1N33O

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n33O00
2UU9O 4DR4O 5BR8O 4B3MO 4LF9O 4DR6O 4DUZO 5A2QN 4LF8O 4JYAO 1HNWO 1A32A 2E5LO 4LF6O 4DV2O 2VQEO 4B3SO 1KUQA 2UXBO 4OPHA 4X64O 2UUCO 1XMOO 5H5NA 2VQFO 4A5UB 1N34O 4YY3O 1FYJA 5LMUO 3M8AA 4LF4O 4GKJO 2UXCO 1FJGO 2UUBO 2F4VO 4LFBO 4DV4O 1IBLO 4X66O 1DK1A 1IBKO 5BY1A 5LMNO 4JI6O 3O65A 4JI5O 3J81N 1HR0O 3SDLA 4DV6O 1XNQO 4YHHO 3OTOO 4DV5O 3JAMN 5IT9N 1D2DA 1F7YA 1NS1A 2UUAO 4LFAO 1R1BA 3F5TA 1XMQO 3R66A 4B3RO 5IWAO 1IBMO 1XNRO 2DOSA 4LF5O 4DR3O 1I94O 2Z0AA 3T1HO 4JI3O 1AILA 2ZM6O 1FKAO 2ZKOA 4K0KO 1N32O 2N74A 4X65O 4DR5O 4B3TO 2JRIA 4DUYO 1J5EO 2UXDO 4DV1O 1AB3A 2FKXA 4NXMO 1XEQA 4JI1O 4DR1O 4JI0O 4JI2O 3RT3C 4LFCO 3J7AU 4KHPO 4DR2O 5FLXN 4JI7O 4GKKO 2AGAA 1HNXO 3J80N 1HNZO 4DV7O 4LF7O 4JV5O 2HHHO 4NXNO 4OPAA 5BXZA 1N36O 2LW7A 4JI8O 4DV3O 1YZBA 5LL6Y 4JI4O 4OX9O 4DV0O 1G1XB 4X62O 4DR7O 1X59A 4AQYO 1R6TA 2DJVA 1N33O 3T1YO
chains in the Genus database with same CATH superfamily
3ABMC 2Q0OC 2MK3A 3AG3B 3ZMUA 5A2QN 4LF8O 1P4RA 4DV2O 4OPHA 4DW1A 5IJ0B 4I4TA 3JATA 5LMUO 3I5DA 1AVMA 4LFBO 1VF5B 3M99B 2CTPA 2PY5A 1S76D 1K8AW 5LMNO 1R3LC 1Y66A 3OD4A 4G2KA 5KHJA 3TETA 3SDLA 1J95A 1BZKA 4YHHO 3SPGA 4X66B 5EYPB 2RCVA 3ABMB 3T1YB 2QKAA 2OWOA 2XNDG 2DQ0A 2DMXA 1Q90D 3FB7C 2D3OW 4CZZA 4FZ0A 4QJFB 3SPJA 1NR1A 2BTQA 1R1BA 4RUFA 2EINC 3APOA 2DOSA 2ATKC 5ITZA 4MVSA 3CC4V 5EC2C 2Q73A 4TQFA 4QPKA 5CB4A 5CBGA 3W7WA 3O9OA 3RWRD 5GTIZ 4NR1A 4GLXA 4MTOA 1P7GA 2QM7A 3ZN0A 1DTOA 5C93A 4AHCA 4YJ3A 4GKKO 5KUKA 4N23A 3ZEDA 1IVSA 2QTOA 2K9PA 2HHHO 2IJHA 1LNQA 1FXKC 1H2SB 5H6QA 1NBMG 2EINB 3WG7B 3ZMTA 5HFMA 3OR7C 1XMQB 3K5MA 2IW5A 4K8XA 5D5QA 5CA3A 4DR7O 2E74B 4MTFA 2KQXA 5A9GA 4U7NA 3RYIA 2YI9A 2JJ2G 5E79Z 1GK9A 4O2AB 4EKWA 4DR4O 5FNVA 1R6NA 5BMVA 1Q3EA 2VQEO 3RGBA 2UUCO 5L3DA 1FD9A 3ETEA 4LF9B 1XOUA 1FXKB 1YF2A 4LF4O 1KYOF 4H0LB 1GAXA 2P06A 1S5JA 5KA6A 4ZIBA 2YS8A 4D7SA 3K57A 4O4IB 5J9PC 1VF7A 4F6EA 4MVUA 2ARHA 3SPCA 1R3KC 3B2EE 3B09A 2IM9A 4QE9A 5LXTA 4B3RO 4JF3A 1NVPB 2EJRA 2WAMA 4PV1B 1CXZB 4LF5O 1KU9A 2QR4A 4K0KO 4WBNA 2UXCB 2GTAA 1XI1A 4X65O 4DR5O 3MDSA 5JQGB 4CH5A 4J7JA 1GM9A 1I94B 1R6KA 3U11A 2DYRC 2BE3A 4I9WA 2YXYA 1VQNV 1DLBA 1ZL8A 3N2GB 4TWKA 3J80N 4QNHB 3SYCA 3RYHB 2GHYA 2QWPB 5CA0B 3K3WA 1BT8A 2JS5A 4LF7B 1P84F 3ML0A 1WN7A 2M7WA 3DC6A 3FKSG 4DW0A 1M57C 5IYDO 4HAMA 1OCRB 4L8JA 1UJWB 1M1KW 5IJ0A 4J9ZB 4RQFA 1Y6XA 2DYRB 1YDXA 4JI0B 1QNMA 4NTYA 2IJKA 2Q7EA 3OEHG 4FVMA 1YXBA 2UXBO 2IH1C 3TCUA 3TXSA 2WLJA 3UKMA 2VS0A 3UM7A 5EYPA 4LF6B 1FXHA 4IYIA 4XDKA 1XMOB 4DV3B 2N05A 1KD1W 1YTFD 4JI6O 1M57B 3E8FA 3OT7A 2ZNJA 3BPZA 1COWG 2OYQA 4EB6B 4GCZA 4E2LA 4GUNA 3ZRWB 1EZJA 2ETNA 1H38A 1OCCB 2DWDC 3MHSC 5IT9N 2ZCEA 4FLWA 1YI2V 2IJIA 5CBHA 4LF8B 4FM2A 1Y76B 2YXLA 4DV2B 2WLNA 2OCCC 4FFBB 3Q4HA 2JIZG 3STLC 4LCUC 1HW7A 3IFXA 5LMUB 2ADPA 3E22B 1BCCH 4LFBB 2KG7B 4UV9A 5L3CA 1NQTA 2P90A 3ICXA 1I08A 4DV1O 4GX2A 3JAKB 4FLXA 1AB3A 3C3TA 1XEQA 2D2CB 4JI2O 3EHBB 2ZIMA 3MHHC 2QDOA 4RAIA 4X1KB 4YHHB 3JD0A 4JI7O 3RYFB 3ABLC 1HDJA 2Q68A 1MABG 1MA1A 1SQFA 2Q69A 4O2AA 1SQVH 1NR7A 2OCCB 3LSSA 4PA4A 2HR3A 4UV8A 2V1DA 1SC5B 3KZIZ 4LP8A 2QKSA 3TGUH 4RWUA 1H2GA 1Z5VA 3OMAB 3WFVA 4LNUA 3W7UA 3EVKA 2QA4V 1GMGA 3ASOC 2JVDA 1FXKA 3K5NA 1WP8A 3HKEB 3CC2V 5C8YB 5BR8O 4B3MO 2OTLV 1LUVA 3ABLB 1A32A 4CBCA 5FPOA 2CE4A 2VQFO 3KCXA 2WLLB 4B08A 1FYJA 2GBOA 3W7XA 1OV9A 4O4IA 1AI6A 2Y4UA 3GB7C 4UCOA 2W6IG 3S3WA 4ASUG 5IE9A 4X66O 2F43G 3OAAG 1IBKO 1BQ0A 4BIZA 4NKGB 3OE7G 2RDCA 3P3PA 2QTSA 3FX7A 1VQMV 1YIJV 1XNQO 4OGQB 3OTOO 2DE0X 1M9NA 3UO3A 1YJWV 2P4VA 1K5SA 2B1IA 1Q82W 3L9DA 2EIJC 5JQGA 4K35A 4DV6B 1KMIZ 5LGUA 1Z5WA 2VQEB 2WPDG 2UUCB 4YXWG 4ZI7B 4U3FH 2B5UA 2UUAB 3N2GA 4LF4B 4PDRA 1N8RW 3CRMA 2N74A 3RYHA 1J5EO 3K0GA 5CA0A 5IJ9B 4BAYA 3OGIB 3T1HB 5KMGB 3CRRA 4NVPA 3CB2A 3E35A 2YSUB 5EIBD 5LHIA 5IY5C 2ZXWB 2EIJB 1JX9A 4DR1B 5EZYB 4GT1A 4J80A 1BS3A 1D5NA 3SJAC 1VQ7V 2A3QA 2JEUA 3JCUZ 2YDEA 4MW3A 4OX9O 1JPXA 4NXNB 2B9ZA 4B7KA 1W59A 1O9GA 1R6TA 1WPXA 3U0ZA 1YEWA 4X65B 3QF7A 4K3AA 4JTAB 4DV0B 3UCSC 3KKYA 2RNBA 1Q6HA 4R8CA 4LF9O 4F4LA 2R9AA 3CEIA 2QGNA 4PDLA 3OFNG 1L8DA 4FIPC 1NZ6A 3S3XA 4EB6A 2Y69C 5LOVB 1N0JA 2H94A 1VF6C 5EK0A 3ZRWA 2E5LB 4CS3A 4DV4O 4JASA 1DK1A 3WB0A 1RSOB 1AR5A 1YTFB 4O2BB 2CTQA 1Y76A 4JI5O 4UCUA 4PDVA 1DGSA 3JSLA 3LUTB 4FFBA 5LP6C 4WF9V 1JJ2U 3E22A 3JAMN 5BZBA 1SRYA 2KG7A 1F7YA 4QPJA 3JAKA 3LSQA 4FLUA 2UXBB 2WLIB 2Y69B 2P7TC 3CCQV 4X1KA 1I94O 2Z0AA 4IL6Z 3RYFA 1OHHG 1H2NA 2YIBA 1S0VA 1PP9H 1FFXB 2Q0AA 3CCEV 3CHXA 5KHHA 4QE7A 3HB3B 4EEQA 4JI6B 3N27A 5LP6B 3TK1A 5IYBO 3PJSK 4UUJC 3K9AA 5FLXN 3G6EV 1NVPD 1NKDA 1K92A 5B5EZ 4Q6GA 4LF7O 3H1HH 1SQPH 1XDCA 2QM8A 3HKEA 5L3BA 3CCJV 4LC1A 5C8YA 2XHBA 4IHJB 3VOUA 3T1CA 1G1XB 1QR9A 3H9VA 4KFMA 2QSAA 1VARA 3R65A 4TV8B 2WLLA 3K79A 1AJPA 2BTOA 4DV1B 2X7RB 2ZIOA 3UT5B 2YEVB 3ZHVA 4LF6O 5LGNA 4JI7B 2P22C 4B3SO 3ZCCA 1XMOO 3N2KB 3HKBB 3DSQA 5B1BC 1MOFA 4N21A 1JMKC 4FK5C 4TSFG 1FS0G 2EZOA 2PI4A 1CP9A 1K34A 4J7ZA 2LGWA 1WNSA 1ZSPA 3K5LA 1N34B 1AJNA 4DYLA 2GDSA 2ZT9B 3CRCA 4ZI7A 4FJCC 5DEDA 2H3OA 3ZMSA 2CH7B 4IGGA 4Z1MG 1WB8A 5BR8B 4B3MB 5EIBC 3OUSA 3B8NA 5AG2A 3UO2A 3CCLV 4JAUA 5IJ9A 5B1BB 5KMGA 3H1KH 5IWAO 2VQFB 4AI8A 1AP6A 4IIJB 3SGIA 1KC8W 5JJJB 4GYCB 2ZM6O 3ZHSA 3HPLC 1U96A 3MD0A 4Z2WA 1BQZA 5EZYA 1KKCA 2DYSC 3CXHF 1OZ0A 4XBFA 1IBKB 1QR8A 2VWKA 2PF4E 3B40A 1TUBB 2UXNA 4BW9A 1XNQB 3OTOB 2PYLA 2HJFC 3WG7C 5L3GA 3ZMVA 4EFBA 1OCZC 4OPAA 5J2UB 3THOA 3CC7V 2OCHA 1EN6A 2XAHA 2DYSB 5H2FZ 3A0BZ 2DW4A 1L0NH 4OXSA 2YIBD 5LOVA 4CC5A 1J5EB 2F95B 4PA3A 4O4HB 5F2VO 1RSOA 5LGTA 4H13B 5H5NA 1OCZB 3K04A 2CTWA 1KECA 2JGDB 3TJTA 2F4VO 4HNAB 4X9QA 4FLVA 4OX9B 2PYJA 4X1YB 5KA5A 4FMTA 1XREA 5GONB 1SKVA 2WLIA 1PL0A 5JWPA 1KQSU 2R9IA 4DV6O 3L74H 1VF6A 2A06H 3PN1A 3ZRVA 1FFXA 3K06A 2UUAO 2R70A 4GX1A 5LHGA 3JD4A 5LP6A 3IGAC 2YUAA 2ZINA 1IBMO 4O4JB 3T1HO 1AILA 4LFAB 4PHZA 4ZHQB 4I0XB 1IZ3A 1GN2A 4P2ZA 4PD4F 5CN0A 4DV4B 2B1GA 3C3SA 3SYOA 4DR1O 4JI5B 5DECA 1GKFA 2AHZA 3SR2C 4IHJA 4XDLA 3DC5A 4J11A 4TV8A 1QLEC 4DO2A 3WB2A 4NXNO 1V55B 3NXSA 1GN4A 1SZTA 5GTHZ 1PNKA 3B4SA 1OCRC 4DV0O 3OMIB 3UT5A 2YEVA 2OIEA 1JR9A 1VQKV 2DJVA 3CCMV 4UXNA 1TVKB 3N2KA 3HKBA 1VQ6V 1BE3H 1RM1B 3MAQA 3RN4A 3VQXA 4U7OA 3JCZA 1MSWD 2E5LO 2QEXV 1QLEB 2EIMC 1KUQA 3A8TA 2E3CA 3ZMZA 2CH7A 3LDCA 1NI8A 2ITCC 1PL4A 3E8BA 1EFRG 1K73W 3ZRSA 1QVGU 1OCCC 4J42A 3BAAA 3QVNA 2Q8VA 3L75H 4IIJA 4U3JB 4J7KA 4NTWA 4YIPA 4WFBV 4MVQA 2ZE5A 1NTZH 1NJIW 2Y0IA 2FMLA 2EIMB 2KKWA 5EBMC 2Y4TA 4HYOA 3HKDB 4ZOLB 4DV5B 4B3SB 2CK3G 4UVBA 1D5AA 1TUBA 2KB1A 4KUMA 3F7YC 4J41A 2XAJA 4PA6A 3OGCC 1ZLZA 1MG1A 2FKXA 1Q81W 3LNMB 3ABKB 4JYYA 2XAQA 2CGOA 5J2UA 1QLNA 2BOBC 1JQ0A 3CS5A 4JZGA 4LH6A 3UQ8A 3G6BA 3JASB 3AEIA 1OCOC 1Q7YW 1HNZO 2OT5A 3F5WC 5BXZA 2LW7A 3BABA 4WFAV 4X1IB 3CXCU 5IWAB 2JK5C 1P7BA 3LDDA 5JVDB 4O4HA 2GSMB 2ZM6B 1AP5A 2ZDIC 3W7SA 1ORQC 3ZN1A 3IAYA 2JGDA 1XL6A 5H6RA 1IXMA 4O4LB 2ITDC 4HNAA 4NYKA 4RQEA 1MSDA 1E79G 3OMNB 4JYAO 1OCOB 4X1YA 1I7FA 4LH7A 4X64O 1AR4A 1VEWA 1V54C 1GM7A 5GONA 2CUGA 4PJ0Z 4D7TA 1N34O 1QVFU 1SESA 1K97A 4IT5A 4C7UA 1IBLO 3C90A 1ZX3A 4W4KA 4CS4A 4TT3G 3OUFA 3ZBHA 1FJGB 1W0JG 3JAWB 1EN4A 1WLEA 2Q7HA 3ASNB 2RJZA 4O4JA 4RO2A 1BHBA 1KP3A 4UCRA 2A79B 3AK1A 4MVRA 4ZHQA 3G4SV 1MNGA 4I0XA 1TUEB 1B3QA 3L70H 1FFTB 2CGNA 2YC0A 3G80A 1V54B 1URFA 3P32A 2ZE8A 1PPJH 2YICA 2YIAA 3BY6A 4Q20A 2F4VB 1RP3B 3A0HZ 1GTOA 2W6JG 3AK2A 3H1LH 3QNEA 3SJCC 2X0LA 3W7TA 2ZXWC 3RT3C 1F4NA 2V4DA 3A2FA 2EBOA 3B77A 3JD2A 3STZC 4MVMA 1ENVA 2JGUA 1TVKA 3DXRB 2NR5A 2NN4A 3M7MX 4X89A 4JI4O 1IBMB 3K08A 1JJOA 4FM0A 4TOIA 4NTXA 1SQQH 4PI2A 4JI8B 4X88A 1IURA 1Q6IA 2P5OA 1WPBA 1XBLA 4NB5A 5JH7B 2UU9O 1SERA 1SZXA 3E2EA 2N04A 4DUZO 2FYUH 1RPRA 1HNWO 2IBZH 2ZR2A 2BSKB 1SQGA 1VMGA 1W2BU 2Q4PA 1XL4A 4GX0A 4FLYA 3CP1A 2V7QG 4L87A 4U3JA 1E1RG 4UCTA 4FLTA 2BOCC 4KXRA 3IC9A 3BHPA 5IYCO 3SYQA 3O65A 4DXWA 2LFSA 3HKDA 4ZOLA 5DM6V 4G28B 1VIBA 3E86A 1I5XA 1YHQV 1ZWIC 3D8CA 1B6QA 2EX3A 3APQA 2P4KA 4LFAO 3RFRA 2Q9LA 4UVAA 1DF4A 3F5TA 2XT9A 1GH6A 2QWQB 3CYOA 2ZE7A 1N0NA 3VQWA 4JI3O 1M56B 3JASA 2ZKOA 4BR6A 4JAVA 4Z1VA 2W0XA 1XILA 4FFKA 1R3JC 1XNRB 4JTDB 2HEPA 4I55B 4LFCO 1L1FA 4X1IA 1XHZA 3NR7A 1VQ5V 4B3TB 1ZTEA 1F51A 4WCEV 2IH3C 5JVDA 2PUSA 1M93A 4QGPA 4JV5O 5IDJA 5E1AC 3CX5F 2PTMA 2CDYA 1Q8IA 1M4UA 4P9PA 4O4LA 5LHHA 4LWSB 2OTJV 5KHIA 2HJDA 2OIGA 1NU1H 1KBHA 5KUMA 5BMVB 1R73A 1SQXH 2KSDA 2Q7GA 3QO7A 2YXHA 1F4MA 4JPRA 4W4LA 1QU7A 4FZ1A 5JJEB 3EXAA 4ICGA 2ZDIA 1JA8A 1HNZB 4A5UB 4DR6B 3BEHA 3JAWA 1M5IA 2IJJA 1XQ8A 4X8AA 3G71V 1B06A 1V9PA 3D3IA 1T5EA 5JCOC 4D6TH 1HR0O 1I0HA 1KB9F 2VRZA 4WFHA 3CCRV 1FAFA 1SETA 2XOKG 2AW9A 3ZHQA 4DV5O 5D5PA 4F6RB 1FXVA 1GN3A 1NS1A 4JYAB 2HVKC 3JARB 3SYPA 2L35A 4WBNB 4PA7A 4X64B 2WLMA 2XUMA 4WFEA 4JAAA 3BVOA 2WSSG 1JFFB 2RN9A 4MS2A 1YSCA 2XASA 5LBQA 3DXRA 4DUYO 1IBLB 4B7EA 4MVZA 3G67A 4KHPO 3SJBC 1R3IC 3FB8C 4WFGA 2ODMA 1DF5A 4R7CA 4UCVA 1VQ8V 3ZJZA 4UCSA 4PDMA 3FAVB 3OEEG 2DQ3A 5EC1C 1RPOA 2X6CA 1K33A 5B1AB 5JH7A 4DRXB 2YIDA 2HP8A 1YZBA 2Y0PA 3IC7A 5LL6Y 5FPRA 3OTFA 1VP7A 2LP7A 2XAGA 2BSKA 4ABMA 1WJZA 4LBEC 1SQBH 2ADQB 1QBZA 1SA0B 4JGSA 2A9HA 4BIUA 3RBZA 2FL4A 3SPIA 4I50B 3H1IH 1CPYA 2WLKA 4R50A 4YY3O 3ZS8C 3GVMA 4JZ2A 4PI0A 2QKCA 1FJGO 2HFEC 2LO1A 3E89A 2UUBO 5JJNB 4JI4B 3FYEB 3QO8A 5TISZ 3CMEV 4O2BA 2LQTA 1Q43A 2UU9B 3Q4HB 4PA9A 2BCCH 3ETQA 2LGQA 4DUZB 1K4DC 3ABTA 1HNWB 2P67A 1S5HC 4I55A 1X4TA 3OR6C 2DWEC 5B66Z 2X6AA 1PKXA 1TAEA 4UFZA 2UXDO 5J2TB 1TA8A 4NXMO 4XDJA 1K7DA 5KHGA 4DR2O 4LWSA 2EZPA 1V55C 1I5YA 1US6A 1HNXO 4AILC 2O57A 4MT8A 4FPPA 4GX5A 1N36O 4JI8O 4LNUB 4YJ2B 4AQYO 3E8GA 4JI3B 1N33O 1Z2GA 3BA9A 1RFYA 4CH3A 2NNUA 1RM1C 2JJ1G 4TV9B 1N4CA 5CBFA 1VQPV 4X62B 4BW5A 2Y48A 4LFCB 3WB1A 4CS2A 1XHXA 2E75B 3U10A 1UPGA 1G8MA 4JV5B 4KL1A 3X2QC 1U97A 5EBWC 1Q6UA 4GKJO 5KHKA 3BRCA 4F6RA 2AHYA 1MZFA 1KKDA 2WWWA 4I5SA 5BY1A 1H8EG 3JARA 3J81N 2ZNIA 2EILC 5B3SC 1WAZA 3H1JH 3D3QA 3RW0A 2QWNB 1WB7A 3DGEA 1JFFA 4J9YB 4MTGA 3KCYA 2PZSA 2LFRA 5B1NA 2K1EA 5JCOA 4E4EA 5LYJB 2M6YA 3QTCA 1BGYH 3FD9A 4KP4A 1MMMA 3X2QB 1XNRO 4H44B 1THZA 2PGGA 1HWYA 2GUZB 2GV9A 3ABKC 2ZD9A 4B3TO 3FAVA 3D36C 2JS3A 1BL8A 4TUYB 1NTMH 2EILB 4JYBA 4JI1O 5B3SB 3B8MA 5KX5B 3JD1A 1HR0B 3AG4C 4DRXA 2ZR3A 1PV0A 1NH2B 3K5OA 4YIOA 2WLHA 2JDIG 3ZRXA 4FLZA 2A7WA 5CA1B 4H33A 1SA0A 2R72A 3CCSV 3IJ4A 4DV7B 2F93B 4I50A 3RVYA 3L71H 3ZHUA 2FTKA 2A0LA 2WA4A 5KAFZ 3FYIB 4DUYB 2AZ2A 3AG4B 4H37A 2NLJC 3CE2A 4DR6O 1QQCA 4WFFA 4KHPB 3RVZA 1SF9A 1F23A 5LA6B 3I56V 3K59A 2RQ6A 2CAZC 4BIOA 3OM3B 3I55V 2C2AA 1UFIA 3HKCB 3BA8A 3RYCB 3CRQA 3TXQA 3ASNC 4J10A 2EULA 3VQVA 3GWOA 1S72V 3CPWU 4P30A 2R9RB 3QG5A 4X20B 5IYZB 3JD3A 1W0KG 3JYCA 1OJHA 5LMNB 5B1OA 3CJHB 1B04A 3E83A 5J2TA 4R6ZA 3GWKC 1PNMA 3ZHRA 3R66A 1S77D 1O9HA 1IXBA 3AG1C 1AR1B 4YY3B 4DR3O 1Y74B 1WA8B 1N32O 1PM9A 3ETDA 3KG2A 2QWRB 2UUBB 1HP8A 5GW7A 3A0RA 1CEZA 1Y67A 1ZUQA 3HR0A 3SJQC 2ILMA 1JVMA 1H2LA 5EBLC 4YJ2A 4MSWC 1GN6A 3FB5C 1ROPA 4TV9A 4ZKIA 5HFLA 3T4DA 4HZ3A 4GKKB 1EZVH 1SS3A 3AG1B 1PD3A 2X6BA 2HHHB 2LJ2A 5KLVH 4TQDA 2YI8A 3CCVV 3JALB 2E76B 1G4YB 2Q5ZA 3T1YO 2UXDB 2EJ7A 4DR7B 4NXMB 2QWOB 1GRJA 4IYHA 3ASOB 4DR2B 1AI4A 1HNXB 3VBBA 4I7ZB 4DR4B 1QHTA 3FFQA 1MZEA 3P3NA 2HKOA 1N36B 1KP2A 3CMAV 1GM8A 3L72H 3OW2U 3T4ZA 5LYJA 2QM4A 4AQYB 2GTSA 4UVCA 1BHAA 1N33B 4I4TB 1K5QA 3JATB 2Q6AA 5K1XA 4FM1A 1K4CC 2AXTZ 2GUZA 5CMUA 2Z5UA 3CRAA 1D2DA 3AG2C 2PI5A 5L3FA 1Q86W 4TUYA 1M56C 1H8HG 5KX5A 4PELA 1XMQO 3VQYA 1K3EA 5FL7G 4I9QA 3CSXA 5H9CA 4GKJB 1XUQA 4CH4A 1H2MA 1NT2B 3CCUV 3SYAA 4B3RB 1S3JA 1LR1A 4P9OA 5CA1A 2BTQB 4LF5B 4DK1A 2HG5C 2IU0A 4K0KB 4UB6Z 3E8HA 1BMFG 4DR5B 1NTKH 2FB5A 4ZBMA 4MTXA 5ITZB 5K1PA 2AGAA 2HVJC 1AJQA 4QIWF 5KAIZ 3AG2B 1VQLV 1QCEA 1YCIA 3D36A 3DTUB 2DN9A 5CB4B 3ETGA 2LW1A 5IY5B 2XAFA 3CWBH 2RMKB 3BFRA 1M90W 2CTRA 3K0DA 4X62O 4CH6A 2F66C 4YJ3B 5LA6A 1Y4MA 2IU3A 3T2MA 3QO5A 3LSUA 1YITV 3SPHA 2F23A 3ZX6A 2G38A 2VWJA 1EM1A 4JI1B 3HKCA 1WP7A 4MW8A 4MVOA 4BWAA 1Q5OA 2JEXA 4K8ZA 3RYCA 3K03A 4JTCB 1PNLA 2MW2B 5L3EA 1IX9A 2EIKC 1YVWA 3RYIB 1H2KA 2ZE6A 3ABUA 1G6UA 1FPOA 4X20A 5IYZA 3M8AA 2UXCO 1JOYA 3ZIAG 5FNVB 3CJHA 2QE7G 3CD6V 2H8PC 3L73H 3P30A 5DN6G 3AK3A 4CC6A 3WU2Z 1Y74A 2Q67A 2WA3A 1K9MW 1WA8A 2F1MA 1JCHA 3EFFK 4JYCA 4EFEA 2EIKB 2UXXA 3K58A 1TGOA 1YJ9V 1P49A 1FKAO 1VQ9V 2QJ1A 4GZRB 4RUEA 2JRIA 2AZ0A 3AG7A 1AI7A 2L6LA 2XTAA 2W0FC 3JSNA 1AROP 3FB6C 5LXTB 4JI0O 4DK0A 1VQOV 3LDEA 3J7AU 1AI5A 3AG3C 1IDSA 4HBNA 3LNNA 5B1AC 4DV7O 3JALA 2HLDG 4JI2B 1GO3F 2ZQMA 3H01A 4UB8Z 1BSMA 1S5LZ 4DV3O 1EBOA 1LUWA 3F7VC 3BCCH 4LR3A 3K9SA 1X59A 1ZL8B 3ZHTA 1E1QG 4DR3B 2Z3YA 1N32B 1EN5A 1ZAUA 4G27B 1L0LH 1NH2D 1YJNV 1VQ4V 2P6JA
chains in the Genus database with same CATH topology
2UU9O 4DR4O 5BR8O 4B3MO 4LF9O 4DR6O 4DUZO 5A2QN 4LF8O 4JYAO 1HNWO 1A32A 2E5LO 4LF6O 4DV2O 2VQEO 4B3SO 1KUQA 2UXBO 4OPHA 4X64O 2UUCO 1XMOO 5H5NA 2VQFO 4A5UB 1N34O 4YY3O 1FYJA 5LMUO 3M8AA 4LF4O 4GKJO 2UXCO 1FJGO 2UUBO 2F4VO 4LFBO 4DV4O 1IBLO 4X66O 1DK1A 1IBKO 5BY1A 5LMNO 4JI6O 3O65A 4JI5O 3J81N 1HR0O 3SDLA 4DV6O 1XNQO 4YHHO 3OTOO 4DV5O 3JAMN 5IT9N 1D2DA 1F7YA 1NS1A 2UUAO 4LFAO 1R1BA 3F5TA 1XMQO 3R66A 4B3RO 5IWAO 1IBMO 1XNRO 2DOSA 4LF5O 4DR3O 1I94O 2Z0AA 3T1HO 4JI3O 1AILA 2ZM6O 1FKAO 2ZKOA 4K0KO 1N32O 2N74A 4X65O 4DR5O 4B3TO 2JRIA 4DUYO 1J5EO 2UXDO 4DV1O 1AB3A 2FKXA 4NXMO 1XEQA 4JI1O 4DR1O 4JI0O 4JI2O 3RT3C 4LFCO 3J7AU 4KHPO 4DR2O 5FLXN 4JI7O 4GKKO 2AGAA 1HNXO 3J80N 1HNZO 4DV7O 4LF7O 4JV5O 2HHHO 4NXNO 4OPAA 5BXZA 1N36O 2LW7A 4JI8O 4DV3O 1YZBA 5LL6Y 4JI4O 4OX9O 4DV0O 1G1XB 4X62O 4DR7O 1X59A 4AQYO 1R6TA 2DJVA 1N33O 3T1YO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 O;  4DR4 O;  5BR8 O;  4B3M O;  4LF9 O;  4DR6 O;  4DUZ O;  5A2Q N;  4LF8 O;  4JYA O;  1HNW O;  1A32 A;  2E5L O;  4LF6 O;  4DV2 O;  2VQE O;  4B3S O;  1KUQ A;  2UXB O;  4OPH A;  4X64 O;  2UUC O;  1XMO O;  5H5N A;  2VQF O;  4A5U B;  1N34 O;  4YY3 O;  1FYJ A;  5LMU O;  3M8A A;  4LF4 O;  4GKJ O;  2UXC O;  1FJG O;  2UUB O;  2F4V O;  4LFB O;  4DV4 O;  1IBL O;  4X66 O;  1DK1 A;  1IBK O;  5BY1 A;  5LMN O;  4JI6 O;  3O65 A;  4JI5 O;  3J81 N;  1HR0 O;  3SDL A;  4DV6 O;  1XNQ O;  4YHH O;  3OTO O;  4DV5 O;  3JAM N;  5IT9 N;  1D2D A;  1F7Y A;  1NS1 A;  2UUA O;  4LFA O;  1R1B A;  3F5T A;  1XMQ O;  3R66 A;  4B3R O;  5IWA O;  1IBM O;  1XNR O;  2DOS A;  4LF5 O;  4DR3 O;  1I94 O;  2Z0A A;  3T1H O;  4JI3 O;  1AIL A;  2ZM6 O;  1FKA O;  2ZKO A;  4K0K O;  1N32 O;  2N74 A;  4X65 O;  4DR5 O;  4B3T O;  2JRI A;  4DUY O;  1J5E O;  2UXD O;  4DV1 O;  1AB3 A;  2FKX A;  4NXM O;  1XEQ A;  4JI1 O;  4DR1 O;  4JI0 O;  4JI2 O;  3RT3 C;  4LFC O;  3J7A U;  4KHP O;  4DR2 O;  5FLX N;  4JI7 O;  4GKK O;  2AGA A;  1HNX O;  3J80 N;  1HNZ O;  4DV7 O;  4LF7 O;  4JV5 O;  2HHH O;  4NXN O;  4OPA A;  5BXZ A;  1N36 O;  2LW7 A;  4JI8 O;  4DV3 O;  1YZB A;  5LL6 Y;  4JI4 O;  4OX9 O;  4DV0 O;  1G1X B;  4X62 O;  4DR7 O;  1X59 A;  4AQY O;  1R6T A;  2DJV A;  1N33 O;  3T1Y O; 
#chains in the Genus database with same CATH topology
 3ABM C;  2Q0O C;  2MK3 A;  3AG3 B;  3ZMU A;  5A2Q N;  4LF8 O;  1P4R A;  4DV2 O;  4OPH A;  4DW1 A;  5IJ0 B;  4I4T A;  3JAT A;  5LMU O;  3I5D A;  1AVM A;  4LFB O;  1VF5 B;  3M99 B;  2CTP A;  2PY5 A;  1S76 D;  1K8A W;  5LMN O;  1R3L C;  1Y66 A;  3OD4 A;  4G2K A;  5KHJ A;  3TET A;  3SDL A;  1J95 A;  1BZK A;  4YHH O;  3SPG A;  4X66 B;  5EYP B;  2RCV A;  3ABM B;  3T1Y B;  2QKA A;  2OWO A;  2XND G;  2DQ0 A;  2DMX A;  1Q90 D;  3FB7 C;  2D3O W;  4CZZ A;  4FZ0 A;  4QJF B;  3SPJ A;  1NR1 A;  2BTQ A;  1R1B A;  4RUF A;  2EIN C;  3APO A;  2DOS A;  2ATK C;  5ITZ A;  4MVS A;  3CC4 V;  5EC2 C;  2Q73 A;  4TQF A;  4QPK A;  5CB4 A;  5CBG A;  3W7W A;  3O9O A;  3RWR D;  5GTI Z;  4NR1 A;  4GLX A;  4MTO A;  1P7G A;  2QM7 A;  3ZN0 A;  1DTO A;  5C93 A;  4AHC A;  4YJ3 A;  4GKK O;  5KUK A;  4N23 A;  3ZED A;  1IVS A;  2QTO A;  2K9P A;  2HHH O;  2IJH A;  1LNQ A;  1FXK C;  1H2S B;  5H6Q A;  1NBM G;  2EIN B;  3WG7 B;  3ZMT A;  5HFM A;  3OR7 C;  1XMQ B;  3K5M A;  2IW5 A;  4K8X A;  5D5Q A;  5CA3 A;  4DR7 O;  2E74 B;  4MTF A;  2KQX A;  5A9G A;  4U7N A;  3RYI A;  2YI9 A;  2JJ2 G;  5E79 Z;  1GK9 A;  4O2A B;  4EKW A;  4DR4 O;  5FNV A;  1R6N A;  5BMV A;  1Q3E A;  2VQE O;  3RGB A;  2UUC O;  5L3D A;  1FD9 A;  3ETE A;  4LF9 B;  1XOU A;  1FXK B;  1YF2 A;  4LF4 O;  1KYO F;  4H0L B;  1GAX A;  2P06 A;  1S5J A;  5KA6 A;  4ZIB A;  2YS8 A;  4D7S A;  3K57 A;  4O4I B;  5J9P C;  1VF7 A;  4F6E A;  4MVU A;  2ARH A;  3SPC A;  1R3K C;  3B2E E;  3B09 A;  2IM9 A;  4QE9 A;  5LXT A;  4B3R O;  4JF3 A;  1NVP B;  2EJR A;  2WAM A;  4PV1 B;  1CXZ B;  4LF5 O;  1KU9 A;  2QR4 A;  4K0K O;  4WBN A;  2UXC B;  2GTA A;  1XI1 A;  4X65 O;  4DR5 O;  3MDS A;  5JQG B;  4CH5 A;  4J7J A;  1GM9 A;  1I94 B;  1R6K A;  3U11 A;  2DYR C;  2BE3 A;  4I9W A;  2YXY A;  1VQN V;  1DLB A;  1ZL8 A;  3N2G B;  4TWK A;  3J80 N;  4QNH B;  3SYC A;  3RYH B;  2GHY A;  2QWP B;  5CA0 B;  3K3W A;  1BT8 A;  2JS5 A;  4LF7 B;  1P84 F;  3ML0 A;  1WN7 A;  2M7W A;  3DC6 A;  3FKS G;  4DW0 A;  1M57 C;  5IYD O;  4HAM A;  1OCR B;  4L8J A;  1UJW B;  1M1K W;  5IJ0 A;  4J9Z B;  4RQF A;  1Y6X A;  2DYR B;  1YDX A;  4JI0 B;  1QNM A;  4NTY A;  2IJK A;  2Q7E A;  3OEH G;  4FVM A;  1YXB A;  2UXB O;  2IH1 C;  3TCU A;  3TXS A;  2WLJ A;  3UKM A;  2VS0 A;  3UM7 A;  5EYP A;  4LF6 B;  1FXH A;  4IYI A;  4XDK A;  1XMO B;  4DV3 B;  2N05 A;  1KD1 W;  1YTF D;  4JI6 O;  1M57 B;  3E8F A;  3OT7 A;  2ZNJ A;  3BPZ A;  1COW G;  2OYQ A;  4EB6 B;  4GCZ A;  4E2L A;  4GUN A;  3ZRW B;  1EZJ A;  2ETN A;  1H38 A;  1OCC B;  2DWD C;  3MHS C;  5IT9 N;  2ZCE A;  4FLW A;  1YI2 V;  2IJI A;  5CBH A;  4LF8 B;  4FM2 A;  1Y76 B;  2YXL A;  4DV2 B;  2WLN A;  2OCC C;  4FFB B;  3Q4H A;  2JIZ G;  3STL C;  4LCU C;  1HW7 A;  3IFX A;  5LMU B;  2ADP A;  3E22 B;  1BCC H;  4LFB B;  2KG7 B;  4UV9 A;  5L3C A;  1NQT A;  2P90 A;  3ICX A;  1I08 A;  4DV1 O;  4GX2 A;  3JAK B;  4FLX A;  1AB3 A;  3C3T A;  1XEQ A;  2D2C B;  4JI2 O;  3EHB B;  2ZIM A;  3MHH C;  2QDO A;  4RAI A;  4X1K B;  4YHH B;  3JD0 A;  4JI7 O;  3RYF B;  3ABL C;  1HDJ A;  2Q68 A;  1MAB G;  1MA1 A;  1SQF A;  2Q69 A;  4O2A A;  1SQV H;  1NR7 A;  2OCC B;  3LSS A;  4PA4 A;  2HR3 A;  4UV8 A;  2V1D A;  1SC5 B;  3KZI Z;  4LP8 A;  2QKS A;  3TGU H;  4RWU A;  1H2G A;  1Z5V A;  3OMA B;  3WFV A;  4LNU A;  3W7U A;  3EVK A;  2QA4 V;  1GMG A;  3ASO C;  2JVD A;  1FXK A;  3K5N A;  1WP8 A;  3HKE B;  3CC2 V;  5C8Y B;  5BR8 O;  4B3M O;  2OTL V;  1LUV A;  3ABL B;  1A32 A;  4CBC A;  5FPO A;  2CE4 A;  2VQF O;  3KCX A;  2WLL B;  4B08 A;  1FYJ A;  2GBO A;  3W7X A;  1OV9 A;  4O4I A;  1AI6 A;  2Y4U A;  3GB7 C;  4UCO A;  2W6I G;  3S3W A;  4ASU G;  5IE9 A;  4X66 O;  2F43 G;  3OAA G;  1IBK O;  1BQ0 A;  4BIZ A;  4NKG B;  3OE7 G;  2RDC A;  3P3P A;  2QTS A;  3FX7 A;  1VQM V;  1YIJ V;  1XNQ O;  4OGQ B;  3OTO O;  2DE0 X;  1M9N A;  3UO3 A;  1YJW V;  2P4V A;  1K5S A;  2B1I A;  1Q82 W;  3L9D A;  2EIJ C;  5JQG A;  4K35 A;  4DV6 B;  1KMI Z;  5LGU A;  1Z5W A;  2VQE B;  2WPD G;  2UUC B;  4YXW G;  4ZI7 B;  4U3F H;  2B5U A;  2UUA B;  3N2G A;  4LF4 B;  4PDR A;  1N8R W;  3CRM A;  2N74 A;  3RYH A;  1J5E O;  3K0G A;  5CA0 A;  5IJ9 B;  4BAY A;  3OGI B;  3T1H B;  5KMG B;  3CRR A;  4NVP A;  3CB2 A;  3E35 A;  2YSU B;  5EIB D;  5LHI A;  5IY5 C;  2ZXW B;  2EIJ B;  1JX9 A;  4DR1 B;  5EZY B;  4GT1 A;  4J80 A;  1BS3 A;  1D5N A;  3SJA C;  1VQ7 V;  2A3Q A;  2JEU A;  3JCU Z;  2YDE A;  4MW3 A;  4OX9 O;  1JPX A;  4NXN B;  2B9Z A;  4B7K A;  1W59 A;  1O9G A;  1R6T A;  1WPX A;  3U0Z A;  1YEW A;  4X65 B;  3QF7 A;  4K3A A;  4JTA B;  4DV0 B;  3UCS C;  3KKY A;  2RNB A;  1Q6H A;  4R8C A;  4LF9 O;  4F4L A;  2R9A A;  3CEI A;  2QGN A;  4PDL A;  3OFN G;  1L8D A;  4FIP C;  1NZ6 A;  3S3X A;  4EB6 A;  2Y69 C;  5LOV B;  1N0J A;  2H94 A;  1VF6 C;  5EK0 A;  3ZRW A;  2E5L B;  4CS3 A;  4DV4 O;  4JAS A;  1DK1 A;  3WB0 A;  1RSO B;  1AR5 A;  1YTF B;  4O2B B;  2CTQ A;  1Y76 A;  4JI5 O;  4UCU A;  4PDV A;  1DGS A;  3JSL A;  3LUT B;  4FFB A;  5LP6 C;  4WF9 V;  1JJ2 U;  3E22 A;  3JAM N;  5BZB A;  1SRY A;  2KG7 A;  1F7Y A;  4QPJ A;  3JAK A;  3LSQ A;  4FLU A;  2UXB B;  2WLI B;  2Y69 B;  2P7T C;  3CCQ V;  4X1K A;  1I94 O;  2Z0A A;  4IL6 Z;  3RYF A;  1OHH G;  1H2N A;  2YIB A;  1S0V A;  1PP9 H;  1FFX B;  2Q0A A;  3CCE V;  3CHX A;  5KHH A;  4QE7 A;  3HB3 B;  4EEQ A;  4JI6 B;  3N27 A;  5LP6 B;  3TK1 A;  5IYB O;  3PJS K;  4UUJ C;  3K9A A;  5FLX N;  3G6E V;  1NVP D;  1NKD A;  1K92 A;  5B5E Z;  4Q6G A;  4LF7 O;  3H1H H;  1SQP H;  1XDC A;  2QM8 A;  3HKE A;  5L3B A;  3CCJ V;  4LC1 A;  5C8Y A;  2XHB A;  4IHJ B;  3VOU A;  3T1C A;  1G1X B;  1QR9 A;  3H9V A;  4KFM A;  2QSA A;  1VAR A;  3R65 A;  4TV8 B;  2WLL A;  3K79 A;  1AJP A;  2BTO A;  4DV1 B;  2X7R B;  2ZIO A;  3UT5 B;  2YEV B;  3ZHV A;  4LF6 O;  5LGN A;  4JI7 B;  2P22 C;  4B3S O;  3ZCC A;  1XMO O;  3N2K B;  3HKB B;  3DSQ A;  5B1B C;  1MOF A;  4N21 A;  1JMK C;  4FK5 C;  4TSF G;  1FS0 G;  2EZO A;  2PI4 A;  1CP9 A;  1K34 A;  4J7Z A;  2LGW A;  1WNS A;  1ZSP A;  3K5L A;  1N34 B;  1AJN A;  4DYL A;  2GDS A;  2ZT9 B;  3CRC A;  4ZI7 A;  4FJC C;  5DED A;  2H3O A;  3ZMS A;  2CH7 B;  4IGG A;  4Z1M G;  1WB8 A;  5BR8 B;  4B3M B;  5EIB C;  3OUS A;  3B8N A;  5AG2 A;  3UO2 A;  3CCL V;  4JAU A;  5IJ9 A;  5B1B B;  5KMG A;  3H1K H;  5IWA O;  2VQF B;  4AI8 A;  1AP6 A;  4IIJ B;  3SGI A;  1KC8 W;  5JJJ B;  4GYC B;  2ZM6 O;  3ZHS A;  3HPL C;  1U96 A;  3MD0 A;  4Z2W A;  1BQZ A;  5EZY A;  1KKC A;  2DYS C;  3CXH F;  1OZ0 A;  4XBF A;  1IBK B;  1QR8 A;  2VWK A;  2PF4 E;  3B40 A;  1TUB B;  2UXN A;  4BW9 A;  1XNQ B;  3OTO B;  2PYL A;  2HJF C;  3WG7 C;  5L3G A;  3ZMV A;  4EFB A;  1OCZ C;  4OPA A;  5J2U B;  3THO A;  3CC7 V;  2OCH A;  1EN6 A;  2XAH A;  2DYS B;  5H2F Z;  3A0B Z;  2DW4 A;  1L0N H;  4OXS A;  2YIB D;  5LOV A;  4CC5 A;  1J5E B;  2F95 B;  4PA3 A;  4O4H B;  5F2V O;  1RSO A;  5LGT A;  4H13 B;  5H5N A;  1OCZ B;  3K04 A;  2CTW A;  1KEC A;  2JGD B;  3TJT A;  2F4V O;  4HNA B;  4X9Q A;  4FLV A;  4OX9 B;  2PYJ A;  4X1Y B;  5KA5 A;  4FMT A;  1XRE A;  5GON B;  1SKV A;  2WLI A;  1PL0 A;  5JWP A;  1KQS U;  2R9I A;  4DV6 O;  3L74 H;  1VF6 A;  2A06 H;  3PN1 A;  3ZRV A;  1FFX A;  3K06 A;  2UUA O;  2R70 A;  4GX1 A;  5LHG A;  3JD4 A;  5LP6 A;  3IGA C;  2YUA A;  2ZIN A;  1IBM O;  4O4J B;  3T1H O;  1AIL A;  4LFA B;  4PHZ A;  4ZHQ B;  4I0X B;  1IZ3 A;  1GN2 A;  4P2Z A;  4PD4 F;  5CN0 A;  4DV4 B;  2B1G A;  3C3S A;  3SYO A;  4DR1 O;  4JI5 B;  5DEC A;  1GKF A;  2AHZ A;  3SR2 C;  4IHJ A;  4XDL A;  3DC5 A;  4J11 A;  4TV8 A;  1QLE C;  4DO2 A;  3WB2 A;  4NXN O;  1V55 B;  3NXS A;  1GN4 A;  1SZT A;  5GTH Z;  1PNK A;  3B4S A;  1OCR C;  4DV0 O;  3OMI B;  3UT5 A;  2YEV A;  2OIE A;  1JR9 A;  1VQK V;  2DJV A;  3CCM V;  4UXN A;  1TVK B;  3N2K A;  3HKB A;  1VQ6 V;  1BE3 H;  1RM1 B;  3MAQ A;  3RN4 A;  3VQX A;  4U7O A;  3JCZ A;  1MSW D;  2E5L O;  2QEX V;  1QLE B;  2EIM C;  1KUQ A;  3A8T A;  2E3C A;  3ZMZ A;  2CH7 A;  3LDC A;  1NI8 A;  2ITC C;  1PL4 A;  3E8B A;  1EFR G;  1K73 W;  3ZRS A;  1QVG U;  1OCC C;  4J42 A;  3BAA A;  3QVN A;  2Q8V A;  3L75 H;  4IIJ A;  4U3J B;  4J7K A;  4NTW A;  4YIP A;  4WFB V;  4MVQ A;  2ZE5 A;  1NTZ H;  1NJI W;  2Y0I A;  2FML A;  2EIM B;  2KKW A;  5EBM C;  2Y4T A;  4HYO A;  3HKD B;  4ZOL B;  4DV5 B;  4B3S B;  2CK3 G;  4UVB A;  1D5A A;  1TUB A;  2KB1 A;  4KUM A;  3F7Y C;  4J41 A;  2XAJ A;  4PA6 A;  3OGC C;  1ZLZ A;  1MG1 A;  2FKX A;  1Q81 W;  3LNM B;  3ABK B;  4JYY A;  2XAQ A;  2CGO A;  5J2U A;  1QLN A;  2BOB C;  1JQ0 A;  3CS5 A;  4JZG A;  4LH6 A;  3UQ8 A;  3G6B A;  3JAS B;  3AEI A;  1OCO C;  1Q7Y W;  1HNZ O;  2OT5 A;  3F5W C;  5BXZ A;  2LW7 A;  3BAB A;  4WFA V;  4X1I B;  3CXC U;  5IWA B;  2JK5 C;  1P7B A;  3LDD A;  5JVD B;  4O4H A;  2GSM B;  2ZM6 B;  1AP5 A;  2ZDI C;  3W7S A;  1ORQ C;  3ZN1 A;  3IAY A;  2JGD A;  1XL6 A;  5H6R A;  1IXM A;  4O4L B;  2ITD C;  4HNA A;  4NYK A;  4RQE A;  1MSD A;  1E79 G;  3OMN B;  4JYA O;  1OCO B;  4X1Y A;  1I7F A;  4LH7 A;  4X64 O;  1AR4 A;  1VEW A;  1V54 C;  1GM7 A;  5GON A;  2CUG A;  4PJ0 Z;  4D7T A;  1N34 O;  1QVF U;  1SES A;  1K97 A;  4IT5 A;  4C7U A;  1IBL O;  3C90 A;  1ZX3 A;  4W4K A;  4CS4 A;  4TT3 G;  3OUF A;  3ZBH A;  1FJG B;  1W0J G;  3JAW B;  1EN4 A;  1WLE A;  2Q7H A;  3ASN B;  2RJZ A;  4O4J A;  4RO2 A;  1BHB A;  1KP3 A;  4UCR A;  2A79 B;  3AK1 A;  4MVR A;  4ZHQ A;  3G4S V;  1MNG A;  4I0X A;  1TUE B;  1B3Q A;  3L70 H;  1FFT B;  2CGN A;  2YC0 A;  3G80 A;  1V54 B;  1URF A;  3P32 A;  2ZE8 A;  1PPJ H;  2YIC A;  2YIA A;  3BY6 A;  4Q20 A;  2F4V B;  1RP3 B;  3A0H Z;  1GTO A;  2W6J G;  3AK2 A;  3H1L H;  3QNE A;  3SJC C;  2X0L A;  3W7T A;  2ZXW C;  3RT3 C;  1F4N A;  2V4D A;  3A2F A;  2EBO A;  3B77 A;  3JD2 A;  3STZ C;  4MVM A;  1ENV A;  2JGU A;  1TVK A;  3DXR B;  2NR5 A;  2NN4 A;  3M7M X;  4X89 A;  4JI4 O;  1IBM B;  3K08 A;  1JJO A;  4FM0 A;  4TOI A;  4NTX A;  1SQQ H;  4PI2 A;  4JI8 B;  4X88 A;  1IUR A;  1Q6I A;  2P5O A;  1WPB A;  1XBL A;  4NB5 A;  5JH7 B;  2UU9 O;  1SER A;  1SZX A;  3E2E A;  2N04 A;  4DUZ O;  2FYU H;  1RPR A;  1HNW O;  2IBZ H;  2ZR2 A;  2BSK B;  1SQG A;  1VMG A;  1W2B U;  2Q4P A;  1XL4 A;  4GX0 A;  4FLY A;  3CP1 A;  2V7Q G;  4L87 A;  4U3J A;  1E1R G;  4UCT A;  4FLT A;  2BOC C;  4KXR A;  3IC9 A;  3BHP A;  5IYC O;  3SYQ A;  3O65 A;  4DXW A;  2LFS A;  3HKD A;  4ZOL A;  5DM6 V;  4G28 B;  1VIB A;  3E86 A;  1I5X A;  1YHQ V;  1ZWI C;  3D8C A;  1B6Q A;  2EX3 A;  3APQ A;  2P4K A;  4LFA O;  3RFR A;  2Q9L A;  4UVA A;  1DF4 A;  3F5T A;  2XT9 A;  1GH6 A;  2QWQ B;  3CYO A;  2ZE7 A;  1N0N A;  3VQW A;  4JI3 O;  1M56 B;  3JAS A;  2ZKO A;  4BR6 A;  4JAV A;  4Z1V A;  2W0X A;  1XIL A;  4FFK A;  1R3J C;  1XNR B;  4JTD B;  2HEP A;  4I55 B;  4LFC O;  1L1F A;  4X1I A;  1XHZ A;  3NR7 A;  1VQ5 V;  4B3T B;  1ZTE A;  1F51 A;  4WCE V;  2IH3 C;  5JVD A;  2PUS A;  1M93 A;  4QGP A;  4JV5 O;  5IDJ A;  5E1A C;  3CX5 F;  2PTM A;  2CDY A;  1Q8I A;  1M4U A;  4P9P A;  4O4L A;  5LHH A;  4LWS B;  2OTJ V;  5KHI A;  2HJD A;  2OIG A;  1NU1 H;  1KBH A;  5KUM A;  5BMV B;  1R73 A;  1SQX H;  2KSD A;  2Q7G A;  3QO7 A;  2YXH A;  1F4M A;  4JPR A;  4W4L A;  1QU7 A;  4FZ1 A;  5JJE B;  3EXA A;  4ICG A;  2ZDI A;  1JA8 A;  1HNZ B;  4A5U B;  4DR6 B;  3BEH A;  3JAW A;  1M5I A;  2IJJ A;  1XQ8 A;  4X8A A;  3G71 V;  1B06 A;  1V9P A;  3D3I A;  1T5E A;  5JCO C;  4D6T H;  1HR0 O;  1I0H A;  1KB9 F;  2VRZ A;  4WFH A;  3CCR V;  1FAF A;  1SET A;  2XOK G;  2AW9 A;  3ZHQ A;  4DV5 O;  5D5P A;  4F6R B;  1FXV A;  1GN3 A;  1NS1 A;  4JYA B;  2HVK C;  3JAR B;  3SYP A;  2L35 A;  4WBN B;  4PA7 A;  4X64 B;  2WLM A;  2XUM A;  4WFE A;  4JAA A;  3BVO A;  2WSS G;  1JFF B;  2RN9 A;  4MS2 A;  1YSC A;  2XAS A;  5LBQ A;  3DXR A;  4DUY O;  1IBL B;  4B7E A;  4MVZ A;  3G67 A;  4KHP O;  3SJB C;  1R3I C;  3FB8 C;  4WFG A;  2ODM A;  1DF5 A;  4R7C A;  4UCV A;  1VQ8 V;  3ZJZ A;  4UCS A;  4PDM A;  3FAV B;  3OEE G;  2DQ3 A;  5EC1 C;  1RPO A;  2X6C A;  1K33 A;  5B1A B;  5JH7 A;  4DRX B;  2YID A;  2HP8 A;  1YZB A;  2Y0P A;  3IC7 A;  5LL6 Y;  5FPR A;  3OTF A;  1VP7 A;  2LP7 A;  2XAG A;  2BSK A;  4ABM A;  1WJZ A;  4LBE C;  1SQB H;  2ADQ B;  1QBZ A;  1SA0 B;  4JGS A;  2A9H A;  4BIU A;  3RBZ A;  2FL4 A;  3SPI A;  4I50 B;  3H1I H;  1CPY A;  2WLK A;  4R50 A;  4YY3 O;  3ZS8 C;  3GVM A;  4JZ2 A;  4PI0 A;  2QKC A;  1FJG O;  2HFE C;  2LO1 A;  3E89 A;  2UUB O;  5JJN B;  4JI4 B;  3FYE B;  3QO8 A;  5TIS Z;  3CME V;  4O2B A;  2LQT A;  1Q43 A;  2UU9 B;  3Q4H B;  4PA9 A;  2BCC H;  3ETQ A;  2LGQ A;  4DUZ B;  1K4D C;  3ABT A;  1HNW B;  2P67 A;  1S5H C;  4I55 A;  1X4T A;  3OR6 C;  2DWE C;  5B66 Z;  2X6A A;  1PKX A;  1TAE A;  4UFZ A;  2UXD O;  5J2T B;  1TA8 A;  4NXM O;  4XDJ A;  1K7D A;  5KHG A;  4DR2 O;  4LWS A;  2EZP A;  1V55 C;  1I5Y A;  1US6 A;  1HNX O;  4AIL C;  2O57 A;  4MT8 A;  4FPP A;  4GX5 A;  1N36 O;  4JI8 O;  4LNU B;  4YJ2 B;  4AQY O;  3E8G A;  4JI3 B;  1N33 O;  1Z2G A;  3BA9 A;  1RFY A;  4CH3 A;  2NNU A;  1RM1 C;  2JJ1 G;  4TV9 B;  1N4C A;  5CBF A;  1VQP V;  4X62 B;  4BW5 A;  2Y48 A;  4LFC B;  3WB1 A;  4CS2 A;  1XHX A;  2E75 B;  3U10 A;  1UPG A;  1G8M A;  4JV5 B;  4KL1 A;  3X2Q C;  1U97 A;  5EBW C;  1Q6U A;  4GKJ O;  5KHK A;  3BRC A;  4F6R A;  2AHY A;  1MZF A;  1KKD A;  2WWW A;  4I5S A;  5BY1 A;  1H8E G;  3JAR A;  3J81 N;  2ZNI A;  2EIL C;  5B3S C;  1WAZ A;  3H1J H;  3D3Q A;  3RW0 A;  2QWN B;  1WB7 A;  3DGE A;  1JFF A;  4J9Y B;  4MTG A;  3KCY A;  2PZS A;  2LFR A;  5B1N A;  2K1E A;  5JCO A;  4E4E A;  5LYJ B;  2M6Y A;  3QTC A;  1BGY H;  3FD9 A;  4KP4 A;  1MMM A;  3X2Q B;  1XNR O;  4H44 B;  1THZ A;  2PGG A;  1HWY A;  2GUZ B;  2GV9 A;  3ABK C;  2ZD9 A;  4B3T O;  3FAV A;  3D36 C;  2JS3 A;  1BL8 A;  4TUY B;  1NTM H;  2EIL B;  4JYB A;  4JI1 O;  5B3S B;  3B8M A;  5KX5 B;  3JD1 A;  1HR0 B;  3AG4 C;  4DRX A;  2ZR3 A;  1PV0 A;  1NH2 B;  3K5O A;  4YIO A;  2WLH A;  2JDI G;  3ZRX A;  4FLZ A;  2A7W A;  5CA1 B;  4H33 A;  1SA0 A;  2R72 A;  3CCS V;  3IJ4 A;  4DV7 B;  2F93 B;  4I50 A;  3RVY A;  3L71 H;  3ZHU A;  2FTK A;  2A0L A;  2WA4 A;  5KAF Z;  3FYI B;  4DUY B;  2AZ2 A;  3AG4 B;  4H37 A;  2NLJ C;  3CE2 A;  4DR6 O;  1QQC A;  4WFF A;  4KHP B;  3RVZ A;  1SF9 A;  1F23 A;  5LA6 B;  3I56 V;  3K59 A;  2RQ6 A;  2CAZ C;  4BIO A;  3OM3 B;  3I55 V;  2C2A A;  1UFI A;  3HKC B;  3BA8 A;  3RYC B;  3CRQ A;  3TXQ A;  3ASN C;  4J10 A;  2EUL A;  3VQV A;  3GWO A;  1S72 V;  3CPW U;  4P30 A;  2R9R B;  3QG5 A;  4X20 B;  5IYZ B;  3JD3 A;  1W0K G;  3JYC A;  1OJH A;  5LMN B;  5B1O A;  3CJH B;  1B04 A;  3E83 A;  5J2T A;  4R6Z A;  3GWK C;  1PNM A;  3ZHR A;  3R66 A;  1S77 D;  1O9H A;  1IXB A;  3AG1 C;  1AR1 B;  4YY3 B;  4DR3 O;  1Y74 B;  1WA8 B;  1N32 O;  1PM9 A;  3ETD A;  3KG2 A;  2QWR B;  2UUB B;  1HP8 A;  5GW7 A;  3A0R A;  1CEZ A;  1Y67 A;  1ZUQ A;  3HR0 A;  3SJQ C;  2ILM A;  1JVM A;  1H2L A;  5EBL C;  4YJ2 A;  4MSW C;  1GN6 A;  3FB5 C;  1ROP A;  4TV9 A;  4ZKI A;  5HFL A;  3T4D A;  4HZ3 A;  4GKK B;  1EZV H;  1SS3 A;  3AG1 B;  1PD3 A;  2X6B A;  2HHH B;  2LJ2 A;  5KLV H;  4TQD A;  2YI8 A;  3CCV V;  3JAL B;  2E76 B;  1G4Y B;  2Q5Z A;  3T1Y O;  2UXD B;  2EJ7 A;  4DR7 B;  4NXM B;  2QWO B;  1GRJ A;  4IYH A;  3ASO B;  4DR2 B;  1AI4 A;  1HNX B;  3VBB A;  4I7Z B;  4DR4 B;  1QHT A;  3FFQ A;  1MZE A;  3P3N A;  2HKO A;  1N36 B;  1KP2 A;  3CMA V;  1GM8 A;  3L72 H;  3OW2 U;  3T4Z A;  5LYJ A;  2QM4 A;  4AQY B;  2GTS A;  4UVC A;  1BHA A;  1N33 B;  4I4T B;  1K5Q A;  3JAT B;  2Q6A A;  5K1X A;  4FM1 A;  1K4C C;  2AXT Z;  2GUZ A;  5CMU A;  2Z5U A;  3CRA A;  1D2D A;  3AG2 C;  2PI5 A;  5L3F A;  1Q86 W;  4TUY A;  1M56 C;  1H8H G;  5KX5 A;  4PEL A;  1XMQ O;  3VQY A;  1K3E A;  5FL7 G;  4I9Q A;  3CSX A;  5H9C A;  4GKJ B;  1XUQ A;  4CH4 A;  1H2M A;  1NT2 B;  3CCU V;  3SYA A;  4B3R B;  1S3J A;  1LR1 A;  4P9O A;  5CA1 A;  2BTQ B;  4LF5 B;  4DK1 A;  2HG5 C;  2IU0 A;  4K0K B;  4UB6 Z;  3E8H A;  1BMF G;  4DR5 B;  1NTK H;  2FB5 A;  4ZBM A;  4MTX A;  5ITZ B;  5K1P A;  2AGA A;  2HVJ C;  1AJQ A;  4QIW F;  5KAI Z;  3AG2 B;  1VQL V;  1QCE A;  1YCI A;  3D36 A;  3DTU B;  2DN9 A;  5CB4 B;  3ETG A;  2LW1 A;  5IY5 B;  2XAF A;  3CWB H;  2RMK B;  3BFR A;  1M90 W;  2CTR A;  3K0D A;  4X62 O;  4CH6 A;  2F66 C;  4YJ3 B;  5LA6 A;  1Y4M A;  2IU3 A;  3T2M A;  3QO5 A;  3LSU A;  1YIT V;  3SPH A;  2F23 A;  3ZX6 A;  2G38 A;  2VWJ A;  1EM1 A;  4JI1 B;  3HKC A;  1WP7 A;  4MW8 A;  4MVO A;  4BWA A;  1Q5O A;  2JEX A;  4K8Z A;  3RYC A;  3K03 A;  4JTC B;  1PNL A;  2MW2 B;  5L3E A;  1IX9 A;  2EIK C;  1YVW A;  3RYI B;  1H2K A;  2ZE6 A;  3ABU A;  1G6U A;  1FPO A;  4X20 A;  5IYZ A;  3M8A A;  2UXC O;  1JOY A;  3ZIA G;  5FNV B;  3CJH A;  2QE7 G;  3CD6 V;  2H8P C;  3L73 H;  3P30 A;  5DN6 G;  3AK3 A;  4CC6 A;  3WU2 Z;  1Y74 A;  2Q67 A;  2WA3 A;  1K9M W;  1WA8 A;  2F1M A;  1JCH A;  3EFF K;  4JYC A;  4EFE A;  2EIK B;  2UXX A;  3K58 A;  1TGO A;  1YJ9 V;  1P49 A;  1FKA O;  1VQ9 V;  2QJ1 A;  4GZR B;  4RUE A;  2JRI A;  2AZ0 A;  3AG7 A;  1AI7 A;  2L6L A;  2XTA A;  2W0F C;  3JSN A;  1ARO P;  3FB6 C;  5LXT B;  4JI0 O;  4DK0 A;  1VQO V;  3LDE A;  3J7A U;  1AI5 A;  3AG3 C;  1IDS A;  4HBN A;  3LNN A;  5B1A C;  4DV7 O;  3JAL A;  2HLD G;  4JI2 B;  1GO3 F;  2ZQM A;  3H01 A;  4UB8 Z;  1BSM A;  1S5L Z;  4DV3 O;  1EBO A;  1LUW A;  3F7V C;  3BCC H;  4LR3 A;  3K9S A;  1X59 A;  1ZL8 B;  3ZHT A;  1E1Q G;  4DR3 B;  2Z3Y A;  1N32 B;  1EN5 A;  1ZAU A;  4G27 B;  1L0L H;  1NH2 D;  1YJN V;  1VQ4 V;  2P6J A; 
#chains in the Genus database with same CATH homology
 2UU9 O;  4DR4 O;  5BR8 O;  4B3M O;  4LF9 O;  4DR6 O;  4DUZ O;  5A2Q N;  4LF8 O;  4JYA O;  1HNW O;  1A32 A;  2E5L O;  4LF6 O;  4DV2 O;  2VQE O;  4B3S O;  1KUQ A;  2UXB O;  4OPH A;  4X64 O;  2UUC O;  1XMO O;  5H5N A;  2VQF O;  4A5U B;  1N34 O;  4YY3 O;  1FYJ A;  5LMU O;  3M8A A;  4LF4 O;  4GKJ O;  2UXC O;  1FJG O;  2UUB O;  2F4V O;  4LFB O;  4DV4 O;  1IBL O;  4X66 O;  1DK1 A;  1IBK O;  5BY1 A;  5LMN O;  4JI6 O;  3O65 A;  4JI5 O;  3J81 N;  1HR0 O;  3SDL A;  4DV6 O;  1XNQ O;  4YHH O;  3OTO O;  4DV5 O;  3JAM N;  5IT9 N;  1D2D A;  1F7Y A;  1NS1 A;  2UUA O;  4LFA O;  1R1B A;  3F5T A;  1XMQ O;  3R66 A;  4B3R O;  5IWA O;  1IBM O;  1XNR O;  2DOS A;  4LF5 O;  4DR3 O;  1I94 O;  2Z0A A;  3T1H O;  4JI3 O;  1AIL A;  2ZM6 O;  1FKA O;  2ZKO A;  4K0K O;  1N32 O;  2N74 A;  4X65 O;  4DR5 O;  4B3T O;  2JRI A;  4DUY O;  1J5E O;  2UXD O;  4DV1 O;  1AB3 A;  2FKX A;  4NXM O;  1XEQ A;  4JI1 O;  4DR1 O;  4JI0 O;  4JI2 O;  3RT3 C;  4LFC O;  3J7A U;  4KHP O;  4DR2 O;  5FLX N;  4JI7 O;  4GKK O;  2AGA A;  1HNX O;  3J80 N;  1HNZ O;  4DV7 O;  4LF7 O;  4JV5 O;  2HHH O;  4NXN O;  4OPA A;  5BXZ A;  1N36 O;  2LW7 A;  4JI8 O;  4DV3 O;  1YZB A;  5LL6 Y;  4JI4 O;  4OX9 O;  4DV0 O;  1G1X B;  4X62 O;  4DR7 O;  1X59 A;  4AQY O;  1R6T A;  2DJV A;  1N33 O;  3T1Y O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...