1IZ3A

Dimeric structure of fih (factor inhibiting hif)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
338
structure length
338
Chain Sequence
GSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGGKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIH
publication title Structure of human FIH-1 reveals a unique active site pocket and interaction sites for HIF-1 and von Hippel-Lindau.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 83
structure length 338
sequence length 338
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1iz3A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1iz3A01
2XUMA 4Z2WA 3OD4A 2W0XA 2ILMA 3KCYA 3P3NA 4B7KA 4BIOA 3P3PA 2YDEA 2Y0IA 4B7EA 1MZFA 2CGOA 1H2NA 1IZ3A 4JAAA 1H2MA 4AI8A 2CGNA 1H2KA 1YCIA 3KCXA 4Z1VA 5JWPA 4QU2A 3D8CA 2WA3A 2WA4A 4NR1A 1H2LA 1MZEA 2YC0A
chains in the Genus database with same CATH superfamily
1UU5A 1AI4A 3NO8A 3LIGA 3PIJA 2QDOA 3JCUZ 3J26N 1GAXA 2D2CB 4I4TB 3TEWA 1KGYA 5FLIA 4FFBA 3FE5A 1MABG 3AVRA 1UN1A 3O1PA 2N05A 5DG1A 4BA6A 1KJRA 3FX3A 1GN3A 5IJ0A 4LHNA 1VQOV 4PDWB 1GZWA 2A1XA 1DF5A 4META 2RMKB 2HP8A 4Q0PA 4W6YA 4JI8O 5FZ9A 3CRCA 5FYMA 1AI6A 4WV8A 4XXAA 3OUIA 4FZ0A 4L8JA 2X53S 4AGRA 1OCOB 2EF6A 3I2KA 2K9ZA 1RUI2 1HB1A 5FJKA 2H6BA 2J1TA 1UIJA 4ZZ5A 4FFBB 3N3HA 3LDEA 2Q8VA 2VXJA 1RIRA 1XU2A 3T1HO 4OFGA 1QU0A 3ASNB 5IJ0B 2YROA 1GZWB 2E53A 3E35A 5FYZA 1JOPA 3K0GA 4LITA 2O1QA 3CEWA 5FPLA 1YTFB 3ZRWA 1W0KG 3MV11 4GXLA 4BQ5A 2WYFA 1FNZA 5G05L 4Z82A 3AG4B 3S3XA 3R6SA 4R7CA 3WNMA 5C3PA 3BRCA 2QZ2A 3CJIC 1OFSA 5FZIA 4ZIBA 4ITCA 1S1AA 4A5UB 3POIA 2PTMA 3VKFC 1I5YA 1YQ5A 1PHMA 1XPWA 5HXMA 4UB6Z 3N35A 2P1BA 3MF6A 1O3QA 3DKQA 2TBVA 3I2DA 4DB5A 4FQZA 3IDEA 5E16A 2GP3A 3MIGA 3THOA 2C9KA 3SYAA 1QDCA 3R4SA 4XJ9A 3KF3A 4BWAA 3ZRWB 5C4WC 1VAVA 4CPBA 5FP4A 1XMOB 3M3OA 1NLQA 2NPIA 4Y22A 5DPNA 2WT1A 1U0AA 1N0NA 3I3BA 4K9SA 2XBO1 4CU7A 3RYPA 2XHBA 3M3QA 3ZRXA 2E74B 2Y6LA 4DR7O 3THCA 1W6MB 1GR3A 2JS3A 1ZREA 3APQA 3BALA 1C5IA 1HRI2 3T0BA 2DCKA 4Q4W2 1V0AA 4IEQA 1XHZA 2WSSG 1H2LA 2IW5A 4GYCB 3DXUA 3VBHA 4EJRA 5JOWA 3ZXJA 3UGFA 4QNHB 1HQNA 1VALA 4XBQA 4HK9A 2EAKA 3F5WC 2VZVA 2QBXA 4Y22B 3IZOA 4DEQA 4DR2B 4N43A 5ANQA 4FFIA 5EYPA 2UU9O 2WIIB 5C7GA 4JC1A 1AR5A 4DV5O 1JFFA 3W5MA 2FB5A 5B3SC 1I6XA 1IG3A 3LEMA 1KS5A 2A71A 2RG4A 4GQ7A 4I50A 4ZXKA 4QPGC 2EIKB 4H2AA 2F4PA 1JOYA 3OTOO 1OOPC 4F83A 3J7LA 2P4VA 2Z5UA 4H44B 3GALA 1PM9A 3K4AA 4XYXA 1UPSA 4PD4F 2GMPA 3SEPA 4N43B 3WQ7A 4AVTA 3WP4A 1COWG 1FV3A 2HBTA 2VMHA 1JFFB 2B39A 4M4RA 1STMA 4GKYA 1Z7S3 5IK4A 5D2AA 1LOCA 4AVSA 1YDXA 2BUKA 1CP9A 1MSWD 1NVPB 1K12A 4I50B 2FD8A 1NT0A 3ACHA 4DIQA 2RR11 3MICA 4K7JA 2GALA 1S0GA 4B3TB 3NAPA 3T2PA 3Q8FA 4DO2A 4NHXA 4Y5SA 4PIYA 5KBFA 1XSQA 3RS6A 4Q6GA 2DCJA 4LF5B 1L7RA 2GC1A 3EJKA 2ZE7A 4LH6A 4GX5A 2WN2A 1UY1A 2A0LA 4N8MA 1S2BA 4FXGB 2ZGRA 1V9U3 5CU1A 1FFXB 2HWF3 3LGRA 5LL6Y 4KG8A 4PI0A 3UGGA 2R1BA 4CDUA 2XLFA 3OSDA 4MGQA 1RPRA 3VBFA 3USSA 4BQ3A 3TRSB 1PD3A 3F5TA 1RM1C 2OT7A 1B35A 1GUIA 4O2AA 2IUWA 1K5MA 1XRUA 4BLJA 4L8QA 3QNEA 1RHI1 4QXKA 1RYYA 3NAPB 1FPN2 1HB2A 3SJAC 2CGNA 1S0IA 2F1MA 4AAXA 1OD5A 5DEDA 5C8CC 1GP5A 2WS92 4P9IA 2XJSA 1TE1B 2ADQB 4E4SA 3UESA 4FPGA 2E9QA 4IHJA 3C3TA 2WFF3 3C2UA 2MEV1 5IY5C 4QX7A 2WO7A 4CDUB 3VBFB 1PM7A 4EKWA 2ZZJA 2B45X 1QU7A 4MH0E 3ZHQA 5F5AA 1UD1A 1B35B 5EYXA 1R1BA 3CZUA 2BBAA 4BIOA 1DYPA 1W0OA 1XNRO 1AR72 4MUVA 4Q4Y3 4DV6O 2W1SA 3TXQA 4RQPA 1UFIA 1SCRA 3JUUA 4NXNO 2CH7B 2F4LA 2ZIOA 4H37A 2G9ZA 4LF9B 5KHHA 1SFYA 1ZRFA 1LB2A 3SPJA 1CWPA 2ORXA 3QOPA 4QXBA 3CHXA 4IHJB 1OBNA 1SQGA 5AVPA 4GWMA 2XPJA 5C70A 1AILA 1E1QG 2JWPA 1PIV1 2OUJA 1DQ1A 4K0KO 3WG2A 5IVFA 1MZFA 3NJXA 2N7GA 1SRYA 2B5HA 1W8FA 3PUSA 1UYYA 2FDJA 4YVSC 5J7MA 3LEKA 1C1FA 4RQPB 2ARHA 4XF3A 1BEV1 3ORJA 4AQTA 1AR91 1WJZA 2EICA 3NV2A 4UCSA 2J1SA 3BOWA 1WLCA 4OHVA 1R082 4KWLA 3AKPA 3BOPA 1R091 1F2NA 5GZEA 3CMAV 3OW2U 4COYA 1IHMA 3HVDA 4QPIB 1TEIA 3HNMA 3OE7G 4JYAO 5FZ7A 2UURA 4I09A 2JIZG 2D97A 3E8FA 3W7TA 4D7YA 4BQYA 4E4HA 3VBSA 3K59A 1KB9F 5FPAA 4XOGA 4LOTA 1LENA 4P9YA 1W2AX 2W0FC 4TQFA 5K8SA 1NCQC 4RHV2 1AI7A 2Y69C 2P34A 3U78A 4MHUA 1LR1A 2Y6JA 1VQ4V 1VBA2 1CZVA 2HWC3 3N9LA 1WMXA 2QDRA 1ASJ1 4KH9A 1JZ2A 4OHXA 3A8TA 1OQDA 4I5SA 2BERA 2JDUA 5GM0A 5KAFZ 4QGLA 1FXKC 1ZRDA 3E6CC 2EZOA 5LYJA 4PCRA 4QKNA 4XAAA 3NJVA 3S7EA 1GWKA 2R063 2IBZH 3VBSB 1BK1A 1R6KA 4BIUA 4MTXA 4TV9A 2OUHA 4QQLA 4JYBA 3VZKA 3OMNB 1LECA 4X8PA 4BIZA 5A9GA 2XDVA 2E31A 2G4IA 3ILNA 4YG6A 5A1LA 4B3SO 1LGCA 3HEIA 3ABKB 2XH6A 2UXBO 4BR6A 2GUZA 3D5OA 3H7JA 2IVJA 1POQA 4AI1A 3AP7A 3FLRA 1EN5A 3ASOC 1KS4A 4RGAA 4AHYA 4DR5B 2Q67A 2V09A 4QX0A 2PI4A 5FMBA 3IC9A 4TV9B 1WNSA 5L3DA 4X62O 4RS5C 1MPXA 1RHI3 4A3ZA 4HVRA 2OIEA 3IBMA 3FFZA 3EVKA 4GJZA 1LHOA 5HFMA 4W6WA 4H33A 4FBFA 1T2XA 1RJ7A 4YWAA 4BW9A 3IMNA 3N7LA 5D8AA 1AXYA 4LOSA 4AYUA 2HWD2 3SYPA 2GUZB 4BOWA 1E5IA 4DRRA 1EYBA 5LHGA 3PTRB 3DL3A 3JQXA 1W90A 2F43G 1FX5A 4P9JA 2PHFA 5A6ZA 3K04A 4FFKA 4ZHQA 4YHHO 2WAOA 1BE3H 1RXGA 5CB4A 1Q86W 1UL9A 2V1DA 1ENVA 3CEIA 1KU9A 1MS4A 1QQP1 1XMQO 2W68A 3AK0A 1QHTA 3LSDA 2YG0A 2XAQA 1SESA 1OUXA 4AEJA 1LAJA 5FZKA 3CBNA 4K3UA 5T5OA 2EIGA 2RM22 3OAAG 5D8AB 4AFMA 5EIBD 1HXS2 3WX5A 3GBWA 5IYDO 4XZPA 1ZWIC 3AG2B 3IAPA 1VBB1 3RN4A 3RVHA 3GGLA 1Y66A 5A3UA 1EUTA 1H8HG 3OEBA 4ZHQB 1SMVA 3I56V 4UFLA 1PIV3 5F39A 1VQ9V 2ZX1A 1ZYBA 5CBGA 4DV2B 2WABA 2ARCA 3U75A 2YEVA 4UCOA 2E5LO 4AVAA 1M90W 2EIJB 2CK3G 4XDPA 2MK3A 4OMDA 4XUQA 2FCUA 2VCBA 1AL22 4DV4B 2JKXA 4A6OA 2XASA 1QJU3 1RVF1 2BCCH 3B2EE 3SQOA 2VQEB 3T2QA 1RINA 2LJ2A 4WBBA 4DFSA 4QGMA 4K3AA 3WDVA 5TSWA 1KFUL 1J5EB 3TEYA 3K06A 4QJFB 4QQOA 3S30A 1Q8SA 1GZTA 5CKQA 2C2AA 5GZFA 4URAA 4IV1C 4XDQA 1QLEC 4CUGA 1F9KA 4MGYE 3B01A 3A4UA 5CKNA 2YEVB 2WLJA 5BNOC 1O7FA 4NHMA 3E8GA 1VE0A 2FTKA 4IYIA 5GONA 3B00A 5BPXA 1ND2C 2QWQB 4NHKA 2BSKA 2V5YA 2Z5WA 1K8AW 3GVMA 2Y6FA 3NMBA 3RZGA 4WZCA 1BS3A 2W94A 2RS13 5E6HA 2EAAA 3WSOA 4OQ9A 1IS3A 2X5IA 5LW9A 3S5AA 3HKDA 4FOWA 3ACFA 1K73W 2JDKA 1XE0A 1MZ5A 2PAKA 3J7NA 3WV6A 3BEHA 1Y7BA 5GONB 5LATA 5C93A 2EX3A 4FAHA 2ZGLA 1OZ0A 3LIHA 3N9QA 3K3NA 4HXCA 4A42A 3HOBA 4I0XA 4NRMA 2ADDA 2BSKB 5JCTA 4QIWF 4O4HA 1O4TA 1OA3A 4KQ7A 1EV11 3W21A 5F32A 1Q6UA 3KQ4B 4HN1A 3OMIB 1S55A 1VQ6V 1FXZA 2BJSA 3VZJA 1SA0A 3C3VA 3OD0A 2XXZA 5A3PA 1XE7A 3OY8A 3H7YA 4BXSV 1AHSA 4NJ4A 4JRAA 1JUIA 2R043 5FYCA 2X5IB 3RRDA 3VDDC 3OTFA 1LOEA 1DGWX 4CH3A 3OFNG 3BN6A 1UXZA 1V6JA 2DWRA 1WCQA 1JHNA 1K3IA 2J1VA 4LMFA 4Q4V2 4QU1A 1F4MA 4FLWA 1S0DA 2CAVA 5I0RA 4E8CA 4NN0A 4I0XB 4DR1B 3H3UA 4MGZE 4ZHNA 4O4HB 1S2KA 3H1YA 3CCUV 4CA9A 4BIFA 1SETA 4ICGA 1FMD3 3RZHA 1SA0B 3OY8B 3MLJA 1V6MA 1K34A 2VE1A 3ZN5A 5K4LA 1UZ0A 1YQ8A 5EPAA 3WNLA 1JYWA 1YFWA 1TAEA 4X8AA 3H50A 4FJCC 1PV0A 2JEUA 4FM0A 2QCSB 1VQMV 2Z69A 4EB6A 1QF3A 2QKAA 2UUBO 4K1ZA 3HKBA 1OCCB 4O4IA 3B9IA 1SEFA 2AEZA 5T5LA 2A6WA 2UWCA 4XFFA 3LB9A 4CE8A 1LJ7A 3EHBB 4PF5A 1QH6A 1VBB3 4MXVA 1CR7A 4W50A 2BTOA 1SQVH 5IAXA 1Q56A 5LMUB 2JGDA 2DQ0A 5JXGA 3B09A 2XONA 4QB6A 4H14A 3E5UA 1FI2A 2Y8KA 5CKMA 2ZGPA 4QE9A 4DUYB 4LIVA 2HWE1 4UOJA 1LEDA 3HKBB 4O4IB 3I2HA 1DGSA 3GF6A 4FCAA 5FTTC 4CDXC 4DR6O 1Q82W 2H0VA 1POV3 1KECA 4UF0A 3TN92 2XT9A 3DEMA 2VBBA 1DQ5A 2JGDB 2WZR1 1UKRA 5FY0A 3C3SA 1ULDA 2Y33A 3OGRA 4OVEA 2RE9A 1DBNA 1ODNA 2CU5A 1W39A 4B3NA 1JCHA 3D6EA 4CU8A 2X6BA 4FPLA 2EIDA 4FIPC 3HWJA 4AE2A 4OXSA 4W8JA 1URFA 3TNPB 3DYPA 1BMV2 4JTDB 2QM4A 1QXPA 1V6LA 4YZ1A 4Y4YA 1QLNA 2OX0A 1L0NH 1PMHX 1YFYA 4DXSA 1Z78A 1JYXA 1ZBE3 3N7JA 2YBKA 4UF0B 2CGOA 4OQ8A 2PI5A 3QO5A 3UK9A 1F4NA 3WU2Z 4CTEA 3R4UA 2Q8CA 4TZDA 3EHKA 4JI3O 4WZFA 1BK0A 2GNMA 3AC0A 3CNAA 3W58A 2B1GA 5F5CA 5AC92 3KG2A 4PI2A 1LOAA 2GNTA 1W59A 1AYN1 1DYOA 3JD71 4IEZA 5FYYA 3CWBH 2Y34A 4XFCA 2VO5A 3ENRA 5LCWL 2OKXA 4MS2A 1SS3A 1KP3A 3ZRVA 5F3CA 1EV13 3L9JT 3D3IA 5FO7B 2BU9A 2WN3A 1IOAA 1E79G 1O8SA 2VPVA 2BEOA 3J7AU 4Y24A 4M3CB 5FOBB 1LHVA 4LHSA 3TEXA 5F3IA 4QPJA 2Y4TA 3T2OA 2VBDA 4FPOB 1SBEA 1PVC3 4J7JA 2ZDIC 1AVBA 4IGGA 4R8HA 5DUUA 3N9NA 4O4LA 4DUWA 1VRH3 4LULA 1PMJX 4CH6A 2QTWB 4OX9O 4M0HA 3R05A 1PZ9A 2RS33 2P06A 1PO23 4GMP1 5JVDA 5CAZA 3CCLV 5LHHA 1FV2A 1H9PA 1KDKA 4YIOA 4R52A 2BNNA 2IXIA 1CX1A 3NJYA 2OPKA 3WOGA 5EC2C 2BZDA 4Q1RA 3MLLA 4DK0A 3CJIA 5I8YA 3ETPA 4OZOA 3VDBA 2YIBD 2QGNA 1XDCA 4MOAA 3PJSK 5EIYB 4LNVA 3N2GB 1ZA7A 4DV0B 1ZBA3 2DBNA 1PPJH 4RQEA 2JB8A 1CPYA 3LDRA 4O4LB 4YGBA 1PGL2 3D0JA 2PELA 1DYKA 4JX0A 5C4WA 2IH3C 4K8RB 4CSWA 4U7NA 2Y48A 5FY5A 1Q5OA 5JVDB 1HDJA 1VMHA 3LZZA 4K8XA 1WBLA 4Q8KA 5CA0A 2PLV1 4XQ4A 5K0UC 1JZ7A 1OLQA 3CJIB 2JDZA 2O0OA 3AMNA 4F6RA 4B3RB 2ZT9B 2Q5ZA 3NRUA 5IYCO 3BIWE 4JTNA 3OGVA 5FWEA 1GOGA 3ASIA 1NI8A 4X65B 5FZLA 1W2BU 1FJGB 1OPMA 1CONA 3AL6A 4IUGA 1ND3C 4B29A 4FLVA 4KGGA 3M99B 1UX6A 4F3JA 1R6NA 5C4WB 2RMU1 3OEEG 1UOFA 2BTVC 2I74A 1L7LA 4U3JA 1JMKC 2W2IA 2WLHA 3S7IA 1NLRA 1US6A 1W8ZA 1ZX5A 1WMDA 2PHLA 1CAWA 5CA0B 1AVMA 5A33A 3KB5A 4PDMA 5SV8A 4OHWA 4D7SA 3AYEA 3ES1A 1HLCA 4C90A 4XDJA 4FOQA 5GTHZ 4I02A 1O9HA 1RUI1 3AYAA 3LEIA 3HPNA 3FL7A 4LHLA 3V0BA 1J1TA 1RUC3 1VF7A 4DZGA 3KT7A 3ZXEA 1YIFA 3WF3A 3M3EA 2WT0A 4R9DA 2ZGKA 2YHJA 4RYDA 2CAZC 4GCZA 1V55C 1D4M3 5HV0A 2ZINA 2I45A 4U3JB 2VBPA 2ZGQA 1CQ9A 2FQPA 3RWKX 1FFTB 2QQPA 2AHYA 1QHDA 4CDWC 3AL5A 3L9DA 5A33B 3CRMA 1N8RW 1DCSA 3MHHC 4EFBA 3OBZA 4AHCA 3URFA 1Z7S2 5DAWA 1O9GA 1K5JA 1BQZA 3DV8A 3W7WA 5BXZA 2VCAA 5GW7A 1ONAA 3VQVA 4NHYA 3V0BB 5FO9B 3ZMTA 3QCWA 4P02B 4LHKA 5F2WA 3UJOA 3JD73 2WO3A 4N7IA 1W2TA 4YM0A 5FK7A 4LORA 1V9U2 2CTWA 2HWF2 4QX3A 2L9LA 2PZSA 4JF3A 3KT1A 5JI9A 5A7OA 4Z2AA 2ZZQA 4J6GA 3WDUA 3VGIA 3SPCA 3CU7A 1HNZO 4X1KB 3JD3A 3N9PA 2K0GA 3GWOA 3CDZB 2CHHA 3ZCCA 1YLLA 2Y26A 1S3JA 4JV5B 2IJKA 1NZIA 1VAKA 3IFXA 2A6VA 2OZJA 1EBOA 2Q8DA 5FZ3A 1HRI1 4HAMA 4ISRA 5GALA 1NLSA 4LKFA 4Q4W1 5H6QA 5C8CA 5J3UA 2O8QA 1C8NA 2PHXA 1J95A 1WMEA 1Q8PA 2WFF2 1MQTC 4IERA 4KG0A 3MW4A 2E33A 4LFBO 4UBHA 4HZ3A 1RM1B 1E5RA 4ONUA 5CBHA 4AHWA 3MW3A 1CGPA 5FZ0A 4N7UA 5HCFA 1DGRA 4V1PA 4Y1XA 3AP4A 4ZONA 4Q4Y2 4EN0A 5FBJA 3AZVA 3CRQA 1V54C 1NTMH 3BCCH 1FD9A 2DN9A 1SQFA 4PQ9A 2QJ1A 3D3QA 5C8CB 1HNXB 1QH7A 4ZKIA 5KHIA 2Q7EA 2ODMA 2VZ1A 3JCIA 3ZN1A 3VD5A 1JH5A 2OCCC 5IY5B 1MS0A 3OEAA 5H9SA 4PA3A 3H0OA 4Y20A 2WA4A 2PAMA 5L7OC 2PLV3 5LGTA 3RQ0A 5JMOA 1NZCA 1LHUA 1U12A 4AW7A 4P2ZA 3WEZA 4LFAO 1WP7A 3WB0A 2AYHA 2YIBA 4YVSA 2ZMKA 2R9IA 5FXWA 2JDAA 2DVBA 4ABMA 4GWNA 2VTFA 3AZYA 3WINE 4HMZA 4QD2A 4MVOA 4CEWC 2VQFO 1IBMB 1UPGA 1JZ3A 3ZMZA 2X09A 5JH7A 2OS2A 2RMU3 5IWFA 1NT2B 1ZZCA 3M3CA 4UFMA 4QM9A 2BNOA 4LBQD 2IH1C 5B1NA 2CTPA 4P14A 5B1OA 2GC2A 3CS5A 4Q4X3 2A3YA 3NKGA 2ZEWA 4XBNA 1L0LH 1A34A 4LO7A 2AACA 2Q4PA 2GNBA 3VBUA 3O1MA 4YVSB 2JG9C 5CNAA 3FWEA 5BMVA 1QJY3 1NCQA 3AVSA 1EY2A 2DVFA 2VVFA 3K58A 2JDMA 3TB0A 4QPWA 4GAZA 5JH7B 2HWC2 4WVMA 1FPN1 4Q0QA 4JZRA 3GJAA 4DINB 3CMGA 2Q7HA 4FPKA 4BW5A 3WF1A 2FDKA 3K75B 2WS91 4YFWA 2ADPA 1QY4A 1FXKA 2VC9A 1GV9A 4WF9V 2X0LA 2JE7A 2R062 3FB7C 4J1XA 1PKXA 3MBWA 2RV9A 3RYRA 5BMVB 1NCQB 2Y69B 1KBHA 4KU7A 1AR71 2XQRA 5FZBA 2ARBA 4FT8A 3ZOIA 5KAIZ 4WVMB 2OVUA 3USUA 4LR4A 1IXBA 1L7QA 2XKOA 1SG3A 4LLFA 2ZS6B 3ZSMA 4LLOA 1FXKB 3OR7C 3B69A 1CIWA 3QF7A 1X9TA 1IPKA 3I2OA 1DGLA 1FXHA 1DLBA 3ZHTA 4PA7A 4HETA 4FLZA 4YM2A 3JSNA 2BP6A 4RS5A 5L3EA 1N1VA 3PL0A 2UY8A 2E7QA 1IGOA 2P4EA 2RDSA 4KU8A 1UYPA 3USUB 2VMCA 1WD3A 3HBZA 3RYCA 2LW1A 4Q4W3 4MGTA 2YXSA 2QUOA 3VHRA 3V56A 1R081 4EQVA 2XWJB 3VBRC 3ZJZA 5JR7B 1DLLA 5FJHA 1ZZ6A 3EMRA 4CVUA 3ASOB 4E9KA 3CJHB 4AZZA 4NPLA 1UOGA 4DV3O 4PBOA 1VB2A 2KKWA 2EXHA 5B5EZ 2LROA 4GMP0 4RS5B 5C3SA 2XTAA 5FY1A 1OXCA 1O91A 1IVSA 2UXDO 5JXHA 2GDFA 3KV5A 4XF1A 5GLTA 4FXKB 1YFXA 4RHV1 3IPVA 3RYCB 2PMWB 2GH2A 1ZUQA 3ZM8A 4YGCA 1BL8A 5HXVA 3HJRA 3WXPA 5FIXA 1VMFA 3VD4A 1VBA1 3O1RA 4R4ZA 3RVZA 3RDIA 1SACA 4KBBA 1KQRA 2BNMA 2ZCWA 2WNVC 1H6XA 4Z8BA 3VL8A 5FKBA 4R9AA 4I0AA 1HW5A 1UZWA 1XILA 2LGWA 1IS6A 4LE3A 4ES8A 2VZ3A 1EP0A 1YC61 2R7EB 2YC2A 5EHDA 1CIYA 5EYYA 2ITCC 4CUBA 4FOYA 2OQ7A 1ULFA 3OT7A 3P30A 1GRJA 3K57A 1QJZA 2ZMNA 3RMXA 3IPVB 3CXHF 2X05A 4NB5A 4JI6O 1QJU2 4HKOA 1NKDA 2BW8A 4Q1PA 4DXWA 4GUNA 4DY5A 5LA2A 3RVYA 4PIXA 1N3OA 4LWSB 3A21A 3GCWA 4JKLA 1NE6A 4IV1A 5LP6C 1VQPV 4KP4A 4UCUA 3J81N 2M6YA 2HJDA 3HT1A 1SZXA 1D0GA 1REFA 1JJ2U 2GH8A 1XSRA 3WFVA 1ND2A 1FPN3 4N9IA 4HKWA 5JAXA 1OPOA 2F23A 3AMPA 3BU0A 3S0MA 5ISLA 1AJNA 2FCTA 2HWD1 3I49A 1DGWA 2DMXA 1N34B 2IFRA 1PK6C 4OI2A 3KHBA 5JOXA 1B04A 3VB9A 3CYOA 3NSTA 4CS2A 2RS12 4H7MA 3IAQA 4IV1B 5KXBA 1QLEB 4PLNA 5CA3A 3T1MA 5BNOB 2QQWA 1W06A 4X64B 3WDYA 3RT3C 3ZXAC 4DXZA 4Z07A 5DN2A 2HHHO 1XEQA 3MIDA 2QA4V 2GU9A 2VZUA 1ND2B 4UCRA 3POYA 4R6ZA 3CCSV 1MOFA 3VLBB 4Z92B 2RM21 3AYDA 3WG1A 1GOFA 4YW5A 4OYUA 3JASA 1AJOA 1S0FA 2ATFA 1ZRIA 4JCKA 5IVJA 4DQAA 1HXS1 4JKMA 3WHUA 2HWB2 4IW3A 2AZ0A 4I0BA 2QEXV 3PU3A 4ES9A 2C24A 2VOVA 4AEKA 1OD3A 2VUCA 4F8AA 3B7MA 2OIIA 5FXVA 3Q9OA 1H8TC 1NX9A 2Q69A 2R042 3VDDA 2JG8A 1YYNA 3MIEA 2W6IG 1ST8A 5JIAA 3ZSLA 1N33O 3BI3A 1URXA 5GTIZ 2WR9A 3AKRA 3NKTA 3IIAA 2PHTA 5DUXA 1AL21 3LEGA 1R083 3DC5A 1TUEB 2YY1A 1FMD2 3U37A 5APAA 3M7AA 3NW4A 5DAPA 2JD4A 1U5XA 4O4JA 1REEA 3VDDB 5F6LB 4QU2A 3S6PA 1NQDA 3H1JH 4W4LA 1F31A 1ZA4A 2Q1MA 2HLEA 4GKKB 3K9SA 4AVCA 5A32A 1RUG2 4IETA 2LFSA 2WLLA 1WA8A 1VBA3 2VTXJ 5KMGA 2YXYA 1VBB2 3MUZ1 4QQPA 1H30A 2WRAA 3CE2A 1RP3B 1HW7A 2DYSC 4O4JB 3S3WA 5KUKA 1OHFA 4XTPA 3MDSA 5JOYA 3POEA 2L35A 2WO1A 3OGCC 4IE0A 5KC6A 4DY3A 4XEZA 4GH4A 5T5PA 1CZSA 2ZGOA 2BDRA 1M56C 2ZIMA 2EXJA 1AJKA 1O8PA 3N7MA 4CXXA 1RUNA 2K2SA 3O12A 2QQIA 2WLLB 1WA8B 5FPUA 2J22A 4XBLA 5KMGB 1CJPA 3C7OA 2VQ0A 1CD3G 4FZ1A 4UFIA 4GIQA 3BPZA 1SHWB 4OPHA 4RSUA 4YLZA 4LBKA 5LBQA 4BISA 3L2HA 1QNYA 4Z1MG 1OUSA 1S0JA 1W3VA 5L3GA 4C1WA 2WAMA 1UOBA 2GBOA 2JDNA 3T4VA 1IPSA 3SH3A 1H2KA 4LF7B 1R3KC 4IEXA 5FYHA 1P7BA 1IXMA 5E79Z 4WFAV 5CFCC 5JI7A 1R73A 5LMNB 4CDXB 1HB3A 3DECA 4COWA 4Q4V1 2I2SA 4JI1B 4HK8A 2XLAA 1KUQA 1ZBE2 5FKCA 4OUMA 2XL7A 2HWD3 1GOHA 3AZXA 2XHKA 4FI9A 3VL9A 3U0ZA 4NWWA 4ATFA 1RUOA 3IAYA 3FYIB 3O1UA 1XMOO 3E22B 4PELA 3ATGA 2ZHKA 4MGIE 3CCVV 4CH4A 2B8MA 5FZGA 4DPNA 4ZU5A 2Y6HA 3CL1A 4PT6A 2A9HA 2BBVA 3MHSC 1VARA 5EBWC 3VQXA 1NQTA 2XJTA 4FTBA 4CCMA 3HKEA 1GZCA 4AFBA 2BOIA 1SLAA 2LQTA 3O9OA 3ZXLA 4IESA 5H9RA 2PXJA 1XQ8A 2RM23 5HCBA 1UY3A 4OI4A 4JGYC 5FZ8A 2JE9A 4OUEA 2CDYA 5LOVA 1OJHA 4C91A 2Q4SA 2B1IA 4DR2O 2JECA 1XNQB 3LA7A 3G4SV 3WW3A 3T09A 3ABZA 1PVC2 2VW0A 5J1XA 1V00A 1G8WA 3ZDSA 4UT5A 2ZDIA 1JOJA 1ZX3A 5EK0A 2CUGA 1W6OA 4M00A 3HKEB 2WQZC 4LR3A 3WF4A 1VRH2 4I9QA 3ZMVA 5FPXA 2RS32 1PO22 2R72A 2JDPA 1O4YA 2BTQA 1QR8A 1H9WA 3WB1A 1EAH2 4UXNA 1W03A 5LOVB 1DU3D 3B8NA 4J11A 2W95A 3TN91 3NNLA 4E2LA 5K1XA 2MNGA 3T1LA 5C33A 2V4DA 2WO2A 3O65A 5FYSA 2R073 1XBFA 1ZBA2 3F2ZA 1W6OB 2G1MA 1Z2GA 2LO1A 5LK5A 4WCEV 4TYSA 3ZIXA 3PU8A 3VOUA 3NNJA 4TN7A 3S57A 4B08A 2VUJA 3LDCA 3AM2A 1GQPA 2QQMA 3I3EA 4XFHA 1Z0HA 1BMV1 2BTQB 4BDVB 1ULPA 4B3TO 2WSVA 4LKDA 1JYNA 2YPJA 4P9LA 4HN0A 4DXRA 1W9YA 3VHPA 1YI9A 4LF5O 4GX2A 1VBD3 5FY9A 2XB6C 3WF2A 1G1XB 1BVVA 4NIIA 1H38A 1UKGA 5I0UA 2VVEA 4RD7A 4UW3A 1WAZA 3OEHG 3MV01 4M4PA 4M0NA 4ZU7A 2GTAA 3AFGA 3H8RA 1GNHA 3O7OA 1YHFA 2JDHA 1ND3A 1SQ4A 4CS3A 1XNCA 1XXNA 3WG7C 2C9AA 2V72A 3M8LA 3CP1A 4XQWA 5AC91 2O57A 1DFQA 2Q1FA 3DSQA 1MZEA 3VD7A 3MI8A 3FLTA 4BQ1A 1QJFA 4FTSA 2X7RB 5FPZA 5EC1C 2JIGA 1TUBB 3DGTA 5A3TA 2BFUL 5KC5A 3CCRV 1LUWA 3HNYM 4QHZA 2XUEA 3ZBHA 3LSSA 1RUF2 3C8XA 2FDIA 5F3EA 3J7MA 3APOA 1RUC2 3MFCA 1H4HA 1VIWB 1ND3B 1UZYA 1PZ8A 4IL7A 5T5JA 2JXAA 3ZKYA 5FZDA 4YRDA 2ZEZA 1D4M2 2F4VB 5HBAA 2WT2A 3JATA 3RMYA 2AUYA 4BU2A 3KMHA 5KX5A 3ZFEC 2R49A 3I3DA 4SBVA 1YJNV 4CDWA 4Q4V3 2HKOA 1JHJA 1BMFG 2DVAA 3IB3A 2GMEA 5BR8B 2D6KA 4LF9O 3PLQA 4LFCB 3IKWA 2BV4A 3ZPYA 3UNPA 4QB2A 2XL9A 2B5UA 2UUAB 2VZOA 3AZZA 3VBOC 5EV7A 4WM8C 1UOJA 1DF0A 4OLLA 4QKFA 3QACA 5IK7A 4AEDC 3OUJA 3AKSA 4FM1A 1U96A 2ET1A 5IVYA 1V55B 3INAA 1IG0A 3JD72 4XFAA 3JATB 1YF2A 5KX5B 2WBKA 4DUXA 4CUCA 1PGL1 2VQTA 4CDWB 2ZABA 3A0RA 2AXTZ 2ETNA 1K45A 2P6HA 4WM7C 4UCTA 5FAXA 2QJVA 2VNGA 3KM5A 3LUTB 3RG0A 4WBNA 4ZZ8A 1XL6A 5JJEB 2LRPA 4RN5A 3J8F3 4K6BA 1K42A 4CS4A 2ORZA 1S0EA 4NMIA 5H6RA 4IEOA 1YRZA 4COVA 2JJ2G 1VQNV 2L6LA 2XR4A 3ZX7A 3HIFA 1NBMG 1GH6A 1H1MA 5AG2A 4FPJA 4AXOA 4MADA 4P9PA 4WFHA 4ZOLA 2RS53 3ME2A 3GHNA 1YJKA 2P7TC 2DU0A 3F7VC 1WN7A 5FZAA 5FZMA 1MQTA 3ZYFA 5BY1A 3OYWA 3T3YA 4WBNB 1BLZA 1LODA 2KB1A 3GCXA 5E8AA 3KGLA 5FZ6A 1FS0G 5JOZA 4UFKA 2YC4A 1SC5B 2CWSA 4CC5A 3VKOA 5GZCA 2E51A 2A70A 3ZN0A 2G9GA 2RNBA 2Y0IA 3CC7V 1OVSA 4NPMA 5FQ0A 3FFQA 3JD4A 1QXRA 1C3HA 3SMHA 3KT4A 4N21A 5BNNC 1H2GA 2OPWA 4PF1A 1R6TA 4NOTA 3B8MA 2PYLA 1Y4MA 1MQTB 3OYWB 1Y6XA 2WFPA 2NMOA 1RSOA 5L7OA 4QXHA 1GU3A 4J9ZB 1OLME 1NQJA 3DC6A 1NTZH 4IXLA 2VL4A 3AG4C 4D94A 3QG5A 2XUMA 1Z7S1 3A0NA 3RYKA 4ZPIA 4AHZA 1H2NA 4I3GA 1VP6A 1V54B 1A3KA 4QGPA 4IGQA 2D6LX 3G67A 4FLTA 1G8MA 5FQ0B 1ENRA 4DR5O 4ASMB 5EFUA 1QJEA 4X6QB 3M4FA 5AC93 4X88A 5H5NA 2Y6KA 2RMU2 1M4UA 4MW3A 1ZSPA 3SCHA 2OCCB 1W0PA 1VRBA 4JI5B 2NP0A 1RSOB 5L7OB 2A6XA 3CD6V 1V9U1 4Q4X2 5BUVA 2HWF1 4C8DA 5DDJ3 4AFDA 1HR0B 4G9SB 2G9FA 4KGQA 4GB33 2ZX4A 2EXIA 2HEYF 2JG9A 1ZRCA 1UNBA 1QJY2 5BNQA 4CEWB 1LU1A 3ZMNA 2PHUA 2ZM6B 4I0WB 1COV3 1O59A 1Q6IA 1AJQA 3GM8A 4JDOA 5KA6A 4KI5M 1MEC3 4FP2A 3QH6A 3WP3A 4TXWA 4PV1B 3G6BA 3UCSC 3BKZA 4EZHA 5JWPA 4A7ZA 2IWGB 3D8CA 1LESA 2JDIG 5GKAC 1LRHA 2WFF1 4HKLA 1VQKV 2IVIB 2DU1A 4QHOA 3UGHA 2NNUA 4NVPA 4B3MB 2JG9B 4FFHA 2ZXWC 4XVHA 5FPOA 5A6XA 1F8VA 5DECA 2A3WA 4FLYA 1TME3 4Z2WA 1Y9MA 1NUKA 1W6MA 2E3CA 4Q4Y1 1S2EA 1VQ7V 4IGOA 4O9GA 4DV2O 3EO6A 4IYHA 4D3WA 1FNYA 5BY5A 1HKDA 3CKHA 3FZ3A 3VBHC 3SJBC 2WYSA 3FKSG 1OLRA 1HRV3 1YIJV 2ZPXA 4UI9L 4N23A 2W46A 3K51A 1FKAO 2ZD9A 3SCGA 5E88A 3DF0A 4DV4O 3KCXA 3GZTB 4XJUA 1Q8VA 2PF4E 4P9OA 2VQEO 3ELNA 3FN9A 5FUNA 4XF4A 1EZJA 1HN1A 5H2FZ 1J5EO 4K1YA 4NXMB 4UVCA 1GN6A 1MVEA 2P22C 4IEVA 5DZEA 1UU6A 4CRQA 4OPAA 3JAWB 2W92A 4D69A 1F5JA 3O1VA 2QKDA 3NQHA 5D21A 3STZC 2AGSA 1HQWA 3I2GA 4AQYB 2K46A 3VBRA 4YGDA 4MTOA 2A5ZA 4LC1A 1AR62 5FMOS 3ZPOA 3K4DA 1IX9A 2A3QA 3LCPA 2ZMLA 4LPLA 2WZPP 2OTLV 3ZN6A 4E4DX 2W5FA 4UFZA 2W1QA 2BWCA 3BVOA 1KDMA 1LU2A 4Q5OA 1L3JA 5FYVA 2C5DA 2P5OA 2XMLA 4AI0A 1RUE2 3B94A 4UCVA 2B42B 5F2SA 2VD7A 3JQWA 4L11A 1QIQA 3LDDA 2HWC1 1YXWA 1DZQA 4J25A 3B5LB 5AVAA 3VBRB 2WNVA 2WNEA 1W28A 1GK9A 1NS1A 1W2OA 4FPCA 2VZQA 3I2JA 3ZHUA 1FFXA 1R3JC 4YJ2B 3ZFGC 2QKCA 3ETGA 3H42B 1H1AA 3ZN6B 3MF9A 1O3SA 1SFPA 2X6CA 4FLUA 2R061 1S5LZ 3C7GA 2ZJCA 2W47A 1P7GA 1K5MC 3LAGA 1GQHA 2P3KA 1JUHA 1XYNA 4G4FA 2ZGTA 2OCHA 4P5YA 4J7ZA 1GMMA 4HG6B 2ET7A 3OOXA 4PJYA 2A79B 3BVCA 4Q26A 2WNVB 3R66A 1S76D 4AF9A 2XAGA 2DURA 3R4DB 4JDNA 3ICXA 4A2UA 4HSJA 4DR1O 3VQWA 3WNOA 4I30A 3LA3A 4DUVA 3C7HA 5DAQA 4L97A 2WWWA 3OUHA 1XOYA 2V5DA 1S5JA 1VBC3 2OYQA 4QAWA 4H0LB 5IDJA 5HV4A 1ZAUA 2ZX2A 3DCQA 2VGDA 2YU1A 3RZMA 5LGUA 1W9FA 2ZR2A 3L70H 4ZI7A 3M2MA 5IT9N 1W0NA 5IVCA 1CXZB 1GKFA 1QJX3 2Z3YA 3A0HZ 4X66B 1RUJ3 3MPPG 3UT5A 4E4ZA 3VD9A 2CH7A 4CP0A 4QDQA 2BGCA 2SLIA 4XHBA 3RZKA 2YIAA 2F6BA 1PK6A 3N9OA 5EJ3A 3H9VA 1OCRC 5DN6G 2A75A 1YSCA 4I3PA 2B9VA 3HQUA 5FCCA 5LK7B 4YVWC 5JXIA 2W1WA 2F95B 4JASA 1V9PA 1YIPA 3FB5C 1JODA 2HBUA 1J59A 4DRVA 2QQUA 3VN4A 2RDNA 4Y3OA 4YG3A 3BY6A 2FCVA 5LMUO 4QQHA 4ZI7B 1JA8A 1C5HA 2D5FA 4UVAA 3UT5B 1OQEA 1IBLB 4HANA 5FRAA 4DUYO 1CVNA 1N32B 3H8OA 1PK6B 2YS8A 2PUSA 5FLXN 4XDKA 1B06A 5B1AC 3HD8B 4Y33A 1H8TA 1GYKA 4QPIA 5LASA 5M0TA 1R3LC 4UAPA 4UW4A 4XHXA 5F8PA 2P6CA 4XXPA 3RJ2X 1RUH1 1IPJA 4AL9A 5JLVA 3VV1A 3LOIA 2QSAA 3I59B 2CY6A 1NY72 5A80A 1KJLA 3KV6A 2ZQMA 1KEXA 4ASKA 4V2VA 3UYJA 2XVLA 1XJAA 1QJU1 3RGBA 4GX0A 3DN7A 4LF4B 4PDLA 2D3PA 4XUTA 5IFPA 1H8TB 5LY2A 5LBCA 3ST7A 3AKQA 1YQ2A 1F51A 3MHZA 5EP9A 4FO9A 4ARYA 1MS8A 2AEYA 3ZMUA 1TQ5A 3FB8C 3M70A 4A41A 3MPBA 4BPZA 4BK5A 2FZ2A 4LUKA 3NJZA 4ASUG 3TXSA 3DXTA 3I7DA 4X1IA 2W0XA 3V65A 5CZKA 1GP6A 3AG1C 1MSDA 1D2QA 1NZ6A 3L71H 1UPIA 4D0QA 5CVRA 4K8ZA 2E75B 5DMYA 1HNWB 1MS1A 1BYHA 4X20A 3HPLC 3VKMA 1A32A 1GNYA 4WVWA 1FT9A 4LF8B 2RS11 2A7AA 4XC9A 2VRZA 5JZGC 4DK1A 3ACGA 1BJQA 1RC6A 2VZSA 2Z0AA 1AP6A 4X1IB 5C9AC 3PVNA 4JI7B 3LSQA 3ACLA 2VOWA 1W9TA 1BZWA 4NTYA 2HG5C 1CZTA 4AK3A 1A8DA 4NTXA 1YNAA 4MVRA 1I94B 2DYSB 3STLC 1VP7A 3EYPA 4UBGA 5KR7A 4X20B 2HWB1 4JGZA 1JXNA 5IVEA 1WA4A 4XILA 4RGKA 1V6NA 3BAAA 3N36A 3PUIA 1BSMA 4Y5Z0 3NV3A 1PVXA 3JBG3 3OF1A 3E6BA 2R041 2ZCEA 2J42A 1XC6A 1M56B 4YW2A 2XJPA 1GLHA 5FV3A 2V4VA 1UY2A 5DXDA 4ET7A 5CFCA 1JBCA 3QO7A 2VMFA 4DV0O 1N1SA 3ZYIB 2ZEXA 4RA0A 1WPXA 1J84A 1V6IA 2UUCB 4BAYA 1TZOA 3ZKUA 2YU2A 3CCQV 2NM1A 4JGZB 5I0DA 1GSLA 4UWDA 1FMD1 2WLMA 4QX1A 1LKNA 1VBE2 1GM9A 3K9AA 2TEPA 4ZS3A 1RXFA 2PQQA 4YZ4A 4L92A 4B3RO 5K9YA 1SQBH 4MO3M 1LOFC 5CFCB 3N27A 1DGRN 1H8EG 4X65O 4HZFA 1FJGO 2GMMA 2BGOA 3NR7A 1RUG1 1QQCA 4JGYA 2GAUA 2EJ7A 2Y64A 3PMEA 5CFDC 2PHRA 3RI9A 1WKYA 1UCXA 5IFTA 5JPMB 4AQ2A 5BZBA 4KWJA 4Q0SA 1JQ0A 1RUH3 4YNIA 2ZGUA 3FHIB 5F5IA 3A0KA 1XNTA 3VD3A 4GZ9A 3I5DA 3BUCA 4PLMA 4MG2A 2KD7A 4BQXA 2Z42A 1Y74A 2F66C 1XQNA 1S4CA 4JGYB 3MIFA 3WNNA 4Y1YA 1QVFU 1U5YA 1POV1 2B46X 4CDQC 2LUWA 2UXCB 4WFFA 3X2QB 4IV3C 4B7KA 4HVQA 1ORQC 3K77A 3H3LA 2R072 2XAHA 3UQ8A 4LQRA 1AROP 2YUAA 1J58A 2ZACA 1E1RG 4WFGA 2EVXA 2YGMA 4A6SA 3UV9A 3ZRSA 4MSWC 2D6OX 3RSJA 1Y74B 4LJHA 3RI8A 3LKJA 4Y1ZA 2QQLA 2VMIA 1GKBA 2Q73A 1ENQA 1VBD2 1ZBE1 3LPFA 3EXUA 1Y67A 2IJJA 4JI2B 3I3MA 5DZFA 3ZIAG 1KMIZ 1WLDA 3JSLA 3KZ4C 5I91A 5JMCA 4QHBA 2EINC 2GN7A 4KWKA 5CBLA 5IYZA 1DDLA 1V6OA 2IJHA 1XYPA 1TG7A 4GJYA 4CPBD 2QQVA 2P90A 2D3OW 5KXDA 4JV5O 2BQPA 2GC3A 1X7NA 4AOCA 3AB0A 3E89A 2XGXA 1GWMA 4E2QA 5KWRA 3TYJA 4JI4B 4MVTA 2HWB3 3VKNA 5IATA 1O3TA 4CXWA 1K4DC 1ROPA 2EJRA 2WA3A 4BHPA 2RJLA 3UO3A 3WG7B 5IYZB 1OCZC 1PVC1 5J2TA 4KFMA 1S5HC 3SYCA 3B93A 3ZFEA 2LALA 3K08A 1EUUA 2R16A 1VRH1 3ZYGA 1I5PA 2HLDG 2RS31 3SITA 1PO21 4DV7B 1NH2D 1CPNA 1FOD3 2QR4A 1S72V 1HNXO 2R32A 1EAH1 1F4AA 4FM2A 1T5EA 5LY1A 3VBOA 3ZR6A 1XE8A 4TSVA 3JD0A 4NR1A 5LXTA 2WWSA 5A1FA 5AFBA 4AEDA 2WQ4A 5FYTA 4ATEA 2EIEA 3T1YB 4R4XA 4QDRA 5J2TB 1SPPA 1W2UA 2LW8A 2Q5TA 1ZBA1 2FZ1A 4H13B 1M57C 3ZFEB 2YSUB 5G04L 2XJQA 4I01A 3G71V 4E2SA 2SBAA 1IBMO 1RUG3 1SLIA 2EZPA 2OTJV 2JKBA 2GSYA 4KHPB 3LDBA 3JYCA 4MVUA 1NKGA 3E1F1 4XF9A 3UKVA 3VBOB 3J8F2 2HVJC 1N36B 4WM8B 4CXYA 2LTNA 1NTKH 4AGVA 4DW1A 5LXTB 1YJLA 4AEDB 2EIMC 5E1RA 1AX2A 2Q0AA 1UWWA 4L2NA 1SPPB 1F35A 1OH3A 1OI6A 1VJ2A 1G9FA 4QX2A 2D44A 3M8AA 1EN4A 3GWKC 4S2GA 4HOOA 3DTUB 2JDYA 2RS52 1M5IA 4LEJA 4Y5TA 2VW1A 3N7KA 2PA7A 1W99A 5JSOA 1Q8IA 1YXBA 1BHGA 2ZE6A 1X4TA 3W7XA 3ZXFA 4RQFA 2G38A 5CADA 1CPMA 3AP9A 2VWJA 1AR83 3O0WA 3Q8BA 4UW6A 1GO3F 4AAPA 2ERFA 4O9EA 3AJZA 3UM7A 1RUF1 1WP8A 4Q2FA 2N04A 4F7ZA 5A7QA 1OC1A 1RUC1 4R9CA 3SH4A 1KITA 2RN9A 1OQ1A 2WNUC 2Y60A 1MA1A 5BNNA 4IE7A 3RW0A 1D4M1 2JENA 3OMAB 5CG9A 1JPXA 2D6NA 4GKJB 3ZFFC 4E4EA 5F5QA 5F1RA 2JVDA 2E26A 4LBMA 3BABA 1G7YA 3N4MA 4NTWA 1CESA 4LF6B 2VW2A 3KWVA 2WPDG 4JZGA 5KXCA 3O0VA 4M3CA 1G9BA 3JB8A 4QDSA 1WW5A 2YPDA 3RYFA 1OA2A 3AKTA 1YWKA 4YY3B 5BNNB 1WGPA 1K3EA 5JCOC 3VBBA 3GB7C 3L2YA 4AHXA 1RGSA 3H1KH 3C7EA 4BQWA 4Q20A 4DV1B 1UZVA 3THTA 4HSLA 4AG4A 2QQJA 2VMEA 4W6XA 4WFEA 2D5HA 3MAQA 5DDJ2 2QWOB 2PGGA 1R64A 4PQQA 3WDTA 4LIUA 4GB32 4B4QA 3WNXA 4I55A 1W6PA 4DNYA 3P1IA 1ZZ9A 2C1FA 3C90A 3RYFB 2JJ1G 2AR6A 1OURA 2D3SA 1COV2 3B02A 3N2GA 5CA1A 2BOBC 5FNVA 4LCUC 1NOVA 1MEC2 2A06H 3E8BA 3E2EA 5H9QA 2ZXQA 2KR2A 3AYCA 4LH7A 1QXJA 3WDWA 5B66Z 4GD4A 4TSFG 3JAMN 2RJKA 1TMF3 1PX4A 1EAH3 1IQDC 5H9PA 2HEPA 2R0FA 1XBLA 3GHMA 4IEWA 4I55B 4TLGA 1W6PB 4PDRA 4HYOA 1TME2 1WW7A 2J1AA 3V0AA 5CA1B 1V6KA 1DTOA 5FNVB 2YUEA 3WP6A 4IE6A 1G4YB 2Y4UA 3CRAA 2GZWA 1EPWA 4TWTA 1MR5A 4YJ3A 5IJ9A 3POGA 1DF4A 1HWYA 1SQPH 1NA1C 4R8CA 3E97A 1FYJA 3I4IA 1DQ6A 2EBOA 2YDEA 3ILFA 3O14A 1HRV2 1OT5A 3AZWA 1LUVA 2ZA9A 4EFEA 1AYM3 4Q27A 4MGSA 1DQ2A 3SR2C 2RJZA 1Z5VA 5FZ1A 1W2NA 1TVKA 4A3XA 2JX9A 1ULEA 4AQ6A 4JZ2A 4FAGA 2ZXWB 3VZLA 4LA3A 2WLQA 2LFRA 3E5QA 3ZX6A 1T6GC 2E7TA 3AK1A 2DTWA 3GYDA 2J1RA 2DTYA 4URTA 3E6DA 4YW3A 4ZS2A 3V0AB 4HPKA 4AGGA 1US3A 4N90A 2H8PC 1FATA 4YJ3B 5IJ9B 4JV4A 3BODA 3VBHB 3JALA 4XACA 1KP2A 1K9MW 3O1TA 3KVAA 4X9QA 5DM6V 2KQXA 5SV5A 3CX5F 3A2FA 2CTVA 3LF7A 1MS9A 1PP9H 2HJIA 3BPSA 5EYPB 3KGZA 3IDCB 1NH2B 1TVKB 5DQ0A 1QKQA 1RUD3 1WPBA 4Q4X1 3MEPA 1JMUB 1GM8A 4KBZA 4XCBA 2RQ6A 4CU9A 1N34O 1J3QA 4V2WA 1RUF3 3HB3B 1UQXA 4HPKB 5A3LA 1QJY1 3I8TA 4QPGA 2BOJA 5LA1A 1POV0 4DR4B 3JALB 4DUZB 1OOPA 4XFBA 1XREA 4X64O 1JS9A 5FZEA 2IU3A 1OLMA 5F2VO 2LGQA 4WVVA 3SPHA 4OGQB 4XUPA 1QNWA 2CWMA 3ETEA 4XQDA 3ZFGA 5GZDA 1AX1A 3D3AA 3HNBM 1X8MA 4S2FA 5B3SB 4DMIA 2CDPA 2ZGNA 2DYRC 1NR7A 4AVBA 2ZGMA 4HNAA 5JVVA 4OUSA 2P3IA 1Q8QA 4X1KA 3ZS8C 3WCSA 1WMFA 4QPGB 3ILRA 5FMOL 3JCZA 1AX0A 1QDOA 1W3XA 1OOPB 4CZSA 4PA6A 3ABUA 4L99A 3GNEA 4INDA 2VY0A 4LKEA 3G6JB 5IYYA 3MLKA 5BNPC 3E5XA 5F7UA 1AR1B 3ZFGB 3AMQA 1GBGA 4W4ZA 1L8DA 5T55A 1WWYA 4BZ4A 4O2AB 5CBFA 4HNAB 5J96B 1VBC2 1K5MB 3LNNA 4PJ0Z 2AENA 4MGKE 1GN4A 2FMYA 5LB6A 5JUVA 4MVSA 1QEXA 2XKPA 2O8OA 1QJX2 1ZLZA 2IXJA 1RUJ2 2KA3A 3K2OA 1M4WA 3MIHA 1YFUA 4FFFA 1F15A 4KL1A 5L19A 2ZR3A 3VUOA 3GBFA 1BCCH 2ZNJA 2N74A 4GKKO 5FP8A 2XAFA 3L73H 2XBO3 5FY8A 1IBKB 1AR61 1W8TA 4FPFA 1QBZA 3OBRA 4YVWA 4YZ2A 1APNA 4KUMA 4JI0B 2QNKA 3B77A 2EIBA 4FPPA 2UWBA 3D36C 1CJDA 2X10A 4YZ5A 2VXRA 1RUE1 3P3PA 1VEWA 2QZ3A 2C4XA 5AFEA 3MIBA 2E76B 1OCRB 2J1EA 2RDCA 4LXLA 4FFGA 3AXDA 2BRTA 1VB4A 2P5BA 4EV0A 1SQQH 1HB4A 3W59A 4YVWB 4H55A 5FDBA 2Q68A 1YQCA 2WLKA 3KQRA 1XL4A 1DIWA 4LBOA 4X1YA 5A2QN 4XCAA 3VBUC 4CCJA 5LA6A 5GLVA 3K0DA 1Q6HA 4H3WA 3HMYA 2NLJC 2QE7G 2QQNA 4D6RA 5IWAB 2WKKA 2VECA 1CX4A 3WDXA 2DV9A 3KV4A 4Y1UA 2MW2B 2J7MA 2GC0A 2ES3A 1UMIA 4QE7A 3KHCA 4LF7O 2ZX0A 4A7YA 3JAKA 3RPQA 3BTYA 3AG3C 1IS5A 5T50A 3PURA 5B1AB 3PDQA 3H01A 1PO12 2JE8A 1NG0A 5LMNO 3LDKA 2WLNA 4YW4A 4RFT0 4JI1O 4DR3B 3BB6A 4AI8A 2R9AA 3T2TA 4X1YB 3WUDA 1LGNA 1PX3A 5LA6B 2WNOA 1SKVA 3CLPA 1GM7A 1GMGA 2Q6AA 1K4CC 2VOKA 1BBT1 3MFAA 1JOBA 4SLIA 5FP9A 2RR13 4FP3A 3SC7X 4PA4A 1VMJA 4J7KA 2CTQA 2XLGA 3JAKB 1HP8A 1H6YA 1GTOA 1D5AA 3UT0A 1WUVA 2DWDC 4E27A 5FUIA 3JXSA 1XU1A 1N4CA 4RUEA 4YFZA 5LYJB 1Y3TA 3AK3A 3ES4A 1UF2C 4FVVA 3GZAA 3JU9A 3Q8EA 3QD6A 3ETDA 2D40A 3QVNA 5JZGA 5LWBA 3FUOA 4QPKA 2WWUA 4Q0UA 5IJRA 3ZMSA 5CA6A 1C57A 5C9AA 2IU0A 3PTYA 4LP8A 1XNQO 3PUHA 4JI8B 1VQ8V 3L72H 2OXBA 3K46A 3AG1B 4MX3A 2GTSA 3KZIZ 3U1XA 1BVP1 2H0BA 5EBLC 3OPWA 3FHQA 3ZHRA 1HX6A 2GV9A 1S0VA 5EQUA 4QX8A 3ZVXA 3N9MA 4JKKA 2MEV3 5LBFA 3WLUA 2ZGSA 2A7WA 2YXHA 1G86A 1FYUA 3ACIA 4GLXA 5ANNA 1QMJA 4K40A 2DCZA 3THPA 3T1HB 3CJHA 1KFXL 4COZA 3JBG2 1O5LA 5JZGB 5DUWA 3IM0A 3DXRA 3WT3A 4CP9A 3AK2A 2A6ZA 3RNSA 4GA9A 5C9AB 4PIZA 5LGNA 4YPJA 1Q90D 1JJOA 1BXHA 5FY7A 3K48A 2OQ6A 2VAUA 1NY71 5LEJA 4EWAA 1O3RA 3APBA 4IDZA 3UKNA 5C3QA 4D6SA 4TWKA 5C71A 2UY9A 4NYKA 1ZZ8A 3WG4A 1AR63 1VF5B 2E6VA 4HT1T 1YJ9V 1VIBA 3H9AA 1A8MA 2DCTA 1UYXA 4D8MA 5IYBO 3CCJV 3JZVA 5CB4B 3DXRB 3V64A 4CP9B 2AC1A 3AMHA 3I3QA 2FHRA 1KC8W 3ON7A 2ZEYA 3SCFA 1LOFA 2JS5A 1UYZA 2ZNIA 4C1XA 1B6QA 1BEV3 5GLZA 5D5PA 4N53C 1PGSA 3PMSA 1AR93 3ABTA 1RUE3 2YIDA 2ZKNA 4AFCA 3W9AA 4LTAA 5CFDA 2QFEA 4FMTA 4G27B 1R093 2FDGA 3TK1A 5C5UA 2YC0A 1DK1A 1EFRG 3ZXGA 2BPA2 5FZCA 4DR7B 1FAFA 4BMBA 4QX5A 4Y4RA 2XAJA 4LK6A 5DUVA 3FJSA 3K5LA 4LWSA 2R70A 4Y26A 1JZ8A 4G2KA 3UO2A 1RUH2 1XOUA 2AH2A 1SZTA 1O6UA 4XF0A 5C3OA 4OHZA 2P17A 4UFJA 1RMU1 1E5SA 2QQOA 2H94A 2ZOEB 4TT3G 5FXXA 4CEYC 1ASJ3 4LO5B 1RTVA 2UU9B 5CFDB 1WCSA 4WVZA 5L9BA 3BFRA 2XNDG 2F4VO 1U5IA 1K7DA 4DV5B 1DLCA 2D43A 5T3NA 2EILC 4CDQA 4MXWA 1PL4A 1X50A 4IV3A 2UU8A 5FXZA 2QKSA 1WZXA 4RO2A 2VU9A 2JB4A 3FB6C 5BR8O 3ZYRA 4N9HA 1TNRA 2XJVA 1LTEA 4UB8Z 4LFCO 3OTOB 3J7HA 2LW7A 3WW1A 2JGUA 2CAUA 5BNOA 3NNGA 2UUAO 5FFOC 1BBT3 2GN3A 1US2A 1OKQA 2VJXA 3AFKA 4XJWA 4JVAA 2Q30A 1I08A 3FAVA 3LFIA 3TETA 1FAYA 1ZL8A 4EE2A 3SJQC 3MUY1 1AXKA 1SDWA 3JD2A 4CDQB 5FO8B 4MXWB 2VNVA 2JICA 5E89A 2PFWA 5ACA2 1H8VA 4IV3B 2VOXA 1ZVFA 4YARA 4LBQA 2VCMA 5FMCA 1C8M2 1CAUA 3DUIA 2YI8A 1CAXA 3PHMA 1VBE1 4IT5A 5FPBA 5L3BA 4RR3C 3BTZA 1OF3A 3HKDB 5FYBA 3N2KA 2JG8C 1RITA 2UXNA 4O61A 3TCUA 3TGUH 4NIGA 2D93A 3LQCA 1AI5A 3ABMC 1MVQA 5GJ6A 3FAVB 2F93B 4MHRA 3T08A 3VHNA 3IMMA 2XQXA 1ZL8B 3HN1A 2LM3A 1EZVH 4WFBV 2W52A 4JTCB 5A6YA 2NR5A 1Y9GA 3P32A 3TNQA 3SKJE 1R1ZA 1MZ6A 5ABJC 1D2DA 4LBQB 5KHJA 5FZ4A 4CCKA 4BMEA 1CAUB 3HR9A 5LA9A 2ZE8A 1CAXB 4QMAA 2EINB 2DVGA 2PY5A 3A7QA 1BQ0A 1PGW2 2ZTNA 4GULA 1QQP3 2HFEC 3N2KB 3K3OA 1XUQA 3DPRC 2EA7A 1I3HA 2QTSA 4CP1A 2ZAAA 1W9WA 3HN3A 2AGAA 3ABLC 1ZZ7A 4TTGA 5I0SA 3NV4A 3W5NA 4XJAA 1FOD2 4ZXEA 3FBYA 1D0HA 3QH7A 5J36A 1L1FA 1QR9A 3VZNA 4Q29A 1PMIA 4FVMA 1WCUA 4K20A 1O5UA 5B4XA 3TOJA 3PVBB 4MTFA 3THDA 3RZZA 1XNRB 2BVVA 3NVCA 4DV6B 1OCZB 3MD0A 1KYOF 1JTZX 3IJ4A 4QKBA 4M01A 2R071 5LBEA 4NXNB 4BH9A 3H8UA 4EB6B 1YEWA 1R1A2 4GH4C 2Q8EA 3CMEV 4YW1A 1KD1W 4CCLA 2CE4A 3SYOA 5B2GB 3AG7A 1JR9A 1ZNPA 3ZMOA 1RFYA 4OZXA 4NUBA 4LUMA 1RVF3 5FBZA 2DBIA 4GWIA 5L3CA 4K0KB 1YVWA 3PJYA 1VBD1 5JQGA 4JI5O 4EWDA 1YI2V 1EN6A 4YIPA 2CDOA 1YCIA 5L36A 5F6KA 2EXKA 4ISQA 4CZZA 1SQXH 3OPZA 1HR0O 2P3JA 3Q4HA 1M57B 3RZLA 3FC0A 1SERA 1HQLA 3POSA 2W1UA 1WBFA 1RMU3 1YQ6A 4OMCA 1SBDA 4XMAA 2R0HA 4J10A 2ZM6O 3BA9A 3SEEA 5CG8A 1NU1H 4CDXA 2R6QA 1AR4A 5EJZB 3P3NA 4JYAB 4ZKTB 1BKZA 3OR6C 5JQGB 4CUAA 1ZZBA 2VH9A 1AR82 2W91A 4GZRB 4MT8A 5J2UA 2EIMB 2NQYA 3CSXA 2IXHA 5JIUA 3E22A 3H1IH 1CAVA 3ML0A 1E5HA 3Q4HB 3SISA 4B3MO 2WNUA 2ENRA 4OCTA 4JQTA 1WCDJ 4GT1A 5FL7G 2JJ6A 3K5NA 5FPVA 1XNAA 2Z4FA 1ENSA 2FMDA 5B1BC 4F6EA 1YO8A 3ZFFA 3MYXA 3WF0A 2A6YA 1C28A 2BYVE 3VQYA 3LNMB 4NIHA 4AQSA 2D7FA 2JEMA 4YZ3A 2X8KA 5FK8A 5J2UB 2BE3A 3WNKA 3BU7A 1CAVB 1VBE3 1ULOA 4JGSA 2WNUB 4J42A 3FBMA 1TNFA 1MG1A 3T30A 1K92A 5JCOA 1JYCA 4B3SB 2B7YA 3GBGA 5D5QA 1KD7A 2HEWF 2UXBB 4G3YC 4NXMO 3DYMA 5EZWA 3ZFFB 2IXCA 3D4KA 3ZIWA 5IVBA 4HL0A 2NYYA 2RHPA 3I2FA 5DAVA 1WB7A 1MACA 3UETA 1IKPA 2DE0X 4A4AA 2K1EA 3OBTA 3W7SA 1DHKB 2YB7A 3NWKA 3POFA 4AQYO 1VQ5V 2QQKA 3WP5A 4NRPA 3J8F1 4DEVA 4X62B 1AB3A 3WY6A 4JRLA 3KVBA 4ORFA 4GX1A 3KS7A 3T0DA 2BFUS 1OMIA 3RWNA 1FXVA 4OHYA 4LBNA 1R3IC 4P9WA 5JR2A 3H1HH 2A73B 4P9XA 2WZEA 3NL1A 3J9SA 4XTMA 2RS51 1Y9QA 1TMF2 2GSMB 5LBBA 3QLQA 1WCKA 1G9DA 3KF5A 2IZWA 5JJNB 4YHHB 2E7AA 3M3IA 2DUQA 1HDKA 1XMQB 2M7WA 2D6PA 1I0HA 4G28B 2UYAA 4XPVA 4MSVA 2QM8A 3LSUA 5JSPA 1P84F 2BGPA 1JW6A 2WUHA 5A1AA 5DABA 1JYIA 1NA1A 4EN6B 1J83A 2HWE3 3DGEA 3T2MA 1OH4A 4B4PA 2W39A 5J48A 3SHRA 4BWOA 1AYM2 3WW4A 2EULA 3LWCA 1I5XA 1VF6C 4EEQA 4B1MA 1SZBA 4FOVA 3IN9A 5K0UA 1TUBA 3K03A 1G9CA 4AR2A 4F6RB 5IW0A 3EBRA 2WZR3 5CEHA 1UJWB 3PN1A 5FPRA 2XWBB 4TLFA 1YI7A 2E5LB 5LZ6A 5A3OA 1J3PA 1AXZA 5F3GA 2W87A 5CMUA 3ZYBA 1NCRC 1NA1B 4FPEA 3ZR5A 3OGSA 2XG3A 3PVEA 1GQGA 4UVBA 2EALA 4JPRA 3PUAA 1CAWB 2RDRA 4X66O 2OYZA 4QB1A 1IQAA 1AZDA 5K0UB 4EN7B 1RUD2 3G6EV 3MDPA 5DDJ1 5IT6A 3CXCU 4TOIA 3KKYA 1ZRRA 1LHWA 3CC2V 2QWPB 2XVGA 5FZOA 4GB31 3Q8AA 1WLTA 5FY4A 4AI2A 5A7NA 2CYFA 3P5BA 3CRRA 5EBMC 2VZPA 3OBAA 1COV1 1AYN3 4LBJA 1DQ4A 2DWEC 4B8EA 1H4GA 1TVGA 2ILMA 1MEC1 3EQEA 4NRQA 3VKLA 2WINB 5J98B 4NIAA 1JZ6A 1Q81W 5K7PA 5LEKA 4LBLA 4LA2A 2ZKOA 3PJQA 3K5OA 4HVOA 4C0BA 1OF4A 1IBLO 3AJYA 3KSCA 1GN2A 4X8NA 3KV9A 1N32O 2AHZA 1W8UA 5FZOB 4OULA 4QPYA 4S2HA 3U4XA 3A22A 1OA4A 2WLPA 3LE0A 5KUMA 1PNKA 3BGAA 3OG2A 1TME1 3CCEV 4A45A 1DZTA 1LR5A 3KCYA 3SNMA 1W04A 3B4SA 3OUSA 1AUYA 2OT5A 3BA8A 1QOSA 1BT8A 5BNPA 4RFRB 4KMQA 4JAVA 4GMP3 4I9WA 1HRV1 1GZ9A 1UZZA 1UY0A 2DYRB 2AZ2A 3POJA 1BGYH 2GP5A 3P6BA 3FMGA 3PUQA 3W7UA 4R9BA 2YICA 3OGIB 4LF4O 1T6BX 3WG3A 1KKCA 5J37A 1MS3A 1AP5A 2PYTA 1LGBA 2YBSA 2XJRA 2IM9A 4CBCA 2W9XA 1SFNA 4QXCA 3O5SA 1ODMA 3GXUA 1JX9A 2K9PA 2V7QG 4HONA 4CH5A 5DZGA 4PDWC 5BNPB 1NJIW 2ZKLA 2QDNA 1N0JA 1JU4A 2HR3A 4CCDA 3CPWU 5I0TA 1IKQA 3OM3B 2XBO2 4LBEC 2YV8A 3FLPA 1SF9A 3POWA 2IXKA 3OGJA 2X29A 3SLIA 3CZJA 4XDOA 4P9GA 1P4RA 4UW5A 1OCOC 3D36A 1LHNA 1HNWO 3U4SA 4ASLA 1VLNA 4U3FH 2UUBB 5KA5A 5DG2A 2CSGA 4LF8O 4PHZA 5A3MA 4L0PA 2V4AA 3ASNC 3UKTA 3B9CA 4K8FA 1YHQV 1S0CA 4QM8A 5LRRA 5A3NA 3UKMA 5HCAA 4JI7O 4Y20B 5K1PA 1JN2P 2W3JA 4COUA 2XOKG 4UUJC 3WQ0A 2AW9A 5EWSA 2PQSA 1H1IA 3SPGA 5J09A 3WD5A 2ARAA 2NN8A 1I94O 3WNPA 1RUI3 2HYXA 1Y4WA 3BTAA 3RBZA 4FSJA 5CISA 3LPGA 4CEWA 1AF9A 3K79A 1VMGA 3TAYA 3HAGA 3NNFA 1F5FA 2H6CA 4NAMA 3WB2A 4DR6B 3CC4V 1AJPA 1VR3A 4YM3A 1MNGA 2W08A 1W6NA 1G6NA 1NR1A 5EZYA 3ZHSA 3GZEA 3J4UH 1KQSU 3BIEA 4YM1A 1W8HA 5JXJA 3B40A 1ENXA 3SXWA 3RZJA 1LOBA 4Q0VA 2UUCO 5IK5A 2VS0A 3VBUB 4PA9A 1UW8A 2OZ6A 3IT8A 3ZYPA 2Z79A 1VBC1 2Z2SB 2RR12 2TNFA 3VZMA 2WLIA 2BVBA 4LO6B 5HCHA 3R65A 1C4RA 1QJX1 1RUJ1 3AG3B 1I5ZA 2QTOA 2DF7A 5L73A 4H7LA 4MLOA 3W20A 4NWVA 1CN1A 1QWRA 1W6NB 4B4RA 5EZYB 3A23A 2DOSA 2P67A 4JI3B 4AWDA 3BTXA 4BB3A 1OSGA 2QM7A 3U10A 3CCMV 1U5ZA 4P5HA 3OUFA 2Y6GA 4CYDA 4XABA 2KXLA 3CO2A 2KG7A 1H0BA 1RHI2 2WLIB 2HH9A 5HI0A 3ROUA 1Z5WA 3F95A 1HRI3 4XDLA 3O1SA 4IEUA 3ZSEA 2EIKC 1KXGA 1SLCA 2Q1ZB 5I8TA 3JAWA 3SGIA 1F4HA 1M93A 3ITQA 4PLOA 1Q3EA 2WC2A 2WL1A 4LNUA 2YI9A 1I7FA 2YMZA 4TQDA 2VQUA 1J3RA 4JTAB 2MEV2 2C26A 2VM9A 3JARA 4DS0A 4N43C 2P37A 3RWRD 2YFUA 4NE9A 5ITZA 2KG7B 2UWAA 1BQPA 3ALQA 4CU6A 1S0BA 2JD9A 2UXCO 3WHTA 2Y0PA 1WW4A 1S77D 4OX9B 3K3WA 4BXFA 5CB7A 1SLLA 2NN4A 5FYUA 3ZHVA 4JAAA 4XFGA 4BYYA 4FK5C 4LE4A 1IDSA 4ZBMA 4L87A 4IEYA 4CCOA 4Z1VA 4LNUB 5FYIA 2DUPA 2FDHA 4PDVA 3GZUC 3OD4A 4IIJA 2VVDA 4O2BA 3JARB 2J1UA 1PO11 2ZHLA 2DYCA 2UXXA 4XIKA 1PIV2 3U14A 3AXEA 4YJ2A 1I9RA 4EWEA 3O1OA 1QVGU 1Q7YW 5ITZB 3KLSA 5GLWA 3R0RA 3HQRA 4YW7A 2CTRA 1UMZA 3WW2A 4JI2O 2HKXA 3IGAC 3WUCA 4MVQA 2HYKA 3AX4A 1BEV2 4N53A 4CC6A 5JPNB 2Q9LA 4M3CF 1AR92 4Q8LA 3TJTA 3NAPC 2GDSA 4BCUA 2DFCA 4IIJB 5I93A 1R092 5KLVH 1XNDA 4O2BB 4IE4A 3SDLA 3K4ZA 4MVMA 2VG9A 4AI9A 1N3PA 3LA2A 1SLTA 1N1YA 4R50A 2D6MA 4CDUC 1LEMA 1JYTA 3VBFC 5CIRA 4S2DA 2OIGA 4JI4O 2IXLA 1A78A 3CB2A 4OI1A 3E86A 1B35C 2CGPA 2LS6A 2Q7GA 4N53B 1LCLA 2IC1A 4NROA 5KHKA 2KSDA 4NPRA 4CEYA 1ASJ2 4A44A 1CEZA 1LNSA 4UXAA 2ETEA 5T54A 3ZXDA 2O14A 1GP4A 1JU3A 2WS93 5FLHA 4BJ0A 4YGEA 1DP0A 1SDDB 1YITV 4EROA 5FZHA 3ZSKA 1P8JA 2PAEA 2YXLA 4DV7O 3T0AA 3ECQA 4F4LA 1MMMA 2DDUA 3MZHA 4LO4B 5LP6A 3WZ1A 3T4ZA 3JBG1 3SPIA 2BWAA 4FTEA 4AFAA 3IDBB 1X9PA 1BBT2 1JZ4A 2WWJA 1AR73 2D98A 1K33A 1ZTEA 5IE9A 4CEYB 4FQ4A 3C7FA 3T1YO 4UYBA 2NMNA 4RQPC 3VDCA 1IZ3A 2DCYA 2QWRB 3PIGA 4ZU4A 2HJFC 3U11A 4O65A 2EILB 1REDA 2XVKA 5A3WA 3PNAA 4LT5A 3PVOA 5FP3A 1WLWA 1WB8A 2JEXA 2ZBJA 5A6QA 1BHAA 3ZSJA 1VQLV 2YGLA 1JVMA 1PM4A 4C0HA 2B4KA 5JDBA 4UFHA 4J41A 2OWOA 5A7SA 3TWIA 5LP6B 4QPIC 4KHPO 2NLRA 1QGLA 4RR3A 1ALYA 3QTCA 2ID4A 4LK7A 1HN0A 3ZO0B 1JI6A 3OCPA 1N36O 1XI1A 4Y1VA 2ADEA 4FPHA 2CV6A 3UJQA 3I59A 2JIJA 1Q8OA 4CCNA 4BM8A 2HEVF 4P00B 2MHFA 4JQRA 1J1LA 1NXMA 4YSFA 4U7OA 4EN9B 4XETA 3EFFK 3RYHA 3JASB 2C0ZA 1X36A 1OHHG 5B4NA 5D1IA 4J80A 1SBFA 5GLUA 5JJJB 2PHWA 5ABJA 1HNZB 2HVKC 3VDAA 3RFRA 2B9UA 5CYYA 5CN0A 1C1LA 3AMMA 2WJSA 2FMLA 1K5QA 1UIKA 4RR3B 2VTXA 1QQP2 2JG8B 5HFLA 3DPRA 1DG6A 4P08A 2VOTA 3VBSC 4B7EA 3ABMB 3I55V 1ULCA 5C8YA 3H3ZA 2R1DA 4RHV3 3H1LH 3S5QA 2PN5A 4CCCA 1RB8G 4XW3A 3RYHB 5L3FA 2YYOA 3ZYJB 2IJIA 4JYYA 4LFBB 3HKCA 2ZHNA 1TGOA 4HBNA 2VCCA 1NXD1 5ABJB 2QWNB 4YW6A 2VQAA 3ABKC 1D7PM 4DRXA 4DW0A 1HV0A 1PO13 1HV1A 2AZ5A 2R9RB 4GKJO 1UXXX 5KHGA 2FL4A 2IFWA 5IUQA 3ZLIA 3TEZA 4AEMA 3HBKA 4NIDA 2E32A 4A7KA 2WZ8A 3J80N 3DPRB 3ZDVA 4JDMA 4RL7A 3U07A 1HJFA 5L9VA 2R30A 1THZA 4RGGA 4LF6O 3AP5A 5C6CA 1RPOA 2ZX3A 5C8YB 1M9NA 3ABLB 4UV9A 1Y76A 4X89A 4NO4A 5A32B 4W65A 1JYVA 4AILC 5H9CA 4JHZA 4IQPA 3EB7A 2YZ4A 4YY3O 4C7UA 3HKCB 4XUNA 1RVF2 2E63A 3LFMA 4E8DA 3VZOA 1QOTA 3E8HA 4B1LA 4DRXB 1X33A 1B09A 4DV1O 4LFAB 2Q0OC 5ACA1 3B3QE 4BK4A 4JGZC 5C3RA 2RJ2A 4MW8A 1C8M1 2DQ3A 2VNOA 1DQ0A 4MVZA 2NZ9A 3FYEB 3TBDA 2VQFB 5EJ1B 5DAXA 5I8SA 4GH4B 4BQ4A 2ATKC 1SLBA 3ZN4A 1Y76B 2Y0OA 1RMU2 1WD4A 1OVPA 2P4KA 2I07B 4EN8B 4QKDA 4KWUA 2XOMA 2V73A 1Q43A 4GKXA 1W8OA 5FREA 2WSUA 5D8AC 5FZFA 1X8EA 1UMHA 1QOOA 4BLIA 1NYWA 3ETQA 4BE3A 4U2AA 4QWNA 1W6QA 3AG2C 3A0BZ 1U97A 1XNBA 4NHLA 3KD4A 5T52A 3BCWA 4UV8A 1PNGA 3WR0A 2D3RA 1PGW1 3X29B 2C6SA 5L9RA 5HPOA 1D5NA 4MYEA 1D2SA 3AEIA 4D6TH 3Q8CA 2VR4A 4I7ZB 5GZGA 3QBQA 1ULGA 2YFZA 3HQXA 4AI3A 5FWJA 2EIJC 2GNDA 5LA0A 3WVJA 2VUDA 3IIIA 1EV12 3CQOA 3G80A 5F37A 2GHYA 1A6CA 1FOD1 1HXS3 1GWLA 4XUOA 1GANA 1LOGA 2XJUA 1JZ5A 1W6QB 3OB8A 1UX7A 5A70A 2OA2A 4GWJA 2LP7A 3LD8A 4XBFA 5FMDA 5TISZ 1N1TA 4JTOA 2ITDC 1W8NA 1N47A 1IS4A 3X2QC 3MW2A 1K5SA 1UU4A 2VULA 4D6QA 1XHXA 4K35A 4XIOA 2PYJA 2OW4A 4IE5A 3RJRA 5FOJB 5IK8A 4PBPA 4CCEA 5B1BB 1WA6X 3I97A 1R1A1 2FBEA 1D4VB 3T1CA 1UY4A 2P2KA 1EPZA 1G9AA 1AL23 1AL0G 1PZ7A 3GDBA 4DYLA 2CL2A 2WQ8A 2ARXA 1P49A 1F7YA 4K21A 1MS5A 3H1WA 3FX7A 3WQ1A 2Y38A 1GNZA 2B9ZA 3L75H 5C5TA 2X6AA 1YZBA 5IAVA 1HJGA 2RVAA 1W0JG 3T4DA 1GFF2 1YTFD 3EXAA 4DR4O 1HIXA 4U36A 1LNQA 3I54A 2TUNA 1OFNA 4MV2A 2FDFA 4CP2A 3FHAA 2P3YA 1X82A 4XE9A 4DV3B 4DUZO 3QO8A 3DYOA 4JYCA 2VZRA 1B3QA 1H2MA 2UYBA 2Q8OA 3CIHA 1M06G 1AR81 4HLTA 5FP7A 2UXDB 2QVSB 3FUQA 2A3XA 2FKXA 4XFIA 5A7WA 1IURA 4O7XA 4TV8A 3LSEA 1UAIA 4L9BA 3JD1A 2VMDA 2HWE2 2X5IC 4M3CE 4AVVA 2PHDA 1N3QA 4JAUA 3DKWA 1TA8A 1WLEA 3ZEDA 2MPFA 4MZUA 4KXRA 1VF6A 4ARXA 4J1WA 4ZY9A 4XZUG 1BZKA 1ZM1A 3OPTA 4LKSA 4OI0A 5A7PA 3M7MX 3ZYHA 4YXWG 4X6RB 2WZR2 1WW6A 5JSRA 3NNMA 5ACA3 1RJ8A 1OV9A 1RL3A 3WCRA 1C8M3 5A7WB 2DVDA 5KXEA 5J9PC 1PL0A 4TV8B 5IHRA 3SJCC 1NCRA 4DO0A 1PNMA 3MGUA 1XYOA 4JI6B 2AREA 4YYOA 3G7DA 1I1EA 2RCVA 1OKOA 2FYUH 2RDQA 3NXSA 1FPOA 5FUPA 4RUFA 3SYQA 3SKVA 1H2SB 2VMGA 3GJBA 1QNMA 3POBA 2KM2A 1E57A 1OCCC 2G19A 4XURA 5BYNA 2XHNA 3I2IA 3UL2A 4HFSA 2ZE5A 3F7YC 4XJZA 5C8WA 4NKGB 2DW4A 3SH5A 1PNFA 4YG0A 1EM1A 1XNKA 4IEPA 3ZXKA 4QT6A 5LHIA 4LO8A 3D0SA 1IBKO 2JRIA 4P30A 1NCRB 4RAIA 4GALA 3H8XA 3AP6A 4BQ2A 3OJBA 1AYN2 3JB4C 4JI0O 3T4HB 1QCEA 5F9TA 3RYIA 3MO4A 5LRSA 4XJ8A 3FD9A 5FR3A 1TMF1 2CNAA 4XAEA 3HR0A 3L74H 5IVVA 5ERLA 1NE4A 2YBPA 2JK5C 1KRIA 1KKDA 1PNLA 4TUYA 5BXXA 4DXTA 1VPHA 4WM8A 1NVPD 1V70A 4XMIA 2HHHB 4IGPA 4QQ2A 3LOBA 1O4ZA 3O0XA 1XB9A 4E2GA 5BV6A 4FPYA 4EYUA 1W8WA 1SCSA 2P6JA 3RYIB 2BOCC 2DFBA 1R1A3 3H1MA 3HT2A 4KNCA 1ACCA 1LULA 3E83A 3BYWA 4W4KA 3WQBA 5FLJA 3D82A 1X59A 4WM7A 3NV1A 5IWAO 3IDAA 3BHPA 1AYM1 1DZRA 2ZAHA 4IL6Z 1W05A 2WAAA 4RWUA 2VNRA 2ZHMA 5EIBC 2VZTA 3TN93 4TUYB 1YUDA 1BCXA 4FLXA 2QE3A 1BHBA 4QGNA 3CJXA 1VAMA 3KCCA 1N33B 1Y43B 4I4TA 2DUOA 4DR3O 3VHOA 5EXOA 1NAEA 4MTGA 1M1KW 4I2OA 2F17A 1GICA 4DOUA 2H3OA 4ZOLB 1F23A 3M1HA 4PDWA 5E1AC 1K97A 4NAOA 4D7TA 4WM7B 3IWZA 2W6JG 3K5MA 2VUAA 2WDBA 1UO9A 1YJWV 1G6UA 3OGGA 2PLV2 3CF6E 4JHTA 4EZ4A 3IC7A 2DJVA 4J9YB 2VWKA 1RUD1 1W9SA
chains in the Genus database with same CATH topology
1UU5A 4QM9A 3OPZA 2BNOA 4LBQD 2P3JA 2W0XA 3NO8A 3V65A 4P14A 3FC0A 3J26N 2GC2A 1HQLA 3POSA 4Q4X3 2A3YA 3NKGA 5FLIA 3FE5A 1WBFA 1RMU3 1SBDA 4XBNA 1UN1A 4XMAA 2R0HA 1D2QA 4LO7A 5DG1A 1UPIA 4BA6A 5CG8A 1KJRA 5CVRA 3FX3A 3VBUA 2GNBA 1MS1A 4LHNA 1BYHA 4CDXA 4YVSB 4PDWB 2JG9C 2R6QA 5CNAA 1GZWA 3FWEA 3P3NA 4ZKTB 3VKMA 1QJY3 1NCQA 1VZ5A 1EY2A 1BKZA 4WVWA 1FT9A 4META 2DVFA 1ZZBA 2RS11 2VH9A 2VVFA 4Q0PA 1AR82 4W6YA 2A7AA 3TB0A 2NQYA 5JZGC 2HWC2 4WVMA 1BJQA 1FPN1 2IXHA 4Q0QA 4WV8A 5JIUA 4XXAA 3M3CA 4DINB 1RC6A 4FPKA 2X53S 1CAVA 4AGRA 5C9AC 3PVNA 1OIIA 2EF6A 3SISA 2K9ZA 1RUI2 2WS91 4YFWA 2WNUA 2ENRA 3ACLA 1QY4A 2VOWA 2H6BA 1UIJA 1BZWA 1WCDJ 3N3HA 1GV9A 1JR7A 4AK3A 2JJ6A 4BHGA 1A8DA 1RIRA 1YNAA 1XU2A 2JE7A 1ENSA 2FMDA 2R062 4OFGA 1QU0A 4J1XA 1YO8A 2YROA 3ZFFA 4UBGA 3MYXA 1GZWB 2E53A 3RYRA 2HWB1 4JGZA 1JXNA 1NCQB 1WA4A 4XILA 2A6YA 1V6NA 1C28A 2BYVE 4AQSA 4KU7A 2D7FA 1AR71 3N36A 2ARBA 2O1QA 4FT8A 4Y5Z0 2JEMA 3NV3A 1PVXA 4YZ3A 2X8KA 3JBG3 3OF1A 3CEWA 3E6BA 4WVMB 2OVUA 2R041 3USUA 4GXLA 4YW2A 3BU7A 2XJPA 4LR4A 1FNZA 1CAVB 1GLHA 4Z82A 4M2GA 1VBE3 2XKOA 3R6SA 4LLFA 5DXDA 5CFCA 1JBCA 2ZS6B 2WNUB 3ZSMA 2QZ2A 3FBMA 4LLOA 1TNFA 3CJIC 1OFSA 3B69A 1JYCA 2B7YA 1CIWA 1N1SA 3GBGA 3ZYIB 4RA0A 4ITCA 1KD7A 1S1AA 2HEWF 2PTMA 3VKFC 1V6IA 1IPKA 4G3YC 1DGLA 1PHMA 3N35A 4HETA 5EZWA 3ZFFB 2IXCA 2NM1A 4JGZB 3MF6A 1GSLA 3D4KA 4YM2A 1FMD1 2TBVA 3I2DA 3ZIWA 4DB5A 1O3QA 4FQZA 3IDEA 5E16A 4HL0A 2NYYA 2RHPA 4RS5A 1LKNA 1VBE2 3MIGA 1QDCA 1MACA 1N1VA 3R4SA 1IKPA 2E7QA 2TEPA 2UY8A 4XJ9A 1IGOA 3OBTA 4KU8A 2PQQA 4YZ4A 1DHKB 5C4WC 1VAVA 3NWKA 4L92A 3USUB 3WP5A 1WD3A 3HBZA 3J8F1 5K9YA 3M3OA 4Q4W3 2NPIA 2YXSA 4Y22A 2QUOA 2WT1A 3WY6A 1LOFC 1U0AA 5CFCB 4K9SA 2XBO1 1DGRN 4JRLA 3VHRA 3V56A 4ORFA 3RYPA 3KS7A 3M3QA 1R081 2BFUS 1OMIA 3RWNA 2XWJB 4OHYA 4LBNA 3VBRC 4HZFA 2GMMA 5JR7B 1DLLA 1ZZ6A 4P9WA 2A73B 4E9KA 4P9XA 1RUG1 1W6MB 4JGYA 3NL1A 1GR3A 3J9SA 2GAUA 4PBOA 1ZREA 4XTMA 4M27A 1VB2A 3PMEA 5CFDC 2PHRA 3RI9A 2RS51 3BALA 1C5IA 2EXHA 1Y9QA 1UCXA 1HRI2 2DCKA 1TMF2 4GMP0 4Q4W2 4RS5B 5JPMB 4IEQA 3QLQA 1WCKA 1O91A 1G9DA 1H2LA 2IZWA 4AQ2A 3VBHA 3M3IA 2E7AA 4EJRA 2GDFA 4KWJA 4XF1A 3ZXJA 5JOWA 4Q0SA 5GLTA 2DUQA 1HDKA 1HQNA 4FXKB 1VALA 4XBQA 1YFXA 4HK9A 1RUH3 4RHV1 3IPVA 4YNIA 2EAKA 2D6PA 2ZGUA 3FHIB 2GH2A 4Y22B 3A0KA 4YGCA 2UYAA 4N43A 4XPVA 4MSVA 5HXVA 3WXPA 2WIIB 1VBA1 4R4ZA