1N33O

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n33O00
4JI7O 1FJGO 4DV2O 3F5TA 4LF9O 2ZM6O 1HNZO 5LL6Y 1X59A 2ZKOA 4DR6O 4DV6O 4X66O 4KHPO 2UXCO 3RT3C 2UUAO 5IWAO 4LFAO 2UXDO 4DV1O 1IBKO 4NXMO 3T1HO 4X64O 1AILA 1HNXO 1FKAO 1A32A 1DK1A 2F4VO 1R1BA 4JI6O 2Z0AA 4JI0O 4NXNO 1R6TA 1XNRO 3J7AU 4LF5O 2N74A 3O65A 4B3TO 3SDLA 1XNQO 4B3SO 5A2QN 2UXBO 1XMQO 4LF7O 1XMOO 4DV7O 1N36O 4DV4O 4OPAA 2UUCO 1N32O 4X62O 2HHHO 1D2DA 1I94O 1NS1A 4DR3O 5LMUO 4A5UB 4AQYO 1KUQA 4YY3O 4YHHO 1XEQA 1IBLO 2E5LO 4JI1O 4LF8O 2JRIA 4DV3O 3T1YO 4GKKO 2DOSA 2FKXA 5BXZA 4DV5O 4LFCO 4OX9O 2AGAA 2LW7A 4K0KO 3J81N 4B3RO 4JI3O 5BY1A 2DJVA 4OPHA 4GKJO 2UU9O 2VQFO 4JI4O 1YZBA 3J80N 4LF6O 1J5EO 4DR4O 4JV5O 3JAMN 1N33O 4DR2O 3OTOO 5FLXN 1HNWO 1IBMO 1HR0O 5H5NA 4X65O 1FYJA 5BR8O 1AB3A 5LMNO 1G1XB 4JI8O 2VQEO 4B3MO 4LF4O 4DV0O 5IT9N 4DR1O 4DR5O 4DUYO 2UUBO 4LFBO 4JI2O 3R66A 1F7YA 3M8AA 4JYAO 4DUZO 1N34O 4DR7O 4JI5O
chains in the Genus database with same CATH superfamily
4J11A 5E79Z 4X65B 1V9PA 3K57A 2HEPA 4RQEA 3H1KH 5K1PA 3E86A 3C3SA 3QG5A 1KYOF 4X1KB 2JGDB 3ABMC 4KXRA 3CC4V 1M56C 3RN4A 4WFGA 1JPXA 4J7JA 4O2BB 1SS3A 1IXBA 4TV9B 2HVKC 1M93A 5DEDA 3J7AU 1Q3EA 1QVFU 3RYIA 2EZOA 1TA8A 2M7WA 3HKCA 4CS3A 4ICGA 2HP8A 4DV7O 2Y69C 3ZHVA 3JALA 5IY5C 2ODMA 2HHHO 5IYDO 4I55A 1YIJV 2YI8A 4WFAV 4MW8A 4GCZA 1WN7A 2OIGA 2KB1A 4ASUG 1GN3A 3KCXA 1ZL8A 3FAVB 3T2MA 2X0LA 4JI1O 2Q8VA 3CMAV 4DV3O 4DV5O 2JS3A 3W7XA 2QJ1A 2BTQA 3J81N 4K3AA 3P32A 4JYBA 4GKJO 1VQ8V 4CS2A 5TISZ 4DR5B 1IBMO 1HR0O 1VF7A 5KAIZ 2HG5C 2LFSA 2ZM6B 5FNVB 2Y48A 1RSOB 4I0XA 1MSDA 4AQYB 2Y4TA 2JJ1G 4UVCA 4H0LB 3CCMV 3E8GA 2MW2B 1M56B 3W7TA 3F5TA 3TXSA 1TGOA 4G2KA 5J2UA 2R70A 3WG7C 3W7UA 1AI5A 4YJ3B 4PD4F 2N05A 2XT9A 3RYCA 1S5JA 4WFEA 1AILA 1KBHA 1VQLV 3OAAG 1FAFA 2F43G 2M6YA 4BW9A 4FLTA 3D3IA 1XNRO 1ZUQA 3LSQA 1H2MA 3STLC 3MHHC 1RPRA 4B3SO 3Q4HA 1XMQO 3JATA 5IJ0B 2X6AA 2Q7GA 1FXVA 2E3CA 1N32O 5LMNB 1FXKB 4R6ZA 1IVSA 5ITZB 1CP9A 5LMUO 2H94A 5EIBC 3ZBHA 3TJTA 1G8MA 4PI0A 1URFA 1NR7A 3ZRVA 1BE3H 3SYAA 1F23A 5EK0A 2AGAA 1WJZA 5LYJB 3AG2C 2GSMB 4B3RO 3ABKB 4PJ0Z 4ZBMA 1E1QG 5LYJA 2VQFO 4JI4O 2UUAB 1YZBA 3N2GA 1Q82W 2QM8A 5B1AB 2GV9A 4UVAA 4JAUA 2H8PC 3JSNA 3JCZA 5H5NA 5JQGA 1OCRC 3H9VA 2RMKB 3B40A 4RO2A 1BHAA 5DECA 3SYCA 4DR2B 1BHBA 3T4DA 4U3JA 3EFFK 2A79B 1JA8A 2LJ2A 3HKEB 1S77D 1YDXA 2ITCC 3QO5A 1Z2GA 4KFMA 2F66C 2JK5C 3SPCA 1Q6IA 4X64B 2ZKOA 2CUGA 4D6TH 2UXBB 2K9PA 2UXDO 1AROP 3ZHQA 3S3XA 2E76B 2JEXA 1Q90D 1A32A 5D5PA 5C93A 3QO7A 3AK2A 4LF9B 1EZVH 3IC9A 2OIEA 4NVPA 3STZC 3LDCA 4DV3B 2WWWA 1S5HC 1AR4A 3SDLA 1RM1B 1V54C 4FFBB 4LF7O 3ABMB 1WB8A 1J5EB 2YI9A 1XMOO 4GLXA 4LR3A 2IH1C 4LP8A 3L73H 4DW0A 3ASOB 4J7KA 1OCZB 1J95A 1K9MW 1KUQA 1YJNV 3B8MA 3WB2A 1QCEA 3MD0A 4IT5A 3F7VC 1NKDA 3ZN0A 1QU7A 2Q9LA 1I5YA 4IHJA 2MK3A 3W7SA 2BTOA 4FLVA 4D7TA 1QR9A 3RYHB 3SJBC 4JYYA 3K5MA 4TV8A 1RPOA 2YXYA 3IFXA 5LBQA 2B1IA 1Y76B 3JAMN 4DR1B 1Y76A 5LGUA 3G67A 1HP8A 4LNUB 1FYJA 2OTLV 2K1EA 3ASNB 3E35A 4FM1A 3DTUB 1R6NA 4R8CA 1YSCA 3ZRWB 2UXCB 3BA8A 4XDKA 4XDLA 3M8AA 3H1LH 2LW1A 1IBKB 2BCCH 4OGQB 2WPDG 3RYCB 5IYBO 1PPJH 2QWRB 4RUEA 2YIBD 4YIOA 1RSOA 4I0XB 2YIBA 3OR6C 2QM4A 4KHPO 3K58A 1HNZB 2FTKA 3CS5A 1BQ0A 5LMUB 2CTQA 4I9QA 1W0KG 3GVMA 1FPOA 4JI0O 3JASA 4X1IA 3IJ4A 5IYZB 1VQ6V 2GDSA 3ZN1A 4UCTA 2IM9A 1PL4A 5IYZA 3TETA 2V4DA 2YUAA 3BHPA 1GN4A 2XAJA 2QEXV 2EIJC 5JVDB 3SR2C 3JAWA 4BIOA 1VQ5V 2ZNJA 1NS1A 3AEIA 4DV6B 1XL4A 1YI2V 1MSWD 1AI6A 1V54B 2ZIMA 3BCCH 2NNUA 2P06A 5BR8B 4OX9O 3AG4B 5F2VO 4F6RA 4UCSA 2AXTZ 4WCEV 5BY1A 3U0ZA 4OPHA 1UFIA 5JVDA 1VQ7V 1NH2D 2WLMA 4JI2B 3CMEV 4LF6O 1K97A 1B06A 2P7TC 3OTOO 2ETNA 4LH7A 1VF6A 4FM0A 2IU0A 4DV5B 4N21A 2PTMA 1G1XB 3ZHRA 2OYQA 3BY6A 4JI8O 2G38A 5L3GA 3E8BA 4BW5A 1XUQA 1Y4MA 2JJ2G 2CTWA 1SERA 2CDYA 1AR5A 4FJCC 3VQYA 3FYIB 1N0JA 1QHTA 4K0KB 3K06A 3OD4A 5DN6G 2CGOA 4FMTA 1N36B 3I56V 5EZYA 2ZM6O 5JJNB 2EIJB 4LF7B 4P2ZA 4DR6O 1FFXB 1R3LC 4F6EA 3CB2A 4UB8Z 1R6KA 4B7KA 1VP7A 1GM8A 3ETGA 5CA1B 3K0GA 4J41A 4LNUA 4JAAA 3ZJZA 4C7UA 3O65A 2EBOA 4LH6A 4PDVA 4J10A 4L87A 5KHJA 1ZTEA 2NN4A 3WG7B 1B6QA 4CC5A 1TUBB 1W0JG 2A3QA 4FLXA 2UUBB 4PDLA 3OFNG 4O4IB 4B3SB 1DTOA 3JAKA 1Q5OA 1AP5A 1I94B 3K5NA 2JRIA 2OCHA 4JAVA 4EFBA 2V7QG 5LGNA 1K5SA 4JV5B 1WP7A 5GTHZ 1AI7A 1Q7YW 2UU9O 3CX5F 4B7EA 3CWBH 4NTXA 3I5DA 5H9CA 3UCSC 2Q5ZA 3EHBB 3JD2A 2P6JA 1TUBA 4JTDB 4MTOA 3L70H 2R9RB 5D5QA 4B3RB 1L8DA 4BIUA 2Q67A 4LFBO 1JJOA 4JZGA 4B3TB 4JI0B 5B1NA 1AJPA 2F93B 3AG2B 4DV2O 4I50B 4UFZA 4DXWA 2F4VB 2DN9A 4I9WA 4PA9A 1VQNV 2BSKB 1M57B 4X66O 4YJ3A 1TUEB 1OHHG 4IYHA 3E22A 2QWOB 1H38A 4O2AB 4X8AA 1YF2A 3VQVA 2ZCEA 1FXKC 1DGSA 1Q43A 2F95B 5B3SB 1HNXO 3F7YC 3D36C 3GWOA 1KKDA 1MABG 3OUSA 5CB4B 1R6TA 3OE7G 4TV8B 4KL1A 3G80A 3CCVV 1EZJA 2UXBO 4YY3B 2UXDB 1GK9A 1H2NA 1XI1A 1AJQA 1RFYA 2Y0PA 1K3EA 2KKWA 3LDDA 4XBFA 2ATKC 2DYRB 5IY5B 4X62O 4GZRB 2N04A 3OTOB 1US6A 4FZ1A 1EBOA 1MZEA 3SJCC 5KA5A 5JCOA 5HFMA 1GM7A 3I55V 4JI8B 2GUZA 4UCVA 4CH4A 1XOUA 1WA8A 5CBGA 2XOKG 3ML0A 1PP9H 1X4TA 1QBZA 2ZE8A 4K0KO 2DJVA 3JATB 2EX3A 5IJ0A 1JVMA 1S3JA 2YC0A 1PL0A 3J80N 2CTRA 4LF4B 1P7BA 3OM3B 1FJGB 2WLIA 4ZIBA 4CZZA 4YIPA 4DRXB 1GN2A 3D36A 1VEWA 3UO3A 4JI5B 2QA4V 5EBWC 2Q68A 2QKCA 4LWSA 5LOVA 3ZMVA 2PI4A 4FZ0A 4DUZO 1F4MA 4DR7O 3UT5A 3SGIA 1SQGA 3CXHF 2AHYA 4UCUA 3P3PA 4JI6B 1ZL8B 3FAVA 5EIBD 3FYEB 2W0FC 3FB6C 4DR3B 2WLLA 3N2KB 3ABKC 3CEIA 3L9DA 2UXCO 3ETDA 4W4LA 1TVKA 4DV1O 1IBKO 4DV0B 1Z5WA 2R9AA 1L1FA 2ILMA 4FLWA 1VQKV 2YIAA 4UV8A 5LXTB 4MTFA 3CCUV 5EYPB 4U3JB 1CEZA 5CBFA 3K03A 3APOA 1H2LA 3K08A 4NTWA 3FB7C 3SJAC 5GTIZ 4O4IA 1K4DC 2W0XA 2Q7HA 2UU9B 4QNHB 2WLLB 1VMGA 3RBZA 2YS8A 3FD9A 4EEQA 3CSXA 5KMGA 1IBLO 3HB3B 1MMMA 1Z5VA 1VQ9V 3K0DA 4IL6Z 4LFBB 4O2AA 1W2BU 4DR4B 4KP4A 2QTOA 4TSFG 2LW7A 2DW4A 3ASOC 1KD1W 2A7WA 4WFFA 4X20B 5EBLC 3BPZA 4MSWC 1NU1H 2AZ2A 1HNWO 3K3WA 3O9OA 1SA0A 3L72H 2UUCB 5LP6B 5BR8O 1PM9A 3P3NA 2ZD9A 4OX9B 1KMIZ 5LP6A 3ABLB 1V55B 1HWYA 2P4KA 5IT9N 2OWOA 1XQ8A 2FYUH 1MA1A 4JI2O 1XDCA 1FS0G 2PZSA 4WF9V 5E1AC 2WLHA 2AW9A 2YEVA 2Q7EA 3ZRSA 2YDEA 4EB6B 3WFVA 1MZFA 3CCLV 1WAZA 2XASA 5IJ9B 5KAFZ 3AG1B 3DXRA 3TCUA 4FK5C 2QDOA 4PHZA 4BIZA 3KKYA 4FPPA 4MVMA 2IJJA 1K92A 1BGYH 3ZRWA 2RCVA 4QE7A 2BOBC 4UCOA 4JTAB 4U7NA 3AG3B 4TQDA 3A8TA 1G6UA 2IW5A 1W59A 2A9HA 1SETA 2RDCA 1S76D 4H33A 1XNQO 4NKGB 3RW0A 2QGNA 4FLYA 3CJHA 2L6LA 2JVDA 4P9PA 1R73A 2A0LA 3CJHB 1N8RW 1K73W 2GHYA 2QE7G 2P5OA 1D5AA 1ZSPA 1L0LH 4ZHQB 4AQYO 1ENVA 3OEHG 3TGUH 1RM1C 4I50A 3SPIA 3L71H 1K5QA 3RGBA 2JIZG 4LBEC 4LF5B 1BQZA 1GM9A 1HW7A 2CK3G 3THOA 2HLDG 3S3WA 1PD3A 2GBOA 4DUZB 5EZYB 3W7WA 4JI3O 4FLUA 2JS5A 2AHZA 1JOYA 3G6BA 1G4YB 1NTKH 2XAQA 2D3OW 2X6CA 5L3BA 3CCSV 1WB7A 1GRJA 1WA8B 1N33O 1EN4A 2JGDA 1BT8A 4I5SA 3HKEA 2ADQB 2ZE6A 1AB3A 3JARA 3D8CA 2YICA 1BL8A 5JWPA 4DV0O 1NJIW 3QO8A 5KX5A 4ZI7A 5BZBA 3K59A 2RN9A 3MDSA 5LHGA 1IXMA 1T5EA 4MT8A 5CA3A 4JYAO 4RAIA 1Q6HA 1BSMA 1TVKB 2ZDIC 1YXBA 4NYKA 3E89A 1OV9A 2LQTA 5CA0A 4YJ2A 4FLZA 5LL6Y 2DMXA 4X88A 1I08A 1FD9A 2Y4UA 3RYFB 4P30A 1JMKC 2GUZB 3OW2U 2KSDA 3H1IH 4LFAO 3UT5B 3PJSK 3LDEA 3HKDB 4CC6A 4O2BA 2F4VO 5B66Z 1SA0B 3RVZA 2LGQA 5CA1A 1P4RA 1YCIA 4X66B 4BAYA 5GW7A 2VQFB 1YJ9V 4JI4B 5KUKA 2KG7B 4CH5A 2HHHB 1XHZA 1NVPB 5H6QA 1K7DA 4HZ3A 4DRXA 5KLVH 1M9NA 3SPGA 5KHHA 5K1XA 4DV4O 5IDJA 2B9ZA 5IWAB 3LNMB 3CC7V 2PI5A 3E2EA 4NXMB 1D2DA 1JFFA 3ZEDA 1VARA 2YXLA 3FFQA 2ZQMA 1MG1A 3KG2A 2ITDC 4YY3O 4TV9A 1Q81W 1XEQA 1DF4A 1CPYA 5LP6C 2BOCC 4IYIA 5BXZA 4K35A 1WPXA 2ZDIA 2ZXWC 1NZ6A 2HFEC 2FMLA 1IBMB 4JI1B 3ABUA 1LNQA 5J2UB 5LXTA 2X7RB 1NR1A 2VRZA 3VQWA 3EXAA 1VQOV 2PGGA 1SQFA 2OCCB 4DR5O 1SQXH 4PA6A 5IE9A 1SC5B 1AP6A 4O4HB 3N27A 3KCYA 2ZR3A 3HKBA 5LHHA 1GN6A 3K9SA 5J2TB 1FJGO 2LP7A 4PA7A 4OXSA 4LFCB 4O4LB 1Y74B 4I4TA 2YSUB 1Y67A 3VOUA 3E22B 2BSKA 1PNMA 2YEVB 4J9ZB 2C2AA 3BVOA 3CRQA 1XNRB 4X1YA 1MOFA 3BABA 5B1OA 4H37A 4MVUA 4JI6O 2Z0AA 4BWAA 2XNDG 4CH6A 4X20A 3TXQA 4DUYB 4LF5O 1K33A 2Q0OC 5BMVA 3Q4HB 1E79G 5A2QN 2JEUA 4DV1B 1SESA 3GWKC 1XILA 1XL6A 3OEEG 3CP1A 2R72A 1P84F 1PKXA 1XMQB 1IURA 3SYPA 1QQCA 2YIDA 3AG3C 5CBHA 4DO2A 1QLEB 3AK3A 4YHHO 2R9IA 2Z3YA 4G27B 3CRCA 4HYOA 3B2EE 3BEHA 1MNGA 1ROPA 5DM6V 2NLJC 1K8AW 3DSQA 2WAMA 3JARB 2ZE5A 3CRRA 4KHPB 2RQ6A 5KX5B 1ZLZA 1ZX3A 2EJ7A 4ABMA 4UVBA 4DR2O 1O9HA 2XHBA 4DV7B 3JYCA 5H2FZ 2LFRA 5FL7G 4WFBV 2B1GA 4QPJA 3VQXA 4HNAA 2E75B 4DK1A 4GKKB 5KHKA 1NVPD 5L3FA 3RYFA 4LC1A 3ZHUA 2EIMC 5HFLA 1N34O 1R3IC 2IJIA 1M1KW 4JI7O 3C90A 3CXCU 1M5IA 4MVOA 1IZ3A 2CAZC 2QWNB 2QKSA 1ZWIC 4DV6O 4GKJB 3D3QA 1SZXA 4MW3A 2XAFA 5IWAO 3SPJA 1S0VA 4NXMO 3T1HO 2PY5A 4Z1MG 4EFEA 4X64O 2PF4E 2ZE7A 4H13B 4F6RB 4RWUA 2PUSA 4QPKA 2UXXA 5GONA 1KP3A 2NR5A 1BMFG 3A0HZ 3OGIB 2QSAA 1COWG 1CXZB 1XMOB 4IIJB 3VBBA 3DGEA 2HKOA 4K8ZA 1JJ2U 1M4UA 5CMUA 4MVRA 2DE0X 4AHCA 1PNLA 4GX5A 2ADPA 3HKBB 4CH3A 3UQ8A 1SKVA 3AG7A 3WB0A 2KG7A 2VWJA 4HBNA 1I0HA 4NTYA 1OCCC 2DYSB 5JCOC 1VQ4V 5EC2C 5KMGB 1NT2B 2HVJC 3SYOA 1Y66A 3ZMUA 3UM7A 5JJJB 1EFRG 1H2KA 3L75H 4EB6A 4PELA 2H3OA 5KA6A 1LR1A 5B1BB 4QJFB 1Q86W 4YXWG 4N23A 4TWKA 2ARHA 3HPLC 3BRCA 3DC5A 3UO2A 1KB9F 1N32B 2P22C 1GO3F 4GT1A 5LMNO 2EIKC 2P4VA 2XTAA 4DR1O 4FVMA 3JASB 4TUYA 4X1IB 4R7CA 3R66A 3QVNA 1F7YA 5EC1C 5KUMA 1WLEA 3ETQA 4GX2A 1HNZO 4GUNA 4GX0A 3G71V 3CRAA 4JGSA 2UUAO 4GX1A 2EILB 1Y6XA 2W6IG 5J2TA 4X9QA 3DXRB 4JYAB 2VQEB 2PYJA 2KQXA 3G6EV 1FKAO 1DK1A 3K79A 2FB5A 3LNNA 4YHHB 4X89A 3CRMA 3ICXA 4Z2WA 2N74A 4JPRA 5J9PC 2DYRC 1QVGU 1VQMV 2P90A 5C8YA 4OPAA 2F1MA 3LUTB 2Q69A 2OTJV 4NB5A 1F51A 1SQBH 5B1AC 1SQVH 4UCRA 2EINB 1SQQH 3NR7A 2VS0A 3U10A 4NR1A 4ZOLA 3OTFA 2AZ0A 3B77A 2EIKB 2ZR2A 3RFRA 3MAQA 2ZT9B 2L35A 3A0RA 4PDMA 4LF8O 4GKKO 3OT7A 5LA6A 4DV4B 4B08A 3L74H 2LO1A 2DWDC 1N34B 2YXHA 4WBNB 4ZKIA 4QIWF 2WLJA 2UXNA 3P30A 3C3TA 1K4CC 5C8YB 1J5EO 3ZX6A 4IIJA 1M57C 1GTOA 5FLXN 5EBMC 1YTFD 2E74B 2IU3A 1I7FA 1NQTA 3T1HB 3TK1A 3F5WC 2O57A 2QR4A 2W6JG 1KKCA 1L0NH 3T1YB 2F23A 3NXSA 3B4SA 1E1RG 4MTGA 4CS4A 3K9AA 4AI8A 3A0BZ 1ZAUA 1PV0A 4X62B 2JDIG 3SJQC 4JTCB 1NTZH 1U97A 4MVZA 3OR7C 1OCCB 1EM1A 2JGUA 1LUVA 4PI2A 4DR6B 3E83A 3HKDA 5L3EA 3BFRA 2A06H 4UV9A 3UKMA 3H1JH 1AR1B 3ZIAG 2WA4A 3MHSC 3JD3A 3AG1C 3AK1A 2OT5A 3B8NA 1IX9A 2CGNA 1I5XA 3OMIB 1B04A 2WLIB 4HNAB 4G28B 3LSUA 5A9GA 4O4JA 1I94O 4X1KA 1D5NA 2ZIOA 4NXNB 3K5OA 5IJ9A 1OCZC 3ABLC 3B09A 1YVWA 4O4HA 1FXHA 3GB7C 2OCCC 2FKXA 1HDJA 5H6RA 3PN1A 5JJEB 1TAEA 2D2CB 1SZTA 2HJDA 3ZCCA 2BTQB 2GTAA 3FB8C 2GTSA 3JCUZ 4JV5O 1WP8A 4W4KA 1VIBA 4X65O 4IHJB 1JFFB 5FNVA 4I55B 1YHQV 3QTCA 3H1HH 3RYHA 2IBZH 2VQEO 2E5LB 1FFTB 1QLEC 3DC6A 4FFBA 3JAKB 2ZINA 3E8FA 1EN5A 4ZHQA 1N4CA 2VWKA 5AG2A 3X2QC 3JD0A 4J9YB 1Y74A 1H2GA 5JH7A 1R3KC 2LGWA 2Q6AA 3CCRV 1PNKA 2Q4PA 4E2LA 4I4TB 2Y69B 4DV2B 3ETEA 5LGTA 3RT3C 4R50A 1QR8A 4LF6B 4X1YB 4PV1B 1OZ0A 4JF3A 3WB1A 3T1CA 4JI7B 1DF5A 1F4NA 4Q20A 3ASNC 2HJFC 1SQPH 2DYSC 3OGCC 2EINC 3CHXA 4LF8B 3ZMSA 2RNBA 5JH7B 4LCUC 3CD6V 4U3FH 1KP2A 1HNWB 2X6BA 3K5LA 1N36O 4UUJC 1P7GA 2UUCO 5KHGA 5LA6B 5JQGB 3T4ZA 5FPOA 5FPRA 4DYLA 3BAAA 4A5UB 5B5EZ 2Q73A 3ZMZA 2WSSG 5CB4A 4DW1A 1OCRB 3T1YO 5B3SC 2WLKA 1H8HG 3KZIZ 4RQFA 2CTPA 3N2KA 4PA4A 3ZS8C 5ITZA 1VQPV 1YTFB 4WBNA 4MS2A 4H44B 4LF4O 2UUBO 3FKSG 5EYPA 3G4SV 4O4JB 1AJNA 1XNQB 1OCOB 4J80A 1LUWA 4JI5O 4XDJA 1DLBA 1WNSA 2B5UA 1R3JC 1P49A 4DR7B 3CYOA 2QM7A 2PYLA 1B3QA 4BR6A 4B3MB 4HAMA 3ZMTA 3M7MX 4PA3A 1OCOC 1R1BA 3FB5C 4LWSB 4NXNO 1M90W 1QLNA 1Q8IA 2IJHA 4MVSA 2RJZA 1NH2B 4B3TO 2CH7A 2IH3C 1XHXA 2DQ0A 4Q6GA 3QNEA 1THZA 4D7SA 3U11A 4TOIA 4JASA 3CCQV 4DK0A 2QWQB 3ZRXA 3OUFA 4J7ZA 3CCEV 4RUFA 4FFKA 1XBLA 1O9GA 5GONB 1VF5B 4YJ2B 5CA0B 3M99B 3JALB 2BE3A 2E5LO 1OJHA 3K04A 2XAGA 1HNXB 1BCCH 1JCHA 2DOSA 1GAXA 3SPHA 1UJWB 1V55C 1KU9A 1AVMA 3QF7A 1FFXA 2EZPA 4MVQA 1IBLB 2CH7B 1RP3B 4MTXA 1JR9A 3JSLA 1YEWA 1BS3A 4K8XA 4LFAB 2ZXWB 4Z1VA 4DR4O 1VF6C 3CCJV 3EVKA 4UXNA 5B1BC 2WLNA 2HR3A 4TT3G 4AILC 3AG4C 3RYIB 1AI4A 4O4LA 3HKCB 1GMGA 2DWEC 3IC7A 1IDSA 3BA9A 3RWRD 1FXKA 3JD4A 2P67A 2Z5UA 2ZNIA 4L8JA 3CC2V 2EIMB 3CPWU 1JX9A 4EKWA 1Q6UA 3H01A 2V1DA 3ZHTA 4CBCA 4WFHA 1EN6A 1K34A 4LF9O 1WPBA 3IGAC 1KECA 3WU2Z 1X59A 1YJWV 1GKFA 1UPGA 5L3DA 3SYQA 1HR0B 4QE9A 3RVYA 4IGGA 4JZ2A 4U7OA 1SF9A 2Y0IA 1N0NA 1BZKA 3CE2A 1KC8W 4FIPC 2FL4A 3X2QB 1GH6A 3LSSA 2QTSA 4TUYB 3HR0A 2WA3A 3R65A 3FX7A 2XUMA 1JQ0A 2EILC 1H2SB 5LOVB 2IJKA 4F4LA 2EULA 1NTMH 3A2FA 1KQSU 1S72V 4E4EA 2QKAA 5BMVB 4DR3O 2QWPB 5CN0A 1ORQC 2XAHA 3ZHSA 4J42A 4ZI7B 4GYCB 4JI3B 2DQ3A 4QGPA 5KHIA 3OMAB 4PDRA 1XREA 4LFCO 1U96A 5LHIA 1N33B 2Q0AA 3IAYA 4UB6Z 4TQFA 1S5LZ 4FM2A 3JAWB 2EJRA 3OMNB 1NBMG 4JYCA 1SRYA 3APQA 5L3CA 2CE4A 1QNMA 3ABTA 4ZOLB 4B3MO 1YITV 3N2GB 4DUYO 1NI8A 5IYCO 4P9OA 3E8HA 4KUMA 3JD1A 4I7ZB 1H8EG
chains in the Genus database with same CATH topology
4JI7O 1FJGO 4DV2O 3F5TA 4LF9O 2ZM6O 1HNZO 5LL6Y 1X59A 2ZKOA 4DR6O 4DV6O 4X66O 4KHPO 2UXCO 3RT3C 2UUAO 5IWAO 4LFAO 2UXDO 4DV1O 1IBKO 4NXMO 3T1HO 4X64O 1AILA 1HNXO 1FKAO 1A32A 1DK1A 2F4VO 1R1BA 4JI6O 2Z0AA 4JI0O 4NXNO 1R6TA 1XNRO 3J7AU 4LF5O 2N74A 3O65A 4B3TO 3SDLA 1XNQO 4B3SO 5A2QN 2UXBO 1XMQO 4LF7O 1XMOO 4DV7O 1N36O 4DV4O 4OPAA 2UUCO 1N32O 4X62O 2HHHO 1D2DA 1I94O 1NS1A 4DR3O 5LMUO 4A5UB 4AQYO 1KUQA 4YY3O 4YHHO 1XEQA 1IBLO 2E5LO 4JI1O 4LF8O 2JRIA 4DV3O 3T1YO 4GKKO 2DOSA 2FKXA 5BXZA 4DV5O 4LFCO 4OX9O 2AGAA 2LW7A 4K0KO 3J81N 4B3RO 4JI3O 5BY1A 2DJVA 4OPHA 4GKJO 2UU9O 2VQFO 4JI4O 1YZBA 3J80N 4LF6O 1J5EO 4DR4O 4JV5O 3JAMN 1N33O 4DR2O 3OTOO 5FLXN 1HNWO 1IBMO 1HR0O 5H5NA 4X65O 1FYJA 5BR8O 1AB3A 5LMNO 1G1XB 4JI8O 2VQEO 4B3MO 4LF4O 4DV0O 5IT9N 4DR1O 4DR5O 4DUYO 2UUBO 4LFBO 4JI2O 3R66A 1F7YA 3M8AA 4JYAO 4DUZO 1N34O 4DR7O 4JI5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 O;  1FJG O;  4DV2 O;  3F5T A;  4LF9 O;  2ZM6 O;  1HNZ O;  5LL6 Y;  1X59 A;  2ZKO A;  4DR6 O;  4DV6 O;  4X66 O;  4KHP O;  2UXC O;  3RT3 C;  2UUA O;  5IWA O;  4LFA O;  2UXD O;  4DV1 O;  1IBK O;  4NXM O;  3T1H O;  4X64 O;  1AIL A;  1HNX O;  1FKA O;  1A32 A;  1DK1 A;  2F4V O;  1R1B A;  4JI6 O;  2Z0A A;  4JI0 O;  4NXN O;  1R6T A;  1XNR O;  3J7A U;  4LF5 O;  2N74 A;  3O65 A;  4B3T O;  3SDL A;  1XNQ O;  4B3S O;  5A2Q N;  2UXB O;  1XMQ O;  4LF7 O;  1XMO O;  4DV7 O;  1N36 O;  4DV4 O;  4OPA A;  2UUC O;  1N32 O;  4X62 O;  2HHH O;  1D2D A;  1I94 O;  1NS1 A;  4DR3 O;  5LMU O;  4A5U B;  4AQY O;  1KUQ A;  4YY3 O;  4YHH O;  1XEQ A;  1IBL O;  2E5L O;  4JI1 O;  4LF8 O;  2JRI A;  4DV3 O;  3T1Y O;  4GKK O;  2DOS A;  2FKX A;  5BXZ A;  4DV5 O;  4LFC O;  4OX9 O;  2AGA A;  2LW7 A;  4K0K O;  3J81 N;  4B3R O;  4JI3 O;  5BY1 A;  2DJV A;  4OPH A;  4GKJ O;  2UU9 O;  2VQF O;  4JI4 O;  1YZB A;  3J80 N;  4LF6 O;  1J5E O;  4DR4 O;  4JV5 O;  3JAM N;  1N33 O;  4DR2 O;  3OTO O;  5FLX N;  1HNW O;  1IBM O;  1HR0 O;  5H5N A;  4X65 O;  1FYJ A;  5BR8 O;  1AB3 A;  5LMN O;  1G1X B;  4JI8 O;  2VQE O;  4B3M O;  4LF4 O;  4DV0 O;  5IT9 N;  4DR1 O;  4DR5 O;  4DUY O;  2UUB O;  4LFB O;  4JI2 O;  3R66 A;  1F7Y A;  3M8A A;  4JYA O;  4DUZ O;  1N34 O;  4DR7 O;  4JI5 O; 
#chains in the Genus database with same CATH topology
 4J11 A;  5E79 Z;  4X65 B;  1V9P A;  3K57 A;  2HEP A;  4RQE A;  3H1K H;  5K1P A;  3E86 A;  3C3S A;  3QG5 A;  1KYO F;  4X1K B;  2JGD B;  3ABM C;  4KXR A;  3CC4 V;  1M56 C;  3RN4 A;  4WFG A;  1JPX A;  4J7J A;  4O2B B;  1SS3 A;  1IXB A;  4TV9 B;  2HVK C;  1M93 A;  5DED A;  3J7A U;  1Q3E A;  1QVF U;  3RYI A;  2EZO A;  1TA8 A;  2M7W A;  3HKC A;  4CS3 A;  4ICG A;  2HP8 A;  4DV7 O;  2Y69 C;  3ZHV A;  3JAL A;  5IY5 C;  2ODM A;  2HHH O;  5IYD O;  4I55 A;  1YIJ V;  2YI8 A;  4WFA V;  4MW8 A;  4GCZ A;  1WN7 A;  2OIG A;  2KB1 A;  4ASU G;  1GN3 A;  3KCX A;  1ZL8 A;  3FAV B;  3T2M A;  2X0L A;  4JI1 O;  2Q8V A;  3CMA V;  4DV3 O;  4DV5 O;  2JS3 A;  3W7X A;  2QJ1 A;  2BTQ A;  3J81 N;  4K3A A;  3P32 A;  4JYB A;  4GKJ O;  1VQ8 V;  4CS2 A;  5TIS Z;  4DR5 B;  1IBM O;  1HR0 O;  1VF7 A;  5KAI Z;  2HG5 C;  2LFS A;  2ZM6 B;  5FNV B;  2Y48 A;  1RSO B;  4I0X A;  1MSD A;  4AQY B;  2Y4T A;  2JJ1 G;  4UVC A;  4H0L B;  3CCM V;  3E8G A;  2MW2 B;  1M56 B;  3W7T A;  3F5T A;  3TXS A;  1TGO A;  4G2K A;  5J2U A;  2R70 A;  3WG7 C;  3W7U A;  1AI5 A;  4YJ3 B;  4PD4 F;  2N05 A;  2XT9 A;  3RYC A;  1S5J A;  4WFE A;  1AIL A;  1KBH A;  1VQL V;  3OAA G;  1FAF A;  2F43 G;  2M6Y A;  4BW9 A;  4FLT A;  3D3I A;  1XNR O;  1ZUQ A;  3LSQ A;  1H2M A;  3STL C;  3MHH C;  1RPR A;  4B3S O;  3Q4H A;  1XMQ O;  3JAT A;  5IJ0 B;  2X6A A;  2Q7G A;  1FXV A;  2E3C A;  1N32 O;  5LMN B;  1FXK B;  4R6Z A;  1IVS A;  5ITZ B;  1CP9 A;  5LMU O;  2H94 A;  5EIB C;  3ZBH A;  3TJT A;  1G8M A;  4PI0 A;  1URF A;  1NR7 A;  3ZRV A;  1BE3 H;  3SYA A;  1F23 A;  5EK0 A;  2AGA A;  1WJZ A;  5LYJ B;  3AG2 C;  2GSM B;  4B3R O;  3ABK B;  4PJ0 Z;  4ZBM A;  1E1Q G;  5LYJ A;  2VQF O;  4JI4 O;  2UUA B;  1YZB A;  3N2G A;  1Q82 W;  2QM8 A;  5B1A B;  2GV9 A;  4UVA A;  4JAU A;  2H8P C;  3JSN A;  3JCZ A;  5H5N A;  5JQG A;  1OCR C;  3H9V A;  2RMK B;  3B40 A;  4RO2 A;  1BHA A;  5DEC A;  3SYC A;  4DR2 B;  1BHB A;  3T4D A;  4U3J A;  3EFF K;  2A79 B;  1JA8 A;  2LJ2 A;  3HKE B;  1S77 D;  1YDX A;  2ITC C;  3QO5 A;  1Z2G A;  4KFM A;  2F66 C;  2JK5 C;  3SPC A;  1Q6I A;  4X64 B;  2ZKO A;  2CUG A;  4D6T H;  2UXB B;  2K9P A;  2UXD O;  1ARO P;  3ZHQ A;  3S3X A;  2E76 B;  2JEX A;  1Q90 D;  1A32 A;  5D5P A;  5C93 A;  3QO7 A;  3AK2 A;  4LF9 B;  1EZV H;  3IC9 A;  2OIE A;  4NVP A;  3STZ C;  3LDC A;  4DV3 B;  2WWW A;  1S5H C;  1AR4 A;  3SDL A;  1RM1 B;  1V54 C;  4FFB B;  4LF7 O;  3ABM B;  1WB8 A;  1J5E B;  2YI9 A;  1XMO O;  4GLX A;  4LR3 A;  2IH1 C;  4LP8 A;  3L73 H;  4DW0 A;  3ASO B;  4J7K A;  1OCZ B;  1J95 A;  1K9M W;  1KUQ A;  1YJN V;  3B8M A;  3WB2 A;  1QCE A;  3MD0 A;  4IT5 A;  3F7V C;  1NKD A;  3ZN0 A;  1QU7 A;  2Q9L A;  1I5Y A;  4IHJ A;  2MK3 A;  3W7S A;  2BTO A;  4FLV A;  4D7T A;  1QR9 A;  3RYH B;  3SJB C;  4JYY A;  3K5M A;  4TV8 A;  1RPO A;  2YXY A;  3IFX A;  5LBQ A;  2B1I A;  1Y76 B;  3JAM N;  4DR1 B;  1Y76 A;  5LGU A;  3G67 A;  1HP8 A;  4LNU B;  1FYJ A;  2OTL V;  2K1E A;  3ASN B;  3E35 A;  4FM1 A;  3DTU B;  1R6N A;  4R8C A;  1YSC A;  3ZRW B;  2UXC B;  3BA8 A;  4XDK A;  4XDL A;  3M8A A;  3H1L H;  2LW1 A;  1IBK B;  2BCC H;  4OGQ B;  2WPD G;  3RYC B;  5IYB O;  1PPJ H;  2QWR B;  4RUE A;  2YIB D;  4YIO A;  1RSO A;  4I0X B;  2YIB A;  3OR6 C;  2QM4 A;  4KHP O;  3K58 A;  1HNZ B;  2FTK A;  3CS5 A;  1BQ0 A;  5LMU B;  2CTQ A;  4I9Q A;  1W0K G;  3GVM A;  1FPO A;  4JI0 O;  3JAS A;  4X1I A;  3IJ4 A;  5IYZ B;  1VQ6 V;  2GDS A;  3ZN1 A;  4UCT A;  2IM9 A;  1PL4 A;  5IYZ A;  3TET A;  2V4D A;  2YUA A;  3BHP A;  1GN4 A;  2XAJ A;  2QEX V;  2EIJ C;  5JVD B;  3SR2 C;  3JAW A;  4BIO A;  1VQ5 V;  2ZNJ A;  1NS1 A;  3AEI A;  4DV6 B;  1XL4 A;  1YI2 V;  1MSW D;  1AI6 A;  1V54 B;  2ZIM A;  3BCC H;  2NNU A;  2P06 A;  5BR8 B;  4OX9 O;  3AG4 B;  5F2V O;  4F6R A;  4UCS A;  2AXT Z;  4WCE V;  5BY1 A;  3U0Z A;  4OPH A;  1UFI A;  5JVD A;  1VQ7 V;  1NH2 D;  2WLM A;  4JI2 B;  3CME V;  4LF6 O;  1K97 A;  1B06 A;  2P7T C;  3OTO O;  2ETN A;  4LH7 A;  1VF6 A;  4FM0 A;  2IU0 A;  4DV5 B;  4N21 A;  2PTM A;  1G1X B;  3ZHR A;  2OYQ A;  3BY6 A;  4JI8 O;  2G38 A;  5L3G A;  3E8B A;  4BW5 A;  1XUQ A;  1Y4M A;  2JJ2 G;  2CTW A;  1SER A;  2CDY A;  1AR5 A;  4FJC C;  3VQY A;  3FYI B;  1N0J A;  1QHT A;  4K0K B;  3K06 A;  3OD4 A;  5DN6 G;  2CGO A;  4FMT A;  1N36 B;  3I56 V;  5EZY A;  2ZM6 O;  5JJN B;  2EIJ B;  4LF7 B;  4P2Z A;  4DR6 O;  1FFX B;  1R3L C;  4F6E A;  3CB2 A;  4UB8 Z;  1R6K A;  4B7K A;  1VP7 A;  1GM8 A;  3ETG A;  5CA1 B;  3K0G A;  4J41 A;  4LNU A;  4JAA A;  3ZJZ A;  4C7U A;  3O65 A;  2EBO A;  4LH6 A;  4PDV A;  4J10 A;  4L87 A;  5KHJ A;  1ZTE A;  2NN4 A;  3WG7 B;  1B6Q A;  4CC5 A;  1TUB B;  1W0J G;  2A3Q A;  4FLX A;  2UUB B;  4PDL A;  3OFN G;  4O4I B;  4B3S B;  1DTO A;  3JAK A;  1Q5O A;  1AP5 A;  1I94 B;  3K5N A;  2JRI A;  2OCH A;  4JAV A;  4EFB A;  2V7Q G;  5LGN A;  1K5S A;  4JV5 B;  1WP7 A;  5GTH Z;  1AI7 A;  1Q7Y W;  2UU9 O;  3CX5 F;  4B7E A;  3CWB H;  4NTX A;  3I5D A;  5H9C A;  3UCS C;  2Q5Z A;  3EHB B;  3JD2 A;  2P6J A;  1TUB A;  4JTD B;  4MTO A;  3L70 H;  2R9R B;  5D5Q A;  4B3R B;  1L8D A;  4BIU A;  2Q67 A;  4LFB O;  1JJO A;  4JZG A;  4B3T B;  4JI0 B;  5B1N A;  1AJP A;  2F93 B;  3AG2 B;  4DV2 O;  4I50 B;  4UFZ A;  4DXW A;  2F4V B;  2DN9 A;  4I9W A;  4PA9 A;  1VQN V;  2BSK B;  1M57 B;  4X66 O;  4YJ3 A;  1TUE B;  1OHH G;  4IYH A;  3E22 A;  2QWO B;  1H38 A;  4O2A B;  4X8A A;  1YF2 A;  3VQV A;  2ZCE A;  1FXK C;  1DGS A;  1Q43 A;  2F95 B;  5B3S B;  1HNX O;  3F7Y C;  3D36 C;  3GWO A;  1KKD A;  1MAB G;  3OUS A;  5CB4 B;  1R6T A;  3OE7 G;  4TV8 B;  4KL1 A;  3G80 A;  3CCV V;  1EZJ A;  2UXB O;  4YY3 B;  2UXD B;  1GK9 A;  1H2N A;  1XI1 A;  1AJQ A;  1RFY A;  2Y0P A;  1K3E A;  2KKW A;  3LDD A;  4XBF A;  2ATK C;  2DYR B;  5IY5 B;  4X62 O;  4GZR B;  2N04 A;  3OTO B;  1US6 A;  4FZ1 A;  1EBO A;  1MZE A;  3SJC C;  5KA5 A;  5JCO A;  5HFM A;  1GM7 A;  3I55 V;  4JI8 B;  2GUZ A;  4UCV A;  4CH4 A;  1XOU A;  1WA8 A;  5CBG A;  2XOK G;  3ML0 A;  1PP9 H;  1X4T A;  1QBZ A;  2ZE8 A;  4K0K O;  2DJV A;  3JAT B;  2EX3 A;  5IJ0 A;  1JVM A;  1S3J A;  2YC0 A;  1PL0 A;  3J80 N;  2CTR A;  4LF4 B;  1P7B A;  3OM3 B;  1FJG B;  2WLI A;  4ZIB A;  4CZZ A;  4YIP A;  4DRX B;  1GN2 A;  3D36 A;  1VEW A;  3UO3 A;  4JI5 B;  2QA4 V;  5EBW C;  2Q68 A;  2QKC A;  4LWS A;  5LOV A;  3ZMV A;  2PI4 A;  4FZ0 A;  4DUZ O;  1F4M A;  4DR7 O;  3UT5 A;  3SGI A;  1SQG A;  3CXH F;  2AHY A;  4UCU A;  3P3P A;  4JI6 B;  1ZL8 B;  3FAV A;  5EIB D;  3FYE B;  2W0F C;  3FB6 C;  4DR3 B;  2WLL A;  3N2K B;  3ABK C;  3CEI A;  3L9D A;  2UXC O;  3ETD A;  4W4L A;  1TVK A;  4DV1 O;  1IBK O;  4DV0 B;  1Z5W A;  2R9A A;  1L1F A;  2ILM A;  4FLW A;  1VQK V;  2YIA A;  4UV8 A;  5LXT B;  4MTF A;  3CCU V;  5EYP B;  4U3J B;  1CEZ A;  5CBF A;  3K03 A;  3APO A;  1H2L A;  3K08 A;  4NTW A;  3FB7 C;  3SJA C;  5GTI Z;  4O4I A;  1K4D C;  2W0X A;  2Q7H A;  2UU9 B;  4QNH B;  2WLL B;  1VMG A;  3RBZ A;  2YS8 A;  3FD9 A;  4EEQ A;  3CSX A;  5KMG A;  1IBL O;  3HB3 B;  1MMM A;  1Z5V A;  1VQ9 V;  3K0D A;  4IL6 Z;  4LFB B;  4O2A A;  1W2B U;  4DR4 B;  4KP4 A;  2QTO A;  4TSF G;  2LW7 A;  2DW4 A;  3ASO C;  1KD1 W;  2A7W A;  4WFF A;  4X20 B;  5EBL C;  3BPZ A;  4MSW C;  1NU1 H;  2AZ2 A;  1HNW O;  3K3W A;  3O9O A;  1SA0 A;  3L72 H;  2UUC B;  5LP6 B;  5BR8 O;  1PM9 A;  3P3N A;  2ZD9 A;  4OX9 B;  1KMI Z;  5LP6 A;  3ABL B;  1V55 B;  1HWY A;  2P4K A;  5IT9 N;  2OWO A;  1XQ8 A;  2FYU H;  1MA1 A;  4JI2 O;  1XDC A;  1FS0 G;  2PZS A;  4WF9 V;  5E1A C;  2WLH A;  2AW9 A;  2YEV A;  2Q7E A;  3ZRS A;  2YDE A;  4EB6 B;  3WFV A;  1MZF A;  3CCL V;  1WAZ A;  2XAS A;  5IJ9 B;  5KAF Z;  3AG1 B;  3DXR A;  3TCU A;  4FK5 C;  2QDO A;  4PHZ A;  4BIZ A;  3KKY A;  4FPP A;  4MVM A;  2IJJ A;  1K92 A;  1BGY H;  3ZRW A;  2RCV A;  4QE7 A;  2BOB C;  4UCO A;  4JTA B;  4U7N A;  3AG3 B;  4TQD A;  3A8T A;  1G6U A;  2IW5 A;  1W59 A;  2A9H A;  1SET A;  2RDC A;  1S76 D;  4H33 A;  1XNQ O;  4NKG B;  3RW0 A;  2QGN A;  4FLY A;  3CJH A;  2L6L A;  2JVD A;  4P9P A;  1R73 A;  2A0L A;  3CJH B;  1N8R W;  1K73 W;  2GHY A;  2QE7 G;  2P5O A;  1D5A A;  1ZSP A;  1L0L H;  4ZHQ B;  4AQY O;  1ENV A;  3OEH G;  3TGU H;  1RM1 C;  4I50 A;  3SPI A;  3L71 H;  1K5Q A;  3RGB A;  2JIZ G;  4LBE C;  4LF5 B;  1BQZ A;  1GM9 A;  1HW7 A;  2CK3 G;  3THO A;  2HLD G;  3S3W A;  1PD3 A;  2GBO A;  4DUZ B;  5EZY B;  3W7W A;  4JI3 O;  4FLU A;  2JS5 A;  2AHZ A;  1JOY A;  3G6B A;  1G4Y B;  1NTK H;  2XAQ A;  2D3O W;  2X6C A;  5L3B A;  3CCS V;  1WB7 A;  1GRJ A;  1WA8 B;  1N33 O;  1EN4 A;  2JGD A;  1BT8 A;  4I5S A;  3HKE A;  2ADQ B;  2ZE6 A;  1AB3 A;  3JAR A;  3D8C A;  2YIC A;  1BL8 A;  5JWP A;  4DV0 O;  1NJI W;  3QO8 A;  5KX5 A;  4ZI7 A;  5BZB A;  3K59 A;  2RN9 A;  3MDS A;  5LHG A;  1IXM A;  1T5E A;  4MT8 A;  5CA3 A;  4JYA O;  4RAI A;  1Q6H A;  1BSM A;  1TVK B;  2ZDI C;  1YXB A;  4NYK A;  3E89 A;  1OV9 A;  2LQT A;  5CA0 A;  4YJ2 A;  4FLZ A;  5LL6 Y;  2DMX A;  4X88 A;  1I08 A;  1FD9 A;  2Y4U A;  3RYF B;  4P30 A;  1JMK C;  2GUZ B;  3OW2 U;  2KSD A;  3H1I H;  4LFA O;  3UT5 B;  3PJS K;  3LDE A;  3HKD B;  4CC6 A;  4O2B A;  2F4V O;  5B66 Z;  1SA0 B;  3RVZ A;  2LGQ A;  5CA1 A;  1P4R A;  1YCI A;  4X66 B;  4BAY A;  5GW7 A;  2VQF B;  1YJ9 V;  4JI4 B;  5KUK A;  2KG7 B;  4CH5 A;  2HHH B;  1XHZ A;  1NVP B;  5H6Q A;  1K7D A;  4HZ3 A;  4DRX A;  5KLV H;  1M9N A;  3SPG A;  5KHH A;  5K1X A;  4DV4 O;  5IDJ A;  2B9Z A;  5IWA B;  3LNM B;  3CC7 V;  2PI5 A;  3E2E A;  4NXM B;  1D2D A;  1JFF A;  3ZED A;  1VAR A;  2YXL A;  3FFQ A;  2ZQM A;  1MG1 A;  3KG2 A;  2ITD C;  4YY3 O;  4TV9 A;  1Q81 W;  1XEQ A;  1DF4 A;  1CPY A;  5LP6 C;  2BOC C;  4IYI A;  5BXZ A;  4K35 A;  1WPX A;  2ZDI A;  2ZXW C;  1NZ6 A;  2HFE C;  2FML A;  1IBM B;  4JI1 B;  3ABU A;  1LNQ A;  5J2U B;  5LXT A;  2X7R B;  1NR1 A;  2VRZ A;  3VQW A;  3EXA A;  1VQO V;  2PGG A;  1SQF A;  2OCC B;  4DR5 O;  1SQX H;  4PA6 A;  5IE9 A;  1SC5 B;  1AP6 A;  4O4H B;  3N27 A;  3KCY A;  2ZR3 A;  3HKB A;  5LHH A;  1GN6 A;  3K9S A;  5J2T B;  1FJG O;  2LP7 A;  4PA7 A;  4OXS A;  4LFC B;  4O4L B;  1Y74 B;  4I4T A;  2YSU B;  1Y67 A;  3VOU A;  3E22 B;  2BSK A;  1PNM A;  2YEV B;  4J9Z B;  2C2A A;  3BVO A;  3CRQ A;  1XNR B;  4X1Y A;  1MOF A;  3BAB A;  5B1O A;  4H37 A;  4MVU A;  4JI6 O;  2Z0A A;  4BWA A;  2XND G;  4CH6 A;  4X20 A;  3TXQ A;  4DUY B;  4LF5 O;  1K33 A;  2Q0O C;  5BMV A;  3Q4H B;  1E79 G;  5A2Q N;  2JEU A;  4DV1 B;  1SES A;  3GWK C;  1XIL A;  1XL6 A;  3OEE G;  3CP1 A;  2R72 A;  1P84 F;  1PKX A;  1XMQ B;  1IUR A;  3SYP A;  1QQC A;  2YID A;  3AG3 C;  5CBH A;  4DO2 A;  1QLE B;  3AK3 A;  4YHH O;  2R9I A;  2Z3Y A;  4G27 B;  3CRC A;  4HYO A;  3B2E E;  3BEH A;  1MNG A;  1ROP A;  5DM6 V;  2NLJ C;  1K8A W;  3DSQ A;  2WAM A;  3JAR B;  2ZE5 A;  3CRR A;  4KHP B;  2RQ6 A;  5KX5 B;  1ZLZ A;  1ZX3 A;  2EJ7 A;  4ABM A;  4UVB A;  4DR2 O;  1O9H A;  2XHB A;  4DV7 B;  3JYC A;  5H2F Z;  2LFR A;  5FL7 G;  4WFB V;  2B1G A;  4QPJ A;  3VQX A;  4HNA A;  2E75 B;  4DK1 A;  4GKK B;  5KHK A;  1NVP D;  5L3F A;  3RYF A;  4LC1 A;  3ZHU A;  2EIM C;  5HFL A;  1N34 O;  1R3I C;  2IJI A;  1M1K W;  4JI7 O;  3C90 A;  3CXC U;  1M5I A;  4MVO A;  1IZ3 A;  2CAZ C;  2QWN B;  2QKS A;  1ZWI C;  4DV6 O;  4GKJ B;  3D3Q A;  1SZX A;  4MW3 A;  2XAF A;  5IWA O;  3SPJ A;  1S0V A;  4NXM O;  3T1H O;  2PY5 A;  4Z1M G;  4EFE A;  4X64 O;  2PF4 E;  2ZE7 A;  4H13 B;  4F6R B;  4RWU A;  2PUS A;  4QPK A;  2UXX A;  5GON A;  1KP3 A;  2NR5 A;  1BMF G;  3A0H Z;  3OGI B;  2QSA A;  1COW G;  1CXZ B;  1XMO B;  4IIJ B;  3VBB A;  3DGE A;  2HKO A;  4K8Z A;  1JJ2 U;  1M4U A;  5CMU A;  4MVR A;  2DE0 X;  4AHC A;  1PNL A;  4GX5 A;  2ADP A;  3HKB B;  4CH3 A;  3UQ8 A;  1SKV A;  3AG7 A;  3WB0 A;  2KG7 A;  2VWJ A;  4HBN A;  1I0H A;  4NTY A;  1OCC C;  2DYS B;  5JCO C;  1VQ4 V;  5EC2 C;  5KMG B;  1NT2 B;  2HVJ C;  3SYO A;  1Y66 A;  3ZMU A;  3UM7 A;  5JJJ B;  1EFR G;  1H2K A;  3L75 H;  4EB6 A;  4PEL A;  2H3O A;  5KA6 A;  1LR1 A;  5B1B B;  4QJF B;  1Q86 W;  4YXW G;  4N23 A;  4TWK A;  2ARH A;  3HPL C;  3BRC A;  3DC5 A;  3UO2 A;  1KB9 F;  1N32 B;  2P22 C;  1GO3 F;  4GT1 A;  5LMN O;  2EIK C;  2P4V A;  2XTA A;  4DR1 O;  4FVM A;  3JAS B;  4TUY A;  4X1I B;  4R7C A;  3R66 A;  3QVN A;  1F7Y A;  5EC1 C;  5KUM A;  1WLE A;  3ETQ A;  4GX2 A;  1HNZ O;  4GUN A;  4GX0 A;  3G71 V;  3CRA A;  4JGS A;  2UUA O;  4GX1 A;  2EIL B;  1Y6X A;  2W6I G;  5J2T A;  4X9Q A;  3DXR B;  4JYA B;  2VQE B;  2PYJ A;  2KQX A;  3G6E V;  1FKA O;  1DK1 A;  3K79 A;  2FB5 A;  3LNN A;  4YHH B;  4X89 A;  3CRM A;  3ICX A;  4Z2W A;  2N74 A;  4JPR A;  5J9P C;  2DYR C;  1QVG U;  1VQM V;  2P90 A;  5C8Y A;  4OPA A;  2F1M A;  3LUT B;  2Q69 A;  2OTJ V;  4NB5 A;  1F51 A;  1SQB H;  5B1A C;  1SQV H;  4UCR A;  2EIN B;  1SQQ H;  3NR7 A;  2VS0 A;  3U10 A;  4NR1 A;  4ZOL A;  3OTF A;  2AZ0 A;  3B77 A;  2EIK B;  2ZR2 A;  3RFR A;  3MAQ A;  2ZT9 B;  2L35 A;  3A0R A;  4PDM A;  4LF8 O;  4GKK O;  3OT7 A;  5LA6 A;  4DV4 B;  4B08 A;  3L74 H;  2LO1 A;  2DWD C;  1N34 B;  2YXH A;  4WBN B;  4ZKI A;  4QIW F;  2WLJ A;  2UXN A;  3P30 A;  3C3T A;  1K4C C;  5C8Y B;  1J5E O;  3ZX6 A;  4IIJ A;  1M57 C;  1GTO A;  5FLX N;  5EBM C;  1YTF D;  2E74 B;  2IU3 A;  1I7F A;  1NQT A;  3T1H B;  3TK1 A;  3F5W C;  2O57 A;  2QR4 A;  2W6J G;  1KKC A;  1L0N H;  3T1Y B;  2F23 A;  3NXS A;  3B4S A;  1E1R G;  4MTG A;  4CS4 A;  3K9A A;  4AI8 A;  3A0B Z;  1ZAU A;  1PV0 A;  4X62 B;  2JDI G;  3SJQ C;  4JTC B;  1NTZ H;  1U97 A;  4MVZ A;  3OR7 C;  1OCC B;  1EM1 A;  2JGU A;  1LUV A;  4PI2 A;  4DR6 B;  3E83 A;  3HKD A;  5L3E A;  3BFR A;  2A06 H;  4UV9 A;  3UKM A;  3H1J H;  1AR1 B;  3ZIA G;  2WA4 A;  3MHS C;  3JD3 A;  3AG1 C;  3AK1 A;  2OT5 A;  3B8N A;  1IX9 A;  2CGN A;  1I5X A;  3OMI B;  1B04 A;  2WLI B;  4HNA B;  4G28 B;  3LSU A;  5A9G A;  4O4J A;  1I94 O;  4X1K A;  1D5N A;  2ZIO A;  4NXN B;  3K5O A;  5IJ9 A;  1OCZ C;  3ABL C;  3B09 A;  1YVW A;  4O4H A;  1FXH A;  3GB7 C;  2OCC C;  2FKX A;  1HDJ A;  5H6R A;  3PN1 A;  5JJE B;  1TAE A;  2D2C B;  1SZT A;  2HJD A;  3ZCC A;  2BTQ B;  2GTA A;  3FB8 C;  2GTS A;  3JCU Z;  4JV5 O;  1WP8 A;  4W4K A;  1VIB A;  4X65 O;  4IHJ B;  1JFF B;  5FNV A;  4I55 B;  1YHQ V;  3QTC A;  3H1H H;  3RYH A;  2IBZ H;  2VQE O;  2E5L B;  1FFT B;  1QLE C;  3DC6 A;  4FFB A;  3JAK B;  2ZIN A;  3E8F A;  1EN5 A;  4ZHQ A;  1N4C A;  2VWK A;  5AG2 A;  3X2Q C;  3JD0 A;  4J9Y B;  1Y74 A;  1H2G A;  5JH7 A;  1R3K C;  2LGW A;  2Q6A A;  3CCR V;  1PNK A;  2Q4P A;  4E2L A;  4I4T B;  2Y69 B;  4DV2 B;  3ETE A;  5LGT A;  3RT3 C;  4R50 A;  1QR8 A;  4LF6 B;  4X1Y B;  4PV1 B;  1OZ0 A;  4JF3 A;  3WB1 A;  3T1C A;  4JI7 B;  1DF5 A;  1F4N A;  4Q20 A;  3ASN C;  2HJF C;  1SQP H;  2DYS C;  3OGC C;  2EIN C;  3CHX A;  4LF8 B;  3ZMS A;  2RNB A;  5JH7 B;  4LCU C;  3CD6 V;  4U3F H;  1KP2 A;  1HNW B;  2X6B A;  3K5L A;  1N36 O;  4UUJ C;  1P7G A;  2UUC O;  5KHG A;  5LA6 B;  5JQG B;  3T4Z A;  5FPO A;  5FPR A;  4DYL A;  3BAA A;  4A5U B;  5B5E Z;  2Q73 A;  3ZMZ A;  2WSS G;  5CB4 A;  4DW1 A;  1OCR B;  3T1Y O;  5B3S C;  2WLK A;  1H8H G;  3KZI Z;  4RQF A;  2CTP A;  3N2K A;  4PA4 A;  3ZS8 C;  5ITZ A;  1VQP V;  1YTF B;  4WBN A;  4MS2 A;  4H44 B;  4LF4 O;  2UUB O;  3FKS G;  5EYP A;  3G4S V;  4O4J B;  1AJN A;  1XNQ B;  1OCO B;  4J80 A;  1LUW A;  4JI5 O;  4XDJ A;  1DLB A;  1WNS A;  2B5U A;  1R3J C;  1P49 A;  4DR7 B;  3CYO A;  2QM7 A;  2PYL A;  1B3Q A;  4BR6 A;  4B3M B;  4HAM A;  3ZMT A;  3M7M X;  4PA3 A;  1OCO C;  1R1B A;  3FB5 C;  4LWS B;  4NXN O;  1M90 W;  1QLN A;  1Q8I A;  2IJH A;  4MVS A;  2RJZ A;  1NH2 B;  4B3T O;  2CH7 A;  2IH3 C;  1XHX A;  2DQ0 A;  4Q6G A;  3QNE A;  1THZ A;  4D7S A;  3U11 A;  4TOI A;  4JAS A;  3CCQ V;  4DK0 A;  2QWQ B;  3ZRX A;  3OUF A;  4J7Z A;  3CCE V;  4RUF A;  4FFK A;  1XBL A;  1O9G A;  5GON B;  1VF5 B;  4YJ2 B;  5CA0 B;  3M99 B;  3JAL B;  2BE3 A;  2E5L O;  1OJH A;  3K04 A;  2XAG A;  1HNX B;  1BCC H;  1JCH A;  2DOS A;  1GAX A;  3SPH A;  1UJW B;  1V55 C;  1KU9 A;  1AVM A;  3QF7 A;  1FFX A;  2EZP A;  4MVQ A;  1IBL B;  2CH7 B;  1RP3 B;  4MTX A;  1JR9 A;  3JSL A;  1YEW A;  1BS3 A;  4K8X A;  4LFA B;  2ZXW B;  4Z1V A;  4DR4 O;  1VF6 C;  3CCJ V;  3EVK A;  4UXN A;  5B1B C;  2WLN A;  2HR3 A;  4TT3 G;  4AIL C;  3AG4 C;  3RYI B;  1AI4 A;  4O4L A;  3HKC B;  1GMG A;  2DWE C;  3IC7 A;  1IDS A;  3BA9 A;  3RWR D;  1FXK A;  3JD4 A;  2P67 A;  2Z5U A;  2ZNI A;  4L8J A;  3CC2 V;  2EIM B;  3CPW U;  1JX9 A;  4EKW A;  1Q6U A;  3H01 A;  2V1D A;  3ZHT A;  4CBC A;  4WFH A;  1EN6 A;  1K34 A;  4LF9 O;  1WPB A;  3IGA C;  1KEC A;  3WU2 Z;  1X59 A;  1YJW V;  1GKF A;  1UPG A;  5L3D A;  3SYQ A;  1HR0 B;  4QE9 A;  3RVY A;  4IGG A;  4JZ2 A;  4U7O A;  1SF9 A;  2Y0I A;  1N0N A;  1BZK A;  3CE2 A;  1KC8 W;  4FIP C;  2FL4 A;  3X2Q B;  1GH6 A;  3LSS A;  2QTS A;  4TUY B;  3HR0 A;  2WA3 A;  3R65 A;  3FX7 A;  2XUM A;  1JQ0 A;  2EIL C;  1H2S B;  5LOV B;  2IJK A;  4F4L A;  2EUL A;  1NTM H;  3A2F A;  1KQS U;  1S72 V;  4E4E A;  2QKA A;  5BMV B;  4DR3 O;  2QWP B;  5CN0 A;  1ORQ C;  2XAH A;  3ZHS A;  4J42 A;  4ZI7 B;  4GYC B;  4JI3 B;  2DQ3 A;  4QGP A;  5KHI A;  3OMA B;  4PDR A;  1XRE A;  4LFC O;  1U96 A;  5LHI A;  1N33 B;  2Q0A A;  3IAY A;  4UB6 Z;  4TQF A;  1S5L Z;  4FM2 A;  3JAW B;  2EJR A;  3OMN B;  1NBM G;  4JYC A;  1SRY A;  3APQ A;  5L3C A;  2CE4 A;  1QNM A;  3ABT A;  4ZOL B;  4B3M O;  1YIT V;  3N2G B;  4DUY O;  1NI8 A;  5IYC O;  4P9O A;  3E8H A;  4KUM A;  3JD1 A;  4I7Z B;  1H8E G; 
#chains in the Genus database with same CATH homology
 4JI7 O;  1FJG O;  4DV2 O;  3F5T A;  4LF9 O;  2ZM6 O;  1HNZ O;  5LL6 Y;  1X59 A;  2ZKO A;  4DR6 O;  4DV6 O;  4X66 O;  4KHP O;  2UXC O;  3RT3 C;  2UUA O;  5IWA O;  4LFA O;  2UXD O;  4DV1 O;  1IBK O;  4NXM O;  3T1H O;  4X64 O;  1AIL A;  1HNX O;  1FKA O;  1A32 A;  1DK1 A;  2F4V O;  1R1B A;  4JI6 O;  2Z0A A;  4JI0 O;  4NXN O;  1R6T A;  1XNR O;  3J7A U;  4LF5 O;  2N74 A;  3O65 A;  4B3T O;  3SDL A;  1XNQ O;  4B3S O;  5A2Q N;  2UXB O;  1XMQ O;  4LF7 O;  1XMO O;  4DV7 O;  1N36 O;  4DV4 O;  4OPA A;  2UUC O;  1N32 O;  4X62 O;  2HHH O;  1D2D A;  1I94 O;  1NS1 A;  4DR3 O;  5LMU O;  4A5U B;  4AQY O;  1KUQ A;  4YY3 O;  4YHH O;  1XEQ A;  1IBL O;  2E5L O;  4JI1 O;  4LF8 O;  2JRI A;  4DV3 O;  3T1Y O;  4GKK O;  2DOS A;  2FKX A;  5BXZ A;  4DV5 O;  4LFC O;  4OX9 O;  2AGA A;  2LW7 A;  4K0K O;  3J81 N;  4B3R O;  4JI3 O;  5BY1 A;  2DJV A;  4OPH A;  4GKJ O;  2UU9 O;  2VQF O;  4JI4 O;  1YZB A;  3J80 N;  4LF6 O;  1J5E O;  4DR4 O;  4JV5 O;  3JAM N;  1N33 O;  4DR2 O;  3OTO O;  5FLX N;  1HNW O;  1IBM O;  1HR0 O;  5H5N A;  4X65 O;  1FYJ A;  5BR8 O;  1AB3 A;  5LMN O;  1G1X B;  4JI8 O;  2VQE O;  4B3M O;  4LF4 O;  4DV0 O;  5IT9 N;  4DR1 O;  4DR5 O;  4DUY O;  2UUB O;  4LFB O;  4JI2 O;  3R66 A;  1F7Y A;  3M8A A;  4JYA O;  4DUZ O;  1N34 O;  4DR7 O;  4JI5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...