3U11A

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
197
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 65
structure length 197
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u11A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u11A02
5JCTA 3D0JA 2UYBA 3CJXA 1NXMA 3HIFA 4KU8A 3ETQA 1ZZ9A 4N9HA 3JZVA 2E9QA 3S7EA 2VECA 1CAXB 1RTVA 3CF6E 2PAKA 4D7SA 4QGNA 3IWZA 1FXZA 3SHRA 1O7FA 4LTAA 4N9IA 1ZRDA 5FCCA 4ONUA 3CEWA 3IDCB 3EJKA 1YHFA 4I02A 1PM7A 1SEFA 4YNIA 3LAGA 4EWAA 3SCHA 3FJSA 4YARA 4HVRA 5I8SA 4MUVA 1CGPA 2XGXA 3KSCA 3H9AA 3LA2A 3GYDA 5FPXA 4XFFA 4TLFA 1YWKA 2GAUA 4XF0A 2CGPA 1ZVFA 2PAMA 1Q5OA 3EHKA 3I59A 5I91A 3BCWA 1O5LA 5KHIA 3MZHA 4H7LA 5EFUA 4MV2A 1Q3EA 4JTNA 3ELNA 1X82A 2ET7A 1O3QA 3TNQA 5I93A 1ZREA 3KMHA 3UKVA 2HKXA 3H50A 1EP0A 4XFGA 1XE7A 4BH9A 2UYAA 4HN0A 4F8AA 5FLHA 4IESA 2FQPA 5F1RA 2IXKA 1X7NA 1X8EA 2ATFA 5FQ0B 1O5UA 5JSRA 4MGKE 3U11A 4IETA 2Q0AA 1O3RA 3ACLA 3E6BA 3U0ZA 3EBRA 4AQ6A 3I59B 4LA2A 2D93A 3TNPB 2CAUA 3ES4A 3WW2A 2DCTA 4JV4A 2OZ6A 4XEZA 2QCSB 3E97A 1VR3A 3IDBB 1Q43A 3RYPA 2PHDA 1QY4A 4IEQA 3QACA 1GQHA 4I01A 1L3JA 1RUNA 1QXRA 1LR5A 2GC1A 1SFNA 4ZU4A 2IXLA 4XFAA 2MNGA 2GU9A 5FDBA 5BV6A 3DN7A 4HSJA 1OI6A 4IEYA 1YFWA 5K8SA 1O3SA 3OTFA 1FI2A 4UBGA 2CAVA 3H8UA 3H1YA 1NYWA 2IXHA 4UBHA 2O8QA 4ZU5A 2XLGA 3WW4A 4QM9A 2BEOA 3UKTA 4KL1A 4HZFA 3HT2A 4Z82A 2BYVE 2N7GA 3H7JA 3I54A 3NJZA 4I0BA 4AVAA 5J48A 2K9ZA 4FBFA 1CAWB 3EO6A 5I0TA 2K0GA 5E16A 5EZWA 4XF3A 3LWCA 2BGCA 4J1XA 2PAEA 4YYOA 2XL7A 4BYYA 5FPZA 2O1QA 1YFXA 4RD7A 1OD5A 1UIKA 3LOIA 3H7YA 4PJYA 2QDRA 2PQQA 5T3NA 5LEKA 4META 5J3UA 1J1LA 4UXAA 3CLPA 4QM8A 3LA3A 4MGZE 2GC0A 2FMYA 1IPKA 1O4TA 5CADA 4HLTA 1CAUA 3RPQA 3USSA 5I0RA 3DV8A 5BUVA 4XFCA 4IEOA 4QXKA 3H3ZA 4Q0SA 2UY9A 2GC2A 3DL3A 3FHIB 4XF9A 2XL9A 3O14A 4Q29A 4EWEA 3G7DA 3NVCA 4ZU7A 1WA4A 4IEPA 4BIFA 2VQAA 2GH2A 4XF4A 1J3PA 1LRHA 4A2UA 1ZZCA 3M70A 3E5QA 1YLLA 1IPJA 4GULA 3MYXA 4AXOA 1RL3A 1YFUA 3PNAA 5FQ0A 1XRUA 2PA7A 4WBBA 3N4MA 3I7DA 2VPVA 4XF1A 1DZRA 4BHPA 4IEZA 1CAVA 1DZTA 1OMIA 3PVBB 5KHGA 3ST7A 3NW4A 5I8YA 1EY2A 1CX4A 2EVXA 3KGLA 4QMAA 5C8WA 2IC1A 3E6CC 1UIJA 4EV0A 2UY8A 3RZZA 4XFIA 3D0SA 4I2OA 4PIYA 2QNKA 5KBFA 1O3TA 4B29A 1YUDA 4Q0UA 2BNNA 4WZCA 3ES1A 4Z07A 2PYTA 1VJ2A 1ZZ7A 2GC3A 2D5HA 3QOPA 4JTOA 1H1IA 2OZJA 4YSFA 1CAVB 1QXJA 3NL1A 1V70A 4HVOA 1OFNA 1Y9QA 1FT9A 2H0VA 3BB6A 4XFHA 1EPZA 4E2QA 5C6CA 5BPXA 4L11A 1WLTA 4E2SA 4FT8A 2ZCWA 4MH0E 4KU7A 2Q30A 4X6QB 1LKNA 4HN1A 4IERA 3H1WA 3KGZA 5KHJA 1ZRFA 4HVQA 1LB2A 4AVCA 1QWRA 3FFQA 2Z2SB 3CL1A 4I0AA 4MGIE 1J3RA 1J59A 3IBMA 3R6SA 1GQGA 4P9GA 4WVZA 3MPBA 5CVRA 3KCCA 2D40A 3HQXA 2OA2A 2QVSB 4I3PA 2Q1ZB 4J1WA 3RDIA 2HJIA 3RNSA 3S7IA 1UCXA 4I09A 5J7MA 5HI0A 2XHKA 4QX5A 1UW8A 2MPFA 2Q4SA 4XETA 5BXXA 3ROUA 3LZZA 4PIXA 5FLJA 4IEVA 3S0MA 3SMHA 4KWJA 5LRSA 3D82A 5KHKA 1NZCA 2V09A 2WC2A 3E6DA 1DGWA 2PHLA 3C3VA 3SCGA 1Y3TA 5D1IA 5JSPA 1WGPA 4MX3A 3HT1A 4L2NA 4D7TA 1HW5A 2GZWA 5KHHA 2H6CA 1PMIA 4NVPA 4IEXA 3UKNA 4MZUA 4YRDA 3BPZA 2PTMA 3CO2A 4HSLA 3BALA 3MDPA 2F4PA 2XKPA 2I45A 1UD1A 1EYBA 1G6NA 4E2GA 3ZDSA 2H6BA 2QJVA 1UPIA 3DKWA 3E5XA 4LA3A 2B5HA 5I8TA 3FWEA 1JUHA 2CV6A 4QGMA 1I5ZA 3VHRA 2B8MA 3OCPA 4IEWA 4KWLA 4LEJA 2IXCA 2Z69A 3FX3A 5BY5A 4LUKA 2ET1A 3SCFA 1CAUB 3IIAA 4PIZA 4EWDA 3U10A 4XFBA 4HMZA 1TQ5A 4Q0QA 1XE8A 4R8HA 4EROA 3L2HA 3H1MA 5I0UA 4O9GA 2XLAA 3E5UA 1I6XA 3NKTA 1VP6A 2BNOA 4R52A 2XKOA 3EQEA 3LA7A 2B9UA 1RGSA 1X8MA 1RUOA 4AQ2A 2BNMA 4ORFA 2MHFA 3FE5A 1CAWA 3RYRA 5FLIA 3WW3A 5JAXA 2IXIA 3GBFA 2D5FA 1DGRA 5LRRA 1ZZ8A 1ZRRA 3OD0A 3B02A 4FAHA 4MGYE 1RC6A 4K8FA 3OF1A 4JVAA 3M3IA 4DINB 4QGLA 3RYKA 2IXJA 5LEJA 5JR7B 4LULA 2EAAA 1ZZBA 2EA7A 4Q0PA 2P17A 1NE6A 4AVBA 2ETEA 1CAXA 3H3UA 4LLOA 2PFWA 2OPKA 3OGJA 1ZRCA 3BU7A 4X6RB 3FZ3A 1ZNPA 3NSTA 3SXWA 2Y0OA 1SQ4A 1ZX5A 4OFGA 2WFPA 1H1MA 2OYZA 1NE4A 5JSOA 1J58A 1U12A 5AVPA 4IEUA 2C0ZA 5E1RA 3WW1A 4LUMA 4OLLA 2XLFA 4KWKA 4O9EA 4Q0VA 4CYDA 3PLQA 1YFYA 1ZZ6A 2KXLA 4HBNA 4FAGA 4F7ZA 5I0SA 5CU1A 2ZKLA 1J3QA
chains in the Genus database with same CATH superfamily
2BOCC 2WIIB 4HK9A 4XJUA 3JZVA 4CPBD 3HR0A 5FY9A 3IWZA 4YPJA 1QJU3 1ZRDA 3CEWA 1CN1A 3ZYGA 3N35A 4CDQA 4TQDA 1RPRA 2VUJA 2RS31 2J1AA 2FTKA 4JI5B 3VDDC 5BNNB 3HWJA 1Y66A 2FMLA 2GAUA 1EV11 1UAIA 4J7ZA 5JQGB 1MMMA 4GKYA 2AACA 2WL1A 3ACIA 3M8LA 2ES3A 4CDXA 5LYJB 4A7YA 2F4LA 2QQUA 4PDRA 1E5IA 3JSNA 2WZR2 3TB0A 3QO7A 3WP3A 4LWSA 3N7MA 5FZAA 2BJSA 1H6YA 2MW2B 4IV1C 5JDBA 3WDYA 5GLWA 1P8JA 1WKYA 2BCCH 2R72A 4NHYA 2OZ6A 5CBGA 1ASJ3 3MHZA 4QWNA 5EBWC 4CU7A 4B1LA 3NV2A 1JOYA 2D97A 5L3GA 3JBG1 2RVAA 2C4XA 1PNLA 3PUQA 4QB6A 3VDAA 4UBGA 3W7SA 2VMDA 5IY5B 3LDDA 2QA4V 4OHYA 2WYSA 2RS51 4ZU5A 3TETA 1K5MA 5HV4A 1SZTA 2CTRA 3PUAA 4LBJA 1JOBA 4M3CA 5A1FA 1W3XA 3F5TA 1HQNA 4LBQB 5L3CA 3CQOA 4IV3A 4XABA 3LWCA 2JDZA 5CB7A 2WLIB 2UXBB 4YYOA 4BYYA 4JRAA 1XUQA 4KGGA 2DBIA 1RUG2 1LR1A 3AG1C 3WDWA 1S0BA 4MTGA 4DXSA 1NTMH 2PF4E 4N7IA 4JI2O 2O8OA 3C3TA 5JZGB 2Z0AA 3ABKB 2Q4PA 4UF0B 1NS1A 2JDHA 3AZVA 2PYJA 4YGBA 4J42A 1AYM3 3M1HA 3ZFFA 1POV1 2P6HA 4Q0SA 5FYTA 5BNPB 3O12A 2BVBA 4KBZA 4GT1A 5H6QA 4C1XA 3STLC 5ERLA 1K5JA 4CH4A 4X66O 2OT5A 1W0PA 4IEPA 2A3QA 4BIFA 1CR7A 4OQ8A 1JI6A 1VBB1 1ZZCA 5J36A 1YFUA 4CA9A 3LDBA 4UI9L 3VL8A 4LKSA 3LF7A 2KKWA 3JAKA 2E75B 2R042 1RP3B 1CESA 4GJZA 5BMVB 4GKJB 4XPVA 1QQCA 1QJU1 5F6LB 2GSYA 3GCXA 1HQLA 4LIUA 3D4KA 3I2DA 1BVP1 4WZCA 4HETA 1QCEA 4Z07A 1OURA 1ZZ7A 3B8NA 3CCJV 4V2WA 1F5FA 1VF6C 3T2MA 5C3OA 1FT9A 4LH7A 4R9BA 1P84F 2VS0A 3WQBA 5C6CA 3R4SA 4JASA 2KR2A 2PHXA 1K92A 1NQDA 1AR81 1BKZA 4Y20B 4DOUA 3X2QB 5KHJA 1W3VA 3UO2A 1LB2A 4GJYA 2UU8A 1NTZH 4NE9A 1YIFA 1UY2A 1W8UA 2D6MA 5DUVA 5FYHA 4LXLA 4FQ4A 2HWC2 2GMPA 2HVJC 3SYQA 4I3PA 4CC5A 5HXMA 2LALA 4Q27A 3WP5A 3WQ1A 3EB7A 4N53C 4RQPA 3E8GA 4K8ZA 3A22A 3D82A 3JAWB 5KHKA 4RHV3 1D2QA 2JJ1G 1DGWA 2UXCO 1M9NA 1CX1A 2UXBO 1POQA 1UOJA 2P90A 1PX4A 4Q4V2 3GHNA 4HXCA 3ZOIA 2UUAO 4Y22A 5BNNC 1FOD3 5C5UA 3JATA 4XE9A 1G6NA 4YW1A 1K45A 1S0VA 1IXMA 2DJVA 4BQWA 1UY3A 3WX5A 3NRUA 2WJSA 4G3YC 1I5ZA 3M3QA 4W6YA 4OI2A 2Y4TA 5LMNO 2LM3A 3T1YB 1DQ6A 4A41A 4JZGA 4JC1A 4YM1A 4EN6B 1SQVH 3FD9A 5IWAO 5FY0A 3U10A 2VVDA 4ZONA 4QX8A 5AVAA 4Q0QA 2WZEA 2B46X 4UW5A 2VULA 1FMD2 1UOGA 1A34A 1RUF1 2XKOA 2Q8OA 3S6PA 1CAWA 2C9KA 4RS5A 2PHFA 3K06A 1MS4A 1O8PA 4DR1O 1WBLA 4FOVA 4MGYE 3M3IA 3VD5A 3BOPA 1ULCA 4YM2A 1ENQA 4K20A 4YIOA 3K9SA 1JPXA 1CWPA 1ZRIA 4LULA 4ZXEA 2LROA 3MLLA 1I9RA 1RUE2 1S55A 1MSWD 1GNZA 1VMHA 3WNXA 3R4UA 3SXWA 2RS53 4I55A 4TV8B 1ZX5A 1RXFA 5AVPA 4AR2A 2Q67A 1BQZA 2WUHA 1V6JA 2VG9A 3ZVXA 3FKSG 3D0JA 1WCKA 4COWA 4QXHA 2PXJA 4NPLA 4R9DA 3VZNA 3ECQA 5ANQA 1S3JA 4XQ4A 1VRBA 1GM8A 1O7FA 1OHHG 2ZMLA 3E83A 3PN1A 3BI3A 5EIYB 1Q90D 5FNVB 4R9CA 2WAAA 1CGPA 5FY4A 2VMEA 2VTXA 1XNQO 1AI7A 5KHIA 2X53S 5FY7A 1U0AA 1Q3EA 2XBO2 2XQXA 3KWVA 1MZ6A 5JXGA 2GDSA 4Q4W3 3OGGA 4QGPA 1KKDA 4H7MA 4XFGA 3OJBA 3SJQC 1CIWA 4Y1VA 2OQ7A 4YGCA 4IETA 1IKPA 3N2KA 3ZXEA 2VZVA 3GWOA 5LBEA 3H0OA 3OGIB 3DYPA 2JDMA 1VR3A 5F3EA 2PHDA 2BPA2 2XJVA 4QU1A 2DFCA 4GX0A 1NT2B 3Q8BA 4CU6A 4I01A 4M3CB 4JI2B 5FPVA 3VKNA 1W39A 4XACA 2A6XA 2YHJA 1AP6A 3JASA 1T6BX 1LNQA 3BAAA 5L7OB 5BV6A 3D6EA 4EB6B 1V9U2 3VUOA 4JI0O 4X65O 3ZRSA 3WW4A 4QX0A 2VZ3A 3JALB 4ASUG 4D6QA 2J1TA 1I08A 4HZFA 3OMIB 1SQFA 4BQXA 2L35A 1IS3A 1FAFA 1D4M2 5FXVA 3J8F2 1LESA 1THZA 1PP9H 2Z4FA 3RG0A 4TQFA 3B01A 2O1QA 3I56V 1OD5A 3X29B 4X1KA 3GF6A 5A32A 2AUYA 1LGCA 2ARBA 4META 2A6VA 2DUQA 3BN6A 1ZBA2 3VZLA 2ZIMA 2ETNA 3K57A 2YV8A 3LA3A 2HWD1 2XQRA 4JYAO 5LBCA 4HLTA 2BFUL 4QQLA 4XFCA 1G7YA 2EJ7A 2HEPA 3UETA 4BMBA 1RM1C 4NRQA 2ID4A 3FBMA 2WLPA 5C8CB 1RYYA 2PELA 3UK9A 4CEWB 1XE0A 2Y4UA 4XF4A 2EIMB 3RYHA 4TUYB 1YLLA 2VE1A 4FJCC 2IJJA 3HN1A 3K48A 1QBZA 5I0DA 1MQTA 4XF1A 2D98A 2YXSA 5HFLA 3DECA 1N1TA 3DUIA 3J7LA 4AF9A 4LF5B 5LY1A 2Z42A 3A23A 5HFMA 5C71A 2VZRA 4B29A 3JBG2 5K1PA 4RR3A 2PYTA 3DYMA 1LUWA 1OCRB 3W7TA 3R4DB 1YJNV 5JIUA 1MS8A 2ZGUA 4DV2O 5F39A 1LTEA 1W99A 1K3EA 4MH0E 4LF4O 4XTPA 4CPBA 4Q4W1 2W68A 3LFMA 2VBBA 1ZRFA 1GMGA 3D36C 1ROPA 4XBQA 2KG7B 1QJY3 3IBMA 2NN8A 2ORZA 2CGOA 1MR5A 3J7MA 4OPHA 1N36B 1F35A 4HNAB 3S7IA 2OYQA 3OPWA 2Q4SA 3FMGA 1OQDA 3LZZA 5FL7G 3OY8A 5L9VA 5B4NA 1RSOB 3UT5B 2ADDA 2WC2A 5GZGA 1E1QG 1YNAA 3E6DA 3SCGA 3T0AA 1IOAA 2RM23 3LB9A 3IKWA 4L2NA 3E22B 1W6PA 3UKNA 2D6KA 5CKMA 1PNMA 4DR3O 1Q8PA 4LKFA 1AJOA 1W6OB 5EIBC 4UW3A 1GQPA 3T1HO 5IYZA 3BPSA 2GBOA 1ENVA 4MXWB 2XONA 1YTFD 4WFFA 1OQ1A 4MW3A 5AC93 3LFIA 2CTWA 3I2JA 5ITZA 3C90A 4PI2A 4CBCA 4NHKA 1C8M1 1PM4A 3RZHA 2W2IA 2EX3A 4DR4O 2QZ2A 4D6RA 1EUTA 2J1VA 2Y38A 3FBYA 3VLBB 4BU2A 3S3WA 5FLIA 2IXIA 4AI8A 3OD4A 5FY5A 2BV4A 3U07A 2YC0A 1MA1A 2W3JA 4CZSA 4MVZA 3URFA 4MSWC 1QR8A 2OCCB 1AYN1 1VQ9V 2WZR3 1S2BA 2ZDIA 5C33A 2EILB 3BTAA 4H0LB 2R9IA 4ZZ8A 5T54A 2ARAA 3WQ0A 3APOA 2VNVA 1XNCA 1E5RA 2OT7A 3HKDB 3RZKA 1JYWA 4Z1MG 2B7YA 2W94A 3N9PA 3J81N 5KXBA 3CJXA 1CEZA 2E9QA 4YVWA 1GZWA 3KVBA 5JI9A 2MK3A 3HOBA 3KD4A 1WUVA 4ZS3A 1H2KA 3ZHTA 2ZXQA 3BIWE 1RUD3 4CDWC 4LBMA 2DYRB 2DN9A 2QE7G 3NXSA 4XAEA 1QHDA 1W04A 4CDUC 2ZJCA 3QD6A 1RM1B 2BWCA 5IVFA 2VY0A 3KT7A 3K5MA 3PJQA 2DVDA 3TNQA 1HNXB 2WSSG 2QKDA 4YGEA 3WNPA 1FFTB 1OHFA 3J7NA 4O4HA 1D0HA 4GX2A 4GXLA 1NTKH 2FDIA 3O0WA 4I4TB 3U37A 1ALYA 2VUDA 3EBRA 2D93A 5L3EA 4GA9A 5DG2A 1PK6A 2FBEA 3L73H 3W5NA 4LO7A 1Q43A 3CD6V 2Q8DA 4DIQA 3QACA 3BVOA 1GQHA 2FZ1A 1ST8A 2PHWA 4K3AA 4ZOLA 4FK5C 2CGNA 5C8CC 2F6BA 5A7QA 4GH4A 2MNGA 5FDBA 5A3OA 3OTFA 2JJ2G 1HB3A 1XNDA 3S5AA 5T5PA 2CH7A 2ZEZA 1YQ2A 1NVPD 5H2FZ 4A44A 4H2AA 2G9GA 1HKDA 4AFAA 4FLYA 3AMNA 4A5UB 2UUCO 3H7JA 1NZ6A 2WT2A 1GANA 4FBFA 3VBOC 2VL4A 3IMNA 4DV0O 1QJZA 2XL7A 4RD7A 2F66C 3PVNA 4IE6A 4X8AA 1GH6A 3CJHB 1LJ7A 2PQSA 3QCWA 2GC0A 2D6NA 2Z5UA 5I0RA 3USSA 4LK6A 1LOAA 1JQ0A 2BVVA 4QKDA 4YG0A 3CHXA 5JI7A 4UFJA 4F4LA 2GP3A 5F2SA 2ZGMA 3F7YC 4O4JB 2EXKA 3X2QC 2HJDA 3AEIA 3LQCA 1VB4A 4XIOA 2RJLA 4EZ4A 2XG3A 4CP1A 4LQRA 1DGWX 5IATA 2WO1A 1X33A 1UPGA 1POV0 1DZTA 1HR0O 1OMIA 2VR4A 2CDYA 3BEHA 1W03A 5C8YA 2D6PA 4UB8Z 4XUNA 3M4FA 2F17A 5JVDA 1OVPA 2VZPA 1YUDA 1JW6A 1XNQB 3KHCA 1FYUA 4DK0A 1NCRA 3ZRXA 1HXS3 2VOVA 4FTEA 2Y0IA 3ML0A 2JE7A 2Y6KA 3OE7G 2ZCWA 1S0GA 3ZN0A 2Q30A 3ZRWB 1HRV2 2DTWA 5FYYA 4LF8B 1RXGA 3FC0A 2YGMA 1BEV3 1WCSA 5LMUB 3RVYA 1URFA 2E26A 5FO9B 4MGIE 5FAXA 3AK0A 5JH7B 3ZXLA 5FNVA 1V0AA 1PK6C 4XDOA 4A6SA 5DQ0A 3FHAA 5A33A 4QX5A 3WHUA 4U7OA 2UUAB 5A70A 2HWD2 1RUC2 1B06A 5FLJA 2VQFO 1PO11 3HR9A 4COYA 4FZ1A 5EJZB 4DEQA 5CYYA 5LBFA 3ATGA 4DO2A 4QHBA 3V56A 2Y6LA 5FIXA 3MW4A 4MOAA 3ZKYA 2VXRA 3WD5A 2EILC 3TGUH 2E51A 4LCUC 1N1VA 5FYVA 4OI1A 2XAQA 3OM3B 1H4GA 1QLNA 4JF3A 4PA9A 1NZIA 1UYXA 1HRI2 1LENA 5LK5A 1OCCB 1DZQA 4EKWA 4MADA 3D5OA 3GB7C 1EBOA 2PHTA 3M3CA 4HK8A 1LOGA 2AH2A 5F5AA 2IFWA 1AF9A 4AQ2A 3AJZA 2R70A 5IAVA 2OUJA 1CZVA 3T09A 1COV3 1VQ4V 3DXTA 1BLZA 3RYKA 2EXIA 3K59A 4DO0A 4AVBA 1JHJA 4FFGA 1UL9A 1BS3A 2P67A 1UYZA 1WD4A 1LU1A 4A7ZA 1JZ2A 3FZ3A 4QX3A 2LP7A 3PJSK 4RFRB 4P9YA 1NE4A 1OOPA 3WSOA 3ZXDA 1U12A 1XHXA 3ZYBA 2QEXV 3WW1A 2GMMA 4ICGA 5GONB 1ZYBA 4LNUB 1UWWA 2AHZA 3I3DA 1G4YB 2MEV2 2ZGKA 4F7ZA 1K42A 4KWUA 1XREA 1O59A 4NXNO 4N9HA 4P9XA 1SLLA 2J1SA 1ZAUA 1JOPA 4UB6Z 1UZWA 5CA3A 1XXNA 2VBPA 4XW3A 1H8VA 4AVTA 3RS6A 1UY4A 2W6JG 4JTAB 2P3KA 1JZ6A 1SEFA 4PA4A 4FM2A 4YARA 4A6OA 2HWE1 4RSUA 3JCUZ 5BZBA 1W2AX 2EXJA 1LHOA 2LFRA 2LW8A 1COWG 1VRH2 1SFPA 4FFKA 2HWE2 2DUPA 3ZMOA 1K5QA 4NMIA 2WQ4A 4JI6B 1XYNA 3LOBA 2LJ2A 2XWBB 2J1RA 4LO8A 4YW4A 1I5XA 4N90A 2JDNA 1PKXA 5EHDA 4Q4Y3 1DK1A 3RYFA 3BA8A 3MBWA 1O9HA 5J2UB 3VHNA 3B8MA 1QNMA 3I97A 1RPOA 1M5IA 1XDCA 1JYIA 3WF1A 1FPN2 2W1QA 2IH1C 3KQ4B 3ZRVA 3LDKA 1V6MA 4B3SB 3L9DA 2ILMA 3GBGA 4UFKA 4HT1T 1ZBE1 4QAWA 1K5MB 5JVVA 2F93B 4V1PA 5CFCB 2XJRA 1C1FA 3HKBB 5B3SB 5B1AB 2ZM6O 1LR5A 2GC1A 1QH6A 3AZZA 1SFNA 4DYLA 4L92A 3ZSKA 2YB7A 4CXYA 1GRJA 1PL0A 1S0JA 1FI2A 3CRMA 1MEC2 2X05A 3RZJA 1NYWA 5DZEA 2KQXA 4OPAA 3RVHA 3H42B 1B35C 3I2HA 5APAA 4UFZA 5JXJA 2ZHMA 4N53A 5D8AA 5C9AB 3HT2A 4Z82A 2N7GA 3WG2A 3ZFGC 3UJQA 5CKNA 4B3RO 1AROP 5A2QN 4K1YA 5FK8A 2WFF3 2PN5A 2BU9A 5BNNA 5C5TA 5FPUA 4D8MA 1ULEA 2VVEA 4XVHA 4DW0A 2BBAA 1O8SA 1SESA 1DYKA 4Q29A 4EWEA 4Q4V1 4QDRA 1RUF2 1ZA7A 4ZHNA 4LOTA 2VOKA 5FP8A 1HDKA 2AC1A 1PM9A 3PIJA 5EYPB 4DR2B 1OF3A 3PNAA 2VW0A 1Y6XA 2QTOA 4KI5M 1P49A 4FPPA 2BP6A 1EAH2 4OI0A 4BHPA 4AGVA 3TXQA 4LF7B 3ST7A 3I2IA 1CX4A 1DG6A 3KGLA 4B3NA 1C8M3 3RZZA 4U3JA 4NN0A 2QNKA 4RO2A 4RHV1 1Q81W 2VMGA 3ZSJA 1W59A 2GC3A 2E5LO 3DTUB 4UCRA 4UV8A 3WHTA 5FZ4A 4HVOA 1OFNA 4AHXA 1I94O 4O2BB 3RI8A 4E2SA 2QKSA 4FT8A 4CCOA 2YXYA 2VWKA 4JAVA 4IL7A 3O1MA 4E8DA 3UCSC 5JOYA 3FN9A 1JTZX 4QB1A 4AW7A 3ZXAC 2FDHA 1UN1A 3AKSA 4XHBA 4YIPA 3VKLA 4BIOA 2QVSB 4G28B 2YICA 4I09A 1S76D 5T5LA 1MABG 1RVF3 1VARA 2QQWA 4XETA 1O91A 1STMA 1V6LA 5C3QA 4JCKA 5CFCC 1ZBE3 1FX5A 1DQ2A 1R3LC 1VQPV 2GMEA 4GKKO 4EQVA 1QQP3 4XC9A 3AK1A 3B69A 4MXWA 3L72H 1QH7A 1B35A 5FWJA 4ASKA 4MHRA 4GLXA 4L9BA 1I5PA 1QOTA 4CU8A 2ZAHA 1LHWA 2N05A 2OCHA 1VQ7V 5FR3A 1EYBA 3A8TA 3K03A 3SH5A 1ULOA 3K46A 5FXWA 5DAWA 5JMOA 2JG8A 1PZ9A 2P4KA 1LODA 4KWLA 1KQSU 1NCRC 2ET1A 3OBRA 1RUJ2 3IZOA 3WFVA 4J10A 1XE8A 4TWKA 1AI5A 2NLJC 2AYHA 4AILC 2VJXA 4ORFA 1A78A 5B1OA 2Y60A 3VD3A 5LP6C 2DYCA 5FUNA 5CA1A 1R3KC 1OPMA 5CA6A 2HYKA 4J80A 1Y4MA 2ODMA 3JYCA 4OHZA 2OVUA 1M93A 1OA4A 4CUCA 3P1IA 4RR3B 1VBA1 3AJYA 2ADPA 2J42A 4O2AA 5EPAA 3CS5A 3A0BZ 1YQ5A 1VBE1 2B1IA 3T2TA 1VMJA 3LCPA 5IJ0B 1VBA2 2D3PA 1Q8IA 3LPFA 1GM9A 4QX7A 4RQPB 2BZDA 3IMMA 4CS2A 2DCKA 3RJ2X 1AXKA 1JYNA 4D7SA 2PZSA 3ZMZA 1T6GC 5B3SC 1F51A 3VBSA 3OMNB 3MV11 2D7FA 3LAGA 4EWAA 4UAPA 3WQ7A 3AZXA 3WV6A 3APQA 1Y43B 3WOGA 3RJRA 4CH6A 4DQAA 5BMVA 5LMUO 1MNGA 2QDNA 2G38A 1O5LA 3BYWA 3MZHA 1AR72 5AFEA 5JPNB 4W65A 1CZTA 1O3QA 5I93A 2A71A 4DRXB 3BGAA 2E74B 2NPIA 5E1AC 1Q8SA 2WNEA 1Y74A 1WW6A 3O1RA 1X8EA 1O5UA 1MQTB 4DUVA 3E6BA 4MLOA 4FPJA 4AI1A 1GO3F 1OD3A 2EIKC 3LEGA 1ULFA 3GCWA 3N7LA 1HW7A 3H9VA 4QPYA 5K0UB 1GAXA 4NIAA 3RYPA 4PDMA 4Q8KA 1OUSA 2ZHLA 1JZ5A 2XBO3 3JAMN 4H55A 1OQEA 4YZ4A 2VAUA 4OQ9A 4YZ5A 1KJLA 4I50A 3DN7A 2IH3C 2R041 2IXHA 1FXKC 3U4XA 4GQ7A 3WU2Z 1YQ6A 4L87A 2GNDA 3ZN6A 1Z7S1 2XWJB 2BEOA 4QM9A 3K51A 1VQKV 1WPXA 4OUSA 5LATA 2JD9A 2K9ZA 2K0GA 2VZTA 2ZXWB 2R1DA 3EXUA 1R1A1 1IG3A 4P30A 1VRH1 3AYAA 2QDRA 5TSWA 5D8AC 1G9DA 4LFBB 2DFBA 4V2VA 4BJ0A 1W8FA 2FMYA 1YVWA 1O4TA 5DPNA 1OC1A 5FPOA 1SFYA 3L71H 2WKKA 5FZ9A 4XJ9A 1ODMA 4TN7A 1GZWB 4DV5B 1UMIA 4GWIA 1QU7A 2RS11 2VWJA 5FV3A 4LBNA 5JH7A 3M70A 4CDQB 2RDCA 2LUWA 3ZN5A 1JMUB 1KQRA 1YXBA 3I2GA 3I2KA 4WBBA 2XJUA 2QKCA 4LBLA 4GB32 1HNWB 4LHNA 4IUGA 1A3KA 4E2LA 4IXLA 1M4UA 1EV13 3RYIA 4YWAA 2TEPA 3WDUA 4CDXB 2G1MA 1QU0A 1ND3A 3U4SA 1DQ5A 4HKOA 5FREA 2ZDIC 2BRTA 2OZJA 2XUEA 4COUA 1Q56A 5FFOC 4H14A 1HR0B 4INDA 3ZHUA 1D4VB 1LGBA 4FFFA 1FYJA 1VIWB 2LW1A 3VQWA 1XNKA 2TNFA 4Q4X2 4LF4B 4UCTA 4WVMA 1UO9A 2VMCA 4AVCA 3CL1A 4LR4A 3WXPA 5A3NA 3TEZA 2YSUB 3RBZA 3DC6A 4XJZA 5FLXN 5FZEA 3C7HA 1J59A 3IAPA 3RI9A 5IYYA 3ZMUA 1UY1A 1ULDA 2GUZA 1S0DA 5J09A 1VBC3 5DAXA 5BXXA 3M7MX 1YQ8A 1ND2B 2A0LA 2V09A 1D4M3 1MZFA 2F4VB 3C7FA 5FZFA 2DW4A 4XDQA 3TEWA 3H1HH 4LBEC 4L8JA 5CBFA 2H6CA 4L99A 1GBGA 4MZUA 1N3PA 1WCDJ 3C3SA 1G9AA 2DOSA 2YUAA 5LA6B 1AL0G 3MW3A 2F4PA 2RJ2A 2I45A 4NWWA 1TME1 4G4FA 2X10A 2V7QG 4JI1O 4DV1O 4ZZ5A 3N9NA 4P9LA 5DECA 4ITCA 2Q8EA 4BOWA 5L36A 1R083 4LUKA 2CK3G 3IIAA 1VB2A 1TNFA 1MS1A 1M56C 1ZWIC 4HMZA 3H1MA 2YPJA 1VP6A 1I5YA 2H8PC 5A3MA 3MFCA 3H1LH 2YDEA 3G71V 2WN2A 4XJWA 4DR4B 1N0JA 2EIKB 4JI7O 2D5FA 3ZFFB 2ITCC 4UFHA 4ZKIA 2ZAAA 1NLRA 3R0RA 1RC6A 2UU9B 3H1KH 4UCUA 4QGLA 4JI0B 2A75A 2R9RB 4ZXKA 3BTYA 4IE5A 4JQRA 2EA7A 2P17A 5JJJB 4YVWB 5FP7A 4Z92B 1W90A 1QJX3 2ZMNA 3M3EA 2DU1A 3IDAA 5IYCO 1SLCA 1UX7A 1OBNA 2OCCC 2BTVC 5E1RA 2W08A 5A6XA 3VBFC 2XLFA 2Y6FA 3CE2A 1J5EO 4G27B 1PVC2 1GFF2 5FLHA 2IU3A 4COVA 5EWSA 2VECA 4FP2A 5KA6A 5EC2C 1FXZA 4FVVA 5FCCA 3T3YA 1Q82W 1VQ5V 1AYN3 2WZR1 4P2ZA 3T1LA 1K5MC 4XQDA 3C7GA 4KQ7A 3CYOA 1G9FA 1BK1A 2VXJA 3AKPA 2VZQA 2AREA 2XTAA 4IGQA 4QKBA 2R49A 4UCSA 3A0NA 2ZE6A 2E63A 3ZXKA 1N3OA 2WINB 2OWOA 3CRCA 5EJ3A 3JARA 3UKVA 1LEMA 3SLIA 4N43A 2HKXA 1EM1A 1N0NA 3WR0A 4X1IB 2UWAA 1X7NA 2NP0A 1KKCA 2ITDC 3AG2C 4IQPA 3RQ0A 5FZLA 1OH4A 3Q4HB 2Q7GA 4NHMA 5IK7A 3D3AA 1IDSA 3J26N 2QCSB 1R73A 1QY4A 1F31A 1RUNA 5L3DA 2DQ0A 4M3CF 2JXAA 5FMCA 2IVIB 3DCQA 2ZZQA 2VH9A 1DLBA 3OY8B 4S2DA 2W39A 1WMDA 5IYDO 5EYPA 2O8QA 1ZUQA 3AP4A 3MLJA 4I3GA 1R082 2VZUA 2HYXA 4DY3A 1F23A 1CAWB 3RYCA 2B45X 3CMAV 2DDUA 4XCAA 3OTOB 2VU9A 4OXSA 2HWB2 2ZMKA 2R32A 5T3NA 5LEKA 4UXAA 3O0XA 3GWKC 4TSFG 1QQP1 5ACA1 2IBZH 2OPWA 1KRIA 1HXS1 3RPQA 1Y9MA 2PY5A 3OW2U 1PO21 2UY9A 2A1XA 4CH3A 3ABUA 5F3IA 1ZTEA 2WBKA 2GNBA 1BEV1 3OGVA 3NVCA 2CNAA 5JJEB 2GH2A 3FX7A 1AZDA 4CDUA 4FO9A 3AYDA 1JBCA 2FDKA 3VGIA 4ZY9A 2BW8A 1RL3A 3A0HZ 4DV1B 3LEIA 5FQ0A 1PGW2 3P6BA 3KZIZ 1HRI1 4LO5B 4LITA 2VPVA 5FMBA 1OH3A 4NHXA 3AG2B 4JZRA 3PVBB 3FB7C 1EPWA 2Q69A 2JVDA 1GP4A 3ZHSA 5ABJA 3PMSA 4DXTA 4DB5A 4FPOB 3AG4B 4U7NA 3CJIB 1ENRA 1V54B 1W6QB 3E2EA 1PGSA 1XQNA 2ARCA 1EZJA 4OVEA 4YSFA 1GK9A 3K0GA 1DYOA 2HFEC 4OMDA 3RGBA 2LRPA 1NVPB 3LSQA 1UNBA 2JIGA 2QE3A 4DR1B 1N3QA 4LR3A 1OCOB 4KU7A 2WAOA 1LKNA 1X9PA 1LNSA 4IERA 1C8M2 2JG8B 3PDQA 5A6ZA 2OIGA 2HBTA 3AMMA 3SYCA 2C9AA 1UYYA 3J9SA 1QXPA 4WVZA 1ZA4A 2HVKC 3U14A 1US6A 3PTYA 2FCVA 3CZJA 3Q8AA 4QPGA 1ZM1A 4KWJA 1H30A 4L0PA 2E7TA 1Q8VA 1CP9A 4XURA 3LSSA 3MUZ1 3HT1A 4O4LA 3PUSA 1BBT3 3R66A 2CWMA 3TRSB 4AHWA 4XMIA 5CMUA 4QQOA 3MDPA 4FVMA 4QXBA 1X36A 4QDSA 2YY1A 2ZEWA 4JKKA 1FS0G 4OGQB 2WA4A 1IURA 4S2GA 4AHZA 1FPOA 1AVMA 4BLJA 4BK5A 4MYEA 3FX3A 4KH9A 4GALA 3OEAA 2WLKA 4PIZA 5L7OC 3IFXA 4FFBB 2AEZA 4J9YB 1COV1 1SBDA 4JGSA 3DPRA 1DBNA 2UXDO 2XLAA 3E5UA 4LBKA 3K3NA 4MVMA 2EIDA 2B9UA 1OCZC 1X8MA 1RUOA 1NY71 2WO2A 2NYYA 1WA8B 4ATFA 4GWJA 3JD1A 3ETEA 4X20A 1KU9A 4MO3M 5KC5A 2DTYA 2YROA 1DLCA 3MUY1 4RL7A 4BQ3A 1OA3A 5CIRA 2EAAA 3AMQA 1UXXX 1CAXA 5C3SA 2XJPA 2OPKA 1PV0A 5GM0A 3I3QA 1H4HA 4K35A 3IC9A 2A06H 5C4WA 2WS91 3VKMA 2XAGA 1J58A 1NQTA 2ZX1A 1BHGA 2IVJA 4FCAA 4OLLA 4MGTA 1CPNA 4UYBA 3THPA 1OOPB 2W46A 3S30A 3AG4C 1RMU3 4K40A 1JMKC 1J3QA 4HPKB 5FZIA 1TGOA 2UYBA 3K9AA 1ZZ9A 5FZ0A 1HNZO 4AI3A 3S57A 4RQFA 5FZ7A 1VMFA 4Y1XA 3POIA 4X9QA 1UXZA 4K3UA 3UGGA 3DEMA 5E88A 3VQXA 4D0QA 5EZYB 4JI3O 4D94A 4HVRA 3ZX7A 5DZGA 4MUVA 5FYSA 3BODA 1GN3A 5FPXA 5IE9A 2BTQB 1YWKA 2QFEA 4P9OA 2ENRA 3UGFA 4A42A 4COZA 4AFMA 2P1BA 4FMTA 4ZPIA 2FL4A 2YUEA 2WA3A 4QB2A 4DUZB 1K8AW 5A3WA 4RHV2 2QZ3A 4GMP3 3M99B 3KMHA 3JCZA 4DR3B 5HV0A 2K1EA 3K0DA 1E57A 5F1RA 4WM8B 3JQXA 5LY2A 2I07B 1O3RA 4AQ6A 1RUD1 1ONAA 2I74A 1OCZB 4X1YA 3K08A 2QTSA 3VB9A 4XEZA 3LEKA 3NJXA 3VOUA 2V73A 2LTNA 1DF0A 3ILRA 1DQ4A 3T0BA 5A33B 4ZHQB 3RYFB 2ZM6B 4BW9A 2R30A 2GU9A 4AQTA 3PU3A 4DW1A 4NIHA 4XMAA 4QNHB 1Z7S3 5F3GA 4LF9B 2ZNIA 2ZTNA 5CKQA 1GYKA 2C5DA 1UY0A 3LDRA 4DPNA 3IN9A 4CUBA 3CB2A 1BHAA 2RDRA 1NR1A 4IIJB 4KHPB 2ZPXA 2J7MA 4Y5Z0 3QG5A 3ZHRA 4DUYO 1R1A3 1TNRA 5IW0A 1FFXA 1P7BA 3ZYHA 4UWDA 4LKEA 1TMF3 5HXVA 3SC7X 1IVSA 3VL9A 1JFFA 5EZWA 5FYMA 5B1AC 3T4HB 4DR6O 4NB5A 2MEV3 2X6CA 3AK2A 1RHI1 5A7NA 2VTXJ 4Y5SA 3TJTA 2Y48A 3CLPA 4QM8A 4YM3A 3HAGA 4Q4X3 4GKKB 3E89A 1RITA 1WN7A 2DU0A 3POWA 5C4WC 1E5SA 3TXSA 1VQ8V 1LAJA 2JG8C 5L3FA 1R6KA 4UVCA 1V00A 1RUG1 4OZOA 3WUDA 4GYCB 2NQYA 1VPHA 5F5CA 1IPSA 4PQQA 1SLAA 5FO8B 4B7KA 4BQYA 3WVJA 4JYCA 1NOVA 3KT1A 4UUJC 1KS5A 2W91A 1V55B 5J1XA 4QKFA 5G04L 3H8OA 3AZWA 4I30A 3ACGA 4CP0A 4R9AA 4B3MB 4LF7O 4YM0A 1H8TC 2EVXA 1J95A 1UIJA 1VP7A 2B9VA 4XFIA 4N8MA 4PIYA 2P37A 3WEZA 1XMQO 4D6TH 4PHZA 1VJ2A 4LNUA 1YJWV 4JGYB 1GZCA 3OGSA 3E86A 3QOPA 2BBVA 1MVQA 4R50A 4XTMA 4BW5A 4RGAA 1Q8OA 4LKDA 4FTBA 4X6QB 1C5HA 4AFBA 1GN4A 1RVF1 1VBB2 4GMP1 5LOVB 2Z2SB 2F4VO 1K4CC 2WS93 4LC1A 3KM5A 5KUMA 4GX5A 1SDDB 1RUJ3 3RVZA 1GQGA 5F32A 2XJTA 3MIBA 4HZ3A 4BMEA 4GH4B 3RDIA 4CCJA 3RNSA 4JRLA 4PLMA 3OG2A 2MPFA 3O1VA 3SH3A 3ZO0B 3AC0A 1I0HA 2R7EB 1XC6A 1DU3D 5JXIA 4DR7O 4CXWA 2IJIA 5LGUA 3K2OA 2N04A 4XBFA 3ZX6A 5CB4B 1JOJA 1DLLA 5FY8A 1W6MB 5JSPA 3ABZA 4PELA 4UW6A 1XL6A 2RR13 4CVUA 4I9WA 5D5QA 4I5SA 1W9YA 4MGSA 2JIJA 4LBQA 1V6NA 2Z3YA 1SQXH 2QQKA 4DR5B 1KMIZ 1L8DA 4FM1A 4NTWA 5EP9A 4NAOA 5IK8A 3HKBA 2Z69A 2HWC1 4FFHA 2J22A 4AVVA 1XBLA 3VQVA 2AZ5A 4DXRA 1BSMA 1AB3A 5EYYA 1VALA 2EIMC 3SJBC 1XNTA 1WAZA 1UYPA 2ZACA 3IIIA 1JZ4A 3L74H 2LS6A 2YFZA 1W0JG 5CNAA 3AG3B 4CC6A 1FV3A 2B5UA 4KMQA 1QJEA 1JYCA 1Y67A 1CPYA 4JVAA 2QQMA 3BIEA 3W20A 1OLRA 4B3TO 2CDPA 3G6EV 2YIAA 2W5FA 4DV4O 2ZX2A 4YFWA 4LLOA 4DV7O 5LXTB 2Q1MA 2YU2A 5T52A 2VNGA 1SCSA 1HB4A 2PHRA 1QR9A 2WPDG 1IS6A 4JAUA 2V4DA 2CE4A 3KV6A 1KFUL 5DDJ3 2YI9A 1UU5A 2HLDG 2NR5A 5I0SA 5CU1A 1F9KA 4GH4C 4YHHO 3ZBHA 1SERA 3SJAC 1X9TA 3V0AB 2JG9B 4OX9B 5F7UA 1RUH2 5A6QA 2A6WA 2WWJA 5KC6A 1YHFA 2AEYA 4CXXA 3NAPA 1Q6UA 1D2SA 1ZBE2 2VC9A 4Q26A 4X62O 5I8SA 5IJ0A 4JI5O 2HHHO 1KECA 3MIGA 1WLWA 2EZOA 4XF0A 4QU2A 5I91A 1LECA 4Z1VA 4BB3A 4J9ZB 2WLMA 2P7TC 1CONA 3FLRA 2HEVF 2GHYA 3SYOA 1TMF2 1NLSA 3STZC 4OMCA 2JE8A 2XBO1 2WLQA 4XDKA 3ZYPA 2E76B 3IAYA 4LA2A 3LNMB 1VRH3 1PO23 2CAUA 4URAA 1AJNA 4PI0A 1SA0B 2AGAA 2R043 3PURA 3THDA 1JZ3A 3DKQA 1BCCH 4XAAA 5CA0B 3JBG3 5LA1A 5JR2A 2GV9A 3JD73 2O14A 1QMJA 1MPXA 4ZU4A 3K4DA 4XFAA 1F4MA 1IKQA 3FLTA 1HQWA 5KXCA 1F2NA 2XVLA 3KHBA 1M06G 1YO8A 3H1YA 4WFAV 3VBOA 4JZ2A 4CEYA 2YFUA 1JR9A 5EK0A 3VN4A 3W7UA 1K7DA 5GLUA 2Q6AA 1UKGA 1RUI3 4FPCA 2FDJA 1UF2C 4LPLA 2HEWF 4NTXA 4QE9A 4DUYB 1AUYA 1SC5B 4FLZA 2BYVE 3I54A 4XXAA 2W92A 3AG3C 5I0TA 3T1YO 3G4SV 2NNUA 3FB5C 1XB9A 3AL5A 3WF2A 1DP0A 3H7YA 2YC4A 2FB5A 2R9AA 1POV3 2WZ8A 2OX0A 1BMFG 2XUMA 1J1LA 5IYBO 3TCUA 4MGZE 5C9AA 1EFRG 3WG7B 2W87A 1V9PA 4NXMO 4A3XA 1L1FA 3KZ4C 3GZAA 4QXKA 3VBSC 3ASOC 2BTOA 1VBB3 1XOYA 3DL3A 3VBFA 1CPMA 4IV1A 4XHXA 3H8XA 1Q6HA 3DPRB 5FZMA 1H8HG 2VO5A 1VAVA 4EN8B 3AKQA 2DYRC 2E33A 1EN6A 1GU3A 4BXFA 3VZJA 3E5QA 4TT3G 4E8CA 2RE9A 3J7AU 3KG2A 1F7YA 5E8AA 1BQPA 2EINC 2HWE3 5FBZA 5T5OA 2P3JA 3T08A 4RN5A 5KHGA 1QIQA 3NV4A 1BBT1 1EY2A 1MZ5A 1UMHA 5C8WA 5FPBA 4JDMA 3HKCA 2UY8A 4OYUA 3WNOA 4CU9A 4O7XA 1GWMA 3SNMA 2QQNA 3RWRD 4B4RA 2UWCA 1RIRA 4B8EA 4MW8A 3K75B 3N2GA 1NCQC 5K7PA 2YC2A 2UU9O 4Y4RA 4LORA 1AP5A 4NO4A 4UFLA 1D0GA 4PF5A 3CJIA 4HN1A 4B3TB 1IS5A 3HVDA 2BE3A 1KDKA 3P30A 2ZABA 4YXWG 4M4PA 3OUSA 1RJ7A 1TE1B 4YGDA 4YG3A 1VQNV 4P9GA 3FYEB 4PT6A 2QQLA 1HLCA 2GALA 2VQTA 5J7MA 3CBNA 2XHKA 2O0OA 4J25A 3U1XA 3JCIA 5GALA 4DR7B 2HWB1 1IBMO 2D3RA 4IEVA 3POFA 1US2A 4FPKA 3O1OA 3LPGA 2IJHA 4IW3A 5KMGA 1S72V 3VBOB 3GVMA 1PIV3 1J1TA 3I55V 2AZ0A 1OA2A 5FP9A 5KHHA 4CEYC 1PMIA 4NVPA 2JS3A 1R081 3OPTA 4WFBV 2ZEYA 5L3BA 2JGDA 3W21A 2DBNA 2H6BA 1QLEC 3W58A 1C28A 3DKWA 3LIHA 5B1BC 3AYEA 1PNFA 4MT8A 4QX1A 1YJKA 2IU0A 4P5YA 2WFF1 3K77A 5BY5A 3WNNA 4HG6B 1ULGA 2VZ1A 1AI4A 5FJHA 4FZ0A 4FXKB 2XAHA 4AEKA 4K1ZA 3BTXA 4PDLA 4BZ4A 2FCUA 3L2HA 3AKTA 3DGTA 4FI9A 4A45A 2VZOA 4TV9A 1APNA 3CZUA 4KXRA 3ILNA 4BWOA 4F6RB 1XNRO 1YI9A 3DSQA 3WW3A 3GBFA 4YJ2A 4MVSA 1ZZ8A 1TME3 4FAHA 3JD0A 5LWBA 4XDLA 5KWRA 1JH5A 4XUTA 4NIDA 5KX5B 4UF0A 3ASNC 5B4XA 1G6UA 4YLZA 1CXZB 4Z8BA 1KBHA 5EYXA 3G67A 1VBD2 2VM9A 5KXEA 2P2KA 4BE3A 5LGNA 1HX6A 1RUI1 2Z5WA 2EBOA 3GHMA 1ZZ6A 1HXS2 4FAGA 3RMXA 2PI5A 2R063 5DAVA 1XMQB 1NXMA 4ASLA 5LASA 3UQ8A 1HDJA 2XAFA 4S2FA 1LOFC 4XYXA 5FPAA 5JJNB 3W7WA 3J8F3 3IJ4A 1VF7A 2BGPA 4UW4A 5A32B 3KV4A 4LE3A 1LULA 1SLBA 3WB0A 1F4AA 4BIUA 5LL6Y 1QJX2 1BZKA 3MIFA 4LBOA 3MI8A 4URTA 5J9PC 4BAYA 3GYDA 4JYAB 1VBA3 3Q4HA 1OCRC 1XU1A 3ETDA 1ZVFA 2PAMA 1FXHA 2QQPA 5F6KA 5EFUA 4AQYB 2PUSA 1FAYA 4XUOA 2YIBA 4JHZA 4WM8C 2LGQA 1REFA 4AL9A 4O4LB 2IJKA 4NOTA 3JARB 1W8ZA 2NN4A 1R64A 1G8WA 2HWB3 3T2PA 5IK5A 5SV8A 4RR3C 5CFDA 4CCKA 3I59B 3POJA 1HN0A 4UFIA 2QJ1A 2JDYA 3ES4A 3N9LA 4P02B 4IE4A 1MS9A 1QF3A 4TSVA 1XNRB 3N36A 4U2AA 2HH9A 3L2YA 2X6AA 3SEPA 1HIXA 1R091 1O3SA 1FKAO 2OS2A 3RWKX 1S5JA 1PO13 1BZWA 3H8UA 2UXXA 2A9HA 4FFIA 3VZMA 3JATB 3OEHG 5H9SA 3HBKA 2D6LX 1W8NA 1Z5WA 3ZDVA 2JB8A 4W50A 4BWAA 5LA6A 3OGCC 2LFSA 4JTDB 1BQ0A 4HANA 4JKMA 5GZEA 4I0BA 3JALA 4UXNA 1A8MA 4KP4A 4Y1UA 4UT5A 1SRYA 5F2VO 1AR93 1DHKB 2CL2A 2HWD3 4Q4X1 1UIKA 2H0BA 1PGL2 2PQQA 4LNVA 4OZXA 5H9CA 1FNYA 4C1WA 1EAH1 2VRZA 4HKWA 4NXMB 1IPKA 2Y6HA 2E5LB 4CS4A 3VDCA 5BUVA 4UCVA 1N32O 2WLIA 3W7XA 1NBMG 4E4SA 2G4IA 5FK7A 5GZDA 1OUXA 1BE3H 3MIEA 1TVKA 4DFSA 4IT5A 2QR4A 3TN93 1J3PA 5FXXA 2O57A 1QKQA 2VW1A 4GULA 5AFBA 4IHJB 3QH6A 3I7DA 5EC1C 2GN7A 4PJ0Z 3OMAB 1XBFA 3VHPA 1PD3A 3ORJA 4QX2A 3VBHB 3TOJA 4QIWF 2XOKG 4N43C 4FPEA 2P22C 2XB6C 3O1UA 4PDVA 4ARXA 1C8NA 1G86A 1SS3A 2RR12 2CYFA 2HHHB 1O3TA 4I55B 5FZCA 2ZZJA 2ZKOA 1BBT2 4XILA 4QT6A 3BU0A 1H1IA 1MS0A 5JQGA 5FO7B 1Q86W 1SQGA 3NL1A 4LBQD 4PA7A 5L7OA 1Y9QA 2N74A 5FY1A 1Y76A 3V64A 3L70H 4X65B 4Y26A 3AM2A 2YBSA 3ASNB 4XZPA 3KGZA 3AZYA 4JYBA 3PTRB 2A7AA 4PBPA 1G1XB 3WLUA 1J3RA 4OCTA 4PDWB 1MG1A 2W52A 3R6SA 5KA5A 1H2LA 4MVRA 2OKXA 3BOWA 3RZGA 3HQXA 5M0TA 2Q1ZB 1R6NA 2ATKC 4OUEA 4AI9A 4NYKA 3B77A 5BYNA 1AR62 2BQPA 1AYM2 2CUGA 5J2UA 4PLNA 3QO5A 3QLQA 2Y26A 3SMHA 4DV6O 3J8F1 3GJBA 4O65A 4YW2A 1DIWA 2Q8VA 4Q4V3 3JD4A 3IB3A 4Q4Y1 4CRQA 4P9PA 4S2HA 1MQTC 4DUWA 1EUUA 3JXSA 3NWKA 2ZGRA 4LA3A 3U75A 1U5XA 5AC91 1VBC2 5AG2A 4Y20A 3FWEA 2CV6A 4PF1A 2SBAA 5IYZB 4JGZB 3M2MA 1CQ9A 1NLQA 2YBPA 2Y6JA 2ORXA 4RGKA 4XFBA 1TQ5A 2B9ZA 1OVSA 4O9GA 1OPOA 1UPSA 3I2FA 1JXNA 1RGSA 2VNRA 3T1CA 4H3WA 1JHNA 2W1WA 3KF5A 3ZPOA 5FZDA 1BMV2 3RYRA 1DFQA 1M90W 2NMOA 1W28A 3UGHA 1GOHA 2C2AA 2WNOA 5HPOA 5LRRA 4RYDA 5FMOL 1WJZA 3B93A 5DUUA 5LEJA 2JX9A 1XSRA 2ZGQA 2JEUA 5GZFA 1ZX3A 3T1HB 3C2UA 3H3UA 3QBQA 1KP2A 1X4TA 4BDVB 3AXEA 2DMXA 3N9OA 5DDJ1 1SQ4A 1WA8A 4CH5A 1H8TA 3IT8A 5J2TA 4MTFA 5EBLC 1GLHA 1QVGU 3WP6A 1RUC1 1WCUA 3CEIA 2R1BA 1DF4A 2WDBA 5JCTA 2FDGA 1W0OA 5IVYA 4XJAA 1CAXB 3UT5A 3SPGA 5FZBA 5E89A 4WFGA 5LMNB 4QPIA 5T5JA 2WLNA 4N9IA 4LTAA 2YIDA 1QJU2 2D3SA 3KV5A 3K5NA 4LT5A 1S4CA 1WP8A 2BTQA 4Y1YA 4P14A 3VKOA 2R16A 1TAEA 3B5LB 3LA2A 1PGW1 3PMEA 1SQPH 5DXDA 2OTJV 2JWPA 2VUCA 2CGPA 3I59A 2RS33 4HOOA 3BCWA 3FLPA 3MLKA 4MV2A 1RUF3 5BXZA 4N21A 2YPDA 2NZ9A 3NAPB 2ET7A 1O4YA 3CMGA 3ZR6A 5BR8B 3FAVB 4IYIA 2OIEA 1QOSA 4HN0A 5LBBA 4F8AA 4FFBA 3C8XA 3LSDA 2X6BA 3WB1A 1L0NH 1UJWB 2LO1A 5JSRA 1PK6B 2P6JA 2QQOA 4B3MO 2DCTA 4BPZA 2W47A 3JD71 3E1F1 4XJ8A 2YGLA 5FMDA 1CZSA 4IEQA 1Q8QA 3GM8A 2WLHA 1QXRA 2QQVA 2W1UA 2PHUA 4LWSB 1W05A 1GKFA 4BQ4A 1V9U3 1WMEA 3PL0A 4IEYA 1XPWA 5K8SA 4JGZC 4CP9A 3ZIXA 4IIJA 2CAVA 1N1YA 1I7FA 3E35A 4Q1RA 3POGA 2Q73A 1TG7A 2MEV1 2XLGA 5FRAA 2JGUA 3VBHC 4N43B 3E22A 3WG3A 4JAAA 4LO6B 2P5OA 3WNKA 2P4VA 3EO6A 3ME2A 2BGCA 4AEDC 4QQPA 3N9MA 4ARYA 3ABMC 2ZIOA 5HCHA 4PJYA 5JOZA 3MIDA 1D7PM 3N2GB 5KR7A 4Y5TA 3K79A 3QF7A 3DPRC 2DVFA 4Q5OA 3AG7A 4IEOA 5GONA 3H3ZA 2A3XA 5KLVH 2WQ8A 3KCYA 2YMZA 1ZLZA 3G7DA 2UURA 4ZU7A 4YZ2A 5FKBA 1SLIA 4EB6A 4H44B 3AL6A 4EFBA 3M7AA 3SYPA 1NX9A 3TBDA 2Q5ZA 1XRUA 1UX6A 2HBUA 5FJKA 1QOOA 1FATA 1FPN1 2DQ3A 5JZGC 4AWDA 1RSOA 2JD4A 4Y4YA 3CKHA 4I2OA 2BOBC 4FPFA 3NNJA 3THCA 5GKAC 5C8YB 2PGGA 2D2CB 4G9SB 1VQMV 1SBEA 2GNTA 3AVRA 2KG7A 5KAIZ 2E32A 2ZE8A 4XFHA 5IWFA 4E2QA 2QUOA 2X29A 3ZMTA 5IT6A 4X62B 4P9WA 1SQBH 1QEXA 1YSCA 4I0AA 1SBFA 1CVNA 5FUIA 5D5PA 1AR83 5K1XA 1WLCA 4EZHA 1SQQH 4LFCO 1QJY2 3OBAA 5GJ6A 1C3HA 4YZ3A 1SG3A 3UYJA 1NI8A 1MOFA 2XNDG 3PIGA 4DXZA 5GTIZ 4YJ3A 3G6BA 4LO4B 2VQFB 1W8HA 1H2NA 4YVSA 4JDNA 1L7RA 4HL0A 3AYCA 1C1LA 4MG2A 4I0WB 3QO8A 5FUPA 1W2NA 3ZYRA 2RM22 1JUIA 3ZXFA 2VOWA 5D8AB 1GP6A 3RYCB 2PYLA 3WY6A 1WLEA 2XKPA 1IGOA 1KS4A 1NA1C 3CC4V 4B4PA 3NMBA 1YEWA 3FB6C 1NG0A 3RMYA 4I7ZB 1HNWO 1ULPA 5DMYA 4LOSA 1FV2A 4DV3B 3AG1B 4EROA 2E6VA 1KJRA 2OTLV 3PVOA 2HWF1 3LA7A 1QJFA 3ALQA 2A6ZA 3JU9A 2W1SA 2FD8A 3M8AA 3ON7A 5IFTA 1FFXB 1OLME 1U5YA 1DGRN 3OOXA 3R05A 4J6GA 4DINB 3CC2V 5LCWL 1YI7A 3K5LA 4AFCA 3OGJA 1ZRCA 3DXUA 2CTQA 1RB8G 4DEVA 1YIJV 1IHMA 3WNLA 1W0KG 2LQTA 3CMEV 3EXAA 3RW0A 1AL23 4CE8A 5FBJA 4FLVA 3HIFA 3HJRA 3ZN4A 5FYZA 4QE7A 3GALA 3CF6E 2P5BA 2R073 1XI1A 1AHSA 4I02A 3CIHA 4WVWA 5J98B 3FAVA 3O1TA 1HRV1 5F5QA 4HPKA 5C7GA 2KM2A 3B40A 3MHSC 3AXDA 3VDBA 1B04A 3CCEV 4QPIC 4PCRA 3CCVV 4YZ1A 5JOXA 4JTNA 5CISA 3VD4A 3B2EE 1AR91 2WNUB 3GJAA 1BYHA 2VVFA 3AP5A 4FSJA 1EP0A 2QQJA 4C90A 4BH9A 4H33A 4YVSC 4PD4F 2VOTA 2XAJA 4IESA 5D21A 2C6SA 4MGKE 1NQJA 2K46A 1VF5B 3V65A 1W6OA 4WFHA 4JV4A 1AX2A 1W8TA 4F3JA 3E97A 4UVAA 3IDBB 2Y34A 2VZSA 4DV3O 3ZMNA 5LHGA 4LF8O 4QD2A 4ZI7B 3AP6A 4DV7B 1W8OA 5FP4A 3ILFA 1KITA 4YFZA 4RAIA 5HCAA 1LHVA 1EZVH 4MTOA 3BTZA 1K9MW 1TVKB 1YFWA 3JASB 2QKAA 1AR71 2HG5C 2EJRA 4MXVA 3LEMA 1Z2GA 3ETGA 4NIIA 4YY3O 3C7EA 2EIJB 3DF0A 2EIBA 5L73A 5CA1B 3PUHA 2E3CA 5FZGA 5FYIA 4XF3A 1B3QA 4MHUA 3TYJA 4I4TA 5F2WA 3V0AA 2CH7B 1L7LA 2YXLA 2JEMA 1Z7S2 1IZ3A 4BLIA 1UQXA 3HNMA 4N7UA 4E4HA 1YQCA 2P4EA 4LE4A 2BWAA 2YIBD 2WO3A 1WB8A 1W2UA 1YYNA 4K21A 1RMU1 2GC2A 1JA8A 3FHIB 1YCIA 4C0BA 1AXYA 3R65A 3LKJA 2UWBA 3HPLC 1AR82 3USUB 1P4RA 4BISA 2ZE5A 1AYN2 1Z78A 5DG1A 1ZL8A 3RZMA 3H1JH 2IZWA 3ASOB 2PA7A 4J11A 5JCOC 2F43G 4A7KA 2HJFC 3D8CA 1SZBA 4X8PA 3E8FA 1GOFA 3WCRA 2FHRA 4M00A 5CN0A 4QPKA 3WG7C 1HP8A 1GTOA 2V4VA 5FZ6A 4BR6A 1SHWB 2WN3A 2OUHA 3VBBA 4PA6A 2QGNA 2D5HA 2EINB 2JB4A 3OB8A 2ARHA 1QGLA 2HLEA 1F5JA 5H6RA 3BB6A 4YG6A 5BPXA 4RFT0 2XH6A 5BR8O 4QQ2A 1L0LH 4JKLA 1XHZA 1UU4A 4CCMA 2QWRB 4HFSA 3H1WA 4X1YB 2GN3A 4NRMA 2WZPP 1S2KA 4Q1PA 3FFQA 1QWRA 3KF3A 1RUH1 2K2SA 1WP7A 3ACHA 1WW7A 1JN2P 4YVWC 1RUC3 2WO7A 3ABKC 2XDVA 4L8QA 2A3WA 4MVOA 1MZEA 1NCQB 4QPJA 4E9KA 1IBKB 3N7JA 1YF2A 4J41A 1W2BU 1W6PB 5GTHZ 3K04A 4GIQA 2ZHKA 3SKVA 1HNZB 5G05L 4BQ5A 3OPZA 4D7TA 4CUGA 1YHQV 2EAKA 2DWRA 2WLJA 5EQUA 1YITV 3VBUC 2PTMA 1F4NA 3N2KB 3KVAA 3S3XA 3PVEA 4CZZA 3BALA 4P9JA 4XZUG 5E6HA 1NH2D 1UD1A 3CCMV 1ORQC 3ZDSA 4K7JA 3E5XA 3MFAA 3DGEA 1XOUA 4LF6B 4UOJA 4FLWA 4X8NA 1KFXL 1IG0A 3FYIB 1HN1A 1U5ZA 4CDWA 4AG4A 4AE2A 2R6QA 2FYUH 2JKXA 3SQOA 1I6XA 3NKTA 4M01A 4ZBMA 2BNOA 4R52A 4CEYB 2RR11 5CBLA 4FPYA 4EFEA 3OR7C 2ZXWC 4X64O 2DWEC 1BVVA 3K3OA 3RT3C 4WM7A 1ZRRA 4IHJA 2WQZC 2EULA 2ZOEB 3ZSMA 2AZ2A 3VHOA 3EVKA 1NT0A 2HWC3 1IBKO 5CFDC 2VCBA 2WNUC 2YYOA 3VQYA 2JS5A 3NSTA 2ARXA 2DCYA 5JSOA 1S0EA 5A7PA 1F8VA 1HV1A 3JAKB 5F8PA 1FJGB 3CDZB 1HNXO 1DCSA 1JJ2U 1JU3A 4EE2A 1OF4A 1Z0HA 4TZDA 3D36A 4CDQC 5C8CA 1K3IA 3P5BA 3N7KA 3A0RA 1MACA 5B1NA 5HBAA 2WSUA 3G6JB 2RS13 1Z5VA 2PAKA 4E27A 3B3QE 2HWF2 2QQIA 1V55C 1TEIA 1UU6A 4DMIA 2XJQA 2Q9LA 3B7MA 2R0HA 4CDXC 1PVC1 3O65A 3H8RA 4UFMA 1VAMA 3TEXA 5K0UC 1E79G 3VBUB 3OUHA 4LLFA 1PIV2 3P3NA 3F7VC 4JI8B 1K5SA 1Q5OA 3K5OA 1N32B 2XHBA 4W6XA 3NO8A 1AR61 3ELNA 1X82A 5IDJA 1WLDA 5C3PA 1NCQA 2EIJC 3OUFA 4BQ2A 1BCXA 3A4UA 1NUKA 4AEJA 4ASMB 4FM0A 1AR92 4B08A 1FPN3 4Y3OA 3AB0A 3ACLA 3TWIA 3UJOA 1AR1B 3B94A 2QM7A 1VIBA 3MAQA 4RGGA 1WPBA 2D43A 3NNMA 4QPGB 5LBQA 4FP3A 5LA0A 3K4AA 2AR6A 3CWBH 1YJ9V 1TUBA 2X5IA 2QSAA 4W4LA 1D5NA 4I0XB 1MEC3 1GP5A 1OI6A 4LHKA 1H38A 4P00B 2RS52 3BUCA 2CWSA 3ZPYA 3ZSLA 1GZ9A 2Y8KA 2AHYA 3E8HA 3T1MA 5DUWA 3AK3A 4AEDB 4WM7B 2QTWB 1W2OA 3DXRA 3ABMB 3ZMVA 4JI8O 1JYXA 2D44A 4AVAA 4PQ9A 5E16A 1I94B 4DR6B 3CXHF 4FOWA 5FPZA 2KB1A 2LGWA 1HV0A 3FB8C 3RZLA 1R1BA 2ZGLA 2JJ6A 3EMRA 4NWVA 3VBRB 4NROA 4JI7B 3CRQA 5EIBD 3AFKA 1FMD3 3IC7A 1GN2A 2JDAA 1TVGA 2GH8A 3UESA 3E8BA 3GGLA 1KB9F 3ZM8A 3APBA 1JZ8A 4Q4W2 1VMGA 4EN7B 3A2FA 1LRHA 3AX4A 3HKEB 4O4IA 4E4ZA 3WT3A 3TAYA 5JPMB 1IBLB 2YBKA 1AI6A 2P3YA 1UMZA 2CHHA 4JQTA 5IFPA 3H3LA 3FUOA 2WNVB 3I4IA 1EAH3 3EYPA 1M57B 5K0UA 1UOFA 1C57A 4KUMA 4NKGB 5KBFA 1C4RA 3ES1A 2ZX3A 2Q0OC 4SLIA 1QXJA 4FOQA 3F5WC 3AVSA 1NAEA 2ERFA 4DUZO 4EYUA 1EPZA 4AK3A 2V5YA 2RDSA 2JENA 3RRDA 1H2MA 2VW2A 3WB2A 3CCRV 3WNMA 3NNGA 3BKZA 4AHYA 3POYA 4GAZA 2BERA 4LF6O 3VBSB 2B4KA 3ZYJB 2GSMB 5D2AA 1PZ7A 4TWTA 1WWYA 5FZ8A 2WFF2 1XNAA 5CVRA 4DRRA 1JYVA 3SGIA 3FHQA 4OHXA 2ZR2A 1GOGA 4AI0A 2DUOA 5H5NA 1FJGO 2A79B 4C7UA 2UXNA 4TOIA 4QJFB 2DVGA 1CJDA 2WR9A 2WT1A 3ROUA 5KUKA 1W6NB 3GZTB 3IDEA 3AMHA 1SMVA 2YEVB 4JGZA 1U96A 5D1IA 1WGPA 1UZZA 2GZWA 2I2SA 2V4AA 4GMP0 2KD7A 2WWSA 3VV1A 5E79Z 4HSLA 4HAMA 5FYUA 4JPRA 4QDQA 4SBVA 1J84A 1WW4A 3HD8B 2B5HA 5FP3A 3WF4A 3VD7A 2UUCB 4CSWA 1AR63 2WWWA 1MS5A 1S2EA 3WDVA 3VHRA 4KFMA 1N33O 2B8MA 4BXSV 3OCPA 1K34A 1W06A 2IXCA 3WDXA 3HQRA 1S1AA 3SCFA 1ACCA 1H8EG 1EN4A 3P3PA 2RS12 5ISLA 5BNOC 3RN4A 3VDDB 4P9IA 1YTFB 3ENRA 1H2SB 4AHCA 1C5IA 3I8TA 1MVEA 2MHFA 5LZ6A 5FYBA 2Q7HA 3OD0A 3U78A 1YRZA 3W5MA 3OF1A 2TUNA 1R3JC 1ND3C 5EXOA 3UT0A 1NY72 1IQAA 1ZZBA 2AGSA 3I3EA 1M4WA 3BU7A 3S5QA 2OIIA 4TXWA 1ZBA3 5ANNA 2CSGA 3LE0A 5ABJC 1KGYA 3FUQA 4IEUA 5J96B 4LUMA 2GTSA 5KX5A 2VMHA 1T2XA 3CCLV 2GDFA 1EN5A 1VEWA 2JIZG 1REDA 3BA9A 4O2BA 1NU1H 5DN2A 4KU8A 4LIVA 4O4JA 3JQWA 1RUE1 2CDOA 3SHRA 3VZOA 4LP8A 2RDNA 3OTOO 4PBOA 4B3SO 4QHOA 1VBD3 4CUAA 3HPNA 4FPLA 3A21A 4GWMA 5J2TB 1LCLA 4E4DX 3FJSA 1H0BA 3FL7A 4DRXA 3OYWA 1ASJ1 4JI1B 1YC61 2YZ4A 4OHWA 4FIPC 4ZS2A 1W9SA 3VBRC 4IE0A 3W59A 2R062 1ASJ2 1GNHA 2RMU2 1F4HA 4H7LA 5IJ9A 4YVSB 4RS5C 2F1MA 4WBNB 3H01A 4WM7C 3V0BA 1ZREA 5A80A 4JI4B 1TMF1 3H50A 3ZXGA 1XE7A 1REEA 5CZKA 3I5DA 3A0KA 2V1DA 4R7CA 2QDOA 3ZS8C 2ATFA 1U97A 5FQ0B 2VTFA 4W4KA 3U0ZA 1BHBA 3O9OA 3WW2A 3SPHA 4Q6GA 1YJLA 1AILA 2Q5TA 4LF5O 2RS32 3OFNG 5C3RA 2YS8A 1ND2A 2BDRA 3JD2A 4LHLA 1PZ8A 4KG0A 4C8DA 1G8MA 4UVBA 1H6XA 4MVQA 3JUUA 3ZEDA 4TV9B 3SPJA 2J1EA 2JEXA 1AJQA 1FD9A 1QNWA 4EN0A 2X7RB 4LHSA 1SPPA 1LGNA 1AYM1 3OR6C 4JGYC 2CTPA 3CRAA 3ZN1A 2JRIA 2RQ6A 2QWPB 3OEEG 1R1ZA 4ET7A 2X5IC 5BNOB 3CPWU 1FXKB 4Y1ZA 4TLGA 1WMFA 4KL1A 2WNVC 2ZX0A 4ABMA 5A3PA 2X09A 2DE0X 5FYCA 2OW4A 1K12A 4J1XA 2PAEA 5HCFA 2PLV2 5ACA3 3T4VA 5FOJB 3UL2A 5F5IA 1I1EA 1K33A 1FOD2 1JX9A 4CDUB 1W8WA 3USUA 1HB1A 1N34O 4CCLA 1WBFA 2VQ0A 1LU2A 3SR2C 4FOYA 2VUAA 1O9GA 1CAUA 3DV8A 3LDCA 2DVAA 3HKDA 2JG9C 2A70A 1XYOA 4MVUA 4LJHA 1NA1A 3SITA 1RHI2 1VQ6V 4Z2AA 2WLLB 2YU1A 2XL9A 1YXWA 5LOVA 3ZHVA 2RM21 4MTXA 4N23A 3K4ZA 3MIHA 1RUJ1 1W6QA 4CCDA 1OCOC 1CIYA 1SDWA 3N4MA 2DYSB 1ODNA 4AQYO 2TBVA 1JYTA 4IEZA 2XVGA 3NW4A 4AVSA 1OOPC 4GUNA 2BGOA 2IC1A 5IVJA 3D0SA 5IAXA 1J83A 4IE7A 4B1MA 1SKVA 2A73B 1O4ZA 5GW7A 2OXBA 3PHMA 1KUQA 5IJRA 1HB2A 2W0XA 2QWOB 1VBE2 2FDFA 1WLTA 1LHNA 1KD7A 5SV5A 4QPWA 2FKXA 5IUQA 4BCUA 2M7WA 2OQ6A 4AI2A 5LP6A 3SH4A 3AKRA 5GLZA 4NR1A 4OUMA 4LK7A 2AXTZ 3MPBA 3KCCA 3D3IA 2D40A 3WF0A 4YJ3B 4WVMB 1LOCA 2BOIA 3VBHA 1RVF2 3SYAA 1JU4A 5FZKA 5A7WA 3JB8A 2IW5A 1NZCA 1GR3A 4GZRB 1LOBA 4R6ZA 3J7HA 3C3VA 3MD0A 3OUIA 2RCVA 1SF9A 3LD8A 5JXHA 1UZVA 4WV8A 4AGRA 5GLVA 2IM9A 3IPVB 2ZGOA 4GKJO 3BHPA 3UM7A 1H2GA 1SZXA 3ZN6B 4E2GA 1TUBB 2X5IB 1UPIA 2DCJA 1JS9A 2WWUA 1N1SA 3SJCC 2ZR3A 4L97A 4X64B 5CBHA 4LEJA 1JODA 5JIAA 1H1AA 4EWDA 1WCQA 4OI4A 4DXWA 2GUZB 2DVBA 1AJPA 2HP8A 3ZFEB 2WLLA 2JG9A 4X88A 3FE5A 1PO22 4IL6Z 4CP2A 1NKDA 1IX9A 1F15A 5FZOB 1WW5A 1LUVA 3B02A 3HBZA 4Q2FA 5FZ3A 4AEDA 3ZXJA 3I2OA 3OAAG 4ZI7A 1QVFU 1GWKA 3PU8A 3NR7A 4Q0PA 1TA8A 3RYIB 5IK4A 4O2AB 3H1IH 2QM4A 3MF6A 2Y0OA 3W9AA 4DY5A 2BOJA 1LOFA 4CEWA 4X1IA 1DGLA 2C0ZA 3ZJZA 4O9EA 3OYWB 5A6YA 2VGDA 3ETQA 3LDEA 3CXCU 4ONUA 3THTA 1DQ1A 4P08A 2W0FC 4ES9A 1OKQA 1PM7A 2V5DA 2ZA9A 4QPGC 1AL21 1VLNA 4H37A 3THOA 4WCEV 4XDJA 3KT4A 2RHPA 4BIZA 3J4UH 2W9XA 5BNPA 5L9BA 2RDQA 3AP7A 2KA3A 4FPHA 2XR4A 1G9CA 1W9WA 5CAZA 1M57C 4DV5O 2R0FA 2BSKB 2UYAA 4EJRA 5F37A 1ZL8B 1VAKA 3CP1A 1AX0A 2K9PA 2DYSC 3HNYM 2IFRA 3Q9OA 1HRV3 4C0HA 4RWUA 4JI6O 1AR5A 1BL8A 4WM8A 2XPJA 3ZFEC 4W8JA 1VF6A 1AVBA 5LYJA 4DV2B 1AXZA 4QPIB 1XQ8A 1QJX1 5CG8A 1P7GA 3RFRA 4CCEA 1COV2 4RUFA 1OKOA 1Y74B 1WD3A 1W0NA 2C24A 2P06A 1VE0A 4HSJA 3O5SA 5L19A 4M0NA 2L9LA 3HKEA 4O4IB 2R061 3SDLA 1S0CA 4X66B 2JDUA 2P3IA 3OT7A 3FFZA 4NJ4A 5K4LA 1S5LZ 3OUJA 4R8CA 2NM1A 3UKTA 2EIEA 5DEDA 1PHMA 3SISA 2WS92 2ZBJA 3Q8FA 4XDPA 1I3HA 3N3HA 1JCHA 1UOBA 4ES8A 5LHIA 4D3WA 5DAQA 2QWNB 4JI3B 4XBNA 5J3UA 4OHVA 5FOBB 4D69A 1VBE3 5CADA 3UV9A 3WINE 5DAPA 4KBBA 2H3OA 4EEQA 4IV3B 4P5HA 2IWGB 5C70A 3VDDA 1WA4A 4YJ2B 2P6CA 4FQZA 1N4CA 4K8XA 4UCOA 4YY3B 2ZD9A 1X50A 3QNEA 2ZKNA 1DYPA 3EFFK 4D6SA 2ADEA 1YDXA 5IVBA 3GZUC 1UFIA 5A7OA 1O6UA 3O1PA 2ZHNA 4DRVA 3OEBA 2WYFA 2B39A 5B2GB 5I8YA 1V54C 1URXA 1XYPA 3E6CC 1QJY1 2GP5A 2YEVA 1GM7A 1V6IA 4Q0UA 2ZQMA 2BNNA 4R4XA 2Q7EA 3HN3A 2ZCEA 1XU2A 4B4QA 3NV1A 4CCNA 4JTOA 1CAVB 2ZGSA 3MV01 2UUBO 1PMHX 1S0IA 2JK5C 3GZEA 2Q1FA 4U3FH 2E7QA 2V72A 4HVQA 3WF3A 2C26A 3WG1A 2DCZA 1OSGA 4IDZA 4XQWA 4WFEA 2XJSA 2C1FA 2OA2A 4J1WA 1GICA 2HJIA 3I3MA 1UCXA 2VBDA 2DURA 3UNPA 1V9U1 5H9QA 3B9IA 3NAPC 1PO12 4RUEA 4WBNA 1T5EA 4U3JB 5C93A 2PHLA 3OBZA 1GV9A 3NKGA 5BNQA 3T0DA 3A7QA 2A3YA 4Q4Y2 1D4M1 5CB4A 2F23A 3BPZA 2YXHA 3WP4A 4UV9A 2EF6A 5ITZB 4LMFA 4MGQA 1IS4A 4NUBA 5A7SA 3UO3A 4CCCA 3CX5F 2A6YA 3CCUV 4DK1A 4GB33 1D5AA 3VKFC 4IEWA 4QHZA 3MGUA 2JDIG 2UUBB 5LB6A 2Y69C 4ZOLB 1AR4A 1PMJX 5LHHA 1FXKA 1R093 3JD3A 4R8HA 2Z79A 4CDWB 3LNNA 1PVXA 1W9TA 4Q20A 5FXZA 3EQEA 3PUIA 3I49A 4NTYA 2BFUS 1Y4WA 1BK0A 5EZYA 4JX0A 1DGRA 1XJAA 2FMDA 4IV3C 4K6BA 1A8DA 2CU5A 5DABA 4K8FA 2Q8CA 1B35B 3ABLC 5JR7B 2SLIA 1NE6A 5FMOS 2JE9A 1NKGA 1ZSPA 5KAFZ 3V0BB 2X0LA 4RS5B 5EJ1B 1H1MA 1WMXA 4PA3A 4K0KB 2WT0A 3ZFGB 4R4ZA 3BABA 5FPRA 1TUEB 1WNSA 2E31A 1FNZA 3PLQA 4FLTA 1G9BA 3N9QA 3CC7V 1PVC3 2ZEXA 1LHUA 3K3WA 1QQP2 1S0FA 3POBA 3IGAC 3SPIA 1VBD1 4PDWC 3L9JT 5IVEA 1BJQA 3O0VA 4QGNA 1N36O 3IDCB 3EJKA 1KP3A 2ZGNA 3VZKA 3BRCA 4W6WA 4YNIA 2BSKA 3Q8EA 4QKNA 3SCHA 3WZ1A 4E4EA 1K4DC 5EBMC 1IQDC 2VD7A 2XGXA 3KSCA 3QH7A 4XFFA 2JDPA 3LSEA 1QDOA 1CD3G 1NCRB 4KGQA 3G80A 4NHLA 3EHKA 3SEEA 4F6EA 4A3ZA 4GD4A 1YI2V 1SA0A 3KLSA 2A7WA 3TN92 4K9SA 5IWAB 2JKBA 2GNMA 2E53A 2IXKA 4NXNB 4Y33A 3C7OA 4GCZA 4JHTA 4JDOA 2Q0AA 1M1KW 4OX9O 3LIGA 3WG4A 1FXVA 5A9GA 1VQLV 1UKRA 5A1LA 1BEV2 3EHBB 5KXDA 2E7AA 2IXLA 3AFGA 2VMFA 4FLXA 1RMU2 2EALA 3HMYA 3BY6A 2BUKA 1R6TA 3HNBM 4BA6A 5LA9A 1RUI2 2VMIA 1R1A2 1PPJH 4MSVA 1MSDA 5IY5C 1YZBA 3GBWA 4BQ1A 1US3A 1S5HC 1N34B 2PI4A 1IXBA 4GWNA 3NJZA 5J48A 4ISRA 3J80N 4IV1B 2XASA 3KS7A 3T4DA 1NA1B 5DUXA 1U5IA 3RSJA 1YFXA 3LOIA 1B09A 3INAA 4QXCA 3D3QA 2WRAA 2RJZA 4WZFA 3JSLA 3SKJE 3HB3B 5JMCA 2VCCA 1NH2B 3T2QA 1Y76B 4ZHQA 5BY1A 5A1AA 3M3OA 1NXD1 1DQ0A 5IVCA 3GDBA 4XF9A 5C4WB 2ZS6B 3AP9A 1E5HA 3B9CA 1KEXA 3ACFA 3LSUA 2B1GA 3VBFB 2YI8A 2ZNJA 5JZGA 3ICXA 3BFRA 1AJKA 2WAMA 4PDWA 2M6YA 4AZZA 5FZOA 4BM8A 2RMKB 4DR2O 5T50A 2VQEB 3T4ZA 3NV3A 2YG0A 2Q68A 3WUCA 2WABA 3HQUA 4KG8A 1OT5A 5LA2A 2RG4A 3MDSA 3KCXA 3MO4A 5IHRA 3HEIA 1PNGA 4IGOA 4EV0A 1VQOV 3Q8CA 4M4RA 2HR3A 1WA6X 4F6RA 1L7QA 2PMWB 5FZ1A 3RYHB 1XNBA 4F83A 4AAPA 4X20B 1DDLA 3B00A 2AENA 3ZR5A 1V70A 1KD1W 5LGTA 4JTCB 1H9WA 1S77D 1OLQA 3JB4C 3TEYA 2Y33A 4NIGA 4M3CE 3UKMA 2VOXA 3KB5A 3OSDA 5A7WB 4AEMA 3IAQA 1IBLO 2Y69B 3KQRA 4QQHA 3NNFA 1SLTA 2FCTA 2UXCB 4LFAB 2G9FA 1QDCA 4HYOA 3ZIAG 2RJKA 3MEPA 3CJIC 4J7JA 4LH6A 1PX3A 4XBLA 5KMGB 1R3IC 2ZINA 1PIV1 1PGL1 2VNOA 2PLV1 1AR73 1K73W 5LRSA 1IBMB 1A6CA 1YIPA 3BCCH 1K97A 1XMOO 4YW7A 3VBRA 1HW5A 4NPMA 4Z2WA 5DN6G 4XIKA 3ZKUA 5A3TA 1MS3A 4YRDA 5IVVA 2NLRA 2DF7A 4FTSA 3CNAA 5CFCA 5C9AC 1DGSA 3O7OA 1RUH3 1ENSA 3POSA 2QJVA 1GMMA 4WF9V 2DV9A 4XCBA 4EN9B 4DV6B 1ZBA1 5I8TA 3MHHC 1JUHA 1JVMA 4QGMA 1FOD1 2JDKA 1EV12 3B4SA 4CP9B 4FLUA 3PJYA 1HWYA 1CAUB 4U36A 5GZCA 2EXHA 4HKLA 2X8KA 2B42B 1V6KA 1RUE3 1ENXA 4FPGA 1UZYA 1KDMA 5T55A 5LXTA 4IGPA 3JAWA 1NJIW 3OBTA 1OZ0A 2ADQB 5K9YA 1KYOF 2JICA 4AGGA 3ASIA 2RNBA 4GKXA 2D6OX 2IXJA 1W9FA 4YW6A 1BMV1 2ETEA 4Y22B 5FZHA 3MICA 1LEDA 3SPCA 2WSVA 4BK4A 4X6RB 2CY6A 1ZNPA 5L9RA 1KXGA 3K58A 4D7YA 4K0KO 1D2DA 2OYZA 2RN9A 4LF9O 3CCQV 1ND2C 2CAZC 1ND3B 4LFCB 4KWKA 4CYDA 1GSLA 2KXLA 2GTAA 4HBNA 5FTTC 5AC92 2XMLA 5DDJ2 4KNCA 1W6NA 3S7EA 1XILA 1RTVA 1H9PA 4LFAO 1XSQA 1GUIA 4DV0B 4W4ZA 4OULA 1HJGA 2JECA 3ZCCA 3TK1A 2FZ2A 2WNVA 2AW9A 3H9AA 1HJFA 1GN6A 5ABJB 5JOWA 1UZ0A 1Q6IA 3MPPG 4TLFA 1N33B 3NNLA 3MF9A 1XEQA 5B5EZ 1VBC1 2QM8A 5DZFA 5FPLA 1A32A 1SCRA 2VCAA 3O1SA 4ZKTB 4O4HB 3F2ZA 4M0HA 5IJ9B 3CRRA 4DS0A 1Y7BA 4KHPO 1RINA 2FQPA 4C91A 3ZFFC 4AAXA 2VCMA 3U11A 4NAMA 2PLV3 5ACA2 2VQEO 1SPPB 3TNPB 2Y6GA 1W6MA 1GKBA 3P32A 5GLTA 3WDTA 3KKYA 2VQUA 1DF5A 5DM6V 1L3JA 1OLMA 2NMNA 2EICA 5B66Z 5JCOA 4YW5A 1N47A 4NPRA 4HNAA 3ZLIA 3JD72 1V6OA 1CJPA 1TZOA 2XXZA 3ZSEA 5A3UA 3F95A 3ITQA 4IYHA 4B7EA 5LK7B 1RJ8A 1OV9A 3CJHA 4JV5O 5CA0A 3BVCA 4UBHA 3ZYIB 1PNKA 4X1KB 1BT8A 2QBXA 1JFFB 5LP6B 4TYSA 4I0XA 2Y0PA 4ZIBA 3ZYFA 2XVKA 2LW7A 2J1UA 5CG9A 1OFSA 4GX1A 2EIGA 4XOGA 4PLOA 4I9QA 4TV8A 3I3BA 4O61A 1XL4A 1JZ7A 1QNYA 4YHHB 5BNOA 5FKCA 4DUXA 1AX1A 3TN91 5IT9N 1DTOA 1WB7A 2HWF3 3O14A 4A4AA 1OJHA 2ZGPA 4RQPC 2CTVA 1SETA 1GZTA 2VQAA 1M56B 4A2UA 1IPJA 5HCBA 3ZIWA 5JWPA 3ETPA 2RMU3 3MYXA 4AXOA 1NR7A 3QTCA 1WZXA 5TISZ 3GXUA 3GNEA 1AL22 4YW3A 1OXCA 5H9RA 3VBUA 1DZRA 1CAVA 5CFDB 1LOEA 3DXRB 4JV5B 4QMAA 4MS2A 1BXHA 3NJVA 3ABLB 1PL4A