1N33O

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n33O00
4JI1O 5BY1A 4LF7O 3J7AU 4DV4O 2VQEO 1FJGO 3OTOO 3RT3C 2UXDO 4DR1O 4X64O 5H5NA 1F7YA 5LL6Y 4DV1O 4X62O 1AILA 2ZM6O 1HNXO 4LF9O 3SDLA 4JI4O 4LFAO 2Z0AA 4JI7O 4DR3O 2UU9O 4OPAA 4JI6O 1XNRO 1NS1A 1R6TA 4DR2O 1N36O 4K0KO 1D2DA 4B3RO 1N32O 4DR5O 1YZBA 4DR4O 3O65A 3J80N 4DUYO 5FLXN 4DV7O 4NXNO 5IT9N 1IBLO 4JI8O 4LF6O 4DV3O 1X59A 2HHHO 4AQYO 3R66A 4A5UB 1G1XB 2UUAO 1HNZO 2N74A 4X65O 4DR6O 4GKJO 3M8AA 2AGAA 1J5EO 5A2QN 4YHHO 3T1YO 4JV5O 2UUBO 3J81N 1FYJA 4LFCO 4LF5O 4JI5O 2DOSA 1AB3A 1HR0O 5BR8O 1XNQO 1XMOO 4B3TO 4DV5O 4B3SO 1N33O 4LFBO 1I94O 5BXZA 1A32A 2VQFO 3JAMN 2FKXA 4NXMO 4X66O 5IWAO 2ZKOA 4DV6O 2E5LO 4DV0O 4DUZO 4JI3O 4YY3O 1KUQA 4JI2O 1XMQO 4DV2O 4LF4O 1FKAO 3F5TA 2JRIA 4DR7O 2UXBO 4OPHA 1IBKO 1DK1A 4JYAO 5LMNO 4OX9O 1R1BA 4B3MO 1IBMO 2UXCO 1HNWO 3T1HO 2UUCO 4KHPO 4LF8O 2F4VO 4JI0O 2DJVA 5LMUO 2LW7A 1N34O 1XEQA 4GKKO
chains in the Genus database with same CATH superfamily
5LGUA 4IHJA 1FJGO 3K3WA 3DC6A 1SQFA 4X88A 4FFBA 4LFCB 5H6QA 1HNXB 5J2UB 5J2TA 4OXSA 2YEVA 2EX3A 2WLHA 3B4SA 3E35A 3ZMUA 5FNVB 1K73W 4JI5B 1PPJH 2ZIOA 4PJ0Z 2RMKB 1JQ0A 2YXLA 4JI8B 4G27B 2DYRC 1XOUA 3CCQV 2EIJB 2NNUA 4ZBMA 1SS3A 2KG7B 2Q68A 4A5UB 5JQGB 1QLNA 4JI2B 4LF7B 5EIBC 5EYPA 2F43G 5EC2C 5B5EZ 1V55C 3BHPA 1WNSA 3BY6A 2FL4A 3G80A 1BHAA 4GKJO 4TV9B 3UM7A 1R3KC 5AG2A 4DO2A 1Y76B 4RWUA 1DTOA 4CH4A 1UFIA 3TGUH 2OT5A 1FAFA 5KX5B 1W0JG 1PNKA 2YSUB 3HKCB 4X64B 3DXRA 3RYFB 1M4UA 3L75H 2YIAA 1YJ9V 1AB3A 3N2GA 2ZM6B 3APQA 3MHHC 3SYQA 4UCTA 3CRQA 3FYIB 3LSUA 3E83A 2JDIG 4CS2A 4RQEA 1A32A 2ZDIC 3CRAA 2VQFB 4ZKIA 1OCRC 4GT1A 3OAAG 1M1KW 3B77A 5LGTA 3I56V 1GM8A 3F5TA 3U0ZA 1IBKO 5HFMA 1SF9A 2G38A 3JAWA 3HPLC 2H3OA 3OEHG 4O4IB 1JOYA 5L3GA 3RGBA 2DWDC 3R65A 1K92A 2LW7A 5E79Z 4GLXA 3JCZA 5EK0A 5KX5A 2JS5A 3HR0A 4RUFA 4DK0A 2IBZH 2JIZG 1BZKA 2Q5ZA 1Y76A 4UCVA 1HNXO 4BW5A 3SPHA 4ZHQA 1K5QA 1W0KG 2EIMB 3CXCU 1NS1A 1K8AW 4IIJB 4FLVA 2GSMB 3CEIA 3UT5B 3UKMA 1Q86W 2F93B 3ZMZA 4B3RB 1UJWB 4LFBB 1BCCH 1Y67A 4J42A 4LR3A 5FL7G 4FLYA 5JVDB 3R66A 4GX0A 1G1XB 3ZMVA 4H33A 4JI1B 3ZHRA 1NU1H 2UXBB 2W6IG 3OUFA 5B3SC 5KHIA 2VWKA 4QJFB 1D5AA 4FPPA 4FLTA 1OV9A 1AP6A 4DXWA 4QGPA 4TUYB 3ETQA 5A2QN 4JI6B 1TAEA 1VQ6V 2Q4PA 3CXHF 1J95A 4PDRA 3HKDA 2ZE8A 3A0BZ 1ENVA 2VS0A 2DYRB 3CCVV 2HLDG 1XMOB 2Q0OC 3JAMN 1VF5B 1OCOB 3CC4V 1TUBB 3Q4HA 3JD3A 4YY3O 4EEQA 1Y74B 2R9RB 1AR5A 4UB6Z 2LJ2A 4ZIBA 2DMXA 3UT5A 2Q7GA 2ADPA 4KHPO 4MT8A 4JYYA 2QA4V 2HVKC 2ITCC 1V54C 5KHGA 3P3NA 1O9HA 3H1HH 4DR1B 2WWWA 2UXDO 3AK1A 4UB8Z 3T4DA 2Y0PA 2P6JA 3LDCA 3IC9A 1XI1A 3D3QA 4JI7O 4OPAA 3JYCA 2CGOA 2P67A 1Q90D 3SYAA 5LHIA 5IDJA 2H8PC 1GN4A 1KMIZ 1FXHA 4FLXA 4Q20A 2ARHA 3O65A 1URFA 2RDCA 3E86A 3K04A 5DEDA 1EM1A 1H2MA 3CSXA 1HP8A 4NB5A 1K4CC 3ZHVA 1WPBA 1NTMH 3C90A 2IM9A 4JASA 3RN4A 3AG4C 4JYAB 2F1MA 3GWOA 4BIOA 1BGYH 1ORQC 4JAAA 1ZL8A 4UVBA 2AGAA 2C2AA 2VWJA 4XDKA 2Z5UA 3SJBC 4UVCA 4XBFA 2JJ2G 3K9SA 4KXRA 1BSMA 2IU3A 1R6KA 1X4TA 3K5OA 1IDSA 3K5LA 1IZ3A 1QVFU 3AG3C 4X9QA 3TJTA 4GZRB 4P9PA 2FKXA 4FK5C 1JX9A 4U3JB 1WA8A 4JI3O 3HB3B 2E74B 2E75B 3IJ4A 5EC1C 1FKAO 1OJHA 4QIWF 5FNVA 2PTMA 3KZIZ 1LNQA 2P90A 1HNWO 5LA6B 4MW8A 4O2BA 2Y69B 3CCLV 3E8FA 1J5EB 5LMUO 3RBZA 2DE0X 4FIPC 5IJ0A 1E1QG 2W0FC 4PD4F 4U7NA 5JJEB 1RPRA 3IAYA 3ABKC 4O4JA 3JAKB 4JAVA 3E2EA 2HFEC 1JMKC 4DR2O 2UU9B 1Q6HA 1VQ8V 1NR7A 1FFXB 1YITV 1VQNV 4KFMA 1US6A 5L3BA 1VARA 4J10A 1JFFB 4J80A 3AG2B 1QVGU 5EBLC 1O9GA 3AG4B 1BQZA 4NXMB 4NXNO 4FM2A 4TWKA 4DV0B 4NXNB 4WF9V 5EIBD 4AQYO 4YY3B 1CEZA 1TA8A 3ZRXA 3HKEB 1VF7A 4DV2B 2NLJC 4DR7B 1WLEA 3NXSA 1HNZO 5LMNB 2PYLA 5B1AB 1JFFA 5B1AC 1R3LC 5JCOA 5LP6A 2FTKA 3ZEDA 4JTDB 1E1RG 3OR6C 1CPYA 1RSOA 1N34B 1F4NA 4QE7A 5J2TB 2WLLA 3PJSK 2XT9A 3T1YB 1OZ0A 4LF5O 1YHQV 1EBOA 1HR0O 1XMOO 4G28B 1XILA 2PGGA 1H2SB 1HR0B 1N33O 1YVWA 1KP3A 3JSLA 2QWNB 2A06H 5IWAO 2ATKC 3SPGA 3KKYA 2WA3A 1Q6IA 4D7TA 2A79B 2CDYA 2JRIA 2BTQB 4OPHA 2AZ2A 3AG1C 2Z3YA 2M6YA 3CJHB 4UCOA 1PNLA 4H13B 5D5QA 4DRXB 4B3MO 3ZN1A 2YI9A 3WG7C 1VQLV 1BL8A 5EBMC 3HKEA 1IBMB 1WA8B 2E3CA 3CRMA 2R9IA 4PA4A 4JI1O 3FYEB 2X6CA 3B09A 1SZXA 4ABMA 3KG2A 1THZA 2ZE6A 5H5NA 4R8CA 3K0DA 2LW1A 4IYHA 3O9OA 3G71V 2Z0AA 3FKSG 1WJZA 1B04A 1DLBA 3D36C 2E5LB 2L35A 1QNMA 3RYCA 1OCCB 3BRCA 2X0LA 3SYOA 2EIKC 4F6EA 1NH2D 3C3TA 2XAFA 3LSSA 2PYJA 4JI3B 2HHHO 2R72A 4UV9A 4YIPA 5CA1B 4R6ZA 3SYPA 4J7ZA 2WLIB 5B1BB 4O4HA 1MMMA 4MTFA 5CBHA 4FZ1A 4B7EA 4I50A 4NR1A 2D3OW 2AXTZ 3LDEA 2Q0AA 2XHBA 3RYFA 1NI8A 4JV5O 5IJ9A 2UUBO 1FYJA 4X1KA 1YI2V 1XNQB 1GK9A 2EILB 4B3TB 2H94A 2HJDA 2QSAA 3EVKA 3X2QC 1IURA 1H38A 2JGUA 2ZKOA 4WFBV 1YTFD 3JSNA 3SJQC 4CH3A 1U96A 2ZQMA 4JAUA 2QE7G 4LP8A 1S72V 4BIUA 4MVMA 4H37A 4L87A 3RFRA 1TUBA 4YIOA 1IXBA 1PP9H 2CUGA 3A2FA 3JD0A 5KLVH 2VQEB 2OTJV 4F6RA 1S3JA 4WFFA 3OTOO 4R7CA 5B1BC 5EZYB 2HKOA 1MSWD 5J2UA 4X62B 3FB8C 3B8MA 1Q8IA 2F95B 5C93A 3CX5F 4FJCC 4GX2A 1OCCC 2EIMC 1YEWA 5CB4B 4ZOLA 4DV5B 4E2LA 5EZYA 3J80N 2EJ7A 4TSFG 2DN9A 3MD0A 2OCCB 5IYDO 4TV9A 4DV3O 3ZJZA 1AJNA 1I0HA 1PL4A 4TQDA 2OWOA 1CXZB 1HWYA 2MW2B 1SA0A 4QNHB 1WP8A 2P4VA 2BOCC 1JJOA 1GKFA 4X1YA 1I08A 3K79A 3JASA 4J9YB 2CE4A 2ZXWB 1QR9A 4CS4A 5KUMA 5GTIZ 1KKCA 2HG5C 4IYIA 3TK1A 4JI5O 2AZ0A 3MDSA 5BR8O 5J9PC 2LP7A 2EJRA 2GDSA 4WCEV 3CCEV 3AK2A 4DK1A 2E5LO 3LDDA 4AILC 2N04A 2UXNA 4IT5A 1FXVA 1XMQB 4DW0A 4E4EA 3CPWU 5DECA 5DM6V 4DV2O 4O4LB 5GW7A 1JVMA 1XREA 5A9GA 1KQSU 4NTWA 5LA6A 2LO1A 1FPOA 5BMVB 4JI0O 3CCUV 3FB6C 5K1XA 3F5WC 5IYCO 3TCUA 1OHHG 1N0NA 4D6TH 3RT3C 3G4SV 3B40A 4X64O 3WFVA 3CC7V 1M56C 1T5EA 4X1IB 5CA3A 4MVUA 3JARB 2PF4E 3VQVA 1XHZA 3B8NA 4KP4A 1D2DA 1MNGA 1SKVA 2Q67A 1LR1A 1KBHA 4XDJA 2P5OA 1SRYA 2BCCH 3K57A 1LUVA 1MSDA 1AJPA 2KSDA 1HNWB 3ETEA 4AQYB 5L3EA 2HP8A 4JYBA 4B08A 5IJ9B 2YICA 3ZRWA 3EHBB 4LF4B 3K9AA 3SGIA 4RUEA 2QWOB 1W59A 1YXBA 2Y69C 3STLC 3G6EV 2FMLA 2ZDIA 3M8AA 1SQPH 3ZS8C 2GUZB 5L3CA 2P4KA 4TT3G 4O4HB 4YHHB 1J5EO 4Q6GA 3TETA 5GONA 1NTKH 4FLUA 1KU9A 4TQFA 2BSKB 3VBBA 4N23A 3JATA 3MAQA 2YXYA 4LFCO 3C3SA 2EIJC 4XDLA 4PDVA 4LF9B 2JVDA 4WBNA 1GAXA 1EN5A 1RM1B 5IYBO 1PM9A 2V4DA 2ETNA 4BW9A 2N05A 4ICGA 1K97A 2QTOA 2Y4UA 4RAIA 4CH6A 4YJ2B 2ILMA 1MOFA 1VQ5V 5LBQA 1V9PA 3QG5A 4J7JA 3H1LH 5LXTB 1HNZB 4UXNA 3SPIA 4TV8B 4LBEC 3GWKC 3SPCA 3JASB 5EYPB 1XL6A 2YXHA 4PI0A 4HZ3A 2KG7A 2JGDB 1WB7A 4W4LA 1ZTEA 3CWBH 1XL4A 1YCIA 4DV4O 2F23A 3ABMC 1N8RW 3W7TA 3CB2A 3DGEA 2ZE5A 2PZSA 3LUTB 1HDJA 1XUQA 4JI4B 2ZM6O 1SERA 1GN2A 3VQWA 2YI8A 4FM1A 5LXTA 1NTZH 2UXXA 4EB6A 2X6BA 4DR3O 2UU9O 1FFXA 2Q9LA 3APOA 5LGNA 4B3RO 1QCEA 1N32O 3RWRD 1YDXA 1CP9A 1ZAUA 2DQ0A 3ETDA 4X20B 2DW4A 5JH7B 4NYKA 1S5LZ 2IJKA 2X6AA 1LUWA 4Z1VA 3ZMTA 4IHJB 5JJNB 5JWPA 5H9CA 1JA8A 4WFEA 4HBNA 3QF7A 4JZ2A 2ZINA 2QM8A 3TXSA 3JD4A 4BR6A 3W7WA 4GX1A 2UXDB 1Y66A 4DR6O 1VP7A 2CTWA 4NTXA 2QWQB 2V7QG 3E8GA 3L71H 3RVYA 4UV8A 5CA0A 1AJQA 1P49A 3BABA 4U3JA 3T1YO 3KCYA 2XOKG 1RPOA 2PY5A 2QEXV 2EBOA 3NR7A 4J9ZB 3OM3B 1JPXA 2RCVA 4B3SO 4DR3B 2Y4TA 2ZR3A 4JF3A 3SPJA 2IJJA 2WLMA 1DF5A 1NVPD 1ZL8B 4I5SA 5B1NA 2YS8A 4GUNA 4JYAO 3JD2A 1G4YB 1BS3A 1Q3EA 1GH6A 2AHZA 4UVAA 2QM4A 4O4IA 1M5IA 2WAMA 3SJAC 5LYJA 2VRZA 3OFNG 1VQOV 4GKKO 5KA5A 2KQXA 3ABMB 3JD1A 2UUAB 1Z5VA 2WLIA 3FAVB 1EN4A 1EN6A 2QKAA 1HW7A 2ODMA 1MABG 1PD3A 2K1EA 1FD9A 1I5YA 4DV1B 4LC1A 3OTFA 1M57C 1XHXA 1N4CA 1YSCA 1XNRO 1VF6C 3E8BA 4MTOA 2WSSG 4D7SA 4DR2B 3HKCA 2ZNIA 3FX7A 1AI7A 1GM7A 4DR4B 3E89A 4I7ZB 3THOA 5FLXN 4DV7O 3K58A 2UUCB 1MA1A 2DYSB 3WB0A 4OGQB 3SJCC 1AI5A 1FJGB 1NQTA 1DGSA 3OEEG 5JQGA 1AP5A 3OR7C 1QBZA 4TOIA 1QLEC 1ZUQA 5CA0B 1F51A 1VQ7V 4NKGB 3U10A 1M57B 2Y48A 1K9MW 2Y0IA 2R70A 3CS5A 2XUMA 5LHHA 1M90W 1AVMA 4YJ3A 1TGOA 4YJ2A 4B3TO 3H1JH 3B2EE 4U7OA 2VQFO 1YTFB 1EZVH 3QO5A 4DUZO 2QTSA 4TUYA 1KUQA 1BMFG 2WLNA 1VIBA 3JATB 3ABKB 4DR7O 3D8CA 2WLLB 5LOVB 4DV7B 3FB7C 2WPDG 3CCSV 2F4VO 2HR3A 4BAYA 1L0NH 1BE3H 2Q73A 2KB1A 4EFBA 3ZN0A 1BHBA 5KAIZ 3ZRWB 3RYIB 1GRJA 1AILA 1GM9A 4UFZA 3SDLA 4JI7B 3E22A 3CRRA 3RYIA 2F66C 4AHCA 3W7XA 3S3XA 1Q5OA 2QGNA 2JEUA 3K08A 4I0XA 2IU0A 3P32A 3P3PA 2OCHA 3I5DA 2WA4A 1FS0G 3ZCCA 3AG2C 1Q81W 4LF6B 1N0JA 5HFLA 1KB9F 1QR8A 4X1KB 3BA8A 5DN6G 1KECA 3BEHA 1NZ6A 5IY5B 3ZHSA 4Z2WA 3CCJV 2P22C 3ZIAG 1L0LH 3UQ8A 4ZI7B 3OMNB 3IGAC 3UCSC 1H8HG 4F4LA 1VQMV 4I9QA 1XQ8A 3ML0A 3FAVA 1NT2B 4GKKB 2ZE7A 1AROP 1EZJA 4WFGA 3OTOB 4O4LA 3CMEV 3K5MA 1FFTB 3ASNC 3J81N 2PUSA 3ABUA 1SQBH 2RQ6A 4HNAB 3H01A 4WFHA 4DYLA 2Q7EA 2WLKA 1ZSPA 4LFBO 5BXZA 1Q82W 5E1AC 4J41A 4X8AA 3T4ZA 3VOUA 4DR5B 2IH3C 3ZRVA 1FXKA 3CRCA 3RYHA 3AG1B 4CBCA 4KHPB 3ASOB 2UUCO 1P7BA 4MVQA 4LF8O 2CH7A 2ZCEA 1WAZA 4FZ0A 4PA9A 1XEQA 5JCOC 1KD1W 1SA0B 2Q7HA 4DR1O 1F23A 4HNAA 2LQTA 1K7DA 4JI4O 2EZOA 4R50A 3TXQA 4PA6A 4AI8A 1R3IC 5IWAB 2DWEC 2XAHA 1MZFA 2GBOA 2QKSA 3CC2V 3IC7A 1PV0A 4OX9B 1IXMA 1MG1A 1IBLO 1SQXH 3QTCA 2F4VB 1RSOB 2FB5A 3FFQA 5GTHZ 1NKDA 1ZWIC 2W6JG 3G67A 3WB1A 5B66Z 2CK3G 2YIBD 3W7UA 1JR9A 4LWSA 4CC5A 1I7FA 2QWPB 3STZC 5K1PA 2EIKB 2Q8VA 3GVMA 1Q43A 4ASUG 1Y74A 4LWSB 2LFRA 1NH2B 3ASOC 1KYOF 1H2KA 4MVRA 1S5JA 3OE7G 4L8JA 1B3QA 2XASA 4DUYB 4X89A 1G8MA 5KMGB 1I94B 4DUZB 4EKWA 3VQXA 1VQ4V 3HKDB 4JI2O 2QR4A 5LOVA 1Z5WA 1Q7YW 3IFXA 2PI4A 5IYZA 4LF8B 1IBMO 2EILC 2XTAA 3BCCH 5IJ0B 5IYZB 1Y4MA 3L74H 1L1FA 4CC6A 4KUMA 4I50B 2Q6AA 3OMIB 3WB2A 3S3WA 4HYOA 2D2CB 3F7VC 2GUZA 4QPJA 2X7RB 5CA1A 3K5NA 1NBMG 4F6RB 4LH6A 5LP6B 2FYUH 3L70H 1COWG 3DSQA 4C7UA 1R6TA 3RW0A 3QNEA 4I55A 4DV6B 3UO3A 2XAGA 1H2LA 3N27A 2CTQA 4PA3A 4DR5O 3K06A 2HJFC 1W2BU 3RYCB 4DR4O 3N2KA 4O2AB 3CCMV 1YJNV 5BZBA 2AHYA 3L9DA 1NJIW 4B3MB 4QPKA 3JALB 1RM1C 3M99B 2CTRA 4PI2A 1ZLZA 3JALA 3A8TA 3F7YC 3HKBB 2DYSC 1G6UA 1H8EG 4EFEA 2K9PA 4QE9A 2GTSA 4H0LB 3I55V 2R9AA 3MHSC 3L72H 4PDLA 3A0HZ 3OD4A 2A3QA 2BSKA 1VQPV 1QQCA 2YIBA 1PL0A 3CD6V 3CMAV 4DV5O 3G6BA 3H9VA 1I94O 1M93A 2P06A 1PKXA 1WN7A 3OGCC 2P7TC 5KHKA 3JCUZ 3N2GB 4JYCA 4JZGA 4I4TA 4LF4O 4LCUC 1IX9A 1NR1A 2ZXWC 2UXCB 3ZHUA 1OCZC 3ZX6A 2KKWA 2RJZA 2CGNA 1KP2A 1FXKC 3X2QB 2VQEO 3CCRV 1R6NA 5CBGA 2OYQA 3VQYA 1D5NA 4DR6B 3JARA 4X62O 4CH5A 3N2KB 4O2AA 3ASNB 4LFAO 4K0KB 4IGGA 1EFRG 2BE3A 4I55B 3KCXA 3T1CA 3Q4HB 1N36O 4K8XA 1RP3B 3AG3B 1JJ2U 4FVMA 2CTPA 1K5SA 1B6QA 3D36A 4MS2A 4P30A 2EINB 1V54B 4JI8O 4PHZA 2XAQA 4LH7A 4O4JB 2DQ3A 2BTOA 3ABTA 4JTCB 4FFBB 2CAZC 1IVSA 2N74A 1K34A 4X65O 3UO2A 1JCHA 2OTLV 1Z2GA 4GX5A 5GONB 4FLZA 4LFAB 3OW2U 3U11A 2UUBB 4EB6B 1K3EA 2QDOA 1QU7A 1AR4A 1WP7A 1TUEB 3FB5C 1SQQH 2ZR2A 3L73H 2QKCA 1K33A 4FLWA 3H1IH 1GN6A 4IL6Z 2QWRB 4HAMA 3H1KH 4UCRA 4X66O 1QHTA 4DV0O 2JK5C 3ZHQA 2HVJC 5H6RA 2RNBA 5LHGA 5C8YA 4MTGA 2IJIA 5CMUA 4OX9O 3CE2A 1R1BA 5KAFZ 5IY5C 5KA6A 2IW5A 2LGWA 3OT7A 2B9ZA 5LMUB 4K35A 4MVSA 1XDCA 5KHHA 2ZIMA 3CHXA 3JAKA 3J7AU 2PI5A 4I4TB 4K8ZA 4WBNB 3PN1A 4G2KA 4DV1O 2HEPA 4LF9O 1XBLA 2NN4A 3SR2C 1P7GA 1WB8A 2JEXA 4WFAV 4YJ3B 4JV5B 4PV1B 3K03A 4GCZA 4ZI7A 3BFRA 5JVDA 5EBWC 4B7KA 4CZZA 1SQGA 5IT9N 3D3IA 2E76B 3K0GA 4H44B 1VMGA 4IIJA 2HHHB 2O57A 4GKJB 5IE9A 3RYHB 3BVOA 1FXKB 3ZRSA 5TISZ 1H2NA 5C8YB 4W4KA 3LNNA 4I9WA 4GYCB 2L6LA 1ZX3A 2YC0A 1VQ9V 4X1IA 3ABLB 1SETA 5BR8B 2DOSA 5JJJB 1SQVH 2A7WA 2V1DA 3ICXA 3OUSA 1Y6XA 3AK3A 2EINC 3JAWB 5D5PA 1XNRB 2YDEA 1TVKB 1DF4A 4UCUA 1NVPB 4MW3A 4X66B 3RVZA 5KHJA 3QO7A 5CB4A 1M56B 4DW1A 4Z1MG 1BT8A 2A0LA 4JGSA 3LNMB 1R73A 1E79G 5LYJB 5JH7A 1YIJV 3BA9A 5ITZA 2B1GA 4LF7O 4DV4B 2M7WA 4UUJC 1N36B 3QVNA 5H2FZ 4RO2A 1F4MA 1L8DA 4K0KO 1ROPA 1N32B 4MTXA 3ABLC 3DTUB 1YZBA 3E22B 2JGDA 3BAAA 4DUYO 2XNDG 3AG7A 2BTQA 1X59A 2IH1C 5LP6C 4ZHQB 3LSQA 4JI0B 1GMGA 4DV3B 1GTOA 1GN3A 3ETGA 2UUAO 5CBFA 2QM7A 5ITZB 3T1HB 1SESA 2BOBC 1QLEB 4YXWG 4JTAB 4PELA 4NTYA 1V55B 4X20A 2OCCC 2Q69A 2LFSA 4LF5B 1SZTA 2LGQA 4KL1A 1K4DC 1XNQO 4O2BB 3ZBHA 5CN0A 1S5HC 1BQ0A 1TVKA 1S77D 3AEIA 1VQKV 4J7KA 4DV6O 1OCRB 3EXAA 2YUAA 3K59A 4PDMA 3P30A 1YF2A 1IBKB 1MZEA 2UXBO 1DK1A 4MSWC 4BWAA 2W0XA 4LNUB 1GO3F 4X65B 3ZHTA 2UXCO 1H2GA 2CH7B 1IBLB 4NVPA 4K3AA 2JS3A 1AI4A 5F2VO 4TV8A 5KUKA 2DJVA 4FMTA 4RQFA 5BY1A 1M9NA 2GV9A 1YJWV 2OIGA 2ZNJA 1F7YA 4N21A 1PNMA 5LL6Y 3WU2Z 1VF6A 2IJHA 1B06A 2RN9A 1N33B 1VEWA 4JI6O 3GB7C 5FPRA 4BIZA 2AW9A 2QJ1A 3CJHA 2ZT9B 1P84F 3SYCA 5BMVA 3QO8A 4PA7A 5L3DA 5B3SB 2ITDC 4FM0A 4CS3A 1RFYA 4LF6O 2GHYA 4MVZA 1OCZB 3OMAB 3DXRB 2A9HA 2B1IA 2MK3A 3EFFK 2YIDA 1KC8W 1R3JC 3HKBA 1SC5B 3M7MX 5B1OA 4YHHO 1AI6A 3CYOA 1P4RA 1WPXA 5KMGA 4I0XB 1OCOC 1U97A 2ADQB 4FFKA 1S0VA 4JPRA 4B3SB 2OIEA 4P2ZA 3T2MA 4LNUA 4U3FH 4X1YB 3W7SA 3BPZA 4MVOA 1S76D 4NXMO 3CP1A 4J11A 2GTAA 2WLJA 3E8HA 4DRXA 2XAJA 1XMQO 2EZPA 5L3FA 1KKDA 1UPGA 1AR1B 5LMNO 3A0RA 1I5XA 3FD9A 2B5UA 2ZD9A 1Q6UA 4P9OA 3T1HO 3WG7B 3OGIB 4UCSA 2YEVB 4ZOLB 2JJ1G 5FPOA 2EULA 3ZMSA 2NR5A 1N34O 3DC5A
chains in the Genus database with same CATH topology
4JI1O 5BY1A 4LF7O 3J7AU 4DV4O 2VQEO 1FJGO 3OTOO 3RT3C 2UXDO 4DR1O 4X64O 5H5NA 1F7YA 5LL6Y 4DV1O 4X62O 1AILA 2ZM6O 1HNXO 4LF9O 3SDLA 4JI4O 4LFAO 2Z0AA 4JI7O 4DR3O 2UU9O 4OPAA 4JI6O 1XNRO 1NS1A 1R6TA 4DR2O 1N36O 4K0KO 1D2DA 4B3RO 1N32O 4DR5O 1YZBA 4DR4O 3O65A 3J80N 4DUYO 5FLXN 4DV7O 4NXNO 5IT9N 1IBLO 4JI8O 4LF6O 4DV3O 1X59A 2HHHO 4AQYO 3R66A 4A5UB 1G1XB 2UUAO 1HNZO 2N74A 4X65O 4DR6O 4GKJO 3M8AA 2AGAA 1J5EO 5A2QN 4YHHO 3T1YO 4JV5O 2UUBO 3J81N 1FYJA 4LFCO 4LF5O 4JI5O 2DOSA 1AB3A 1HR0O 5BR8O 1XNQO 1XMOO 4B3TO 4DV5O 4B3SO 1N33O 4LFBO 1I94O 5BXZA 1A32A 2VQFO 3JAMN 2FKXA 4NXMO 4X66O 5IWAO 2ZKOA 4DV6O 2E5LO 4DV0O 4DUZO 4JI3O 4YY3O 1KUQA 4JI2O 1XMQO 4DV2O 4LF4O 1FKAO 3F5TA 2JRIA 4DR7O 2UXBO 4OPHA 1IBKO 1DK1A 4JYAO 5LMNO 4OX9O 1R1BA 4B3MO 1IBMO 2UXCO 1HNWO 3T1HO 2UUCO 4KHPO 4LF8O 2F4VO 4JI0O 2DJVA 5LMUO 2LW7A 1N34O 1XEQA 4GKKO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 O;  5BY1 A;  4LF7 O;  3J7A U;  4DV4 O;  2VQE O;  1FJG O;  3OTO O;  3RT3 C;  2UXD O;  4DR1 O;  4X64 O;  5H5N A;  1F7Y A;  5LL6 Y;  4DV1 O;  4X62 O;  1AIL A;  2ZM6 O;  1HNX O;  4LF9 O;  3SDL A;  4JI4 O;  4LFA O;  2Z0A A;  4JI7 O;  4DR3 O;  2UU9 O;  4OPA A;  4JI6 O;  1XNR O;  1NS1 A;  1R6T A;  4DR2 O;  1N36 O;  4K0K O;  1D2D A;  4B3R O;  1N32 O;  4DR5 O;  1YZB A;  4DR4 O;  3O65 A;  3J80 N;  4DUY O;  5FLX N;  4DV7 O;  4NXN O;  5IT9 N;  1IBL O;  4JI8 O;  4LF6 O;  4DV3 O;  1X59 A;  2HHH O;  4AQY O;  3R66 A;  4A5U B;  1G1X B;  2UUA O;  1HNZ O;  2N74 A;  4X65 O;  4DR6 O;  4GKJ O;  3M8A A;  2AGA A;  1J5E O;  5A2Q N;  4YHH O;  3T1Y O;  4JV5 O;  2UUB O;  3J81 N;  1FYJ A;  4LFC O;  4LF5 O;  4JI5 O;  2DOS A;  1AB3 A;  1HR0 O;  5BR8 O;  1XNQ O;  1XMO O;  4B3T O;  4DV5 O;  4B3S O;  1N33 O;  4LFB O;  1I94 O;  5BXZ A;  1A32 A;  2VQF O;  3JAM N;  2FKX A;  4NXM O;  4X66 O;  5IWA O;  2ZKO A;  4DV6 O;  2E5L O;  4DV0 O;  4DUZ O;  4JI3 O;  4YY3 O;  1KUQ A;  4JI2 O;  1XMQ O;  4DV2 O;  4LF4 O;  1FKA O;  3F5T A;  2JRI A;  4DR7 O;  2UXB O;  4OPH A;  1IBK O;  1DK1 A;  4JYA O;  5LMN O;  4OX9 O;  1R1B A;  4B3M O;  1IBM O;  2UXC O;  1HNW O;  3T1H O;  2UUC O;  4KHP O;  4LF8 O;  2F4V O;  4JI0 O;  2DJV A;  5LMU O;  2LW7 A;  1N34 O;  1XEQ A;  4GKK O; 
#chains in the Genus database with same CATH topology
 5LGU A;  4IHJ A;  1FJG O;  3K3W A;  3DC6 A;  1SQF A;  4X88 A;  4FFB A;  4LFC B;  5H6Q A;  1HNX B;  5J2U B;  5J2T A;  4OXS A;  2YEV A;  2EX3 A;  2WLH A;  3B4S A;  3E35 A;  3ZMU A;  5FNV B;  1K73 W;  4JI5 B;  1PPJ H;  2ZIO A;  4PJ0 Z;  2RMK B;  1JQ0 A;  2YXL A;  4JI8 B;  4G27 B;  2DYR C;  1XOU A;  3CCQ V;  2EIJ B;  2NNU A;  4ZBM A;  1SS3 A;  2KG7 B;  2Q68 A;  4A5U B;  5JQG B;  1QLN A;  4JI2 B;  4LF7 B;  5EIB C;  5EYP A;  2F43 G;  5EC2 C;  5B5E Z;  1V55 C;  3BHP A;  1WNS A;  3BY6 A;  2FL4 A;  3G80 A;  1BHA A;  4GKJ O;  4TV9 B;  3UM7 A;  1R3K C;  5AG2 A;  4DO2 A;  1Y76 B;  4RWU A;  1DTO A;  4CH4 A;  1UFI A;  3TGU H;  2OT5 A;  1FAF A;  5KX5 B;  1W0J G;  1PNK A;  2YSU B;  3HKC B;  4X64 B;  3DXR A;  3RYF B;  1M4U A;  3L75 H;  2YIA A;  1YJ9 V;  1AB3 A;  3N2G A;  2ZM6 B;  3APQ A;  3MHH C;  3SYQ A;  4UCT A;  3CRQ A;  3FYI B;  3LSU A;  3E83 A;  2JDI G;  4CS2 A;  4RQE A;  1A32 A;  2ZDI C;  3CRA A;  2VQF B;  4ZKI A;  1OCR C;  4GT1 A;  3OAA G;  1M1K W;  3B77 A;  5LGT A;  3I56 V;  1GM8 A;  3F5T A;  3U0Z A;  1IBK O;  5HFM A;  1SF9 A;  2G38 A;  3JAW A;  3HPL C;  2H3O A;  3OEH G;  4O4I B;  1JOY A;  5L3G A;  3RGB A;  2DWD C;  3R65 A;  1K92 A;  2LW7 A;  5E79 Z;  4GLX A;  3JCZ A;  5EK0 A;  5KX5 A;  2JS5 A;  3HR0 A;  4RUF A;  4DK0 A;  2IBZ H;  2JIZ G;  1BZK A;  2Q5Z A;  1Y76 A;  4UCV A;  1HNX O;  4BW5 A;  3SPH A;  4ZHQ A;  1K5Q A;  1W0K G;  2EIM B;  3CXC U;  1NS1 A;  1K8A W;  4IIJ B;  4FLV A;  2GSM B;  3CEI A;  3UT5 B;  3UKM A;  1Q86 W;  2F93 B;  3ZMZ A;  4B3R B;  1UJW B;  4LFB B;  1BCC H;  1Y67 A;  4J42 A;  4LR3 A;  5FL7 G;  4FLY A;  5JVD B;  3R66 A;  4GX0 A;  1G1X B;  3ZMV A;  4H33 A;  4JI1 B;  3ZHR A;  1NU1 H;  2UXB B;  2W6I G;  3OUF A;  5B3S C;  5KHI A;  2VWK A;  4QJF B;  1D5A A;  4FPP A;  4FLT A;  1OV9 A;  1AP6 A;  4DXW A;  4QGP A;  4TUY B;  3ETQ A;  5A2Q N;  4JI6 B;  1TAE A;  1VQ6 V;  2Q4P A;  3CXH F;  1J95 A;  4PDR A;  3HKD A;  2ZE8 A;  3A0B Z;  1ENV A;  2VS0 A;  2DYR B;  3CCV V;  2HLD G;  1XMO B;  2Q0O C;  3JAM N;  1VF5 B;  1OCO B;  3CC4 V;  1TUB B;  3Q4H A;  3JD3 A;  4YY3 O;  4EEQ A;  1Y74 B;  2R9R B;  1AR5 A;  4UB6 Z;  2LJ2 A;  4ZIB A;  2DMX A;  3UT5 A;  2Q7G A;  2ADP A;  4KHP O;  4MT8 A;  4JYY A;  2QA4 V;  2HVK C;  2ITC C;  1V54 C;  5KHG A;  3P3N A;  1O9H A;  3H1H H;  4DR1 B;  2WWW A;  2UXD O;  3AK1 A;  4UB8 Z;  3T4D A;  2Y0P A;  2P6J A;  3LDC A;  3IC9 A;  1XI1 A;  3D3Q A;  4JI7 O;  4OPA A;  3JYC A;  2CGO A;  2P67 A;  1Q90 D;  3SYA A;  5LHI A;  5IDJ A;  2H8P C;  1GN4 A;  1KMI Z;  1FXH A;  4FLX A;  4Q20 A;  2ARH A;  3O65 A;  1URF A;  2RDC A;  3E86 A;  3K04 A;  5DED A;  1EM1 A;  1H2M A;  3CSX A;  1HP8 A;  4NB5 A;  1K4C C;  3ZHV A;  1WPB A;  1NTM H;  3C90 A;  2IM9 A;  4JAS A;  3RN4 A;  3AG4 C;  4JYA B;  2F1M A;  3GWO A;  4BIO A;  1BGY H;  1ORQ C;  4JAA A;  1ZL8 A;  4UVB A;  2AGA A;  2C2A A;  2VWJ A;  4XDK A;  2Z5U A;  3SJB C;  4UVC A;  4XBF A;  2JJ2 G;  3K9S A;  4KXR A;  1BSM A;  2IU3 A;  1R6K A;  1X4T A;  3K5O A;  1IDS A;  3K5L A;  1IZ3 A;  1QVF U;  3AG3 C;  4X9Q A;  3TJT A;  4GZR B;  4P9P A;  2FKX A;  4FK5 C;  1JX9 A;  4U3J B;  1WA8 A;  4JI3 O;  3HB3 B;  2E74 B;  2E75 B;  3IJ4 A;  5EC1 C;  1FKA O;  1OJH A;  4QIW F;  5FNV A;  2PTM A;  3KZI Z;  1LNQ A;  2P90 A;  1HNW O;  5LA6 B;  4MW8 A;  4O2B A;  2Y69 B;  3CCL V;  3E8F A;  1J5E B;  5LMU O;  3RBZ A;  2DE0 X;  4FIP C;  5IJ0 A;  1E1Q G;  2W0F C;  4PD4 F;  4U7N A;  5JJE B;  1RPR A;  3IAY A;  3ABK C;  4O4J A;  3JAK B;  4JAV A;  3E2E A;  2HFE C;  1JMK C;  4DR2 O;  2UU9 B;  1Q6H A;  1VQ8 V;  1NR7 A;  1FFX B;  1YIT V;  1VQN V;  4KFM A;  1US6 A;  5L3B A;  1VAR A;  4J10 A;  1JFF B;  4J80 A;  3AG2 B;  1QVG U;  5EBL C;  1O9G A;  3AG4 B;  1BQZ A;  4NXM B;  4NXN O;  4FM2 A;  4TWK A;  4DV0 B;  4NXN B;  4WF9 V;  5EIB D;  4AQY O;  4YY3 B;  1CEZ A;  1TA8 A;  3ZRX A;  3HKE B;  1VF7 A;  4DV2 B;  2NLJ C;  4DR7 B;  1WLE A;  3NXS A;  1HNZ O;  5LMN B;  2PYL A;  5B1A B;  1JFF A;  5B1A C;  1R3L C;  5JCO A;  5LP6 A;  2FTK A;  3ZED A;  4JTD B;  1E1R G;  3OR6 C;  1CPY A;  1RSO A;  1N34 B;  1F4N A;  4QE7 A;  5J2T B;  2WLL A;  3PJS K;  2XT9 A;  3T1Y B;  1OZ0 A;  4LF5 O;  1YHQ V;  1EBO A;  1HR0 O;  1XMO O;  4G28 B;  1XIL A;  2PGG A;  1H2S B;  1HR0 B;  1N33 O;  1YVW A;  1KP3 A;  3JSL A;  2QWN B;  2A06 H;  5IWA O;  2ATK C;  3SPG A;  3KKY A;  2WA3 A;  1Q6I A;  4D7T A;  2A79 B;  2CDY A;  2JRI A;  2BTQ B;  4OPH A;  2AZ2 A;  3AG1 C;  2Z3Y A;  2M6Y A;  3CJH B;  4UCO A;  1PNL A;  4H13 B;  5D5Q A;  4DRX B;  4B3M O;  3ZN1 A;  2YI9 A;  3WG7 C;  1VQL V;  1BL8 A;  5EBM C;  3HKE A;  1IBM B;  1WA8 B;  2E3C A;  3CRM A;  2R9I A;  4PA4 A;  4JI1 O;  3FYE B;  2X6C A;  3B09 A;  1SZX A;  4ABM A;  3KG2 A;  1THZ A;  2ZE6 A;  5H5N A;  4R8C A;  3K0D A;  2LW1 A;  4IYH A;  3O9O A;  3G71 V;  2Z0A A;  3FKS G;  1WJZ A;  1B04 A;  1DLB A;  3D36 C;  2E5L B;  2L35 A;  1QNM A;  3RYC A;  1OCC B;  3BRC A;  2X0L A;  3SYO A;  2EIK C;  4F6E A;  1NH2 D;  3C3T A;  2XAF A;  3LSS A;  2PYJ A;  4JI3 B;  2HHH O;  2R72 A;  4UV9 A;  4YIP A;  5CA1 B;  4R6Z A;  3SYP A;  4J7Z A;  2WLI B;  5B1B B;  4O4H A;  1MMM A;  4MTF A;  5CBH A;  4FZ1 A;  4B7E A;  4I50 A;  4NR1 A;  2D3O W;  2AXT Z;  3LDE A;  2Q0A A;  2XHB A;  3RYF A;  1NI8 A;  4JV5 O;  5IJ9 A;  2UUB O;  1FYJ A;  4X1K A;  1YI2 V;  1XNQ B;  1GK9 A;  2EIL B;  4B3T B;  2H94 A;  2HJD A;  2QSA A;  3EVK A;  3X2Q C;  1IUR A;  1H38 A;  2JGU A;  2ZKO A;  4WFB V;  1YTF D;  3JSN A;  3SJQ C;  4CH3 A;  1U96 A;  2ZQM A;  4JAU A;  2QE7 G;  4LP8 A;  1S72 V;  4BIU A;  4MVM A;  4H37 A;  4L87 A;  3RFR A;  1TUB A;  4YIO A;  1IXB A;  1PP9 H;  2CUG A;  3A2F A;  3JD0 A;  5KLV H;  2VQE B;  2OTJ V;  4F6R A;  1S3J A;  4WFF A;  3OTO O;  4R7C A;  5B1B C;  5EZY B;  2HKO A;  1MSW D;  5J2U A;  4X62 B;  3FB8 C;  3B8M A;  1Q8I A;  2F95 B;  5C93 A;  3CX5 F;  4FJC C;  4GX2 A;  1OCC C;  2EIM C;  1YEW A;  5CB4 B;  4ZOL A;  4DV5 B;  4E2L A;  5EZY A;  3J80 N;  2EJ7 A;  4TSF G;  2DN9 A;  3MD0 A;  2OCC B;  5IYD O;  4TV9 A;  4DV3 O;  3ZJZ A;  1AJN A;  1I0H A;  1PL4 A;  4TQD A;  2OWO A;  1CXZ B;  1HWY A;  2MW2 B;  1SA0 A;  4QNH B;  1WP8 A;  2P4V A;  2BOC C;  1JJO A;  1GKF A;  4X1Y A;  1I08 A;  3K79 A;  3JAS A;  4J9Y B;  2CE4 A;  2ZXW B;  1QR9 A;  4CS4 A;  5KUM A;  5GTI Z;  1KKC A;  2HG5 C;  4IYI A;  3TK1 A;  4JI5 O;  2AZ0 A;  3MDS A;  5BR8 O;  5J9P C;  2LP7 A;  2EJR A;  2GDS A;  4WCE V;  3CCE V;  3AK2 A;  4DK1 A;  2E5L O;  3LDD A;  4AIL C;  2N04 A;  2UXN A;  4IT5 A;  1FXV A;  1XMQ B;  4DW0 A;  4E4E A;  3CPW U;  5DEC A;  5DM6 V;  4DV2 O;  4O4L B;  5GW7 A;  1JVM A;  1XRE A;  5A9G A;  1KQS U;  4NTW A;  5LA6 A;  2LO1 A;  1FPO A;  5BMV B;  4JI0 O;  3CCU V;  3FB6 C;  5K1X A;  3F5W C;  5IYC O;  3TCU A;  1OHH G;  1N0N A;  4D6T H;  3RT3 C;  3G4S V;  3B40 A;  4X64 O;  3WFV A;  3CC7 V;  1M56 C;  1T5E A;  4X1I B;  5CA3 A;  4MVU A;  3JAR B;  2PF4 E;  3VQV A;  1XHZ A;  3B8N A;  4KP4 A;  1D2D A;  1MNG A;  1SKV A;  2Q67 A;  1LR1 A;  1KBH A;  4XDJ A;  2P5O A;  1SRY A;  2BCC H;  3K57 A;  1LUV A;  1MSD A;  1AJP A;  2KSD A;  1HNW B;  3ETE A;  4AQY B;  5L3E A;  2HP8 A;  4JYB A;  4B08 A;  5IJ9 B;  2YIC A;  3ZRW A;  3EHB B;  4LF4 B;  3K9A A;  3SGI A;  4RUE A;  2QWO B;  1W59 A;  1YXB A;  2Y69 C;  3STL C;  3G6E V;  2FML A;  2ZDI A;  3M8A A;  1SQP H;  3ZS8 C;  2GUZ B;  5L3C A;  2P4K A;  4TT3 G;  4O4H B;  4YHH B;  1J5E O;  4Q6G A;  3TET A;  5GON A;  1NTK H;  4FLU A;  1KU9 A;  4TQF A;  2BSK B;  3VBB A;  4N23 A;  3JAT A;  3MAQ A;  2YXY A;  4LFC O;  3C3S A;  2EIJ C;  4XDL A;  4PDV A;  4LF9 B;  2JVD A;  4WBN A;  1GAX A;  1EN5 A;  1RM1 B;  5IYB O;  1PM9 A;  2V4D A;  2ETN A;  4BW9 A;  2N05 A;  4ICG A;  1K97 A;  2QTO A;  2Y4U A;  4RAI A;  4CH6 A;  4YJ2 B;  2ILM A;  1MOF A;  1VQ5 V;  5LBQ A;  1V9P A;  3QG5 A;  4J7J A;  3H1L H;  5LXT B;  1HNZ B;  4UXN A;  3SPI A;  4TV8 B;  4LBE C;  3GWK C;  3SPC A;  3JAS B;  5EYP B;  1XL6 A;  2YXH A;  4PI0 A;  4HZ3 A;  2KG7 A;  2JGD B;  1WB7 A;  4W4L A;  1ZTE A;  3CWB H;  1XL4 A;  1YCI A;  4DV4 O;  2F23 A;  3ABM C;  1N8R W;  3W7T A;  3CB2 A;  3DGE A;  2ZE5 A;  2PZS A;  3LUT B;  1HDJ A;  1XUQ A;  4JI4 B;  2ZM6 O;  1SER A;  1GN2 A;  3VQW A;  2YI8 A;  4FM1 A;  5LXT A;  1NTZ H;  2UXX A;  4EB6 A;  2X6B A;  4DR3 O;  2UU9 O;  1FFX A;  2Q9L A;  3APO A;  5LGN A;  4B3R O;  1QCE A;  1N32 O;  3RWR D;  1YDX A;  1CP9 A;  1ZAU A;  2DQ0 A;  3ETD A;  4X20 B;  2DW4 A;  5JH7 B;  4NYK A;  1S5L Z;  2IJK A;  2X6A A;  1LUW A;  4Z1V A;  3ZMT A;  4IHJ B;  5JJN B;  5JWP A;  5H9C A;  1JA8 A;  4WFE A;  4HBN A;  3QF7 A;  4JZ2 A;  2ZIN A;  2QM8 A;  3TXS A;  3JD4 A;  4BR6 A;  3W7W A;  4GX1 A;  2UXD B;  1Y66 A;  4DR6 O;  1VP7 A;  2CTW A;  4NTX A;  2QWQ B;  2V7Q G;  3E8G A;  3L71 H;  3RVY A;  4UV8 A;  5CA0 A;  1AJQ A;  1P49 A;  3BAB A;  4U3J A;  3T1Y O;  3KCY A;  2XOK G;  1RPO A;  2PY5 A;  2QEX V;  2EBO A;  3NR7 A;  4J9Z B;  3OM3 B;  1JPX A;  2RCV A;  4B3S O;  4DR3 B;  2Y4T A;  2ZR3 A;  4JF3 A;  3SPJ A;  2IJJ A;  2WLM A;  1DF5 A;  1NVP D;  1ZL8 B;  4I5S A;  5B1N A;  2YS8 A;  4GUN A;  4JYA O;  3JD2 A;  1G4Y B;  1BS3 A;  1Q3E A;  1GH6 A;  2AHZ A;  4UVA A;  2QM4 A;  4O4I A;  1M5I A;  2WAM A;  3SJA C;  5LYJ A;  2VRZ A;  3OFN G;  1VQO V;  4GKK O;  5KA5 A;  2KQX A;  3ABM B;  3JD1 A;  2UUA B;  1Z5V A;  2WLI A;  3FAV B;  1EN4 A;  1EN6 A;  2QKA A;  1HW7 A;  2ODM A;  1MAB G;  1PD3 A;  2K1E A;  1FD9 A;  1I5Y A;  4DV1 B;  4LC1 A;  3OTF A;  1M57 C;  1XHX A;  1N4C A;  1YSC A;  1XNR O;  1VF6 C;  3E8B A;  4MTO A;  2WSS G;  4D7S A;  4DR2 B;  3HKC A;  2ZNI A;  3FX7 A;  1AI7 A;  1GM7 A;  4DR4 B;  3E89 A;  4I7Z B;  3THO A;  5FLX N;  4DV7 O;  3K58 A;  2UUC B;  1MA1 A;  2DYS B;  3WB0 A;  4OGQ B;  3SJC C;  1AI5 A;  1FJG B;  1NQT A;  1DGS A;  3OEE G;  5JQG A;  1AP5 A;  3OR7 C;  1QBZ A;  4TOI A;  1QLE C;  1ZUQ A;  5CA0 B;  1F51 A;  1VQ7 V;  4NKG B;  3U10 A;  1M57 B;  2Y48 A;  1K9M W;  2Y0I A;  2R70 A;  3CS5 A;  2XUM A;  5LHH A;  1M90 W;  1AVM A;  4YJ3 A;  1TGO A;  4YJ2 A;  4B3T O;  3H1J H;  3B2E E;  4U7O A;  2VQF O;  1YTF B;  1EZV H;  3QO5 A;  4DUZ O;  2QTS A;  4TUY A;  1KUQ A;  1BMF G;  2WLN A;  1VIB A;  3JAT B;  3ABK B;  4DR7 O;  3D8C A;  2WLL B;  5LOV B;  4DV7 B;  3FB7 C;  2WPD G;  3CCS V;  2F4V O;  2HR3 A;  4BAY A;  1L0N H;  1BE3 H;  2Q73 A;  2KB1 A;  4EFB A;  3ZN0 A;  1BHB A;  5KAI Z;  3ZRW B;  3RYI B;  1GRJ A;  1AIL A;  1GM9 A;  4UFZ A;  3SDL A;  4JI7 B;  3E22 A;  3CRR A;  3RYI A;  2F66 C;  4AHC A;  3W7X A;  3S3X A;  1Q5O A;  2QGN A;  2JEU A;  3K08 A;  4I0X A;  2IU0 A;  3P32 A;  3P3P A;  2OCH A;  3I5D A;  2WA4 A;  1FS0 G;  3ZCC A;  3AG2 C;  1Q81 W;  4LF6 B;  1N0J A;  5HFL A;  1KB9 F;  1QR8 A;  4X1K B;  3BA8 A;  5DN6 G;  1KEC A;  3BEH A;  1NZ6 A;  5IY5 B;  3ZHS A;  4Z2W A;  3CCJ V;  2P22 C;  3ZIA G;  1L0L H;  3UQ8 A;  4ZI7 B;  3OMN B;  3IGA C;  3UCS C;  1H8H G;  4F4L A;  1VQM V;  4I9Q A;  1XQ8 A;  3ML0 A;  3FAV A;  1NT2 B;  4GKK B;  2ZE7 A;  1ARO P;  1EZJ A;  4WFG A;  3OTO B;  4O4L A;  3CME V;  3K5M A;  1FFT B;  3ASN C;  3J81 N;  2PUS A;  3ABU A;  1SQB H;  2RQ6 A;  4HNA B;  3H01 A;  4WFH A;  4DYL A;  2Q7E A;  2WLK A;  1ZSP A;  4LFB O;  5BXZ A;  1Q82 W;  5E1A C;  4J41 A;  4X8A A;  3T4Z A;  3VOU A;  4DR5 B;  2IH3 C;  3ZRV A;  1FXK A;  3CRC A;  3RYH A;  3AG1 B;  4CBC A;  4KHP B;  3ASO B;  2UUC O;  1P7B A;  4MVQ A;  4LF8 O;  2CH7 A;  2ZCE A;  1WAZ A;  4FZ0 A;  4PA9 A;  1XEQ A;  5JCO C;  1KD1 W;  1SA0 B;  2Q7H A;  4DR1 O;  1F23 A;  4HNA A;  2LQT A;  1K7D A;  4JI4 O;  2EZO A;  4R50 A;  3TXQ A;  4PA6 A;  4AI8 A;  1R3I C;  5IWA B;  2DWE C;  2XAH A;  1MZF A;  2GBO A;  2QKS A;  3CC2 V;  3IC7 A;  1PV0 A;  4OX9 B;  1IXM A;  1MG1 A;  1IBL O;  1SQX H;  3QTC A;  2F4V B;  1RSO B;  2FB5 A;  3FFQ A;  5GTH Z;  1NKD A;  1ZWI C;  2W6J G;  3G67 A;  3WB1 A;  5B66 Z;  2CK3 G;  2YIB D;  3W7U A;  1JR9 A;  4LWS A;  4CC5 A;  1I7F A;  2QWP B;  3STZ C;  5K1P A;  2EIK B;  2Q8V A;  3GVM A;  1Q43 A;  4ASU G;  1Y74 A;  4LWS B;  2LFR A;  1NH2 B;  3ASO C;  1KYO F;  1H2K A;  4MVR A;  1S5J A;  3OE7 G;  4L8J A;  1B3Q A;  2XAS A;  4DUY B;  4X89 A;  1G8M A;  5KMG B;  1I94 B;  4DUZ B;  4EKW A;  3VQX A;  1VQ4 V;  3HKD B;  4JI2 O;  2QR4 A;  5LOV A;  1Z5W A;  1Q7Y W;  3IFX A;  2PI4 A;  5IYZ A;  4LF8 B;  1IBM O;  2EIL C;  2XTA A;  3BCC H;  5IJ0 B;  5IYZ B;  1Y4M A;  3L74 H;  1L1F A;  4CC6 A;  4KUM A;  4I50 B;  2Q6A A;  3OMI B;  3WB2 A;  3S3W A;  4HYO A;  2D2C B;  3F7V C;  2GUZ A;  4QPJ A;  2X7R B;  5CA1 A;  3K5N A;  1NBM G;  4F6R B;  4LH6 A;  5LP6 B;  2FYU H;  3L70 H;  1COW G;  3DSQ A;  4C7U A;  1R6T A;  3RW0 A;  3QNE A;  4I55 A;  4DV6 B;  3UO3 A;  2XAG A;  1H2L A;  3N27 A;  2CTQ A;  4PA3 A;  4DR5 O;  3K06 A;  2HJF C;  1W2B U;  3RYC B;  4DR4 O;  3N2K A;  4O2A B;  3CCM V;  1YJN V;  5BZB A;  2AHY A;  3L9D A;  1NJI W;  4B3M B;  4QPK A;  3JAL B;  1RM1 C;  3M99 B;  2CTR A;  4PI2 A;  1ZLZ A;  3JAL A;  3A8T A;  3F7Y C;  3HKB B;  2DYS C;  1G6U A;  1H8E G;  4EFE A;  2K9P A;  4QE9 A;  2GTS A;  4H0L B;  3I55 V;  2R9A A;  3MHS C;  3L72 H;  4PDL A;  3A0H Z;  3OD4 A;  2A3Q A;  2BSK A;  1VQP V;  1QQC A;  2YIB A;  1PL0 A;  3CD6 V;  3CMA V;  4DV5 O;  3G6B A;  3H9V A;  1I94 O;  1M93 A;  2P06 A;  1PKX A;  1WN7 A;  3OGC C;  2P7T C;  5KHK A;  3JCU Z;  3N2G B;  4JYC A;  4JZG A;  4I4T A;  4LF4 O;  4LCU C;  1IX9 A;  1NR1 A;  2ZXW C;  2UXC B;  3ZHU A;  1OCZ C;  3ZX6 A;  2KKW A;  2RJZ A;  2CGN A;  1KP2 A;  1FXK C;  3X2Q B;  2VQE O;  3CCR V;  1R6N A;  5CBG A;  2OYQ A;  3VQY A;  1D5N A;  4DR6 B;  3JAR A;  4X62 O;  4CH5 A;  3N2K B;  4O2A A;  3ASN B;  4LFA O;  4K0K B;  4IGG A;  1EFR G;  2BE3 A;  4I55 B;  3KCX A;  3T1C A;  3Q4H B;  1N36 O;  4K8X A;  1RP3 B;  3AG3 B;  1JJ2 U;  4FVM A;  2CTP A;  1K5S A;  1B6Q A;  3D36 A;  4MS2 A;  4P30 A;  2EIN B;  1V54 B;  4JI8 O;  4PHZ A;  2XAQ A;  4LH7 A;  4O4J B;  2DQ3 A;  2BTO A;  3ABT A;  4JTC B;  4FFB B;  2CAZ C;  1IVS A;  2N74 A;  1K34 A;  4X65 O;  3UO2 A;  1JCH A;  2OTL V;  1Z2G A;  4GX5 A;  5GON B;  4FLZ A;  4LFA B;  3OW2 U;  3U11 A;  2UUB B;  4EB6 B;  1K3E A;  2QDO A;  1QU7 A;  1AR4 A;  1WP7 A;  1TUE B;  3FB5 C;  1SQQ H;  2ZR2 A;  3L73 H;  2QKC A;  1K33 A;  4FLW A;  3H1I H;  1GN6 A;  4IL6 Z;  2QWR B;  4HAM A;  3H1K H;  4UCR A;  4X66 O;  1QHT A;  4DV0 O;  2JK5 C;  3ZHQ A;  2HVJ C;  5H6R A;  2RNB A;  5LHG A;  5C8Y A;  4MTG A;  2IJI A;  5CMU A;  4OX9 O;  3CE2 A;  1R1B A;  5KAF Z;  5IY5 C;  5KA6 A;  2IW5 A;  2LGW A;  3OT7 A;  2B9Z A;  5LMU B;  4K35 A;  4MVS A;  1XDC A;  5KHH A;  2ZIM A;  3CHX A;  3JAK A;  3J7A U;  2PI5 A;  4I4T B;  4K8Z A;  4WBN B;  3PN1 A;  4G2K A;  4DV1 O;  2HEP A;  4LF9 O;  1XBL A;  2NN4 A;  3SR2 C;  1P7G A;  1WB8 A;  2JEX A;  4WFA V;  4YJ3 B;  4JV5 B;  4PV1 B;  3K03 A;  4GCZ A;  4ZI7 A;  3BFR A;  5JVD A;  5EBW C;  4B7K A;  4CZZ A;  1SQG A;  5IT9 N;  3D3I A;  2E76 B;  3K0G A;  4H44 B;  1VMG A;  4IIJ A;  2HHH B;  2O57 A;  4GKJ B;  5IE9 A;  3RYH B;  3BVO A;  1FXK B;  3ZRS A;  5TIS Z;  1H2N A;  5C8Y B;  4W4K A;  3LNN A;  4I9W A;  4GYC B;  2L6L A;  1ZX3 A;  2YC0 A;  1VQ9 V;  4X1I A;  3ABL B;  1SET A;  5BR8 B;  2DOS A;  5JJJ B;  1SQV H;  2A7W A;  2V1D A;  3ICX A;  3OUS A;  1Y6X A;  3AK3 A;  2EIN C;  3JAW B;  5D5P A;  1XNR B;  2YDE A;  1TVK B;  1DF4 A;  4UCU A;  1NVP B;  4MW3 A;  4X66 B;  3RVZ A;  5KHJ A;  3QO7 A;  5CB4 A;  1M56 B;  4DW1 A;  4Z1M G;  1BT8 A;  2A0L A;  4JGS A;  3LNM B;  1R73 A;  1E79 G;  5LYJ B;  5JH7 A;  1YIJ V;  3BA9 A;  5ITZ A;  2B1G A;  4LF7 O;  4DV4 B;  2M7W A;  4UUJ C;  1N36 B;  3QVN A;  5H2F Z;  4RO2 A;  1F4M A;  1L8D A;  4K0K O;  1ROP A;  1N32 B;  4MTX A;  3ABL C;  3DTU B;  1YZB A;  3E22 B;  2JGD A;  3BAA A;  4DUY O;  2XND G;  3AG7 A;  2BTQ A;  1X59 A;  2IH1 C;  5LP6 C;  4ZHQ B;  3LSQ A;  4JI0 B;  1GMG A;  4DV3 B;  1GTO A;  1GN3 A;  3ETG A;  2UUA O;  5CBF A;  2QM7 A;  5ITZ B;  3T1H B;  1SES A;  2BOB C;  1QLE B;  4YXW G;  4JTA B;  4PEL A;  4NTY A;  1V55 B;  4X20 A;  2OCC C;  2Q69 A;  2LFS A;  4LF5 B;  1SZT A;  2LGQ A;  4KL1 A;  1K4D C;  1XNQ O;  4O2B B;  3ZBH A;  5CN0 A;  1S5H C;  1BQ0 A;  1TVK A;  1S77 D;  3AEI A;  1VQK V;  4J7K A;  4DV6 O;  1OCR B;  3EXA A;  2YUA A;  3K59 A;  4PDM A;  3P30 A;  1YF2 A;  1IBK B;  1MZE A;  2UXB O;  1DK1 A;  4MSW C;  4BWA A;  2W0X A;  4LNU B;  1GO3 F;  4X65 B;  3ZHT A;  2UXC O;  1H2G A;  2CH7 B;  1IBL B;  4NVP A;  4K3A A;  2JS3 A;  1AI4 A;  5F2V O;  4TV8 A;  5KUK A;  2DJV A;  4FMT A;  4RQF A;  5BY1 A;  1M9N A;  2GV9 A;  1YJW V;  2OIG A;  2ZNJ A;  1F7Y A;  4N21 A;  1PNM A;  5LL6 Y;  3WU2 Z;  1VF6 A;  2IJH A;  1B06 A;  2RN9 A;  1N33 B;  1VEW A;  4JI6 O;  3GB7 C;  5FPR A;  4BIZ A;  2AW9 A;  2QJ1 A;  3CJH A;  2ZT9 B;  1P84 F;  3SYC A;  5BMV A;  3QO8 A;  4PA7 A;  5L3D A;  5B3S B;  2ITD C;  4FM0 A;  4CS3 A;  1RFY A;  4LF6 O;  2GHY A;  4MVZ A;  1OCZ B;  3OMA B;  3DXR B;  2A9H A;  2B1I A;  2MK3 A;  3EFF K;  2YID A;  1KC8 W;  1R3J C;  3HKB A;  1SC5 B;  3M7M X;  5B1O A;  4YHH O;  1AI6 A;  3CYO A;  1P4R A;  1WPX A;  5KMG A;  4I0X B;  1OCO C;  1U97 A;  2ADQ B;  4FFK A;  1S0V A;  4JPR A;  4B3S B;  2OIE A;  4P2Z A;  3T2M A;  4LNU A;  4U3F H;  4X1Y B;  3W7S A;  3BPZ A;  4MVO A;  1S76 D;  4NXM O;  3CP1 A;  4J11 A;  2GTA A;  2WLJ A;  3E8H A;  4DRX A;  2XAJ A;  1XMQ O;  2EZP A;  5L3F A;  1KKD A;  1UPG A;  1AR1 B;  5LMN O;  3A0R A;  1I5X A;  3FD9 A;  2B5U A;  2ZD9 A;  1Q6U A;  4P9O A;  3T1H O;  3WG7 B;  3OGI B;  4UCS A;  2YEV B;  4ZOL B;  2JJ1 G;  5FPO A;  2EUL A;  3ZMS A;  2NR5 A;  1N34 O;  3DC5 A; 
#chains in the Genus database with same CATH homology
 4JI1 O;  5BY1 A;  4LF7 O;  3J7A U;  4DV4 O;  2VQE O;  1FJG O;  3OTO O;  3RT3 C;  2UXD O;  4DR1 O;  4X64 O;  5H5N A;  1F7Y A;  5LL6 Y;  4DV1 O;  4X62 O;  1AIL A;  2ZM6 O;  1HNX O;  4LF9 O;  3SDL A;  4JI4 O;  4LFA O;  2Z0A A;  4JI7 O;  4DR3 O;  2UU9 O;  4OPA A;  4JI6 O;  1XNR O;  1NS1 A;  1R6T A;  4DR2 O;  1N36 O;  4K0K O;  1D2D A;  4B3R O;  1N32 O;  4DR5 O;  1YZB A;  4DR4 O;  3O65 A;  3J80 N;  4DUY O;  5FLX N;  4DV7 O;  4NXN O;  5IT9 N;  1IBL O;  4JI8 O;  4LF6 O;  4DV3 O;  1X59 A;  2HHH O;  4AQY O;  3R66 A;  4A5U B;  1G1X B;  2UUA O;  1HNZ O;  2N74 A;  4X65 O;  4DR6 O;  4GKJ O;  3M8A A;  2AGA A;  1J5E O;  5A2Q N;  4YHH O;  3T1Y O;  4JV5 O;  2UUB O;  3J81 N;  1FYJ A;  4LFC O;  4LF5 O;  4JI5 O;  2DOS A;  1AB3 A;  1HR0 O;  5BR8 O;  1XNQ O;  1XMO O;  4B3T O;  4DV5 O;  4B3S O;  1N33 O;  4LFB O;  1I94 O;  5BXZ A;  1A32 A;  2VQF O;  3JAM N;  2FKX A;  4NXM O;  4X66 O;  5IWA O;  2ZKO A;  4DV6 O;  2E5L O;  4DV0 O;  4DUZ O;  4JI3 O;  4YY3 O;  1KUQ A;  4JI2 O;  1XMQ O;  4DV2 O;  4LF4 O;  1FKA O;  3F5T A;  2JRI A;  4DR7 O;  2UXB O;  4OPH A;  1IBK O;  1DK1 A;  4JYA O;  5LMN O;  4OX9 O;  1R1B A;  4B3M O;  1IBM O;  2UXC O;  1HNW O;  3T1H O;  2UUC O;  4KHP O;  4LF8 O;  2F4V O;  4JI0 O;  2DJV A;  5LMU O;  2LW7 A;  1N34 O;  1XEQ A;  4GKK O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...