1N33O

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n33O00
1HR0O 4OX9O 1FJGO 1DK1A 2F4VO 1HNWO 3M8AA 4DR1O 4GKKO 4JI1O 1I94O 4X65O 4YY3O 3RT3C 3O65A 4JI5O 2ZKOA 4LF7O 1XEQA 1N34O 4LF5O 4OPHA 1NS1A 2DJVA 4OPAA 4DV5O 1X59A 2N74A 5BR8O 4JI4O 4DUYO 4DR6O 1XNRO 5BY1A 4DR5O 4JI2O 5H5NA 1XMOO 4DV7O 1XMQO 1N36O 3T1HO 4NXMO 2UXDO 4LFAO 3J80N 4JI8O 1G1XB 2AGAA 1D2DA 5IT9N 1FKAO 4K0KO 4DV0O 4X66O 5IWAO 2FKXA 2VQFO 1IBMO 4AQYO 1IBKO 2UUAO 3JAMN 5BXZA 3J81N 5LMUO 4LFBO 4DV6O 4GKJO 3R66A 1A32A 1HNXO 4DV3O 1R6TA 4DV2O 2LW7A 1HNZO 4DR4O 1FYJA 4YHHO 4LF4O 4DV1O 1IBLO 1N32O 2UUBO 1AILA 4LFCO 4LF6O 4B3SO 5LMNO 4JI3O 4DR2O 1R1BA 2UUCO 4KHPO 3OTOO 2UXBO 3SDLA 1XNQO 5LL6Y 5A2QN 5FLXN 1YZBA 3J7AU 4NXNO 2UXCO 2E5LO 4JI6O 1AB3A 4JV5O 4DUZO 2JRIA 2VQEO 4B3RO 4A5UB 1J5EO 2ZM6O 3F5TA 2DOSA 4JI7O 2UU9O 4X64O 1N33O 4LF9O 1F7YA 4JYAO 3T1YO 4X62O 4DR3O 4DR7O 4JI0O 1KUQA 2Z0AA 4DV4O 4LF8O 4B3TO 2HHHO 4B3MO
chains in the Genus database with same CATH superfamily
2IU0A 5BZBA 1RSOB 3W7WA 1M56B 4HNAA 1WJZA 3RYHA 3BCCH 4LF9B 5J2TB 1H2KA 2IJHA 2AZ2A 1QHTA 1VP7A 3C3SA 2N74A 3OR7C 5CA1A 3CRAA 5BY1A 1YF2A 1XMOO 3STZC 5B5EZ 4DV7O 1ZL8A 2GV9A 3D36A 1OCRC 3SJBC 4J9YB 4JI8O 2ZDIA 4X88A 1P7BA 1K97A 3K9AA 4HNAB 3U11A 3RYFA 3DSQA 2IJJA 3E8BA 3JATA 2VWJA 4PHZA 3ZRWA 1WA8A 1XMQB 4FFKA 3LUTB 3SPIA 4QE7A 1Q82W 1AP6A 1IVSA 4N21A 5CA1B 3G71V 3E8GA 1HNZO 1S5HC 1OJHA 3AG3C 4W4KA 4O4IB 1FYJA 1H2NA 2E74B 4PA9A 3W7SA 1IBLO 3LDCA 1QLNA 3SR2C 1DTOA 4MVUA 4KUMA 5LMNO 1XL4A 4MW3A 2DN9A 1R1BA 2DYRB 4PA7A 1HNXB 3KKYA 3RYFB 3QF7A 2LQTA 3OGCC 3ZRWB 1WA8B 2DW4A 4IT5A 2JRIA 2P67A 3I5DA 5DECA 4Z1MG 4F6EA 2DOSA 3OUSA 1E79G 1Q6HA 3CE2A 2IJIA 4TQDA 1SQQH 3RN4A 3JASA 1BE3H 5FPRA 1VF7A 4IYIA 3SYPA 2YIAA 2W6JG 1AR5A 4FZ1A 2P06A 3D36C 1FFXB 2ZDIC 5JWPA 1NH2B 1BGYH 1NQTA 5CBGA 2DYRC 3JARB 1XMOB 2DWDC 4JYBA 1AR1B 4ZI7B 2WLLA 2ITCC 2LW1A 5F2VO 4D7TA 2IW5A 1JPXA 5GTHZ 3BFRA 3LDDA 1BHAA 5IT9N 2KSDA 2QM8A 3RVZA 3ABMC 3CHXA 4P9OA 1FXKB 3J81N 3F7YC 3CCQV 4O4JA 3DC5A 2X6CA 1UJWB 2XAQA 4H44B 4FM1A 2GDSA 2A79B 1B06A 1LNQA 3WB0A 5LYJB 2WLLB 3HR0A 1AJNA 3B2EE 4O2BA 3EXAA 5JCOA 5E1AC 1Q43A 3ABTA 4EFBA 5J2UA 1EM1A 4NB5A 2CH7A 2GUZB 4GX0A 1PNKA 4H13B 4D7SA 3BVOA 3FFQA 1QLEC 1W0JG 2HEPA 1DLBA 2GHYA 2GTAA 1YZBA 4DR4B 2Q6AA 2KKWA 2XTAA 2QTSA 4JI6O 2L6LA 2JGDA 2HLDG 5CA3A 3ZHTA 1PM9A 4G2KA 5CN0A 4GYCB 4LR3A 4UV8A 1GN2A 2CH7B 5D5PA 4WF9V 3ABLB 1S3JA 4MVOA 2LJ2A 4B3TO 1V55B 4DW1A 3E35A 3SYAA 4RAIA 1Y66A 4H37A 1I94O 1GN3A 1YVWA 4IIJB 3OR6C 4YY3O 1KMIZ 1AI4A 3W7TA 1UPGA 3CMAV 2XAHA 1XHZA 1R3LC 1AR4A 1DGSA 1KC8W 3TETA 4XDLA 2H8PC 1G4YB 2F4VB 2P6JA 1B6QA 1V54C 4DUYO 4UCOA 1Z2GA 4XDJA 1K9MW 1EZJA 3ZIAG 2QKAA 2BTQB 5GONA 4AI8A 5JCOC 2WWWA 3BRCA 5LGTA 2WAMA 3AK3A 4YJ3A 5EC1C 2WSSG 2JJ1G 4MVMA 5B3SC 4ZOLB 1N36B 4LH7A 5L3GA 4LFAB 2X6BA 1ZX3A 3UKMA 3R65A 3VQVA 1K4CC 3NR7A 3LNMB 2XAFA 2FYUH 3CCRV 4EKWA 4FLXA 4DV1O 2ZNIA 3EVKA 1M57B 1KU9A 3ZMUA 3K57A 5GONB 3CP1A 1LUVA 3F5WC 1K5QA 5LHIA 2GTSA 1SKVA 2ILMA 5IYBO 3ETGA 3SJCC 4LFCB 1M90W 4A5UB 2EIJC 1J5EO 2O57A 3RW0A 4BW5A 5B1AC 1NR1A 4QNHB 1N33O 2PY5A 5HFMA 1CPYA 2HR3A 3HKCA 1I94B 2XAJA 2HHHO 1SC5B 3M7MX 1QQCA 2EINB 3CJHA 1D5NA 4UV9A 1ZWIC 2OTLV 1L0NH 4X1IA 2ZXWC 1Q7YW 4UXNA 2W0FC 4DUYB 4MVQA 5JJEB 3E89A 1SESA 1XEQA 1DF5A 3E83A 4OX9B 1FJGB 5D5QA 1KP3A 2GSMB 2B9ZA 2MK3A 3OM3B 4DR5O 3HKCB 5L3DA 5ITZB 2NR5A 3CCSV 3PN1A 1OCCB 3AEIA 1Q3EA 1IURA 1OCZC 4DRXA 3LSQA 1E1QG 3AG2C 1VARA 4PDVA 3CJHB 1BZKA 1HDJA 2P7TC 3CYOA 2FL4A 2XNDG 1XI1A 3IGAC 1PD3A 3K9SA 2PYLA 4JAAA 1YTFB 1IBMO 1IBKO 3MHSC 3VQWA 2EIMB 4C7UA 4WFAV 4PJ0Z 1X4TA 1GRJA 3CMEV 2HJDA 2M7WA 3WB1A 1N32O 2OYQA 4O4LB 3JALB 1PNMA 4WBNA 2YI8A 2CTRA 2IM9A 2R9RB 1R3IC 1PV0A 4NXNO 3BA9A 2UXCO 1AJQA 5EIBD 3JAKA 3LSSA 2WLHA 3JCZA 4X9QA 4NVPA 1YI2V 4BIZA 5H2FZ 1FS0G 4I0XA 2PUSA 2QDOA 4JGSA 2JVDA 1F7YA 3WB2A 4NTXA 2WA4A 3CB2A 3GWKC 3RGBA 4PV1B 1S77D 3O9OA 5DEDA 2YSUB 3CC2V 1KQSU 1NU1H 2P22C 1N8RW 2RMKB 2KQXA 2X6AA 3BHPA 4FPPA 3B4SA 5B66Z 5C8YB 3O65A 1THZA 4DV4B 2NNUA 1MA1A 1N34O 4BIUA 2CDYA 2XASA 2DJVA 4JI4O 4P30A 5DM6V 5IJ9B 1FPOA 1R3JC 4TUYB 3K06A 2LFSA 1I5XA 1SA0A 3N2KA 5EZYA 1NR7A 4CH6A 2ZQMA 1BQ0A 3CCLV 2ZE6A 1V9PA 5EBMC 1IBMB 1IBKB 1J95A 1F4NA 3STLC 3TXSA 3HKEA 4K0KO 2R72A 2A9HA 3GB7C 3CEIA 1S5LZ 2UUAO 2VS0A 4JTCB 2Q68A 5LP6A 4R50A 4YJ2A 3HB3B 4FFBA 1N32B 3CX5F 1WNSA 4H33A 4IYHA 4X66B 4LCUC 4B3SO 3OAAG 2HVJC 1KP2A 2C2AA 2VRZA 1VIBA 3VBBA 4GKJB 1WP7A 1Y74A 1XNQO 1AJPA 3OMNB 1MNGA 5LHHA 4XDKA 3JD4A 3L70H 3WU2Z 4TQFA 3L71H 2B1IA 1WPXA 1YIJV 3SPHA 1H38A 5CB4B 3F5TA 4WFEA 3ZN0A 4JI7O 3A2FA 3VOUA 4JASA 2YI9A 3OMIB 4MTXA 3T1YO 4K8ZA 1PP9H 3JCUZ 3D3IA 4QPJA 2JIZG 1ORQC 2AXTZ 1NI8A 2A06H 4F6RA 2WLMA 1Y74B 2Y69C 4JI1O 3G67A 4HZ3A 1G6UA 4UVAA 1N34B 2F1MA 4K8XA 1OCRB 3K5LA 4JI5O 4JI4B 4LF7O 5LGNA 1F23A 3B8MA 4L87A 3H9VA 4X1YA 1JMKC 1VQ5V 3RYCA 4DR6O 1OZ0A 1L8DA 5FNVA 5H5NA 5LP6C 1N4CA 2H3OA 3DXRB 3K5OA 2WLKA 3FYEB 1E1RG 3T4ZA 1G1XB 1P4RA 2WLIA 3DTUB 3CXCU 5EIBC 3AG3B 3CRCA 4GT1A 1TUBA 2BSKA 5EC2C 5IWAO 4JPRA 4GX1A 1HP8A 2Q7HA 1ZLZA 4LFBO 4DV6O 4RUEA 3FX7A 4FM2A 2XOKG 4CZZA 5KHGA 3RYCB 4F4LA 4B3SB 2X0LA 5FNVB 3ZJZA 4LF4O 1O9GA 2CUGA 2WLIB 3RYHB 1EZVH 4J41A 4MSWC 4U3FH 1Z5VA 2QWRB 5FLXN 3J7AU 1SQFA 4UCSA 5DN6G 4LBEC 2ZR2A 4JTDB 3VQXA 4JYCA 1K3EA 2HFEC 5KAIZ 2QM7A 3BEHA 1SZXA 3JD2A 4MTFA 2BTOA 1ZL8B 1SQGA 2ETNA 4Z1VA 2CTWA 3AK1A 4ABMA 3K08A 4CS4A 4JI0O 1SZTA 2Z0AA 4JI1B 3JATB 3KZIZ 1HR0O 4B3RB 3EHBB 3G6EV 2KG7A 4DR1O 4JI5B 5LOVA 4X65O 2AHYA 4X64B 1EN4A 1M5IA 1KYOF 3RT3C 3Q4HA 1O9HA 4TV9A 1WB7A 2P4VA 2JEXA 1M9NA 2YC0A 4UB6Z 2BOBC 2D3OW 4DV5O 3D8CA 3ABMB 1XNRO 3OFNG 4WCEV 2JJ2G 1TA8A 4D6TH 5E79Z 1MG1A 3QG5A 5IWAB 1XREA 3ZCCA 3M99B 4X89A 1K33A 4LFBB 4DV6B 1VEWA 2W0XA 4OXSA 5KMGA 3OGIB 5KX5A 2XUMA 5LMUO 1QLEB 4DV7B 1R6KA 4WFGA 4CH5A 5IY5B 4JI8B 1R6TA 4PELA 5LHGA 1EFRG 1N0JA 1BMFG 3JASB 2OCCC 1GKFA 2QWPB 2ARHA 1WN7A 2A3QA 3C3TA 4J7ZA 1YEWA 3WFVA 4X8AA 2OIEA 1HNZB 4JAVA 1JJOA 2QGNA 2EZOA 3GVMA 1IBLB 1Y76A 5LMNB 2ZM6O 4NTWA 1I0HA 4FJCC 3B77A 3KG2A 1HR0B 5BMVA 1K5SA 4HYOA 1B04A 1JVMA 4FVMA 5IY5C 2ITDC 1VQ6V 5JJJB 1V54B 4GX5A 1LUWA 2CE4A 2BOCC 1HNWO 2IH1C 2BE3A 4O4JB 3ZX6A 3EFFK 3QO8A 1FAFA 5KLVH 2ZCEA 4DK0A 1K92A 4DV5B 4O2BB 3PJSK 3FB6C 1SQXH 2Z5UA 5J2UB 1X59A 2V4DA 1K4DC 2Y48A 2AZ0A 5B3SB 2X7RB 5BMVB 1XUQA 5LA6A 4I4TA 5B1BC 1RFYA 2AGAA 3CCVV 3LNNA 5IJ0A 3JSLA 2Q9LA 4GLXA 1VQLV 4TSFG 1U97A 1JJ2U 4YIOA 2JGDB 2IBZH 2UXNA 4DK1A 1SQBH 5BXZA 4MVSA 3QTCA 1AVMA 1S76D 3AG4C 4I5SA 3P32A 1SETA 4MVRA 5LA6B 3ASOC 1BQZA 4EB6A 2UUBO 2EIJB 3K0DA 3OEHG 2UUCO 3IC7A 5B1AB 2K9PA 4KHPO 2UXBO 2ZD9A 3CSXA 3A0BZ 1JA8A 3RFRA 3UO2A 2ZM6B 3QNEA 1PKXA 4UCUA 1M93A 2EILB 1ZAUA 2JS5A 1VQ8V 3CRRA 2ZXWB 2P5OA 2QSAA 1N0NA 5KHHA 2DYSC 4BIOA 4FLTA 4JI6B 5KAFZ 4LF8O 4YJ3B 2AW9A 4TV8A 4CS3A 1ROPA 3S3WA 1S5JA 1VQPV 3S3XA 5B1OA 4W4LA 1JOYA 1XDCA 1OCZB 2ZKOA 5JVDA 3AG2B 1SS3A 1WP8A 5H6RA 4B3TB 4I55A 5LBQA 4OPHA 1Q86W 1NS1A 3ZS8C 1BCCH 1BS3A 2YXHA 4LP8A 2HVKC 4YY3B 5CBHA 2EILC 2IJKA 1GM9A 2WA3A 2UXDO 2F95B 1VQNV 3HKDA 4EFEA 3TK1A 1IZ3A 1GM7A 5CA0A 5C93A 3ZRXA 4O4HA 5IE9A 4DV0O 4XBFA 1AP5A 3L72H 5GTIZ 4MTOA 4JYYA 4CC6A 4K35A 3JAMN 3X2QC 4CC5A 1FFTB 2QTOA 3RVYA 4I55B 5GW7A 1HWYA 4P2ZA 1L1FA 2ADPA 3WG7C 1SERA 1VQ7V 2LW7A 4DO2A 4GX2A 3K5NA 1GK9A 2UUCB 4HBNA 3K5MA 4J42A 4KHPB 4LF6O 3W7XA 2UXBB 4JI3O 4WFFA 1I5YA 1AI7A 5JH7A 2N05A 4U7OA 4X1IB 4FLWA 2ZINA 1GTOA 5AG2A 2LGQA 5LL6Y 4FIPC 5A2QN 1JX9A 4IHJA 1NZ6A 4TOIA 4DV1B 2EX3A 1XQ8A 1K34A 1RM1C 1RPOA 2QA4V 1GN6A 5IYCO 1YHQV 3E2EA 3KCXA 1MZFA 2JK5C 4DRXB 1FXHA 4JYAO 5L3EA 3B40A 4IGGA 2Q5ZA 5JH7B 2IU3A 4OGQB 2EJRA 3P30A 4X20A 4GKKO 1NT2B 4H0LB 5KHJA 1J5EB 1Q5OA 3ZHQA 1EN5A 2CAZC 4B7EA 1H2LA 1N33B 1WPBA 1NVPD 2DQ0A 1R6NA 3N27A 4QPKA 4R6ZA 4YIPA 2ZR3A 2HHHB 2FMLA 4FMTA 1XL6A 1B3QA 4WBNB 2UXDB 2B5UA 4JI2O 1D5AA 4NTYA 1VQKV 3OD4A 3TXQA 3T1HO 4JZGA 1QVGU 4DV0B 4J7KA 2N04A 2H94A 4MW8A 3JAKB 1D2DA 3K79A 3FAVA 5FL7G 3OTFA 1ZUQA 3H01A 4DR5B 4LWSA 3L73H 2VQFO 3AG1B 4I0XB 2F93B 1I7FA 3SGIA 3APQA 2XHBA 4LF6B 5JJNB 2RCVA 5IYZA 3SJQC 3ZHUA 4RWUA 3ZEDA 1XILA 2YEVA 5TISZ 3OTOO 3FAVB 1JFFA 4DW0A 4PDLA 1T5EA 4E2LA 4KL1A 1VQMV 2Q7EA 4ASUG 2VQEO 1OCOC 2JEUA 2Y69B 4ZIBA 1H8HG 2ODMA 1SA0B 3N2KB 5EZYB 1GAXA 1MSWD 4LF9O 1MZEA 3AG1C 3E86A 4DR3O 4NXNB 4WFHA 3L74H 2UXCB 5IYZB 3HKEB 1SF9A 1P84F 1DK1A 4R7CA 2YEVB 3M8AA 1JFFB 5LP6B 1KKCA 4YJ2B 1XBLA 4RQFA 3NXSA 4BR6A 4FFBB 1VQ4V 3IFXA 4J10A 4JI2B 2WLJA 3LDEA 2LGWA 3ASNC 4X1KA 5BR8O 2RJZA 4LNUA 4PI0A 2FB5A 4J9ZB 5J9PC 1XMQO 4KP4A 4NXMO 3CCUV 2CTPA 2EIKC 3JAWA 2YXLA 3F7VC 4ZHQA 2CTQA 3AG7A 1NKDA 1K7DA 4ZKIA 3CWBH 2ZE8A 3BA8A 3ZMSA 1AI6A 1JCHA 1A32A 4AILC 1HNXO 2V7QG 3FYIB 4U3JA 5EK0A 4LNUB 5J2TA 2XT9A 1Y4MA 3HPLC 3DGEA 4K0KB 4QIWF 3IAYA 3ZN1A 3CXHF 3A0RA 4F6RB 1ZTEA 2UUAB 3H1HH 1F4MA 4G27B 3JAWB 1LR1A 3B8NA 4P9PA 3H1LH 5JQGA 1VQ9V 2DQ3A 2VQEB 3FKSG 4FLVA 2E5LO 4J7JA 1NH2D 1AB3A 5IYDO 5H6QA 4X1YB 4NYKA 3H1KH 2QKSA 1IX9A 3IC9A 2EBOA 4B08A 1NTZH 3OT7A 4DR3B 3AK2A 4ICGA 4U3JB 2UU9O 3BPZA 1XNQB 3UO3A 4I9QA 4DR7O 2OIGA 1KUQA 3ETDA 2ZE7A 5KHIA 1TUBB 2BSKB 3QO5A 4B3MO 4O4IA 1IXBA 2Y0PA 1JQ0A 3E8FA 4I9WA 5JQGB 1Q8IA 4JI7B 4JTAB 3ABKC 4QE9A 3T2MA 3T1YB 2QKCA 5BR8B 4TWKA 1TGOA 4J11A 5EBWC 4UFZA 1QU7A 4UVBA 3RBZA 3L75H 4NXMB 4RQEA 1M56C 4LH6A 3SYOA 2QJ1A 1XOUA 4LF7B 2Q4PA 3JYCA 1HW7A 2Q8VA 2ZIMA 3QVNA 1ENVA 3CCJV 2OCCB 1YJ9V 4O2AA 4DR6B 1BHBA 5LGUA 2YUAA 4I50A 1YJNV 3ZMVA 1URFA 2KB1A 4I7ZB 3A8TA 3T4DA 2GBOA 2PI4A 4DV3O 1FFXA 4FZ0A 4PA3A 2ZNJA 4DR4O 5L3FA 1H8EG 3JARA 3CC4V 3SPGA 1AILA 2KG7B 2QR4A 5LOVB 2JDIG 4ZI7A 1R73A 2XAGA 3RYIA 4UCRA 3Q4HB 4TV9B 2E5LB 4UUJC 3SDLA 2R9AA 4O2AB 3P3NA 1ZSPA 4I50B 3T1CA 4LF4B 1W0KG 3K03A 4FLZA 3JD1A 3OUFA 3KCYA 2Q73A 2UU9B 3G4SV 4J80A 1K73W 4N23A 4DR7B 3ABUA 1FXKA 1PPJH 1Y6XA 5KA5A 1WAZA 1TAEA 3UM7A 3ZHVA 4B3MB 2YICA 1S72V 4X62O 4JF3A 3G80A 5LYJA 3CC7V 5KUKA 3RYIB 3BY6A 2ADQB 4DXWA 5A9GA 2HKOA 3CD6V 2F4VO 3ETQA 5KMGB 2YS8A 1Q6UA 5KX5B 2GUZA 3H1JH 5B1BB 2QWNB 2F43G 3JD0A 2OT5A 4JI0B 2Q0AA 4G28B 3HKBA 1GH6A 1KB9F 4DR1B 3K04A 3C90A 4X65B 1H2MA 1QCEA 3THOA 1N36O 3AG4B 4IL6Z 4LFAO 2JGUA 4RO2A 1W2BU 3MHHC 3N2GA 1Y76B 3ASOB 1VQOV 2BCCH 2Z3YA 1XNRB 3SJAC 4FLYA 5EBLC 4DV3B 4AQYO 1WB8A 3RWRD 5LXTA 2ZIOA 1CEZA 4IIJA 3R66A 3HKBB 1M1KW 1I08A 1KD1W 3ZHSA 3ZRVA 5KHKA 3CRQA 1YCIA 1NJIW 1VMGA 2Q69A 2RN9A 4LFCO 1EBOA 5FPOA 3K59A 5LMUB 4Z2WA 1FXKC 3ZBHA 3N2GB 2DYSB 1M4UA 1G8MA 2BTQA 1TUEB 5LXTB 4NR1A 4JV5O 2HG5C 5CBFA 2R9IA 3FB5C 2P90A 3UCSC 1P7GA 4X62B 1KECA 1PNLA 2V1DA 4I4TB 3U10A 3ETEA 4PI2A 2L35A 4ZOLA 2MW2B 3CS5A 5L3CA 5IJ0B 3TGUH 2M6YA 1SQVH 3FB8C 4KXRA 3ML0A 3K3WA 4OX9O 1FJGO 2HJFC 1GO3F 4HAMA 2K1EA 4FK5C 1UFIA 1YTFD 4CH4A 4MT8A 4PDMA 3UQ8A 2QM4A 1QNMA 2F66C 4UB8Z 4UVCA 2FTKA 4YXWG 2PYJA 4LF5O 3ABLC 4EB6B 4R8CA 1V55C 4DYLA 1HNWB 3E8HA 2A7WA 4NKGB 3X2QB 5HFLA 3CRMA 2CK3G 4FM0A 3K0GA 2B1GA 3WG7B 5H9CA 3J80N 1QVFU 1MMMA 1KBHA 1SRYA 4AQYB 2W6IG 2Q7GA 1NBMG 1YJWV 1Z5WA 4CH3A 1QR9A 3QO7A 2PF4E 1OHHG 2F23A 2YXYA 3K58A 1TVKA 3W7UA 4TV8B 4BAYA 2HP8A 1RM1B 4PA6A 2Y4UA 5B1NA 3IJ4A 2ZE5A 1FD9A 2WLNA 4DR2O 3SYQA 2YDEA 2RQ6A 5ITZA 5JVDB 4JV5B 1OV9A 3JSNA 3TJTA 4KFMA 4PDRA 4Q6GA 1YXBA 5IDJA 4JAUA 3ZRSA 1Y67A 2EULA 1PL0A 2RDCA 2UUBB 1M57C 3H1IH 1AI5A 2ZT9B 4PA4A 4EEQA 1TVKB 2UXXA 3DC6A 4WFBV 3HKDB 2Q0OC 5CA0B 1XHXA 4DV4O 2A0LA 4O4HB 1K8AW 2LFRA 5KA6A 2E3CA 4O4LA 3CCMV 2P4KA 3JALA 1NTMH 3FB7C 4BWAA 2RNBA 4LF5B 1VF5B 1SQPH 1PL4A 3FD9A 5K1PA 1CP9A 2E76B 4LF8B 1H2SB 4JZ2A 4K3AA 1P49A 2OCHA 1BL8A 1JR9A 2PGGA 2EINC 1DF4A 4CS2A 3MD0A 2DWEC 2CGNA 2EJ7A 4IHJB 4AHCA 3OMAB 1W59A 2WPDG 4L8JA 1IDSA 4X66O 3OE7G 1VF6A 4TT3G 3CPWU 2PI5A 3OW2U 4GKJO 1OCCC 1AROP 5C8YA 2CGOA 4QGPA 4DV2O 2ATKC 1R3KC 3APOA 4DR2B 4YHHO 3UT5A 1Q6IA 4X20B 3SPCA 1OCOB 1RP3B 1F51A 5IJ9A 2YIBD 4TUYA 3BAAA 1KKDA 3MAQA 2EIMC 2JS3A 1L0LH 4E4EA 5CMUA 3VQYA 1YITV 4BW9A 2DE0X 1RPRA 4DUZO 1YDXA 4JI3B 3L9DA 4QJFB 1WLEA 3ZMTA 1EN6A 2Y4TA 2LP7A 1CXZB 3UT5B 4GUNA 2R70A 1H2GA 3ASNB 4MVZA 4LWSB 4UCTA 1COWG 4LC1A 2QEXV 1GN4A 5L3BA 4JYAB 2OWOA 2EIKB 4RUFA 1MSDA 4PD4F 1QBZA 4OPAA 3SYCA 2YIDA 4GKKB 1IXMA 1VF6C 2IH3C 3ZHRA 1S0VA 5K1XA 4MS2A 2OTJV 3P3PA 5CB4A 1QR8A 1MOFA 3B09A 2QWQB 4CBCA 2EZPA 1FKAO 4U7NA 3MDSA 2YIBA 3I56V 2FKXA 2AHZA 2QWOB 4DV2B 1NVPB 3T1HB 1GMGA 3ICXA 3D3QA 4YHHB 2DMXA 2Y0IA 3ZMZA 1MABG 2PZSA 2G38A 5KUMA 3BABA 3E22A 4FLUA 2VQFB 3CCEV 5EYPA 1US6A 1U96A 4Q20A 2VWKA 2Q67A 2E75B 3LSUA 3DXRA 4DUZB 1RSOA 4MTGA 1NTKH 1Q81W 1BSMA 4X1KB 3GWOA 4B7KA 3U0ZA 1Q90D 3G6BA 1GM8A 2PTMA 4B3RO 2NLJC 2QE7G 3A0HZ 2NN4A 3ABKB 4X64O 3OTOB 4GZRB 3SPJA 3I55V 2D2CB 1BT8A 3E22B 4UCVA 4GCZA 3JD3A 2LO1A 3OEEG 4ZBMA 5EYPB 4ZHQB 3TCUA 1YSCA 1FXVA
chains in the Genus database with same CATH topology
1HR0O 4OX9O 1FJGO 1DK1A 2F4VO 1HNWO 3M8AA 4DR1O 4GKKO 4JI1O 1I94O 4X65O 4YY3O 3RT3C 3O65A 4JI5O 2ZKOA 4LF7O 1XEQA 1N34O 4LF5O 4OPHA 1NS1A 2DJVA 4OPAA 4DV5O 1X59A 2N74A 5BR8O 4JI4O 4DUYO 4DR6O 1XNRO 5BY1A 4DR5O 4JI2O 5H5NA 1XMOO 4DV7O 1XMQO 1N36O 3T1HO 4NXMO 2UXDO 4LFAO 3J80N 4JI8O 1G1XB 2AGAA 1D2DA 5IT9N 1FKAO 4K0KO 4DV0O 4X66O 5IWAO 2FKXA 2VQFO 1IBMO 4AQYO 1IBKO 2UUAO 3JAMN 5BXZA 3J81N 5LMUO 4LFBO 4DV6O 4GKJO 3R66A 1A32A 1HNXO 4DV3O 1R6TA 4DV2O 2LW7A 1HNZO 4DR4O 1FYJA 4YHHO 4LF4O 4DV1O 1IBLO 1N32O 2UUBO 1AILA 4LFCO 4LF6O 4B3SO 5LMNO 4JI3O 4DR2O 1R1BA 2UUCO 4KHPO 3OTOO 2UXBO 3SDLA 1XNQO 5LL6Y 5A2QN 5FLXN 1YZBA 3J7AU 4NXNO 2UXCO 2E5LO 4JI6O 1AB3A 4JV5O 4DUZO 2JRIA 2VQEO 4B3RO 4A5UB 1J5EO 2ZM6O 3F5TA 2DOSA 4JI7O 2UU9O 4X64O 1N33O 4LF9O 1F7YA 4JYAO 3T1YO 4X62O 4DR3O 4DR7O 4JI0O 1KUQA 2Z0AA 4DV4O 4LF8O 4B3TO 2HHHO 4B3MO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 O;  4OX9 O;  1FJG O;  1DK1 A;  2F4V O;  1HNW O;  3M8A A;  4DR1 O;  4GKK O;  4JI1 O;  1I94 O;  4X65 O;  4YY3 O;  3RT3 C;  3O65 A;  4JI5 O;  2ZKO A;  4LF7 O;  1XEQ A;  1N34 O;  4LF5 O;  4OPH A;  1NS1 A;  2DJV A;  4OPA A;  4DV5 O;  1X59 A;  2N74 A;  5BR8 O;  4JI4 O;  4DUY O;  4DR6 O;  1XNR O;  5BY1 A;  4DR5 O;  4JI2 O;  5H5N A;  1XMO O;  4DV7 O;  1XMQ O;  1N36 O;  3T1H O;  4NXM O;  2UXD O;  4LFA O;  3J80 N;  4JI8 O;  1G1X B;  2AGA A;  1D2D A;  5IT9 N;  1FKA O;  4K0K O;  4DV0 O;  4X66 O;  5IWA O;  2FKX A;  2VQF O;  1IBM O;  4AQY O;  1IBK O;  2UUA O;  3JAM N;  5BXZ A;  3J81 N;  5LMU O;  4LFB O;  4DV6 O;  4GKJ O;  3R66 A;  1A32 A;  1HNX O;  4DV3 O;  1R6T A;  4DV2 O;  2LW7 A;  1HNZ O;  4DR4 O;  1FYJ A;  4YHH O;  4LF4 O;  4DV1 O;  1IBL O;  1N32 O;  2UUB O;  1AIL A;  4LFC O;  4LF6 O;  4B3S O;  5LMN O;  4JI3 O;  4DR2 O;  1R1B A;  2UUC O;  4KHP O;  3OTO O;  2UXB O;  3SDL A;  1XNQ O;  5LL6 Y;  5A2Q N;  5FLX N;  1YZB A;  3J7A U;  4NXN O;  2UXC O;  2E5L O;  4JI6 O;  1AB3 A;  4JV5 O;  4DUZ O;  2JRI A;  2VQE O;  4B3R O;  4A5U B;  1J5E O;  2ZM6 O;  3F5T A;  2DOS A;  4JI7 O;  2UU9 O;  4X64 O;  1N33 O;  4LF9 O;  1F7Y A;  4JYA O;  3T1Y O;  4X62 O;  4DR3 O;  4DR7 O;  4JI0 O;  1KUQ A;  2Z0A A;  4DV4 O;  4LF8 O;  4B3T O;  2HHH O;  4B3M O; 
#chains in the Genus database with same CATH topology
 2IU0 A;  5BZB A;  1RSO B;  3W7W A;  1M56 B;  4HNA A;  1WJZ A;  3RYH A;  3BCC H;  4LF9 B;  5J2T B;  1H2K A;  2IJH A;  2AZ2 A;  1QHT A;  1VP7 A;  3C3S A;  2N74 A;  3OR7 C;  5CA1 A;  3CRA A;  5BY1 A;  1YF2 A;  1XMO O;  3STZ C;  5B5E Z;  4DV7 O;  1ZL8 A;  2GV9 A;  3D36 A;  1OCR C;  3SJB C;  4J9Y B;  4JI8 O;  2ZDI A;  4X88 A;  1P7B A;  1K97 A;  3K9A A;  4HNA B;  3U11 A;  3RYF A;  3DSQ A;  2IJJ A;  3E8B A;  3JAT A;  2VWJ A;  4PHZ A;  3ZRW A;  1WA8 A;  1XMQ B;  4FFK A;  3LUT B;  3SPI A;  4QE7 A;  1Q82 W;  1AP6 A;  1IVS A;  4N21 A;  5CA1 B;  3G71 V;  3E8G A;  1HNZ O;  1S5H C;  1OJH A;  3AG3 C;  4W4K A;  4O4I B;  1FYJ A;  1H2N A;  2E74 B;  4PA9 A;  3W7S A;  1IBL O;  3LDC A;  1QLN A;  3SR2 C;  1DTO A;  4MVU A;  4KUM A;  5LMN O;  1XL4 A;  4MW3 A;  2DN9 A;  1R1B A;  2DYR B;  4PA7 A;  1HNX B;  3KKY A;  3RYF B;  3QF7 A;  2LQT A;  3OGC C;  3ZRW B;  1WA8 B;  2DW4 A;  4IT5 A;  2JRI A;  2P67 A;  3I5D A;  5DEC A;  4Z1M G;  4F6E A;  2DOS A;  3OUS A;  1E79 G;  1Q6H A;  3CE2 A;  2IJI A;  4TQD A;  1SQQ H;  3RN4 A;  3JAS A;  1BE3 H;  5FPR A;  1VF7 A;  4IYI A;  3SYP A;  2YIA A;  2W6J G;  1AR5 A;  4FZ1 A;  2P06 A;  3D36 C;  1FFX B;  2ZDI C;  5JWP A;  1NH2 B;  1BGY H;  1NQT A;  5CBG A;  2DYR C;  3JAR B;  1XMO B;  2DWD C;  4JYB A;  1AR1 B;  4ZI7 B;  2WLL A;  2ITC C;  2LW1 A;  5F2V O;  4D7T A;  2IW5 A;  1JPX A;  5GTH Z;  3BFR A;  3LDD A;  1BHA A;  5IT9 N;  2KSD A;  2QM8 A;  3RVZ A;  3ABM C;  3CHX A;  4P9O A;  1FXK B;  3J81 N;  3F7Y C;  3CCQ V;  4O4J A;  3DC5 A;  2X6C A;  1UJW B;  2XAQ A;  4H44 B;  4FM1 A;  2GDS A;  2A79 B;  1B06 A;  1LNQ A;  3WB0 A;  5LYJ B;  2WLL B;  3HR0 A;  1AJN A;  3B2E E;  4O2B A;  3EXA A;  5JCO A;  5E1A C;  1Q43 A;  3ABT A;  4EFB A;  5J2U A;  1EM1 A;  4NB5 A;  2CH7 A;  2GUZ B;  4GX0 A;  1PNK A;  4H13 B;  4D7S A;  3BVO A;  3FFQ A;  1QLE C;  1W0J G;  2HEP A;  1DLB A;  2GHY A;  2GTA A;  1YZB A;  4DR4 B;  2Q6A A;  2KKW A;  2XTA A;  2QTS A;  4JI6 O;  2L6L A;  2JGD A;  2HLD G;  5CA3 A;  3ZHT A;  1PM9 A;  4G2K A;  5CN0 A;  4GYC B;  4LR3 A;  4UV8 A;  1GN2 A;  2CH7 B;  5D5P A;  4WF9 V;  3ABL B;  1S3J A;  4MVO A;  2LJ2 A;  4B3T O;  1V55 B;  4DW1 A;  3E35 A;  3SYA A;  4RAI A;  1Y66 A;  4H37 A;  1I94 O;  1GN3 A;  1YVW A;  4IIJ B;  3OR6 C;  4YY3 O;  1KMI Z;  1AI4 A;  3W7T A;  1UPG A;  3CMA V;  2XAH A;  1XHZ A;  1R3L C;  1AR4 A;  1DGS A;  1KC8 W;  3TET A;  4XDL A;  2H8P C;  1G4Y B;  2F4V B;  2P6J A;  1B6Q A;  1V54 C;  4DUY O;  4UCO A;  1Z2G A;  4XDJ A;  1K9M W;  1EZJ A;  3ZIA G;  2QKA A;  2BTQ B;  5GON A;  4AI8 A;  5JCO C;  2WWW A;  3BRC A;  5LGT A;  2WAM A;  3AK3 A;  4YJ3 A;  5EC1 C;  2WSS G;  2JJ1 G;  4MVM A;  5B3S C;  4ZOL B;  1N36 B;  4LH7 A;  5L3G A;  4LFA B;  2X6B A;  1ZX3 A;  3UKM A;  3R65 A;  3VQV A;  1K4C C;  3NR7 A;  3LNM B;  2XAF A;  2FYU H;  3CCR V;  4EKW A;  4FLX A;  4DV1 O;  2ZNI A;  3EVK A;  1M57 B;  1KU9 A;  3ZMU A;  3K57 A;  5GON B;  3CP1 A;  1LUV A;  3F5W C;  1K5Q A;  5LHI A;  2GTS A;  1SKV A;  2ILM A;  5IYB O;  3ETG A;  3SJC C;  4LFC B;  1M90 W;  4A5U B;  2EIJ C;  1J5E O;  2O57 A;  3RW0 A;  4BW5 A;  5B1A C;  1NR1 A;  4QNH B;  1N33 O;  2PY5 A;  5HFM A;  1CPY A;  2HR3 A;  3HKC A;  1I94 B;  2XAJ A;  2HHH O;  1SC5 B;  3M7M X;  1QQC A;  2EIN B;  3CJH A;  1D5N A;  4UV9 A;  1ZWI C;  2OTL V;  1L0N H;  4X1I A;  2ZXW C;  1Q7Y W;  4UXN A;  2W0F C;  4DUY B;  4MVQ A;  5JJE B;  3E89 A;  1SES A;  1XEQ A;  1DF5 A;  3E83 A;  4OX9 B;  1FJG B;  5D5Q A;  1KP3 A;  2GSM B;  2B9Z A;  2MK3 A;  3OM3 B;  4DR5 O;  3HKC B;  5L3D A;  5ITZ B;  2NR5 A;  3CCS V;  3PN1 A;  1OCC B;  3AEI A;  1Q3E A;  1IUR A;  1OCZ C;  4DRX A;  3LSQ A;  1E1Q G;  3AG2 C;  1VAR A;  4PDV A;  3CJH B;  1BZK A;  1HDJ A;  2P7T C;  3CYO A;  2FL4 A;  2XND G;  1XI1 A;  3IGA C;  1PD3 A;  3K9S A;  2PYL A;  4JAA A;  1YTF B;  1IBM O;  1IBK O;  3MHS C;  3VQW A;  2EIM B;  4C7U A;  4WFA V;  4PJ0 Z;  1X4T A;  1GRJ A;  3CME V;  2HJD A;  2M7W A;  3WB1 A;  1N32 O;  2OYQ A;  4O4L B;  3JAL B;  1PNM A;  4WBN A;  2YI8 A;  2CTR A;  2IM9 A;  2R9R B;  1R3I C;  1PV0 A;  4NXN O;  3BA9 A;  2UXC O;  1AJQ A;  5EIB D;  3JAK A;  3LSS A;  2WLH A;  3JCZ A;  4X9Q A;  4NVP A;  1YI2 V;  4BIZ A;  5H2F Z;  1FS0 G;  4I0X A;  2PUS A;  2QDO A;  4JGS A;  2JVD A;  1F7Y A;  3WB2 A;  4NTX A;  2WA4 A;  3CB2 A;  3GWK C;  3RGB A;  4PV1 B;  1S77 D;  3O9O A;  5DED A;  2YSU B;  3CC2 V;  1KQS U;  1NU1 H;  2P22 C;  1N8R W;  2RMK B;  2KQX A;  2X6A A;  3BHP A;  4FPP A;  3B4S A;  5B66 Z;  5C8Y B;  3O65 A;  1THZ A;  4DV4 B;  2NNU A;  1MA1 A;  1N34 O;  4BIU A;  2CDY A;  2XAS A;  2DJV A;  4JI4 O;  4P30 A;  5DM6 V;  5IJ9 B;  1FPO A;  1R3J C;  4TUY B;  3K06 A;  2LFS A;  1I5X A;  1SA0 A;  3N2K A;  5EZY A;  1NR7 A;  4CH6 A;  2ZQM A;  1BQ0 A;  3CCL V;  2ZE6 A;  1V9P A;  5EBM C;  1IBM B;  1IBK B;  1J95 A;  1F4N A;  3STL C;  3TXS A;  3HKE A;  4K0K O;  2R72 A;  2A9H A;  3GB7 C;  3CEI A;  1S5L Z;  2UUA O;  2VS0 A;  4JTC B;  2Q68 A;  5LP6 A;  4R50 A;  4YJ2 A;  3HB3 B;  4FFB A;  1N32 B;  3CX5 F;  1WNS A;  4H33 A;  4IYH A;  4X66 B;  4LCU C;  4B3S O;  3OAA G;  2HVJ C;  1KP2 A;  2C2A A;  2VRZ A;  1VIB A;  3VBB A;  4GKJ B;  1WP7 A;  1Y74 A;  1XNQ O;  1AJP A;  3OMN B;  1MNG A;  5LHH A;  4XDK A;  3JD4 A;  3L70 H;  3WU2 Z;  4TQF A;  3L71 H;  2B1I A;  1WPX A;  1YIJ V;  3SPH A;  1H38 A;  5CB4 B;  3F5T A;  4WFE A;  3ZN0 A;  4JI7 O;  3A2F A;  3VOU A;  4JAS A;  2YI9 A;  3OMI B;  4MTX A;  3T1Y O;  4K8Z A;  1PP9 H;  3JCU Z;  3D3I A;  4QPJ A;  2JIZ G;  1ORQ C;  2AXT Z;  1NI8 A;  2A06 H;  4F6R A;  2WLM A;  1Y74 B;  2Y69 C;  4JI1 O;  3G67 A;  4HZ3 A;  1G6U A;  4UVA A;  1N34 B;  2F1M A;  4K8X A;  1OCR B;  3K5L A;  4JI5 O;  4JI4 B;  4LF7 O;  5LGN A;  1F23 A;  3B8M A;  4L87 A;  3H9V A;  4X1Y A;  1JMK C;  1VQ5 V;  3RYC A;  4DR6 O;  1OZ0 A;  1L8D A;  5FNV A;  5H5N A;  5LP6 C;  1N4C A;  2H3O A;  3DXR B;  3K5O A;  2WLK A;  3FYE B;  1E1R G;  3T4Z A;  1G1X B;  1P4R A;  2WLI A;  3DTU B;  3CXC U;  5EIB C;  3AG3 B;  3CRC A;  4GT1 A;  1TUB A;  2BSK A;  5EC2 C;  5IWA O;  4JPR A;  4GX1 A;  1HP8 A;  2Q7H A;  1ZLZ A;  4LFB O;  4DV6 O;  4RUE A;  3FX7 A;  4FM2 A;  2XOK G;  4CZZ A;  5KHG A;  3RYC B;  4F4L A;  4B3S B;  2X0L A;  5FNV B;  3ZJZ A;  4LF4 O;  1O9G A;  2CUG A;  2WLI B;  3RYH B;  1EZV H;  4J41 A;  4MSW C;  4U3F H;  1Z5V A;  2QWR B;  5FLX N;  3J7A U;  1SQF A;  4UCS A;  5DN6 G;  4LBE C;  2ZR2 A;  4JTD B;  3VQX A;  4JYC A;  1K3E A;  2HFE C;  5KAI Z;  2QM7 A;  3BEH A;  1SZX A;  3JD2 A;  4MTF A;  2BTO A;  1ZL8 B;  1SQG A;  2ETN A;  4Z1V A;  2CTW A;  3AK1 A;  4ABM A;  3K08 A;  4CS4 A;  4JI0 O;  1SZT A;  2Z0A A;  4JI1 B;  3JAT B;  3KZI Z;  1HR0 O;  4B3R B;  3EHB B;  3G6E V;  2KG7 A;  4DR1 O;  4JI5 B;  5LOV A;  4X65 O;  2AHY A;  4X64 B;  1EN4 A;  1M5I A;  1KYO F;  3RT3 C;  3Q4H A;  1O9H A;  4TV9 A;  1WB7 A;  2P4V A;  2JEX A;  1M9N A;  2YC0 A;  4UB6 Z;  2BOB C;  2D3O W;  4DV5 O;  3D8C A;  3ABM B;  1XNR O;  3OFN G;  4WCE V;  2JJ2 G;  1TA8 A;  4D6T H;  5E79 Z;  1MG1 A;  3QG5 A;  5IWA B;  1XRE A;  3ZCC A;  3M99 B;  4X89 A;  1K33 A;  4LFB B;  4DV6 B;  1VEW A;  2W0X A;  4OXS A;  5KMG A;  3OGI B;  5KX5 A;  2XUM A;  5LMU O;  1QLE B;  4DV7 B;  1R6K A;  4WFG A;  4CH5 A;  5IY5 B;  4JI8 B;  1R6T A;  4PEL A;  5LHG A;  1EFR G;  1N0J A;  1BMF G;  3JAS B;  2OCC C;  1GKF A;  2QWP B;  2ARH A;  1WN7 A;  2A3Q A;  3C3T A;  4J7Z A;  1YEW A;  3WFV A;  4X8A A;  2OIE A;  1HNZ B;  4JAV A;  1JJO A;  2QGN A;  2EZO A;  3GVM A;  1IBL B;  1Y76 A;  5LMN B;  2ZM6 O;  4NTW A;  1I0H A;  4FJC C;  3B77 A;  3KG2 A;  1HR0 B;  5BMV A;  1K5S A;  4HYO A;  1B04 A;  1JVM A;  4FVM A;  5IY5 C;  2ITD C;  1VQ6 V;  5JJJ B;  1V54 B;  4GX5 A;  1LUW A;  2CE4 A;  2BOC C;  1HNW O;  2IH1 C;  2BE3 A;  4O4J B;  3ZX6 A;  3EFF K;  3QO8 A;  1FAF A;  5KLV H;  2ZCE A;  4DK0 A;  1K92 A;  4DV5 B;  4O2B B;  3PJS K;  3FB6 C;  1SQX H;  2Z5U A;  5J2U B;  1X59 A;  2V4D A;  1K4D C;  2Y48 A;  2AZ0 A;  5B3S B;  2X7R B;  5BMV B;  1XUQ A;  5LA6 A;  4I4T A;  5B1B C;  1RFY A;  2AGA A;  3CCV V;  3LNN A;  5IJ0 A;  3JSL A;  2Q9L A;  4GLX A;  1VQL V;  4TSF G;  1U97 A;  1JJ2 U;  4YIO A;  2JGD B;  2IBZ H;  2UXN A;  4DK1 A;  1SQB H;  5BXZ A;  4MVS A;  3QTC A;  1AVM A;  1S76 D;  3AG4 C;  4I5S A;  3P32 A;  1SET A;  4MVR A;  5LA6 B;  3ASO C;  1BQZ A;  4EB6 A;  2UUB O;  2EIJ B;  3K0D A;  3OEH G;  2UUC O;  3IC7 A;  5B1A B;  2K9P A;  4KHP O;  2UXB O;  2ZD9 A;  3CSX A;  3A0B Z;  1JA8 A;  3RFR A;  3UO2 A;  2ZM6 B;  3QNE A;  1PKX A;  4UCU A;  1M93 A;  2EIL B;  1ZAU A;  2JS5 A;  1VQ8 V;  3CRR A;  2ZXW B;  2P5O A;  2QSA A;  1N0N A;  5KHH A;  2DYS C;  4BIO A;  4FLT A;  4JI6 B;  5KAF Z;  4LF8 O;  4YJ3 B;  2AW9 A;  4TV8 A;  4CS3 A;  1ROP A;  3S3W A;  1S5J A;  1VQP V;  3S3X A;  5B1O A;  4W4L A;  1JOY A;  1XDC A;  1OCZ B;  2ZKO A;  5JVD A;  3AG2 B;  1SS3 A;  1WP8 A;  5H6R A;  4B3T B;  4I55 A;  5LBQ A;  4OPH A;  1Q86 W;  1NS1 A;  3ZS8 C;  1BCC H;  1BS3 A;  2YXH A;  4LP8 A;  2HVK C;  4YY3 B;  5CBH A;  2EIL C;  2IJK A;  1GM9 A;  2WA3 A;  2UXD O;  2F95 B;  1VQN V;  3HKD A;  4EFE A;  3TK1 A;  1IZ3 A;  1GM7 A;  5CA0 A;  5C93 A;  3ZRX A;  4O4H A;  5IE9 A;  4DV0 O;  4XBF A;  1AP5 A;  3L72 H;  5GTI Z;  4MTO A;  4JYY A;  4CC6 A;  4K35 A;  3JAM N;  3X2Q C;  4CC5 A;  1FFT B;  2QTO A;  3RVY A;  4I55 B;  5GW7 A;  1HWY A;  4P2Z A;  1L1F A;  2ADP A;  3WG7 C;  1SER A;  1VQ7 V;  2LW7 A;  4DO2 A;  4GX2 A;  3K5N A;  1GK9 A;  2UUC B;  4HBN A;  3K5M A;  4J42 A;  4KHP B;  4LF6 O;  3W7X A;  2UXB B;  4JI3 O;  4WFF A;  1I5Y A;  1AI7 A;  5JH7 A;  2N05 A;  4U7O A;  4X1I B;  4FLW A;  2ZIN A;  1GTO A;  5AG2 A;  2LGQ A;  5LL6 Y;  4FIP C;  5A2Q N;  1JX9 A;  4IHJ A;  1NZ6 A;  4TOI A;  4DV1 B;  2EX3 A;  1XQ8 A;  1K34 A;  1RM1 C;  1RPO A;  2QA4 V;  1GN6 A;  5IYC O;  1YHQ V;  3E2E A;  3KCX A;  1MZF A;  2JK5 C;  4DRX B;  1FXH A;  4JYA O;  5L3E A;  3B40 A;  4IGG A;  2Q5Z A;  5JH7 B;  2IU3 A;  4OGQ B;  2EJR A;  3P30 A;  4X20 A;  4GKK O;  1NT2 B;  4H0L B;  5KHJ A;  1J5E B;  1Q5O A;  3ZHQ A;  1EN5 A;  2CAZ C;  4B7E A;  1H2L A;  1N33 B;  1WPB A;  1NVP D;  2DQ0 A;  1R6N A;  3N27 A;  4QPK A;  4R6Z A;  4YIP A;  2ZR3 A;  2HHH B;  2FML A;  4FMT A;  1XL6 A;  1B3Q A;  4WBN B;  2UXD B;  2B5U A;  4JI2 O;  1D5A A;  4NTY A;  1VQK V;  3OD4 A;  3TXQ A;  3T1H O;  4JZG A;  1QVG U;  4DV0 B;  4J7K A;  2N04 A;  2H94 A;  4MW8 A;  3JAK B;  1D2D A;  3K79 A;  3FAV A;  5FL7 G;  3OTF A;  1ZUQ A;  3H01 A;  4DR5 B;  4LWS A;  3L73 H;  2VQF O;  3AG1 B;  4I0X B;  2F93 B;  1I7F A;  3SGI A;  3APQ A;  2XHB A;  4LF6 B;  5JJN B;  2RCV A;  5IYZ A;  3SJQ C;  3ZHU A;  4RWU A;  3ZED A;  1XIL A;  2YEV A;  5TIS Z;  3OTO O;  3FAV B;  1JFF A;  4DW0 A;  4PDL A;  1T5E A;  4E2L A;  4KL1 A;  1VQM V;  2Q7E A;  4ASU G;  2VQE O;  1OCO C;  2JEU A;  2Y69 B;  4ZIB A;  1H8H G;  2ODM A;  1SA0 B;  3N2K B;  5EZY B;  1GAX A;  1MSW D;  4LF9 O;  1MZE A;  3AG1 C;  3E86 A;  4DR3 O;  4NXN B;  4WFH A;  3L74 H;  2UXC B;  5IYZ B;  3HKE B;  1SF9 A;  1P84 F;  1DK1 A;  4R7C A;  2YEV B;  3M8A A;  1JFF B;  5LP6 B;  1KKC A;  4YJ2 B;  1XBL A;  4RQF A;  3NXS A;  4BR6 A;  4FFB B;  1VQ4 V;  3IFX A;  4J10 A;  4JI2 B;  2WLJ A;  3LDE A;  2LGW A;  3ASN C;  4X1K A;  5BR8 O;  2RJZ A;  4LNU A;  4PI0 A;  2FB5 A;  4J9Z B;  5J9P C;  1XMQ O;  4KP4 A;  4NXM O;  3CCU V;  2CTP A;  2EIK C;  3JAW A;  2YXL A;  3F7V C;  4ZHQ A;  2CTQ A;  3AG7 A;  1NKD A;  1K7D A;  4ZKI A;  3CWB H;  2ZE8 A;  3BA8 A;  3ZMS A;  1AI6 A;  1JCH A;  1A32 A;  4AIL C;  1HNX O;  2V7Q G;  3FYI B;  4U3J A;  5EK0 A;  4LNU B;  5J2T A;  2XT9 A;  1Y4M A;  3HPL C;  3DGE A;  4K0K B;  4QIW F;  3IAY A;  3ZN1 A;  3CXH F;  3A0R A;  4F6R B;  1ZTE A;  2UUA B;  3H1H H;  1F4M A;  4G27 B;  3JAW B;  1LR1 A;  3B8N A;  4P9P A;  3H1L H;  5JQG A;  1VQ9 V;  2DQ3 A;  2VQE B;  3FKS G;  4FLV A;  2E5L O;  4J7J A;  1NH2 D;  1AB3 A;  5IYD O;  5H6Q A;  4X1Y B;  4NYK A;  3H1K H;  2QKS A;  1IX9 A;  3IC9 A;  2EBO A;  4B08 A;  1NTZ H;  3OT7 A;  4DR3 B;  3AK2 A;  4ICG A;  4U3J B;  2UU9 O;  3BPZ A;  1XNQ B;  3UO3 A;  4I9Q A;  4DR7 O;  2OIG A;  1KUQ A;  3ETD A;  2ZE7 A;  5KHI A;  1TUB B;  2BSK B;  3QO5 A;  4B3M O;  4O4I A;  1IXB A;  2Y0P A;  1JQ0 A;  3E8F A;  4I9W A;  5JQG B;  1Q8I A;  4JI7 B;  4JTA B;  3ABK C;  4QE9 A;  3T2M A;  3T1Y B;  2QKC A;  5BR8 B;  4TWK A;  1TGO A;  4J11 A;  5EBW C;  4UFZ A;  1QU7 A;  4UVB A;  3RBZ A;  3L75 H;  4NXM B;  4RQE A;  1M56 C;  4LH6 A;  3SYO A;  2QJ1 A;  1XOU A;  4LF7 B;  2Q4P A;  3JYC A;  1HW7 A;  2Q8V A;  2ZIM A;  3QVN A;  1ENV A;  3CCJ V;  2OCC B;  1YJ9 V;  4O2A A;  4DR6 B;  1BHB A;  5LGU A;  2YUA A;  4I50 A;  1YJN V;  3ZMV A;  1URF A;  2KB1 A;  4I7Z B;  3A8T A;  3T4D A;  2GBO A;  2PI4 A;  4DV3 O;  1FFX A;  4FZ0 A;  4PA3 A;  2ZNJ A;  4DR4 O;  5L3F A;  1H8E G;  3JAR A;  3CC4 V;  3SPG A;  1AIL A;  2KG7 B;  2QR4 A;  5LOV B;  2JDI G;  4ZI7 A;  1R73 A;  2XAG A;  3RYI A;  4UCR A;  3Q4H B;  4TV9 B;  2E5L B;  4UUJ C;  3SDL A;  2R9A A;  4O2A B;  3P3N A;  1ZSP A;  4I50 B;  3T1C A;  4LF4 B;  1W0K G;  3K03 A;  4FLZ A;  3JD1 A;  3OUF A;  3KCY A;  2Q73 A;  2UU9 B;  3G4S V;  4J80 A;  1K73 W;  4N23 A;  4DR7 B;  3ABU A;  1FXK A;  1PPJ H;  1Y6X A;  5KA5 A;  1WAZ A;  1TAE A;  3UM7 A;  3ZHV A;  4B3M B;  2YIC A;  1S72 V;  4X62 O;  4JF3 A;  3G80 A;  5LYJ A;  3CC7 V;  5KUK A;  3RYI B;  3BY6 A;  2ADQ B;  4DXW A;  5A9G A;  2HKO A;  3CD6 V;  2F4V O;  3ETQ A;  5KMG B;  2YS8 A;  1Q6U A;  5KX5 B;  2GUZ A;  3H1J H;  5B1B B;  2QWN B;  2F43 G;  3JD0 A;  2OT5 A;  4JI0 B;  2Q0A A;  4G28 B;  3HKB A;  1GH6 A;  1KB9 F;  4DR1 B;  3K04 A;  3C90 A;  4X65 B;  1H2M A;  1QCE A;  3THO A;  1N36 O;  3AG4 B;  4IL6 Z;  4LFA O;  2JGU A;  4RO2 A;  1W2B U;  3MHH C;  3N2G A;  1Y76 B;  3ASO B;  1VQO V;  2BCC H;  2Z3Y A;  1XNR B;  3SJA C;  4FLY A;  5EBL C;  4DV3 B;  4AQY O;  1WB8 A;  3RWR D;  5LXT A;  2ZIO A;  1CEZ A;  4IIJ A;  3R66 A;  3HKB B;  1M1K W;  1I08 A;  1KD1 W;  3ZHS A;  3ZRV A;  5KHK A;  3CRQ A;  1YCI A;  1NJI W;  1VMG A;  2Q69 A;  2RN9 A;  4LFC O;  1EBO A;  5FPO A;  3K59 A;  5LMU B;  4Z2W A;  1FXK C;  3ZBH A;  3N2G B;  2DYS B;  1M4U A;  1G8M A;  2BTQ A;  1TUE B;  5LXT B;  4NR1 A;  4JV5 O;  2HG5 C;  5CBF A;  2R9I A;  3FB5 C;  2P90 A;  3UCS C;  1P7G A;  4X62 B;  1KEC A;  1PNL A;  2V1D A;  4I4T B;  3U10 A;  3ETE A;  4PI2 A;  2L35 A;  4ZOL A;  2MW2 B;  3CS5 A;  5L3C A;  5IJ0 B;  3TGU H;  2M6Y A;  1SQV H;  3FB8 C;  4KXR A;  3ML0 A;  3K3W A;  4OX9 O;  1FJG O;  2HJF C;  1GO3 F;  4HAM A;  2K1E A;  4FK5 C;  1UFI A;  1YTF D;  4CH4 A;  4MT8 A;  4PDM A;  3UQ8 A;  2QM4 A;  1QNM A;  2F66 C;  4UB8 Z;  4UVC A;  2FTK A;  4YXW G;  2PYJ A;  4LF5 O;  3ABL C;  4EB6 B;  4R8C A;  1V55 C;  4DYL A;  1HNW B;  3E8H A;  2A7W A;  4NKG B;  3X2Q B;  5HFL A;  3CRM A;  2CK3 G;  4FM0 A;  3K0G A;  2B1G A;  3WG7 B;  5H9C A;  3J80 N;  1QVF U;  1MMM A;  1KBH A;  1SRY A;  4AQY B;  2W6I G;  2Q7G A;  1NBM G;  1YJW V;  1Z5W A;  4CH3 A;  1QR9 A;  3QO7 A;  2PF4 E;  1OHH G;  2F23 A;  2YXY A;  3K58 A;  1TVK A;  3W7U A;  4TV8 B;  4BAY A;  2HP8 A;  1RM1 B;  4PA6 A;  2Y4U A;  5B1N A;  3IJ4 A;  2ZE5 A;  1FD9 A;  2WLN A;  4DR2 O;  3SYQ A;  2YDE A;  2RQ6 A;  5ITZ A;  5JVD B;  4JV5 B;  1OV9 A;  3JSN A;  3TJT A;  4KFM A;  4PDR A;  4Q6G A;  1YXB A;  5IDJ A;  4JAU A;  3ZRS A;  1Y67 A;  2EUL A;  1PL0 A;  2RDC A;  2UUB B;  1M57 C;  3H1I H;  1AI5 A;  2ZT9 B;  4PA4 A;  4EEQ A;  1TVK B;  2UXX A;  3DC6 A;  4WFB V;  3HKD B;  2Q0O C;  5CA0 B;  1XHX A;  4DV4 O;  2A0L A;  4O4H B;  1K8A W;  2LFR A;  5KA6 A;  2E3C A;  4O4L A;  3CCM V;  2P4K A;  3JAL A;  1NTM H;  3FB7 C;  4BWA A;  2RNB A;  4LF5 B;  1VF5 B;  1SQP H;  1PL4 A;  3FD9 A;  5K1P A;  1CP9 A;  2E76 B;  4LF8 B;  1H2S B;  4JZ2 A;  4K3A A;  1P49 A;  2OCH A;  1BL8 A;  1JR9 A;  2PGG A;  2EIN C;  1DF4 A;  4CS2 A;  3MD0 A;  2DWE C;  2CGN A;  2EJ7 A;  4IHJ B;  4AHC A;  3OMA B;  1W59 A;  2WPD G;  4L8J A;  1IDS A;  4X66 O;  3OE7 G;  1VF6 A;  4TT3 G;  3CPW U;  2PI5 A;  3OW2 U;  4GKJ O;  1OCC C;  1ARO P;  5C8Y A;  2CGO A;  4QGP A;  4DV2 O;  2ATK C;  1R3K C;  3APO A;  4DR2 B;  4YHH O;  3UT5 A;  1Q6I A;  4X20 B;  3SPC A;  1OCO B;  1RP3 B;  1F51 A;  5IJ9 A;  2YIB D;  4TUY A;  3BAA A;  1KKD A;  3MAQ A;  2EIM C;  2JS3 A;  1L0L H;  4E4E A;  5CMU A;  3VQY A;  1YIT V;  4BW9 A;  2DE0 X;  1RPR A;  4DUZ O;  1YDX A;  4JI3 B;  3L9D A;  4QJF B;  1WLE A;  3ZMT A;  1EN6 A;  2Y4T A;  2LP7 A;  1CXZ B;  3UT5 B;  4GUN A;  2R70 A;  1H2G A;  3ASN B;  4MVZ A;  4LWS B;  4UCT A;  1COW G;  4LC1 A;  2QEX V;  1GN4 A;  5L3B A;  4JYA B;  2OWO A;  2EIK B;  4RUF A;  1MSD A;  4PD4 F;  1QBZ A;  4OPA A;  3SYC A;  2YID A;  4GKK B;  1IXM A;  1VF6 C;  2IH3 C;  3ZHR A;  1S0V A;  5K1X A;  4MS2 A;  2OTJ V;  3P3P A;  5CB4 A;  1QR8 A;  1MOF A;  3B09 A;  2QWQ B;  4CBC A;  2EZP A;  1FKA O;  4U7N A;  3MDS A;  2YIB A;  3I56 V;  2FKX A;  2AHZ A;  2QWO B;  4DV2 B;  1NVP B;  3T1H B;  1GMG A;  3ICX A;  3D3Q A;  4YHH B;  2DMX A;  2Y0I A;  3ZMZ A;  1MAB G;  2PZS A;  2G38 A;  5KUM A;  3BAB A;  3E22 A;  4FLU A;  2VQF B;  3CCE V;  5EYP A;  1US6 A;  1U96 A;  4Q20 A;  2VWK A;  2Q67 A;  2E75 B;  3LSU A;  3DXR A;  4DUZ B;  1RSO A;  4MTG A;  1NTK H;  1Q81 W;  1BSM A;  4X1K B;  3GWO A;  4B7K A;  3U0Z A;  1Q90 D;  3G6B A;  1GM8 A;  2PTM A;  4B3R O;  2NLJ C;  2QE7 G;  3A0H Z;  2NN4 A;  3ABK B;  4X64 O;  3OTO B;  4GZR B;  3SPJ A;  3I55 V;  2D2C B;  1BT8 A;  3E22 B;  4UCV A;  4GCZ A;  3JD3 A;  2LO1 A;  3OEE G;  4ZBM A;  5EYP B;  4ZHQ B;  3TCU A;  1YSC A;  1FXV A; 
#chains in the Genus database with same CATH homology
 1HR0 O;  4OX9 O;  1FJG O;  1DK1 A;  2F4V O;  1HNW O;  3M8A A;  4DR1 O;  4GKK O;  4JI1 O;  1I94 O;  4X65 O;  4YY3 O;  3RT3 C;  3O65 A;  4JI5 O;  2ZKO A;  4LF7 O;  1XEQ A;  1N34 O;  4LF5 O;  4OPH A;  1NS1 A;  2DJV A;  4OPA A;  4DV5 O;  1X59 A;  2N74 A;  5BR8 O;  4JI4 O;  4DUY O;  4DR6 O;  1XNR O;  5BY1 A;  4DR5 O;  4JI2 O;  5H5N A;  1XMO O;  4DV7 O;  1XMQ O;  1N36 O;  3T1H O;  4NXM O;  2UXD O;  4LFA O;  3J80 N;  4JI8 O;  1G1X B;  2AGA A;  1D2D A;  5IT9 N;  1FKA O;  4K0K O;  4DV0 O;  4X66 O;  5IWA O;  2FKX A;  2VQF O;  1IBM O;  4AQY O;  1IBK O;  2UUA O;  3JAM N;  5BXZ A;  3J81 N;  5LMU O;  4LFB O;  4DV6 O;  4GKJ O;  3R66 A;  1A32 A;  1HNX O;  4DV3 O;  1R6T A;  4DV2 O;  2LW7 A;  1HNZ O;  4DR4 O;  1FYJ A;  4YHH O;  4LF4 O;  4DV1 O;  1IBL O;  1N32 O;  2UUB O;  1AIL A;  4LFC O;  4LF6 O;  4B3S O;  5LMN O;  4JI3 O;  4DR2 O;  1R1B A;  2UUC O;  4KHP O;  3OTO O;  2UXB O;  3SDL A;  1XNQ O;  5LL6 Y;  5A2Q N;  5FLX N;  1YZB A;  3J7A U;  4NXN O;  2UXC O;  2E5L O;  4JI6 O;  1AB3 A;  4JV5 O;  4DUZ O;  2JRI A;  2VQE O;  4B3R O;  4A5U B;  1J5E O;  2ZM6 O;  3F5T A;  2DOS A;  4JI7 O;  2UU9 O;  4X64 O;  1N33 O;  4LF9 O;  1F7Y A;  4JYA O;  3T1Y O;  4X62 O;  4DR3 O;  4DR7 O;  4JI0 O;  1KUQ A;  2Z0A A;  4DV4 O;  4LF8 O;  4B3T O;  2HHH O;  4B3M O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...