STMA 1OD3A 3I5DA 3IDEA 2CDYA 2XAFA 3DXRB 1XMOO 3KQRA 5CFCB 5ERLA 3ZR6A 2IUWA 5TSWA 1FS0G 2D3OW 5GTHZ 1PGL2 3ZXKA 5C3PA 4LKEA 1DHKB 2AZ0A 3LOIA 3CCJV 3MUY1 3VBSB 4B08A 4X1IB 5C8CB 1AP6A 2OKXA 4D3WA 1JYWA 3AVRA 4MXWB 4KU8A 2AACA 3JCZA 4JI8B 2AHYA 4WBNA 4TN7A 4W65A 2IJKA 5JH7B 1FMD1 1G8WA 4F6RA 1FOD1 4FZ0A 1S2BA 4MLOA 1E5IA 5FZAA 1Y74B 3B02A 3E8FA 1NKGA 3WDXA 2HR3A 3K4DA 4LMFA 3WG4A 2HHHB 1O91A 4COWA 5KHGA 1BK0A 4XPVA 5IVYA 2B9UA 3SH3A 1JOPA 4HOOA 1UZVA 2VW2A 2GC2A 2QE3A 3POBA 1NA1A 2E51A 4TV9A 2VOKA 3WY6A 2ARBA 4DV3O 3MLLA 1NAEA 3U10A 3IPVB 2GNTA 5JCOC 1O3QA 3DGTA 5BXXA 3TETA 2WNOA 1XYOA 4NIHA 1AUYA 3WB1A 3LDKA 1NI8A 3B5LB 1OJHA 2X29A 3N9NA 4HFSA 2ORZA 3WQ7A 2JDZA 3JCUZ 4D7TA 5KBFA 1S5HC 1LRHA 1RYYA 4K8FA 4MVZA 3VQYA 3P3PA 1Z0HA 1QLNA 1PIV1 1LOGA 3AP9A 4MOAA 1GM7A 2C5DA 3N35A 1AJPA 5LGTA 2VMCA 3DYPA 3J7NA 3NQHA 3ACFA 4CH6A 3ETDA 4DV7B 4A5UB 4R52A 4ZHQA 4JI3O 4SLIA 4UBGA 2WZEA 2BOCC 1H9WA 5A7OA 3AK2A 4B3SO 4PA9A 3KGZA 5FYTA 3ACLA 4K3UA 1XNTA 1TNRA 1UFIA 4M0NA 4DR4O 5FZIA 1S0JA 3QOPA 1U0AA 4HSLA 2AEYA 4DQAA 5FWJA 4FFBA 4D6TH 1DQ2A 2HWC3 2XWBB 3WEZA 5FUIA 1FXKC 5B3SC 2HWF3 2CAZC 5A33A 2X6BA 2YICA 3KG2A 1AR61 1MOFA 4A7YA 4EN7B 4NN0A 4FPYA 1RFYA 1B3QA 1XEQA 2RR11 4LFAO 1JBCA 4B3MO 4H33A 4XACA 5FZGA 2XJTA 4ZY9A 3DPRC 3VBOC 1R1A2 1LODA 5JPMB 2E7AA 2XHNA 2LS6A 4CEWA 3VDDB 4WV8A 4J6GA 4QXHA 2YIBA 5FYUA 3E1F1 2RS32 2QR4A 1UZ0A 3V0AA 3BALA 2JG9B 3NL1A 3MZHA 3T2QA 2HWE2 4N90A 1XC6A 3RWRD 1DF5A 3OF1A 1GNZA 5C5UA 3PLQA 1F4AA 4FXKB 3ZDVA 1XMQO 2VULA 4AK3A 4PA7A 3O1OA 1VQNV 1RSOA 3ZN5A 1WZXA 3OBZA 5DUUA 4X66O 2ET7A 1BQ0A 4MSVA 4X65B 4CSWA 5C5TA 3SQOA 4LO5B 2XH6A 5DPNA 4FP2A 4PLNA 1CX1A 2ZS6B 3BUCA 5LHGA 4EROA 2OT7A 1TMF3 1V6OA 2ZE8A 1XNAA 2VW0A 1D2SA 5AVPA 2DBNA 2ZCEA 2DVFA 1QU0A 4QB1A 5F5IA 2CGOA 1IBMO 2Y6GA 4W6YA 3MFAA 5J48A 1RMU2 2XVKA 3UJOA 1JJOA 5J1XA 3ACIA 4XDOA 4JI6O 4LF5B 3LA3A 4PIXA 4DRXA 3BCCH 1BVP1 5IK7A 3MLJA 4MX3A 4DEQA 1Y7BA 2IWGB 4Y1ZA 1WJZA 5JSRA 4E4ZA 3JD2A 2E32A 5DUWA 4JAUA 4AGVA 3LSUA 2WWJA 5IK5A 1VB2A 2PMWB 5LRRA 4C90A 1JOJA 4WBNB 4LIVA 2Q68A 2WO1A 4QQLA 5CBLA 1SQGA 4F6RB 3CEWA 4FBFA 3ZIXA 3K5LA 1J3RA 3KKYA 1KRIA 3CXCU 1ST8A 1CN1A 1FFXA 4J9ZB 4N21A 1TME2 2DYRC 2VOWA 4OCTA 4BU2A 5IATA 4X20A 3JD72 4J7ZA 1NA1B 5LGNA 2JXAA 2VMFA 4TV9B 2ZX4A 3WNOA 5FIXA 1BE3H 3WF1A 4NIDA 2KKWA 1ZBA1 1W8WA 1J84A 3PIGA 5LW9A 3RRDA 4FM2A 1FJGB 4GJZA 4IDZA 2DW4A 1ULEA 1P84F 2ZIMA 1GSLA 5B1AB 1LOBA 2UWBA 3B9CA 2V73A 2A1XA 1KC8W 3FZ3A 5C3OA 3B9IA 4YWAA 4IL6Z 1V9PA 4A7ZA 2B1GA 4TV8A 2VZ1A 4Y33A 4BIUA 4CCLA 5CB4A 1PGSA 2ZDIA 1AI4A 1RVF1 2D98A 4TQDA 2A3WA 4FTBA 3WU2Z 2LRPA 2XUEA 3SLIA 2RNBA 5ACA1 2FCTA 1QR9A 1C5IA 1GM8A 3OMAB 4NRMA 4ZS2A 4LBQB 2XG3A 3AFKA 1O7FA 3LPGA 2WLHA 2DUQA 4JI7B 1QXPA 3E97A 1OPOA 5L3FA 4EQVA 5A3OA 1L3JA 3OUHA 5DECA 4JI1O 3DEMA 5DN2A 3ZHVA 3FB6C 4OMDA 4QPIA 4FFBB 3N2KB 4E8CA 4ZU7A 3SPIA 1AYM2 2FMLA 1Q8QA 3O1SA 2ZOEB 3WP6A 2GTAA 4X6RB 5I0UA 5IE9A 1W2BU 5A33B 3OTOB 4AAXA 1Y66A 5CFDC 4Y24A 5F6KA 4CU8A 5IVVA 5JOZA 3UNPA 4QKBA 4D0QA 2B39A 4XQ4A 3KHBA 4CEWB 1W8FA 4X1KB 1TUEB 1LGCA 1ND2A 4JI2O 4LNVA 4NIAA 3V0AB 5FZHA 2WYFA 1NS1A 1W8NA 4QGNA 4ES9A 1GYKA 1GWLA 3AMMA 2CNAA 3H8UA 2HBUA 2ORXA 1J3QA 1RSOB 4ISRA 2E74B 2JEXA 3M8LA 4B3TO 4QPKA 1JVMA 1BMV2 4PA3A 4UCTA 3WD5A 1PGW2 1JYIA 1D4M3 4AEDC 5HCBA 2XR4A 1O6UA 1BSMA 2UYBA 3JSNA 2VQEB 4NB5A 3OM3B 1HB4A 3PURA 3NXSA 4S2FA 4M3CA 3P1IA 5ISLA 2BBAA 2G4IA 3ZJZA 1NKDA 1N1YA 1PMJX 1YFXA 1HJGA 1RUH2 4LITA 4P08A 4KHPO 2OIIA 4BQYA 1BK1A 2B45X 1ENSA 3B69A 5BR8O 4N8MA 2A9HA 2IM9A 4DRXB 1D4VB 2NR5A 3NAPC 4QKFA 4GB31 1H4HA 2EJRA 5FJKA 4TWTA 5JQGA 2OW4A 3UKTA 4UV9A 4XJ8A 3BIWE 4IGPA 5B1OA 2WT1A 4ZU5A 4UFJA 4I5SA 5DZFA 5GW7A 5KAFZ 1QKQA 2BDRA 4LE3A 4HMZA 3V0BB 3NKGA 4YW4A 3CC2V 1ULDA 2WNVC 4HPKA 3WHUA 5E79Z 1ULFA 3WG7B 1WP8A 2ZE6A 4W6XA 5C4WA 1XHXA 5IW0A 4BISA 5JIUA 2QWOB 4XF3A 1OBNA 1W28A 4X20B 3S0MA 4ISQA 1W2TA 1Y9MA 3T30A 4LR4A 1V9U1 3RI8A 1PMHX 4DV0O 4HN0A 4MADA 4XILA 4HANA 4R6ZA 3IAYA 3ZYJB 2QNKA 3N27A 1J1TA 1IG3A 1W0KG 1Y9QA 4BA6A 2Z0AA 3LDBA 3OW2U 4LHNA 4Q4X1 2NZ9A 4AFMA 3SYAA 4JASA 2G19A 2QKCA 2A7AA 3PUAA 3SPHA 5LMUB 4EB6A 4OHZA 5LA6A 3CMGA 4QXCA 2B42B 4TV8B 2Q7GA 1EAH1 5CB4B 2WBKA 3RVZA 1OQEA 1IQDC 3H3LA 4W4LA 2PYTA 2ZNIA 4CDWA 1OKQA 4NAMA 3G71V 4Y1YA 1UYZA 3MF9A 2HBTA 1MEC2 5LHIA 5FYBA 1GFF2 1K45A 4NHLA 5E89A 2EIBA 2PHFA 2BOJA 3J9SA 4YGBA 3POGA 1VP7A 4HSJA 3A21A 1FMD3 1FOD3 1SZTA 2UUCB 4QPIB 2WO2A 3VKMA 4MS2A 5H5NA 2EIMB 3N7LA 1G8MA 4IV1C 4AHXA 3EO6A 1GZTA 2VNVA 1MVEA 3CCVV 2K9PA 3L70H 3LFIA 1QJX1 1L7QA 4CP0A 5FZ3A 5LHHA 2EZPA 1TZOA 1LHOA 4WFFA 1RUC2 4XUOA 3TXSA 4BB3A 4DR6B 4PELA 2WLPA 4WVMA 1G7YA 3JQXA 1ND2B 2CV6A 3KV9A 1XE7A 2RS11 5C7GA 2X5IA 4MTXA 1WMEA 3R66A 2UXCB 3MIGA 3ZOIA 2CTWA 1HW7A 1CIWA 1XB9A 2VR4A 4P9XA 1L0NH 1UU5A 2BWAA 2DDUA 2W08A 2W87A 4TLFA 3IIIA 4UCRA 2VCAA 4ONUA 5CG9A 3OY8A 4ZU4A 1GN6A 2WFF2 2PAKA 1PIV3 1S77D 5BNQA 2W39A 4FPCA 1MACA 4QIWF 5B5EZ 4JGZC 3SEEA 2UXNA 3ETGA 1NLRA 2QDOA 3NRUA 1P4RA 3D36C 2WDBA 4XDJA 1M4UA 2XLGA 1YUDA 2IXLA 4XTPA 1NCQB 2QGNA 4PI0A 1AR72 1W39A 1R6NA 1HLCA 4Y5SA 3IWZA 2WINB 3ZSLA 2PYLA 4M3CB 1M4WA 3J7HA 1SDWA 1HDJA 1V6IA 3HR0A 2JEUA 3BCWA 1R6KA 1N1SA 1SETA 1GH6A 1UAIA 2DMXA 1V55B 5T5LA 3H1KH 4DUWA 2F4VO 3RVYA 3T1LA 2Y0PA 1FI2A 1GP5A 5K8SA 2G9GA 1J5EO 1AR63 2A6WA 1PVC1 5IVCA 1TUBA 2JB8A 3IB3A 1I5YA 3BIEA 2RR13 4B7KA 3UO3A 1YQ8A 1YDXA 3APOA 1UU6A 2AREA 5I8SA 5FMBA 3WNMA 4FFGA 3TGUH 1RL3A 2GZWA 4A2UA 3LDDA 4GKKO 3BHPA 4EN6B 4XURA 4AG4A 4LLFA 4X1YA 4L92A 5AC92 1IPKA 3NVCA 4DK0A 4NXMB 4WFGA 3ASNB 4HPKB 3RWNA 2NN4A 2R061 2QWRB 5CBFA 1HRI2 5JPNB 5C9AA 5C4WB 1H2GA 1BCXA 2WAMA 1SERA 2Z42A 1XILA 2QQJA 3VBRA 4X89A 4AEKA 1GZWB 4BXFA 4RD7A 2JX9A 4GKJB 2J1RA 4JTAB 2WLKA 4WM7C 3J8F1 2J1VA 1S0BA 2AXTZ 2BEOA 1RPOA 3HNYM 4YW2A 2JDUA 3STZC 3TYJA 4Z92B 5H6RA 4TYSA 4RN5A 1V70A 4DUZO 3WF4A 4NTWA 5DDJ2 2JDPA 2PXJA 1FAYA 3RNSA 3ZYRA 2D6LX 5JXGA 4J11A 3FLTA 3RJ2X 2VQTA 4PD4F 4IEWA 3RZGA 1KQRA 3NV1A 1UY1A 3THPA 3K06A 2FKXA 1IPSA 3ZMOA 2LP7A 3ZFFA 2W6JG 2E75B 1PNKA 2BE3A 4J25A 1GZ9A 1FMD2 2VZTA 3ZKUA 4I3PA 3CXHF 3D0SA 3JARA 3RYIA 4FI9A 1WCUA 4R9AA 4J41A 5B4XA 1S0IA 4IEYA 5IYDO 4QWNA 2KD7A 4DXWA 4K1ZA 3BTYA 3K57A 3MEPA 5KHHA 5L3CA 4E4DX 3RZKA 3OTFA 4CUGA 1LULA 3O1VA 1YTFD 2YC0A 4HKOA 1D0HA 2BNNA 4O7XA 4BQWA 4ZXEA 1HW5A 1N3PA 2J1AA 4CBCA 4RWUA 4YY3O 3W5NA 2GN3A 4BPZA 2VTFA 3B8NA 4LWSA 3MV01 2LFSA 1XJAA 1TGOA 4YPJA 2VOVA 5BPXA 4WM8B 4WVMB 1ZBA3 4NR1A 2IW5A 2VE1A 1ZL8B 1XU2A 3TEXA 2X5IB 5FP7A 3KB5A 4JPRA 4XFHA 1BZWA 5BZBA 4DR1O 5IFTA 1VBB2 1Q6UA 4U7NA 3RJRA 2HEPA 3VHOA 4LF8O 1W6PA 3AG2B 5E1AC 3OY8B 4LF4O 1RVF3 1A3KA 4GCZA 5LB6A 5IYYA 2ZXWB 3ZKYA 1SLAA 3I2GA 3GWKC 4BW5A 3SCFA 1GLHA 4HN1A 4KMQA 1KUQA 3VBHA 1W9TA 1JZ6A 1I94O 4ARYA 5F3CA 4K6BA 3LAGA 2SLIA 1EUUA 1YJNV 4COUA 4YW6A 2RM21 1U97A 4Q4Y1 4LPLA 1AR62 2UXDO 3ABKB 1JH5A 2P2KA 2VNRA 4Q4V1 1SKVA 2IJIA 1FFTB 4DUVA 3VBSC 1UOFA 2ZHMA 5C8CC 4BQ3A 3KV6A 5EWSA 2Q67A 4CE8A 4LK7A 3NR7A 2JVDA 4DV1B 4GH4A 4I50A 3UT0A 1VQ6V 3CRQA 2QQPA 1X50A 3U37A 1W6OA 2P5OA 3T1CA 5A6ZA 4BM8A 3WSOA 1NJIW 1SLTA 2A0LA 2Q69A 2PAEA 2GNDA 4JZRA 4J1WA 3DF0A 4LORA 3I2JA 3X2QB 5JMCA 1MMMA 4X1YB 1VRH1 1R73A 3KSCA 5FY9A 3UT5A 5D21A 1H6YA 4JGYA 3CS5A 3TXQA 2XWJB 1CR7A 1UMZA 2RDSA 1OA2A 2D97A 3SCHA 3ZN4A 5LEKA 1DLCA 3SEPA 3W7WA 5FYCA 1CWPA 4MVRA 3BB6A 1XUQA 5F3GA 1P7BA 5FYZA 4R4XA 3PL0A 1D2DA 3VBRB 1N34B 1SQQH 2DU0A 3DC6A 1DIWA 3M3OA 1S4CA 3OPZA 4LOTA 5FLXN 2EBOA 3FHAA 1GN2A 1RJ8A 5FZMA 1XE8A 2PHLA 3MGUA 3RYFA 5BNPA 3GBWA 4LK6A 3NV3A 3CMAV 2H6BA 4KG0A 1G9FA 2H0VA 2PUSA 4WFAV 2DF7A 2FDFA 3RBZA 3J7LA 2H8PC 1YIJV 2F6BA 4UW3A 4CUCA 4LF7B 3ZFFB 1QJZA 4LKDA 2XJSA 2KR2A 2KSDA 1J1LA 1MZFA 4QJFB 1U12A 2EIKB 1VQPV 3Q8BA 2MPFA 2EXKA 3D82A 4NHKA 4GB33 3JARB 4DO0A 5IWFA 1YFYA 3K3OA 3AMQA 4LEJA 3T4HB 3JAKB 2FDHA 2P06A 4GWIA 1NR7A 2V5DA 5FJHA 2JJ6A 2IVIB 3N9QA 1I0HA 3ICXA 1IG0A 3ACGA 1M56B 2ARXA 3PJQA 2JK5C 4GMP1 4BQ1A 3ENRA 3T2OA 2BSKA 1OV9A 3CCLV 4RA0A 4XVHA 5DN6G 3OSDA 1QJY1 4BH9A 3VDDC 2AH2A 4YVSB 1XRUA 1ZBA2 4XETA 1LHUA 2JG9C 2BVVA 4BDVB 1VJ2A 4XF1A 4LO8A 3APQA 3FKSG 1V9U3 4XFAA 5F2SA 2YC2A 4GWJA 1KD1W 2QVSB 4XMAA 2XBO2 3AFGA 1ACCA 3IDAA 2OT5A 1VE0A 1XSRA 2D3RA 1EN5A 4PDMA 4Q4X3 3E6DA 1POV0 1T2XA 3IM0A 1O4YA 3DL3A 4AVAA 1C57A 3AC0A 3CRCA 3I2OA 3OGCC 5ACA2 3M3QA 1WW6A 5CN0A 1PO21 1LNQA 5FYIA 1KB9F 4HVOA 1VQMV 1X82A 3CJIA 4XJWA 2JDYA 2ZZJA 1W6PB 2ZMNA 4N53A 3LF7A 1EAH3 4ITCA 2Y69B 3C7OA 1W6MA 3Q9OA 3HKDA 1OSGA 3NJZA 4ZS3A 4LUMA 3HT2A 5FPVA 5AG2A 1GQGA 4RUFA 1TG7A 4FPEA 2ES3A 4P2ZA 1KD7A 4O2BA 3VBHB 1CP9A 2R7EB 3LGRA 2XL9A 4D6RA 3ELNA 1X9TA 5JR2A 5LMNO 3H42B 5HCHA 3FB7C 3VD3A 2VUDA 5FMOL 5SV8A 3AG4C 3TCUA 3LEKA 3LKJA 3UO2A 2E7TA 5JUVA 4IEVA 4AI3A 3K5MA 1H2MA 3HQUA 3SYQA 1MA1A 4BK5A 5L9RA 2ZNJA 4MW8A 2DWDC 4H0LB 2OZ6A 4GH4B 2ATKC 4I50B 1GNHA 1DG6A 1GM9A 5D5QA 1WGPA 3DXTA 3VQWA 2OIGA 5T5JA 1ZX3A 5L3DA 1QJX3 2WQ8A 5FZ7A 3ETEA 1RITA 1PV0A 1IURA 1KFXL 2C24A 1VMGA 2CAUA 1QF3A 3S5QA 2YEVA 2J1EA 4MTGA 1AVMA 1LOAA 2RS13 3UT5B 4XAAA 1NA1C 3JCIA 4YYOA 4EFBA 1E5HA 4ATEA 4JGYB 4X62O 5E1RA 1REFA 3ES4A 3SYOA 5EHDA 2VD7A 1R64A 2DUPA 3ETQA 5KXCA 4Y26A 4KQ7A 2GHYA 1QHTA 4FXGB 3RZMA 2E5LB 1YJLA 2E63A 4AYUA 3BODA 2VBDA 5B1AC 1QR8A 5AFBA 1H6XA 4CRQA 2V4AA 5JR7B 1UPSA 3AXEA 3DKWA 5JMOA 1OCCB 2QQOA 1UIKA 4UV8A 5BNPB 1K4CC 1UZZA 4QM9A 3E86A 2FYUH 4X9QA 4XE9A 4MGSA 5A7WA 3BRCA 1M1KW 3E35A 1AYN1 4GB32 2RG4A 3A8TA 3UQ8A 1K5MA 4W4ZA 3M3IA 4P14A 4XJAA 5KHJA 4QDQA 3OJBA 2QKAA 2F66C 1Q6HA 1PVC3 3KHCA 5IVFA 1HRV2 1WA8A 1R3KC 5HXVA 5A6QA 3VZOA 3D3QA 1MZ6A 2D6KA 1C1FA 3O1UA 5GZDA 2GC0A 1CZTA 3T1YB 1K9MW 3CO2A 4N7UA 2XJUA 2PLV1 3IZOA 5FZ6A 3LZZA 2JE8A 3M8AA 4X8NA 1OA3A 4O4HB 5IK8A 4CZSA 5CAZA 2ZACA 5A32A 1QCEA 3U11A 2ZGQA 5B1BC 2BSKB 3V56A 1GQHA 1V9U2 4BAYA 2R063 4CEWC 2OZJA 4NOTA 4C7UA 2IXJA 2ZEXA 3HNBM 4Q4X2 1L0LH 3CX5F 3C7GA 5C3QA 2CGPA 3URFA 1FPN3 1S5LZ 1OCOB 4J80A 3J8F3 2R0FA 1RUNA 3N7MA 1VQ4V 3LUTB 5EQUA 3PUQA 5FBJA 4DY3A 4CXYA 4HAMA 4QB2A 3WW4A 5FP4A 1ALYA 3Q8EA 5JZGA 3H1MA 1ENXA 3VQXA 3EXUA 2BTQA 4GA9A 3KLSA 4BIFA 4H2AA 4IE6A 1AHSA 1HR0B 4D8MA 3E2EA 2RS51 4I0XA 1XMOB 1N3QA 3AKTA 1BL8A 4KNCA 2W5FA 3SC7X 5KA6A 1CXZB 4BQ2A 2CAVA 1UPGA 2QJ1A 4TTGA 4EZ4A 3CJIB 4QKNA 1R6TA 4KH9A 3I97A 3VHNA 1W6MB 1Q7YW 1JW6A 1XPWA 4DEVA 5I0SA 2X8KA 2RJKA 2GAUA 2HG5C 2HYXA 2ZR2A 4DR2B 4O2BB 5GLTA 3RW0A 1B6QA 3U14A 3CCQV 3ABMB 1G6NA 3H9VA 2XAHA 4BLJA 4LH6A 1VR3A 4CYDA 3K9AA 1JU4A 4RQPA 1QJX2 4G3YC 3IDCB 3WDTA 1CONA 1C28A 4A6OA 1QOTA 4K8RB 3KM5A 4QPYA 4O2AA 2VY0A 1EV11 2P6JA 3A0RA 2VRZA 1WLCA 1NVPB 2DCYA 4FPJA 3W5MA 4DMIA 5C6CA 4EWDA 3RMXA 2EIDA 3BI3A 1Y4MA 5FO8B 1PL0A 4GX2A 1QOSA 5FK7A 2EIEA 3WG7C 1HQLA 4KWKA 2YU1A 5FL7G 2ZX2A 2D6PA 2XVLA 1S2KA 4Y5TA 3MIFA 1LHVA 1J95A 3M7AA 1BQPA 2OVUA 3AJZA 3QVNA 1LENA 2R9RB 4DRVA 3AX4A 3SISA 4CU7A 1VIWB 1DGWA 1MS5A 3T0BA 2AR6A 1GKFA 3MDPA 4BQ4A 1Q86W 2Y33A 2F1MA 2RMU3 3CWBH 3OBTA 2E26A 3JASA 5KHKA 2X6AA 1EBOA 3PUHA 4Q4W1 1IOAA 4IE0A 4UI9L 3FL7A 2RS31 5FBZA 4B3SB 2P4EA 3DV8A 3I54A 4FFKA 3R4UA 3UJQA 1LHWA 2A73B 3C3VA 1J58A 1DQ4A 4JYBA 1O5UA 5F1RA 1PNFA 2EALA 3AZWA 2X0LA 3FX7A 2FCVA 1MS8A 3MIHA 2ZDIC 3BVCA 4JF3A 1BHAA 1AILA 4Q26A 4CU6A 1VBE2 5DXDA 1KDKA 4LKFA 1I08A 4MW3A 2RM23 3KT1A 4Q4Y3 2UXXA 1PVC2 3K0DA 3QNEA 5EK0A 3B77A 1AL21 4Q4V3 2C26A 1VAMA 5FY8A 2Q8CA 4B3MB 1K5MB 1W06A 4PLMA 4YSFA 4NUBA 1V6JA 4XTMA 5EZWA 3ON7A 2DE0X 4OLLA 1JXNA 2XHBA 2YY1A 1VF5B 3AKRA 4QPIC 2O14A 5D8AA 1Q3EA 2EIMC 5CG8A 5IYBO 4E27A 5H9CA 4E4EA 4OHYA 3KV4A 4PDWA 2VWKA 1RMU1 1JODA 4JVAA 3WB0A 1VRH3 4XF0A 1W90A 1Q90D 5A32B 1DYKA 4CVUA 4JKLA 4UCVA 4XJUA 1Z78A 1KMIZ 3OYWA 1GN3A 4TUYA 1MS1A 4F8AA 3ZSJA 3N7KA 4JAVA 1ND2C 4GYCB 4KGGA 1UD1A 4ASKA 2W95A 4IGQA 2O8QA 1HQWA 4PCRA 4GX1A 4RGKA 3VB9A 4P9GA 4JYYA 5FDBA 1R3IC 3KT4A 3WF2A 4IETA 1DGWX 4KG8A 4QHOA 1XNQB 3MF6A 3THCA 5HV4A 1U5YA 2NLRA 1Q8SA 1TME1 3SXWA 1NTZH 2FL4A 3E6BA 5JZGB 4I9QA 4CDQA 3UGHA 3PU3A 1OD5A 1D2QA 3LA7A 3CIHA 3JD71 5KHIA 3I2DA 4Q0SA 2HHHO 4JI6B 4S2HA 3RN4A 2ODMA 1HNZB 1G1XB 2UYAA 4LKSA 4JZ2A 1GMGA 2VGDA 2B5UA 1IBLB 2D40A 3Q8FA 1NCQC 3I3DA 3JATA 1YXBA 1DGLA 2B1IA 1PZ7A 1GP4A 2VM9A 4AEDB 2YBKA 2BERA 2JIJA 3ZR5A 2BFUL 1CAWA 3DUIA 2VUAA 4UWDA 3MIEA 1AVBA 4U7OA 1WMFA 1LOCA 4TXWA 4A42A 3NMBA 1W9YA 2GMMA 4JYCA 1WLWA 2P3KA 5FXVA 3OUSA 1B35A 5FPLA 2OIEA 3A0BZ 4C91A 5I8TA 2YSUB 1DU3D 2D6OX 1IQAA 4LC1A 3J81N 1CVNA 2N04A 4GMP3 4RQPB 1W8TA 2ZEWA 4FMTA 1YQ6A 5IDJA 2LQTA 4ZOLA 1QJY3 1RB8G 1ZRRA 1JJ2U 1HXS1 1NQTA 1GTOA 1K8AW 2VS0A 4GMP0 4N43A 4RQEA 5CMUA 3ASNC 2LGWA 1IDSA 5D1IA 2BCCH 5AVAA 2DBIA 4B1MA 5C4WC 1I5XA 3PU8A 2WNEA 5IAXA 1RIRA 4SBVA 1ZRCA 2Z3YA 4CTEA 2P37A 3U4XA 1UYPA 1RUF2 4JQTA 3VZMA 4BWOA 1PK6A 4RGGA 1AROP 3IAPA 1BZKA 2W92A 5FPAA 3PVNA 3DSQA 2VU9A 5J36A 2WZPP 4PQ9A 1F4NA 3JUUA 4QXKA 1PO23 1RXGA 1S1AA 3JASB 1DLLA 3HQXA 5A3MA 5L73A 2JS3A 3KCCA 5A7SA 5IWAB 4MO3M 4UFLA 1A8MA 4LBJA 4BOWA 4P02B 4Q4Y2 2OCCB 1SLIA 4I2OA 1XQ8A 4CS4A 4JI1B 4N9HA 2Z4FA 5CA3A 4Q4V2 5EBWC 4AW7A 1GR3A 1H2SB 1KP3A 1QNMA 5LGUA 4BW9A 4Q5OA 3LSEA 1CJDA 5JDBA 3ALQA 5EV7A 3V64A 3PJSK 3ACHA 3HAGA 3GBGA 5FR3A 2CGNA 2JB4A 3GGLA 4OVEA 2WQZC 1LUWA 3WLUA 1ZZ8A 1BMV1 1PGW1 4UFHA 3PMEA 2EAKA 4GIQA 2Z5UA 4JHZA 4E2GA 2K2SA 3V65A 3A0HZ 1XU1A 1VRH2 4AHWA 4JI0B 5D8AB 3WNNA 3RYHA 4JI2B 3OD0A 2WZ8A 4H7MA 1B06A 3WF3A 3KZIZ 4Y1UA 1CESA 5H9SA 5JSPA 2A70A 1RUH1 3OGIB 3JB8A 4PDWB 3OGJA 2ZD9A 4GD4A 2BJSA 3GZTB 3ABLB 2Q0OC 2QWPB 3SH4A 3UL2A 3B8MA 2WT0A 2HEWF 1LESA 4NRPA 5HPOA 4MHUA 4BMBA 4IEOA 4B3TB 3WUCA 3OYWB 4TUYB 2VQFO 1DQ1A 2FDIA 2ITDC 1A8DA 1F2NA 3G80A 2X5IC 4JYAO 3T3YA 1UY0A 2GN7A 2QDNA 1SZXA 1L1FA 1EM1A 4OYUA 1VAVA 4LA3A 3J80N 1O59A 1XNKA 1BLZA 3C2UA 4BIOA 3ZRVA 4IE4A 3TJTA 2WPDG 3AG2C 3SJCC 1ASJ1 1YO8A 5F3EA 4JDOA 3RG0A 1I5ZA 2ZXWC 4CDQB 4F3JA 1S0FA 4OUMA 2DCTA 3VD5A 2WWUA 3VDBA 4W6WA 5FZBA 4PJ0Z 1VALA 5BR8B 3H1IH 1EP0A 2D6NA 3WP4A 1AYN3 3RZJA 4R4ZA 2Y64A 1KFUL 4LH7A 1IS6A 3OT7A 4H44B 5KR7A 2B9VA 4JGZB 2BRTA 3ABKC 3A2FA 3P30A 3ZXLA 1LHNA 3H8XA 2VMGA 4XFGA 4YFWA 1Y67A 1E5SA 4BZ4A 1VBA3 4QPJA 1FJGO 3CB2A 1DGRN 2Q7HA 1QJY2 4EWAA 1QQCA 2PLV3 2AEZA 4E9KA 1KDMA 1H2LA 2FBEA 2RDNA 2HFEC 1PHMA 3CLPA 2C2AA 4Q0PA 3SYCA 3MICA 4MTOA 4ASUG 2E33A 3CHXA 3HBZA 4QU2A 1MEC1 2Y6HA 3W7SA 5FNVA 3X2QC 1YHFA 2IH3C 2GUZA 5E16A 2QZ3A 4HKLA 2WWSA 4N43B 1ENRA 1QDCA 1YFUA 3M3CA 1M9NA 3PJYA 2ILMA 5J37A 3OMNB 5IJRA 5C9AC 3E83A 4Q8KA 4JI7O 3QD6A 2A75A 5FZFA 3B2EE 1SQVH 1PO22 3VZKA 1UOBA 4F83A 2A06H 1K4DC 2W6IG 5CYYA 3VBRC 5EYPA 3MW2A 5GLVA 1LJ7A 4B7EA 3EMRA 2DN9A 3LNNA 3AYCA 2GMEA 1K5QA 4UAPA 2WWWA 5KA5A 1CAXA 2RS53 1RUC1 3FD9A 3OTOO 5A3UA 1FNZA 2XNDG 3AZVA 5A7QA 1UZYA 2BGCA 2JDNA 2A3YA 4QD2A 3VBFA 2Y6FA 1PPJH 1W0PA 4IQPA 1XDCA 3CE2A 3PUIA 1WUVA 3O7OA 3SPGA 4FIPC 2ZA9A 4DFSA 4FP3A 3RDIA 4QX1A 3JD0A 3ZFFC 3T1HO 5B1NA 2WSVA 2OQ7A 2EIKC 1F7YA 2WFF1 1PNGA 5J09A 1Z5VA 3AZZA 3F5TA 3VD9A 3SGIA 3DCQA 2LJ2A 5DM6V 2IBZH 4QKDA 2QQMA 5C8WA 3OR7C 1EV13 3MAQA 1KEXA 1LR5A 3SR2C 2ZX1A 1XNCA 1M56C 1AR71 2ZINA 4CEYA 2WS91 1GZCA 4CXXA 4CS2A 2Q1ZB 3RYHB 2XOMA 2Q4PA 4DV4O 1HNXB 1OPMA 2V5YA 1VLNA 4XBQA 2DQ0A 3NV4A 4FAGA 4EWEA 5TISZ 3CRRA 4UUJC 1W2UA 1O4TA 1F4HA 3WFVA 1U5ZA 4ASMB 3NKTA 4LBKA 4AQ2A 2UXBB 2XJVA 4IE7A 3LE0A 3ZFEA 1JYNA 5D2AA 4PT6A 3I49A 4YG3A 2YXLA 1F23A 2LM3A 1ZUQA 3T4DA 1R1A3 1DTOA 1Y9GA 5ANQA 3AYEA 1LEMA 2EILB 4IE5A 1XBLA 1DZQA 1Q8OA 4Q4W3 2NYYA 2L9LA 2WO3A 4L97A 2RS33 3E5QA 5KXEA 3HPNA 2WLIA 1AYN2 4MSWC 4YJ2A 2A6YA 3K2OA 3FBYA 1N1TA 3LCPA 2Y69C 1DGRA 2VZRA 3I2KA 3ITQA 2TEPA 3VBUA 2F4LA 1NT0A 4L0PA 2EXHA 4DY5A 2KG7A 3T2TA 1MSDA 3ZMUA 1AL23 3VBHC 4OUEA 3TB0A 1BEV2 1W9WA 2YHJA 4NROA 4DOUA 5E8AA 4MGZE 4EN9B 1H2KA 2GNMA 4R7CA 4XIOA 2JGDA 4I55B 2QTWB 2WR9A 5DDJ1 3LD8A 2OYZA 5EBLC 1ZZ6A 4IEPA 4CCDA 2JGUA 3K9SA 5EYXA 3JD3A 2NQYA 4DR7B 4GH4C 1RJ7A 1RMU3 2OTJV 1E5RA 1DQ5A 3R4SA 3I8TA 1COWG 5GJ6A 4HNAA 1YZBA 5LMUO 3OBRA 4LT5A 3M2MA 2KB1A 4HBNA 1C4RA 5L36A 1SEFA 3L2YA 3R05A 2ETEA 5EIBC 3KCYA 4E2LA 4Z8BA 4EE2A 2YIBD 1XNRB 5JJJB 1GKBA 5FNVB 3HKCA 4AE2A 1R3LC 2GUZB 3F5WC 1W2NA 3FE5A 4PDRA 4GULA 1VBC2 4JGYC 4OULA 1UMIA 4QB6A 2P1BA 4V2WA 1OOPB 3G6JB 2FTKA 3GM8A 5KUMA 4LHSA 4GZ9A 1G9CA 1S0VA 2RS52 4YW1A 4O4JA 3VKNA 2YGMA 4XC9A 1AL0G 4G9SB 5KX5A 1TME3 4Y5Z0 1SG3A 2UUCO 1G6UA 3O0XA 1ZZCA 1H1AA 4RYDA 4CP9B 2I74A 5FKBA 4C1XA 4K1YA 3GHNA 3JD73 2AZ5A 4YM3A 1JZ4A 5SV5A 1ZYBA 5KC6A 1CAXB 5A3NA 1G9AA 5FAXA 2LW8A 5I0TA 5H9RA 1OCCC 2GTSA 3DGEA 5F2VO 1SBDA 2ZGRA 3AKQA 4QPGA 4NAOA 2CWSA 5BNPC 4B3NA 3O65A 2YI8A 3IN9A 3VBFB 3UYJA 4YLZA 1A78A 4DR6O 4BLIA 4E8DA 4ABMA 2R32A 1K7DA 2P4VA 2JIZG 4YHHO 4QNHB 1HJFA 3RSJA 3HBKA 1VBB1 3B3QE 3POEA 3KZ4C 5KXDA 4MGTA 1XOUA 1EV12 5LWBA 4JI5O 1ZNPA 2QTOA 1ONAA 3H3UA 4IERA 3RYPA 2ET1A 2WUHA 1JHNA 1YJWV 3OEEG 4U36A 5IVEA 4YY3B 2VVEA 5HFLA 2O1QA 4META 1AI5A 3X29B 2J7MA 1HXS3 2Q5TA 5FPUA 3AMNA 4J42A 1VMHA 4DNYA 4CEYB 1US2A 1US6A 1UOJA 4RS5B 2P7TC 5T54A 1D5AA 2XOKG 2RDQA 2XLFA 1D7PM 2W1UA 4ICGA 1AYM3 5IVJA 2W68A 2QM7A 1N47A 3S3XA 1MPXA 2LUWA 5BY1A 3HR9A 3OAAG 3AL5A 4Q4W2 3ASOB 4LF8B 2OXBA 3ZFEB 3AJYA 4XXAA 1OCOC 4LF4B 4KFMA 3BOWA 4NE9A 2PELA 2WT2A 5FOBB 1PP9H 5EJ1B 4BMEA 4G28B 2DUOA 1WLDA 2GSYA 1LAJA 5KLVH 4UW5A 1N1VA 2XDVA 2IZWA 5DAQA 1UKRA 3BYWA 1URXA 1BXHA 3A4UA 1TVGA 3ZXDA 3M70A 2WLIB 3RMYA 2RJ2A 1AL22 4DUYO 4P9WA 3CJIC 2BUKA 1LUVA 2HJIA 4YJ2B 4N53C 4RAIA 2HWB2 4XFIA 5CA0A 4FJCC 4KU7A 3ZRWA 4EJRA 3VBUB 4I3GA 1AJKA 3GBFA 1OQDA 3K3WA 4QPWA 3ABZA 2KG7B 4E2QA 5FQ0B 1DF0A 2WQ4A 4I7ZB 2XTAA 5J3UA 3USSA 4CXWA 5FZ1A 1AJQA 1GBGA 4J7KA 2VZVA 3ABMC 4EFEA 2VXJA 3N4MA 1H0BA 4DIQA 4GKYA 1IZ3A 4MXVA 1PNMA 2W47A 5J2UA 2JGDB 5CISA 1NQJA 2VMIA 3AG4B 1MZ5A 3ECQA 1YIPA 3DYOA 3ILNA 1EZVH 3ZX6A 1RUH3 1V6LA 4D69A 2VXRA 4Q0VA 5T3NA 2NMOA 2W91A 3JQWA 5I0DA 4HNAB 2WNUA 4CH4A 2AUYA 4DV2O 4H7LA 2GMPA 5FLJA 1EY2A 4LF9B 5FP9A 2Y6LA 4EN0A 4NPLA 4WVWA 3VGIA 4YARA 4M3CE 3O0VA 2Q4SA 2QE7G 1ND3A 5F5QA 2XUMA 4UCSA 4QMAA 3HKCB 3LDRA 2GH8A 5JLVA 5KMGA 3ZYHA 3IJ4A 1NG0A 2IXCA 5CKMA 1PM4A 1ZREA 3ZMSA 1X7NA 2VC9A 1LB2A 4PBOA 1QH7A 1HWYA 5FK8A 1SA0A 1W0JG 4BK4A 3I59A 4GX0A 2QZ2A 3AZYA 2UUAO 5BUVA 5KX5B 1R082 2V72A 1J3PA 1VQLV 2JEMA 2FQPA 1BVVA 2D2CB 3UGGA 2QWQB 2EXJA 1OCZB 2ZGKA 1OI6A 2XBO1 1BS3A 1EPWA 4UF0A 4YGCA 4M0HA 4QPGB 3TEWA 2K1EA 4B3RO 5L9BA 3MLKA 2PQSA 1OMIA 4LBNA 1K5MC 1FYJA 1Y6XA 2JKXA 1ZRIA 2CU5A 4MYEA 3CC7V 5F32A 4ZHQB 1Q56A 2ZEZA 1NZ6A 1HXS2 4K8XA 5A6YA 5BNOA 1S3JA 4ZPIA 3SMHA 1K42A 1OF3A 3HN3A 1MS9A 5CKQA 1MEC3 1WBFA 1N0NA 3G6EV 3K3NA 2DOSA 4CDXA 2WLJA 2VTXJ 4WBBA 1GANA 1HKDA 1F31A 4IEUA 5A80A 3TK1A 4GLXA 1NH2D 4JV4A 4IHJA 3LOBA 4B8EA 2YBSA 5FZ4A 3QO5A 3BPZA 5A9GA 5A3PA 4MGIE 3K46A 3CNAA 5B1BB 5ANNA 2VCMA 1NBMG 1RGSA 2BQPA 1FV3A 1T6GC 1W59A 4TSFG 3GXUA 4DXTA 1QJFA 1OQ1A 2XLAA 1UOGA 4RO2A 2IFWA 3D3IA 3ILRA 1DQ6A 2JRIA 1QVGU 4YG6A 1RUC3 3B40A 4LA2A 5FPBA 3IDBB 1GWMA 1KKDA 5JZGC 4RR3A 2XKPA 3PVEA 2VPVA 1RUJ1 2G9FA 1ZZ9A 1CAUA 2HWD1 3OR6C 4JGSA 2R1DA 5JIAA 1WA4A 3CCRV 3POIA 2HYKA 3VD7A 1R092 3T09A 1V6KA 1F51A 4WM7A 2ADDA 4X8AA 3O1RA 1OURA 4D7SA 3ZMNA 4UFMA 4ARXA 3ZRWB 5T50A 2VUCA 1N32O 2WFF3 1S0GA 3JD4A 1RM1B 4FK5C 2VW1A 2ZHLA 4LFCB 5C8YA 1RC6A 2ZCWA 3KGLA 1OA4A 3D5OA 2Q5ZA 4S2GA 2Q8OA 5IY5B 3VL8A 1V54B 1RHI1 2UU9O 2QQKA 4PBPA 4E2SA 2DVBA 4PDLA 3C3SA 1K12A 3FB8C 5J2UB 1AR73 2ZMKA 2QWNB 5F2WA 4ZXKA 5K9YA 4H14A 4RQPC 5J7MA 5GZEA 1RUI2 2QEXV 2CTRA 1F15A 3D6EA 2GU9A 1DBNA 1WKYA 3ES1A 5JXHA 1HB3A 4MVTA 2WYSA 4GWMA 4R8HA 2YXSA 1HB1A 4CDUA 4AL9A 3WDYA 1KECA 4ES8A 2WNUB 2WLMA 1HN1A 5B4NA 5CKNA 4PJYA 1HRV1 3AG7A 4FM1A 3VUOA 5FYSA 5BYNA 4LF7O 1S0CA 2C4XA 5F6LB 1MQTA 1ND3B 2KXLA 3MW4A 2ENRA 4XUNA 2LALA 2VZQA 5CBHA 1ASJ2 4HVRA 1PKXA 1FFXB 3ROUA 2DVGA 5L3EA 5CBGA 2YBPA 2C6SA 4XABA 2DVDA 5AC93 5JXIA 2ZEYA 1GUIA 3S57A 1SA0B 1SBFA 1HRI3 4C8DA 4OPAA 2JDMA 2DQ3A 2WIIB 1WNSA 5FXWA 2HLEA 4FPPA 4NXNO 1S0EA 2YIDA 5FY4A 1L7RA 2OCCC 2A71A 1E57A 4QXBA 4GUNA 1RUG1 3CCSV 3QH7A 2PHDA 3AP7A 3CZJA 3CF6E 4LF6B 4UW4A 4UF0B 1SC5B 4K35A 3NNLA 1OLMA 3H8RA 2CE4A 1LOEA 2XHKA 3RYCA 4ZIBA 1AB3A 4PDVA 4Y1VA 4AFBA 4JTDB 5DDJ3 3ZN6A 1W6QA 4OI2A 1ULPA 3B94A 2TUNA 3MIBA 3C7EA 2J22A 2XQRA 5T55A 4DK1A 4X64B 4XOGA 1K3EA 1H30A 4UXAA 4K8ZA 2FMYA 1Y76A 3J26N 2BBVA 1PM9A 1I6XA 1KKCA 1GWKA 5BNNA 2VBBA 2K9ZA 4DV6O 1NQDA 1NXMA 5D8AC 5CFCA 3O5SA 4X88A 1W2AX 2R30A 2W2IA 2PY5A 2RN9A 2ZR3A 4FFFA 4GKXA 1H8HG 1Z7S2 2P34A 4PDWC 3BU0A 1N36O 2Y0IA 2Z2SB 5FTTC 3AG3C 4F4LA 1MVQA 3S3WA 3P3NA 5JJNB 4HVQA 1OFNA 4CDXB 4CPBD 3ABLC 3OUIA 1A34A 4YM0A 3K79A 2A3QA 5DG2A 3HT1A 2FDGA 2ZKLA 3MIDA 1SZBA 3LEIA 1VQKV 3GZAA 4M3CF 5DEDA 1Y74A 3TRSB 3F2ZA 1KQSU 5LA9A 4DUXA 1QH6A 1XQNA 2L35A 2AYHA 1NXD1 1KP2A 2W3JA 3H1YA 3OMIB 5KC5A 1W03A 3JU9A 3I7DA 1RUE2 3SDLA 3IFXA 1EPZA 5M0TA 2VH9A 3GF6A 3CPWU 3K04A 2ZXQA 4J10A 4QX7A 4LBOA 1BMFG 1N33O 4RR3B 3WDVA 3BA8A 4CDQC 1QVFU 1WPXA 1VBD1 4HXCA 5H6QA 1GO3F 4LNUA 1IXMA 3OEHG 4LCUC 2YV8A 3OGSA 1I9RA 2WC2A 1F35A 2Y38A 2ZM6B 2G9ZA 3H7YA 1TE1B 2H6CA 5KWRA 4V1PA 1F4MA 4P9YA 1IVSA 4CU9A 1CIYA 1VBB3 2ZMLA 1IKQA 4YXWG 2RJLA 4AXOA 4CP2A 1WN7A 1NYWA 3C3TA 2W0FC 4BWAA 3Q8CA 1QNWA 1NE6A 1LNSA 1HN0A 4J7JA 2I07B 1JI6A 3GYDA 3EFFK 4COVA 2QSAA 4LIUA 3OG2A 3FB5C 4KWLA 2WS92 4QX8A 3PDQA 2E7QA 5F5CA 5C8YB 2E5LO 5GM0A 4AQTA 2WAOA 3K03A 2R072 4NHMA 1H1MA 3BAAA 1VBE1 1QJU2 4HYOA 3LNMB 3ABTA 1VB4A 3TEYA 2ZIOA 3ZYIB 3O1PA 4S2DA 3QG5A 1Y3TA 5FPRA 2ZGTA 5JQGB 1H8TA 2OQ6A 5FZKA 4N43C 4CDUB 3ZHUA 4CH3A 4O65A 4R8CA 2YUEA 2YZ4A 3WQBA 2PHXA 4QGLA 5J2TA 4XBFA 1VQ5V 4WZFA 2LTNA 2KA3A 1X33A 4PA4A 2P3YA 2DYSB 2IH1C 2NP0A 1MQTB 3FLPA 3TAYA 2QTSA 2PA7A 2TNFA 5CEHA 1NH2B 3ZYPA 2JDAA 1AXYA 1PK6C 2PHRA 4QQHA 1UY2A 2VZUA 1XE0A 2GC1A 3T4VA 2CY6A 4DXSA 3EXAA 3F95A 5GLWA 2IJHA 5LP6A 2WAAA 3POJA 3T1YO 5GALA 3B01A 1NLQA 4UVBA 3DXUA 2JS5A 3QO7A 2JDKA 4XCBA 5A6XA 5IK4A 3VBBA 2YPJA 4K9SA 1THZA 3MPPG 5FY5A 3OE7G 4XCAA 5DQ0A 1BJQA 4ZKIA 1OF4A 5F5AA 1QWRA 2EJ7A 1JX9A 4MHRA 2PZSA 3H1JH 4IIJA 2F17A 4EB6B 5LA6B 1NT2B 4FVVA 1VPHA 5CADA 3UCSC 3RYCB 1T6BX 4QGPA 4M4PA 4UFIA 2UURA 1RP3B 1O4ZA 2WLLA 2VBPA 1W6QB 1RXFA 2P6CA 3ZHSA 4DV5O 1JUHA 1AR92 1YQ2A 4XF4A 4CDWB 4P00B 5BY5A 1Y76B 4OHXA 2R9AA 4AWDA 5LA0A 4YG0A 5BNNB 3ABUA 2R16A 5FY0A 1HR0O 4OX9B 2BW8A 1FYUA 2VQUA 2A6ZA 2WLNA 1V6NA 1W8UA 5EIBD 1W8OA 1UCXA 2R72A 3TBDA 5FREA 3HNMA 5EYYA 1OZ0A 1WBLA 2VQAA 3OUJA 4FOWA 2UUBO 3UKNA 4Q27A 3KQ4B 2WN2A 1JYXA 4W8JA 4OMCA 2R0HA 2NN8A 4H3WA 1W3VA 2TBVA 4DR2O 4OPHA 1VF6C 4GWNA 2PHUA 1ZRDA 1H2NA 1W3XA 3IAQA 3WNPA 1XOYA 4AVVA 5FO9B 2EILC 4P5YA 1UN1A 4MVQA 2MEV1 5A7NA 4A3XA 1VAKA 4UCOA 3P5BA 3U1XA 2FHRA 3OGRA 2Y4UA 3LB9A 2XBO3 1RUD1 2J1TA 4HG6B 5HCFA 2CH7A 1ZAUA 2IXIA 1RUF1 2D44A 2QQWA 1IS4A 4LNUB 4NIGA 3ZIWA 1AP5A 2DCJA 1UY3A 4YM1A 2HJFC 1DFQA 5K0UA 2Y4TA 1PO11 5ACA3 2KM2A 4FTSA 5H9QA 2E3CA 3RS6A 1R1ZA 3BVOA 2E9QA 3IMNA 5FMCA 2RE9A 5GLZA 3ZHTA 3TEZA 2BVBA 1REDA 3T0DA 4LBQA 1SFNA 1CGPA 5F3IA 3ZXFA 3H1WA 4GAZA 5IT9N 1SMVA 2W9XA 4DXRA 4N7IA 1H8EG 1WCQA 4TOIA 3TN92 1O3RA 4L99A 1IS3A 1X8EA 4XXPA 4MGQA 3B93A 3KD4A 4FFIA 4EN8B 1TUBB 5IHRA 1UYYA 2WJSA 3N2KA 5FLIA 1JQ0A 1HNWB 3BTXA 2O0OA 5J96B 1H8TB 1K5SA 1WD3A 1OUXA 3CL1A 3UM7A 1OOPC 1ENVA 5J2TB 1H9PA 2E6VA 3CQOA 5T5PA 3EQEA 4YIOA 4FOQA 1AX1A 3TNPB 4IW3A 2BOIA 4Z2AA 4OZXA 3NV2A 1JMKC 2WFPA 4X1KA 5C9AB 1RUJ3 2HWD3 4RHV2 5LP6B 2OUHA 4ET7A 2P3JA 4OHVA 1WLEA 4LTAA 4URTA 4AHCA 2Q1FA 1NY71 3E8GA 5C33A 4ZBMA 3THOA 3R4DB 4AQSA 2A5ZA 2P4KA 5JVVA 3VBFC 2JJ1G 2F43G 4AI8A 2WKKA 1G9DA 1SLCA 5EJZB 1W8HA 2XVGA 1XSQA 2Q8EA 3VN4A 2XJQA 4K0KO 1K73W 4IIJB 3S6PA 4GX5A 4K3AA 2EX3A 1QEXA 2W94A 1XI1A 1RHI3 3SJBC 1GOHA 3U07A 3PHMA 2WLLB 4Y1XA 5A1AA 3VKLA 4MVUA 2ZJCA 1XNQO 2G1MA 1GN4A 4QT6A 4DRRA 3VHRA 1NVPD 1Q5OA 3G67A 3ZMVA 2GH2A 3CBNA 5CU1A 4QX5A 3RYIB 5JOWA 3AB0A 3W59A 4CEYC 3G6BA 2PHTA 4HL0A 4RS5C 5J9PC 2ZHNA 2VQFB 4NRQA 3M99B 4AQYB 1HNZO 1HRV3 3OGVA 1IBLO 4JYAB 4MVSA 3WQ1A 4ZZ8A 1DK1A 4PLOA 1MR5A 1DF4A 3MI8A 4UFZA 2W1QA 2ADQB 2RVAA 5IFPA 3B7MA 2JG8A 1SQPH 3ASOC 5EXOA 4U3JA 4AI0A 2NM1A 2BV4A 4QX2A 3ZFEC 3V0BA 1U5IA 3CU7A 4I30A 4XDQA 2CDOA 1WW5A 3GJBA 4AEJA 4LWSB 4YVWA 1PL4A 2B9ZA 2ADPA 2ZZQA 4UVCA 1UQXA 4IEZA 1FX5A 4K21A 2O57A 1A32A 3M4FA 1VMFA 2DURA 1ZLZA 2PI4A 1RUG3 5H2FZ 5A70A 1WB7A 3GJAA 3EB7A 5GTIZ 4LLOA 1PZ9A 3SNMA 3NNJA 1JZ5A 1I3HA 3WW2A 1E1RG 1AR5A 1KS4A 2CH7B 2DTWA 4JV5O 3VBUC 4AVBA 1Q8PA 1JOYA 2UY8A 1E1QG 4KP4A 4UBHA 2JECA 1NR1A 5K0UB 3NNFA 3NSTA 3NNGA 2E53A 1N4CA 1QU7A 1NTMH 2ITCC 5IJ9A 4AFAA 2PI5A 2C0ZA 1GOFA 3UKVA 5A3WA 2HLDG 4UT5A 2Y60A 2VMEA 2E76B 3STLC 5FRAA 4FVMA 2YFUA 4DR5O 3ZS8C 5CNAA 1AXZA 5BV6A 1XL4A 2BZDA 4D6SA 4OHWA 4F6EA 2HWC2 4OFGA 5C93A 1P49A 5IWAO 3ZM8A 1JPXA 4AGRA 1DYOA 2YPDA 1S76D 2YGLA 2HWF2 1WW4A 1HX6A 3ZYGA 2Q1MA 1CPMA 4O4LA 4FT8A 4CA9A 1W6OB 4PIZA 4YFZA 5LA1A 3B00A 1I1EA 5JI9A 4HK9A 4AI1A 2CTQA 3K5OA 5DZEA 4LBLA 2OYQA 3WNXA 4FO9A 4I4TA 2ZAHA 4COZA 2IU3A 2I45A 2P5BA 1YFWA 1RUJ2 2HWD2 3H9AA 3ZSEA 4LP8A 4ZONA 2LFRA 1NX9A 4NHYA 3RZHA 1QMJA 4JI0O 3CMEV 3K58A 1VBD3 2VZOA 3T1HB 2IVJA 3WR0A 3A22A 5C3SA 1DYPA 4J9YB 1OCZC 4CZZA 1JU3A 1DGSA 1UXZA 2CSGA 4A41A 4TT3G 4DB5A 4QPGC 3U4SA 1ZA7A 2YXYA 1PMIA 1BKZA 3O0WA 1CZSA 1RHI2 1PM7A 2ZHKA 1O3SA 3ASIA 3EJKA 1YYNA 1Q8VA 3BEHA 1COV1 2A6VA 1TMF2 4NPMA 3DKQA 3RYFB 4C1WA 5EJ3A 2H0BA 5EZYA 2B8MA 3VZJA 3T0AA 1WWYA 3RZZA 1LOFA 1CPYA 4DV4B 4LFBB 1JZ8A 2BYVE 1Q6IA 1NTKH 5FYYA 1NCQA 2Q8DA 1VBE3 2GP5A 4CC6A 2FDJA 1KXGA 1N8RW 3MBWA 4QM8A 4Z07A 1SLLA 4LOSA 1OFSA 2Y6KA 3R65A 1BEV1 2V09A 4TWKA 4UFKA 1OKOA 3ETPA 4XMIA 3T2MA 2XPJA 1U5XA 4I0AA 1IBKB 2XAQA 2VMHA 4RL7A 3L72H 2EAAA 3SH5A 1ODMA 4YZ2A 3MO4A 3NWKA 4UB8Z 4BIZA 5DZGA 1C8M1 3CEIA 1V6MA 2JG8B 5FXXA 2YG0A 3PTYA 4U3JB 3BTZA 3W20A 4I0BA 4FPOB 3CD6V 4LQRA 1K5JA 4CCKA 2B46X 4Q6GA 4Y20A 4YZ1A 3F7YC 2FMDA 1RUG2 4FLYA 4YVWB 3LEMA 2IXHA 2Z5WA 4AQ6A 4C0BA 4U2AA 2AZ2A 3E8BA 1AI7A 1M90W 4E4SA 4Y4YA 5JOXA 3Q8AA 1SCRA 3KT7A 5FYVA 1VBC1 1GZWA 1R3JC 1UIJA 1POV1 5HXMA 1YLLA 2HKXA 1S2EA 4A3ZA 3ORJA 3OPTA 2EIJB 3AEIA 3APBA 3ZX7A 4JZGA 3FN9A 2EIGA 3T08A 2WN3A 4HLTA 1WMDA 4IV3A 3AP4A 4CUAA 1C1LA 2R70A 1RM1C 4N53B 1P8JA 3WXPA 3RGBA 3HKDB 4QHZA 4KWJA 3W7XA 5IY5C 2ARCA 1G4YB 1V54C 1TEIA 4JI4O 4ASLA 1Y4WA 5K7PA 1H38A 4YZ3A 2DCKA 5IJ9B 2AGAA 2XJPA 4DR3O 2FDKA 4P9IA 1SBEA 1OHFA 2BTOA 3UGFA 3CCUV 1VQOV 2HH9A 3JSLA 3BTAA 2NLJC 1TVKA 3INAA 3WX5A 1Y43B 3WW1A 1M93A 2WNUC 4UOJA 4Q8LA 4DV3B 4FZ1A 3MDSA 5GZCA 1APNA 4HONA 5GKAC 2ZABA 5BMVA 2VUJA 4GXLA 3KMHA 3SPCA 5LXTA 4O4LB 4MGKE 1ND3C 2YI9A 4FM0A 4FPHA 2X09A 3MHHC 1D0GA 5EP9A 2DFBA 3UKMA 2LO1A 1CJPA 2MEV3 5K1PA 1LECA 1W9FA 2BP6A 4I4TB 1M57B 1KJRA 3RZLA 1VBD2 4XQDA 2VOTA 5LBBA 4R9DA 2D5HA 1W0NA 2YEVB 1F8VA 4AVCA 4FLXA 4KBZA 4OXSA 3AZXA 4WM8A 5LBFA 4YHHB 1RUD3 5FP8A 5GONA 4WCEV 3Q4HA 2JIGA 1RUF3 2QKSA 1HNXO 3UETA 1ZL8A 3DYMA 1ZVFA 4PHZA 1ZZ7A 3FFQA 1ZM1A 4JI3B 4JI5B 1CAVA 1ZTEA 2RCVA 3WP3A 1PO13 1SQ4A 4MGYE 5FKCA 2GV9A 4DR4B 2V4DA 2UXBO 4INDA 2D93A 1D4M2 4QQOA 5DG1A 1AF9A 2M6YA 2XL7A 5CIRA 4E4HA 5ABJA 4XAEA 1DCSA 5HV0A 1C5HA 1NU1H 3JAWA 1POQA 2BNOA 5FY7A 3C7FA 3HMYA 2ID4A 5EZYB 5C71A 3MHSC 5A7WB 1JR9A 2J42A 2HWB1 4LFAB 3H8OA 2DWRA 3SJAC 5BNOC 3K5NA 1CQ9A 3SJQC 2DTYA 4M01A 1IS5A 4IXLA 3BKZA 1FAFA 1BHBA 5FZDA 2LROA 1MSWD 1WA8B 1Z5WA 3O1MA 5HBAA 4U3FH 4CDXC 3WG3A 3H50A 1XYNA 3HVDA 1DQ0A 3NJXA 2YYOA 2ETNA 2JJ2G 2GC3A 2P17A 4LUKA 3IC7A 3VDCA 1XMQB 1UX6A 2BOBC 3CZUA 3IBMA 4LXLA 5JI7A 3VQVA 4X66B 5L7OA 4DUYB 2XONA 3A0NA 1NZIA 1ZSPA 5CB7A 4CPBA 5C70A 1SQXH 1NLSA 2WSSG 2BU9A 4XIKA 4DR7O 1GU3A 4Y20B 4A4AA 3KVAA 2D3SA 3CYOA 3NO8A 4FPGA 2JE9A 3S7EA 1W9SA 1XYPA 4NKGB 1M5IA 4RR3C 3ZEDA 1JHJA 4URAA 2GSMB 5I8YA 2KQXA 4JI8O 1E79G 3SITA 1IBMB 3SKVA 4FLUA 1FV2A 1NE4A 4RFRB 3KS7A 1YIFA 2BTQB 4EZHA 2JD9A 1EN4A 1XNRO 1FPN1 3ZXJA 4XFBA 3PN1A 1X59A 4G2KA 4I0XB 1CD3G 2AC1A 1I7FA 4IV3B 5ITZA 1ORQC 3BOPA 3M3EA 1R081 2QA4V 1X9PA 3O1TA 3CJHA 2C9KA 3WP5A 3PTRB 4DV2B 3CCMV 1OVPA 1AR81 2WZR1 3OEBA 4OI1A 3LFMA 4L11A 3BFRA 2JWPA 1SFPA 5JSOA 1TNFA 3ZFGA 1NCRA 1FOD2 2XJRA 3RYKA 3E22A 1TVKB 2Q7EA 3AG1B 2QQVA 3I56V 3L9JT 5LL6Y 3JAKA 2VOXA 2MNGA 4CDUC 2RDCA 2HJDA 4O2AB 4KUMA 1K97A 4XW3A 3QBQA 1JZ7A 3LDEA 5EFUA 2UUAB 1ROPA 1QLEB 4AVSA 4JTOA 2MEV2 2DJVA 4CCNA 5LATA 3IGAC 1S55A 5BMVB 5FFOC 2DYSC 2MHFA 3L71H 2ATFA 2QJVA 5LXTB 3ZMTA 1MQTC 2XQXA 4DV7O 2R6QA 2CK3G 5FXZA 4YW5A 2QCSB 4AF9A 3VHPA 2WA3A 1AR1B 1PX4A 4YVSA 1SPPA 5JVDA 1HV0A 1RINA 1RUD2 3RQ0A 1OH3A 4IESA 1QHDA 3MYXA 2ZE5A 3BABA 2EINB 4B3RB 1TQ5A 1B04A 3K77A 2XAGA 5A1LA 2OUJA 4WVVA 1LGNA 3WQ0A 5A7PA 2ZGSA 1R1BA 2V1DA 3IT8A 2X53S 4TSVA 1PO12 5GONB 3Q4HB 3FUOA 4TQFA 3K08A 1X36A 4FFHA 2IC1A 3OCPA 1JMUB 1OVSA 1CAVB 2PF4E 1PIV2 4Q20A 4MH0E 3M1HA 2FD8A 3FBMA 5CA6A 4DYLA 2RMU1 3ATGA 4PI2A 4Q29A 4F7ZA 5B2GB 2EXIA 3A23A 4XDLA 4L8JA 4A45A 5ABJB 4D94A 1UW8A 1W0OA 3JAWB 3THDA 4HZFA 4HETA 4CDWC 1WMXA 3VV1A 4IYHA 1R091 3LSQA 2JDIG 3HKEA 3KWVA 3JALA 1XNBA 5BNNC 1REEA 3B4SA 3JD1A 4A7KA 1QY4A 1H4GA 5CFCC 3GWOA 1ENQA 5H9PA 4R50A 2CUGA 4X65O 4IGOA 3J7AU 4OZOA 5IUQA 3ZN1A 3BU7A 4LE4A 1PZ8A 2RR12 3OUFA 2B7YA 2YFZA 5FY1A 3MV11 4DW0A 4I09A 4FQZA 2A7WA 4B4RA 5CVRA 3D8CA 3LPFA 1PX3A 3AYAA 5LK5A 1WCKA 3JBG1 3GALA 1O9HA 3JZVA 4XUQA 3AG3B 3AL6A 3ZXAC 4EYUA 1OLRA 3UESA 1G9BA 1SDDB 4CP1A 1HB2A 4IEXA 5JXJA 1RUI1 2VVDA 4GQ7A 1NY72 4DXZA 2VMDA 4BHPA 4XBNA 4IUGA 3POSA 2OWOA 5L7OB 5IJ0A 4LF5O 3T2PA 2OS2A 2PYJA 1OC1A 1YXWA 3T1MA
chains in the Genus database with same CATH topology
3QH7A 2PHDA 3ZVXA 5LRSA 3AP7A 4DINB 2HWF3 4ORFA 5A33A 3CF6E 4XBLA 1AR61 4UW4A 1G6NA 4A7YA 4EN7B 1LEDA 1AJOA 4NN0A 4FPYA 3AP6A 2ZPXA 1LOEA 2XHKA 4BLJA 2RR11 1VR3A 4CYDA 1JBCA 4Y1VA 4AFBA 3SCGA 2XJTA 2ERFA 2WBPA 2Q4AA 5DDJ3 3DPRC 3ZN6A 4RQPA 1MS4A 1W6QA 4OI2A 3VBOC 1R1A2 1LODA 3B94A 1QJX2 2TUNA 4G3YC 5JPMB 3IDCB 3WDTA 3MIBA 1CONA 1C28A 2E7AA 1LU1A 1QOTA 3KM5A 3ZDSA 1O5LA 4CEWA 4QPYA 1COV3 5T55A 3VDDB 4XOGA 2VY0A 1EV11 4J6GA 4WV8A 4UXAA 1H30A 2FMYA 3J26N 1WLCA 2BBVA 2DYCA 1I6XA 2RS32 1DRYA 2DCYA 4FPJA 4DMIA 5C6CA 4EWDA 3BALA 2JG9B 5FCCA 3RMXA 3V0AA 3NL1A 5BNNA 3MZHA 1H1IA 5FO8B 2HWE2 4N90A 2K9ZA 1QOSA 1NQDA 1NXMA 5D8AC 3OF1A 1GNZA 3N7JA 5CFCA 3O5SA 3PLQA 1HQLA 4KWKA 2VECA 3QCWA 2R30A 4FOYA 4FXKB 2ZX2A 2VULA 4HKWA 4AK3A 4NO4A 4H55A 4GKXA 1DZRA 2D6PA 2XVLA 1S2KA 3I4IA 1Z7S2 4OJ8A 2P34A 3MIFA 4PDWC 1CAWB 1LHVA 3GNEA 2Y0IA 2Z2SB 5FTTC 3ZN5A 3M7AA 1MVQA 1BEV3 2OVUA 1BQPA 3AJZA 5DUUA 4HVQA 3P3NA 1OFNA 2ET7A 4L2NA 1LENA 4MSVA 4DRVA 4COYA 4CDXB 3AX4A 4AFDA 3SISA 4P9LA 4LO5B 4YM0A 1VIWB 1DGWA 2XH6A 3ILFA 1MS5A 2AR6A 4FP2A 2O8OA 3MDPA 5DG2A 3HT1A 4PLNA 2ZKLA 3MIDA 1B35B 3GZAA 4M3CF 2RMU3 2ZS6B 3TRSB 3ZFGB 3OBTA 1NCRB 5KHKA 2PTMA 1QH6A 1XQNA 4EROA 1TMF3 4Q4W1 1V6OA 1IOAA 1H8TC 2AYHA 1NXD1 2VW0A 1D2SA 5AVPA 4JAAA 2DVFA 1QU0A 2RS31 5FO7B 3H1YA 1H8VA 2CGOA 5FBZA 3TWIA 5KC5A 1C8M3 3DV8A 3I54A 2CWMA 3R4UA 3UJQA 1LHWA 3JU9A 3POYA 3I7DA 1RUE2 1EPZA 2A73B 3C3VA 1J58A 1DQ4A 2VH9A 1O5UA 3GF6A 4W6YA 1JR7A 5F1RA 3MFAA 1AX2A 5J48A 1PNFA 1YCIA 1VP6A 1RMU2 2XVKA 2EALA 3AZWA 4FPKA 3USUA 3UJOA 1MS8A 3MIHA 1UL9A 4LBOA 3LA3A 4Q26A 4PIXA 1VBE2 1Z7S1 1KDKA 4RR3B 5DXDA 3WDVA 1BVP1 5IK7A 3MLJA 4CDQC 4MX3A 1VBD1 2RM23 3KT1A 4Q4Y3 1Y7BA 1PVC2 2IWGB 4Y1ZA 2YDEA 3DPRA 1AL21 3ME2A 2YV8A 3RYRA 3VBOA 3GZUC 1I9RA 3AXDA 4BHFA 4Q4V3 2WC2A 1VAMA 2JICA 2Y38A 4PIYA 4E4ZA 5JSRA 3VZLA 5DUWA 3H7YA 1VBC3 4AGVA 5IK5A 1TE1B 4CVYA 1PK6B 2H6CA 1VB2A 5KWRA 3AMHA 5LRRA 4V1PA 4C90A 1K5MB 4P9YA 1POV3 1JOJA 4PLMA 4YSFA 4JRAA 1VBB3 2ZMLA 1IKQA 4Q1PA 2RJLA 1V6JA 3PVBB 2JE7A 4AXOA 4XTMA 4QQLA 5CBLA 5EZWA 3CEWA 4CP2A 2EA7A 4FBFA 1NYWA 3V17A 4OLLA 1JXNA 3N6WA 1QNWA 3WG2A 1NE6A 3K48A 2YY1A 3ZIXA 3AKRA 4QPIC 2I07B 5D8AA 3GYDA 4AHYA 4COVA 1Q3EA 4KWLA 3PVOA 2WS92 1J3RA 3K51A 4BCUA 1UKGA 5CG8A 2E7QA 4K40A 1KRIA 4E27A 1RVF2 3WV6A 1CN1A 4OHYA 1TME2 1RUE1 2VOWA 2R041 4PDWA 5GM0A 4AQTA