2UUBO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
total genus 36
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uubO00
4LF4O 4B3TO 4JI8O 1N36O 1XMOO 4LFAO 3RT3C 1J5EO 5FLXN 2UUBO 4X66O 4DV2O 5BY1A 5BR8O 2FKXA 4JI5O 5LMNO 2N74A 4OPAA 2E5LO 1AB3A 2Z0AA 2UXBO 1IBMO 2UUAO 4KHPO 2F4VO 5IT9N 1XNRO 2VQEO 4X62O 3M8AA 4DV0O 4DR5O 1FKAO 4JI7O 5H5NA 4DUYO 1XMQO 4LF9O 1HNWO 4DR1O 4JI0O 3SDLA 5LL6Y 1A32A 1F7YA 1YZBA 4DV6O 4NXMO 2VQFO 4DR6O 1HR0O 4K0KO 4LFCO 4JI4O 4NXNO 1NS1A 5BXZA 1IBLO 2LW7A 2AGAA 4DR7O 1X59A 4B3MO 3F5TA 1XEQA 1FJGO 1G1XB 3JAMN 4JI1O 4DV4O 4JI6O 5A2QN 4DR4O 4GKKO 5IWAO 3J81N 1D2DA 4DUZO 1HNZO 2DOSA 3J80N 2UXDO 4GKJO 4LFBO 1I94O 4B3RO 1R6TA 4AQYO 2UU9O 2ZM6O 4JV5O 4DR3O 4JI3O 3R66A 3OTOO 1N34O 4LF7O 4DV7O 4A5UB 3T1HO 3O65A 4B3SO 3J7AU 4DV1O 4DR2O 4LF5O 3T1YO 1HNXO 4YHHO 1DK1A 4JYAO 4YY3O 1R1BA 1KUQA 2UUCO 1XNQO 4DV3O 1AILA 2DJVA 5LMUO 1N33O 2HHHO 4DV5O 2JRIA 1IBKO 1FYJA 1N32O 4OPHA 4X65O 4LF6O 4X64O 2ZKOA 2UXCO 4OX9O 4JI2O 4LF8O
chains in the Genus database with same CATH superfamily
4LF4O 2QM4A 4B3RB 3E83A 3EVKA 3E8GA 4QE7A 4X1IA 1M90W 4OPAA 2M7WA 3CJHB 2Z0AA 2UXBO 3PN1A 3OTFA 5LHGA 4I7ZB 1JVMA 4B3SB 2BE3A 2EIJC 3SPJA 1GM7A 1OCRB 1RM1B 3A0HZ 1XMOB 4I50A 2QE7G 4JI7O 2HJDA 4PA4A 3JATA 2ODMA 3CP1A 4DR1O 2XAHA 1EZJA 1N33B 3B4SA 4DV6O 4TUYB 4I9WA 4PDMA 4BW5A 4X20A 1OCCB 1I5XA 5IJ0A 4NTYA 3ABLC 4MTGA 3AG1B 3SJCC 1LR1A 1VQ7V 4UCTA 3H01A 4O4JB 1F23A 4CC6A 3G67A 4X66B 2WWWA 3ZX6A 3E22B 4DR6B 3P3NA 4JI4B 1NH2B 4MTXA 4AQYO 2UUAB 2B1IA 3L74H 5J2TB 3STZC 4DR3O 4JI3O 3OT7A 5BMVA 1OCRC 4CS2A 1RM1C 3O65A 4GUNA 4LF5O 1Z5WA 2QGNA 1H2SB 1V9PA 4JTCB 3ZMVA 1DK1A 4JYAO 3UO2A 5GONB 3I56V 3CCSV 2OTJV 1Y67A 2Y48A 1OCCC 1LUVA 2HFEC 3CJHA 4PA3A 4ZI7B 1QLEB 3AG1C 3CEIA 3RVZA 3LUTB 5KHJA 4YHHB 2EBOA 4Z1VA 3EHBB 3OAAG 2CH7B 3RT3C 4QE9A 4CZZA 3U10A 3K79A 1J5EO 5A9GA 3CXCU 5LMUB 1UFIA 2QSAA 3HKCB 5CA1B 2B1GA 2QTSA 2YXHA 4UB6Z 4TUYA 3JAKB 1FAFA 2GDSA 3SJAC 3L70H 2CK3G 2EILB 2HEPA 3SJQC 2LO1A 4OXSA 2VS0A 1K7DA 4O4JA 4DUYO 3NR7A 4JI0O 3E22A 3ZHQA 4CH5A 4NB5A 3F5WC 1CPYA 1YJWV 3B09A 3BA9A 1O9HA 1TUBA 3AG2B 1QLEC 3S3WA 3KCXA 2WLJA 3VQXA 4F6EA 2EJ7A 5J2TA 4JAUA 2ZE7A 4J80A 4CH4A 1SQPH 1RP3B 4D7TA 4FM0A 1FXHA 1MZFA 1VIBA 1CXZB 2EINB 1AI5A 5GONA 1URFA 2DWDC 2QEXV 4IYHA 1YHQV 2V7QG 5IY5B 3IFXA 4MVMA 3ETEA 4ZI7A 1Q7YW 2Y69B 1XL4A 2PI4A 2EILC 3OTOO 1N34O 4DUZB 2YUAA 4WBNB 3K58A 1W0KG 1HWYA 1VEWA 5LP6C 1BL8A 2DE0X 2UU9B 3HKCA 4X1YB 4MTFA 2XHBA 1JA8A 3JAKA 3JCUZ 3K5NA 1L0LH 1N32O 4OPHA 1PV0A 1KYOF 4DYLA 1OCZB 5LHHA 4DR4B 1Q90D 4FM2A 3FYIB 5IJ9A 2JEXA 2WLKA 2WPDG 2CTQA 1GMGA 2EINC 4LBEC 1JR9A 4CC5A 1EM1A 3TJTA 3CRRA 1R6KA 3G4SV 3AEIA 2Q0OC 3IC7A 5IY5C 2Y69C 4LF7B 4OX9B 2MK3A 4R50A 2XUMA 5IT9N 1SERA 4KP4A 2LFRA 4DV1B 1ZLZA 1VQKV 4UVBA 4DR5O 4YIPA 2QKSA 1XREA 1I5YA 4K8XA 1DGSA 4HAMA 3E35A 5GTIZ 4HZ3A 3CSXA 3RBZA 1LNQA 3ABKB 1VQNV 1V54C 3AK1A 4X65B 1OCZC 2IH3C 4DXWA 2EJRA 2JK5C 1M56C 3SJBC 1K73W 2QA4V 2GSMB 1QQCA 2F95B 1RFYA 3AG7A 3F7YC 2E75B 5JCOA 3RYHB 3BHPA 1WA8B 4QPKA 4G28B 1YI2V 1SC5B 5CN0A 1QBZA 1IBMB 4X1YA 1XNRB 1FD9A 2W6JG 1K8AW 1GM8A 3C90A 4DV7O 3RYCB 4EKWA 4R7CA 4AHCA 5F2VO 3DSQA 3SGIA 1TGOA 1E79G 5H6QA 3FFQA 4I9QA 3K5OA 2UUCO 3W7TA 2ITDC 2WLLA 1P7BA 1KD1W 2RMKB 4HNAB 3BCCH 3ABKC 3LNNA 2X7RB 3T1HB 2WA3A 5LGNA 4JI6B 4WFHA 4B08A 4LF6O 2UXCO 1NTZH 3ASNC 2ITCC 2XAJA 5JJEB 2IU3A 2IH1C 4EEQA 5CBGA 4IL6Z 5CBFA 5C93A 3RN4A 4LFAO 2X6CA 2HG5C 1I94B 1V55B 2YIBD 4O2BB 2YC0A 4DV5B 3JD4A 5LMNO 3JYCA 1S5LZ 5IYBO 4XDKA 1L0NH 3BVOA 3K04A 3WB2A 4MW8A 1AR5A 3KG2A 3SPGA 1IZ3A 1WPBA 3Q4HB 3JD2A 1AVMA 2BTOA 2K1EA 2WAMA 3FB7C 3E86A 3ZRXA 1H2LA 4CH3A 4FZ1A 1NVPD 4JF3A 3RYHA 3SDLA 1WA8A 3JSLA 4LFCO 3HB3B 2JEUA 2QM7A 1VF5B 5B5EZ 1VQPV 4J7KA 2OTLV 3RYCA 1HNWB 4FLYA 3L9DA 5LGTA 5LOVB 1OHHG 1HNZO 3J80N 1V55C 3ZHSA 2UXDO 4GKJO 2A3QA 4LFBO 1N4CA 2CDYA 2YIAA 1H8EG 1I08A 1BS3A 1NR7A 4HNAA 1PL0A 2Q9LA 4JV5O 2Q68A 4PDVA 2GV9A 4MVRA 4GT1A 4JASA 1EBOA 3APQA 5H2FZ 2DN9A 2B9ZA 2DYSB 4NVPA 1AI7A 4FLWA 5JH7B 2GBOA 2GUZB 1SESA 2CTRA 2OCHA 4W4LA 5IYCO 1XNQO 4O2BA 1DLBA 1OV9A 1PM9A 2HHHO 1FJGB 2AXTZ 1UJWB 3WG7B 3UO3A 3HKBB 4GKKB 2L6LA 4BAYA 5IWAB 1GAXA 4X89A 2UXNA 1S3JA 3M7MX 4JAVA 2FYUH 1VQOV 2KB1A 1H2KA 2CTWA 3JARB 5DN6G 4Q20A 5K1PA 4TV9B 1XI1A 1SQQH 3CWBH 1FS0G 1NI8A 4DV0O 2GTAA 1Q6HA 1ZWIC 2DYSC 4PA9A 1HNXB 1G8MA 1OZ0A 1S72V 3OGCC 1XHXA 3LDEA 3T2MA 1H2GA 2VQFO 4JYYA 2QKAA 1IBLO 2ZXWB 3LSQA 4ZOLB 1XEQA 4TOIA 3TCUA 5A2QN 2HP8A 3G6EV 4DV2B 2Z3YA 5JH7A 1AI6A 4GX2A 2GUZA 2NLJC 5FPOA 2KSDA 3LDCA 2HJFC 4I0XB 2QWNB 5B66Z 1P7GA 4NYKA 1S0VA 4BIUA 1SA0B 1P4RA 2E3CA 3G80A 3CCUV 3HKBA 2EIKB 3ZMUA 1R3KC 1NJIW 3ZN0A 2Q67A 2WLIB 3RW0A 4TV8A 3T4DA 1AR1B 1DTOA 3D8CA 3JARA 1QNMA 4TV9A 4FZ0A 2ZXWC 1IBKO 5LBQA 5EIBD 1YTFB 4F4LA 3B2EE 4RQFA 1SRYA 3ZRWB 2PYJA 2ADQB 4JI2O 2LJ2A 1YSCA 1N36O 2FMLA 1AP5A 5FLXN 4D7SA 5BR8O 2Q8VA 1MZEA 1VQLV 1SETA 5L3CA 5LXTB 4IT5A 4ZOLA 4GX0A 3BPZA 3D3QA 2EIKC 4PJ0Z 4UXNA 5KUMA 1BGYH 2RN9A 2AZ0A 2QDOA 2RDCA 1KKCA 3HKDB 2C2AA 3BABA 5L3EA 2UXBB 4JPRA 1MA1A 4I0XA 1XDCA 3ICXA 3K06A 1RPOA 3OD4A 1O9GA 4LF8B 2P06A 1SA0A 4TSFG 3HR0A 1PKXA 3BRCA 2UUBB 1AP6A 4DV6B 4MVUA 2WLIA 1VF6C 2ZE8A 5KX5B 4B3RO 1SQFA 4QIWF 3GWOA 3OUSA 2YICA 5B1OA 2AHZA 3QVNA 4X62B 1F4NA 1AR4A 3JASB 3ZRWA 4B3SO 3J7AU 4DR2O 4UCOA 3ZRVA 3ETGA 2Y0PA 2XAGA 1G6UA 4NXMB 4AQYB 4K0KB 3ZMZA 2E76B 1VF6A 4UVCA 1N33O 1YIJV 4FK5C 4K3AA 1SQGA 1PNKA 4AI8A 5EBWC 4W4KA 5KLVH 4ABMA 2XOKG 1N8RW 5LXTA 5CA0B 2Q4PA 1KMIZ 2JJ1G 2IU0A 2Q73A 5AG2A 2IM9A 2F1MA 4X66O 4LH6A 1IURA 4JI5O 4UV9A 2E5LO 1KBHA 3R65A 4CS3A 3KKYA 2UUAO 2N05A 4YIOA 2W0FC 4JZ2A 1TUEB 1K33A 2GHYA 4NR1A 3M8AA 2OYQA 3CC4V 1IXBA 2XAFA 3VQWA 2X6BA 4NTWA 4U7OA 3FAVB 4GYCB 5KX5A 3KCYA 4D6TH 3IJ4A 4BW9A 2BSKB 2PF4E 4P30A 4O4LB 1NS1A 1NTKH 4EFBA 1VF7A 3MD0A 3CRAA 3JASA 4DUYB 5B3SB 3ZHRA 3STLC 4JI0B 1GKFA 3A8TA 1K34A 4ICGA 1JPXA 2AHYA 2YI9A 4I4TB 5LP6B 3CC2V 4PDLA 3SPCA 4KHPB 1BQ0A 3N2KB 3GVMA 3RGBA 1M57B 4WFEA 5CA0A 3ZIAG 2ZIOA 3UM7A 3B8NA 1SQVH 4DK0A 1KUQA 3CXHF 1HR0B 2Q7GA 1AJNA 1S76D 1AILA 1JX9A 2RCVA 3CX5F 4UUJC 3OTOB 1Q81W 4JTAB 1CEZA 3CC7V 5B3SC 5JVDB 2CE4A 5J2UB 3T1CA 2VWKA 3SR2C 1U97A 2CH7A 3FAVA 5B1NA 4RUEA 5CA1A 1N32B 3L75H 5L3FA 5IYDO 3OMIB 2BSKA 4O4LA 1M57C 1M5IA 4I5SA 1V54B 4LWSB 3H1JH 3SYPA 3VBBA 3JAWB 1M56B 3SYCA 4YY3B 4LF9O 1WP7A 3APOA 1LUWA 2W0XA 4TWKA 4ZBMA 1Y66A 1SZTA 4I4TA 5LP6A 1GM9A 1AROP 2JGUA 4IHJB 3N2KA 4X64B 4DR5B 1BSMA 3JAMN 1F4MA 5FNVB 4DR4O 1QHTA 3CCRV 2WLMA 4JTDB 5L3DA 3DC5A 3J81N 2DOSA 2JGDB 3WU2Z 4C7UA 4GZRB 3CB2A 2FL4A 2NN4A 5L3GA 2ZNIA 3UKMA 1YJNV 4PI0A 3TETA 2ZM6O 2PY5A 4IYIA 3ZMTA 4E4EA 5J9PC 1PL4A 4LF7O 3TK1A 5LYJB 2PYLA 4FPPA 1ORQC 2CUGA 5CMUA 4UCRA 4Z1MG 4DV1O 3ASNB 2P67A 2HKOA 5JVDA 1NH2D 2IW5A 3H1IH 1NZ6A 2O57A 5J2UA 4WBNA 2Z5UA 2Q0AA 3RYFB 1R1BA 1NQTA 1QU7A 1FXKB 4WF9V 4H33A 1I0HA 2FTKA 4RO2A 4LC1A 4DR7B 1K3EA 1E1RG 4PHZA 2LGWA 1K9MW 1NKDA 2WSSG 1R3IC 4JAAA 4X65O 1M4UA 5D5PA 4LWSA 2EZOA 1H8HG 3JAWA 1GN4A 3ZHVA 2UUCB 2JS5A 4N23A 3FYEB 4L87A 3OGIB 1VP7A 4TT3G 4FFKA 2JVDA 3ZEDA 1QVFU 5KHHA 5CBHA 5KAFZ 1IBMO 2UXCB 3VQYA 5KAIZ 2KKWA 4MSWC 1XNRO 1FFTB 1VQ9V 5FNVA 3DC6A 2XNDG 5D5QA 2GTSA 1MNGA 1XMQO 4BIOA 4HYOA 2JGDA 2OT5A 4DV3B 1FXKC 5LL6Y 1A32A 3RVYA 2JDIG 5BXZA 5ITZB 3IAYA 5EBLC 3LDDA 3QNEA 3EXAA 2NR5A 5JJNB 1G1XB 3FX7A 2K9PA 5LYJA 4JI1O 4JI6O 5GW7A 4JI8B 1P49A 2QWQB 4J10A 3RYFA 1BQZA 1I94O 1Y6XA 1VARA 1KP2A 2LFSA 1KB9F 3CE2A 4WCEV 2WLNA 4BIZA 4UFZA 5KA5A 4EB6B 3SYQA 3OMAB 3CRCA 2Q69A 1HNZB 3ML0A 2WLHA 4BWAA 5DM6V 1NBMG 1DF5A 4MVOA 4ZHQB 2R9AA 1EFRG 2LW1A 3IC9A 4NXNB 2N04A 1BZKA 1WPXA 4IIJB 4JV5B 2V1DA 3OFNG 1B04A 4LP8A 3GWKC 4P9PA 4DV4B 2QJ1A 2IBZH 3U0ZA 3SYAA 2PGGA 4FJCC 1GRJA 2YSUB 1WB7A 1TVKB 5FPRA 2HHHB 3ZHTA 1AB3A 3DGEA 1N0NA 3SYOA 3K5LA 1Q43A 4FLTA 1E1QG 1KP3A 5ITZA 1QR8A 3OUFA 3IGAC 4CBCA 1Q3EA 1XHZA 1IX9A 2VQEO 1JFFB 3AG4B 4P9OA 3Q4HA 2P4VA 5KA6A 5CA3A 3OW2U 2IJIA 5TISZ 1KC8W 2Y0IA 1YJ9V 3CCVV 4R8CA 1KQSU 1JCHA 1B06A 2EZPA 4DV0B 1FJGO 1MMMA 1XBLA 3OM3B 5E79Z 4EFEA 1SKVA 1PD3A 5KMGB 2XAQA 5JWPA 4GKKO 4PELA 4YXWG 4FLXA 5IWAO 2DWEC 3VQVA 1D2DA 3D36C 4QPJA 3OE7G 5LOVA 3GB7C 4ZHQA 2R70A 1DF4A 5C8YB 3H9VA 1K4CC 3K57A 2A79B 3BY6A 2CAZC 4IIJA 1ROPA 2F4VB 1PPJH 4CH6A 3D3IA 3C3SA 2NNUA 1K5SA 4BR6A 4A5UB 3AG4C 1ENVA 1QCEA 3ZS8C 2DYRB 4J42A 2ZDIC 3P30A 1FPOA 1HNXO 4G2KA 2YS8A 4K35A 3FB5C 1TVKA 4E2LA 2LQTA 1AI4A 3N2GB 4B3MB 4H44B 1HDJA 1Z2GA 3HKEB 2Q7HA 2CTPA 3BEHA 1JFFA 2XASA 2XT9A 4B3TO 4LCUC 1MSDA 2ILMA 2ZDIA 4X1IB 4GLXA 1Z5VA 4DV2O 2HR3A 1U96A 3QF7A 1XUQA 1GH6A 4RQEA 1GTOA 1H2NA 3BFRA 3DXRB 5EZYB 4JI2B 2ZQMA 2KQXA 4U3JB 1W59A 2BTQB 4I50B 2DYRC 3UT5B 5IYZB 3JATB 5KMGA 5FL7G 3T1YB 3M99B 1UPGA 4PD4F 3G71V 3I5DA 3I55V 4MS2A 1ZL8B 3ZJZA 5C8YA 1SQXH 1AJQA 2P22C 2X0LA 1QR9A 2OCCB 2LW7A 4L8JA 2AGAA 3TGUH 3HPLC 4LF4B 1K92A 1MOFA 4UCVA 4UB8Z 1QVGU 4H37A 4Z2WA 1Q6IA 1P84F 4DW1A 4TQDA 3ZCCA 4FIPC 5EC2C 1YVWA 3OMNB 1VQMV 2E74B 3FB6C 3MDSA 3N2GA 1BHBA 1SS3A 4JI7B 3UQ8A 1Q8IA 2YXLA 4DR1B 1FFXB 3W7XA 1EN5A 4PA7A 2DQ0A 2V4DA 1WLEA 2DJVA 3CPWU 2DQ3A 3QO5A 1IXMA 2OCCC 1VQ5V 1YDXA 3DXRA 1VMGA 5EZYA 3OEHG 4DR2B 4HBNA 1M9NA 4U3JA 2LP7A 3F7VC 2D2CB 4PDRA 2BTQA 4LF8O 3UT5A 5IYZA 1XMOO 1G4YB 4WFAV 2UUBO 5DECA 1K97A 1ZL8A 2A7WA 2N74A 1ZTEA 4PV1B 5DEDA 2BCCH 4O4IB 4DR3B 1TA8A 4JI3B 4DW0A 2ZT9B 3CRMA 3WFVA 1GK9A 1EN6A 2PUSA 4UCUA 1VQ8V 4K8ZA 2A06H 4LF5B 4X62O 2YEVB 2ZIMA 4OGQB 4JYAB 5KHKA 2YI8A 4JI5B 3ABTA 2YXYA 2E5LB 3ZMSA 5EBMC 2HVJC 4NXMO 4NTXA 2ATKC 3RWRD 4GX1A 1Q82W 2CGNA 1TUBB 3HKDA 4JI4O 3TXQA 4DR6O 4K0KO 1YITV 4MVZA 3AK2A 1IDSA 5K1XA 4YJ2B 1EZVH 3C3TA 2QM8A 1X59A 3F5TA 1WP8A 4QNHB 3K03A 1Q5OA 3E8BA 1J5EB 2ZR2A 1S77D 2YDEA 4XDLA 1FFXA 1WNSA 2ZNJA 3DTUB 2P5OA 3CCLV 4RWUA 4G27B 3THOA 4ZIBA 4KL1A 4ASUG 2ZE5A 5EC1C 1MG1A 3K0GA 3E2EA 2VRZA 1J95A 4YHHO 2G38A 1TAEA 5LMUO 3ASOB 3OEEG 3JSNA 3BAAA 2UXXA 4O4IA 1JQ0A 3QO7A 5GTHZ 5IJ9B 2ZKOA 1W2BU 4O2AB 1GN6A 4B7EA 1BHAA 2YEVA 3LSUA 3H1KH 3ZHUA 2EX3A 5KUKA 4FLZA 1SZXA 3NXSA 4P2ZA 5EYPB 2FKXA 1YTFD 2YIDA 1NVPB 3QG5A 1XQ8A 4FFBB 2ZCEA 4YJ2A 1N34B 4KHPO 3TXSA 2CGOA 3K5MA 3FB8C 3FKSG 2OWOA 1KU9A 2HVKC 3WB0A 4FMTA 2ZINA 5JQGB 1PP9H 4XBFA 3L72H 1D5NA 3OR6C 3JD1A 3ASOC 1HR0O 4XDJA 3CD6V 1HP8A 3RFRA 1QLNA 3CCEV 3MHSC 2ADPA 4CS4A 2L35A 1Q6UA 4J9ZB 4LF9B 4DUZO 1JJOA 1OJHA 4UCSA 1H38A 4FVMA 1NR1A 3AG2C 3LSSA 4PI2A 2UU9O 1KECA 2RQ6A 1L1FA 2YIBA 3E8HA 2Y4TA 3AK3A 2RNBA 5B1BB 2P90A 3MHHC 3L71H 4O2AA 1MABG 1ZAUA 2DMXA 2QR4A 4TQFA 4RUFA 2WLLB 2A9HA 4ZKIA 4YY3O 2RJZA 5IE9A 2Q6AA 2EULA 1BE3H 1R3LC 5LHIA 5EYPA 5KHIA 2ZM6B 5B1AB 1M93A 3K9AA 4FFBA 3CMAV 4H13B 1PNMA 2H3OA 2F93B 3WB1A 2JS3A 4X64O 1Q86W 4OX9O 3T4ZA 5JCOC 4U7NA 4QGPA 1NT2B 3AG3B 3CCJV 4X9QA 5JQGA 4WFGA 5EK0A 2Y4UA 4KFMA 1OCOB 4J7ZA 5BY1A 3FD9A 1Y74B 4DV7B 1RSOB 1WAZA 5B1BC 1EN4A 1FKAO 1BT8A 1S5JA 5LGUA 5H5NA 4FLVA 1XOUA 3LNMB 1I7FA 2Q7EA 5KHGA 2B5UA 2H8PC 4YJ3B 2D3OW 3CCQV 5B1AC 3OR7C 1MSWD 1ZSPA 3E8FA 5HFLA 4LF6B 3K0DA 3ZRSA 1RPRA 4IHJA 4LH7A 4DR7O 3VOUA 2MW2B 2R72A 2P4KA 1XMQB 4LFAB 1S5HC 2BOBC 3B77A 1US6A 3AG3C 1Y4MA 2R9RB 1THZA 1OCOC 1ZUQA 4KXRA 1R3JC 5LMNB 2ARHA 2W6IG 2F43G 3JALB 1R6TA 1YXBA 4JYBA 2QKCA 2Q5ZA 1YCIA 4RAIA 2ZR3A 4JI1B 2LGQA 4LR3A 3SPIA 5E1AC 3T1HO 4UVAA 3KZIZ 3W7SA 2X6AA 2KG7B 1GN3A 2H94A 2AW9A 2F23A 3L73H 4LFCB 1KKDA 4DV3O 3CS5A 5H9CA 4I55B 1ZX3A 1FXKA 1N0JA 2EIMB 4DV5O 4DO2A 1Y74A 5BZBA 3EFFK 1RSOA 3JD3A 4WFFA 4MT8A 2PI5A 1K5QA 2ZD9A 4JI8O 4GKJB 2UXDB 4LFBB 2P7TC 5H6RA 4U3FH 3P3PA 4YJ3A 2JJ2G 3U11A 2OIEA 2BOCC 5CB4B 1WJZA 4J7JA 2ZE6A 3ABMB 5EIBC 1W0JG 4N21A 1B3QA 2QWPB 3BA8A 5LA6B 3RYIB 5HFMA 3ZN1A 3P32A 1XNQB 1R6NA 1HNWO 4UV8A 2AZ2A 1IVSA 4JYCA 2EIMC 3JALA 2PZSA 4NXNO 3B8MA 1L8DA 3MAQA 2VQEB 2QWRB 1X4TA 1H2MA 3K08A 4DV4O 1SF9A 3UCSC 4F6RB 3CRQA 2KG7A 2XTAA 3B40A 3JCZA 1GN2A 4GCZA 2FB5A 4AILC 4DRXB 2M6YA 4I55A 4KUMA 2VWJA 3ABMC 3K9SA 4MVQA 4LNUB 1GO3F 2IJHA 2P6JA 2A0LA 4EB6A 1K4DC 4MVSA 1JJ2U 4H0LB 4O4HB 1HW7A 4TV8B 3ETDA 4X8AA 3N27A 2VQFB 3X2QB 1Y76B 3CMEV 1IBLB 2ETNA 2JRIA 1M1KW 1NU1H 1SQBH 3ETQA 5CB4A 2QTOA 4FLUA 3CCMV 1NTMH 3ABUA 4FM1A 5LA6A 3W7WA 3RYIA 1PNLA 2F66C 3A2FA 4J9YB 1T5EA 3D36A 3QO8A 2DW4A 4X1KB 2IJJA 2QWOB 2WA4A 3WG7C 2F4VO 1YF2A 3A0BZ 4B3TB 1R73A 4PA6A 4DK1A 3QTCA 4F6RA 4MW3A 1JMKC 3X2QC 1F7YA 4J11A 1YZBA 4JGSA 3A0RA 4JZGA 1IBKB 1VQ6V 1BCCH 1CP9A 4DRXA 3S3XA 4R6ZA 5IDJA 1BMFG 4B3MO 4LNUA 1WB8A 3CYOA 4QJFB 1N36B 5JJJB 4IGGA 4O4HA 1WN7A 5BR8B 1D5AA 3ZBHA 3E89A 4X20B 1Y76A 3H1HH 2HLDG 5IJ0B 1JOYA 4X88A 4J41A 3R66A 4WFBV 2EIJB 1F51A 3H1LH 1B6QA 1YEWA 3JD0A 3K59A 1XL6A 3CHXA 1FXVA 3T1YO 2R9IA 3O9OA 2IJKA 1XILA 5L3BA 3K3WA 3G6BA 3W7UA 4X1KA 4MTOA 4Q6GA 1COWG 1FYJA 2PTMA 1AJPA 5BMVB 4NKGB 2OIGA 3ABLB 3PJSK 3HKEA 1VQ4V 4B7KA 3SPHA 2JIZG 4GX5A
chains in the Genus database with same CATH topology
4LF4O 4B3TO 4JI8O 1N36O 1XMOO 4LFAO 3RT3C 1J5EO 5FLXN 2UUBO 4X66O 4DV2O 5BY1A 5BR8O 2FKXA 4JI5O 5LMNO 2N74A 4OPAA 2E5LO 1AB3A 2Z0AA 2UXBO 1IBMO 2UUAO 4KHPO 2F4VO 5IT9N 1XNRO 2VQEO 4X62O 3M8AA 4DV0O 4DR5O 1FKAO 4JI7O 5H5NA 4DUYO 1XMQO 4LF9O 1HNWO 4DR1O 4JI0O 3SDLA 5LL6Y 1A32A 1F7YA 1YZBA 4DV6O 4NXMO 2VQFO 4DR6O 1HR0O 4K0KO 4LFCO 4JI4O 4NXNO 1NS1A 5BXZA 1IBLO 2LW7A 2AGAA 4DR7O 1X59A 4B3MO 3F5TA 1XEQA 1FJGO 1G1XB 3JAMN 4JI1O 4DV4O 4JI6O 5A2QN 4DR4O 4GKKO 5IWAO 3J81N 1D2DA 4DUZO 1HNZO 2DOSA 3J80N 2UXDO 4GKJO 4LFBO 1I94O 4B3RO 1R6TA 4AQYO 2UU9O 2ZM6O 4JV5O 4DR3O 4JI3O 3R66A 3OTOO 1N34O 4LF7O 4DV7O 4A5UB 3T1HO 3O65A 4B3SO 3J7AU 4DV1O 4DR2O 4LF5O 3T1YO 1HNXO 4YHHO 1DK1A 4JYAO 4YY3O 1R1BA 1KUQA 2UUCO 1XNQO 4DV3O 1AILA 2DJVA 5LMUO 1N33O 2HHHO 4DV5O 2JRIA 1IBKO 1FYJA 1N32O 4OPHA 4X65O 4LF6O 4X64O 2ZKOA 2UXCO 4OX9O 4JI2O 4LF8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 O;  4B3T O;  4JI8 O;  1N36 O;  1XMO O;  4LFA O;  3RT3 C;  1J5E O;  5FLX N;  2UUB O;  4X66 O;  4DV2 O;  5BY1 A;  5BR8 O;  2FKX A;  4JI5 O;  5LMN O;  2N74 A;  4OPA A;  2E5L O;  1AB3 A;  2Z0A A;  2UXB O;  1IBM O;  2UUA O;  4KHP O;  2F4V O;  5IT9 N;  1XNR O;  2VQE O;  4X62 O;  3M8A A;  4DV0 O;  4DR5 O;  1FKA O;  4JI7 O;  5H5N A;  4DUY O;  1XMQ O;  4LF9 O;  1HNW O;  4DR1 O;  4JI0 O;  3SDL A;  5LL6 Y;  1A32 A;  1F7Y A;  1YZB A;  4DV6 O;  4NXM O;  2VQF O;  4DR6 O;  1HR0 O;  4K0K O;  4LFC O;  4JI4 O;  4NXN O;  1NS1 A;  5BXZ A;  1IBL O;  2LW7 A;  2AGA A;  4DR7 O;  1X59 A;  4B3M O;  3F5T A;  1XEQ A;  1FJG O;  1G1X B;  3JAM N;  4JI1 O;  4DV4 O;  4JI6 O;  5A2Q N;  4DR4 O;  4GKK O;  5IWA O;  3J81 N;  1D2D A;  4DUZ O;  1HNZ O;  2DOS A;  3J80 N;  2UXD O;  4GKJ O;  4LFB O;  1I94 O;  4B3R O;  1R6T A;  4AQY O;  2UU9 O;  2ZM6 O;  4JV5 O;  4DR3 O;  4JI3 O;  3R66 A;  3OTO O;  1N34 O;  4LF7 O;  4DV7 O;  4A5U B;  3T1H O;  3O65 A;  4B3S O;  3J7A U;  4DV1 O;  4DR2 O;  4LF5 O;  3T1Y O;  1HNX O;  4YHH O;  1DK1 A;  4JYA O;  4YY3 O;  1R1B A;  1KUQ A;  2UUC O;  1XNQ O;  4DV3 O;  1AIL A;  2DJV A;  5LMU O;  1N33 O;  2HHH O;  4DV5 O;  2JRI A;  1IBK O;  1FYJ A;  1N32 O;  4OPH A;  4X65 O;  4LF6 O;  4X64 O;  2ZKO A;  2UXC O;  4OX9 O;  4JI2 O;  4LF8 O; 
#chains in the Genus database with same CATH topology
 4LF4 O;  2QM4 A;  4B3R B;  3E83 A;  3EVK A;  3E8G A;  4QE7 A;  4X1I A;  1M90 W;  4OPA A;  2M7W A;  3CJH B;  2Z0A A;  2UXB O;  3PN1 A;  3OTF A;  5LHG A;  4I7Z B;  1JVM A;  4B3S B;  2BE3 A;  2EIJ C;  3SPJ A;  1GM7 A;  1OCR B;  1RM1 B;  3A0H Z;  1XMO B;  4I50 A;  2QE7 G;  4JI7 O;  2HJD A;  4PA4 A;  3JAT A;  2ODM A;  3CP1 A;  4DR1 O;  2XAH A;  1EZJ A;  1N33 B;  3B4S A;  4DV6 O;  4TUY B;  4I9W A;  4PDM A;  4BW5 A;  4X20 A;  1OCC B;  1I5X A;  5IJ0 A;  4NTY A;  3ABL C;  4MTG A;  3AG1 B;  3SJC C;  1LR1 A;  1VQ7 V;  4UCT A;  3H01 A;  4O4J B;  1F23 A;  4CC6 A;  3G67 A;  4X66 B;  2WWW A;  3ZX6 A;  3E22 B;  4DR6 B;  3P3N A;  4JI4 B;  1NH2 B;  4MTX A;  4AQY O;  2UUA B;  2B1I A;  3L74 H;  5J2T B;  3STZ C;  4DR3 O;  4JI3 O;  3OT7 A;  5BMV A;  1OCR C;  4CS2 A;  1RM1 C;  3O65 A;  4GUN A;  4LF5 O;  1Z5W A;  2QGN A;  1H2S B;  1V9P A;  4JTC B;  3ZMV A;  1DK1 A;  4JYA O;  3UO2 A;  5GON B;  3I56 V;  3CCS V;  2OTJ V;  1Y67 A;  2Y48 A;  1OCC C;  1LUV A;  2HFE C;  3CJH A;  4PA3 A;  4ZI7 B;  1QLE B;  3AG1 C;  3CEI A;  3RVZ A;  3LUT B;  5KHJ A;  4YHH B;  2EBO A;  4Z1V A;  3EHB B;  3OAA G;  2CH7 B;  3RT3 C;  4QE9 A;  4CZZ A;  3U10 A;  3K79 A;  1J5E O;  5A9G A;  3CXC U;  5LMU B;  1UFI A;  2QSA A;  3HKC B;  5CA1 B;  2B1G A;  2QTS A;  2YXH A;  4UB6 Z;  4TUY A;  3JAK B;  1FAF A;  2GDS A;  3SJA C;  3L70 H;  2CK3 G;  2EIL B;  2HEP A;  3SJQ C;  2LO1 A;  4OXS A;  2VS0 A;  1K7D A;  4O4J A;  4DUY O;  3NR7 A;  4JI0 O;  3E22 A;  3ZHQ A;  4CH5 A;  4NB5 A;  3F5W C;  1CPY A;  1YJW V;  3B09 A;  3BA9 A;  1O9H A;  1TUB A;  3AG2 B;  1QLE C;  3S3W A;  3KCX A;  2WLJ A;  3VQX A;  4F6E A;  2EJ7 A;  5J2T A;  4JAU A;  2ZE7 A;  4J80 A;  4CH4 A;  1SQP H;  1RP3 B;  4D7T A;  4FM0 A;  1FXH A;  1MZF A;  1VIB A;  1CXZ B;  2EIN B;  1AI5 A;  5GON A;  1URF A;  2DWD C;  2QEX V;  4IYH A;  1YHQ V;  2V7Q G;  5IY5 B;  3IFX A;  4MVM A;  3ETE A;  4ZI7 A;  1Q7Y W;  2Y69 B;  1XL4 A;  2PI4 A;  2EIL C;  3OTO O;  1N34 O;  4DUZ B;  2YUA A;  4WBN B;  3K58 A;  1W0K G;  1HWY A;  1VEW A;  5LP6 C;  1BL8 A;  2DE0 X;  2UU9 B;  3HKC A;  4X1Y B;  4MTF A;  2XHB A;  1JA8 A;  3JAK A;  3JCU Z;  3K5N A;  1L0L H;  1N32 O;  4OPH A;  1PV0 A;  1KYO F;  4DYL A;  1OCZ B;  5LHH A;  4DR4 B;  1Q90 D;  4FM2 A;  3FYI B;  5IJ9 A;  2JEX A;  2WLK A;  2WPD G;  2CTQ A;  1GMG A;  2EIN C;  4LBE C;  1JR9 A;  4CC5 A;  1EM1 A;  3TJT A;  3CRR A;  1R6K A;  3G4S V;  3AEI A;  2Q0O C;  3IC7 A;  5IY5 C;  2Y69 C;  4LF7 B;  4OX9 B;  2MK3 A;  4R50 A;  2XUM A;  5IT9 N;  1SER A;  4KP4 A;  2LFR A;  4DV1 B;  1ZLZ A;  1VQK V;  4UVB A;  4DR5 O;  4YIP A;  2QKS A;  1XRE A;  1I5Y A;  4K8X A;  1DGS A;  4HAM A;  3E35 A;  5GTI Z;  4HZ3 A;  3CSX A;  3RBZ A;  1LNQ A;  3ABK B;  1VQN V;  1V54 C;  3AK1 A;  4X65 B;  1OCZ C;  2IH3 C;  4DXW A;  2EJR A;  2JK5 C;  1M56 C;  3SJB C;  1K73 W;  2QA4 V;  2GSM B;  1QQC A;  2F95 B;  1RFY A;  3AG7 A;  3F7Y C;  2E75 B;  5JCO A;  3RYH B;  3BHP A;  1WA8 B;  4QPK A;  4G28 B;  1YI2 V;  1SC5 B;  5CN0 A;  1QBZ A;  1IBM B;  4X1Y A;  1XNR B;  1FD9 A;  2W6J G;  1K8A W;  1GM8 A;  3C90 A;  4DV7 O;  3RYC B;  4EKW A;  4R7C A;  4AHC A;  5F2V O;  3DSQ A;  3SGI A;  1TGO A;  1E79 G;  5H6Q A;  3FFQ A;  4I9Q A;  3K5O A;  2UUC O;  3W7T A;  2ITD C;  2WLL A;  1P7B A;  1KD1 W;  2RMK B;  4HNA B;  3BCC H;  3ABK C;  3LNN A;  2X7R B;  3T1H B;  2WA3 A;  5LGN A;  4JI6 B;  4WFH A;  4B08 A;  4LF6 O;  2UXC O;  1NTZ H;  3ASN C;  2ITC C;  2XAJ A;  5JJE B;  2IU3 A;  2IH1 C;  4EEQ A;  5CBG A;  4IL6 Z;  5CBF A;  5C93 A;  3RN4 A;  4LFA O;  2X6C A;  2HG5 C;  1I94 B;  1V55 B;  2YIB D;  4O2B B;  2YC0 A;  4DV5 B;  3JD4 A;  5LMN O;  3JYC A;  1S5L Z;  5IYB O;  4XDK A;  1L0N H;  3BVO A;  3K04 A;  3WB2 A;  4MW8 A;  1AR5 A;  3KG2 A;  3SPG A;  1IZ3 A;  1WPB A;  3Q4H B;  3JD2 A;  1AVM A;  2BTO A;  2K1E A;  2WAM A;  3FB7 C;  3E86 A;  3ZRX A;  1H2L A;  4CH3 A;  4FZ1 A;  1NVP D;  4JF3 A;  3RYH A;  3SDL A;  1WA8 A;  3JSL A;  4LFC O;  3HB3 B;  2JEU A;  2QM7 A;  1VF5 B;  5B5E Z;  1VQP V;  4J7K A;  2OTL V;  3RYC A;  1HNW B;  4FLY A;  3L9D A;  5LGT A;  5LOV B;  1OHH G;  1HNZ O;  3J80 N;  1V55 C;  3ZHS A;  2UXD O;  4GKJ O;  2A3Q A;  4LFB O;  1N4C A;  2CDY A;  2YIA A;  1H8E G;  1I08 A;  1BS3 A;  1NR7 A;  4HNA A;  1PL0 A;  2Q9L A;  4JV5 O;  2Q68 A;  4PDV A;  2GV9 A;  4MVR A;  4GT1 A;  4JAS A;  1EBO A;  3APQ A;  5H2F Z;  2DN9 A;  2B9Z A;  2DYS B;  4NVP A;  1AI7 A;  4FLW A;  5JH7 B;  2GBO A;  2GUZ B;  1SES A;  2CTR A;  2OCH A;  4W4L A;  5IYC O;  1XNQ O;  4O2B A;  1DLB A;  1OV9 A;  1PM9 A;  2HHH O;  1FJG B;  2AXT Z;  1UJW B;  3WG7 B;  3UO3 A;  3HKB B;  4GKK B;  2L6L A;  4BAY A;  5IWA B;  1GAX A;  4X89 A;  2UXN A;  1S3J A;  3M7M X;  4JAV A;  2FYU H;  1VQO V;  2KB1 A;  1H2K A;  2CTW A;  3JAR B;  5DN6 G;  4Q20 A;  5K1P A;  4TV9 B;  1XI1 A;  1SQQ H;  3CWB H;  1FS0 G;  1NI8 A;  4DV0 O;  2GTA A;  1Q6H A;  1ZWI C;  2DYS C;  4PA9 A;  1HNX B;  1G8M A;  1OZ0 A;  1S72 V;  3OGC C;  1XHX A;  3LDE A;  3T2M A;  1H2G A;  2VQF O;  4JYY A;  2QKA A;  1IBL O;  2ZXW B;  3LSQ A;  4ZOL B;  1XEQ A;  4TOI A;  3TCU A;  5A2Q N;  2HP8 A;  3G6E V;  4DV2 B;  2Z3Y A;  5JH7 A;  1AI6 A;  4GX2 A;  2GUZ A;  2NLJ C;  5FPO A;  2KSD A;  3LDC A;  2HJF C;  4I0X B;  2QWN B;  5B66 Z;  1P7G A;  4NYK A;  1S0V A;  4BIU A;  1SA0 B;  1P4R A;  2E3C A;  3G80 A;  3CCU V;  3HKB A;  2EIK B;  3ZMU A;  1R3K C;  1NJI W;  3ZN0 A;  2Q67 A;  2WLI B;  3RW0 A;  4TV8 A;  3T4D A;  1AR1 B;  1DTO A;  3D8C A;  3JAR A;  1QNM A;  4TV9 A;  4FZ0 A;  2ZXW C;  1IBK O;  5LBQ A;  5EIB D;  1YTF B;  4F4L A;  3B2E E;  4RQF A;  1SRY A;  3ZRW B;  2PYJ A;  2ADQ B;  4JI2 O;  2LJ2 A;  1YSC A;  1N36 O;  2FML A;  1AP5 A;  5FLX N;  4D7S A;  5BR8 O;  2Q8V A;  1MZE A;  1VQL V;  1SET A;  5L3C A;  5LXT B;  4IT5 A;  4ZOL A;  4GX0 A;  3BPZ A;  3D3Q A;  2EIK C;  4PJ0 Z;  4UXN A;  5KUM A;  1BGY H;  2RN9 A;  2AZ0 A;  2QDO A;  2RDC A;  1KKC A;  3HKD B;  2C2A A;  3BAB A;  5L3E A;  2UXB B;  4JPR A;  1MA1 A;  4I0X A;  1XDC A;  3ICX A;  3K06 A;  1RPO A;  3OD4 A;  1O9G A;  4LF8 B;  2P06 A;  1SA0 A;  4TSF G;  3HR0 A;  1PKX A;  3BRC A;  2UUB B;  1AP6 A;  4DV6 B;  4MVU A;  2WLI A;  1VF6 C;  2ZE8 A;  5KX5 B;  4B3R O;  1SQF A;  4QIW F;  3GWO A;  3OUS A;  2YIC A;  5B1O A;  2AHZ A;  3QVN A;  4X62 B;  1F4N A;  1AR4 A;  3JAS B;  3ZRW A;  4B3S O;  3J7A U;  4DR2 O;  4UCO A;  3ZRV A;  3ETG A;  2Y0P A;  2XAG A;  1G6U A;  4NXM B;  4AQY B;  4K0K B;  3ZMZ A;  2E76 B;  1VF6 A;  4UVC A;  1N33 O;  1YIJ V;  4FK5 C;  4K3A A;  1SQG A;  1PNK A;  4AI8 A;  5EBW C;  4W4K A;  5KLV H;  4ABM A;  2XOK G;  1N8R W;  5LXT A;  5CA0 B;  2Q4P A;  1KMI Z;  2JJ1 G;  2IU0 A;  2Q73 A;  5AG2 A;  2IM9 A;  2F1M A;  4X66 O;  4LH6 A;  1IUR A;  4JI5 O;  4UV9 A;  2E5L O;  1KBH A;  3R65 A;  4CS3 A;  3KKY A;  2UUA O;  2N05 A;  4YIO A;  2W0F C;  4JZ2 A;  1TUE B;  1K33 A;  2GHY A;  4NR1 A;  3M8A A;  2OYQ A;  3CC4 V;  1IXB A;  2XAF A;  3VQW A;  2X6B A;  4NTW A;  4U7O A;  3FAV B;  4GYC B;  5KX5 A;  3KCY A;  4D6T H;  3IJ4 A;  4BW9 A;  2BSK B;  2PF4 E;  4P30 A;  4O4L B;  1NS1 A;  1NTK H;  4EFB A;  1VF7 A;  3MD0 A;  3CRA A;  3JAS A;  4DUY B;  5B3S B;  3ZHR A;  3STL C;  4JI0 B;  1GKF A;  3A8T A;  1K34 A;  4ICG A;  1JPX A;  2AHY A;  2YI9 A;  4I4T B;  5LP6 B;  3CC2 V;  4PDL A;  3SPC A;  4KHP B;  1BQ0 A;  3N2K B;  3GVM A;  3RGB A;  1M57 B;  4WFE A;  5CA0 A;  3ZIA G;  2ZIO A;  3UM7 A;  3B8N A;  1SQV H;  4DK0 A;  1KUQ A;  3CXH F;  1HR0 B;  2Q7G A;  1AJN A;  1S76 D;  1AIL A;  1JX9 A;  2RCV A;  3CX5 F;  4UUJ C;  3OTO B;  1Q81 W;  4JTA B;  1CEZ A;  3CC7 V;  5B3S C;  5JVD B;  2CE4 A;  5J2U B;  3T1C A;  2VWK A;  3SR2 C;  1U97 A;  2CH7 A;  3FAV A;  5B1N A;  4RUE A;  5CA1 A;  1N32 B;  3L75 H;  5L3F A;  5IYD O;  3OMI B;  2BSK A;  4O4L A;  1M57 C;  1M5I A;  4I5S A;  1V54 B;  4LWS B;  3H1J H;  3SYP A;  3VBB A;  3JAW B;  1M56 B;  3SYC A;  4YY3 B;  4LF9 O;  1WP7 A;  3APO A;  1LUW A;  2W0X A;  4TWK A;  4ZBM A;  1Y66 A;  1SZT A;  4I4T A;  5LP6 A;  1GM9 A;  1ARO P;  2JGU A;  4IHJ B;  3N2K A;  4X64 B;  4DR5 B;  1BSM A;  3JAM N;  1F4M A;  5FNV B;  4DR4 O;  1QHT A;  3CCR V;  2WLM A;  4JTD B;  5L3D A;  3DC5 A;  3J81 N;  2DOS A;  2JGD B;  3WU2 Z;  4C7U A;  4GZR B;  3CB2 A;  2FL4 A;  2NN4 A;  5L3G A;  2ZNI A;  3UKM A;  1YJN V;  4PI0 A;  3TET A;  2ZM6 O;  2PY5 A;  4IYI A;  3ZMT A;  4E4E A;  5J9P C;  1PL4 A;  4LF7 O;  3TK1 A;  5LYJ B;  2PYL A;  4FPP A;  1ORQ C;  2CUG A;  5CMU A;  4UCR A;  4Z1M G;  4DV1 O;  3ASN B;  2P67 A;  2HKO A;  5JVD A;  1NH2 D;  2IW5 A;  3H1I H;  1NZ6 A;  2O57 A;  5J2U A;  4WBN A;  2Z5U A;  2Q0A A;  3RYF B;  1R1B A;  1NQT A;  1QU7 A;  1FXK B;  4WF9 V;  4H33 A;  1I0H A;  2FTK A;  4RO2 A;  4LC1 A;  4DR7 B;  1K3E A;  1E1R G;  4PHZ A;  2LGW A;  1K9M W;  1NKD A;  2WSS G;  1R3I C;  4JAA A;  4X65 O;  1M4U A;  5D5P A;  4LWS A;  2EZO A;  1H8H G;  3JAW A;  1GN4 A;  3ZHV A;  2UUC B;  2JS5 A;  4N23 A;  3FYE B;  4L87 A;  3OGI B;  1VP7 A;  4TT3 G;  4FFK A;  2JVD A;  3ZED A;  1QVF U;  5KHH A;  5CBH A;  5KAF Z;  1IBM O;  2UXC B;  3VQY A;  5KAI Z;  2KKW A;  4MSW C;  1XNR O;  1FFT B;  1VQ9 V;  5FNV A;  3DC6 A;  2XND G;  5D5Q A;  2GTS A;  1MNG A;  1XMQ O;  4BIO A;  4HYO A;  2JGD A;  2OT5 A;  4DV3 B;  1FXK C;  5LL6 Y;  1A32 A;  3RVY A;  2JDI G;  5BXZ A;  5ITZ B;  3IAY A;  5EBL C;  3LDD A;  3QNE A;  3EXA A;  2NR5 A;  5JJN B;  1G1X B;  3FX7 A;  2K9P A;  5LYJ A;  4JI1 O;  4JI6 O;  5GW7 A;  4JI8 B;  1P49 A;  2QWQ B;  4J10 A;  3RYF A;  1BQZ A;  1I94 O;  1Y6X A;  1VAR A;  1KP2 A;  2LFS A;  1KB9 F;  3CE2 A;  4WCE V;  2WLN A;  4BIZ A;  4UFZ A;  5KA5 A;  4EB6 B;  3SYQ A;  3OMA B;  3CRC A;  2Q69 A;  1HNZ B;  3ML0 A;  2WLH A;  4BWA A;  5DM6 V;  1NBM G;  1DF5 A;  4MVO A;  4ZHQ B;  2R9A A;  1EFR G;  2LW1 A;  3IC9 A;  4NXN B;  2N04 A;  1BZK A;  1WPX A;  4IIJ B;  4JV5 B;  2V1D A;  3OFN G;  1B04 A;  4LP8 A;  3GWK C;  4P9P A;  4DV4 B;  2QJ1 A;  2IBZ H;  3U0Z A;  3SYA A;  2PGG A;  4FJC C;  1GRJ A;  2YSU B;  1WB7 A;  1TVK B;  5FPR A;  2HHH B;  3ZHT A;  1AB3 A;  3DGE A;  1N0N A;  3SYO A;  3K5L A;  1Q43 A;  4FLT A;  1E1Q G;  1KP3 A;  5ITZ A;  1QR8 A;  3OUF A;  3IGA C;  4CBC A;  1Q3E A;  1XHZ A;  1IX9 A;  2VQE O;  1JFF B;  3AG4 B;  4P9O A;  3Q4H A;  2P4V A;  5KA6 A;  5CA3 A;  3OW2 U;  2IJI A;  5TIS Z;  1KC8 W;  2Y0I A;  1YJ9 V;  3CCV V;  4R8C A;  1KQS U;  1JCH A;  1B06 A;  2EZP A;  4DV0 B;  1FJG O;  1MMM A;  1XBL A;  3OM3 B;  5E79 Z;  4EFE A;  1SKV A;  1PD3 A;  5KMG B;  2XAQ A;  5JWP A;  4GKK O;  4PEL A;  4YXW G;  4FLX A;  5IWA O;  2DWE C;  3VQV A;  1D2D A;  3D36 C;  4QPJ A;  3OE7 G;  5LOV A;  3GB7 C;  4ZHQ A;  2R70 A;  1DF4 A;  5C8Y B;  3H9V A;  1K4C C;  3K57 A;  2A79 B;  3BY6 A;  2CAZ C;  4IIJ A;  1ROP A;  2F4V B;  1PPJ H;  4CH6 A;  3D3I A;  3C3S A;  2NNU A;  1K5S A;  4BR6 A;  4A5U B;  3AG4 C;  1ENV A;  1QCE A;  3ZS8 C;  2DYR B;  4J42 A;  2ZDI C;  3P30 A;  1FPO A;  1HNX O;  4G2K A;  2YS8 A;  4K35 A;  3FB5 C;  1TVK A;  4E2L A;  2LQT A;  1AI4 A;  3N2G B;  4B3M B;  4H44 B;  1HDJ A;  1Z2G A;  3HKE B;  2Q7H A;  2CTP A;  3BEH A;  1JFF A;  2XAS A;  2XT9 A;  4B3T O;  4LCU C;  1MSD A;  2ILM A;  2ZDI A;  4X1I B;  4GLX A;  1Z5V A;  4DV2 O;  2HR3 A;  1U96 A;  3QF7 A;  1XUQ A;  1GH6 A;  4RQE A;  1GTO A;  1H2N A;  3BFR A;  3DXR B;  5EZY B;  4JI2 B;  2ZQM A;  2KQX A;  4U3J B;  1W59 A;  2BTQ B;  4I50 B;  2DYR C;  3UT5 B;  5IYZ B;  3JAT B;  5KMG A;  5FL7 G;  3T1Y B;  3M99 B;  1UPG A;  4PD4 F;  3G71 V;  3I5D A;  3I55 V;  4MS2 A;  1ZL8 B;  3ZJZ A;  5C8Y A;  1SQX H;  1AJQ A;  2P22 C;  2X0L A;  1QR9 A;  2OCC B;  2LW7 A;  4L8J A;  2AGA A;  3TGU H;  3HPL C;  4LF4 B;  1K92 A;  1MOF A;  4UCV A;  4UB8 Z;  1QVG U;  4H37 A;  4Z2W A;  1Q6I A;  1P84 F;  4DW1 A;  4TQD A;  3ZCC A;  4FIP C;  5EC2 C;  1YVW A;  3OMN B;  1VQM V;  2E74 B;  3FB6 C;  3MDS A;  3N2G A;  1BHB A;  1SS3 A;  4JI7 B;  3UQ8 A;  1Q8I A;  2YXL A;  4DR1 B;  1FFX B;  3W7X A;  1EN5 A;  4PA7 A;  2DQ0 A;  2V4D A;  1WLE A;  2DJV A;  3CPW U;  2DQ3 A;  3QO5 A;  1IXM A;  2OCC C;  1VQ5 V;  1YDX A;  3DXR A;  1VMG A;  5EZY A;  3OEH G;  4DR2 B;  4HBN A;  1M9N A;  4U3J A;  2LP7 A;  3F7V C;  2D2C B;  4PDR A;  2BTQ A;  4LF8 O;  3UT5 A;  5IYZ A;  1XMO O;  1G4Y B;  4WFA V;  2UUB O;  5DEC A;  1K97 A;  1ZL8 A;  2A7W A;  2N74 A;  1ZTE A;  4PV1 B;  5DED A;  2BCC H;  4O4I B;  4DR3 B;  1TA8 A;  4JI3 B;  4DW0 A;  2ZT9 B;  3CRM A;  3WFV A;  1GK9 A;  1EN6 A;  2PUS A;  4UCU A;  1VQ8 V;  4K8Z A;  2A06 H;  4LF5 B;  4X62 O;  2YEV B;  2ZIM A;  4OGQ B;  4JYA B;  5KHK A;  2YI8 A;  4JI5 B;  3ABT A;  2YXY A;  2E5L B;  3ZMS A;  5EBM C;  2HVJ C;  4NXM O;  4NTX A;  2ATK C;  3RWR D;  4GX1 A;  1Q82 W;  2CGN A;  1TUB B;  3HKD A;  4JI4 O;  3TXQ A;  4DR6 O;  4K0K O;  1YIT V;  4MVZ A;  3AK2 A;  1IDS A;  5K1X A;  4YJ2 B;  1EZV H;  3C3T A;  2QM8 A;  1X59 A;  3F5T A;  1WP8 A;  4QNH B;  3K03 A;  1Q5O A;  3E8B A;  1J5E B;  2ZR2 A;  1S77 D;  2YDE A;  4XDL A;  1FFX A;  1WNS A;  2ZNJ A;  3DTU B;  2P5O A;  3CCL V;  4RWU A;  4G27 B;  3THO A;  4ZIB A;  4KL1 A;  4ASU G;  2ZE5 A;  5EC1 C;  1MG1 A;  3K0G A;  3E2E A;  2VRZ A;  1J95 A;  4YHH O;  2G38 A;  1TAE A;  5LMU O;  3ASO B;  3OEE G;  3JSN A;  3BAA A;  2UXX A;  4O4I A;  1JQ0 A;  3QO7 A;  5GTH Z;  5IJ9 B;  2ZKO A;  1W2B U;  4O2A B;  1GN6 A;  4B7E A;  1BHA A;  2YEV A;  3LSU A;  3H1K H;  3ZHU A;  2EX3 A;  5KUK A;  4FLZ A;  1SZX A;  3NXS A;  4P2Z A;  5EYP B;  2FKX A;  1YTF D;  2YID A;  1NVP B;  3QG5 A;  1XQ8 A;  4FFB B;  2ZCE A;  4YJ2 A;  1N34 B;  4KHP O;  3TXS A;  2CGO A;  3K5M A;  3FB8 C;  3FKS G;  2OWO A;  1KU9 A;  2HVK C;  3WB0 A;  4FMT A;  2ZIN A;  5JQG B;  1PP9 H;  4XBF A;  3L72 H;  1D5N A;  3OR6 C;  3JD1 A;  3ASO C;  1HR0 O;  4XDJ A;  3CD6 V;  1HP8 A;  3RFR A;  1QLN A;  3CCE V;  3MHS C;  2ADP A;  4CS4 A;  2L35 A;  1Q6U A;  4J9Z B;  4LF9 B;  4DUZ O;  1JJO A;  1OJH A;  4UCS A;  1H38 A;  4FVM A;  1NR1 A;  3AG2 C;  3LSS A;  4PI2 A;  2UU9 O;  1KEC A;  2RQ6 A;  1L1F A;  2YIB A;  3E8H A;  2Y4T A;  3AK3 A;  2RNB A;  5B1B B;  2P90 A;  3MHH C;  3L71 H;  4O2A A;  1MAB G;  1ZAU A;  2DMX A;  2QR4 A;  4TQF A;  4RUF A;  2WLL B;  2A9H A;  4ZKI A;  4YY3 O;  2RJZ A;  5IE9 A;  2Q6A A;  2EUL A;  1BE3 H;  1R3L C;  5LHI A;  5EYP A;  5KHI A;  2ZM6 B;  5B1A B;  1M93 A;  3K9A A;  4FFB A;  3CMA V;  4H13 B;  1PNM A;  2H3O A;  2F93 B;  3WB1 A;  2JS3 A;  4X64 O;  1Q86 W;  4OX9 O;  3T4Z A;  5JCO C;  4U7N A;  4QGP A;  1NT2 B;  3AG3 B;  3CCJ V;  4X9Q A;  5JQG A;  4WFG A;  5EK0 A;  2Y4U A;  4KFM A;  1OCO B;  4J7Z A;  5BY1 A;  3FD9 A;  1Y74 B;  4DV7 B;  1RSO B;  1WAZ A;  5B1B C;  1EN4 A;  1FKA O;  1BT8 A;  1S5J A;  5LGU A;  5H5N A;  4FLV A;  1XOU A;  3LNM B;  1I7F A;  2Q7E A;  5KHG A;  2B5U A;  2H8P C;  4YJ3 B;  2D3O W;  3CCQ V;  5B1A C;  3OR7 C;  1MSW D;  1ZSP A;  3E8F A;  5HFL A;  4LF6 B;  3K0D A;  3ZRS A;  1RPR A;  4IHJ A;  4LH7 A;  4DR7 O;  3VOU A;  2MW2 B;  2R72 A;  2P4K A;  1XMQ B;  4LFA B;  1S5H C;  2BOB C;  3B77 A;  1US6 A;  3AG3 C;  1Y4M A;  2R9R B;  1THZ A;  1OCO C;  1ZUQ A;  4KXR A;  1R3J C;  5LMN B;  2ARH A;  2W6I G;  2F43 G;  3JAL B;  1R6T A;  1YXB A;  4JYB A;  2QKC A;  2Q5Z A;  1YCI A;  4RAI A;  2ZR3 A;  4JI1 B;  2LGQ A;  4LR3 A;  3SPI A;  5E1A C;  3T1H O;  4UVA A;  3KZI Z;  3W7S A;  2X6A A;  2KG7 B;  1GN3 A;  2H94 A;  2AW9 A;  2F23 A;  3L73 H;  4LFC B;  1KKD A;  4DV3 O;  3CS5 A;  5H9C A;  4I55 B;  1ZX3 A;  1FXK A;  1N0J A;  2EIM B;  4DV5 O;  4DO2 A;  1Y74 A;  5BZB A;  3EFF K;  1RSO A;  3JD3 A;  4WFF A;  4MT8 A;  2PI5 A;  1K5Q A;  2ZD9 A;  4JI8 O;  4GKJ B;  2UXD B;  4LFB B;  2P7T C;  5H6R A;  4U3F H;  3P3P A;  4YJ3 A;  2JJ2 G;  3U11 A;  2OIE A;  2BOC C;  5CB4 B;  1WJZ A;  4J7J A;  2ZE6 A;  3ABM B;  5EIB C;  1W0J G;  4N21 A;  1B3Q A;  2QWP B;  3BA8 A;  5LA6 B;  3RYI B;  5HFM A;  3ZN1 A;  3P32 A;  1XNQ B;  1R6N A;  1HNW O;  4UV8 A;  2AZ2 A;  1IVS A;  4JYC A;  2EIM C;  3JAL A;  2PZS A;  4NXN O;  3B8M A;  1L8D A;  3MAQ A;  2VQE B;  2QWR B;  1X4T A;  1H2M A;  3K08 A;  4DV4 O;  1SF9 A;  3UCS C;  4F6R B;  3CRQ A;  2KG7 A;  2XTA A;  3B40 A;  3JCZ A;  1GN2 A;  4GCZ A;  2FB5 A;  4AIL C;  4DRX B;  2M6Y A;  4I55 A;  4KUM A;  2VWJ A;  3ABM C;  3K9S A;  4MVQ A;  4LNU B;  1GO3 F;  2IJH A;  2P6J A;  2A0L A;  4EB6 A;  1K4D C;  4MVS A;  1JJ2 U;  4H0L B;  4O4H B;  1HW7 A;  4TV8 B;  3ETD A;  4X8A A;  3N27 A;  2VQF B;  3X2Q B;  1Y76 B;  3CME V;  1IBL B;  2ETN A;  2JRI A;  1M1K W;  1NU1 H;  1SQB H;  3ETQ A;  5CB4 A;  2QTO A;  4FLU A;  3CCM V;  1NTM H;  3ABU A;  4FM1 A;  5LA6 A;  3W7W A;  3RYI A;  1PNL A;  2F66 C;  3A2F A;  4J9Y B;  1T5E A;  3D36 A;  3QO8 A;  2DW4 A;  4X1K B;  2IJJ A;  2QWO B;  2WA4 A;  3WG7 C;  2F4V O;  1YF2 A;  3A0B Z;  4B3T B;  1R73 A;  4PA6 A;  4DK1 A;  3QTC A;  4F6R A;  4MW3 A;  1JMK C;  3X2Q C;  1F7Y A;  4J11 A;  1YZB A;  4JGS A;  3A0R A;  4JZG A;  1IBK B;  1VQ6 V;  1BCC H;  1CP9 A;  4DRX A;  3S3X A;  4R6Z A;  5IDJ A;  1BMF G;  4B3M O;  4LNU A;  1WB8 A;  3CYO A;  4QJF B;  1N36 B;  5JJJ B;  4IGG A;  4O4H A;  1WN7 A;  5BR8 B;  1D5A A;  3ZBH A;  3E89 A;  4X20 B;  1Y76 A;  3H1H H;  2HLD G;  5IJ0 B;  1JOY A;  4X88 A;  4J41 A;  3R66 A;  4WFB V;  2EIJ B;  1F51 A;  3H1L H;  1B6Q A;  1YEW A;  3JD0 A;  3K59 A;  1XL6 A;  3CHX A;  1FXV A;  3T1Y O;  2R9I A;  3O9O A;  2IJK A;  1XIL A;  5L3B A;  3K3W A;  3G6B A;  3W7U A;  4X1K A;  4MTO A;  4Q6G A;  1COW G;  1FYJ A;  2PTM A;  1AJP A;  5BMV B;  4NKG B;  2OIG A;  3ABL B;  3PJS K;  3HKE A;  1VQ4 V;  4B7K A;  3SPH A;  2JIZ G;  4GX5 A; 
#chains in the Genus database with same CATH homology
 4LF4 O;  4B3T O;  4JI8 O;  1N36 O;  1XMO O;  4LFA O;  3RT3 C;  1J5E O;  5FLX N;  2UUB O;  4X66 O;  4DV2 O;  5BY1 A;  5BR8 O;  2FKX A;  4JI5 O;  5LMN O;  2N74 A;  4OPA A;  2E5L O;  1AB3 A;  2Z0A A;  2UXB O;  1IBM O;  2UUA O;  4KHP O;  2F4V O;  5IT9 N;  1XNR O;  2VQE O;  4X62 O;  3M8A A;  4DV0 O;  4DR5 O;  1FKA O;  4JI7 O;  5H5N A;  4DUY O;  1XMQ O;  4LF9 O;  1HNW O;  4DR1 O;  4JI0 O;  3SDL A;  5LL6 Y;  1A32 A;  1F7Y A;  1YZB A;  4DV6 O;  4NXM O;  2VQF O;  4DR6 O;  1HR0 O;  4K0K O;  4LFC O;  4JI4 O;  4NXN O;  1NS1 A;  5BXZ A;  1IBL O;  2LW7 A;  2AGA A;  4DR7 O;  1X59 A;  4B3M O;  3F5T A;  1XEQ A;  1FJG O;  1G1X B;  3JAM N;  4JI1 O;  4DV4 O;  4JI6 O;  5A2Q N;  4DR4 O;  4GKK O;  5IWA O;  3J81 N;  1D2D A;  4DUZ O;  1HNZ O;  2DOS A;  3J80 N;  2UXD O;  4GKJ O;  4LFB O;  1I94 O;  4B3R O;  1R6T A;  4AQY O;  2UU9 O;  2ZM6 O;  4JV5 O;  4DR3 O;  4JI3 O;  3R66 A;  3OTO O;  1N34 O;  4LF7 O;  4DV7 O;  4A5U B;  3T1H O;  3O65 A;  4B3S O;  3J7A U;  4DV1 O;  4DR2 O;  4LF5 O;  3T1Y O;  1HNX O;  4YHH O;  1DK1 A;  4JYA O;  4YY3 O;  1R1B A;  1KUQ A;  2UUC O;  1XNQ O;  4DV3 O;  1AIL A;  2DJV A;  5LMU O;  1N33 O;  2HHH O;  4DV5 O;  2JRI A;  1IBK O;  1FYJ A;  1N32 O;  4OPH A;  4X65 O;  4LF6 O;  4X64 O;  2ZKO A;  2UXC O;  4OX9 O;  4JI2 O;  4LF8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...