1XEQA

Crystal tructure of rna binding domain of influenza b virus non-structural protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
89
structure length
89
Chain Sequence
GATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Nonstructural protein NS1
publication title Conserved surface features form the double-stranded RNA binding site of non-structural protein 1 (NS1) from influenza A and B viruses.
pubmed doi rcsb
source organism Influenza b virus (b/lee/40)
total genus 31
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xeqA00
1IBLO 4JI7O 1D2DA 1DK1A 4LFBO 2LW7A 2UXCO 4B3MO 3SDLA 5FLXN 4JI8O 3J81N 5IWAO 5BXZA 4AQYO 1HNZO 1R6TA 4DV7O 1FJGO 4X66O 4DV0O 4JI2O 5A2QN 4DUYO 3M8AA 5LMUO 4YY3O 1J5EO 4B3SO 1A32A 2UXBO 2HHHO 5LMNO 4B3RO 4GKJO 4JI6O 1IBKO 1FKAO 2E5LO 4B3TO 4OPAA 1R1BA 4DV2O 4JI3O 4DV5O 4DR7O 4JI0O 2UU9O 5LL6Y 1XMQO 1IBMO 1AB3A 3OTOO 2Z0AA 4DV1O 2UUAO 4DV3O 4OX9O 4LF9O 1HNXO 4DV6O 2DJVA 5IT9N 2DOSA 4LF6O 4DR5O 4JI5O 4DR4O 4OPHA 5BY1A 4DR6O 4DR3O 3JAMN 4NXMO 4X65O 1XNQO 1HR0O 4X62O 4NXNO 4A5UB 4LFAO 1AILA 4YHHO 5BR8O 4JI1O 1N32O 2FKXA 1YZBA 5H5NA 2VQFO 1XNRO 2N74A 2ZM6O 1F7YA 2UXDO 2UUCO 3R66A 4DUZO 3T1YO 4JYAO 2JRIA 1HNWO 4DR2O 1FYJA 4LF8O 4GKKO 4DV4O 1KUQA 4KHPO 1NS1A 2UUBO 3F5TA 3O65A 1XMOO 4LF5O 1N36O 1G1XB 3RT3C 2F4VO 1XEQA 1N34O 4JI4O 1N33O 3T1HO 4LFCO 4JV5O 2AGAA 3J80N 4LF7O 2VQEO 1X59A 1I94O 4K0KO 3J7AU 4X64O 4LF4O 2ZKOA 4DR1O
chains in the Genus database with same CATH superfamily
1IBLO 1I5YA 5IYZA 3OMAB 2PUSA 4FFBB 1S0VA 3FB8C 3R65A 1KKCA 4R7CA 3HPLC 4AQYO 4U3FH 4UCOA 4DV0O 4X1KA 4MVSA 2Q6AA 4D7SA 5KUKA 5GONB 3I56V 4DUYB 1OHHG 3AG2C 3CC2V 3W7UA 1FKAO 2IJJA 2E5LO 4B3TO 1XDCA 3LSUA 4N23A 3RN4A 3HKDA 3JAWA 4EB6B 1V9PA 3K57A 2WLLA 5EK0A 4JI3B 1R6NA 5KUMA 1ZWIC 1MSDA 3OTOO 4W4KA 4ZI7A 4O4JA 1XBLA 2Z0AA 4O2BA 4OX9O 3LDDA 1TUBB 4P2ZA 3ZS8C 3ZIAG 5LGUA 3CX5F 1YVWA 5KMGB 2BE3A 3UKMA 1GAXA 1PL0A 5BR8O 4IGGA 3JD3A 3WFVA 4I7ZB 5D5QA 5JH7A 1K73W 4E2LA 3M99B 1FXKC 2D3OW 1SQVH 1VQ8V 1M90W 3UO2A 2ZR2A 2ADQB 2UXXA 4H33A 3LSSA 4CBCA 2ZM6B 4JAAA 1ZUQA 1P7BA 2ATKC 3ZMVA 2GUZA 2Q0OC 1NZ6A 1IVSA 1AI7A 2XOKG 3OM3B 2LO1A 1QVGU 1AJNA 3ZMTA 2JVDA 4X65B 3GWKC 1FXKB 2HFEC 1PKXA 2F4VO 4LF5B 1Y74B 1YJWV 4NB5A 4FLUA 4FLZA 3H1LH 2QKCA 4IHJA 2VQEO 4B7EA 4LH6A 1VQ5V 1K8AW 3E86A 3ML0A 2DWEC 2YICA 3E22A 2XUMA 3A0HZ 5BXZA 1HNZO 3H01A 3JALB 4JZ2A 3CPWU 1PNKA 4X20B 5LMUB 4DK1A 4WBNB 1VQ6V 1B04A 2HHHB 4CS4A 1UPGA 1DGSA 2JS5A 2KG7A 2Q9LA 1KD1W 1KB9F 1J95A 1E1RG 2RQ6A 1YJNV 3JATB 1KQSU 3ZBHA 1IBMB 5IDJA 4I55B 3JCZA 4JGSA 1QBZA 4OPHA 1TAEA 3P30A 3OW2U 4FLTA 1NJIW 1VF6A 5LOVB 2RCVA 3ZJZA 1HR0B 3T2MA 2XAGA 5H2FZ 1M93A 3W7TA 4TWKA 2QA4V 4LFAB 1L0NH 5LP6C 4FVMA 2FKXA 1YI2V 1P49A 4PA9A 5CA1A 2HKOA 3FX7A 2CTWA 2RJZA 1W59A 3T1YO 1AROP 5CBHA 4X1YB 3HR0A 4OGQB 3JYCA 4KFMA 3P32A 4I0XB 2ARHA 2RNBA 3MDSA 3LNNA 2V7QG 2QSAA 4UCUA 3J7AU 4LF7B 2EX3A 1I94B 1YTFD 2GDSA 3C3TA 1D2DA 4UV8A 2PGGA 1IBLB 2P6JA 3SPIA 3CD6V 1ENVA 3TCUA 4JYYA 2NLJC 4GX2A 3EFFK 1XQ8A 2WLKA 4CS2A 4DV0B 2A0LA 4PDRA 2RN9A 2UXBO 5LMNO 1GO3F 2QM4A 3T4DA 4Z1MG 2L35A 3ZHRA 4FM2A 1G6UA 1VQMV 1YIJV 2E5LB 4B3TB 3SJCC 1F4NA 1ZSPA 3N2KA 5GW7A 3FAVB 4DRXA 2EBOA 3FKSG 2YXHA 4PDVA 5IWAB 4JTAB 2F93B 4U7NA 3RYCA 4O4IB 1I7FA 3OTOB 4IIJB 5EIBC 5ITZB 1R3JC 4OX9B 1VQOV 4LF6O 2HVKC 3AK2A 4DW1A 4NR1A 2KKWA 1WAZA 5LYJB 2BTQB 2CGNA 4QE7A 1RPOA 3SYAA 1BZKA 4YHHO 5B1AB 3BPZA 3JD2A 5BR8B 2Q8VA 3QVNA 1NH2D 1W0KG 1L1FA 4CS3A 4E4EA 3OR7C 2QR4A 4YJ3B 4UVCA 5KA6A 3L71H 4UFZA 3OUFA 4UUJC 2FTKA 3CC7V 4JYBA 4J10A 4QPJA 2OCCC 1ZAUA 3BABA 4TV8A 2WLIA 2IJHA 3SJAC 2ZIOA 3F7YC 3JSNA 4FM1A 3G4SV 1V55B 3VQVA 2F4VB 4Q6GA 3CRQA 5B66Z 5B1BC 2OCCB 1AI5A 1QHTA 4C7UA 2VQEB 1BHAA 2ITDC 2IBZH 2MW2B 2ZXWC 3QF7A 3OUSA 1FFTB 1RPRA 2W6IG 4ZKIA 2GTSA 1OCRB 1COWG 5B1BB 4X66O 3JD0A 1HNZB 1Z5VA 2B1GA 4QJFB 1J5EO 2OWOA 4K3AA 4O2AA 4PI2A 5B3SC 1I08A 1VQKV 2V1DA 4GX1A 4QE9A 2ZCEA 3U0ZA 3CJHB 4KP4A 1MMMA 5LXTB 3LNMB 2XAFA 3T4ZA 1VQ9V 1HWYA 5B3SB 3ZRSA 4JI0O 4FLYA 4JTDB 1E1QG 1JMKC 3LUTB 2UUAO 4NKGB 4I50A 5KHIA 3DXRA 2EIMB 3RYIA 3FYIB 3D3QA 2WSSG 4U7OA 5IYZB 4RO2A 2PY5A 5L3BA 3H9VA 3OFNG 4LH7A 5F2VO 4J41A 2WAMA 3OEHG 2W6JG 3BHPA 3APOA 1S76D 3JSLA 4X1KB 1WN7A 5LP6A 3ZMSA 1PD3A 1BCCH 1N32O 2H94A 4MTGA 2QWRB 1V54C 2XAJA 3ZRWA 3ABMB 3HKDB 3JAWB 1MOFA 1XI1A 4RAIA 2N04A 5DM6V 2BOBC 4JYAO 5J2UB 1HNWO 4X88A 4IYIA 4MT8A 2WLLB 3T1YB 1SQPH 3H1KH 4LF8O 4PV1B 5JVDA 1B3QA 2K9PA 1K9MW 1V54B 3ETEA 3FFQA 4GT1A 4ZI7B 4O4JB 2E76B 4O2BB 3TXQA 3ZHSA 1S3JA 1ZL8A 1XL4A 2ZKOA 2JEUA 1N0JA 3HKBA 4TV9B 4CH5A 4YJ2A 2P7TC 1XILA 2KB1A 1BS3A 5K1PA 1DLBA 4PI0A 4TQDA 2LFSA 3WB0A 1Z2GA 1AI4A 3KCXA 3SGIA 2UXBB 1MSWD 1KYOF 1XHZA 3TK1A 2GUZB 5LMNB 4JASA 1BQZA 2O57A 1Y6XA 3OEEG 1UFIA 3S3XA 1NTMH 1VIBA 4IT5A 2PZSA 2L6LA 3AG3C 1Q8IA 3KCYA 2X0LA 4H13B 3UM7A 1BHBA 4LF9O 3HKEA 5EC1C 2Y4UA 4DV6O 2F23A 3P3PA 3E83A 1Q6HA 1JX9A 2DN9A 3MHSC 4P9PA 4LF6B 3E22B 4DR3O 2LFRA 2BCCH 3AG3B 4YIOA 4PDMA 3BY6A 1KBHA 3OD4A 2JJ1G 1TVKB 4TUYA 4YHHB 2DYSC 4J9ZB 1GTOA 4WFHA 1DF4A 1Q6IA 3ZHVA 3K5NA 1Q86W 3EXAA 3GVMA 2IH1C 2ZR3A 3SPCA 2KG7B 4NTWA 1NTKH 4YIPA 3CE2A 2DYSB 2QDOA 3CEIA 3LDEA 4JZGA 1VMGA 1XNQB 4MVUA 3PN1A 3E2EA 1VF6C 5CN0A 3OGCC 1XREA 1N33O 1KKDA 2PYLA 5H6RA 2ZIMA 4ZBMA 4K0KO 1BSMA 4TT3G 4JI7O 3MAQA 4RUFA 2ZDIA 1AP6A 1SF9A 1SS3A 3ZCCA 4X9QA 5CBGA 1FPOA 2Q69A 5KAFZ 1PV0A 5H6QA 4TQFA 2FMLA 4BIOA 3CCEV 3ZEDA 3L75H 4D7TA 4FIPC 1AVMA 3SJQC 1J5EB 2DQ3A 1IX9A 3ZHQA 4I9QA 1LNQA 4B7KA 4UCVA 4OPAA 4WFAV 1S5JA 4I9WA 4DR7O 2DE0X 1GM8A 2YS8A 4FLVA 1SQBH 3A0BZ 4JI0B 2JEXA 2WLNA 1WLEA 2QTOA 3Q4HA 2DOSA 4G28B 3CS5A 2WLHA 4DO2A 4FMTA 5J2UA 5IE9A 3KG2A 4X62O 2VWJA 3AG2B 1ZLZA 1SZTA 4J7JA 3AK3A 1G4YB 4JI1O 1H8EG 3K03A 4R6ZA 2P06A 1JFFA 1N32B 1L0LH 3TJTA 1VF7A 2Y0PA 3B8NA 3R66A 4DUZO 3IGAC 2YI8A 1R3KC 3VQXA 3N2KB 4PA7A 4O4HA 2IU3A 4JYAB 4AI8A 1HNWB 4DRXB 4I4TA 4TV9A 1RSOB 3IFXA 3K59A 3CRRA 1VQ7V 4LF8B 3RYCB 2ZE8A 3TXSA 4UV9A 4JV5O 1H2SB 2YDEA 3BA9A 3BEHA 3S3WA 1BMFG 1DF5A 4X1IB 5B1NA 3RYHA 2JGUA 3CP1A 3QTCA 4EFBA 4JI8O 4MS2A 1QNMA 2LP7A 3L72H 2YEVA 3BRCA 1YXBA 3A2FA 4F4LA 3A0RA 4GX5A 4RQFA 2QGNA 4B3SO 1XUQA 3DC5A 1IZ3A 1QR9A 2CAZC 4Z1VA 3C3SA 2QTSA 4LR3A 1B06A 4BR6A 4JI6O 1K4CC 1YHQV 3G67A 2QWOB 4PHZA 4TV8B 2GHYA 2WLIB 4GZRB 2H8PC 3JAKA 1IDSA 1TUEB 4MTOA 1RM1C 2R9AA 3WU2Z 4U3JA 1D5AA 1HNXO 1TVKA 5IT9N 3FD9A 4LF9B 4H37A 3CRMA 5IY5C 1EN5A 2HJFC 3GWOA 2FB5A 4DR3B 4J9YB 1R6KA 1FFXA 4O2AB 4ICGA 3K0DA 4B08A 3JARA 3APQA 3HKCB 1Q90D 5CA0A 4F6RA 4DV4O 3ASOC 2UUBO 2EZOA 2AHZA 1XEQA 1M4UA 4I50B 4XDKA 3DXRB 4JI4O 3RYIB 1Y66A 2ODMA 1N33B 2F66C 1X59A 4BW5A 1EZJA 3ASOB 2VQFO 2KQXA 3K04A 2QKAA 4JI7B 1S5LZ 3E89A 5LP6B 3J81N 2QWNB 3RVYA 2QM8A 4WCEV 1KMIZ 4DV7O 4MTFA 1YJ9V 4WFGA 1F4MA 3ZRWB 3CYOA 4GLXA 3K5OA 2N05A 4GKJO 5JVDB 3X2QC 3ZN0A 3CCSV 1BE3H 4BIUA 1Y4MA 5LA6A 2Q7EA 4LNUA 5FL7G 2UU9O 4DR7B 4FFKA 4AQYB 1PNLA 1OV9A 1AB3A 1ROPA 1ZL8B 4DV1O 4DV3O 3HKBB 5DECA 5EBMC 2DW4A 4YJ2B 3UT5A 4LBEC 4BW9A 2IU0A 1GN3A 3D36C 1SQQH 2R9IA 3VQWA 3GB7C 2H3OA 5GTHZ 4NXMO 3IJ4A 4FZ0A 2FL4A 2E74B 2IM9A 1QU7A 1IXBA 2K1EA 1AJQA 1RSOA 1K34A 4X62B 2OCHA 1US6A 1TA8A 1K5QA 4JI1B 3K9AA 2JJ2G 2N74A 5L3GA 1FXHA 1R3IC 5JWPA 3CSXA 1XOUA 1ZX3A 2UUCO 2XASA 1NI8A 1RP3B 2P5OA 5EYPA 3K5LA 3H1HH 4DUZB 2D2CB 4X1IA 4DR2O 2M7WA 1FYJA 2CDYA 1YDXA 3CRCA 1JA8A 1PL4A 3ZRXA 5EZYA 1XMOO 1N8RW 1N36O 1EZVH 2XT9A 1B6QA 3HKEB 1NH2B 4PA3A 4JV5B 2A7WA 2BSKB 4J42A 4G2KA 1SQGA 4LFBO 1AR1B 4B3MO 5FLXN 1EBOA 1VQ4V 1Q43A 4JF3A 4JI8B 2ZQMA 4TUYB 4QIWF 1OZ0A 3ZMUA 1WA8A 3C90A 4YY3O 3U11A 1A32A 1JPXA 4B3SB 2HLDG 4NYKA 2B5UA 1IBKO 3DC6A 4FZ1A 4JI6B 2P4VA 2QWPB 1JVMA 4D6TH 2W0FC 1O9GA 4XDJA 4DV2O 2ZDIC 3CXCU 4PDLA 2EILC 2EJ7A 1VP7A 4WFFA 2WWWA 5LGNA 4J7KA 2ZXWB 3ABTA 4CZZA 2ZE6A 4N21A 2YIAA 5KHJA 1HNXB 2WA4A 5JQGB 1OJHA 2OIGA 2Q67A 2E75B 1NTZH 3HKCA 2AHYA 3JASA 3MD0A 2LJ2A 1UJWB 2YIDA 3JD1A 4CC6A 1AR5A 3OGIB 5FNVA 1QLNA 2ETNA 5IYDO 1MG1A 4FM0A 1R3LC 3OMNB 5JJJB 2QWQB 1NS1A 3F5TA 4DV4B 2E3CA 2UUBB 1ORQC 4JI4B 1JR9A 4CC5A 3BA8A 3Q4HB 3NXSA 3SPHA 1GM7A 3RVZA 5E79Z 2WLMA 2VQFB 2UXCO 2Y0IA 2OIEA 1GN6A 1WP7A 3B4SA 2RMKB 3IC7A 4QPKA 4DV7B 1JFFB 2WLJA 4HAMA 5GTIZ 1X4TA 3E8GA 4GUNA 2YI9A 1SZXA 1NU1H 2YC0A 4O4HB 4GX0A 4I4TB 4DXWA 2P90A 3BVOA 4DV5O 3B77A 4HZ3A 2UU9B 5KHGA 4FLXA 2ZE7A 2X6AA 4GYCB 3MHHC 3TETA 2DJVA 4DV1B 3D36A 3RYHB 3SYCA 4DV3B 2PYJA 4DR4O 3DTUB 2PF4E 2LGWA 3HB3B 5L3FA 5HFMA 2CGOA 1SETA 1Q82W 4X65O 2YEVB 1S77D 4LP8A 5E1AC 3RYFA 4NXMB 1CPYA 4NXNO 3E8FA 3ABKC 1PP9H 3PJSK 1FAFA 2NN4A 1EN6A 2Y48A 5J2TB 1KECA 5EBLC 3N2GA 1XNRO 1MZEA 4MVRA 2Q73A 4QNHB 4ZHQA 1NVPD 2BSKA 3ABKB 2UUCB 1Y76A 1P7GA 1M5IA 2A06H 2CH7A 5C8YB 3JAKB 3ETDA 3O65A 5HFLA 4DR2B 2JS3A 1XMOB 4ABMA 4U3JB 1N36B 2FYUH 3OAAG 1PM9A 2HG5C 5CBFA 2X6CA 3ZMZA 1BL8A 4K35A 5H9CA 5K1XA 1FFXB 3ZHUA 4B3MB 3ASNC 3FB6C 1FJGO 2YUAA 4UB8Z 3SYQA 3M8AA 1SERA 5CB4A 3JARB 5CA3A 2IW5A 3AK1A 1GKFA 3ASNB 2EINC 3OE7G 5CA0B 1IBKB 1RFYA 1E79G 4F6RB 5JCOC 3K58A 1QLEC 5JQGA 4HNAA 4DYLA 4DV2B 2EINB 3G80A 1OCOC 1XMQO 4X66B 4FLWA 3AG1C 1Q5OA 4LWSA 1QVFU 1T5EA 1CP9A 2Y4TA 3OT7A 5L3CA 1OCOB 4UCSA 1AP5A 3G71V 2EZPA 4MW3A 3F5WC 1MZFA 3AG1B 2AW9A 2WPDG 1BQ0A 2DMXA 4A5UB 1JQ0A 1KP3A 3ABLC 3I55V 3OR6C 5IJ9A 2UUAB 2LW1A 3CCQV 1SQXH 2ILMA 5LA6B 4LNUB 3EHBB 4WF9V 1K97A 1M56C 1WPXA 2V4DA 3ABLB 2PI4A 4RWUA 2BTOA 4R50A 3JCUZ 5B1OA 4HBNA 2Q68A 2VWKA 4PJ0Z 2AGAA 4CH6A 3UT5B 2P22C 2KSDA 1M56B 3THOA 3DGEA 2CUGA 5AG2A 1S72V 2ZNJA 4CH4A 2JDIG 5KX5A 3O9OA 4GCZA 2UXCB 2ZE5A 4ZOLA 5IWAO 4UCRA 2IJKA 4JI2O 3RWRD 2JIZG 1O9HA 2X6BA 1MNGA 2ZT9B 1H2KA 1GH6A 4IYHA 1CXZB 3D3IA 4XDLA 5EYPB 2QKSA 3CCJV 2F43G 1Q81W 4Q20A 1I0HA 2XNDG 5EZYB 1M9NA 5BMVA 2CE4A 3U10A 1AR4A 1K3EA 5JJNB 4DV5B 1S5HC 1NKDA 3B2EE 4W4LA 1G8MA 2PTMA 2A9HA 2YSUB 5LHIA 1VQNV 1JJ2U 1JOYA 3CMEV 2LQTA 1TGOA 5J2TA 4UVAA 2HR3A 3SPGA 4DR5O 4JI5O 4EFEA 5BY1A 4DR6O 4NVPA 4DR4B 4ASUG 1GK9A 1XL6A 3QO5A 1WA8B 3K9SA 2F1MA 2F95B 4XBFA 5C8YA 1QCEA 4NXNB 4MSWC 3ABUA 1MA1A 1URFA 3K3WA 3ZN1A 3W7XA 1GN2A 5DEDA 4FPPA 2UXDO 1XNRB 1SA0A 1U96A 4DV6B 1SQFA 4WFEA 4NTYA 1RM1B 2CTQA 1GRJA 2DQ0A 4GKKO 1H38A 4J7ZA 4L87A 3BAAA 1G1XB 2GTAA 3CWBH 2ITCC 1NBMG 2AXTZ 2Q7GA 3QG5A 3UO3A 5IY5B 3T1HO 4FK5C 2M6YA 4MVZA 4X64O 3IC9A 5LHGA 2IH3C 3CHXA 4DR1O 4LF4O 4P9OA 3BFRA 3JASB 2LW7A 1KC8W 1THZA 3UCSC 5DN6G 1CEZA 2XAQA 4RUEA 2DWDC 3RW0A 2AZ2A 5FNVB 1FJGB 3G6BA 1IURA 2R9RB 3L9DA 3ETQA 4LCUC 4B3RO 1H2LA 3IAYA 1JCHA 2EIJC 4X8AA 4K0KB 5JCOA 2GV9A 4R8CA 3W7SA 5KHKA 4K8XA 2G38A 4O4LA 5FPOA 4DK0A 1WP8A 1PPJH 1HW7A 2EIJB 3AEIA 1VQPV 3F7VC 1XMQB 4NTXA 3H1JH 1WB7A 1IXMA 3L73H 5EBWC 4KUMA 1SESA 4P30A 2LGQA 2JGDB 2ZD9A 1YTFB 1BT8A 3WG7C 3M7MX 4PA4A 2HVJC 4FFBA 1DTOA 2YXYA 1FXVA 3STLC 3WG7B 4JAUA 3X2QB 5GONA 4H0LB 2QE7G 1WB8A 2GBOA 4H44B 4L8JA 4EB6A 3WB1A 4KHPO 2P4KA 5C93A 1N4CA 1VQLV 3RT3C 1P84F 4TSFG 2EIKC 1N34O 3L70H 2YIBD 2XTAA 1NQTA 1M57C 1DK1A 1TUBA 2EIKB 3RYFB 1K33A 3SDLA 1YCIA 3ZHTA 1FS0G 1K92A 2A79B 1SKVA 1YEWA 3EVKA 3CCUV 2Q5ZA 3VQYA 1D5NA 2R72A 5KMGA 1Q6UA 4JI2B 1M57B 3N2GB 3CCMV 4X89A 4EKWA 3WB2A 3NR7A 4EEQA 1R73A 4ZHQB 3N27A 5B1AC 1HDJA 3RBZA 5LBQA 1Y76B 3I5DA 1H2NA 2CH7B 1W2BU 2ZINA 1PNMA 1F51A 4FJCC 5EIBD 2UXNA 1YSCA 3LSQA 2CTRA 5IJ0B 1Z5WA 1FXKA 1LUVA 3KKYA 1LUWA 4IL6Z 2WA3A 4F6EA 1Y74A 3ICXA 1GN4A 4Z2WA 5IYBO 1V55C 5KHHA 3P3NA 3K06A 4PA6A 1FD9A 1AI6A 4JI5B 4DR5B 3JAMN 1XNQO 4DR6B 5L3DA 1WJZA 4RQEA 5CB4B 3K5MA 1AILA 3KZIZ 4G27B 4ZIBA 3JALA 1YZBA 2GSMB 1N0NA 1OCRC 1Q3EA 4MVMA 5J9PC 5H5NA 4X20A 1H8HG 4KXRA 3ZRVA 2CTPA 3JD4A 4WBNA 3LDCA 2UXDB 2EILB 1ZTEA 5CMUA 2QJ1A 4TOIA 4HNAB 2Q0AA 2W0XA 4GKKB 4LFCO 4AILC 3BCCH 3FYEB 4LWSB 3JATA 1YITV 1JJOA 3T1HB 5D5PA 4I55A 2YXLA 4QGPA 2ADPA 4X64B 4WFBV 4LF4B 4DR1B 3E8HA 1WNSA 3TGUH 2EIMC 1M1KW 3CC4V 1SRYA 4JPRA 5A2QN 4DUYO 5LOVA 5A9GA 5JJEB 2JK5C 5IJ9B 1NR7A 3QNEA 4CH3A 5KLVH 5TISZ 5LHHA 2OTJV 4B3RB 2VS0A 4AHCA 1H2MA 3VOUA 2JGDA 5KAIZ 5LGTA 1HP8A 3ABMC 2VRZA 4JI3O 3K79A 3VBBA 4X1YA 1LR1A 5LL6Y 1KU9A 4J11A 4YXWG 2EULA 3DSQA 1OCCC 1YF2A 4I0XA 5L3EA 5BZBA 4HYOA 2Q4PA 5IYCO 1BGYH 5KX5B 4JAVA 1OCZC 4BWAA 4GKJB 4ZOLB 1Y67A 3OTFA 5FPRA 4J80A 1OCCB 3OMIB 1VARA 2QEXV 3FB5C 2QM7A 2Y69C 1U97A 1QR8A 4UCTA 1OCZB 4MTXA 4BAYA 4MVQA 2B9ZA 3CRAA 2ZM6O 1EN4A 2ZNIA 2Y69B 5BMVB 2YIBA 2JRIA 2EJRA 3H1IH 3CMAV 3QO8A 3AG4C 1KUQA 4LF5O 4KHPB 2HP8A 2IJIA 3FAVA 1W0JG 5JH7B 4PELA 3A8TA 3RFRA 1XHXA 1N34B 3J80N 1K5SA 4O4IA 3CXHF 3AG4B 3ETGA 4MVOA 2OYQA 4IIJA 1NVPB 5ITZA 2X7RB 3K0GA 3QO7A 2R70A 3UQ8A 2B1IA 1P4RA 3FB7C 2C2AA 3B09A 3SYPA 1GM9A 2XAHA 1R6TA 5LYJA 2BTQA 1Q7YW 4IHJB 5LMUO 2DYRC 1AJPA 3G6EV 5IJ0A 1QQCA 2HHHO 3SYOA 1VF5B 1SA0B 3RGBA 2RDCA 2NNUA 1L8DA 3STZC 1NR1A 3D8CA 3CB2A 4YJ3A 1EFRG 2DYRB 1R1BA 4KL1A 4UB6Z 1MABG 3T1CA 3CCRV 4LFBB 2HJDA 4K8ZA 4JYCA 3K08A 3ZX6A 2OTLV 1IBMO 4UVBA 2AZ0A 3CCLV 3CCVV 1SC5B 2Q7HA 4JTCB 4YY3B 3W7WA 3L74H 5EC2C 1WPBA 4OXSA 2A3QA 4PD4F 4I5SA 5B5EZ 1HR0O 4UXNA 3E8BA 4DW0A 4LFAO 3AG7A 3B40A 1VEWA 2XHBA 2P67A 4MW8A 1KP2A 4LC1A 1K4DC 2Z3YA 4BIZA 1F7YA 1QLEB 2Z5UA 2PI5A 3B8MA 2HEPA 3CJHA 4O4LB 5LXTA 1I5XA 2MK3A 3E35A 5KA5A 1NT2B 3SR2C 1K7DA 2CK3G 1F23A 1EM1A 1GMGA 5CA1B 2OT5A 3SJBC 2BOCC 1H2GA 4LF7O 4LFCB 1I94O 3SPJA 2NR5A
chains in the Genus database with same CATH topology
1IBLO 4JI7O 1D2DA 1DK1A 4LFBO 2LW7A 2UXCO 4B3MO 3SDLA 5FLXN 4JI8O 3J81N 5IWAO 5BXZA 4AQYO 1HNZO 1R6TA 4DV7O 1FJGO 4X66O 4DV0O 4JI2O 5A2QN 4DUYO 3M8AA 5LMUO 4YY3O 1J5EO 4B3SO 1A32A 2UXBO 2HHHO 5LMNO 4B3RO 4GKJO 4JI6O 1IBKO 1FKAO 2E5LO 4B3TO 4OPAA 1R1BA 4DV2O 4JI3O 4DV5O 4DR7O 4JI0O 2UU9O 5LL6Y 1XMQO 1IBMO 1AB3A 3OTOO 2Z0AA 4DV1O 2UUAO 4DV3O 4OX9O 4LF9O 1HNXO 4DV6O 2DJVA 5IT9N 2DOSA 4LF6O 4DR5O 4JI5O 4DR4O 4OPHA 5BY1A 4DR6O 4DR3O 3JAMN 4NXMO 4X65O 1XNQO 1HR0O 4X62O 4NXNO 4A5UB 4LFAO 1AILA 4YHHO 5BR8O 4JI1O 1N32O 2FKXA 1YZBA 5H5NA 2VQFO 1XNRO 2N74A 2ZM6O 1F7YA 2UXDO 2UUCO 3R66A 4DUZO 3T1YO 4JYAO 2JRIA 1HNWO 4DR2O 1FYJA 4LF8O 4GKKO 4DV4O 1KUQA 4KHPO 1NS1A 2UUBO 3F5TA 3O65A 1XMOO 4LF5O 1N36O 1G1XB 3RT3C 2F4VO 1XEQA 1N34O 4JI4O 1N33O 3T1HO 4LFCO 4JV5O 2AGAA 3J80N 4LF7O 2VQEO 1X59A 1I94O 4K0KO 3J7AU 4X64O 4LF4O 2ZKOA 4DR1O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL O;  4JI7 O;  1D2D A;  1DK1 A;  4LFB O;  2LW7 A;  2UXC O;  4B3M O;  3SDL A;  5FLX N;  4JI8 O;  3J81 N;  5IWA O;  5BXZ A;  4AQY O;  1HNZ O;  1R6T A;  4DV7 O;  1FJG O;  4X66 O;  4DV0 O;  4JI2 O;  5A2Q N;  4DUY O;  3M8A A;  5LMU O;  4YY3 O;  1J5E O;  4B3S O;  1A32 A;  2UXB O;  2HHH O;  5LMN O;  4B3R O;  4GKJ O;  4JI6 O;  1IBK O;  1FKA O;  2E5L O;  4B3T O;  4OPA A;  1R1B A;  4DV2 O;  4JI3 O;  4DV5 O;  4DR7 O;  4JI0 O;  2UU9 O;  5LL6 Y;  1XMQ O;  1IBM O;  1AB3 A;  3OTO O;  2Z0A A;  4DV1 O;  2UUA O;  4DV3 O;  4OX9 O;  4LF9 O;  1HNX O;  4DV6 O;  2DJV A;  5IT9 N;  2DOS A;  4LF6 O;  4DR5 O;  4JI5 O;  4DR4 O;  4OPH A;  5BY1 A;  4DR6 O;  4DR3 O;  3JAM N;  4NXM O;  4X65 O;  1XNQ O;  1HR0 O;  4X62 O;  4NXN O;  4A5U B;  4LFA O;  1AIL A;  4YHH O;  5BR8 O;  4JI1 O;  1N32 O;  2FKX A;  1YZB A;  5H5N A;  2VQF O;  1XNR O;  2N74 A;  2ZM6 O;  1F7Y A;  2UXD O;  2UUC O;  3R66 A;  4DUZ O;  3T1Y O;  4JYA O;  2JRI A;  1HNW O;  4DR2 O;  1FYJ A;  4LF8 O;  4GKK O;  4DV4 O;  1KUQ A;  4KHP O;  1NS1 A;  2UUB O;  3F5T A;  3O65 A;  1XMO O;  4LF5 O;  1N36 O;  1G1X B;  3RT3 C;  2F4V O;  1XEQ A;  1N34 O;  4JI4 O;  1N33 O;  3T1H O;  4LFC O;  4JV5 O;  2AGA A;  3J80 N;  4LF7 O;  2VQE O;  1X59 A;  1I94 O;  4K0K O;  3J7A U;  4X64 O;  4LF4 O;  2ZKO A;  4DR1 O; 
#chains in the Genus database with same CATH topology
 1IBL O;  1I5Y A;  5IYZ A;  3OMA B;  2PUS A;  4FFB B;  1S0V A;  3FB8 C;  3R65 A;  1KKC A;  4R7C A;  3HPL C;  4AQY O;  4U3F H;  4UCO A;  4DV0 O;  4X1K A;  4MVS A;  2Q6A A;  4D7S A;  5KUK A;  5GON B;  3I56 V;  4DUY B;  1OHH G;  3AG2 C;  3CC2 V;  3W7U A;  1FKA O;  2IJJ A;  2E5L O;  4B3T O;  1XDC A;  3LSU A;  4N23 A;  3RN4 A;  3HKD A;  3JAW A;  4EB6 B;  1V9P A;  3K57 A;  2WLL A;  5EK0 A;  4JI3 B;  1R6N A;  5KUM A;  1ZWI C;  1MSD A;  3OTO O;  4W4K A;  4ZI7 A;  4O4J A;  1XBL A;  2Z0A A;  4O2B A;  4OX9 O;  3LDD A;  1TUB B;  4P2Z A;  3ZS8 C;  3ZIA G;  5LGU A;  3CX5 F;  1YVW A;  5KMG B;  2BE3 A;  3UKM A;  1GAX A;  1PL0 A;  5BR8 O;  4IGG A;  3JD3 A;  3WFV A;  4I7Z B;  5D5Q A;  5JH7 A;  1K73 W;  4E2L A;  3M99 B;  1FXK C;  2D3O W;  1SQV H;  1VQ8 V;  1M90 W;  3UO2 A;  2ZR2 A;  2ADQ B;  2UXX A;  4H33 A;  3LSS A;  4CBC A;  2ZM6 B;  4JAA A;  1ZUQ A;  1P7B A;  2ATK C;  3ZMV A;  2GUZ A;  2Q0O C;  1NZ6 A;  1IVS A;  1AI7 A;  2XOK G;  3OM3 B;  2LO1 A;  1QVG U;  1AJN A;  3ZMT A;  2JVD A;  4X65 B;  3GWK C;  1FXK B;  2HFE C;  1PKX A;  2F4V O;  4LF5 B;  1Y74 B;  1YJW V;  4NB5 A;  4FLU A;  4FLZ A;  3H1L H;  2QKC A;  4IHJ A;  2VQE O;  4B7E A;  4LH6 A;  1VQ5 V;  1K8A W;  3E86 A;  3ML0 A;  2DWE C;  2YIC A;  3E22 A;  2XUM A;  3A0H Z;  5BXZ A;  1HNZ O;  3H01 A;  3JAL B;  4JZ2 A;  3CPW U;  1PNK A;  4X20 B;  5LMU B;  4DK1 A;  4WBN B;  1VQ6 V;  1B04 A;  2HHH B;  4CS4 A;  1UPG A;  1DGS A;  2JS5 A;  2KG7 A;  2Q9L A;  1KD1 W;  1KB9 F;  1J95 A;  1E1R G;  2RQ6 A;  1YJN V;  3JAT B;  1KQS U;  3ZBH A;  1IBM B;  5IDJ A;  4I55 B;  3JCZ A;  4JGS A;  1QBZ A;  4OPH A;  1TAE A;  3P30 A;  3OW2 U;  4FLT A;  1NJI W;  1VF6 A;  5LOV B;  2RCV A;  3ZJZ A;  1HR0 B;  3T2M A;  2XAG A;  5H2F Z;  1M93 A;  3W7T A;  4TWK A;  2QA4 V;  4LFA B;  1L0N H;  5LP6 C;  4FVM A;  2FKX A;  1YI2 V;  1P49 A;  4PA9 A;  5CA1 A;  2HKO A;  3FX7 A;  2CTW A;  2RJZ A;  1W59 A;  3T1Y O;  1ARO P;  5CBH A;  4X1Y B;  3HR0 A;  4OGQ B;  3JYC A;  4KFM A;  3P32 A;  4I0X B;  2ARH A;  2RNB A;  3MDS A;  3LNN A;  2V7Q G;  2QSA A;  4UCU A;  3J7A U;  4LF7 B;  2EX3 A;  1I94 B;  1YTF D;  2GDS A;  3C3T A;  1D2D A;  4UV8 A;  2PGG A;  1IBL B;  2P6J A;  3SPI A;  3CD6 V;  1ENV A;  3TCU A;  4JYY A;  2NLJ C;  4GX2 A;  3EFF K;  1XQ8 A;  2WLK A;  4CS2 A;  4DV0 B;  2A0L A;  4PDR A;  2RN9 A;  2UXB O;  5LMN O;  1GO3 F;  2QM4 A;  3T4D A;  4Z1M G;  2L35 A;  3ZHR A;  4FM2 A;  1G6U A;  1VQM V;  1YIJ V;  2E5L B;  4B3T B;  3SJC C;  1F4N A;  1ZSP A;  3N2K A;  5GW7 A;  3FAV B;  4DRX A;  2EBO A;  3FKS G;  2YXH A;  4PDV A;  5IWA B;  4JTA B;  2F93 B;  4U7N A;  3RYC A;  4O4I B;  1I7F A;  3OTO B;  4IIJ B;  5EIB C;  5ITZ B;  1R3J C;  4OX9 B;  1VQO V;  4LF6 O;  2HVK C;  3AK2 A;  4DW1 A;  4NR1 A;  2KKW A;  1WAZ A;  5LYJ B;  2BTQ B;  2CGN A;  4QE7 A;  1RPO A;  3SYA A;  1BZK A;  4YHH O;  5B1A B;  3BPZ A;  3JD2 A;  5BR8 B;  2Q8V A;  3QVN A;  1NH2 D;  1W0K G;  1L1F A;  4CS3 A;  4E4E A;  3OR7 C;  2QR4 A;  4YJ3 B;  4UVC A;  5KA6 A;  3L71 H;  4UFZ A;  3OUF A;  4UUJ C;  2FTK A;  3CC7 V;  4JYB A;  4J10 A;  4QPJ A;  2OCC C;  1ZAU A;  3BAB A;  4TV8 A;  2WLI A;  2IJH A;  3SJA C;  2ZIO A;  3F7Y C;  3JSN A;  4FM1 A;  3G4S V;  1V55 B;  3VQV A;  2F4V B;  4Q6G A;  3CRQ A;  5B66 Z;  5B1B C;  2OCC B;  1AI5 A;  1QHT A;  4C7U A;  2VQE B;  1BHA A;  2ITD C;  2IBZ H;  2MW2 B;  2ZXW C;  3QF7 A;  3OUS A;  1FFT B;  1RPR A;  2W6I G;  4ZKI A;  2GTS A;  1OCR B;  1COW G;  5B1B B;  4X66 O;  3JD0 A;  1HNZ B;  1Z5V A;  2B1G A;  4QJF B;  1J5E O;  2OWO A;  4K3A A;  4O2A A;  4PI2 A;  5B3S C;  1I08 A;  1VQK V;  2V1D A;  4GX1 A;  4QE9 A;  2ZCE A;  3U0Z A;  3CJH B;  4KP4 A;  1MMM A;  5LXT B;  3LNM B;  2XAF A;  3T4Z A;  1VQ9 V;  1HWY A;  5B3S B;  3ZRS A;  4JI0 O;  4FLY A;  4JTD B;  1E1Q G;  1JMK C;  3LUT B;  2UUA O;  4NKG B;  4I50 A;  5KHI A;  3DXR A;  2EIM B;  3RYI A;  3FYI B;  3D3Q A;  2WSS G;  4U7O A;  5IYZ B;  4RO2 A;  2PY5 A;  5L3B A;  3H9V A;  3OFN G;  4LH7 A;  5F2V O;  4J41 A;  2WAM A;  3OEH G;  2W6J G;  3BHP A;  3APO A;  1S76 D;  3JSL A;  4X1K B;  1WN7 A;  5LP6 A;  3ZMS A;  1PD3 A;  1BCC H;  1N32 O;  2H94 A;  4MTG A;  2QWR B;  1V54 C;  2XAJ A;  3ZRW A;  3ABM B;  3HKD B;  3JAW B;  1MOF A;  1XI1 A;  4RAI A;  2N04 A;  5DM6 V;  2BOB C;  4JYA O;  5J2U B;  1HNW O;  4X88 A;  4IYI A;  4MT8 A;  2WLL B;  3T1Y B;  1SQP H;  3H1K H;  4LF8 O;  4PV1 B;  5JVD A;  1B3Q A;  2K9P A;  1K9M W;  1V54 B;  3ETE A;  3FFQ A;  4GT1 A;  4ZI7 B;  4O4J B;  2E76 B;  4O2B B;  3TXQ A;  3ZHS A;  1S3J A;  1ZL8 A;  1XL4 A;  2ZKO A;  2JEU A;  1N0J A;  3HKB A;  4TV9 B;  4CH5 A;  4YJ2 A;  2P7T C;  1XIL A;  2KB1 A;  1BS3 A;  5K1P A;  1DLB A;  4PI0 A;  4TQD A;  2LFS A;  3WB0 A;  1Z2G A;  1AI4 A;  3KCX A;  3SGI A;  2UXB B;  1MSW D;  1KYO F;  1XHZ A;  3TK1 A;  2GUZ B;  5LMN B;  4JAS A;  1BQZ A;  2O57 A;  1Y6X A;  3OEE G;  1UFI A;  3S3X A;  1NTM H;  1VIB A;  4IT5 A;  2PZS A;  2L6L A;  3AG3 C;  1Q8I A;  3KCY A;  2X0L A;  4H13 B;  3UM7 A;  1BHB A;  4LF9 O;  3HKE A;  5EC1 C;  2Y4U A;  4DV6 O;  2F23 A;  3P3P A;  3E83 A;  1Q6H A;  1JX9 A;  2DN9 A;  3MHS C;  4P9P A;  4LF6 B;  3E22 B;  4DR3 O;  2LFR A;  2BCC H;  3AG3 B;  4YIO A;  4PDM A;  3BY6 A;  1KBH A;  3OD4 A;  2JJ1 G;  1TVK B;  4TUY A;  4YHH B;  2DYS C;  4J9Z B;  1GTO A;  4WFH A;  1DF4 A;  1Q6I A;  3ZHV A;  3K5N A;  1Q86 W;  3EXA A;  3GVM A;  2IH1 C;  2ZR3 A;  3SPC A;  2KG7 B;  4NTW A;  1NTK H;  4YIP A;  3CE2 A;  2DYS B;  2QDO A;  3CEI A;  3LDE A;  4JZG A;  1VMG A;  1XNQ B;  4MVU A;  3PN1 A;  3E2E A;  1VF6 C;  5CN0 A;  3OGC C;  1XRE A;  1N33 O;  1KKD A;  2PYL A;  5H6R A;  2ZIM A;  4ZBM A;  4K0K O;  1BSM A;  4TT3 G;  4JI7 O;  3MAQ A;  4RUF A;  2ZDI A;  1AP6 A;  1SF9 A;  1SS3 A;  3ZCC A;  4X9Q A;  5CBG A;  1FPO A;  2Q69 A;  5KAF Z;  1PV0 A;  5H6Q A;  4TQF A;  2FML A;  4BIO A;  3CCE V;  3ZED A;  3L75 H;  4D7T A;  4FIP C;  1AVM A;  3SJQ C;  1J5E B;  2DQ3 A;  1IX9 A;  3ZHQ A;  4I9Q A;  1LNQ A;  4B7K A;  4UCV A;  4OPA A;  4WFA V;  1S5J A;  4I9W A;  4DR7 O;  2DE0 X;  1GM8 A;  2YS8 A;  4FLV A;  1SQB H;  3A0B Z;  4JI0 B;  2JEX A;  2WLN A;  1WLE A;  2QTO A;  3Q4H A;  2DOS A;  4G28 B;  3CS5 A;  2WLH A;  4DO2 A;  4FMT A;  5J2U A;  5IE9 A;  3KG2 A;  4X62 O;  2VWJ A;  3AG2 B;  1ZLZ A;  1SZT A;  4J7J A;  3AK3 A;  1G4Y B;  4JI1 O;  1H8E G;  3K03 A;  4R6Z A;  2P06 A;  1JFF A;  1N32 B;  1L0L H;  3TJT A;  1VF7 A;  2Y0P A;  3B8N A;  3R66 A;  4DUZ O;  3IGA C;  2YI8 A;  1R3K C;  3VQX A;  3N2K B;  4PA7 A;  4O4H A;  2IU3 A;  4JYA B;  4AI8 A;  1HNW B;  4DRX B;  4I4T A;  4TV9 A;  1RSO B;  3IFX A;  3K59 A;  3CRR A;  1VQ7 V;  4LF8 B;  3RYC B;  2ZE8 A;  3TXS A;  4UV9 A;  4JV5 O;  1H2S B;  2YDE A;  3BA9 A;  3BEH A;  3S3W A;  1BMF G;  1DF5 A;  4X1I B;  5B1N A;  3RYH A;  2JGU A;  3CP1 A;  3QTC A;  4EFB A;  4JI8 O;  4MS2 A;  1QNM A;  2LP7 A;  3L72 H;  2YEV A;  3BRC A;  1YXB A;  3A2F A;  4F4L A;  3A0R A;  4GX5 A;  4RQF A;  2QGN A;  4B3S O;  1XUQ A;  3DC5 A;  1IZ3 A;  1QR9 A;  2CAZ C;  4Z1V A;  3C3S A;  2QTS A;  4LR3 A;  1B06 A;  4BR6 A;  4JI6 O;  1K4C C;  1YHQ V;  3G67 A;  2QWO B;  4PHZ A;  4TV8 B;  2GHY A;  2WLI B;  4GZR B;  2H8P C;  3JAK A;  1IDS A;  1TUE B;  4MTO A;  1RM1 C;  2R9A A;  3WU2 Z;  4U3J A;  1D5A A;  1HNX O;  1TVK A;  5IT9 N;  3FD9 A;  4LF9 B;  4H37 A;  3CRM A;  5IY5 C;  1EN5 A;  2HJF C;  3GWO A;  2FB5 A;  4DR3 B;  4J9Y B;  1R6K A;  1FFX A;  4O2A B;  4ICG A;  3K0D A;  4B08 A;  3JAR A;  3APQ A;  3HKC B;  1Q90 D;  5CA0 A;  4F6R A;  4DV4 O;  3ASO C;  2UUB O;  2EZO A;  2AHZ A;  1XEQ A;  1M4U A;  4I50 B;  4XDK A;  3DXR B;  4JI4 O;  3RYI B;  1Y66 A;  2ODM A;  1N33 B;  2F66 C;  1X59 A;  4BW5 A;  1EZJ A;  3ASO B;  2VQF O;  2KQX A;  3K04 A;  2QKA A;  4JI7 B;  1S5L Z;  3E89 A;  5LP6 B;  3J81 N;  2QWN B;  3RVY A;  2QM8 A;  4WCE V;  1KMI Z;  4DV7 O;  4MTF A;  1YJ9 V;  4WFG A;  1F4M A;  3ZRW B;  3CYO A;  4GLX A;  3K5O A;  2N05 A;  4GKJ O;  5JVD B;  3X2Q C;  3ZN0 A;  3CCS V;  1BE3 H;  4BIU A;  1Y4M A;  5LA6 A;  2Q7E A;  4LNU A;  5FL7 G;  2UU9 O;  4DR7 B;  4FFK A;  4AQY B;  1PNL A;  1OV9 A;  1AB3 A;  1ROP A;  1ZL8 B;  4DV1 O;  4DV3 O;  3HKB B;  5DEC A;  5EBM C;  2DW4 A;  4YJ2 B;  3UT5 A;  4LBE C;  4BW9 A;  2IU0 A;  1GN3 A;  3D36 C;  1SQQ H;  2R9I A;  3VQW A;  3GB7 C;  2H3O A;  5GTH Z;  4NXM O;  3IJ4 A;  4FZ0 A;  2FL4 A;  2E74 B;  2IM9 A;  1QU7 A;  1IXB A;  2K1E A;  1AJQ A;  1RSO A;  1K34 A;  4X62 B;  2OCH A;  1US6 A;  1TA8 A;  1K5Q A;  4JI1 B;  3K9A A;  2JJ2 G;  2N74 A;  5L3G A;  1FXH A;  1R3I C;  5JWP A;  3CSX A;  1XOU A;  1ZX3 A;  2UUC O;  2XAS A;  1NI8 A;  1RP3 B;  2P5O A;  5EYP A;  3K5L A;  3H1H H;  4DUZ B;  2D2C B;  4X1I A;  4DR2 O;  2M7W A;  1FYJ A;  2CDY A;  1YDX A;  3CRC A;  1JA8 A;  1PL4 A;  3ZRX A;  5EZY A;  1XMO O;  1N8R W;  1N36 O;  1EZV H;  2XT9 A;  1B6Q A;  3HKE B;  1NH2 B;  4PA3 A;  4JV5 B;  2A7W A;  2BSK B;  4J42 A;  4G2K A;  1SQG A;  4LFB O;  1AR1 B;  4B3M O;  5FLX N;  1EBO A;  1VQ4 V;  1Q43 A;  4JF3 A;  4JI8 B;  2ZQM A;  4TUY B;  4QIW F;  1OZ0 A;  3ZMU A;  1WA8 A;  3C90 A;  4YY3 O;  3U11 A;  1A32 A;  1JPX A;  4B3S B;  2HLD G;  4NYK A;  2B5U A;  1IBK O;  3DC6 A;  4FZ1 A;  4JI6 B;  2P4V A;  2QWP B;  1JVM A;  4D6T H;  2W0F C;  1O9G A;  4XDJ A;  4DV2 O;  2ZDI C;  3CXC U;  4PDL A;  2EIL C;  2EJ7 A;  1VP7 A;  4WFF A;  2WWW A;  5LGN A;  4J7K A;  2ZXW B;  3ABT A;  4CZZ A;  2ZE6 A;  4N21 A;  2YIA A;  5KHJ A;  1HNX B;  2WA4 A;  5JQG B;  1OJH A;  2OIG A;  2Q67 A;  2E75 B;  1NTZ H;  3HKC A;  2AHY A;  3JAS A;  3MD0 A;  2LJ2 A;  1UJW B;  2YID A;  3JD1 A;  4CC6 A;  1AR5 A;  3OGI B;  5FNV A;  1QLN A;  2ETN A;  5IYD O;  1MG1 A;  4FM0 A;  1R3L C;  3OMN B;  5JJJ B;  2QWQ B;  1NS1 A;  3F5T A;  4DV4 B;  2E3C A;  2UUB B;  1ORQ C;  4JI4 B;  1JR9 A;  4CC5 A;  3BA8 A;  3Q4H B;  3NXS A;  3SPH A;  1GM7 A;  3RVZ A;  5E79 Z;  2WLM A;  2VQF B;  2UXC O;  2Y0I A;  2OIE A;  1GN6 A;  1WP7 A;  3B4S A;  2RMK B;  3IC7 A;  4QPK A;  4DV7 B;  1JFF B;  2WLJ A;  4HAM A;  5GTI Z;  1X4T A;  3E8G A;  4GUN A;  2YI9 A;  1SZX A;  1NU1 H;  2YC0 A;  4O4H B;  4GX0 A;  4I4T B;  4DXW A;  2P90 A;  3BVO A;  4DV5 O;  3B77 A;  4HZ3 A;  2UU9 B;  5KHG A;  4FLX A;  2ZE7 A;  2X6A A;  4GYC B;  3MHH C;  3TET A;  2DJV A;  4DV1 B;  3D36 A;  3RYH B;  3SYC A;  4DV3 B;  2PYJ A;  4DR4 O;  3DTU B;  2PF4 E;  2LGW A;  3HB3 B;  5L3F A;  5HFM A;  2CGO A;  1SET A;  1Q82 W;  4X65 O;  2YEV B;  1S77 D;  4LP8 A;  5E1A C;  3RYF A;  4NXM B;  1CPY A;  4NXN O;  3E8F A;  3ABK C;  1PP9 H;  3PJS K;  1FAF A;  2NN4 A;  1EN6 A;  2Y48 A;  5J2T B;  1KEC A;  5EBL C;  3N2G A;  1XNR O;  1MZE A;  4MVR A;  2Q73 A;  4QNH B;  4ZHQ A;  1NVP D;  2BSK A;  3ABK B;  2UUC B;  1Y76 A;  1P7G A;  1M5I A;  2A06 H;  2CH7 A;  5C8Y B;  3JAK B;  3ETD A;  3O65 A;  5HFL A;  4DR2 B;  2JS3 A;  1XMO B;  4ABM A;  4U3J B;  1N36 B;  2FYU H;  3OAA G;  1PM9 A;  2HG5 C;  5CBF A;  2X6C A;  3ZMZ A;  1BL8 A;  4K35 A;  5H9C A;  5K1X A;  1FFX B;  3ZHU A;  4B3M B;  3ASN C;  3FB6 C;  1FJG O;  2YUA A;  4UB8 Z;  3SYQ A;  3M8A A;  1SER A;  5CB4 A;  3JAR B;  5CA3 A;  2IW5 A;  3AK1 A;  1GKF A;  3ASN B;  2EIN C;  3OE7 G;  5CA0 B;  1IBK B;  1RFY A;  1E79 G;  4F6R B;  5JCO C;  3K58 A;  1QLE C;  5JQG A;  4HNA A;  4DYL A;  4DV2 B;  2EIN B;  3G80 A;  1OCO C;  1XMQ O;  4X66 B;  4FLW A;  3AG1 C;  1Q5O A;  4LWS A;  1QVF U;  1T5E A;  1CP9 A;  2Y4T A;  3OT7 A;  5L3C A;  1OCO B;  4UCS A;  1AP5 A;  3G71 V;  2EZP A;  4MW3 A;  3F5W C;  1MZF A;  3AG1 B;  2AW9 A;  2WPD G;  1BQ0 A;  2DMX A;  4A5U B;  1JQ0 A;  1KP3 A;  3ABL C;  3I55 V;  3OR6 C;  5IJ9 A;  2UUA B;  2LW1 A;  3CCQ V;  1SQX H;  2ILM A;  5LA6 B;  4LNU B;  3EHB B;  4WF9 V;  1K97 A;  1M56 C;  1WPX A;  2V4D A;  3ABL B;  2PI4 A;  4RWU A;  2BTO A;  4R50 A;  3JCU Z;  5B1O A;  4HBN A;  2Q68 A;  2VWK A;  4PJ0 Z;  2AGA A;  4CH6 A;  3UT5 B;  2P22 C;  2KSD A;  1M56 B;  3THO A;  3DGE A;  2CUG A;  5AG2 A;  1S72 V;  2ZNJ A;  4CH4 A;  2JDI G;  5KX5 A;  3O9O A;  4GCZ A;  2UXC B;  2ZE5 A;  4ZOL A;  5IWA O;  4UCR A;  2IJK A;  4JI2 O;  3RWR D;  2JIZ G;  1O9H A;  2X6B A;  1MNG A;  2ZT9 B;  1H2K A;  1GH6 A;  4IYH A;  1CXZ B;  3D3I A;  4XDL A;  5EYP B;  2QKS A;  3CCJ V;  2F43 G;  1Q81 W;  4Q20 A;  1I0H A;  2XND G;  5EZY B;  1M9N A;  5BMV A;  2CE4 A;  3U10 A;  1AR4 A;  1K3E A;  5JJN B;  4DV5 B;  1S5H C;  1NKD A;  3B2E E;  4W4L A;  1G8M A;  2PTM A;  2A9H A;  2YSU B;  5LHI A;  1VQN V;  1JJ2 U;  1JOY A;  3CME V;  2LQT A;  1TGO A;  5J2T A;  4UVA A;  2HR3 A;  3SPG A;  4DR5 O;  4JI5 O;  4EFE A;  5BY1 A;  4DR6 O;  4NVP A;  4DR4 B;  4ASU G;  1GK9 A;  1XL6 A;  3QO5 A;  1WA8 B;  3K9S A;  2F1M A;  2F95 B;  4XBF A;  5C8Y A;  1QCE A;  4NXN B;  4MSW C;  3ABU A;  1MA1 A;  1URF A;  3K3W A;  3ZN1 A;  3W7X A;  1GN2 A;  5DED A;  4FPP A;  2UXD O;  1XNR B;  1SA0 A;  1U96 A;  4DV6 B;  1SQF A;  4WFE A;  4NTY A;  1RM1 B;  2CTQ A;  1GRJ A;  2DQ0 A;  4GKK O;  1H38 A;  4J7Z A;  4L87 A;  3BAA A;  1G1X B;  2GTA A;  3CWB H;  2ITC C;  1NBM G;  2AXT Z;  2Q7G A;  3QG5 A;  3UO3 A;  5IY5 B;  3T1H O;  4FK5 C;  2M6Y A;  4MVZ A;  4X64 O;  3IC9 A;  5LHG A;  2IH3 C;  3CHX A;  4DR1 O;  4LF4 O;  4P9O A;  3BFR A;  3JAS B;  2LW7 A;  1KC8 W;  1THZ A;  3UCS C;  5DN6 G;  1CEZ A;  2XAQ A;  4RUE A;  2DWD C;  3RW0 A;  2AZ2 A;  5FNV B;  1FJG B;  3G6B A;  1IUR A;  2R9R B;  3L9D A;  3ETQ A;  4LCU C;  4B3R O;  1H2L A;  3IAY A;  1JCH A;  2EIJ C;  4X8A A;  4K0K B;  5JCO A;  2GV9 A;  4R8C A;  3W7S A;  5KHK A;  4K8X A;  2G38 A;  4O4L A;  5FPO A;  4DK0 A;  1WP8 A;  1PPJ H;  1HW7 A;  2EIJ B;  3AEI A;  1VQP V;  3F7V C;  1XMQ B;  4NTX A;  3H1J H;  1WB7 A;  1IXM A;  3L73 H;  5EBW C;  4KUM A;  1SES A;  4P30 A;  2LGQ A;  2JGD B;  2ZD9 A;  1YTF B;  1BT8 A;  3WG7 C;  3M7M X;  4PA4 A;  2HVJ C;  4FFB A;  1DTO A;  2YXY A;  1FXV A;  3STL C;  3WG7 B;  4JAU A;  3X2Q B;  5GON A;  4H0L B;  2QE7 G;  1WB8 A;  2GBO A;  4H44 B;  4L8J A;  4EB6 A;  3WB1 A;  4KHP O;  2P4K A;  5C93 A;  1N4C A;  1VQL V;  3RT3 C;  1P84 F;  4TSF G;  2EIK C;  1N34 O;  3L70 H;  2YIB D;  2XTA A;  1NQT A;  1M57 C;  1DK1 A;  1TUB A;  2EIK B;  3RYF B;  1K33 A;  3SDL A;  1YCI A;  3ZHT A;  1FS0 G;  1K92 A;  2A79 B;  1SKV A;  1YEW A;  3EVK A;  3CCU V;  2Q5Z A;  3VQY A;  1D5N A;  2R72 A;  5KMG A;  1Q6U A;  4JI2 B;  1M57 B;  3N2G B;  3CCM V;  4X89 A;  4EKW A;  3WB2 A;  3NR7 A;  4EEQ A;  1R73 A;  4ZHQ B;  3N27 A;  5B1A C;  1HDJ A;  3RBZ A;  5LBQ A;  1Y76 B;  3I5D A;  1H2N A;  2CH7 B;  1W2B U;  2ZIN A;  1PNM A;  1F51 A;  4FJC C;  5EIB D;  2UXN A;  1YSC A;  3LSQ A;  2CTR A;  5IJ0 B;  1Z5W A;  1FXK A;  1LUV A;  3KKY A;  1LUW A;  4IL6 Z;  2WA3 A;  4F6E A;  1Y74 A;  3ICX A;  1GN4 A;  4Z2W A;  5IYB O;  1V55 C;  5KHH A;  3P3N A;  3K06 A;  4PA6 A;  1FD9 A;  1AI6 A;  4JI5 B;  4DR5 B;  3JAM N;  1XNQ O;  4DR6 B;  5L3D A;  1WJZ A;  4RQE A;  5CB4 B;  3K5M A;  1AIL A;  3KZI Z;  4G27 B;  4ZIB A;  3JAL A;  1YZB A;  2GSM B;  1N0N A;  1OCR C;  1Q3E A;  4MVM A;  5J9P C;  5H5N A;  4X20 A;  1H8H G;  4KXR A;  3ZRV A;  2CTP A;  3JD4 A;  4WBN A;  3LDC A;  2UXD B;  2EIL B;  1ZTE A;  5CMU A;  2QJ1 A;  4TOI A;  4HNA B;  2Q0A A;  2W0X A;  4GKK B;  4LFC O;  4AIL C;  3BCC H;  3FYE B;  4LWS B;  3JAT A;  1YIT V;  1JJO A;  3T1H B;  5D5P A;  4I55 A;  2YXL A;  4QGP A;  2ADP A;  4X64 B;  4WFB V;  4LF4 B;  4DR1 B;  3E8H A;  1WNS A;  3TGU H;  2EIM C;  1M1K W;  3CC4 V;  1SRY A;  4JPR A;  5A2Q N;  4DUY O;  5LOV A;  5A9G A;  5JJE B;  2JK5 C;  5IJ9 B;  1NR7 A;  3QNE A;  4CH3 A;  5KLV H;  5TIS Z;  5LHH A;  2OTJ V;  4B3R B;  2VS0 A;  4AHC A;  1H2M A;  3VOU A;  2JGD A;  5KAI Z;  5LGT A;  1HP8 A;  3ABM C;  2VRZ A;  4JI3 O;  3K79 A;  3VBB A;  4X1Y A;  1LR1 A;  5LL6 Y;  1KU9 A;  4J11 A;  4YXW G;  2EUL A;  3DSQ A;  1OCC C;  1YF2 A;  4I0X A;  5L3E A;  5BZB A;  4HYO A;  2Q4P A;  5IYC O;  1BGY H;  5KX5 B;  4JAV A;  1OCZ C;  4BWA A;  4GKJ B;  4ZOL B;  1Y67 A;  3OTF A;  5FPR A;  4J80 A;  1OCC B;  3OMI B;  1VAR A;  2QEX V;  3FB5 C;  2QM7 A;  2Y69 C;  1U97 A;  1QR8 A;  4UCT A;  1OCZ B;  4MTX A;  4BAY A;  4MVQ A;  2B9Z A;  3CRA A;  2ZM6 O;  1EN4 A;  2ZNI A;  2Y69 B;  5BMV B;  2YIB A;  2JRI A;  2EJR A;  3H1I H;  3CMA V;  3QO8 A;  3AG4 C;  1KUQ A;  4LF5 O;  4KHP B;  2HP8 A;  2IJI A;  3FAV A;  1W0J G;  5JH7 B;  4PEL A;  3A8T A;  3RFR A;  1XHX A;  1N34 B;  3J80 N;  1K5S A;  4O4I A;  3CXH F;  3AG4 B;  3ETG A;  4MVO A;  2OYQ A;  4IIJ A;  1NVP B;  5ITZ A;  2X7R B;  3K0G A;  3QO7 A;  2R70 A;  3UQ8 A;  2B1I A;  1P4R A;  3FB7 C;  2C2A A;  3B09 A;  3SYP A;  1GM9 A;  2XAH A;  1R6T A;  5LYJ A;  2BTQ A;  1Q7Y W;  4IHJ B;  5LMU O;  2DYR C;  1AJP A;  3G6E V;  5IJ0 A;  1QQC A;  2HHH O;  3SYO A;  1VF5 B;  1SA0 B;  3RGB A;  2RDC A;  2NNU A;  1L8D A;  3STZ C;  1NR1 A;  3D8C A;  3CB2 A;  4YJ3 A;  1EFR G;  2DYR B;  1R1B A;  4KL1 A;  4UB6 Z;  1MAB G;  3T1C A;  3CCR V;  4LFB B;  2HJD A;  4K8Z A;  4JYC A;  3K08 A;  3ZX6 A;  2OTL V;  1IBM O;  4UVB A;  2AZ0 A;  3CCL V;  3CCV V;  1SC5 B;  2Q7H A;  4JTC B;  4YY3 B;  3W7W A;  3L74 H;  5EC2 C;  1WPB A;  4OXS A;  2A3Q A;  4PD4 F;  4I5S A;  5B5E Z;  1HR0 O;  4UXN A;  3E8B A;  4DW0 A;  4LFA O;  3AG7 A;  3B40 A;  1VEW A;  2XHB A;  2P67 A;  4MW8 A;  1KP2 A;  4LC1 A;  1K4D C;  2Z3Y A;  4BIZ A;  1F7Y A;  1QLE B;  2Z5U A;  2PI5 A;  3B8M A;  2HEP A;  3CJH A;  4O4L B;  5LXT A;  1I5X A;  2MK3 A;  3E35 A;  5KA5 A;  1NT2 B;  3SR2 C;  1K7D A;  2CK3 G;  1F23 A;  1EM1 A;  1GMG A;  5CA1 B;  2OT5 A;  3SJB C;  2BOC C;  1H2G A;  4LF7 O;  4LFC B;  1I94 O;  3SPJ A;  2NR5 A; 
#chains in the Genus database with same CATH homology
 1IBL O;  4JI7 O;  1D2D A;  1DK1 A;  4LFB O;  2LW7 A;  2UXC O;  4B3M O;  3SDL A;  5FLX N;  4JI8 O;  3J81 N;  5IWA O;  5BXZ A;  4AQY O;  1HNZ O;  1R6T A;  4DV7 O;  1FJG O;  4X66 O;  4DV0 O;  4JI2 O;  5A2Q N;  4DUY O;  3M8A A;  5LMU O;  4YY3 O;  1J5E O;  4B3S O;  1A32 A;  2UXB O;  2HHH O;  5LMN O;  4B3R O;  4GKJ O;  4JI6 O;  1IBK O;  1FKA O;  2E5L O;  4B3T O;  4OPA A;  1R1B A;  4DV2 O;  4JI3 O;  4DV5 O;  4DR7 O;  4JI0 O;  2UU9 O;  5LL6 Y;  1XMQ O;  1IBM O;  1AB3 A;  3OTO O;  2Z0A A;  4DV1 O;  2UUA O;  4DV3 O;  4OX9 O;  4LF9 O;  1HNX O;  4DV6 O;  2DJV A;  5IT9 N;  2DOS A;  4LF6 O;  4DR5 O;  4JI5 O;  4DR4 O;  4OPH A;  5BY1 A;  4DR6 O;  4DR3 O;  3JAM N;  4NXM O;  4X65 O;  1XNQ O;  1HR0 O;  4X62 O;  4NXN O;  4A5U B;  4LFA O;  1AIL A;  4YHH O;  5BR8 O;  4JI1 O;  1N32 O;  2FKX A;  1YZB A;  5H5N A;  2VQF O;  1XNR O;  2N74 A;  2ZM6 O;  1F7Y A;  2UXD O;  2UUC O;  3R66 A;  4DUZ O;  3T1Y O;  4JYA O;  2JRI A;  1HNW O;  4DR2 O;  1FYJ A;  4LF8 O;  4GKK O;  4DV4 O;  1KUQ A;  4KHP O;  1NS1 A;  2UUB O;  3F5T A;  3O65 A;  1XMO O;  4LF5 O;  1N36 O;  1G1X B;  3RT3 C;  2F4V O;  1XEQ A;  1N34 O;  4JI4 O;  1N33 O;  3T1H O;  4LFC O;  4JV5 O;  2AGA A;  3J80 N;  4LF7 O;  2VQE O;  1X59 A;  1I94 O;  4K0K O;  3J7A U;  4X64 O;  4LF4 O;  2ZKO A;  4DR1 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...