3U11A

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
197
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 65
structure length 197
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u11A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u11A02
5E16A 3HT2A 1FXZA 3OGJA 4I02A 4FAGA 1ZZ9A 4YARA 2PHDA 1I5ZA 3PNAA 4XEZA 2WFPA 3WW3A 2IXLA 4ZU7A 4IEYA 1VJ2A 3BALA 3FWEA 2UYBA 1OD5A 4IEUA 2VPVA 3NVCA 4XFAA 3S0MA 1V70A 1QXRA 2PFWA 2QJVA 1CGPA 4OLLA 1SFNA 4IEZA 5I8SA 1XE7A 1ZRFA 2UYAA 4Q0UA 3CO2A 1G6NA 3SMHA 5I8YA 1ZRRA 1TQ5A 4HSLA 4MH0E 3IDCB 3E5UA 1LB2A 4D7SA 5FQ0B 5FLIA 2EVXA 4F7ZA 1J59A 4B29A 1CAWB 2B8MA 3PLQA 2PAEA 1SQ4A 1WLTA 4Q0QA 3BPZA 1SEFA 1UCXA 5JSPA 3IDBB 1X82A 1VR3A 4Q0SA 4YRDA 1RL3A 4BH9A 5FLHA 3IIAA 3FE5A 3EO6A 2XLGA 1YFUA 3ES1A 2BNMA 3I59B 2GC2A 1ZVFA 3OCPA 1HW5A 5JR7B 3EBRA 4EWAA 5I0RA 4A2UA 3E5QA 1X8MA 1FI2A 2CV6A 2XKPA 3H7YA 4K8FA 4EROA 4HVOA 3SCFA 3E6CC 5LRSA 1ZZBA 4DINB 5HI0A 2E9QA 2HJIA 4XFCA 5BY5A 3MDPA 3EJKA 4LA2A 4HLTA 3D0SA 4MGYE 4ZU4A 5LEKA 2IXIA 4Z82A 4QX5A 4IEPA 2PHLA 4WVZA 3SXWA 1YFYA 2OZ6A 3LAGA 3OTFA 3H9AA 4MGZE 1EP0A 4AVCA 1CAVA 1O3RA 4UXAA 1RUNA 3DN7A 3H1YA 2QDRA 1Q5OA 4META 4Q0VA 2UY8A 3USSA 4NVPA 1NE6A 2O8QA 3CEWA 4J1WA 4LUMA 4XFBA 1O3TA 1CAXB 1O4TA 5CVRA 2KXLA 2D5HA 2BNNA 2Q30A 3ACLA 4XF0A 5D1IA 2K9ZA 3WW1A 1J3QA 2Z69A 4HZFA 3E6DA 4XETA 4KU8A 1UIJA 4I0BA 3R6SA 2H0VA 1J1LA 3GYDA 2FQPA 1ZX5A 1NZCA 3LWCA 4PIZA 4KU7A 3MPBA 4L2NA 1O3QA 1U12A 3L2HA 4IERA 1YHFA 3SCGA 1CAUA 4IEXA 4EV0A 1OI6A 3SCHA 1Y9QA 5KBFA 4QM8A 4LA3A 3BU7A 5BV6A 4I2OA 3E97A 3HIFA 3FFQA 4P9GA 4OFGA 5JAXA 1QY4A 1DZRA 1NXMA 3N4MA 3U10A 1YUDA 1PMIA 3RNSA 1YLLA 4MGIE 3RZZA 1Q43A 4QM9A 3TNQA 5J7MA 1J3PA 1ZZCA 1GQGA 5K8SA 3C3VA 1CX4A 1YFXA 1RTVA 3KSCA 4LEJA 5LEJA 3ZDSA 3EQEA 1DZTA 2Q0AA 5I8TA 4R52A 3KGZA 5JCTA 3DKWA 4WBBA 4AVAA 1IPJA 2Z2SB 2OZJA 3NJZA 5I93A 4HSJA 1PM7A 1EYBA 4YSFA 2MNGA 4JVAA 2BEOA 4XFIA 2MPFA 4LLOA 1OMIA 4HMZA 5T3NA 2ZCWA 2ETEA 2IXCA 5CADA 5FPXA 3GBFA 4XFFA 3IBMA 1YWKA 4Q29A 4YNIA 4O9EA 2MHFA 4BHPA 1NE4A 3D0JA 3S7EA 4QMAA 4UBHA 3FJSA 1J3RA 3CLPA 2ZKLA 3HQXA 3H3ZA 4UBGA 2UY9A 3NL1A 2IXKA 3D82A 4O9GA 3KGLA 2BYVE 1ZNPA 5J3UA 3MYXA 3H8UA 2XGXA 2PTMA 2GC3A 5I0TA 2H6BA 5EFUA 1VP6A 1EPZA 2OPKA 4XFHA 2D40A 3NKTA 3H50A 2Y0OA 3G7DA 2D93A 5BPXA 5FPZA 2WC2A 1LKNA 4ORFA 4XF4A 5FDBA 4MX3A 2HKXA 1DGRA 2PYTA 1UW8A 1GQHA 1ZZ6A 3IWZA 2PAKA 3I54A 3LA7A 3UKNA 4KWLA 3QOPA 5JSOA 2V09A 3B02A 2C0ZA 4Q0PA 3PVBB 4D7TA 2EAAA 1J58A 4MV2A 2GZWA 4E2QA 2QVSB 1FT9A 5EZWA 3LZZA 3M70A 2H6CA 2ATFA 3OF1A 1I6XA 4BIFA 2N7GA 5KHKA 2VQAA 4HN1A 1RUOA 5KHHA 2GC1A 3HT1A 2GH2A 4IESA 1X8EA 2Q4SA 4H7LA 4LTAA 1UD1A 4AQ6A 2K0GA 1O5LA 4PJYA 3VHRA 2I45A 4FBFA 3BB6A 2XKOA 3LA3A 2IXJA 4HVRA 4XF1A 1RC6A 4GULA 4E2SA 4QGNA 1CAVB 4IEVA 4QXKA 4Z07A 1UPIA 1JUHA 3CF6E 3RPQA 3RYRA 2BNOA 3OD0A 3ES4A 5JSRA 4AXOA 3U11A 2XL9A 1QWRA 3ROUA 3ST7A 3WW4A 1UIKA 2GC0A 1ZZ8A 3I7DA 4J1XA 3E6BA 5C6CA 1ZZ7A 5I0UA 3FZ3A 1WA4A 4AVBA 1DGWA 4R8HA 3U0ZA 4TLFA 2IC1A 1ZREA 4PIYA 4XF3A 2VECA 4BYYA 1Y3TA 4L11A 5I91A 5LRRA 3H1WA 3RYPA 3WW2A 2O1QA 4KL1A 1QXJA 4JTOA 5E1RA 1CAUB 5FQ0A 1IPKA 3TNPB 3FHIB 1L3JA 4X6RB 3FX3A 2D5FA 4I0AA 1CAWA 5C8WA 4KWJA 5FLJA 5AVPA 4MZUA 4JTNA 2CAVA 4HBNA 3ELNA 4XF9A 4N9IA 2XLAA 3RDIA 2XLFA 5I0SA 1LR5A 3UKTA 4EWDA 5BUVA 3O14A 1NYWA 3CL1A 3UKVA 3LOIA 3H7JA 1O7FA 4IEWA 1ZRDA 1O5UA 2EA7A 2CAUA 3SHRA 3I59A 1OFNA 4CYDA 1XE8A 4LULA 4QGMA 4FT8A 4QGLA 3S7IA 3NW4A 2PAMA 3DL3A 4PIXA 4AQ2A 5J48A 4ZU5A 3H1MA 3BCWA 5F1RA 1YFWA 3ETQA 4MUVA 4X6QB 1RGSA 4IEQA 5KHJA 2B5HA 2IXHA 1Q3EA 2ET1A 4HN0A 5KHGA 5CU1A 3H3UA 4I3PA 5BXXA 4LUKA 4RD7A 2Q1ZB 4HVQA 3LA2A 2CGPA 3QACA 4KWKA 4WZCA 2DCTA 4EWEA 1ZRCA 4MGKE 1H1MA 4I09A 2OYZA 4IEOA 2F4PA 1CAXA 2PQQA 1EY2A 3JZVA 4F8AA 2P17A 2PA7A 3RYKA 1WGPA 4I01A 2FMYA 1XRUA 2B9UA 3E5XA 2OA2A 4E2GA 2BGCA 2XL7A 4N9HA 3KMHA 1LRHA 2QNKA 4IETA 4XFGA 2ET7A 4FAHA 3CJXA 1H1IA 1O3SA 2GAUA 3M3IA 5FCCA 4ONUA 2QCSB 2GU9A 3DV8A 2XHKA 5KHIA 1X7NA 3KCCA 3EHKA 4YYOA 3MZHA 3NSTA 4JV4A
chains in the Genus database with same CATH superfamily
4J80A 4PA6A 3L70H 5DG2A 2EXHA 4MVUA 3OEAA 3T4HB 3RW0A 1W90A 1QQCA 4M00A 2OYQA 3BALA 2BOBC 2JDPA 3NVCA 1VP7A 4X20A 4MOAA 1HRV3 1POV3 4Q0UA 1US6A 1W59A 5BNOA 3FUOA 4MH0E 1K5SA 4OUMA 3SDLA 4K6BA 4RQPA 1V54B 4DR3B 3AP6A 2Q69A 1BGYH 1CAWB 5JOZA 4A5UB 2WYSA 1YJ9V 3QG5A 1F7YA 2A7AA 3AK0A 5JLVA 3O9OA 3ZCCA 4RHV2 2NR5A 5T54A 1KFXL 1SCSA 2XLGA 3IZOA 3PIGA 3ZN6B 5JCOA 5HXVA 2A9HA 1P7BA 1HW5A 3ETPA 4EWAA 5I0RA 5C5UA 3BOPA 4QPIB 4OI2A 1YQCA 4EN9B 2QM4A 2HLDG 1TME1 3HKEA 4XFCA 2B7YA 3HKBB 5LGNA 4HLTA 2IXIA 2DYSB 4YM0A 5KXBA 3Q4HB 3UK9A 2YIAA 4M4RA 1PO11 4HXCA 3H0OA 4Q0VA 2UY8A 4F6RB 4NVPA 3MI8A 4FLZA 1O3TA 3O1PA 5D1IA 2ZGKA 4X9QA 2ZMKA 1VBA1 2JE9A 2Y6GA 1C8NA 2F6BA 5FYTA 1S1AA 1CAUA 2D44A 3BU7A 1OCRB 3I2OA 4N53C 3VDDB 4UCUA 2WSUA 3SGIA 4QM9A 4SBVA 1WA8A 2FB5A 3M3EA 4PDVA 3OGSA 1FPOA 3ECQA 3WNNA 4L9BA 2EICA 5IVCA 3A0BZ 2ZMLA 4UW4A 3O7OA 3LFMA 3BGAA 2V72A 5F3CA 3OUFA 3USUB 4LHKA 1NA1C 1NE4A 4PDWB 1NKGA 1HB3A 2RMU3 1M93A 2BUKA 2RMKB 5FJKA 4BQ4A 4URAA 2GC3A 3KF5A 2WQ4A 3MO4A 3I49A 2P1BA 5FP9A 2F4VO 3A23A 5GLTA 4NXNB 3ZPOA 3CZJA 2HWC2 1PZ7A 2O8OA 2ZD9A 5JH7B 2XONA 3ZBHA 1DGRA 3STZC 1N36B 4YVSB 2C0ZA 5CA1B 1DGSA 2BVBA 1AJQA 3OSDA 1XSQA 2E26A 3BEHA 4AFCA 1ND2C 3M70A 4K35A 2N7GA 1EAH1 5DAWA 4QDSA 4B1LA 1UY4A 4IESA 4AEJA 3DXRB 4IXLA 1NQJA 1VQ5V 1Q8SA 5G04L 1H1AA 1K4CC 4QGNA 4EN8B 2IM9A 2KR2A 5FY0A 2WNEA 1Y6XA 2BNOA 5ABJB 3PUSA 3O1SA 1LOCA 2D6KA 4DO0A 2RS52 2ZCEA 2BOCC 3VHOA 2ZZQA 2VS0A 4IUGA 4QX0A 2VUAA 4Z1MG 3VLBB 4L11A 3AP9A 4AK3A 3PL0A 4I9WA 3M4FA 5FREA 5GZFA 4BR6A 4Q4V1 1SQXH 3IJ4A 1EZJA 2JENA 1BEV1 1O91A 3LNNA 3T0BA 5IYDO 1S77D 3WVJA 1LNQA 3AMPA 5J2UB 4QGMA 3R05A 5B1BC 1W9TA 4FT8A 3WB0A 3L74H 3AG2C 3A0KA 1ND3A 1NAEA 1FS0G 3TAYA 3J26N 2FTKA 4AGGA 4LJHA 2CTQA 1RGSA 4I9QA 4BLIA 2W1WA 2WS93 2VQEB 3WNLA 3POYA 3BABA 2ZHKA 1SFYA 3D6EA 1MSDA 1BJQA 5FLXN 1S0DA 5C8CB 3T4DA 4YPJA 2E75B 2VMEA 4Y5TA 4JYYA 3FHQA 2OYZA 3I56V 2WBKA 3A7QA 5JCOC 3BI3A 3SEEA 1IG3A 2A3QA 1PMJX 4MVTA 1BSMA 3F5TA 2W1SA 3JD72 3AP4A 3CCUV 3QD6A 1FXKA 3KWVA 2GAUA 1JOJA 2GU9A 4CPBD 1K3IA 4K0KO 1VBC2 2HWC1 5K9YA 4RUFA 1XNBA 4SLIA 1OHFA 4Q6GA 5K7PA 1M90W 3A0NA 4FJCC 1VQLV 1XMQO 1YXWA 2E7AA 4FPCA 1AL0G 4YM2A 4YW3A 2VZQA 3KT1A 4QQLA 5JDBA 1H2LA 2PFWA 5T5OA 4YZ1A 1SFNA 2JG8B 3O1TA 1RUG2 4X1IB 1IKPA 3OT7A 4YVWA 1K5QA 3IAPA 4YY3O 2Y6HA 4LF7B 4OMDA 4F3JA 3VBHA 2RM23 5LHIA 2XJRA 2AR6A 4Z8BA 1JZ2A 1IDSA 4ATEA 3VL9A 1BQ0A 2N04A 3OUIA 5JSPA 2RS51 5FYIA 1DF5A 2ZOEB 1MVQA 4XYXA 1W2NA 3V0AB 5E88A 1RL3A 5FLHA 3Q8EA 3ZXEA 1AL21 1H9WA 4PT6A 1YQ5A 3EFFK 2ADEA 3LDDA 1QVFU 4NHMA 1HB4A 3THDA 3X2QB 4H44B 1SFPA 3K48A 1TUEB 3KCYA 1H8VA 3MDPA 4J7ZA 3JYCA 1CIWA 4B4RA 4I0XB 1AYN1 4LBKA 5IHRA 1MZ5A 5LWBA 4FPOB 1D5NA 2CNAA 4N7IA 4XBQA 2B46X 2LFRA 4NXNO 2CGOA 4JAVA 4ZHQA 4MTFA 5DAPA 3CRCA 5J37A 4PI0A 2JB8A 4DUXA 1N36O 2DE0X 1S0BA 4LO7A 4EZ4A 5EQUA 4Y5Z0 1UZ0A 2YS8A 5K0UB 2NLRA 5C9AB 3ACLA 4XF0A 1BHAA 1AJOA 4XMIA 2JG9B 5D8AA 1UU5A 2Z69A 3WG3A 1KEXA 2UWAA 2Y0IA 4BK4A 1O3QA 4KBBA 4IERA 3THOA 1KXGA 4FM1A 3FX7A 1HRV2 3AK1A 1LULA 2ZM6O 3RMXA 3WDUA 4LF4B 1FJGO 4TV8A 3OY8A 4IIJB 4CC5A 5A80A 4FFGA 2ZXQA 3WG7C 2ZIOA 4UCTA 3KKYA 2Y8KA 2BE3A 4LH7A 1LTEA 3JD71 1GU3A 2E6VA 2OZJA 1YO8A 3J8F3 2BEOA 1DQ2A 5FMOS 1OZ0A 2ETEA 4ES8A 2ZS6B 2MHFA 2R043 3VHPA 5CKQA 4YZ5A 1DBNA 2WZEA 1STMA 1JZ6A 4XPVA 3DCQA 1YTFB 1HQWA 1GM9A 2R9IA 1WCUA 5LCWL 5F6KA 2OPKA 4AQYO 2E76B 4GH4A 3B2EE 4YG6A 3CQOA 4GKJB 3K3OA 2YPJA 5B4NA 1OBNA 2HKXA 3SQOA 1GNHA 1ZZ6A 1RUG1 3GWKC 1EM1A 2QKDA 4FI9A 4URTA 1HNZB 2R6QA 4NO4A 1ND3C 3V0BA 5A32B 4DIQA 2QVSB 1NY71 3CJHB 2WZR3 1KJRA 4QB2A 3VB9A 4A3XA 5JOWA 2UXBO 1HJGA 3MW3A 1UOBA 5LATA 5A7NA 1UD1A 2Q7EA 1R3KC 3ZJZA 4LF6B 3NJVA 2J1UA 3HB3B 1GN2A 1H2GA 1CAVB 4MVRA 2QA4V 5FMDA 1HNXB 2XL9A 5A7WA 3I7DA 4QGPA 3U75A 1GKBA 5JXIA 2X5IB 4OHVA 3C7FA 3FZ3A 3UT5A 3RS6A 3U0ZA 3E89A 2C9AA 4JI5O 5I91A 1FXKC 3ZFEA 1PGW2 4KL1A 2NN8A 4QU1A 5A70A 1DG6A 1R73A 3RWKX 1JFFA 5CFDA 1UYPA 1P8JA 3WNXA 2WLMA 2W3JA 4NN0A 2DBNA 2RMU2 3T0AA 2VZPA 3WDVA 5ERLA 3SLIA 1E1RG 4IQPA 4GWNA 4JQTA 4XQ4A 4OQ8A 2VH9A 4A6SA 4ZU5A 2ZGQA 4YVWC 3SJAC 1N33B 5FP3A 3ETQA 2EULA 4LF7O 3VBHC 2KM2A 2HWF1 1F4MA 2VJXA 5FYZA 4UW6A 1W8UA 2R0HA 4J9YB 5HPOA 2FZ2A 2CGPA 2XQXA 3HJRA 1AZDA 4ET7A 4B3SB 5IAXA 1H1MA 4K9SA 2F4PA 2ZPXA 2PQQA 3G67A 3O1MA 2YHJA 1V55B 3C8XA 5LY1A 2BFUS 1FYJA 3L9JT 2B9UA 4CEWA 2PF4E 5C8CC 5J2TB 3VD5A 1FKAO 2ET7A 1VQOV 3TRSB 5FCCA 3P32A 1Q6HA 3RWRD 3DV8A 1GBGA 5BZBA 1NOVA 5F5QA 1NCRB 4UAPA 4GT1A 3T3YA 5E16A 5FKCA 5J36A 1ZZ9A 4LT5A 3CCRV 1W0PA 4DV2B 1VJ2A 4S2FA 4OCTA 5E8AA 4FPHA 3AG3B 5D8AC 2GSMB 4C1WA 3KD4A 5FZAA 1U5XA 2XBO3 2WWJA 3ZYRA 3JSNA 3JALA 4CH3A 4RGKA 1TQ5A 3NNMA 1XU2A 1Q86W 1JW6A 4P02B 2JG8C 2BBVA 3B5LB 2MEV1 3I3MA 2LQTA 1JN2P 2WS92 2JXAA 3C7HA 2CAZC 1PM4A 4U7OA 5T5PA 4AGVA 4JKMA 1PGW1 2BWCA 2RG4A 1ASJ1 4XUQA 4DK1A 3SYOA 3SCFA 4LK6A 4RR3A 3LDCA 4IV3A 2GH8A 2A73B 2V4DA 2CY6A 3FB8C 3MD0A 3W7XA 3K9SA 4I55B 3ZXDA 4AFBA 4O4HB 1W0KG 3H9AA 4CH4A 1O3RA 2L9LA 4A7KA 1EV13 4AILC 4GKJO 1K33A 4MXWB 1CAXB 4XBLA 1IBMO 1YHQV 3H01A 4HNAA 1IURA 4CDXA 4H0LB 2VO5A 3LWCA 3RWNA 2B45X 3O12A 1DP0A 3UT0A 1CPNA 1OI6A 1Y9QA 5KBFA 1QOSA 1Y9MA 2HBUA 1MR5A 2XAJA 4IV1B 1FAFA 2LALA 3JQWA 3RZZA 3P1IA 5F2WA 2VZUA 3LGRA 4RO2A 3VOUA 3C3VA 2RM22 1RTVA 3OMIB 1JU3A 3RZGA 1Q8PA 2PELA 4R4XA 3AZWA 4NOTA 2RDQA 2D6PA 1A34A 2D3RA 4AVAA 1V9PA 4FPYA 1UKRA 3OTOO 5IFPA 2H94A 1S2EA 1JCHA 4YSFA 2MNGA 2BTQB 2R1BA 4QWNA 4ZY9A 4FLWA 1IS4A 3ZFEC 3S7EA 1LECA 1NT0A 4YWAA 3I8TA 4Y1VA 3GWOA 4UUJC 4P5YA 4INDA 5KXEA 1G8MA 2OT7A 4B1MA 3NMBA 3LDKA 1W9YA 5C4WA 5CFDC 4AFAA 1O8PA 4I3GA 5KXDA 2OIEA 2QQUA 4GKKB 5C70A 1SBFA 3D3AA 4ORFA 4XF4A 2WLIB 4S2HA 1QLEC 2JJ6A 4DXSA 4F4LA 2HWE3 2ZA9A 1GFF2 4AAXA 4PF1A 3ZRVA 1N33O 1M1KW 4CH5A 3LB9A 4FLYA 1RUOA 2P4EA 3BU0A 1JPXA 2GC1A 5ISLA 2QQWA 5A1AA 3BA8A 2WFF1 2ZIMA 5FBJA 3AG1C 2OCCC 4KGGA 1GKFA 1C28A 1OF4A 3LEMA 4IEVA 1UPIA 1RUC3 3RPQA 1K45A 1OQEA 3HWJA 4B3SO 3ES4A 4AI0A 4AXOA 3SPIA 1P7GA 1ODNA 2EIKB 4CEWC 5JJEB 4TWKA 3LIHA 4Y1ZA 5GALA 1Y3TA 1O59A 3E1F1 2B9VA 1I9RA 1PO23 4OMCA 1EN6A 1IPKA 2FCUA 4AWDA 4X6RB 3FX3A 2D5FA 2IZWA 2X5IC 2ZE8A 2JEXA 3T1MA 3QH7A 5FZ9A 1OJHA 4A4AA 3ML0A 4N9IA 5A6YA 2CDOA 2WLNA 2C5DA 1H9PA 3SHRA 2AH2A 1J5EB 1Z0HA 4CYDA 5L9VA 3ON7A 1UU6A 5LHGA 1WKYA 4QKBA 1RHI3 4AEDB 2PAMA 4PIXA 1AYM3 3CU7A 5LGUA 1XUQA 2HYKA 4NIHA 3BKZA 1P49A 3CC7V 4XJ8A 5LXTB 2WZR2 5A3OA 1VQNV 4LUKA 4MW8A 2QWRB 1C4RA 4E4SA 2QE7G 1RUD1 4Q4W3 2R063 2Y34A 1F4NA 5DUVA 4BW5A 4F8AA 1FPN1 1RM1B 3FYEB 4FVVA 2V7QG 1WGPA 1QKQA 4JI0B 3WOGA 1GZWB 2NN4A 4DR5B 3E5XA 1LRHA 4RR3C 3DPRA 4FAHA 4IV3C 4QQOA 2VQFB 4B7EA 2XMLA 5B5EZ 4H2AA 4DOUA 5FWJA 4FCAA 3UGHA 3T4ZA 1VQKV 4YYOA 1MS5A 1TUBA 1R3LC 4PJ0Z 2Y64A 2HYXA 2YXHA 2PHDA 2BTOA 2WFPA 1KDMA 4XEZA 3ZEDA 4ZU7A 2ITDC 5A3TA 3WNPA 1BBT1 4NRQA 1O8SA 5BR8B 1W2TA 1FAYA 4LP8A 4UCRA 4CDXC 2EIEA 3CO2A 2DQ0A 3I3EA 3NAPB 2A79B 4D7SA 5FQ0B 2J1RA 3SH5A 1L0LH 1Y74A 5FIXA 2XAFA 2ENRA 2GN7A 1XQNA 1B35A 4GYCB 4Y1YA 2VOVA 2OPWA 2BBAA 4GQ7A 3I4IA 3VQVA 4QX8A 4GIQA 5FZKA 2PZSA 1XNDA 1IBKB 1JZ3A 1HDJA 2JJ2G 5B1AB 5JQGB 4GWJA 3EBRA 3U37A 3E6CC 5FUNA 1UPGA 4GB31 4DINB 1VALA 4KUMA 5IWFA 1CXZB 3WB2A 4OHYA 1S2BA 5LEKA 1LOBA 2IJIA 2OZ6A 3POBA 5DMYA 4EEQA 5FK8A 3ZSEA 1MEC3 1G9AA 1CQ9A 4OXSA 4IGPA 4Q2FA 5F39A 1AI5A 2OVUA 1O4TA 1N0JA 4FZ0A 3WQ0A 3E8BA 4DFSA 2BCCH 1W8HA 4LHLA 4QXCA 1N47A 4XUOA 1K4DC 4FP2A 3TGUH 3VBRA 2XBO2 4MVZA 5JAXA 4UWDA 4UOJA 2GNDA 1HN0A 3M2MA 3N2GA 1XEQA 4MTGA 1SQFA 3U14A 1TG7A 1QJY3 1MNGA 5I93A 5EJZB 3VBSA 1IXBA 1KS5A 4LLOA 4RWUA 1SPPA 1FXHA 1YWKA 4O9EA 4XUPA 2PHTA 2CYFA 4BQ1A 4YM3A 2EJ7A 1GZCA 2F66C 2QKSA 2Y69B 3DUIA 4JI4B 1YNAA 5L7OB 2VULA 5FWEA 1R1A2 1SQGA 1VBE2 2Y33A 1W0OA 3POIA 4NAMA 5C3SA 1VRH3 5CKMA 1MQTB 3M8LA 3RI9A 2L35A 3GXUA 3GF6A 4W6XA 3G80A 3MBWA 3N9MA 5F2SA 1J5EO 4MX3A 3PTYA 1JOYA 3CMGA 3UKNA 1EV12 3QOPA 3BFRA 2V09A 4NRMA 3EMRA 2A6ZA 3PVBB 4Q26A 4BE3A 4XHXA 1IGOA 4EE2A 5EZWA 5IY5C 5HBAA 3ILFA 3PUAA 4O2BB 1OVSA 3GZAA 3OGIB 2GH2A 5FYBA 5LYJA 3LDEA 1S5LZ 3ZRWB 2DTWA 1FATA 4LTAA 4AQ6A 3HR0A 2K0GA 1QJEA 2YEVA 3VHRA 4FBFA 4NIGA 3MFCA 3ZMVA 1H2KA 1H8TA 3AZVA 5A6XA 5LHHA 5GM0A 5FYYA 2JB4A 1SBDA 1WMDA 2Q6AA 4YG0A 1ZZ8A 4LFAB 2QQKA 1YJKA 3E6BA 5ITZA 1JYTA 2AEYA 2YFZA 3C3TA 4JI0O 1CX1A 4O4LA 1WA4A 5LBCA 2P6HA 2VCMA 1WPBA 4YJ3A 1ZREA 2VECA 3DPRC 3HKDB 2BV4A 2VQFO 4X1KA 3AVSA 3POGA 3F5WC 3ZXJA 1SQVH 1Y9GA 2WLLA 3AEIA 4JYBA 1YXBA 1ZBA3 1U96A 1Z7S3 1OD3A 4I0AA 3Q8AA 2EIKC 4J11A 2JGUA 3ABTA 4JTNA 1K34A 5EIBD 2CAVA 2W68A 1UO9A 5BUVA 3VKLA 1NYWA 1Y76B 1EUTA 1VBD3 1FYUA 3E2EA 4JI2B 4JDOA 4CCOA 3ZMSA 4JGYA 5KMGB 4M3CA 1KQSU 4FQ4A 3NW4A 1DCSA 5J48A 4OHZA 3H1MA 2XBO1 5JI7A 2Z79A 5BXZA 4Q8KA 2Q73A 3WT3A 1GRJA 1ULPA 1QJZA 1E5RA 1LHNA 1B35C 5KHGA 4FQZA 3GZEA 4BIUA 1TGOA 1T6GC 2VQ0A 3MIDA 1EPWA 4E2LA 4R7CA 1V9U3 3EVKA 2UXDB 5LA6A 3CCMV 3ZXFA 4R50A 2OUHA 5CB7A 4ZXKA 5IUQA 5GKAC 1RUC2 4DRRA 2RE9A 3ZRXA 4DXRA 4BWAA 5E1AC 3KMHA 2QNKA 4P30A 1R1A1 3VD9A 2R70A 1VBE1 2KG7B 3GJAA 4FPPA 3FN9A 3NO8A 2ZACA 2VCCA 3BRCA 1RM1C 1AR63 3JAWB 1BL8A 1NJIW 1PO22 2HWB3 4ZI7B 4Z2WA 1FXZA 3MUY1 3HNMA 3IDEA 3P30A 2HP8A 1NQTA 5SV5A 2E7TA 1JXNA 5HV0A 2CL2A 2D6LX 4XTMA 3BVOA 4UFLA 4OI4A 1QCEA 3INAA 5EZYA 3LF7A 4YW4A 3MLJA 5IE9A 2PMWB 3OGRA 1NG0A 1IQAA 1RHI2 4FFHA 1LB2A 3VBRC 1R3JC 1W03A 1AYM2 2WWUA 3LE0A 4GKYA 2PAEA 2IH1C 4QX2A 2RR11 3NJXA 4JHZA 3QCWA 5H5NA 1RVF1 4XCBA 3MF9A 1Z2GA 3PUQA 5FZHA 2Q7GA 5AC93 1GICA 4Y26A 4JZ2A 5FYVA 4CDQA 1RXGA 3VBSC 5AG2A 3N35A 1PK6B 1K97A 1Q6IA 2BTVC 2R062 3TEWA 3JB4C 4YGBA 2WAAA 3S5AA 3JARB 2NMOA 4LORA 5FZLA 1OA4A 2RJLA 4GX5A 1PPJH 4YJ2B 4IE0A 4ZU4A 3GBGA 2PUSA 2ZXWB 3H8RA 2G1MA 1D2QA 4RFT0 3ZRSA 4CEYA 3K46A 5FOJB 5FNVA 5T5JA 2JIGA 5LBQA 2W94A 4WBNB 1LHUA 1NVPB 2NP0A 5KUMA 4TUYB 1W39A 4LUMA 2NPIA 1KECA 1MG1A 2Q30A 5IYYA 1CZTA 3I2HA 3GCWA 2RN9A 1AR73 3R4UA 3E6DA 4QJFB 3RYCB 3ZMZA 1TVKB 3ZSMA 3DF0A 2UUBO 3GYDA 4CUBA 5IYZA 3OBZA 4CP9A 2Q8VA 2UURA 2W92A 3HIFA 2BOIA 1MS0A 2HHHO 3IPVA 1VIBA 1YLLA 5CZKA 5DDJ2 4C90A 1H8TC 4ZKTB 1YFXA 4LKDA 1YI2V 1I7FA 1RSOA 2HVJC 2P06A 2QZ2A 2GNTA 5FP4A 2VD7A 4CUAA 3GNEA 5H9QA 3C7EA 1K73W 4K8RB 4JVAA 1NH2D 1A8DA 2P90A 2MPFA 3MEPA 3MIFA 4HMZA 2IXCA 4RUEA 3J4UH 4FZ1A 3RQ0A 1W6MA 3S57A 3H3ZA 2IXKA 1CWPA 3KGLA 2DFBA 1ZNPA 5GLUA 4PBPA 4W6WA 5FZ6A 3RG0A 4E27A 1NTZH 2D40A 3KCXA 4XUNA 4K7JA 1HNWB 1S0JA 2UUCB 4MSVA 4XQDA 2WC2A 4X66O 2DVFA 3R4DB 3SR2C 3FLRA 4JGYC 3VBOB 1MEC2 3E83A 2ZKOA 1RUF1 1MQTC 1T5EA 4KHPO 3A22A 5B66Z 1G9CA 1H4HA 4M3CE 4XBNA 1N3PA 2XB6C 2QDOA 5IAVA 3G4SV 3HT1A 4LE4A 1HV0A 3CCSV 2HH9A 4J42A 5FZMA 2CSGA 1LODA 3CMAV 4WFGA 2P7TC 4EFEA 2UXDO 3PJYA 3ZX6A 1I94O 3BHPA 4O4IB 3U11A 4J1XA 1W6OA 1ENQA 1XMOB 1XILA 4YG3A 3RYHA 1OSGA 4FP3A 1AJKA 2JICA 2HVKC 1QJY2 2D6MA 4XF3A 3UNPA 4WFHA 4G4FA 5B1OA 4XAEA 4B3NA 2ERFA 2YBKA 3WP4A 2HLEA 4DR7B 4ASMB 1BXHA 2AHYA 1XNCA 4X1YB 1LEDA 3OMAB 1WN7A 5FO9B 4IEWA 4TOIA 1VRH2 1R6KA 1OOPA 4UFHA 5DAVA 2AW9A 4DR4B 5FXXA 3DL3A 2PLV1 2VY0A 4HT1T 3BVCA 4DYLA 1QF3A 4LNUA 2VZTA 2JS3A 5DDJ1 4DV0O 3AYAA 1UY2A 1HRI2 5KHJA 1HX6A 2B5HA 3HN3A 4MVSA 2ZMNA 1LOGA 5BXXA 2EINC 2Q67A 1FMD1 3APQA 4X64B 2JDHA 4EWEA 5EV7A 3JATA 4P9LA 1XNQO 5FTTC 3CHXA 4JI8B 4C1XA 3ZYPA 2XJPA 5JXJA 5JJNB 3QTCA 3OYWA 4WM8B 2BSKA 1YYNA 1ZL8A 1PGL2 2OTJV 5CN0A 1HB2A 3RZJA 1BK1A 3CJXA 3DEMA 1WBFA 1H1IA 5DM6V 3QO8A 4AL9A 2QUOA 2RHPA 5LA0A 4DRXB 1N34O 2O0OA 5KXCA 5DABA 2AHZA 3MZHA 3K04A 3MIEA 3BTXA 1NCQA 4CEYC 2GTAA 1D0HA 2FDKA 1ZBA2 4LH6A 1LOEA 3GGLA 2BP6A 1IZ3A 1BK0A 1CONA 4XHBA 2RNBA 4IEYA 5DUUA 2WO3A 3S0MA 5A3MA 4JI1B 1QU7A 3LQCA 4BQ3A 1SQPH 1MZ6A 1UN1A 5B4XA 3C7GA 1Y7BA 2UYAA 3ASOB 3F7VC 4O7XA 1N1YA 1LUVA 5BY1A 1VE0A 1J59A 2EXJA 1NS1A 1BVP1 4Y20A 1CJPA 3BPZA 2VWJA 2ZKNA 3OEBA 2D98A 3D5OA 1S55A 2FDFA 1H4GA 5JOYA 4X8NA 3O1VA 3AG7A 4XQWA 2RV9A 2YBSA 4BH9A 1YFUA 2R072 1V9U2 1R1ZA 1PO13 1W99A 3WQ1A 1WD4A 3N7JA 3ZIWA 1PKXA 3LSQA 3B01A 4IHJA 5CBGA 1AB3A 5HCFA 3G71V 2GN3A 2G9FA 2XVKA 4EB6A 3CJIA 1JZ7A 4FOYA 1PK6C 3D0SA 1V6OA 4GCZA 1VBA3 2FMLA 3NNGA 1I0HA 1JZ4A 2VNGA 2EJRA 1AR62 2WUHA 2QDRA 1YEWA 4L99A 4BDVB 1TVGA 1GH6A 1CVNA 1PNFA 4DW1A 4V2VA 1NT2B 4XTPA 4CUCA 4Z1VA 4LITA 1PMHX 4O61A 4UW3A 1JJOA 1UZZA 2G4IA 3R6SA 4Q5OA 2B4KA 1HRI1 2KA3A 2I74A 1IS6A 1A3KA 4IEXA 3SCHA 4G9SB 4MW3A 3JASA 1DZRA 1QY4A 2TBVA 1RUH1 2DYRC 4ISRA 3LKJA 2JDYA 5EYPB 2VUDA 1FFXA 4AW7A 2A06H 2ZEXA 2X7RB 4YGEA 4Y22B 3QO5A 3WQBA 1XMOO 3CXCU 3NV2A 3NJZA 2AC1A 3WXPA 2DOSA 2VW1A 4HETA 5AC92 2XJTA 3M8AA 4YM1A 4TV9B 1IHMA 4YFWA 5LOVA 2UY9A 4DV5B 3D82A 3KQ4B 3JD0A 2DUPA 1ZBA1 1UXXX 1JBCA 1QEXA 3O0XA 4NPMA 3ZHUA 1GNYA 1EAH3 2DWRA 1QGLA 1QQP2 1LKNA 1QNYA 3ACHA 4BJ0A 2G38A 4COYA 1OOPC 1RUJ2 1GQHA 1N32O 1GP6A 3LA7A 1PL4A 2VMIA 3H1IH 4DR4O 4ATFA 2ZHLA 3PHMA 2WNUA 2VXJA 2AREA 3ZYHA 2AZ2A 1FT9A 1QR8A 4BB3A 3N2KB 5FOBB 1AR72 4P9YA 4KGQA 1XOYA 4FPJA 1GN6A 3IAQA 3ZFFB 3IAYA 1LEMA 2JDMA 3BB6A 3LA3A 5CB4B 2IXJA 1W28A 1RC6A 5LK5A 2R071 1W9SA 1XL6A 2ZE5A 4DV4O 3NJYA 5M0TA 5BMVA 4Q4V3 3D3QA 5FZOA 3WW4A 3MICA 3IMNA 2LUWA 5L3CA 1BEV3 3I3QA 4LO8A 2WNVA 1WAZA 1LU2A 1FV2A 4JI3B 3TK1A 1C3HA 1XB9A 4AVVA 3K2OA 3QO7A 1AR61 1NCQC 1W9WA 4MZUA 3HKCA 3FL7A 2X29A 5H9RA 3IGAC 3RDIA 4LF5O 3DGTA 1GN3A 1HDKA 1YIFA 4JI7B 1U0AA 5IJ9B 4CDUA 4GUNA 4MT8A 4E4DX 2WN3A 3OMNB 3ZS8C 4O4JB 5FY5A 4I4TA 3AP5A 4MS2A 2G9GA 5HCBA 5CEHA 3ABMB 4RGAA 3TBDA 4XJAA 3CRQA 5A6QA 4C0BA 1AR81 5CG8A 3MDSA 3H3LA 1QHTA 1W9FA 2NMNA 2VAUA 2FKXA 4A6OA 1LHOA 4U3JB 3PVOA 4I50A 2UUAB 3CKHA 5AC91 2HWC3 3BIWE 3JZVA 4UVCA 1YTFD 4D7YA 4NHXA 1RINA 2PA7A 2VM9A 2DCZA 5L73A 3RVZA 2NM1A 4KG0A 4X89A 1UX6A 3CNAA 2JECA 3AKRA 5A7OA 1Q8VA 1J1TA 3MIBA 3KB5A 2P5BA 1UZYA 3K4DA 2P3JA 3NV4A 3CJIC 2RS32 3KCCA 4WM8C 1QQP1 3TEXA 4N53B 1ZSPA 3LPFA 4QQPA 4EKWA 3JBG2 4XE9A 1RUJ1 4PF5A 4I02A 1AR5A 1URFA 3PN1A 4YARA 3JAKB 3BA9A 4OX9B 3O0VA 3LSEA 4IEUA 4TXWA 2RS53 3RYFB 4AI8A 3ITQA 4LR3A 3SMHA 1OPOA 1NA1B 2SLIA 1AL23 4FTSA 5FLIA 5A33B 5FJHA 4HK9A 2IUWA 2EIDA 2YU2A 5C8YA 4MXVA 3VGIA 3RMYA 1US3A 4Q0SA 5GLVA 1DYPA 3T1HO 1AYN3 1NQDA 4CPBA 4D0QA 4BXFA 2OIGA 2H8PC 3FAVA 1ZBE1 4XDLA 4YGDA 4OI0A 4X65O 1A8MA 1ND2B 4DQAA 2VC9A 4TZDA 3CBNA 4TQDA 3UGGA 5HI0A 1IS5A 5BY5A 5BNPA 5CISA 4MGYE 4ZOLA 4IE7A 1SS3A 1ULOA 4QX5A 1IVSA 5FZ3A 3B4SA 4LKSA 4U7NA 2W0FC 4H13B 1SKVA 1G1XB 2O8QA 1NR1A 4XFBA 5DUXA 1SF9A 4BLJA 4XACA 2Q5TA 2YROA 3MV11 3W58A 2WNUC 1K5MB 2VBPA 4I0BA 1YRZA 4AOCA 1W2AX 3L2HA 3JD73 3VDBA 4LE3A 1AROP 5BV6A 2HEYF 2AGAA 4XDKA 5LA1A 2GMPA 4IW3A 1KP3A 2BPA2 3N4MA 3RNSA 1WP8A 5G05L 1AF9A 3TNQA 1W3XA 1GQGA 3OUHA 5LEJA 2Z3YA 1LGCA 5EHDA 3WDWA 2F4LA 2VOKA 4ZHNA 2L6LA 4HSJA 4X20B 1EYBA 1THZA 4TSVA 1JA8A 4OZOA 5B1BB 1XQ8A 3KT7A 2WNVC 5T50A 4WVVA 4NTWA 4JI3O 1QLNA 4BHPA 2RS31 3D0JA 5BNOB 1K9MW 3N9PA 3E22A 1PO12 1FOD1 1ENXA 4RQPB 1RUG3 5CNAA 4EN0A 1WP7A 3JBG1 2BQPA 3BPSA 1JHJA 1S5JA 1KUQA 3CCLV 2WLQA 4LWSA 3WEZA 4AG4A 1UXZA 5IVYA 1EPZA 4NPLA 3DYOA 3N7KA 1M56C 2XT9A 1NZ6A 4X88A 4W50A 4QPYA 4LBQA 4A3ZA 1WLCA 4CDUC 1MSWD 2PAKA 1QJX2 1WUVA 2ZZJA 1QVGU 2DVDA 1IX9A 4LBEC 2QTWB 4YXWG 3HKEB 1JYCA 2KQXA 4DS0A 2EILC 4DY3A 3TXQA 4ISQA 3MIHA 2Z4FA 4B3RO 3TB0A 3CB2A 3RFRA 1GM8A 4QXKA 3J81N 2QKAA 2KSDA 2ARAA 3CCVV 4MTXA 2GALA 1LJ7A 2A3WA 5H6RA 2WLKA 3BN6A 1AJNA 3STLC 2F1MA 5C6CA 3SEPA 1J84A 2WWWA 3OBTA 1VQ4V 4QB6A 4MGQA 3VBFA 1ZUQA 2FHRA 4CTEA 2EALA 3CE2A 4JTOA 1CAUB 4LBJA 1AI4A 4UB6Z 1LUWA 2WSSG 2WABA 3AXEA 4FOQA 5CAZA 2VUCA 1W05A 3B09A 1WA8B 2VU9A 1U5IA 1G7YA 3SPGA 3VBUA 1D0GA 3PUIA 5FXZA 2HWF3 3ME2A 4UFJA 3SJQC 2DBIA 5GTIZ 4X62O 2UXCB 3I59A 1EAH2 2RDSA 4XDOA 2Y26A 1RFYA 3WF3A 5IJ0A 4BQYA 2OQ6A 4MUVA 1XNRB 4BA6A 3VV1A 2RJKA 4FIPC 2ZBJA 2F17A 2Q8EA 2PI5A 2JGDA 3ZFGA 3UV9A 1ULGA 4HVQA 3G6EV 2D97A 3ABMC 1BQPA 1ENSA 1OF3A 3NKGA 3V56A 3ZR6A 3TEYA 5LP6A 4CDWA 4QPJA 4OI1A 1X36A 2ZX0A 5LL6Y 4I01A 1MZEA 2FMYA 4Q4V2 3C3SA 3ACFA 2GV9A 5FBZA 2Q68A 1CZVA 3PMEA 2V5YA 1OQ1A 4ZZ8A 4UF0A 2V5DA 1IS3A 1BEV2 3ZVXA 4O2AA 3K0GA 5BNPC 1UMZA 4CXYA 1M4UA 1PZ9A 1WW7A 3O65A 1BZKA 5FUPA 4AHZA 2JIJA 3DYMA 1S0EA 4IGOA 2W0XA 3KV6A 4KWUA 1QJX1 2IJJA 3WG7B 5KX5A 4TQFA 1HIXA 3ZN4A 3FWEA 2UYBA 4XXAA 2VPVA 1LGNA 2CHHA 3BTYA 3THPA 5DPNA 2D6NA 2UU9O 1WWYA 4CCDA 2MEV3 5BNNA 1HP8A 4J25A 1CGPA 4FPLA 5I8YA 4CCKA 2BRTA 4FPGA 1WB7A 3E5UA 3NXSA 1F51A 4WCEV 3I2IA 3H1LH 2B8MA 2DURA 4AZZA 1ASJ3 1UMHA 1WLTA 2K2SA 3MFAA 1GLHA 4I0WB 2XDVA 4CA9A 1OCCC 3T1YB 2X6AA 1NKDA 5JIAA 1XDCA 1JZ5A 3LOBA 3FB5C 3HR9A 4M3CF 3IIAA 1SA0A 5TSWA 5LASA 2LTNA 5EBWC 5KC6A 2OCHA 3ETEA 2QWPB 1ND3B 4E9KA 4JV5B 2P2KA 5FO8B 1EBOA 4Q4X2 5FPRA 5LRSA 5SV8A 5C5TA 2HJIA 1VQ7V 2EZPA 1E1QG 2J1TA 3WCSA 2AYHA 2P37A 1F23A 4AHYA 5A7SA 4KH9A 3BUCA 5IT6A 1QH6A 5L9RA 3JCUZ 3ZYBA 4HANA 4CU8A 2GHYA 1COV1 3ABLC 4U3FH 3CEWA 4FFFA 2VUJA 4GKXA 1PHMA 3WW1A 5JVVA 4DV6B 1FNYA 4BISA 1UIJA 1S76D 1FXKB 1GWLA 5FZEA 3FFQA 1K5MC 3ZYGA 3LEIA 2AZ5A 1Q43A 4OGQB 1AL22 1XBLA 3PUHA 1OLQA 2XVLA 3KSCA 2Y60A 1SDWA 3RVYA 1HR0B 4QPGA 1S0FA 4AI9A 1B6QA 5JCTA 4XBFA 5CMUA 3OUJA 2E5LB 3A0RA 1SDDB 1W6QA 4N43A 4DUYO 2YZ4A 1U5YA 5IVJA 1CD3G 2PYLA 3VBFC 4RN5A 3W7SA 2YI9A 3CXHF 4NMIA 1AYN2 3GBFA 4DUZB 5F5AA 4YVWB 4QMAA 4LFCB 1F5FA 1J3RA 1ORQC 1XBFA 3VBHB 3WUCA 4P9XA 3SPCA 4WV8A 1HQLA 5CFCA 4AGRA 4UFMA 1UAIA 3AKSA 4W8JA 1DQ1A 1UF2C 4MG2A 1AVBA 4CU9A 1TMF3 3VBUC 5BNOC 4DR3O 4LF8B 2DMXA 3RYIA 4RQPC 2DCYA 4LFBB 3ATGA 4OUSA 2WFF3 2ZGSA 2XOKG 1I5PA 2A6VA 5FAXA 3OGVA 5JSOA 2DQ3A 4YZ4A 3B00A 1HXS1 3I2GA 1MOFA 3MPPG 3NQHA 3ZPYA 2D2CB 2EAAA 3L73H 4RFRB 5KLVH 2ZDIA 1XNRO 3KHBA 3WP5A 2XR4A 2BWAA 3ZN0A 2QGNA 3ZFGC 1ZLZA 2GUZA 4PJYA 3RGBA 1JUIA 4XF1A 1BYHA 3FD9A 1DF4A 4ZHQB 2QWQB 2QQIA 4BQ5A 2XWBB 4ZONA 1DIWA 4IT5A 1ZZ7A 4R9DA 5D8AB 5C93A 4Q4X1 5KAIZ 4AVBA 4QAWA 5CG9A 4QPKA 3ZXGA 2ZR3A 2WAOA 1C1LA 2D3SA 2ADDA 5HFLA 5JJJB 3AYCA 3B9IA 5EBLC 1QXJA 1W2BU 2QQPA 3DC5A 1L3JA 4LF9B 5AVPA 3OPTA 2YUEA 3PMSA 5I0DA 4TV8B 3OY8B 3URFA 4AVTA 2RS11 1VRBA 4BWOA 1P4RA 1PVC2 1NY72 1UNBA 4BQWA 1WMXA 5L3GA 1CPMA 3WNMA 2DCKA 5BNNC 1SZTA 3NRUA 1MS1A 1OLMA 3SNMA 3RZMA 1UY1A 1RUD3 5F1RA 5E79Z 4N21A 3MHZA 4X6QB 1KYOF 5JMCA 3QBQA 1BMV2 1FPN3 2VCAA 4WFFA 4FTBA 5DAQA 3H3UA 5E89A 4D8MA 4ZS3A 2JVDA 3ZSJA 3DTUB 1SLAA 3MV01 4QPWA 5FPBA 4NXMB 3IB3A 4KWKA 4TT3G 2XJUA 1YQ2A 2DV9A 1WA6X 4GH4B 2F93B 3POEA 4K20A 4IEOA 2J1EA 1EY2A 1X9PA 3ZKUA 1JTZX 4UFZA 3GJBA 2YC2A 3RYKA 3AMQA 4M4PA 4RS5A 4CZZA 4DXZA 1KU9A 4JV5O 3V0BB 4E2GA 4CXXA 4IETA 3R66A 4WFBV 1YITV 4EYUA 1BBT3 3UO2A 4KQ7A 2B1IA 1CN1A 4MVMA 2ZHNA 3EHKA 4BZ4A 2BZDA 4L8JA 1UY0A 3AFGA 2F43G 2XWJB 1KS4A 2VNVA 1H2MA 4X8AA 4LBQD 2IXLA 3IDAA 5A7WB 4P9JA 4MGTA 1G86A 2E63A 2HWD1 3IT8A 4HZ3A 3Q8BA 3H1HH 1HLCA 3UT5B 2HWF2 1O6UA 3OOXA 1PIV2 3ZFEB 3PJQA 2R7EB 2JDNA 2VVEA 3D4KA 4F7ZA 3VKOA 1IXMA 4AFDA 2EIMC 5GTHZ 4NWWA 1JFFB 5CFDB 3S3WA 4Q0QA 1OKOA 3KHCA 1F15A 2K1EA 3LD8A 4EZHA 4GB33 3J7MA 2VRZA 1VR3A 5J96B 2JDKA 4RQEA 4GA9A 4QKDA 2AZ0A 1GANA 1QLEB 5T55A 1ZTEA 4L0PA 2C1FA 1I1EA 1JOBA 1KD1W 2CV6A 1VQ8V 3ZDVA 4COVA 2AUYA 5EC1C 2IFWA 5LMNB 1ZZBA 4H55A 4QE9A 1O4ZA 1HN1A 4XJWA 5CFCC 3BCCH 4K1YA 3KV9A 2O14A 4UV8A 2Y6FA 5FR3A 1PVC1 1V00A 3CRAA 4WVMA 3AG1B 3OGGA 3ZMTA 4AVCA 3MLKA 2OCCB 4LF8O 1RUNA 4META 2E51A 2J7MA 2DVGA 2R1DA 2VQEO 1NZIA 4U36A 1D4VB 2WQ8A 2D5HA 4JYAB 1K3EA 3LEGA 2GDFA 4HZFA 2B1GA 2Z42A 4CEWB 3J80N 2H0VA 2BVVA 3NNFA 1BMV1 2JD4A 5EYPA 2ZDIC 3G6JB 1NU1H 2VZSA 5GONA 3WFVA 1XNAA 2XXZA 5CBFA 4MGSA 2A6WA 2MEV2 3VD4A 2QQLA 1L8DA 4WFAV 1W8ZA 3RVHA 5FFOC 4A44A 2C26A 4MGIE 1GR3A 1IG0A 2FL4A 2WA4A 4C8DA 1ASJ2 1OC1A 3EQEA 1DZTA 1K5JA 2E3CA 3DKWA 4CS4A 4E4ZA 5EC2C 2VOWA 1OFSA 2VWKA 5DEDA 2ZEWA 2WA3A 3I3BA 4GWIA 5T3NA 1XSRA 3WG1A 4Q29A 3SPJA 3JALB 1SHWB 3NV3A 4A42A 1YJNV 3WU2Z 2E33A 2VZ3A 3SYQA 3OR7C 4LF9O 2H0BA 2BYVE 1QOOA 3OJBA 3HPNA 3TN91 1UZVA 3LDBA 1VP6A 3WX5A 1VF6A 3N9LA 1BCXA 4AQTA 2EAKA 2X6BA 3CIHA 4UCSA 2KKWA 5FDBA 1GQPA 2WAMA 2FDIA 1H0BA 1IBLB 3IWZA 1VF7A 1SQQH 2YPDA 4KWLA 3M7MX 5LB6A 1AI6A 1PIV1 2HEPA 1LENA 1R082 4GAZA 3UKMA 5LGTA 1UYYA 4MV2A 3GM8A 2Q8OA 3QLQA 4QU2A 3HMYA 4Y1XA 2ETNA 3OF1A 1AUYA 1GWKA 4DUWA 4RR3B 1OLME 4FFBA 4IV3B 1AX1A 2A3XA 2X09A 4K3UA 2Q4SA 1KP2A 2IJHA 2RJZA 4I5SA 1JI6A 3ZKYA 3GALA 2E32A 4ABMA 1IQDC 2R0FA 2ID4A 1WZXA 3Q8CA 2WIIB 2PI4A 3OD0A 1Q56A 3N9NA 2RQ6A 4H7MA 3OB8A 4XDJA 1D7PM 3PU3A 2IWGB 4HNAB 5H6QA 3KLSA 4JTAB 2XH6A 2HR3A 4TLFA 2IC1A 4A7YA 2H3OA 1SZBA 4BQXA 4CDXB 3RYPA 3L2YA 2ZHMA 3TNPB 1K12A 2YFUA 3WLUA 5CBHA 4KWJA 1KQRA 2P3KA 2JS5A 2ZE7A 4XF9A 1KJLA 4MO3M 2OW4A 1SC5B 3O14A 2DWDC 2VGDA 3D8CA 3UKVA 2XUMA 1ZRDA 2Y4UA 4LBNA 4EJRA 4CUGA 1TMF2 4LF4O 1XE8A 1W6NA 2LGQA 4RGGA 2ZE6A 1E5SA 4BU2A 3RSJA 4QGLA 4P9WA 1W6PA 2WFF2 2X10A 2VQTA 4OULA 3MGUA 1W8WA 1YCIA 1OCOC 3FLPA 2R9RB 1RMU1 5FZCA 1H2SB 5C4WB 1Q3EA 3FMGA 1VQPV 2P4VA 2WO1A 1GWMA 4HPKA 4J9ZB 2WLJA 3VZNA 3HAGA 3H9VA 1L0NH 1R1A3 1VBE3 4I09A 1VB4A 4LR4A 1KC8W 4DR2B 3N9QA 3ILRA 4HYOA 1X59A 1KBHA 2PN5A 2BGCA 4JTCB 4JGZA 4GH4C 4XFGA 3JD2A 3AJZA 1SG3A 1N1SA 4P08A 5DN2A 4R6ZA 2XHKA 2A71A 5GW7A 1A32A 3UM7A 1HNZO 4HK8A 4RQFA 1XYOA 1UL9A 4AF9A 2ORZA 3AFKA 2NQYA 4WZFA 1AVMA 1TZOA 1R081 1OD5A 4GD4A 2RR13 3GHMA 4J10A 5EIYB 2VVFA 4LF6O 3A4UA 1RVF3 5FZIA 1TNFA 5JZGA 1N4CA 2V4AA 5I8SA 2DF7A 3KS7A 1HNXO 5L9BA 4JPRA 3UQ8A 4B3TB 2K46A 1KGYA 3WR0A 2Q7HA 1Q7YW 1B3QA 1MMMA 1RUD2 1VMJA 4GMP1 2CH7A 4YHHB 1FPN2 2NZ9A 4CH6A 4YRDA 4ASUG 2D7FA 5FZ0A 4TWTA 1B06A 5EP9A 2VMFA 4GWMA 1SMVA 2ZX1A 2P22C 3RZLA 3AK3A 4A45A 2PHWA 2WDBA 4AR2A 4QD2A 1KKCA 2CWSA 5IY5B 4MVOA 1AR91 1CPYA 3TXSA 3QVNA 3SXWA 1GUIA 1BBT2 1VF6C 1YQ8A 4YZ3A 1W8TA 3GDBA 2ODMA 1TMF1 3AKQA 2XJQA 2WZPP 1EN5A 3DXTA 3VUOA 1B04A 1IBLO 4ZKIA 2W6IG 2Q1FA 1SLCA 5HXMA 2B42B 3KZ4C 1NH2B 4OZXA 2YIDA 2YV8A 1GK9A 4JYCA 5JVDA 1NZCA 4PIZA 3AG4C 5F3EA 3DPRB 1U12A 1YHFA 4LCUC 1VBB2 4P00B 1AP5A 2TNFA 4MTOA 2YY1A 1VAVA 4LHNA 3U10A 1TUBB 3MLLA 1QR9A 3TOJA 3THCA 1CX4A 4CVUA 1PL0A 1UX7A 1YDXA 3ASNC 2DVAA 1XI1A 3ZN5A 2WYFA 1BHGA 1OUSA 3I97A 5CA0A 5C7GA 2Z2SB 4GB32 1J83A 1Y43B 5FMOL 1PM7A 2ATKC 4PHZA 5FP7A 1OMIA 4CS2A 2UXXA 1BT8A 1VQ9V 4DV2O 5L3DA 4Q1PA 1Y74B 1RUF3 3L9DA 5J3UA 2XGXA 2VNRA 1REDA 4CSWA 1B35B 3HBKA 2CGNA 3KG2A 5EFUA 2QQVA 4PELA 4LC1A 3IM0A 2Q9LA 2JX9A 4P9OA 3P5BA 3AMMA 3I54A 1DLLA 4K0KB 5L36A 4BOWA 5LBBA 5JPNB 5FV3A 3ZYIB 1BMFG 2H6CA 4BIFA 4QDQA 4OQ9A 1M57C 1REEA 4IGQA 3IFXA 4PLOA 2LP7A 1XMQB 5EXOA 2C9KA 4WM7A 2E74B 3ZXAC 4HFSA 1H6YA 3VD7A 1OKQA 3UGFA 1W06A 4JDNA 2Q8CA 4CS3A 3DC6A 4J6GA 4Q4Y3 4DR2O 4PV1B 4PDMA 3KZIZ 4K21A 4YY3B 4OPHA 1R6TA 4Y1UA 3CPWU 4W4LA 5EIBC 1QJU2 3QH6A 1CIYA 3ZMOA 4JGZC 1AXKA 4XJ9A 1XPWA 3H1WA 2WT2A 1ZAUA 3FHIB 3VBRB 1CAWA 2HEVF 2JRIA 4QDRA 2PLV3 2VE1A 2XLAA 4HKWA 3K5MA 3N2GB 2E31A 4HKOA 4TN7A 4QXBA 4AI2A 3ACGA 5DDJ3 3ZN6A 1UQXA 2WINB 5FZBA 4FLXA 5AFEA 1GN4A 2Z5WA 2G19A 5JZGC 3VBSB 1R092 2B5UA 1FMD3 1VBB1 5FPLA 4COUA 5LK7B 4QPIA 3BCWA 1SPPB 3O0WA 3ORJA 4B3TO 2D3OW 3N36A 4NE9A 1IKQA 3HKBA 2PHRA 5FYHA 1DGRN 3KQRA 4QT6A 4LQRA 1XJAA 3Q4HA 4YHHO 4I3PA 3HBZA 2WRAA 2Q1ZB 1WMEA 2WT1A 3QACA 4F6RA 3T2TA 2P4KA 4AVSA 1WLDA 5C4WC 2BFUL 2FBEA 3ABZA 4FFIA 5FPAA 4GKKO 2I07B 2WJSA 4LBOA 2LRPA 4H33A 2BGOA 2ZM6B 1S2KA 4RHV1 1FJGB 2XL7A 3HNYM 2VMCA 2EXKA 1O3SA 4UV9A 3K51A 3BY6A 5LYJB 1QOTA 1RUE2 3VDDA 4DV7B 5DZEA 2JDZA 5IK8A 3CC2V 2YEVB 3UJQA 2HBTA 3BOWA 4ZS2A 1H8TB 1WMFA 3T30A 2P3IA 1LHWA 3OFNG 1I5ZA 3PNAA 1E57A 4ZPIA 2VOTA 1OHHG 1MABG 5ITZB 5KA5A 3C2UA 2QJVA 5D5QA 4O4LB 5HCHA 2VCBA 4IEZA 3USUA 4YJ3B 5JPMB 1ZRFA 2Z0AA 4YLZA 5JMOA 4ARYA 1ZRRA 4X1KB 4AQYB 3B3QE 2PYJA 1F9KA 4PDWA 3WG4A 3L71H 2OKXA 2A70A 2YGLA 2BJSA 3FYIB 5JI9A 2DVBA 2ZR2A 2WLLB 1N1TA 4B29A 4TLGA 1HW7A 1JR9A 1SQ4A 5K4LA 3PVEA 1SEFA 3M3CA 4OVEA 1DZQA 4BK5A 4Z92B 4F6EA 3NNJA 4LPLA 3J7HA 1QJU1 5JH7A 2YC0A 4NKGB 4YVSA 2UXBB 3VDCA 3JUUA 4JGYB 5CA1A 3SKJE 5JR7B 5DXDA 2GMEA 4M3CB 1NLSA 1XYPA 2CTRA 1X8MA 1FI2A 3H7YA 3SJBC 4HVOA 5IJRA 4NIIA 1UMIA 4ICGA 4K8XA 4DR6B 3DXRA 1KDKA 3EJKA 1PZ8A 4IE5A 4N8MA 3W5MA 3FKSG 1JH5A 4WVZA 3LAGA 3PTRB 4MGZE 2XG3A 1HRI3 4UXAA 4NROA 2UWBA 3JD4A 1UY3A 5ABJA 1M9NA 4JI5B 5LA6B 1MPXA 4LHSA 3WCRA 2DJVA 2VOXA 1R091 4YGCA 1RUH3 4L8QA 4YW1A 2P6CA 4TTGA 4XETA 3IN9A 3CWBH 2IVJA 1W8OA 2B39A 3WDXA 2RR12 5A3NA 3MPBA 5A2QN 1RVF2 3SISA 1UJWB 3O5SA 1BKZA 4WM7C 1SLIA 2GTSA 4DR5O 3C90A 1U5ZA 1PMIA 2EF6A 4AHCA 5D2AA 3UYJA 4N23A 5J7MA 4QX7A 4E4HA 4NPRA 2P5OA 5FZGA 3ZDSA 3A8TA 5IK5A 4DUVA 1YSCA 3U4SA 5LZ6A 3LDRA 5J2UA 3VQXA 3ZR5A 2Z5UA 1C5IA 3SH4A 4DPNA 5EZYB 1RUE1 5BYNA 1W2OA 1V54C 3OG2A 1XHXA 5BR8O 2ARXA 1XHZA 3P3NA 3ZM8A 1BVVA 1PX4A 2QM8A 3LPGA 2EINB 2CWMA 3J7NA 4FPFA 5C8CA 2HG5C 2WLPA 3RZKA 4G27B 4JI6B 4CDQB 3AM2A 4CE8A 3HNBM 1RB8G 3FB6C 2R073 3UL2A 4QPIC 4P5HA 3I2JA 1OH4A 5A3WA 3JCZA 4B08A 1IBKO 4P9IA 4AYUA 2DYSC 4BAYA 1NTMH 1BHBA 1WPXA 3K5LA 1TA8A 5EYXA 1CZSA 2XKOA 4O65A 3H1JH 5K1XA 4CEYB 1BCCH 3IMMA 5FNVB 1JUHA 5IDJA 1JMKC 3GZUC 2ZGNA 4COWA 4FVMA 4QE7A 5LA2A 4Q1RA 3ABKB 2JG8A 1B09A 1NR7A 4X1IA 5FY9A 1FX5A 4UYBA 5IYZB 4ES9A 1NX9A 1SETA 3ZYJB 4CP9B 4JZGA 1OCRC 4J7JA 4DV7O 3VDDC 1WCKA 2V73A 3IPVB 4BM8A 3ELNA 1DF0A 2BU9A 3MHSC 3SYCA 3UKTA 1RUF2 2X53S 2MW2B 3CL1A 1VBC1 3V0AA 1RSOB 3J7LA 3H7JA 2EA7A 1SQBH 1C1FA 1AR83 5KA6A 5ACA3 3VL8A 3W20A 2VG9A 1UOGA 1JZ8A 2W2IA 2VZVA 4PDWC 1W6MB 1ENVA 2RDNA 3I55V 2CTPA 3K4ZA 1T2XA 4Y3OA 1QMJA 3CEIA 4I0XA 3WQ7A 2DU0A 4UCOA 5CU1A 1IBMB 1LESA 2CE4A 2KD7A 4DNYA 4IGGA 3LA2A 5FMCA 1WLEA 4JI4O 1WW5A 4XJZA 4I30A 2ZTNA 4W6YA 4YVSC 1QQP3 3AXDA 2IW5A 5K0UA 5C9AA 5F3GA 2JG9A 1PGSA 3CC4V 4Q4Y2 1RUJ3 1C8M3 5F8PA 1JODA 2XUEA 4Y33A 2LS6A 4KP4A 4DR6O 1JVMA 3ZSKA 5FPOA 4FSJA 1N0NA 1DGWX 1F4HA 3ZIAG 3PURA 3NSTA 3T08A 1SCRA 3AZZA 3OTOB 1X4TA 1J95A 2ZGOA 4IIJA 4LO5B 2DYRB 1QXPA 5ABJC 4IE4A 2VZRA 1ALYA 2PLV2 4S2DA 3CDZB 1W6OB 2QWOB 5IK4A 4JX0A 3RYHB 2YICA 3ZIXA 4A41A 4MVQA 4LIUA 2X05A 1QHDA 4LFAO 3ASIA 3JAMN 5E6HA 1FMD2 2EX3A 3SITA 3JSLA 1JQ0A 4PCRA 1RP3B 1ZBE3 2GSYA 1QNWA 5H9CA 4JAAA 3MUZ1 4BMBA 4JCKA 4GLXA 3WINE 1HRV1 3BYWA 1POV1 1Q81W 5FPUA 2ZNJA 1DTOA 1S4CA 3K9AA 2C4XA 2IU3A 1OOPB 5F3IA 5LW9A 4LOSA 5IK7A 4WFEA 3B9CA 4CP1A 4ZBMA 4MADA 5A32A 4CZSA 1L1FA 4PA7A 1QH7A 3CJHA 2VMDA 1HKDA 1GZTA 4JI2O 3CMEV 1CJDA 2FDJA 2CUGA 4LNUB 3WUDA 3AMHA 3ICXA 2JKXA 5A1LA 1A6CA 3G6BA 2PHLA 1N3QA 3AX4A 1VARA 2ZGPA 1GMMA 1CAVA 1UU4A 4K1ZA 3W21A 2GNMA 2YG0A 3JATB 4AHWA 1VIWB 4JI6O 5FKBA 3SKVA 3AYDA 4LBLA 2KXLA 2BNNA 4LKFA 2W39A 2X5IA 3OYWB 2BSKB 1ZL8B 3VZMA 4JTDB 1ZX5A 4KU7A 4FXGB 2PHFA 4NHKA 1TE1B 3SCGA 4CU7A 3T2MA 5FY4A 1Y67A 4IYHA 4TSFG 2HEWF 4OHXA 3SH3A 3CCQV 1NCQB 3T4VA 3P6BA 3S3XA 2RS33 3HN1A 2J1AA 1Z5VA 3SJCC 1FOD3 4NUBA 4CU6A 3JBG3 4FO9A 3KGZA 4Q4Y1 2QFEA 1T6BX 3B93A 4B4QA 2VW2A 2ZAAA 3PJSK 5EJ1B 4FPKA 1ULCA 3IIIA 4UBHA 1US2A 4QHOA 3FJSA 3R65A 3FBMA 2GBOA 1FNZA 4NB5A 4XURA 1YJWV 1V6MA 3DGEA 3M7AA 1ULDA 2ZX3A 4Y20B 1F31A 3E86A 1L7RA 2TUNA 4XFHA 1I3HA 2Y0OA 2JK5C 3RJRA 2QEXV 4ZZ5A 3VKNA 2YI8A 1G9DA 1MS8A 4FLTA 4MSWC 3AP7A 2RMU1 5IYBO 3B02A 1GSLA 1G9FA 1AR1B 3N7LA 2GZWA 5J2TA 1VAMA 2DW4A 3X2QC 4IHJB 1RUH2 1I6XA 3PU8A 4FM2A 5ANNA 4CDQC 2LM3A 2V4VA 1H30A 4EB6B 3CJIB 4Y24A 1NCRA 1LNSA 3RT3C 1SZXA 5FXVA 3ZO0B 4XJUA 3D3IA 5JXHA 5JSRA 3ROUA 2PQSA 4B3MB 5KWRA 2GC0A 4ZIBA 5C9AC 5K0UC 2EXIA 2JG9C 5I0UA 1ONAA 5EYYA 2ZNIA 4R8HA 1DGWA 5IW0A 4PLNA 4N7UA 5L3EA 3K3NA 5LRRA 2A6XA 2QQOA 4AE2A 5FXWA 4AQSA 2QTSA 5A7QA 5FK7A 1JX9A 3ABKC 3JASB 3DXUA 3PIJA 4FXKB 1W8NA 4HBNA 3J7AU 4GX0A 3B77A 1WD3A 4I7ZB 2XLFA 2HKOA 4IYIA 1LR5A 5JOXA 1FFXB 5J9PC 3JD1A 1UZWA 2WSVA 1GOHA 1O5UA 4Y4YA 1GV9A 1ZA7A 1KMIZ 4LULA 5JXGA 2DCJA 1DLBA 4R9AA 2R9AA 1V6KA 3S30A 4DR1B 1RPOA 4D6SA 1OCZB 5LOVB 3ZN1A 4UVAA 1DHKB 2ES3A 2IXHA 4I55A 1LU1A 2ET1A 2XHNA 4O4HA 3OBRA 1N3OA 2YXLA 1W3VA 4UCVA 2LFSA 1MS9A 4MXWA 2DYCA 3W59A 3AMNA 1H8HG 1CAXA 1SACA 2WS91 4DY5A 2WNUB 1HNWO 1O9HA 5AVAA 4M0NA 2UUCO 3B69A 3RRDA 1QJX3 4M01A 1Q8QA 1ULFA 3KV4A 1AI7A 3M3IA 4EQVA 2QCSB 3WG2A 2CTWA 4COZA 4P2ZA 4DV1B 4IV1A 1XNTA 1V6IA 4UXNA 2WL1A 2XAQA 3HT2A 3WF2A 1DFQA 2MK3A 2OTLV 1KRIA 3WW3A 3F7YC 3J8F2 2WNOA 5BMVB 5FZOB 3AC0A 5F9TA 4XFAA 2AEZA 1QXRA 2R042 1OQDA 2PGGA 2BTQA 1V6LA 2HJFC 1XE7A 3CP1A 2WNVB 1AR82 4AFMA 5ACA2 3SYAA 1LR1A 2P3YA 5DQ0A 4NJ4A 2JIZG 4DV3B 2EVXA 2DTYA 1X50A 1S5HC 4E4EA 1K92A 5EBMC 1XC6A 1QDCA 3HKCB 4G28B 2EBOA 3HEIA 1MACA 4GJYA 2AENA 3IDBB 4BIOA 3VZKA 1M56B 2YXSA 2WLIA 3ACIA 3ZHVA 2QDNA 3D36A 4Z2AA 1H6XA 4DR7O 3K03A 2BNMA 4CDUB 2GC2A 2W47A 1TEIA 2RM21 3K59A 1COV3 1NLQA 4BCUA 2QBXA 4EN6B 2XKPA 4I4TB 5F32A 1NUKA 1KITA 1BS3A 3M99B 2OS2A 1C8M2 2EILB 5IFTA 4E8CA 3JXSA 1K7DA 1EP0A 3DN7A 1W8FA 1Q5OA 2AXTZ 2Y48A 4JKKA 4IL6Z 5FZ8A 4BW9A 4I50B 4J1WA 3P3PA 4R9CA 2SBAA 5CVRA 4LOTA 1V55C 1R64A 2JDUA 3V64A 4X64O 4KU8A 2WO7A 1J1LA 4GXLA 4AEKA 3VQWA 1R1BA 3K77A 4CP0A 5CA6A 1LHVA 1W0NA 4JI8O 2FCTA 5IYCO 4XCAA 5BNQA 3E97A 4P9GA 4OFGA 1NCRC 1NXMA 4FOVA 1SERA 3E8HA 1Y4MA 5B1NA 2JDAA 4GZRB 5JR2A 1RPRA 4L87A 3W9AA 1ZZCA 3CRRA 3TYJA 3K75B 1ZBE2 1ZYBA 1Q90D 3OAAG 4B3MO 1ZM1A 4R52A 5FYSA 3AG3C 1RXFA 3T0DA 1BQZA 2ORXA 1POQA 4AEDA 2E53A 2CU5A 5F5CA 2ZCWA 2QJ1A 4ZXEA 4UFKA 3VBBA 2FYUH 4FLVA 4D6QA 4UB8Z 3HQXA 4JI1O 1JYXA 3WB1A 2ZJCA 4LO6B 3C7OA 5LXTA 1HXS3 4LIVA 2Y0PA 5LY2A 3LSDA 3DECA 2P67A 5C8YB 3J8F1 1XREA 3H50A 4UW5A 2KB1A 5FPZA 2WR9A 5DN6G 2R041 1EFRG 4YIOA 1UPSA 4R8CA 2YGMA 3AB0A 3OGCC 2O57A 5A3PA 5ACA1 3FAVB 1TAEA 4XZPA 1GZWA 4DR1O 3I2KA 3U78A 2QSAA 1MS4A 3S5QA 3K0DA 2A5ZA 4W65A 3K79A 3H42B 5H2FZ 1OXCA 4JRLA 1R3IC 1NLRA 3MW4A 1Q8OA 4Q4X3 5BNPB 4H7LA 1VLNA 4ZOLB 4XW3A 2YXYA 5FL7G 2I45A 1LOAA 3X29B 1GM7A 1YQ6A 3WSOA 5JWPA 3JU9A 3RYRA 2W1UA 4L97A 2WZR1 1N8RW 3EB7A 4B8EA 4D6RA 5IATA 3GZTB 1FOD2 3VN4A 5EK0A 1F35A 2RS13 1QU0A 1YJLA 3GBWA 1C8M1 1YVWA 4QXHA 1ULEA 3NAPA 4JASA 2J42A 1GZ9A 1MVEA 2WT0A 4D94A 5KC5A 5FQ0A 1Q82W 1Y4WA 4DV1O 5H9SA 4IV1C 5FLJA 5C3RA 2R49A 1EN4A 1COWG 1WJZA 1AJPA 3VHNA 1OCCB 2J1VA 5IVVA 3WHTA 2BDRA 1JYWA 3N7MA 4YW7A 2X0LA 4QX1A 3EXAA 1PX3A 4K8ZA 3J9SA 5CA3A 4JZRA 4DO2A 5JQGA 3BAAA 2A3YA 2Y6JA 5IVEA 2XHBA 2QKCA 1WB8A 4Q20A 2A0LA 1Z5WA 3K3WA 5B3SB 1WCQA 3E22B 4DV3O 2UU8A 1KB9F 2FDGA 1VMFA 4LXLA 1UYXA 3IC7A 3BODA 4LWSB 1VB2A 4NIDA 2ADQB 5DECA 1OCZC 3ABLB 2UUBB 4DV5O 1ZRCA 4MGKE 1REFA 3D36C 4LBQB 4PA4A 3A2FA 3GVMA 1G8WA 1FD9A 2JD9A 5DZFA 1AXYA 1E5HA 2P17A 3GHNA 1HB1A 2HHHB 4NTYA 4LLFA 4P9PA 2OA2A 5GZGA 3AZXA 1WCSA 1DLCA 2XNDG 4FMTA 2A6YA 4YW6A 2IU0A 3CCJV 4IE6A 3WNKA 2HWD3 1VMGA 4H3WA 2VTXA 1SLBA 1F5JA 2XASA 3H8OA 2JDIG 1LOFA 3DKQA 1OA2A 1PVXA 2DDUA 2W9XA 1LAJA 3OGJA 4FAGA 4YZ2A 2NLJC 3LFIA 5ANQA 2C2AA 1LCLA 2FD8A 4GMP0 3FHAA 3FBYA 1UWWA 4GX2A 3VBFB 4OLLA 4NYKA 1YIPA 3UCSC 5CYYA 2YU1A 3K57A 4HSLA 1XE0A 4FM0A 5A6ZA 4X66B 5L7OA 3SYPA 2R30A 3N9OA 5FY1A 1RUI3 1GP4A 3CSXA 1MQTA 1L7LA 1SLTA 3POJA 4KHPB 2QWNB 3BIEA 3U4XA 1X82A 3VBUB 2HWE2 3GB7C 4WVWA 3FE5A 2BGPA 3ES1A 3I59B 3T2QA 3KT4A 1PVC3 2DUOA 4AEDC 1ZVFA 3U07A 3ABUA 2ITCC 4GX1A 5FO7B 5GLWA 5IJ0B 3U1XA 5J09A 4JI7O 1DYOA 4PDLA 3APOA 1ODMA 4O2BA 1AP6A 2E9QA 2A7WA 1I94B 3AK2A 3B40A 5FYMA 3ENRA 3ZRWA 4RA0A 3MW2A 3VKMA 4NAOA 3SPHA 4IEPA 4PDRA 2JGDB 4KG8A 3ZFGB 3MIGA 1YFYA 2GP5A 1JMUB 2LW8A 1S0VA 3APBA 4XMAA 3OW2U 3H1YA 3JQXA 1S0IA 3NR7A 3E8FA 4MLOA 5HCAA 1G4YB 5CIRA 5IWAB 3CX5F 2EIJB 5FRAA 2LO1A 5LP6B 2RDRA 4CDWB 1PD3A 1MZFA 1D4M3 1V6NA 4AAPA 2YBPA 5LA9A 5D5PA 3HKDA 3ETGA 2FQPA 4AI3A 1CEZA 2YMZA 3DSQA 1PNKA 2UUAO 4BXSV 3O1OA 1EV11 4ASKA 1U97A 3AKTA 2Y38A 4UF0B 1S0CA 4EV0A 5GZCA 3ETDA 4O2AB 4DW0A 4QM8A 2DU1A 4I2OA 1I08A 5EJ3A 5K1PA 4PA9A 1YUDA 1V0AA 4RL7A 2VNOA 3HD8B 2WO2A 5APAA 5LMUB 5K8SA 3B8NA 1Y76A 1RYYA 5KX5B 2IH3C 4KI5M 2Q0AA 5I8TA 4BPZA 2BERA 2C6SA 1IPJA 3TN93 5FY8A 4DV0B 3T2PA 2ARCA 5KMGA 4XFIA 5BNNB 1RJ8A 2IBZH 4GJZA 3NV1A 5FPXA 4XFFA 3NAPC 1YIJV 3B94A 2WKKA 4OX9O 5C71A 2ZKLA 1GTOA 4G2KA 4CCEA 1H38A 1GAXA 2VXRA 1COV2 3NL1A 3ZXLA 1XNQB 4V1PA 1PIV3 2D3PA 3MYXA 3H8UA 1Y66A 1X9TA 3CZUA 4EN7B 1IOAA 4Q4W2 5AFBA 5A3LA 2J22A 1VPHA 4UT5A 5J1XA 4CCNA 4XDPA 3WF4A 4G3YC 1SA0B 1UKGA 4UI9L 4YFZA 5B1AC 1ST8A 3S6PA 2OX0A 1N34B 2WWSA 1NXD1 2W46A 2ADPA 4NRPA 1J58A 3BTZA 1W04A 1UYZA 2ZGTA 2I2SA 2GNBA 5D21A 1D2SA 2GDSA 3WV6A 2KG7A 3W7WA 3PDQA 2FZ1A 4R4ZA 2IJKA 3JAWA 2HWE1 4C0HA 2QTOA 4ZI7A 1OURA 4GULA 2QM7A 3CF6E 3RJ2X 1EZVH 3OEEG 4Y5SA 3VZLA 4ASLA 2P34A 3ST7A 1QWRA 3ZX7A 4JKLA 3POSA 4R9BA 3FFZA 4GZ9A 4HONA 3RBZA 4BYYA 5T52A 3CCEV 3AKPA 3W7TA 3ZSLA 3WW2A 1RUC1 4KXRA 5E1RA 3M1HA 1DYKA 2YB7A 1QIQA 5CKNA 5HV4A 1LOFC 2EIMB 2ARBA 3JCIA 1WNSA 4D69A 1HXS2 1JOPA 2ZX4A 2VZ1A 1HQNA 1RMU3 3CS5A 1O7FA 4QPGB 5GZDA 1MA1A 1NTKH 1PO21 2LROA 1W6QB 4N43B 2YDEA 1PK6A 3OE7G 2HJDA 2QE3A 2ZGMA 3S7IA 4E8DA 1P84F 1KD7A 2LW7A 3JARA 1OUXA 1YFWA 2ARHA 4A7ZA 4PA3A 5KUKA 2YIBA 3E35A 2Y69C 4XZUG 1DQ6A 2HFEC 2XTAA 5L7OC 4IEQA 4YJ2A 3KM5A 4CBCA 1SLLA 4HN0A 4XIOA 2NNUA 2OT5A 5CFCB 1RITA 4QKFA 3NNLA 4RYDA 2ZINA 2VR4A 3WHUA 1RHI1 3ZYFA 3TETA 5B3SC 1DDLA 1VF5B 1LGBA 4CCMA 1AYM1 1YZBA 1VQ6V 4WZCA 3RZHA 3RYIB 4WBNA 1D5AA 4TUYA 4DXTA 1I5YA 2Y6LA 4AI1A 3CD6V 2QR4A 3WZ1A 3E8GA 3RYCA 1OH3A 1XRUA 1TVKA 4H37A 4W4ZA 4N9HA 1OPMA 4HAMA 2YSUB 2PXJA 4JRAA 1R083 4JDMA 4Q4W1 5EPAA 3OPWA 2R061 2RS12 2XJVA 2YC4A 1X7NA 3F95A 3L72H 3K5NA 2GUZB 2VBBA 2ZEYA 4KBZA 4ARXA 4FTEA 3KV5A 2W87A 1NBMG 1VEWA 1V6JA 4XILA 4NR1A 5IWAO 4JGSA 2OIIA 1HJFA 2Q8DA 4GMP3 4NHLA 1YF2A 3EYPA 1PNLA 5FZ4A 5LBFA 3Q8FA 3VZJA 1VMHA 2OXBA 3ILNA 4QHZA 3IDCB 5B2GB 3L75H 2DUQA 1GNZA 1H8EG 3OEHG 3ZOIA 3PLQA 5LMUO 1URXA 1N32B 3A0HZ 3KVAA 5A3UA 2XQRA 3WD5A 4RAIA 1Q6UA 2RVAA 5CBLA 4PQ9A 1ZRIA 1AR93 3MAQA 4DZGA 3KVBA 2K9PA 3EO6A 3UESA 3VBOA 2PY5A 1AILA 2VMGA 3WNOA 2EZOA 4A2UA 3E5QA 4JQRA 4K8FA 4EROA 4YW5A 3CYOA 1GP5A 3AVRA 2UXCO 1DU3D 4DV4B 1M4WA 1G6UA 3AYEA 3JB8A 2W91A 3LUTB 3N3HA 1YI9A 4LNVA 2PHXA 2HWD2 3ZHTA 3ZMUA 1OLRA 4O4IA 1NE6A 2Q5ZA 3ZXKA 2WPDG 3VKFC 1O9GA 2K9ZA 1J3QA 4RS5B 2V1DA 2JJ1G 2BOJA 1Z7S2 2Y4TA 4YW2A 4LF5B 1MEC1 2EIJC 2WLHA 4DEQA 5LP6C 2QQMA 4CDWC 4LA3A 1W2UA 4CP2A 1BE3H 4FOWA 3TJTA 4X1YA 3W7UA 1VBD2 2W95A 2N74A 1J3PA 2X8KA 1Q8IA 1DQ0A 1NI8A 3V65A 4LBMA 1GO3F 4PQQA 2CK3G 4XUTA 5F37A 1AX2A 3B8MA 4D6TH 1RUI2 2WZ8A 3RN4A 3H8XA 4WBBA 4J7KA 1AR4A 3T2OA 3T1LA 5CADA 3EHBB 3IC9A 3IBMA 4D3WA 1TME3 4F83A 2XPJA 2J1SA 5FZDA 4CCJA 4UBGA 1OCOB 5DUWA 4CC6A 4UFIA 1QJY1 1S3JA 2PTMA 2JE7A 5I0TA 2H6BA 5TISZ 4FK5C 1OA3A 2X6CA 2F95B 3KF3A 3NKTA 4QQHA 3G7DA 2ZT9B 2D93A 1S0GA 2A1XA 1G9BA 1ZX3A 3HPLC 2OUJA 3ZHQA 3OBAA 5A7PA 5L19A 4BMEA 3JD3A 1UW8A 2NYYA 2UWCA 3R4SA 2M6YA 4OPAA 3DYPA 2VVDA 3H1KH 1F2NA 5F2VO 4WM8A 4D7TA 3T1YO 4C7UA 3AJYA 2JEMA 4QIWF 4E2QA 3FB7C 2IVIB 4DXWA 3LZZA 3Q9OA 1VRH1 3WP3A 2ATFA 1FXVA 3ZHRA 1UOFA 2XAGA 5KHHA 2DN9A 1D4M2 4GALA 4DRXA 2HWB2 4PBOA 3HQUA 2ZXWC 5EWSA 2VTXJ 3HVDA 1UFIA 3A21A 3THTA 1K42A 4PI2A 4WVMB 2P6JA 4Z07A 4AHXA 4YIPA 1C57A 2W08A 3F2ZA 2ZQMA 3FC0A 4XDQA 4HG6B 2F23A 5FYCA 4OYUA 5C33A 1YC61 1BZWA 3OUSA 2Y6KA 4ITCA 4PIYA 4XVHA 2FCVA 3TN92 3UJOA 5GONB 1KFUL 2VZOA 2E7QA 5FZ7A 5J98B 5IVBA 2WN2A 4DV6O 2VBDA 3T1HB 1PGL1 5F5IA 3TCUA 1JJ2U 2XOMA 1VBB3 2ZEZA 3I2DA 3LSSA 1JYIA 3OM3B 5DZGA 1FV3A 4X65B 1HV1A 4TYSA 1I5XA 3LSUA 4Y4RA 2ZGRA 2ILMA 2EIBA 1SBEA 2CAUA 4DEVA 1D2DA 1A78A 1Z7S1 4XIKA 1M06G 5FZ1A 4QNHB 1SRYA 3OD4A 5JUVA 1E79G 1XOUA 3TWIA 4AQ2A 5A9GA 4Q27A 5KAFZ 1HR0O 1JYVA 4XOGA 2JEUA 3M3QA 3TEZA 4QPGC 2DFCA 2E5LO 1VBD1 1WLWA 4N43C 1XYNA 3AL5A 3ZHSA 2ZABA 4RHV3 2GMMA 3FLTA 4DUZO 1CP9A 4XXPA 1RUI1 4LK7A 4LFCO 2W6JG 5KR7A 3POFA 4CRQA 1PNMA 3WF0A 1W0JG 1K8AW 4NIAA 3VBOC 1OT5A 4LFBO 2BW8A 4JHTA 1V9U1 3UO3A 3AG4B 4FFBB 1UOJA 4XABA 2W5FA 5KHIA 1WCDJ 3AL6A 3GCXA 1XL4A 3K08A 1GOFA 1X33A 2D43A 3ASNB 4Y22A 2LGWA 3CRMA 3K58A 1V70A 5FUIA 3VQYA 4NWVA 2PHUA 4FPEA 1POV0 4XAAA 3WDYA 1L7QA 1RMU2 1D4M1 2HWB1 4CXWA 1G6NA 4P14A 1QJU3 2FMDA 4TV9A 4U2AA 3I5DA 1MS3A 2JE8A 3HOBA 1CR7A 3WF1A 2W1QA 4QB1A 2XJSA 1GOGA 3UETA 1UCXA 4BQ2A 3LEKA 3K06A 4NTXA 5IT9N 2AGSA 5GLZA 3LCPA 2QQNA 4XC9A 1W6NB 2A75A 3OCPA 1W6PB 4B3RB 4PLMA 1C5HA 3N2KA 1QBZA 2EIGA 2XAHA 1R093 1M57B 5FYUA 5L3FA 2ZAHA 1WW4A 2OQ7A 4LKEA 4MHUA 4LA2A 3ZFFA 4Z82A 2VTFA 1H2NA 2WQZC 5LBEA 3OTFA 5CB4A 4HPKB 1RJ7A 4WF9V 3MHHC 4EFBA 3OR6C 3O1UA 2XVGA 2DWEC 3USSA 1JYNA 2W52A 3BTAA 4J41A 4QX3A 1GYKA 4K40A 1PNGA 4RSUA 4CCCA 3FUQA 2IFRA 2ZX2A 5F7UA 3WP6A 3SC7X 2M7WA 4NXMO 4M0HA 4B7KA 1F8VA 4AEMA 4JGZB 3LIGA 2RCVA 3I2FA 2ZGLA 4L2NA 2YIBD 1YI7A 3VZOA 1R6NA 4L92A 3QF7A 1SESA 2AACA 1DQ4A 4HOOA 4BIZA 2YYOA 2CTVA 2C24A 4X62B 4RS5C 3EXUA 5H9PA 3ZLIA 1KKDA 2VMHA 1AR71 4FLUA 1RUE3 1DQ5A 3IKWA 5F6LB 5C3QA 4LEJA 3T09A 1NVPD 4MHRA 4UVBA 2CDPA 3VDAA 2UXNA 5IJ9A 3PVNA 1EUUA 4NHYA 2ZGUA 3ALQA 1AR92 5JZGB 2Q4PA 1ZA4A 3ASOC 4O4JA 4YNIA 4DMIA 4W4KA 1AHSA 4B4PA 1O4YA 3CLPA 4DB5A 4FFKA 3QNEA 2YUAA 4O9GA 4QQ2A 1XU1A 1JS9A 3O1RA 2FDHA 3ZMNA 3R0RA 4IL7A 3WY6A 5L3B