1XEQA

Crystal tructure of rna binding domain of influenza b virus non-structural protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
89
structure length
89
Chain Sequence
GATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein NS1
publication title Conserved surface features form the double-stranded RNA binding site of non-structural protein 1 (NS1) from influenza A and B viruses.
pubmed doi rcsb
source organism Influenza b virus (b/lee/40)
molecule tags Viral protein
total genus 31
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xeqA00
4AQYO 5IWAO 2UXCO 4LFBO 2AGAA 2E5LO 3OTOO 1XEQA 1HNWO 5LL6Y 3T1HO 1XNQO 2N74A 3J81N 1X59A 4JI2O 4YHHO 5IT9N 4LF6O 4A5UB 2UXDO 4KHPO 4DR2O 4OPAA 1J5EO 2F4VO 2UUCO 3R66A 1N34O 1I94O 4DR6O 2VQFO 2FKXA 4DV1O 5BY1A 3JAMN 2ZM6O 1F7YA 4X65O 2JRIA 4DR7O 2VQEO 4LFAO 5H5NA 4X62O 1DK1A 3F5TA 1AILA 2Z0AA 4DV5O 4LF7O 2ZKOA 4JI3O 2UUBO 3SDLA 4DV0O 4YY3O 1N33O 2DOSA 4DV6O 4B3TO 5LMNO 1FJGO 4JI0O 1IBMO 5BR8O 5A2QN 2HHHO 4JV5O 1AB3A 4LF9O 1G1XB 4DR3O 1NS1A 1HNXO 4K0KO 2LW7A 4B3MO 4NXMO 1FYJA 4LF5O 1HNZO 1R1BA 4DUZO 1N36O 3J7AU 4DR5O 1D2DA 1KUQA 3T1YO 1A32A 1IBKO 3O65A 1XMQO 1IBLO 2UUAO 4X64O 4LF4O 4LF8O 3RT3C 4OX9O 4DV2O 4DR1O 4DV3O 4JI5O 4DV7O 1XMOO 2UU9O 1XNRO 4X66O 3M8AA 4DV4O 4JYAO 1FKAO 4JI8O 5LMUO 4JI6O 4LFCO 2DJVA 4JI4O 4NXNO 2UXBO 1N32O 5FLXN 4DR4O 1YZBA 5BXZA 1R6TA 1HR0O 4DUYO 4GKJO 4GKKO 4B3RO 4JI1O 3J80N 4B3SO 4OPHA 4JI7O
chains in the Genus database with same CATH superfamily
1K9MW 2AGAA 1JMKC 1CP9A 5CB4B 2GBOA 3AG2C 1ORQC 3A0RA 5LGNA 2Y4UA 4YHHO 2EBOA 4MTFA 2BOBC 1I94O 2F4VB 3FAVA 1M1KW 2P90A 4HBNA 3OFNG 4LWSB 4X62O 2ZM6B 4HZ3A 4H13B 4PHZA 3VOUA 5CBGA 4TQDA 2R72A 4U3FH 2XASA 1VF6C 1Q6UA 1XHXA 5LMNO 3JASA 3IGAC 1QNMA 1IBMO 1NQTA 5A2QN 1AI7A 1NTZH 1M56B 2Y0IA 2FYUH 2P06A 4F4LA 3FYIB 1BZKA 1YIJV 4YJ2A 4PELA 5GTHZ 3CCVV 2VS0A 1O9GA 3T1YO 1JX9A 1WP7A 2VWKA 1BQ0A 5KLVH 4O4LB 4MTGA 1P7BA 1O9HA 1IBLB 1KU9A 4ZIBA 1FS0G 1Y66A 2EZOA 1VQ8V 4BIZA 4JYAO 3DTUB 2NNUA 4AILC 3I56V 1Q8IA 1V55C 2BSKB 1EBOA 4FZ0A 4P2ZA 5EYPB 3ZEDA 5J9PC 3CPWU 4DK1A 4IYHA 2WSSG 4UVAA 1QQCA 4H0LB 4EFBA 3D3IA 1KQSU 4MT8A 5J2TB 1GO3F 4LFBO 4HAMA 3HKBB 5LL6Y 1QU7A 4U7NA 4JZ2A 2Q9LA 1JJ2U 3JSLA 1KMIZ 3JATB 5K1XA 3KG2A 2UXDO 3CYOA 4YHHB 2QM7A 5IYDO 1JPXA 2X7RB 2XOKG 5B1NA 3M7MX 3OM3B 4ZBMA 1I94B 3JD2A 1AJPA 3RYFA 4QE7A 2Q5ZA 2YICA 2HVJC 1BSMA 2AHZA 1OCOC 4X62B 4IL6Z 3UT5B 5JH7B 4JPRA 4J11A 1NKDA 3G6EV 3ICXA 2CTRA 3F5WC 4DYLA 5LMNB 2WLLB 1IBMB 3K5OA 1YF2A 1NTMH 1JJOA 1XREA 3CCEV 4DR3O 2CDYA 1GN3A 5J2TA 5LYJA 4FLVA 5JQGA 1JQ0A 3VBBA 1UFIA 3CXHF 4TSFG 2V1DA 1MG1A 5KMGB 4UCSA 1Y67A 5JJEB 3G67A 1MOFA 4O4IB 4IYIA 3T1YB 3CC2V 4WF9V 2EIKB 1ZTEA 3IC9A 1XOUA 4WFAV 3L70H 1GN4A 1PKXA 1WA8A 4GKKB 2XAQA 4JI5O 2JGDA 2ZE7A 1JR9A 1XMOO 2EX3A 5IWAB 3M8AA 4UCUA 4JYAB 1BCCH 1SESA 4RWUA 1R3JC 4DRXB 3K0DA 2DQ0A 2Q0AA 1R6TA 2EJ7A 1H2NA 1PV0A 3QG5A 1ZLZA 1E1QG 1DF4A 1BHBA 3J80N 4B3SO 4TQFA 3LNNA 4ZKIA 3TK1A 4Q6GA 4ZHQA 4LFBB 1JFFB 3CCLV 2D3OW 1V9PA 2N74A 3JYCA 4ZOLA 2Q8VA 3CCUV 3Q4HB 3RVZA 1WJZA 2HJDA 3ABLB 3AG4C 2QTSA 3WFVA 3B40A 1SQFA 1VEWA 3JAMN 1H2GA 3U10A 1ZWIC 1KYOF 5J2UB 2A0LA 4WFFA 5BZBA 1MABG 1QLEC 1KD1W 1I5YA 3KKYA 4WBNA 5BR8O 2WWWA 5KA5A 2IM9A 2B1GA 4RQEA 2RNBA 4I50A 3D3QA 3SJQC 1DLBA 3WG7C 4B3MO 3W7WA 3RGBA 5KUKA 1FFXA 3ZCCA 4IT5A 2OWOA 1IXMA 5H6QA 1GM7A 2F23A 1IBKO 1DF5A 3SYQA 1SQQH 1TUBA 4CC5A 3RT3C 3CCSV 3EFFK 1S77D 1AI5A 3E22B 2QTOA 2UU9O 4JI5B 3TGUH 1XMOB 3OAAG 4JI4O 4UB6Z 2ZD9A 2ETNA 3W7XA 1NU1H 1Q81W 1LUWA 5IYZB 1GMGA 1V54C 1VF7A 4JI1O 1GRJA 4O2AB 4PDLA 3ASNB 2HEPA 4JI7O 5L3BA 2BTOA 2CH7B 1LNQA 3OTOO 4B3SB 2HLDG 4YJ3B 3RBZA 1S3JA 3HKCB 2Q7EA 5C8YB 2M6YA 4CS4A 2L35A 3K03A 3QO8A 2UUBB 5DM6V 1Q7YW 3ML0A 5FNVA 1CEZA 2YI8A 4LBEC 1WP8A 3E83A 1CXZB 3W7SA 1F23A 2Q7GA 1H8HG 1PL4A 1Q82W 2ZDIA 2VQFO 2JS3A 2PGGA 2VRZA 5EIBD 4PD4F 4BWAA 3DC6A 1F51A 2Z0AA 3ZX6A 5IYBO 2IU3A 4TV9A 5CBHA 3F7VC 3UQ8A 1K4CC 1Q43A 1R3LC 4QNHB 3JSNA 3K58A 5IYZA 2YXHA 1VQNV 1Q86W 3IC7A 2HHHO 2IH3C 5BR8B 1NH2B 4R8CA 3UKMA 3N2KA 1FXKB 1AR4A 4TUYB 3HKEB 2HG5C 3SR2C 2LW7A 2X6AA 1R1BA 4B3MB 4DR5O 4TV8B 1SERA 2PI5A 2Q67A 1SA0A 4CBCA 2OIEA 4FFKA 2R70A 2F43G 4K35A 1TVKB 2ZDIC 2EILC 2ILMA 1IBKB 4FIPC 4I4TA 4R7CA 2ADQB 1H2LA 5IDJA 4DV2O 4UV9A 3SYPA 1K97A 5HFLA 2RN9A 2F95B 2BTQB 2GSMB 3JAKA 4PV1B 1YJ9V 2EIMB 2AW9A 1SQPH 1Y74A 1XL6A 4MVQA 2RQ6A 2UU9B 2DWEC 5L3EA 3LSSA 3ETDA 1H38A 4JI4B 3CCRV 5L3DA 3T2MA 2WLKA 4FFBB 4I9WA 5DECA 2LO1A 3H1HH 2WLIA 4UCRA 4CH3A 3CXCU 4RAIA 5BMVB 3B8NA 1W2BU 3ZN0A 4JZGA 2Y69C 3K04A 3VQXA 5KHKA 2P5OA 4JI1B 1AP5A 1RSOA 4NTXA 1JCHA 5LP6A 4MS2A 3OTOB 4NYKA 4MW3A 4TV8A 3ABKB 1XUQA 4YIOA 1SKVA 4GX1A 4DR2O 1OHHG 4DR6O 1IXBA 3KCXA 2VQFB 1YTFB 1YDXA 1R3KC 4MVRA 3ZHTA 3K5NA 1PNMA 4DV6O 5IJ0B 3AG2B 3MHHC 2ZE5A 5C93A 5LHHA 4UCTA 1N8RW 3LUTB 3OMIB 4ZI7B 1IVSA 5IE9A 2HHHB 1MSDA 2GTAA 1VQMV 1QLNA 5KX5B 1RM1C 3ASOC 1MZEA 3C3SA 3L71H 4G28B 5GONA 5LP6C 2UXXA 2XAGA 2XUMA 3FX7A 1M57C 1QBZA 4X89A 2WLHA 1A32A 3WB0A 1N0NA 4DR5B 5GTIZ 4G27B 4FVMA 5EZYB 1B6QA 2YUAA 3UO2A 5IY5C 2DYRC 3BA9A 1WLEA 2Q68A 2YS8A 4JAAA 4DV2B 1NBMG 2Q7HA 1ENVA 1Z5VA 4OGQB 5E1AC 1VQLV 1QCEA 5F2VO 4QJFB 4TT3G 1EFRG 3CRQA 2DMXA 2EINC 3CX5F 1GM9A 3B2EE 5AG2A 2CTPA 3OR7C 1P84F 2PYLA 4O4HA 4ASUG 5B5EZ 2P7TC 3FAVB 1NR7A 1W0JG 3L74H 2PI4A 1LR1A 3APQA 2H94A 4H37A 4J7KA 4KXRA 1Y4MA 4X1IA 3ZRXA 2FTKA 1MSWD 5EC2C 1VF6A 3JASB 3R66A 4YIPA 4FLUA 1N34O 1V55B 4LH6A 4GT1A 2QWQB 5BY1A 4DR6B 1KP3A 4LP8A 3BFRA 4YJ2B 2ZT9B 4DV5O 3SDLA 4YY3O 4GUNA 3K06A 2LQTA 1M5IA 4DV6B 5CA0A 3HKDB 1SZXA 1OZ0A 2IJHA 2HVKC 4PDRA 3OGIB 2P22C 3OEHG 4LR3A 3UCSC 2B5UA 2YIBD 3JD0A 2PTMA 3SPIA 2ZE8A 1DTOA 2E3CA 1D5AA 1VMGA 5JWPA 2RJZA 1Q3EA 4H44B 1R6KA 3ZMSA 2B1IA 2ADPA 4CS3A 1OCCC 1OCOB 5JCOA 2Q6AA 2ZQMA 4X64O 3AK2A 2QWRB 3K08A 3HR0A 1SC5B 3JARA 3P30A 4X9QA 3RYCB 2G38A 3E2EA 3SJBC 4FLYA 1FPOA 3OEEG 5L3CA 4GZRB 5B66Z 2CK3G 2P67A 3FB5C 2YI9A 3HKDA 5B3SC 3FB7C 1VQOV 5TISZ 4GKKO 3L73H 5IWAO 4BW5A 5JJNB 1SETA 4ICGA 5KUMA 3RYFB 3RW0A 2FL4A 4GX5A 1AR1B 4JI2O 5JCOC 1SRYA 2JVDA 1J5EO 1FJGB 2QM4A 2ZR2A 3TXSA 1P49A 1N34B 3QF7A 2IBZH 4LFAO 3RYCA 4JYYA 2OIGA 2YDEA 1S5HC 2K9PA 4DW1A 5LYJB 5JQGB 1XQ8A 2JDIG 1I0HA 3MAQA 2Y48A 2LGWA 4AI8A 4DV0O 4DV5B 1N33O 3H1IH 2NR5A 4YY3B 1BHAA 3AG4B 4B08A 1J95A 3A8TA 3OGCC 1WA8B 2JGUA 3CE2A 3DC5A 1KKDA 1Q6IA 2JGDB 1M90W 3T1CA 1T5EA 4LF5O 1P4RA 2W6IG 4CC6A 3S3WA 3MD0A 4MVUA 5L3GA 5IYCO 3SYCA 1WNSA 1R3IC 5GW7A 1QLEB 2B9ZA 1XMQO 1YJWV 2CTQA 2OCHA 4X64B 4NTYA 1GN2A 4O4JA 3ZMUA 3SJCC 4J9ZB 3LNMB 4GX2A 3G4SV 3BPZA 1VQKV 3H9VA 3G71V 1FKAO 4UFZA 3ABMC 2DJVA 4ZHQB 4RUEA 3TJTA 2Y0PA 3WG7B 4ZOLB 4DR4O 1YZBA 4WFGA 3X2QC 4FLXA 2QA4V 1QVGU 3BHPA 3HB3B 3BABA 4QE9A 1Z2GA 4JTCB 2GUZB 4L8JA 2X0LA 4UXNA 4GYCB 4JASA 3P32A 4PA9A 2QM8A 3T1HO 3EVKA 1X59A 3OUFA 1R73A 3CCMV 4JI2B 2W0FC 4WBNB 1J5EB 1Y76A 2W6JG 4YXWG 2P4KA 1V54B 2VQEO 2GV9A 4I50B 2EULA 4U3JA 4LFAB 4X20A 1HDJA 3ZMZA 5ITZA 1XBLA 1VARA 2UUBO 5LGTA 1FFXB 4N23A 3IAYA 4G2KA 5JJJB 1PM9A 4DV0B 1N33B 1AROP 2GUZA 2ZXWC 1AB3A 1TUBB 1EZJA 1AP6A 2NN4A 1YVWA 2VWJA 1L0NH 1K8AW 3IFXA 2WA4A 1CPYA 3C3TA 1N36O 1QHTA 4LCUC 4LF5B 3CCQV 1EM1A 4RQFA 2E74B 5LA6A 1PL0A 2UUAO 4WFHA 4LF4O 4D7SA 1XMQB 2XAHA 1S76D 4QPJA 3ZHRA 4CH5A 1I7FA 1X4TA 2E75B 3NR7A 1ZUQA 5B1BC 1F4MA 3ZRSA 4EEQA 3JD3A 5FNVB 3LDCA 3FYEB 1S5JA 4DR4B 2YIAA 4QGPA 2JJ1G 3THOA 1WB7A 3WU2Z 3LDDA 2O57A 2UXNA 2EILB 5FPOA 2IJJA 2QJ1A 2JEUA 2E5LO 4F6EA 3K59A 1PNLA 2P4VA 1I5XA 1XNQO 3RVYA 3T1HB 3D36A 4X1KA 1FFTB 3RYIA 1ZX3A 1SZTA 1BGYH 4TV9B 2QWOB 1VQ4V 4MVMA 4EFEA 1HP8A 1FAFA 3K5MA 1S72V 3MDSA 3QO5A 1WAZA 3N2KB 5EC1C 2YXYA 2WLNA 4Z1VA 1DK1A 2Y69B 4JTAB 2VQEB 1QR8A 4NVPA 3UO3A 1SA0B 4J41A 2JK5C 2V7QG 3AK1A 2QE7G 3ZBHA 4I4TB 1ZL8A 2BCCH 1AVMA 5JVDA 2CGOA 1SQVH 2N04A 1H2MA 1PPJH 3RFRA 4FM0A 3JAKB 1K5QA 4FM1A 3D36C 1Y74B 3FB6C 1D2DA 5LXTA 1N36B 2HFEC 3SPCA 2R9AA 3CS5A 1VF5B 3STZC 1F4NA 4LF8O 5D5QA 4J80A 3ZHSA 1VQ9V 2OTJV 2WLIB 2UUAB 4LF4B 2DYSC 2XTAA 1WPBA 3OT7A 3FFQA 2CUGA 3ZN1A 4DV7O 1VIBA 3K79A 4UCOA 3SPJA 1RSOB 1W59A 4KFMA 4LFCO 1SQXH 4QPKA 1RM1B 3ASOB 5LP6B 2HKOA 4NKGB 4DO2A 2ARHA 3CEIA 4PA3A 1XHZA 1M57B 3NXSA 4FPPA 2LFSA 3ZRWA 1HW7A 2DQ3A 1QVFU 2ZNIA 1XDCA 1P7GA 4CH4A 3CJHA 3ETGA 1EN5A 5IY5B 2CAZC 2DYRB 2E5LB 4XBFA 5E79Z 3CB2A 4IHJA 2K1EA 4JGSA 1XNQB 2AZ0A 2YC0A 1TA8A 4I0XA 3ZMTA 2EINB 3DXRA 1Q6HA 1NVPB 4JYCA 4FK5C 1OCZC 3FD9A 3STLC 5EBLC 5EIBC 5KAIZ 2H8PC 5GONB 1R6NA 4UVBA 2OCCC 3AG3C 4JTDB 1URFA 3N2GA 4XDJA 2V4DA 3JALA 4EB6A 5CBFA 4HNAA 4J7JA 3BA8A 3ZMVA 2A7WA 3H1JH 5KHHA 3K9SA 2RMKB 4NTWA 1B06A 4IIJA 5LBQA 3FKSG 2IW5A 4E4EA 2QWPB 4CS2A 2JJ2G 4WCEV 2IJKA 2LJ2A 5CN0A 2OTLV 1NJIW 2N05A 4LNUA 4F6RA 1GM8A 1KKCA 1HWYA 2XHBA 4TOIA 3ETQA 4OX9O 4UCVA 4LF8B 1SQGA 4PA4A 4O4HB 3W7TA 4DV7B 4W4LA 2LFRA 1IURA 1L1FA 3BCCH 4LFCB 1U96A 1YEWA 5BXZA 1Y6XA 3K9AA 2FB5A 4X1IB 1S0VA 2CE4A 1YTFD 1FD9A 1OCCB 3E8HA 1M4UA 4KL1A 3E86A 4MTXA 1EZVH 1Q5OA 1L0LH 1UJWB 2NLJC 5FL7G 3J81N 1EN6A 1W0KG 4JYBA 2EIJC 2KG7A 2XNDG 2DE0X 2UUCO 2PY5A 4R50A 4UV8A 4B7KA 4PA7A 4DW0A 5CA0B 5B3SB 1L8DA 3I5DA 3L72H 4DR7O 3S3XA 5H5NA 3OMAB 2JEXA 4JAUA 4O2BA 2P6JA 4BW9A 3T4ZA 2KKWA 3F7YC 4N21A 1YJNV 1FJGO 1TGOA 3VQWA 1S5LZ 1YCIA 4JV5O 1JOYA 1HNXO 1WN7A 1GH6A 1SQBH 3EXAA 1VQ7V 2WA3A 3JARB 4K3AA 1N0JA 3H1KH 4X88A 1GTOA 3K0GA 2WPDG 3RN4A 5DN6G 2E76B 5B1AC 4PDMA 3CP1A 3ABTA 4GKJB 5LHIA 2ZINA 4OX9B 5IJ9B 3H01A 1PNKA 2WLJA 4AQYB 2AXTZ 2PZSA 2QKAA 3PJSK 4LC1A 3G6BA 3K57A 5CA3A 3OTFA 4QIWF 1U97A 4P30A 1OCRC 3PN1A 4PA6A 2UXBO 3L75H 1COWG 1YHQV 1TUEB 2GHYA 1KP2A 1ZSPA 3KZIZ 3GWOA 3N27A 4AHCA 2F66C 1AI6A 3UM7A 2Q73A 3IJ4A 3RYHA 1YXBA 2UXCO 4X65B 3O9OA 4Q20A 3OUSA 4I9QA 3GB7C 4J7ZA 2YIBA 3CC4V 2YXLA 5H6RA 4JI3B 5LOVA 3ABMB 5H9CA 1AR5A 3SJAC 1Q90D 3AK3A 1OV9A 2EZPA 2HJFC 1RPRA 2R9IA 3OMNB 2D2CB 3X2QB 4U7OA 2UUCB 3ZRVA 5IJ9A 2ODMA 1BS3A 5CB4A 3QO7A 3TETA 4BAYA 3F5TA 1WPXA 3B8MA 3U0ZA 4DR7B 3CD6V 2ZKOA 2QKCA 1G6UA 2KSDA 3SPGA 2MK3A 3L9DA 2Z3YA 2QEXV 3AG1C 4PDVA 3I55V 5L3FA 1BL8A 3OR6C 1G1XB 1KBHA 1XI1A 4JV5B 1BQZA 1MA1A 2DW4A 4LWSA 2M7WA 2IJIA 4O4JB 4CZZA 4OXSA 1VQ5V 1HNXB 3E8BA 4PI0A 2Y4TA 2XAFA 2YEVB 2GTSA 4XDKA 1GK9A 1E1RG 2W0XA 2ZXWB 3E8GA 2C2AA 4DV4O 2AHYA 4FLTA 5LMUO 1YI2V 1XILA 4FMTA 4I7ZB 4I5SA 4NXNO 1NR1A 3EHBB 1N32O 4O4LA 4RO2A 4DK0A 2UXBB 2ZR3A 1Z5WA 2HR3A 3LSUA 1Y76B 4OPHA 1GN6A 2L6LA 1AJQA 3H1LH 3VQYA 1HNWO 3AG7A 2UXCB 5KHIA 5D5PA 4U3JB 2YEVA 4X20B 5IT9N 1NZ6A 5ITZB 3W7UA 3E8FA 4Z1MG 4KHPO 2BSKA 4KP4A 3ZHVA 1M56C 5EYPA 1G4YB 5B1BB 1SF9A 1MMMA 2H3OA 3ZHQA 4XDLA 2FKXA 2PF4E 2QWNB 1K73W 4HYOA 1F7YA 1GKFA 1KECA 3HKBA 2HP8A 3U11A 3TXQA 5KA6A 3QNEA 3JATA 1BE3H 4MW8A 1NT2B 3AEIA 2QSAA 5LA6B 2JS5A 4LF9O 3B77A 2AZ2A 1K5SA 2QKSA 3R65A 3CSXA 4GCZA 3MHSC 1AJNA 3ETEA 4NXMO 3UT5A 5JH7A 1YSCA 3A0BZ 2Q69A 3O65A 2WLLA 5EK0A 1US6A 4FZ1A 3CMAV 4MVZA 2Z5UA 4P9PA 4B7EA 4DR1O 5EBMC 3C90A 1XNRO 2YSUB 4UB8Z 5K1PA 1LUVA 4JI8O 4JI6O 5KMGA 1B04A 4DV4B 4O4IA 5LMUB 4NXNB 4X1KB 3RYIB 2UXDB 1PP9H 1I08A 1N32B 3BY6A 3HPLC 3JD4A 2RCVA 3LSQA 3FB8C 4B3RO 4JAVA 3SPHA 1XL4A 2A06H 4FLWA 1K34A 4ABMA 1H2KA 1XEQA 2DYSB 5KHJA 1K7DA 4K8XA 1FXHA 3T4DA 1HNWB 5DEDA 4DRXA 4LF6O 2ITDC 5B1OA 3P3NA 4OPAA 4KHPB 5CA1B 1NI8A 1MNGA 2ZE6A 1BMFG 3ZS8C 1ZL8B 1ZAUA 4DR3B 5JVDB 4MTOA 1AI4A 1JFFA 2PUSA 3OD4A 5KAFZ 3CWBH 3Q4HA 2DOSA 4B3TO 3DSQA 2EIKC 2DN9A 5LXTB 4WFBV 1TAEA 5HFMA 4JI0O 2F1MA 3P3PA 5LGUA 3BVOA 2QR4A 4X8AA 1NS1A 4LF9B 1WB8A 5J2UA 3BEHA 3CCJV 3CC7V 2JIZG 3A2FA 2ZIMA 3BAAA 1OCZB 2LW1A 1HNZO 3E35A 3CRCA 4DUZO 1K3EA 4NXMB 1VQPV 4MVSA 2OCCB 3AG3B 3LDEA 1ROPA 3WB2A 4I55B 5CA1A 3KCYA 3ZRWB 4GLXA 4R6ZA 4DR1B 3CJHB 4D6TH 1XNRB 3ABLC 4JI8B 4JI6B 2MW2B 4IHJB 2XAJA 2Q4PA 3SYOA 1HR0O 2YIDA 2FMLA 1JVMA 1RP3B 4DUYO 4I0XB 3DXRB 3E22A 2ZIOA 3GVMA 4B3RB 3BRCA 4J10A 4D7TA 3JD1A 2PYJA 1N4CA 1RFYA 3B09A 4FJCC 1KB9F 2R9RB 2DWDC 3N2GB 2BE3A 3JALB 4EB6B 4HNAB 4I55A 3JAWB 4LF6B 1PD3A 4O2AA 4P9OA 4IIJB 4DV1O 1OJHA 3SYAA 2BOCC 2CH7A 2JRIA 2ZCEA 1M9NA 4YJ3A 2A79B 3HKCA 3ZJZA 1EN4A 5C8YA 1AILA 4FLZA 2Q0OC 4LF7O 2WAMA 3OW2U 1MZFA 3K3WA 1NH2D 2X6CA 4LNUB 4B3TB 4F6RB 3APOA 1K33A 2IH1C 2EIJB 1KC8W 4K8ZA 2WLMA 4JI0B 2QGNA 4K0KO 3G80A 4NR1A 4L87A 2QDOA 5KHGA 2ZNJA 3J7AU 4NB5A 1KUQA 1HNZB 3K5LA 4DUZB 1IDSA 1IZ3A 3JAWA 3ASNC 4CH6A 2XT9A 4X1YB 3ZIAG 1FXKA 4TWKA 1VQ6V 3ABUA 4TUYA 4DV3O 3HKEA 1THZA 5FPRA 4JI7B 4X66O 4JF3A 4GX0A 2IU0A 2GDSA 3DGEA 2ATKC 1NVPD 4Z2WA 1D5NA 2ITCC 5FLXN 1IX9A 3TCUA 1TVKA 2A9HA 2KG7B 3D8CA 4DXWA 4GKJO 3E89A 1H2SB 1HR0B 5B1AB 1GAXA 3QVNA 2F93B 4DUYB 2BTQA 4AQYO 1RPOA 4E2LA 4W4KA 1K4DC 1VP7A 2CGNA 1E79G 4O2BB 3GWKC 4UVCA 4FFBA 4A5UB 2X6BA 3ZHUA 4BR6A 5H2FZ 4J42A 1OCRB 4MVOA 2F4VO 4UUJC 5BMVA 1FXKC 4X1YA 1SS3A 4FM2A 3JCUZ 2ZM6O 4X65O 4BIOA 1BT8A 2EJRA 4DV1B 2LGQA 4J9YB 3OE7G 4JI3O 4PJ0Z 4LF7B 2KQXA 2OYQA 1M93A 1UPGA 5A9GA 4H33A 4BIUA 2A3QA 2EIMC 1K92A 3M99B 2LP7A 3B4SA 2KB1A 4K0KB 1FYJA 1H8EG 5IJ0A 4MSWC 1B3QA 4LH7A 4C7UA 3RWRD 1IBLO 4ZI7A 1DGSA 2RDCA 3A0HZ 3QTCA 3CRAA 2OT5A 3CRMA 1G8MA 1YITV 4IGGA 4EKWA 3AG1B 5KX5A 1FXVA 3RYHB 3ABKC 4PI2A 2CTWA 4DV3B 4WFEA 1QR9A 1NTKH 3CHXA 3WB1A 4X66B 3VQVA 4RUFA 5LOVB 3SGIA 5CMUA 5LHGA 1JA8A 5EZYA 4DR2B 3CRRA 4KUMA 3JCZA 5EBWC 3CMEV
chains in the Genus database with same CATH topology
4AQYO 5IWAO 2UXCO 4LFBO 2AGAA 2E5LO 3OTOO 1XEQA 1HNWO 5LL6Y 3T1HO 1XNQO 2N74A 3J81N 1X59A 4JI2O 4YHHO 5IT9N 4LF6O 4A5UB 2UXDO 4KHPO 4DR2O 4OPAA 1J5EO 2F4VO 2UUCO 3R66A 1N34O 1I94O 4DR6O 2VQFO 2FKXA 4DV1O 5BY1A 3JAMN 2ZM6O 1F7YA 4X65O 2JRIA 4DR7O 2VQEO 4LFAO 5H5NA 4X62O 1DK1A 3F5TA 1AILA 2Z0AA 4DV5O 4LF7O 2ZKOA 4JI3O 2UUBO 3SDLA 4DV0O 4YY3O 1N33O 2DOSA 4DV6O 4B3TO 5LMNO 1FJGO 4JI0O 1IBMO 5BR8O 5A2QN 2HHHO 4JV5O 1AB3A 4LF9O 1G1XB 4DR3O 1NS1A 1HNXO 4K0KO 2LW7A 4B3MO 4NXMO 1FYJA 4LF5O 1HNZO 1R1BA 4DUZO 1N36O 3J7AU 4DR5O 1D2DA 1KUQA 3T1YO 1A32A 1IBKO 3O65A 1XMQO 1IBLO 2UUAO 4X64O 4LF4O 4LF8O 3RT3C 4OX9O 4DV2O 4DR1O 4DV3O 4JI5O 4DV7O 1XMOO 2UU9O 1XNRO 4X66O 3M8AA 4DV4O 4JYAO 1FKAO 4JI8O 5LMUO 4JI6O 4LFCO 2DJVA 4JI4O 4NXNO 2UXBO 1N32O 5FLXN 4DR4O 1YZBA 5BXZA 1R6TA 1HR0O 4DUYO 4GKJO 4GKKO 4B3RO 4JI1O 3J80N 4B3SO 4OPHA 4JI7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY O;  5IWA O;  2UXC O;  4LFB O;  2AGA A;  2E5L O;  3OTO O;  1XEQ A;  1HNW O;  5LL6 Y;  3T1H O;  1XNQ O;  2N74 A;  3J81 N;  1X59 A;  4JI2 O;  4YHH O;  5IT9 N;  4LF6 O;  4A5U B;  2UXD O;  4KHP O;  4DR2 O;  4OPA A;  1J5E O;  2F4V O;  2UUC O;  3R66 A;  1N34 O;  1I94 O;  4DR6 O;  2VQF O;  2FKX A;  4DV1 O;  5BY1 A;  3JAM N;  2ZM6 O;  1F7Y A;  4X65 O;  2JRI A;  4DR7 O;  2VQE O;  4LFA O;  5H5N A;  4X62 O;  1DK1 A;  3F5T A;  1AIL A;  2Z0A A;  4DV5 O;  4LF7 O;  2ZKO A;  4JI3 O;  2UUB O;  3SDL A;  4DV0 O;  4YY3 O;  1N33 O;  2DOS A;  4DV6 O;  4B3T O;  5LMN O;  1FJG O;  4JI0 O;  1IBM O;  5BR8 O;  5A2Q N;  2HHH O;  4JV5 O;  1AB3 A;  4LF9 O;  1G1X B;  4DR3 O;  1NS1 A;  1HNX O;  4K0K O;  2LW7 A;  4B3M O;  4NXM O;  1FYJ A;  4LF5 O;  1HNZ O;  1R1B A;  4DUZ O;  1N36 O;  3J7A U;  4DR5 O;  1D2D A;  1KUQ A;  3T1Y O;  1A32 A;  1IBK O;  3O65 A;  1XMQ O;  1IBL O;  2UUA O;  4X64 O;  4LF4 O;  4LF8 O;  3RT3 C;  4OX9 O;  4DV2 O;  4DR1 O;  4DV3 O;  4JI5 O;  4DV7 O;  1XMO O;  2UU9 O;  1XNR O;  4X66 O;  3M8A A;  4DV4 O;  4JYA O;  1FKA O;  4JI8 O;  5LMU O;  4JI6 O;  4LFC O;  2DJV A;  4JI4 O;  4NXN O;  2UXB O;  1N32 O;  5FLX N;  4DR4 O;  1YZB A;  5BXZ A;  1R6T A;  1HR0 O;  4DUY O;  4GKJ O;  4GKK O;  4B3R O;  4JI1 O;  3J80 N;  4B3S O;  4OPH A;  4JI7 O; 
#chains in the Genus database with same CATH topology
 1K9M W;  2AGA A;  1JMK C;  1CP9 A;  5CB4 B;  2GBO A;  3AG2 C;  1ORQ C;  3A0R A;  5LGN A;  2Y4U A;  4YHH O;  2EBO A;  4MTF A;  2BOB C;  1I94 O;  2F4V B;  3FAV A;  1M1K W;  2P90 A;  4HBN A;  3OFN G;  4LWS B;  4X62 O;  2ZM6 B;  4HZ3 A;  4H13 B;  4PHZ A;  3VOU A;  5CBG A;  4TQD A;  2R72 A;  4U3F H;  2XAS A;  1VF6 C;  1Q6U A;  1XHX A;  5LMN O;  3JAS A;  3IGA C;  1QNM A;  1IBM O;  1NQT A;  5A2Q N;  1AI7 A;  1NTZ H;  1M56 B;  2Y0I A;  2FYU H;  2P06 A;  4F4L A;  3FYI B;  1BZK A;  1YIJ V;  4YJ2 A;  4PEL A;  5GTH Z;  3CCV V;  2VS0 A;  1O9G A;  3T1Y O;  1JX9 A;  1WP7 A;  2VWK A;  1BQ0 A;  5KLV H;  4O4L B;  4MTG A;  1P7B A;  1O9H A;  1IBL B;  1KU9 A;  4ZIB A;  1FS0 G;  1Y66 A;  2EZO A;  1VQ8 V;  4BIZ A;  4JYA O;  3DTU B;  2NNU A;  4AIL C;  3I56 V;  1Q8I A;  1V55 C;  2BSK B;  1EBO A;  4FZ0 A;  4P2Z A;  5EYP B;  3ZED A;  5J9P C;  3CPW U;  4DK1 A;  4IYH A;  2WSS G;  4UVA A;  1QQC A;  4H0L B;  4EFB A;  3D3I A;  1KQS U;  4MT8 A;  5J2T B;  1GO3 F;  4LFB O;  4HAM A;  3HKB B;  5LL6 Y;  1QU7 A;  4U7N A;  4JZ2 A;  2Q9L A;  1JJ2 U;  3JSL A;  1KMI Z;  3JAT B;  5K1X A;  3KG2 A;  2UXD O;  3CYO A;  4YHH B;  2QM7 A;  5IYD O;  1JPX A;  2X7R B;  2XOK G;  5B1N A;  3M7M X;  3OM3 B;  4ZBM A;  1I94 B;  3JD2 A;  1AJP A;  3RYF A;  4QE7 A;  2Q5Z A;  2YIC A;  2HVJ C;  1BSM A;  2AHZ A;  1OCO C;  4X62 B;  4IL6 Z;  3UT5 B;  5JH7 B;  4JPR A;  4J11 A;  1NKD A;  3G6E V;  3ICX A;  2CTR A;  3F5W C;  4DYL A;  5LMN B;  2WLL B;  1IBM B;  3K5O A;  1YF2 A;  1NTM H;  1JJO A;  1XRE A;  3CCE V;  4DR3 O;  2CDY A;  1GN3 A;  5J2T A;  5LYJ A;  4FLV A;  5JQG A;  1JQ0 A;  3VBB A;  1UFI A;  3CXH F;  4TSF G;  2V1D A;  1MG1 A;  5KMG B;  4UCS A;  1Y67 A;  5JJE B;  3G67 A;  1MOF A;  4O4I B;  4IYI A;  3T1Y B;  3CC2 V;  4WF9 V;  2EIK B;  1ZTE A;  3IC9 A;  1XOU A;  4WFA V;  3L70 H;  1GN4 A;  1PKX A;  1WA8 A;  4GKK B;  2XAQ A;  4JI5 O;  2JGD A;  2ZE7 A;  1JR9 A;  1XMO O;  2EX3 A;  5IWA B;  3M8A A;  4UCU A;  4JYA B;  1BCC H;  1SES A;  4RWU A;  1R3J C;  4DRX B;  3K0D A;  2DQ0 A;  2Q0A A;  1R6T A;  2EJ7 A;  1H2N A;  1PV0 A;  3QG5 A;  1ZLZ A;  1E1Q G;  1DF4 A;  1BHB A;  3J80 N;  4B3S O;  4TQF A;  3LNN A;  4ZKI A;  3TK1 A;  4Q6G A;  4ZHQ A;  4LFB B;  1JFF B;  3CCL V;  2D3O W;  1V9P A;  2N74 A;  3JYC A;  4ZOL A;  2Q8V A;  3CCU V;  3Q4H B;  3RVZ A;  1WJZ A;  2HJD A;  3ABL B;  3AG4 C;  2QTS A;  3WFV A;  3B40 A;  1SQF A;  1VEW A;  3JAM N;  1H2G A;  3U10 A;  1ZWI C;  1KYO F;  5J2U B;  2A0L A;  4WFF A;  5BZB A;  1MAB G;  1QLE C;  1KD1 W;  1I5Y A;  3KKY A;  4WBN A;  5BR8 O;  2WWW A;  5KA5 A;  2IM9 A;  2B1G A;  4RQE A;  2RNB A;  4I50 A;  3D3Q A;  3SJQ C;  1DLB A;  3WG7 C;  4B3M O;  3W7W A;  3RGB A;  5KUK A;  1FFX A;  3ZCC A;  4IT5 A;  2OWO A;  1IXM A;  5H6Q A;  1GM7 A;  2F23 A;  1IBK O;  1DF5 A;  3SYQ A;  1SQQ H;  1TUB A;  4CC5 A;  3RT3 C;  3CCS V;  3EFF K;  1S77 D;  1AI5 A;  3E22 B;  2QTO A;  2UU9 O;  4JI5 B;  3TGU H;  1XMO B;  3OAA G;  4JI4 O;  4UB6 Z;  2ZD9 A;  2ETN A;  3W7X A;  1NU1 H;  1Q81 W;  1LUW A;  5IYZ B;  1GMG A;  1V54 C;  1VF7 A;  4JI1 O;  1GRJ A;  4O2A B;  4PDL A;  3ASN B;  2HEP A;  4JI7 O;  5L3B A;  2BTO A;  2CH7 B;  1LNQ A;  3OTO O;  4B3S B;  2HLD G;  4YJ3 B;  3RBZ A;  1S3J A;  3HKC B;  2Q7E A;  5C8Y B;  2M6Y A;  4CS4 A;  2L35 A;  3K03 A;  3QO8 A;  2UUB B;  5DM6 V;  1Q7Y W;  3ML0 A;  5FNV A;  1CEZ A;  2YI8 A;  4LBE C;  1WP8 A;  3E83 A;  1CXZ B;  3W7S A;  1F23 A;  2Q7G A;  1H8H G;  1PL4 A;  1Q82 W;  2ZDI A;  2VQF O;  2JS3 A;  2PGG A;  2VRZ A;  5EIB D;  4PD4 F;  4BWA A;  3DC6 A;  1F51 A;  2Z0A A;  3ZX6 A;  5IYB O;  2IU3 A;  4TV9 A;  5CBH A;  3F7V C;  3UQ8 A;  1K4C C;  1Q43 A;  1R3L C;  4QNH B;  3JSN A;  3K58 A;  5IYZ A;  2YXH A;  1VQN V;  1Q86 W;  3IC7 A;  2HHH O;  2IH3 C;  5BR8 B;  1NH2 B;  4R8C A;  3UKM A;  3N2K A;  1FXK B;  1AR4 A;  4TUY B;  3HKE B;  2HG5 C;  3SR2 C;  2LW7 A;  2X6A A;  1R1B A;  4B3M B;  4DR5 O;  4TV8 B;  1SER A;  2PI5 A;  2Q67 A;  1SA0 A;  4CBC A;  2OIE A;  4FFK A;  2R70 A;  2F43 G;  4K35 A;  1TVK B;  2ZDI C;  2EIL C;  2ILM A;  1IBK B;  4FIP C;  4I4T A;  4R7C A;  2ADQ B;  1H2L A;  5IDJ A;  4DV2 O;  4UV9 A;  3SYP A;  1K97 A;  5HFL A;  2RN9 A;  2F95 B;  2BTQ B;  2GSM B;  3JAK A;  4PV1 B;  1YJ9 V;  2EIM B;  2AW9 A;  1SQP H;  1Y74 A;  1XL6 A;  4MVQ A;  2RQ6 A;  2UU9 B;  2DWE C;  5L3E A;  3LSS A;  3ETD A;  1H38 A;  4JI4 B;  3CCR V;  5L3D A;  3T2M A;  2WLK A;  4FFB B;  4I9W A;  5DEC A;  2LO1 A;  3H1H H;  2WLI A;  4UCR A;  4CH3 A;  3CXC U;  4RAI A;  5BMV B;  3B8N A;  1W2B U;  3ZN0 A;  4JZG A;  2Y69 C;  3K04 A;  3VQX A;  5KHK A;  2P5O A;  4JI1 B;  1AP5 A;  1RSO A;  4NTX A;  1JCH A;  5LP6 A;  4MS2 A;  3OTO B;  4NYK A;  4MW3 A;  4TV8 A;  3ABK B;  1XUQ A;  4YIO A;  1SKV A;  4GX1 A;  4DR2 O;  1OHH G;  4DR6 O;  1IXB A;  3KCX A;  2VQF B;  1YTF B;  1YDX A;  1R3K C;  4MVR A;  3ZHT A;  3K5N A;  1PNM A;  4DV6 O;  5IJ0 B;  3AG2 B;  3MHH C;  2ZE5 A;  5C93 A;  5LHH A;  4UCT A;  1N8R W;  3LUT B;  3OMI B;  4ZI7 B;  1IVS A;  5IE9 A;  2HHH B;  1MSD A;  2GTA A;  1VQM V;  1QLN A;  5KX5 B;  1RM1 C;  3ASO C;  1MZE A;  3C3S A;  3L71 H;  4G28 B;  5GON A;  5LP6 C;  2UXX A;  2XAG A;  2XUM A;  3FX7 A;  1M57 C;  1QBZ A;  4X89 A;  2WLH A;  1A32 A;  3WB0 A;  1N0N A;  4DR5 B;  5GTI Z;  4G27 B;  4FVM A;  5EZY B;  1B6Q A;  2YUA A;  3UO2 A;  5IY5 C;  2DYR C;  3BA9 A;  1WLE A;  2Q68 A;  2YS8 A;  4JAA A;  4DV2 B;  1NBM G;  2Q7H A;  1ENV A;  1Z5V A;  4OGQ B;  5E1A C;  1VQL V;  1QCE A;  5F2V O;  4QJF B;  4TT3 G;  1EFR G;  3CRQ A;  2DMX A;  2EIN C;  3CX5 F;  1GM9 A;  3B2E E;  5AG2 A;  2CTP A;  3OR7 C;  1P84 F;  2PYL A;  4O4H A;  4ASU G;  5B5E Z;  2P7T C;  3FAV B;  1NR7 A;  1W0J G;  3L74 H;  2PI4 A;  1LR1 A;  3APQ A;  2H94 A;  4H37 A;  4J7K A;  4KXR A;  1Y4M A;  4X1I A;  3ZRX A;  2FTK A;  1MSW D;  5EC2 C;  1VF6 A;  3JAS B;  3R66 A;  4YIP A;  4FLU A;  1N34 O;  1V55 B;  4LH6 A;  4GT1 A;  2QWQ B;  5BY1 A;  4DR6 B;  1KP3 A;  4LP8 A;  3BFR A;  4YJ2 B;  2ZT9 B;  4DV5 O;  3SDL A;  4YY3 O;  4GUN A;  3K06 A;  2LQT A;  1M5I A;  4DV6 B;  5CA0 A;  3HKD B;  1SZX A;  1OZ0 A;  2IJH A;  2HVK C;  4PDR A;  3OGI B;  2P22 C;  3OEH G;  4LR3 A;  3UCS C;  2B5U A;  2YIB D;  3JD0 A;  2PTM A;  3SPI A;  2ZE8 A;  1DTO A;  2E3C A;  1D5A A;  1VMG A;  5JWP A;  2RJZ A;  1Q3E A;  4H44 B;  1R6K A;  3ZMS A;  2B1I A;  2ADP A;  4CS3 A;  1OCC C;  1OCO B;  5JCO A;  2Q6A A;  2ZQM A;  4X64 O;  3AK2 A;  2QWR B;  3K08 A;  3HR0 A;  1SC5 B;  3JAR A;  3P30 A;  4X9Q A;  3RYC B;  2G38 A;  3E2E A;  3SJB C;  4FLY A;  1FPO A;  3OEE G;  5L3C A;  4GZR B;  5B66 Z;  2CK3 G;  2P67 A;  3FB5 C;  2YI9 A;  3HKD A;  5B3S C;  3FB7 C;  1VQO V;  5TIS Z;  4GKK O;  3L73 H;  5IWA O;  4BW5 A;  5JJN B;  1SET A;  4ICG A;  5KUM A;  3RYF B;  3RW0 A;  2FL4 A;  4GX5 A;  1AR1 B;  4JI2 O;  5JCO C;  1SRY A;  2JVD A;  1J5E O;  1FJG B;  2QM4 A;  2ZR2 A;  3TXS A;  1P49 A;  1N34 B;  3QF7 A;  2IBZ H;  4LFA O;  3RYC A;  4JYY A;  2OIG A;  2YDE A;  1S5H C;  2K9P A;  4DW1 A;  5LYJ B;  5JQG B;  1XQ8 A;  2JDI G;  1I0H A;  3MAQ A;  2Y48 A;  2LGW A;  4AI8 A;  4DV0 O;  4DV5 B;  1N33 O;  3H1I H;  2NR5 A;  4YY3 B;  1BHA A;  3AG4 B;  4B08 A;  1J95 A;  3A8T A;  3OGC C;  1WA8 B;  2JGU A;  3CE2 A;  3DC5 A;  1KKD A;  1Q6I A;  2JGD B;  1M90 W;  3T1C A;  1T5E A;  4LF5 O;  1P4R A;  2W6I G;  4CC6 A;  3S3W A;  3MD0 A;  4MVU A;  5L3G A;  5IYC O;  3SYC A;  1WNS A;  1R3I C;  5GW7 A;  1QLE B;  2B9Z A;  1XMQ O;  1YJW V;  2CTQ A;  2OCH A;  4X64 B;  4NTY A;  1GN2 A;  4O4J A;  3ZMU A;  3SJC C;  4J9Z B;  3LNM B;  4GX2 A;  3G4S V;  3BPZ A;  1VQK V;  3H9V A;  3G71 V;  1FKA O;  4UFZ A;  3ABM C;  2DJV A;  4ZHQ B;  4RUE A;  3TJT A;  2Y0P A;  3WG7 B;  4ZOL B;  4DR4 O;  1YZB A;  4WFG A;  3X2Q C;  4FLX A;  2QA4 V;  1QVG U;  3BHP A;  3HB3 B;  3BAB A;  4QE9 A;  1Z2G A;  4JTC B;  2GUZ B;  4L8J A;  2X0L A;  4UXN A;  4GYC B;  4JAS A;  3P32 A;  4PA9 A;  2QM8 A;  3T1H O;  3EVK A;  1X59 A;  3OUF A;  1R73 A;  3CCM V;  4JI2 B;  2W0F C;  4WBN B;  1J5E B;  1Y76 A;  2W6J G;  4YXW G;  2P4K A;  1V54 B;  2VQE O;  2GV9 A;  4I50 B;  2EUL A;  4U3J A;  4LFA B;  4X20 A;  1HDJ A;  3ZMZ A;  5ITZ A;  1XBL A;  1VAR A;  2UUB O;  5LGT A;  1FFX B;  4N23 A;  3IAY A;  4G2K A;  5JJJ B;  1PM9 A;  4DV0 B;  1N33 B;  1ARO P;  2GUZ A;  2ZXW C;  1AB3 A;  1TUB B;  1EZJ A;  1AP6 A;  2NN4 A;  1YVW A;  2VWJ A;  1L0N H;  1K8A W;  3IFX A;  2WA4 A;  1CPY A;  3C3T A;  1N36 O;  1QHT A;  4LCU C;  4LF5 B;  3CCQ V;  1EM1 A;  4RQF A;  2E74 B;  5LA6 A;  1PL0 A;  2UUA O;  4WFH A;  4LF4 O;  4D7S A;  1XMQ B;  2XAH A;  1S76 D;  4QPJ A;  3ZHR A;  4CH5 A;  1I7F A;  1X4T A;  2E75 B;  3NR7 A;  1ZUQ A;  5B1B C;  1F4M A;  3ZRS A;  4EEQ A;  3JD3 A;  5FNV B;  3LDC A;  3FYE B;  1S5J A;  4DR4 B;  2YIA A;  4QGP A;  2JJ1 G;  3THO A;  1WB7 A;  3WU2 Z;  3LDD A;  2O57 A;  2UXN A;  2EIL B;  5FPO A;  2IJJ A;  2QJ1 A;  2JEU A;  2E5L O;  4F6E A;  3K59 A;  1PNL A;  2P4V A;  1I5X A;  1XNQ O;  3RVY A;  3T1H B;  3D36 A;  4X1K A;  1FFT B;  3RYI A;  1ZX3 A;  1SZT A;  1BGY H;  4TV9 B;  2QWO B;  1VQ4 V;  4MVM A;  4EFE A;  1HP8 A;  1FAF A;  3K5M A;  1S72 V;  3MDS A;  3QO5 A;  1WAZ A;  3N2K B;  5EC1 C;  2YXY A;  2WLN A;  4Z1V A;  1DK1 A;  2Y69 B;  4JTA B;  2VQE B;  1QR8 A;  4NVP A;  3UO3 A;  1SA0 B;  4J41 A;  2JK5 C;  2V7Q G;  3AK1 A;  2QE7 G;  3ZBH A;  4I4T B;  1ZL8 A;  2BCC H;  1AVM A;  5JVD A;  2CGO A;  1SQV H;  2N04 A;  1H2M A;  1PPJ H;  3RFR A;  4FM0 A;  3JAK B;  1K5Q A;  4FM1 A;  3D36 C;  1Y74 B;  3FB6 C;  1D2D A;  5LXT A;  1N36 B;  2HFE C;  3SPC A;  2R9A A;  3CS5 A;  1VF5 B;  3STZ C;  1F4N A;  4LF8 O;  5D5Q A;  4J80 A;  3ZHS A;  1VQ9 V;  2OTJ V;  2WLI B;  2UUA B;  4LF4 B;  2DYS C;  2XTA A;  1WPB A;  3OT7 A;  3FFQ A;  2CUG A;  3ZN1 A;  4DV7 O;  1VIB A;  3K79 A;  4UCO A;  3SPJ A;  1RSO B;  1W59 A;  4KFM A;  4LFC O;  1SQX H;  4QPK A;  1RM1 B;  3ASO B;  5LP6 B;  2HKO A;  4NKG B;  4DO2 A;  2ARH A;  3CEI A;  4PA3 A;  1XHZ A;  1M57 B;  3NXS A;  4FPP A;  2LFS A;  3ZRW A;  1HW7 A;  2DQ3 A;  1QVF U;  2ZNI A;  1XDC A;  1P7G A;  4CH4 A;  3CJH A;  3ETG A;  1EN5 A;  5IY5 B;  2CAZ C;  2DYR B;  2E5L B;  4XBF A;  5E79 Z;  3CB2 A;  4IHJ A;  2K1E A;  4JGS A;  1XNQ B;  2AZ0 A;  2YC0 A;  1TA8 A;  4I0X A;  3ZMT A;  2EIN B;  3DXR A;  1Q6H A;  1NVP B;  4JYC A;  4FK5 C;  1OCZ C;  3FD9 A;  3STL C;  5EBL C;  5EIB C;  5KAI Z;  2H8P C;  5GON B;  1R6N A;  4UVB A;  2OCC C;  3AG3 C;  4JTD B;  1URF A;  3N2G A;  4XDJ A;  2V4D A;  3JAL A;  4EB6 A;  5CBF A;  4HNA A;  4J7J A;  3BA8 A;  3ZMV A;  2A7W A;  3H1J H;  5KHH A;  3K9S A;  2RMK B;  4NTW A;  1B06 A;  4IIJ A;  5LBQ A;  3FKS G;  2IW5 A;  4E4E A;  2QWP B;  4CS2 A;  2JJ2 G;  4WCE V;  2IJK A;  2LJ2 A;  5CN0 A;  2OTL V;  1NJI W;  2N05 A;  4LNU A;  4F6R A;  1GM8 A;  1KKC A;  1HWY A;  2XHB A;  4TOI A;  3ETQ A;  4OX9 O;  4UCV A;  4LF8 B;  1SQG A;  4PA4 A;  4O4H B;  3W7T A;  4DV7 B;  4W4L A;  2LFR A;  1IUR A;  1L1F A;  3BCC H;  4LFC B;  1U96 A;  1YEW A;  5BXZ A;  1Y6X A;  3K9A A;  2FB5 A;  4X1I B;  1S0V A;  2CE4 A;  1YTF D;  1FD9 A;  1OCC B;  3E8H A;  1M4U A;  4KL1 A;  3E86 A;  4MTX A;  1EZV H;  1Q5O A;  1L0L H;  1UJW B;  2NLJ C;  5FL7 G;  3J81 N;  1EN6 A;  1W0K G;  4JYB A;  2EIJ C;  2KG7 A;  2XND G;  2DE0 X;  2UUC O;  2PY5 A;  4R50 A;  4UV8 A;  4B7K A;  4PA7 A;  4DW0 A;  5CA0 B;  5B3S B;  1L8D A;  3I5D A;  3L72 H;  4DR7 O;  3S3X A;  5H5N A;  3OMA B;  2JEX A;  4JAU A;  4O2B A;  2P6J A;  4BW9 A;  3T4Z A;  2KKW A;  3F7Y C;  4N21 A;  1YJN V;  1FJG O;  1TGO A;  3VQW A;  1S5L Z;  1YCI A;  4JV5 O;  1JOY A;  1HNX O;  1WN7 A;  1GH6 A;  1SQB H;  3EXA A;  1VQ7 V;  2WA3 A;  3JAR B;  4K3A A;  1N0J A;  3H1K H;  4X88 A;  1GTO A;  3K0G A;  2WPD G;  3RN4 A;  5DN6 G;  2E76 B;  5B1A C;  4PDM A;  3CP1 A;  3ABT A;  4GKJ B;  5LHI A;  2ZIN A;  4OX9 B;  5IJ9 B;  3H01 A;  1PNK A;  2WLJ A;  4AQY B;  2AXT Z;  2PZS A;  2QKA A;  3PJS K;  4LC1 A;  3G6B A;  3K57 A;  5CA3 A;  3OTF A;  4QIW F;  1U97 A;  4P30 A;  1OCR C;  3PN1 A;  4PA6 A;  2UXB O;  3L75 H;  1COW G;  1YHQ V;  1TUE B;  2GHY A;  1KP2 A;  1ZSP A;  3KZI Z;  3GWO A;  3N27 A;  4AHC A;  2F66 C;  1AI6 A;  3UM7 A;  2Q73 A;  3IJ4 A;  3RYH A;  1YXB A;  2UXC O;  4X65 B;  3O9O A;  4Q20 A;  3OUS A;  4I9Q A;  3GB7 C;  4J7Z A;  2YIB A;  3CC4 V;  2YXL A;  5H6R A;  4JI3 B;  5LOV A;  3ABM B;  5H9C A;  1AR5 A;  3SJA C;  1Q90 D;  3AK3 A;  1OV9 A;  2EZP A;  2HJF C;  1RPR A;  2R9I A;  3OMN B;  2D2C B;  3X2Q B;  4U7O A;  2UUC B;  3ZRV A;  5IJ9 A;  2ODM A;  1BS3 A;  5CB4 A;  3QO7 A;  3TET A;  4BAY A;  3F5T A;  1WPX A;  3B8M A;  3U0Z A;  4DR7 B;  3CD6 V;  2ZKO A;  2QKC A;  1G6U A;  2KSD A;  3SPG A;  2MK3 A;  3L9D A;  2Z3Y A;  2QEX V;  3AG1 C;  4PDV A;  3I55 V;  5L3F A;  1BL8 A;  3OR6 C;  1G1X B;  1KBH A;  1XI1 A;  4JV5 B;  1BQZ A;  1MA1 A;  2DW4 A;  4LWS A;  2M7W A;  2IJI A;  4O4J B;  4CZZ A;  4OXS A;  1VQ5 V;  1HNX B;  3E8B A;  4PI0 A;  2Y4T A;  2XAF A;  2YEV B;  2GTS A;  4XDK A;  1GK9 A;  1E1R G;  2W0X A;  2ZXW B;  3E8G A;  2C2A A;  4DV4 O;  2AHY A;  4FLT A;  5LMU O;  1YI2 V;  1XIL A;  4FMT A;  4I7Z B;  4I5S A;  4NXN O;  1NR1 A;  3EHB B;  1N32 O;  4O4L A;  4RO2 A;  4DK0 A;  2UXB B;  2ZR3 A;  1Z5W A;  2HR3 A;  3LSU A;  1Y76 B;  4OPH A;  1GN6 A;  2L6L A;  1AJQ A;  3H1L H;  3VQY A;  1HNW O;  3AG7 A;  2UXC B;  5KHI A;  5D5P A;  4U3J B;  2YEV A;  4X20 B;  5IT9 N;  1NZ6 A;  5ITZ B;  3W7U A;  3E8F A;  4Z1M G;  4KHP O;  2BSK A;  4KP4 A;  3ZHV A;  1M56 C;  5EYP A;  1G4Y B;  5B1B B;  1SF9 A;  1MMM A;  2H3O A;  3ZHQ A;  4XDL A;  2FKX A;  2PF4 E;  2QWN B;  1K73 W;  4HYO A;  1F7Y A;  1GKF A;  1KEC A;  3HKB A;  2HP8 A;  3U11 A;  3TXQ A;  5KA6 A;  3QNE A;  3JAT A;  1BE3 H;  4MW8 A;  1NT2 B;  3AEI A;  2QSA A;  5LA6 B;  2JS5 A;  4LF9 O;  3B77 A;  2AZ2 A;  1K5S A;  2QKS A;  3R65 A;  3CSX A;  4GCZ A;  3MHS C;  1AJN A;  3ETE A;  4NXM O;  3UT5 A;  5JH7 A;  1YSC A;  3A0B Z;  2Q69 A;  3O65 A;  2WLL A;  5EK0 A;  1US6 A;  4FZ1 A;  3CMA V;  4MVZ A;  2Z5U A;  4P9P A;  4B7E A;  4DR1 O;  5EBM C;  3C90 A;  1XNR O;  2YSU B;  4UB8 Z;  5K1P A;  1LUV A;  4JI8 O;  4JI6 O;  5KMG A;  1B04 A;  4DV4 B;  4O4I A;  5LMU B;  4NXN B;  4X1K B;  3RYI B;  2UXD B;  1PP9 H;  1I08 A;  1N32 B;  3BY6 A;  3HPL C;  3JD4 A;  2RCV A;  3LSQ A;  3FB8 C;  4B3R O;  4JAV A;  3SPH A;  1XL4 A;  2A06 H;  4FLW A;  1K34 A;  4ABM A;  1H2K A;  1XEQ A;  2DYS B;  5KHJ A;  1K7D A;  4K8X A;  1FXH A;  3T4D A;  1HNW B;  5DED A;  4DRX A;  4LF6 O;  2ITD C;  5B1O A;  3P3N A;  4OPA A;  4KHP B;  5CA1 B;  1NI8 A;  1MNG A;  2ZE6 A;  1BMF G;  3ZS8 C;  1ZL8 B;  1ZAU A;  4DR3 B;  5JVD B;  4MTO A;  1AI4 A;  1JFF A;  2PUS A;  3OD4 A;  5KAF Z;  3CWB H;  3Q4H A;  2DOS A;  4B3T O;  3DSQ A;  2EIK C;  2DN9 A;  5LXT B;  4WFB V;  1TAE A;  5HFM A;  4JI0 O;  2F1M A;  3P3P A;  5LGU A;  3BVO A;  2QR4 A;  4X8A A;  1NS1 A;  4LF9 B;  1WB8 A;  5J2U A;  3BEH A;  3CCJ V;  3CC7 V;  2JIZ G;  3A2F A;  2ZIM A;  3BAA A;  1OCZ B;  2LW1 A;  1HNZ O;  3E35 A;  3CRC A;  4DUZ O;  1K3E A;  4NXM B;  1VQP V;  4MVS A;  2OCC B;  3AG3 B;  3LDE A;  1ROP A;  3WB2 A;  4I55 B;  5CA1 A;  3KCY A;  3ZRW B;  4GLX A;  4R6Z A;  4DR1 B;  3CJH B;  4D6T H;  1XNR B;  3ABL C;  4JI8 B;  4JI6 B;  2MW2 B;  4IHJ B;  2XAJ A;  2Q4P A;  3SYO A;  1HR0 O;  2YID A;  2FML A;  1JVM A;  1RP3 B;  4DUY O;  4I0X B;  3DXR B;  3E22 A;  2ZIO A;  3GVM A;  4B3R B;  3BRC A;  4J10 A;  4D7T A;  3JD1 A;  2PYJ A;  1N4C A;  1RFY A;  3B09 A;  4FJC C;  1KB9 F;  2R9R B;  2DWD C;  3N2G B;  2BE3 A;  3JAL B;  4EB6 B;  4HNA B;  4I55 A;  3JAW B;  4LF6 B;  1PD3 A;  4O2A A;  4P9O A;  4IIJ B;  4DV1 O;  1OJH A;  3SYA A;  2BOC C;  2CH7 A;  2JRI A;  2ZCE A;  1M9N A;  4YJ3 A;  2A79 B;  3HKC A;  3ZJZ A;  1EN4 A;  5C8Y A;  1AIL A;  4FLZ A;  2Q0O C;  4LF7 O;  2WAM A;  3OW2 U;  1MZF A;  3K3W A;  1NH2 D;  2X6C A;  4LNU B;  4B3T B;  4F6R B;  3APO A;  1K33 A;  2IH1 C;  2EIJ B;  1KC8 W;  4K8Z A;  2WLM A;  4JI0 B;  2QGN A;  4K0K O;  3G80 A;  4NR1 A;  4L87 A;  2QDO A;  5KHG A;  2ZNJ A;  3J7A U;  4NB5 A;  1KUQ A;  1HNZ B;  3K5L A;  4DUZ B;  1IDS A;  1IZ3 A;  3JAW A;  3ASN C;  4CH6 A;  2XT9 A;  4X1Y B;  3ZIA G;  1FXK A;  4TWK A;  1VQ6 V;  3ABU A;  4TUY A;  4DV3 O;  3HKE A;  1THZ A;  5FPR A;  4JI7 B;  4X66 O;  4JF3 A;  4GX0 A;  2IU0 A;  2GDS A;  3DGE A;  2ATK C;  1NVP D;  4Z2W A;  1D5N A;  2ITC C;  5FLX N;  1IX9 A;  3TCU A;  1TVK A;  2A9H A;  2KG7 B;  3D8C A;  4DXW A;  4GKJ O;  3E89 A;  1H2S B;  1HR0 B;  5B1A B;  1GAX A;  3QVN A;  2F93 B;  4DUY B;  2BTQ A;  4AQY O;  1RPO A;  4E2L A;  4W4K A;  1K4D C;  1VP7 A;  2CGN A;  1E79 G;  4O2B B;  3GWK C;  4UVC A;  4FFB A;  4A5U B;  2X6B A;  3ZHU A;  4BR6 A;  5H2F Z;  4J42 A;  1OCR B;  4MVO A;  2F4V O;  4UUJ C;  5BMV A;  1FXK C;  4X1Y A;  1SS3 A;  4FM2 A;  3JCU Z;  2ZM6 O;  4X65 O;  4BIO A;  1BT8 A;  2EJR A;  4DV1 B;  2LGQ A;  4J9Y B;  3OE7 G;  4JI3 O;  4PJ0 Z;  4LF7 B;  2KQX A;  2OYQ A;  1M93 A;  1UPG A;  5A9G A;  4H33 A;  4BIU A;  2A3Q A;  2EIM C;  1K92 A;  3M99 B;  2LP7 A;  3B4S A;  2KB1 A;  4K0K B;  1FYJ A;  1H8E G;  5IJ0 A;  4MSW C;  1B3Q A;  4LH7 A;  4C7U A;  3RWR D;  1IBL O;  4ZI7 A;  1DGS A;  2RDC A;  3A0H Z;  3QTC A;  3CRA A;  2OT5 A;  3CRM A;  1G8M A;  1YIT V;  4IGG A;  4EKW A;  3AG1 B;  5KX5 A;  1FXV A;  3RYH B;  3ABK C;  4PI2 A;  2CTW A;  4DV3 B;  4WFE A;  1QR9 A;  1NTK H;  3CHX A;  3WB1 A;  4X66 B;  3VQV A;  4RUF A;  5LOV B;  3SGI A;  5CMU A;  5LHG A;  1JA8 A;  5EZY A;  4DR2 B;  3CRR A;  4KUM A;  3JCZ A;  5EBW C;  3CME V; 
#chains in the Genus database with same CATH homology
 4AQY O;  5IWA O;  2UXC O;  4LFB O;  2AGA A;  2E5L O;  3OTO O;  1XEQ A;  1HNW O;  5LL6 Y;  3T1H O;  1XNQ O;  2N74 A;  3J81 N;  1X59 A;  4JI2 O;  4YHH O;  5IT9 N;  4LF6 O;  4A5U B;  2UXD O;  4KHP O;  4DR2 O;  4OPA A;  1J5E O;  2F4V O;  2UUC O;  3R66 A;  1N34 O;  1I94 O;  4DR6 O;  2VQF O;  2FKX A;  4DV1 O;  5BY1 A;  3JAM N;  2ZM6 O;  1F7Y A;  4X65 O;  2JRI A;  4DR7 O;  2VQE O;  4LFA O;  5H5N A;  4X62 O;  1DK1 A;  3F5T A;  1AIL A;  2Z0A A;  4DV5 O;  4LF7 O;  2ZKO A;  4JI3 O;  2UUB O;  3SDL A;  4DV0 O;  4YY3 O;  1N33 O;  2DOS A;  4DV6 O;  4B3T O;  5LMN O;  1FJG O;  4JI0 O;  1IBM O;  5BR8 O;  5A2Q N;  2HHH O;  4JV5 O;  1AB3 A;  4LF9 O;  1G1X B;  4DR3 O;  1NS1 A;  1HNX O;  4K0K O;  2LW7 A;  4B3M O;  4NXM O;  1FYJ A;  4LF5 O;  1HNZ O;  1R1B A;  4DUZ O;  1N36 O;  3J7A U;  4DR5 O;  1D2D A;  1KUQ A;  3T1Y O;  1A32 A;  1IBK O;  3O65 A;  1XMQ O;  1IBL O;  2UUA O;  4X64 O;  4LF4 O;  4LF8 O;  3RT3 C;  4OX9 O;  4DV2 O;  4DR1 O;  4DV3 O;  4JI5 O;  4DV7 O;  1XMO O;  2UU9 O;  1XNR O;  4X66 O;  3M8A A;  4DV4 O;  4JYA O;  1FKA O;  4JI8 O;  5LMU O;  4JI6 O;  4LFC O;  2DJV A;  4JI4 O;  4NXN O;  2UXB O;  1N32 O;  5FLX N;  4DR4 O;  1YZB A;  5BXZ A;  1R6T A;  1HR0 O;  4DUY O;  4GKJ O;  4GKK O;  4B3R O;  4JI1 O;  3J80 N;  4B3S O;  4OPH A;  4JI7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...