3K06A

Crystal structure of cng mimicking nak mutant, nak-ntpp, k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGNTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k06A00
5KUMA 3STZC 2ATKC 4PDMA 2BOBC 4LCUC 3VOUA 3AG2C 4RUFA 1OCZC 1R3LC 3T2MA 4JTCB 1OCOC 3T4DA 3SPIA 3F7YC 2HG5C 2QTOA 3KG2A 2DYRC 4P9OA 3K06A 4GX1A 2EIJC 2WLJA 3EFFK 4QNHB 3TETA 3E83A 2QKSA 4XDJA 2ZXWC 3AG3C 2AHZA 4LBEC 1M57C 4G27B 3SJQC 3AG1C 3LDEA 2A0LA 3GB7C 4PA9A 3SYAA 2WLMA 2WLIA 2JK5C 3F5WC 3HPLC 3T1CA 5BZBA 1LNQA 5EC2C 4GX0A 1ORQC 5EBWC 5IY5C 1V54C 1V55C 3ABMC 3K08A 3RVYA 1G4YB 4PDVA 4HZ3A 4JTAB 4BW5A 4WFFA 2DWEC 3OR6C 1R3KC 5B1BC 2EILC 2NLJC 3BEHA 4RO2A 2IH3C 2Q69A 4XDKA 4MVQA 2P7TC 3SPCA 3E8FA 4MSWC 2HVJC 2Q6AA 2W0FC 3IFXA 1J95A 4MW3A 4PDRA 4WFGA 5J9PC 2EINC 2Y69C 1K4DC 1ZWIC 2WLLA 3LNMB 3E8BA 1KKDA 4KFMA 3UKMA 2WLIB 4LP8A 4X88A 2ITDC 4MS2A 3OUFA 4MTOA 5CBHA 3ASNC 3SYOA 3K03A 4UUJC 2Q68A 1P7BA 3FB6C 4I9WA 3ASOC 4RUEA 4H33A 4XDLA 3SYCA 3E89A 4MVSA 4R8CA 1OCRC 3E86A 3RW0A 2X6BA 3FB7C 4GX5A 4P9PA 2A79B 4MVMA 5KUKA 3F7VC 3R65A 3LDCA 4PA6A 4OXSA 1JVMA 1K4CC 3T4ZA 4X89A 4PA4A 4J9ZB 1S5HC 2BOCC 4HYOA 5E1AC 2H8PC 3ABKC 5B1AC 2WLLB 5B3SC 3AG4C 3K0DA 2EIMC 2EIKC 2ITCC 4MVUA 2R9RB 4QE7A 4R6ZA 4MVOA 2A9HA 3LUTB 3RBZA 4EKWA 4MW8A 4J9YB 4ZBMA 3RVZA 4X8AA 2X6AA 3SPHA 3JYCA 1R3JC 1BL8A 3OGCC 4MTGA 4QE9A 4TWKA 2HVKC 3E8HA 3OUSA 3PJSK 4MVRA 4R50A 3SYPA 3K04A 3FB8C 4PA7A 3E8GA 3SYQA 2IH1C 2WLHA 2WLNA 4H37A 4MVZA 3ABLC 4WFEA 4R7CA 4DXWA 2HFEC 2HJFC 3X2QC 4PDLA 3WG7C 4PA3A 1R3IC 1M56C 2OCCC 4WFHA 2DYSC 3SPGA 5CBGA 2WLKA 2YEVA 3K0GA 2X6CA 3LDDA 3STLC 5CBFA 2ZD9A 3TCUA 4RAIA 4P2ZA 3IGAC 1XL4A 2AHYA 3ZRSA 4CBCA 4F4LA 2K1EA 4JTDB 1XL6A 4G28B 4P30A 1OCCC 5EBMC 5EBLC 3ZJZA 2Q67A 3FB5C 3SPJA 1QLEC 4MTFA 2KB1A 3OR7C 5EK0A 4GX2A 2DWDC 3UM7A 5EC1C
chains in the Genus database with same CATH superfamily
3G4SV 1F23A 1SQXH 4HNAA 2GSMB 5B1NA 4DW1A 3N2GA 3E83A 1JR9A 4LBEC 4FLYA 5IYBO 2JRIA 2N74A 5BZBA 4QIWF 2UXNA 4PHZA 4JZGA 1PPJH 1N33O 4HAMA 3OR6C 4RO2A 3JARA 2PI5A 4LF4O 4LC1A 2Q8VA 4DV2O 5LL6Y 3U11A 4GKKO 3W7SA 1US6A 5DN6G 1GM7A 5EZYB 5J9PC 2QWRB 3AK1A 2OT5A 3U10A 3DC5A 1JJOA 1QHTA 1VQOV 1QR9A 4RQFA 4LFBO 4LP8A 1IBLB 2WPDG 4YJ2A 3ASNC 3QF7A 2UXDO 2CH7A 3WU2Z 4L8JA 4DR1B 4F6EA 3ASOC 4XDLA 3ASOB 3DTUB 3ETEA 5CA3A 2R70A 3ZMUA 1JVMA 3ETDA 1I0HA 2CTQA 5LP6A 3WB2A 1SA0A 1BS3A 4CC6A 1EN5A 3H1KH 1N33B 1XMQB 4QE7A 2FKXA 5KX5B 4JYBA 4ZOLA 1BZKA 4D7TA 3OTOO 1CXZB 1YHQV 4LF4B 1OV9A 1NR7A 4DV2B 4QE9A 4FM0A 4UCTA 1RM1B 3E8HA 3OUSA 3JAWB 2OYQA 4GKKB 4LF9O 4LWSA 4O4HB 4LFAO 2E75B 5GTHZ 4JI6O 4DXWA 2VRZA 2X6CA 3D36A 5CBFA 4LFBB 2AHYA 5LYJB 2UXDB 1N0JA 4G28B 3ZJZA 4X62O 3SPJA 1QCEA 1SESA 3CRRA 1XREA 5KA6A 3K5NA 3CMAV 1UJWB 2Y4UA 3ZBHA 1SS3A 3BAAA 1HNWB 3QVNA 4UVCA 4K0KO 3ZX6A 4PA9A 2Q7EA 1KQSU 3OTOB 1Q6IA 1G4YB 4WFFA 1PD3A 1SQQH 4LF9B 1SZXA 2P7TC 1TVKB 4W4KA 3L9DA 3CCJV 3IFXA 2B9ZA 2YS8A 5LOVA 4FLWA 1K4DC 2F43G 3BPZA 5L3BA 5CA0B 2PTMA 4X62B 3HKBB 4NKGB 5CA1B 3KZIZ 2Q4PA 4I9WA 1HNZO 5A9GA 1S5JA 5KHIA 1GTOA 1P49A 4JYCA 2X6BA 3RYFB 1K73W 1MSDA 4DYLA 4NVPA 4K0KB 3N2KB 1VQ5V 1M56B 3AG4C 4JI8O 4R6ZA 4I50A 2VQEO 4F6RB 3QO5A 3Q4HB 3SJCC 4JYYA 4MTGA 3QO8A 2UUAO 2RNBA 3RGBA 5L3CA 4TUYB 4FLZA 4TV9A 1TUBB 3UT5B 1S5LZ 4Z1MG 2FMLA 3X2QC 3CPWU 1WB7A 1S0VA 2OCCC 4J7JA 1XHXA 3ZCCA 4NR1A 2AZ2A 4CBCA 2GTSA 2K1EA 1V54B 3ABMB 4P30A 3ZIAG 2Q67A 4LH7A 4GX2A 1HNZB 1S3JA 1PL0A 2JS5A 3GWOA 2RCVA 3SJAC 2QWPB 1O9GA 1OCOC 1IDSA 3JD1A 2BTQB 1E1RG 4LR3A 3EFFK 2JIZG 4ZHQA 4NYKA 1VF7A 1QU7A 4TQDA 1YIJV 4FFBB 2VQEB 3KCYA 1J5EO 5LBQA 1W2BU 3A0BZ 2UUAB 3L72H 2IH3C 1JJ2U 2Q0AA 3G80A 4WFGA 1YVWA 3VBBA 1AJPA 1LUVA 4PJ0Z 1RFYA 1H2SB 4UCSA 1GN4A 2YICA 2EIKB 5CBHA 4RWUA 2HR3A 2EULA 1YDXA 4JZ2A 1XNRO 3K5MA 4MVMA 1VF6A 4PA6A 1K4CC 3T4ZA 1DF4A 3ABKC 2O57A 1J5EB 3ABKB 5CN0A 1FAFA 2IW5A 1N4CA 1AI4A 1U97A 2E3CA 4EKWA 1WPXA 3RVZA 1YXBA 2F4VO 4FIPC 2WLNA 2Y0PA 2Q73A 4PDLA 1V9PA 1YTFB 2CTPA 3SPGA 1FXVA 4X20B 5JWPA 3IC7A 4UCOA 4JTDB 2GUZA 2UUCO 3H01A 2CE4A 1V55B 1QLEC 3K57A 3CRCA 1QLEB 5KHHA 3STZC 1XNRB 1HP8A 4DR6B 2ZT9B 2WSSG 2HKOA 3F7YC 3P30A 2QTOA 1R6TA 5CMUA 3AG3C 3ZRWA 1VQ9V 3AG3B 4I4TB 4DV5B 2WLIA 3IAYA 2GHYA 3J80N 3K08A 1BQZA 1H2LA 2UXBO 3ETQA 2KG7B 5B1BC 3SJBC 2F4VB 1NKDA 2P22C 1UFIA 2P06A 2WAMA 1R1BA 1NQTA 4X1IB 4YHHO 3L75H 4ZI7B 5LXTB 2VQFB 4FM2A 2F93B 5KMGB 2AGAA 2UUCB 3HKEA 1VQLV 2CH7B 1AP5A 3FB6C 1WP8A 2CAZC 2RJZA 1K33A 5IYZB 4DV3B 3DC6A 1SRYA 5KUKA 3ZS8C 4O4IA 4JASA 3ZHVA 3AG7A 1GK9A 2ADPA 3G71V 2DYSB 1VF5B 4HYOA 5E1AC 3B2EE 2WLLB 3K0DA 2EIMC 5IT9N 2UXBB 4FLUA 2Z3YA 1M93A 4ZOLB 2YSUB 4B3TO 1XUQA 1BL8A 2YIAA 5K1PA 4K8XA 1SQGA 3D3IA 5B1OA 3BVOA 4IT5A 3S3XA 3JSLA 2Y0IA 2CUGA 3E8GA 4YHHB 1QNMA 5C8YB 5BMVA 4WFEA 4JI3O 2HFEC 3F5TA 5JH7B 4I0XA 1Y4MA 2YEVA 5JJEB 3CE2A 2UXCO 3ZRVA 3ZRSA 4OPHA 4D7SA 3J81N 2PYLA 2UUBO 1RPRA 4J41A 1PM9A 2DWDC 4FFKA 3VQVA 4J10A 4RUFA 2DW4A 4JTCB 1P7GA 4EB6A 1NH2B 2RMKB 4ZKIA 1M57C 4UV9A 1M57B 3SYAA 4DO2A 1IBMO 3LNNA 3K58A 2JK5C 2YI8A 1NR1A 1E1QG 4LNUB 4B3TB 2DWEC 3ZHRA 4YJ3A 5TISZ 2Q69A 1KKCA 4GCZA 1AI5A 5FNVB 2Q6AA 3B4SA 4MW3A 5J2UA 3HKDA 2XHBA 4PV1B 1GO3F 2L35A 4CS2A 4X1KA 3UCSC 2UXCB 5B3SB 5H6QA 2UUBB 1NZ6A 1BGYH 3I55V 2ZR2A 2Y4TA 1YITV 4GX5A 4E2LA 4NXNO 1I08A 4JAVA 2BSKB 4MTXA 4PA4A 2KSDA 2JGDB 1IBMB 2C2AA 1PV0A 4O2BB 2QDOA 1ZL8A 2QKCA 2A9HA 3LUTB 4I55A 4DK1A 5BXZA 1AR4A 4TWKA 2QKAA 3PJSK 4AHCA 4UCRA 4YXWG 3ABLC 2QM8A 2R9AA 2EX3A 1KC8W 3SR2C 4WFHA 3H9VA 4P2ZA 3JATB 3HKCA 1NTZH 1NBMG 3CRQA 2WA3A 3TXSA 3G6BA 1GM8A 2JJ2G 1EZVH 4LCUC 5FL7G 2HHHO 4NXNB 3T4DA 1IZ3A 1GN6A 2LGWA 5J2TA 4U7OA 4XBFA 1MNGA 4P9OA 2XAJA 1FXKA 3K5LA 2QWQB 5A2QN 2Y48A 2E76B 3T1CA 1SZTA 3C90A 1H38A 1VMGA 4BW5A 1YI2V 5JVDB 1AB3A 1FFTB 2HVJC 4W4LA 1WA8A 2YIDA 4H13B 4QPKA 3OTFA 1FFXB 1OZ0A 2ZQMA 4KP4A 3K5OA 3A8TA 5ITZA 3RFRA 1JMKC 4IHJA 2L6LA 1GH6A 4MS2A 5K1XA 4CS3A 1RSOA 1CP9A 3H1JH 3HR0A 4K35A 4RUEA 4GT1A 2HHHB 4MVSA 3W7TA 1F7YA 1PNLA 2EBOA 3LSUA 3F7VC 3WG7B 3APOA 5LHHA 4KHPO 2BE3A 1S76D 1S77D 1R3JC 2JEUA 4H0LB 1KP2A 3NXSA 4EFEA 3AG2B 2IH1C 4X1YB 1Q90D 4NXMO 4DRXA 2HJFC 1RP3B 4DW0A 4YY3O 4FVMA 1BQ0A 1MABG 1K7DA 3J7AU 3AK2A 2FTKA 1VEWA 1R73A 3RYIA 5JQGA 5IY5B 4BIUA 1TAEA 5FPOA 3UM7A 2ILMA 3EXAA 4PDMA 1RM1C 1I5YA 3ZMZA 2XOKG 3SPIA 4JI2O 1BHAA 4TV8A 1YJ9V 2LO1A 3TGUH 4KHPB 2A0LA 2OIGA 1YSCA 1P4RA 1QVFU 3HPLC 4J11A 2KKWA 3PN1A 1XHZA 2QJ1A 3TK1A 4E4EA 2ZCEA 2H94A 2PYJA 4CH3A 4NTYA 4PD4F 4K8ZA 4NXMB 4JI7O 3CMEV 1F4NA 4YY3B 2B5UA 4B3RO 5BR8O 2ITDC 1L0NH 4B08A 1SF9A 2FYUH 3RYHA 2OWOA 3SYCA 1KUQA 4JI2B 4LFAB 3FYEB 4JI6B 1TUEB 3LDCA 4JI5O 4X89A 1PKXA 2ZDIC 3RYCA 3RBZA 3UO2A 4O4LB 3CCRV 3OEEG 3OGCC 1F4MA 2XAHA 3JAKA 3CB2A 5IJ0A 4R50A 4DV1O 4JI7B 5CB4B 4LF6O 4O2AB 1NS1A 4R7CA 3S3WA 1WLEA 3LSQA 4B3RB 1M56C 4U3JB 5BR8B 3AG1B 2WLKA 5IYCO 1K3EA 2X0LA 3JALB 1ZAUA 1SQVH 2KB1A 2EILB 3T1YO 2XAGA 1IXMA 1OCZC 1OCZB 3B40A 1THZA 2HG5C 3KG2A 2YIBA 1JCHA 4NTWA 1Q7YW 3K06A 1FXHA 1PNMA 4JI5B 4XDJA 1YJNV 2PUSA 3OMNB 2UU9O 3IJ4A 2WWWA 1SQPH 2ZNJA 2Q5ZA 1AILA 3QTCA 1V54C 3ABMC 3B77A 1AI6A 4B7EA 2MW2B 3CRAA 2VS0A 1GN2A 1JFFA 2EJRA 4MVQA 4DV1B 1E79G 2W0FC 3JASA 4LF6B 3CCVV 2OTLV 1H8HG 3KKYA 3JD3A 3E22B 4DUZO 2HLDG 4GYCB 3ETGA 1N0NA 4JI8B 3DXRB 1VQKV 4JI4O 1H2MA 1Y74B 3CC7V 2IJHA 3B09A 3CRMA 4KXRA 1YTFD 2ETNA 4BAYA 3T1YB 2ARHA 2Z5UA 4WBNB 2XT9A 5EYPA 1GAXA 2IJIA 3EVKA 2UU9B 2H8PC 3CJHA 2JS3A 2EIKC 1LUWA 1WP7A 3WB0A 5KLVH 1WB8A 1Y76B 4X9QA 2PI4A 1Y66A 2WLHA 1VQ8V 1GN3A 4DUZB 3FAVB 4TOIA 5H6RA 1ENVA 1VQPV 2IJJA 3STLC 5IJ9B 4KL1A 4JI4B 3BFRA 3W7WA 1AI7A 1VP7A 5B66Z 3JD2A 1VQ4V 5GONB 1NVPB 3ZHTA 5EZYA 4JAAA 1R6KA 1KD1W 1Q82W 1SQBH 2ZXWC 1KMIZ 2ZXWB 3LDEA 4O4JB 2ODMA 1W0JG 2B1IA 1AR1B 4I5SA 1V55C 3AK3A 5KHGA 2LJ2A 5L3DA 3W7XA 1L8DA 2IM9A 4HNAB 4CS4A 3N2GB 1Y6XA 4GUNA 3MHHC 3CCMV 5IDJA 4UB8Z 4UFZA 4X88A 1VARA 4MTOA 3MAQA 4UUJC 1M5IA 3CP1A 3JSNA 4CH5A 1WPBA 3JAWA 3K79A 3JARB 3E89A 4R8CA 1B6QA 4O4HA 1G6UA 3THOA 1HWYA 2A79B 4MT8A 2D3OW 2M6YA 1H2NA 4H44B 3RN4A 5LMUO 2FB5A 5LYJA 4CC5A 3A0HZ 1NH2D 3C3SA 1K8AW 2CGNA 4YJ2B 4X8AA 1H8EG 1Q6UA 1SETA 3O65A 2AZ0A 2P90A 5H9CA 1EBOA 3SYPA 1Q86W 5EIBC 1FYJA 4MVZA 3CCUV 5KHKA 1U96A 1ZX3A 1KB9F 3ZMSA 2DYSC 2W6JG 4Z2WA 5LP6B 1MMMA 2P4KA 1SA0B 1XMOO 4F4LA 5EBLC 3FB5C 3OR7C 1P84F 4WFAV 3ML0A 1TVKA 2ATKC 5FPRA 2BTOA 2RDCA 3CX5F 3APQA 4LWSB 5L3EA 1Q43A 2EIJC 3CC2V 2RQ6A 2EIJB 5CA0A 5LMUB 1EZJA 2ZDIA 3FYIB 2Q0OC 4DV7O 3F5WC 3D36C 4IIJA 4ICGA 3HKBA 5EBWC 2YIBD 5CA1A 3RVYA 4DV0O 1XOUA 2Q9LA 3M7MX 1YZBA 4D6TH 2IJKA 3ICXA 2CTRA 2W0XA 1BHBA 3O9OA 3SPCA 3K59A 1D5AA 1BCCH 2ZIMA 3RYFA 2B1GA 3N2KA 4CH6A 1VIBA 1O9HA 5L3FA 2XTAA 1MSWD 4L87A 1B06A 3P3PA 4F6RA 2HJDA 3Q4HA 3ABTA 3JCUZ 4AILC 5KAIZ 4ASUG 3CCQV 1FJGO 3DSQA 5KHJA 1QBZA 4H33A 3RYHB 3OMAB 1N32O 2EJ7A 4TUYA 1TUBA 3UT5A 4WFBV 4JI3B 5LOVB 2A3QA 4J7KA 4J9ZB 4DV7B 2BOCC 4BWAA 4AI8A 4JV5O 5B3SC 2ITCC 4JI0O 4DV0B 1Q6HA 1X4TA 3G6EV 4MW8A 4J9YB 3CYOA 5LHGA 3K9SA 3CWBH 4OX9O 2JEXA 1BMFG 3K04A 2BTQA 1XILA 2DYRB 1N8RW 3R66A 4DR5O 4JGSA 3QG5A 2PGGA 4FFBA 1K92A 1DF5A 4A5UB 1YJWV 1XEQA 3T1HO 4I50B 2PZSA 1FJGB 2ZE5A 1Z5WA 3ZHUA 4MTFA 1AP6A 1W0KG 2Z0AA 2P4VA 1N36O 1NU1H 4DR2O 1AJNA 4J7ZA 4UB6Z 4TV9B 2PY5A 1FPOA 4IL6Z 4JV5B 3RT3C 3JD4A 4JI0B 4GX0A 4PELA 2XUMA 4CZZA 1KYOF 3P3NA 4OX9B 1D5NA 3E2EA 5H5NA 5DEDA 3E8FA 5LMNO 5AG2A 1K34A 4DR5B 3E35A 4ZHQB 1I5XA 2JVDA 5LHIA 1X59A 5E79Z 3LNMB 1KKDA 5HFLA 4NB5A 1RPOA 1KP3A 2RN9A 3OUFA 3T1HB 3SYOA 4IYHA 1MZFA 3OAAG 4OPAA 5B5EZ 4I7ZB 4J42A 1N36B 3RW0A 4DR2B 4N21A 5LA6A 3IC9A 4KUMA 2JJ1G 2NR5A 3SGIA 4X20A 1VQ6V 4LF5O 5H2FZ 1XQ8A 2E74B 3VQXA 4MVOA 1N34O 4ZBMA 1OCCB 2X6AA 4RQEA 1BE3H 4FMTA 3BHPA 1K5SA 2AW9A 2HVKC 5LMNB 3FB8C 4FZ0A 2DQ0A 3H1HH 1VF6C 1Q81W 4U7NA 5L3GA 2E5LO 3WG7C 4I4TA 5IE9A 4X64O 3K9AA 3K0GA 2UXXA 2DJVA 4RAIA 5HFMA 1VQMV 2KG7A 1XMQO 4IYIA 1KECA 5EC1C 1HR0O 3AG2C 4X1IA 4LF8O 3ZMTA 2VWKA 1AROP 1COWG 4ZI7A 2AHZA 5LXTA 4DK0A 4G2KA 1KU9A 4LF5B 1VQNV 1ZUQA 5KMGA 3GB7C 1EM1A 1XDCA 1DTOA 4U3FH 1LNQA 1N34B 5LGTA 5IY5C 3ASNB 4PDVA 2GUZB 3BEHA 2XNDG 1K9MW 1D2DA 1ZSPA 1WN7A 3JD0A 4B7KA 5IYZA 4DUYO 3TJTA 4DV6O 3N27A 2QEXV 5D5QA 1EFRG 3QNEA 2HP8A 2E5LB 1L0LH 3CEIA 1HNWO 3P32A 4X64B 1EN6A 1M4UA 3ZRWB 1H2KA 1CPYA 3CHXA 5GTIZ 1DK1A 2WLLA 1Q3EA 4KFMA 3UKMA 2WLIB 3OT7A 2Q7HA 3NR7A 4FLVA 4BIZA 2GTAA 1HR0B 3H1LH 3E86A 4LF8B 5C8YA 4P9PA 4UCUA 2G38A 2YXHA 5JH7A 2W6IG 3CXCU 2ADQB 5B1AC 3CS5A 3CC4V 5B1AB 2QWNB 4B3SO 2WA4A 4X66O 4FM1A 1KBHA 3HKEB 3MD0A 4DV6B 2YXYA 4DUYB 1Q5OA 3MDSA 2VWJA 1MOFA 1HDJA 4OGQB 1JA8A 1GRJA 1SKVA 4O4IB 1BSMA 4YIOA 1HNXO 3LDDA 2ZD9A 1IBKO 1PL4A 4LNUA 4UV8A 2CDYA 2EZPA 1XL4A 4I9QA 4FZ1A 1TA8A 3VQWA 5EK0A 3ZHQA 1M1KW 3OE7G 5FNVA 4JI1O 3T2MA 1I7FA 2V7QG 4FK5C 2ZKOA 4UVBA 3TETA 2WLJA 5BMVB 2D2CB 3ZHSA 3AG1C 2NN4A 4I0XB 5JCOC 5GW7A 3BRCA 2JDIG 4IIJB 2YEVB 2CK3G 4B3SB 2DE0X 5IYDO 4X66B 2DOSA 1R3KC 2EILC 2NLJC 3I5DA 3A0RA 3OD4A 1GMGA 3OW2U 1S72V 1J95A 4WCEV 3BABA 2EINC 2BSKA 4EB6B 1GM9A 2IU0A 2EINB 2JGDA 1HNXB 2ZE6A 3WB1A 1IBKB 3E8BA 1URFA 4O2BA 4DR7O 3M99B 3AG4B 3QO7A 3FKSG 1NJIW 1B3QA 2F1MA 5JJJB 4LFCO 2GBOA 4JI1B 4N23A 3L70H 4YJ3B 1OCRC 5DM6V 1OCRB 3W7UA 1LR1A 3JAMN 5J2UB 1AVMA 2MK3A 3HKDB 4OXSA 3X2QB 1NVPD 2CTWA 1NTKH 1XNQO 2OCCB 3HB3B 3JATA 4X1KB 2A06H 4UCVA 4MVUA 3CSXA 2F66C 3SDLA 2AXTZ 5C93A 4MVRA 4EFBA 3U0ZA 2DN9A 2F95B 1OCOB 3UQ8A 4QJFB 2EZOA 3FFQA 4ZIBA 4J80A 1SC5B 2XASA 4DR7B 1DLBA 3TCUA 2X7RB 5KA5A 4LFCB 2V4DA 3B8NA 1XL6A 5EBMC 1ZL8B 5JVDA 2LW7A 4I55B 1SERA 2P67A 3VOUA 1ZLZA 1F51A 1FFXA 4UXNA 2N04A 4HBNA 1XNQB 3WFVA 1T5EA 2CGOA 4YIPA 1QLNA 3D8CA 1L1FA 1ORQC 3ABUA 1BT8A 3HKCB 2F23A 1QQCA 4DR6O 4GKJO 1MA1A 1VQ7V 1QR8A 5J2TB 4FJCC 1TGOA 1FXKC 5KAFZ 3GWKC 2PF4E 1FXKB 1ZWIC 2QSAA 3L74H 3JCZA 3FX7A 4DV5O 1K97A 1SQFA 5EIBD 2OIEA 1YF2A 3K3WA 1JQ0A 3H1IH 2QGNA 4WF9V 3BY6A 1IVSA 1FS0G 1NI8A 4TT3G 4X1YA 3FB7C 1WA8B 2YUAA 5LA6B 2Q7GA 4GZRB 5IWAO 3OGIB 4DV4O 2XAFA 2VQFO 1R6NA 5ITZB 1FD9A 4Z1VA 4IHJB 2OCHA 2XAQA 1YEWA 5KX5A 2R9RB 4AQYO 3CXHF 4K3AA 4GKJB 1RSOB 2ZR3A 4CH4A 2LFRA 4DV3O 2KQXA 4NTXA 4LH6A 1MG1A 3TXQA 4PA3A 1R3IC 5CBGA 3IGAC 2K9PA 1Y67A 3VQYA 1Z5VA 2QWOB 5B1BB 4UVAA 5KUMA 1NTMH 1R3LC 2A7WA 5IWAB 4QNHB 4C7UA 4DV4B 4LF7O 2QKSA 3AEIA 1WNSA 4G27B 4DRXB 3SJQC 2GV9A 1JOYA 5LP6C 3ZN1A 4FLTA 3BA8A 2YC0A 4AQYB 5EC2C 1QVGU 2ZNIA 1ROPA 3RYIB 5JQGB 2ZE8A 4HZ3A 4QPJA 2QA4V 5FLXN 1XI1A 1IURA 4XDKA 5D5PA 2LW1A 4PDRA 1M90W 2YDEA 2OTJV 4TV8B 1AR5A 1H2GA 2DMXA 2EIMB 2LFSA 2YXLA 3K03A 4O4LA 3GVMA 3BCCH 2Q68A 2N05A 2ZIOA 1YCIA 5CB4A 4O2AA 2QM7A 3EHBB 3CCSV 3I56V 2QE7G 4LF7B 2ZE7A 3BA9A 5BY1A 4QGPA 3R65A 3ZEDA 3L73H 4U3JA 1W59A 5JCOA 4X65O 3JALA 3B8MA 1JPXA 3LSSA 1XMOB 3OEHG 1DGSA 4DR3O 2NNUA 1JX9A 2FL4A 2QTSA 3JYCA 3SPHA 4BR6A 4JYAO 1I94O 1CEZA 4PA7A 1M9NA 4H37A 2ZM6O 3OM3B 3D3QA 4JPRA 3CD6V 2V1DA 4JF3A 5DECA 1Z2GA 3A2FA 4PI2A 3RYCB 2P5OA 3DGEA 1IXBA 3RWRD 2YI9A 5F2VO 1B04A 2BOBC 4PI0A 3JAKB 5IJ0B 2DYRC 4GX1A 4TSFG 3E22A 4X65B 3UO3A 1G1XB 2WLMA 3DXRA 1UPGA 3CCEV 4DR4O 1Y74A 3OFNG 2H3OA 4DR3B 4JTAB 4JAUA 1GKFA 1OJHA 4WBNA 4JYAB 1N32B 5JJNB 3L71H 1I94B 3FD9A 2R9IA 1FKAO 4MSWC 2ZM6B 2LGQA 1WJZA 2Y69C 1OHHG 4Q6GA 2Y69B 5LGUA 2HEPA 4Q20A 3CCLV 4B3MO 2P6JA 3KCXA 1Q8IA 4IGGA 2QM4A 2ZINA 3ZMVA 1IX9A 2BCCH 2QR4A 1P7BA 1Y76A 1NT2B 4TQFA 1JFFB 2JGUA 1K5QA 1MZEA 3JASB 1G8MA 4FPPA 3ABLB 3FAVA 3ZRXA 5LGNA 4ABMA 4GLXA 4BIOA 2LP7A 5IJ9A 2GDSA 1S5HC 3C3TA 3OMIB 4DR4B 1XBLA 1EN4A 1ZTEA 1PP9H 4EEQA 2LQTA 2DQ3A 5GONA 3M8AA 1HW7A 4FLXA 1WAZA 1AJQA 3SYQA 2IU3A 3MHSC 5EYPB 1A32A 4O4JA 1PNKA 4BW9A 3G67A 2M7WA 4B3MB 3CJHB 1IBLO 2IBZH 1OCCC 2R72A 3ZN0A 4DR1O
chains in the Genus database with same CATH topology
3OE7G 1VQ4V 3G4SV 1NVPB 4RUFA 2DW4A 1F23A 3T2MA 4JTCB 2GSMB 2V7QG 4FK5C 5B1NA 1KD1W 1R6KA 1Q82W 4UVBA 3TETA 2WLJA 1NH2B 3E83A 4ZKIA 2ZXWC 4LBEC 1M57C 2ZXWB 4UV9A 5IYBO 1M57B 3AG1C 3LDEA 3SYAA 4DO2A 5GW7A 1W0JG 2JK5C 2B1IA 2JDIG 5BZBA 2YEVB 1AR1B 2CK3G 4QIWF 2UXNA 1NR1A 1E1QG 5IYDO 4I5SA 1V55C 4HAMA 2DWEC 3OR6C 1R3KC 2EILC 2NLJC 4RO2A 5L3DA 2PI5A 3A0RA 2Q69A 3W7XA 4GCZA 4LC1A 1GMGA 1AI5A 3OW2U 2Q6AA 1S72V 1J95A 4MW3A 3W7SA 4WCEV 5DN6G 1GM7A 5J9PC 2EINC 2OT5A 1GM9A 2IU0A 2EINB 3MHHC 1GO3F 3CCMV 1VQOV 5IDJA 1QR9A 4RQFA 3E8BA 3M99B 4LP8A 4X88A 5B3SB 3AG4B 3QO7A 2WPDG 4MTOA 5H6QA 3ASNC 3FKSG 1NJIW 4UUJC 3CP1A 3ASOC 3I55V 4N23A 3K79A 4XDLA 2ZR2A 3ASOB 3E89A 4R8CA 3DTUB 1OCRC 1B6QA 5DM6V 1OCRB 1YITV 4GX5A 4E2LA 1HWYA 3ETEA 2A79B 3W7UA 4MT8A 5CA3A 2D3OW 3ZMUA 2MK3A 1JVMA 4OXSA 3ETDA 4JAVA 3X2QB 4MTXA 1NVPD 4PA4A 2OCCB 3HB3B 2C2AA 1NH2D 4MVUA 4QE7A 1K8AW 2A9HA 3LUTB 4JYBA 4X8AA 1YHQV 1H8EG 1NR7A 1SETA 4QE9A 4TWKA 5C93A 1RM1B 3E8HA 3OUSA 3PJSK 4MVRA 2P90A 5H9CA 1EBOA 3SYPA 1Q86W 1OCOB 4YXWG 4MVZA 3CCUV 3ABLC 4QJFB 2QM8A 2EZOA 4DXWA 1KC8W 2XASA 3ZMSA 4WFHA 2DYSC 2W6JG 2X6CA 1DLBA 3D36A 5CBFA 3TCUA 4P2ZA 2AHYA 2X7RB 4F4LA 5KA5A 1NBMG 3B8NA 1XL6A 4G28B 5EBMC 5EBLC 3ZJZA 3FB5C 3SPJA 3OR7C 1QCEA 1SESA 4WFAV 3ML0A 1SERA 1GM8A 2ATKC 2P67A 2JJ2G 3VOUA 4LCUC 5FL7G 5KA6A 1F51A 3T4DA 1UJWB 3CMAV 4U7OA 4XBFA 4UXNA 4P9OA 5L3EA 2XAJA 2EIJC 3CC2V 1FXKA 2EIJB 4UVCA 3WFVA 2Y48A 1EZJA 2ZDIA 3FYIB 4PA9A 1QLNA 3F5WC 3T1CA 1L1FA 1KQSU 1ORQC 1SZTA 5EBWC 3ABUA 3RVYA 1H38A 1G4YB 4BW5A 4WFFA 1YI2V 1PD3A 2IJKA 1BHBA 2P7TC 3SPCA 1FFTB 1VQ7V 2HVJC 3CCJV 3IFXA 1QR8A 4QPKA 2B1GA 1OZ0A 2ZQMA 4FJCC 1FXKC 4KP4A 1K4DC 1FXKB 2F43G 5L3FA 1ZWIC 5L3BA 3JCZA 1K97A 1MSWD 4MS2A 4L87A 3K3WA 3ABTA 1JQ0A 4ASUG 3CCQV 4WF9V 1CP9A 3BY6A 4I9WA 1FS0G 4RUEA 1QBZA 4H33A 4GT1A 3OMAB 4MVSA 3W7TA 4TT3G 1GTOA 4JYCA 2X6BA 3FB7C 1PNLA 4WFBV 2EBOA 1K73W 3F7VC 3WG7B 1VQ5V 4J9ZB 2XAFA 1M56B 2BOCC 5LHHA 1R6NA 5B3SC 2XAQA 3AG4C 2ITCC 1S76D 2R9RB 4R6ZA 1S77D 3G6EV 4MW8A 3QO5A 3CYOA 4J9YB 5LHGA 1R3JC 2JEUA 1KP2A 3NXSA 3QO8A 4MTGA 2JEXA 5L3CA 3AG2B 2ZR3A 1BMFG 2LFRA 3K04A 2IH1C 2DYRB 1N8RW 1MG1A 4Z1MG 2HJFC 3X2QC 4JGSA 4PA3A 3CPWU 1S0VA 1R3IC 2OCCC 1MABG 1K7DA 5CBGA 1K92A 2FTKA 1DF5A 3IGAC 1R73A 3ZCCA 4CBCA 2K1EA 1YJWV 5IY5B 1V54B 3ABMB 4P30A 3ZIAG 4BIUA 2Q67A 4MTFA 5B1BB 4GX2A 4UVAA 3UM7A 1S3JA 1PL0A 5KUMA 3GWOA 4PDMA 1RM1C 1I5YA 3ZMZA 1R3LC 1W0KG 2XOKG 1OCOC 3SPIA 3JD1A 1AJNA 1E1RG 4QNHB 1BHAA 3EFFK 2JIZG 2QKSA 3AEIA 1YJ9V 4G27B 3SJQC 1JOYA 2A0LA 1QVFU 1YSCA 1P4RA 3ZN1A 3HPLC 3JD4A 1YIJV 5EC2C 4GX0A 4PELA 1QVGU 1ROPA 4CZZA 5LBQA 4HZ3A 4QPJA 1W2BU 2QA4V 2IH3C 1JJ2U 3E2EA 3TK1A 2H94A 4XDKA 3E8FA 1K34A 4PDRA 4WFGA 3VBBA 1M90W 3CMEV 1F4NA 3E35A 2OTJV 1AJPA 1I5XA 5LHIA 2B5UA 3LNMB 1H2GA 1KKDA 5HFLA 1RPOA 1KP3A 2ITDC 2EIMB 2EIKB 2LFSA 3OUFA 5CBHA 3SYOA 3K03A 3OAAG 2Q68A 2HR3A 3SYCA 3RW0A 4N21A 2QM7A 3EHBB 3CCSV 4MVMA 2QE7G 3I56V 3FYEB 3R65A 1TUEB 3LDCA 4PA6A 1K4CC 4KUMA 3T4ZA 2JJ1G 4X89A 1PKXA 1DF4A 1VQ6V 2ZDIC 3ABKC 1JPXA 3B8MA 3LSSA 3ABKB 5CN0A 2IW5A 3OEHG 1AI4A 4MVOA 3RBZA 4EKWA 2NNUA 1WPXA 4ZBMA 1OCCB 3RVZA 2X6AA 4RQEA 1JX9A 3JYCA 3SPHA 4FMTA 3CCRV 3OEEG 3OGCC 1F4MA 2XAHA 1K5SA 2HVKC 4R50A 1CEZA 3FB8C 4PA7A 2DQ0A 1M9NA 4FIPC 4H37A 2WLNA 3OM3B 1Q81W 4R7CA 4U7NA 4JPRA 5L3GA 1WLEA 4PDLA 3WG7C 3CD6V 2V1DA 3LSQA 1YTFB 1M56C 4JF3A 3AG1B 3K9AA 3SPGA 1FXVA 2WLKA 3K0GA 2UXXA 5IYCO 1K3EA 4RAIA 2X0LA 3IC7A 5HFMA 1VQMV 4JTDB 3DGEA 3H01A 1V55B 1QLEC 2KB1A 1KECA 2EILB 1QLEB 5EC1C 3STZC 2BOBC 2XAGA 3AG2C 1IXMA 1OCZC 2WSSG 1OCZB 2HKOA 3F7YC 3P30A 3ZMTA 1THZA 2HG5C 2QTOA 3KG2A 1JCHA 2DYRC 1Q7YW 1AROP 1FXHA 3K06A 1COWG 1PNMA 4GX1A 4TSFG 4XDJA 3AG3C 5CMUA 2AHZA 3ZRWA 1VQ9V 3AG3B 4G2KA 1VQNV 3GB7C 2WLMA 2WLIA 1YJNV 1DTOA 3OMNB 3CCEV 1LNQA 3OFNG 2WWWA 5LGTA 2GHYA 5IY5C 1V54C 3ABMC 3ASNB 3K08A 3B77A 4PDVA 1AI6A 4JTAB 5B1BC 3BEHA 1GKFA 2XNDG 4JAUA 1K9MW 2EJRA 4MVQA 3JD0A 1NKDA 2R9IA 1E79G 4MSWC 2QEXV 2W0FC 1EFRG 3QNEA 2WAMA 3CCVV 1NQTA 2OTLV 1H8HG 3P32A 3JD3A 2Y69C 1OHHG 2Y69B 3ZRWB 1CPYA 5LGUA 4Q20A 3CCLV 2WLLA 2HLDG 3ETGA 4KFMA 3UKMA 2WLIB 2P6JA 1VQKV 4BIZA 2IJHA 3CC7V 1VQLV 1YTFD 3ZMVA 1P7BA 3FB6C 4BAYA 2Z5UA 3E86A 1K33A 4P9PA 1SRYA 1K5QA 4FPPA 1G8MA 3ABLB 5KUKA 3ZRXA 5LGNA 4JASA 2LP7A 2W6IG 1GK9A 2IJIA 3CXCU 1S5HC 3G71V 3OMIB 2DYSB 4HYOA 5E1AC 2H8PC 5B1AC 3CC4V 2WLLB 3K0DA 5B1AB 2EIMC 2EIKC 2Z3YA 2YSUB 3MD0A 1BL8A 2DQ3A 3D3IA 5B1OA 1AJQA 2PI4A 1MOFA 3E8GA 1Y66A 3SYQA 2IU3A 2WLHA 3MHSC 1VQ8V 4WFEA 2HFEC 1PNKA 5H6RA 1ENVA 1VQPV 2YEVA 1Y4MA 2IJJA 2M7WA 3LDDA 3STLC 2ZD9A 4UV8A 2EZPA 3W7WA 1XL4A 3ZRVA 3ZRSA 1AI7A 1OCCC 1RPRA 5EK0A 3ZN0A 3JD2A 2DWDC 1M1KW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KUM A;  3STZ C;  2ATK C;  4PDM A;  2BOB C;  4LCU C;  3VOU A;  3AG2 C;  4RUF A;  1OCZ C;  1R3L C;  3T2M A;  4JTC B;  1OCO C;  3T4D A;  3SPI A;  3F7Y C;  2HG5 C;  2QTO A;  3KG2 A;  2DYR C;  4P9O A;  3K06 A;  4GX1 A;  2EIJ C;  2WLJ A;  3EFF K;  4QNH B;  3TET A;  3E83 A;  2QKS A;  4XDJ A;  2ZXW C;  3AG3 C;  2AHZ A;  4LBE C;  1M57 C;  4G27 B;  3SJQ C;  3AG1 C;  3LDE A;  2A0L A;  3GB7 C;  4PA9 A;  3SYA A;  2WLM A;  2WLI A;  2JK5 C;  3F5W C;  3HPL C;  3T1C A;  5BZB A;  1LNQ A;  5EC2 C;  4GX0 A;  1ORQ C;  5EBW C;  5IY5 C;  1V54 C;  1V55 C;  3ABM C;  3K08 A;  3RVY A;  1G4Y B;  4PDV A;  4HZ3 A;  4JTA B;  4BW5 A;  4WFF A;  2DWE C;  3OR6 C;  1R3K C;  5B1B C;  2EIL C;  2NLJ C;  3BEH A;  4RO2 A;  2IH3 C;  2Q69 A;  4XDK A;  4MVQ A;  2P7T C;  3SPC A;  3E8F A;  4MSW C;  2HVJ C;  2Q6A A;  2W0F C;  3IFX A;  1J95 A;  4MW3 A;  4PDR A;  4WFG A;  5J9P C;  2EIN C;  2Y69 C;  1K4D C;  1ZWI C;  2WLL A;  3LNM B;  3E8B A;  1KKD A;  4KFM A;  3UKM A;  2WLI B;  4LP8 A;  4X88 A;  2ITD C;  4MS2 A;  3OUF A;  4MTO A;  5CBH A;  3ASN C;  3SYO A;  3K03 A;  4UUJ C;  2Q68 A;  1P7B A;  3FB6 C;  4I9W A;  3ASO C;  4RUE A;  4H33 A;  4XDL A;  3SYC A;  3E89 A;  4MVS A;  4R8C A;  1OCR C;  3E86 A;  3RW0 A;  2X6B A;  3FB7 C;  4GX5 A;  4P9P A;  2A79 B;  4MVM A;  5KUK A;  3F7V C;  3R65 A;  3LDC A;  4PA6 A;  4OXS A;  1JVM A;  1K4C C;  3T4Z A;  4X89 A;  4PA4 A;  4J9Z B;  1S5H C;  2BOC C;  4HYO A;  5E1A C;  2H8P C;  3ABK C;  5B1A C;  2WLL B;  5B3S C;  3AG4 C;  3K0D A;  2EIM C;  2EIK C;  2ITC C;  4MVU A;  2R9R B;  4QE7 A;  4R6Z A;  4MVO A;  2A9H A;  3LUT B;  3RBZ A;  4EKW A;  4MW8 A;  4J9Y B;  4ZBM A;  3RVZ A;  4X8A A;  2X6A A;  3SPH A;  3JYC A;  1R3J C;  1BL8 A;  3OGC C;  4MTG A;  4QE9 A;  4TWK A;  2HVK C;  3E8H A;  3OUS A;  3PJS K;  4MVR A;  4R50 A;  3SYP A;  3K04 A;  3FB8 C;  4PA7 A;  3E8G A;  3SYQ A;  2IH1 C;  2WLH A;  2WLN A;  4H37 A;  4MVZ A;  3ABL C;  4WFE A;  4R7C A;  4DXW A;  2HFE C;  2HJF C;  3X2Q C;  4PDL A;  3WG7 C;  4PA3 A;  1R3I C;  1M56 C;  2OCC C;  4WFH A;  2DYS C;  3SPG A;  5CBG A;  2WLK A;  2YEV A;  3K0G A;  2X6C A;  3LDD A;  3STL C;  5CBF A;  2ZD9 A;  3TCU A;  4RAI A;  4P2Z A;  3IGA C;  1XL4 A;  2AHY A;  3ZRS A;  4CBC A;  4F4L A;  2K1E A;  4JTD B;  1XL6 A;  4G28 B;  4P30 A;  1OCC C;  5EBM C;  5EBL C;  3ZJZ A;  2Q67 A;  3FB5 C;  3SPJ A;  1QLE C;  4MTF A;  2KB1 A;  3OR7 C;  5EK0 A;  4GX2 A;  2DWD C;  3UM7 A;  5EC1 C; 
#chains in the Genus database with same CATH topology
 3G4S V;  1F23 A;  1SQX H;  4HNA A;  2GSM B;  5B1N A;  4DW1 A;  3N2G A;  3E83 A;  1JR9 A;  4LBE C;  4FLY A;  5IYB O;  2JRI A;  2N74 A;  5BZB A;  4QIW F;  2UXN A;  4PHZ A;  4JZG A;  1PPJ H;  1N33 O;  4HAM A;  3OR6 C;  4RO2 A;  3JAR A;  2PI5 A;  4LF4 O;  4LC1 A;  2Q8V A;  4DV2 O;  5LL6 Y;  3U11 A;  4GKK O;  3W7S A;  1US6 A;  5DN6 G;  1GM7 A;  5EZY B;  5J9P C;  2QWR B;  3AK1 A;  2OT5 A;  3U10 A;  3DC5 A;  1JJO A;  1QHT A;  1VQO V;  1QR9 A;  4RQF A;  4LFB O;  4LP8 A;  1IBL B;  2WPD G;  4YJ2 A;  3ASN C;  3QF7 A;  2UXD O;  2CH7 A;  3WU2 Z;  4L8J A;  4DR1 B;  4F6E A;  3ASO C;  4XDL A;  3ASO B;  3DTU B;  3ETE A;  5CA3 A;  2R70 A;  3ZMU A;  1JVM A;  3ETD A;  1I0H A;  2CTQ A;  5LP6 A;  3WB2 A;  1SA0 A;  1BS3 A;  4CC6 A;  1EN5 A;  3H1K H;  1N33 B;  1XMQ B;  4QE7 A;  2FKX A;  5KX5 B;  4JYB A;  4ZOL A;  1BZK A;  4D7T A;  3OTO O;  1CXZ B;  1YHQ V;  4LF4 B;  1OV9 A;  1NR7 A;  4DV2 B;  4QE9 A;  4FM0 A;  4UCT A;  1RM1 B;  3E8H A;  3OUS A;  3JAW B;  2OYQ A;  4GKK B;  4LF9 O;  4LWS A;  4O4H B;  4LFA O;  2E75 B;  5GTH Z;  4JI6 O;  4DXW A;  2VRZ A;  2X6C A;  3D36 A;  5CBF A;  4LFB B;  2AHY A;  5LYJ B;  2UXD B;  1N0J A;  4G28 B;  3ZJZ A;  4X62 O;  3SPJ A;  1QCE A;  1SES A;  3CRR A;  1XRE A;  5KA6 A;  3K5N A;  3CMA V;  1UJW B;  2Y4U A;  3ZBH A;  1SS3 A;  3BAA A;  1HNW B;  3QVN A;  4UVC A;  4K0K O;  3ZX6 A;  4PA9 A;  2Q7E A;  1KQS U;  3OTO B;  1Q6I A;  1G4Y B;  4WFF A;  1PD3 A;  1SQQ H;  4LF9 B;  1SZX A;  2P7T C;  1TVK B;  4W4K A;  3L9D A;  3CCJ V;  3IFX A;  2B9Z A;  2YS8 A;  5LOV A;  4FLW A;  1K4D C;  2F43 G;  3BPZ A;  5L3B A;  5CA0 B;  2PTM A;  4X62 B;  3HKB B;  4NKG B;  5CA1 B;  3KZI Z;  2Q4P A;  4I9W A;  1HNZ O;  5A9G A;  1S5J A;  5KHI A;  1GTO A;  1P49 A;  4JYC A;  2X6B A;  3RYF B;  1K73 W;  1MSD A;  4DYL A;  4NVP A;  4K0K B;  3N2K B;  1VQ5 V;  1M56 B;  3AG4 C;  4JI8 O;  4R6Z A;  4I50 A;  2VQE O;  4F6R B;  3QO5 A;  3Q4H B;  3SJC C;  4JYY A;  4MTG A;  3QO8 A;  2UUA O;  2RNB A;  3RGB A;  5L3C A;  4TUY B;  4FLZ A;  4TV9 A;  1TUB B;  3UT5 B;  1S5L Z;  4Z1M G;  2FML A;  3X2Q C;  3CPW U;  1WB7 A;  1S0V A;  2OCC C;  4J7J A;  1XHX A;  3ZCC A;  4NR1 A;  2AZ2 A;  4CBC A;  2GTS A;  2K1E A;  1V54 B;  3ABM B;  4P30 A;  3ZIA G;  2Q67 A;  4LH7 A;  4GX2 A;  1HNZ B;  1S3J A;  1PL0 A;  2JS5 A;  3GWO A;  2RCV A;  3SJA C;  2QWP B;  1O9G A;  1OCO C;  1IDS A;  3JD1 A;  2BTQ B;  1E1R G;  4LR3 A;  3EFF K;  2JIZ G;  4ZHQ A;  4NYK A;  1VF7 A;  1QU7 A;  4TQD A;  1YIJ V;  4FFB B;  2VQE B;  3KCY A;  1J5E O;  5LBQ A;  1W2B U;  3A0B Z;  2UUA B;  3L72 H;  2IH3 C;  1JJ2 U;  2Q0A A;  3G80 A;  4WFG A;  1YVW A;  3VBB A;  1AJP A;  1LUV A;  4PJ0 Z;  1RFY A;  1H2S B;  4UCS A;  1GN4 A;  2YIC A;  2EIK B;  5CBH A;  4RWU A;  2HR3 A;  2EUL A;  1YDX A;  4JZ2 A;  1XNR O;  3K5M A;  4MVM A;  1VF6 A;  4PA6 A;  1K4C C;  3T4Z A;  1DF4 A;  3ABK C;  2O57 A;  1J5E B;  3ABK B;  5CN0 A;  1FAF A;  2IW5 A;  1N4C A;  1AI4 A;  1U97 A;  2E3C A;  4EKW A;  1WPX A;  3RVZ A;  1YXB A;  2F4V O;  4FIP C;  2WLN A;  2Y0P A;  2Q73 A;  4PDL A;  1V9P A;  1YTF B;  2CTP A;  3SPG A;  1FXV A;  4X20 B;  5JWP A;  3IC7 A;  4UCO A;  4JTD B;  2GUZ A;  2UUC O;  3H01 A;  2CE4 A;  1V55 B;  1QLE C;  3K57 A;  3CRC A;  1QLE B;  5KHH A;  3STZ C;  1XNR B;  1HP8 A;  4DR6 B;  2ZT9 B;  2WSS G;  2HKO A;  3F7Y C;  3P30 A;  2QTO A;  1R6T A;  5CMU A;  3AG3 C;  3ZRW A;  1VQ9 V;  3AG3 B;  4I4T B;  4DV5 B;  2WLI A;  3IAY A;  2GHY A;  3J80 N;  3K08 A;  1BQZ A;  1H2L A;  2UXB O;  3ETQ A;  2KG7 B;  5B1B C;  3SJB C;  2F4V B;  1NKD A;  2P22 C;  1UFI A;  2P06 A;  2WAM A;  1R1B A;  1NQT A;  4X1I B;  4YHH O;  3L75 H;  4ZI7 B;  5LXT B;  2VQF B;  4FM2 A;  2F93 B;  5KMG B;  2AGA A;  2UUC B;  3HKE A;  1VQL V;  2CH7 B;  1AP5 A;  3FB6 C;  1WP8 A;  2CAZ C;  2RJZ A;  1K33 A;  5IYZ B;  4DV3 B;  3DC6 A;  1SRY A;  5KUK A;  3ZS8 C;  4O4I A;  4JAS A;  3ZHV A;  3AG7 A;  1GK9 A;  2ADP A;  3G71 V;  2DYS B;  1VF5 B;  4HYO A;  5E1A C;  3B2E E;  2WLL B;  3K0D A;  2EIM C;  5IT9 N;  2UXB B;  4FLU A;  2Z3Y A;  1M93 A;  4ZOL B;  2YSU B;  4B3T O;  1XUQ A;  1BL8 A;  2YIA A;  5K1P A;  4K8X A;  1SQG A;  3D3I A;  5B1O A;  3BVO A;  4IT5 A;  3S3X A;  3JSL A;  2Y0I A;  2CUG A;  3E8G A;  4YHH B;  1QNM A;  5C8Y B;  5BMV A;  4WFE A;  4JI3 O;  2HFE C;  3F5T A;  5JH7 B;  4I0X A;  1Y4M A;  2YEV A;  5JJE B;  3CE2 A;  2UXC O;  3ZRV A;  3ZRS A;  4OPH A;  4D7S A;  3J81 N;  2PYL A;  2UUB O;  1RPR A;  4J41 A;  1PM9 A;  2DWD C;  4FFK A;  3VQV A;  4J10 A;  4RUF A;  2DW4 A;  4JTC B;  1P7G A;  4EB6 A;  1NH2 B;  2RMK B;  4ZKI A;  1M57 C;  4UV9 A;  1M57 B;  3SYA A;  4DO2 A;  1IBM O;  3LNN A;  3K58 A;  2JK5 C;  2YI8 A;  1NR1 A;  1E1Q G;  4LNU B;  4B3T B;  2DWE C;  3ZHR A;  4YJ3 A;  5TIS Z;  2Q69 A;  1KKC A;  4GCZ A;  1AI5 A;  5FNV B;  2Q6A A;  3B4S A;  4MW3 A;  5J2U A;  3HKD A;  2XHB A;  4PV1 B;  1GO3 F;  2L35 A;  4CS2 A;  4X1K A;  3UCS C;  2UXC B;  5B3S B;  5H6Q A;  2UUB B;  1NZ6 A;  1BGY H;  3I55 V;  2ZR2 A;  2Y4T A;  1YIT V;  4GX5 A;  4E2L A;  4NXN O;  1I08 A;  4JAV A;  2BSK B;  4MTX A;  4PA4 A;  2KSD A;  2JGD B;  1IBM B;  2C2A A;  1PV0 A;  4O2B B;  2QDO A;  1ZL8 A;  2QKC A;  2A9H A;  3LUT B;  4I55 A;  4DK1 A;  5BXZ A;  1AR4 A;  4TWK A;  2QKA A;  3PJS K;  4AHC A;  4UCR A;  4YXW G;  3ABL C;  2QM8 A;  2R9A A;  2EX3 A;  1KC8 W;  3SR2 C;  4WFH A;  3H9V A;  4P2Z A;  3JAT B;  3HKC A;  1NTZ H;  1NBM G;  3CRQ A;  2WA3 A;  3TXS A;  3G6B A;  1GM8 A;  2JJ2 G;  1EZV H;  4LCU C;  5FL7 G;  2HHH O;  4NXN B;  3T4D A;  1IZ3 A;  1GN6 A;  2LGW A;  5J2T A;  4U7O A;  4XBF A;  1MNG A;  4P9O A;  2XAJ A;  1FXK A;  3K5L A;  2QWQ B;  5A2Q N;  2Y48 A;  2E76 B;  3T1C A;  1SZT A;  3C90 A;  1H38 A;  1VMG A;  4BW5 A;  1YI2 V;  5JVD B;  1AB3 A;  1FFT B;  2HVJ C;  4W4L A;  1WA8 A;  2YID A;  4H13 B;  4QPK A;  3OTF A;  1FFX B;  1OZ0 A;  2ZQM A;  4KP4 A;  3K5O A;  3A8T A;  5ITZ A;  3RFR A;  1JMK C;  4IHJ A;  2L6L A;  1GH6 A;  4MS2 A;  5K1X A;  4CS3 A;  1RSO A;  1CP9 A;  3H1J H;  3HR0 A;  4K35 A;  4RUE A;  4GT1 A;  2HHH B;  4MVS A;  3W7T A;  1F7Y A;  1PNL A;  2EBO A;  3LSU A;  3F7V C;  3WG7 B;  3APO A;  5LHH A;  4KHP O;  2BE3 A;  1S76 D;  1S77 D;  1R3J C;  2JEU A;  4H0L B;  1KP2 A;  3NXS A;  4EFE A;  3AG2 B;  2IH1 C;  4X1Y B;  1Q90 D;  4NXM O;  4DRX A;  2HJF C;  1RP3 B;  4DW0 A;  4YY3 O;  4FVM A;  1BQ0 A;  1MAB G;  1K7D A;  3J7A U;  3AK2 A;  2FTK A;  1VEW A;  1R73 A;  3RYI A;  5JQG A;  5IY5 B;  4BIU A;  1TAE A;  5FPO A;  3UM7 A;  2ILM A;  3EXA A;  4PDM A;  1RM1 C;  1I5Y A;  3ZMZ A;  2XOK G;  3SPI A;  4JI2 O;  1BHA A;  4TV8 A;  1YJ9 V;  2LO1 A;  3TGU H;  4KHP B;  2A0L A;  2OIG A;  1YSC A;  1P4R A;  1QVF U;  3HPL C;  4J11 A;  2KKW A;  3PN1 A;  1XHZ A;  2QJ1 A;  3TK1 A;  4E4E A;  2ZCE A;  2H94 A;  2PYJ A;  4CH3 A;  4NTY A;  4PD4 F;  4K8Z A;  4NXM B;  4JI7 O;  3CME V;  1F4N A;  4YY3 B;  2B5U A;  4B3R O;  5BR8 O;  2ITD C;  1L0N H;  4B08 A;  1SF9 A;  2FYU H;  3RYH A;  2OWO A;  3SYC A;  1KUQ A;  4JI2 B;  4LFA B;  3FYE B;  4JI6 B;  1TUE B;  3LDC A;  4JI5 O;  4X89 A;  1PKX A;  2ZDI C;  3RYC A;  3RBZ A;  3UO2 A;  4O4L B;  3CCR V;  3OEE G;  3OGC C;  1F4M A;  2XAH A;  3JAK A;  3CB2 A;  5IJ0 A;  4R50 A;  4DV1 O;  4JI7 B;  5CB4 B;  4LF6 O;  4O2A B;  1NS1 A;  4R7C A;  3S3W A;  1WLE A;  3LSQ A;  4B3R B;  1M56 C;  4U3J B;  5BR8 B;  3AG1 B;  2WLK A;  5IYC O;  1K3E A;  2X0L A;  3JAL B;  1ZAU A;  1SQV H;  2KB1 A;  2EIL B;  3T1Y O;  2XAG A;  1IXM A;  1OCZ C;  1OCZ B;  3B40 A;  1THZ A;  2HG5 C;  3KG2 A;  2YIB A;  1JCH A;  4NTW A;  1Q7Y W;  3K06 A;  1FXH A;  1PNM A;  4JI5 B;  4XDJ A;  1YJN V;  2PUS A;  3OMN B;  2UU9 O;  3IJ4 A;  2WWW A;  1SQP H;  2ZNJ A;  2Q5Z A;  1AIL A;  3QTC A;  1V54 C;  3ABM C;  3B77 A;  1AI6 A;  4B7E A;  2MW2 B;  3CRA A;  2VS0 A;  1GN2 A;  1JFF A;  2EJR A;  4MVQ A;  4DV1 B;  1E79 G;  2W0F C;  3JAS A;  4LF6 B;  3CCV V;  2OTL V;  1H8H G;  3KKY A;  3JD3 A;  3E22 B;  4DUZ O;  2HLD G;  4GYC B;  3ETG A;  1N0N A;  4JI8 B;  3DXR B;  1VQK V;  4JI4 O;  1H2M A;  1Y74 B;  3CC7 V;  2IJH A;  3B09 A;  3CRM A;  4KXR A;  1YTF D;  2ETN A;  4BAY A;  3T1Y B;  2ARH A;  2Z5U A;  4WBN B;  2XT9 A;  5EYP A;  1GAX A;  2IJI A;  3EVK A;  2UU9 B;  2H8P C;  3CJH A;  2JS3 A;  2EIK C;  1LUW A;  1WP7 A;  3WB0 A;  5KLV H;  1WB8 A;  1Y76 B;  4X9Q A;  2PI4 A;  1Y66 A;  2WLH A;  1VQ8 V;  1GN3 A;  4DUZ B;  3FAV B;  4TOI A;  5H6R A;  1ENV A;  1VQP V;  2IJJ A;  3STL C;  5IJ9 B;  4KL1 A;  4JI4 B;  3BFR A;  3W7W A;  1AI7 A;  1VP7 A;  5B66 Z;  3JD2 A;  1VQ4 V;  5GON B;  1NVP B;  3ZHT A;  5EZY A;  4JAA A;  1R6K A;  1KD1 W;  1Q82 W;  1SQB H;  2ZXW C;  1KMI Z;  2ZXW B;  3LDE A;  4O4J B;  2ODM A;  1W0J G;  2B1I A;  1AR1 B;  4I5S A;  1V55 C;  3AK3 A;  5KHG A;  2LJ2 A;  5L3D A;  3W7X A;  1L8D A;  2IM9 A;  4HNA B;  4CS4 A;  3N2G B;  1Y6X A;  4GUN A;  3MHH C;  3CCM V;  5IDJ A;  4UB8 Z;  4UFZ A;  4X88 A;  1VAR A;  4MTO A;  3MAQ A;  4UUJ C;  1M5I A;  3CP1 A;  3JSN A;  4CH5 A;  1WPB A;  3JAW A;  3K79 A;  3JAR B;  3E89 A;  4R8C A;  1B6Q A;  4O4H A;  1G6U A;  3THO A;  1HWY A;  2A79 B;  4MT8 A;  2D3O W;  2M6Y A;  1H2N A;  4H44 B;  3RN4 A;  5LMU O;  2FB5 A;  5LYJ A;  4CC5 A;  3A0H Z;  1NH2 D;  3C3S A;  1K8A W;  2CGN A;  4YJ2 B;  4X8A A;  1H8E G;  1Q6U A;  1SET A;  3O65 A;  2AZ0 A;  2P90 A;  5H9C A;  1EBO A;  3SYP A;  1Q86 W;  5EIB C;  1FYJ A;  4MVZ A;  3CCU V;  5KHK A;  1U96 A;  1ZX3 A;  1KB9 F;  3ZMS A;  2DYS C;  2W6J G;  4Z2W A;  5LP6 B;  1MMM A;  2P4K A;  1SA0 B;  1XMO O;  4F4L A;  5EBL C;  3FB5 C;  3OR7 C;  1P84 F;  4WFA V;  3ML0 A;  1TVK A;  2ATK C;  5FPR A;  2BTO A;  2RDC A;  3CX5 F;  3APQ A;  4LWS B;  5L3E A;  1Q43 A;  2EIJ C;  3CC2 V;  2RQ6 A;  2EIJ B;  5CA0 A;  5LMU B;  1EZJ A;  2ZDI A;  3FYI B;  2Q0O C;  4DV7 O;  3F5W C;  3D36 C;  4IIJ A;  4ICG A;  3HKB A;  5EBW C;  2YIB D;  5CA1 A;  3RVY A;  4DV0 O;  1XOU A;  2Q9L A;  3M7M X;  1YZB A;  4D6T H;  2IJK A;  3ICX A;  2CTR A;  2W0X A;  1BHB A;  3O9O A;  3SPC A;  3K59 A;  1D5A A;  1BCC H;  2ZIM A;  3RYF A;  2B1G A;  3N2K A;  4CH6 A;  1VIB A;  1O9H A;  5L3F A;  2XTA A;  1MSW D;  4L87 A;  1B06 A;  3P3P A;  4F6R A;  2HJD A;  3Q4H A;  3ABT A;  3JCU Z;  4AIL C;  5KAI Z;  4ASU G;  3CCQ V;  1FJG O;  3DSQ A;  5KHJ A;  1QBZ A;  4H33 A;  3RYH B;  3OMA B;  1N32 O;  2EJ7 A;  4TUY A;  1TUB A;  3UT5 A;  4WFB V;  4JI3 B;  5LOV B;  2A3Q A;  4J7K A;  4J9Z B;  4DV7 B;  2BOC C;  4BWA A;  4AI8 A;  4JV5 O;  5B3S C;  2ITC C;  4JI0 O;  4DV0 B;  1Q6H A;  1X4T A;  3G6E V;  4MW8 A;  4J9Y B;  3CYO A;  5LHG A;  3K9S A;  3CWB H;  4OX9 O;  2JEX A;  1BMF G;  3K04 A;  2BTQ A;  1XIL A;  2DYR B;  1N8R W;  3R66 A;  4DR5 O;  4JGS A;  3QG5 A;  2PGG A;  4FFB A;  1K92 A;  1DF5 A;  4A5U B;  1YJW V;  1XEQ A;  3T1H O;  4I50 B;  2PZS A;  1FJG B;  2ZE5 A;  1Z5W A;  3ZHU A;  4MTF A;  1AP6 A;  1W0K G;  2Z0A A;  2P4V A;  1N36 O;  1NU1 H;  4DR2 O;  1AJN A;  4J7Z A;  4UB6 Z;  4TV9 B;  2PY5 A;  1FPO A;  4IL6 Z;  4JV5 B;  3RT3 C;  3JD4 A;  4JI0 B;  4GX0 A;  4PEL A;  2XUM A;  4CZZ A;  1KYO F;  3P3N A;  4OX9 B;  1D5N A;  3E2E A;  5H5N A;  5DED A;  3E8F A;  5LMN O;  5AG2 A;  1K34 A;  4DR5 B;  3E35 A;  4ZHQ B;  1I5X A;  2JVD A;  5LHI A;  1X59 A;  5E79 Z;  3LNM B;  1KKD A;  5HFL A;  4NB5 A;  1RPO A;  1KP3 A;  2RN9 A;  3OUF A;  3T1H B;  3SYO A;  4IYH A;  1MZF A;  3OAA G;  4OPA A;  5B5E Z;  4I7Z B;  4J42 A;  1N36 B;  3RW0 A;  4DR2 B;  4N21 A;  5LA6 A;  3IC9 A;  4KUM A;  2JJ1 G;  2NR5 A;  3SGI A;  4X20 A;  1VQ6 V;  4LF5 O;  5H2F Z;  1XQ8 A;  2E74 B;  3VQX A;  4MVO A;  1N34 O;  4ZBM A;  1OCC B;  2X6A A;  4RQE A;  1BE3 H;  4FMT A;  3BHP A;  1K5S A;  2AW9 A;  2HVK C;  5LMN B;  3FB8 C;  4FZ0 A;  2DQ0 A;  3H1H H;  1VF6 C;  1Q81 W;  4U7N A;  5L3G A;  2E5L O;  3WG7 C;  4I4T A;  5IE9 A;  4X64 O;  3K9A A;  3K0G A;  2UXX A;  2DJV A;  4RAI A;  5HFM A;  1VQM V;  2KG7 A;  1XMQ O;  4IYI A;  1KEC A;  5EC1 C;  1HR0 O;  3AG2 C;  4X1I A;  4LF8 O;  3ZMT A;  2VWK A;  1ARO P;  1COW G;  4ZI7 A;  2AHZ A;  5LXT A;  4DK0 A;  4G2K A;  1KU9 A;  4LF5 B;  1VQN V;  1ZUQ A;  5KMG A;  3GB7 C;  1EM1 A;  1XDC A;  1DTO A;  4U3F H;  1LNQ A;  1N34 B;  5LGT A;  5IY5 C;  3ASN B;  4PDV A;  2GUZ B;  3BEH A;  2XND G;  1K9M W;  1D2D A;  1ZSP A;  1WN7 A;  3JD0 A;  4B7K A;  5IYZ A;  4DUY O;  3TJT A;  4DV6 O;  3N27 A;  2QEX V;  5D5Q A;  1EFR G;  3QNE A;  2HP8 A;  2E5L B;  1L0L H;  3CEI A;  1HNW O;  3P32 A;  4X64 B;  1EN6 A;  1M4U A;  3ZRW B;  1H2K A;  1CPY A;  3CHX A;  5GTI Z;  1DK1 A;  2WLL A;  1Q3E A;  4KFM A;  3UKM A;  2WLI B;  3OT7 A;  2Q7H A;  3NR7 A;  4FLV A;  4BIZ A;  2GTA A;  1HR0 B;  3H1L H;  3E86 A;  4LF8 B;  5C8Y A;  4P9P A;  4UCU A;  2G38 A;  2YXH A;  5JH7 A;  2W6I G;  3CXC U;  2ADQ B;  5B1A C;  3CS5 A;  3CC4 V;  5B1A B;  2QWN B;  4B3S O;  2WA4 A;  4X66 O;  4FM1 A;  1KBH A;  3HKE B;  3MD0 A;  4DV6 B;  2YXY A;  4DUY B;  1Q5O A;  3MDS A;  2VWJ A;  1MOF A;  1HDJ A;  4OGQ B;  1JA8 A;  1GRJ A;  1SKV A;  4O4I B;  1BSM A;  4YIO A;  1HNX O;  3LDD A;  2ZD9 A;  1IBK O;  1PL4 A;  4LNU A;  4UV8 A;  2CDY A;  2EZP A;  1XL4 A;  4I9Q A;  4FZ1 A;  1TA8 A;  3VQW A;  5EK0 A;  3ZHQ A;  1M1K W;  3OE7 G;  5FNV A;  4JI1 O;  3T2M A;  1I7F A;  2V7Q G;  4FK5 C;  2ZKO A;  4UVB A;  3TET A;  2WLJ A;  5BMV B;  2D2C B;  3ZHS A;  3AG1 C;  2NN4 A;  4I0X B;  5JCO C;  5GW7 A;  3BRC A;  2JDI G;  4IIJ B;  2YEV B;  2CK3 G;  4B3S B;  2DE0 X;  5IYD O;  4X66 B;  2DOS A;  1R3K C;  2EIL C;  2NLJ C;  3I5D A;  3A0R A;  3OD4 A;  1GMG A;  3OW2 U;  1S72 V;  1J95 A;  4WCE V;  3BAB A;  2EIN C;  2BSK A;  4EB6 B;  1GM9 A;  2IU0 A;  2EIN B;  2JGD A;  1HNX B;  2ZE6 A;  3WB1 A;  1IBK B;  3E8B A;  1URF A;  4O2B A;  4DR7 O;  3M99 B;  3AG4 B;  3QO7 A;  3FKS G;  1NJI W;  1B3Q A;  2F1M A;  5JJJ B;  4LFC O;  2GBO A;  4JI1 B;  4N23 A;  3L70 H;  4YJ3 B;  1OCR C;  5DM6 V;  1OCR B;  3W7U A;  1LR1 A;  3JAM N;  5J2U B;  1AVM A;  2MK3 A;  3HKD B;  4OXS A;  3X2Q B;  1NVP D;  2CTW A;  1NTK H;  1XNQ O;  2OCC B;  3HB3 B;  3JAT A;  4X1K B;  2A06 H;  4UCV A;  4MVU A;  3CSX A;  2F66 C;  3SDL A;  2AXT Z;  5C93 A;  4MVR A;  4EFB A;  3U0Z A;  2DN9 A;  2F95 B;  1OCO B;  3UQ8 A;  4QJF B;  2EZO A;  3FFQ A;  4ZIB A;  4J80 A;  1SC5 B;  2XAS A;  4DR7 B;  1DLB A;  3TCU A;  2X7R B;  5KA5 A;  4LFC B;  2V4D A;  3B8N A;  1XL6 A;  5EBM C;  1ZL8 B;  5JVD A;  2LW7 A;  4I55 B;  1SER A;  2P67 A;  3VOU A;  1ZLZ A;  1F51 A;  1FFX A;  4UXN A;  2N04 A;  4HBN A;  1XNQ B;  3WFV A;  1T5E A;  2CGO A;  4YIP A;  1QLN A;  3D8C A;  1L1F A;  1ORQ C;  3ABU A;  1BT8 A;  3HKC B;  2F23 A;  1QQC A;  4DR6 O;  4GKJ O;  1MA1 A;  1VQ7 V;  1QR8 A;  5J2T B;  4FJC C;  1TGO A;  1FXK C;  5KAF Z;  3GWK C;  2PF4 E;  1FXK B;  1ZWI C;  2QSA A;  3L74 H;  3JCZ A;  3FX7 A;  4DV5 O;  1K97 A;  1SQF A;  5EIB D;  2OIE A;  1YF2 A;  3K3W A;  1JQ0 A;  3H1I H;  2QGN A;  4WF9 V;  3BY6 A;  1IVS A;  1FS0 G;  1NI8 A;  4TT3 G;  4X1Y A;  3FB7 C;  1WA8 B;  2YUA A;  5LA6 B;  2Q7G A;  4GZR B;  5IWA O;  3OGI B;  4DV4 O;  2XAF A;  2VQF O;  1R6N A;  5ITZ B;  1FD9 A;  4Z1V A;  4IHJ B;  2OCH A;  2XAQ A;  1YEW A;  5KX5 A;  2R9R B;  4AQY O;  3CXH F;  4K3A A;  4GKJ B;  1RSO B;  2ZR3 A;  4CH4 A;  2LFR A;  4DV3 O;  2KQX A;  4NTX A;  4LH6 A;  1MG1 A;  3TXQ A;  4PA3 A;  1R3I C;  5CBG A;  3IGA C;  2K9P A;  1Y67 A;  3VQY A;  1Z5V A;  2QWO B;  5B1B B;  4UVA A;  5KUM A;  1NTM H;  1R3L C;  2A7W A;  5IWA B;  4QNH B;  4C7U A;  4DV4 B;  4LF7 O;  2QKS A;  3AEI A;  1WNS A;  4G27 B;  4DRX B;  3SJQ C;  2GV9 A;  1JOY A;  5LP6 C;  3ZN1 A;  4FLT A;  3BA8 A;  2YC0 A;  4AQY B;  5EC2 C;  1QVG U;  2ZNI A;  1ROP A;  3RYI B;  5JQG B;  2ZE8 A;  4HZ3 A;  4QPJ A;  2QA4 V;  5FLX N;  1XI1 A;  1IUR A;  4XDK A;  5D5P A;  2LW1 A;  4PDR A;  1M90 W;  2YDE A;  2OTJ V;  4TV8 B;  1AR5 A;  1H2G A;  2DMX A;  2EIM B;  2LFS A;  2YXL A;  3K03 A;  4O4L A;  3GVM A;  3BCC H;  2Q68 A;  2N05 A;  2ZIO A;  1YCI A;  5CB4 A;  4O2A A;  2QM7 A;  3EHB B;  3CCS V;  3I56 V;  2QE7 G;  4LF7 B;  2ZE7 A;  3BA9 A;  5BY1 A;  4QGP A;  3R65 A;  3ZED A;  3L73 H;  4U3J A;  1W59 A;  5JCO A;  4X65 O;  3JAL A;  3B8M A;  1JPX A;  3LSS A;  1XMO B;  3OEH G;  1DGS A;  4DR3 O;  2NNU A;  1JX9 A;  2FL4 A;  2QTS A;  3JYC A;  3SPH A;  4BR6 A;  4JYA O;  1I94 O;  1CEZ A;  4PA7 A;  1M9N A;  4H37 A;  2ZM6 O;  3OM3 B;  3D3Q A;  4JPR A;  3CD6 V;  2V1D A;  4JF3 A;  5DEC A;  1Z2G A;  3A2F A;  4PI2 A;  3RYC B;  2P5O A;  3DGE A;  1IXB A;  3RWR D;  2YI9 A;  5F2V O;  1B04 A;  2BOB C;  4PI0 A;  3JAK B;  5IJ0 B;  2DYR C;  4GX1 A;  4TSF G;  3E22 A;  4X65 B;  3UO3 A;  1G1X B;  2WLM A;  3DXR A;  1UPG A;  3CCE V;  4DR4 O;  1Y74 A;  3OFN G;  2H3O A;  4DR3 B;  4JTA B;  4JAU A;  1GKF A;  1OJH A;  4WBN A;  4JYA B;  1N32 B;  5JJN B;  3L71 H;  1I94 B;  3FD9 A;  2R9I A;  1FKA O;  4MSW C;  2ZM6 B;  2LGQ A;  1WJZ A;  2Y69 C;  1OHH G;  4Q6G A;  2Y69 B;  5LGU A;  2HEP A;  4Q20 A;  3CCL V;  4B3M O;  2P6J A;  3KCX A;  1Q8I A;  4IGG A;  2QM4 A;  2ZIN A;  3ZMV A;  1IX9 A;  2BCC H;  2QR4 A;  1P7B A;  1Y76 A;  1NT2 B;  4TQF A;  1JFF B;  2JGU A;  1K5Q A;  1MZE A;  3JAS B;  1G8M A;  4FPP A;  3ABL B;  3FAV A;  3ZRX A;  5LGN A;  4ABM A;  4GLX A;  4BIO A;  2LP7 A;  5IJ9 A;  2GDS A;  1S5H C;  3C3T A;  3OMI B;  4DR4 B;  1XBL A;  1EN4 A;  1ZTE A;  1PP9 H;  4EEQ A;  2LQT A;  2DQ3 A;  5GON A;  3M8A A;  1HW7 A;  4FLX A;  1WAZ A;  1AJQ A;  3SYQ A;  2IU3 A;  3MHS C;  5EYP B;  1A32 A;  4O4J A;  1PNK A;  4BW9 A;  3G67 A;  2M7W A;  4B3M B;  3CJH B;  1IBL O;  2IBZ H;  1OCC C;  2R72 A;  3ZN0 A;  4DR1 O; 
#chains in the Genus database with same CATH homology
 3OE7 G;  1VQ4 V;  3G4S V;  1NVP B;  4RUF A;  2DW4 A;  1F23 A;  3T2M A;  4JTC B;  2GSM B;  2V7Q G;  4FK5 C;  5B1N A;  1KD1 W;  1R6K A;  1Q82 W;  4UVB A;  3TET A;  2WLJ A;  1NH2 B;  3E83 A;  4ZKI A;  2ZXW C;  4LBE C;  1M57 C;  2ZXW B;  4UV9 A;  5IYB O;  1M57 B;  3AG1 C;  3LDE A;  3SYA A;  4DO2 A;  5GW7 A;  1W0J G;  2JK5 C;  2B1I A;  2JDI G;  5BZB A;  2YEV B;  1AR1 B;  2CK3 G;  4QIW F;  2UXN A;  1NR1 A;  1E1Q G;  5IYD O;  4I5S A;  1V55 C;  4HAM A;  2DWE C;  3OR6 C;  1R3K C;  2EIL C;  2NLJ C;  4RO2 A;  5L3D A;  2PI5 A;  3A0R A;  2Q69 A;  3W7X A;  4GCZ A;  4LC1 A;  1GMG A;  1AI5 A;  3OW2 U;  2Q6A A;  1S72 V;  1J95 A;  4MW3 A;  3W7S A;  4WCE V;  5DN6 G;  1GM7 A;  5J9P C;  2EIN C;  2OT5 A;  1GM9 A;  2IU0 A;  2EIN B;  3MHH C;  1GO3 F;  3CCM V;  1VQO V;  5IDJ A;  1QR9 A;  4RQF A;  3E8B A;  3M99 B;  4LP8 A;  4X88 A;  5B3S B;  3AG4 B;  3QO7 A;  2WPD G;  4MTO A;  5H6Q A;  3ASN C;  3FKS G;  1NJI W;  4UUJ C;  3CP1 A;  3ASO C;  3I55 V;  4N23 A;  3K79 A;  4XDL A;  2ZR2 A;  3ASO B;  3E89 A;  4R8C A;  3DTU B;  1OCR C;  1B6Q A;  5DM6 V;  1OCR B;  1YIT V;  4GX5 A;  4E2L A;  1HWY A;  3ETE A;  2A79 B;  3W7U A;  4MT8 A;  5CA3 A;  2D3O W;  3ZMU A;  2MK3 A;  1JVM A;  4OXS A;  3ETD A;  4JAV A;  3X2Q B;  4MTX A;  1NVP D;  4PA4 A;  2OCC B;  3HB3 B;  2C2A A;  1NH2 D;  4MVU A;  4QE7 A;  1K8A W;  2A9H A;  3LUT B;  4JYB A;  4X8A A;  1YHQ V;  1H8E G;  1NR7 A;  1SET A;  4QE9 A;  4TWK A;  5C93 A;  1RM1 B;  3E8H A;  3OUS A;  3PJS K;  4MVR A;  2P90 A;  5H9C A;  1EBO A;  3SYP A;  1Q86 W;  1OCO B;  4YXW G;  4MVZ A;  3CCU V;  3ABL C;  4QJF B;  2QM8 A;  2EZO A;  4DXW A;  1KC8 W;  2XAS A;  3ZMS A;  4WFH A;  2DYS C;  2W6J G;  2X6C A;  1DLB A;  3D36 A;  5CBF A;  3TCU A;  4P2Z A;  2AHY A;  2X7R B;  4F4L A;  5KA5 A;  1NBM G;  3B8N A;  1XL6 A;  4G28 B;  5EBM C;  5EBL C;  3ZJZ A;  3FB5 C;  3SPJ A;  3OR7 C;  1QCE A;  1SES A;  4WFA V;  3ML0 A;  1SER A;  1GM8 A;  2ATK C;  2P67 A;  2JJ2 G;  3VOU A;  4LCU C;  5FL7 G;  5KA6 A;  1F51 A;  3T4D A;  1UJW B;  3CMA V;  4U7O A;  4XBF A;  4UXN A;  4P9O A;  5L3E A;  2XAJ A;  2EIJ C;  3CC2 V;  1FXK A;  2EIJ B;  4UVC A;  3WFV A;  2Y48 A;  1EZJ A;  2ZDI A;  3FYI B;  4PA9 A;  1QLN A;  3F5W C;  3T1C A;  1L1F A;  1KQS U;  1ORQ C;  1SZT A;  5EBW C;  3ABU A;  3RVY A;  1H38 A;  1G4Y B;  4BW5 A;  4WFF A;  1YI2 V;  1PD3 A;  2IJK A;  1BHB A;  2P7T C;  3SPC A;  1FFT B;  1VQ7 V;  2HVJ C;  3CCJ V;  3IFX A;  1QR8 A;  4QPK A;  2B1G A;  1OZ0 A;  2ZQM A;  4FJC C;  1FXK C;  4KP4 A;  1K4D C;  1FXK B;  2F43 G;  5L3F A;  1ZWI C;  5L3B A;  3JCZ A;  1K97 A;  1MSW D;  4MS2 A;  4L87 A;  3K3W A;  3ABT A;  1JQ0 A;  4ASU G;  3CCQ V;  4WF9 V;  1CP9 A;  3BY6 A;  4I9W A;  1FS0 G;  4RUE A;  1QBZ A;  4H33 A;  4GT1 A;  3OMA B;  4MVS A;  3W7T A;  4TT3 G;  1GTO A;  4JYC A;  2X6B A;  3FB7 C;  1PNL A;  4WFB V;  2EBO A;  1K73 W;  3F7V C;  3WG7 B;  1VQ5 V;  4J9Z B;  2XAF A;  1M56 B;  2BOC C;  5LHH A;  1R6N A;  5B3S C;  2XAQ A;  3AG4 C;  2ITC C;  1S76 D;  2R9R B;  4R6Z A;  1S77 D;  3G6E V;  4MW8 A;  3QO5 A;  3CYO A;  4J9Y B;  5LHG A;  1R3J C;  2JEU A;  1KP2 A;  3NXS A;  3QO8 A;  4MTG A;  2JEX A;  5L3C A;  3AG2 B;  2ZR3 A;  1BMF G;  2LFR A;  3K04 A;  2IH1 C;  2DYR B;  1N8R W;  1MG1 A;  4Z1M G;  2HJF C;  3X2Q C;  4JGS A;  4PA3 A;  3CPW U;  1S0V A;  1R3I C;  2OCC C;  1MAB G;  1K7D A;  5CBG A;  1K92 A;  2FTK A;  1DF5 A;  3IGA C;  1R73 A;  3ZCC A;  4CBC A;  2K1E A;  1YJW V;  5IY5 B;  1V54 B;  3ABM B;  4P30 A;  3ZIA G;  4BIU A;  2Q67 A;  4MTF A;  5B1B B;  4GX2 A;  4UVA A;  3UM7 A;  1S3J A;  1PL0 A;  5KUM A;  3GWO A;  4PDM A;  1RM1 C;  1I5Y A;  3ZMZ A;  1R3L C;  1W0K G;  2XOK G;  1OCO C;  3SPI A;  3JD1 A;  1AJN A;  1E1R G;  4QNH B;  1BHA A;  3EFF K;  2JIZ G;  2QKS A;  3AEI A;  1YJ9 V;  4G27 B;  3SJQ C;  1JOY A;  2A0L A;  1QVF U;  1YSC A;  1P4R A;  3ZN1 A;  3HPL C;  3JD4 A;  1YIJ V;  5EC2 C;  4GX0 A;  4PEL A;  1QVG U;  1ROP A;  4CZZ A;  5LBQ A;  4HZ3 A;  4QPJ A;  1W2B U;  2QA4 V;  2IH3 C;  1JJ2 U;  3E2E A;  3TK1 A;  2H94 A;  4XDK A;  3E8F A;  1K34 A;  4PDR A;  4WFG A;  3VBB A;  1M90 W;  3CME V;  1F4N A;  3E35 A;  2OTJ V;  1AJP A;  1I5X A;  5LHI A;  2B5U A;  3LNM B;  1H2G A;  1KKD A;  5HFL A;  1RPO A;  1KP3 A;  2ITD C;  2EIM B;  2EIK B;  2LFS A;  3OUF A;  5CBH A;  3SYO A;  3K03 A;  3OAA G;  2Q68 A;  2HR3 A;  3SYC A;  3RW0 A;  4N21 A;  2QM7 A;  3EHB B;  3CCS V;  4MVM A;  2QE7 G;  3I56 V;  3FYE B;  3R65 A;  1TUE B;  3LDC A;  4PA6 A;  1K4C C;  4KUM A;  3T4Z A;  2JJ1 G;  4X89 A;  1PKX A;  1DF4 A;  1VQ6 V;  2ZDI C;  3ABK C;  1JPX A;  3B8M A;  3LSS A;  3ABK B;  5CN0 A;  2IW5 A;  3OEH G;  1AI4 A;  4MVO A;  3RBZ A;  4EKW A;  2NNU A;  1WPX A;  4ZBM A;  1OCC B;  3RVZ A;  2X6A A;  4RQE A;  1JX9 A;  3JYC A;  3SPH A;  4FMT A;  3CCR V;  3OEE G;  3OGC C;  1F4M A;  2XAH A;  1K5S A;  2HVK C;  4R50 A;  1CEZ A;  3FB8 C;  4PA7 A;  2DQ0 A;  1M9N A;  4FIP C;  4H37 A;  2WLN A;  3OM3 B;  1Q81 W;  4R7C A;  4U7N A;  4JPR A;  5L3G A;  1WLE A;  4PDL A;  3WG7 C;  3CD6 V;  2V1D A;  3LSQ A;  1YTF B;  1M56 C;  4JF3 A;  3AG1 B;  3K9A A;  3SPG A;  1FXV A;  2WLK A;  3K0G A;  2UXX A;  5IYC O;  1K3E A;  4RAI A;  2X0L A;  3IC7 A;  5HFM A;  1VQM V;  4JTD B;  3DGE A;  3H01 A;  1V55 B;  1QLE C;  2KB1 A;  1KEC A;  2EIL B;  1QLE B;  5EC1 C;  3STZ C;  2BOB C;  2XAG A;  3AG2 C;  1IXM A;  1OCZ C;  2WSS G;  1OCZ B;  2HKO A;  3F7Y C;  3P30 A;  3ZMT A;  1THZ A;  2HG5 C;  2QTO A;  3KG2 A;  1JCH A;  2DYR C;  1Q7Y W;  1ARO P;  1FXH A;  3K06 A;  1COW G;  1PNM A;  4GX1 A;  4TSF G;  4XDJ A;  3AG3 C;  5CMU A;  2AHZ A;  3ZRW A;  1VQ9 V;  3AG3 B;  4G2K A;  1VQN V;  3GB7 C;  2WLM A;  2WLI A;  1YJN V;  1DTO A;  3OMN B;  3CCE V;  1LNQ A;  3OFN G;  2WWW A;  5LGT A;  2GHY A;  5IY5 C;  1V54 C;  3ABM C;  3ASN B;  3K08 A;  3B77 A;  4PDV A;  1AI6 A;  4JTA B;  5B1B C;  3BEH A;  1GKF A;  2XND G;  4JAU A;  1K9M W;  2EJR A;  4MVQ A;  3JD0 A;  1NKD A;  2R9I A;  1E79 G;  4MSW C;  2QEX V;  2W0F C;  1EFR G;  3QNE A;  2WAM A;  3CCV V;  1NQT A;  2OTL V;  1H8H G;  3P32 A;  3JD3 A;  2Y69 C;  1OHH G;  2Y69 B;  3ZRW B;  1CPY A;  5LGU A;  4Q20 A;  3CCL V;  2WLL A;  2HLD G;  3ETG A;  4KFM A;  3UKM A;  2WLI B;  2P6J A;  1VQK V;  4BIZ A;  2IJH A;  3CC7 V;  1VQL V;  1YTF D;  3ZMV A;  1P7B A;  3FB6 C;  4BAY A;  2Z5U A;  3E86 A;  1K33 A;  4P9P A;  1SRY A;  1K5Q A;  4FPP A;  1G8M A;  3ABL B;  5KUK A;  3ZRX A;  5LGN A;  4JAS A;  2LP7 A;  2W6I G;  1GK9 A;  2IJI A;  3CXC U;  1S5H C;  3G71 V;  3OMI B;  2DYS B;  4HYO A;  5E1A C;  2H8P C;  5B1A C;  3CC4 V;  2WLL B;  3K0D A;  5B1A B;  2EIM C;  2EIK C;  2Z3Y A;  2YSU B;  3MD0 A;  1BL8 A;  2DQ3 A;  3D3I A;  5B1O A;  1AJQ A;  2PI4 A;  1MOF A;  3E8G A;  1Y66 A;  3SYQ A;  2IU3 A;  2WLH A;  3MHS C;  1VQ8 V;  4WFE A;  2HFE C;  1PNK A;  5H6R A;  1ENV A;  1VQP V;  2YEV A;  1Y4M A;  2IJJ A;  2M7W A;  3LDD A;  3STL C;  2ZD9 A;  4UV8 A;  2EZP A;  3W7W A;  1XL4 A;  3ZRV A;  3ZRS A;  1AI7 A;  1OCC C;  1RPR A;  5EK0 A;  3ZN0 A;  3JD2 A;  2DWD C;  1M1K W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...