3U11A

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
197
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 65
structure length 197
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u11A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u11A02
5FPZA 1QWRA 5FPXA 4WBBA 3ETQA 1ZRCA 4JVAA 4EROA 2EA7A 1UIJA 4YNIA 4P9GA 4J1XA 3UKVA 4HVRA 1YFWA 1YLLA 5KHJA 4QMAA 3D0SA 1NZCA 2MHFA 4X6QB 4ZU7A 1O3QA 5BPXA 4YSFA 4EWDA 5JSRA 5CVRA 3S0MA 4XF3A 4BH9A 4J1WA 3IDCB 1XE7A 3NVCA 3LA2A 3NJZA 4UBGA 2ATFA 3BPZA 3SMHA 4D7SA 2XKPA 4F7ZA 2H6BA 2GC2A 4XF1A 5FLHA 3FFQA 3WW3A 5I91A 1ZZ7A 5I93A 2HKXA 4LA2A 2GC1A 4IEXA 4CYDA 3GBFA 4AVBA 4I02A 3L2HA 3KMHA 1NE4A 5CADA 2O8QA 1LRHA 3DKWA 3M70A 3NKTA 3ST7A 1EP0A 2OZJA 3KCCA 4XF0A 5E16A 1O3RA 1EY2A 5I0SA 4Q29A 3H1WA 5J7MA 4NVPA 1ZZBA 3DL3A 4HZFA 2GC0A 5J48A 4K8FA 1YWKA 2N7GA 4MZUA 1X82A 2XHKA 4OLLA 5I0RA 4TLFA 1ZRFA 3MZHA 3MPBA 1JUHA 4FT8A 5FLJA 4IETA 4HN0A 4MUVA 1ZZ9A 3CJXA 1OD5A 4MGKE 3FX3A 1X8MA 1ZNPA 2OZ6A 2XLFA 2PFWA 4Q0QA 2D40A 2H0VA 4IEYA 3MDPA 3OF1A 2EVXA 4JV4A 4XFHA 1WA4A 3D82A 5BXXA 4XFFA 5LEJA 4EWAA 4X6RB 4FAHA 4LA3A 4LULA 5FDBA 5BV6A 3HT2A 3HQXA 2ET7A 2ETEA 3ZDSA 4ZU4A 2C0ZA 3NSTA 3B02A 4I09A 1O3SA 1ZRDA 3RPQA 1GQGA 1NYWA 2E9QA 2PTMA 2F4PA 3M3IA 3BALA 3DN7A 2QCSB 1O4TA 4I3PA 1J3RA 1OMIA 4IEQA 4ZU5A 3WW1A 1HW5A 1FI2A 3EHKA 2KXLA 4OFGA 4YARA 1J1LA 2OA2A 1UW8A 4L2NA 2MPFA 3O14A 1YHFA 1IPKA 2UY9A 2PAMA 1Q5OA 3LZZA 3SXWA 2D5FA 5KHHA 4IEUA 4MGZE 5KHGA 3BB6A 3I7DA 1CAXB 3IWZA 1J3PA 2GU9A 2OYZA 1UPIA 4KU7A 5I0UA 2UYAA 4I2OA 1O5UA 5D1IA 3RNSA 1DZRA 2B5HA 3OGJA 4MV2A 1G6NA 5FLIA 2WC2A 4Q0VA 1Y3TA 1RTVA 1LB2A 2XL7A 5JAXA 2H6CA 2BYVE 4AQ6A 4AVCA 4FAGA 1LR5A 1RC6A 4LUKA 4MH0E 1QY4A 3VHRA 3KGZA 3SCHA 1RGSA 4WVZA 3CO2A 1CX4A 2PA7A 2PYTA 5FQ0B 4Z82A 4HSJA 1J59A 2QVSB 2Q0AA 3WW4A 3ROUA 1YFXA 1CAWA 2QDRA 3PVBB 2XGXA 1ZVFA 2K0GA 3FZ3A 4AXOA 1YFUA 1ZZ6A 2QJVA 4META 1NXMA 4QGNA 4XF4A 4IERA 4XETA 2CAUA 5EFUA 1ZRRA 2PAKA 2IXIA 3I59B 3I59A 5JSOA 4A2UA 3H1YA 4KU8A 2GH2A 2IC1A 5E1RA 4H7LA 2PQQA 5F1RA 1DGRA 4MX3A 3C3VA 4R52A 4WZCA 4JTOA 3JZVA 1I6XA 5EZWA 2VPVA 3LA3A 4HVQA 5FQ0A 2D93A 1XE8A 3E5QA 1J3QA 3LOIA 1X7NA 1O3TA 4RD7A 4Q0PA 5CU1A 4ONUA 4BYYA 3LWCA 2CV6A 2PAEA 4E2SA 4QX5A 1TQ5A 1DGWA 4LLOA 3E97A 2GC3A 3LAGA 3S7EA 5C8WA 3ACLA 3ES4A 3FE5A 1LKNA 3D0JA 3EO6A 1ZZ8A 4HN1A 1YUDA 5KBFA 1Q43A 3E5UA 1ZX5A 3H8UA 3IIAA 3CEWA 1DZTA 1CAXA 3SCGA 1ZREA 3TNQA 1PMIA 5LRRA 2Q4SA 5T3NA 2K9ZA 2I45A 2GZWA 5JSPA 3QOPA 4KWLA 3RZZA 5C6CA 4AQ2A 4BHPA 5I8YA 3SHRA 5I8TA 3OD0A 1ZZCA 2EAAA 2O1QA 1QXRA 2BNOA 4UXAA 4XFIA 1VP6A 2XLGA 2ZKLA 4IEOA 2FMYA 4IEVA 3H1MA 5FCCA 1CAVA 3OCPA 3HT1A 2IXCA 4O9GA 3S7IA 4QGMA 3BU7A 3UKNA 5LEKA 4AVAA 3MYXA 2MNGA 3IBMA 1UD1A 1H1MA 4EWEA 3CF6E 4GULA 3H7YA 1O5LA 3LA7A 4KWKA 4E2QA 5K8SA 2V09A 3R6SA 4XFBA 4UBHA 3DV8A 1CAUB 1I5ZA 4JTNA 2OPKA 2XL9A 4QM8A 4HLTA 4MGIE 1EYBA 5BY5A 4HSLA 3E5XA 2FQPA 1PM7A 1UCXA 1Q3EA 1RUOA 4L11A 1FT9A 2XLAA 3OTFA 2BNMA 4PIYA 4BIFA 2UY8A 3PNAA 3U0ZA 2D5HA 2DCTA 3RYKA 4ORFA 2IXJA 2Q1ZB 4N9HA 1CGPA 4KWJA 4N9IA 4QM9A 3UKTA 3USSA 2HJIA 5BUVA 4D7TA 3E6BA 3NW4A 4FBFA 5I0TA 4E2GA 1RUNA 3EJKA 1IPJA 2WFPA 2XKOA 1O7FA 2QNKA 3FWEA 3QACA 4XEZA 3SCFA 4LEJA 1OI6A 2VECA 4DINB 5KHIA 3TNPB 2IXLA 1VR3A 3GYDA 3E6DA 4O9EA 4LUMA 4IEZA 2IXKA 4KL1A 3FHIB 3U11A 2Z69A 3ELNA 2CAVA 3E6CC 4PIZA 3RYRA 3FJSA 4XFGA 1J58A 1WLTA 1QXJA 4MGYE 4HMZA 1L3JA 5I8SA 4PJYA 2B8MA 4YRDA 4Q0UA 1H1IA 1SEFA 1YFYA 1OFNA 3CLPA 3RYPA 3NL1A 4F8AA 4XFAA 4IESA 1UIKA 4I01A 4I0AA 2Z2SB 2ET1A 2Y0OA 4Z07A 4EV0A 1GQHA 3H9AA 4HVOA 5LRSA 1U12A 3H3ZA 3ES1A 4YYOA 2VQAA 4LTAA 3BCWA 2UYBA 3I54A 5HI0A 5JCTA 1XRUA 3H7JA 1EPZA 2BNNA 2CGPA 2ZCWA 3N4MA 3U10A 2PHLA 3H50A 4QXKA 1X8EA 4IEWA 4HBNA 3EBRA 2Q30A 3EQEA 3HIFA 5AVPA 3PLQA 4I0BA 1SFNA 3H3UA 2PHDA 1FXZA 1Y9QA 1CAUA 1SQ4A 3WW2A 1WGPA 2GAUA 1VJ2A 3G7DA 3KSCA 3RDIA 4IEPA 1RL3A 4PIXA 4Q0SA 4XF9A 2BGCA 5J3UA 2B9UA 4XFCA 5KHKA 1CAWB 4B29A 1NE6A 3KGLA 3CL1A 4QGLA 1CAVB 2BEOA 3IDBB 5JR7B 2IXHA 1V70A 2P17A 4R8HA
chains in the Genus database with same CATH superfamily
3OR6C 1BBT1 3ETQA 1BMFG 2E7AA 3AG7A 4SBVA 1N33B 1QNYA 4CCCA 4CH5A 2FMDA 2JDUA 3OPZA 5J2TA 4YNIA 3K5LA 4J1XA 1RUC3 4GA9A 2OCHA 5L3DA 2QE3A 1CPYA 3I2IA 2ARBA 4XF3A 4XIOA 1JYIA 1JMUB 2B5UA 5LZ6A 2V72A 3LDBA 2RS13 4JYYA 1QHTA 2YIDA 1APNA 5JJEB 3O1RA 4N53B 3KZ4C 2VVFA 4M0NA 2JWPA 1QCEA 4JI1O 3CBNA 1BMV1 4I02A 1XPWA 2WNUB 2VRZA 4N90A 4Y4YA 1HRV1 4UXNA 1DU3D 4LF7B 2ZHNA 3OTOO 5DZGA 5LBCA 2CK3G 3H1WA 5LHGA 4HZFA 4MOAA 3UGHA 4CXYA 1X82A 3KD4A 4D6TH 1G7YA 1W9YA 3MZHA 1JUHA 1L0LH 2FB5A 5H6RA 1OD5A 3AYAA 3WDYA 2P37A 1SZTA 4I50B 4IE6A 5HV0A 1EAH3 4X6RB 3R4SA 3B00A 4BB3A 4TV9A 1ULCA 3ZFGB 2ZX2A 4ZI7B 4QJFB 3ZHRA 4J42A 1GKBA 2Q1MA 3OEEG 3A0RA 5JOXA 5LY1A 4JCKA 3EXUA 1HXS2 4N43C 3MIBA 2GUZA 3O14A 2X09A 5IK5A 1H9WA 4NXNO 1JOJA 2VNOA 4AVSA 1XYPA 1ODMA 3WU2Z 1R3IC 5EWSA 4YM0A 2E26A 4I2OA 3CMAV 2YDEA 5JCOC 3A2FA 3ZMTA 4NHXA 3V0BA 5EQUA 3T0DA 3J26N 2AGAA 3RSJA 1FPN3 4CU9A 3LD8A 4FM0A 2ZGTA 3VD4A 1UY1A 3UK9A 1OHHG 4LXLA 5LXTA 4CE8A 3HKBA 1QY4A 2ZOEB 4A42A 1K97A 4UCRA 4L92A 2C2AA 5A3NA 1K5MA 2GH8A 1ZBA2 3N2KA 2Z5WA 1KECA 4CXWA 4SLIA 2QDRA 4QX8A 5JMOA 3SKVA 2QA4V 5J37A 3TXSA 2IXIA 2R1BA 4AGGA 1SPPA 4QDQA 3CB2A 4KU8A 4LIVA 1COV2 4FZ1A 2A71A 4CEYC 5FLXN 1POV1 3CE2A 2PLV1 5CG8A 3SNMA 5FQ0A 3A8TA 3HNBM 5IK7A 5GLUA 1SLTA 4XUTA 5IATA 5DDJ3 2ZBJA 3AXDA 5IYCO 2W6JG 2Q67A 2PAEA 1ZLZA 4CP1A 1EM1A 4UW4A 1CX1A 3D0JA 1OSGA 4L0PA 2WZR3 4GX2A 1NUKA 4JI1B 2XJPA 2HEYF 2D44A 4LBKA 1V6JA 3LCPA 4ZS2A 1Q56A 5F3CA 2JX9A 1JYVA 1N3OA 4LF4O 5FXZA 3NR7A 5M0TA 1VARA 1QLNA 1GWKA 3LPGA 2JRIA 2YICA 4EZ4A 2WO3A 4QAWA 2RM23 4IEVA 3RZHA 1GKFA 1Y7BA 5DZEA 2D97A 4O9GA 1RUG2 2NN4A 3GBGA 3CCSV 1Y6XA 1UYXA 2BBAA 2F4LA 4KWKA 3VKNA 2V09A 2GHYA 3MF6A 3OW2U 4JI6B 2WJSA 2XL9A 4Y22B 1VBD3 3V65A 5EBWC 1RUJ3 1KBHA 1SLCA 1PO22 2YV8A 4CCJA 2QQUA 3U0ZA 4FLVA 4XCAA 1W0JG 4OX9B 3UKTA 1Y9MA 3M4FA 1HDJA 3X2QB 3CJIB 1AL23 4FQ4A 5GALA 4JI3B 2DWDC 2RDSA 4ASKA 4O9EA 2Z69A 2TEPA 5HCFA 5FZBA 2GDSA 3E6CC 4XDQA 4FTEA 1FV3A 3WF4A 3ZXKA 4JYBA 4CH3A 1UX6A 1WLCA 3RMYA 4F8AA 4BQ3A 1JYWA 3VBFB 4I01A 5JXJA 4CP0A 1K33A 3DKQA 5AFEA 5J1XA 4LNUB 5J2UA 3JB8A 3BCWA 5IY5B 1WJZA 1ZBA1 2N05A 4GX1A 4YJ3A 3RZKA 2JDMA 3H7JA 4O65A 2BNNA 3N4MA 2X5IA 1B35A 1OURA 2VMEA 4L99A 5EC1C 4YZ2A 3PLQA 4AR2A 5L3FA 3GCWA 4K3UA 3WF2A 1HV0A 4FXGB 1FAFA 5L3BA 1JJOA 2QM8A 3CYOA 4CEYB 1CAVB 4QPKA 2WLMA 4AQYB 1XE0A 4LPLA 3H3LA 2YHJA 4FPFA 1BHAA 1MOFA 1GV9A 1OOPB 3BAAA 1V9U1 2MEV1 5IHRA 1YQ2A 3R65A 3CDZB 3FN9A 5KHJA 1QLEC 2KB1A 1LNSA 4CS2A 4IV1B 5FYMA 4EWDA 3MW4A 4WFEA 3CRQA 3J9SA 3ABLC 1TME3 5FMCA 1ENSA 5JR2A 1DG6A 4KGQA 1AX1A 4OUEA 3H1HH 1GOGA 4IEXA 1W8ZA 4JI2B 3GBFA 3DYOA 4LF9O 1HN0A 5IYZB 1V9U3 4FFBA 2R063 1NY72 2E7QA 5F3IA 3T30A 4LFBO 1FNZA 1QOOA 4PI2A 1PIV1 4HK9A 4MS2A 4QNHB 3DF0A 1SZBA 2NN8A 4DV6O 2RDQA 4BQXA 1P49A 1P7BA 1KYOF 1BBT3 2BQPA 3CWBH 1JFFB 2NPIA 2JIGA 2D40A 1VPHA 2GMPA 4IEYA 2YXHA 4DXSA 3D82A 2E7TA 3R4DB 2BSKA 3ETDA 4DUZO 3IB3A 3M3QA 4ZXEA 3A22A 4AGRA 1HNWB 4G9SB 3WLUA 4CDXB 2RMU3 3DN7A 1J3RA 3ABMB 2VNVA 5CFCA 4ZU5A 2ZX4A 3PUIA 3LSQA 2VUCA 3N9MA 3CRMA 3JSLA 3CCMV 5KXCA 2XWJB 4O4IB 1HNXO 3KKYA 2PN5A 2DCJA 4XILA 3ZYJB 1MACA 4HK8A 1QIQA 1RUD2 3OGVA 1NLQA 1GBGA 2B5HA 2RM21 3S3XA 2GALA 3CZJA 1FXKA 2VUDA 4CCDA 1AYM1 3EXAA 2FMLA 1WCQA 3B5LB 4DO0A 4MH0E 4AHYA 4L8QA 4JI4O 2XHBA 1FFXB 5DM6V 4BWOA 4V1PA 4TYSA 3M3CA 3RYHA 2BTVC 3E35A 3HNYM 5FAXA 4CEWB 4GMP3 4UCSA 2VBBA 3S57A 4C0HA 4QHOA 5A7OA 3ACHA 2ITDC 2XJRA 2PAKA 3M99B 2JENA 3GZEA 1O59A 2J1UA 1G4YB 4WM8B 2XB6C 4HKWA 3KV5A 2JEMA 3T2QA 4NIAA 2K2SA 4HYOA 2W94A 3BCCH 3CEIA 3WP6A 4CS4A 5CYYA 2XAFA 2AHYA 1QH7A 4O2BB 2E76B 3KT1A 2LTNA 1GYKA 4C8DA 2XJSA 5KAIZ 1XDCA 3LWCA 2CV6A 1GZWA 4L8JA 1X9PA 4GMP1 4FJCC 2VW2A 1V6IA 1ULPA 3S7EA 1FKAO 3ES4A 4D6QA 5IT9N 1WD3A 1YTFB 4GLXA 4UW6A 1VQMV 2WA3A 1MS3A 4YIPA 4DYLA 4B3MO 3FHAA 5H2FZ 1NI8A 3VD5A 2BZDA 5LGUA 3L9DA 1M4WA 2JB8A 4RHV1 2O1QA 4GX0A 5DQ0A 3VKMA 2P1BA 5FCCA 5IYBO 4XUNA 4RQPA 1PO12 5A7WA 5EZYB 2WN2A 1KC8W 1SBDA 1Y76A 4GULA 1BS3A 3T0BA 4OI2A 3C7GA 4IL7A 5J98B 1GUIA 5FP7A 2VO5A 3KV4A 3VDDB 4FOQA 2ARHA 3FUOA 2RR11 1Q6UA 5C9AA 1X9TA 4O2AA 3AL5A 1MG1A 4B4RA 1COWG 3T1CA 4NPMA 4JC1A 4N9HA 1J84A 3PMEA 4BR6A 4ZHQB 5FZOB 4S2DA 1MSDA 4W4KA 3N9PA 3AMPA 4GKKO 2HWE3 4HAMA 2OVUA 3GYDA 3T09A 2UXCO 4LUMA 1UZWA 4M01A 3W7SA 2QSAA 2C24A 1NVPB 4BISA 1WLTA 5EXOA 1X4TA 2HWE1 2FHRA 3ZEDA 4JDNA 4C91A 4NIIA 4M3CE 2UXBB 4P9OA 5HV4A 1GK9A 1U12A 1VRBA 2XJVA 3I3EA 5CISA 4UFZA 4MG2A 1GU3A 5AVPA 3D3IA 1NR1A 1E1RG 1ENQA 4KBZA 5C8YB 3KSCA 2CDYA 3WINE 4COWA 2WWJA 2SLIA 2VZ1A 2P4EA 4B29A 5E89A 1DGSA 2UXDO 4NN0A 1I94O 1VBA1 1QDOA 2WNVA 3HAGA 4IGQA 2K9PA 4DFSA 2HWC3 1W04A 2IBZH 1GR3A 1AR4A 3ABUA 2VMDA 1AR92 3CXHF 3I3DA 1PO11 2A6VA 1DQ6A 4D0QA 5JSRA 1V55B 2EBOA 1XOYA 3IDCB 2ATFA 5LHHA 1QR8A 4GH4C 2H6BA 4JQTA 1LECA 2P5BA 5FLHA 1WPXA 3THDA 3JALA 4F6RA 3MIFA 2VR4A 4YVWA 4Q4V1 2UWBA 3OY8A 2Q5ZA 4DV3B 3L2HA 2PGGA 3HQRA 4E4ZA 1TG7A 3OPTA 1TME1 5FZLA 2M7WA 3DKWA 1W6PA 4JGYB 1YITV 1H9PA 5AFBA 2WLLB 1E5HA 2PYJA 3CCJV 1QR9A 3NRUA 4LH6A 4NRMA 2AHZA 5F5CA 4OLLA 4DUZB 1W3XA 5FK8A 4LFCB 2XVLA 2EULA 4TOIA 5IW0A 3VZNA 3RQ0A 1WA8A 1VAVA 1BEV2 2XR4A 3POWA 4P5YA 3F5WC 4RQEA 3AYEA 5LEJA 4LULA 1ENXA 3K04A 2J22A 1NCRA 2Q6AA 4QDSA 3B02A 3ON7A 4IGOA 5FY8A 3AKSA 2EINC 3ZMOA 4ISRA 4B3RB 5FZ9A 3VBRC 4U7NA 4A3ZA 1RUF2 4ZY9A 2H0BA 1ZYBA 3ZRVA 1D4M1 3K4ZA 1RUC1 2DYCA 1AI6A 3X2QC 1RYYA 4H7MA 3LB9A 5FZ8A 2E32A 4B3RO 4YZ4A 3CZUA 3V0AA 5KHHA 1RUI3 4LHSA 4O4IA 1Q8IA 2WLIA 1DQ5A 5FL7G 2XBO1 3KV6A 5T5JA 2W47A 1RXFA 3BKZA 2ZABA 1NA1A 4CZZA 4N53C 2G38A 2Y69B 4CDXA 2RMU1 5FMOS 2QQWA 1ONAA 2IW5A 4Y26A 1CD3G 2WNVB 4A6SA 1N3QA 1C1FA 4GB32 1HN1A 1J59A 2QVSB 3ROUA 1W6OA 5DPNA 1VQNV 1NZ6A 1YFUA 3JBG3 3SPJA 3ZR5A 1N34B 2TBVA 3ZN0A 1SQPH 1CP9A 3OSDA 4IIJB 2DBNA 5BMVA 4A2UA 4JAVA 4WFAV 3TBDA 3VDCA 1AX2A 5F1RA 4GKJB 1WMDA 4ZONA 3N2KB 2DVAA 1IQDC 3T0AA 4UFLA 1WP8A 1J3QA 2W6IG 1NCQA 4RR3A 4WVMB 3ZXGA 1UMZA 1AXYA 2ZT9B 2X05A 3T2OA 2HEVF 1ENVA 5L19A 2PF4E 3AK1A 4PHZA 5K1XA 1MVEA 3G4SV 5FFOC 4OUMA 2VUJA 5FV3A 4XW3A 1ST8A 5KR7A 1PGW2 2FDKA 5G05L 2NLJC 2A0LA 3G80A 5CZKA 4DR5B 4MGQA 3OR7C 3FC0A 3LGRA 4PA9A 1AJOA 1VBD1 5B3SC 2ZMLA 5JSPA 1WMXA 1ZA7A 1XSQA 3EMRA 1TMF1 4CS3A 4JI3O 1T6GC 1QQP2 5L7OA 5T5LA 3WFVA 4P08A 2Y6HA 5C5UA 4FPPA 2LRPA 3IBMA 3AP9A 2VM9A 2FDHA 3O7OA 1I3HA 3WDVA 2WFF1 1YRZA 4JTAB 4DZGA 1FPOA 5IFPA 1PGL1 1BZWA 4FOYA 5ITZA 3OEAA 2R7EB 1KGYA 1RHI3 4ARXA 2AZ2A 2X5IB 1Q3EA 5FYZA 2BNMA 2FTKA 1BVP1 1SBEA 1PX4A 5IAXA 1CGPA 5BUVA 2AACA 2WT2A 3LIHA 5E8AA 4PA6A 1HXS3 4JZRA 4MADA 5B66Z 3VBSC 4YGDA 3I3QA 1FX5A 1N32B 3VD3A 1FMD3 2DVFA 3BUCA 1N1YA 2J42A 3C8XA 1RFYA 1MS1A 5I8SA 4TSFG 4YRDA 3CLPA 3NL1A 3ZHSA 1WW5A 1UIKA 4Z07A 4GXLA 4JV5O 4MGTA 3PN1A 1HKDA 1RJ8A 5JUVA 1R1A3 3VDAA 4EQVA 3GJAA 4X9QA 1S76D 1NA1C 3SYQA 3H50A 3A4UA 3J8F3 3ZYFA 3TEWA 4TLGA 1RUJ1 3K75B 4Y22A 1I9RA 2PHDA 1ASJ3 4JGZC 4LHKA 2P06A 3MUY1 5D8AB 1W6QA 1DQ4A 4HG6B 1QJX1 2BGCA 1VAMA 4BMEA 2WNUC 4XFCA 2QQKA 3WQ0A 2DFCA 1RM1B 1XNQB 5AC93 3MO4A 3E22B 4CDQC 4M4RA 3K3WA 1AR81 4AILC 1TAEA 4BIZA 1QKQA 1G9AA 4I0XA 4UV9A 3WXPA 4Q1RA 3A0KA 4RUEA 2XONA 4EROA 2VTXJ 1K4CC 5DDJ2 3DPRA 2BGPA 3W21A 4QMAA 1NZCA 3FLPA 1W03A 3F2ZA 2XMLA 4XMIA 4J80A 4ZBMA 1Q86W 2VOKA 5IVEA 1WCDJ 1K8AW 3BI3A 3DYPA 3O12A 4LOTA 1UU6A 2GC2A 4EFEA 2D6NA 2RS51 1ZZ7A 1KP3A 3I2KA 3E2EA 4NOTA 3KMHA 2IH3C 2IJKA 2BDRA 2VTXA 5C8CC 2X29A 3ST7A 3BOPA 4RQFA 4XF0A 4OGQB 3AXEA 2ZINA 3IPVB 5LB6A 2WZ8A 1CIYA 4QPYA 2BSKB 1LOCA 1ZRFA 1V55C 2IJJA 4RHV3 1TMF2 3ZYRA 2OCCB 4Q8LA 1H8TA 4J7ZA 4OHWA 1FJGB 1VBD2 2EVXA 1NS1A 1NJIW 5LXTB 2UUCB 1LU1A 4AHXA 4QPGA 5GLWA 5IVBA 3L72H 2ETEA 2QKDA 4ISQA 3FAVA 1R082 3G71V 2E5LB 1N34O 3DEMA 4I3PA 1XSRA 4KHPO 5FYSA 4CC6A 3UYJA 4OQ8A 4OFGA 4YARA 2D2CB 2C6SA 4K7JA 2PHUA 2ZDIC 3BB6A 3CCEV 3T08A 2JKBA 5KXEA 5BNNA 4IUGA 5TSWA 4B1LA 3OGRA 4K8RB 4Q0VA 3VBUA 1RTVA 3ZFGA 4QQHA 1SA0A 1IS3A 4Z2WA 1OOPA 4YZ3A 4E4EA 4QPGB 4JF3A 4D3WA 2YC2A 3VHRA 3PTRB 5FPVA 5FY1A 1RVF2 4Y33A 1GANA 3UV9A 1C4RA 1FYUA 4GAZA 4IXLA 2JE7A 4ZS3A 1ZZ6A 2QJVA 4XJUA 2SBAA 1H6YA 5BMVB 4X66O 5EFUA 1CONA 1ZBE1 4HNAB 1XMOO 4HFSA 5JOZA 3BTAA 4YFWA 3ILRA 3K03A 4CTEA 2PXJA 4LCUC 1OHFA 2A9HA 2VS0A 3WDUA 1LOAA 3O0XA 4YJ3B 3THPA 3W5MA 2BERA 4N53A 3AB0A 1PL4A 4NHMA 3N35A 1JYNA 1Z2GA 4MVZA 4L87A 1AYN1 4FVVA 1G9DA 4PDMA 1M5IA 1S0VA 3CPWU 3K51A 3BIEA 2GV9A 1S77D 4JQRA 1YVWA 4GB31 5F3GA 4LF6B 1GO3F 2F93B 5KXDA 2A73B 1Z7S2 3OBRA 3JATB 4DY5A 1US3A 5K0UB 2E5LO 1R1A1 4B7KA 3NXSA 1RMU2 4DR3O 4BHPA 2ZZQA 3VQVA 2R062 1UQXA 2EAAA 5BNOB 2XQRA 1PVXA 5LP6A 1SRYA 3B3QE 4O4LA 3N2GA 1TA8A 5LEKA 3DCQA 1IPSA 3K77A 2ZKNA 1E5RA 1NX9A 4K1YA 2YXYA 4E9KA 5D8AA 1TVKB 2R061 4URTA 5KMGA 1BBT2 1NCRC 3B40A 5EJ3A 1L1FA 2VVEA 2HHHO 2P6HA 1OCZC 5L36A 3K57A 4CSWA 2XVKA 2EXJA 3VKLA 2Y64A 4YPJA 2UY8A 3OBZA 2D5HA 2DCTA 3JBG1 1XYOA 1X50A 5LA1A 3HMYA 2WLLA 4AF9A 2J1SA 1N3PA 2F43G 3SDLA 5I0TA 4QIWF 3D36C 1V6NA 4NYKA 3WNMA 3CSXA 1KDMA 2YB7A 1AR91 1O7FA 3FWEA 5JDBA 1REFA 1AUYA 1TNRA 4D69A 3LF7A 2ENRA 4MGYE 2X10A 1VQ5V 5C7GA 1PIV3 5LCWL 1HR0B 4IESA 1VQOV 2Z2SB 2ET1A 2YPDA 3WF0A 2UUAB 4YYOA 2VGDA 1EPZA 5BNNC 2WIIB 1YJ9V 2DDUA 2JECA 4O4HA 4NHKA 1WGPA 1AYM3 3LEMA 3DC5A 4GUNA 4PIXA 3RYIB 4XF9A 4LBEC 2HFEC 1KFUL 4D6SA 4TXWA 3RI9A 4GKJO 4U36A 4Q8KA 2V4AA 2QDOA 3FBMA 5HCBA 5J36A 3CL1A 1RHI1 2RDCA 4C0BA 5ITZB 3KVAA 4DV2O 3SEPA 4WBBA 3JQXA 3E89A 1JZ7A 5C4WA 4FLTA 1YNAA 5FYVA 3UKVA 1AP5A 5C93A 4XJ9A 2VC9A 3UKMA 4OHYA 2MHFA 2R49A 1IQAA 1JPXA 4PDLA 3H1IH 4J1WA 4PI0A 4NIDA 3SMHA 4D7SA 2NLRA 2RVAA 5B4NA 3QG5A 3I3MA 2ATKC 3S5QA 2IJHA 1UYPA 4CYDA 3AEIA 1U5XA 2RR12 2E53A 3MD0A 3VKFC 5CADA 2RHPA 1AYN3 1IBMB 2JDZA 3WG4A 4X8AA 3BIWE 2EXIA 1PO13 2YGMA 3N27A 3U78A 3BABA 4EN9B 1VBB1 5LGTA 4WVMA 4E8DA 2CWMA 4YW5A 5LP6C 1XNAA 1CIWA 2P22C 2OZ6A 4JHZA 1V0AA 3DC6A 1SMVA 2YIBA 3ZJZA 2VXRA 3BRCA 3UT5B 1H2GA 1EV12 3WCSA 1AJQA 3O1UA 3ASOB 3IPVA 5J9PC 2W52A 4QPIB 1N8RW 1OMIA 1QJY3 1R6TA 1V6MA 5EZYA 4YG6A 4RQPB 1OQEA 2JGDB 1UW8A 3HR9A 3PUAA 5K1PA 3NAPA 5EIYB 1JZ8A 3W7WA 1AHSA 2FDJA 2WLNA 3WQ1A 1VRH2 1ZA4A 1UAIA 4Q1PA 2VQFO 2X5IC 5D1IA 1H8TC 1IOAA 2A6ZA 4XIKA 5ACA3 1LB2A 1RUI1 3L75H 3Q4HB 4JGZA 2IUWA 1DGRN 2AREA 4TQDA 3PUQA 2LFSA 4LQRA 4K6BA 2D43A 3ZSLA 1LCLA 1SACA 1FJGO 3N7MA 4WVZA 3WB1A 4P2ZA 2R042 3JARB 4C90A 4QX7A 2H3OA 4JRLA 3I8TA 2H94A 4MVQA 2XGXA 1NXMA 3CJIC 3WX5A 5FWEA 2YC0A 3POFA 3QBQA 5FUNA 1RSOA 3H1KH 4Y1UA 2QTWB 2Z4FA 3LQCA 1W0OA 1NLSA 3JYCA 4R9BA 3H8OA 1JBCA 1NT0A 4YVSA 3L73H 1WA6X 3OY8B 1QJU2 4K0KO 1RPOA 4QWNA 3KQRA 1DCSA 3LEGA 4E4DX 1EN5A 1BZKA 4Y3OA 1DGWA 3OJBA 1N33O 3VDBA 3CKHA 2Q7EA 2HWF1 5FZDA 4BJ0A 1YUDA 4LFBB 1K45A 3MIGA 3JASA 4O61A 1B04A 3BY6A 3CCRV 4CBCA 4IT5A 3SCGA 2TNFA 5ANNA 1IBKO 1ULGA 4A3XA 4KWLA 5FYUA 1IBMO 2W2IA 2KG7A 2BVBA 1AR62 1FOD3 2FMYA 1SDWA 3SYPA 3HT1A 3SPCA 3BU7A 2OKXA 2JEXA 4OZXA 2WLPA 4QPIA 4J9ZB 3C3TA 3FLTA 4Y1YA 2ZGOA 1BEV3 4MGIE 1W0KG 3L2YA 3H1JH 1VP7A 4XVHA 1W2UA 2BVVA 2XASA 3O9OA 3OTFA 4KG8A 3VD7A 1N1VA 3APOA 1N1TA 3MV11 3AFGA 1PMHX 2RG4A 4MTOA 2LM3A 5F5AA 4MVUA 3SEEA 2HJIA 2ZDIA 4FK5C 3J7MA 1YTFD 1V54C 3ZCCA 2A70A 4AQTA 1QNWA 2ZKOA 1A3KA 2DVBA 4LK6A 1ULOA 5L7OC 4JZGA 2ADPA 1MMMA 5A1LA 4Z92B 5CFCC 1R6NA 5E6HA 1QXJA 1HB4A 4X20A 1DTOA 2YS8A 1MS5A 4NTXA 4M00A 3H3ZA 4CCLA 4QB2A 2IWGB 2QWNB 1LUVA 3LDKA 4FLZA 1KP2A 1I94B 3PIJA 1Z5VA 4GCZA 2VUAA 2VTFA 4CPBD 4GB33 2R071 3RYFA 4XHBA 3LE0A 2R9AA 1O91A 1Y76B 5JMCA 2DU0A 1W6OB 1EBOA 1NQDA 3RVYA 3JD2A 4LBQD 4A41A 4O2AB 2NZ9A 1J83A 2G1MA 2Y4UA 4YW1A 1GZTA 4DR5O 1F15A 3HWJA 1ZL8B 4PDWB 4EN7B 3ZPOA 3I3BA 3MICA 5HPOA 2XAJA 2WSUA 1ZTEA 4UVCA 1K5JA 4JI6O 2QKCA 3QH7A 2B9ZA 1YFWA 5EIBC 4Y20B 2DWRA 4QX1A 3X29B 5IT6A 4B3TO 4P30A 2GMMA 3NVCA 4UBGA 1HWYA 3VBFA 5GLTA 4JZ2A 5LGNA 1MABG 3GJBA 3WW3A 5JH7A 1OCCB 1OFSA 4U3JA 3W9AA 3ZLIA 3KCYA 1N36B 1LAJA 3ZO0B 4XJ8A 1G6UA 2PHWA 4MHUA 1LOEA 2AEYA 1QQP3 3AFKA 3O1VA 3KCCA 1OCZB 2IFRA 3IMNA 2EIMC 3OBAA 4FPYA 5CA1A 1EY2A 1Y9GA 5C33A 1IX9A 1XNRB 1BGYH 5A3WA 3ZRXA 1VF5B 2Y0IA 2N7GA 3QTCA 1PM4A 1XEQA 1HRV3 4Q2FA 4IETA 3ZXEA 2Q0OC 1S72V 4TT3G 4MYEA 2Z0AA 5IY5C 1XBFA 2PFWA 3AG3C 3TEYA 4OPHA 4XFHA 3SYOA 3T1LA 4XMAA 5FREA 5HFLA 4FAHA 3D8CA 5GZCA 2ADQB 2ET7A 1UWWA 5KMGB 2BFUL 4INDA 2C0ZA 3N9QA 2ZZJA 4B4PA 4WFGA 4M3CB 3NJYA 1H2NA 1OQ1A 1BE3H 4Y5SA 3N2GB 4U7OA 2JDNA 5DN6G 4XDJA 4L2NA 1SFPA 1YHFA 1H0BA 3TAYA 5FY9A 3O1OA 5JPNB 4JAAA 2WWSA 4UCOA 2Y6GA 4XUPA 5IJRA 4ZZ8A 4NXMO 2JK5C 2FL4A 1NQTA 4EN0A 1COV1 2FCUA 3WVJA 1NBMG 2RS32 3ZSKA 2DF7A 2ZX0A 4JI5B 2Q8DA 1S5LZ 5K7PA 3MIDA 4RGGA 1AI4A 4V2VA 3P3NA 1RIRA 1ZL8A 4PDWA 1L7LA 1W8NA 4DV7B 3J8F2 3NAPB 1KKCA 2XWBB 3RZGA 2WT1A 1JFFA 4LFCO 5FQ0B 4BDVB 2ZEZA 1W2NA 1VBC2 2B39A 5JXGA 3E1F1 2CH7A 4OCTA 3M8LA 5CFDC 2YBSA 1B35C 5FTTC 2WAMA 2D6KA 1BCXA 4AAXA 1R3LC 5FJHA 3KT4A 4AQYO 4NWVA 4J7JA 4HOOA 2WS92 4HANA 3ZSEA 4KHPB 1XI1A 3M3OA 2PLV2 4XJAA 2ZM6O 5JPMB 5IVVA 3NNMA 4I5SA 5IYZA 1BK0A 2GNTA 1S2EA 4YGEA 3THTA 1VMFA 3MDSA 2AC1A 4Q0PA 4PJ0Z 2XAQA 2HWD1 4CRQA 2WDBA 2UXXA 5IYYA 1IKPA 4E2SA 1LGCA 4XQ4A 4X20B 2GTSA 2RJKA 2R9RB 3ACLA 5LY2A 1ZZ8A 3LKJA 3PJSK 2PI4A 4PDVA 5KX5A 4XPVA 1PX3A 1CZTA 2UWAA 3MGUA 4FXKB 1BCCH 1UU5A 1DZTA 3POJA 1YIJV 4ITCA 1GZ9A 4I30A 4OMCA 1AB3A 5I8TA 2FKXA 4XFIA 2DCYA 2R1DA 2FCTA 4F4LA 5LK7B 4DV0O 2XJTA 3CF6E 1OT5A 3H7YA 3CS5A 2YI9A 3BN6A 4RHV2 1TMF3 2BTQA 4MGSA 2R32A 1I5ZA 2Y6KA 4IDZA 1VQ8V 1UZVA 2VCMA 3HNMA 1S0DA 1EYBA 1BMV2 4DNYA 4NR1A 3G67A 3UNPA 3NQHA 2JS5A 3ZMVA 3C90A 1C8NA 4QU1A 1WW4A 1M4UA 5FZ7A 2WQ4A 4UB6Z 1VQKV 2VNRA 1JQ0A 3ZRSA 4AEDA 3SPGA 3OYWB 1IPJA 3LFMA 2AYHA 4R8CA 2DYRC 2P4KA 1XQNA 4BA6A 5IWAB 3M7AA 4PIZA 2IH1C 1LJ7A 5DG1A 3ZFGC 3T2MA 2EINB 3JU9A 2WSSG 4LF4B 5C3SA 5LBQA 5FZKA 1F8VA 2H8PC 1W2BU 4XFAA 1OC1A 1MS8A 4MXWA 1RP3B 2ZTNA 3VHOA 1FPN2 1SLAA 2RDNA 5CKMA 1PZ9A 4JTCB 2CGPA 1G9BA 4LP8A 4ASUG 5J2TB 4MLOA 4WM8A 2Q73A 1DP0A 4WM7A 1J95A 4UFIA 3HKCA 1LHUA 3RJRA 2EIJC 4DK1A 2FCVA 3ZVXA 4CP9B 1NE6A 3ZXDA 3AZWA 4JKLA 3WB0A 5A3UA 1HLCA 1QJFA 2HWB1 1QWRA 4AYUA 3S30A 5FUIA 2MK3A 3SJQC 4AHWA 1GMGA 1OUXA 1HP8A 1GM7A 3IJ4A 4LOSA 4O4LB 1OKQA 5LP6B 3LA2A 5IJ9A 2WYSA 3OUIA 1EN6A 4TN7A 3RN4A 2HKXA 2ZXQA 2XOMA 2PELA 3C7FA 5CIRA 2HWD3 1BQ0A 3IAQA 1G86A 3WV6A 3AKTA 5F2WA 2P34A 1RMU3 2GNBA 1HIXA 2LGWA 3NKTA 2EXKA 3M70A 2ZPXA 3VBSB 2RM22 4KUMA 2PI5A 2UU8A 2VQ0A 1ZZBA 2JB4A 2GC0A 2XHNA 5JQGA 1BSMA 1SQFA 1F4HA 3MPBA 5LATA 4KP4A 1G8MA 4IHJA 2CGNA 5L3EA 3AK3A 4DEVA 3VHNA 4LR4A 4N43A 1W8TA 1AXKA 4LA3A 4AWDA 1PO23 4WCEV 1W6NB 4JI8O 5DN2A 1Y74A 2WZR1 4HETA 3FYEB 4RA0A 4I09A 5DAVA 2YBPA 1KB9F 2OTLV 4ZPIA 1TZOA 3WW1A 3OUHA 4QQOA 3EHKA 2KXLA 4XABA 1P4RA 1AJKA 3B2EE 3AZYA 1D2QA 2F1MA 3O1TA 3VBOC 2OX0A 1VMJA 2B7YA 4FM2A 1NAEA 4AEDC 3AG3B 4UW5A 4LR3A 3CXCU 1U5IA 3UL2A 4QQLA 4W50A 5D5QA 3JAKB 2UYAA 3IMMA 3BTXA 1THZA 1PIV2 2Q68A 5CB4B 2CSGA 5A70A 3ICXA 3OOXA 4LF5B 4JKKA 2PHXA 3T4HB 3CRRA 3H42B 3UETA 4XE9A 1RC6A 3AVSA 2WA4A 3DXUA 1WB7A 1WBFA 5GZGA 4X62B 2PA7A 2ZQMA 3FX7A 3MFAA 4JYAO 4CEYA 4HSJA 4JHTA 2E74B 1YFXA 4LF8O 2VMGA 3FZ3A 5LA0A 4GALA 4NJ4A 5FZMA 3FAVB 1WB8A 2HJFC 4M0HA 4GH4B 2Y26A 1K5MC 1Q8VA 4QU2A 4JI2O 2VPVA 1MZEA 4HVQA 2D93A 3E5QA 3QNEA 3RZLA 3U75A 1QEXA 3D5OA 4BE3A 5SV5A 2NP0A 1WUVA 2ZA9A 2CU5A 2JG8A 2GBOA 1W39A 2RS11 5FZCA 2CDOA 3K5MA 4AI1A 5DAWA 3FB8C 4XJZA 4UYBA 2WPDG 1LOBA 3TNQA 1O8SA 2RR13 1ND2A 2YXSA 5I8YA 4BQWA 2DUQA 2OQ7A 3ASNC 5DMYA 1DZQA 3K59A 4HONA 4IEOA 4R4XA 3MUZ1 2A7AA 5CA6A 2WKKA 4I3GA 2BJSA 1VBE1 3C7EA 3VBRB 1WMFA 1XNKA 4MVRA 5FPAA 5JI9A 2X53S 3VQXA 1QMJA 4RO2A 3R6SA 3KZIZ 1KMIZ 3K08A 1GN2A 4GT1A 4FPCA 2OQ6A 1YDXA 2R041 3ZYGA 5DABA 3GGLA 1KU9A 1PM7A 1UCXA 2JIJA 1YQCA 2P3KA 4PIYA 3JCZA 1XC6A 3NAPC 3ZOIA 4AFMA 5GTHZ 2FDFA 2QWRB 4X1YA 1I5PA 1WW6A 4WM7B 3GDBA 2Q69A 3JATA 3GVMA 4LF8B 1VRH1 2KA3A 4FPKA 3ZIWA 4OYUA 4XXAA 4XYXA 3ELNA 3AX4A 3WSOA 2EJRA 5E88A 3D6EA 3P3PA 1OH3A 1RUD3 1AR72 1OFNA 5BYNA 3QH6A 1YQ5A 3BOWA 2DMXA 2VQEB 5EK0A 3CJHB 4MO3M 3ABLB 1H6XA 1ROPA 4K8ZA 4I0WB 3VB9A 4LE4A 4QXKA 4MVMA 4J25A 4HBNA 4X1IA 4O4JA 1QJEA 4P5HA 4UFJA 3G7DA 4N7IA 2DU1A 4Q0SA 2ADEA 2UXCB 1GAXA 2LQTA 4DPNA 4LBJA 2VCBA 3KF3A 2P90A 4WF9V 1K5MB 2BEOA 2CTRA 3ZYHA 5LOVB 4A44A 2BE3A 2P17A 4QPWA 3SJCC 4BW9A 4Q20A 4WVWA 4QE7A 1O4ZA 5DG2A 1YI2V 1NKGA 3WY6A 3NV2A 2VULA 1BT8A 4FP2A 4P9GA 3VBUB 1JCHA 2UWCA 3ZYIB 4KWUA 4ZXKA 3JD1A 2NYYA 5L9RA 5A3OA 4XF1A 2OWOA 3ZX7A 3GWOA 1IHMA 1S55A 2YXLA 1NOVA 1VB2A 1Q6HA 1WN7A 4BQ4A 3A0NA 4PQ9A 3EHBB 2O8QA 1LHOA 2A1XA 1AR63 4MT8A 1D4VB 2LO1A 4B3MB 3SJBC 4TV9B 1K3EA 5AC91 1DLBA 2ZGLA 4MZUA 4TLFA 4XDOA 4MUVA 4FPOB 3VBHC 2ZE5A 1AILA 2H0VA 1WAZA 4R9DA 4JV4A 5I0DA 5LMUO 1VALA 3VZLA 2JD9A 4TWKA 4PT6A 3H0OA 4YY3O 5H9PA 1QXPA 3ZFFA 4ZU4A 2VQUA 3ETPA 4GD4A 1WNSA 3AK2A 4M4PA 5ACA1 3M3IA 2XAHA 3QD6A 4DRXB 4IEQA 1PV0A 1HW5A 4DR1B 1UN1A 5JCOA 3WHUA 5ERLA 4LBOA 4XC9A 4EYUA 1LUWA 1B6QA 1D5AA 2JGUA 1SBFA 1MS4A 3VZKA 1UO9A 5IVCA 3IN9A 4IEUA 4CCEA 2D7FA 1UXZA 4ZZ5A 1UPIA 5FXWA 2B46X 3A0HZ 2I74A 4YW3A 3W5NA 4COUA 4OMDA 1WD4A 2O57A 1N0NA 4B8EA 5A32B 2ZEWA 4NHYA 4JYAB 1Y3TA 5JOWA 3ETEA 2WLIB 2RNBA 1GTOA 1BK1A 3HN3A 4WV8A 4I0XB 1IBLB 3ME2A 1RUE3 2YG0A 2ARCA 2EIMB 1V6KA 2CTVA 2Q0AA 3PVNA 4BQ1A 2D3PA 2K0GA 1D0HA 3B77A 1CWPA 4META 2V1DA 1ZRRA 1UOGA 1NCRB 3WDTA 1QNMA 4H3WA 2BUKA 2AGSA 5T5OA 2LW1A 3ZMNA 5D21A 4BU2A 3OM3B 2Y33A 3QO8A 1YJKA 3BFRA 4YLZA 2KSDA 2E63A 1QF3A 3ZMUA 3VBFC 1AR93 4UF0A 2AW9A 1IBLO 2HYXA 4QX5A 1TQ5A 2CGOA 4G2KA 4UAPA 1AR61 3DGEA 5FYYA 3NKGA 3VKOA 1AI5A 1QU7A 5A33B 3TJTA 1E5IA 1JH5A 5CNAA 4KNCA 3V56A 3SPHA 4B3TB 3ECQA 3IM0A 3ABMC 4NKGB 4QPIC 5GZDA 2RJZA 2EIBA 2ARAA 4AI9A 2Z79A 4FI9A 2W1SA 1Y67A 1PHMA 2ZHKA 1W06A 3O5SA 3A7QA 5IJ0A 3B9CA 3AP6A 5FNVB 2QR4A 3S7IA 1KD1W 2GTAA 4BW5A 3E83A 1FNYA 4P9JA 1UD1A 1QJU1 4EWEA 3BTYA 3LA7A 2Q5TA 5FPLA 3N36A 5C3OA 2VCCA 2GNMA 5DUXA 4ET7A 4FFFA 1CAUB 2HWB2 1PPJH 4JTNA 2OPKA 1HJFA 3WB2A 4G27B 4HSLA 1RUOA 1SQVH 3AMNA 5FYTA 4HZ3A 3RYKA 1ND3A 4Q6GA 1X33A 1NVPD 5D8AC 4QM9A 5ABJC 1VIWB 3OBTA 5HXMA 3UGFA 2CUGA 4PF5A 4UUJC 1YHQV 3OE7G 2R70A 1S5JA 1AZDA 4QQ2A 1OI6A 4NWWA 5A1AA 4FFBB 3FLRA 4KL1A 1RUI2 1NH2D 2EILC 4Q4X2 4QPJA 1CR7A 4EEQA 4BLIA 4NB5A 4YZ1A 2RS33 1AL0G 3UJQA 4AGVA 1CEZA 3CCLV 2XG3A 1EUUA 2VQAA 4B3SB 5HI0A 4UFHA 1W99A 4FPEA 4KMQA 4LWSB 3T4VA 2LALA 1QLEB 1GP4A 2VZQA 1ACCA 3EQEA 3R05A 2WUHA 3HIFA 3PDQA 3ZN4A 1TUBA 4CEWC 1AVBA 4ZKIA 3LFIA 1IS5A 3TB0A 4K9SA 4IV1C 1VBE3 3IC7A 4MVOA 3ZIXA 2VD7A 3CD6V 4Q4Y1 3IKWA 1JR9A 5JR7B 5IWAO 4PA3A 4FPJA 4Q4X1 2Y6JA 5FOBB 3ZHQA 3VDDA 2PLV3 2BU9A 2RJ2A 1ZRCA 4CCNA 4MVSA 2HWC1 4EZHA 1VBB2 5CFDB 3I49A 2B1GA 3CRCA 1LOFA 4UOJA 3F7YC 3HR0A 4CDUA 4J11A 3OMAB 1S2KA 2GDFA 1AR5A 1U5YA 4DW1A 4M3CF 5JVVA 3BODA 3V0AB 2KKWA 3C7OA 3BVCA 4WFBV 5LMNB 3OT7A 4LKSA 2ARXA 4A7YA 2CHHA 5B1BC 3MI8A 1W9TA 5FY7A 4P9LA 4JI8B 3O0VA 3T2TA 4BOWA 1AR82 2ZX3A 4QX3A 1A34A 4UFMA 3ZHVA 3PU3A 3MIEA 3KLSA 1RB8G 5K4LA 5C4WC 4X64O 1K73W 2CH7B 1O9HA 2R30A 3I97A 3FX3A 3THOA 2R073 1F4AA 4B3NA 2DUOA 3VL8A 3TEXA 1RHI2 4XFFA 4IYIA 4IW3A 4N7UA 2QTSA 2X6CA 1HB1A 2Q7GA 1HJGA 1JMKC 5K0UC 1FXHA 3RPQA 1ZRDA 4LFAB 1DLCA 2VQTA 4JGYA 2GP5A 1RINA 4LLFA 3OG2A 5L73A 3P30A 1C57A 3SITA 1F4MA 2PHFA 5T52A 1W9WA 2YU2A 3RG0A 2VQFB 1FFXA 3ORJA 3WP3A 4I55B 1BJQA 5LHIA 1F5FA 3T1YB 1OCRB 3O65A 1UPGA 3P1IA 2O8OA 1PNMA 5FYBA 1DIWA 3E86A 4WM8C 5EJZB 4QB6A 2P5OA 4QT6A 4ATFA 1R1A2 4LHNA 1OZ0A 3MLJA 1N4CA 4FAGA 5G04L 1KEXA 1CX4A 1PGL2 1JOBA 3T4ZA 2R9IA 3PVBB 1FXKC 2JIZG 1OUSA 3NV3A 3RZJA 1LEMA 5FBZA 1GICA 4CUBA 4GQ7A 1Z5WA 5AC92 3MIHA 5E1RA 4Z2AA 2VAUA 1XILA 1R1ZA 1K92A 1DGRA 3ML0A 3PVEA 3J81N 3ZS8C 1NY71 4LH7A 4R52A 4UV8A 4JI4B 1WCKA 4X64B 1Q8OA 1KITA 3S5AA 2R0HA 2E3CA 4H55A 5EIBD 4R50A 1H8HG 1URXA 5J96B 2Q8EA 4BYYA 1W9SA 3U07A 1NKDA 5B3SB 3I2GA 3LAGA 3INAA 4XXPA 2GP3A 1RMU1 4QKNA 4YW4A 5FXVA 4QX0A 1ASJ1 2AXTZ 2QQLA 1UFIA 5KBFA 2HLDG 4FPGA 3ZHTA 2DYSB 4LO4B 2V7QG 4HXCA 3OTOB 2I45A 3ZXFA 1XQ8A 5FZOA 1HV1A 1XOUA 1XNRO 1UYYA 5A6XA 3QO5A 2Y6FA 4UI9L 5A3MA 4UFKA 3JD4A 2ETNA 1HNWO 3VHPA 3MW3A 2EAKA 2EF6A 4MHRA 1DFQA 1WLWA 1V54B 3N7JA 4KGGA 3K0GA 2QWOB 2IU0A 1SFYA 3OPWA 1OF4A 4DV0B 2AUYA 3I4IA 4DEQA 2ZE8A 2KQXA 3U1XA 5FO8B 2GSYA 1SZXA 1R083 2PHTA 2ZD9A 4Z1MG 2WQZC 3USSA 1JHNA 1AVMA 3E6BA 1SCRA 2FZ2A 4FBFA 4Y4RA 2VZVA 5JLVA 3FL7A 5T55A 3FUQA 1Q8PA 4EFBA 1A8DA 2CAVA 5D5PA 2ZXWB 2JDHA 3RYRA 3WG3A 1HRI3 5K9YA 3N9NA 2WABA 3OMNB 2A6YA 4DV5B 1L3JA 4R9AA 1W8UA 4Q0UA 5F9TA 1UU4A 2LGQA 1V6OA 4B7EA 1XU1A 3H9AA 4D8MA 4XJWA 3BPSA 5BNPA 2Q7HA 2DQ3A 1XRUA 3U10A 4IEWA 2W5FA 2Q30A 3F7VC 4TV8A 2Q9LA 5IVYA 1CAUA 3WF1A 4ZIBA 1GNYA 1UY4A 2GAUA 1S2BA 2LS6A 4IEPA 1W59A 5JVDB 5JJJB 3NV4A 2DCKA 1M90W 3AVRA 1W8FA 3CU7A 4HKLA 3MEPA 1AR1B 4CVUA 4TTGA 3USUA 2QM4A 3ABZA 1FYJA 3IDBB 1OA4A 3AMHA 3JCUZ 2G9ZA 4S2GA 4DR3B 2EA7A 2XQXA 3I56V 4LBQA 2QTOA 3H1LH 4LO7A 1FXKB 3B01A 4JYCA 4BQ2A 3D0SA 4ZU7A 2R72A 1IGOA 2WSVA 1W6MA 4LO8A 4FIPC 3J7AU 4NXMB 2OT5A 3NJZA 3K58A 2WAOA 3TN93 2XKPA 5GTIZ 2PHRA 3NWKA 3RW0A 1ND2C 1K7DA 5I91A 4Q5OA 3AK0A 4XDKA 5C3QA 1XU2A 1Z7S3 3NJVA 2XVGA 4ES9A 1NE4A 2OW4A 4LO5B 3AJYA 1LRHA 3CC4V 4NUBA 1CZSA 1GN4A 1WP7A 2QWPB 5H5NA 4DR4O 2YEVA 4IV3B 4NRQA 2DOSA 4Q29A 1HW7A 4LF5O 3P32A 1L7RA 3DL3A 4MTFA 3TXQA 1YWKA 2QEXV 3GZAA 1XMOB 2VW1A 3JCIA 2BOCC 2DV9A 4GKXA 1C8M2 1ZZ9A 1SCSA 3POIA 2YUAA 3H8XA 1ZNPA 2ZMKA 3QLQA 2XLFA 1ND3C 3VD9A 5LA6A 5JZGB 4J6GA 5BXXA 4EWAA 4MVTA 4AI0A 4DRRA 4DV2B 3FFZA 4AZZA 1OQDA 3NSTA 1D7PM 1JS9A 3K9SA 1NYWA 1QJX2 2BRTA 4H33A 1O4TA 2D6PA 4LKDA 3VBHB 3WUCA 5KLVH 5F5IA 3VBUC 2UY9A 4JPRA 5ABJA 4WVVA 2PAMA 2HVKC 2D5FA 2WFF2 2W08A 2EALA 3IWZA 3POYA 3G6EV 1J3PA 3N9OA 2VWJA 2RN9A 3ZSJA 4XAEA 4UWDA 2D6OX 2YFUA 4UCTA 1O5UA 5T5PA 3F5TA 3GCXA 4MV2A 1HX6A 4XCBA 5BY1A 2D3OW 4BIOA 1YJWV 4WM7C 4J9YB 3VN4A 4CUGA 1CXZB 1FXVA 1HNZB 5DXDA 3BU0A 2XT9A 5B5EZ 2GUZB 2O14A 2UUCO 1SESA 2L6LA 3ASIA 4K20A 3ZFEC 2ZAAA 4CU7A 4AXOA 1KRIA 1VQ4V 3DYMA 3AG1B 2VZUA 5FY5A 4MW3A 2DWEC 4XTPA 2Z42A 3JXSA 3ZDVA 2DVGA 2VMFA 1OCOB 3JZVA 5A7QA 2XUEA 2W3JA 3QCWA 3SH4A 4UCVA 2ZGNA 4Q26A 2HHHB 5GKAC 1OJHA 3LUTB 4ASLA 4RS5B 3VDDC 5CAZA 2CY6A 3J80N 1CPMA 5T54A 4CXXA 1MEC1 1WKYA 1UXXX 3EO6A 4YHHB 2YYOA 1DHKB 4LBLA 1PNKA 3H8UA 3J7HA 3HKEB 1CAXA 5C4WB 1NZIA 1E5SA 1SQQH 5DAXA 3CJIA 5C6CA 4AQ2A 2HBUA 3AMQA 5IJ9B 1QXRA 4K21A 3A21A 3W59A 2YZ4A 3KVBA 2W1QA 4QGMA 2P2KA 1I08A 3K9AA 3KB5A 1O5LA 1LR1A 4NHLA 2BOJA 3E8GA 2PQSA 1F35A 4LIUA 3JD0A 4QM8A 4DIQA 2ZJCA 4DR2B 4JDMA 1BL8A 3AP4A 1UKGA 3E22A 1EV13 4IHJB 3VZJA 1Q8QA 1F23A 2YU1A 1FAYA 1KKDA 1F9KA 4KWJA 4RFRB 3HKCB 1XNDA 5GONB 5JQGB 5H9QA 3K0DA 4D7TA 1W6QB 1QJY2 4WFFA 3SPIA 1LTEA 5F3EA 5FO7B 2Y69C 3HBZA 4FP3A 2XUMA 4FZ0A 1US2A 3SCFA 3ETGA 1PVC1 1C5IA 4WFHA 4CA9A 4IEZA 2IXKA 5B4XA 4XFGA 1J58A 4BK5A 4HMZA 2CNAA 2DQ0A 3IFXA 3K4DA 2C5DA 1MS9A 4XZPA 1I5XA 2PY5A 2LFRA 4YWAA 4EV0A 5C3PA 4RAIA 4LMFA 5ACA2 3MFCA 3MF9A 4LTAA 1Y4MA 1RM1C 2JDYA 1Q82W 1VQ7V 5DUWA 2WQ8A 1AF9A 3EBRA 3HD8B 4XBFA 2VMHA 4I0BA 1VEWA 2R043 5FP4A 2BP6A 2JE9A 3VQYA 1GFF2 3B8NA 1Z78A 3O0WA 2P6CA 4XHXA 4XUOA 5J3UA 2P3YA 3CX5F 5JXIA 4UW3A 1ZWIC 1YXWA 2FBEA 5BNOA 2IXHA 2OS2A 3LSUA 4CUAA 4AVTA 1FMD1 4OVEA 4DOUA 5FPZA 4QKDA 5JOYA 2B4KA 2PZSA 4FOWA 4TV8B 1X36A 1MVQA 3ZPYA 2X6AA 3AG2B 4Q4Y3 3V0BB 1IKQA 3M2MA 4X6QB 2RS53 2ZAHA 3WP5A 4FOVA 1M9NA 4NAOA 1XHXA 5CVRA 4XOGA 2W1WA 3Q8BA 5EHDA 4DMIA 1OCCC 5L7OB 4F7ZA 3FFQA 5JIAA 1XMQB 3IDAA 4AVBA 1QJZA 2EIEA 4JI7B 1K3IA 3AKRA 1US6A 5IAVA 1QU0A 3ALQA 3HVDA 1CPNA 1S3JA 4DV7O 1JYTA 2OZJA 3FD9A 5FZFA 5FJKA 3WNKA 3TRSB 2D6MA 3O1MA 3POBA 5J48A 5FZ6A 3ABKC 4FT8A 4I50A 1O9GA 4ATEA 1TGOA 1ZX3A 5C8CA 4C1XA 4Q4W2 1VBC1 1S0IA 1JU4A 4ZKTB 4XAAA 1W0PA 1ZBE2 2WRAA 3JD3A 4EN6B 2VZ3A 2OT7A 2ES3A 4OZOA 1GQGA 2EILB 1VQ6V 1IG3A 3AJZA 1SLBA 2JICA 2QCSB 5CB7A 1W3VA 1POV0 1EZVH 4A7KA 1OVPA 3DECA 3TGUH 1W9FA 5CKQA 1Q5OA 1OCRC 4D7YA 4MW8A 3LDRA 1NXD1 4GWMA 2WAAA 2WN3A 4YM3A 2FZ1A 2N04A 4Q4X3 3WP4A 1XNCA 5I0UA 1DF4A 2QBXA 2KM2A 5KX5B 5FYIA 3U14A 1DZRA 2Y4TA 3C3SA 3WDWA 2QQJA 2GNDA 3OGGA 2BYVE 4QKFA 4RFT0 4R7CA 5KUKA 5HXVA 5FUPA 1D4M3 1D2SA 3UESA 3DUIA 3PU8A 1MZFA 1Q8SA 1OVSA 5A3TA 4ZHNA 2NMOA 3WW4A 2A06H 1YJNV 3E8BA 2ORXA 5CBHA 3VGIA 4S2HA 4M3CA 2V5DA 4QGNA 4XETA 2HEPA 1SDDB 2A5ZA 4X8NA 1VBE2 2VG9A 2NQYA 1AR71 1L0NH 1M06G 2WO1A 2EIGA 3H1YA 5DDJ1 4N21A 4YG3A 1R73A 1JXNA 4XTMA 3ZYPA 2R6QA 1NLRA 4YGCA 2W92A 5B2GB 4WBNA 4COZA 2W39A 3VL9A 4A7ZA 5KUMA 3E8HA 2OIIA 1XE8A 5GM0A 3LOIA 4NTYA 5FK7A 2ZIOA 1VBB3 2ZX1A 1SS3A 4PQQA 1QQCA 4EE2A 1D5NA 2JG9A 3FE5A 1LKNA 4X1KA 3OUFA 4DV5O 2RS12 5CEHA 3RYCA 1Q81W 4TZDA 5T50A 1D0GA 4P9XA 1ZX5A 4EN8B 2ZM6B 3HJRA 3NO8A 5LRRA 3STZC 1DYKA 3JALB 3RZZA 4I4TA 5IK8A 2QKSA 3RFRA 1I1EA 3LDDA 3TETA 1BLZA 2VZRA 1PK6C 2ZKLA 2JJ1G 2WWWA 5H9CA 4R9CA 4LBNA 1GMMA 1IVSA 2UUBO 1GM9A 4CP9A 5EPAA 2MNGA 5C71A 2ZNJA 2CWSA 3WZ1A 3CC2V 5JVDA 3MBWA 1XNTA 4CH4A 5K8SA 5FIXA 4XFBA 3JSNA 1POV3 2GMEA 3BTZA 3OEBA 3CP1A 2R072 4HLTA 3D36A 4JGYC 2W87A 1KJLA 3R66A 4JI5O 1AL21 3KWVA 4BIFA 1W2OA 1OBNA 4DR7O 1UOJA 1GH6A 3KM5A 2IXJA 5B1AB 4L97A 4COYA 2VMCA 4N9IA 3ACGA 3KG2A 4AEJA 4YIOA 1QVGU 4BK4A 1WW7A 1JZ2A 2QUOA 3IC9A 1DQ0A 4GWJA 4XEZA 1LESA 5LWBA 1VR3A 3DSQA 1MQTA 1SLLA 2EIJB 1OCOC 1YIFA 1MZ5A 3Q8AA 5FP3A 2BGOA 2P67A 5JH7B 4PJYA 3OYWA 5FP9A 3TK1A 4AEDB 1YFYA 3RYPA 4P00B 1PM9A 3PUHA 3NNLA 3IT8A 4RS5A 1WLDA 1C1LA 3RVZA 5JXHA 3JAMN 2BOBC 2V73A 3LSSA 4Y1ZA 1VMHA 4P9IA 1YIPA 3LPFA 2PHLA 5EC2C 1PGW1 2WL1A 2BOIA 3H3UA 1IBKB 1Y9QA 1UNBA 4JV5B 2O0OA 1S5HC 4AI8A 3BHPA 1VBC3 1ZBA3 2I07B 5FZ0A 1AXZA 2OIGA 5IFTA 3RDIA 4KH9A 2BWCA 3IGAC 5H6QA 3K79A 1TNFA 2WNEA 2B9UA 2WNOA 1M93A 2ZEXA 1WMEA 1VF7A 4Y5TA 4QGLA 2WS93 2XBO3 1V70A 4RGAA 4PCRA 4BIUA 1REEA 3CRAA 1SC5B 4K0KB 1U96A 3JQWA 5EJ1B 4DUYB 2NNUA 1LOGA 3AP5A 1XBLA 1QBZA 1IZ3A 5IE9A 1DF5A 3WQBA 1O3QA 1Z0HA 4YZ5A 5BPXA 3ZMSA 1YXBA 3CNAA 5LBBA 1K5QA 2ZGQA 3JD71 3APBA 3LSDA 1BXHA 3ZKYA 2WZR2 4J41A 1HQWA 4OQ9A 3OGIB 1RJ7A 4LNVA 1SQBH 4QB1A 1NQJA 1IDSA 3CC7V 1SHWB 3RJ2X 4B4QA 1OKOA 1IXMA 4RYDA 3K4AA 3THCA 2QKAA 4WZFA 4H0LB 5E16A 4TWTA 4EB6B 4ASMB 4NO4A 3FBYA 1RUG3 2BPA2 4U3FH 3C2UA 5LK5A 2JD4A 3PHMA 2ZHLA 1ND3B 5FLJA 4HN0A 5LA6B 5JZGA 3L70H 1BQZA 4W65A 1OA2A 4E27A 5F7UA 1UZYA 4AFBA 1IS6A 4HPKB 4LO6B 4Q0QA 5FY0A 2A6XA 4PBOA 5FBJA 5BV6A 4XBNA 3HT2A 4A4AA 1QVFU 4W8JA 2E9QA 3ZN6A 2HWF2 2RCVA 4HL0A 4H14A 2F4PA 2YIBD 5L3GA 1M1KW 1NA1B 2W46A 2A7WA 5JI7A 1PO21 3BYWA 1AL22 1M57B 3WD5A 2Y38A 3KV9A 4YM1A 4AL9A 1YO8A 1GN3A 1GLHA 4F6RB 4I55A 3LZZA 4JRAA 1E57A 2A3QA 4X8PA 5LMNO 1K5SA 4IV3C 2ZGSA 4JI0B 1W6MB 1RUG1 4AE2A 4DS0A 4DB5A 4LF6O 3OGJA 4BLJA 4FPLA 4LBQB 5JAXA 1PL0A 2H6CA 3T3YA 1DYOA 3TWIA 1RXGA 1UL9A 4ARYA 3SH5A 1NTMH 1XNQO 2Q8CA 3ZHUA 4Q4V2 1LNQA 1WA8B 1KQSU 3WQ7A 5EP9A 3GHMA 4YVSB 2EX3A 1OPMA 2WNVC 3AYDA 4GKKB 1XHZA 1S0JA 1PNFA 2OYQA 4XF4A 3SISA 2FD8A 3I59A 5D2AA 2E33A 4EB6A 5CA1B 2GH2A 1LOFC 3UO2A 4MX3A 3C3VA 4ICGA 4HPKA 4I9QA 3ZFEB 1G9FA 2E51A 4BCUA 4JASA 4RD7A 2L35A 1JYCA 2D3RA 3Q4HA 4QHZA 2GC3A 2EIKC 4A6OA 3J7NA 1TME2 4HN1A 3LEIA 1N36O 4CCOA 1ZUQA 2P3IA 4Y20A 3T1MA 3GM8A 1YJLA 1UPSA 2M6YA 3CEWA 2HWD2 3RRDA 2RMKB 5EYPB 3WG2A 2QFEA 2GZWA 3QOPA 2ZE7A 1GSLA 4FM1A 3EVKA 1GWLA 1CJDA 3VQWA 4B08A 1VP6A 1HB2A 4QQPA 4IE0A 2ZXWC 1SERA 3DTUB 2JEUA 4N23A 5A6QA 4DRXA 5LW9A 2JE8A 3MYXA 1HB3A 1ZRIA 1H1MA 1HR0O 4PLOA 2DCZA 3WUDA 3ZR6A 1MNGA 1JZ6A 2W0FC 4CZSA 1SKVA 3UT5A 1PZ7A 3E5XA 3MLLA 3VUOA 1HXS1 1FT9A 1S0BA 2QGNA 4LWSA 5JZGC 2J1RA 4DV4B 3J8F1 2W1UA 3KS7A 5A7WB 3MHSC 2CTWA 3K48A 1Q6IA 3LSEA 3K5OA 4TQFA 1OXCA 3U4SA 2WFPA 4GZ9A 5C9AC 1W0NA 2QNKA 3UCSC 3C7HA 5KXBA 3QACA 1R091 3RWKX 5CBGA 5KHIA 2IXLA 3LEKA 5FP8A 4Q4W1 2VZTA 3AZVA 4RL7A 1JN2P 3U11A 2WFF3 5EYYA 3J7LA 4FQZA 4NRPA 1IG0A 3N7KA 4D94A 1OOPC 1QGLA 1H1IA 4ZOLB 3PL0A 2XPJA 1HQNA 4HVOA 4O2BA 1GQPA 1SETA 4YM2A 1ZAUA 4CH6A 5GZEA 5F37A 2UYBA 4P02B 5JCTA 4YJ2A 1YSCA 4YW6A 3VZMA 3CMGA 4CDQB 4AOCA 3ZFEA 2VY0A 2ZCWA 4FLUA 5LYJA 1SFNA 3EB7A 2Z3YA 1FATA 4IGGA 1R1BA 3KHCA 5F5QA 3W7UA 3B94A 1MQTC 2W0XA 3IAPA 2YPJA 3RYIA 3OGSA 3GF6A 1W28A 1FOD1 1JUIA 2X8KA 1O6UA 4LBMA 1K9MW 4HKOA 3JASB 4OXSA 4RWUA 3IAYA 2F4VB 3DXTA 3RGBA 5J09A 1QJY1 4PF1A 2EJ7A 2JG9B 4MSVA 3MAQA 4BH9A 3S0MA 2VBPA 4DUWA 5KC5A 1VMGA 2CE4A 2Z5UA 3HOBA 4UCUA 1N47A 2IVJA 4PA4A 3NV1A 2CYFA 3ZFFC 3OMIB 2PYLA 3ASOC 4PBPA 2XJQA 4J10A 4LA2A 4IL6Z 1F2NA 1D2DA 1EPWA 5CKNA 4IYHA 4KI5M 3EFFK 2VZOA 4OPAA 1AROP 2MEV3 1YI9A 1CESA 1H1AA 2UU9B 1LEDA 4BXFA 2EIDA 1EP0A 4URAA 1Q90D 5FMBA 1E1QG 4G28B 1R3JC 1GM8A 4NVPA 1R3KC 4NE9A 3ZSMA 2DYSC 1JU3A 1XYNA 1PK6A 2VZPA 5FYCA 5LMUB 3RYHB 1O8PA 1DGLA 4KQ7A 1PVC2 4GWNA 4IGPA 1V9PA 2UUAO 4XQDA 2ORZA 5DECA 3GB7C 2OTJV 2BW8A 1KQRA 1OLRA 1MEC2 2PTMA 2Y34A 5F8PA 3ABTA 1MZ6A 3B4SA 1XJAA 5F6KA 1J1LA 4Z8BA 3OUJA 1XNBA 4KBBA 3ACIA 5IVJA 2JVDA 4CU8A 1HNZO 3I2JA 2Y48A 3HKEA 1CAXB 3ENRA 1PMJX 2ZS6B 1SQGA 2JGDA 5CMUA 3ZRWA 1AR73 3W7TA 1W8WA 5C70A 1S0EA 5CFDA 2VE1A 3RWNA 2XL7A 3WNXA 2WZEA 3DGTA 1GP5A 3AC0A 1RGSA 2HG5C 4LE3A 5ANQA 3CO2A 5DAQA 5FKBA 2G4IA 4Z82A 1GP6A 4DR6O 3KCXA 3UJOA 4Z1VA 3ZN1A 4QXHA 3CCVV 2D3SA 1T6BX 1CAWA 5CG9A 3JD72 4LORA 2WT0A 3QF7A 2QQVA 4QE9A 3ZBHA 4BAYA 4QGPA 4UT5A 5JSOA 1V00A 4NMIA 3ZMZA 5F2VO 4AHCA 3HN1A 4W6YA 4BWAA 1HNXB 1UJWB 4JTOA 3VOUA 1S4CA 1AJNA 1X7NA 2JDIG 3FYIB 1BYHA 2VQEO 2RS52 2W9XA 1SA0B 3FB7C 3PUSA 4DXTA 3JUUA 3HBKA 5BNQA 5AG2A 4DR4B 3RI8A 3FKSG 3PTYA 2XTAA 3MV01 2JDKA 1KUQA 5FZ4A 1VAKA 4JKMA 1MSWD 3CCUV 4GJZA 1UOFA 3BEHA 2EZOA 5ABJB 1TUEB 1C8M1 1ZZCA 4JAUA 1EFRG 2UXNA 4X66B 4QKBA 3OUSA 1CAVA 3LDCA 1VBA3 5H9SA 5ISLA 1H8VA 1LULA 2FYUH 3UKNA 4AVAA 2DYRB 1T2XA 2QZ2A 2IM9A 4Y24A 2DURA 3PMSA 1H4HA 3LNNA 1YI7A 1LGNA 1URFA 1H38A 4R6ZA 2QQIA 1XL4A 2WS91 4AFCA 4N43B 1B35B 4I9WA 3UT0A 2B1IA 1ZBE3 3MPPG 1KS4A 2R0FA 3FB6C 4AI2A 2ILMA 5FNVA 3POGA 4ORFA 1F51A 3WOGA 1H2LA 2Q4PA 4JI7O 1VB4A 5FPOA 3NW4A 4OHVA 3IDEA 3I2OA 1ORQC 2ITCC 3K3OA 3AG1C 5FO9B 3RYCB 1ODNA 2YMZA 3FJSA 4BMBA 4KXRA 4JGSA 2EXHA 4AQSA 1R093 1K12A 1U5ZA 2C1FA 3HPNA 4LITA 4CU6A 2BTOA 1OH4A 1GQHA 2WLJA 5KC6A 1QDCA 5DZFA 3CMEV 4JX0A 2XOKG 2JJ2G 4FCAA 1X8EA 1O4YA 2ID4A 1RUE2 3GNEA 1POQA 2YI8A 5BXZA 3FMGA 5H9RA 1FXZA 1NTZH 2QQNA 1VJ2A 1TVKA 3GZTB 4XQWA 4GKYA 5BR8O 2KD7A 4DK0A 4G3YC 5EBLC 3HKBB 4FMTA 1IXBA 4R8HA 1ND2B 5LA9A 5FPXA 3WF3A 2UURA 3IIIA 1KXGA 1LHVA 4Y5Z0 1UIJA 4V2WA 1B09A 3ZXLA 4HVRA 1YLLA 1DQ2A 2X0LA 1RUH2 4CC5A 4YSFA 3GWKC 4P9YA 5A7PA 5FYHA 1IURA 1PGSA 5AVAA 4ZOLA 1LENA 2B42B 1EV11 3WNLA 3DPRC 1A8MA 4XBLA 2HH9A 1GWMA 1B06A 1G1XB 2B45X 5FZHA 1W8HA 1P7GA 1PZ8A 3GALA 5I0SA 1H2MA 4HNAA 3ZFFB 3FHQA 3M3EA 3VZOA 2E31A 5I0RA 4NPLA 3KF5A 2OIEA 4HT1T 1E79G 3POSA 1N0JA 1GOFA 5IDJA 1WBLA 2HWB3 5C8CB 1X8MA 4K35A 4OULA 1OV9A 3OF1A 4PLNA 3WG1A 5F32A 5FDBA 2LJ2A 3KHBA 3ZDSA 1KJRA 3L74H 4LF9B 3PJQA 3KQ4B 4EJRA 1FD9A 2P4VA 2W95A 3JAKA 4CCMA 3HQUA 1N32O 2X7RB 1LHNA 5FPBA 2DUPA 3WR0A 4LKFA 2PUSA 1A32A 5JJNB 3SXWA 5EYPA 1FMD2 2OYZA 4YY3B 4KU7A 2RV9A 5B1AC 5F39A 3WEZA 4D6RA 3ZRWB 4ES8A 1RUF1 3P5BA 2C9KA 1S0CA 2V5YA 4DY3A 5IYDO 1G6NA 4FFIA 5TISZ 2P3JA 4ZI7A 1MPXA 1EUTA 3WCRA 1EZJA 1Y74B 5EV7A 4AVCA 2HKOA 3ZYBA 3T1YO 4FLWA 3KGZA 2X6BA 4E8CA 3MW2A 1ASJ2 3B8MA 3OAAG 3WNNA 4JI0O 4XDLA 4FFGA 1OLME 3Q9OA 3S6PA 1ZVFA 4UB8Z 5GZFA 1G8WA 4IERA 3H9VA 4F3JA 2IVIB 1F4NA 3I59B 2VJXA 3HB3B 4O4JB 2IC1A 4E2LA 4NXNB 1HDKA 5E79Z 4DR6B 2XBO2 2J7MA 2ERFA 1JTZX 3LDEA 4WZCA 3L71H 2WNUA 3AG2C 2LP7A 2E75B 3S3WA 4OI4A 1XMQO 1TVGA 1BHBA 1RUC2 2K46A 3URFA 1Z7S1 4ONUA 3LIGA 2VNGA 5JIUA 1GNHA 4DV1B 1U0AA 1YCIA 3D3QA 2ZEYA 3E97A 2V4DA 2VOVA 2WWUA 3SYCA 2UXDB 5C8WA 3FB5C 3G6BA 1W6PB 4GIQA 3HEIA 3KT7A 3DPRB 4X89A 4GYCB 3GXUA 3IIAA 4PLMA 5GLVA 4YVWB 5T3NA 3SYAA 3N9LA 1BQPA 4QHBA 1VIBA 1ZM1A 3OD0A 4YVWC 3CQOA 5GONA 1JHJA 4UXAA 3APQA 4F6EA 3H1MA 1AR83 2WZPP 4LF7O 1M57C 5A3PA 1G9CA 4YGBA 4X65B 1CVNA 4X88A 2UXBO 1CN1A 1GZCA 1OA3A 3BVOA 4UBHA 1LU2A 2IU3A 2CTQA 1FV2A 3T1HO 2JS3A 4W4LA 3STLC 3H8RA 3WHTA 4DXWA 1EAH2 3VBRA 2G19A 4L11A 4COVA 3W7XA 4DO2A 3N3HA 2HWF3 2RJLA 3ASNB 1CQ9A 1REDA 2FDIA 4MXWB 1R64A 1W2AX 3RZMA 1I7FA 4E2GA 1RUNA 2XKOA 2UU9O 3RWRD 4XZUG 3Q8EA 4LEJA 2VECA 5LYJB 4DINB 3E6DA 3ATGA 1DF0A 3V64A 4CDQA 2WLKA 1T5EA 5FZ1A 1FPN1 1LODA 1DGWX 2DE0X 1SF9A 1XREA 3MHZA 4AI3A 2JG8B 3PJYA 3CCQV 1SEFA 1JYXA 1GOHA 1UZZA 2RQ6A 4BPZA 2ODMA 3B69A 5LRSA 3JAWB 2F4VO 1HRI1 4CPBA 4DRVA 3AZZA 4PD4F 5KWRA 4BM8A 1LGBA 3I54A 2JDPA 1NU1H 4S2FA 2AZ0A 5L9BA 4DR2O 1QHDA 4GH4A 4AFDA 4Q4V3 1RVF3 3GZUC 1SQ4A 1ENRA 3WW2A 2YGLA 4ZHQA 1RL3A 1W2TA 5C5TA 5CA0A 1KDKA 4YVSC 4FVMA 1CAWB 3MHHC 5FKCA 1W05A 1Y43B 1I0HA 1KD7A 1COV3 1OD3A 2D6LX 3A0BZ 5C8YA 4DV3O 1NG0A 3W58A 4XACA 1BHGA 2WINB 2JDAA 3ACFA 1OLQA 3WG7B 3HKDB 4AFAA 4YHHO 1XUQA 3ZXAC 3SC7X 3ILFA 1JVMA 5CB4A 2F17A 2YBKA 4OI0A 5CBFA 1ZSPA 3U4XA 4H2AA 4PDRA 3MLKA 2VOWA 4QXCA 1XE7A 2VW0A 1JX9A 4BXSV 3BPZA 4GWIA 1P8JA 1R081 1VE0A 5A3LA 1JZ5A 5DUVA 2WLHA 3L9JT 3NNFA 5B1NA 1VQ9V 1AP6A 2ZCEA 3B93A 1NCQB 4RR3B 3H01A 4MXVA 4E4HA 4YFZA 4CDUC 5IUQA 1ULFA 2ZHMA 3LOBA 3OFNG 3SJAC 4LT5A 1O3RA 4X62O 1BKZA 3Q8FA 4BQ5A 1QOTA 4IIJA 5IK4A 3SQOA 1W6NA 4NAMA 2XDVA 1UKRA 1UOBA 3RBZA 2KR2A 1IS4A 1KFXL 4DV4O 3RMXA 2OUHA 5FPUA 4XDPA 4LFAO 1GRJA 3GBWA 3MDPA 1PK6B 2VL4A 1WA4A 1RUJ2 2J1EA 2OXBA 1RUE1 5A9GA 2JJ6A 5IWFA 1WCSA 2DBIA 5DUUA 5LBFA 4XUQA 3O1SA 2AH2A 4FLYA 2J1AA 5CBLA 1U97A 3POEA 3VBSA 3BALA 5IVFA 5HCHA 2N74A 1YEWA 3G6JB 1C3HA 1FI2A 5LASA 3CIHA 2OA2A 2MPFA 4K3AA 4TUYA 2Y8KA 4YG0A 5FOJB 3AG4B 2BBVA 1GN6A 2OPWA 1VF6C 5KHGA 4MSWC 1HRI2 3Q8CA 5KAFZ 1K34A 3K2OA 4FFKA 2Y6LA 5FZGA 2RS31 5BNPC 2VCAA 4LK7A 2HLEA 3RNSA 4CDWA 4X1KB 4IE4A 4YW2A 2XAGA 2ZR3A 3RT3C 1NR7A 2WC2A 4EKWA 3SKJE 1GZWB 5JWPA 1NT2B 2Q8OA 4P9WA 4AQ6A 2NR5A 1JI6A 2QE7G 4UVAA 5FMDA 3SCHA 2PYTA 5KA6A 3O1PA 1J1TA 2BWAA 3USUB 4WBNB 4OHXA 1AYM2 5FWJA 4G4FA 2CAZC 3ZN6B 1SG3A 3PVOA 1RSOB 5C3RA 2W68A 3R0RA 4PA7A 3VBOA 2DVDA 5DEDA 2QJ1A 4CEWA 1YF2A 2DTYA 1PNGA 4AVVA 5CA3A 4PV1B 5A7SA 3B09A 1XB9A 5B1BB 1QQP1 4P14A 1I6XA 5EZWA 1F5JA 3JARA 5HBAA 3OD4A 4YJ2B 1Y66A 5BNPB 2QM7A 1OLMA 2ZR2A 4LC1A 5A7NA 4QXBA 3UGGA 1O3TA 4U3JB 2YFZA 1K4DC 1J5EO 2BFUS 1UX7A 4LLOA 1I5YA 2C4XA 1ULDA 5A32A 2A3XA 1UY2A 3TN92 4B3SO 5DAPA 3DXRA 3AZXA 5FZIA 3NNJA 4Q27A 3E5UA 2Y60A 2I2SA 1DQ1A 1PNLA 4AAPA 2QDNA 1H8EG 1TEIA 2K9ZA 2MEV2 3ZIAG 3ILNA 3LNMB 1PP9H 1V9U2 4FFHA 1CJPA 2IJIA 2ADDA 4K40A 3SHRA 4Y1XA 1B3QA 2QQOA 1AYN2 2JG9C 2BNOA 1UY3A 2C9AA 3OCPA 2IXCA 2VOTA 4A5UB 5CFCB 2C26A 2VVDA 2E6VA 1EN4A 4NTWA 2GSMB 2BV4A 1BVVA 4FPHA 1C8M3 2RDRA 1ULEA 3AG4C 3RYFB 2DFBA 3DV8A 3IZOA 1TUBB 1WZXA 2BTQB 2HVJC 1PVC3 2JXAA 1Y4WA 3OGCC 5L3CA 2FQPA 3SGIA 2YIAA 2EICA 4FTSA 4E4SA 3ZN5A 2NM1A 1H2KA 3PNAA 1WWYA 2WR9A 4FO9A 2YY1A 4K1ZA 1DDLA 4QX2A 1MEC3 1QJX3 2F23A 2RMU2 3VLBB 5FZ3A 1PKXA 1RVF1 3EJKA 1UYZA 3ZXJA 1WPBA 4AEKA 1W8OA 4AEMA 5KA5A 3FHIB 2DW4A 4OUSA 5BNOC 4XBQA 2YC4A 2IFWA 1GNZA 3BGAA 3I2DA 4LNUA 5J2UB 1VRH3 2DTWA 3ABKB 3JAWA 1UMIA 2B9VA 1XXNA 2A79B 2B8MA 1H4GA 3AYCA 4RUFA 2QQMA 1P84F 1VF6A 4I0AA 2Y0OA 1OPOA 5B1OA 2AZ5A 4DUXA 3ES1A 1DYPA 4IV1A 4JTDB 3HPLC 2AENA 4CDWC 1MQTB 4DUYO 2HBTA 3TCUA 4NPRA 5HFMA 2YSUB 1A78A 5C9AB 1QH6A 4L9BA 2CL2A 3VBOB 2A3YA 3T1HB 1JW6A 1L7QA 4DV6B 1AX0A 3PIGA 3JD73 5LOVA 3BA9A 5KHKA 1TE1B 4KFMA 1V6LA 1RUH1 2OCCC 3KGLA 4X65O 1F7YA 3F95A 2BCCH 4LJHA 3K5NA 1YYNA 5FZEA 3RS6A 1A6CA 1C5HA 3CHXA 4MTXA 4O4HB 2L9LA 4JVAA 5E1AC 3ZM8A 3K46A 3I2FA 2G9FA 3A23A 1QJU3 2ZGUA 2G9GA 2QQPA 2QZ3A 1RITA 5HCAA 4W6XA 3DXRB 3WNOA 1RPRA 2XNDG 5IJ0B 4DXRA 2A6WA 4O7XA 4QPGC 2ZNIA 1JZ3A 2DJVA 2VOXA 4RGKA 2A75A 4I4TB 4BZ4A 2ZIMA 2P6JA 1WLEA 5I93A 2GC1A 1UMHA 4IQPA 1ALYA 4DV1O 2D98A 4TUYB 5LL6Y 1MR5A 3SLIA 2NMNA 1X59A 5A33A 3TN91 1MA1A 2EIKB 1DLLA 2ZE6A 1JOPA 4J7KA 1UF2C 1FOD2 4K8XA 4QD2A 2LROA 1VBA2 2VZSA 1DBNA 1NH2B 4JDOA 5J7MA 4UF0B 2F95B 3K06A 3I55V 2WBKA 4DR7B 2ZGRA 4K8FA 3T2PA 2XHKA 2CTPA 4NIHA 1UY0A 3CJXA 4DXZA 4MGKE 3NJXA 2ZGPA 2ZACA 4RQPC 5FXXA 4NIGA 2HP8A 4C7UA 2VBDA 2VMIA 1Q7YW 4DUVA 3HQXA 1PD3A 1F31A 3ZX6A 4FTBA 4JGZB 1O3SA 2EZPA 2P7TC 2UUBB 1J5EB 2WYFA 4FSJA 1KS5A 2RE9A 1H2SB 4CDWB 4CCKA 3I5DA 1VQPV 4FLXA 5FZAA 2HWE2 2HYKA 1IPKA 4RN5A 1OF3A 1FFTB 5GJ6A 2FDGA 5K0UA 1S0FA 4MGZE 1AJPA 2VXJA 5APAA 3I7DA 5A2QN 2GU9A 4GMP0 2A3WA 5LBEA 5CN0A 3WNPA 4YXWG 1R092 4CDUB 2WO7A 1STMA 3ZKUA 3PURA 4LHLA 5FLIA 3HKDA 2W91A 1NTKH 2ZMNA 2YUEA 3B9IA 4ABMA 1LR5A 4LUKA 1H30A 4R4ZA 4H37A 1K42A 2VH9A 5FR3A 1JJ2U 2HR3A 5EYXA 1NCQC 4RR3C 2CAUA 2YROA 1SPPB 3R4UA 4W6WA 1JOYA 4C1WA 3EYPA 4H7LA 2PQQA 4F83A 2R16A 2HWC2 1SLIA 3LA3A 1YQ6A 1N1SA 2Q1FA 4Y1VA 4U2AA 4TSVA 3J4UH 1QOSA 2Y0PA 4Q4Y2 5CU1A 5FMOL 1SQXH 3WG7C 1RUH3 1C28A 2F6BA 3AKQA 3D4KA 2CDPA 2WLQA 2JKXA 3JB4C 3I2HA 5A1FA 1FS0G 4YW7A 3TYJA 1XL6A 4N8MA 4OHZA 2GN7A 3ITQA 5BNNB 5BZBA