3U11A

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
197
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 65
structure length 197
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u11A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u11A02
5I91A 5FLIA 2O1QA 4KWJA 1Q3EA 2VPVA 3H3ZA 1J3RA 1VR3A 1RTVA 2IXLA 2Q4SA 4L11A 1DZTA 2Y0OA 3SCFA 2PHLA 2OZ6A 2CAUA 4FBFA 2H6BA 3GBFA 2UY8A 3DKWA 1O7FA 4XFGA 1CAXB 4HN0A 4KWLA 3PNAA 1ZRFA 2PAEA 3FWEA 5BV6A 4PIYA 4ZU7A 4LEJA 3L2HA 1QXRA 2IXKA 5C8WA 3H7YA 4X6QB 3KGZA 2GC3A 4LUMA 2QNKA 3BU7A 4XETA 4QGMA 1YFUA 3NW4A 4AQ6A 5J48A 4EWAA 2DCTA 2MHFA 4JTOA 4QGLA 4Q0SA 3H1WA 2EVXA 4MV2A 3ACLA 1YHFA 3FFQA 4HVOA 5LEJA 2CV6A 4J1XA 1CGPA 1U12A 3IDCB 3DN7A 1DZRA 3FZ3A 5JSPA 3SHRA 3LA7A 4META 2PYTA 1ZX5A 3SMHA 3CJXA 4PJYA 2P17A 1O5LA 2D93A 3OCPA 5LRRA 1DGRA 2Z69A 1J58A 1LRHA 3PVBB 5KHGA 3EO6A 1UD1A 2HKXA 4KU8A 4AQ2A 2IXCA 2PAKA 2ZCWA 5FLJA 3FX3A 3ETQA 3GYDA 2VECA 3E5XA 2OA2A 1TQ5A 3TNPB 4HLTA 4IEPA 5BPXA 3WW1A 3IBMA 4HN1A 4EROA 3MPBA 1QXJA 3BALA 5CU1A 2ZKLA 2XGXA 5FLHA 3U11A 3SCHA 3H1YA 4KWKA 3IWZA 3QOPA 3LWCA 3D0JA 5JCTA 1X8EA 1NE6A 4FAGA 4MGIE 2BNOA 1O3TA 4Q0QA 1CAUA 5K8SA 4QX5A 3NJZA 2PTMA 1H1MA 2Z2SB 4I0BA 1UW8A 4ZU5A 4IEOA 1CAVA 5FCCA 1GQGA 1RC6A 4LLOA 5I8SA 1HW5A 4AVAA 1X82A 1FXZA 2XLAA 4Q0VA 3IDBB 1O5UA 1EPZA 4XF0A 5BUVA 3B02A 4LA2A 3SXWA 3FHIB 2B9UA 3CL1A 3QACA 3HIFA 3KMHA 2BEOA 3NVCA 4Q0UA 4XF1A 2H6CA 2ETEA 4MUVA 3OGJA 3U0ZA 3UKTA 5CADA 5FPXA 1WA4A 4MH0E 3S7IA 1CAUB 5KHHA 3E6CC 3KGLA 1YWKA 5J3UA 3I59A 4XFAA 3PLQA 5EFUA 2C0ZA 5AVPA 3NSTA 1CAVB 4D7SA 1SQ4A 2BNMA 1DGWA 2UY9A 4N9HA 3HT1A 2QVSB 4BH9A 4XFIA 2QDRA 4PIXA 3RYKA 4QMAA 4IERA 1X7NA 5F1RA 1UPIA 2D5FA 3USSA 4MGZE 3I54A 2EAAA 4CYDA 3CF6E 1O3QA 3G7DA 4WZCA 4EWDA 2PQQA 4RD7A 1CAWA 2H0VA 2E9QA 1OI6A 3I59B 4I2OA 2Q0AA 3H9AA 2ET1A 1VP6A 2PA7A 3WW4A 2GZWA 4I01A 3E6DA 3C3VA 3NKTA 3E97A 3NL1A 4TLFA 1ZRRA 2XL9A 5I0UA 4L2NA 2XLGA 2XKOA 4I3PA 4AVCA 1UIJA 2I45A 4XFBA 2GAUA 5I8YA 1XRUA 3CO2A 3LZZA 4IEYA 4HVQA 4I09A 3BPZA 1ZNPA 5JR7B 3H7JA 1SEFA 5FQ0A 5I8TA 2O8QA 4DINB 2IC1A 4PIZA 4MZUA 3OF1A 5JSRA 4Q29A 3CLPA 5BY5A 1CAWB 3H8UA 4LULA 4J1WA 1L3JA 3D0SA 4E2QA 1EYBA 4JVAA 3H50A 5T3NA 3MYXA 5E16A 3CEWA 3ROUA 3ST7A 2OYZA 2PFWA 1YFWA 3VHRA 3EBRA 1NE4A 5KHKA 4LA3A 3BCWA 4F7ZA 4GULA 4WBBA 2D40A 4EWEA 5KHJA 5FQ0B 1Y9QA 5I0TA 4ORFA 1J3QA 3EJKA 3LA3A 2MNGA 1PMIA 2Q1ZB 5J7MA 1OD5A 4HMZA 3R6SA 4YARA 3TNQA 5FDBA 3RDIA 5JSOA 2F4PA 2CAVA 4O9GA 4Z82A 4E2SA 4FT8A 5LEKA 2GC0A 4MX3A 2EA7A 4OFGA 2UYBA 1LB2A 4BYYA 1LKNA 2OZJA 2N7GA 4I02A 4HSLA 4IEUA 4JV4A 5I0SA 1RUOA 1FT9A 1ZZBA 2IXJA 4HVRA 3JZVA 1ZZCA 2FMYA 4QGNA 4FAHA 4R52A 1ZZ9A 2PAMA 1QY4A 1O4TA 1UIKA 1ZRDA 3H1MA 4D7TA 2UYAA 2K9ZA 3O14A 2Q30A 4N9IA 4XF4A 5EZWA 3LAGA 2XKPA 4XFHA 1RUNA 3ES4A 3D82A 4HBNA 2XL7A 5BXXA 2GU9A 1ZRCA 1O3SA 3KCCA 5C6CA 3EHKA 4H7LA 1I6XA 1Q43A 1G6NA 3FJSA 5I93A 2MPFA 2B5HA 2QJVA 4NVPA 4XEZA 2GC1A 1FI2A 1IPJA 3M70A 3ES1A 4P9GA 1PM7A 3FE5A 1O3RA 4YYOA 2IXIA 4ZU4A 4BHPA 2D5HA 3DV8A 3RYRA 3I7DA 2ET7A 1J59A 5HI0A 3M3IA 4IETA 2FQPA 1OMIA 1QWRA 1YUDA 1LR5A 2XHKA 1J1LA 2XLFA 3HQXA 3RZZA 3E6BA 3EQEA 4XF9A 4Z07A 4IEWA 4UBGA 4IEXA 4O9EA 2QCSB 1NXMA 1X8MA 5FPZA 4B29A 1ZREA 4R8HA 1ZZ8A 3ELNA 3RPQA 4KL1A 2BYVE 4X6RB 1CX4A 4UBHA 3KSCA 1JUHA 3MZHA 3E5QA 2VQAA 3H3UA 3S0MA 1IPKA 3ZDSA 3U10A 2V09A 5KHIA 2BGCA 4I0AA 1GQHA 1ZZ6A 1H1IA 4KU7A 3RYPA 2CGPA 1WLTA 2GH2A 3UKVA 3OD0A 1RL3A 4YSFA 4YRDA 4QXKA 1YFXA 4Q0PA 3N4MA 3SCGA 1EY2A 2K0GA 4WVZA 4K8FA 4E2GA 1EP0A 5D1IA 4BIFA 5CVRA 4XFFA 3MDPA 2GC2A 3RNSA 1V70A 1ZVFA 1I5ZA 4AXOA 2OPKA 3S7EA 2WC2A 4LTAA 4HZFA 4ONUA 1YLLA 3DL3A 4A2UA 1VJ2A 4QM8A 3UKNA 3WW3A 5I0RA 4MGYE 4AVBA 4XFCA 4IEVA 2HJIA 4JTNA 4HSJA 5LRSA 2PHDA 1UCXA 2BNNA 2KXLA 4EV0A 3OTFA 1J3PA 2IXHA 3BB6A 4QM9A 1XE8A 4UXAA 3E5UA 4IESA 1ZZ7A 2B8MA 4MGKE 4F8AA 1NZCA 1Q5OA 3LA2A 1OFNA 4YNIA 1CAXA 3IIAA 1WGPA 5E1RA 3HT2A 5KBFA 4IEQA 5JAXA 1SFNA 4LUKA 1RGSA 1NYWA 2WFPA 4IEZA 4XF3A 1XE7A 3LOIA 3WW2A 4OLLA 1YFYA 2ATFA 1Y3TA
chains in the Genus database with same CATH superfamily
5FP3A 4PV1B 4PF1A 1FOD3 3RWRD 1A78A 2Y0PA 3OM3B 3H8OA 1YI7A 4A7KA 3ZFEA 4JHZA 3IPVA 3IJ4A 3WF4A 4GB31 4BQXA 3B9IA 3LNMB 3I49A 3THTA 3H7YA 5C8WA 3VQXA 3KGZA 1FOD2 3JAKA 2Q1FA 1BL8A 1N33B 4DS0A 1NBMG 4X1IA 5C8CA 1LNQA 4LF4B 2WZR1 4Q0SA 4Y5TA 1EUTA 5FMBA 2X29A 2HEYF 3AG3C 2EVXA 3H1WA 2P3IA 5T5PA 2WIIB 2V5YA 4B1MA 1Q8OA 1W90A 4XC9A 4GX1A 5D5QA 3IDCB 3GZUC 3MIFA 3E89A 4JZGA 5KAFZ 2VNOA 4IL7A 2R071 3WY6A 4EN8B 1AR71 4CU9A 1NX9A 4JI0B 4Q4Y3 1DG6A 2D6OX 4K3AA 4JI5O 1O5LA 2PELA 5LRRA 4YGEA 2Z69A 3GGLA 2ZD9A 3VKFC 4J9ZB 5K1PA 2OIEA 5KXBA 3VDBA 4FOQA 2GMMA 2ZCWA 5FLJA 1UOBA 2OPWA 2BBVA 4FP3A 3OUHA 4GT1A 5GM0A 2VTXA 1UPGA 3ITQA 2JS3A 2W91A 1C8M3 5DMYA 4PLNA 5FLHA 4Q4Y2 3U11A 1KFUL 1DYKA 3CCVV 3KD4A 1XNTA 3LWCA 2WO2A 3EHBB 1Q86W 4XJ9A 1SQFA 2ZAAA 1CAUA 5K8SA 3I2HA 3K3OA 1K73W 2Z2SB 4KBBA 3HNMA 4P30A 3I3BA 3PTYA 4W6WA 4JI4B 2YXYA 4FFBA 1GMGA 2B9UA 3P5BA 2VQFO 4M0NA 4XUOA 2CYFA 5IDJA 4S2GA 2VNGA 4XFAA 1NY72 3PLQA 3GXUA 4CDQB 1IXBA 1N0JA 1R3IC 3SGIA 1DGWA 3TBDA 4Q4W1 4AVSA 2QVSB 2SBAA 2Y48A 1OBNA 3J9SA 1F51A 3WVJA 4KBZA 2GUZB 2WINB 2HWD1 2E9QA 2K9PA 3I2JA 1YJKA 3I59B 2VQTA 1TUBA 3NL1A 2XHNA 2ZR2A 4Y5Z0 2I45A 4QX3A 5FPRA 1L0NH 1HNWB 2EAKA 1SLCA 1PX4A 4G4FA 1VRH1 4IV1A 2IBZH 1HQNA 2RS11 4QWNA 5BMVA 3GCXA 2XH6A 4EFBA 5EIBC 4UVBA 2LFRA 4NAMA 1J95A 1PO13 4QDQA 3R05A 3WP5A 3WSOA 4O61A 4JCKA 4B3SO 2D40A 3J7MA 4DXSA 5LGTA 4X88A 1Y9QA 4ORFA 1KD7A 2R72A 2QTSA 5KUMA 1UY1A 2CTWA 1R64A 5CFCB 4NWWA 5F3CA 5BYNA 1KRIA 1K7DA 5CBLA 2A6VA 4I4TA 3WF2A 3MF9A 1ONAA 2IXJA 4HVRA 3NAPB 4R4ZA 4JF3A 5EYPA 3WUCA 2PAMA 4YW3A 1VLNA 3PUQA 5FZ3A 1GN2A 3JQXA 2GDSA 3C8XA 5F5QA 3ZFGB 1MS9A 2UXCB 5C9AA 2NLRA 1H6XA 3CDZB 3VBHC 4CS3A 5LBCA 1RXGA 3L2YA 3EXUA 1V55B 3VKOA 2Q6AA 2F43G 1RHI1 2CTVA 3FUQA 4U7NA 4JI8O 1FATA 1ND2C 4QGPA 3RZGA 2DYCA 5FYBA 4YFZA 3CE2A 3WHTA 1DQ0A 1GBGA 1IBKO 1MQTC 1YUDA 2WN3A 1RPOA 5EWSA 3AL6A 3N9OA 1M56C 2Z5UA 5FKCA 1IHMA 4UFZA 4NTYA 5FZOA 1R1BA 2ZOEB 1X9PA 1JUHA 5FYIA 3VBRA 3CRMA 2ZGUA 3M3QA 5CNAA 3VDAA 2JENA 2A79B 1WLEA 4Q27A 2UUAO 1F5FA 1VMGA 1JVMA 4XJUA 1PGSA 1F2NA 1D4M3 2ZE7A 1Y43B 5FYYA 3ZFEC 2GC2A 3WG7C 4Z8BA 4AOCA 4HZFA 3J80N 2OUHA 4WCEV 1AI6A 4MADA 1W0JG 2HJIA 4CBCA 4R50A 2JEXA 4JYAB 2IXHA 1J3PA 1QJZA 4ZS2A 1LNSA 1XHZA 2W47A 5EYXA 1B3QA 3FBYA 4NRPA 5BR8B 1D4M2 2W92A 1Q5OA 1MZEA 5C8CC 3B94A 1XJAA 4XDKA 3K51A 1BQPA 2GNDA 4X8NA 1W6QA 1UQXA 2OCCC 2PI4A 2WFPA 3QH7A 5FUPA 1REFA 3M7AA 2OUJA 4O4IB 3KM5A 2WSVA 1REEA 1XBLA 1XOYA 1DYPA 4RQEA 3AZYA 1SETA 1NQDA 2JD9A 4YZ2A 3OBRA 4FVMA 3RN4A 4Q1PA 3AG4C 3OEEG 4I0XB 3T1HB 3PNAA 4JQTA 2ZR3A 2VG9A 3L70H 4GMP3 2UUCB 4ZONA 3C90A 5M0TA 5F3IA 2WT0A 5A3PA 1AVBA 1GZCA 4EWAA 1LR1A 2AR6A 2VZ1A 3ZXFA 1W2TA 1Y67A 5BNOB 1COV1 2F17A 1M4UA 3B8MA 1QOSA 3HBKA 1CGPA 3EFFK 1MS4A 1FNZA 1BYHA 2Y69B 3BVCA 3AG2B 1ZX5A 1TVKA 1K33A 1JI6A 4ZS3A 1SQBH 1JJOA 4XTMA 1K34A 2KM2A 2JGDB 2IXCA 3T4VA 3BTXA 1QMJA 1TQ5A 3VKMA 1KBHA 5ACA3 2IH3C 2B42B 2XAHA 1SG3A 3D6EA 4FAGA 2BNOA 5EC2C 3THPA 2QQKA 3LSEA 1UAIA 1TAEA 3ABUA 5I8SA 2QQPA 4QU1A 1BMV2 1NR7A 5JOZA 3B02A 5ACA2 3T08A 5LW9A 4ATEA 1D0GA 1XEQA 3A23A 3MFAA 3VBBA 2RDQA 3VBOA 3OTOB 2JG9A 1SZXA 4KH9A 4AYUA 2I2SA 4UYBA 3B3QE 2JX9A 2C0ZA 3VL9A 5GZDA 4BIZA 2WO3A 2ZINA 5IW0A 2EIDA 2VBPA 1OKQA 2E75B 4TN7A 1UY4A 5IAXA 4HFSA 3USSA 1POQA 1O3QA 3VD3A 2LUWA 3ZXGA 1BT8A 1LUWA 3CEIA 4BJ0A 4GLXA 1OH3A 1PZ9A 4CDXC 2KQXA 4LFBB 3J7HA 3OGVA 4I01A 2ERFA 1H8EG 2V4VA 4CC5A 3ZN5A 2XL9A 1X9TA 3EVKA 2YG0A 4L2NA 2UXDO 4XBLA 2WLMA 5D8AB 2LROA 4FLUA 5FK8A 3H1IH 3CJHA 5JSRA 3WCSA 1SS3A 1SLLA 1J84A 5SV8A 4E2QA 4YWAA 4A6OA 3LEMA 4DUVA 2PFWA 4LXLA 5C9AC 3E86A 3FC0A 1GO3F 4GULA 4DRXA 5K0UB 4P9XA 4EWEA 1XNAA 5IT9N 1S2KA 2VOKA 2MNGA 1ZTEA 2HWB3 3AMHA 1M57C 5JH7A 3RJ2X 1SCRA 1SA0A 1S0JA 4NIHA 5K4LA 4DR7B 4OFGA 2UYBA 5JOYA 5CZKA 1TE1B 4B1LA 1XC6A 2W5FA 2WNUA 4JV4A 3DYPA 4CP0A 3TXSA 4X62O 4DNYA 2YFZA 1YJ9V 1FXHA 2O8OA 1UY0A 2QQNA 4YW6A 2B9ZA 1MSDA 3PN1A 2X5IA 3D4KA 4GWNA 4I5SA 3DECA 5DDJ1 2HWB2 2JKBA 1GYKA 3WB1A 2HR3A 2PYLA 5FZKA 1DQ4A 4CP2A 2Q30A 2ARAA 4HBNA 4OMDA 3EB7A 4X20B 3VBRC 3E1F1 4W4LA 1ZLZA 5LGUA 3SPCA 3GALA 3RYIB 4FOYA 5FYSA 1YHQV 3POWA 1NTKH 2VUAA 4PDVA 3HKCB 1WMEA 2GP3A 3LSSA 5JQGA 3LUTB 2WSSG 1UYZA 1G6UA 3POYA 1VQNV 2RM23 2QQMA 4WM8A 2FZ1A 4K7JA 4LP8A 3BU0A 1M5IA 1R73A 2W68A 1P4RA 2W08A 4BZ4A 3CD6V 1OMIA 4XDPA 2XHKA 3BY6A 1W2AX 1XUQA 1UYYA 2AUYA 1XMOB 4UBGA 4DR6B 2Z4FA 3P6BA 2WLLB 2XWJB 4MVOA 4X6RB 5GALA 2HJDA 2VMCA 1EV13 3VD4A 2XBO1 4TSVA 1ZA4A 2YIAA 5G04L 5DQ0A 5H9CA 3RMXA 1JTZX 3TOJA 4AXOA 3S7EA 2ENRA 3BCCH 3PUSA 4A2UA 5FBZA 1EV12 3UO3A 1V9U2 4LHKA 2W9XA 4HSJA 2P7TC 4DXWA 3EXAA 4FFKA 4MGKE 4GMP0 4PA9A 2JDYA 1HNZO 4LKSA 3K46A 4GKYA 5E1RA 1UZWA 4AFAA 1L7QA 3LD8A 4B3NA 1Z0HA 1XQNA 3NKGA 2WO1A 5EPAA 2VPVA 5FYUA 1ZBA1 5LK5A 1RPRA 1RITA 2VW1A 1RUG2 5L9BA 4URTA 2PAEA 4JI5B 3UKMA 4DEVA 2E26A 2YGMA 1VBA3 1HDKA 1OA4A 2JGUA 1BJQA 1S2EA 1RUC1 1K42A 4LUMA 1CPNA 1MS1A 4WVWA 1NI8A 4O4JB 3M4FA 5ANQA 2DCTA 4TWKA 2JDHA 4MG2A 4CUGA 1BHAA 2EXKA 1FXKB 3I8TA 1JFFB 3PU3A 2LW7A 2LALA 3WOGA 4H0LB 1VBA2 3SHRA 4MTGA 1AR61 4GJYA 5IVBA 4AFMA 3SMHA 3CJXA 3JD71 1Q8SA 2GMPA 3WP6A 1W04A 3WDUA 4J10A 3VBOC 2JG9C 1V0AA 4DW1A 4DV7O 2VQFB 5HCHA 3GYDA 2ZEWA 3IT8A 1WCKA 2O14A 3C7FA 1MACA 3CKHA 4XIOA 3CSXA 3BALA 4NXMO 2KR2A 5A7WB 2DMXA 3C7OA 2XWBB 3FUOA 1K97A 3UGFA 3W59A 5JPMB 4WFHA 4MGIE 3NJZA 4ES9A 4H55A 4MSWC 4CDQA 3IGAC 4OI0A 1VMJA 1FPOA 1US6A 1CVNA 3ABMB 2N05A 3ENRA 4AI0A 4DR2O 3HQUA 1W99A 2GUZA 3PUIA 2YIBA 2WQZC 5FP9A 3I59A 4AVTA 5B1AC 4D7SA 2XASA 4IE0A 4Y4RA 1PD3A 1ENXA 4YW7A 3JAMN 2C9KA 4C0HA 1LHOA 1DHKB 2F93B 1NLRA 1MSWD 4IERA 4LKDA 1WUVA 3GBWA 2VOWA 1C28A 2IVIB 3OW2U 3POJA 3ABZA 1H2SB 4CU6A 2EILB 4B3SB 1ROPA 5IATA 3S3XA 2JS5A 1G4YB 1PO21 2VE1A 4CCNA 4DUZO 4NUBA 1D7PM 3SQOA 1VF7A 4RQPB 4I09A 2WNUC 5T5OA 3H7JA 5I8TA 1QIQA 3ZM8A 5LHGA 2VOXA 1DGWX 2X5IC 1XOUA 3AKPA 5CFCA 3ABLB 4HK9A 3ME2A 1RJ7A 1YQ5A 3LOBA 4HANA 1NE4A 4DY5A 1URXA 1HQWA 3T3YA 5IFPA 3BRCA 4KP4A 2OKXA 3NAPA 3L75H 5I0TA 4YG0A 5A7NA 1QGLA 1BCCH 5BNPB 4BQYA 2WWUA 5EJ3A 3JBG1 3VL8A 4OI1A 4MX3A 5IYYA 5LYJB 3ZFGA 4WM8C 1XE0A 4RN5A 4WBNB 3NNMA 4JI8B 5T50A 1YIPA 1V6IA 1K3IA 2G9GA 3L73H 2YYOA 4FPEA 2YMZA 3QF7A 3NO8A 1Q8VA 1QY4A 4QIWF 3O9OA 2UXNA 1IBKB 3T1LA 3B40A 1C8NA 2VRZA 2VXRA 2XKPA 4BW9A 5CYYA 2OW4A 1YF2A 1KP2A 4GB33 1G8MA 3T2OA 1I3HA 5LB6A 3ZMVA 5C5UA 1JZ5A 4DV0O 1P7GA 1EBOA 4D3WA 2MPFA 1VF5B 1F15A 3OEHG 1A32A 4NVPA 2OYQA 5FOJB 2D6MA 2VUJA 1FI2A 2UUAB 3M70A 1AR91 2G38A 3FN9A 4Y1YA 1NG0A 2WZR3 1S1AA 5H2FZ 2N04A 3ZYJB 3DV8A 4UB6Z 4GB32 2P5BA 4FTBA 4BB3A 2R073 3UESA 3AMQA 4JGZC 4COWA 4DIQA 1OQEA 4B29A 3PU8A 3RPQA 4TV9B 2PHFA 1W06A 2WZR2 3DTUB 1E1RG 3M2MA 4W8JA 4I0AA 5CAZA 4YSFA 3S30A 1PL0A 2R072 3HQRA 1AR72 4DPNA 3HD8B 1TG7A 2J1AA 3RNSA 2DU0A 3BABA 4BW5A 2P1BA 4EB6B 5J96B 2JECA 1K8AW 4O4IA 2Y60A 2BNNA 3WQ1A 1KQSU 3BIEA 3T0AA 5K9YA 2BTQB 5FY4A 4I0XA 5FZ0A 1YI9A 3I2DA 2EBOA 3SYCA 4RHV1 3BYWA 5LBQA 4LQRA 5I91A 2W1QA 1Q3EA 3AK3A 2Q7EA 1TME1 3SYPA 1RTVA 1OA3A 3ZBHA 2CAUA 4Q4W3 3RZKA 3CZUA 2H6BA 2VZTA 4NN0A 4XPVA 1V6LA 5BNOA 2QKAA 5LA1A 3SYOA 3WNXA 5FJHA 5IYDO 1ULGA 3CXCU 1GR3A 2HWD3 3MUY1 3L2HA 3T1MA 1FXVA 2HP8A 1MVQA 2VMIA 2N74A 2H8PC 1ENVA 1POV1 4FM1A 1W6OB 3LKJA 4Q4W2 3WU2Z 1CEZA 2A6XA 4FPYA 1DQ6A 4V2WA 4MV2A 1R081 4DO2A 2A7AA 2JGDA 4XCAA 4XOGA 1Q90D 4FPPA 4UOJA 2R0FA 1OLQA 1VRH3 5FO9B 2FTKA 2Y6HA 2FDJA 2HWD2 2P3YA 2RS13 5EBWC 2KA3A 4CDQC 3DEMA 1DTOA 1VF6A 2RDSA 1EN4A 3DUIA 2IFWA 1UX7A 2CGOA 3ZHUA 3AYAA 3W7WA 3K08A 2D7FA 3TYJA 3PVBB 4FQ4A 1E79G 1FYJA 4KU8A 4DXRA 1QOOA 2VW0A 3ETQA 2IVJA 1VRH2 3G6JB 3E5XA 3O1SA 2RS12 1GNHA 2HWF1 1K3EA 2CTPA 2Y8KA 4YW5A 2XGXA 2NLJC 2HVKC 3H1YA 5CISA 3ZSEA 3KF5A 4BCUA 2R30A 4QPJA 2CGNA 4ZI7B 2WWSA 1WB8A 4CZSA 3INAA 4NMIA 4O4LB 4C90A 3CMEV 3WZ1A 1PM9A 2VCBA 4J41A 3QACA 2ID4A 5A6YA 4FZ1A 4Q0UA 2BV4A 2UXDB 4MH0E 1ZM1A 3KGLA 3DCQA 2OX0A 1RHI3 3WF0A 3OB8A 1VBB1 3LGRA 2ZGLA 1S0EA 1EPWA 4FFHA 5HPOA 1JXNA 4L92A 4QMAA 2XVLA 4ZXEA 1H2NA 3N7LA 5D8AA 4WFAV 4KG0A 1WLDA 3WQ0A 3IM0A 1D2SA 3CS5A 2WLJA 4QU2A 3NAPC 3ASOB 1BEV1 4OHXA 4JGSA 1OJHA 2Y26A 3E6DA 1RHI2 3E97A 3S5AA 4QPIB 2GHYA 3ZFGC 5KAIZ 1TA8A 1UIJA 4AVCA 1HN1A 2W6JG 3HMYA 4F6RB 3CO2A 5K0UA 5A7QA 4MVMA 5JR7B 3QCWA 2O8QA 5FY8A 3BI3A 4X62B 3FLPA 4OZXA 4LITA 5LGNA 2YHJA 2E63A 2A7WA 2ZX4A 3IAPA 4F7ZA 1FFTB 4RUFA 1L7LA 1QJEA 1J3QA 3NV4A 5J98B 1UU6A 2ZGKA 5FDBA 5AFEA 3U78A 3KQ4B 2AEZA 3NNGA 1BBT1 4QHBA 1LKNA 2OCHA 4RQFA 5C3RA 4X20A 4LH7A 3FHAA 3GNEA 2VNRA 3O0VA 4HSLA 3HNYM 2GSYA 3RYIA 4LHSA 2DUOA 4KI5M 4YM2A 3E2EA 1BK0A 4FZ0A 1FV2A 3HKCA 1FJGO 2CHHA 5FZEA 4ABMA 1HDJA 2XAJA 5EZWA 5FP8A 1JYNA 1QJU1 1CZVA 5L73A 4GJZA 5IJRA 2YS8A 4QKNA 1NKDA 1BHBA 3I3MA 1XL6A 1H2MA 1PM7A 2WLLA 1AYM1 5T5JA 3D36C 2F23A 1COV3 3JARB 3ZIAG 2OS2A 3ZYHA 2F1MA 4LC1A 2ZEZA 5EP9A 3WNKA 5CG9A 3M3OA 4X8AA 2QWPB 4CCOA 2AACA 4UFLA 2QCSB 3TEZA 1AP6A 2FMLA 3T2MA 4N43B 1HNZB 1IPKA 5C93A 2AH2A 4OHWA 3H01A 4LOSA 1LCLA 5IJ9B 1ALYA 5E89A 4E4EA 3RG0A 4M3CA 1EP0A 1DGRN 5D1IA 4CDUB 3KV9A 1GRJA 2QWOB 1XQ8A 4Q1RA 5BNOC 3HN3A 1GK9A 4W50A 2YC0A 1HRV1 4K40A 1YJLA 4IEVA 3VGIA 3VOUA 3ZIWA 1AJOA 3FLRA 5CA1B 1UCXA 4FLZA 1UYXA 2DE0X 4YFWA 1ZZ7A 1N1VA 1Y6XA 2NQYA 5CA3A 3ML0A 2A75A 4XJZA 3HAGA 2VZPA 2ZKNA 1AL0G 1OHFA 3BTZA 4OQ8A 3LDBA 4QGLA 1WMXA 5F6LB 2ARHA 3AG3B 1XB9A 4O4JA 1OPOA 1UZYA 4RL7A 4Q2FA 4BR6A 4UVCA 1H4GA 3N2KB 1FXKA 5A3TA 2EIGA 1JFFA 5BV6A 4EZHA 4ZU7A 4LEJA 4YW1A 3BN6A 2QBXA 3ZMNA 2GC3A 4DV7B 1SESA 2JIGA 2E74B 1QR8A 3SDLA 1F9KA 4K20A 1OVPA 3ZXEA 4JTOA 1N32O 1IS6A 3WP4A 4NXMB 1NT2B 3KZ4C 1M9NA 3WLUA 1ZX3A 2GH8A 5CN0A 1NQJA 2CDYA 5FIXA 2VZSA 2IH1C 3OPWA 1DCSA 3NXSA 3FLTA 5A7WA 2P17A 4YM1A 5IVEA 3OCPA 1WCQA 4FPFA 3O65A 5FTTC 2YSUB 4GH4C 3ZOIA 1UJWB 1SQGA 4LBKA 1E5HA 2A06H 1RUI1 2QUOA 4DR2B 2DCKA 3LCPA 2HWE1 3A0NA 3RZMA 3UK9A 4NXNO 4X1YB 2Q73A 3H3LA 2D44A 4I55B 3I2FA 2QM8A 2JB4A 5D8AC 2V1DA 3OAAG 4MT8A 1YQ8A 3A0RA 3VQWA 5B1OA 5A33B 3CCMV 1AX1A 3WDVA 1XREA 2O0OA 1S0VA 5DDJ3 2GP5A 3LF7A 4A44A 3CCEV 3KMHA 1QJY1 2W0FC 4DUZB 3OGJA 3U0ZA 4Z1VA 4L87A 1KECA 4JYBA 1YWKA 2JG8B 3I3QA 3K3WA 3NSTA 2EIBA 3BEHA 1OKOA 1SFPA 4BPZA 1VQ8V 2ZIOA 2BNMA 5DDJ2 5FYZA 1ZUQA 2YGLA 2W0XA 2VQUA 5FWEA 5LA9A 4XURA 3KKYA 4RQPA 4IGQA 5A3LA 3PUAA 4K0KO 4EWDA 4YY3O 2H0VA 1YYNA 1ZA7A 1JZ7A 5DXDA 3RQ0A 3WDYA 3WW4A 4MVQA 1LGNA 4OPHA 2KSDA 3ZHVA 4TQFA 5FV3A 4YVWC 2LRPA 1MABG 4IEYA 1NU1H 3BPZA 1W39A 2VZVA 2XBO3 2RMKB 5CEHA 3OF1A 1O9GA 4O7XA 3CLPA 2EIJB 3D0SA 3VZNA 4KFMA 4JVAA 5E16A 3ZYFA 1I94O 3PVOA 3NNLA 5LYJA 4XXPA 2BWCA 2NMNA 1LULA 4MS2A 4WBNA 3BCWA 2IJIA 4IYIA 4XTPA 4NJ4A 3L72H 1GFF2 1WAZA 4AI8A 2XBO2 2Q4PA 3PIGA 1IQDC 1JU4A 1G86A 1KYOF 4FLYA 4S2DA 3E35A 4PDWA 4PDLA 3SYAA 4DV0B 1K45A 3VBHB 2RJLA 4LO7A 3D5OA 1JA8A 1AR5A 1AXYA 3WNMA 3MHZA 4XQDA 3OR6C 3ZMTA 4R52A 4MW8A 5AG2A 1O4TA 1UIKA 1ZBA3 5GZCA 2YPDA 3H1MA 3GM8A 3L9JT 1GNYA 5FZGA 1PVC1 2TBVA 3CNAA 3JSNA 2LGWA 4OYUA 4AG4A 4XFHA 1MQTB 2XJPA 3ES4A 2G4IA 2DBNA 4XJ8A 1SF9A 2VD7A 4QT6A 1GN4A 1IG3A 1D2QA 1X50A 3AL5A 1RUC3 2A5ZA 1ZBA2 4Y3OA 3APQA 4TV9A 2GSMB 1H1AA 3O1MA 2FZ2A 3SYQA 2DCZA 4PQ9A 1TMF1 5HV4A 1AR63 2BBAA 1RUC2 1F23A 3D8CA 5LBEA 3JD73 4O9EA 2DCJA 4A7YA 1O6UA 4I9WA 4WFGA 4QQ2A 3CZJA 4DRVA 4EB6A 5C5TA 1Y4MA 3LEIA 5IYCO 2OIGA 1LUVA 2O57A 2PLV2 5KHIA 1ZZ6A 2Z5WA 1CQ9A 5FXZA 1SBDA 3RZLA 4CUCA 2WYSA 1AR62 1F8VA 2VUDA 3RFRA 2BTQA 3IB3A 4HK8A 1VAMA 4W4ZA 4CA9A 2OCCB 3JD72 4QX8A 1S2BA 2Q8EA 1H9WA 1FXKC 3B8NA 3OYWB 5T54A 1VBC1 3UKNA 4AQYO 5J1XA 1KD1W 3UM7A 1E5IA 3AG4B 1RUH1 3KCYA 1GUIA 2RS31 4AEMA 4YJ2B 1GQPA 2ZEYA 4IEQA 5JJJB 3MLKA 4YHHO 3QLQA 4CC6A 2YXLA 1RGSA 3S3WA 3HKBB 1Y3TA 3MIGA 3B5LB 4K21A 2O1QA 4IHJB 2ZGRA 2IZWA 3WHUA 1W6OA 2FCVA 4KNCA 4XFGA 1IZ3A 3UL2A 5DECA 2LO1A 3K79A 5C7GA 3SJCC 3J26N 3P32A 2VZ3A 4HAMA 3AP9A 1GAXA 4DV6O 4RO2A 1GWKA 1PO23 4BDVB 1OLME 4KG8A 2YU2A 2A3QA 4YPJA 4HONA 2VCMA 5LEJA 2D98A 1FX5A 2WO7A 3SISA 4MTXA 4H3WA 4JI1O 2XOKG 3MO4A 1Z5WA 1PO22 5CKMA 1NZ6A 5FP7A 3Q8EA 3W7XA 4ZI7A 3W7UA 5IHRA 2V4DA 4B3RO 4O4LA 4Q5OA 2EILC 1O91A 4GZ9A 5GZGA 3JBG3 4FO9A 4M4PA 5B4XA 3JUUA 3D3IA 3VZMA 3J7NA 3MIHA 4FPOB 4WFEA 5J9PC 1GICA 5AFBA 2QE7G 2JE7A 3JALB 1SLAA 1GWLA 3K58A 1KQRA 5F5AA 5FCCA 3CCUV 4LK6A 1X82A 3ABLC 3FHQA 3SR2C 5JR2A 3JBG2 3CL1A 4MOAA 3W5NA 1QVGU 4J80A 5BXZA 3A2FA 3ETDA 3HKDB 1BK1A 2KD7A 4CDXB 2P67A 4BMEA 2JKXA 1GM8A 5CADA 1Q56A 5C71A 5J3UA 5DN2A 2LP7A 2UURA 4AQSA 5BNPC 1ASJ1 2PYJA 1D5NA 2VM9A 1O4YA 1AR93 1UXZA 4QPIA 2VVEA 4DUWA 1APNA 5F1RA 4F6RA 4LBQD 4KXRA 3NRUA 5JZGC 1KDMA 4J6GA 3ZYBA 3RJRA 4LF6O 4CPBD 4FSJA 1D5AA 5LA6B 4A3XA 2QDOA 3E8FA 1SMVA 4JHTA 3KHCA 2HHHO 5LK7B 1ULOA 3Q9OA 1AR92 4OVEA 3WCRA 2VNVA 2XLGA 4DV2O 4YM0A 1G9AA 4I7ZB 1UPSA 2UXBO 3H1LH 4NPRA 1SBFA 1RM1C 5E88A 3ZEDA 5D2AA 1VPHA 1CX1A 2WLIA 1W2OA 4XDOA 1YITV 4XW3A 1QDOA 4JKKA 4MLOA 2A3XA 1WKYA 3RRDA 2EXIA 4XUNA 3JATB 4AI1A 1CN1A 1A3KA 3AZXA 1WPXA 5C4WA 5KHJA 2FCTA 1NTZH 3U14A 2R9AA 4SBVA 1OOPB 3TEXA 4CSWA 1PKXA 5DPNA 1TNFA 2GC0A 2EA7A 3ZXLA 3O1OA 4RHV3 4AR2A 3KCXA 3CCJV 3JXSA 1RUOA 4NE9A 1SLTA 4CXWA 2OVUA 1OPMA 1TME3 1A6CA 2ZQMA 1JYCA 3CBNA 3ICXA 4D7TA 1K92A 1BS3A 3QO8A 4Y33A 1BCXA 5CKQA 3JARA 3LAGA 1RUNA 1HW7A 5BXXA 4RHV2 2GU9A 4YIOA 4S2FA 1RVF1 1Q43A 1W6NB 2XJTA 2E7TA 1AI5A 1LTEA 1TME2 1POV3 2P3KA 3TK1A 2BTOA 4N43A 2EIMB 5CFDB 4GA9A 1SLBA 1CR7A 2IXIA 2YC2A 4YZ1A 4RS5B 1E5RA 2Y4UA 1R083 4R9DA 4JDNA 4P2ZA 1J83A 4IETA 3QVNA 5IJ9A 4L9BA 2DU1A 4ATFA 3RZZA 5IVFA 3OD4A 4CDUA 1X8MA 3FFZA 2BWAA 2Q9LA 1C3HA 1YQ6A 1R082 5JOXA 5D21A 3SKJE 1LJ7A 3H3UA 2ADDA 3G6BA 5CA1A 4FTSA 1IX9A 2HWF3 4N53B 4QXKA 5H9PA 3WP3A 4IGPA 4YM3A 3SCGA 5IWAO 1SHWB 4MGTA 4MXWB 3O5SA 1HXS1 1JPXA 3MPPG 1K5MB 2WC2A 4B08A 3SH5A 3DL3A 1CWPA 1HN0A 4CTEA 4QM8A 1H30A 5JXJA 5A7PA 2VGDA 2FHRA 3IAQA 4XQWA 4QKFA 2HWF2 2PQSA 2C6SA 4LOTA 1VIWB 4YLZA 3N2KA 2BPA2 3DXTA 1N32B 3A0KA 3M3EA 1ZBE1 3HVDA 3H3ZA 2BERA 4LIUA 1RUG1 2Y6GA 3ABKC 1VBB3 2ZX1A 2W94A 3RYHB 4FBFA 4N21A 5IAVA 1R3KC 1Q8QA 4Q26A 2RDNA 3ILFA 2GTSA 2ZACA 1IS3A 3OBTA 5JVDB 2PI5A 5CA0B 1UOGA 4AQTA 2DDUA 3O1PA 1BEV3 5IYBO 4UV8A 4QKDA 2RE9A 4XDLA 1GOHA 1QH6A 1LESA 2K2SA 1LODA 2QNKA 1YQCA 1VBB2 2W87A 3NW4A 2V7QG 4YXWG 5J48A 5GLWA 4NXNB 2PHXA 1H6YA 2JJ6A 3IFXA 5JJEB 2KKWA 1AR1B 1DZRA 1KB9F 1BEV2 3W21A 3K2OA 2A71A 4A3ZA 5FZMA 1JR9A 4X1YA 1XYNA 4A4AA 1PIV2 4CEYC 4I55A 3T1YO 1I1EA 2D3SA 2LTNA 1LRHA 4BQ3A 2DQ3A 5LHHA 5DUXA 3RWNA 1UD1A 1W3XA 1OT5A 4LF5O 1ZYBA 1VMFA 3M8AA 5J36A 4ZZ8A 2R9IA 5A33A 3B4SA 1WNSA 5H6QA 3IBMA 1N1SA 3H1JH 1BBT3 2YPJA 4QPIC 2QQVA 3IWZA 2YBKA 3PMEA 3KT4A 1NE6A 4JKMA 4ITCA 5JXHA 4QX5A 5A6QA 1XMQO 2JG8A 4GIQA 4HKOA 4IE6A 4K0KB 3AYDA 3N7KA 4YY3B 4Y26A 2YROA 4LMFA 5BUVA 3WF1A 3F7VC 1GU3A 1BBT2 3FHIB 4XQ4A 5GLUA 2BE3A 2DWRA 5DAQA 2AZ5A 1QJU3 4XF1A 4BK5A 3H0OA 2BDRA 2E76B 5FXVA 1WA4A 4K8XA 5KHHA 5FNVB 5F3EA 4D8MA 4P9PA 5J2UB 4ZHQB 4JI2O 1AYM3 3KLSA 4XFIA 1GTOA 1NS1A 4TOIA 4X65O 2D5FA 3APOA 1I94B 1QJU2 4H37A 5B3SC 5A6ZA 4E27A 2I07B 3RS6A 4XBFA 2Z3YA 5FMCA 1WA8B 3N9LA 2AEYA 4Q20A 3S57A 2VCCA 2ZE6A 1F4AA 1AYM2 4XFBA 4LFCO 4HXCA 1W8NA 4JRAA 3WDWA 1ZNPA 1EFRG 3CRCA 2IC1A 3K5NA 4Q29A 3H8UA 5JUVA 3H50A 2AGSA 3CEWA 4LBQB 3VBHA 4PJ0Z 2F4LA 2H94A 5FZFA 2ITCC 2MEV1 3ZJZA 1HRV3 1HP8A 4WBBA 4XACA 1VQ4V 1H8VA 1RUJ2 5IVVA 2R70A 1VQMV 4NHYA 4YW4A 4JYCA 3I55V 2L6LA 2J1VA 3MICA 2CNAA 2ZDIA 4R8CA 4N43C 3AXEA 3Q8AA 1MQTA 3IDEA 1POV0 3HOBA 1WD4A 1GWMA 3RYFB 2H0BA 2JB8A 1W3VA 3ASNB 2GNMA 1HRV2 4LF9O 3WFVA 2XR4A 3I2IA 3KB5A 3NNFA 5F5IA 4QGNA 4XMAA 3BOPA 1NAEA 4XHBA 4CDUC 1RP3B 1UKRA 5F2WA 2VR4A 3D82A 1S76D 1DLBA 4LBEC 4JGZB 3MAQA 3PJSK 3OGIB 1JOYA 1YDXA 4U2AA 1F35A 1W9TA 5DZFA 4B4RA 2DYSB 2QJVA 3KS7A 4AHYA 3ZN6B 3OY8B 3ES1A 4GALA 1GM7A 4GUNA 3MIEA 4UXNA 1R6NA 2WPDG 5L9RA 3K5OA 1RFYA 1U5IA 3JQWA 3HQXA 1AJKA 1S77D 1W0NA 1WJZA 4AQYB 5A3WA 2HYKA 1UY3A 4R8HA 3ZMSA 3VD5A 4LCUC 4UBHA 3OYWA 1W9WA 3KSCA 2XMLA 3FB5C 1UU4A 3WG2A 1RUI3 4ARYA 3IZOA 3OSDA 3RYPA 2QQJA 3TAYA 1V00A 4YHHB 2HWE3 3SC7X 4ZKTB 3W58A 5FZHA 1FV3A 4YJ2A 4K8FA 4E2GA 3J81N 4RSUA 4OULA 2J22A 3AP7A 4RGKA 1ZVFA 5FYCA 4OHVA 2OPKA 3C7GA 1JZ2A 3HKBA 3WW3A 1FKAO 5I0RA 1RUI2 4AVBA 2EIEA 2WZEA 3DGTA 2C4XA 4IHJA 3QH6A 1QNYA 2HWE2 1JMUB 3LEGA 4LNUB 2B8MA 4F8AA 1HNXO 3WG3A 4DV6B 4LKEA 2JXAA 3ZHQA 3CJIB 5HCFA 2ATKC 1JX9A 1QJY3 2EJ7A 5JAXA 1KC8W 1KEXA 3ASIA 2AYHA 4IEZA 3AYCA 4HNAB 2BSKB 1YFYA 2ATFA 2VWKA 4UWDA 1PK6B 2Y38A 1OH4A 4E4HA 2Y0OA 1IS5A 3AKTA 2ITDC 2Z79A 5GLZA 3N9PA 4JI1B 5IK5A 3RMYA 5EYYA 1CZSA 4KWLA 1QJY2 4YIPA 2Z42A 4C7UA 1PMHX 2RHPA 3V65A 4BXSV 4INDA 4B3RB 3BU7A 4FMTA 1G9FA 4FI9A 5FRAA 2X05A 1GKBA 2PZSA 1OURA 2XB6C 4AQ6A 3DC5A 2C1FA 1SBEA 5FO8B 2RVAA 1K9MW 4CU7A 1RUD1 1YIJV 3F5TA 2AXTZ 2JG8C 1SQVH 1IBLO 4QD2A 4DB5A 4QJFB 3Q4HB 4META 3VZKA 3JD3A 1JODA 1K4DC 3ZO0B 2FDHA 1X36A 5CB4B 2ARXA 5DUUA 2VZRA 3JALA 2R32A 1L1FA 4MGSA 4WM7B 2VECA 2XONA 3B93A 3MIBA 4UT5A 3WW1A 2WABA 5CB7A 2ADEA 3ZSLA 2WFF1 3HKDA 3GBGA 1V6KA 4OUSA 4CDXA 3O1TA 2J7MA 5FP4A 5HCBA 2RDRA 4LO4B 3W7SA 1H1MA 5A1AA 2EIJC 5KLVH 4LF6B 4GKXA 2ZX3A 1O8PA 2VBBA 1PVC3 1VQKV 3T4DA 2HHHB 2VMHA 4Z1MG 2ETEA 4ET7A 3HKEB 3ZKYA 5H5NA 1JZ4A 5LA6A 1JYTA 4DV2B 2RQ6A 2VQEO 2HBUA 2UXBB 3K0DA 4DV4O 2B1GA 1FAYA 4Y1ZA 1QF3A 4NRQA 2X10A 5GZFA 3B09A 2UY9A 4RUEA 1PVC2 5IK4A 1XSRA 2VS0A 1P7BA 2PHWA 4WF9V 4D94A 1H2GA 4NRMA 4Q4X1 3SPGA 1TMF3 2VJXA 1JN2P 4J42A 4LLFA 4NTXA 2QE3A 1DBNA 3GZEA 1AI4A 3FKSG 3JATA 2ZDIC 2P06A 5GJ6A 4KMQA 4I3PA 1HV0A 1XRUA 2QM7A 1KFXL 3ZYPA 2R041 1IVSA 1QR9A 2DUQA 4COUA 1TMF2 4QXBA 5KC5A 1OOPA 4LULA 4J9YB 1V6OA 2P34A 3VBUB 4HG6B 3JD2A 1GP4A 5BY1A 3OMNB 3ROUA 3ST7A 5IVCA 1RXFA 1YFWA 2AHYA 1VBC3 1SQQH 1L7RA 5ITZB 2YV8A 1Z7S1 2CDPA 4FXGB 5FY0A 4ZZ5A 1XU2A 5DAPA 2K1EA 1VB4A 1WW4A 1PL4A 1RUH3 3RDIA 4Z82A 1ST8A 2B45X 4U3FH 5LEKA 2DQ0A 4OX9O 3MV11 5F2SA 2OZJA 4I02A 2NZ9A 3KWVA 2W46A 1W05A 1W6PB 3VDCA 3GWKC 1VBC2 2QDNA 1RB8G 3AMPA 1KJRA 2DURA 2ZGSA 1RUH2 4AVVA 2PN5A 1K5SA 3L74H 5IT6A 2RS32 3THDA 5CFDA 4RS5A 3G80A 4N9IA 3WB2A 1H8TB 3FB7C 2D6NA 3CRQA 3CC4V 1OCOB 3EHKA 1I6XA 3J8F1 1S0CA 3H9VA 3JB4C 3ZYIB 5LP6C 2PUSA 3O7OA 2RDCA 1GP6A 2WWJA 4W6YA 1O3RA 4YYOA 4BHPA 1JOPA 3OBZA 5IWAB 2DVDA 4AEJA 2WLPA 2YU1A 2NYYA 3MI8A 5KA5A 2B7YA 4QDRA 5HI0A 3K57A 4TZDA 4N53A 4PT6A 5FZAA 4QXHA 1OA2A 5TSWA 2WQ4A 4UCUA 3VZLA 1Y74B 4MXWA 5LHIA 5JLVA 2VULA 2WZ8A 1K5MA 5B5EZ 4QPYA 1WBFA 4NROA 3ZCCA 1XPWA 5FO7B 2ZHLA 3OEAA 4UCTA 4QNHB 4YRDA 3AVSA 4AEDB 4WVZA 1SQXH 3O1UA 1S5LZ 1NJIW 3R66A 2AENA 3LFIA 3BAAA 5BNNB 2BP6A 2WNEA 1I5ZA 5L7OB 4ONUA 2DWDC 1QNMA 1BVP1 4LBMA 3CWBH 2ZAHA 1M4WA 2QJ1A 2GDFA 3AYEA 3ACFA 3A7QA 3U07A 2VOTA 3RYHA 3POGA 3I3DA 1RYYA 1WMDA 4YNIA 1C5HA 4JRLA 5CA6A 1OF4A 3GDBA 5JVDA 2YBPA 2DVGA 5CA0A 5DN6G 4UCVA 5DZGA 4MVZA 1S0IA 4K1YA 5KA6A 4ISRA 1ASJ3 4WVMB 2MK3A 3OUFA 2HYXA 2PHTA 3T1YB 1JHJA 3JAWB 4PIYA 2DYRC 3ZMZA 4LF5B 1ASJ2 2ES3A 1IPSA 4GH4B 2ZTNA 2P90A 1KP3A 4UW6A 2IUWA 2B5UA 1YNAA 4YZ4A 4MXVA 5JXGA 4CRQA 4WFFA 2RJZA 1RINA 1O59A 4P5HA 4TT3G 1C1LA 3VDDC 1XMQB 3I97A 1QLNA 2YZ4A 2JVDA 2QR4A 3CC2V 4CUBA 4NIAA 3F2ZA 3ACHA 2KB1A 3K04A 2JEUA 2V5DA 2EZPA 4J7ZA 1R1ZA 1W2BU 2HKXA 4OHZA 4LORA 1EAH1 2ZNJA 4X66O 4LBLA 1HX6A 1FMD1 3SLIA 5A32B 5BPXA 4NIGA 1H4HA 2CTRA 1FAFA 3WNLA 4QKBA 4TSFG 1QKQA 3QOPA 4QQLA 2CH7B 5JCTA 5FBJA 4JI2B 2WAMA 4AGGA 3AC0A 2RV9A 4X65B 4I30A 5IVJA 4XJAA 1HLCA 5FNVA 1RC6A 4ZHQA 5J2UA 3SJQC 2UWAA 4XF0A 3V64A 4R4XA 5C8YB 4QQHA 2ZT9B 1N1YA 1WLCA 3OBAA 1UNBA 4CXYA 1SFYA 4OZOA 1RVF3 2NN8A 3V56A 2H3OA 1WA8A 4LFCB 3E6CC 5EFUA 4P00B 1OOPC 4YVWB 1UL9A 3E8BA 1XNRO 2JDKA 4LF7O 1QEXA 1CXZB 2MW2B 1KGYA 2ZHNA 3N9MA 4MGZE 4DYLA 3ZN4A 1VAVA 3TCUA 4IT5A 1DZQA 4RD7A 1Y4WA 1RVF2 2P22C 5C3OA 4ZY9A 3ZS8C 4LBQA 3C3VA 1PGL1 1NTMH 3NKTA 4PDRA 2Y4TA 4CPBA 1GN6A 3CP1A 3K4ZA 2ZGNA 1YVWA 4U3JB 4PIZA 1W28A 4HZ3A 1GSLA 1L0LH 1CAWB 1L3JA 3UCSC 4LF9B 1AL21 4UW3A 3E22B 2YY1A 1CPYA 1D2DA 1WCUA 4H7MA 4XILA 4OXSA 2EIMC 5CFDC 1V9U3 1HXS3 4RS5C 4DV3O 4X89A 5LMNO 4FJCC 3RYFA 2JJ2G 3O12A 4FFIA 5CIRA 1B09A 3KT1A 4LK7A 1AR82 5FZ7A 1KDKA 4CCEA 1BMFG 5FK7A 3HPNA 2D97A 4O9GA 5KX5B 4I0WB 4PBPA 2HEPA 5C33A 1MS5A 3PMSA 2ZKOA 4DV5O 1DU3D 4CE8A 5HFLA 1HXS2 2ZXWC 2WS91 4JGZA 3JCZA 3VBSC 1ZZBA 4HT1T 2ZEXA 1ZBE3 1N3PA 4N53C 3OFNG 4RR3C 1RUG3 1UMIA 1LENA 5FY5A 3ZN6A 3OY8A 1H0BA 2FDGA 3OEBA 2JEMA 1NVPD 2K9ZA 4XF4A 2WLQA 1K5MC 5FPAA 1JBCA 4AFBA 4IE5A 4B4PA 3ACGA 1DDLA 4OGQB 3Q8FA 2HKOA 5JMOA 3FJSA 1ZBE2 3UV9A 4MVUA 5I93A 2B5HA 5K7PA 1W9YA 3OG2A 1JCHA 3MHSC 3BTYA 4NTWA 5BNQA 1Z2GA 4L99A 4LO8A 3I7DA 1BSMA 1ORQC 1CPMA 3SPHA 3OOXA 2FQPA 5JOWA 1KUQA 1LR5A 2EJRA 4D6QA 4LPLA 3OMIB 3OUIA 4Z07A 3CMAV 2VTFA 4LNVA 2PLV1 5LA2A 3BOWA 4FPKA 2JRIA 1HNXB 5FWJA 1FFXB 3AG7A 2BGCA 1QU0A 5GLVA 2CGPA 2QEXV 2ADQB 1T5EA 3T2PA 4MVSA 4LNUA 1JJ2U 4EN0A 1XDCA 1PGW1 2BFUS 5EXOA 4BISA 1YO8A 3CJIA 4ZBMA 3T4HB 4E8CA 1RJ8A 1X33A 3DYOA 4G3YC 4HNAA 2BSKA 4BQWA 1VJ2A 1OFSA 3IMNA 4TLGA 4XHXA 1PK6A 3ZFFB 5H9RA 3WEZA 2AZ2A 3O1VA 3UO2A 1BHGA 1N4CA 2YUEA 2Q5ZA 3JSLA 3QNEA 3HT2A 4ZHNA 1RSOB 2A9HA 2VVFA 4LUKA 4K3UA 1XE7A 1D0HA 4JDOA 4OLLA 2UU9O 4LHNA 3K75B 3VZOA 3ZYGA 5JMCA 4KWJA 5J2TB 2D2CB 1SDWA 1IQAA 4EE2A 1IBLB 3E8GA 2E5LO 3MF6A 3GBFA 5GTIZ 4AILC 4G2KA 4JASA 2GNTA 5B4NA 3UGGA 1SKVA 4M00A 3K3NA 4EYUA 4CEWC 3GHMA 4BQ5A 4PELA 1MOFA 3I56V 3CX5F 2IXKA 5T55A 1I9RA 1AI7A 2AZ0A 3GZAA 2E32A 4BM8A 4XETA 1SZBA 2PXJA 1YI2V 3H8XA 5CB4A 1OSGA 4V2VA 1VARA 4O4HB 3N27A 1U12A 3ATGA 4WM7A 4DXZA 3GB7C 4QX7A 4B3TB 4AFCA 3DPRB 1XU1A 4BIUA 1VMHA 2DV9A 2WAOA 3ZR5A 1XNCA 2MEV3 3HEIA 2NNUA 5KHGA 4YZ5A 2A73B 1LGCA 1V54B 2WWWA 1F4NA 1AJNA 4Y1UA 1M06G 1JS9A 1XSQA 1TUEB 3N9NA 2CK3G 2FYUH 1DGSA 3UGHA 3LSUA 1VRBA 4QX0A 4TUYB 4JPRA 2ZZJA 2LW1A 2VQEB 4UV9A 3M1HA 4DV4B 4BK4A 4KWKA 2GALA 2A0LA 4QB1A 2DFCA 3AM2A 1QJFA 2MEV2 3HKEA 1PZ8A 1ACCA 4ASKA 1BE3H 2QWRB 2PTMA 4AFDA 4ZU5A 4IEOA 4UFHA 1WCSA 1XNDA 4DUYO 2UUBO 1OCRB 4LA2A 2RMU1 5JZGB 1LHUA 1RUF1 3WX5A 1AX2A 2XJVA 2Q67A 4GKJO 1PZ7A 5LBFA 2ODMA 2WNVC 3M99B 1S4CA 2ZJCA 1OLMA 5FOBB 1BKZA 1SQ4A 4FOVA 1RM1B 1YEWA 4HKWA 3RYKA 2AREA 2WBKA 1UPIA 2JK5C 2Z0AA 5F5CA 2J1UA 1HB4A 3ASNC 2P4KA 4CH5A 3UJQA 5FZDA 2PQQA 4EQVA 3GWOA 5EJ1B 3VBUA 2ZZQA 3W7TA 1TGOA 2Q0AA 4IIJB 1VP6A 2ET1A 3LE0A 4AZZA 1QQP1 4LF8O 3S5QA 2FDKA 5F9TA 2CAZC 1V6NA 2PGGA 5A9GA 5EQUA 3FMGA 3ZVXA 2GV9A 3QBQA 5ITZA 1AR73 1EZJA 4OX9B 1Y9GA 4EN7B 5ANNA 3P3PA 2DYSC 1XNQO 2OTJV 1WPBA 2Y64A 2G1MA 1W6PA 3B9CA 5AC91 5IFTA 1HB2A 4MGQA 1ND3B 4COZA 2ZM6O 4ZOLB 5FQ0B 5DUWA 1PMIA 3D36A 2V73A 1MNGA 1B35C 5JSOA 2CAVA 1YTFD 4L0PA 3BVOA 3AG1B 2XAGA 1H8TA 4BAYA 2W52A 4DQAA 3P1IA 3LDKA 1C8M2 5FXWA 1AR4A 2X0LA 1CIYA 4GZRB 1IBMO 4JZ2A 1Y7BA 1ZZ9A 3ORJA 1LU2A 1S72V 3H1HH 3JASB 4LT5A 5FJKA 1XYPA 1NLQA 2QQIA 3VBFC 3KV6A 4AI3A 2WYFA 3N36A 3WDXA 1G9BA 5C6CA 4N7UA 4Y4YA 4AHXA 2X6CA 3ABTA 1IGOA 1Y74A 1HQLA 4P9GA 2KG7B 3JU9A 3CJIC 1SCSA 4OPAA 1W8TA 1H2KA 1RUD3 3SJAC 4QQOA 2WNOA 3K9SA 2YEVB 4Z92B 2TEPA 3RSJA 2A3YA 1PK6C 1N3OA 1QWRA 1NVPB 4AEDA 2Y6LA 5DM6V 2Y0IA 3E6BA 3JYCA 4X8PA 1C5IA 1ZREA 5BNNA 2EULA 2XNDG 4JI6B 3NV2A 3MV01 5L7OA 5EC1C 3GJAA 3QO5A 2VQAA 1DFQA 5EIYB 3ZMUA 5CG8A 1RUD2 5IWFA 3ZDSA 1MS3A 2YXHA 4IXLA 1NCQC 3UKVA 1PVXA 1RL3A 1SLIA 1HRI1 3N4MA 3C7HA 2P6JA 2K0GA 2WFF3 4YJ3B 2BOIA 5DABA 3KQRA 4JAUA 3WUDA 5LA0A 2DBIA 4GKKO 3ZRSA 4YGCA 1XBFA 3ABKB 4P08A 5LRSA 1YZBA 1PO12 4XYXA 4WVMA 1L8DA 4MHUA 4HL0A 4FPLA 1FNYA 2XDVA 3LA2A 2WFF2 4IQPA 1WGPA 2XG3A 4AW7A 4PD4F 1JYWA 2FDFA 3BUCA 4RYDA 3JAWA 1Y66A 1WCDJ 4WM7C 4FVVA 4GH4A 1UMZA 3SCFA 2XHBA 2FL4A 4CDWB 3BA8A 4JV5B 2OTLV 1CAXB 5FL7G 1OF3A 4KWUA 3UYJA 4A45A 4Q4X3 2QKDA 1GH6A 4CEYB 3ETGA 3J4UH 2Y6JA 1BLZA 3NNJA 4X6QB 4QPKA 5FZLA 2EALA 5IY5B 3WQBA 4X66B 3GZTB 3BHPA 5JIUA 5FYTA 4GX0A 3EYPA 3HNBM 3NWKA 1PIV1 2R043 2X09A 5DG2A 3DN7A 4Q4X2 1OV9A 5A32A 2QQLA 2V72A 2R16A 1S0FA 1Q8IA 3LA7A 2Q7GA 2JDUA 4FXKB 2EXJA 3GHNA 3WDTA 1UOFA 2A70A 2CH7A 4MTOA 1LEDA 3UT0A 4AQ2A 4CS4A 4JC1A 2IW5A 5F3GA 1Z7S3 2R042 3FX3A 3K4AA 1AP5A 1ENQA 3CRRA 4OUEA 5A3OA 2Q8CA 1KU9A 3N35A 4Y22B 4IEPA 1AJPA 4HN1A 3K5LA 1UN1A 1R6TA 5C8YA 5I0DA 2ZKLA 2ILMA 4EKWA 5GKAC 3VQYA 2JDPA 1KS5A 4QPGB 3SCHA 1V9PA 2BUKA 4RWUA 5JCOA 1XNRB 2IFRA 4LF7B 1HV1A 5E6HA 4ICGA 3LDDA 2JICA 4DR4O 1QQCA 1Z7S2 1N0NA 3JD4A 1MEC1 1AYN1 5KXEA 3VBUC 5LXTB 4YVWA 4LLOA 1HW5A 1FXZA 3RI9A 1LOEA 2ETNA 1EPZA 5C3SA 4MO3M 5B3SB 4G27B 4XBNA 4P9OA 3ZR6A 2BEOA 4M3CF 3USUB 3CXHF 4FPGA 2H6CA 4R9AA 4MUVA 5TISZ 3UKTA 4BU2A 3S7IA 3J8F3 3PIJA 3DXRB 3V0BB 4IV3B 1HJFA 2JDZA 4AHZA 2W6IG 4DY3A 2VL4A 1I08A 1OCZB 4D7YA 3VHOA 2PY5A 2W1SA 1X7NA 5ISLA 2VZOA 4U3JA 1S0BA 4H13B 5F39A 1LAJA 1R6KA 2Q1MA 4DV3B 5A7SA 5LMNB 1CAWA 4BA6A 3ALQA 3J8F2 1YRZA 4NHLA 1IOAA 4I2OA 2EIKC 3E22A 1U5ZA 4JGYB 4CH3A 2A6WA 4L97A 4QDSA 4QX2A 1H8TC 4J25A 2A6YA 2BTVC 1N36B 2E31A 5I8YA 4JDMA 1PV0A 1US2A 2DVFA 1OCOC 4DV5B 5T52A 2YC4A 3KV5A 2A3WA 5KX5A 3MYXA 2Q69A 2G9ZA 1RUJ1 1W9FA 4F3JA 1C1FA 2Y34A 2EZOA 3DSQA 4DR3O 4NIIA 4BQ1A 1MG1A 5DZEA 1OQ1A 1OUSA 2B46X 4E9KA 2GN3A 1SQPH 2Q1ZB 3ZLIA 4XJWA 1OD5A 1NUKA 4CP9B 4FFFA 4ASLA 3ZMOA 1LB2A 2X6BA 1NCRB 3FYIB 2LS6A 2CU5A 2NN4A 4C8DA 5LWBA 2A1XA 1DK1A 4AEDC 4IE7A 4IGGA 4AL9A 4IV1C 5BNNC 3C2UA 3ZN1A 2BU9A 4TV8B 5L7OC 3SNMA 4ZPIA 2AHZA 4X9QA 4K9SA 1ZRCA 2ZGOA 3C3TA 3T09A 2XJQA 3FL7A 1YTFB 3A0HZ 2VQ0A 4JI7O 1UZ0A 3AZZA 2CWSA 5EJZB 1COWG 1KITA 5FUIA 3LIGA 3FE5A 2ZBJA 1FFXA 3G71V 1T2XA 2FDIA 4XUQA 4HPKB 1JUIA 2D43A 1OD3A 4PHZA 5C70A 3LQCA 4XUPA 2XLFA 4FFGA 2RJ2A 4IEXA 5FLXN 3TJTA 1QHTA 5E8AA 3M8LA 4G28B 1MR5A 4L8JA 1EAH3 2ZGTA 3M3CA 1CONA 4OI4A 4UAPA 1SZTA 4KU7A 3ZFFA 3PURA 1FMD3 2Y33A 2IJJA 1P8JA 1F4MA 3RGBA 1VQPV 2UU9B 4Q4V1 1QHDA 3U37A 2QGNA 4EZ4A 3POSA 4NB5A 1RSOA 4M0HA 1V70A 3R4DB 2E5LB 5EV7A 1P49A 2VMFA 2I74A 1EAH2 4PA4A 4XFCA 2ZX0A 4JTNA 4CP1A 5LY1A 5J2TA 4R9CA 1VIBA 1FMD2 2QA4V 4BQ4A 1XE8A 4ARXA 2DJVA 5LY2A 4FM0A 2FD8A 1NKGA 1OFNA 1YIFA 3FBMA 3ZHTA 1R3LC 4XMIA 1QBZA 4X64B 2BCCH 2X7RB 1LHVA 1DQ2A 5LZ6A 1U96A 5FLIA 2QTWB 3AK2A 1DZTA 1X4TA 3VKNA 1G9DA 4P9WA 3ZRXA 1VEWA 1O7FA 2VCAA 1W6MB 4O4HA 4HN0A 5LMUO 4PI2A 1ZRFA 3Q8BA 2J1TA 3FWEA 1P84F 3DPRA 1BQ0A 4FLVA 1JOJA 2Q8VA 3O0WA 1DGLA 4ES8A 3AK1A 3ACLA 4LE4A 1YHFA 2C5DA 5JCOC 1M90W 2CV6A 4J1XA 1BGYH 4XCBA 5ERLA 1X59A 4XIKA 2RM22 1PX3A 5LL6Y 4TUYA 3T2TA 2BOCC 4LO5B 2J42A 3TRSB 3VB9A 4NIDA 1AL23 4F6EA 4I9QA 1UWWA 3IKWA 1LOFA 3PL0A 1PGL2 4XAEA 4DUYB 2UUBB 5FYMA 4K1ZA 1DF0A 2WR9A 3MUZ1 1VQ9V 1W03A 5BNPA 5LATA 4BIOA 2F95B 1ODNA 1JOBA 5H9QA 3LDCA 3NJVA 1H8HG 2XT9A 4D6SA 3FX7A 2BZDA 4GKJB 4HLTA 3AKRA 3MPBA 3S6PA 5JZGA 1AL22 4BQ2A 4LE3A 3X2QB 3H1KH 2W2IA 3WV6A 2WS93 3POFA 3P30A 4JTAB 1O3TA 4NHMA 2P5OA 2NMOA 4M3CB 4GX5A 4I0BA 3CCRV 4AF9A 4LR3A 1W9SA 2LFSA 5FMOS 2XAFA 2YBSA 2VC9A 3AP6A 4LF8B 4N90A 3MFCA 3V0AB 2WS92 1JZ3A 3H8RA 2V4AA 4IIJA 4JI3O 3T2QA 3DC6A 1CAVB 4GX2A 4MVTA 5L3BA 4GWIA 1N3QA 1XNQB 3OGSA 3X29B 4UF0B 1OI6A 4D6RA 1W0KG 1JHNA 3K03A 1PMJX 2A6ZA 3H9AA 1VAKA 2ZM6B 2PLV3 2Q0OC 1H9PA 3U75A 2XKOA 4RAIA 4ZXKA 3C7EA 1ND3A 2E51A 3POEA 4CH6A 3R65A 1DQ1A 4XAAA 4ZOLA 1SEFA 5FQ0A 4GAZA 2RJKA 3RI8A 1JYIA 1IBMB 3FB8C 5T3NA 1XNBA 4SLIA 4YG3A 4BLJA 1KJLA 4LFAO 3EBRA 3SEEA 5KHKA 5B2GB 3LDRA 4GQ7A 5LBBA 4BOWA 2QQOA 2QWNB 3VHPA 1KS4A 3KVAA 3EJKA 1IKPA 1WW6A 4S2HA 1KMIZ 3JASA 2C24A 2YI9A 2RR11 4IUGA 1QH7A 2ZS6B 1PGW2 2QM4A 1RUE1 1XILA 3ZSJA 1E5SA 4IEUA 4PI0A 5LP6B 5FY7A 5I0SA 4UCSA 3JZVA 3DKQA 1U97A 5A1FA 1QDCA 4R6ZA 4B7KA 4DR5O 1W0PA 3OPZA 1FPN1 5FZ8A 3CIHA 2KG7A 2W39A 3POIA 2VY0A 3O14A 5A3UA 5JXIA 3OE7G 2VTXJ 2UWCA 5B1BB 4CVUA 4FP2A 4PDMA 2WLKA 2YEVA 2DCYA 4AGRA 2XJSA 2EINB 3ZFFC 2GTAA 2ZGPA 4K8ZA 2R49A 4XXAA 3FB6C 4O2BB 2NPIA 4XEZA 1IPJA 4BMBA 1W8UA 2DUPA 2M6YA 1HIXA 2JDAA 4QX1A 4LWSB 4X1KB 1LU1A 4XDQA 2DF7A 4A41A 5F7UA 4B3MO 4FLWA 4GKKB 1AVMA 3LSQA 1XYOA 2BOJA 4WFBV 3PVNA 4YJ3A 4AAPA 1K5JA 2ARBA 3UT5B 4EJRA 3A0BZ 1ZZ8A 1QJX1 2BYVE 2RS51 1WA6X 4QHOA 4GWJA 4QPWA 1VE0A 4Q8LA 2OQ6A 1OZ0A 3ZRWB 3U10A 1W8FA 2V09A 3APBA 1ULFA 2WA4A 3N7MA 2WLHA 1GP5A 1QXPA 2D6KA 3B00A 5EBLC 3G6EV 4FM2A 5L3GA 4XFFA 3BPSA 3I2OA 1MA1A 2YUAA 3VUOA 1PNKA 2KXLA 4QM9A 3DPRC 4NOTA 4UXAA 4IESA 2CUGA 5ABJB 2RMU3 4I3GA 2IU3A 4CH4A 4CDWA 4Z2AA 2HLDG 1CAXA 1RUF3 1GZWB 2DYRB 5KBFA 1V54C 1YQ2A 2R1DA 1G8WA 4PDWB 4CEYA 2QFEA 2QKCA 2ORZA 1R1A1 3PJYA 4Q8KA 2XTAA 2IXLA 4JX0A 2OZ6A 1GV9A 4UB8Z 3HPLC 1LOFC 2RMU2 1Q6HA 4QQPA 2BOBC 1OQDA 2WUHA 5KC6A 3C3SA 1RUF2 5L3EA 3CC7V 3MBWA 2JDNA 4N7IA 3A8TA 3VDDB 4DW0A 2QTOA 2XQXA 2B39A 1OCCC 1QXRA 3ETPA 4NO4A 3TEYA 4MSVA 1OCRC 3CPWU 1QQP3 3AVRA 4J11A 2R1BA 2WKKA 1I5YA 5A70A 2MHFA 1WMFA 2JDIG 1LECA 3QD6A 3FFQA 1LGBA 1O9HA 2QQWA 4UW4A 4IL6Z 1DQ5A 4M4RA 2P2KA 3WQ7A 3FZ3A 1WD3A 4Y22A 1AZDA 2XVGA 4DR4B 2XJRA 4LH6A 1QQP2 2Q5TA 3LNNA 4QPGA 1R3JC 4PJYA 5JWPA 3RZHA 5AC93 1Q7YW 3EO6A 1W59A 4UI9L 5FREA 1HKDA 4FLTA 1NLSA 4AE2A 5LXTA 4O65A 2EICA 3N3HA 3POBA 1CIWA 2W1WA 2JDMA 4NWVA 4HETA 1ULPA 1S0GA 3USUA 2BVVA 5AC92 2HFEC 3OPTA 3OJBA 4Q0QA 1UW8A 3DXRA 3V0BA 5FPBA 2AGAA 4IV3A 3ZXDA 5FZ4A 4Q0VA 4A42A 3UNPA 2HEVF 2VVDA 3SXWA 4COVA 3IC7A 4DRRA 1Y76B 4C0BA 5DAXA 5FYHA 2GBOA 2NP0A 1PNLA 2Y6FA 1QLEB 1ND3C 3CYOA 2HG5C 4AK3A 4F4LA 1YCIA 1WB7A 5F32A 3MW4A 4JGYA 4UCOA 1BVVA 4YGBA 2CE4A 4D69A 3AG1C 2QDRA 1FD9A 1EUUA 1DLCA 1PM4A 5JDBA 2RG4A 5F6KA 4CS2A 3W9AA 3SPJA 5IK7A 1HR0O 4DR3B 3RVYA 4UFKA 4JAAA 3WT3A 1GANA 4PLOA 4JKLA 3TB0A 3N2GB 3BTAA 4P9LA 2XOMA 3R0RA 3LPFA 4DINB 3JB8A 4MZUA 1ZSPA 3TXQA 2PF4E 3AJZA 1BZKA 1HRI3 5FAXA 4J1WA 3AP4A 4CP9A 5F2VO 2ZXWB 3T1CA 1UXXX 1AJQA 3VBSB 4LIVA 1AR81 2QQUA 2F4VO 2HBTA 5IE9A 3VHRA 1NCRA 2W3JA 4B7EA 4EFEA 5KMGB 4RR3B 1A34A 2XXZA 3E83A 1VBE1 1GM9A 4ASUG 2G19A 2Q7HA 4OI2A 4HMZA 5FY9A 1HRI2 2XUEA 4K35A 2OT7A 1B6QA 2UWBA 1S0DA 3TGUH 4TV8A 4JI7B 1SPPB 5EIBD 1J5EO 4KGGA 2CTQA 3ZPYA 3FAVB 1FT9A 1MZ5A 1UY2A 2HLEA 1ZZCA 2FMYA 3LDEA 1MZ6A 1I5XA 5C3PA 2UYAA 4G9SB 1DP0A 2XL7A 4HPKA 2WL1A 1STMA 5CFCC 2EX3A 1M93A 1ENRA 2E33A 3KCCA 2R9RB 4H7LA 4PA3A 5A1LA 1G6NA 1SACA 3AKQA 5A3MA 5F8PA 1AHSA 2GC1A 5KUKA 2E7QA 3ZPOA 2FB5A 1Y9MA 1VBD1 4ZU4A 2VH9A 3AMMA 1PIV3 3IN9A 3B01A 2CWMA 1IDSA 2VBDA 4XDJA 3WXPA 2R061 2UU8A 1Z78A 3ZKUA 3RW0A 1IG0A 4IEWA 5DAWA 1V55C 5FKBA 3JD1A 1NXMA 4CDWC 1SDDB 2CSGA 5JPNB 1CX4A 1EN5A 3E8HA 3N7JA 4WVVA 5KWRA 3A22A 3U4XA 1H1IA 4I50B 2IJHA 3NV1A 2CY6A 5IY5C 1JU3A 1WN7A 5IJ0B 5GLTA 4E8DA 5EK0A 3QTCA 4RGGA 1IS4A 2WLIB 3K0GA 1Z5VA 3AZVA 1E1QG 1SRYA 4LTAA 2JD4A 2Y6KA 3CRAA 1Q6UA 2VAUA 1RMU1 5FPVA 2WN2A 1HWYA 4YVSB 1MEC3 5LMUB 1AYN3 1QU7A 3E5UA 5GTHZ 1S3JA 4DUXA 4CZZA 5C4WB 4CEWB 1VQ7V 3CQOA 4QB2A 1MPXA 1W6MA 3O1RA 3TN91 1NA1B 2JIZG 1SFNA 3BA9A 1ULDA 5CVRA 3GVMA 3RYCB 3VLBB 1MEC2 1AYN2 1NXD1 5IK8A 1J3RA 5IYZB 2FKXA 4FTEA 2Q68A 4QPGC 4H33A 1MVEA 2UY8A 5LASA 2WDBA 4EN6B 3PTRB 5EZYB 1GOGA 5DUVA 4LJHA 4XUTA 3J7LA 3K5MA 2OQ7A 2DN9A 4PBOA 4P9YA 4JYYA 3HN1A 5GONB 4QGMA 2AC1A 1W2NA 3MEPA 2ZIMA 5L9VA 1YXWA 5HV0A 5JSPA 4IV3C 3D3QA 2D3RA 1AB3A 1COV2 2K46A 4IYHA 1OCZC 5JVVA 2PYTA 1RUJ3 2AW9A 4NR1A 1DGRA 2JIJA 1R091 1F7YA 4OHYA 3LEKA 1FYUA 3CMGA 3KF3A 1YC61 1XHXA 3TNPB 2XQRA 4JGYC 1LOGA 1QXJA 5J37A 1VP7A 4JI3B 2Y69C 3R4UA 4TQDA 1FS0G 2WNVB 3V0AA 3D0JA 4B4QA 1N34O 3AG2C 3BODA 2HWC1 4Y20B 4PF5A 4C91A 3RBZA 1W8ZA 2DVBA 4PA7A 4MHRA 2R6QA 4WV8A 3LB9A 1CAVA 4DO0A 1GQGA 1BQZA 1ENSA 2Q8OA 5CBFA 5GZEA 1GMMA 2B4KA 3N9QA 4P02B 3UETA 1U0AA 1VF6C 2R0HA 2DVAA 3SJBC 5E1AC 1BZWA 1C4RA 5FPXA 4UF0A 3KZIZ 5FMDA 3AFKA 1SERA 1VQ6V 1EN6A 2D6LX 1V6JA 1FOD1 4BXFA 1H2LA 5T5LA 4N9HA 4YZ3A 4CCLA 3L71H 1NCRC 4DV1O 4NYKA 3ZXJA 4CYDA 1JYVA 1Q81W 2YXSA 4WZCA 2BRTA 4LFAB 5H6RA 2GNBA 4PCRA 4K6BA 1AROP 3ACIA 3ZHRA 1O8SA 1C57A 1VB2A 5IVYA 2WQ8A 2ORXA 2GAUA 1DIWA 4HVQA 1N8RW 1B35B 5A80A 4RGAA 1MMMA 1RIRA 4M01A 4Q4V3 3T0DA 3ZRVA 4Q4Y1 1NZIA 1A8MA 4A5UB 2OYZA 5KR7A 4Q6GA 5LOVB 2BFUL 1K4CC 4DR5B 2LW8A 5LP6A 3I2KA 4LKFA 3MHHC 1OUXA 4QE9A 4BE3A 2YIDA 3THOA 2B9VA 2HJFC 5FZ9A 4IDZA 2PHRA 1Q82W 2C9AA 3VBFB 5J7MA 4HYOA 4E2SA 1C8M1 4Q4V2 3VV1A 2BGPA 2ZPXA 4QE7A 5JJNB 3NR7A 5A2QN 1OC1A 3KHBA 2ZX2A 3STZC 1NY71 3MIDA 4O2BA 5K0UC 4NHXA 4B3MB 3WD5A 1VQOV 5APAA 3RVZA 2ZMNA 4J7KA 4O2AB 1LOBA 3NV3A 2QWQB 4LWSA 4X1KA 4KHPO 2P4EA 1O3SA 3SEPA 5D5PA 1EM1A 3A4UA 5SV5A 1UZVA 3URFA 3UT5A 1T6GC 1UF2C 4AI2A 3HWJA 5HCAA 3NJYA 5B1NA 4H44B 1NCQB 4H14A 3ZRWA 3B69A 3LSDA 3WG4A 5A3NA 3M3IA 2P4VA 3JCIA 2BGOA 4UUJC 5J09A 2WA3A 1XXNA 3EQEA 2XAQA 4XBQA 5E79Z 3DYMA 3IMMA 4NPMA 4Y24A 4JTDB 3IC9A 3RVHA 3FD9A 1VALA 1UX6A 5HFMA 1GQHA 1V6MA 1QNWA 4TXWA 3KV4A 1CESA 1YFXA 3FYEB 5ABJA 2DFBA 4TTGA 3AXDA 2VZQA 2XUMA 1GZWA 1PO11 3AFGA 1S5HC 1YLLA 3PUHA 3K06A 1T6BX 2WJSA 1NH2D 2VWJA 1ZL8B 5A6XA 3I3EA 2PHDA 3BB6A 3DGEA 4B3TO 2J1SA 1XI1A 1IKQA 1NZCA 3IIAA 4CCKA 1ND2B 3WNNA 2C26A 3VDDA 4XF3A 4DR1O 2NR5A 2FCUA 1TZOA 1WWYA 3AZWA 1Q6IA 1ZRIA 2P6HA 1J1TA 1VR3A 2Q4SA 4L11A 1URFA 2VMDA 1OXCA 2PHLA 4YGDA 3STLC 3QO7A 4AHWA 3SH4A 1IXMA 3X2QC 4UFIA 4QAWA 3VZJA 3OUSA 3TEWA 1M56B 3DKWA 4H2AA 3OUJA 3K77A 3OR7C 2DTYA 4MW3A 2JE9A 1F5JA 2ZE5A 4LBOA 1W8OA 3ZSMA 5CBGA 3BKZA 4KUMA 2ZGQA 1E57A 2JJ1G 2W95A 3ZFEB 3AEIA 1JMKC 3WG7B 3LIHA 1CJPA 4Y5SA 4HVOA 2L9LA 3IPVB 2R7EB 4TYSA 1YJNV 3WG1A 2IM9A 1TEIA 4NAOA 4L8QA 3HB3B 3QG5A 4KQ7A 3JAKB 2C2AA 4PQQA 1J58A 4DOUA 4X1IB 5C8CB 1Q8PA 5FPOA 1GN3A 5EHDA 3OT7A 1UFIA 1N33O 4JZRA 5L36A 2OA2A 2RR13 1VQ5V 2ZNIA 4LF4O 1F31A 2GN7A 4E4SA 3IDAA 1Y76A 1D4M1 2YB7A 2FMDA 2ZMLA 5CU1A 2PHUA 1JQ0A 1RUE3 5HXVA 1OHHG 4W4KA 4D6TH 3P3NA 2RS33 1MZFA 2X6AA 1WZXA 4JI0O 3ETEA 4U7OA 4UW5A 2XLAA 4P9IA 2RR12 1FPN3 1HR0B 2D6PA 3T30A 2QZ3A 1W6NA 3B7MA 3HIFA 3BIWE 1UU5A 4E4ZA 1RUE2 2G9FA 3AK0A 3NMBA 1H38A 1PPJH 2P37A 2EIKB 4AI9A 1CAUB 2VMEA 5KXCA 5G05L 3A21A 5FZBA 1DLLA 4PA6A 2GMEA 3N2GA 1FPN2 4OCTA 3HT1A 2CL2A 3CCQV 4FFBB 3CF6E 3G7DA 4FLXA 4U36A 1WP8A 2F4VB 4A6SA 4AWDA 3ABMC 4JI4O 4GMP1 2QSAA 2GZWA 1ULCA 3VBSA 1CP9A 5F37A 5FY1A 4YG6A 1ZRRA 1EZVH 5I0UA 1QJX3 2RS53 2RNBA 4DMIA 3R4SA 5KMGA 5B1BC 4RR3A 1D4VB 3CU7A 4URAA 4FIPC 1B04A 2EINC 4FK5C 2ZABA 2Q8DA 5BY5A 1J5EB 3WB0A 1DF4A 1HB3A 2YI8A 1K12A 4J7JA 4ASMB 2NM1A 1TUBB 2WT1A 3H42B 1SPPA 5A7OA 1XNKA 1O4ZA 1QJX2 1YSCA 1N47A 2RS52 4XZUG 3T4ZA 3GJBA 4UFMA 3FAVA 1LOCA 1CJDA 3OGCC 2E53A 4LR4A 4CCJA 2DTWA 3AMNA 1UYPA 3LA3A 4RQPC 1CD3G 4IV1B 3R6SA 4YARA 4MYEA 5BMVB 1GZ9A 1BMV1 5ACA1 2BVBA 4P5YA 4FT8A 3VHNA 1K5QA 2WT2A 5FZ1A 4BYYA 1HNWO 3KT7A 1U5YA 1PHMA 4JI6O 5CMUA 1R1A3 1CZTA 5JI9A 2QKSA 1ZRDA 4N23A 5DG1A 4GXLA 1QOTA 1GKFA 1W2UA 2BW8A 4I4TB 3M7MX 4ZIBA 5FXXA 1NOVA 1R1A2 1WW7A 4FCAA 5EYPB 5ABJC 3ZXKA 3UJOA 3EMRA 1JW6A 4C1XA 4B8EA 2P6CA 5FPUA 4LBNA 4PDWC 3RYRA 2WSUA 3PJQA 5C9AB 5FYVA 4LHLA 1J59A 3U1XA 4I50A 2HVJC 3KG2A 5HBAA 4W65A 2SLIA 2VW2A 3DXUA 5IJ0A 1J1LA 3NJXA 4DFSA 4R9BA 4XF9A 4LO6B 3VD7A 2OXBA 2UXCO 2E6VA 1I0HA 1M57B 5H9SA 3G67A 2E7AA 4GYCB 3VKLA 3WNOA 2WRAA 3MZHA 4JV5O 4Y1XA 2HH9A 2X8KA 3S0MA 4YVSA 1US3A 4AAXA 1FJGB 1XL4A 1PNGA 2P3JA 1AXKA 1WLTA 5FFOC 3UQ8A 2IU0A 2L35A 4Q0PA 4E2LA 3W20A 4CEWA 3SKVA 1EY2A 1TVGA 1PNFA 4Y1VA 4BIFA 1I7FA 4HOOA 3I5DA 1NA1A 3MDPA 1HB1A 4YW2A 1UKGA 1LEMA 4P14A 3SITA 2ARCA 5FZOB 4EEQA 3VBRB 3RYCA 1YJWV 3BFRA 4RA0A 4AEKA 4COYA 1AXZA 4N8MA 5K1XA 5IYZA 3K9AA 5GW7A 4XE9A 2HWB1 3B2EE 2IWGB 2ZGMA 3F5WC 1ULEA 1LHNA 1IURA 5EZYA 2OIIA 2X53S 3K48A 3VN4A 3WF3A 1UO9A 3LOIA 2B1IA 4R7CA 4IGOA 3JD0A 3SPIA 1AUYA 3MW3A 1KKCA 5GONA 3HJRA 1ZWIC 4WZFA 4NKGB 3PHMA 4CUAA 3ZIXA 1NH2B 5FUNA 4QXCA 3BGAA 1WW5A 2TUNA 4JYAO 1W8WA 1DF5A 5L19A 1W6QB 2OWOA 2CDOA 4IE4A 5BR8O 2WZPP 1MS0A 5JI7A 1GNZA 1MS8A 1WBLA 1YFUA 2RM21 2XVKA 5HXMA 4AGVA 1I5PA 1QLEC 3ZSKA 3I2GA 3AKSA 2QZ2A 1UMHA 1TNRA 5L3CA 2ZHKA 1N34B 3KVBA 4GCZA 3WNPA 1GLHA 4JTCB 4UVAA 3T1HO 3I4IA 3THCA 3D3AA 5DEDA 1AR83 2ZHMA 2D93A 3CCSV 2WNVA 4CCCA 4OQ9A 1DYOA 1LOAA 4Y20A 2VZUA 2VMGA 2UUCO 2YDEA 4BWOA 2OT5A 1VBE3 2PAKA 1EV11 1V9U1 3NQHA 4UFJA 1VQLV 3GF6A 1G1XB 4EROA 1S55A 1TVKB 3HR0A 2J1EA 1X8EA 3MD0A 3F7YC 3O0XA 1W0OA 1N36O 3OGGA 4GD4A 3PDQA 4DV1B 1VBE2 4OMCA 3ZDVA 3ZYRA 1UZZA 2VO5A 4AVAA 2EXHA 2YIBD 3TETA 3IDBB 1O5UA 4QHZA 3MDSA 3LPGA 4MVRA 3F95A 4EN9B 2ZMKA 2VXJA 3ILNA 3NVCA 3ZHSA 1YXBA 1AF9A 3ILRA 4F83A 1THZA 1NT0A 1JZ8A 2ZCEA 3AX4A 4NPLA 4D0QA 4FQZA 3G4SV 3IIIA 2XPJA 5AVPA 2IJKA 3ZX7A 4DEQA 3LFMA 3MLLA 3RWKX 1JYXA 4BH9A 1VBD3 4PIXA 4ISQA 4FPJA 2VOVA 3B77A 3I54A 2EAAA 1B35A 1REDA 3VBOB 2JG9B 1BXHA 4GWMA 1VBA1 2R063 2WLNA 1W8HA 3ON7A 2LQTA 4UCRA 2PA7A 4XABA 2ZXQA 4DXTA 2ZE8A 3AB0A 5LOVA 3MLJA 3OTOO 4TLFA 4CU8A 4PLMA 5LCWL 1WP7A 1VBD2 2JE8A 3VD9A 3LZZA 1PNMA 3ECQA 1NQTA 4XZPA 5FZ6A 3VBFA 4IW3A 2R062 3ZX6A 2YICA 1AX0A 4QB6A 4V1PA 1PP9H 2DW4A 1EYBA 5EBMC 4RFT0 2RN9A 4CCDA 3ASOC 2XJUA 2ZA9A 1QCEA 5DAVA 2PMWB 4LA3A 3K59A 3L9DA 3GCWA 1UOJA 4LFBO 4BWAA 1F4HA 1RMU3 2EF6A 3Q8CA 4MTFA 2ADPA 3CJHB 5CKNA 3WINE 4E4DX