2UUBO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uubO00
5A2QN 3T1HO 4B3TO 3SDLA 4DUZO 4DV5O 4X64O 4DR2O 4GKKO 4LF7O 1IBMO 1R1BA 4X62O 2FKXA 2AGAA 4DR3O 2HHHO 2UXDO 4LFAO 1IBKO 4LFBO 5H5NA 4JI8O 4LF4O 4KHPO 4NXMO 1N36O 2UXCO 1XNQO 1XMOO 4B3SO 4X65O 2ZM6O 2UUAO 4JI7O 1X59A 4JI6O 1R6TA 5BXZA 4LF9O 4JV5O 1KUQA 5IWAO 1A32A 4DV4O 4DR4O 3O65A 3J7AU 4X66O 4GKJO 1AB3A 3RT3C 4B3MO 4DV0O 4OPHA 1NS1A 3F5TA 3R66A 5BR8O 2UUBO 3M8AA 1J5EO 1N32O 4DV3O 3OTOO 2Z0AA 1XMQO 4JI4O 4LFCO 1XEQA 5LMUO 2E5LO 1HNZO 2DJVA 1D2DA 2F4VO 1DK1A 5LMNO 5LL6Y 2VQFO 2UUCO 4DR6O 4DR7O 4B3RO 2DOSA 4JI2O 4JYAO 1AILA 2ZKOA 4JI3O 2UXBO 5IT9N 5BY1A 4A5UB 3T1YO 1HR0O 5FLXN 4NXNO 1N34O 1HNXO 3JAMN 1FJGO 4YY3O 4DR1O 4LF6O 2VQEO 4LF8O 1XNRO 2UU9O 4DV2O 1HNWO 2JRIA 4LF5O 4YHHO 1N33O 4OPAA 1FKAO 4JI5O 4K0KO 1F7YA 4AQYO 3J80N 1G1XB 1YZBA 4JI1O 4JI0O 3J81N 4DV1O 1FYJA 4DV7O 2N74A 4OX9O 1I94O 1IBLO 4DUYO 4DR5O 2LW7A 4DV6O
chains in the Genus database with same CATH superfamily
2WSSG 4CH5A 1K7DA 1XOUA 1IBMO 5LHGA 4X62O 3JAKB 2X6BA 5CBHA 2PF4E 4DRXA 3MAQA 2UXDO 4JF3A 1NR7A 4LFBO 4JI8O 1K5SA 2YEVA 5HFMA 2RCVA 2DYSB 2EIKC 2L35A 4LF8B 2B1IA 5KA6A 3ZRWA 4O4HA 3D3IA 1MG1A 3JD3A 1FFXB 4QJFB 5C93A 2RDCA 1IBLB 3X2QC 1A32A 2WLLB 3G71V 2IJHA 3W7TA 1BZKA 3O65A 2XUMA 5LHIA 1AB3A 3AG7A 2KSDA 4LNUA 1PV0A 1HW7A 2QA4V 2HFEC 1W59A 1TVKB 5JJNB 3JAWB 1RFYA 5CA3A 1JVMA 4TSFG 1XMQO 1M57B 3Q4HA 4KHPB 4W4LA 3SPHA 5JH7A 1WP8A 1XMOB 4O4LB 4U3JA 3L75H 4B3RO 3FAVA 3K5NA 2ZINA 3CRAA 4JTCB 1PPJH 2Q7HA 1CPYA 3E8FA 3K0DA 1MNGA 3W7UA 3CSXA 1HWYA 1GO3F 1SA0A 4DW0A 3IC9A 1N32B 3JSNA 2NN4A 2WLJA 1S77D 1AROP 1V9PA 1Y76B 3CCSV 2Y4UA 3T1HO 1QR8A 3BEHA 3SGIA 4IT5A 2XTAA 3AG2B 4OGQB 1BS3A 1OCZC 1HP8A 1KMIZ 3FX7A 1RM1B 5L3BA 1W2BU 2JS3A 4CH3A 4TV8A 3WG7C 1FAFA 3E83A 1ZAUA 2BCCH 1N34B 1Q6UA 2GV9A 5K1XA 1H2GA 1X59A 4DK1A 4FLWA 2WLKA 1QVFU 3ZN0A 5KA5A 4I9WA 5B1NA 2DWDC 3CE2A 4QPJA 2V1DA 2X6AA 3EVKA 1OZ0A 4DV6B 2YIDA 4B3MO 1E1QG 5KUMA 3ZN1A 3D36C 2LQTA 3EXAA 4IIJB 3B4SA 4GCZA 1AVMA 2Y48A 4ICGA 3OTOO 1R3KC 2Z0AA 4LP8A 3CD6V 1EZVH 2P6JA 2PGGA 3HKEA 1ZLZA 5IJ9B 1RSOB 2WAMA 2RQ6A 4W4KA 3ABMC 3CXHF 2Q4PA 2IJIA 4X65B 5DN6G 4O4IA 1K73W 2IH3C 1SQXH 4A5UB 3QTCA 5CBFA 2R9IA 4LF4B 4X89A 2EX3A 3VQWA 2LFRA 3ASOB 4J11A 4YHHO 5BR8B 5L3GA 4AILC 1SRYA 3C3SA 1PP9H 5JJEB 4X1KA 1OCCC 3BA8A 1L1FA 3ASNB 3UKMA 1O9GA 3M99B 1Q6HA 4MVUA 4RUFA 1JFFB 5IDJA 1YXBA 3LNMB 2AGAA 4ZOLB 1SZXA 4N21A 4JGSA 1QCEA 2DYRB 4WF9V 1TAEA 1TUBA 4I0XB 2P06A 3TK1A 3K08A 4O2AA 4I4TA 1S5JA 3ETEA 4JI6O 4LF5B 2Q69A 3RVZA 2LJ2A 4Z1VA 1KC8W 2ZIMA 4JI1B 1KUQA 5B5EZ 4XDKA 3K59A 1K8AW 3E35A 4RO2A 1KU9A 3CJHB 5J2TA 2P7TC 1COWG 4GZRB 1I7FA 3G80A 2ZDIA 4XDJA 4DR1B 1R3JC 4I50B 4WFBV 1ZSPA 5LYJB 4PDLA 2LFSA 1AP5A 1IVSA 1QLEB 1WB8A 3ZX6A 4TT3G 3ABTA 4QE9A 4GX5A 2B1GA 4JYAO 4O2BB 5IWAB 2QWQB 3AG4C 1UJWB 3M7MX 2R70A 2CTQA 3R65A 3RYHB 3WB0A 3G67A 3N2KA 2UXNA 1YTFD 3ABUA 2N74A 5AG2A 1XQ8A 4LBEC 4LF9B 4WBNA 5D5QA 4EEQA 5LMUB 1ROPA 3SR2C 3THOA 1SQGA 1NJIW 4E4EA 2C2AA 1EM1A 3FKSG 4B7KA 1U96A 5CA0A 5EYPB 1YDXA 2JGDA 4FMTA 1N8RW 5CN0A 2Q73A 3T1YB 2Q8VA 3ETQA 3HPLC 1XNQO 1UFIA 4B3SO 2EINB 4F6EA 1G4YB 2XOKG 3E86A 2OTLV 1P7BA 4TQDA 5CMUA 4FFBB 4FM1A 1YVWA 1VQ9V 4WCEV 3TXSA 2QM4A 1K4CC 2H8PC 4JI3B 4YJ2B 1JMKC 1LNQA 3CCRV 1IBMB 4F4LA 1XHZA 4X62B 3OW2U 1M90W 4BWAA 3HKDA 2O57A 2UXDB 1DLBA 1TUEB 4LFBB 2EIKB 4JI8B 4DO2A 5LP6A 4K0KB 3ETGA 1F51A 3L73H 1BL8A 2Y69C 4LWSB 1P84F 5LL6Y 4DR6O 3JAKA 4HZ3A 3X2QB 3G6EV 1IXMA 1BE3H 2CGNA 3JATB 4R50A 3K58A 1M4UA 4X1IB 2EIJB 4UFZA 5H6QA 1AI5A 5LGNA 3P32A 3JAMN 1Y6XA 1FJGO 1Q81W 1VQ7V 5L3CA 3QNEA 2JEXA 4MVRA 1T5EA 3H1IH 4PELA 2FB5A 2BE3A 2QWOB 5EZYB 3LDCA 3L71H 4MTXA 1XMQB 2WLLA 3CPWU 3IGAC 1Q6IA 1VMGA 2MK3A 3SJCC 4GKKO 2IJJA 4WFAV 1K34A 2LW1A 2GTSA 4FK5C 1SC5B 4B3RB 1PNKA 2PYJA 4K8XA 3OGCC 3KG2A 1NT2B 3HKCB 3EFFK 3CXCU 2HKOA 3APOA 1Q3EA 2JEUA 2AXTZ 5LA6B 2YICA 2EILC 1NTKH 5IYZB 1H2NA 5BXZA 1JOYA 4X20B 4F6RA 1H38A 3LSQA 1CP9A 1GH6A 1NU1H 4NB5A 2PUSA 3T1HB 1VQOV 2GUZA 3CC2V 5JVDB 4OPHA 3ZMSA 1SQPH 3WG7B 1D5AA 3R66A 3KZIZ 5GW7A 5JWPA 1OV9A 1AJNA 3DC5A 5FPRA 4CS4A 1BCCH 1Y76A 4HBNA 1JJ2U 4J7KA 1HNZO 3K5MA 3P3NA 5LMNO 2VQFO 4DR7O 3H9VA 2ZKOA 3OEHG 2Q5ZA 2ITDC 1OCRC 3T4DA 4MTFA 5KMGA 1HNXO 1AI7A 1GM8A 2QWRB 2K9PA 4B3MB 1P7GA 3H01A 4Q6GA 2MW2B 2VQEO 4CC5A 2YIBA 1WA8B 1OCOC 3AG1B 1N33O 4ASUG 4ZIBA 3J80N 3OTOB 4DV1O 3OT7A 3WU2Z 3ABMB 4OX9O 3OMAB 2ZE5A 1FXKB 3P3PA 2Q0OC 3OR6C 4DV5O 4MW8A 5KUKA 1QHTA 4IIJA 1JPXA 1AR4A 3JD0A 1LR1A 4RWUA 3C90A 4NVPA 1KP2A 1H2MA 2EZOA 3L9DA 1RSOA 2F95B 4NXMO 1VQ8V 3FB5C 1WN7A 4ZI7B 1KP3A 4CZZA 1EN5A 1VF5B 4CH6A 4PDRA 5LOVA 3ZS8C 4YHHB 2OIGA 1K97A 3CCMV 1KECA 1THZA 5J2UB 3CWBH 3OGIB 4HAMA 3K0GA 3ABKC 2ZD9A 3CYOA 2EULA 3TCUA 2Q6AA 1NS1A 2HR3A 3LUTB 3VQYA 5B3SC 1I08A 2DQ3A 4DV3O 4DV2B 2HLDG 4IGGA 2E74B 5H2FZ 5B1AC 3SJAC 3WB1A 3CB2A 4IHJA 2E5LO 4JYCA 3P30A 3HKBB 3EHBB 4JASA 4JI6B 1PNLA 1JFFA 1NVPB 4X64B 5B1BC 2DOSA 5IE9A 3RFRA 4HNAA 1BT8A 1IDSA 2ITCC 4L8JA 2OCHA 1BSMA 3O9OA 3K5OA 4I0XA 3BY6A 2JGUA 2BSKB 1Q5OA 4LF6O 2XAGA 3OMIB 4U7OA 4UVBA 3BFRA 2Q7EA 2LP7A 4UB6Z 3SYOA 1JQ0A 1UPGA 4JI5O 2H3OA 3J81N 4QPKA 4DV7O 3I5DA 3CJHA 5LBQA 1ZL8B 1EBOA 4X9QA 3CCQV 3H1LH 1QU7A 2IBZH 3SDLA 4DUZO 2YXYA 4LF7O 2YXLA 4X66B 1Z5VA 1ZX3A 1FXVA 4I50A 4UV8A 1E79G 3AG4B 2JIZG 4DR3O 4JYAB 2Y0PA 2DW4A 1W0JG 4ABMA 4LFAO 3N2GB 4X1YB 4XDLA 5EBWC 1M1KW 4ZHQA 2ZM6O 3HB3B 4UVCA 1YSCA 2ZDIC 1S72V 4O2BA 4FPPA 1WPXA 3SPJA 3G6BA 4GX1A 2DWEC 4X88A 3IJ4A 4R7CA 5FNVA 4DV4O 3RYFA 1NTMH 3RYHA 1YITV 2XAQA 4O4JA 4JAAA 1P49A 2GDSA 2XAJA 1VF7A 5EIBD 4KUMA 1J5EO 2XAFA 1L0LH 2UXXA 4LCUC 1FD9A 2A7WA 2V7QG 4JAUA 2E75B 4LFCO 2KQXA 3OAAG 1WAZA 1SS3A 1XNQB 2VWJA 1XHXA 2HVKC 2KKWA 1WJZA 3JALB 3ZHTA 1KB9F 3K04A 3E22B 2E3CA 3ABLC 3CC7V 3B8NA 2WLHA 1SF9A 4B08A 3B2EE 1TA8A 2M7WA 1NKDA 2ETNA 1QQCA 5BZBA 3I56V 2BTQB 2Q9LA 1SETA 2UU9O 2DMXA 2P67A 2JRIA 1N0NA 5KX5A 4FFBA 1NR1A 3E8HA 2KG7B 4I55B 5JCOA 2ZR3A 3SPIA 4DUYO 5B1OA 4MTOA 4DR5O 3JARB 5LGTA 4AI8A 1YTFB 1I5XA 1R1BA 1CEZA 5KHJA 2ILMA 4FLZA 1KKCA 3ZJZA 5DM6V 4WFFA 1PL0A 4LWSA 2QKAA 4PV1B 2EJRA 1YIJV 3H1KH 5EIBC 2YEVB 4PA7A 3OM3B 3LDEA 4TUYB 1M56C 3STLC 4MVMA 5FPOA 3JD2A 5GONA 1VF6C 3ZRWB 4YY3B 2GSMB 4GX0A 4MVQA 4PA6A 3ZHUA 4MT8A 1ORQC 3BAAA 3F7VC 2CTPA 2EILB 3CC4V 4BIZA 1SQVH 3LNNA 3E8GA 1S5LZ 4TOIA 2PY5A 4ZKIA 4H44B 2Q7GA 1VP7A 2BOBC 1ZTEA 5IT9N 5BY1A 4J42A 4WFGA 2E76B 1S0VA 3GB7C 2ARHA 4K35A 5LA6A 3S3WA 4MVOA 4YXWG 2QTSA 2P90A 2YIBD 5F2VO 2ZE6A 5IYZA 3K5LA 1N36B 5EK0A 3VQVA 3LSSA 4OPAA 1Y74B 4P2ZA 1FKAO 2IM9A 3AK2A 4AQYO 3AG3B 2CUGA 1PNMA 4QIWF 3TETA 2WLIB 5B66Z 1Q90D 5JVDA 1HNZB 5CA1B 5DECA 2ZE7A 4UCOA 4TWKA 2VQFB 2X6CA 2VWKA 4P30A 4DR7B 1SQBH 3OUSA 2HHHO 5ITZB 2DE0X 4H0LB 1BHBA 4I5SA 3IAYA 2ZCEA 2QDOA 3E2EA 1S3JA 2OWOA 1OCOB 1M9NA 1RP3B 3DXRA 2UUAO 4JPRA 2VQEB 1FPOA 4IL6Z 4J80A 1R6TA 1N33B 1SZTA 2CTWA 4PD4F 3F5WC 4PHZA 4JV5O 1LUWA 2ZR2A 4YIOA 2LO1A 3AK1A 2UUCB 4BIOA 5IJ0A 1AJPA 1B06A 4DR4O 4P9PA 2CE4A 2PI4A 1SKVA 3RT3C 4DV5B 2GTAA 3OMNB 5EBMC 3OUFA 4DV0O 5E1AC 1VQKV 1RPOA 1WA8A 3AG2C 2UUBO 2JVDA 1RM1C 4LC1A 2QKSA 2CTRA 1AJQA 1FXKA 4NXMB 2LGWA 3IFXA 3UO2A 3GWKC 3UT5A 4D6TH 4BW5A 2F23A 2QTOA 2F4VO 3K06A 5IY5C 3CCJV 3UM7A 2ZXWC 4J9YB 4DW1A 4JI2O 2YSUB 5BMVB 2Y4TA 2ZQMA 3ABKB 3STZC 4NXNO 3BVOA 4ZI7A 5JQGB 5B3SB 4FM0A 1R73A 1XNRO 2B5UA 4JTAB 3CRQA 4UCSA 1H8HG 1SQQH 4YIPA 2D2CB 3ZIAG 1K4DC 4DV3B 5J2UA 1NH2B 3RW0A 1DF4A 2ADPA 3A2FA 1F4MA 1V54C 3F7YC 2PI5A 3SJQC 2OCCC 5B1BB 4DR2O 2AZ2A 5L3FA 2IJKA 4OXSA 1OHHG 3ZBHA 1R6NA 2CAZC 3ETDA 1MSWD 3ZMTA 4LF4O 2W0FC 1FFXA 5KHIA 2UXCO 1H8EG 2PTMA 3TGUH 4EFEA 3HKBA 4YJ3B 4LF6B 3UQ8A 1R3LC 4J41A 3ZEDA 4JI5B 1YF2A 1VQLV 4DV7B 1TVKA 3FB8C 3JAWA 2IH1C 5LXTB 2R72A 3RYCB 4DUZB 5IYDO 1WLEA 4O4LA 4WFHA 1YJWV 1NTZH 2AW9A 1BHAA 4DR3B 3JASB 1U97A 2DYRC 1XEQA 1SERA 2ZM6B 2D3OW 1EN4A 4GT1A 4C7UA 3APQA 1OCZB 3K9SA 4UCUA 3ZMVA 3AEIA 1EFRG 2XASA 4NYKA 1HR0O 4X1YA 4DV4B 3CCLV 5GTIZ 4DR1O 1XREA 4KFMA 4RAIA 1M93A 3FFQA 1MZFA 4NTYA 2XHBA 1Q82W 3JCZA 4PI0A 3BA9A 2QR4A 1J5EB 2WPDG 1RPRA 4JI0O 1FYJA 1HDJA 1BMFG 4LFCB 4FLTA 3SPCA 2RMKB 3TJTA 4KXRA 5L3DA 3N2KB 2CH7B 3KCXA 1Y67A 4WBNB 3PJSK 4NKGB 1VEWA 4FZ1A 2CGOA 4FZ0A 1GM9A 1K92A 2YS8A 5CA0B 2JK5C 2ODMA 4FLYA 1Q8IA 2HJDA 4PJ0Z 1KYOF 1US6A 2NR5A 1S5HC 2WLNA 3JALA 3L72H 3E22A 4BR6A 1P4RA 4R8CA 1I0HA 4D7TA 4LF9O 1YJ9V 2BOCC 1I5YA 4DUYB 3J7AU 4DR5B 1V55C 3CS5A 1JR9A 1XILA 5IJ9A 2X7RB 1GKFA 4LH6A 1JJOA 2JS5A 5EBLC 2PYLA 2KG7A 4I55A 1WNSA 4Z2WA 1OCCB 3OTFA 4PDVA 3I55V 3JARA 2FMLA 2N05A 3T4ZA 3CX5F 1YEWA 3A0HZ 4NTXA 2BTOA 1N0JA 3HKDB 2A0LA 2XNDG 3KKYA 4JTDB 4I7ZB 1JCHA 4JZGA 1X4TA 2GBOA 1M56B 2Q67A 2VRZA 4JI3O 5JCOC 1GMGA 1K33A 3NXSA 4GLXA 3BHPA 5C8YB 3S3XA 3RN4A 4X8AA 3FB6C 1XUQA 2AHZA 3RBZA 1AI6A 3WFVA 1KQSU 4FLXA 1G8MA 2Z5UA 3MD0A 5JJJB 5KLVH 4K0KO 4FFKA 1YZBA 1VQPV 1MZEA 2QGNA 3QF7A 2P5OA 1I94O 4ZOLA 2V4DA 2OT5A 4TUYA 2F1MA 4B3TO 4RQFA 2AZ0A 2CK3G 2R9RB 1GK9A 2JDIG 4LH7A 4J10A 3T1CA 1B04A 2CDYA 4UXNA 4CS2A 2FYUH 3MHSC 2EIJC 5H5NA 1IURA 1PL4A 2XAHA 5H9CA 4CH4A 3CHXA 5K1PA 3CRCA 4AQYB 4FM2A 3RWRD 3SJBC 3VOUA 3CCUV 1YJNV 3K79A 3VQXA 4U7NA 4TV9B 4JYBA 2QM8A 5LYJA 3A0RA 2ZE8A 1Q43A 1IX9A 4F6RB 4CBCA 1Y74A 2HHHB 1W0KG 5L3EA 3G4SV 4QE7A 3K03A 1F23A 2GUZB 2LGQA 2PZSA 4UUJC 2WLIA 2F43G 5A9GA 5CA1A 1MA1A 1Q86W 2UUAB 3FD9A 5TISZ 4BAYA 4D7SA 4ZBMA 4EB6B 5ITZA 3W7XA 4JV5B 2B9ZA 1SESA 1AP6A 4UCVA 2UXBO 3BRCA 4MW3A 3SYAA 4DR4B 3TXQA 4JZ2A 3RYIB 1YI2V 4DV0B 1VQNV 3D8CA 1HNWO 4NTWA 1ZUQA 4B3SB 2UUBB 5KMGB 3ZHVA 1G1XB 5EYPA 5IYBO 4J7JA 1JA8A 3OD4A 1B6QA 5IY5B 2OTJV 5LHHA 4FLUA 2ZXWB 3KCYA 2ZIOA 2EIMC 5E79Z 2F4VB 4G28B 4K3AA 3A0BZ 5DEDA 3K9AA 4RUEA 4HYOA 2HVJC 4JI2B 2P4KA 2WA4A 1BQ0A 1GRJA 1GN2A 1IBKO 4NXNB 1M5IA 2KB1A 2QKCA 1GAXA 4H37A 3CCVV 4TQFA 1O9HA 3QO8A 1XNRB 2Y69B 4JI7O 1NVPD 4YJ2A 1V54B 5CB4B 3AG1C 3QO5A 5BMVA 2WA3A 3FB7C 2OCCB 4PI2A 4DR6B 1KBHA 1GN4A 4UCTA 2RNBA 1XBLA 1LUVA 2QWPB 5JQGA 3ZHSA 1FXKC 3L74H 4GKJO 1E1RG 5LOVB 2R9AA 4DR2B 1JX9A 3U10A 4MSWC 1FJGB 3F5TA 2N04A 3LDDA 3VBBA 4DRXB 2HEPA 3B40A 1J95A 4MVSA 4JI4O 3JATA 1GN3A 3GWOA 1QNMA 2ZT9B 4X1IA 2DN9A 2UXCB 2W0XA 4KP4A 2QWNB 3ZRSA 2EZPA 3QO7A 1WPBA 5LP6C 4U3FH 4FLVA 1ZWIC 1VIBA 4J7ZA 1DK1A 4GKKB 4WFEA 4O4HB 1AILA 4IHJB 1NZ6A 3RGBA 4BW9A 1FXHA 5EZYA 2NLJC 4MVZA 2YIAA 2IW5A 3FYEB 4YJ3A 2F66C 4LNUB 1GN6A 4LF8O 3ICXA 5D5PA 2RN9A 4DV2O 4HNAB 2DYSC 3A8TA 1XDCA 5KAFZ 2A79B 1F7YA 4L87A 4P9OA 1PM9A 1IBLO 3Q4HB 5LXTA 2LW7A 5JH7B 3RYCA 4X64O 3HKCA 4U3JB 2A06H 3FAVB 3W7SA 3MHHC 2QSAA 3JASA 1HR0B 4X20A 5J9PC 4KHPO 5KHGA 3SYCA 1IZ3A 2A9HA 2W6JG 1XMOO 1M57C 3CP1A 1VARA 4DXWA 4XBFA 2JJ2G 3JD4A 1SA0B 2Q68A 1K9MW 5LMNB 4JI0B 2X0LA 4ZHQB 1OCRB 3L70H 4H13B 1KD1W 4X66O 2YI9A 2JJ1G 2QM7A 3RVYA 1EN6A 1HNXB 2ATKC 1R3IC 2HG5C 2IU0A 4GUNA 3M8AA 5FNVB 1N32O 3RYFB 2M6YA 3OEEG 4TV8B 4N23A 4MS2A 2ZNIA 3C3TA 5KAIZ 4FIPC 4DV1B 4O4JB 3SPGA 1PD3A 4OX9B 1BQZA 1CXZB 4UB8Z 2YXHA 4GX2A 2CH7A 3DC6A 3D36A 3ZCCA 4G2KA 1YCIA 4PA3A 4NR1A 2RJZA 2QE7G 5FL7G 1WB7A 1YHQV 4K8ZA 1V55B 1AI4A 1QR9A 3JCUZ 3K57A 1N34O 1F4NA 1QLNA 2OIEA 3BABA 1MOFA 4JYYA 1NQTA 4IYHA 3UO3A 1TGOA 2VS0A 3SYPA 3AK3A 4FJCC 4R6ZA 1H2SB 5GTHZ 3HKEB 2YUAA 3OFNG 2H94A 1DGSA 1GTOA 4DV6O 1QBZA 2AHYA 5KX5B 3ZMUA 3D3QA 1EZJA 1Q7YW 2A3QA 2FKXA 1DTOA 4O4IB 3K3WA 5B1AB 3JSLA 1XL6A 2QEXV 1BGYH 2OYQA 2Y0IA 3HR0A 4X65O 1PKXA 3IC7A 2E5LB 1VQMV 5LGUA 2HP8A 3ZRVA 2IU3A 1DF5A 4GYCB 4Q20A 1I94B 3U0ZA 5HFLA 4X1KB 1VF6A 3B77A 1G6UA 5C8YA 4H33A 1AR5A 4B3TB 3ZRXA 4I9QA 2DQ0A 3OR7C 3QVNA 1AR1B 3CCEV 4CS3A 4QGPA 5BR8O 1K3EA 3MDSA 4EFBA 3CMEV 1S76D 3W7WA 2WWWA 3ASOC 1Z5WA 3DSQA 4UV9A 5GONB 2Q0AA 1H2LA 1TUBB 2W6IG 1Y4MA 4O2AB 4I4TB 1KKDA 1VQ5V 1D2DA 3U11A 3BPZA 2BSKA 4LF7B 3ASNC 4EKWA 1Z2GA 4MTGA 4UCRA 3GVMA 1WP7A 2YDEA 5J2TB 4QNHB 4YY3O 4LFAB 1ZL8A 1MABG 5IYCO 4LF5O 2Z3YA 3FYIB 4JI1O 4DK0A 4TV9A 2P4VA 4G27B 1MMMA 2YC0A 5A2QN 1H2KA 1FFTB 3N2GA 1OJHA 3CRRA 1B3QA 5EC1C 3H1JH 5KHHA 2ZNJA 2EBOA 4PA9A 3CRMA 1IXBA 3BCCH 1K5QA 3OE7G 1D5NA 2UXBB 4FVMA 2HJFC 1L0NH 1XI1A 3ML0A 1N36O 1URFA 5KHKA 4PA4A 3ZHQA 1NBMG 1MSDA 2NNUA 4B7EA 4E2LA 1HNWB 3PN1A 3ABLB 3H1HH 1QLEC 4EB6A 1FS0G 3ZMZA 1N4CA 3SYQA 2XT9A 5IWAO 2FL4A 4BIUA 3AG3C 2EIMB 3DXRB 2ADQB 3RYIA 3B09A 2F93B 3ZHRA 4CC6A 2GHYA 2EJ7A 2L6LA 3CEIA 4KL1A 1SQFA 5H6RA 2JGDB 3N27A 3NR7A 2WLMA 5IJ0B 3LSUA 2UU9B 3WB2A 1NH2D 2K1EA 4Z1MG 3E89A 1R6KA 3DGEA 4RQEA 1IBKB 4UVAA 5EC2C 2YI8A 5LMUO 4JAVA 2DJVA 3DTUB 3B8MA 2FTKA 4JI7B 2UUCO 1VQ6V 4DYLA 4PDMA 2BTQA 3QG5A 3UCSC 3JD1A 3JYCA 4J9ZB 3T1YO 5FLXN 5CBGA 3UT5B 3CMAV 4GKJB 4AHCA 4IYIA 1GM7A 1NI8A 1QVGU 3E8BA 3T2MA 2P22C 5CB4A 4LR3A 2EINC 1XL4A 1L8DA 2G38A 2QJ1A 4JI4B 1Y66A 1ENVA 5LP6B 1VQ4V
chains in the Genus database with same CATH topology
5A2QN 3T1HO 4B3TO 3SDLA 4DUZO 4DV5O 4X64O 4DR2O 4GKKO 4LF7O 1IBMO 1R1BA 4X62O 2FKXA 2AGAA 4DR3O 2HHHO 2UXDO 4LFAO 1IBKO 4LFBO 5H5NA 4JI8O 4LF4O 4KHPO 4NXMO 1N36O 2UXCO 1XNQO 1XMOO 4B3SO 4X65O 2ZM6O 2UUAO 4JI7O 1X59A 4JI6O 1R6TA 5BXZA 4LF9O 4JV5O 1KUQA 5IWAO 1A32A 4DV4O 4DR4O 3O65A 3J7AU 4X66O 4GKJO 1AB3A 3RT3C 4B3MO 4DV0O 4OPHA 1NS1A 3F5TA 3R66A 5BR8O 2UUBO 3M8AA 1J5EO 1N32O 4DV3O 3OTOO 2Z0AA 1XMQO 4JI4O 4LFCO 1XEQA 5LMUO 2E5LO 1HNZO 2DJVA 1D2DA 2F4VO 1DK1A 5LMNO 5LL6Y 2VQFO 2UUCO 4DR6O 4DR7O 4B3RO 2DOSA 4JI2O 4JYAO 1AILA 2ZKOA 4JI3O 2UXBO 5IT9N 5BY1A 4A5UB 3T1YO 1HR0O 5FLXN 4NXNO 1N34O 1HNXO 3JAMN 1FJGO 4YY3O 4DR1O 4LF6O 2VQEO 4LF8O 1XNRO 2UU9O 4DV2O 1HNWO 2JRIA 4LF5O 4YHHO 1N33O 4OPAA 1FKAO 4JI5O 4K0KO 1F7YA 4AQYO 3J80N 1G1XB 1YZBA 4JI1O 4JI0O 3J81N 4DV1O 1FYJA 4DV7O 2N74A 4OX9O 1I94O 1IBLO 4DUYO 4DR5O 2LW7A 4DV6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q N;  3T1H O;  4B3T O;  3SDL A;  4DUZ O;  4DV5 O;  4X64 O;  4DR2 O;  4GKK O;  4LF7 O;  1IBM O;  1R1B A;  4X62 O;  2FKX A;  2AGA A;  4DR3 O;  2HHH O;  2UXD O;  4LFA O;  1IBK O;  4LFB O;  5H5N A;  4JI8 O;  4LF4 O;  4KHP O;  4NXM O;  1N36 O;  2UXC O;  1XNQ O;  1XMO O;  4B3S O;  4X65 O;  2ZM6 O;  2UUA O;  4JI7 O;  1X59 A;  4JI6 O;  1R6T A;  5BXZ A;  4LF9 O;  4JV5 O;  1KUQ A;  5IWA O;  1A32 A;  4DV4 O;  4DR4 O;  3O65 A;  3J7A U;  4X66 O;  4GKJ O;  1AB3 A;  3RT3 C;  4B3M O;  4DV0 O;  4OPH A;  1NS1 A;  3F5T A;  3R66 A;  5BR8 O;  2UUB O;  3M8A A;  1J5E O;  1N32 O;  4DV3 O;  3OTO O;  2Z0A A;  1XMQ O;  4JI4 O;  4LFC O;  1XEQ A;  5LMU O;  2E5L O;  1HNZ O;  2DJV A;  1D2D A;  2F4V O;  1DK1 A;  5LMN O;  5LL6 Y;  2VQF O;  2UUC O;  4DR6 O;  4DR7 O;  4B3R O;  2DOS A;  4JI2 O;  4JYA O;  1AIL A;  2ZKO A;  4JI3 O;  2UXB O;  5IT9 N;  5BY1 A;  4A5U B;  3T1Y O;  1HR0 O;  5FLX N;  4NXN O;  1N34 O;  1HNX O;  3JAM N;  1FJG O;  4YY3 O;  4DR1 O;  4LF6 O;  2VQE O;  4LF8 O;  1XNR O;  2UU9 O;  4DV2 O;  1HNW O;  2JRI A;  4LF5 O;  4YHH O;  1N33 O;  4OPA A;  1FKA O;  4JI5 O;  4K0K O;  1F7Y A;  4AQY O;  3J80 N;  1G1X B;  1YZB A;  4JI1 O;  4JI0 O;  3J81 N;  4DV1 O;  1FYJ A;  4DV7 O;  2N74 A;  4OX9 O;  1I94 O;  1IBL O;  4DUY O;  4DR5 O;  2LW7 A;  4DV6 O; 
#chains in the Genus database with same CATH topology
 2WSS G;  4CH5 A;  1K7D A;  1XOU A;  1IBM O;  5LHG A;  4X62 O;  3JAK B;  2X6B A;  5CBH A;  2PF4 E;  4DRX A;  3MAQ A;  2UXD O;  4JF3 A;  1NR7 A;  4LFB O;  4JI8 O;  1K5S A;  2YEV A;  5HFM A;  2RCV A;  2DYS B;  2EIK C;  2L35 A;  4LF8 B;  2B1I A;  5KA6 A;  3ZRW A;  4O4H A;  3D3I A;  1MG1 A;  3JD3 A;  1FFX B;  4QJF B;  5C93 A;  2RDC A;  1IBL B;  3X2Q C;  1A32 A;  2WLL B;  3G71 V;  2IJH A;  3W7T A;  1BZK A;  3O65 A;  2XUM A;  5LHI A;  1AB3 A;  3AG7 A;  2KSD A;  4LNU A;  1PV0 A;  1HW7 A;  2QA4 V;  2HFE C;  1W59 A;  1TVK B;  5JJN B;  3JAW B;  1RFY A;  5CA3 A;  1JVM A;  4TSF G;  1XMQ O;  1M57 B;  3Q4H A;  4KHP B;  4W4L A;  3SPH A;  5JH7 A;  1WP8 A;  1XMO B;  4O4L B;  4U3J A;  3L75 H;  4B3R O;  3FAV A;  3K5N A;  2ZIN A;  3CRA A;  4JTC B;  1PPJ H;  2Q7H A;  1CPY A;  3E8F A;  3K0D A;  1MNG A;  3W7U A;  3CSX A;  1HWY A;  1GO3 F;  1SA0 A;  4DW0 A;  3IC9 A;  1N32 B;  3JSN A;  2NN4 A;  2WLJ A;  1S77 D;  1ARO P;  1V9P A;  1Y76 B;  3CCS V;  2Y4U A;  3T1H O;  1QR8 A;  3BEH A;  3SGI A;  4IT5 A;  2XTA A;  3AG2 B;  4OGQ B;  1BS3 A;  1OCZ C;  1HP8 A;  1KMI Z;  3FX7 A;  1RM1 B;  5L3B A;  1W2B U;  2JS3 A;  4CH3 A;  4TV8 A;  3WG7 C;  1FAF A;  3E83 A;  1ZAU A;  2BCC H;  1N34 B;  1Q6U A;  2GV9 A;  5K1X A;  1H2G A;  1X59 A;  4DK1 A;  4FLW A;  2WLK A;  1QVF U;  3ZN0 A;  5KA5 A;  4I9W A;  5B1N A;  2DWD C;  3CE2 A;  4QPJ A;  2V1D A;  2X6A A;  3EVK A;  1OZ0 A;  4DV6 B;  2YID A;  4B3M O;  1E1Q G;  5KUM A;  3ZN1 A;  3D36 C;  2LQT A;  3EXA A;  4IIJ B;  3B4S A;  4GCZ A;  1AVM A;  2Y48 A;  4ICG A;  3OTO O;  1R3K C;  2Z0A A;  4LP8 A;  3CD6 V;  1EZV H;  2P6J A;  2PGG A;  3HKE A;  1ZLZ A;  5IJ9 B;  1RSO B;  2WAM A;  2RQ6 A;  4W4K A;  3ABM C;  3CXH F;  2Q4P A;  2IJI A;  4X65 B;  5DN6 G;  4O4I A;  1K73 W;  2IH3 C;  1SQX H;  4A5U B;  3QTC A;  5CBF A;  2R9I A;  4LF4 B;  4X89 A;  2EX3 A;  3VQW A;  2LFR A;  3ASO B;  4J11 A;  4YHH O;  5BR8 B;  5L3G A;  4AIL C;  1SRY A;  3C3S A;  1PP9 H;  5JJE B;  4X1K A;  1OCC C;  3BA8 A;  1L1F A;  3ASN B;  3UKM A;  1O9G A;  3M99 B;  1Q6H A;  4MVU A;  4RUF A;  1JFF B;  5IDJ A;  1YXB A;  3LNM B;  2AGA A;  4ZOL B;  1SZX A;  4N21 A;  4JGS A;  1QCE A;  2DYR B;  4WF9 V;  1TAE A;  1TUB A;  4I0X B;  2P06 A;  3TK1 A;  3K08 A;  4O2A A;  4I4T A;  1S5J A;  3ETE A;  4JI6 O;  4LF5 B;  2Q69 A;  3RVZ A;  2LJ2 A;  4Z1V A;  1KC8 W;  2ZIM A;  4JI1 B;  1KUQ A;  5B5E Z;  4XDK A;  3K59 A;  1K8A W;  3E35 A;  4RO2 A;  1KU9 A;  3CJH B;  5J2T A;  2P7T C;  1COW G;  4GZR B;  1I7F A;  3G80 A;  2ZDI A;  4XDJ A;  4DR1 B;  1R3J C;  4I50 B;  4WFB V;  1ZSP A;  5LYJ B;  4PDL A;  2LFS A;  1AP5 A;  1IVS A;  1QLE B;  1WB8 A;  3ZX6 A;  4TT3 G;  3ABT A;  4QE9 A;  4GX5 A;  2B1G A;  4JYA O;  4O2B B;  5IWA B;  2QWQ B;  3AG4 C;  1UJW B;  3M7M X;  2R70 A;  2CTQ A;  3R65 A;  3RYH B;  3WB0 A;  3G67 A;  3N2K A;  2UXN A;  1YTF D;  3ABU A;  2N74 A;  5AG2 A;  1XQ8 A;  4LBE C;  4LF9 B;  4WBN A;  5D5Q A;  4EEQ A;  5LMU B;  1ROP A;  3SR2 C;  3THO A;  1SQG A;  1NJI W;  4E4E A;  2C2A A;  1EM1 A;  3FKS G;  4B7K A;  1U96 A;  5CA0 A;  5EYP B;  1YDX A;  2JGD A;  4FMT A;  1N8R W;  5CN0 A;  2Q73 A;  3T1Y B;  2Q8V A;  3ETQ A;  3HPL C;  1XNQ O;  1UFI A;  4B3S O;  2EIN B;  4F6E A;  1G4Y B;  2XOK G;  3E86 A;  2OTL V;  1P7B A;  4TQD A;  5CMU A;  4FFB B;  4FM1 A;  1YVW A;  1VQ9 V;  4WCE V;  3TXS A;  2QM4 A;  1K4C C;  2H8P C;  4JI3 B;  4YJ2 B;  1JMK C;  1LNQ A;  3CCR V;  1IBM B;  4F4L A;  1XHZ A;  4X62 B;  3OW2 U;  1M90 W;  4BWA A;  3HKD A;  2O57 A;  2UXD B;  1DLB A;  1TUE B;  4LFB B;  2EIK B;  4JI8 B;  4DO2 A;  5LP6 A;  4K0K B;  3ETG A;  1F51 A;  3L73 H;  1BL8 A;  2Y69 C;  4LWS B;  1P84 F;  5LL6 Y;  4DR6 O;  3JAK A;  4HZ3 A;  3X2Q B;  3G6E V;  1IXM A;  1BE3 H;  2CGN A;  3JAT B;  4R50 A;  3K58 A;  1M4U A;  4X1I B;  2EIJ B;  4UFZ A;  5H6Q A;  1AI5 A;  5LGN A;  3P32 A;  3JAM N;  1Y6X A;  1FJG O;  1Q81 W;  1VQ7 V;  5L3C A;  3QNE A;  2JEX A;  4MVR A;  1T5E A;  3H1I H;  4PEL A;  2FB5 A;  2BE3 A;  2QWO B;  5EZY B;  3LDC A;  3L71 H;  4MTX A;  1XMQ B;  2WLL A;  3CPW U;  3IGA C;  1Q6I A;  1VMG A;  2MK3 A;  3SJC C;  4GKK O;  2IJJ A;  4WFA V;  1K34 A;  2LW1 A;  2GTS A;  4FK5 C;  1SC5 B;  4B3R B;  1PNK A;  2PYJ A;  4K8X A;  3OGC C;  3KG2 A;  1NT2 B;  3HKC B;  3EFF K;  3CXC U;  2HKO A;  3APO A;  1Q3E A;  2JEU A;  2AXT Z;  5LA6 B;  2YIC A;  2EIL C;  1NTK H;  5IYZ B;  1H2N A;  5BXZ A;  1JOY A;  4X20 B;  4F6R A;  1H38 A;  3LSQ A;  1CP9 A;  1GH6 A;  1NU1 H;  4NB5 A;  2PUS A;  3T1H B;  1VQO V;  2GUZ A;  3CC2 V;  5JVD B;  4OPH A;  3ZMS A;  1SQP H;  3WG7 B;  1D5A A;  3R66 A;  3KZI Z;  5GW7 A;  5JWP A;  1OV9 A;  1AJN A;  3DC5 A;  5FPR A;  4CS4 A;  1BCC H;  1Y76 A;  4HBN A;  1JJ2 U;  4J7K A;  1HNZ O;  3K5M A;  3P3N A;  5LMN O;  2VQF O;  4DR7 O;  3H9V A;  2ZKO A;  3OEH G;  2Q5Z A;  2ITD C;  1OCR C;  3T4D A;  4MTF A;  5KMG A;  1HNX O;  1AI7 A;  1GM8 A;  2QWR B;  2K9P A;  4B3M B;  1P7G A;  3H01 A;  4Q6G A;  2MW2 B;  2VQE O;  4CC5 A;  2YIB A;  1WA8 B;  1OCO C;  3AG1 B;  1N33 O;  4ASU G;  4ZIB A;  3J80 N;  3OTO B;  4DV1 O;  3OT7 A;  3WU2 Z;  3ABM B;  4OX9 O;  3OMA B;  2ZE5 A;  1FXK B;  3P3P A;  2Q0O C;  3OR6 C;  4DV5 O;  4MW8 A;  5KUK A;  1QHT A;  4IIJ A;  1JPX A;  1AR4 A;  3JD0 A;  1LR1 A;  4RWU A;  3C90 A;  4NVP A;  1KP2 A;  1H2M A;  2EZO A;  3L9D A;  1RSO A;  2F95 B;  4NXM O;  1VQ8 V;  3FB5 C;  1WN7 A;  4ZI7 B;  1KP3 A;  4CZZ A;  1EN5 A;  1VF5 B;  4CH6 A;  4PDR A;  5LOV A;  3ZS8 C;  4YHH B;  2OIG A;  1K97 A;  3CCM V;  1KEC A;  1THZ A;  5J2U B;  3CWB H;  3OGI B;  4HAM A;  3K0G A;  3ABK C;  2ZD9 A;  3CYO A;  2EUL A;  3TCU A;  2Q6A A;  1NS1 A;  2HR3 A;  3LUT B;  3VQY A;  5B3S C;  1I08 A;  2DQ3 A;  4DV3 O;  4DV2 B;  2HLD G;  4IGG A;  2E74 B;  5H2F Z;  5B1A C;  3SJA C;  3WB1 A;  3CB2 A;  4IHJ A;  2E5L O;  4JYC A;  3P30 A;  3HKB B;  3EHB B;  4JAS A;  4JI6 B;  1PNL A;  1JFF A;  1NVP B;  4X64 B;  5B1B C;  2DOS A;  5IE9 A;  3RFR A;  4HNA A;  1BT8 A;  1IDS A;  2ITC C;  4L8J A;  2OCH A;  1BSM A;  3O9O A;  3K5O A;  4I0X A;  3BY6 A;  2JGU A;  2BSK B;  1Q5O A;  4LF6 O;  2XAG A;  3OMI B;  4U7O A;  4UVB A;  3BFR A;  2Q7E A;  2LP7 A;  4UB6 Z;  3SYO A;  1JQ0 A;  1UPG A;  4JI5 O;  2H3O A;  3J81 N;  4QPK A;  4DV7 O;  3I5D A;  3CJH A;  5LBQ A;  1ZL8 B;  1EBO A;  4X9Q A;  3CCQ V;  3H1L H;  1QU7 A;  2IBZ H;  3SDL A;  4DUZ O;  2YXY A;  4LF7 O;  2YXL A;  4X66 B;  1Z5V A;  1ZX3 A;  1FXV A;  4I50 A;  4UV8 A;  1E79 G;  3AG4 B;  2JIZ G;  4DR3 O;  4JYA B;  2Y0P A;  2DW4 A;  1W0J G;  4ABM A;  4LFA O;  3N2G B;  4X1Y B;  4XDL A;  5EBW C;  1M1K W;  4ZHQ A;  2ZM6 O;  3HB3 B;  4UVC A;  1YSC A;  2ZDI C;  1S72 V;  4O2B A;  4FPP A;  1WPX A;  3SPJ A;  3G6B A;  4GX1 A;  2DWE C;  4X88 A;  3IJ4 A;  4R7C A;  5FNV A;  4DV4 O;  3RYF A;  1NTM H;  3RYH A;  1YIT V;  2XAQ A;  4O4J A;  4JAA A;  1P49 A;  2GDS A;  2XAJ A;  1VF7 A;  5EIB D;  4KUM A;  1J5E O;  2XAF A;  1L0L H;  2UXX A;  4LCU C;  1FD9 A;  2A7W A;  2V7Q G;  4JAU A;  2E75 B;  4LFC O;  2KQX A;  3OAA G;  1WAZ A;  1SS3 A;  1XNQ B;  2VWJ A;  1XHX A;  2HVK C;  2KKW A;  1WJZ A;  3JAL B;  3ZHT A;  1KB9 F;  3K04 A;  3E22 B;  2E3C A;  3ABL C;  3CC7 V;  3B8N A;  2WLH A;  1SF9 A;  4B08 A;  3B2E E;  1TA8 A;  2M7W A;  1NKD A;  2ETN A;  1QQC A;  5BZB A;  3I56 V;  2BTQ B;  2Q9L A;  1SET A;  2UU9 O;  2DMX A;  2P67 A;  2JRI A;  1N0N A;  5KX5 A;  4FFB A;  1NR1 A;  3E8H A;  2KG7 B;  4I55 B;  5JCO A;  2ZR3 A;  3SPI A;  4DUY O;  5B1O A;  4MTO A;  4DR5 O;  3JAR B;  5LGT A;  4AI8 A;  1YTF B;  1I5X A;  1R1B A;  1CEZ A;  5KHJ A;  2ILM A;  4FLZ A;  1KKC A;  3ZJZ A;  5DM6 V;  4WFF A;  1PL0 A;  4LWS A;  2QKA A;  4PV1 B;  2EJR A;  1YIJ V;  3H1K H;  5EIB C;  2YEV B;  4PA7 A;  3OM3 B;  3LDE A;  4TUY B;  1M56 C;  3STL C;  4MVM A;  5FPO A;  3JD2 A;  5GON A;  1VF6 C;  3ZRW B;  4YY3 B;  2GSM B;  4GX0 A;  4MVQ A;  4PA6 A;  3ZHU A;  4MT8 A;  1ORQ C;  3BAA A;  3F7V C;  2CTP A;  2EIL B;  3CC4 V;  4BIZ A;  1SQV H;  3LNN A;  3E8G A;  1S5L Z;  4TOI A;  2PY5 A;  4ZKI A;  4H44 B;  2Q7G A;  1VP7 A;  2BOB C;  1ZTE A;  5IT9 N;  5BY1 A;  4J42 A;  4WFG A;  2E76 B;  1S0V A;  3GB7 C;  2ARH A;  4K35 A;  5LA6 A;  3S3W A;  4MVO A;  4YXW G;  2QTS A;  2P90 A;  2YIB D;  5F2V O;  2ZE6 A;  5IYZ A;  3K5L A;  1N36 B;  5EK0 A;  3VQV A;  3LSS A;  4OPA A;  1Y74 B;  4P2Z A;  1FKA O;  2IM9 A;  3AK2 A;  4AQY O;  3AG3 B;  2CUG A;  1PNM A;  4QIW F;  3TET A;  2WLI B;  5B66 Z;  1Q90 D;  5JVD A;  1HNZ B;  5CA1 B;  5DEC A;  2ZE7 A;  4UCO A;  4TWK A;  2VQF B;  2X6C A;  2VWK A;  4P30 A;  4DR7 B;  1SQB H;  3OUS A;  2HHH O;  5ITZ B;  2DE0 X;  4H0L B;  1BHB A;  4I5S A;  3IAY A;  2ZCE A;  2QDO A;  3E2E A;  1S3J A;  2OWO A;  1OCO B;  1M9N A;  1RP3 B;  3DXR A;  2UUA O;  4JPR A;  2VQE B;  1FPO A;  4IL6 Z;  4J80 A;  1R6T A;  1N33 B;  1SZT A;  2CTW A;  4PD4 F;  3F5W C;  4PHZ A;  4JV5 O;  1LUW A;  2ZR2 A;  4YIO A;  2LO1 A;  3AK1 A;  2UUC B;  4BIO A;  5IJ0 A;  1AJP A;  1B06 A;  4DR4 O;  4P9P A;  2CE4 A;  2PI4 A;  1SKV A;  3RT3 C;  4DV5 B;  2GTA A;  3OMN B;  5EBM C;  3OUF A;  4DV0 O;  5E1A C;  1VQK V;  1RPO A;  1WA8 A;  3AG2 C;  2UUB O;  2JVD A;  1RM1 C;  4LC1 A;  2QKS A;  2CTR A;  1AJQ A;  1FXK A;  4NXM B;  2LGW A;  3IFX A;  3UO2 A;  3GWK C;  3UT5 A;  4D6T H;  4BW5 A;  2F23 A;  2QTO A;  2F4V O;  3K06 A;  5IY5 C;  3CCJ V;  3UM7 A;  2ZXW C;  4J9Y B;  4DW1 A;  4JI2 O;  2YSU B;  5BMV B;  2Y4T A;  2ZQM A;  3ABK B;  3STZ C;  4NXN O;  3BVO A;  4ZI7 A;  5JQG B;  5B3S B;  4FM0 A;  1R73 A;  1XNR O;  2B5U A;  4JTA B;  3CRQ A;  4UCS A;  1H8H G;  1SQQ H;  4YIP A;  2D2C B;  3ZIA G;  1K4D C;  4DV3 B;  5J2U A;  1NH2 B;  3RW0 A;  1DF4 A;  2ADP A;  3A2F A;  1F4M A;  1V54 C;  3F7Y C;  2PI5 A;  3SJQ C;  2OCC C;  5B1B B;  4DR2 O;  2AZ2 A;  5L3F A;  2IJK A;  4OXS A;  1OHH G;  3ZBH A;  1R6N A;  2CAZ C;  3ETD A;  1MSW D;  3ZMT A;  4LF4 O;  2W0F C;  1FFX A;  5KHI A;  2UXC O;  1H8E G;  2PTM A;  3TGU H;  4EFE A;  3HKB A;  4YJ3 B;  4LF6 B;  3UQ8 A;  1R3L C;  4J41 A;  3ZED A;  4JI5 B;  1YF2 A;  1VQL V;  4DV7 B;  1TVK A;  3FB8 C;  3JAW A;  2IH1 C;  5LXT B;  2R72 A;  3RYC B;  4DUZ B;  5IYD O;  1WLE A;  4O4L A;  4WFH A;  1YJW V;  1NTZ H;  2AW9 A;  1BHA A;  4DR3 B;  3JAS B;  1U97 A;  2DYR C;  1XEQ A;  1SER A;  2ZM6 B;  2D3O W;  1EN4 A;  4GT1 A;  4C7U A;  3APQ A;  1OCZ B;  3K9S A;  4UCU A;  3ZMV A;  3AEI A;  1EFR G;  2XAS A;  4NYK A;  1HR0 O;  4X1Y A;  4DV4 B;  3CCL V;  5GTI Z;  4DR1 O;  1XRE A;  4KFM A;  4RAI A;  1M93 A;  3FFQ A;  1MZF A;  4NTY A;  2XHB A;  1Q82 W;  3JCZ A;  4PI0 A;  3BA9 A;  2QR4 A;  1J5E B;  2WPD G;  1RPR A;  4JI0 O;  1FYJ A;  1HDJ A;  1BMF G;  4LFC B;  4FLT A;  3SPC A;  2RMK B;  3TJT A;  4KXR A;  5L3D A;  3N2K B;  2CH7 B;  3KCX A;  1Y67 A;  4WBN B;  3PJS K;  4NKG B;  1VEW A;  4FZ1 A;  2CGO A;  4FZ0 A;  1GM9 A;  1K92 A;  2YS8 A;  5CA0 B;  2JK5 C;  2ODM A;  4FLY A;  1Q8I A;  2HJD A;  4PJ0 Z;  1KYO F;  1US6 A;  2NR5 A;  1S5H C;  2WLN A;  3JAL A;  3L72 H;  3E22 A;  4BR6 A;  1P4R A;  4R8C A;  1I0H A;  4D7T A;  4LF9 O;  1YJ9 V;  2BOC C;  1I5Y A;  4DUY B;  3J7A U;  4DR5 B;  1V55 C;  3CS5 A;  1JR9 A;  1XIL A;  5IJ9 A;  2X7R B;  1GKF A;  4LH6 A;  1JJO A;  2JS5 A;  5EBL C;  2PYL A;  2KG7 A;  4I55 A;  1WNS A;  4Z2W A;  1OCC B;  3OTF A;  4PDV A;  3I55 V;  3JAR A;  2FML A;  2N05 A;  3T4Z A;  3CX5 F;  1YEW A;  3A0H Z;  4NTX A;  2BTO A;  1N0J A;  3HKD B;  2A0L A;  2XND G;  3KKY A;  4JTD B;  4I7Z B;  1JCH A;  4JZG A;  1X4T A;  2GBO A;  1M56 B;  2Q67 A;  2VRZ A;  4JI3 O;  5JCO C;  1GMG A;  1K33 A;  3NXS A;  4GLX A;  3BHP A;  5C8Y B;  3S3X A;  3RN4 A;  4X8A A;  3FB6 C;  1XUQ A;  2AHZ A;  3RBZ A;  1AI6 A;  3WFV A;  1KQS U;  4FLX A;  1G8M A;  2Z5U A;  3MD0 A;  5JJJ B;  5KLV H;  4K0K O;  4FFK A;  1YZB A;  1VQP V;  1MZE A;  2QGN A;  3QF7 A;  2P5O A;  1I94 O;  4ZOL A;  2V4D A;  2OT5 A;  4TUY A;  2F1M A;  4B3T O;  4RQF A;  2AZ0 A;  2CK3 G;  2R9R B;  1GK9 A;  2JDI G;  4LH7 A;  4J10 A;  3T1C A;  1B04 A;  2CDY A;  4UXN A;  4CS2 A;  2FYU H;  3MHS C;  2EIJ C;  5H5N A;  1IUR A;  1PL4 A;  2XAH A;  5H9C A;  4CH4 A;  3CHX A;  5K1P A;  3CRC A;  4AQY B;  4FM2 A;  3RWR D;  3SJB C;  3VOU A;  3CCU V;  1YJN V;  3K79 A;  3VQX A;  4U7N A;  4TV9 B;  4JYB A;  2QM8 A;  5LYJ A;  3A0R A;  2ZE8 A;  1Q43 A;  1IX9 A;  4F6R B;  4CBC A;  1Y74 A;  2HHH B;  1W0K G;  5L3E A;  3G4S V;  4QE7 A;  3K03 A;  1F23 A;  2GUZ B;  2LGQ A;  2PZS A;  4UUJ C;  2WLI A;  2F43 G;  5A9G A;  5CA1 A;  1MA1 A;  1Q86 W;  2UUA B;  3FD9 A;  5TIS Z;  4BAY A;  4D7S A;  4ZBM A;  4EB6 B;  5ITZ A;  3W7X A;  4JV5 B;  2B9Z A;  1SES A;  1AP6 A;  4UCV A;  2UXB O;  3BRC A;  4MW3 A;  3SYA A;  4DR4 B;  3TXQ A;  4JZ2 A;  3RYI B;  1YI2 V;  4DV0 B;  1VQN V;  3D8C A;  1HNW O;  4NTW A;  1ZUQ A;  4B3S B;  2UUB B;  5KMG B;  3ZHV A;  1G1X B;  5EYP A;  5IYB O;  4J7J A;  1JA8 A;  3OD4 A;  1B6Q A;  5IY5 B;  2OTJ V;  5LHH A;  4FLU A;  2ZXW B;  3KCY A;  2ZIO A;  2EIM C;  5E79 Z;  2F4V B;  4G28 B;  4K3A A;  3A0B Z;  5DED A;  3K9A A;  4RUE A;  4HYO A;  2HVJ C;  4JI2 B;  2P4K A;  2WA4 A;  1BQ0 A;  1GRJ A;  1GN2 A;  1IBK O;  4NXN B;  1M5I A;  2KB1 A;  2QKC A;  1GAX A;  4H37 A;  3CCV V;  4TQF A;  1O9H A;  3QO8 A;  1XNR B;  2Y69 B;  4JI7 O;  1NVP D;  4YJ2 A;  1V54 B;  5CB4 B;  3AG1 C;  3QO5 A;  5BMV A;  2WA3 A;  3FB7 C;  2OCC B;  4PI2 A;  4DR6 B;  1KBH A;  1GN4 A;  4UCT A;  2RNB A;  1XBL A;  1LUV A;  2QWP B;  5JQG A;  3ZHS A;  1FXK C;  3L74 H;  4GKJ O;  1E1R G;  5LOV B;  2R9A A;  4DR2 B;  1JX9 A;  3U10 A;  4MSW C;  1FJG B;  3F5T A;  2N04 A;  3LDD A;  3VBB A;  4DRX B;  2HEP A;  3B40 A;  1J95 A;  4MVS A;  4JI4 O;  3JAT A;  1GN3 A;  3GWO A;  1QNM A;  2ZT9 B;  4X1I A;  2DN9 A;  2UXC B;  2W0X A;  4KP4 A;  2QWN B;  3ZRS A;  2EZP A;  3QO7 A;  1WPB A;  5LP6 C;  4U3F H;  4FLV A;  1ZWI C;  1VIB A;  4J7Z A;  1DK1 A;  4GKK B;  4WFE A;  4O4H B;  1AIL A;  4IHJ B;  1NZ6 A;  3RGB A;  4BW9 A;  1FXH A;  5EZY A;  2NLJ C;  4MVZ A;  2YIA A;  2IW5 A;  3FYE B;  4YJ3 A;  2F66 C;  4LNU B;  1GN6 A;  4LF8 O;  3ICX A;  5D5P A;  2RN9 A;  4DV2 O;  4HNA B;  2DYS C;  3A8T A;  1XDC A;  5KAF Z;  2A79 B;  1F7Y A;  4L87 A;  4P9O A;  1PM9 A;  1IBL O;  3Q4H B;  5LXT A;  2LW7 A;  5JH7 B;  3RYC A;  4X64 O;  3HKC A;  4U3J B;  2A06 H;  3FAV B;  3W7S A;  3MHH C;  2QSA A;  3JAS A;  1HR0 B;  4X20 A;  5J9P C;  4KHP O;  5KHG A;  3SYC A;  1IZ3 A;  2A9H A;  2W6J G;  1XMO O;  1M57 C;  3CP1 A;  1VAR A;  4DXW A;  4XBF A;  2JJ2 G;  3JD4 A;  1SA0 B;  2Q68 A;  1K9M W;  5LMN B;  4JI0 B;  2X0L A;  4ZHQ B;  1OCR B;  3L70 H;  4H13 B;  1KD1 W;  4X66 O;  2YI9 A;  2JJ1 G;  2QM7 A;  3RVY A;  1EN6 A;  1HNX B;  2ATK C;  1R3I C;  2HG5 C;  2IU0 A;  4GUN A;  3M8A A;  5FNV B;  1N32 O;  3RYF B;  2M6Y A;  3OEE G;  4TV8 B;  4N23 A;  4MS2 A;  2ZNI A;  3C3T A;  5KAI Z;  4FIP C;  4DV1 B;  4O4J B;  3SPG A;  1PD3 A;  4OX9 B;  1BQZ A;  1CXZ B;  4UB8 Z;  2YXH A;  4GX2 A;  2CH7 A;  3DC6 A;  3D36 A;  3ZCC A;  4G2K A;  1YCI A;  4PA3 A;  4NR1 A;  2RJZ A;  2QE7 G;  5FL7 G;  1WB7 A;  1YHQ V;  4K8Z A;  1V55 B;  1AI4 A;  1QR9 A;  3JCU Z;  3K57 A;  1N34 O;  1F4N A;  1QLN A;  2OIE A;  3BAB A;  1MOF A;  4JYY A;  1NQT A;  4IYH A;  3UO3 A;  1TGO A;  2VS0 A;  3SYP A;  3AK3 A;  4FJC C;  4R6Z A;  1H2S B;  5GTH Z;  3HKE B;  2YUA A;  3OFN G;  2H94 A;  1DGS A;  1GTO A;  4DV6 O;  1QBZ A;  2AHY A;  5KX5 B;  3ZMU A;  3D3Q A;  1EZJ A;  1Q7Y W;  2A3Q A;  2FKX A;  1DTO A;  4O4I B;  3K3W A;  5B1A B;  3JSL A;  1XL6 A;  2QEX V;  1BGY H;  2OYQ A;  2Y0I A;  3HR0 A;  4X65 O;  1PKX A;  3IC7 A;  2E5L B;  1VQM V;  5LGU A;  2HP8 A;  3ZRV A;  2IU3 A;  1DF5 A;  4GYC B;  4Q20 A;  1I94 B;  3U0Z A;  5HFL A;  4X1K B;  1VF6 A;  3B77 A;  1G6U A;  5C8Y A;  4H33 A;  1AR5 A;  4B3T B;  3ZRX A;  4I9Q A;  2DQ0 A;  3OR7 C;  3QVN A;  1AR1 B;  3CCE V;  4CS3 A;  4QGP A;  5BR8 O;  1K3E A;  3MDS A;  4EFB A;  3CME V;  1S76 D;  3W7W A;  2WWW A;  3ASO C;  1Z5W A;  3DSQ A;  4UV9 A;  5GON B;  2Q0A A;  1H2L A;  1TUB B;  2W6I G;  1Y4M A;  4O2A B;  4I4T B;  1KKD A;  1VQ5 V;  1D2D A;  3U11 A;  3BPZ A;  2BSK A;  4LF7 B;  3ASN C;  4EKW A;  1Z2G A;  4MTG A;  4UCR A;  3GVM A;  1WP7 A;  2YDE A;  5J2T B;  4QNH B;  4YY3 O;  4LFA B;  1ZL8 A;  1MAB G;  5IYC O;  4LF5 O;  2Z3Y A;  3FYI B;  4JI1 O;  4DK0 A;  4TV9 A;  2P4V A;  4G27 B;  1MMM A;  2YC0 A;  5A2Q N;  1H2K A;  1FFT B;  3N2G A;  1OJH A;  3CRR A;  1B3Q A;  5EC1 C;  3H1J H;  5KHH A;  2ZNJ A;  2EBO A;  4PA9 A;  3CRM A;  1IXB A;  3BCC H;  1K5Q A;  3OE7 G;  1D5N A;  2UXB B;  4FVM A;  2HJF C;  1L0N H;  1XI1 A;  3ML0 A;  1N36 O;  1URF A;  5KHK A;  4PA4 A;  3ZHQ A;  1NBM G;  1MSD A;  2NNU A;  4B7E A;  4E2L A;  1HNW B;  3PN1 A;  3ABL B;  3H1H H;  1QLE C;  4EB6 A;  1FS0 G;  3ZMZ A;  1N4C A;  3SYQ A;  2XT9 A;  5IWA O;  2FL4 A;  4BIU A;  3AG3 C;  2EIM B;  3DXR B;  2ADQ B;  3RYI A;  3B09 A;  2F93 B;  3ZHR A;  4CC6 A;  2GHY A;  2EJ7 A;  2L6L A;  3CEI A;  4KL1 A;  1SQF A;  5H6R A;  2JGD B;  3N27 A;  3NR7 A;  2WLM A;  5IJ0 B;  3LSU A;  2UU9 B;  3WB2 A;  1NH2 D;  2K1E A;  4Z1M G;  3E89 A;  1R6K A;  3DGE A;  4RQE A;  1IBK B;  4UVA A;  5EC2 C;  2YI8 A;  5LMU O;  4JAV A;  2DJV A;  3DTU B;  3B8M A;  2FTK A;  4JI7 B;  2UUC O;  1VQ6 V;  4DYL A;  4PDM A;  2BTQ A;  3QG5 A;  3UCS C;  3JD1 A;  3JYC A;  4J9Z B;  3T1Y O;  5FLX N;  5CBG A;  3UT5 B;  3CMA V;  4GKJ B;  4AHC A;  4IYI A;  1GM7 A;  1NI8 A;  1QVG U;  3E8B A;  3T2M A;  2P22 C;  5CB4 A;  4LR3 A;  2EIN C;  1XL4 A;  1L8D A;  2G38 A;  2QJ1 A;  4JI4 B;  1Y66 A;  1ENV A;  5LP6 B;  1VQ4 V; 
#chains in the Genus database with same CATH homology
 5A2Q N;  3T1H O;  4B3T O;  3SDL A;  4DUZ O;  4DV5 O;  4X64 O;  4DR2 O;  4GKK O;  4LF7 O;  1IBM O;  1R1B A;  4X62 O;  2FKX A;  2AGA A;  4DR3 O;  2HHH O;  2UXD O;  4LFA O;  1IBK O;  4LFB O;  5H5N A;  4JI8 O;  4LF4 O;  4KHP O;  4NXM O;  1N36 O;  2UXC O;  1XNQ O;  1XMO O;  4B3S O;  4X65 O;  2ZM6 O;  2UUA O;  4JI7 O;  1X59 A;  4JI6 O;  1R6T A;  5BXZ A;  4LF9 O;  4JV5 O;  1KUQ A;  5IWA O;  1A32 A;  4DV4 O;  4DR4 O;  3O65 A;  3J7A U;  4X66 O;  4GKJ O;  1AB3 A;  3RT3 C;  4B3M O;  4DV0 O;  4OPH A;  1NS1 A;  3F5T A;  3R66 A;  5BR8 O;  2UUB O;  3M8A A;  1J5E O;  1N32 O;  4DV3 O;  3OTO O;  2Z0A A;  1XMQ O;  4JI4 O;  4LFC O;  1XEQ A;  5LMU O;  2E5L O;  1HNZ O;  2DJV A;  1D2D A;  2F4V O;  1DK1 A;  5LMN O;  5LL6 Y;  2VQF O;  2UUC O;  4DR6 O;  4DR7 O;  4B3R O;  2DOS A;  4JI2 O;  4JYA O;  1AIL A;  2ZKO A;  4JI3 O;  2UXB O;  5IT9 N;  5BY1 A;  4A5U B;  3T1Y O;  1HR0 O;  5FLX N;  4NXN O;  1N34 O;  1HNX O;  3JAM N;  1FJG O;  4YY3 O;  4DR1 O;  4LF6 O;  2VQE O;  4LF8 O;  1XNR O;  2UU9 O;  4DV2 O;  1HNW O;  2JRI A;  4LF5 O;  4YHH O;  1N33 O;  4OPA A;  1FKA O;  4JI5 O;  4K0K O;  1F7Y A;  4AQY O;  3J80 N;  1G1X B;  1YZB A;  4JI1 O;  4JI0 O;  3J81 N;  4DV1 O;  1FYJ A;  4DV7 O;  2N74 A;  4OX9 O;  1I94 O;  1IBL O;  4DUY O;  4DR5 O;  2LW7 A;  4DV6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...