3U11A

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
197
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 197
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u11A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u11A02
3CEWA 2Y0OA 3BB6A 4EROA 1ZVFA 2EVXA 1O3TA 5JSOA 5HI0A 3RPQA 4KU7A 3QACA 2I45A 2BEOA 3H50A 3UKVA 3VHRA 2XHKA 1LB2A 3RZZA 2BYVE 3H9AA 2QDRA 1UW8A 1QY4A 2QCSB 1I6XA 4Q0SA 1V70A 1O5LA 2B8MA 4AVAA 3EBRA 3TNPB 1VJ2A 4GULA 5JSPA 5FQ0B 4EV0A 4UXAA 2MHFA 5I91A 2P17A 1CAUB 3FFQA 3H1YA 3N4MA 3HT1A 1CX4A 4HVRA 4WVZA 4HBNA 5E1RA 2PA7A 4LEJA 1Q5OA 2ZKLA 4OLLA 2Q1ZB 3U10A 4QX5A 5BY5A 3NJZA 1RC6A 4HMZA 4MGIE 4HVQA 5KHJA 2H6BA 3I59A 4ORFA 2GH2A 1O3QA 4P9GA 1OMIA 5FLHA 5C6CA 1CAXA 1J58A 4AQ2A 2B9UA 3D0SA 4H7LA 5EZWA 3WW2A 2UY8A 2GU9A 1IPJA 3E5QA 4PIYA 1GQHA 4IETA 1J59A 3GBFA 1ZZ7A 4IEUA 2CV6A 3IWZA 3KSCA 5JR7B 2ET7A 5CU1A 1YFYA 4L2NA 1UCXA 1SFNA 4HSLA 5KHHA 1SEFA 4QGMA 4XEZA 5JCTA 3MZHA 1UIJA 3I7DA 2UY9A 3NW4A 2Q0AA 3BALA 5AVPA 3ZDSA 3C3VA 4QM9A 1CAVA 4I0AA 1FXZA 2PAMA 2H6CA 1YUDA 1ZRCA 2OZJA 1ZX5A 4BH9A 3KGLA 4FAHA 3S0MA 1RUNA 3HQXA 3UKNA 4NVPA 2PHLA 3I54A 5I8TA 1WLTA 1OD5A 2GC2A 2VPVA 4E2SA 4QGLA 4YARA 1ZZ9A 4YNIA 1LRHA 3EQEA 4FBFA 1ZNPA 5KHGA 4KWKA 3FWEA 4I02A 2CGPA 3LZZA 4I3PA 1X82A 4Q29A 3D82A 1JUHA 4XF9A 5K8SA 3BU7A 1O4TA 4HSJA 3ROUA 4HN1A 5BXXA 3DV8A 1DGWA 3B02A 2Z2SB 5BV6A 4IERA 4QMAA 5LEJA 1YHFA 2MNGA 3M3IA 3DKWA 5LRSA 4E2QA 2H0VA 3ETQA 1ZZBA 3ES4A 3H3ZA 4AXOA 5JSRA 3E5XA 4XFGA 2PQQA 4MZUA 2PAKA 1O3SA 5FPXA 3TNQA 4B29A 5I0SA 2EAAA 4KU8A 2ETEA 3OTFA 4Q0QA 5I0UA 4X6QB 3E5UA 4R52A 2C0ZA 4XETA 3LOIA 2Q4SA 3CO2A 3I59B 1ZRRA 5FLIA 2IXJA 4WBBA 1CGPA 3DN7A 2FQPA 5LEKA 4AVBA 1PM7A 2IXHA 2VECA 5F1RA 4OFGA 2N7GA 1EPZA 3IBMA 1YFWA 1YFUA 4MGZE 4IEXA 3FJSA 4JTOA 4IEQA 5E16A 4IEVA 4HLTA 2OA2A 4YRDA 2PYTA 3LA7A 4BYYA 4FAGA 1Y3TA 3H1WA 3CLPA 1CAWB 1G6NA 4J1WA 3IIAA 5EFUA 4LTAA 3CF6E 4QGNA 3OCPA 3KMHA 1CAVB 1UPIA 2HKXA 4IEYA 1ZZ8A 2V09A 4EWDA 1X8MA 2VQAA 1YFXA 4ZU7A 2B5HA 1VP6A 4O9GA 3G7DA 1NZCA 5BPXA 1FI2A 2XLAA 1ZZCA 3E6BA 5D1IA 5T3NA 4MUVA 1H1IA 1YLLA 4E2GA 1ZZ6A 2KXLA 1QXJA 4XFIA 3H1MA 4IESA 3S7EA 3D0JA 4QXKA 2O8QA 2PHDA 5J3UA 5I8SA 5FQ0A 3RYPA 1J1LA 3EHKA 1J3QA 3U11A 3H7YA 1O3RA 3BPZA 1U12A 4JVAA 3PVBB 4BIFA 4N9HA 4EWAA 5FDBA 4ZU4A 2ATFA 2XLFA 4X6RB 1LR5A 3BCWA 3CL1A 4HZFA 3PNAA 5FCCA 2XKPA 2BNNA 3WW3A 1RUOA 3RYRA 4HVOA 1GQGA 2D40A 2QNKA 4FT8A 3H8UA 2IXIA 3ACLA 3O14A 3E6CC 4Z07A 2OPKA 1I5ZA 1H1MA 3LA3A 4Q0UA 1XE8A 4UBGA 2K9ZA 4A2UA 3EO6A 1RL3A 4IEWA 3NKTA 4UBHA 5J48A 3RYKA 3IDCB 3UKTA 5I93A 4LLOA 2UYAA 2K0GA 4IEZA 4O9EA 1O7FA 3FZ3A 4XF4A 1X7NA 4LA2A 3R6SA 4MGYE 4DINB 3SHRA 2QVSB 1TQ5A 1QWRA 4IEOA 2XL9A 3NVCA 2PAEA 2D5HA 5BUVA 1DZRA 5LRRA 1Q3EA 4XFFA 4JV4A 4LUMA 3MPBA 2BNOA 3H3UA 2GZWA 5C8WA 1ZREA 1YWKA 1WA4A 3PLQA 4JTNA 4F8AA 2UYBA 1NYWA 2FMYA 4MV2A 3SCFA 3OGJA 1OI6A 1J3PA 2Z69A 4XFBA 2F4PA 3U0ZA 2GAUA 3S7IA 2ET1A 5KHIA 2XKOA 4KWJA 2IXCA 1DZTA 4PIZA 1CAXB 2WC2A 4R8HA 4L11A 2BNMA 2WFPA 2GC1A 3ES1A 2E9QA 2DCTA 3SCGA 1X8EA 2PTMA 4K8FA 1QXRA 3LWCA 3USSA 1XE7A 5FLJA 4Z82A 1UIKA 1SQ4A 4XFAA 2XGXA 4AVCA 3JZVA 4TLFA 3MYXA 4XF0A 4RD7A 3DL3A 3HIFA 4WZCA 1DGRA 4AQ6A 2D5FA 1Y9QA 4KWLA 3IDBB 1Q43A 3OF1A 3H7JA 4MGKE 4EWEA 2CAVA 4YSFA 3ST7A 2IC1A 3RDIA 2QJVA 1PMIA 1HW5A 4HN0A 3MDPA 2O1QA 2ZCWA 2MPFA 1XRUA 2GC0A 2IXLA 4IEPA 4I09A 2HJIA 1CAUA 5I0TA 3GYDA 4I0BA 4N9IA 2OZ6A 4META 4MX3A 3HT2A 5JAXA 1CAWA 3CJXA 1O5UA 4LULA 2EA7A 5FPZA 3E6DA 2BGCA 3RNSA 1OFNA 1RTVA 4PIXA 5I8YA 1FT9A 3FHIB 5I0RA 3EJKA 1NE6A 2Q30A 1NXMA 1VR3A 2GC3A 4ONUA 3NL1A 5CVRA 4F7ZA 1LKNA 4PJYA 2XL7A 4XF1A 4XF3A 5CADA 3SMHA 3KGZA 4XFCA 4BHPA 4LUKA 1IPKA 5KHKA 3ELNA 3SCHA 2D93A 3KCCA 2PFWA 3LA2A 4CYDA 4LA3A 1ZRFA 2CAUA 4J1XA 4YYOA 3L2HA 3NSTA 4I2OA 3FX3A 4KL1A 2IXKA 5KBFA 3M70A 4QM8A 2OYZA 3LAGA 4D7SA 3E97A 3QOPA 1J3RA 4ZU5A 1WGPA 1EP0A 4MH0E 4Q0PA 4I01A 4XFHA 4D7TA 1EY2A 1L3JA 1RGSA 3WW4A 1ZRDA 3FE5A 1NE4A 3SXWA 5J7MA 1EYBA 3OD0A 2XLGA 4Q0VA 1UD1A 3WW1A
chains in the Genus database with same CATH superfamily
1H8VA 4BCUA 3HBKA 2UUAB 4CUGA 3DPRB 2BEOA 1UYYA 2K1EA 2DQ0A 4GKXA 4ASUG 1L0NH 3I2HA 2N74A 4X20A 4ES8A 3CDZB 1PO22 1X9PA 3THDA 2XT9A 2RR11 4Q0SA 2B8MA 1URFA 3I8TA 3TNPB 3WP3A 5FQ0B 1OT5A 4NTWA 2GTAA 3NWKA 4CCLA 4WVWA 1VQMV 5JI7A 5HFMA 2RE9A 2E75B 1K73W 1WP8A 3VHNA 3U10A 4QX5A 2QQLA 5FO7B 2DOSA 5CFDA 5KHJA 1OSGA 3ZN4A 4D3WA 2LQTA 5LMNO 1BYHA 1M1KW 4DR7B 1CAXA 3VBOC 4AQ2A 3CIHA 4FMTA 1AX0A 3QBQA 1ZZ7A 3NJXA 4HG6B 3ZPYA 4L2NA 4HSLA 1JOYA 4XEZA 3Q4HA 1ALYA 2A73B 4I30A 3S30A 4CUBA 2ZM6B 1PX3A 3OBAA 5BYNA 1Y67A 4BH9A 2XJTA 3HQXA 3TYJA 2DW4A 5I8TA 3FLRA 4LF9B 5CG8A 1IBKB 3OGIB 5AC93 1V00A 1LU2A 2HBTA 4LPLA 4YG3A 2P22C 3RZKA 1XHZA 2RN9A 3OT7A 1MABG 1US3A 5CEHA 1WB7A 1TEIA 4DRRA 1Q8VA 1L7RA 5LEJA 2QDNA 5FR3A 2HWD3 3KV4A 1JZ3A 3AG2C 1VALA 1Y9MA 3ES4A 1ASJ3 4NYKA 4JI3B 1D5AA 3DXUA 4JV5O 3K9SA 1NCQC 3RN4A 1JI6A 3WQBA 1LHWA 3AKSA 2BQPA 1F15A 3POBA 2A6WA 2PELA 5B1AB 1W8TA 3NV2A 2VO5A 4XYXA 1VBD1 5A3PA 1JZ2A 5DZEA 5CA3A 1PL0A 2HWF2 5J96B 2ZMLA 3LA7A 1MS0A 3CLPA 5B4XA 3IIAA 4D69A 5LMUB 1HRI1 4YHHB 4EWDA 1VIWB 4IV1B 4LE3A 4X8PA 4HK9A 4BOWA 4BLJA 2H3OA 4IGPA 3VD5A 4JTAB 1YTFD 1RP3B 5IWFA 4RS5A 2WBKA 4EWAA 1BJQA 5DAVA 3W9AA 1UPSA 2BPA2 5FREA 5K7PA 4JI1B 4FPPA 1GQGA 3CD6V 2QNKA 5FY1A 2HFEC 4KWUA 2QTWB 3MHHC 3MF6A 3E6CC 5EYPB 4I55A 1DGSA 2GMPA 2GN3A 2WZR1 2VQEO 2IJKA 3B9CA 2AHZA 3ILNA 3SDLA 2AC1A 2W6IG 4A2UA 5ANNA 2VZVA 4AHCA 2AGAA 3TAYA 4X1YB 3WINE 3RYFB 4IEZA 1W9TA 3HBZA 3B3QE 2JGUA 2ZE7A 3B94A 4UV9A 1KS5A 2RG4A 3W7TA 4EN9B 2LM3A 1UMZA 2JD4A 3VOUA 5KC6A 2Y64A 1S0VA 3TEXA 1AR4A 1N36O 4GA9A 4AQTA 4NTXA 1LJ7A 2BOJA 5GONB 2IFRA 3I49A 1VQKV 5ERLA 4BJ0A 1PP9H 2WFF1 1SPPB 3JCIA 3BGAA 3HN3A 3ZFFA 5FLJA 3B4SA 1OFSA 3KV6A 2WAOA 3AG1C 3BABA 4FM0A 2B1GA 4JGYC 3RSJA 2GUZB 4DXWA 2DCJA 2R071 3A23A 3CP1A 4LITA 1Z7S3 1D2QA 4MGKE 1W39A 1ZL8B 4GKYA 4NIGA 4LO7A 4Q6GA 3WUDA 2JG8B 5FV3A 5BY1A 3ZKUA 2VM9A 1XU1A 1C5IA 5JJNB 2DU0A 4H0LB 1GLHA 1VMHA 5FZHA 3STZC 1K5MB 5FP4A 4DW0A 3LE0A 2BGCA 2YS8A 4KMQA 4IE5A 1Y4MA 3LEMA 2WWJA 4TUYB 2PXJA 1AB3A 2ZGMA 1A6CA 4PDLA 1PO11 2D93A 2P37A 2A9HA 3L2HA 5GLVA 4DR2O 1WW7A 3O65A 4C0HA 4X62B 4D7SA 1GQPA 1N33B 3NJYA 2EINB 1BBT2 4YW4A 1KMIZ 4I01A 1RJ8A 1LGBA 1LUWA 3O0WA 4V2VA 1AL21 4FPHA 1MEC3 1UD1A 1RFYA 1AR81 1RMU3 1HNWB 2GDSA 3KZIZ 4K0KO 3THTA 4NWWA 3KHBA 4KU7A 5FKBA 5IK4A 3IZOA 4FZ1A 2RS13 2LTNA 4UYBA 2BCCH 4AEDB 4INDA 4X65B 3EBRA 4GULA 3WF3A 1NR1A 1UQXA 4NJ4A 3RYCA 2P17A 1QJX2 3N4MA 3W59A 5IVJA 5LCWL 3HNBM 5EPAA 1BHBA 1W9SA 1CZSA 2UWBA 3ZN5A 2FCUA 1X33A 5HCAA 4BAYA 4JRAA 2A7AA 4CEWA 2YU1A 2GU9A 3RQ0A 3AM2A 3NV4A 1GQHA 2WNVC 4XQDA 3RG0A 4CDUB 1OCRB 3WB1A 2RS31 3CB2A 4HKWA 4LHNA 4KP4A 3VKLA 1W8WA 1G9FA 1CAVA 3P30A 3J8F2 1IS6A 5B1OA 3K03A 1TG7A 3APQA 3UKNA 1WD4A 5J1XA 4DEVA 5DPNA 4KH9A 1UO9A 4JF3A 1XE0A 4D6QA 2VPVA 2CNAA 4Y5TA 5G04L 2CYFA 1VQNV 1ZZ9A 2SBAA 4UW4A 4UCTA 3FKSG 3K57A 3T0BA 4XCAA 1YCIA 2ZHNA 4Q29A 3D82A 2C26A 3VZOA 1Q7YW 4B3TO 3ROUA 4HAMA 2CWMA 4QHBA 1MS5A 5LMNB 4MS2A 2UXBO 4FFKA 4XUTA 4DV4O 2Q8OA 4AXOA 3OFNG 2E5LO 1M56C 5LHHA 4AQYB 4PDWC 4FOVA 2ZHMA 2ZGSA 4JI6O 1QXPA 4R52A 3LOIA 3AKPA 1DQ4A 3ZR5A 1S77D 1KU9A 2VZRA 1WMXA 2ITDC 3WG7C 2WLPA 1W0KG 1MACA 4XBLA 2A6YA 3SH4A 2ZABA 2VR4A 2G4IA 3IDEA 5C9AC 3IT8A 2OA2A 3H1WA 4J1WA 2V5DA 4KNCA 5FYMA 1CAVB 1E1RG 3IKWA 4IEYA 1REEA 1YFXA 1QR9A 1A8MA 4AHWA 1NTMH 1FI2A 2GN7A 3H01A 1AJQA 4UFZA 3LOBA 4Y1UA 1AR1B 4DUYO 2ZNJA 3WG4A 3LUTB 1LUVA 5T55A 5JVVA 2XUMA 1MZFA 4YJ2A 5L3FA 5LYJA 5KLVH 5A9GA 2IXIA 1DBNA 4XJ8A 3JD3A 3ZFGC 2PHTA 3AYAA 3HN1A 1RUD3 3ZRSA 1HLCA 3O5SA 3RYHB 2Q67A 4QNHB 4Y1VA 1JODA 1HXS1 4JZGA 3EB7A 5J48A 2PHUA 3IDCB 4CEYA 2K0GA 4XF4A 3NV3A 3JATA 2YGLA 4AGGA 2WNUB 1RHI2 3NNFA 2G1MA 5LRRA 1S1AA 1WLEA 3LEIA 4EN8B 1XMQO 2P34A 3CCJV 3VD7A 2FDJA 1NYWA 3GNEA 4G27B 3WB0A 1R082 1N4CA 5JOYA 1NCRA 2BUKA 2GAUA 1JOJA 1WNSA 2JEUA 2ADQB 1H8HG 4Q5OA 1HR0B 4XACA 4YFWA 3ZMZA 1W6QB 3AP5A 2BTOA 2XH6A 5BNOA 1OLME 1VBC2 1OXCA 1F51A 1UF2C 3T2PA 2VMGA 3VDDA 2VQEB 2PYLA 4LH6A 1OJHA 4O2AA 1WA6X 2ZGQA 4RR3A 1ACCA 2EF6A 1BE3H 4X66B 1RVF2 4QXHA 3TXSA 5A3UA 1Y7BA 5FY5A 1ZA4A 3L73H 5BNPC 1RUH1 4OX9O 3LFMA 5KA6A 2HJIA 1KYOF 2WLMA 1IHMA 3J7HA 1RUI3 3OEHG 1R1A1 2XASA 5IJRA 4CEYB 4IIJA 2W9XA 4IT5A 1DQ0A 3ZXJA 4LR4A 3JATB 4PT6A 2J1RA 1W8HA 2W3JA 1QNWA 4AFAA 4RGKA 1S0JA 4XJAA 3WP6A 2BWAA 1YI9A 2R16A 1WW5A 4CYDA 1GICA 1V6KA 3CHXA 4KL1A 1NCRB 1ZUQA 3SYPA 4EB6B 2P3JA 2VQ0A 1HIXA 2C24A 5LA2A 3GXUA 4XIKA 2D6OX 1STMA 3JU9A 1RYYA 5IJ0A 4JDOA 1ZRDA 1W0OA 3M7AA 5D5QA 1SQBH 3BY6A 2V1DA 3CCSV 3ZIAG 1NAEA 2FD8A 4HK8A 5FZKA 4NHYA 4EJRA 4WBNA 1BGYH 3VBOB 4CDXC 1VQOV 1N0JA 3T2OA 5ANQA 5D8AC 3UK9A 1AYM1 3VKMA 4M4RA 1ZBA1 1RUJ2 2WSUA 3K5OA 4RHV2 4KGQA 1AX1A 1GWLA 2NN8A 4FFGA 3BKZA 1K42A 5A1AA 3WZ1A 5I91A 5J09A 2XG3A 4LOSA 3EXUA 3VBFC 1QQP3 2DWRA 3CCMV 4IW3A 4BQXA 4LF6O 3I2JA 1I5XA 4JASA 2PA7A 4JZ2A 4JKKA 2WQ4A 1V6NA 1DGRN 3ZFEC 2H6BA 3D3QA 4CCDA 4LF7O 1BEV2 1GP6A 4CXYA 1P7BA 3ZXAC 5F5IA 3ASNC 1AR61 5FBZA 2FKXA 2UUBO 1YO8A 1M5IA 3NRUA 3ZN6B 1VQ9V 2UY9A 3AG2B 2P7TC 3ZR6A 4K0KB 1JW6A 2D6PA 2OZJA 5LA6A 2YY1A 1DLLA 4XABA 2P67A 1NCQB 2Y6GA 5IJ0B 5CA0B 4KUMA 1M4UA 1OOPC 4NHXA 2JD9A 1OUSA 3E1F1 4YARA 2OPWA 2AYHA 2I2SA 4LO6B 3ZYIB 1XNDA 4W50A 4DRXA 1ULGA 4GKJB 4L0PA 2UWAA 4XF9A 2BFUS 3P3NA 1SLLA 5CBHA 4CPBD 3B8NA 1NH2D 1JCHA 4QIWF 1N8RW 2OT5A 2JDHA 4ZIBA 2W92A 1QVFU 3MIFA 1OLMA 2VBDA 3OEEG 3BTZA 4YM3A 2EJ7A 1YEWA 2ETEA 3K58A 4QB6A 3SJQC 5IK5A 4XJZA 3C2UA 1DGWX 1MQTA 2Z5WA 4FVMA 4JGYA 2QTSA 4FP3A 1W0NA 3T2QA 2VUAA 4AE2A 2HH9A 3MHZA 2W0FC 3FJSA 2ZGKA 3ZHRA 3JD73 2UU9B 4JTCB 5J98B 1NOVA 3N36A 4FQZA 2LROA 2JXAA 3J26N 2WO1A 3K08A 1ZZ8A 2X29A 3BRCA 4M0NA 1S3JA 3DXRA 1HB2A 4B3TB 2EIGA 5FZ1A 2CDYA 2ZT9B 3JBG3 5FFOC 4LOTA 3PMSA 1QXJA 4PD4F 2HJDA 1XXNA 5LBEA 4YFZA 3H1MA 4XBFA 2WL1A 3RYPA 4DV4B 5ISLA 4DRXB 3HWJA 4LLFA 1H0BA 5IYCO 4Q4Y3 4JI6B 2CAZC 2BNNA 5CBLA 1RUOA 4AEJA 1VQLV 4XE9A 2WS91 2Q73A 1VBE2 3KV5A 1YC61 4NE9A 4ZPIA 1AXYA 1N3QA 2Q69A 1H1MA 3CZJA 4CSWA 4FLTA 1IXBA 3KM5A 4JI7O 2ERFA 5BNNA 5DUXA 2NNUA 3AG1B 5EBWC 4LHSA 2Y34A 1RUC1 3PJQA 3Q8CA 1L7LA 2F4LA 4JGYB 2AXTZ 1BQZA 4EZ4A 4AAXA 5KXCA 4K3UA 1Q8SA 2VZ3A 5EXOA 2O14A 4FLXA 1BCCH 4HOOA 2FMYA 1Y4WA 1J3PA 2Z69A 3O1MA 4JGZC 4DUYB 5CIRA 2RNBA 4KHPB 4N21A 1UOBA 3N9QA 4E2LA 2Y0IA 2E53A 1VRH1 5A3MA 2B46X 2VMEA 2XUEA 5FZ8A 2J1SA 3ZIWA 2VD7A 4UW6A 4XHBA 3CJHB 4RD7A 5CKMA 1SFYA 2D5FA 2FYUH 3IDBB 1IDSA 2QQNA 4NB5A 1K4DC 2JG9A 3E8HA 3N2KA 3OBTA 2W47A 4Y1ZA 1PMIA 1CQ9A 4ES9A 2EALA 1QJY2 2IXLA 3GGLA 4GWMA 5DECA 4UW5A 4QDQA 1I5PA 2R043 1W8NA 5E79Z 1OCOC 3EJKA 3GCWA 5I0RA 1CN1A 3U07A 2DJVA 4XOGA 2CH7B 2DQ3A 4MVQA 2BFUL 3FBYA 3KGZA 4W65A 3HKCA 4PHZA 4FTBA 1VMJA 1WCUA 3VBSC 3JAKB 1OLRA 5FMBA 4X89A 3M70A 5KBFA 1ROPA 4B8EA 3ZRVA 4WZFA 4ZU5A 4GMP3 3MO4A 3UT5B 3KCYA 4GWJA 1BT8A 4R50A 2D6MA 2L9LA 2VUDA 1BQPA 4Q0VA 4S2HA 5FWJA 4OX9B 4BU2A 2IJHA 1QNMA 2W5FA 1G1XB 5JSOA 1TNFA 3WB2A 5A7PA 1U0AA 2EJRA 4LH7A 2WNVB 4TXWA 4DK0A 4GT1A 1J84A 1K3IA 1S0IA 1NJIW 2XHKA 2J22A 1HB4A 4BQ2A 3B77A 3AFKA 2JG9B 1LOFC 1C1FA 1FFXB 4CP9B 1YSCA 4X1IA 4OHZA 3JALA 3AYDA 2I74A 3VLBB 2WPDG 4QXCA 2DVGA 3ZRWA 3ON7A 1A8DA 5FXZA 2HWB2 3LIHA 3SPCA 1W3VA 5C6CA 4Y24A 1G9AA 2DU1A 3T0AA 2E74B 1YFYA 4CU9A 1CD3G 5ITZA 2P6HA 2BOCC 5F3EA 3C3VA 1FPN1 1JU3A 2ZX1A 1UYPA 1M56B 1ZRCA 1G86A 4NUBA 3SQOA 5ACA1 1TMF1 2Z79A 4PDWB 1AP6A 3KS7A 4GCZA 4KGGA 2QQMA 1UY4A 3ZMTA 4LF4B 3WG7B 2RM21 4HPKA 1J95A 2CE4A 1VBB1 2SLIA 1BMV1 5C9AB 1Z5WA 1W59A 3DEMA 4U7NA 2EILB 5CNAA 3AK3A 2VWKA 1WMEA 2R063 3BA9A 5EJZB 3GVMA 5EBLC 4K1YA 3T4HB 5IE9A 5FYBA 4DV6O 4X1IB 4MG2A 4XFGA 4H55A 4NHMA 4G4FA 3CXHF 2UUBB 5HCHA 3LD8A 2CSGA 4LFAO 1W90A 3ZRWB 4DR3B 4X8AA 4P9XA 3BCCH 4Q1PA 4FPEA 1UAIA 2IXHA 4UVCA 1VARA 1H4GA 3LEGA 5CMUA 5J2TA 1CJPA 3ZXEA 1YITV 2RS52 4XBQA 4BQ4A 3ME2A 2XJPA 3F5WC 1XJAA 1CAWB 1V9U1 3ZFGB 4AFBA 1U5ZA 4URAA 3ZYFA 2V09A 2VQAA 1F4AA 4QB2A 1EAH1 5JZGA 2W94A 2DYRC 2NZ9A 4NROA 4C8DA 4ASMB 1WUVA 1C3HA 4O4LA 1H38A 3M8AA 2PHDA 1QJZA 1OBNA 1HRI2 2Q8VA 3IM0A 3BPZA 4HPKB 4FPLA 4FFHA 5DN6G 1XU2A 4XTPA 1EN4A 4JI2O 3ZSJA 4XW3A 2E6VA 4ITCA 5FBJA 3RZLA 3UO2A 2X7RB 4AFMA 4MOAA 4A45A 4E4HA 3WV6A 3CJIC 3LGRA 3AZYA 2ZNIA 3ABKC 4CPBA 2Y0PA 3I2IA 1QJEA 2G9ZA 3WDXA 4BISA 3UCSC 1J1TA 3CQOA 5FWEA 2RCVA 4CDXA 1TQ5A 2BBVA 2PQSA 2XL9A 3ZSMA 2PAEA 3OUIA 4K3AA 2GZWA 5C8WA 1ZREA 4XJUA 4FQ4A 1GN3A 1QH7A 3MLKA 5J2TB 5IVCA 4S2FA 4CU6A 2ZJCA 2D98A 1XNRO 3C8XA 2YEVA 4BDVB 2ZKNA 2JX9A 3OGJA 4PA4A 5LBFA 3FB5C 5BNPB 5JCOA 4I9QA 2OQ6A 3UM7A 1DZTA 3CCQV 4FFIA 3RT3C 3MLLA 1FOD3 4UVBA 4JCKA 4O65A 2RMU3 4J7JA 1V9PA 1BL8A 1NA1C 3LDBA 5C4WC 2P6CA 1IGOA 3HR9A 3DL3A 1S0GA 3ZXGA 1Q86W 2WFF2 1DP0A 1JOPA 2OWOA 4EWEA 1LEDA 4WFBV 1UMHA 1IX9A 1B35C 5C71A 3MW3A 3H8XA 1VF7A 5FO9B 1Q8OA 4DV3O 2VWJA 5DABA 3POJA 2YFUA 3AXEA 3OB8A 2LW8A 3E86A 3CJXA 1W8OA 3JD0A 5FPZA 2E76B 1SLAA 2ORXA 3N27A 4CDXB 3ILRA 3ZXLA 3O0VA 5D8AB 1S4CA 2VW2A 2VE1A 1E5RA 4YPJA 1WPBA 1ZRFA 1ZM1A 3AKQA 4QPKA 3ACIA 5JI9A 3W5NA 4XQ4A 2HWE3 1R6NA 3PU8A 1QU0A 4NXMO 1CEZA 4E8CA 1WGPA 3O1VA 5EP9A 2PF4E 4HL0A 3ATGA 4LNUA 1XNTA 3ZFEB 1FXHA 4PV1B 2JDAA 3WW1A 3CEWA 1EFRG 3WG3A 3PHMA 1VIBA 5HI0A 3ASNB 1SMVA 3QACA 4OI0A 1Q8IA 4CXXA 4GYCB 1N34O 3KKYA 1IG0A 1AL22 4ZXKA 3OM3B 1WAZA 5T5JA 3ZHUA 3OUSA 4G2KA 2Q8DA 4QX1A 4XCBA 2P5BA 3WCSA 1OZ0A 1PVC3 5FYHA 1IKQA 5DN2A 1NR7A 3VBBA 4LMFA 1NQDA 1NTKH 2OTJV 4QAWA 1OOPB 2NP0A 2ZGPA 3NJZA 2DN9A 1GANA 5L3EA 5F9TA 4WFFA 1H8EG 4J9ZB 4Z92B 2V7QG 4HYOA 3OAAG 1N3OA 2R9RB 4NPMA 3NMBA 5EIBC 2YI8A 1IQDC 1SFNA 2QUOA 3KZ4C 4EEQA 3S5QA 4QM9A 4AOCA 1GN6A 3QTCA 1LODA 2CL2A 4CCOA 2ZAAA 3OPTA 1YUDA 4GWIA 1KKDA 5FPUA 1HV1A 1MMMA 4P9WA 3RMXA 4CS3A 1AI7A 2ZD9A 4B3SO 2VNVA 4AI1A 1IXMA 1HN0A 3ABTA 2RS32 4P08A 5T54A 3J7MA 3TGUH 5KHGA 1O4ZA 1XNCA 2BGPA 4YJ3A 1KFXL 3ALQA 1Q6HA 4DUZB 4WFHA 1H2NA 3FUOA 2CTWA 2JDIG 2L6LA 5FTTC 3J8F3 1GP4A 2P06A 1JN2P 3LSUA 3ZYGA 4WM8C 1GNZA 4TN7A 5FMOS 1D2SA 1K45A 5A3NA 4ZY9A 3UGFA 1EZVH 4DV0O 1YF2A 4B29A 5IAVA 4QXBA 2YUAA 5GTIZ 1V6IA 2CUGA 2DV9A 3HPNA 4KQ7A 3BEHA 3L72H 3INAA 4CC6A 5BMVB 3TWIA 1QR8A 1Z7S2 4AWDA 1ORQC 4OFGA 1HJGA 1W06A 1RUE1 3K75B 4YRDA 3UGHA 5FK8A 2D6LX 3PN1A 2A70A 2WN3A 3TK1A 1LOBA 3APOA 4ZU7A 2B5HA 3RGBA 4PJ0Z 1HDJA 3R66A 4UWDA 2IW5A 1L1FA 1H1IA 3DKQA 3A22A 2WLIA 1B09A 3MFAA 1D7PM 3OMIB 1D4VB 3K5LA 3VD9A 2JDMA 4BIFA 4YVWA 2NN4A 4A7ZA 1W8FA 4UT5A 4HZFA 1WCDJ 3AX4A 3AP4A 5LW9A 1SESA 3PIJA 4JGZB 1ENQA 3WCRA 3H8UA 1TME3 3GBGA 3GZUC 4P5HA 1GU3A 1GK9A 1NXD1 4YLZA 4OQ9A 1KFUL 2BW8A 4N53A 2K2SA 2BE3A 4ZBMA 4LF8B 4UUJC 1HJFA 1PVC1 3VQXA 3VBUA 1AX2A 3PUSA 2BTVC 4TV9A 2IUWA 5LGNA 2D5HA 2UXNA 3G67A 2ID4A 1YI2V 3BI3A 4Q20A 2WO7A 4CCMA 3MPBA 2RS12 4XBNA 3BVCA 2YBPA 4MV2A 2XJUA 3RWNA 5LWBA 2ZMKA 5B1BC 2XKOA 1I5YA 3D8CA 2QWRB 2QQJA 1NLRA 5L3CA 1C28A 4K8FA 3FHAA 3AG4C 2C2AA 1I08A 5C8YA 3AMNA 1OCOB 2PI4A 2IH3C 4X1KA 3QD6A 4DV5O 5EK0A 2VZTA 1YI7A 2B4KA 5L7OC 4MW3A 2XBO3 1UZVA 4BR6A 4YZ4A 5DG2A 3NAPA 2AR6A 3B00A 1QJU1 2C9KA 3VBSB 2X05A 3R4UA 4GMP0 3GDBA 4CTEA 4FOYA 5DQ0A 4DR6B 5IY5C 5GLWA 3CRAA 5H6RA 1XNRB 4N53B 1G7YA 1RXGA 3WX5A 2ZMNA 3NR7A 5IVFA 3RNSA 3VBUB 1W6NA 5JJEB 5FP9A 2HHHB 2VG9A 3AP6A 4XF3A 2JS5A 4L9BA 5JXGA 3W7UA 2YC4A 2WUHA 3VZJA 5JWPA 1R1A2 5T50A 4XC9A 4LBJA 1MS1A 1REDA 2CAUA 2JIJA 3THOA 3WEZA 4FPGA 1AJPA 4DXSA 5FMOL 3AMQA 2WZPP 5C3RA 3RBZA 1PPJH 1UY2A 4BLIA 1Y74A 4HT1T 1PGL2 4XFHA 1COWG 3DGEA 2WDBA 3DC5A 1QOTA 2P4VA 4IQPA 4XDPA 4FLZA 1K5JA 1HX6A 1AR93 5LP6C 4QPGA 4QQPA 3ZMNA 4NIIA 4WFGA 1RPRA 2YIAA 2AZ2A 1DYOA 4X1KB 1US6A 1XMOB 3U14A 4DV3B 2ZDIA 3I2FA 2UUCO 3M3EA 2GSMB 4QB1A 3J7NA 2X53S 2G19A 2BYVE 3NAPB 4P9OA 2YXHA 3BAAA 2HWC1 4PCRA 1E79G 2ZXWC 5CN0A 1RITA 3KD4A 3D6EA 3H1YA 4DR4B 4AQSA 1AYM2 4JKMA 2JE7A 4JYAO 3RI8A 5KC5A 1X59A 1ENXA 5CYYA 3VHOA 3TN91 4EYUA 1OQ1A 4ORFA 3T4DA 5EHDA 1J58A 5EZWA 2G38A 5JVDA 4QJFB 1IPJA 4PIYA 5DXDA 1N1YA 1G4YB 4QPYA 4YXWG 3K9AA 1H9WA 1TE1B 1V6OA 1M4WA 3ZHTA 1PIV3 1RUD2 1SQXH 1S2EA 3D36A 1LGCA 1FS0G 3GHNA 1FXZA 1Y74B 4DNYA 1BEV3 4DXZA 3FLPA 1TUBB 2X10A 3I54A 1N34B 2GH8A 4AEMA 4DV7O 3UGGA 4DR5B 2FL4A 2YI9A 4CZZA 1RPOA 5ABJC 4K21A 1US2A 3EQEA 1ZNPA 1RSOA 2OCCC 4CCKA 1RUG1 2F1MA 2VCBA 1H8TA 1OKOA 3X29B 2A7WA 4EE2A 2IFWA 5FO8B 1QVGU 1U5YA 4BWOA 1VRBA 5TISZ 1LNSA 2LJ2A 3PJYA 3DKWA 2D7FA 1RXFA 4A44A 5HPOA 4MZUA 3WSOA 2DYRB 5J2UA 1K9MW 2ZGOA 3K77A 2OQ7A 4Q0QA 4QPIC 5A1LA 1O4YA 1AILA 1H6XA 5FLIA 4BIUA 3ECQA 4QHOA 2N7GA 4GH4C 3R4DB 2Q4PA 4B3SB 1NUKA 1GOHA 1Y76A 2W68A 1SQVH 1OA2A 2XMLA 5LK7B 1PZ7A 5EFUA 4QGNA 3H1HH 1OQEA 2PLV1 3CJIB 1IG3A 3ABKB 5FZ0A 5A80A 4LWSA 5IDJA 2ZGNA 2CHHA 2XVLA 1NG0A 4Q4W3 2PMWB 4N90A 2UUAO 1U12A 1VAVA 4X6RB 2EULA 1JFFA 3WFVA 1HKDA 3H8OA 3WW3A 3Q8AA 3LF7A 3A8TA 3I55V 3P5BA 4ZKIA 4YY3O 3AG3C 5FIXA 5C8CC 3O14A 1E5IA 1HRV3 4GZ9A 2VZPA 3TETA 2TEPA 3HB3B 4CZSA 3WOGA 2VTXJ 3VZLA 1R3LC 4AVTA 3W7WA 1KD1W 1Q56A 5A3TA 5C4WB 2WS92 2B9ZA 4FVVA 4DR7O 1BZWA 3KF5A 3DCQA 4MVOA 4N43A 4LUMA 4OHVA 4UFMA 4C0BA 1SACA 2F23A 1Q8PA 3X2QC 2UYBA 4U2AA 1Y76B 4O4JB 1RUC2 2ZM6O 3OY8B 3WXPA 2ET1A 1B35B 4FTSA 2TBVA 4AFCA 3GF6A 4L11A 5DUWA 3JD2A 2E9QA 2DCTA 3MBWA 4R8CA 3OPZA 1JMUB 4GQ7A 1IBKO 4PA9A 3SJAC 1CXZB 4GKKO 2DVDA 4DV2B 1MS3A 3WNLA 2ZCEA 2JGDA 3KT1A 5DEDA 1VRH2 1X4TA 2ZX2A 2V73A 1APNA 4AG4A 2ZOEB 2VNRA 5EJ3A 4CDWC 4JI3O 2QJ1A 3ZHVA 1PGW2 1M93A 2YIBD 1KKCA 1BZKA 2Q9LA 4IV3C 5J36A 1LEMA 1OC1A 1XYPA 4AI2A 2J1UA 4JI8B 4BK4A 4LFBB 3THPA 4WM8A 4N43B 1OPOA 3AZXA 1IOAA 3GCXA 2Y26A 4QX0A 3L71H 5FLXN 4AVVA 5IAXA 3QO7A 1DYPA 2YSUB 5LMUO 4DV5B 1HQNA 4YHHO 4MH0E 4UFJA 5DDJ1 1PZ9A 2CTRA 5FYUA 2YDEA 5KMGA 3UNPA 5BR8O 4BXFA 5E6HA 3SXWA 1UJWB 1UZYA 1R3JC 2XLGA 1GNHA 1OQDA 4Y20B 1IS5A 1W0PA 4FIPC 3BB6A 3WDYA 1ZVFA 2Z42A 1O3TA 3RJ2X 4U3FH 3W21A 1CWPA 1YZBA 2HBUA 3JD72 1MSWD 4B3NA 1Y43B 2LS6A 1FPOA 4I5SA 4BMEA 4A41A 2QDRA 5JPMB 1HNZB 1SG3A 5A6QA 4LC1A 4ZI7A 4TOIA 1Q8QA 3JXSA 4Q4V1 5FY9A 2YXYA 4QKFA 4XIOA 2KM2A 2CGOA 5JH7B 4I4TB 5CA1A 1LAJA 2B42B 1Q5OA 4Y5Z0 2Q1ZB 5KXEA 4EQVA 3I2DA 1GH6A 3I59A 4TTGA 3WG2A 1J5EB 2LUWA 4P9GA 1OMIA 5FLHA 4JAAA 3SEEA 4Q4Y2 4N8MA 4FLWA 3WW2A 2Y38A 1SCRA 3ZEDA 2R49A 2YB7A 4WM8B 3ZMSA 4QKDA 5DUUA 1EUUA 4XDJA 2ET7A 2CTVA 1UCXA 1SEFA 1ULEA 3MIGA 2Y4TA 2X6CA 3NW4A 1IVSA 5DM6V 1SDDB 2RR13 2EIDA 4XMIA 3S3WA 4FAHA 3NQHA 1GTOA 2VCMA 3WDTA 3S0MA 1RUNA 4W4KA 3I3DA 1QGLA 2WYSA 3UQ8A 3M1HA 5KMGB 1VBA1 4EFBA 3M7MX 3VV1A 2BZDA 2DMXA 5APAA 4E8DA 1HQWA 5CBFA 2WNOA 4FXGB 3CPWU 2XOKG 3ZYRA 3KB5A 2E51A 5ACA2 4UV8A 4JYAB 1A78A 1WCSA 1W6MA 2OVUA 1N32O 2VNGA 1MNGA 1PO21 5GZDA 1W9WA 3W5MA 5K9YA 5FP8A 4DRVA 3CCVV 2ZINA 1TAEA 1QLNA 1BMV2 5DAWA 1B04A 3OG2A 1ONAA 2QZ3A 1F8VA 1LOAA 2VS0A 2ADEA 4C91A 3OTFA 5I0UA 5CA1B 1OA3A 3N7MA 3I59B 3USUA 2BDRA 3IMNA 2WLNA 1WCKA 1LHUA 3RZHA 1C57A 4IEXA 5LHIA 5A7QA 3AMMA 3KF3A 4HLTA 1V54C 4JGSA 2ILMA 2PYTA 4BYYA 3OJBA 1VQ8V 1G6NA 1KECA 1T2XA 4RQEA 3WNKA 1ND3C 4EFEA 4FM2A 4X62O 3DPRA 2R042 3LCPA 5FYSA 4AL9A 5GZEA 1BHAA 1U5XA 3F2ZA 1DCSA 3U4XA 4MUVA 4UXNA 4WVMB 3RWRD 4IESA 2LW7A 1SBDA 5FQ0A 4H44B 3FX7A 4COVA 1HNWO 2JB8A 1G9BA 1UWWA 4TV8A 1HQLA 1VBD3 3SYCA 1PGSA 2QQWA 3TBDA 2VQFO 1WBFA 1UZWA 5B1BB 1O9HA 4WF9V 4X65O 4IE7A 1HNXB 1NU1H 1NLQA 4QPWA 4Q0UA 3VKNA 4AHXA 3EO6A 2F66C 1LNQA 4PF5A 2VQTA 4NRMA 4QWNA 3N9LA 5EYYA 1W6PB 3ACFA 1YIJV 4QX7A 4ET7A 2Y60A 5FZOA 1JZ5A 4MVRA 3OBRA 4IE4A 3USUB 4UOJA 2P1BA 3N3HA 4TWTA 4KG8A 5L7OB 1DZRA 4Q8KA 5FPRA 5CKQA 2Z3YA 2RDSA 2HWF1 4F8AA 2D2CB 1K34A 5EJ1B 4BZ4A 5JXJA 1FV3A 2DBIA 1ST8A 4WM7C 3LSDA 4O4IB 4PIZA 2W0XA 3AP7A 4OMCA 2WZR3 2WFPA 5IY5B 1B06A 2RV9A 2I07B 1GN2A 3T1YO 4YY3B 2EICA 4CH4A 1NT2B 4DUWA 4YW1A 3CYOA 4QPJA 4WZCA 3E8FA 2HLEA 3RZJA 4KWLA 5L3BA 1PMJX 4TV8B 4OUSA 4PQQA 4GLXA 5GTHZ 3T2TA 2DE0X 4P9JA 2QJVA 4F6RB 2MPFA 3JYCA 5LXTB 2AREA 1HV0A 4E27A 2OZ6A 4AQYO 2HR3A 5JAXA 2WFF3 2QFEA 5ABJA 5LP6B 1JYXA 2Q1MA 2D43A 4UCOA 5FZOB 3AMHA 2GMEA 4IV1A 4MGSA 4P9YA 2EIKC 1P84F 4XJWA 3UETA 2R073 1EN6A 4CH3A 1YXWA 2R062 2VW1A 5KHKA 1F5FA 1FNZA 3SCHA 3SPGA 2D97A 1M06G 4GKKB 3A21A 3FX3A 1F7YA 4Y22B 1GUIA 1LHVA 4QM8A 3F7YC 5EV7A 2ZXWB 3AVRA 1EP0A 1CPMA 5FZ3A 1L3JA 3WG1A 3TRSB 2FZ2A 2UWCA 3VUOA 3ZLIA 3ETDA 1MG1A 3K4AA 5FYVA 2ZZJA 3TEWA 5EYPA 5G05L 1ZWIC 2HP8A 4LBEC 3H50A 4Y5SA 4L87A 3UKVA 4X1YA 3RYFA 3MW2A 4YM1A 2NYYA 5L3DA 4MXWA 1PO13 1V70A 2PYJA 3K51A 4CDQC 5A70A 3H9VA 1D4M1 2VVEA 4JC1A 3RRDA 4BQWA 4HBNA 1AVMA 2A3WA 1GZCA 3WD5A 3L70H 2YPJA 5ABJB 4JKLA 2R70A 1AL23 2ZX4A 5LASA 5B3SC 2XDVA 3ZKYA 5GONA 2OCCB 4L8QA 1AR83 3RMYA 3ZX7A 1UY1A 1SPPA 3J7LA 4XXPA 2YIBA 2JDKA 4QQLA 5BR8B 2A6VA 5K0UC 3VZKA 1LCLA 3JAWB 3I7DA 2GUZA 4QU2A 1COV1 5EQUA 4XDQA 1HR0O 4AFDA 1V55B 1QDCA 2OT7A 2XTAA 1ZX5A 1BBT1 4YW5A 3T1HB 1LOGA 1OHHG 2A71A 4ZHNA 4QPIB 1ZL8A 3UKMA 1G8WA 4B7KA 1UYZA 3VL8A 3K04A 3GZAA 2XWJB 1DQ5A 5LY1A 2JG8A 4Q8LA 4C1WA 4YVSA 2QQPA 3FAVA 4H14A 4NN0A 1FNYA 4M0HA 3WNOA 4KWKA 1F23A 3L75H 4GH4B 1POV1 2UXXA 1K5MA 2VOTA 3E8BA 5BXXA 4X66O 2D6NA 2Z2SB 3M3IA 4MXWB 1JUIA 3PIGA 2JENA 5F2VO 2RS33 4K6BA 1YYNA 3C7EA 4ZZ5A 1FOD2 4TUYA 3FL7A 1QJX1 3NNJA 4BWAA 4CE8A 2RMU2 3WVJA 2C9AA 4NIAA 2V4VA 3M3CA 3WUCA 4XETA 3AK1A 3WNMA 1AYN1 2ZEZA 4IUGA 4CS4A 1VQ5V 2OS2A 4AVBA 2B45X 2XWBB 4Q26A 1KQSU 1YFUA 3GALA 1K12A 3VQYA 2GDFA 1GM7A 1PL4A 1PD3A 1AJNA 4KI5M 4FAGA 3AG3B 3BTYA 3GWKC 5C8CB 3ZYJB 1VQ4V 4LTAA 3LDEA 4LNVA 1WN7A 2JB4A 2J7MA 4LP8A 2D44A 4YIOA 3G7DA 4MSWC 1N32B 2X8KA 1ZZCA 3E6BA 4ABMA 5FMDA 4AEDA 1O6UA 4XDKA 1A32A 1UZZA 4YVSB 3G80A 3K5MA 4DO0A 3FAVB 2PGGA 1O3RA 1QKQA 4N9HA 4MVSA 2ATFA 1LHOA 3BCWA 3CL1A 1KDKA 2HWE2 1LU1A 5FZFA 4IGQA 1FXKC 2O57A 4CVUA 2XAHA 4UW3A 4GB31 2JDUA 5F39A 4UCVA 4CDUA 1ZRIA 1K5QA 3O1SA 1JX9A 3ICXA 4A4AA 3FZ3A 1T6BX 5H9CA 3HQUA 3K46A 4MGYE 3SHRA 1FXVA 1QWRA 3I3MA 5A33B 3I3BA 1BVP1 1W2OA 2Y6HA 5DZFA 4XFFA 3MD0A 4DY5A 2IU0A 3KCXA 4JTNA 3TOJA 5CBGA 3VQVA 1IS4A 1OI6A 3U0ZA 2B1IA 1MZ6A 1PVC2 2QWQB 1VE0A 2R6QA 4UB8Z 4E4EA 1GOGA 4RQPC 4CDWB 2IXCA 4R8HA 2YROA 5KAFZ 2ZX0A 4IE6A 3T2MA 1HXS3 1PM9A 4IV3B 2VQFB 4TLFA 5FYYA 3IAYA 3Q8EA 5T5PA 3ZDVA 4M3CB 4GKJO 3CRQA 1I3HA 3OMAB 5EZYB 4LIUA 2RQ6A 1FD9A 3MDPA 5CFDC 2QQUA 4HZ3A 3B01A 3I97A 1FMD1 2CDOA 4J80A 5GZGA 4CXWA 1DG6A 3WHTA 1UMIA 4XQWA 3URFA 2Y69C 1QJU2 4DXRA 4JI0O 2VZUA 3E6DA 4PIXA 1RTVA 1XPWA 1ZYBA 5IT9N 5E89A 2Z4FA 3CSXA 3T09A 1VR3A 1RHI1 1LOCA 4FJCC 2A1XA 3T1YB 2UXCO 3ACGA 4TZDA 2UU9O 1B6QA 1R081 4MHRA 2XONA 2Q5TA 3CCRV 3H42B 2JS3A 4PELA 1RUH3 4D7TA 5D2AA 2W39A 4AAPA 2VOXA 2WO2A 4QHZA 3OYWB 1SERA 2VNOA 1Q6IA 1R1A3 1VBC1 4JZRA 3BIEA 3HKBA 4GJZA 3RYHA 2WQZC 3RVYA 1ENSA 3SNMA 1W03A 3RPQA 1JXNA 1TZOA 1GV9A 4JQTA 4QE9A 1Z5VA 5LOVB 5FNVB 3A0HZ 3J4UH 1AXZA 4JAVA 3K5NA 4XAEA 1RVF1 1ND3A 1UW8A 1YIPA 5GJ6A 1QEXA 2WNUA 2GHYA 5FY0A 1GZTA 2ZBJA 1SZTA 2MHFA 4MVMA 3PUHA 4EN6B 4ASLA 2XNDG 1KBHA 5FZMA 5JOWA 4Y26A 1QOSA 4QU1A 1RC6A 1CP9A 2YMZA 3F5TA 4CRQA 3SGIA 2HWC2 4GX0A 2WIIB 2YUEA 1W6QA 2VU9A 1CPNA 1AJOA 5LA0A 2DTWA 1AYM3 2E26A 1TME2 5KHHA 2IJJA 1CZVA 1ZBA3 3TXQA 1MZEA 5F2WA 2VMCA 5JCTA 3TN92 1DGLA 4XDOA 2YC2A 4I0WB 3HKDB 4KHPO 1FAFA 4ARXA 4NMIA 4DY3A 3KGLA 5IK8A 3SYQA 2KB1A 1SS3A 1ZBE3 4RS5C 5B2GB 1W2NA 4LBLA 4JI4O 5GLUA 4FOQA 2HLDG 2ARXA 2UURA 1AR73 3N9MA 2GC2A 4NHKA 5LB6A 5FY8A 4YNIA 3GJAA 4OULA 1AJKA 5EC2C 3HKBB 3FWEA 3MUZ1 2VZQA 2YPDA 5FUPA 1Y66A 1AR63 1V54B 2RJZA 4NIHA 1RUJ1 4MTOA 5BV6A 2M6YA 1GO3F 1V6LA 1ND3B 3UO3A 2RVAA 3A0NA 4XURA 1NLSA 1RUG2 3AKTA 3E5XA 2HEWF 2JEMA 1IBLB 2ZACA 4R9CA 5I0SA 2E7AA 3O1RA 4IE0A 2P4KA 2ARAA 1XOUA 4EB6A 3MI8A 3EFFK 1JYIA 3DN7A 2XBO2 4LHKA 2BOIA 4OUMA 4DFSA 2XQRA 1C8NA 3R65A 1I0HA 3P1IA 3R4SA 5E16A 4EN0A 3DECA 4OUEA 4KXRA 4RUEA 4ZOLB 4OI4A 1FX5A 3ZFFC 1QU7A 4LR3A 1GRJA 5LA9A 3VBOA 4FK5C 3SISA 1PK6C 4P9LA 2WYFA 1WA8B 3ASOC 3EVKA 5L3GA 4N23A 3PTRB 5JOZA 4R4ZA 1S0EA 4JQRA 1N1TA 1RM1C 2YU2A 3D0JA 3EHKA 1JHJA 1J3QA 3ASIA 3PVBB 2NQYA 1S5JA 4NRQA 4ATEA 1IBMO 3RYRA 4AW7A 3OSDA 3Q9OA 2DUOA 4OHWA 2XJQA 5CISA 3CRCA 3ACLA 1XBLA 3JB4C 1DF5A 3CMAV 4WVVA 3N7JA 1AR92 3H3LA 3L2YA 1RUF1 3NKTA 4EZHA 3ZN6A 5A2QN 4SBVA 4U36A 5DG1A 3CNAA 3KT7A 2PHWA 4LBQD 4DEQA 1WMFA 1POQA 4HNAB 5GALA 1X9TA 5J9PC 2QM7A 5A1FA 3VQWA 3OE7G 4MHUA 4FM1A 1NCQA 5CA0A 1EUTA 1YWKA 3PLQA 1U97A 3U37A 4Z8BA 1H1AA 2ZE6A 3LPGA 1OH4A 2JDPA 3POFA 2OX0A 2WS93 3CEIA 4YM2A 2ZPXA 4RN5A 3EHBB 4AVSA 4R4XA 2EXKA 3LWCA 1XE7A 1REFA 3BYWA 4D7YA 5KUKA 3N2GB 1JJ2U 4LF4O 3TB0A 1R3KC 1RUC3 2EIKB 2BRTA 1ZBE1 2B39A 3O0XA 1DGRA 5IJ9B 2J1EA 1AI4A 3K2OA 1AR71 1UZ0A 1Q43A 1PIV2 4ISQA 2BOBC 5K0UA 3OTOB 4BB3A 3P3PA 4LQRA 3BTAA 1V0AA 2IC1A 3C90A 1S0CA 3IIIA 4YGBA 2DDUA 4PDVA 1OVSA 3MICA 1R091 3ZMOA 1VBE1 2DCZA 5F5QA 2ATKC 2ZIOA 4JAUA 4CCJA 4PLOA 1Y9GA 3GYDA 4CEWC 2D6KA 4QQOA 4PLNA 5CB4B 2AH2A 1VRH3 4DR3O 4LULA 1R1BA 1ULPA 4CC5A 5LHGA 2PN5A 4MTFA 4B3MB 5CADA 4YZ1A 3CC4V 3FN9A 3NNMA 1VAMA 4ZZ8A 5IHRA 3ELNA 2ARHA 4XJ9A 2XR4A 4I2OA 4LCUC 1LTEA 2OYZA 4CDQB 2P4EA 4Q0PA 1N1VA 2R72A 4FOWA 2BERA 3HAGA 1K92A 1QQCA 3J80N 2EXJA 2FDHA 3JASB 3SITA 4JYBA 2FDKA 5B3SB 1W6OB 4QX3A 2P6JA 2OTLV 3ZM8A 1YJLA 2OYQA 5K0UB 3ETGA 4JI0B 1LB2A 1VLNA 4HKOA 2QCSB 1I6XA 2A5ZA 1KC8W 4XMAA 2F4VO 2VAUA 2P90A 1SCSA 1ENVA 1WW6A 4Q4W2 3WHUA 4C1XA 4U3JB 2PY5A 4LKFA 1BLZA 2VCAA 2UXCB 1SFPA 2ZKLA 3N7LA 2BV4A 5BY5A 1JQ0A 3AYEA 5CAZA 1EV13 2GH2A 1O3QA 1JA8A 2KQXA 2ZKOA 4Q4V2 1GYKA 1H2MA 3KG2A 2VVFA 3SKVA 1XQ8A 3KSCA 3WP4A 2GP5A 3JD4A 1HRV2 4F6EA 1UIJA 4WFAV 5JDBA 1FXKA 3CJHA 3JD1A 2G9FA 4Q27A 3UL2A 4CS2A 2F93B 5A3OA 4I50A 3T1CA 2RDRA 3N7KA 2FMLA 3RVHA 4TLGA 1FYJA 3SH3A 3EYPA 1FFTB 4E2SA 1Z78A 4IGGA 4BPZA 4QGLA 1P7GA 3VB9A 4U7OA 3WLUA 2DYCA 2AACA 1JUHA 2G9GA 4DZGA 1VBA2 1R1ZA 2OKXA 4NXNB 1ULDA 2VOVA 1W28A 4DOUA 3HNYM 4RQPA 1O8SA 2CH7A 4UFKA 2ZGLA 1FPN3 4BE3A 4QD2A 2PAKA 1O3SA 4O2BA 1H4HA 4W8JA 5FPXA 5IWAB 1N0NA 5ACA3 1TMF3 4ISRA 3JAKA 2JKBA 2C0ZA 2HWB1 1NCRC 1DZQA 5C7GA 3UT5A 1SDWA 2RM23 4OHXA 2EIMC 1VBB3 4NHLA 1UX7A 3ABUA 5CFCC 4JI4B 4PBPA 2DYSC 2ZGTA 3ZMUA 2VXRA 5L9RA 3IDAA 3U78A 1KITA 5BNOC 1WP7A 1N3PA 4TSFG 4XAAA 1FXKB 1GNYA 1X8MA 2DUQA 2WNVA 3VDDC 2BTQB 1VP6A 2W1UA 1IS3A 1NZCA 4I50B 2R9IA 5D1IA 1FFXA 1ZZ6A 4CP9A 1S5HC 4RR3C 2KG7B 3VBHC 3L9JT 4JPRA 3ZJZA 3AZWA 1V6JA 4QX2A 3ABMC 3KT4A 4Q4X1 1HDKA 5LK5A 4P9PA 3HKEA 4H13B 2ZHLA 3OGCC 5T5LA 1LECA 2W95A 2D40A 3JARB 5DUVA 5FPOA 5FY7A 2VOKA 4RQPB 3JAMN 1V9U3 2JDYA 4EKWA 4CP0A 3LA3A 1D0HA 4UBGA 1DDLA 4J7KA 4BQ1A 4O2BB 4NRPA 3CE2A 1EAH3 4Y33A 1YJNV 3OUHA 1SQQH 4X20B 2QKCA 3CS5A 4NIDA 1OF4A 2J1TA 4CH6A 3OW2U 3R6SA 3PJSK 3T08A 2QVSB 4JYYA 4PDMA 3JQXA 4OI2A 1BVVA 5KWRA 5BUVA 4PDWA 1MOFA 5E1AC 3J7AU 1P49A 4YGDA 4WFEA 2RS51 1EV11 4Y1XA 4LO5B 2DCKA 2F4PA 5CFDB 4PDRA 4KWJA 3QCWA 1SKVA 3PL0A 5C9AA 3BOPA 1CAXB 1F9KA 2WC2A 3CMGA 3ORJA 2Y69B 1QXRA 1IBMB 2DWDC 5FZIA 4Z82A 5KUMA 4AVCA 5SV8A 3Q4HB 4FFBA 1QLEC 5J37A 3SEPA 4BQ3A 4DUZO 1UXXX 2KKWA 1QHDA 2CWSA 3MW4A 4BQYA 2CAVA 5GKAC 3HKEB 5IFPA 2WRAA 1QDOA 2RR12 1B3QA 3KLSA 3IC7A 3E8GA 3ETPA 1NQTA 2EAKA 1GZWA 4I09A 2GNBA 3AZZA 3WDUA 2E31A 1TVGA 1R6TA 5I0TA 4AYUA 5E8AA 3GZEA 1CAWA 3ZFGA 4DR1B 2K9PA 3OGSA 1SLCA 4D94A 4ONUA 1S0BA 1I94B 1MS4A 3LB9A 4MXVA 1HW7A 1K8AW 4YW2A 2CK3G 4K8RB 2KD7A 1OLQA 1SQPH 3B7MA 1ENRA 4LBQA 1DQ6A 1OHFA 3Q8FA 1OF3A 3E97A 3BUCA 4DO2A 1M9NA 1Q81W 2X09A 1IKPA 3OD0A 4WCEV 4FFBB 4EROA 4JYCA 1Y6XA 1MZ5A 5F3IA 1GKBA 4KBBA 2OW4A 4IHJA 3OGVA 2XVKA 3CMEV 3HOBA 3LKJA 3H1IH 2WT0A 1PK6A 4MW8A 1O5LA 2P5OA 5K1PA 1MQTC 5JSPA 1ZSPA 1GZWB 5GLZA 4FPCA 4RS5B 4MO3M 4KFMA 4WVZA 5AC91 4COUA 1DK1A 4LF8O 3O1OA 2RDQA 5BNPA 2JJ2G 2VULA 2EXHA 4D8MA 3FC0A 4PI0A 4AHYA 1DFQA 1D4M2 4DS0A 1VBD2 4I55B 3E5QA 1YHQV 2UXDO 1CX1A 4A6SA 1KXGA 2HWD1 2LP7A 4S2GA 4J11A 2Y6LA 3OOXA 4K8ZA 5L36A 4LBQB 2QE3A 1ASJ1 2Q0AA 3CRMA 1YJKA 1GBGA 5IYYA 2H6CA 3WF1A 5JPNB 1PNFA 1NTZH 1F35A 3U75A 3E22A 1T6GC 4NVPA 1WLTA 3I2GA 4CP2A 3T1MA 1FJGO 4ZXEA 4OI1A 4RAIA 1COV2 2F4VB 4K35A 1VB4A 2YBSA 2EX3A 1X82A 2FHRA 4RSUA 1VP7A 2CTQA 3OD4A 4FPKA 3BU7A 4IHJB 3NNGA 2DFCA 5F5CA 5F2SA 4X8NA 1DLBA 3ZFFB 3V65A 5FYCA 4QMAA 5BNNC 1AI5A 1PK6B 1EZJA 4LFCO 5LRSA 3ASOB 4E2QA 2WZR2 5D8AA 4O4HA 2L35A 5LGTA 1JYTA 5LZ6A 1X36A 4YW7A 3ZMVA 4DR6O 1AF9A 3ZSEA 3KQRA 3K4DA 4CBCA 2R7EB 3LDDA 1RM1B 3E5UA 5L19A 2EIBA 3VBFA 2HHHO 3C7GA 4NR1A 5F1RA 2J1AA 1SQFA 2NLRA 3MPPG 4UCSA 2IBZH 5FYIA 3ZFEA 5FUNA 4DPNA 1K7DA 4FPYA 1AYN2 4YW6A 4AI9A 4FPFA 2WSSG 4DXTA 1UPIA 1LOEA 3E22B 2XLAA 5T3NA 1XREA 2KXLA 2VL4A 4MGTA 3MV11 2JG9C 4QXKA 3AYCA 3POYA 5L73A 1C8M3 1IQAA 5LL6Y 3H7YA 3JB8A 2R072 3J81N 1HB3A 3ZSKA 3K4ZA 1XMOO 1VMGA 3C3SA 1OOPA 1XYNA 5HV0A 2WJSA 2Q7HA 1JZ8A 2VVDA 5FOBB 1RUE3 2GNTA 2YYOA 4FT8A 4YWAA 3A0RA 2GSYA 3QG5A 1WB8A 1A34A 3I5DA 2ZX3A 2VUCA 2VRZA 4O4HB 3OBZA 4DR4O 3H1KH 5DZGA 4RL7A 3RYKA 3UKTA 1R64A 2XHBA 1NVPB 4DINB 1UU5A 4HFSA 3LDKA 4IEOA 4LBMA 2ZA9A 4N7UA 3VBFB 1Z7S1 4GB32 3RYCB 2MEV3 3K0DA 2BNOA 3H3UA 2ETNA 5HXVA 1UX6A 1PO12 4BK5A 3ETEA 4FP2A 5F7UA 2V72A 3SCFA 3WDWA 2A6XA 4XFBA 4YG0A 4UVAA 4AI8A 3IFXA 5KHIA 4LKDA 2ZE5A 1NY71 1KP2A 4P2ZA 4CEWB 3MV01 2GC1A 2VBBA 3D3IA 1WBLA 1UIKA 4DR5O 4XFAA 2EILC 3JZVA 2JE9A 4G3YC 1GM9A 1AR82 1AI6A 1WLDA 3JCZA 1WWYA 1UY0A 3VD3A 4KG0A 3PUIA 4CA9A 4YSFA 2CTPA 5IW0A 4R7CA 3T4ZA 1F4HA 4JDMA 3OGGA 5BMVA 1KEXA 1JTZX 3PVEA 2JKXA 5HCFA 1FAYA 5L9VA 1XHXA 5DAXA 1XUQA 3PUAA 4I0BA 2QKAA 4JV5B 4C7UA 1AL0G 4MX3A 1VF5B 1UU6A 1A3KA 2H8PC 1MEC1 3B69A 5HXMA 1RMU1 2VW0A 3RS6A 4Z1MG 4LT5A 3UESA 4COWA 3FB8C 4XUOA 2HKOA 3OR6C 3NL1A 1FMD2 4TYSA 5CVRA 4BW5A 2FDIA 4PJYA 3SPIA 3V56A 1SF9A 2RS11 4FPJA 1SZXA 2W1SA 1IPKA 3SPHA 5B4NA 3IJ4A 2DF7A 4CCEA 2VOWA 2PFWA 1I1EA 2F43G 3CU7A 4J1XA 3CKHA 3GJBA 2Q7GA 1QJU3 3HEIA 4C90A 2P2KA 4CU7A 3QOPA 5IUQA 1M57C 2ZHKA 3D3AA 4ASKA 1W05A 3OUFA 3C7OA 3FE5A 1MA1A 2WA3A 4JGZA 4ZONA 4P02B 1GFF2 1W0JG 2A6ZA 3LSSA 3O7OA 4M01A 2ZEXA 5CFCA 2I45A 2W46A 1JR9A 3KWVA 4HANA 3VHRA 4A6OA 1MPXA 1QIQA 2XVGA 3B40A 1C8M1 4SLIA 2RDNA 1CONA 2ODMA 3LFIA 2C6SA 2X5IC 1VJ2A 1W2UA 2GMMA 4K7JA 3FFQA 1JYVA 3HT1A 1XYOA 3ZN0A 3DYPA 4LEJA 3VBHA 4HONA 4LK7A 5CZKA 4YJ2B 3G6JB 4MGIE 4HVQA 3APBA 5LYJB 3CXCU 1UKRA 3WF2A 2AEZA 4OXSA 4R9BA 3D0SA 5D5PA 5K4LA 5EIBD 5FZ6A 1J59A 1R73A 3M4FA 1D2DA 4B3RO 4XUNA 4ZKTB 4MVUA 5JZGC 2R9AA 3PDQA 5FZDA 3MZHA 3EMRA 1JOBA 3VKFC 3MAQA 1N36B 2MEV1 2HWC3 2V4AA 1KD7A 5FPAA 3JSNA 2JE8A 1PGL1 1C4RA 1NT0A 3AXDA 3VZNA 3ZSLA 3VBSA 5KX5A 2Z5UA 1QOOA 2Z0AA 1YQCA 3CWBH 2QM4A 4XPVA 3QF7A 1XB9A 1J83A 4MVTA 4FBFA 4DV2O 1SETA 3A0BZ 3TN93 2CGPA 4AGVA 2WLLA 2EIMB 4K8XA 5H9PA 5CFCB 2DVBA 2DYSB 2HEVF 4HN1A 2D3RA 1DGWA 5IVBA 4JHTA 5BNOB 4IERA 1VAKA 2X0LA 1VQ7V 1L8DA 3ETQA 3PVOA 2DWEC 2P3YA 5FZBA 3VDDB 3RJRA 2UXDB 4AR2A 2JJ1G 4O2AB 1HXS2 1LOFA 5FPVA 2Y6FA 2QKSA 4RR3B 4Y3OA 3VBHB 2AGSA 3AVSA 3K48A 2Q4SA 3UJQA 1ZRRA 2KA3A 1TA8A 1E57A 1YQ5A 5FZEA 1YTFB 4JI8O 5JCOC 3ABMB 4LFBO 3FLTA 1W2BU 3IBMA 5H9SA 1L7QA 2QWOB 1RUG3 2Y6KA 1PVXA 5C5UA 2EZOA 3JQWA 1FJGB 4GIQA 4DR2B 1RUD1 4IIJB 3LPFA 4K20A 3ZCCA 2DURA 1KUQA 1JYCA 2HEPA 2Q5ZA 5BPXA 2FCVA 2QQKA 5KX5B 4IGOA 2LGQA 1O8PA 2MW2B 2RJ2A 4LFCB 3NJVA 1XL6A 2XB6C 3DYMA 3JSLA 4IL6Z 4H37A 4G9SB 5FXXA 3PTYA 3S3XA 1K5SA 4S2DA 2WLLB 5JXHA 5JIAA 1H30A 5JQGA 5A6YA 2LFRA 1HNZO 5I0DA 1RUH2 4P14A 2OPKA 1I5ZA 4WBNB 4BA6A 4LO8A 1OVPA 2K9ZA 2PLV3 3ZRXA 3I3QA 1MVQA 4UBHA 5FZAA 5H9RA 4V1PA 1F4NA 5BNQA 1QF3A 4LLOA 4O9EA 1QLEB 2E7QA 1O7FA 4LA2A 2IH1C 1J5EO 2HEYF 1H6YA 4JV4A 4M4PA 1TUBA 4NKGB 2AEYA 1WA4A 1RUF2 4OZOA 1O59A 1JHNA 3R0RA 2VZOA 2NR5A 1E1QG 1VPHA 3ABLC 4X64O 4NPLA 2AUYA 4ZS3A 5GZFA 1RUI1 2BNMA 1WMDA 3H1JH 4PBOA 4QE7A 1OURA 4LKSA 3POWA 1N47A 4AEKA 2IVJA 3A4UA 2XOMA 2JDZA 3S5AA 3C7HA 1G8MA 3HIFA 2ZIMA 3B8MA 4UI9L 3OF1A 4QQHA 3D4KA 5LA6B 1ZBA2 2EIJC 2QEXV 1K97A 4XTMA 2JK5C 2WLQA 5JQGB 1YQ2A 4HN0A 2ZCWA 1AUYA 2GC0A 3QH7A 2UXBB 4IEPA 1ZBE2 1QH6A 2E5LB 5C93A 1DU3D 1AR72 3VL9A 1W3XA 3BVOA 5F37A 2E33A 5LBQA 5AVAA 3DXTA 2LFSA 2A75A 1R092 5FPBA 2BWCA 1Q90D 5I8YA 1FT9A 2JDNA 1P8JA 4HKLA 3HMYA 1DIWA 3CJIA 4FLVA 2ARCA 1KJLA 5JOXA 1AR62 1GWKA 3GWOA 1ZLZA 3B5LB 3MFCA 4XFCA 2QA4V 3G4SV 1PZ8A 3LA2A 4LA3A 4FSJA 4BQ5A 1XNQO 1E5SA 3ACHA 1SC5B 1SLTA 4NO4A 1AR5A 1MQTB 4ARYA 1QQP1 2ZR3A 1EY2A 3HR0A 3O1PA 4L99A 5KAIZ 2QTOA 1RGSA 3WW4A 3ZOIA 5FXVA 2EIEA 2PHXA 2TNFA 2W08A 2BBAA 4K9SA 5J7MA 3TJTA 5FZLA 1AHSA 3JCUZ 2OIGA 4Y4YA 2D3OW 2ZQMA 3UJOA 2W6JG 1GN4A 3DXRB 3K59A 2YV8A 3RZZA 1NA1A 5C4WA 3RVZA 4MVZA 3CZUA 1URXA 3FFZA 3ENRA 1HNXO 3LQCA 4MLOA 2R30A 3N9PA 2RJKA 5DDJ3 2KSDA 5A6XA 1QBZA 1PGW1 4XVHA 5E1RA 3RWKX 4O4JA 3C3TA 4B1LA 3OY8A 1MSDA 1B35A 1QJFA 5BZBA 4CUAA 2B9UA 3I56V 1VQ6V 4LBOA 4E9KA 1XMQB 5A6ZA 2WABA 1GKFA 1XQNA 2V5YA 4ATFA 2D3PA 4BIOA 3O9OA 2GBOA 4YW3A 5BNNB 5FP7A 4K40A 3BALA 2PHFA 3ZYBA 4W4ZA 5C5TA 3LIGA 5LBCA 5CKNA 3HPLC 4OMDA 4XXAA 1OCZC 4TSVA 4Q4V3 4YVWC 3ZX6A 3IMMA 2Y33A 4RQFA 1OD5A 5JMOA 3MIDA 3WNPA 2CGNA 2JEXA 3A2FA 4FLUA 3HNMA 2WR9A 1NZ6A 3TCUA 2N04A 3JD71 5K8SA 4IYIA 1OV9A 4BIZA 3AP9A 3WNXA 4X9QA 5B1NA 4AI3A 3DV8A 2IJIA 1NA1B 4N53C 4P5YA 2WSVA 4YM0A 4LO4B 1CJDA 1F31A 2BVVA 3VBUC 5FKCA 1S72V 1F4MA 3JBG1 4XUQA 2QGNA 3F95A 3TNQA 4B3RB 2EAAA 2W2IA 1WJZA 2A0LA 3UT0A 2WWUA 1YQ6A 4N7IA 1PNLA 1VBA3 3KV9A 3N2KB 3OEAA 4WBBA 3POIA 1SRYA 4R9AA 2FQPA 1K33A 4Q4Y1 2Q0OC 2BJSA 1YFWA 5F6LB 4MGZE 1RIRA 4JTOA 2ZGRA 4OGQB 5IFTA 3I4IA 3W20A 4UCUA 4Y20A 2QQIA 3GB7C 1UOGA 3WU2Z 1PO23 1UL9A 3WF4A 4LE4A 2HKXA 1NX9A 3B93A 1E5HA 2AZ0A 2GP3A 4E2GA 1R6KA 2YZ4A 3HKCB 2QE7G 1NI8A 4L97A 3VGIA 3NAPC 3V0BA 4QDRA 2E7TA 3AZVA 3B9IA 4KBZA 1XL4A 4V2WA 4JVAA 2GNDA 5JH7A 4I4TA 2QSAA 3LDCA 4IL7A 3O1TA 4OPHA 5LY2A 4BMBA 4AILC 1H2KA 1HWYA 1NQJA 4DIQA 2BGOA 4O7XA 1MS8A 3BIWE 2BU9A 1UOFA 2A79B 1NBMG 2N05A 4B4RA 4Q4X2 4LF6B 4IEWA 3ZIXA 5C3QA 2JIZG 5GZCA 5JMCA 3BFRA 2VMDA 3LEKA 2Y48A 4Q1RA 4LF7B 1SLIA 1GAXA 4E4DX 5FJKA 3I2KA 1UN1A 3P32A 1S2KA 3JALB 1SBFA 4MSVA 3AC0A 4A7KA 5FJHA 3MUY1 3D5OA 2X5IA 3GBWA 3HQRA 5FRAA 5F6KA 1VF6C 4QPGC 3B09A 2R041 4UFLA 5T5OA 4NTYA 4DW1A 3T1HO 2PZSA 3IC9A 2Q6AA 5IK7A 5FZGA 3SCGA 5B66Z 2PTMA 2ZDIC 2JECA 2VZSA 3AL5A 3CC7V 1EV12 2JWPA 3IAPA 1XILA 1JYNA 5ITZB 3V0BB 3QO8A 5DMYA 4D6TH 3ABZA 3M3QA 1RJ7A 3OUJA 3MF9A 5C3OA 1XSQA 4H33A 5H6QA 2WZ8A 4Y4RA 4J7ZA 2HWF3 1SHWB 1JH5A 2R32A 4GMP1 1LHNA 1M57B 1I9RA 4R9DA 4W6YA 3VBRC 4MADA 1XBFA 2WAAA 3V64A 3WP5A 3HJRA 5F8PA 2EA7A 2E32A 4X64B 4BXSV 1OFNA 3M2MA 4F7ZA 1LKNA 3D36C 2WO3A 1LENA 5EYXA 2HJFC 4CH5A 5FMCA 1BHGA 4BHPA 4WVMA 3WT3A 1BXHA 1DTOA 3WF0A 3NSTA 2FTKA 1CIYA 1FPN2 2A06H 2X5IB 4D6RA 2ZTNA 1TMF2 2VZ1A 5FY4A 1H8TC 2DVFA 4LF5O 3MGUA 3VHPA 2Q7EA 4P9IA 2RM22 2XJSA 1VBB2 3LNNA 2IWGB 5JZGB 1JZ6A 1W6PA 3DC6A 3E83A 2IVIB 3H9AA 5IVEA 1G9DA 3V0AA 3K06A 4O4LB 4QX8A 5TSWA 5A7NA 4L8JA 3T4VA 5L7OA 2TUNA 1UKGA 1WD3A 2P3IA 4UXAA 2J42A 3NV1A 2FMDA 2KR2A 1QMJA 4AK3A 4JI7B 2DCYA 1KB9F 1YJ9V 2ZS6B 4DUXA 5FZ9A 4HMZA 1XNQB 4Y1YA 4AZZA 2GTSA 1CESA 4O4IA 1R3IC 1TUEB 5JXIA 3FMGA 4IEUA 1TGOA 3IWZA 5AC92 2ARBA 4TQDA 2R061 5IATA 4OPAA 1CPYA 2CDPA 1V9U2 1NH2B 2WWWA 5CG9A 5JR2A 4FXKB 1KP3A 2QQVA 2F6BA 4M00A 4DQAA 4DMIA 1EAH2 4MT8A 4B1MA 1D4M3 2PHLA 2VMHA 1EN5A 2HWD2 5A7WA 4F6RA 1S5LZ 3OGRA 2D3SA 1G6UA 3QVNA 2YEVB 1ASJ2 5LXTA 4LJHA 4I02A 4Z1VA 1VEWA 4I3PA 1BQ0A 3W7XA 3Q8BA 5FK7A 3AG4B 3ZXKA 4I0XA 5LP6A 2A3YA 4MTGA 4A3ZA 4AHZA 4QGPA 1GR3A 3V0AB 5FYTA 4GX5A 2P3KA 3MIEA 2C5DA 1FYUA 2X6AA 3T3YA 1P4RA 2ZR2A 1COV3 1U96A 1F5JA 1KQRA 1BBT3 1WZXA 4N43C 2WZEA 1RB8G 4CUCA 4FCAA 4QDSA 2NPIA 4Y22A 4YGEA 1CVNA 4CP1A 2IXJA 4B7EA 5FOJB 4AF9A 2BSKA 2XPJA 4J6GA 4IDZA 3MIBA 1IPSA 2DFBA 4YGCA 2XHNA 3LSEA 1POV3 3WQ1A 5FZCA 4LIVA 5F3GA 4RO2A 2VXJA 2GNMA 4OCTA 5IVYA 4BW9A 4JI5O 4PI2A 1WW4A 3FHQA 3LSQA 2QZ2A 3FYEB 1OH3A 2YBKA 2WLJA 2QKDA 1QJX3 1YLLA 2VQUA 1VMFA 5JJJB 2IZWA 4CU8A 2A3XA 2LO1A 5A7WB 4FLYA 1EM1A 4B4PA 4FFFA 4A7YA 4D6SA 2O8QA 1UY3A 2DUPA 3U11A 1AYN3 2R1BA 5EWSA 2QBXA 5FDBA 1EPWA 4DV1O 3LNMB 1S76D 1JU4A 4ZU4A 2XLFA 2RHPA 2K46A 1SA0A 3OEBA 4LNUB 2OIEA 1ZA7A 4LK6A 4I0XB 1UNBA 3AJZA 2QQOA 3ABLB 3JUUA 3J9SA 2ZEWA 4J10A 4GXLA 4RWUA 1Q6UA 1FOD1 1XE8A 3DGTA 3FUQA 3NNLA 2OIIA 4DB5A 1XEQA 1NZIA 2W91A 4H7MA 4M3CE 3WNNA 2RMU1 5IYBO 3JAWA 5LBBA 2XJVA 1H2LA 2UYAA 4MTXA 5B5EZ 3T0DA 1W9YA 2C4XA 1X7NA 3NVCA 1XC6A 2RDCA 2BSKB 2GV9A 5F5AA 3K0GA 4QPIA 1F2NA 2EIJB 5DAPA 3G6EV 1ZAUA 1W2TA 2ZE8A 2ZXQA 5IVVA 3UYJA 3CC2V 5HCBA 5D21A 3MHSC 4H2AA 4GH4A 1XNKA 4B4QA 2YXSA 5FAXA 1W2AX 4GB33 5IT6A 3OPWA 5FXWA 2VY0A 3SLIA 4UFIA 2EXIA 4XF0A 3THCA 3K3NA 2OCHA 1NY72 1BK1A 5FYZA 3PMEA 1LR1A 5KXDA 2OUJA 2XAFA 1SA0B 2HWE1 2PHRA 5KR7A 4A42A 1HW5A 4UAPA 4RYDA 3BODA 3CCEV 1CAUA 4DV6B 5GM0A 3IN9A 4YJ3B 3H1LH 1IBLO 4N9IA 4GJYA 1HB1A 1RINA 4GX1A 3I2OA 4FPOB 4OVEA 5C8CA 4LFAB 1O5UA 1YQ8A 2BP6A 2WKKA 5C3SA 5KXBA 1NE6A 2Q30A 4LBKA 3KVAA 5JIUA 1CR7A 3TEYA 5FPLA 2HYXA 2XL7A 3G6BA 2NMOA 5K1XA 1M90W 4RFT0 3ILFA 3VZMA 1MEC2 4E4SA 1D5NA 3ZN1A 1TVKA 3VDCA 1W8UA 2EZPA 1O91A 1RMU2 1W04A 3RZMA 3AMPA 2IXKA 3STLC 3ZXFA 3KHCA 1JZ4A 1PNKA 2B7YA 1ZTEA 1C5HA 1FMD3 5M0TA 5H9QA 2W52A 4GAZA 3LDRA 4L92A 1D0GA 1VB2A 1K3EA 3N35A 2V4DA 1XSRA 1DHKB 3UV9A 3SYOA 1YNAA 3AJYA 4NPRA 4PF1A 1RHI3 4JI2B 3R05A 4F83A 4XDLA 3M8LA 1QY4A 2WLIB 3EXAA 5A33A 4AVAA 1R083 3L74H 4EV0A 1OCZB 1CAUB 1YDXA 4YVWB 3DYOA 3GM8A 2EBOA 5LGUA 4OLLA 3G71V 3CBNA 1PHMA 3PURA 1C8M2 1ODMA 3K3WA 3ZHSA 1ND2C 4CDWA 5GLTA 1OCCC 1VBC3 1PX4A 4NWVA 2UY8A 2R0HA 3J8F1 2YXLA 1YIFA 3DPRC 4IETA 3GBFA 2O0OA 2XXZA 2CV6A 1RUE2 3BN6A 2Y8KA 5JR7B 4IV3A 5CU1A 4LF5B 3FB6C 4QGMA 3SC7X 1BCXA 1TVKB 1ULFA 3SKJE 4JDNA 2W1QA 5AVPA 1EBOA 3ZDSA 3N9NA 3WY6A 1RVF3 2W1WA 4I0AA 4LHLA 4M3CA 1XNBA 4DK1A 4TV9B 1BK0A 5JUVA 3PU3A 1U5IA 4GUNA 3WR0A 3X2QB 5KA5A 2Q68A 5EZYA 2YFZA 2WINB 3POGA 2Q8CA 3QLQA 2MEV2 1W8ZA 4UF0A 3LZZA 2HVKC 4AI0A 3PVNA 1O4TA 4HSJA 3OTOO 4DYLA 5CA6A 1K4CC 2QWNB 3S6PA 1YHFA 3ITQA 1VF6A 5C8YB 3RI9A 2H0VA 5C33A 1ZZBA 4D0QA 5JSRA 1S2BA 4OZXA 4FZ0A 3ML0A 4G28B 5LATA 1PV0A 3H0OA 4KU8A 3QO5A 2VTFA 1I7FA 4PQ9A 1UPGA 1SZBA 2JJ6A 2XAGA 2HYKA 5GW7A 4IYHA 2ORZA 4XHXA 1CGPA 2XQXA 5LEKA 2Q8EA 1G9CA 3K3OA 3NO8A 4Z2AA 4B3MO 1EPZA 3VDBA 3OYWA 4LKEA 4IEQA 4IEVA 3DSQA 1TME1 1WCQA 4K1ZA 1RUJ3 4NXMB 3VBRA 2Y4UA 4XZUG 4RHV3 1W6NB 2H0BA 4O9GA 4LBNA 2W87A 5LOVA 2F17A 3K79A 2FB5A 5FNVA 1MR5A 3AB0A 4P30A 3RW0A 3HD8B 1CIWA 1HN1A 4LORA 4COYA 5I8SA 4PA3A 1ZX3A 5B1AC 4Z2WA 1GWMA 4YIPA 4UF0B 1W9FA 2WN2A 4QT6A 2XKPA 1Q82W 1N1SA 2M7WA 5F3CA 5T52A 2HG5C 3C7FA 2UU8A 1KDMA 3MEPA 5H2FZ 1YVWA 4Z07A 4QPGB 3CRRA 1THZA 4IV1C 1PNGA 3FYIB 3QH6A 4HETA 3ZO0B 3MDSA 4RGGA 5I93A 4J9YB 3OMNB 2AENA 2NM1A 2IU3A 3HKDA 4JI5B 4DUVA 3ZXDA 5HFLA 2AW9A 4JTDB 2XBO1 1Q3EA 4FO9A 1V55C 1JJOA 4AGRA 4F3JA 4GALA 1LGNA 1XDCA 4YG6A 1OKQA 3SPJA 3BHPA 4UB6Z 2OUHA 1LESA 2Q1FA 1H2GA 3S7IA 4CCCA 5JLVA 3N9OA 4W6WA 3VBRB 3E2EA 2R1DA 4DV1B 1V6MA 5JVDB 2DTYA 2JIGA 1X8EA 3SR2C 5IYZA 3USSA 4EN7B 1RUF3 2XGXA 3MYXA 3T1LA 1NS1A 4IXLA 1W99A 3AK0A 5SV5A 2GALA 5E88A 4PLMA 3ZBHA 1RUI2 3ZVXA 1KS4A 1JS9A 4E4ZA 1OA4A 3H7JA 4GX2A 3ST7A 5A7OA 3I3EA 4NXNO 2XJRA 1BS3A 5BXZA 3ZS8C 2VTXA 2VUJA 1SQGA 2O1QA 1XRUA 4W4LA 3L9DA 1AVBA 3AL6A 1RSOB 2R0FA 4DV0B 1DYKA 5A3WA 1H8TB 3DTUB 1AR91 1UYXA 3SYAA 5IWAO 2CY6A 4ZOLA 1PMHX 2WT1A 5A3LA 2VJXA 1WA8A 2XAQA 1UFIA 4QQ2A 1T5EA 2FCTA 3FHIB 1OPMA 2GC3A 3CCUV 1QHTA 2H94A 5J2UB 4J41A 4M3CF 5C3PA 4YYOA 1BKZA 2OXBA 4RFRB 4ZHQA 3LAGA 4J25A 2JG8C 4YVSC 4HXCA 4TQFA 1R093 3OR7C 1GSLA 1VBE3 3H8RA 4GWNA 1YRZA 3S57A 2A3QA 4YZ2A 1DQ2A 1L0LH 3WQ0A 2VH9A 1OD3A 5IYZB 4FTEA 4WM7A 1K5MC 4I7ZB 3O1UA 4W6XA 4RHV1 2Y0OA 1WKYA 2EVXA 4XILA 1QQP2 1KGYA 4WV8A 3MIHA 1PIV1 2E3CA 3A0KA 5A32A 1AP5A 2VCCA 5C70A 1DF4A 3BU0A 4LWSB 4QKNA 1BSMA 4LF9O 4HNAA 1AZDA 3RFRA 1FATA 5IYDO 3IAQA 1BEV1 2HVJC 2EINC 2YG0A 4URTA 2FDGA 1CX4A 1WLCA 3BPSA 4HVRA 4P00B 3F7VC 3AK2A 1JFFB 2VMFA 2WLKA 3VN4A 3AKRA 2YHJA 3NXSA 2LW1A 4ZS2A 3W7SA 2VC9A 2JRIA 5FUIA 4TT3G 3CX5F 2PI5A 5HV4A 1DF0A 2LGWA 4H7LA 4LXLA 1AXKA 1CZTA 4XZPA 2B5UA 5DAQA 3B2EE 2C1FA 3N2GA 5FZ7A 3VD4A 5EIYB 4O61A 4AEDC 4ZHQB 5IJ9A 5LA1A 2PAMA 2PLV2 3ZYPA 1DLCA 2QDOA 1QJY3 2QWPB 3M99B 2ADDA 5F32A 1X50A 3SH5A 2FBEA 4WM7B 3BA8A 4GZRB 1LRHA 3KVBA 2YIDA 1FKAO 1OUXA 3MLJA 2WAMA 3IGAC 1GP5A 2AHYA 5CB4A 4B08A 4JX0A 4COZA 1POV0 2WNEA 1MS9A 4A5UB 4CDUC 1Z2GA 1WPXA 3B02A 5A32B 1PM4A 1OCRC 4RUFA 3FB7C 2MNGA 1GM8A 4OYUA 3O12A 3AFGA 1UXZA 3H3ZA 2B9VA 1MVEA 2PQQA 1UOJA 4Q4W1 2JGDB 5FP3A 4X6QB 4R6ZA 4UFHA 4JI1O 4DR1O 4CDQA 2QR4A 3CO2A 2CU5A 1GMMA 2YC0A 1PM7A 2VECA 2WWSA 1I94O 3JBG2 3SJBC 4TWKA 5FZ4A 2ES3A 1GZ9A 2WLHA 3JASA 3RYIA 1VQPV 1S0DA 1JYWA 1XNAA 1Y3TA 1Z0HA 3E35A 1HRV1 1W6OA 5A7SA 3P6BA 2VMIA 2FDFA 3CF6E 4XUPA 3OCPA 3KMHA 4GD4A 1ODNA 3VDAA 1PKXA 4CCNA 1YJWV 3M3OA 1H2SB 4BM8A 3IPVA 2AZ5A 3ZHQA 3BOWA 1IZ3A 3POEA 4XFIA 2ZGUA 3S7EA 3CCLV 2Y6JA 4Q2FA 5AFEA 5J3UA 1J1LA 1JZ7A 4X88A 2HWB3 3RZGA 3GZTB 5CB7A 4U3JA 3T30A 1XI1A 2UUCB