1N33O

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n33O00
2JRIA 1R1BA 4NXMO 2UUCO 4LF7O 4LF5O 4JI4O 1F7YA 2UU9O 4DR3O 5IWAO 1DK1A 4DR4O 2DJVA 2UUAO 2N74A 5LMUO 3T1HO 4JI8O 5H5NA 4DV4O 3O65A 5BXZA 4JI2O 4LFCO 4JI3O 1J5EO 4LF6O 4LF8O 4YHHO 2LW7A 1G1XB 3JAMN 2Z0AA 1IBMO 1A32A 1XNRO 4JYAO 1FJGO 4OPHA 3R66A 4JI7O 4LF9O 1KUQA 1R6TA 2ZM6O 4X66O 4LF4O 4DV7O 1N32O 3F5TA 4B3MO 2DOSA 5IT9N 4DUZO 4AQYO 4JI1O 4JV5O 1AB3A 4GKJO 2E5LO 3M8AA 2VQEO 5BY1A 5A2QN 3J81N 1NS1A 4A5UB 5BR8O 4DR1O 4GKKO 4DV2O 1N36O 5FLXN 4OPAA 1D2DA 4DV1O 1N34O 1XMQO 1IBLO 1HNWO 2UXDO 1X59A 4JI0O 4DR6O 4DR7O 4KHPO 1IBKO 5LMNO 4NXNO 1FKAO 2HHHO 3J80N 2F4VO 4DR2O 1HR0O 4K0KO 1XEQA 2VQFO 1XNQO 1XMOO 4X62O 1YZBA 2FKXA 4JI5O 1N33O 3J7AU 4DV3O 2ZKOA 5LL6Y 4B3RO 1FYJA 4DR5O 4DUYO 1AILA 1I94O 4OX9O 4B3TO 4YY3O 4JI6O 4DV5O 1HNXO 4LFAO 2UXBO 1HNZO 4DV6O 3RT3C 2UUBO 2AGAA 2UXCO 4LFBO 3SDLA 3T1YO 4X64O 3OTOO 4DV0O 4B3SO 4X65O
chains in the Genus database with same CATH superfamily
1R1BA 4GUNA 1WP7A 4WFGA 1MOFA 2UUAO 1MSWD 4LCUC 3CCRV 3RYIB 4I50B 4UCSA 4ZOLB 2VRZA 1G4YB 5IJ0B 2EIKB 3CCQV 3CCVV 4Q6GA 2EILB 4AHCA 1B3QA 2YUAA 2EX3A 2YIAA 2MK3A 4PA6A 3SYAA 5KMGA 3ZIAG 2Z0AA 1N33B 1MMMA 2GHYA 4LF4O 1H2SB 1Q6UA 2K1EA 2P6JA 1AI7A 1V54C 3AEIA 5CBFA 2VQEO 2IJJA 4FM2A 3WB2A 1AP5A 4GKKO 1BZKA 4JTCB 1D2DA 1BMFG 2ZE8A 4TV8B 4JTDB 2UXDO 3OTOB 4KHPO 2HLDG 2IJKA 4JF3A 1GM9A 2AHZA 2ZXWB 4QE7A 1AVMA 2CAZC 5KUKA 4N21A 2WLHA 1VQPV 1QQCA 3G6EV 2VQFO 2ZCEA 1YZBA 3STZC 5E79Z 2E74B 4B3RO 4J7JA 3OMNB 4XDJA 1SQBH 3P3NA 1DGSA 4BIOA 3RYHB 1N0JA 4LNUA 2WSSG 3ZHVA 2QKSA 2OYQA 3D3QA 1PKXA 2HKOA 3VQWA 2IW5A 5L3GA 2UXCO 4JASA 5JCOA 2XNDG 3CP1A 2ADQB 3WB0A 4R7CA 1QNMA 2LGQA 1BE3H 1I08A 2ZT9B 5JQGA 5EZYA 4DR3O 5LOVB 4BWAA 1JFFB 1YHQV 3RVZA 3CD6V 2W0FC 1G6UA 1DF5A 2WPDG 3VOUA 4WFEA 5LYJA 1M5IA 2CTRA 1AJPA 4LF9O 4U3JA 1O9GA 2WLLA 4EEQA 4QPKA 1DLBA 4RWUA 1N36B 2OT5A 2YEVB 1EZVH 3ZMUA 2RN9A 2YSUB 1H2KA 3KG2A 3BABA 3E83A 3JAKB 1Y74B 4HNAB 5LGUA 5BY1A 3ZN0A 1N4CA 2YI9A 4DR1O 4WFHA 1M4UA 3WFVA 1OJHA 2CDYA 5FLXN 2ZNIA 1L1FA 3LNMB 1X59A 1NTKH 3JATA 1ZWIC 3MHSC 3N2GA 5L3CA 3C3TA 3MAQA 2F66C 2AZ2A 2Y0PA 3OEHG 4CC5A 2FKXA 4X1YA 1ZUQA 3WU2Z 2YDEA 3G4SV 3J7AU 3HPLC 4X1IB 1NR7A 5H2FZ 5C8YA 2VWJA 1XNRB 3MD0A 4PA9A 3QF7A 2RDCA 2Q7EA 4JI7B 4DK0A 1FPOA 1I94O 5A9GA 5FL7G 4GYCB 2V1DA 1YEWA 2QDOA 5HFMA 3RVYA 4KL1A 1VQNV 2FYUH 4X64O 1IXMA 2XAFA 3N2KB 1J5EB 2ZDIA 3EVKA 4DV2B 1GN6A 4R50A 3JCZA 3LSSA 1VQKV 3A0HZ 2X6AA 3FB6C 5FPRA 4JI8O 4AQYB 3KZIZ 4Z2WA 3C90A 5EBLC 3ZCCA 4UVAA 1IURA 4PDLA 1TVKB 4IYIA 3ETDA 2QEXV 1XNQB 1UPGA 1Y76A 1SA0A 2A3QA 5C93A 3R66A 3S3XA 4R6ZA 3BFRA 3CC2V 5KX5A 1JOYA 1R3JC 4HBNA 3PN1A 1KMIZ 2JDIG 5JJEB 2PI5A 4LBEC 4JI1O 4ZHQA 4JYYA 3VQYA 2HG5C 4MSWC 3SPCA 5LA6B 2GBOA 1JVMA 2G38A 3ZHSA 5EC2C 2O57A 2FTKA 2UUBB 2GSMB 4BIUA 2QWRB 2N04A 4H33A 3STLC 1XMQO 2JVDA 2CTQA 5CA1B 3H1KH 2PGGA 2V7QG 2HHHO 1BHBA 1XEQA 3ZHUA 5CN0A 5EC1C 3DXRA 3Q4HB 1N33O 1UJWB 4K3AA 4DRXB 4LF8B 5J2UB 4G28B 4LWSB 1W0KG 3H9VA 4GCZA 1XILA 3KKYA 1I5XA 1PNKA 2P67A 2Q9LA 4NR1A 4MVMA 1ZX3A 3ICXA 2D2CB 2UUAB 1R73A 2LP7A 1NTMH 1EN4A 2QM7A 3LSQA 3ZBHA 3ZRXA 2Y69C 4FFBB 1Q3EA 4K8XA 2Q7GA 3M7MX 1V54B 3OTOO 3IGAC 1Q6IA 3JCUZ 4NKGB 4X1KA 4C7UA 3A0RA 4LF4B 1B04A 1SETA 3HKCB 3QVNA 4R8CA 1Q7YW 5JH7A 2XUMA 4X20A 1Q43A 3O65A 5J9PC 3HB3B 1HR0B 1GM7A 4RAIA 1K4DC 3P3PA 5FNVB 1H38A 2WLJA 4JYAO 2OCCC 4O4JA 4FLUA 1HP8A 1GN3A 5KA6A 4WBNA 2UXXA 5B1BC 3W7SA 1QU7A 4WF9V 1WA8B 5IJ9B 4KHPB 4OX9B 1P7GA 5J2TA 2GUZB 1YSCA 2VQFB 1YITV 1BT8A 2BSKB 3RYCA 1TUEB 1OCCC 1P84F 1H2LA 2QTSA 5K1XA 2YIBD 5EK0A 2ZR3A 2JK5C 3JSLA 2R72A 4X65B 1TA8A 4NXNO 1RPOA 3E2EA 3SYPA 3J80N 3R65A 4CS4A 2PF4E 1K4CC 2R9RB 2DE0X 3OTFA 3AK1A 3FD9A 4JI2B 3B8MA 1VF6A 2UXCB 1OCOC 1S5JA 4TV9A 4KFMA 4DR5O 4PHZA 5CA0A 5LP6A 4B7EA 4JYCA 4MW3A 4J42A 4P2ZA 3ZRWA 3IC7A 1VQ8V 1BHAA 1GKFA 4XBFA 2JEUA 2AGAA 2VS0A 3CRAA 2A9HA 1BCCH 5GW7A 1K73W 1M57C 5KHIA 5CMUA 3P32A 1GRJA 4ZI7B 5H6RA 3D36A 1U96A 2R70A 4LF9B 1RFYA 2RJZA 4FLWA 1DK1A 4DR7B 1H2GA 1PM9A 2JGDB 1IDSA 2K9PA 3CEIA 5LMUO 1MZFA 4FZ0A 3BPZA 4UV9A 1AR1B 1YIJV 1WPBA 3JAMN 3CHXA 1GN2A 3CCUV 1XNRO 4DW1A 4DR1B 3ETGA 4OPHA 4JI7O 4MTOA 2ITDC 1SERA 2PUSA 4UCTA 3CE2A 1GK9A 1KD1W 4IT5A 2KG7B 2HJDA 4YJ3B 4EFEA 1JCHA 3W7TA 5IYZA 5L3EA 1BGYH 3CXHF 1VQ9V 4DV2O 2DYRC 4XDLA 3K04A 1VQOV 4PDMA 4GX5A 4NVPA 2L6LA 3S3WA 2BOBC 3CCJV 2ODMA 5D5QA 1X4TA 3E8FA 1IZ3A 1R6KA 4HAMA 4LR3A 3OR6C 2NNUA 1XNQO 5BMVA 4J80A 4JI5O 1VP7A 4NTWA 1F23A 3QO7A 3UT5B 1RPRA 4O2AA 3OAAG 1VEWA 3FAVA 1QCEA 4QJFB 1SQQH 4B3TO 4DV7B 4J11A 4CS2A 4JAAA 1Q5OA 4MVSA 1CP9A 1B06A 1DTOA 3FYEB 4I0XA 4O4LB 2CH7B 4JI8B 2UUBO 2CGNA 4BAYA 1UFIA 4FPPA 1SQPH 3K59A 3K06A 3OMAB 3D3IA 3RYIA 5IJ0A 4LF7O 2WLIA 1S3JA 4DR6B 3QG5A 1N0NA 2Q4PA 2Q5ZA 1QR8A 4JI1B 1AROP 4DV4O 2BTQA 4G27B 5KHKA 4I55B 3JASB 4LF8O 1JJ2U 1F4NA 1XREA 2V4DA 2IU3A 1QR9A 1AI4A 2BOCC 2WLMA 3QO5A 2IH3C 3ZHRA 4JTAB 4FLVA 4FIPC 3GB7C 1XMQB 2DOSA 1AP6A 2QKAA 2Z5UA 4CS3A 3K03A 3SJAC 3THOA 3ZRSA 3APQA 2HHHB 2DYSC 4QGPA 4DV6B 4YJ2B 2GTAA 3SYCA 3ZX6A 1K9MW 4X89A 3ABMC 1WLEA 1IBLO 4O4HB 4LP8A 1NH2D 5IY5C 1FXKC 2Y69B 1Q81W 4RQEA 4FZ1A 1PP9H 1FKAO 1RP3B 3A2FA 2PTMA 4PA3A 3T2MA 4CH3A 4F6RB 3RW0A 1WN7A 1HR0O 1I7FA 3L71H 3K9AA 1FS0G 5CBGA 3G67A 1K34A 1XBLA 1L0NH 3CJHA 3CC7V 3I5DA 4YXWG 2EIMC 4MTGA 4UXNA 3G80A 2QGNA 3FKSG 4OX9O 5IE9A 2HEPA 5KHHA 3DC6A 3CX5F 2OCCB 1VQ4V 3ZHQA 1Q8IA 4ABMA 5B1OA 4KUMA 4L87A 5B1BB 4EB6B 3OM3B 2FMLA 3K5NA 1JFFA 3G6BA 2CK3G 1I5YA 4L8JA 1OZ0A 4X65O 4JYAB 2XASA 5KMGB 4FLXA 1PV0A 2N74A 2XTAA 4DO2A 2VWKA 1OCCB 5H5NA 4JI2O 4IGGA 1Y67A 2Q67A 3RN4A 2DMXA 4I9WA 1VQ5V 4GX0A 4MTXA 3JAKA 1Y74A 3OT7A 4UUJC 1GN4A 2C2AA 4UFZA 1OCOB 2W6JG 4FLTA 3L72H 3B40A 4NXNB 2WLNA 1NU1H 2YS8A 4CZZA 4QPJA 1EN5A 3L75H 2IH1C 4MVOA 4CH4A 1Q82W 4U3FH 1L0LH 1YVWA 3GWOA 1WNSA 5EBMC 1EM1A 2JIZG 1EN6A 1KB9F 3SPHA 4BW9A 5KHJA 4DR7O 3MHHC 3UCSC 2N05A 1VIBA 3K57A 5LMNO 4DR5B 2X6CA 4P9PA 4FK5C 4J9YB 1M57B 4MT8A 4F4LA 1ZTEA 4RUEA 3IC9A 4BIZA 3RFRA 1HW7A 2QJ1A 2RMKB 1YJNV 3O9OA 4CC6A 2YIDA 5EYPA 4UVBA 3BAAA 1VQ7V 3BA9A 2F93B 3H1LH 3N2KA 4JI6O 4DUZB 3W7WA 5JQGB 3OGIB 5LBQA 5IYCO 4RUFA 2Y4UA 4IHJA 4MVUA 5LMUB 2XAGA 3QTCA 2LGWA 1RSOB 2CTWA 5BR8B 1S5LZ 3DSQA 5JVDA 1NH2B 2D3OW 3KCXA 5LYJB 2UUCO 1TVKA 3FFQA 4LH6A 4LF5O 2PI4A 3JYCA 2EJ7A 3L74H 5IWAO 4P9OA 2DYRB 2DJVA 3BHPA 1Z5VA 3PJSK 1FD9A 2NN4A 4B08A 1CXZB 3HKBB 3E8GA 3OW2U 4I9QA 4EKWA 1SQVH 2AXTZ 2Q8VA 2Q73A 3E22B 3T4ZA 2A0LA 4DV7O 5LA6A 2ZINA 2E5LO 1M1KW 1KP3A 3JATB 3X2QC 1FFXB 1AR5A 3HR0A 5GONA 3N2GB 2ZQMA 2LO1A 4QIWF 4LFBB 1KBHA 4IIJA 4JI5B 4UCVA 4I5SA 1AI5A 3TXQA 4DR6O 4MTFA 4YIOA 1NT2B 1MZEA 2E75B 1LR1A 4DRXA 4B3TB 4DR2O 5J2UA 4LWSA 1MABG 4LFCB 4MS2A 3U0ZA 4H13B 2HFEC 1IBMB 5KA5A 5B3SC 2Q0OC 3AG4C 2QA4V 1Q90D 5D5PA 3ABUA 4PD4F 5GTIZ 4LF7B 4DW0A 3BEHA 1R6NA 3JALB 4DV6O 2WLKA 3UM7A 2W6IG 4TT3G 5DM6V 1DF4A 3ASNC 2E3CA 2EIJC 3K0DA 4DV4B 3ASOC 3LSUA 2BTOA 2AZ0A 4PA4A 4X88A 5H9CA 3TCUA 2ATKC 2DYSB 5CA3A 2XHBA 1SA0B 2IJHA 4WFAV 1K5QA 3ZMVA 5KX5B 3ABMB 2JJ2G 2ZNJA 1US6A 2Q7HA 1M93A 5IY5B 1J95A 1XMOB 4ZHQB 1FXKB 3CB2A 1PNMA 1YCIA 3L70H 1WA8A 5IJ9A 3SPJA 1BSMA 1GMGA 4K8ZA 2PYLA 3G71V 1TAEA 1IBLB 1K5SA 3A0BZ 1NVPD 1XHZA 1R3KC 1P4RA 2BSKA 4E4EA 2EIMB 4CBCA 2P4VA 5IYBO 2ZIMA 1NQTA 2DN9A 2PYJA 3JD3A 1XL6A 4O2BB 1JQ0A 2ZD9A 4F6EA 3OUFA 3ZS8C 3SJCC 3I55V 1R3IC 2ARHA 4JI4B 4AI8A 3JAWB 4FLYA 4UCUA 4K35A 1QLEC 3LDDA 3JD4A 1OV9A 3H1IH 1S0VA 4QNHB 2QKCA 4PI0A 4DV3O 2KKWA 3CCSV 3F7VC 1TUBA 4TSFG 1Y66A 3QO8A 2Q69A 2LQTA 4YY3O 1Z2GA 2H3OA 1YTFD 2HR3A 4ZIBA 1E79G 1HNZO 4I4TB 4ZBMA 4RO2A 2X7RB 3SDLA 3OFNG 4P30A 5LXTA 2X6BA 1ZSPA 4H37A 2XAQA 4FMTA 4KP4A 1ORQC 4PDRA 1PD3A 1SZXA 2P7TC 2P06A 4DV1B 1N34B 4MVZA 3ZMSA 3JARB 2DQ3A 4DR4O 2YXHA 4O4JB 1FXHA 5KLVH 3W7XA 1AR4A 1GM8A 1VF7A 1LNQA 3I56V 3T1HO 4X8AA 4TQFA 3KCYA 4WBNB 4OGQB 4JPRA 1JR9A 2P90A 2GTSA 2XAJA 5CB4B 2OCHA 1EBOA 1ZL8B 2KG7A 5DECA 1Y6XA 3AG1C 4YJ3A 2QWNB 4Q20A 1R3LC 2IJIA 3RYCB 1SZTA 5IT9N 3ZN1A 4DUZO 2Y48A 4PJ0Z 4TQDA 1I0HA 1WAZA 4PA7A 5LMNB 2NLJC 5JCOC 5A2QN 5BR8O 2QWOB 3E8BA 5TISZ 3OUSA 4UCOA 5GTHZ 3OMIB 1OCRB 2HJFC 1FXVA 3U11A 2QR4A 1AJNA 4TUYA 3UT5A 3VQXA 5CA0B 4JI6B 1M9NA 2ZE5A 4D6TH 4O4IA 1VMGA 2MW2B 3ZRWB 3CCEV 3SPIA 2DWDC 2JGUA 3BRCA 3EFFK 1BQZA 4JYBA 4O4LA 3CRCA 2CH7A 3UO2A 5EIBC 2ZM6B 1QBZA 1NVPB 3CRQA 3F5WC 2UUCB 4B3MB 4LF5B 4W4LA 5IWAB 3APOA 4LFBO 1G8MA 1MNGA 4B7KA 5L3DA 2WA3A 4BR6A 5LHHA 4J10A 3E35A 1PL0A 2KB1A 3X2QB 1GO3F 4YIPA 2EULA 1HWYA 3HKEB 1F7YA 5LGNA 4I55A 1SS3A 2HVKC 3JASA 1COWG 2B9ZA 4WCEV 1JPXA 4LFCO 2E5LB 1EFRG 3LNNA 2LW7A 2P5OA 3FYIB 1IBMO 4GX1A 3OR7C 4FFKA 2F95B 4GT1A 3RYFB 4J7KA 5JWPA 4I50A 4ZOLA 2CGOA 3CRRA 4YJ2A 3ZJZA 3JD2A 1OHHG 3SR2C 4JAUA 3EHBB 2H94A 1U97A 4GKJO 1ZLZA 3HKDB 2E76B 3AG3C 5B3SB 3TGUH 3AG4B 1WB8A 2UXBB 4DR2B 4O4HA 2ZDIC 2NR5A 3B8NA 3ABLC 3T1CA 4ICGA 5JJNB 3SYQA 1XUQA 5ITZB 3ASNB 1PNLA 2JS3A 1IBKO 2EIJB 3ASOB 2AW9A 4O2AB 1VF5B 2UU9B 4UB6Z 3VBBA 3FAVB 1BQ0A 1Q86W 4D7TA 1B6QA 5B1AC 1XMOO 4TV8A 1JMKC 3UQ8A 1NTZH 3UKMA 1MG1A 2KQXA 1FFTB 1SRYA 3F7YC 3FB8C 2DQ0A 1FJGB 2FL4A 1OCZC 4MW8A 4IYHA 1MSDA 1AILA 3ABTA 4EB6A 1N32B 3AG2C 1HNXO 2ADPA 3LUTB 2IM9A 2WLIB 1KQSU 2W0XA 3TXSA 5EIBD 1YJ9V 4J9ZB 2CUGA 2EZOA 3RYHA 2BTQB 2QE7G 2A06H 4U7OA 1W0JG 3U10A 2JRIA 4Z1VA 3K79A 1HNWB 4JI4O 4LC1A 3CWBH 1YDXA 3TJTA 3GVMA 2WA4A 3K58A 3DTUB 4X62B 4I7ZB 1SQGA 1K92A 1A32A 5LOVA 1QLEB 1QLNA 1NI8A 1K8AW 3TETA 5KAFZ 4NTXA 1LUWA 3F5TA 5L3FA 2KSDA 3JD0A 1D5AA 1KP2A 2QM4A 4WFFA 2Y0IA 4LFAB 3ETEA 2YEVA 4MVQA 3RGBA 3OD4A 4DV1O 2P22C 1N34O 2R9AA 4JZGA 4DV3B 4HNAA 3ML0A 1CEZA 3CJHB 2B5UA 2EBOA 4NTYA 1SQXH 2PY5A 2LFRA 4YY3B 1H2NA 1RM1C 1XI1A 3B77A 1HNZB 4JI3B 1SESA 3RWRD 3OGCC 2CE4A 3BA8A 5B1NA 5LL6Y 1V55C 2OIEA 3ETQA 1RSOA 3IJ4A 4DR4B 5BZBA 4JV5B 4X1IA 3AG1B 1S76D 3T1HB 3JSNA 4PELA 3K5MA 3T1YO 3L73H 1NR1A 3AG7A 3CCMV 4LNUB 4H0LB 1VQ6V 2XT9A 4B3SO 4UVCA 3ZMZA 3IFXA 3ZEDA 5CBHA 3HKBA 2F43G 2RNBA 3E22A 5EZYB 3E8HA 4IL6Z 1NBMG 1WB7A 1VF6C 4GLXA 1G1XB 1H2MA 1OCRC 4GX2A 1S5HC 3L9DA 1K7DA 2HVJC 2ZM6O 5LP6C 2F1MA 1SQFA 3MDSA 3AK3A 1FFXA 3WG7B 1YJWV 4B3MO 1P7BA 4DUYB 3FB7C 2JJ1G 1PL4A 4U3JB 2WLLB 4DYLA 4ASUG 3JD1A 3J81N 3P30A 1P49A 1S77D 5L3BA 5LHIA 3LDCA 3D36C 3DGEA 3ZMTA 4JI0O 2EINC 1V9PA 2QM8A 1H8HG 2QWPB 5KHGA 1QHTA 2ETNA 1JJOA 1SKVA 1M56C 2F4VO 2EZPA 1Y4MA 1THZA 5EYPB 4DK1A 1NZ6A 4K0KO 2QTOA 5IDJA 2Y4TA 1FAFA 1CPYA 4G2KA 5CA1A 2PZSA 4IHJB 2Q0AA 3BVOA 3ZHTA 3JALA 4X1YB 4GZRB 3NXSA 1WJZA 1L8DA 4X66B 3Q4HA 5JVDB 4DV5O 5C8YB 3ZRVA 2UXBO 3B4SA 1KYOF 4LH7A 2FB5A 3AG3B 1K3EA 2JS5A 4NXMO 2UU9O 2RQ6A 2YC0A 3K5LA 3DC5A 2ZE6A 1FXKA 4PI2A 4FFBA 3ABLB 4RQFA 3ABKC 3CSXA 4E2LA 4GKJB 4LF6O 2QWQB 2GV9A 3SYOA 2LFSA 1IVSA 1W59A 1T5EA 4NYKA 4YHHO 1FJGO 2L35A 5GONB 3K0GA 3HKCA 1GH6A 1R6TA 5B1AB 4ZKIA 1KUQA 1W2BU 4FVMA 1N32O 1Y76B 2IBZH 4IIJB 3OEEG 2F23A 2BE3A 4O2BA 1AB3A 1WPXA 5FNVA 1IBKB 1AJQA 2Q6AA 3M8AA 3W7UA 1OCZB 4CH6A 1NS1A 4A5UB 3FB5C 3UO3A 3B2EE 4OPAA 3AG2B 5AG2A 1TGOA 1XHXA 3JAWA 4KXRA 1ROPA 2EIKC 1HNWO 2EILC 3CRMA 4DV0B 3SJBC 2B1GA 2ZIOA 2GUZA 2YXYA 5JJJB 1F4MA 3CCLV 2GDSA 4X62O 1HNXB 3K08A 3FX7A 2YI8A 3AK2A 3SJQC 4FJCC 1S72V 2Q68A 2XOKG 2AHYA 3VQVA 2EJRA 1H8EG 4UCRA 3DXRB 4I4TA 2M7WA 2CTPA 4LFAO 5IYDO 3WB1A 5DN6G 2ZXWC 3E89A 3GWKC 2VQEB 3JARA 3H1HH 5DEDA 2YICA 4GKKB 3CMAV 3CC4V 2A7WA 4X9QA 2WAMA 2UXDB 1VQLV 1IX9A 5CB4A 1YI2V 1ZL8A 4EFBA 5FPOA 4J7ZA 2UXNA 5HFLA 5BXZA 4X1KB 4ZI7A 4JI3O 2HP8A 2RCVA 2ILMA 1KECA 5JH7B 1NJIW 4X20B 2JGDA 1XL4A 3K5OA 1QVGU 4OXSA 2OTJV 1WP8A 1RM1B 2LJ2A 4B3RB 4UV8A 3BCCH 2M6YA 4JV5O 1SC5B 4AILC 3OE7G 3M99B 4UB8Z 4XDKA 1V55B 4U7NA 5EBWC 1GTOA 4FM0A 3RBZA 2YXLA 3E86A 5J2TB 1N36O 1XOUA 2ZR2A 5KUMA 4FM1A 3EXAA 2Z3YA 2H8PC 1M90W 1Q6HA 4WFBV 4NB5A 1TUBB 4DR3B 2A79B 2X0LA 1AI6A 2P4KA 1O9HA 3T1YB 1QVFU 5B66Z 4TOIA 1K33A 1FYJA 1KKDA 3D8CA 2ITCC 4DUYO 1VQMV 4B3SB 5LXTB 1E1RG 3T4DA 4Z1MG 5K1PA 1N8RW 4TV9B 2QSAA 3RT3C 5LP6B 1JA8A 3WG7C 3K9SA 4N23A 2OIGA 3HKEA 1MA1A 3SPGA 2IU0A 1GAXA 4DXWA 1D5NA 1JX9A 2LW1A 4H44B 2WWWA 1E1QG 4BW5A 4J41A 3CPWU 1ZAUA 2YIBA 3CYOA 3RYFA 4HYOA 2EINB 1J5EO 1LUVA 3CMEV 4PV1B 1HDJA 3BY6A 4W4KA 4TWKA 2DWEC 4JAVA 1M56B 2OTLV 2JEXA 1YXBA 4PDVA 3HKDA 1BS3A 3H1JH 4X66O 1KC8W 4AQYO 4JI0B 2ZE7A 1I94B 3SGIA 1F51A 1IXBA 3LDEA 3IAYA 1SF9A 1URFA 2F4VB 1NKDA 1KU9A 3B09A 4K0KB 5ITZA 4X64B 3CXCU 4TUYB 2BCCH 5LHGA 5IYZB 4FLZA 4O4IB 4MVRA 3CS5A 1BL8A 2XAHA 1XDCA 3TK1A 1YTFB 4JZ2A 2OWOA 5F2VO 3K3WA 1ENVA 1Z5WA 4DV5B 3A8TA 3QNEA 1PPJH 4JGSA 4QE9A 2DW4A 1XQ8A 3C3SA 1KKCA 4D7SA 3H01A 2B1IA 2ZKOA 1VARA 5BMVB 3ABKB 4F6RA 4NXMB 2R9IA 5B5EZ 1EZJA 5LGTA 1YF2A 4CH5A 4HZ3A 5KAIZ 5E1AC 5H6QA 3NR7A 3N27A 4LF6B 1K97A 4I0XB 4YHHB 4DV0O
chains in the Genus database with same CATH topology
2JRIA 1R1BA 4NXMO 2UUCO 4LF7O 4LF5O 4JI4O 1F7YA 2UU9O 4DR3O 5IWAO 1DK1A 4DR4O 2DJVA 2UUAO 2N74A 5LMUO 3T1HO 4JI8O 5H5NA 4DV4O 3O65A 5BXZA 4JI2O 4LFCO 4JI3O 1J5EO 4LF6O 4LF8O 4YHHO 2LW7A 1G1XB 3JAMN 2Z0AA 1IBMO 1A32A 1XNRO 4JYAO 1FJGO 4OPHA 3R66A 4JI7O 4LF9O 1KUQA 1R6TA 2ZM6O 4X66O 4LF4O 4DV7O 1N32O 3F5TA 4B3MO 2DOSA 5IT9N 4DUZO 4AQYO 4JI1O 4JV5O 1AB3A 4GKJO 2E5LO 3M8AA 2VQEO 5BY1A 5A2QN 3J81N 1NS1A 4A5UB 5BR8O 4DR1O 4GKKO 4DV2O 1N36O 5FLXN 4OPAA 1D2DA 4DV1O 1N34O 1XMQO 1IBLO 1HNWO 2UXDO 1X59A 4JI0O 4DR6O 4DR7O 4KHPO 1IBKO 5LMNO 4NXNO 1FKAO 2HHHO 3J80N 2F4VO 4DR2O 1HR0O 4K0KO 1XEQA 2VQFO 1XNQO 1XMOO 4X62O 1YZBA 2FKXA 4JI5O 1N33O 3J7AU 4DV3O 2ZKOA 5LL6Y 4B3RO 1FYJA 4DR5O 4DUYO 1AILA 1I94O 4OX9O 4B3TO 4YY3O 4JI6O 4DV5O 1HNXO 4LFAO 2UXBO 1HNZO 4DV6O 3RT3C 2UUBO 2AGAA 2UXCO 4LFBO 3SDLA 3T1YO 4X64O 3OTOO 4DV0O 4B3SO 4X65O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI A;  1R1B A;  4NXM O;  2UUC O;  4LF7 O;  4LF5 O;  4JI4 O;  1F7Y A;  2UU9 O;  4DR3 O;  5IWA O;  1DK1 A;  4DR4 O;  2DJV A;  2UUA O;  2N74 A;  5LMU O;  3T1H O;  4JI8 O;  5H5N A;  4DV4 O;  3O65 A;  5BXZ A;  4JI2 O;  4LFC O;  4JI3 O;  1J5E O;  4LF6 O;  4LF8 O;  4YHH O;  2LW7 A;  1G1X B;  3JAM N;  2Z0A A;  1IBM O;  1A32 A;  1XNR O;  4JYA O;  1FJG O;  4OPH A;  3R66 A;  4JI7 O;  4LF9 O;  1KUQ A;  1R6T A;  2ZM6 O;  4X66 O;  4LF4 O;  4DV7 O;  1N32 O;  3F5T A;  4B3M O;  2DOS A;  5IT9 N;  4DUZ O;  4AQY O;  4JI1 O;  4JV5 O;  1AB3 A;  4GKJ O;  2E5L O;  3M8A A;  2VQE O;  5BY1 A;  5A2Q N;  3J81 N;  1NS1 A;  4A5U B;  5BR8 O;  4DR1 O;  4GKK O;  4DV2 O;  1N36 O;  5FLX N;  4OPA A;  1D2D A;  4DV1 O;  1N34 O;  1XMQ O;  1IBL O;  1HNW O;  2UXD O;  1X59 A;  4JI0 O;  4DR6 O;  4DR7 O;  4KHP O;  1IBK O;  5LMN O;  4NXN O;  1FKA O;  2HHH O;  3J80 N;  2F4V O;  4DR2 O;  1HR0 O;  4K0K O;  1XEQ A;  2VQF O;  1XNQ O;  1XMO O;  4X62 O;  1YZB A;  2FKX A;  4JI5 O;  1N33 O;  3J7A U;  4DV3 O;  2ZKO A;  5LL6 Y;  4B3R O;  1FYJ A;  4DR5 O;  4DUY O;  1AIL A;  1I94 O;  4OX9 O;  4B3T O;  4YY3 O;  4JI6 O;  4DV5 O;  1HNX O;  4LFA O;  2UXB O;  1HNZ O;  4DV6 O;  3RT3 C;  2UUB O;  2AGA A;  2UXC O;  4LFB O;  3SDL A;  3T1Y O;  4X64 O;  3OTO O;  4DV0 O;  4B3S O;  4X65 O; 
#chains in the Genus database with same CATH topology
 1R1B A;  4GUN A;  1WP7 A;  4WFG A;  1MOF A;  2UUA O;  1MSW D;  4LCU C;  3CCR V;  3RYI B;  4I50 B;  4UCS A;  4ZOL B;  2VRZ A;  1G4Y B;  5IJ0 B;  2EIK B;  3CCQ V;  3CCV V;  4Q6G A;  2EIL B;  4AHC A;  1B3Q A;  2YUA A;  2EX3 A;  2YIA A;  2MK3 A;  4PA6 A;  3SYA A;  5KMG A;  3ZIA G;  2Z0A A;  1N33 B;  1MMM A;  2GHY A;  4LF4 O;  1H2S B;  1Q6U A;  2K1E A;  2P6J A;  1AI7 A;  1V54 C;  3AEI A;  5CBF A;  2VQE O;  2IJJ A;  4FM2 A;  3WB2 A;  1AP5 A;  4GKK O;  1BZK A;  4JTC B;  1D2D A;  1BMF G;  2ZE8 A;  4TV8 B;  4JTD B;  2UXD O;  3OTO B;  4KHP O;  2HLD G;  2IJK A;  4JF3 A;  1GM9 A;  2AHZ A;  2ZXW B;  4QE7 A;  1AVM A;  2CAZ C;  5KUK A;  4N21 A;  2WLH A;  1VQP V;  1QQC A;  3G6E V;  2VQF O;  2ZCE A;  1YZB A;  3STZ C;  5E79 Z;  2E74 B;  4B3R O;  4J7J A;  3OMN B;  4XDJ A;  1SQB H;  3P3N A;  1DGS A;  4BIO A;  3RYH B;  1N0J A;  4LNU A;  2WSS G;  3ZHV A;  2QKS A;  2OYQ A;  3D3Q A;  1PKX A;  2HKO A;  3VQW A;  2IW5 A;  5L3G A;  2UXC O;  4JAS A;  5JCO A;  2XND G;  3CP1 A;  2ADQ B;  3WB0 A;  4R7C A;  1QNM A;  2LGQ A;  1BE3 H;  1I08 A;  2ZT9 B;  5JQG A;  5EZY A;  4DR3 O;  5LOV B;  4BWA A;  1JFF B;  1YHQ V;  3RVZ A;  3CD6 V;  2W0F C;  1G6U A;  1DF5 A;  2WPD G;  3VOU A;  4WFE A;  5LYJ A;  1M5I A;  2CTR A;  1AJP A;  4LF9 O;  4U3J A;  1O9G A;  2WLL A;  4EEQ A;  4QPK A;  1DLB A;  4RWU A;  1N36 B;  2OT5 A;  2YEV B;  1EZV H;  3ZMU A;  2RN9 A;  2YSU B;  1H2K A;  3KG2 A;  3BAB A;  3E83 A;  3JAK B;  1Y74 B;  4HNA B;  5LGU A;  5BY1 A;  3ZN0 A;  1N4C A;  2YI9 A;  4DR1 O;  4WFH A;  1M4U A;  3WFV A;  1OJH A;  2CDY A;  5FLX N;  2ZNI A;  1L1F A;  3LNM B;  1X59 A;  1NTK H;  3JAT A;  1ZWI C;  3MHS C;  3N2G A;  5L3C A;  3C3T A;  3MAQ A;  2F66 C;  2AZ2 A;  2Y0P A;  3OEH G;  4CC5 A;  2FKX A;  4X1Y A;  1ZUQ A;  3WU2 Z;  2YDE A;  3G4S V;  3J7A U;  3HPL C;  4X1I B;  1NR7 A;  5H2F Z;  5C8Y A;  2VWJ A;  1XNR B;  3MD0 A;  4PA9 A;  3QF7 A;  2RDC A;  2Q7E A;  4JI7 B;  4DK0 A;  1FPO A;  1I94 O;  5A9G A;  5FL7 G;  4GYC B;  2V1D A;  1YEW A;  2QDO A;  5HFM A;  3RVY A;  4KL1 A;  1VQN V;  2FYU H;  4X64 O;  1IXM A;  2XAF A;  3N2K B;  1J5E B;  2ZDI A;  3EVK A;  4DV2 B;  1GN6 A;  4R50 A;  3JCZ A;  3LSS A;  1VQK V;  3A0H Z;  2X6A A;  3FB6 C;  5FPR A;  4JI8 O;  4AQY B;  3KZI Z;  4Z2W A;  3C90 A;  5EBL C;  3ZCC A;  4UVA A;  1IUR A;  4PDL A;  1TVK B;  4IYI A;  3ETD A;  2QEX V;  1XNQ B;  1UPG A;  1Y76 A;  1SA0 A;  2A3Q A;  5C93 A;  3R66 A;  3S3X A;  4R6Z A;  3BFR A;  3CC2 V;  5KX5 A;  1JOY A;  1R3J C;  4HBN A;  3PN1 A;  1KMI Z;  2JDI G;  5JJE B;  2PI5 A;  4LBE C;  4JI1 O;  4ZHQ A;  4JYY A;  3VQY A;  2HG5 C;  4MSW C;  3SPC A;  5LA6 B;  2GBO A;  1JVM A;  2G38 A;  3ZHS A;  5EC2 C;  2O57 A;  2FTK A;  2UUB B;  2GSM B;  4BIU A;  2QWR B;  2N04 A;  4H33 A;  3STL C;  1XMQ O;  2JVD A;  2CTQ A;  5CA1 B;  3H1K H;  2PGG A;  2V7Q G;  2HHH O;  1BHB A;  1XEQ A;  3ZHU A;  5CN0 A;  5EC1 C;  3DXR A;  3Q4H B;  1N33 O;  1UJW B;  4K3A A;  4DRX B;  4LF8 B;  5J2U B;  4G28 B;  4LWS B;  1W0K G;  3H9V A;  4GCZ A;  1XIL A;  3KKY A;  1I5X A;  1PNK A;  2P67 A;  2Q9L A;  4NR1 A;  4MVM A;  1ZX3 A;  3ICX A;  2D2C B;  2UUA B;  1R73 A;  2LP7 A;  1NTM H;  1EN4 A;  2QM7 A;  3LSQ A;  3ZBH A;  3ZRX A;  2Y69 C;  4FFB B;  1Q3E A;  4K8X A;  2Q7G A;  3M7M X;  1V54 B;  3OTO O;  3IGA C;  1Q6I A;  3JCU Z;  4NKG B;  4X1K A;  4C7U A;  3A0R A;  4LF4 B;  1B04 A;  1SET A;  3HKC B;  3QVN A;  4R8C A;  1Q7Y W;  5JH7 A;  2XUM A;  4X20 A;  1Q43 A;  3O65 A;  5J9P C;  3HB3 B;  1HR0 B;  1GM7 A;  4RAI A;  1K4D C;  3P3P A;  5FNV B;  1H38 A;  2WLJ A;  4JYA O;  2OCC C;  4O4J A;  4FLU A;  1HP8 A;  1GN3 A;  5KA6 A;  4WBN A;  2UXX A;  5B1B C;  3W7S A;  1QU7 A;  4WF9 V;  1WA8 B;  5IJ9 B;  4KHP B;  4OX9 B;  1P7G A;  5J2T A;  2GUZ B;  1YSC A;  2VQF B;  1YIT V;  1BT8 A;  2BSK B;  3RYC A;  1TUE B;  1OCC C;  1P84 F;  1H2L A;  2QTS A;  5K1X A;  2YIB D;  5EK0 A;  2ZR3 A;  2JK5 C;  3JSL A;  2R72 A;  4X65 B;  1TA8 A;  4NXN O;  1RPO A;  3E2E A;  3SYP A;  3J80 N;  3R65 A;  4CS4 A;  2PF4 E;  1K4C C;  2R9R B;  2DE0 X;  3OTF A;  3AK1 A;  3FD9 A;  4JI2 B;  3B8M A;  1VF6 A;  2UXC B;  1OCO C;  1S5J A;  4TV9 A;  4KFM A;  4DR5 O;  4PHZ A;  5CA0 A;  5LP6 A;  4B7E A;  4JYC A;  4MW3 A;  4J42 A;  4P2Z A;  3ZRW A;  3IC7 A;  1VQ8 V;  1BHA A;  1GKF A;  4XBF A;  2JEU A;  2AGA A;  2VS0 A;  3CRA A;  2A9H A;  1BCC H;  5GW7 A;  1K73 W;  1M57 C;  5KHI A;  5CMU A;  3P32 A;  1GRJ A;  4ZI7 B;  5H6R A;  3D36 A;  1U96 A;  2R70 A;  4LF9 B;  1RFY A;  2RJZ A;  4FLW A;  1DK1 A;  4DR7 B;  1H2G A;  1PM9 A;  2JGD B;  1IDS A;  2K9P A;  3CEI A;  5LMU O;  1MZF A;  4FZ0 A;  3BPZ A;  4UV9 A;  1AR1 B;  1YIJ V;  1WPB A;  3JAM N;  3CHX A;  1GN2 A;  3CCU V;  1XNR O;  4DW1 A;  4DR1 B;  3ETG A;  4OPH A;  4JI7 O;  4MTO A;  2ITD C;  1SER A;  2PUS A;  4UCT A;  3CE2 A;  1GK9 A;  1KD1 W;  4IT5 A;  2KG7 B;  2HJD A;  4YJ3 B;  4EFE A;  1JCH A;  3W7T A;  5IYZ A;  5L3E A;  1BGY H;  3CXH F;  1VQ9 V;  4DV2 O;  2DYR C;  4XDL A;  3K04 A;  1VQO V;  4PDM A;  4GX5 A;  4NVP A;  2L6L A;  3S3W A;  2BOB C;  3CCJ V;  2ODM A;  5D5Q A;  1X4T A;  3E8F A;  1IZ3 A;  1R6K A;  4HAM A;  4LR3 A;  3OR6 C;  2NNU A;  1XNQ O;  5BMV A;  4J80 A;  4JI5 O;  1VP7 A;  4NTW A;  1F23 A;  3QO7 A;  3UT5 B;  1RPR A;  4O2A A;  3OAA G;  1VEW A;  3FAV A;  1QCE A;  4QJF B;  1SQQ H;  4B3T O;  4DV7 B;  4J11 A;  4CS2 A;  4JAA A;  1Q5O A;  4MVS A;  1CP9 A;  1B06 A;  1DTO A;  3FYE B;  4I0X A;  4O4L B;  2CH7 B;  4JI8 B;  2UUB O;  2CGN A;  4BAY A;  1UFI A;  4FPP A;  1SQP H;  3K59 A;  3K06 A;  3OMA B;  3D3I A;  3RYI A;  5IJ0 A;  4LF7 O;  2WLI A;  1S3J A;  4DR6 B;  3QG5 A;  1N0N A;  2Q4P A;  2Q5Z A;  1QR8 A;  4JI1 B;  1ARO P;  4DV4 O;  2BTQ A;  4G27 B;  5KHK A;  4I55 B;  3JAS B;  4LF8 O;  1JJ2 U;  1F4N A;  1XRE A;  2V4D A;  2IU3 A;  1QR9 A;  1AI4 A;  2BOC C;  2WLM A;  3QO5 A;  2IH3 C;  3ZHR A;  4JTA B;  4FLV A;  4FIP C;  3GB7 C;  1XMQ B;  2DOS A;  1AP6 A;  2QKA A;  2Z5U A;  4CS3 A;  3K03 A;  3SJA C;  3THO A;  3ZRS A;  3APQ A;  2HHH B;  2DYS C;  4QGP A;  4DV6 B;  4YJ2 B;  2GTA A;  3SYC A;  3ZX6 A;  1K9M W;  4X89 A;  3ABM C;  1WLE A;  1IBL O;  4O4H B;  4LP8 A;  1NH2 D;  5IY5 C;  1FXK C;  2Y69 B;  1Q81 W;  4RQE A;  4FZ1 A;  1PP9 H;  1FKA O;  1RP3 B;  3A2F A;  2PTM A;  4PA3 A;  3T2M A;  4CH3 A;  4F6R B;  3RW0 A;  1WN7 A;  1HR0 O;  1I7F A;  3L71 H;  3K9A A;  1FS0 G;  5CBG A;  3G67 A;  1K34 A;  1XBL A;  1L0N H;  3CJH A;  3CC7 V;  3I5D A;  4YXW G;  2EIM C;  4MTG A;  4UXN A;  3G80 A;  2QGN A;  3FKS G;  4OX9 O;  5IE9 A;  2HEP A;  5KHH A;  3DC6 A;  3CX5 F;  2OCC B;  1VQ4 V;  3ZHQ A;  1Q8I A;  4ABM A;  5B1O A;  4KUM A;  4L87 A;  5B1B B;  4EB6 B;  3OM3 B;  2FML A;  3K5N A;  1JFF A;  3G6B A;  2CK3 G;  1I5Y A;  4L8J A;  1OZ0 A;  4X65 O;  4JYA B;  2XAS A;  5KMG B;  4FLX A;  1PV0 A;  2N74 A;  2XTA A;  4DO2 A;  2VWK A;  1OCC B;  5H5N A;  4JI2 O;  4IGG A;  1Y67 A;  2Q67 A;  3RN4 A;  2DMX A;  4I9W A;  1VQ5 V;  4GX0 A;  4MTX A;  3JAK A;  1Y74 A;  3OT7 A;  4UUJ C;  1GN4 A;  2C2A A;  4UFZ A;  1OCO B;  2W6J G;  4FLT A;  3L72 H;  3B40 A;  4NXN B;  2WLN A;  1NU1 H;  2YS8 A;  4CZZ A;  4QPJ A;  1EN5 A;  3L75 H;  2IH1 C;  4MVO A;  4CH4 A;  1Q82 W;  4U3F H;  1L0L H;  1YVW A;  3GWO A;  1WNS A;  5EBM C;  1EM1 A;  2JIZ G;  1EN6 A;  1KB9 F;  3SPH A;  4BW9 A;  5KHJ A;  4DR7 O;  3MHH C;  3UCS C;  2N05 A;  1VIB A;  3K57 A;  5LMN O;  4DR5 B;  2X6C A;  4P9P A;  4FK5 C;  4J9Y B;  1M57 B;  4MT8 A;  4F4L A;  1ZTE A;  4RUE A;  3IC9 A;  4BIZ A;  3RFR A;  1HW7 A;  2QJ1 A;  2RMK B;  1YJN V;  3O9O A;  4CC6 A;  2YID A;  5EYP A;  4UVB A;  3BAA A;  1VQ7 V;  3BA9 A;  2F93 B;  3H1L H;  3N2K A;  4JI6 O;  4DUZ B;  3W7W A;  5JQG B;  3OGI B;  5LBQ A;  5IYC O;  4RUF A;  2Y4U A;  4IHJ A;  4MVU A;  5LMU B;  2XAG A;  3QTC A;  2LGW A;  1RSO B;  2CTW A;  5BR8 B;  1S5L Z;  3DSQ A;  5JVD A;  1NH2 B;  2D3O W;  3KCX A;  5LYJ B;  2UUC O;  1TVK A;  3FFQ A;  4LH6 A;  4LF5 O;  2PI4 A;  3JYC A;  2EJ7 A;  3L74 H;  5IWA O;  4P9O A;  2DYR B;  2DJV A;  3BHP A;  1Z5V A;  3PJS K;  1FD9 A;  2NN4 A;  4B08 A;  1CXZ B;  3HKB B;  3E8G A;  3OW2 U;  4I9Q A;  4EKW A;  1SQV H;  2AXT Z;  2Q8V A;  2Q73 A;  3E22 B;  3T4Z A;  2A0L A;  4DV7 O;  5LA6 A;  2ZIN A;  2E5L O;  1M1K W;  1KP3 A;  3JAT B;  3X2Q C;  1FFX B;  1AR5 A;  3HR0 A;  5GON A;  3N2G B;  2ZQM A;  2LO1 A;  4QIW F;  4LFB B;  1KBH A;  4IIJ A;  4JI5 B;  4UCV A;  4I5S A;  1AI5 A;  3TXQ A;  4DR6 O;  4MTF A;  4YIO A;  1NT2 B;  1MZE A;  2E75 B;  1LR1 A;  4DRX A;  4B3T B;  4DR2 O;  5J2U A;  4LWS A;  1MAB G;  4LFC B;  4MS2 A;  3U0Z A;  4H13 B;  2HFE C;  1IBM B;  5KA5 A;  5B3S C;  2Q0O C;  3AG4 C;  2QA4 V;  1Q90 D;  5D5P A;  3ABU A;  4PD4 F;  5GTI Z;  4LF7 B;  4DW0 A;  3BEH A;  1R6N A;  3JAL B;  4DV6 O;  2WLK A;  3UM7 A;  2W6I G;  4TT3 G;  5DM6 V;  1DF4 A;  3ASN C;  2E3C A;  2EIJ C;  3K0D A;  4DV4 B;  3ASO C;  3LSU A;  2BTO A;  2AZ0 A;  4PA4 A;  4X88 A;  5H9C A;  3TCU A;  2ATK C;  2DYS B;  5CA3 A;  2XHB A;  1SA0 B;  2IJH A;  4WFA V;  1K5Q A;  3ZMV A;  5KX5 B;  3ABM B;  2JJ2 G;  2ZNJ A;  1US6 A;  2Q7H A;  1M93 A;  5IY5 B;  1J95 A;  1XMO B;  4ZHQ B;  1FXK B;  3CB2 A;  1PNM A;  1YCI A;  3L70 H;  1WA8 A;  5IJ9 A;  3SPJ A;  1BSM A;  1GMG A;  4K8Z A;  2PYL A;  3G71 V;  1TAE A;  1IBL B;  1K5S A;  3A0B Z;  1NVP D;  1XHZ A;  1R3K C;  1P4R A;  2BSK A;  4E4E A;  2EIM B;  4CBC A;  2P4V A;  5IYB O;  2ZIM A;  1NQT A;  2DN9 A;  2PYJ A;  3JD3 A;  1XL6 A;  4O2B B;  1JQ0 A;  2ZD9 A;  4F6E A;  3OUF A;  3ZS8 C;  3SJC C;  3I55 V;  1R3I C;  2ARH A;  4JI4 B;  4AI8 A;  3JAW B;  4FLY A;  4UCU A;  4K35 A;  1QLE C;  3LDD A;  3JD4 A;  1OV9 A;  3H1I H;  1S0V A;  4QNH B;  2QKC A;  4PI0 A;  4DV3 O;  2KKW A;  3CCS V;  3F7V C;  1TUB A;  4TSF G;  1Y66 A;  3QO8 A;  2Q69 A;  2LQT A;  4YY3 O;  1Z2G A;  2H3O A;  1YTF D;  2HR3 A;  4ZIB A;  1E79 G;  1HNZ O;  4I4T B;  4ZBM A;  4RO2 A;  2X7R B;  3SDL A;  3OFN G;  4P30 A;  5LXT A;  2X6B A;  1ZSP A;  4H37 A;  2XAQ A;  4FMT A;  4KP4 A;  1ORQ C;  4PDR A;  1PD3 A;  1SZX A;  2P7T C;  2P06 A;  4DV1 B;  1N34 B;  4MVZ A;  3ZMS A;  3JAR B;  2DQ3 A;  4DR4 O;  2YXH A;  4O4J B;  1FXH A;  5KLV H;  3W7X A;  1AR4 A;  1GM8 A;  1VF7 A;  1LNQ A;  3I56 V;  3T1H O;  4X8A A;  4TQF A;  3KCY A;  4WBN B;  4OGQ B;  4JPR A;  1JR9 A;  2P90 A;  2GTS A;  2XAJ A;  5CB4 B;  2OCH A;  1EBO A;  1ZL8 B;  2KG7 A;  5DEC A;  1Y6X A;  3AG1 C;  4YJ3 A;  2QWN B;  4Q20 A;  1R3L C;  2IJI A;  3RYC B;  1SZT A;  5IT9 N;  3ZN1 A;  4DUZ O;  2Y48 A;  4PJ0 Z;  4TQD A;  1I0H A;  1WAZ A;  4PA7 A;  5LMN B;  2NLJ C;  5JCO C;  5A2Q N;  5BR8 O;  2QWO B;  3E8B A;  5TIS Z;  3OUS A;  4UCO A;  5GTH Z;  3OMI B;  1OCR B;  2HJF C;  1FXV A;  3U11 A;  2QR4 A;  1AJN A;  4TUY A;  3UT5 A;  3VQX A;  5CA0 B;  4JI6 B;  1M9N A;  2ZE5 A;  4D6T H;  4O4I A;  1VMG A;  2MW2 B;  3ZRW B;  3CCE V;  3SPI A;  2DWD C;  2JGU A;  3BRC A;  3EFF K;  1BQZ A;  4JYB A;  4O4L A;  3CRC A;  2CH7 A;  3UO2 A;  5EIB C;  2ZM6 B;  1QBZ A;  1NVP B;  3CRQ A;  3F5W C;  2UUC B;  4B3M B;  4LF5 B;  4W4L A;  5IWA B;  3APO A;  4LFB O;  1G8M A;  1MNG A;  4B7K A;  5L3D A;  2WA3 A;  4BR6 A;  5LHH A;  4J10 A;  3E35 A;  1PL0 A;  2KB1 A;  3X2Q B;  1GO3 F;  4YIP A;  2EUL A;  1HWY A;  3HKE B;  1F7Y A;  5LGN A;  4I55 A;  1SS3 A;  2HVK C;  3JAS A;  1COW G;  2B9Z A;  4WCE V;  1JPX A;  4LFC O;  2E5L B;  1EFR G;  3LNN A;  2LW7 A;  2P5O A;  3FYI B;  1IBM O;  4GX1 A;  3OR7 C;  4FFK A;  2F95 B;  4GT1 A;  3RYF B;  4J7K A;  5JWP A;  4I50 A;  4ZOL A;  2CGO A;  3CRR A;  4YJ2 A;  3ZJZ A;  3JD2 A;  1OHH G;  3SR2 C;  4JAU A;  3EHB B;  2H94 A;  1U97 A;  4GKJ O;  1ZLZ A;  3HKD B;  2E76 B;  3AG3 C;  5B3S B;  3TGU H;  3AG4 B;  1WB8 A;  2UXB B;  4DR2 B;  4O4H A;  2ZDI C;  2NR5 A;  3B8N A;  3ABL C;  3T1C A;  4ICG A;  5JJN B;  3SYQ A;  1XUQ A;  5ITZ B;  3ASN B;  1PNL A;  2JS3 A;  1IBK O;  2EIJ B;  3ASO B;  2AW9 A;  4O2A B;  1VF5 B;  2UU9 B;  4UB6 Z;  3VBB A;  3FAV B;  1BQ0 A;  1Q86 W;  4D7T A;  1B6Q A;  5B1A C;  1XMO O;  4TV8 A;  1JMK C;  3UQ8 A;  1NTZ H;  3UKM A;  1MG1 A;  2KQX A;  1FFT B;  1SRY A;  3F7Y C;  3FB8 C;  2DQ0 A;  1FJG B;  2FL4 A;  1OCZ C;  4MW8 A;  4IYH A;  1MSD A;  1AIL A;  3ABT A;  4EB6 A;  1N32 B;  3AG2 C;  1HNX O;  2ADP A;  3LUT B;  2IM9 A;  2WLI B;  1KQS U;  2W0X A;  3TXS A;  5EIB D;  1YJ9 V;  4J9Z B;  2CUG A;  2EZO A;  3RYH A;  2BTQ B;  2QE7 G;  2A06 H;  4U7O A;  1W0J G;  3U10 A;  2JRI A;  4Z1V A;  3K79 A;  1HNW B;  4JI4 O;  4LC1 A;  3CWB H;  1YDX A;  3TJT A;  3GVM A;  2WA4 A;  3K58 A;  3DTU B;  4X62 B;  4I7Z B;  1SQG A;  1K92 A;  1A32 A;  5LOV A;  1QLE B;  1QLN A;  1NI8 A;  1K8A W;  3TET A;  5KAF Z;  4NTX A;  1LUW A;  3F5T A;  5L3F A;  2KSD A;  3JD0 A;  1D5A A;  1KP2 A;  2QM4 A;  4WFF A;  2Y0I A;  4LFA B;  3ETE A;  2YEV A;  4MVQ A;  3RGB A;  3OD4 A;  4DV1 O;  2P22 C;  1N34 O;  2R9A A;  4JZG A;  4DV3 B;  4HNA A;  3ML0 A;  1CEZ A;  3CJH B;  2B5U A;  2EBO A;  4NTY A;  1SQX H;  2PY5 A;  2LFR A;  4YY3 B;  1H2N A;  1RM1 C;  1XI1 A;  3B77 A;  1HNZ B;  4JI3 B;  1SES A;  3RWR D;  3OGC C;  2CE4 A;  3BA8 A;  5B1N A;  5LL6 Y;  1V55 C;  2OIE A;  3ETQ A;  1RSO A;  3IJ4 A;  4DR4 B;  5BZB A;  4JV5 B;  4X1I A;  3AG1 B;  1S76 D;  3T1H B;  3JSN A;  4PEL A;  3K5M A;  3T1Y O;  3L73 H;  1NR1 A;  3AG7 A;  3CCM V;  4LNU B;  4H0L B;  1VQ6 V;  2XT9 A;  4B3S O;  4UVC A;  3ZMZ A;  3IFX A;  3ZED A;  5CBH A;  3HKB A;  2F43 G;  2RNB A;  3E22 A;  5EZY B;  3E8H A;  4IL6 Z;  1NBM G;  1WB7 A;  1VF6 C;  4GLX A;  1G1X B;  1H2M A;  1OCR C;  4GX2 A;  1S5H C;  3L9D A;  1K7D A;  2HVJ C;  2ZM6 O;  5LP6 C;  2F1M A;  1SQF A;  3MDS A;  3AK3 A;  1FFX A;  3WG7 B;  1YJW V;  4B3M O;  1P7B A;  4DUY B;  3FB7 C;  2JJ1 G;  1PL4 A;  4U3J B;  2WLL B;  4DYL A;  4ASU G;  3JD1 A;  3J81 N;  3P30 A;  1P49 A;  1S77 D;  5L3B A;  5LHI A;  3LDC A;  3D36 C;  3DGE A;  3ZMT A;  4JI0 O;  2EIN C;  1V9P A;  2QM8 A;  1H8H G;  2QWP B;  5KHG A;  1QHT A;  2ETN A;  1JJO A;  1SKV A;  1M56 C;  2F4V O;  2EZP A;  1Y4M A;  1THZ A;  5EYP B;  4DK1 A;  1NZ6 A;  4K0K O;  2QTO A;  5IDJ A;  2Y4T A;  1FAF A;  1CPY A;  4G2K A;  5CA1 A;  2PZS A;  4IHJ B;  2Q0A A;  3BVO A;  3ZHT A;  3JAL A;  4X1Y B;  4GZR B;  3NXS A;  1WJZ A;  1L8D A;  4X66 B;  3Q4H A;  5JVD B;  4DV5 O;  5C8Y B;  3ZRV A;  2UXB O;  3B4S A;  1KYO F;  4LH7 A;  2FB5 A;  3AG3 B;  1K3E A;  2JS5 A;  4NXM O;  2UU9 O;  2RQ6 A;  2YC0 A;  3K5L A;  3DC5 A;  2ZE6 A;  1FXK A;  4PI2 A;  4FFB A;  3ABL B;  4RQF A;  3ABK C;  3CSX A;  4E2L A;  4GKJ B;  4LF6 O;  2QWQ B;  2GV9 A;  3SYO A;  2LFS A;  1IVS A;  1W59 A;  1T5E A;  4NYK A;  4YHH O;  1FJG O;  2L35 A;  5GON B;  3K0G A;  3HKC A;  1GH6 A;  1R6T A;  5B1A B;  4ZKI A;  1KUQ A;  1W2B U;  4FVM A;  1N32 O;  1Y76 B;  2IBZ H;  4IIJ B;  3OEE G;  2F23 A;  2BE3 A;  4O2B A;  1AB3 A;  1WPX A;  5FNV A;  1IBK B;  1AJQ A;  2Q6A A;  3M8A A;  3W7U A;  1OCZ B;  4CH6 A;  1NS1 A;  4A5U B;  3FB5 C;  3UO3 A;  3B2E E;  4OPA A;  3AG2 B;  5AG2 A;  1TGO A;  1XHX A;  3JAW A;  4KXR A;  1ROP A;  2EIK C;  1HNW O;  2EIL C;  3CRM A;  4DV0 B;  3SJB C;  2B1G A;  2ZIO A;  2GUZ A;  2YXY A;  5JJJ B;  1F4M A;  3CCL V;  2GDS A;  4X62 O;  1HNX B;  3K08 A;  3FX7 A;  2YI8 A;  3AK2 A;  3SJQ C;  4FJC C;  1S72 V;  2Q68 A;  2XOK G;  2AHY A;  3VQV A;  2EJR A;  1H8E G;  4UCR A;  3DXR B;  4I4T A;  2M7W A;  2CTP A;  4LFA O;  5IYD O;  3WB1 A;  5DN6 G;  2ZXW C;  3E89 A;  3GWK C;  2VQE B;  3JAR A;  3H1H H;  5DED A;  2YIC A;  4GKK B;  3CMA V;  3CC4 V;  2A7W A;  4X9Q A;  2WAM A;  2UXD B;  1VQL V;  1IX9 A;  5CB4 A;  1YI2 V;  1ZL8 A;  4EFB A;  5FPO A;  4J7Z A;  2UXN A;  5HFL A;  5BXZ A;  4X1K B;  4ZI7 A;  4JI3 O;  2HP8 A;  2RCV A;  2ILM A;  1KEC A;  5JH7 B;  1NJI W;  4X20 B;  2JGD A;  1XL4 A;  3K5O A;  1QVG U;  4OXS A;  2OTJ V;  1WP8 A;  1RM1 B;  2LJ2 A;  4B3R B;  4UV8 A;  3BCC H;  2M6Y A;  4JV5 O;  1SC5 B;  4AIL C;  3OE7 G;  3M99 B;  4UB8 Z;  4XDK A;  1V55 B;  4U7N A;  5EBW C;  1GTO A;  4FM0 A;  3RBZ A;  2YXL A;  3E86 A;  5J2T B;  1N36 O;  1XOU A;  2ZR2 A;  5KUM A;  4FM1 A;  3EXA A;  2Z3Y A;  2H8P C;  1M90 W;  1Q6H A;  4WFB V;  4NB5 A;  1TUB B;  4DR3 B;  2A79 B;  2X0L A;  1AI6 A;  2P4K A;  1O9H A;  3T1Y B;  1QVF U;  5B66 Z;  4TOI A;  1K33 A;  1FYJ A;  1KKD A;  3D8C A;  2ITC C;  4DUY O;  1VQM V;  4B3S B;  5LXT B;  1E1R G;  3T4D A;  4Z1M G;  5K1P A;  1N8R W;  4TV9 B;  2QSA A;  3RT3 C;  5LP6 B;  1JA8 A;  3WG7 C;  3K9S A;  4N23 A;  2OIG A;  3HKE A;  1MA1 A;  3SPG A;  2IU0 A;  1GAX A;  4DXW A;  1D5N A;  1JX9 A;  2LW1 A;  4H44 B;  2WWW A;  1E1Q G;  4BW5 A;  4J41 A;  3CPW U;  1ZAU A;  2YIB A;  3CYO A;  3RYF A;  4HYO A;  2EIN B;  1J5E O;  1LUV A;  3CME V;  4PV1 B;  1HDJ A;  3BY6 A;  4W4K A;  4TWK A;  2DWE C;  4JAV A;  1M56 B;  2OTL V;  2JEX A;  1YXB A;  4PDV A;  3HKD A;  1BS3 A;  3H1J H;  4X66 O;  1KC8 W;  4AQY O;  4JI0 B;  2ZE7 A;  1I94 B;  3SGI A;  1F51 A;  1IXB A;  3LDE A;  3IAY A;  1SF9 A;  1URF A;  2F4V B;  1NKD A;  1KU9 A;  3B09 A;  4K0K B;  5ITZ A;  4X64 B;  3CXC U;  4TUY B;  2BCC H;  5LHG A;  5IYZ B;  4FLZ A;  4O4I B;  4MVR A;  3CS5 A;  1BL8 A;  2XAH A;  1XDC A;  3TK1 A;  1YTF B;  4JZ2 A;  2OWO A;  5F2V O;  3K3W A;  1ENV A;  1Z5W A;  4DV5 B;  3A8T A;  3QNE A;  1PPJ H;  4JGS A;  4QE9 A;  2DW4 A;  1XQ8 A;  3C3S A;  1KKC A;  4D7S A;  3H01 A;  2B1I A;  2ZKO A;  1VAR A;  5BMV B;  3ABK B;  4F6R A;  4NXM B;  2R9I A;  5B5E Z;  1EZJ A;  5LGT A;  1YF2 A;  4CH5 A;  4HZ3 A;  5KAI Z;  5E1A C;  5H6Q A;  3NR7 A;  3N27 A;  4LF6 B;  1K97 A;  4I0X B;  4YHH B;  4DV0 O; 
#chains in the Genus database with same CATH homology
 2JRI A;  1R1B A;  4NXM O;  2UUC O;  4LF7 O;  4LF5 O;  4JI4 O;  1F7Y A;  2UU9 O;  4DR3 O;  5IWA O;  1DK1 A;  4DR4 O;  2DJV A;  2UUA O;  2N74 A;  5LMU O;  3T1H O;  4JI8 O;  5H5N A;  4DV4 O;  3O65 A;  5BXZ A;  4JI2 O;  4LFC O;  4JI3 O;  1J5E O;  4LF6 O;  4LF8 O;  4YHH O;  2LW7 A;  1G1X B;  3JAM N;  2Z0A A;  1IBM O;  1A32 A;  1XNR O;  4JYA O;  1FJG O;  4OPH A;  3R66 A;  4JI7 O;  4LF9 O;  1KUQ A;  1R6T A;  2ZM6 O;  4X66 O;  4LF4 O;  4DV7 O;  1N32 O;  3F5T A;  4B3M O;  2DOS A;  5IT9 N;  4DUZ O;  4AQY O;  4JI1 O;  4JV5 O;  1AB3 A;  4GKJ O;  2E5L O;  3M8A A;  2VQE O;  5BY1 A;  5A2Q N;  3J81 N;  1NS1 A;  4A5U B;  5BR8 O;  4DR1 O;  4GKK O;  4DV2 O;  1N36 O;  5FLX N;  4OPA A;  1D2D A;  4DV1 O;  1N34 O;  1XMQ O;  1IBL O;  1HNW O;  2UXD O;  1X59 A;  4JI0 O;  4DR6 O;  4DR7 O;  4KHP O;  1IBK O;  5LMN O;  4NXN O;  1FKA O;  2HHH O;  3J80 N;  2F4V O;  4DR2 O;  1HR0 O;  4K0K O;  1XEQ A;  2VQF O;  1XNQ O;  1XMO O;  4X62 O;  1YZB A;  2FKX A;  4JI5 O;  1N33 O;  3J7A U;  4DV3 O;  2ZKO A;  5LL6 Y;  4B3R O;  1FYJ A;  4DR5 O;  4DUY O;  1AIL A;  1I94 O;  4OX9 O;  4B3T O;  4YY3 O;  4JI6 O;  4DV5 O;  1HNX O;  4LFA O;  2UXB O;  1HNZ O;  4DV6 O;  3RT3 C;  2UUB O;  2AGA A;  2UXC O;  4LFB O;  3SDL A;  3T1Y O;  4X64 O;  3OTO O;  4DV0 O;  4B3S O;  4X65 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...