3K06A

Crystal structure of cng mimicking nak mutant, nak-ntpp, k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
b'EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGNTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k06A00
4MVSA 3RVZA 2YEVA 4JTDB 2X6BA 5E1AC 1R3LC 2A0LA 1G4YB 3STLC 4H37A 4LBEC 2DYRC 4MVQA 3OR6C 5EBWC 3SJQC 4X88A 3FB8C 5B1AC 3RVYA 4PA4A 1LNQA 1QLEC 4BW5A 3TETA 4WFFA 4EKWA 1XL6A 5BZBA 2Y69C 2P7TC 2NLJC 4G28B 4J9YB 2IH3C 3E8GA 5CBHA 2EIJC 2WLMA 4DXWA 4PA7A 3X2QC 3E86A 3FB5C 3HPLC 3K0GA 4XDJA 3FB7C 3E8BA 4UUJC 5EK0A 3STZC 1OCCC 2BOCC 4PA3A 3AG4C 1R3KC 2HVJC 2Q6AA 2DWDC 5KUKA 4LP8A 1OCZC 2HFEC 3OUSA 3R65A 2H8PC 4PDRA 4R50A 5EBLC 2HJFC 2IH1C 4HYOA 2DYSC 2R9RB 4MTGA 3F7VC 3RBZA 1M57C 4WFEA 4X8AA 4I9WA 1OCRC 3ABLC 3AG1C 3ABKC 3EFFK 3T4ZA 2X6CA 1P7BA 4GX5A 4PDMA 3SYAA 4P9OA 4WFHA 4R8CA 2QKSA 1K4DC 2EIMC 3ASNC 1J95A 1V55C 3LDEA 4TWKA 2OCCC 2Q69A 4MW8A 2EILC 3FB6C 4X89A 4MVOA 3E83A 4XDKA 3F7YC 4XDLA 5CBGA 2A79B 3GB7C 3IGAC 5B1BC 1M56C 3AG2C 3E8HA 3SYQA 3SYOA 4RUFA 4WFGA 3OR7C 1R3IC 2W0FC 3SPGA 3SPIA 3TCUA 3OGCC 3T1CA 3E89A 2AHYA 3LDDA 5KUMA 3E8FA 3SYCA 2BOBC 3T2MA 4PDLA 2K1EA 1R3JC 5EC1C 4H33A 3AG3C 4G27B 3LNMB 3ABMC 4GX1A 4PA9A 2QTOA 3PJSK 4LCUC 4RAIA 4R6ZA 2WLJA 4RUEA 1V54C 5CBFA 5J9PC 3RW0A 3ASOC 4OXSA 2HVKC 1KKDA 2DWEC 3SYPA 4R7CA 1K4CC 4GX0A 2JK5C 3BEHA 4CBCA 2WLKA 4PDVA 2EIKC 2Q68A 2ITCC 5EC2C 2EINC 3K03A 2WLLA 3SPCA 4P9PA 3WG7C 4MS2A 5EBMC 2WLLB 4MVMA 3ZRSA 2ZXWC 4MVUA 4MTOA 4PA6A 1JVMA 4KFMA 3SPHA 4JTCB 2ITDC 2WLIA 3K08A 4J9ZB 3UKMA 3F5WC 3K06A 2WLIB 1BL8A 5B3SC 2Q67A 3VOUA 1ORQC 4QNHB 4P2ZA 4MW3A 4ZBMA 3T4DA 2X6AA 3K04A 4MSWC 1OCOC 3KG2A 4MTFA 4F4LA 3LDCA 5IY5C 4QE9A 1XL4A 2WLNA 2ZD9A 3LUTB 2WLHA 4GX2A 3UM7A 3ZJZA 4RO2A 2AHZA 1ZWIC 2A9HA 4MVZA 3IFXA 4P30A 3OUFA 2HG5C 3JYCA 4HZ3A 4JTAB 3K0DA 2KB1A 4QE7A 2ATKC 1S5HC 3SPJA 4MVRA
chains in the Genus database with same CATH superfamily
4JTDB 2RNBA 3K9SA 1RSOA 3MHSC 3U10A 3HKBA 3ABUA 2QWQB 1SERA 3CJHB 4UV8A 1GN2A 2Y4UA 2ZE6A 4LF6O 2LW7A 3GWOA 4XDJA 3D3QA 5EK0A 2BE3A 5CA3A 2CGOA 4DW0A 2CGNA 3B2EE 5H6RA 1AI7A 2DYSC 3CP1A 1XUQA 4X1YB 1K33A 2CTRA 2F93B 2DQ0A 2Q5ZA 2UXBB 4TSFG 1JX9A 3JAMN 1L0LH 2OTJV 1N33O 3P3PA 5KHKA 1T5EA 3CS5A 2F66C 5KLVH 3E22A 2FKXA 1FXKA 2IU0A 4WCEV 2Q9LA 1HNXO 5EZYB 5FL7G 4OX9O 1JR9A 2LFSA 5LA6B 4DV2O 2K1EA 1SQBH 4F6EA 1KQSU 1JQ0A 1WJZA 1QHTA 3PJSK 2X0LA 5DM6V 2UXDB 3N2KA 1I08A 4OXSA 2DYRB 3K59A 3G4SV 3ABTA 4FM1A 4LNUB 1K4CC 1IXBA 2XASA 1ZAUA 3JAKB 2Q68A 3FAVB 4D7TA 1Q6IA 1R73A 1M90W 3X2QB 4JV5O 3AG4B 1XHXA 3SPHA 1SA0B 4JI7B 3QF7A 1N32B 4N23A 4X66O 4GUNA 1AP6A 4OGQB 5LHHA 1YDXA 5LGTA 1Q90D 3BPZA 2Y4TA 1Q43A 2D3OW 2LJ2A 3LUTB 5J2UA 4GKJB 1KC8W 1FXKC 3J80N 5L3CA 4LR3A 5E79Z 2DOSA 2YIAA 1IURA 2EX3A 5TISZ 1GM8A 5DN6G 1DGSA 4LFBO 4LC1A 3W7WA 2HKOA 1N0JA 2IBZH 4TUYA 2MW2B 2P7TC 3MDSA 2Z5UA 2EIJC 2NR5A 4BWAA 1AJPA 4J11A 2W0XA 1YJ9V 1R3KC 4DUYB 4CH6A 1XI1A 3ZX6A 5CMUA 4O4JB 5J2TA 3CCJV 4O4IA 1K7DA 4X65B 2R9IA 3OGIB 4YY3O 2V4DA 3Q4HB 3U0ZA 2N74A 4MVOA 1AR1B 4NXNO 1AJQA 2F95B 4OPAA 2A79B 3IGAC 3TXQA 3SYOA 5LP6B 1XHZA 4WFGA 3OR7C 4NTYA 3CCEV 4FJCC 3TXSA 1HP8A 1JPXA 2AXTZ 5J9PC 3SJCC 4X20A 4WF9V 2PI5A 3VQYA 2JK5C 2HHHO 2G38A 4O2AA 1XNRO 1YIJV 2QEXV 3AK2A 4LF6B 2GBOA 2CAZC 1KP3A 1FPOA 2Y0IA 5C93A 4MTOA 1Y76B 3W7XA 3UKMA 3K06A 3THOA 4NXMO 3NR7A 5LHGA 4ICGA 4K3AA 1VQ9V 3QVNA 1K97A 2H94A 4MSWC 1JFFB 3TGUH 3OW2U 2YUAA 4ZOLA 2IJHA 5FLXN 5FNVA 4IHJB 1VQLV 1YITV 1GKFA 4U3JA 2JJ1G 4GLXA 4QE7A 1HNWO 1O9GA 3OTFA 3BRCA 1HNXB 4OX9B 1TA8A 4LBEC 2HJDA 3FFQA 4DV2B 1QBZA 1K5QA 2XAHA 4GCZA 5IJ0A 4DV3O 2NLJC 4G28B 2IH3C 3AK1A 3E8GA 2KG7A 1KB9F 1VQ5V 4W4KA 3H1KH 5HFLA 3K0GA 3STZC 4X1KA 5JJJB 1IZ3A 3D8CA 2FB5A 3C3SA 2HFEC 2P90A 2GUZB 4H13B 3H1JH 3BVOA 4TV9B 1RFYA 3CSXA 3W7SA 3IC7A 4WFHA 1QR8A 4J42A 2DQ3A 4TWKA 4HBNA 1BQ0A 1U96A 2M7WA 3CRAA 2Y0PA 4JYCA 2W0FC 2DMXA 4X1IB 3SYCA 3E8FA 1AILA 1MSWD 2ZR2A 3LNMB 4UB8Z 1D5NA 4ZI7B 4R7CA 5IYZA 4DRXB 2JEXA 5FNVB 4IIJB 1L8DA 3ZRSA 3CRMA 4KFMA 3CRCA 5FPRA 1UPGA 1U97A 1CP9A 1VQPV 5B3SC 4DV0B 4X62O 3D36A 3HKDA 2ZIMA 2XAJA 4YY3B 1OCOC 2YDEA 3CRRA 5CB4B 2WLHA 4MVZA 3BA8A 4JTAB 1MABG 1AI6A 2IJKA 5KAFZ 2UUCO 4MVSA 1J5EO 1MA1A 1TVKA 2LGWA 1URFA 5KA6A 4FLZA 4X88A 1ZSPA 1KBHA 5LYJA 3ZHVA 1MMMA 4JI4O 5C8YA 1M57B 1PL0A 1N0NA 3N2GA 1MOFA 3ASNB 5EIBD 2UXXA 2HHHB 3BY6A 1XNRB 2ZE7A 4DUZO 3FKSG 4UVCA 2R70A 3DXRA 2W6IG 1ZL8B 3H9VA 1EFRG 3HKCB 5LXTB 3CCUV 5KX5B 3IC9A 3K5OA 2ZXWB 3AEIA 3ABKC 1MSDA 3ZCCA 2OT5A 3D36C 1LUVA 4NXMB 5IYBO 3DSQA 4EB6A 1YZBA 2HR3A 4WBNA 3RN4A 3JD3A 4XDLA 5CBGA 1O9HA 1SESA 5IYZB 1FFTB 3OMAB 1US6A 4GYCB 3G6BA 4PDLA 2BCCH 4H33A 4RAIA 1FFXA 4BR6A 4ASUG 3RW0A 3BAAA 1P49A 1QLEB 4DV3B 4I55A 4Q6GA 4I50A 5CA0B 5GONA 4UCSA 3E35A 4XBFA 4JAUA 2LW1A 2P4VA 2P06A 3N27A 3RYCA 1JVMA 3ZMUA 1K8AW 1P7GA 5LOVA 2QA4V 2EIMB 1GAXA 3N2GB 5ITZB 5JQGB 4RO2A 2ZNJA 2YIDA 1YSCA 4TV8B 1BQZA 4DR6O 2AGAA 1XILA 3SJQC 1S5LZ 4X64O 2UU9O 1Q82W 3ETGA 1XL6A 3ABMB 5BMVB 4IT5A 4EB6B 5LHIA 3ZMTA 1H38A 4FFBA 1A32A 3E86A 2Q7GA 2UXNA 1HWYA 4NKGB 4DV5O 4UUJC 3RYFB 2BOCC 2BTQB 1VARA 1K34A 1YHQV 1S0VA 4JYYA 2HJFC 1TUBA 2IH1C 4UV9A 4YHHO 3RBZA 4HAMA 1BHAA 3QTCA 4GX5A 1L0NH 4MTXA 1J95A 3SR2C 1GN4A 4JZGA 1GH6A 5EYPB 4X62B 4X89A 3ZMVA 3E8HA 5GONB 2OCHA 5KHGA 2LQTA 5IY5B 1R6NA 1SC5B 1PPJH 5KUMA 1WN7A 2UUCB 2BSKA 1J5EB 2D2CB 1FYJA 4IYIA 5LMUO 4F6RB 1SKVA 4YJ3A 4JI4B 5L3BA 1QLNA 4KHPO 1I94O 1MNGA 2WLLA 3CYOA 3D3IA 1JCHA 4DUZB 2F4VO 1KUQA 2CTWA 2F43G 4NR1A 4I4TB 3K08A 3FD9A 4P2ZA 4UCTA 3UCSC 2BTOA 2XNDG 3PN1A 4FFBB 4UFZA 3JARA 3DC6A 1XL4A 1VF5B 3LSUA 1S3JA 3RYHB 2KB1A 3K79A 1DLBA 3RVZA 2YEVA 1XOUA 1R3LC 3MHHC 4Z1VA 1FS0G 4DR2O 4J10A 3SDLA 4PA4A 2VWKA 1H2LA 4OPHA 4BW9A 1B6QA 3VBBA 5HFMA 2LP7A 4Q20A 4B3SO 1AJNA 1AP5A 2AW9A 4HNAA 1OCCC 2IW5A 3DGEA 1S72V 2LGQA 5IE9A 3WG7B 3C90A 2XHBA 2QKSA 2JDIG 5JVDB 2QE7G 1V55C 1NH2D 2EBOA 1XDCA 1CXZB 3CEIA 2CTPA 4LF7O 2LFRA 3QG5A 2ZM6O 1VQ6V 5BXZA 1R6TA 1P4RA 4JI6O 4DR6B 2QTOA 3WB0A 2B1IA 2XOKG 4X64B 5KMGA 2UU9B 5JWPA 1BGYH 1WAZA 5FPOA 1KP2A 3ZBHA 2B5UA 3S3WA 2N05A 3B8MA 2IJIA 4IGGA 1EZJA 1BHBA 4O4LB 4LH6A 3CHXA 1TGOA 4QGPA 4DV5B 2WA3A 1NS1A 1M9NA 4O2BA 3CPWU 4TQDA 3CC2V 1BL8A 2DYSB 2Q67A 3VOUA 1ORQC 3L72H 3T1HO 2DJVA 2B1GA 1XMQO 4H0LB 4QE9A 2CTQA 4JGSA 2CH7B 1XREA 3CMEV 3LSSA 1XQ8A 1WB8A 4B3TO 1LR1A 3JAWA 2ADQB 3A0BZ 2QM8A 1FKAO 1WPBA 1NH2B 2JS3A 1YF2A 3DC5A 4UXNA 2XTAA 4JAVA 1RSOB 3RT3C 3DTUB 5LMUB 5LBQA 3HKBB 3AG1B 1UJWB 4GKKO 1QCEA 3R66A 2XAFA 4KHPB 1EBOA 1I94B 4J7JA 4PJ0Z 1VQ8V 4DV1O 2OYQA 1OJHA 2F4VB 1X4TA 4K8XA 2LO1A 3EFFK 2X6CA 1E79G 4K35A 5A9GA 3ETDA 3OAAG 4YJ2A 5CA1A 3GB7C 3AG2C 3SYQA 3T1YO 1W0JG 3E22B 1QNMA 3T1CA 1FXKB 2EIKB 3LDDA 4GZRB 2BOBC 1QVFU 5EC1C 1R3JC 4DO2A 3FX7A 1S76D 4RUEA 4DR2B 2JEUA 3SGIA 3N2KB 5LP6C 2MK3A 1Q81W 3LNNA 4CS3A 4EFBA 2OTLV 3JATA 3ZMSA 1WP8A 1BCCH 4B3SB 4J7ZA 4I7ZB 2YC0A 2E75B 1HW7A 3J81N 1QU7A 2ILMA 1BZKA 2ITDC 2FTKA 2QWOB 4DK1A 3K5MA 2NNUA 2CK3G 1AI5A 1I0HA 3CD6V 2WLNA 2ZD9A 1IXMA 1XNQO 5J2UB 3IJ4A 4LF7B 1IBKO 4KUMA 4LF9O 2ZM6B 4JI2O 5E1AC 4DV6O 5EBWC 1PNMA 4JI6B 2ZQMA 4UVAA 4J80A 3U11A 1P84F 5H5NA 1GN6A 4TUYB 2HEPA 5CBHA 4LWSA 4YJ2B 5CA1B 3RYIA 4LFCO 3F5TA 1N33B 3FB7C 1M93A 4PA3A 4J41A 2L6LA 1N8RW 1Q7YW 4LP8A 1Q6UA 1I5YA 5J2TB 4NTWA 3CCMV 4O4IB 3G6EV 5DECA 1XEQA 2RCVA 3FB6C 3T1HB 4PI2A 1XMQB 1Y74A 4B7EA 4I5SA 4B3TB 5AG2A 2DE0X 2P5OA 4JV5B 4DV4O 1TUEB 4DR1O 4BIZA 3AG3C 4PA9A 3OEEG 2ZE8A 2JGDA 4UCRA 1M1KW 4PV1B 4X66B 3B09A 2RQ6A 4X20B 4CBCA 1NT2B 4C7UA 4O2AB 2ZNIA 4GKKB 4TQFA 3SPCA 2ZKOA 5JJEB 1F51A 3I55V 3HKEA 1NBMG 4JI8O 1GO3F 4G2KA 3APQA 3SJBC 2F23A 1IBMO 4DV1B 2UXCO 1EZVH 4LFBB 4QNHB 2YXHA 3QO5A 2JRIA 3K04A 3G67A 1LUWA 5H6QA 4FLYA 5KA5A 3CXHF 4ZOLB 1H8EG 1G8MA 2Y69B 2E5LO 3T1YB 2RJZA 1DTOA 4U3JB 5L3FA 2A0LA 2YICA 2CUGA 1OCZB 2PTMA 5B1AC 2Q4PA 4BW5A 2XT9A 3BFRA 1ROPA 2XAQA 4WFFA 5BZBA 1W2BU 3JSNA 1R1BA 5IJ0B 4B3RO 4DXWA 3WB2A 2KG7B 1WPXA 4A5UB 1RPOA 4NXNB 3E8BA 4JZ2A 4X1KB 4JI1O 3R65A 1MZFA 4HYOA 3F7VC 2YI8A 1M57C 2R72A 1VIBA 1RM1C 3ASNC 4DK0A 4AQYO 2OCCC 2EILC 5B3SB 4DW1A 4BAYA 1OCOB 1XNQB 1WA8A 3TCUA 2VQEO 5LGNA 1NTZH 1QVGU 1R6KA 3GVMA 1IBKB 3VQVA 2JS5A 4DV7O 1NVPD 5D5PA 4JI2B 4G27B 4L8JA 4LCUC 4K0KO 2WLJA 4DV6B 4DR7O 1V54C 1EN4A 3ZRVA 3UO3A 4ZHQA 1QR9A 1KKDA 5H9CA 4GX0A 1NR7A 5B1NA 3WFVA 1I5XA 3ZN0A 3W7TA 1W59A 4PDVA 5B1OA 3FYIB 4LFCB 3L74H 4I0XA 1SETA 1SQFA 1HNWB 2GTAA 3G71V 4J9ZB 5H2FZ 4FZ1A 1NTMH 3HB3B 5DEDA 3ABKB 3KG2A 3HKDB 3H01A 1V9PA 1ZLZA 4F4LA 3ZS8C 2VQFO 4YIPA 2VRZA 3JYCA 1WP7A 1N34O 2ATKC 1IDSA 4H37A 1TVKB 3OR6C 2O57A 1VMGA 1W0KG 4DR1B 5LYJB 3ABLB 4FLXA 5C8YB 1KU9A 2PYLA 2WLMA 3VQWA 3CRQA 1EN5A 2OIEA 2PGGA 5GTIZ 4O4HA 2QTSA 1F7YA 1OZ0A 4LF8O 4E2LA 5EBLC 3DXRB 1YI2V 4JI8B 1OCRC 3T4ZA 5JH7A 4FM2A 2ZCEA 1IBMB 4R8CA 2UXCB 3LDEA 3P30A 3OE7G 3CCSV 3H1HH 4H44B 4WBNB 3UO2A 2GV9A 3JASA 1M56C 3CMAV 4LH7A 1OV9A 3JD1A 3SPGA 3OGCC 1AR4A 4CZZA 2E74B 2E5LB 1IVSA 2WPDG 2PUSA 3T2MA 1JOYA 1GTOA 2RN9A 1ZX3A 1TAEA 2F1MA 2HLDG 1FFXB 2XAGA 1K73W 3ASOC 4ZIBA 3SYPA 3OEHG 4K8ZA 1Q8IA 3MD0A 3EVKA 3RFRA 4I55B 4I50B 4B3RB 2EINC 3K03A 3UT5A 3ZHRA 3CCQV 2DW4A 1K9MW 5K1PA 4MVMA 2KSDA 4MVUA 5IYDO 4PA6A 4JI1B 3RYCB 4CH4A 2WLIA 2B9ZA 3QO7A 3O65A 3ZRWA 5LOVB 5IJ9A 1YXBA 1SRYA 3OM3B 4QPKA 4LFAO 1HR0O 3UM7A 2KQXA 3CCLV 1E1QG 2AHZA 4ABMA 4RQFA 4P30A 2XUMA 3LSQA 2P67A 2VQEB 4MVRA 4D6TH 1PM9A 4B3MO 4ZKIA 1N32O 2DN9A 4DV7B 4JF3A 3FB8C 1LNQA 4K0KB 4DR7B 3CJHA 3ETQA 3A2FA 5L3DA 1Z2GA 1Y6XA 2X7RB 3UQ8A 1NU1H 1H2KA 4X1YA 3M7MX 1TUBB 3G80A 4I9WA 4N21A 2Z0AA 1XMOO 3E83A 1Z5VA 3ZHSA 4NVPA 2CDYA 5B1BC 1AVMA 5B66Z 3ZHTA 4J7KA 2A3QA 3P32A 1AB3A 1YVWA 1PNLA 5LA6A 2QDOA 3K5NA 1K3EA 2BSKB 5L3GA 2WA4A 4LNUA 4FPPA 3JD2A 4LF5O 3B40A 1H8HG 4PELA 4YJ3B 3JAKA 2WSSG 1KD1W 3FAVA 2WLKA 1FXVA 2YI9A 1GK9A 4MS2A 2WLLB 2ZE5A 1OCCB 4LF8B 1SA0A 2VWJA 2QWRB 2ZT9B 3OT7A 1B06A 3ZRXA 3T4DA 3B8NA 2ZIOA 5LGUA 1V55B 3JARB 1ZWIC 1BT8A 3OUFA 4HZ3A 1VQKV 1KYOF 4AI8A 2L35A 4DR5O 2A06H 2YEVB 1AROP 2DYRC 1SQXH 4JYAO 4YHHB 2QR4A 3RVYA 1PP9H 3ZMZA 4E4EA 3K3WA 3JCUZ 5KAIZ 2Q0AA 3ICXA 3X2QC 1H2MA 3KZIZ 2ODMA 2QM7A 3QO8A 4HNAB 1BSMA 4CC6A 3AG4C 1Q86W 4O4JA 4MT8A 1XBLA 2H8PC 4R50A 3ZIAG 2Y48A 5D5QA 4RWUA 3AG1C 4UVBA 3Q4HA 1E1RG 3ZEDA 3TK1A 2OIGA 3CC4V 5LP6A 4LFAB 5IT9N 2H3OA 1COWG 4RQEA 1HR0B 1R3IC 3L70H 3SPIA 5GTHZ 1JA8A 4FLVA 2CE4A 3O9OA 2AZ2A 1KMIZ 4WFBV 4B3MB 3I5DA 4YIOA 4R6ZA 4CC5A 5CBFA 1CPYA 4U3FH 1KKCA 3M8AA 2P6JA 5KMGB 4UCUA 1DF4A 3L73H 3ZHUA 4CH3A 4FLWA 1BS3A 2EIKC 2V1DA 2ITCC 1SZXA 3S3XA 4Z1MG 1UFIA 1Y76A 1G6UA 2YXLA 4JYBA 3BCCH 4FFKA 4O2BB 4DR3O 1VQ7V 1JFFA 2X6AA 1XMOB 2EZPA 4IHJA 1FXHA 2E3CA 1GMGA 1CEZA 2WAMA 2A9HA 3CC7V 2EIJB 1ENVA 4JPRA 3AG2B 3NXSA 3JAWB 1THZA 5BR8O 1PD3A 3ETEA 4DV0O 4CS4A 4PHZA 3TETA 4EKWA 4UCOA 1MG1A 1RP3B 2JIZG 4LF5B 3HPLC 2EZOA 2VS0A 3FYEB 4UB6Z 5KUKA 2Q6AA 5F2VO 1YJWV 2GUZA 1IBLO 3ZHQA 4TV9A 1AR5A 1OHHG 4NTXA 1QQCA 4X8AA 2P4KA 2QKCA 1B04A 4JI5O 1FAFA 1K4DC 1VF6A 4QJFB 4W4LA 4XDKA 1VEWA 3VQXA 1NQTA 4X1IA 4EEQA 4FLTA 2RDCA 2GDSA 1ZUQA 3OTOO 4U7OA 4DR5B 1GM7A 4JASA 4JYAB 4ZI7A 2HVKC 1S5JA 2DWEC 2K9PA 1WNSA 3ML0A 4JI3O 1F23A 4DRXA 4KL1A 4BIUA 4IIJA 3JATB 2Q0OC 2M6YA 2E76B 5GW7A 2GSMB 4FMTA 4PI0A 2QM4A 1N36O 4LF4O 1WB7A 5LMNO 3BABA 1YEWA 4FM0A 1SQQH 1DF5A 1VF6C 3P3NA 2Q7HA 3M99B 4MW3A 5CB4A 4QIWF 4B7KA 1VQ4V 3LDCA 2QJ1A 1Q5OA 4GT1A 3ZJZA 2QGNA 2HG5C 3CCRV 1BE3H 3RWRD 1HNZO 2X6BA 1JMKC 4MVQA 3A8TA 2AZ0A 2KKWA 3TJTA 4FIPC 3HR0A 3EHBB 1VQOV 4IYHA 3AG3B 2ETNA 1H2SB 4FLUA 2Y69C 4KP4A 1NI8A 4PA7A 4LWSB 2RMKB 3RYIB 3JALA 3GWKC 2HVJC 1ZL8A 1OCZC 1L1FA 2EJ7A 2Q7EA 3HKCA 5LXTA 3CXCU 1F4MA 5KX5A 4MTGA 1JJOA 4YXWG 5JJNB 1P7BA 3SYAA 4NYKA 4I9QA 1SQPH 4DR3B 2Q8VA 3F7YC 5K1XA 3CX5F 2QSAA 4QPJA 1X59A 1D2DA 3OD4A 1Y74B 1F4NA 2UUBO 5BR8B 2ZR3A 2FYUH 1SF9A 1SZTA 4GX1A 3K58A 3H1LH 4U7NA 3K57A 1FD9A 2JGDB 1NKDA 5B1AB 5CA0A 3B4SA 4DR4O 2Z3YA 2PYJA 2OWOA 1H2GA 3A0HZ 1BMFG 2ZDIA 3L71H 3B77A 5EBMC 3JCZA 2ZXWC 3HKEB 4L87A 1IBLB 2A7WA 3CWBH 4LF9B 1S77D 2PI4A 2NN4A 2WWWA 4JI5B 5BY1A 3KCYA 2V7QG 4ZBMA 2ZINA 4CS2A 1RM1B 2N04A 5ITZA 5JQGA 3IAYA 4GX2A 2OCCB 2EILB 3AK3A 1FJGO 4JAAA 3JALB 3K9AA 4TV8A 2PY5A 4DYLA 1S5HC 4CH5A 4JI0O 2YXYA 2PF4E 2EULA 5IWAO 3STLC 3OFNG 2IM9A 3OTOB 1Z5WA 1QLEC 3L9DA 4B08A 5BMVA 3EXAA 1G1XB 3QNEA 5KHJA 5IYCO 1V54B 3KCXA 1I7FA 2R9AA 4JI3B 2ZDIC 3RYFA 2BTQA 1NJIW 1GM9A 2YSUB 5EIBC 4PD4F 3OUSA 4LF4B 1N36B 4PDRA 2EJRA 5LMNB 1PKXA 1EM1A 3ABLC 4PDMA 1YJNV 4DV4B 4P9OA 3KKYA 2EIMC 2QWPB 5EYPA 2P22C 3WU2Z 2UUAO 4Z2WA 4MW8A 1NR1A 3CE2A 5KHIA 1NVPB 4EFEA 4BIOA 1D5AA 1Y66A 2GHYA 3K5LA 1WA8B 2YS8A 2FL4A 1HNZB 3ABMC 3JSLA 4F6RA 1M5IA 1WLEA 3AG7A 3BA9A 1DK1A 4AHCA 4ZHQB 3ZN1A 3BEHA 1K5SA 1YCIA 3CCVV 1VF7A 5EC2C 4P9PA 4I0XB 3H1IH 1MZEA 5A2QN 4I4TA 2IJJA 4JTCB 1B3QA 1RPRA 5KHHA 1YTFD 3F5WC 5B5EZ 2QKAA 2UXBO 1HDJA 4AILC 1NTKH 1OCRB 3I56V 3A0RA 1K92A 3WB1A 5IY5C 4FZ0A 1PNKA 3RYHA 2JGUA 3IFXA 2Q73A 3CB2A 4X9QA 1M56B 2YIBA 1M4UA 2UUBB 1VP7A 1G4YB 2UXDO 1SQGA 1Q3EA 3JD4A 5JCOA 4FVMA 4WFAV 4J9YB 3APOA 4AQYB 3ASOB 2YIBD 1GRJA 3FB5C 3SJAC 2FMLA 4DR4B 1N4CA 3L75H 1IX9A 1Y4MA 2DWDC 1GN3A 5IDJA 4O4HB 2EINB 2R9RB 4JI7O 4WFEA 5JVDA 2JJ2G 2ADPA 1SS3A 1Y67A 3C3TA 5JH7B 2JVDA 3W7UA 2Q69A 1H2NA 4GKJO 2QWNB 3E2EA 4TOIA 4KXRA 1YTFB 1VQNV 4RUFA 3JASB 1Q6HA 1FJGB 3E89A 2AHYA 5LL6Y 3BHPA 1PL4A 2GTSA 4JI0B 1JJ2U 4D7SA 5IWAB 5JCOC 3JD0A 1KECA 1VQMV 3OMIB 4IL6Z 4O4LA 2HP8A 4DUYO 1EN6A 5CN0A 3MAQA 2VQFB 3WG7C 3UT5B 1AI4A 2W6JG 5EZYA 1SQVH 1N34B 4X65O 1NZ6A 2ARHA 4FK5C 4UCVA 2WLIB 3RGBA 4NB5A 3ZRWB 3J7AU 1PV0A 2IU3A 5IJ9B 1ZTEA 2UUAB 4MTFA 5L3EA 2CH7A 2C2AA 2PZSA 4TT3G 3K0DA 3OMNB 5B1BB 3SPJA
chains in the Genus database with same CATH topology
4JTDB 1PD3A 3ETEA 2A0LA 3SJQC 1OCZB 5B1AC 3MHSC 3TETA 4BW5A 1ROPA 3ETGA 1Q82W 2XAQA 3ABUA 4WFFA 4EKWA 1XL6A 3ABMB 5BZBA 1SERA 1W2BU 5LHIA 3ZMTA 1H38A 4UV8A 1MG1A 2JIZG 4DXWA 1WPXA 3E86A 1RPOA 2UXNA 2EZOA 1HWYA 3GWOA 3HPLC 3E8BA 4XDJA 4UUJC 5EK0A 3FYEB 2BOCC 5KUKA 2Q6AA 5CA3A 1YJWV 3R65A 1K34A 1YHQV 1S0VA 2HJFC 2IH1C 4HYOA 4UV9A 1AI7A 2DYSC 5H6RA 3F7VC 1OHHG 3RBZA 3CP1A 4HAMA 1M57C 1BHAA 4X8AA 1K33A 4GX5A 1RM1C 1K4DC 2DQ0A 3ASNC 1J95A 4MTXA 4QJFB 4TSFG 1JX9A 2OCCC 2EILC 4X89A 5B3SB 2OTJV 4XDKA 3ZMVA 3E8HA 4BAYA 1NQTA 1OCOB 5IY5B 1FXKA 2IU0A 3TCUA 5LGNA 1R6NA 1QVGU 4WCEV 1R6KA 5FL7G 5KUMA 1NVPD 2LFSA 4U7OA 2K1EA 1KQSU 4G27B 1JQ0A 3PJSK 4LCUC 2X0LA 2WLJA 5DM6V 1GM7A 1V54C 4JASA 3ZRVA 4OXSA 2DYRB 2HVKC 1QR9A 1KKDA 3G4SV 3ABTA 2DWEC 3ML0A 1K4CC 4GX0A 5H9CA 5L3BA 1NR7A 2XASA 5B1NA 1I5XA 3WFVA 3ZN0A 3W7TA 1F23A 1QLNA 4PDVA 4BIUA 2Q68A 5B1OA 1R73A 3FYIB 5GW7A 2GSMB 2WLLA 3CYOA 1SETA 4FMTA 1M90W 3X2QB 3D3IA 1JCHA 2F43G 3AG4B 3SPHA 3G71V 3K08A 4J9ZB 1DF5A 4N23A 4P2ZA 3M99B 3HB3B 4MW3A 3ABKB 5LHHA 5LGTA 2XNDG 4QIWF 2D3OW 3KG2A 3H01A 3LDCA 4F4LA 1VQ4V 1XL4A 3LUTB 4GT1A 1KC8W 1FXKC 3ZJZA 1S3JA 2HG5C 3JYCA 5L3CA 3CCRV 2KB1A 3K79A 2ATKC 1DLBA 5DN6G 1GM8A 3RVZA 2YEVA 2X6BA 1R3LC 3MHHC 4H37A 1FS0G 4LC1A 4MVQA 3OR6C 3W7WA 1W0KG 2HKOA 4PA4A 4FIPC 3EHBB 1VQOV 3AG3B 1B6QA 3VBBA 5HFMA 3ABLB 2Y69C 2P7TC 2LP7A 4KP4A 2Z5UA 2EIJC 2WLMA 4Q20A 1AJNA 4PA7A 1AJPA 1OCCC 2IW5A 1YJ9V 1R3KC 2HVJC 1OZ0A 1OCZC 1L1FA 3DGEA 5CMUA 4E2LA 5EBLC 3CXCU 1S72V 1F4MA 4MTGA 3WG7B 1YI2V 3CCJV 1K7DA 1OCRC 2R9IA 4YXWG 3T4ZA 1P7BA 3SYAA 4R8CA 2QKSA 2JDIG 2QE7G 1V55C 3LDEA 3P30A 3OE7G 3CCSV 1NH2D 4MVOA 1AR1B 1AJQA 2EBOA 3F7YC 2A79B 3IGAC 1M56C 3SYOA 3CMAV 4QPJA 4WFGA 3OR7C 3JD1A 3SPGA 3OGCC 2LFRA 4CZZA 1VQ6V 1F4NA 3CCEV 4FJCC 2WPDG 1P4RA 3T2MA 1JOYA 1GTOA 2ZR3A 1SZTA 1JPXA 4GX1A 2QTOA 4U7NA 2B1IA 2HLDG 2XAGA 2XOKG 5J9PC 1K73W 3ASOC 1KP2A 1NKDA 2B5UA 5B1AB 4WF9V 3SYPA 2PI5A 2JK5C 3OEHG 3B8MA 3MD0A 2IJIA 1YIJV 2Z3YA 1EZJA 1BHBA 2QEXV 1H2GA 2EINC 3K03A 3CCQV 2DW4A 1BMFG 2ZDIA 1K9MW 3B77A 1KP3A 5EBMC 4MVMA 3JCZA 2ZXWC 4MVUA 5IYDO 5C93A 4MTOA 4PA6A 4L87A 1M9NA 1S77D 3W7XA 3CPWU 2WLIA 3UKMA 2PI4A 3QO7A 3CC2V 3K06A 3ZRWA 1BL8A 5LHGA 2DYSB 2WWWA 1VQ9V 2Q67A 3VOUA 1K97A 1ORQC 2V7QG 1SRYA 2H94A 4ZBMA 3OM3B 4MSWC 1RM1B 4QPKA 2B1GA 3OW2U 4QE9A 3UM7A 4JGSA 4GX2A 3CCLV 2IJHA 2OCCB 1E1QG 2AHZA 2EILB 3CMEV 3LSSA 4RQFA 4P30A 1VQLV 3K9AA 1GKFA 1YITV 2JJ1G 4QE7A 1S5HC 3LSQA 2QM8A 2P67A 4MVRA 1NH2B 4ZKIA 4UXNA 4JAVA 3STLC 3OFNG 4LBEC 4JF3A 3FB8C 1QBZA 1K5QA 1LNQA 1QLEC 3DTUB 2XAHA 5LBQA 4GCZA 3QNEA 3AG1B 2NLJC 4G28B 5IYCO 1V54B 2IH3C 3E8GA 1VQ5V 1UJWB 5HFLA 1QCEA 5L3DA 2ZDIC 2X7RB 3K0GA 2XAFA 1NJIW 1GM9A 3STZC 2YSUB 1EBOA 3OUSA 2HFEC 1VQ8V 2P90A 4PDRA 2EJRA 1PKXA 4I9WA 3ABLC 3EFFK 3W7SA 2X6CA 4PDMA 1E79G 4N21A 1YJNV 3IC7A 4P9OA 4WFHA 2EIMC 1QR8A 2DQ3A 4TWKA 3ETDA 3OAAG 4MW8A 1NR1A 3E83A 1NVPB 2M7WA 3GB7C 5B1BC 3AG2C 4JYCA 3SYQA 1Y66A 1W0JG 2W0FC 2GHYA 3T1CA 3P32A 1FXKB 2EIKB 3LDDA 1PNLA 3SYCA 3E8FA 2BOBC 1MSWD 1QVFU 2ZR2A 1K3EA 5EC1C 1R3JC 4DO2A 1S76D 5L3GA 3LNMB 3ABMC 4RUEA 2JEUA 1WLEA 2MK3A 4FPPA 1Q81W 3JD2A 4R7CA 1H8HG 4PELA 3ZN1A 2WSSG 3BEHA 2OTLV 1KD1W 1K5SA 2WLKA 3ZMSA 3CCVV 1FXVA 2JEXA 5EC2C 1GK9A 4P9PA 4MS2A 2WLLB 3ZRSA 1OCCB 4KFMA 2IJJA 4JTCB 2ITDC 1CP9A 1RPRA 2FTKA 1VQPV 3F5WC 1YTFD 5B3SC 3ZRXA 1OCRB 3D36A 2NNUA 3I56V 3A0RA 3T4DA 3B8NA 1K92A 2CK3G 2XAJA 1AI5A 1OCOC 5LGUA 5IY5C 1V55B 3CD6V 1PNKA 2WLNA 2ZD9A 1IXMA 2WLHA 1ZWIC 4MVZA 3IFXA 3OUFA 4HZ3A 4JTAB 1VQKV 4KUMA 1M56B 2IJKA 1AI6A 1MABG 4MVSA 5E1AC 2YEVB 5KA6A 1G4YB 1AROP 5EBWC 2DYRC 1PNMA 4X88A 2ZQMA 3RVYA 4UVAA 3ZMZA 3JD4A 1PL0A 1M57B 4WFAV 3K3WA 4J9YB 5CBHA 1MOFA 3ASOB 3ASNB 2UXXA 3X2QC 3BY6A 3FB5C 3FB7C 2QM7A 3QO8A 4PA3A 3AG4C 3FKSG 4UVCA 1Y4MA 2DWDC 5IDJA 1Q86W 1N8RW 1Q7YW 4LP8A 4MT8A 2W6IG 2H8PC 4R50A 1I5YA 2EINB 3ZIAG 1EFRG 2R9RB 2Y48A 4WFEA 3CCUV 2ZXWB 3AEIA 3AG1C 3ABKC 3CCMV 3ZCCA 2OT5A 4UVBA 2JJ2G 3G6EV 5IYBO 1E1RG 2HR3A 3W7UA 2Q69A 3FB6C 3TK1A 3E2EA 3CC4V 3JD3A 4XDLA 5CBGA 1YTFB 1VQNV 1COWG 4RQEA 4RUFA 1SESA 4I5SA 1R3IC 3SPIA 1FFTB 3E89A 3OMAB 2AHYA 1TUEB 4PDLA 4BIZA 4H33A 3AG3C 4PA9A 4RAIA 4WFBV 1JJ2U 3OEEG 4R6ZA 4ASUG 3JD0A 1M1KW 5CBFA 1KECA 1VQMV 1CPYA 3RW0A 2P6JA 1DF4A 1QLEB 3OMIB 4CBCA 2EIKC 2V1DA 2ITCC 3E35A 5CN0A 3SPCA 4XBFA 4JAUA 5L3FA 3WG7C 1F51A 1AI4A 3I55V 2W6JG 4Z1MG 1NBMG 1GO3F 4G2KA 1JVMA 4JYBA 3ZMUA 4FK5C 1K8AW 2WLIB 4QNHB 3QO5A 3ZRWB 2QA4V 1VQ7V 2IU3A 2X6AA 3K04A 2EIMB 5H6QA 4MTFA 2EZPA 5L3EA 2C2AA 5KA5A 1FXHA 4RO2A 1GMGA 1CEZA 1H8EG 1G8MA 2A9HA 2WAMA 2Y69B 3CC7V 4TT3G 2EIJB 3K0DA 1ENVA 4JPRA 3OMNB 5B1BB 1YSCA 3AG2B 1DTOA 3SPJA 3NXSA 1THZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVS A;  3RVZ A;  2YEV A;  4JTD B;  2X6B A;  5E1A C;  1R3L C;  2A0L A;  1G4Y B;  3STL C;  4H37 A;  4LBE C;  2DYR C;  4MVQ A;  3OR6 C;  5EBW C;  3SJQ C;  4X88 A;  3FB8 C;  5B1A C;  3RVY A;  4PA4 A;  1LNQ A;  1QLE C;  4BW5 A;  3TET A;  4WFF A;  4EKW A;  1XL6 A;  5BZB A;  2Y69 C;  2P7T C;  2NLJ C;  4G28 B;  4J9Y B;  2IH3 C;  3E8G A;  5CBH A;  2EIJ C;  2WLM A;  4DXW A;  4PA7 A;  3X2Q C;  3E86 A;  3FB5 C;  3HPL C;  3K0G A;  4XDJ A;  3FB7 C;  3E8B A;  4UUJ C;  5EK0 A;  3STZ C;  1OCC C;  2BOC C;  4PA3 A;  3AG4 C;  1R3K C;  2HVJ C;  2Q6A A;  2DWD C;  5KUK A;  4LP8 A;  1OCZ C;  2HFE C;  3OUS A;  3R65 A;  2H8P C;  4PDR A;  4R50 A;  5EBL C;  2HJF C;  2IH1 C;  4HYO A;  2DYS C;  2R9R B;  4MTG A;  3F7V C;  3RBZ A;  1M57 C;  4WFE A;  4X8A A;  4I9W A;  1OCR C;  3ABL C;  3AG1 C;  3ABK C;  3EFF K;  3T4Z A;  2X6C A;  1P7B A;  4GX5 A;  4PDM A;  3SYA A;  4P9O A;  4WFH A;  4R8C A;  2QKS A;  1K4D C;  2EIM C;  3ASN C;  1J95 A;  1V55 C;  3LDE A;  4TWK A;  2OCC C;  2Q69 A;  4MW8 A;  2EIL C;  3FB6 C;  4X89 A;  4MVO A;  3E83 A;  4XDK A;  3F7Y C;  4XDL A;  5CBG A;  2A79 B;  3GB7 C;  3IGA C;  5B1B C;  1M56 C;  3AG2 C;  3E8H A;  3SYQ A;  3SYO A;  4RUF A;  4WFG A;  3OR7 C;  1R3I C;  2W0F C;  3SPG A;  3SPI A;  3TCU A;  3OGC C;  3T1C A;  3E89 A;  2AHY A;  3LDD A;  5KUM A;  3E8F A;  3SYC A;  2BOB C;  3T2M A;  4PDL A;  2K1E A;  1R3J C;  5EC1 C;  4H33 A;  3AG3 C;  4G27 B;  3LNM B;  3ABM C;  4GX1 A;  4PA9 A;  2QTO A;  3PJS K;  4LCU C;  4RAI A;  4R6Z A;  2WLJ A;  4RUE A;  1V54 C;  5CBF A;  5J9P C;  3RW0 A;  3ASO C;  4OXS A;  2HVK C;  1KKD A;  2DWE C;  3SYP A;  4R7C A;  1K4C C;  4GX0 A;  2JK5 C;  3BEH A;  4CBC A;  2WLK A;  4PDV A;  2EIK C;  2Q68 A;  2ITC C;  5EC2 C;  2EIN C;  3K03 A;  2WLL A;  3SPC A;  4P9P A;  3WG7 C;  4MS2 A;  5EBM C;  2WLL B;  4MVM A;  3ZRS A;  2ZXW C;  4MVU A;  4MTO A;  4PA6 A;  1JVM A;  4KFM A;  3SPH A;  4JTC B;  2ITD C;  2WLI A;  3K08 A;  4J9Z B;  3UKM A;  3F5W C;  3K06 A;  2WLI B;  1BL8 A;  5B3S C;  2Q67 A;  3VOU A;  1ORQ C;  4QNH B;  4P2Z A;  4MW3 A;  4ZBM A;  3T4D A;  2X6A A;  3K04 A;  4MSW C;  1OCO C;  3KG2 A;  4MTF A;  4F4L A;  3LDC A;  5IY5 C;  4QE9 A;  1XL4 A;  2WLN A;  2ZD9 A;  3LUT B;  2WLH A;  4GX2 A;  3UM7 A;  3ZJZ A;  4RO2 A;  2AHZ A;  1ZWI C;  2A9H A;  4MVZ A;  3IFX A;  4P30 A;  3OUF A;  2HG5 C;  3JYC A;  4HZ3 A;  4JTA B;  3K0D A;  2KB1 A;  4QE7 A;  2ATK C;  1S5H C;  3SPJ A;  4MVR A; 
#chains in the Genus database with same CATH topology
 4JTD B;  2RNB A;  3K9S A;  1RSO A;  3MHS C;  3U10 A;  3HKB A;  3ABU A;  2QWQ B;  1SER A;  3CJH B;  4UV8 A;  1GN2 A;  2Y4U A;  2ZE6 A;  4LF6 O;  2LW7 A;  3GWO A;  4XDJ A;  3D3Q A;  5EK0 A;  2BE3 A;  5CA3 A;  2CGO A;  4DW0 A;  2CGN A;  3B2E E;  5H6R A;  1AI7 A;  2DYS C;  3CP1 A;  1XUQ A;  4X1Y B;  1K33 A;  2CTR A;  2F93 B;  2DQ0 A;  2Q5Z A;  2UXB B;  4TSF G;  1JX9 A;  3JAM N;  1L0L H;  2OTJ V;  1N33 O;  3P3P A;  5KHK A;  1T5E A;  3CS5 A;  2F66 C;  5KLV H;  3E22 A;  2FKX A;  1FXK A;  2IU0 A;  4WCE V;  2Q9L A;  1HNX O;  5EZY B;  5FL7 G;  4OX9 O;  1JR9 A;  2LFS A;  5LA6 B;  4DV2 O;  2K1E A;  1SQB H;  4F6E A;  1KQS U;  1JQ0 A;  1WJZ A;  1QHT A;  3PJS K;  2X0L A;  5DM6 V;  2UXD B;  3N2K A;  1I08 A;  4OXS A;  2DYR B;  3K59 A;  3G4S V;  3ABT A;  4FM1 A;  4LNU B;  1K4C C;  1IXB A;  2XAS A;  1ZAU A;  3JAK B;  2Q68 A;  3FAV B;  4D7T A;  1Q6I A;  1R73 A;  1M90 W;  3X2Q B;  4JV5 O;  3AG4 B;  1XHX A;  3SPH A;  1SA0 B;  4JI7 B;  3QF7 A;  1N32 B;  4N23 A;  4X66 O;  4GUN A;  1AP6 A;  4OGQ B;  5LHH A;  1YDX A;  5LGT A;  1Q90 D;  3BPZ A;  2Y4T A;  1Q43 A;  2D3O W;  2LJ2 A;  3LUT B;  5J2U A;  4GKJ B;  1KC8 W;  1FXK C;  3J80 N;  5L3C A;  4LR3 A;  5E79 Z;  2DOS A;  2YIA A;  1IUR A;  2EX3 A;  5TIS Z;  1GM8 A;  5DN6 G;  1DGS A;  4LFB O;  4LC1 A;  3W7W A;  2HKO A;  1N0J A;  2IBZ H;  4TUY A;  2MW2 B;  2P7T C;  3MDS A;  2Z5U A;  2EIJ C;  2NR5 A;  4BWA A;  1AJP A;  4J11 A;  2W0X A;  1YJ9 V;  1R3K C;  4DUY B;  4CH6 A;  1XI1 A;  3ZX6 A;  5CMU A;  4O4J B;  5J2T A;  3CCJ V;  4O4I A;  1K7D A;  4X65 B;  2R9I A;  3OGI B;  4YY3 O;  2V4D A;  3Q4H B;  3U0Z A;  2N74 A;  4MVO A;  1AR1 B;  4NXN O;  1AJQ A;  2F95 B;  4OPA A;  2A79 B;  3IGA C;  3TXQ A;  3SYO A;  5LP6 B;  1XHZ A;  4WFG A;  3OR7 C;  4NTY A;  3CCE V;  4FJC C;  3TXS A;  1HP8 A;  1JPX A;  2AXT Z;  5J9P C;  3SJC C;  4X20 A;  4WF9 V;  2PI5 A;  3VQY A;  2JK5 C;  2HHH O;  2G38 A;  4O2A A;  1XNR O;  1YIJ V;  2QEX V;  3AK2 A;  4LF6 B;  2GBO A;  2CAZ C;  1KP3 A;  1FPO A;  2Y0I A;  5C93 A;  4MTO A;  1Y76 B;  3W7X A;  3UKM A;  3K06 A;  3THO A;  4NXM O;  3NR7 A;  5LHG A;  4ICG A;  4K3A A;  1VQ9 V;  3QVN A;  1K97 A;  2H94 A;  4MSW C;  1JFF B;  3TGU H;  3OW2 U;  2YUA A;  4ZOL A;  2IJH A;  5FLX N;  5FNV A;  4IHJ B;  1VQL V;  1YIT V;  1GKF A;  4U3J A;  2JJ1 G;  4GLX A;  4QE7 A;  1HNW O;  1O9G A;  3OTF A;  3BRC A;  1HNX B;  4OX9 B;  1TA8 A;  4LBE C;  2HJD A;  3FFQ A;  4DV2 B;  1QBZ A;  1K5Q A;  2XAH A;  4GCZ A;  5IJ0 A;  4DV3 O;  2NLJ C;  4G28 B;  2IH3 C;  3AK1 A;  3E8G A;  2KG7 A;  1KB9 F;  1VQ5 V;  4W4K A;  3H1K H;  5HFL A;  3K0G A;  3STZ C;  4X1K A;  5JJJ B;  1IZ3 A;  3D8C A;  2FB5 A;  3C3S A;  2HFE C;  2P90 A;  2GUZ B;  4H13 B;  3H1J H;  3BVO A;  4TV9 B;  1RFY A;  3CSX A;  3W7S A;  3IC7 A;  4WFH A;  1QR8 A;  4J42 A;  2DQ3 A;  4TWK A;  4HBN A;  1BQ0 A;  1U96 A;  2M7W A;  3CRA A;  2Y0P A;  4JYC A;  2W0F C;  2DMX A;  4X1I B;  3SYC A;  3E8F A;  1AIL A;  1MSW D;  2ZR2 A;  3LNM B;  4UB8 Z;  1D5N A;  4ZI7 B;  4R7C A;  5IYZ A;  4DRX B;  2JEX A;  5FNV B;  4IIJ B;  1L8D A;  3ZRS A;  3CRM A;  4KFM A;  3CRC A;  5FPR A;  1UPG A;  1U97 A;  1CP9 A;  1VQP V;  5B3S C;  4DV0 B;  4X62 O;  3D36 A;  3HKD A;  2ZIM A;  2XAJ A;  4YY3 B;  1OCO C;  2YDE A;  3CRR A;  5CB4 B;  2WLH A;  4MVZ A;  3BA8 A;  4JTA B;  1MAB G;  1AI6 A;  2IJK A;  5KAF Z;  2UUC O;  4MVS A;  1J5E O;  1MA1 A;  1TVK A;  2LGW A;  1URF A;  5KA6 A;  4FLZ A;  4X88 A;  1ZSP A;  1KBH A;  5LYJ A;  3ZHV A;  1MMM A;  4JI4 O;  5C8Y A;  1M57 B;  1PL0 A;  1N0N A;  3N2G A;  1MOF A;  3ASN B;  5EIB D;  2UXX A;  2HHH B;  3BY6 A;  1XNR B;  2ZE7 A;  4DUZ O;  3FKS G;  4UVC A;  2R70 A;  3DXR A;  2W6I G;  1ZL8 B;  3H9V A;  1EFR G;  3HKC B;  5LXT B;  3CCU V;  5KX5 B;  3IC9 A;  3K5O A;  2ZXW B;  3AEI A;  3ABK C;  1MSD A;  3ZCC A;  2OT5 A;  3D36 C;  1LUV A;  4NXM B;  5IYB O;  3DSQ A;  4EB6 A;  1YZB A;  2HR3 A;  4WBN A;  3RN4 A;  3JD3 A;  4XDL A;  5CBG A;  1O9H A;  1SES A;  5IYZ B;  1FFT B;  3OMA B;  1US6 A;  4GYC B;  3G6B A;  4PDL A;  2BCC H;  4H33 A;  4RAI A;  1FFX A;  4BR6 A;  4ASU G;  3RW0 A;  3BAA A;  1P49 A;  1QLE B;  4DV3 B;  4I55 A;  4Q6G A;  4I50 A;  5CA0 B;  5GON A;  4UCS A;  3E35 A;  4XBF A;  4JAU A;  2LW1 A;  2P4V A;  2P06 A;  3N27 A;  3RYC A;  1JVM A;  3ZMU A;  1K8A W;  1P7G A;  5LOV A;  2QA4 V;  2EIM B;  1GAX A;  3N2G B;  5ITZ B;  5JQG B;  4RO2 A;  2ZNJ A;  2YID A;  1YSC A;  4TV8 B;  1BQZ A;  4DR6 O;  2AGA A;  1XIL A;  3SJQ C;  1S5L Z;  4X64 O;  2UU9 O;  1Q82 W;  3ETG A;  1XL6 A;  3ABM B;  5BMV B;  4IT5 A;  4EB6 B;  5LHI A;  3ZMT A;  1H38 A;  4FFB A;  1A32 A;  3E86 A;  2Q7G A;  2UXN A;  1HWY A;  4NKG B;  4DV5 O;  4UUJ C;  3RYF B;  2BOC C;  2BTQ B;  1VAR A;  1K34 A;  1YHQ V;  1S0V A;  4JYY A;  2HJF C;  1TUB A;  2IH1 C;  4UV9 A;  4YHH O;  3RBZ A;  4HAM A;  1BHA A;  3QTC A;  4GX5 A;  1L0N H;  4MTX A;  1J95 A;  3SR2 C;  1GN4 A;  4JZG A;  1GH6 A;  5EYP B;  4X62 B;  4X89 A;  3ZMV A;  3E8H A;  5GON B;  2OCH A;  5KHG A;  2LQT A;  5IY5 B;  1R6N A;  1SC5 B;  1PPJ H;  5KUM A;  1WN7 A;  2UUC B;  2BSK A;  1J5E B;  2D2C B;  1FYJ A;  4IYI A;  5LMU O;  4F6R B;  1SKV A;  4YJ3 A;  4JI4 B;  5L3B A;  1QLN A;  4KHP O;  1I94 O;  1MNG A;  2WLL A;  3CYO A;  3D3I A;  1JCH A;  4DUZ B;  2F4V O;  1KUQ A;  2CTW A;  2F43 G;  4NR1 A;  4I4T B;  3K08 A;  3FD9 A;  4P2Z A;  4UCT A;  3UCS C;  2BTO A;  2XND G;  3PN1 A;  4FFB B;  4UFZ A;  3JAR A;  3DC6 A;  1XL4 A;  1VF5 B;  3LSU A;  1S3J A;  3RYH B;  2KB1 A;  3K79 A;  1DLB A;  3RVZ A;  2YEV A;  1XOU A;  1R3L C;  3MHH C;  4Z1V A;  1FS0 G;  4DR2 O;  4J10 A;  3SDL A;  4PA4 A;  2VWK A;  1H2L A;  4OPH A;  4BW9 A;  1B6Q A;  3VBB A;  5HFM A;  2LP7 A;  4Q20 A;  4B3S O;  1AJN A;  1AP5 A;  2AW9 A;  4HNA A;  1OCC C;  2IW5 A;  3DGE A;  1S72 V;  2LGQ A;  5IE9 A;  3WG7 B;  3C90 A;  2XHB A;  2QKS A;  2JDI G;  5JVD B;  2QE7 G;  1V55 C;  1NH2 D;  2EBO A;  1XDC A;  1CXZ B;  3CEI A;  2CTP A;  4LF7 O;  2LFR A;  3QG5 A;  2ZM6 O;  1VQ6 V;  5BXZ A;  1R6T A;  1P4R A;  4JI6 O;  4DR6 B;  2QTO A;  3WB0 A;  2B1I A;  2XOK G;  4X64 B;  5KMG A;  2UU9 B;  5JWP A;  1BGY H;  1WAZ A;  5FPO A;  1KP2 A;  3ZBH A;  2B5U A;  3S3W A;  2N05 A;  3B8M A;  2IJI A;  4IGG A;  1EZJ A;  1BHB A;  4O4L B;  4LH6 A;  3CHX A;  1TGO A;  4QGP A;  4DV5 B;  2WA3 A;  1NS1 A;  1M9N A;  4O2B A;  3CPW U;  4TQD A;  3CC2 V;  1BL8 A;  2DYS B;  2Q67 A;  3VOU A;  1ORQ C;  3L72 H;  3T1H O;  2DJV A;  2B1G A;  1XMQ O;  4H0L B;  4QE9 A;  2CTQ A;  4JGS A;  2CH7 B;  1XRE A;  3CME V;  3LSS A;  1XQ8 A;  1WB8 A;  4B3T O;  1LR1 A;  3JAW A;  2ADQ B;  3A0B Z;  2QM8 A;  1FKA O;  1WPB A;  1NH2 B;  2JS3 A;  1YF2 A;  3DC5 A;  4UXN A;  2XTA A;  4JAV A;  1RSO B;  3RT3 C;  3DTU B;  5LMU B;  5LBQ A;  3HKB B;  3AG1 B;  1UJW B;  4GKK O;  1QCE A;  3R66 A;  2XAF A;  4KHP B;  1EBO A;  1I94 B;  4J7J A;  4PJ0 Z;  1VQ8 V;  4DV1 O;  2OYQ A;  1OJH A;  2F4V B;  1X4T A;  4K8X A;  2LO1 A;  3EFF K;  2X6C A;  1E79 G;  4K35 A;  5A9G A;  3ETD A;  3OAA G;  4YJ2 A;  5CA1 A;  3GB7 C;  3AG2 C;  3SYQ A;  3T1Y O;  1W0J G;  3E22 B;  1QNM A;  3T1C A;  1FXK B;  2EIK B;  3LDD A;  4GZR B;  2BOB C;  1QVF U;  5EC1 C;  1R3J C;  4DO2 A;  3FX7 A;  1S76 D;  4RUE A;  4DR2 B;  2JEU A;  3SGI A;  3N2K B;  5LP6 C;  2MK3 A;  1Q81 W;  3LNN A;  4CS3 A;  4EFB A;  2OTL V;  3JAT A;  3ZMS A;  1WP8 A;  1BCC H;  4B3S B;  4J7Z A;  4I7Z B;  2YC0 A;  2E75 B;  1HW7 A;  3J81 N;  1QU7 A;  2ILM A;  1BZK A;  2ITD C;  2FTK A;  2QWO B;  4DK1 A;  3K5M A;  2NNU A;  2CK3 G;  1AI5 A;  1I0H A;  3CD6 V;  2WLN A;  2ZD9 A;  1IXM A;  1XNQ O;  5J2U B;  3IJ4 A;  4LF7 B;  1IBK O;  4KUM A;  4LF9 O;  2ZM6 B;  4JI2 O;  5E1A C;  4DV6 O;  5EBW C;  1PNM A;  4JI6 B;  2ZQM A;  4UVA A;  4J80 A;  3U11 A;  1P84 F;  5H5N A;  1GN6 A;  4TUY B;  2HEP A;  5CBH A;  4LWS A;  4YJ2 B;  5CA1 B;  3RYI A;  4LFC O;  3F5T A;  1N33 B;  3FB7 C;  1M93 A;  4PA3 A;  4J41 A;  2L6L A;  1N8R W;  1Q7Y W;  4LP8 A;  1Q6U A;  1I5Y A;  5J2T B;  4NTW A;  3CCM V;  4O4I B;  3G6E V;  5DEC A;  1XEQ A;  2RCV A;  3FB6 C;  3T1H B;  4PI2 A;  1XMQ B;  1Y74 A;  4B7E A;  4I5S A;  4B3T B;  5AG2 A;  2DE0 X;  2P5O A;  4JV5 B;  4DV4 O;  1TUE B;  4DR1 O;  4BIZ A;  3AG3 C;  4PA9 A;  3OEE G;  2ZE8 A;  2JGD A;  4UCR A;  1M1K W;  4PV1 B;  4X66 B;  3B09 A;  2RQ6 A;  4X20 B;  4CBC A;  1NT2 B;  4C7U A;  4O2A B;  2ZNI A;  4GKK B;  4TQF A;  3SPC A;  2ZKO A;  5JJE B;  1F51 A;  3I55 V;  3HKE A;  1NBM G;  4JI8 O;  1GO3 F;  4G2K A;  3APQ A;  3SJB C;  2F23 A;  1IBM O;  4DV1 B;  2UXC O;  1EZV H;  4LFB B;  4QNH B;  2YXH A;  3QO5 A;  2JRI A;  3K04 A;  3G67 A;  1LUW A;  5H6Q A;  4FLY A;  5KA5 A;  3CXH F;  4ZOL B;  1H8E G;  1G8M A;  2Y69 B;  2E5L O;  3T1Y B;  2RJZ A;  1DTO A;  4U3J B;  5L3F A;  2A0L A;  2YIC A;  2CUG A;  1OCZ B;  2PTM A;  5B1A C;  2Q4P A;  4BW5 A;  2XT9 A;  3BFR A;  1ROP A;  2XAQ A;  4WFF A;  5BZB A;  1W2B U;  3JSN A;  1R1B A;  5IJ0 B;  4B3R O;  4DXW A;  3WB2 A;  2KG7 B;  1WPX A;  4A5U B;  1RPO A;  4NXN B;  3E8B A;  4JZ2 A;  4X1K B;  4JI1 O;  3R65 A;  1MZF A;  4HYO A;  3F7V C;  2YI8 A;  1M57 C;  2R72 A;  1VIB A;  1RM1 C;  3ASN C;  4DK0 A;  4AQY O;  2OCC C;  2EIL C;  5B3S B;  4DW1 A;  4BAY A;  1OCO B;  1XNQ B;  1WA8 A;  3TCU A;  2VQE O;  5LGN A;  1NTZ H;  1QVG U;  1R6K A;  3GVM A;  1IBK B;  3VQV A;  2JS5 A;  4DV7 O;  1NVP D;  5D5P A;  4JI2 B;  4G27 B;  4L8J A;  4LCU C;  4K0K O;  2WLJ A;  4DV6 B;  4DR7 O;  1V54 C;  1EN4 A;  3ZRV A;  3UO3 A;  4ZHQ A;  1QR9 A;  1KKD A;  5H9C A;  4GX0 A;  1NR7 A;  5B1N A;  3WFV A;  1I5X A;  3ZN0 A;  3W7T A;  1W59 A;  4PDV A;  5B1O A;  3FYI B;  4LFC B;  3L74 H;  4I0X A;  1SET A;  1SQF A;  1HNW B;  2GTA A;  3G71 V;  4J9Z B;  5H2F Z;  4FZ1 A;  1NTM H;  3HB3 B;  5DED A;  3ABK B;  3KG2 A;  3HKD B;  3H01 A;  1V9P A;  1ZLZ A;  4F4L A;  3ZS8 C;  2VQF O;  4YIP A;  2VRZ A;  3JYC A;  1WP7 A;  1N34 O;  2ATK C;  1IDS A;  4H37 A;  1TVK B;  3OR6 C;  2O57 A;  1VMG A;  1W0K G;  4DR1 B;  5LYJ B;  3ABL B;  4FLX A;  5C8Y B;  1KU9 A;  2PYL A;  2WLM A;  3VQW A;  3CRQ A;  1EN5 A;  2OIE A;  2PGG A;  5GTI Z;  4O4H A;  2QTS A;  1F7Y A;  1OZ0 A;  4LF8 O;  4E2L A;  5EBL C;  3DXR B;  1YI2 V;  4JI8 B;  1OCR C;  3T4Z A;  5JH7 A;  4FM2 A;  2ZCE A;  1IBM B;  4R8C A;  2UXC B;  3LDE A;  3P30 A;  3OE7 G;  3CCS V;  3H1H H;  4H44 B;  4WBN B;  3UO2 A;  2GV9 A;  3JAS A;  1M56 C;  3CMA V;  4LH7 A;  1OV9 A;  3JD1 A;  3SPG A;  3OGC C;  1AR4 A;  4CZZ A;  2E74 B;  2E5L B;  1IVS A;  2WPD G;  2PUS A;  3T2M A;  1JOY A;  1GTO A;  2RN9 A;  1ZX3 A;  1TAE A;  2F1M A;  2HLD G;  1FFX B;  2XAG A;  1K73 W;  3ASO C;  4ZIB A;  3SYP A;  3OEH G;  4K8Z A;  1Q8I A;  3MD0 A;  3EVK A;  3RFR A;  4I55 B;  4I50 B;  4B3R B;  2EIN C;  3K03 A;  3UT5 A;  3ZHR A;  3CCQ V;  2DW4 A;  1K9M W;  5K1P A;  4MVM A;  2KSD A;  4MVU A;  5IYD O;  4PA6 A;  4JI1 B;  3RYC B;  4CH4 A;  2WLI A;  2B9Z A;  3QO7 A;  3O65 A;  3ZRW A;  5LOV B;  5IJ9 A;  1YXB A;  1SRY A;  3OM3 B;  4QPK A;  4LFA O;  1HR0 O;  3UM7 A;  2KQX A;  3CCL V;  1E1Q G;  2AHZ A;  4ABM A;  4RQF A;  4P30 A;  2XUM A;  3LSQ A;  2P67 A;  2VQE B;  4MVR A;  4D6T H;  1PM9 A;  4B3M O;  4ZKI A;  1N32 O;  2DN9 A;  4DV7 B;  4JF3 A;  3FB8 C;  1LNQ A;  4K0K B;  4DR7 B;  3CJH A;  3ETQ A;  3A2F A;  5L3D A;  1Z2G A;  1Y6X A;  2X7R B;  3UQ8 A;  1NU1 H;  1H2K A;  4X1Y A;  3M7M X;  1TUB B;  3G80 A;  4I9W A;  4N21 A;  2Z0A A;  1XMO O;  3E83 A;  1Z5V A;  3ZHS A;  4NVP A;  2CDY A;  5B1B C;  1AVM A;  5B66 Z;  3ZHT A;  4J7K A;  2A3Q A;  3P32 A;  1AB3 A;  1YVW A;  1PNL A;  5LA6 A;  2QDO A;  3K5N A;  1K3E A;  2BSK B;  5L3G A;  2WA4 A;  4LNU A;  4FPP A;  3JD2 A;  4LF5 O;  3B40 A;  1H8H G;  4PEL A;  4YJ3 B;  3JAK A;  2WSS G;  1KD1 W;  3FAV A;  2WLK A;  1FXV A;  2YI9 A;  1GK9 A;  4MS2 A;  2WLL B;  2ZE5 A;  1OCC B;  4LF8 B;  1SA0 A;  2VWJ A;  2QWR B;  2ZT9 B;  3OT7 A;  1B06 A;  3ZRX A;  3T4D A;  3B8N A;  2ZIO A;  5LGU A;  1V55 B;  3JAR B;  1ZWI C;  1BT8 A;  3OUF A;  4HZ3 A;  1VQK V;  1KYO F;  4AI8 A;  2L35 A;  4DR5 O;  2A06 H;  2YEV B;  1ARO P;  2DYR C;  1SQX H;  4JYA O;  4YHH B;  2QR4 A;  3RVY A;  1PP9 H;  3ZMZ A;  4E4E A;  3K3W A;  3JCU Z;  5KAI Z;  2Q0A A;  3ICX A;  3X2Q C;  1H2M A;  3KZI Z;  2ODM A;  2QM7 A;  3QO8 A;  4HNA B;  1BSM A;  4CC6 A;  3AG4 C;  1Q86 W;  4O4J A;  4MT8 A;  1XBL A;  2H8P C;  4R50 A;  3ZIA G;  2Y48 A;  5D5Q A;  4RWU A;  3AG1 C;  4UVB A;  3Q4H A;  1E1R G;  3ZED A;  3TK1 A;  2OIG A;  3CC4 V;  5LP6 A;  4LFA B;  5IT9 N;  2H3O A;  1COW G;  4RQE A;  1HR0 B;  1R3I C;  3L70 H;  3SPI A;  5GTH Z;  1JA8 A;  4FLV A;  2CE4 A;  3O9O A;  2AZ2 A;  1KMI Z;  4WFB V;  4B3M B;  3I5D A;  4YIO A;  4R6Z A;  4CC5 A;  5CBF A;  1CPY A;  4U3F H;  1KKC A;  3M8A A;  2P6J A;  5KMG B;  4UCU A;  1DF4 A;  3L73 H;  3ZHU A;  4CH3 A;  4FLW A;  1BS3 A;  2EIK C;  2V1D A;  2ITC C;  1SZX A;  3S3X A;  4Z1M G;  1UFI A;  1Y76 A;  1G6U A;  2YXL A;  4JYB A;  3BCC H;  4FFK A;  4O2B B;  4DR3 O;  1VQ7 V;  1JFF A;  2X6A A;  1XMO B;  2EZP A;  4IHJ A;  1FXH A;  2E3C A;  1GMG A;  1CEZ A;  2WAM A;  2A9H A;  3CC7 V;  2EIJ B;  1ENV A;  4JPR A;  3AG2 B;  3NXS A;  3JAW B;  1THZ A;  5BR8 O;  1PD3 A;  3ETE A;  4DV0 O;  4CS4 A;  4PHZ A;  3TET A;  4EKW A;  4UCO A;  1MG1 A;  1RP3 B;  2JIZ G;  4LF5 B;  3HPL C;  2EZO A;  2VS0 A;  3FYE B;  4UB6 Z;  5KUK A;  2Q6A A;  5F2V O;  1YJW V;  2GUZ A;  1IBL O;  3ZHQ A;  4TV9 A;  1AR5 A;  1OHH G;  4NTX A;  1QQC A;  4X8A A;  2P4K A;  2QKC A;  1B04 A;  4JI5 O;  1FAF A;  1K4D C;  1VF6 A;  4QJF B;  4W4L A;  4XDK A;  1VEW A;  3VQX A;  1NQT A;  4X1I A;  4EEQ A;  4FLT A;  2RDC A;  2GDS A;  1ZUQ A;  3OTO O;  4U7O A;  4DR5 B;  1GM7 A;  4JAS A;  4JYA B;  4ZI7 A;  2HVK C;  1S5J A;  2DWE C;  2K9P A;  1WNS A;  3ML0 A;  4JI3 O;  1F23 A;  4DRX A;  4KL1 A;  4BIU A;  4IIJ A;  3JAT B;  2Q0O C;  2M6Y A;  2E76 B;  5GW7 A;  2GSM B;  4FMT A;  4PI0 A;  2QM4 A;  1N36 O;  4LF4 O;  1WB7 A;  5LMN O;  3BAB A;  1YEW A;  4FM0 A;  1SQQ H;  1DF5 A;  1VF6 C;  3P3N A;  2Q7H A;  3M99 B;  4MW3 A;  5CB4 A;  4QIW F;  4B7K A;  1VQ4 V;  3LDC A;  2QJ1 A;  1Q5O A;  4GT1 A;  3ZJZ A;  2QGN A;  2HG5 C;  3CCR V;  1BE3 H;  3RWR D;  1HNZ O;  2X6B A;  1JMK C;  4MVQ A;  3A8T A;  2AZ0 A;  2KKW A;  3TJT A;  4FIP C;  3HR0 A;  3EHB B;  1VQO V;  4IYH A;  3AG3 B;  2ETN A;  1H2S B;  4FLU A;  2Y69 C;  4KP4 A;  1NI8 A;  4PA7 A;  4LWS B;  2RMK B;  3RYI B;  3JAL A;  3GWK C;  2HVJ C;  1ZL8 A;  1OCZ C;  1L1F A;  2EJ7 A;  2Q7E A;  3HKC A;  5LXT A;  3CXC U;  1F4M A;  5KX5 A;  4MTG A;  1JJO A;  4YXW G;  5JJN B;  1P7B A;  3SYA A;  4NYK A;  4I9Q A;  1SQP H;  4DR3 B;  2Q8V A;  3F7Y C;  5K1X A;  3CX5 F;  2QSA A;  4QPJ A;  1X59 A;  1D2D A;  3OD4 A;  1Y74 B;  1F4N A;  2UUB O;  5BR8 B;  2ZR3 A;  2FYU H;  1SF9 A;  1SZT A;  4GX1 A;  3K58 A;  3H1L H;  4U7N A;  3K57 A;  1FD9 A;  2JGD B;  1NKD A;  5B1A B;  5CA0 A;  3B4S A;  4DR4 O;  2Z3Y A;  2PYJ A;  2OWO A;  1H2G A;  3A0H Z;  1BMF G;  2ZDI A;  3L71 H;  3B77 A;  5EBM C;  3JCZ A;  2ZXW C;  3HKE B;  4L87 A;  1IBL B;  2A7W A;  3CWB H;  4LF9 B;  1S77 D;  2PI4 A;  2NN4 A;  2WWW A;  4JI5 B;  5BY1 A;  3KCY A;  2V7Q G;  4ZBM A;  2ZIN A;  4CS2 A;  1RM1 B;  2N04 A;  5ITZ A;  5JQG A;  3IAY A;  4GX2 A;  2OCC B;  2EIL B;  3AK3 A;  1FJG O;  4JAA A;  3JAL B;  3K9A A;  4TV8 A;  2PY5 A;  4DYL A;  1S5H C;  4CH5 A;  4JI0 O;  2YXY A;  2PF4 E;  2EUL A;  5IWA O;  3STL C;  3OFN G;  2IM9 A;  3OTO B;  1Z5W A;  1QLE C;  3L9D A;  4B08 A;  5BMV A;  3EXA A;  1G1X B;  3QNE A;  5KHJ A;  5IYC O;  1V54 B;  3KCX A;  1I7F A;  2R9A A;  4JI3 B;  2ZDI C;  3RYF A;  2BTQ A;  1NJI W;  1GM9 A;  2YSU B;  5EIB C;  4PD4 F;  3OUS A;  4LF4 B;  1N36 B;  4PDR A;  2EJR A;  5LMN B;  1PKX A;  1EM1 A;  3ABL C;  4PDM A;  1YJN V;  4DV4 B;  4P9O A;  3KKY A;  2EIM C;  2QWP B;  5EYP A;  2P22 C;  3WU2 Z;  2UUA O;  4Z2W A;  4MW8 A;  1NR1 A;  3CE2 A;  5KHI A;  1NVP B;  4EFE A;  4BIO A;  1D5A A;  1Y66 A;  2GHY A;  3K5L A;  1WA8 B;  2YS8 A;  2FL4 A;  1HNZ B;  3ABM C;  3JSL A;  4F6R A;  1M5I A;  1WLE A;  3AG7 A;  3BA9 A;  1DK1 A;  4AHC A;  4ZHQ B;  3ZN1 A;  3BEH A;  1K5S A;  1YCI A;  3CCV V;  1VF7 A;  5EC2 C;  4P9P A;  4I0X B;  3H1I H;  1MZE A;  5A2Q N;  4I4T A;  2IJJ A;  4JTC B;  1B3Q A;  1RPR A;  5KHH A;  1YTF D;  3F5W C;  5B5E Z;  2QKA A;  2UXB O;  1HDJ A;  4AIL C;  1NTK H;  1OCR B;  3I56 V;  3A0R A;  1K92 A;  3WB1 A;  5IY5 C;  4FZ0 A;  1PNK A;  3RYH A;  2JGU A;  3IFX A;  2Q73 A;  3CB2 A;  4X9Q A;  1M56 B;  2YIB A;  1M4U A;  2UUB B;  1VP7 A;  1G4Y B;  2UXD O;  1SQG A;  1Q3E A;  3JD4 A;  5JCO A;  4FVM A;  4WFA V;  4J9Y B;  3APO A;  4AQY B;  3ASO B;  2YIB D;  1GRJ A;  3FB5 C;  3SJA C;  2FML A;  4DR4 B;  1N4C A;  3L75 H;  1IX9 A;  1Y4M A;  2DWD C;  1GN3 A;  5IDJ A;  4O4H B;  2EIN B;  2R9R B;  4JI7 O;  4WFE A;  5JVD A;  2JJ2 G;  2ADP A;  1SS3 A;  1Y67 A;  3C3T A;  5JH7 B;  2JVD A;  3W7U A;  2Q69 A;  1H2N A;  4GKJ O;  2QWN B;  3E2E A;  4TOI A;  4KXR A;  1YTF B;  1VQN V;  4RUF A;  3JAS B;  1Q6H A;  1FJG B;  3E89 A;  2AHY A;  5LL6 Y;  3BHP A;  1PL4 A;  2GTS A;  4JI0 B;  1JJ2 U;  4D7S A;  5IWA B;  5JCO C;  3JD0 A;  1KEC A;  1VQM V;  3OMI B;  4IL6 Z;  4O4L A;  2HP8 A;  4DUY O;  1EN6 A;  5CN0 A;  3MAQ A;  2VQF B;  3WG7 C;  3UT5 B;  1AI4 A;  2W6J G;  5EZY A;  1SQV H;  1N34 B;  4X65 O;  1NZ6 A;  2ARH A;  4FK5 C;  4UCV A;  2WLI B;  3RGB A;  4NB5 A;  3ZRW B;  3J7A U;  1PV0 A;  2IU3 A;  5IJ9 B;  1ZTE A;  2UUA B;  4MTF A;  5L3E A;  2CH7 A;  2C2A A;  2PZS A;  4TT3 G;  3K0D A;  3OMN B;  5B1B B;  3SPJ A; 
#chains in the Genus database with same CATH homology
 4JTD B;  1PD3 A;  3ETE A;  2A0L A;  3SJQ C;  1OCZ B;  5B1A C;  3MHS C;  3TET A;  4BW5 A;  1ROP A;  3ETG A;  1Q82 W;  2XAQ A;  3ABU A;  4WFF A;  4EKW A;  1XL6 A;  3ABM B;  5BZB A;  1SER A;  1W2B U;  5LHI A;  3ZMT A;  1H38 A;  4UV8 A;  1MG1 A;  2JIZ G;  4DXW A;  1WPX A;  3E86 A;  1RPO A;  2UXN A;  2EZO A;  1HWY A;  3GWO A;  3HPL C;  3E8B A;  4XDJ A;  4UUJ C;  5EK0 A;  3FYE B;  2BOC C;  5KUK A;  2Q6A A;  5CA3 A;  1YJW V;  3R65 A;  1K34 A;  1YHQ V;  1S0V A;  2HJF C;  2IH1 C;  4HYO A;  4UV9 A;  1AI7 A;  2DYS C;  5H6R A;  3F7V C;  1OHH G;  3RBZ A;  3CP1 A;  4HAM A;  1M57 C;  1BHA A;  4X8A A;  1K33 A;  4GX5 A;  1RM1 C;  1K4D C;  2DQ0 A;  3ASN C;  1J95 A;  4MTX A;  4QJF B;  4TSF G;  1JX9 A;  2OCC C;  2EIL C;  4X89 A;  5B3S B;  2OTJ V;  4XDK A;  3ZMV A;  3E8H A;  4BAY A;  1NQT A;  1OCO B;  5IY5 B;  1FXK A;  2IU0 A;  3TCU A;  5LGN A;  1R6N A;  1QVG U;  4WCE V;  1R6K A;  5FL7 G;  5KUM A;  1NVP D;  2LFS A;  4U7O A;  2K1E A;  1KQS U;  4G27 B;  1JQ0 A;  3PJS K;  4LCU C;  2X0L A;  2WLJ A;  5DM6 V;  1GM7 A;  1V54 C;  4JAS A;  3ZRV A;  4OXS A;  2DYR B;  2HVK C;  1QR9 A;  1KKD A;  3G4S V;  3ABT A;  2DWE C;  3ML0 A;  1K4C C;  4GX0 A;  5H9C A;  5L3B A;  1NR7 A;  2XAS A;  5B1N A;  1I5X A;  3WFV A;  3ZN0 A;  3W7T A;  1F23 A;  1QLN A;  4PDV A;  4BIU A;  2Q68 A;  5B1O A;  1R73 A;  3FYI B;  5GW7 A;  2GSM B;  2WLL A;  3CYO A;  1SET A;  4FMT A;  1M90 W;  3X2Q B;  3D3I A;  1JCH A;  2F43 G;  3AG4 B;  3SPH A;  3G71 V;  3K08 A;  4J9Z B;  1DF5 A;  4N23 A;  4P2Z A;  3M99 B;  3HB3 B;  4MW3 A;  3ABK B;  5LHH A;  5LGT A;  2XND G;  4QIW F;  2D3O W;  3KG2 A;  3H01 A;  3LDC A;  4F4L A;  1VQ4 V;  1XL4 A;  3LUT B;  4GT1 A;  1KC8 W;  1FXK C;  3ZJZ A;  1S3J A;  2HG5 C;  3JYC A;  5L3C A;  3CCR V;  2KB1 A;  3K79 A;  2ATK C;  1DLB A;  5DN6 G;  1GM8 A;  3RVZ A;  2YEV A;  2X6B A;  1R3L C;  3MHH C;  4H37 A;  1FS0 G;  4LC1 A;  4MVQ A;  3OR6 C;  3W7W A;  1W0K G;  2HKO A;  4PA4 A;  4FIP C;  3EHB B;  1VQO V;  3AG3 B;  1B6Q A;  3VBB A;  5HFM A;  3ABL B;  2Y69 C;  2P7T C;  2LP7 A;  4KP4 A;  2Z5U A;  2EIJ C;  2WLM A;  4Q20 A;  1AJN A;  4PA7 A;  1AJP A;  1OCC C;  2IW5 A;  1YJ9 V;  1R3K C;  2HVJ C;  1OZ0 A;  1OCZ C;  1L1F A;  3DGE A;  5CMU A;  4E2L A;  5EBL C;  3CXC U;  1S72 V;  1F4M A;  4MTG A;  3WG7 B;  1YI2 V;  3CCJ V;  1K7D A;  1OCR C;  2R9I A;  4YXW G;  3T4Z A;  1P7B A;  3SYA A;  4R8C A;  2QKS A;  2JDI G;  2QE7 G;  1V55 C;  3LDE A;  3P30 A;  3OE7 G;  3CCS V;  1NH2 D;  4MVO A;  1AR1 B;  1AJQ A;  2EBO A;  3F7Y C;  2A79 B;  3IGA C;  1M56 C;  3SYO A;  3CMA V;  4QPJ A;  4WFG A;  3OR7 C;  3JD1 A;  3SPG A;  3OGC C;  2LFR A;  4CZZ A;  1VQ6 V;  1F4N A;  3CCE V;  4FJC C;  2WPD G;  1P4R A;  3T2M A;  1JOY A;  1GTO A;  2ZR3 A;  1SZT A;  1JPX A;  4GX1 A;  2QTO A;  4U7N A;  2B1I A;  2HLD G;  2XAG A;  2XOK G;  5J9P C;  1K73 W;  3ASO C;  1KP2 A;  1NKD A;  2B5U A;  5B1A B;  4WF9 V;  3SYP A;  2PI5 A;  2JK5 C;  3OEH G;  3B8M A;  3MD0 A;  2IJI A;  1YIJ V;  2Z3Y A;  1EZJ A;  1BHB A;  2QEX V;  1H2G A;  2EIN C;  3K03 A;  3CCQ V;  2DW4 A;  1BMF G;  2ZDI A;  1K9M W;  3B77 A;  1KP3 A;  5EBM C;  4MVM A;  3JCZ A;  2ZXW C;  4MVU A;  5IYD O;  5C93 A;  4MTO A;  4PA6 A;  4L87 A;  1M9N A;  1S77 D;  3W7X A;  3CPW U;  2WLI A;  3UKM A;  2PI4 A;  3QO7 A;  3CC2 V;  3K06 A;  3ZRW A;  1BL8 A;  5LHG A;  2DYS B;  2WWW A;  1VQ9 V;  2Q67 A;  3VOU A;  1K97 A;  1ORQ C;  2V7Q G;  1SRY A;  2H94 A;  4ZBM A;  3OM3 B;  4MSW C;  1RM1 B;  4QPK A;  2B1G A;  3OW2 U;  4QE9 A;  3UM7 A;  4JGS A;  4GX2 A;  3CCL V;  2IJH A;  2OCC B;  1E1Q G;  2AHZ A;  2EIL B;  3CME V;  3LSS A;  4RQF A;  4P30 A;  1VQL V;  3K9A A;  1GKF A;  1YIT V;  2JJ1 G;  4QE7 A;  1S5H C;  3LSQ A;  2QM8 A;  2P67 A;  4MVR A;  1NH2 B;  4ZKI A;  4UXN A;  4JAV A;  3STL C;  3OFN G;  4LBE C;  4JF3 A;  3FB8 C;  1QBZ A;  1K5Q A;  1LNQ A;  1QLE C;  3DTU B;  2XAH A;  5LBQ A;  4GCZ A;  3QNE A;  3AG1 B;  2NLJ C;  4G28 B;  5IYC O;  1V54 B;  2IH3 C;  3E8G A;  1VQ5 V;  1UJW B;  5HFL A;  1QCE A;  5L3D A;  2ZDI C;  2X7R B;  3K0G A;  2XAF A;  1NJI W;  1GM9 A;  3STZ C;  2YSU B;  1EBO A;  3OUS A;  2HFE C;  1VQ8 V;  2P90 A;  4PDR A;  2EJR A;  1PKX A;  4I9W A;  3ABL C;  3EFF K;  3W7S A;  2X6C A;  4PDM A;  1E79 G;  4N21 A;  1YJN V;  3IC7 A;  4P9O A;  4WFH A;  2EIM C;  1QR8 A;  2DQ3 A;  4TWK A;  3ETD A;  3OAA G;  4MW8 A;  1NR1 A;  3E83 A;  1NVP B;  2M7W A;  3GB7 C;  5B1B C;  3AG2 C;  4JYC A;  3SYQ A;  1Y66 A;  1W0J G;  2W0F C;  2GHY A;  3T1C A;  3P32 A;  1FXK B;  2EIK B;  3LDD A;  1PNL A;  3SYC A;  3E8F A;  2BOB C;  1MSW D;  1QVF U;  2ZR2 A;  1K3E A;  5EC1 C;  1R3J C;  4DO2 A;  1S76 D;  5L3G A;  3LNM B;  3ABM C;  4RUE A;  2JEU A;  1WLE A;  2MK3 A;  4FPP A;  1Q81 W;  3JD2 A;  4R7C A;  1H8H G;  4PEL A;  3ZN1 A;  2WSS G;  3BEH A;  2OTL V;  1KD1 W;  1K5S A;  2WLK A;  3ZMS A;  3CCV V;  1FXV A;  2JEX A;  5EC2 C;  1GK9 A;  4P9P A;  4MS2 A;  2WLL B;  3ZRS A;  1OCC B;  4KFM A;  2IJJ A;  4JTC B;  2ITD C;  1CP9 A;  1RPR A;  2FTK A;  1VQP V;  3F5W C;  1YTF D;  5B3S C;  3ZRX A;  1OCR B;  3D36 A;  2NNU A;  3I56 V;  3A0R A;  3T4D A;  3B8N A;  1K92 A;  2CK3 G;  2XAJ A;  1AI5 A;  1OCO C;  5LGU A;  5IY5 C;  1V55 B;  3CD6 V;  1PNK A;  2WLN A;  2ZD9 A;  1IXM A;  2WLH A;  1ZWI C;  4MVZ A;  3IFX A;  3OUF A;  4HZ3 A;  4JTA B;  1VQK V;  4KUM A;  1M56 B;  2IJK A;  1AI6 A;  1MAB G;  4MVS A;  5E1A C;  2YEV B;  5KA6 A;  1G4Y B;  1ARO P;  5EBW C;  2DYR C;  1PNM A;  4X88 A;  2ZQM A;  3RVY A;  4UVA A;  3ZMZ A;  3JD4 A;  1PL0 A;  1M57 B;  4WFA V;  3K3W A;  4J9Y B;  5CBH A;  1MOF A;  3ASO B;  3ASN B;  2UXX A;  3X2Q C;  3BY6 A;  3FB5 C;  3FB7 C;  2QM7 A;  3QO8 A;  4PA3 A;  3AG4 C;  3FKS G;  4UVC A;  1Y4M A;  2DWD C;  5IDJ A;  1Q86 W;  1N8R W;  1Q7Y W;  4LP8 A;  4MT8 A;  2W6I G;  2H8P C;  4R50 A;  1I5Y A;  2EIN B;  3ZIA G;  1EFR G;  2R9R B;  2Y48 A;  4WFE A;  3CCU V;  2ZXW B;  3AEI A;  3AG1 C;  3ABK C;  3CCM V;  3ZCC A;  2OT5 A;  4UVB A;  2JJ2 G;  3G6E V;  5IYB O;  1E1R G;  2HR3 A;  3W7U A;  2Q69 A;  3FB6 C;  3TK1 A;  3E2E A;  3CC4 V;  3JD3 A;  4XDL A;  5CBG A;  1YTF B;  1VQN V;  1COW G;  4RQE A;  4RUF A;  1SES A;  4I5S A;  1R3I C;  3SPI A;  1FFT B;  3E89 A;  3OMA B;  2AHY A;  1TUE B;  4PDL A;  4BIZ A;  4H33 A;  3AG3 C;  4PA9 A;  4RAI A;  4WFB V;  1JJ2 U;  3OEE G;  4R6Z A;  4ASU G;  3JD0 A;  1M1K W;  5CBF A;  1KEC A;  1VQM V;  1CPY A;  3RW0 A;  2P6J A;  1DF4 A;  1QLE B;  3OMI B;  4CBC A;  2EIK C;  2V1D A;  2ITC C;  3E35 A;  5CN0 A;  3SPC A;  4XBF A;  4JAU A;  5L3F A;  3WG7 C;  1F51 A;  1AI4 A;  3I55 V;  2W6J G;  4Z1M G;  1NBM G;  1GO3 F;  4G2K A;  1JVM A;  4JYB A;  3ZMU A;  4FK5 C;  1K8A W;  2WLI B;  4QNH B;  3QO5 A;  3ZRW B;  2QA4 V;  1VQ7 V;  2IU3 A;  2X6A A;  3K04 A;  2EIM B;  5H6Q A;  4MTF A;  2EZP A;  5L3E A;  2C2A A;  5KA5 A;  1FXH A;  4RO2 A;  1GMG A;  1CEZ A;  1H8E G;  1G8M A;  2A9H A;  2WAM A;  2Y69 B;  3CC7 V;  4TT3 G;  2EIJ B;  3K0D A;  1ENV A;  4JPR A;  3OMN B;  5B1B B;  1YSC A;  3AG2 B;  1DTO A;  3SPJ A;  3NXS A;  1THZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...