3K06A

Crystal structure of cng mimicking nak mutant, nak-ntpp, k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGNTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
molecule keywords Potassium channel protein NaK
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k06A00
4X89A 3F7VC 2JK5C 3AG1C 5KUKA 3E8FA 4UUJC 2K1EA 2DWEC 3SYPA 4DXWA 1OCRC 3KG2A 2HJFC 5EC2C 4JTAB 4OXSA 1R3LC 3ABKC 1M57C 2HG5C 2DYRC 4MS2A 3JYCA 3K08A 3AG3C 1OCOC 2EINC 3SYOA 3ASNC 4MW3A 5CBFA 4MVUA 4ZBMA 2W0FC 3OUFA 3X2QC 4R50A 3E8HA 1R3KC 4WFGA 2IH1C 5EK0A 3RBZA 3T4ZA 3ZJZA 2AHYA 3AG2C 1K4CC 3BEHA 3LDEA 1LNQA 3R65A 4PA7A 1XL6A 3E8BA 3T2MA 1M56C 3UM7A 4PA3A 4MTFA 4TWKA 4R7CA 4H37A 1OCCC 4X8AA 2ATKC 4P2ZA 2X6AA 4WFFA 1ZWIC 4QE9A 4XDKA 5B1AC 3SPGA 5BZBA 3K03A 3SYQA 5J9PC 2ITDC 3LDDA 4P30A 3OR6C 3LNMB 3EFFK 4MVZA 2X6BA 2YEVA 3SPCA 5CBHA 3RVZA 4LCUC 4CBCA 2NLJC 2Q67A 3E83A 2ITCC 4F4LA 2WLHA 2DWDC 3AG4C 1R3IC 3E89A 4I9WA 1S5HC 4P9OA 2A9HA 5B3SC 3TETA 2WLLA 4MVOA 2Q6AA 1G4YB 2A79B 3OR7C 4MW8A 1R3JC 2QTOA 3OGCC 4GX0A 3VOUA 4PDLA 3OUSA 5CBGA 5EBWC 4G28B 1P7BA 1V55C 2WLIB 2AHZA 1OCZC 3K0DA 1KKDA 4RUFA 2WLIA 5KUMA 2BOBC 2WLMA 3STLC 2ZD9A 2EILC 4R8CA 4HYOA 3SJQC 2KB1A 3PJSK 3STZC 3FB6C 2IH3C 4PDMA 4GX2A 2WLNA 2WLKA 3SYAA 2WLJA 4G27B 1ORQC 4RO2A 5B1BC 3T1CA 4MVMA 4JTCB 3FB5C 2H8PC 4H33A 4RUEA 2WLLB 1V54C 4PDVA 3IFXA 4PA6A 1XL4A 4MSWC 2Y69C 2HFEC 4JTDB 1BL8A 3SPIA 4WFEA 5EC1C 3SPJA 3UKMA 4KFMA 3LUTB 4XDLA 3FB7C 2Q68A 5IY5C 1K4DC 3K04A 5E1AC 2ZXWC 2DYSC 3K0GA 2R9RB 2BOCC 3F7YC 2HVJC 4GX1A 1J95A 4GX5A 4P9PA 4PDRA 4R6ZA 4X88A 5EBMC 3LDCA 3RVYA 3SPHA 2QKSA 4RAIA 3WG7C 4BW5A 4J9YB 4MVSA 4LBEC 2P7TC 2HVKC 2X6CA 4MTOA 3ASOC 4HZ3A 4J9ZB 2EIMC 4MTGA 3F5WC 4WFHA 4LP8A 3K06A 4QE7A 3SYCA 3HPLC 3IGAC 4EKWA 1JVMA 4XDJA 3E86A 4MVQA 4QNHB 4PA4A 4PA9A 3ABLC 2Q69A 3ABMC 3RW0A 3ZRSA 2EIKC 1QLEC 2A0LA 3GB7C 2EIJC 5EBLC 3E8GA 3TCUA 4MVRA 2OCCC 3FB8C 3T4DA
chains in the Genus database with same CATH superfamily
2IW5A 2JK5C 3ABMB 4OX9B 1YXBA 4FZ0A 3K9AA 4OXSA 3APOA 3T1HB 3OD4A 1FKAO 2R70A 2YI8A 4J42A 1XNRO 4X62O 3JD1A 4UXNA 4DR5B 1XEQA 1K4CC 3ZRVA 3KKYA 3U10A 1H2KA 1B3QA 3E22B 2ATKC 1ZWIC 2GHYA 3ETGA 1B06A 3J81N 5LYJB 2X6BA 1XNQO 3RN4A 4N21A 2XTAA 3APQA 1K92A 3W7TA 4MW8A 2ZE8A 3JCUZ 3P32A 2YXHA 3O9OA 5JJJB 3CRAA 4DK0A 4EFBA 4MT8A 1MZEA 1THZA 3C90A 2NN4A 3K59A 3JARB 3SYAA 1I0HA 1I7FA 1SA0B 5LBQA 4LFBB 2UXDB 4DV5B 1ZAUA 3H1JH 3LSUA 5IJ9B 1D2DA 5H9CA 4YJ2A 1B6QA 2Q68A 4BIOA 1XQ8A 4DR2O 5E1AC 3U11A 3EXAA 4P9PA 3RVYA 1BS3A 1BQ0A 5AG2A 1SC5B 4LBEC 3RYHB 3ASOC 2BTQB 4NTYA 5LHGA 4EEQA 4X64O 4LF4B 3ABKB 4JI3O 4I0XA 4QJFB 3CS5A 3SGIA 1QHTA 1JCHA 2EJ7A 5EBLC 2OCCC 1SS3A 1VQLV 3K5NA 3ZHVA 4PD4F 4F6RB 4DV1B 4WFBV 2F95B 4UVCA 1RFYA 2WSSG 3T1HO 1PM9A 3JYCA 5IE9A 5TISZ 4A5UB 1Q81W 4JI8O 4TV9B 2CK3G 3D36C 4R50A 1IBLO 3OMIB 2PY5A 5IY5B 4YJ3B 3T4ZA 3LDEA 4PA7A 5LMUO 1M56C 2JEXA 3QF7A 4QE9A 2BE3A 3L74H 2H3OA 3OTOO 4I5SA 4LWSA 4FLYA 3E83A 2WLHA 3TETA 2A9HA 2CTRA 4JI1B 1R3JC 5IYBO 3BAAA 1GN2A 4G28B 2JGUA 3DSQA 1KKDA 2GUZA 4PI2A 4R8CA 3SJQC 3PJSK 5IWAO 4DV0B 3HKEA 4ZHQB 2ZM6O 1URFA 1N36B 3FFQA 3MHSC 1H2MA 1M5IA 1FFTB 3G6EV 2FTKA 2LJ2A 2WWWA 3HR0A 1BHBA 4KHPO 4IYHA 1K4DC 3IC7A 3JD4A 4GX5A 1FFXA 5LL6Y 1SA0A 2YDEA 3BA8A 3ABUA 4LFBO 3E2EA 4BR6A 1S77D 2LW7A 4QE7A 1HNZB 4IIJA 1W0KG 2N05A 4JZGA 5CA1B 3E35A 5LHHA 4B7KA 2RMKB 4X64B 1Y6XA 2P4VA 4TUYA 2ZDIA 1OZ0A 5BMVB 1MSDA 5DM6V 3JD0A 4QPKA 2RCVA 1QLNA 4ZI7A 2XUMA 4YY3B 3K08A 3ZBHA 3X2QC 3DXRB 3OUFA 3OM3B 1K5SA 1QVFU 4PJ0Z 5EZYB 1L0LH 1GRJA 2G38A 1MA1A 2CDYA 2KG7A 4YXWG 1F4MA 5J2UB 1M57B 2ITDC 3LDDA 3OR6C 4X20A 5CBHA 3JD3A 4DV2O 4WBNB 2FKXA 2RQ6A 4LF9B 4PDLA 2R9IA 1QLEB 3CP1A 3BCCH 1RM1C 4RUFA 2BOBC 3LSQA 2ZD9A 1G8MA 4JI0B 1XHXA 4LR3A 4JV5O 2Q4PA 3WG7B 3Q4HB 1N32B 4PA6A 1NTMH 4E4EA 1T5EA 4JTDB 2Z0AA 3L73H 2E5LB 1WPXA 1KECA 3C3TA 1AJPA 1KQSU 1P7GA 4AQYO 1XREA 3G80A 1TGOA 2HVJC 1BHAA 1KP2A 2CUGA 3WG7C 2UXCO 2ADPA 5J2TA 4EB6B 2X0LA 3AK1A 1SQPH 2EJRA 3IC9A 4RWUA 1M4UA 3D3IA 1YTFD 4I0XB 2GSMB 1N34B 1K34A 4CH3A 2DE0X 3ABMC 2UXXA 4XBFA 1QLEC 3GB7C 2UUAO 2YICA 1TUBB 1W0JG 2EIJB 2QR4A 2Z5UA 1UFIA 1F4NA 4QIWF 3UO2A 3TXSA 4LF8B 1AVMA 1JMKC 1IXBA 5JVDB 1Y74A 1M57C 3N2KB 4O4HB 3ML0A 4MS2A 1MOFA 3O65A 3SYOA 5EIBC 3J80N 4MW3A 4ZBMA 3G6BA 1BT8A 2JEUA 3BHPA 4DR4B 2GV9A 5LGUA 4YJ3A 5EK0A 4CS2A 3X2QB 1HWYA 1P49A 2YXYA 4HNAA 4TWKA 4LF6O 2X6AA 4XDKA 1I94B 2DQ0A 3LNMB 2XAHA 4LCUC 2Q7EA 4JI4O 4DUYO 2P4KA 4DRXB 2UXBO 2P5OA 2IJJA 1VF5B 1XMOO 3S3WA 4RQEA 3HKBB 4UCVA 5EBWC 4UFZA 3CCJV 1OCZC 3C3SA 3K0DA 3HKCA 4IYIA 2F93B 4JYAO 2QKAA 4GX2A 2WLJA 2QSAA 4O4JA 2Q73A 2V4DA 5D5PA 1BMFG 4WBNA 4O4IB 5CA0B 1GAXA 2DJVA 3OW2U 2Y4UA 1CP9A 3UKMA 4KFMA 4B3SO 4IHJA 1PKXA 4J7ZA 3B09A 3CPWU 1YIJV 5JJNB 1FFXB 1SQVH 1PP9H 3ZN0A 3F7YC 2UXBB 3AEIA 4JAAA 4K0KO 1GK9A 3OFNG 3DC6A 3WU2Z 1Z5WA 1TAEA 1VQ9V 4EKWA 2BTQA 3N27A 3H1IH 3UCSC 1AROP 1TUEB 3LSSA 2EZOA 1G6UA 4FIPC 4TUYB 1XUQA 1R6TA 3J7AU 5KAFZ 4JGSA 2EIKB 1GTOA 1DK1A 3VQWA 5KUKA 3E8FA 3KG2A 3ZS8C 1GM8A 4JTAB 4F6RA 1NZ6A 4NXNB 1G1XB 3OEEG 4GT1A 3DXRA 1M56B 5A2QN 1IBKO 3ASNC 4EFEA 3D8CA 3W7XA 1NR7A 3CCMV 4DV5O 2ZXWB 1Q7YW 3L9DA 5GTIZ 2A3QA 3RBZA 1AR5A 1VQOV 4DR4O 4G2KA 3GWOA 1NTKH 5A9GA 1KUQA 4H37A 5KHKA 1QBZA 4UCRA 3OAAG 2L35A 3PN1A 4I50A 2CGOA 1KP3A 3RVZA 4FK5C 4CBCA 3CMAV 5B3SC 1VQNV 1HR0B 3ZMUA 3MAQA 3OGCC 1NBMG 4JI2B 1MMMA 4U3JB 2QEXV 1I08A 1TA8A 4KL1A 4X1YB 4I7ZB 3FB6C 2QM8A 1VF6A 1M90W 2Y0PA 2CE4A 3RGBA 1KC8W 1AI7A 4RO2A 4UB6Z 3T1CA 4B3RO 2XASA 4FLWA 4DRXA 3RYIB 1XMQB 3T1YB 4W4KA 4BIUA 1VIBA 2V1DA 5B1NA 3UT5A 4DR3O 3JCZA 4XDLA 3FB7C 2AW9A 4BWAA 3HKDA 1YITV 2VQFB 4X1IB 5CB4A 2UUBO 4R6ZA 3JALA 2Z3YA 1S76D 1F23A 2Q9LA 1W2BU 1Q8IA 2JDIG 1FJGB 4GYCB 1JVMA 3RYCB 3E86A 4PA9A 4IHJB 4YIPA 2Q69A 3RW0A 2JGDB 3E8GA 3TCUA 2CGNA 3K57A 3FB8C 3UQ8A 3T4DA 1K97A 3AG4B 1NS1A 4LF7B 1P84F 4JAVA 3HB3B 4JYCA 3ZHQA 5EC2C 5BMVA 3FD9A 4DUZB 4YY3O 2HG5C 4PV1B 1VQ8V 2QM4A 1OCOC 2Q7HA 1WLEA 2QWNB 2W0FC 4FLZA 1JJ2U 4NYKA 3FAVA 2B9ZA 1IZ3A 3SJCC 1NH2D 2JJ1G 2HKOA 5B1AC 3VQVA 3CD6V 1N32O 5J9PC 3JATA 3EHBB 4J80A 4P30A 4FJCC 1V54B 1YZBA 3K3WA 5HFLA 3CEIA 4X20B 4FFBA 3RT3C 1FXKB 3B2EE 3OR7C 2EILB 1HR0O 3OUSA 1JA8A 3ETDA 3G71V 1P7BA 2PGGA 5GONB 5BR8O 1S3JA 3SR2C 1M93A 2V7QG 1TVKA 4J7JA 4JZ2A 1SQGA 3CMEV 4J10A 3ZMSA 4B3MO 1IVSA 5LXTB 3Q4HA 4FMTA 5EC1C 4DR6B 1IDSA 1WP7A 2Q8VA 3LUTB 5KHGA 4PELA 4DR7B 3L72H 4RAIA 2VRZA 3A0BZ 4C7UA 1XMQO 2HVKC 2M7WA 4FM1A 5J2TB 4JI2O 5DEDA 2YI9A 2W6IG 1WA8B 1BZKA 1CXZB 2BSKB 1Z5VA 5JQGB 3JALB 1QCEA 1I94O 3F7VC 1AI6A 1Q6IA 5GW7A 2R9AA 3AG1C 4J41A 4X66B 5LP6B 3JSLA 5JVDA 1GKFA 4IIJB 4LNUB 2AZ2A 4KUMA 4WFAV 5L3FA 2P06A 2RJZA 3A8TA 4O2AA 1JFFB 4WFGA 2DMXA 1Q5OA 4UV9A 3CCEV 3BEHA 2ZIMA 1OCCC 4JI8B 4LWSB 3ETEA 2LFSA 4JI5B 4FLXA 4ZI7B 1IBMB 2UXCB 1RPOA 4I9WA 1Q6UA 1MG1A 2Q7GA 4U3JA 3FAVB 3CC7V 5EZYA 3RYFB 1VQMV 1VQ7V 4FFKA 1PPJH 5K1PA 4LF7O 5JCOA 1SQFA 4G27B 5JJEB 1ORQC 3U0ZA 3RYIA 2A7WA 4DV4O 2F1MA 3VBBA 1EBOA 2R72A 4DW1A 1SQQH 4UCOA 4B3TO 3QVNA 3G67A 2D3OW 5EBMC 1WB8A 2QTSA 4ZOLA 5B1BB 1QR8A 3RYHA 1YVWA 2EIMC 4WFHA 1Y66A 2OYQA 2IJHA 3HPLC 1BSMA 3IGAC 5LHIA 2AXTZ 1OCRB 1K9MW 5FLXN 4LF5B 2PI5A 4JI3B 2CTWA 5L3CA 1UJWB 2LQTA 4UB8Z 4LF6B 3QG5A 4CZZA 3P3PA 4QGPA 4LF4O 1AI5A 2D2CB 2CAZC 3P3NA 3ZHTA 1YDXA 1CEZA 1VQ5V 3S3XA 2EINC 2W6JG 5L3EA 3AG2B 2UXNA 5CBFA 1I5YA 2ZDIC 5LMNO 1GN3A 1R3KC 3ZIAG 4DV6B 4I55A 2IH1C 3RFRA 3NR7A 1S72V 1K33A 5B5EZ 3HKCB 2JVDA 3CCLV 2FMLA 3JATB 2XOKG 5LGNA 5LP6A 2QWRB 1SF9A 2DOSA 4FFBB 3E89A 4GKKB 1ZSPA 5JWPA 2RNBA 2ZNIA 3W7UA 4FLVA 1QU7A 4O2BA 4JYBA 1YEWA 3ZRXA 1PV0A 3B40A 1AILA 2VS0A 1O9GA 3K5MA 5LA6B 4J7KA 3HKEB 3AK3A 3T1YO 5EIBD 2H8PC 4DV4B 4DV0O 2WLLB 3IFXA 2HEPA 3CHXA 3CCUV 2Y69C 1JJOA 2DYSB 4ABMA 2E74B 1YJNV 1N36O 5CA3A 3B77A 4AQYB 3OGIB 2F4VB 4DUZO 4GX1A 5KA6A 4GKKO 3A0HZ 1U97A 5C8YA 4J9YB 4TQDA 1B04A 4O4IA 4J9ZB 5IJ0A 3SYCA 4B3MB 1IX9A 4LFAO 2PTMA 5EYPB 4FLTA 3ZRSA 1V55B 1TUBA 2QDOA 2UUAB 4LH6A 4H0LB 4GKJO 2XAQA 1IURA 1GN4A 1Q43A 1Y67A 4CC5A 2K1EA 2DWEC 1NI8A 2HP8A 2HJFC 2B1GA 4DR1O 1FD9A 4CC6A 5KMGB 2DYRC 4D7SA 4ASUG 5C93A 4OGQB 3B8NA 4ZKIA 3OMAB 2YIAA 4O2AB 4CS3A 1FYJA 3H1KH 4UVBA 4HNAB 5JH7A 2EBOA 3T2MA 3UM7A 4JI6O 4X1YA 4FM0A 1VP7A 4WFFA 2HHHO 3LNNA 4HAMA 4BIZA 2YEVA 1L1FA 4F4LA 2LFRA 1JR9A 5B66Z 1R3IC 4PI0A 3ZMTA 5IT9N 1XDCA 2CTQA 4U3FH 2ETNA 2VWJA 3H1LH 4X65B 2YIDA 4NTWA 3MD0A 4I50B 1OHHG 1Z2GA 1TVKB 4H33A 4RUEA 2Q0OC 3JASB 1N33B 5KLVH 2ZIOA 5LMNB 2VQEB 4NB5A 3SPJA 5LOVB 2E75B 3K04A 1YI2V 1SRYA 3FX7A 5L3GA 1KD1W 2P90A 2E3CA 1R6KA 3GWKC 1J95A 2YXLA 4BAYA 3DGEA 3ZCCA 2F4VO 2QKSA 2UU9O 1NQTA 3AG7A 3AK2A 1EM1A 1N0NA 3I5DA 2O57A 4IL6Z 4JI5O 2N04A 4PA4A 1WNSA 3ABLC 3CJHA 3JAKA 4DR5O 1JX9A 4JASA 1Q90D 1XOUA 2ZR2A 3UO3A 3HKDB 3RWRD 1I5XA 4X1KB 3N2GB 4J11A 1OJHA 2Q0AA 1XHZA 1D5AA 2YUAA 4UUJC 2KG7B 1OCRC 3OEHG 4DR2B 2AGAA 2HLDG 4DV7O 3ZMZA 4LF8O 3AG3C 1Q82W 1EN5A 2A06H 4U7OA 3CYOA 4MVUA 4OX9O 3ZHUA 1JFFA 2AHYA 1XL6A 3E8BA 3H9VA 3K58A 4D6TH 1GM7A 5GONA 5KX5A 4JYAB 1WN7A 3WFVA 4Z1MG 3ZRWA 1AI4A 1PNMA 1R1BA 5ITZA 4TT3G 4FPPA 3BABA 3CRQA 1VF6C 2XNDG 5JH7B 5FNVA 5F2VO 1W59A 3QO8A 2XAFA 5H2FZ 3ABLB 2X7RB 4JYYA 1O9HA 4K8XA 2QKCA 2WLKA 1J5EB 4TSFG 4B3RB 4H13B 1US6A 2PF4E 3M7MX 4L8JA 2VQEO 4KXRA 1OCCB 2QGNA 4MTXA 3OE7G 2HR3A 2LW1A 2OCHA 3K0GA 4PDRA 4B08A 1KU9A 2EZPA 4BW5A 4O4LA 5IYZA 3CSXA 3CCVV 4O4HA 2MK3A 2WA3A 1HNXB 1BGYH 2JGDA 3AG1B 5JCOC 4Z1VA 1KBHA 3OTFA 1GM9A 1DTOA 1Q3EA 4GLXA 4X89A 3K5OA 1H8EG 3CE2A 1SZXA 3JAWB 1R73A 1AR4A 1K5QA 1BQZA 4FVMA 4KP4A 5KAIZ 4JPRA 1XMOB 3F5TA 4E2LA 3QO5A 1ZLZA 4LFCB 1DLBA 2OTLV 2RN9A 2ARHA 3HKBA 2ZKOA 1K8AW 1VQ6V 3R66A 2KSDA 3TK1A 3IAYA 1HNZO 3IJ4A 2LGWA 3ZHSA 4MTFA 3W7SA 1ENVA 2DYRB 2YEVB 1VQPV 1S0VA 4JF3A 3SDLA 3M99B 4TV9A 1PD3A 2QWQB 1KB9F 3WB2A 4B3TB 2K9PA 1NR1A 2WLIA 1D5NA 2EILC 1N34O 3QO7A 4UCTA 2VQFO 1NH2B 1VF7A 1MZFA 2XHBA 5K1XA 2ZR3A 4U7NA 1BL8A 5LOVA 1J5EO 4WFEA 2NNUA 3UT5B 1FPOA 1H2SB 2GUZB 2ZM6B 4DR3B 2DYSC 2Y69B 4DR7O 2C2AA 1NJIW 4JI7O 1Y76B 1WJZA 1GMGA 4MTOA 4Q20A 2P67A 4MTGA 4CH6A 1M1KW 3JAKB 2F66C 4QNHB 5LGTA 4YHHO 4RQFA 4CH4A 2L6LA 1HNWO 2OT5A 4MVRA 4DV1O 1QQCA 4PHZA 1IBKB 1N0JA 2IJKA 1AP5A 3TXQA 1UPGA 2OIEA 3BVOA 4DV2B 1R3LC 3MHHC 1LR1A 4LNUA 4Z2WA 3FYIB 1IBLB 1HP8A 3TGUH 4CH5A 1JOYA 4N23A 1DF4A 3E8HA 2JJ2G 1K7DA 3AG2C 4D7TA 4JI7B 5KHIA 2FB5A 3ZX6A 2DW4A 5IWAB 2NR5A 3E22A 2ZINA 2BTOA 2F23A 2UU9B 3CC2V 4LFCO 4H44B 1S5HC 2WLLA 4TV8B 4I4TA 3JAMN 3SJAC 2PYLA 4OPHA 2QTOA 2QWPB 1NVPD 1K3EA 4DR6O 1IBMO 3CX5F 2AZ0A 3STZC 3OTOB 2UXDO 1COWG 1Y4MA 1FJGO 5BR8B 4ZIBA 5B1BC 2ADQB 5C8YB 5H6QA 2B5UA 3FB5C 2VWKA 1VEWA 5IJ0B 2JRIA 2FYUH 3JASA 3SPIA 4NXMB 2Q5ZA 4O2BB 1JPXA 1WPBA 3D36A 4GCZA 1H2GA 2ZQMA 5CMUA 4X88A 1VARA 1JQ0A 3LDCA 4JI4B 2EINB 5KHHA 4MVSA 5KHJA 1VQKV 2HJDA 1QNMA 4XDJA 1RSOA 4DO2A 2HHHB 3EVKA 2QWOB 3CCSV 2EIKC 3CJHB 2A0LA 3BRCA 2N74A 4FZ1A 4P2ZA 1WP8A 4IGGA 2BSKA 5FPOA 1P4RA 4EB6A 4DUYB 2CH7A 2EIMB 2JS3A 1WAZA 4B7EA 2GBOA 3CXHF 4DV3O 2ZE6A 1ZX3A 3ZJZA 1LNQA 3AG3B 4PA3A 3SPGA 2MW2B 1L8DA 2IJIA 2UUCB 2IM9A 4OPAA 4YIOA 1PL4A 3D3QA 1SESA 4ICGA 5FL7G 4YHHB 4P9OA 5H5NA 2M6YA 4BW9A 5IDJA 1XI1A 5CBGA 2WLIB 3ZN1A 3ZHRA 2YIBA 4YJ2B 1LUWA 2DN9A 2LO1A 1K73W 2YIBD 5LYJA 1HDJA 4JTCB 1IXMA 1GH6A 1SKVA 2HFEC 1XNRB 1AJQA 1WA8A 5DECA 1ZTEA 1SZTA 1EN4A 1LUVA 3H1HH 5JQGA 3SPHA 4GZRB 4HBNA 1F7YA 3I55V 4K35A 1E1QG 4NXMO 1SETA 3NXSA 1S5LZ 3F5WC 5LP6C 1S5JA 3WB1A 3I56V 5BY1A 2EIJC 5CN0A 1KKCA 4UVAA 2QA4V 2IBZH 2JIZG 1AB3A 1BCCH 1H2LA 4LFAB 1Y74B 1XBLA 3SYPA 2CTPA 4DXWA 3N2KA 5FPRA 5B1AB 3P30A 4CS4A 1M9NA 1OV9A 4NKGB 1YHQV 1X59A 5ITZB 3ETQA 3N2GA 5FNVB 1OCOB 4GUNA 3FYEB 1KMIZ 3THOA 3CWBH 3JD2A 3SPCA 3VQXA 3B4SA 4TV8A 3AG4C 4DYLA 2Y48A 1YF2A 2Y4TA 1HW7A 3BY6A 1G4YB 1ROPA 2A79B 4JI0O 3VOUA 1ZL8B 5HFMA 1V55C 3OMNB 4X9QA 5KX5B 4LC1A 1HNXO 2BCCH 4O4JB 1FXKC 1NT2B 1AJNA 3A0RA 3QTCA 5L3BA 4ZOLB 2QM7A 1V54C 4B3SB 4NTXA 5H6RA 4MSWC 1KYOF 1EZVH 3ZMVA 1X4TA 2E76B 1NKDA 4X65O 2FL4A 5IJ9A 2IU3A 1EZJA 1AR1B 5L3DA 5CA1A 4AI8A 2ODMA 1RP3B 2W0XA 1F51A 2P6JA 4IT5A 2ZE5A 4ZHQA 2KQXA 3DTUB 1XNQB 3L75H 2H94A 2P7TC 1Q6HA 2X6CA 1VMGA 1Y76A 4HZ3A 4NR1A 1H2NA 4FLUA 3H01A 4MVQA 4JI1O 3VQYA 1MABG 4WF9V 2EULA 4I55B 5B3SB 1MNGA 3FKSG 2UUBB 3GVMA 1N8RW 1QR9A 4DV7B 3RYCA 4KHPB 1E79G 4DR1B 3TJTA 3SJBC 3CRCA 3K9SA 1MSWD 3BA9A 3B8MA 2XAGA 2ILMA 4AHCA 2WPDG 3K03A 3SYQA 1R6NA 4MVZA 3EFFK 1YSCA 2PYJA 2GDSA 2NLJC 1BE3H 5LA6A 4QPJA 2OIGA 1EFRG 4MVOA 1PNKA 2PI4A 2XT9A 5D5QA 4I4TB 1SQXH 4FM2A 4UCSA 3CC4V 3BPZA 5KUMA 3STLC 2P22C 4PDMA 5J2UA 1EN6A 2YS8A 4JAUA 1FXVA 4UV8A 5E79Z 2XAJA 2ZE7A 1V9PA 1FXKA 1XL4A 2WAMA 3QNEA 3L70H 1ZL8A 1YJWV 3BFRA 2YSUB 4DW0A 1YTFB 5EYPA 4K0KB 2Y0IA 4X1IA 5CB4B 5IY5C 2ZXWC 2R9RB 4Q6GA 4X66O 1NTZH 2JS5A 2QJ1A 3KCYA 4LF9O 3ASNB 1N33O 3WB0A 4DV6O 5LXTA 5KMGA 3ABTA 1RPRA 1GO3F 1RSOB 1OCZB 1SERA 1FS0G 2OCCB 4NXNO 3CCQV 2IU0A 2ZCEA 3ICXA 3JAWA 2KKWA 1PNLA 1DF5A 2F43G 2ZT9B 3ABKC 4X62B 4K8ZA 3ASOB 4AILC 4W4LA 2B1IA 3A2FA 5KA5A 2E5LO 3G4SV 5LMUB 1A32A 3K5LA 2YC0A 1ZUQA 5B1OA 3KCXA 4NVPA 2PZSA 2QE7G 3R65A 3CRMA 4R7CA 4X8AA 4LF5O 3MDSA 4GKJB 5IYCO 3CCRV 3JARA 1GN6A 2GTSA 2OTJV 1L0NH 3M8AA 1YCIA 5GTHZ 4WCEV 2Q67A 5BZBA 2ITCC 1H8HG 2DWDC 3ZRWB 1WB7A 3W7WA 5CA0A 2Q6AA 1YJ9V 2PUSA 2OWOA 4GX0A 2ZNJA 3KZIZ 2DQ3A 1DGSA 2AHZA 4F6EA 3L71H 2WLMA 2GTAA 4UCUA 5IYDO 4HYOA 2KB1A 2IH3C 1XILA 2WLNA 1FXHA 5BXZA 4JI6B 4MVMA 1AP6A 1PL0A 1U96A 4PDVA 4TOIA 5DN6G 1NVPB 4I9QA 1NU1H 3RYFA 1Q86W 1FAFA 2RDCA 4TQFA 3CRRA 4LH7A 1QVGU 2EX3A 4X1KA 2BOCC 3JSNA 3OT7A 1H38A 4L87A 3ZEDA 4O4LB 5IYZB 1CPYA 2CH7B 4LP8A 3K06A 3K79A 2LGQA 2WA4A 1VQ4V 4K3AA 4JV5B 2UUCO 1SQBH 2LP7A 4DV3B 4DK1A 3DC5A 1RM1B 3CB2A 1HNWB 1N4CA 3CXCU 1E1RG
chains in the Genus database with same CATH topology
2EIKB 2IW5A 1GTOA 2JK5C 2XAQA 1P4RA 3ABMB 5KUKA 3E8FA 2K1EA 2DWEC 3K9AA 3KG2A 2HJFC 2B1GA 1GM8A 4JTAB 4OXSA 2EIMB 2DYRC 3OEEG 4GT1A 4ASUG 1M56B 5C93A 3B8NA 4ZKIA 3ASNC 3OMAB 3W7XA 1NR7A 3CCMV 2ZXWB 3JD1A 4UXNA 1Q7YW 3RBZA 4UVBA 3ZJZA 1VQOV 1K4CC 4G2KA 1LNQA 2EBOA 3T2MA 3UM7A 3AG3B 3ZRVA 3GWOA 4PA3A 4H37A 3SPGA 2ATKC 4WFFA 1ZWIC 2GHYA 3ETGA 4HAMA 4BIZA 1QBZA 2IJIA 3OAAG 2X6BA 1KP3A 2YEVA 3RVZA 4FK5C 1L1FA 4CBCA 1SESA 2LFRA 4F4LA 4N21A 3CMAV 1R3IC 5FL7G 4P9OA 1K92A 5B3SC 3W7TA 3ZMTA 1VQNV 3ZMUA 4MW8A 3OGCC 1NBMG 5IDJA 3P32A 5CBGA 2QEXV 2WLIB 3ZN1A 4MT8A 1THZA 3FB6C 2QM8A 1K73W 3SYAA 1M90W 3MD0A 1KC8W 1OHHG 1AI7A 4RO2A 3T1CA 2XASA 5LBQA 4JTCB 4H33A 4RUEA 1IXMA 4BIUA 2HFEC 2V1DA 5B1NA 1AJQA 3SPJA 3JCZA 4XDLA 3FB7C 1B6QA 2Q68A 5H9CA 1YI2V 3K04A 5E1AC 1SRYA 1YITV 1SZTA 5L3GA 2P90A 1KD1W 1R6KA 1J95A 4P9PA 4R6ZA 3DGEA 3RVYA 3SPHA 2Z3YA 3ZCCA 4BAYA 2QKSA 1S76D 1NQTA 4LBEC 3I55V 1F23A 3ASOC 1E1QG 5LHGA 1W2BU 1SETA 2JDIG 3NXSA 3F5WC 3ABKB 1JVMA 3E86A 4QJFB 4PA4A 4PA9A 3ABLC 3I56V 2Q69A 3RW0A 1JX9A 1JCHA 4JASA 2ZR2A 1I5XA 2EIJC 5CN0A 5EBLC 3E8GA 3TCUA 4UVAA 2OCCC 3FB8C 2QA4V 3T4DA 2JIZG 1VQLV 1K97A 3AG4B 4UUJC 4JAVA 3HB3B 3SYPA 4DXWA 1OCRC 4JYCA 5EC2C 3OEHG 4WFBV 4UVCA 2HG5C 2WSSG 2HLDG 3ZMZA 5B1AB 1VQ8V 3P30A 3JYCA 1Q81W 1M9NA 3AG3C 1OCOC 1Q82W 4U7OA 1WLEA 3CYOA 2W0FC 4MVUA 1YHQV 2CK3G 4R50A 1JJ2U 3OMIB 1NH2D 5IY5B 3T4ZA 2AHYA 3LDEA 4PA7A 1OCOB 1XL6A 3E8BA 1M56C 1GM7A 2JJ1G 2HKOA 2JEXA 4QE9A 5B1AC 3CD6V 5J9PC 3FYEB 3EHBB 4I5SA 4P30A 3WFVA 4Z1MG 4FJCC 1V54B 3K3WA 3JD2A 3SPCA 5HFLA 3ZRWA 3E83A 2WLHA 3AG4C 3TETA 2Y48A 2A9HA 1AI4A 1PNMA 3BY6A 1G4YB 1FXKB 1ROPA 2A79B 3OR7C 1R3JC 4TT3G 4FPPA 5IYBO 3VOUA 2EILB 5HFMA 3OUSA 2XNDG 3ETDA 4G28B 3G71V 1P7BA 1V55C 3QO8A 2XAFA 1KKDA 3OMNB 3ABLB 2X7RB 4R8CA 3SJQC 3PJSK 4LC1A 1S3JA 2WLKA 1FXKC 2V7QG 1AJNA 4TSFG 3A0RA 5L3BA 3CMEV 2QM7A 1V54C 3ZMSA 3MHSC 5H6RA 4MSWC 1FFTB 4FMTA 3G6EV 2FTKA 3ZMVA 1OCCB 5EC1C 1NKDA 4MTXA 2WWWA 3OE7G 2IU3A 1EZJA 1AR1B 3LUTB 5L3DA 1BHBA 2HR3A 1K4DC 4PELA 3IC7A 3K0GA 3JD4A 1F51A 4PDRA 4GX5A 2P6JA 2EZPA 4RAIA 3DTUB 4BW5A 2H94A 3ABUA 2P7TC 3E2EA 2HVKC 2M7WA 2X6CA 3CCVV 4HZ3A 1S77D 4QE7A 2MK3A 3H01A 4MVQA 1W0KG 2W6IG 3AG1B 1MABG 3E35A 5LHHA 1GM9A 4WF9V 1DTOA 1QCEA 4X89A 2ZDIA 3F7VC 1AI6A 1OZ0A 5GW7A 3AG1C 5B3SB 5DM6V 1H8EG 1R73A 3FKSG 1K5QA 3JD0A 4QPKA 4KP4A 1N8RW 1QR9A 1QLNA 1GKFA 4JPRA 1E79G 3K08A 4E2LA 4KUMA 3QO5A 4WFAV 5L3FA 3X2QC 3OUFA 1DLBA 3OM3B 2OTLV 1K5SA 1QVFU 4WFGA 1MSWD 3B8MA 4UV9A 1K8AW 3TK1A 3CCEV 1VQ6V 3BEHA 2XAGA 4MTFA 3W7SA 1OCCC 4YXWG 1ENVA 2DYRB 2WPDG 3ETEA 2LFSA 1F4MA 2YEVB 3K03A 3SYQA 1M57B 1VQPV 2ITDC 1S0VA 4JF3A 3LDDA 1R6NA 3OR6C 4MVZA 3EFFK 1YSCA 5CBHA 3JD3A 2NLJC 1RPOA 3M99B 4I9WA 4QPJA 4MVOA 1EFRG 1MG1A 1PNKA 2PI4A 1PD3A 3CC7V 4PDLA 2R9IA 1QLEB 3CP1A 1VQMV 1VQ7V 1RM1C 3CC4V 1NR1A 4RUFA 2WLIA 5KUMA 2BOBC 3STLC 3LSQA 2ZD9A 2EILC 1G8MA 4PDMA 3QO7A 4G27B 1ORQC 1NH2B 4JAUA 1FXVA 4UV8A 2XAJA 3WG7B 1FXKA 4PA6A 1XL4A 3VBBA 1EBOA 2WAMA 2ZR3A 3QNEA 4U7NA 4JTDB 1BL8A 1YJWV 2YSUB 1WPXA 2NNUA 4WFEA 1KECA 1YTFB 1AJPA 1KQSU 5IY5C 2ZXWC 2DYSC 2R9RB 2Y69B 2HVJC 2C2AA 2D3OW 1BHAA 5EBMC 1NJIW 1KP2A 3WG7C 3ASNB 2X0LA 2EJRA 1GMGA 5B1BB 3D3IA 4MTOA 1QR8A 4Q20A 1YTFD 2GSMB 2EIMC 2P67A 4MTGA 1Y66A 4WFHA 2IJHA 3ABTA 3HPLC 3IGAC 5LHIA 1M1KW 1RPRA 1OCRB 1K34A 4QNHB 1GO3F 1K9MW 3ABMC 2UXXA 1OCZB 5LGTA 4RQFA 1SERA 2PI5A 1FS0G 4XBFA 1QLEC 3GB7C 2OCCB 5L3CA 1UJWB 2EIJB 1W0JG 2Z5UA 2OT5A 4MVRA 3CCQV 2IU0A 1F4NA 2IJKA 4QIWF 1PNLA 4CZZA 1DF5A 2F43G 1AI5A 1R3LC 3ABKC 1M57C 3MHHC 3FYIB 3ASOB 3ML0A 4MS2A 2B1IA 1MOFA 1CEZA 1VQ5V 1JOYA 3SYOA 2EINC 2W6JG 5KA5A 5L3EA 3AG2B 2UXNA 4MW3A 4N23A 4ZBMA 5CBFA 1DF4A 3G4SV 1I5YA 2ZDIC 3E8HA 2JEUA 5LGUA 1R3KC 3ZIAG 2JJ2G 2IH1C 5EK0A 5B1OA 1K7DA 3X2QB 3AG2C 1HWYA 2QE7G 3R65A 1S72V 1K33A 4TWKA 4R7CA 3CCLV 4X8AA 5LGNA 2XOKG 2DW4A 2X6AA 4XDKA 5IYCO 3CCRV 2DQ0A 3LNMB 2OTJV 2XAHA 4WCEV 4LCUC 3CC2V 2Q67A 5BZBA 2ITCC 1H8HG 2DWDC 3E89A 3ZRWB 1S5HC 3W7WA 2IJJA 2WLLA 2Q6AA 1YJ9V 2QTOA 4RQEA 4GX0A 3W7UA 1NVPD 5EBWC 2DQ3A 1K3EA 2AHZA 3CCJV 1OCZC 3K0DA 4JYBA 2WLMA 5IYDO 3STZC 4HYOA 2KB1A 2IH3C 3ZRXA 4GX2A 1COWG 1FXHA 2WLNA 2WLJA 1Y4MA 5B1BC 4MVMA 5H6QA 2B5UA 1BMFG 3FB5C 2H8PC 1PL0A 2WLLB 4PDVA 1NVPB 3IFXA 5DN6G 3CCUV 3OW2U 2Y69C 2DYSB 3SPIA 3UKMA 1CP9A 1YJNV 4KFMA 5CA3A 1Q86W 1JPXA 1PKXA 3B77A 3CPWU 1YIJV 3D36A 1QVGU 4GCZA 1H2GA 2ZQMA 2BOCC 3F7YC 3ZN0A 4GX1A 5CMUA 4X88A 5KA6A 1JQ0A 3LDCA 3AEIA 2EINB 4J9YB 4MVSA 1H38A 4L87A 1VQKV 4J9ZB 1GK9A 3OFNG 1CPYA 4LP8A 3K06A 3K79A 3SYCA 4EKWA 1VQ4V 1VQ9V 4XDJA 1AROP 4DO2A 2LP7A 1TUEB 3LSSA 2EZOA 1RM1B 3ZRSA 4FIPC 3CCSV 1V55B 2EIKC 2A0LA 3CXCU 4P2ZA 4JGSA 1E1RG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X89 A;  3F7V C;  2JK5 C;  3AG1 C;  5KUK A;  3E8F A;  4UUJ C;  2K1E A;  2DWE C;  3SYP A;  4DXW A;  1OCR C;  3KG2 A;  2HJF C;  5EC2 C;  4JTA B;  4OXS A;  1R3L C;  3ABK C;  1M57 C;  2HG5 C;  2DYR C;  4MS2 A;  3JYC A;  3K08 A;  3AG3 C;  1OCO C;  2EIN C;  3SYO A;  3ASN C;  4MW3 A;  5CBF A;  4MVU A;  4ZBM A;  2W0F C;  3OUF A;  3X2Q C;  4R50 A;  3E8H A;  1R3K C;  4WFG A;  2IH1 C;  5EK0 A;  3RBZ A;  3T4Z A;  3ZJZ A;  2AHY A;  3AG2 C;  1K4C C;  3BEH A;  3LDE A;  1LNQ A;  3R65 A;  4PA7 A;  1XL6 A;  3E8B A;  3T2M A;  1M56 C;  3UM7 A;  4PA3 A;  4MTF A;  4TWK A;  4R7C A;  4H37 A;  1OCC C;  4X8A A;  2ATK C;  4P2Z A;  2X6A A;  4WFF A;  1ZWI C;  4QE9 A;  4XDK A;  5B1A C;  3SPG A;  5BZB A;  3K03 A;  3SYQ A;  5J9P C;  2ITD C;  3LDD A;  4P30 A;  3OR6 C;  3LNM B;  3EFF K;  4MVZ A;  2X6B A;  2YEV A;  3SPC A;  5CBH A;  3RVZ A;  4LCU C;  4CBC A;  2NLJ C;  2Q67 A;  3E83 A;  2ITC C;  4F4L A;  2WLH A;  2DWD C;  3AG4 C;  1R3I C;  3E89 A;  4I9W A;  1S5H C;  4P9O A;  2A9H A;  5B3S C;  3TET A;  2WLL A;  4MVO A;  2Q6A A;  1G4Y B;  2A79 B;  3OR7 C;  4MW8 A;  1R3J C;  2QTO A;  3OGC C;  4GX0 A;  3VOU A;  4PDL A;  3OUS A;  5CBG A;  5EBW C;  4G28 B;  1P7B A;  1V55 C;  2WLI B;  2AHZ A;  1OCZ C;  3K0D A;  1KKD A;  4RUF A;  2WLI A;  5KUM A;  2BOB C;  2WLM A;  3STL C;  2ZD9 A;  2EIL C;  4R8C A;  4HYO A;  3SJQ C;  2KB1 A;  3PJS K;  3STZ C;  3FB6 C;  2IH3 C;  4PDM A;  4GX2 A;  2WLN A;  2WLK A;  3SYA A;  2WLJ A;  4G27 B;  1ORQ C;  4RO2 A;  5B1B C;  3T1C A;  4MVM A;  4JTC B;  3FB5 C;  2H8P C;  4H33 A;  4RUE A;  2WLL B;  1V54 C;  4PDV A;  3IFX A;  4PA6 A;  1XL4 A;  4MSW C;  2Y69 C;  2HFE C;  4JTD B;  1BL8 A;  3SPI A;  4WFE A;  5EC1 C;  3SPJ A;  3UKM A;  4KFM A;  3LUT B;  4XDL A;  3FB7 C;  2Q68 A;  5IY5 C;  1K4D C;  3K04 A;  5E1A C;  2ZXW C;  2DYS C;  3K0G A;  2R9R B;  2BOC C;  3F7Y C;  2HVJ C;  4GX1 A;  1J95 A;  4GX5 A;  4P9P A;  4PDR A;  4R6Z A;  4X88 A;  5EBM C;  3LDC A;  3RVY A;  3SPH A;  2QKS A;  4RAI A;  3WG7 C;  4BW5 A;  4J9Y B;  4MVS A;  4LBE C;  2P7T C;  2HVK C;  2X6C A;  4MTO A;  3ASO C;  4HZ3 A;  4J9Z B;  2EIM C;  4MTG A;  3F5W C;  4WFH A;  4LP8 A;  3K06 A;  4QE7 A;  3SYC A;  3HPL C;  3IGA C;  4EKW A;  1JVM A;  4XDJ A;  3E86 A;  4MVQ A;  4QNH B;  4PA4 A;  4PA9 A;  3ABL C;  2Q69 A;  3ABM C;  3RW0 A;  3ZRS A;  2EIK C;  1QLE C;  2A0L A;  3GB7 C;  2EIJ C;  5EBL C;  3E8G A;  3TCU A;  4MVR A;  2OCC C;  3FB8 C;  3T4D A; 
#chains in the Genus database with same CATH topology
 2IW5 A;  2JK5 C;  3ABM B;  4OX9 B;  1YXB A;  4FZ0 A;  3K9A A;  4OXS A;  3APO A;  3T1H B;  3OD4 A;  1FKA O;  2R70 A;  2YI8 A;  4J42 A;  1XNR O;  4X62 O;  3JD1 A;  4UXN A;  4DR5 B;  1XEQ A;  1K4C C;  3ZRV A;  3KKY A;  3U10 A;  1H2K A;  1B3Q A;  3E22 B;  2ATK C;  1ZWI C;  2GHY A;  3ETG A;  1B06 A;  3J81 N;  5LYJ B;  2X6B A;  1XNQ O;  3RN4 A;  4N21 A;  2XTA A;  3APQ A;  1K92 A;  3W7T A;  4MW8 A;  2ZE8 A;  3JCU Z;  3P32 A;  2YXH A;  3O9O A;  5JJJ B;  3CRA A;  4DK0 A;  4EFB A;  4MT8 A;  1MZE A;  1THZ A;  3C90 A;  2NN4 A;  3K59 A;  3JAR B;  3SYA A;  1I0H A;  1I7F A;  1SA0 B;  5LBQ A;  4LFB B;  2UXD B;  4DV5 B;  1ZAU A;  3H1J H;  3LSU A;  5IJ9 B;  1D2D A;  5H9C A;  4YJ2 A;  1B6Q A;  2Q68 A;  4BIO A;  1XQ8 A;  4DR2 O;  5E1A C;  3U11 A;  3EXA A;  4P9P A;  3RVY A;  1BS3 A;  1BQ0 A;  5AG2 A;  1SC5 B;  4LBE C;  3RYH B;  3ASO C;  2BTQ B;  4NTY A;  5LHG A;  4EEQ A;  4X64 O;  4LF4 B;  3ABK B;  4JI3 O;  4I0X A;  4QJF B;  3CS5 A;  3SGI A;  1QHT A;  1JCH A;  2EJ7 A;  5EBL C;  2OCC C;  1SS3 A;  1VQL V;  3K5N A;  3ZHV A;  4PD4 F;  4F6R B;  4DV1 B;  4WFB V;  2F95 B;  4UVC A;  1RFY A;  2WSS G;  3T1H O;  1PM9 A;  3JYC A;  5IE9 A;  5TIS Z;  4A5U B;  1Q81 W;  4JI8 O;  4TV9 B;  2CK3 G;  3D36 C;  4R50 A;  1IBL O;  3OMI B;  2PY5 A;  5IY5 B;  4YJ3 B;  3T4Z A;  3LDE A;  4PA7 A;  5LMU O;  1M56 C;  2JEX A;  3QF7 A;  4QE9 A;  2BE3 A;  3L74 H;  2H3O A;  3OTO O;  4I5S A;  4LWS A;  4FLY A;  3E83 A;  2WLH A;  3TET A;  2A9H A;  2CTR A;  4JI1 B;  1R3J C;  5IYB O;  3BAA A;  1GN2 A;  4G28 B;  2JGU A;  3DSQ A;  1KKD A;  2GUZ A;  4PI2 A;  4R8C A;  3SJQ C;  3PJS K;  5IWA O;  4DV0 B;  3HKE A;  4ZHQ B;  2ZM6 O;  1URF A;  1N36 B;  3FFQ A;  3MHS C;  1H2M A;  1M5I A;  1FFT B;  3G6E V;  2FTK A;  2LJ2 A;  2WWW A;  3HR0 A;  1BHB A;  4KHP O;  4IYH A;  1K4D C;  3IC7 A;  3JD4 A;  4GX5 A;  1FFX A;  5LL6 Y;  1SA0 A;  2YDE A;  3BA8 A;  3ABU A;  4LFB O;  3E2E A;  4BR6 A;  1S77 D;  2LW7 A;  4QE7 A;  1HNZ B;  4IIJ A;  1W0K G;  2N05 A;  4JZG A;  5CA1 B;  3E35 A;  5LHH A;  4B7K A;  2RMK B;  4X64 B;  1Y6X A;  2P4V A;  4TUY A;  2ZDI A;  1OZ0 A;  5BMV B;  1MSD A;  5DM6 V;  3JD0 A;  4QPK A;  2RCV A;  1QLN A;  4ZI7 A;  2XUM A;  4YY3 B;  3K08 A;  3ZBH A;  3X2Q C;  3DXR B;  3OUF A;  3OM3 B;  1K5S A;  1QVF U;  4PJ0 Z;  5EZY B;  1L0L H;  1GRJ A;  2G38 A;  1MA1 A;  2CDY A;  2KG7 A;  4YXW G;  1F4M A;  5J2U B;  1M57 B;  2ITD C;  3LDD A;  3OR6 C;  4X20 A;  5CBH A;  3JD3 A;  4DV2 O;  4WBN B;  2FKX A;  2RQ6 A;  4LF9 B;  4PDL A;  2R9I A;  1QLE B;  3CP1 A;  3BCC H;  1RM1 C;  4RUF A;  2BOB C;  3LSQ A;  2ZD9 A;  1G8M A;  4JI0 B;  1XHX A;  4LR3 A;  4JV5 O;  2Q4P A;  3WG7 B;  3Q4H B;  1N32 B;  4PA6 A;  1NTM H;  4E4E A;  1T5E A;  4JTD B;  2Z0A A;  3L73 H;  2E5L B;  1WPX A;  1KEC A;  3C3T A;  1AJP A;  1KQS U;  1P7G A;  4AQY O;  1XRE A;  3G80 A;  1TGO A;  2HVJ C;  1BHA A;  1KP2 A;  2CUG A;  3WG7 C;  2UXC O;  2ADP A;  5J2T A;  4EB6 B;  2X0L A;  3AK1 A;  1SQP H;  2EJR A;  3IC9 A;  4RWU A;  1M4U A;  3D3I A;  1YTF D;  4I0X B;  2GSM B;  1N34 B;  1K34 A;  4CH3 A;  2DE0 X;  3ABM C;  2UXX A;  4XBF A;  1QLE C;  3GB7 C;  2UUA O;  2YIC A;  1TUB B;  1W0J G;  2EIJ B;  2QR4 A;  2Z5U A;  1UFI A;  1F4N A;  4QIW F;  3UO2 A;  3TXS A;  4LF8 B;  1AVM A;  1JMK C;  1IXB A;  5JVD B;  1Y74 A;  1M57 C;  3N2K B;  4O4H B;  3ML0 A;  4MS2 A;  1MOF A;  3O65 A;  3SYO A;  5EIB C;  3J80 N;  4MW3 A;  4ZBM A;  3G6B A;  1BT8 A;  2JEU A;  3BHP A;  4DR4 B;  2GV9 A;  5LGU A;  4YJ3 A;  5EK0 A;  4CS2 A;  3X2Q B;  1HWY A;  1P49 A;  2YXY A;  4HNA A;  4TWK A;  4LF6 O;  2X6A A;  4XDK A;  1I94 B;  2DQ0 A;  3LNM B;  2XAH A;  4LCU C;  2Q7E A;  4JI4 O;  4DUY O;  2P4K A;  4DRX B;  2UXB O;  2P5O A;  2IJJ A;  1VF5 B;  1XMO O;  3S3W A;  4RQE A;  3HKB B;  4UCV A;  5EBW C;  4UFZ A;  3CCJ V;  1OCZ C;  3C3S A;  3K0D A;  3HKC A;  4IYI A;  2F93 B;  4JYA O;  2QKA A;  4GX2 A;  2WLJ A;  2QSA A;  4O4J A;  2Q73 A;  2V4D A;  5D5P A;  1BMF G;  4WBN A;  4O4I B;  5CA0 B;  1GAX A;  2DJV A;  3OW2 U;  2Y4U A;  1CP9 A;  3UKM A;  4KFM A;  4B3S O;  4IHJ A;  1PKX A;  4J7Z A;  3B09 A;  3CPW U;  1YIJ V;  5JJN B;  1FFX B;  1SQV H;  1PP9 H;  3ZN0 A;  3F7Y C;  2UXB B;  3AEI A;  4JAA A;  4K0K O;  1GK9 A;  3OFN G;  3DC6 A;  3WU2 Z;  1Z5W A;  1TAE A;  1VQ9 V;  4EKW A;  2BTQ A;  3N27 A;  3H1I H;  3UCS C;  1ARO P;  1TUE B;  3LSS A;  2EZO A;  1G6U A;  4FIP C;  4TUY B;  1XUQ A;  1R6T A;  3J7A U;  5KAF Z;  4JGS A;  2EIK B;  1GTO A;  1DK1 A;  3VQW A;  5KUK A;  3E8F A;  3KG2 A;  3ZS8 C;  1GM8 A;  4JTA B;  4F6R A;  1NZ6 A;  4NXN B;  1G1X B;  3OEE G;  4GT1 A;  3DXR A;  1M56 B;  5A2Q N;  1IBK O;  3ASN C;  4EFE A;  3D8C A;  3W7X A;  1NR7 A;  3CCM V;  4DV5 O;  2ZXW B;  1Q7Y W;  3L9D A;  5GTI Z;  2A3Q A;  3RBZ A;  1AR5 A;  1VQO V;  4DR4 O;  4G2K A;  3GWO A;  1NTK H;  5A9G A;  1KUQ A;  4H37 A;  5KHK A;  1QBZ A;  4UCR A;  3OAA G;  2L35 A;  3PN1 A;  4I50 A;  2CGO A;  1KP3 A;  3RVZ A;  4FK5 C;  4CBC A;  3CMA V;  5B3S C;  1VQN V;  1HR0 B;  3ZMU A;  3MAQ A;  3OGC C;  1NBM G;  4JI2 B;  1MMM A;  4U3J B;  2QEX V;  1I08 A;  1TA8 A;  4KL1 A;  4X1Y B;  4I7Z B;  3FB6 C;  2QM8 A;  1VF6 A;  1M90 W;  2Y0P A;  2CE4 A;  3RGB A;  1KC8 W;  1AI7 A;  4RO2 A;  4UB6 Z;  3T1C A;  4B3R O;  2XAS A;  4FLW A;  4DRX A;  3RYI B;  1XMQ B;  3T1Y B;  4W4K A;  4BIU A;  1VIB A;  2V1D A;  5B1N A;  3UT5 A;  4DR3 O;  3JCZ A;  4XDL A;  3FB7 C;  2AW9 A;  4BWA A;  3HKD A;  1YIT V;  2VQF B;  4X1I B;  5CB4 A;  2UUB O;  4R6Z A;  3JAL A;  2Z3Y A;  1S76 D;  1F23 A;  2Q9L A;  1W2B U;  1Q8I A;  2JDI G;  1FJG B;  4GYC B;  1JVM A;  3RYC B;  3E86 A;  4PA9 A;  4IHJ B;  4YIP A;  2Q69 A;  3RW0 A;  2JGD B;  3E8G A;  3TCU A;  2CGN A;  3K57 A;  3FB8 C;  3UQ8 A;  3T4D A;  1K97 A;  3AG4 B;  1NS1 A;  4LF7 B;  1P84 F;  4JAV A;  3HB3 B;  4JYC A;  3ZHQ A;  5EC2 C;  5BMV A;  3FD9 A;  4DUZ B;  4YY3 O;  2HG5 C;  4PV1 B;  1VQ8 V;  2QM4 A;  1OCO C;  2Q7H A;  1WLE A;  2QWN B;  2W0F C;  4FLZ A;  1JJ2 U;  4NYK A;  3FAV A;  2B9Z A;  1IZ3 A;  3SJC C;  1NH2 D;  2JJ1 G;  2HKO A;  5B1A C;  3VQV A;  3CD6 V;  1N32 O;  5J9P C;  3JAT A;  3EHB B;  4J80 A;  4P30 A;  4FJC C;  1V54 B;  1YZB A;  3K3W A;  5HFL A;  3CEI A;  4X20 B;  4FFB A;  3RT3 C;  1FXK B;  3B2E E;  3OR7 C;  2EIL B;  1HR0 O;  3OUS A;  1JA8 A;  3ETD A;  3G71 V;  1P7B A;  2PGG A;  5GON B;  5BR8 O;  1S3J A;  3SR2 C;  1M93 A;  2V7Q G;  1TVK A;  4J7J A;  4JZ2 A;  1SQG A;  3CME V;  4J10 A;  3ZMS A;  4B3M O;  1IVS A;  5LXT B;  3Q4H A;  4FMT A;  5EC1 C;  4DR6 B;  1IDS A;  1WP7 A;  2Q8V A;  3LUT B;  5KHG A;  4PEL A;  4DR7 B;  3L72 H;  4RAI A;  2VRZ A;  3A0B Z;  4C7U A;  1XMQ O;  2HVK C;  2M7W A;  4FM1 A;  5J2T B;  4JI2 O;  5DED A;  2YI9 A;  2W6I G;  1WA8 B;  1BZK A;  1CXZ B;  2BSK B;  1Z5V A;  5JQG B;  3JAL B;  1QCE A;  1I94 O;  3F7V C;  1AI6 A;  1Q6I A;  5GW7 A;  2R9A A;  3AG1 C;  4J41 A;  4X66 B;  5LP6 B;  3JSL A;  5JVD A;  1GKF A;  4IIJ B;  4LNU B;  2AZ2 A;  4KUM A;  4WFA V;  5L3F A;  2P06 A;  2RJZ A;  3A8T A;  4O2A A;  1JFF B;  4WFG A;  2DMX A;  1Q5O A;  4UV9 A;  3CCE V;  3BEH A;  2ZIM A;  1OCC C;  4JI8 B;  4LWS B;  3ETE A;  2LFS A;  4JI5 B;  4FLX A;  4ZI7 B;  1IBM B;  2UXC B;  1RPO A;  4I9W A;  1Q6U A;  1MG1 A;  2Q7G A;  4U3J A;  3FAV B;  3CC7 V;  5EZY A;  3RYF B;  1VQM V;  1VQ7 V;  4FFK A;  1PPJ H;  5K1P A;  4LF7 O;  5JCO A;  1SQF A;  4G27 B;  5JJE B;  1ORQ C;  3U0Z A;  3RYI A;  2A7W A;  4DV4 O;  2F1M A;  3VBB A;  1EBO A;  2R72 A;  4DW1 A;  1SQQ H;  4UCO A;  4B3T O;  3QVN A;  3G67 A;  2D3O W;  5EBM C;  1WB8 A;  2QTS A;  4ZOL A;  5B1B B;  1QR8 A;  3RYH A;  1YVW A;  2EIM C;  4WFH A;  1Y66 A;  2OYQ A;  2IJH A;  3HPL C;  1BSM A;  3IGA C;  5LHI A;  2AXT Z;  1OCR B;  1K9M W;  5FLX N;  4LF5 B;  2PI5 A;  4JI3 B;  2CTW A;  5L3C A;  1UJW B;  2LQT A;  4UB8 Z;  4LF6 B;  3QG5 A;  4CZZ A;  3P3P A;  4QGP A;  4LF4 O;  1AI5 A;  2D2C B;  2CAZ C;  3P3N A;  3ZHT A;  1YDX A;  1CEZ A;  1VQ5 V;  3S3X A;  2EIN C;  2W6J G;  5L3E A;  3AG2 B;  2UXN A;  5CBF A;  1I5Y A;  2ZDI C;  5LMN O;  1GN3 A;  1R3K C;  3ZIA G;  4DV6 B;  4I55 A;  2IH1 C;  3RFR A;  3NR7 A;  1S72 V;  1K33 A;  5B5E Z;  3HKC B;  2JVD A;  3CCL V;  2FML A;  3JAT B;  2XOK G;  5LGN A;  5LP6 A;  2QWR B;  1SF9 A;  2DOS A;  4FFB B;  3E89 A;  4GKK B;  1ZSP A;  5JWP A;  2RNB A;  2ZNI A;  3W7U A;  4FLV A;  1QU7 A;  4O2B A;  4JYB A;  1YEW A;  3ZRX A;  1PV0 A;  3B40 A;  1AIL A;  2VS0 A;  1O9G A;  3K5M A;  5LA6 B;  4J7K A;  3HKE B;  3AK3 A;  3T1Y O;  5EIB D;  2H8P C;  4DV4 B;  4DV0 O;  2WLL B;  3IFX A;  2HEP A;  3CHX A;  3CCU V;  2Y69 C;  1JJO A;  2DYS B;  4ABM A;  2E74 B;  1YJN V;  1N36 O;  5CA3 A;  3B77 A;  4AQY B;  3OGI B;  2F4V B;  4DUZ O;  4GX1 A;  5KA6 A;  4GKK O;  3A0H Z;  1U97 A;  5C8Y A;  4J9Y B;  4TQD A;  1B04 A;  4O4I A;  4J9Z B;  5IJ0 A;  3SYC A;  4B3M B;  1IX9 A;  4LFA O;  2PTM A;  5EYP B;  4FLT A;  3ZRS A;  1V55 B;  1TUB A;  2QDO A;  2UUA B;  4LH6 A;  4H0L B;  4GKJ O;  2XAQ A;  1IUR A;  1GN4 A;  1Q43 A;  1Y67 A;  4CC5 A;  2K1E A;  2DWE C;  1NI8 A;  2HP8 A;  2HJF C;  2B1G A;  4DR1 O;  1FD9 A;  4CC6 A;  5KMG B;  2DYR C;  4D7S A;  4ASU G;  5C93 A;  4OGQ B;  3B8N A;  4ZKI A;  3OMA B;  2YIA A;  4O2A B;  4CS3 A;  1FYJ A;  3H1K H;  4UVB A;  4HNA B;  5JH7 A;  2EBO A;  3T2M A;  3UM7 A;  4JI6 O;  4X1Y A;  4FM0 A;  1VP7 A;  4WFF A;  2HHH O;  3LNN A;  4HAM A;  4BIZ A;  2YEV A;  1L1F A;  4F4L A;  2LFR A;  1JR9 A;  5B66 Z;  1R3I C;  4PI0 A;  3ZMT A;  5IT9 N;  1XDC A;  2CTQ A;  4U3F H;  2ETN A;  2VWJ A;  3H1L H;  4X65 B;  2YID A;  4NTW A;  3MD0 A;  4I50 B;  1OHH G;  1Z2G A;  1TVK B;  4H33 A;  4RUE A;  2Q0O C;  3JAS B;  1N33 B;  5KLV H;  2ZIO A;  5LMN B;  2VQE B;  4NB5 A;  3SPJ A;  5LOV B;  2E75 B;  3K04 A;  1YI2 V;  1SRY A;  3FX7 A;  5L3G A;  1KD1 W;  2P90 A;  2E3C A;  1R6K A;  3GWK C;  1J95 A;  2YXL A;  4BAY A;  3DGE A;  3ZCC A;  2F4V O;  2QKS A;  2UU9 O;  1NQT A;  3AG7 A;  3AK2 A;  1EM1 A;  1N0N A;  3I5D A;  2O57 A;  4IL6 Z;  4JI5 O;  2N04 A;  4PA4 A;  1WNS A;  3ABL C;  3CJH A;  3JAK A;  4DR5 O;  1JX9 A;  4JAS A;  1Q90 D;  1XOU A;  2ZR2 A;  3UO3 A;  3HKD B;  3RWR D;  1I5X A;  4X1K B;  3N2G B;  4J11 A;  1OJH A;  2Q0A A;  1XHZ A;  1D5A A;  2YUA A;  4UUJ C;  2KG7 B;  1OCR C;  3OEH G;  4DR2 B;  2AGA A;  2HLD G;  4DV7 O;  3ZMZ A;  4LF8 O;  3AG3 C;  1Q82 W;  1EN5 A;  2A06 H;  4U7O A;  3CYO A;  4MVU A;  4OX9 O;  3ZHU A;  1JFF A;  2AHY A;  1XL6 A;  3E8B A;  3H9V A;  3K58 A;  4D6T H;  1GM7 A;  5GON A;  5KX5 A;  4JYA B;  1WN7 A;  3WFV A;  4Z1M G;  3ZRW A;  1AI4 A;  1PNM A;  1R1B A;  5ITZ A;  4TT3 G;  4FPP A;  3BAB A;  3CRQ A;  1VF6 C;  2XND G;  5JH7 B;  5FNV A;  5F2V O;  1W59 A;  3QO8 A;  2XAF A;  5H2F Z;  3ABL B;  2X7R B;  4JYY A;  1O9H A;  4K8X A;  2QKC A;  2WLK A;  1J5E B;  4TSF G;  4B3R B;  4H13 B;  1US6 A;  2PF4 E;  3M7M X;  4L8J A;  2VQE O;  4KXR A;  1OCC B;  2QGN A;  4MTX A;  3OE7 G;  2HR3 A;  2LW1 A;  2OCH A;  3K0G A;  4PDR A;  4B08 A;  1KU9 A;  2EZP A;  4BW5 A;  4O4L A;  5IYZ A;  3CSX A;  3CCV V;  4O4H A;  2MK3 A;  2WA3 A;  1HNX B;  1BGY H;  2JGD A;  3AG1 B;  5JCO C;  4Z1V A;  1KBH A;  3OTF A;  1GM9 A;  1DTO A;  1Q3E A;  4GLX A;  4X89 A;  3K5O A;  1H8E G;  3CE2 A;  1SZX A;  3JAW B;  1R73 A;  1AR4 A;  1K5Q A;  1BQZ A;  4FVM A;  4KP4 A;  5KAI Z;  4JPR A;  1XMO B;  3F5T A;  4E2L A;  3QO5 A;  1ZLZ A;  4LFC B;  1DLB A;  2OTL V;  2RN9 A;  2ARH A;  3HKB A;  2ZKO A;  1K8A W;  1VQ6 V;  3R66 A;  2KSD A;  3TK1 A;  3IAY A;  1HNZ O;  3IJ4 A;  2LGW A;  3ZHS A;  4MTF A;  3W7S A;  1ENV A;  2DYR B;  2YEV B;  1VQP V;  1S0V A;  4JF3 A;  3SDL A;  3M99 B;  4TV9 A;  1PD3 A;  2QWQ B;  1KB9 F;  3WB2 A;  4B3T B;  2K9P A;  1NR1 A;  2WLI A;  1D5N A;  2EIL C;  1N34 O;  3QO7 A;  4UCT A;  2VQF O;  1NH2 B;  1VF7 A;  1MZF A;  2XHB A;  5K1X A;  2ZR3 A;  4U7N A;  1BL8 A;  5LOV A;  1J5E O;  4WFE A;  2NNU A;  3UT5 B;  1FPO A;  1H2S B;  2GUZ B;  2ZM6 B;  4DR3 B;  2DYS C;  2Y69 B;  4DR7 O;  2C2A A;  1NJI W;  4JI7 O;  1Y76 B;  1WJZ A;  1GMG A;  4MTO A;  4Q20 A;  2P67 A;  4MTG A;  4CH6 A;  1M1K W;  3JAK B;  2F66 C;  4QNH B;  5LGT A;  4YHH O;  4RQF A;  4CH4 A;  2L6L A;  1HNW O;  2OT5 A;  4MVR A;  4DV1 O;  1QQC A;  4PHZ A;  1IBK B;  1N0J A;  2IJK A;  1AP5 A;  3TXQ A;  1UPG A;  2OIE A;  3BVO A;  4DV2 B;  1R3L C;  3MHH C;  1LR1 A;  4LNU A;  4Z2W A;  3FYI B;  1IBL B;  1HP8 A;  3TGU H;  4CH5 A;  1JOY A;  4N23 A;  1DF4 A;  3E8H A;  2JJ2 G;  1K7D A;  3AG2 C;  4D7T A;  4JI7 B;  5KHI A;  2FB5 A;  3ZX6 A;  2DW4 A;  5IWA B;  2NR5 A;  3E22 A;  2ZIN A;  2BTO A;  2F23 A;  2UU9 B;  3CC2 V;  4LFC O;  4H44 B;  1S5H C;  2WLL A;  4TV8 B;  4I4T A;  3JAM N;  3SJA C;  2PYL A;  4OPH A;  2QTO A;  2QWP B;  1NVP D;  1K3E A;  4DR6 O;  1IBM O;  3CX5 F;  2AZ0 A;  3STZ C;  3OTO B;  2UXD O;  1COW G;  1Y4M A;  1FJG O;  5BR8 B;  4ZIB A;  5B1B C;  2ADQ B;  5C8Y B;  5H6Q A;  2B5U A;  3FB5 C;  2VWK A;  1VEW A;  5IJ0 B;  2JRI A;  2FYU H;  3JAS A;  3SPI A;  4NXM B;  2Q5Z A;  4O2B B;  1JPX A;  1WPB A;  3D36 A;  4GCZ A;  1H2G A;  2ZQM A;  5CMU A;  4X88 A;  1VAR A;  1JQ0 A;  3LDC A;  4JI4 B;  2EIN B;  5KHH A;  4MVS A;  5KHJ A;  1VQK V;  2HJD A;  1QNM A;  4XDJ A;  1RSO A;  4DO2 A;  2HHH B;  3EVK A;  2QWO B;  3CCS V;  2EIK C;  3CJH B;  2A0L A;  3BRC A;  2N74 A;  4FZ1 A;  4P2Z A;  1WP8 A;  4IGG A;  2BSK A;  5FPO A;  1P4R A;  4EB6 A;  4DUY B;  2CH7 A;  2EIM B;  2JS3 A;  1WAZ A;  4B7E A;  2GBO A;  3CXH F;  4DV3 O;  2ZE6 A;  1ZX3 A;  3ZJZ A;  1LNQ A;  3AG3 B;  4PA3 A;  3SPG A;  2MW2 B;  1L8D A;  2IJI A;  2UUC B;  2IM9 A;  4OPA A;  4YIO A;  1PL4 A;  3D3Q A;  1SES A;  4ICG A;  5FL7 G;  4YHH B;  4P9O A;  5H5N A;  2M6Y A;  4BW9 A;  5IDJ A;  1XI1 A;  5CBG A;  2WLI B;  3ZN1 A;  3ZHR A;  2YIB A;  4YJ2 B;  1LUW A;  2DN9 A;  2LO1 A;  1K73 W;  2YIB D;  5LYJ A;  1HDJ A;  4JTC B;  1IXM A;  1GH6 A;  1SKV A;  2HFE C;  1XNR B;  1AJQ A;  1WA8 A;  5DEC A;  1ZTE A;  1SZT A;  1EN4 A;  1LUV A;  3H1H H;  5JQG A;  3SPH A;  4GZR B;  4HBN A;  1F7Y A;  3I55 V;  4K35 A;  1E1Q G;  4NXM O;  1SET A;  3NXS A;  1S5L Z;  3F5W C;  5LP6 C;  1S5J A;  3WB1 A;  3I56 V;  5BY1 A;  2EIJ C;  5CN0 A;  1KKC A;  4UVA A;  2QA4 V;  2IBZ H;  2JIZ G;  1AB3 A;  1BCC H;  1H2L A;  4LFA B;  1Y74 B;  1XBL A;  3SYP A;  2CTP A;  4DXW A;  3N2K A;  5FPR A;  5B1A B;  3P30 A;  4CS4 A;  1M9N A;  1OV9 A;  4NKG B;  1YHQ V;  1X59 A;  5ITZ B;  3ETQ A;  3N2G A;  5FNV B;  1OCO B;  4GUN A;  3FYE B;  1KMI Z;  3THO A;  3CWB H;  3JD2 A;  3SPC A;  3VQX A;  3B4S A;  4TV8 A;  3AG4 C;  4DYL A;  2Y48 A;  1YF2 A;  2Y4T A;  1HW7 A;  3BY6 A;  1G4Y B;  1ROP A;  2A79 B;  4JI0 O;  3VOU A;  1ZL8 B;  5HFM A;  1V55 C;  3OMN B;  4X9Q A;  5KX5 B;  4LC1 A;  1HNX O;  2BCC H;  4O4J B;  1FXK C;  1NT2 B;  1AJN A;  3A0R A;  3QTC A;  5L3B A;  4ZOL B;  2QM7 A;  1V54 C;  4B3S B;  4NTX A;  5H6R A;  4MSW C;  1KYO F;  1EZV H;  3ZMV A;  1X4T A;  2E76 B;  1NKD A;  4X65 O;  2FL4 A;  5IJ9 A;  2IU3 A;  1EZJ A;  1AR1 B;  5L3D A;  5CA1 A;  4AI8 A;  2ODM A;  1RP3 B;  2W0X A;  1F51 A;  2P6J A;  4IT5 A;  2ZE5 A;  4ZHQ A;  2KQX A;  3DTU B;  1XNQ B;  3L75 H;  2H94 A;  2P7T C;  1Q6H A;  2X6C A;  1VMG A;  1Y76 A;  4HZ3 A;  4NR1 A;  1H2N A;  4FLU A;  3H01 A;  4MVQ A;  4JI1 O;  3VQY A;  1MAB G;  4WF9 V;  2EUL A;  4I55 B;  5B3S B;  1MNG A;  3FKS G;  2UUB B;  3GVM A;  1N8R W;  1QR9 A;  4DV7 B;  3RYC A;  4KHP B;  1E79 G;  4DR1 B;  3TJT A;  3SJB C;  3CRC A;  3K9S A;  1MSW D;  3BA9 A;  3B8M A;  2XAG A;  2ILM A;  4AHC A;  2WPD G;  3K03 A;  3SYQ A;  1R6N A;  4MVZ A;  3EFF K;  1YSC A;  2PYJ A;  2GDS A;  2NLJ C;  1BE3 H;  5LA6 A;  4QPJ A;  2OIG A;  1EFR G;  4MVO A;  1PNK A;  2PI4 A;  2XT9 A;  5D5Q A;  4I4T B;  1SQX H;  4FM2 A;  4UCS A;  3CC4 V;  3BPZ A;  5KUM A;  3STL C;  2P22 C;  4PDM A;  5J2U A;  1EN6 A;  2YS8 A;  4JAU A;  1FXV A;  4UV8 A;  5E79 Z;  2XAJ A;  2ZE7 A;  1V9P A;  1FXK A;  1XL4 A;  2WAM A;  3QNE A;  3L70 H;  1ZL8 A;  1YJW V;  3BFR A;  2YSU B;  4DW0 A;  1YTF B;  5EYP A;  4K0K B;  2Y0I A;  4X1I A;  5CB4 B;  5IY5 C;  2ZXW C;  2R9R B;  4Q6G A;  4X66 O;  1NTZ H;  2JS5 A;  2QJ1 A;  3KCY A;  4LF9 O;  3ASN B;  1N33 O;  3WB0 A;  4DV6 O;  5LXT A;  5KMG A;  3ABT A;  1RPR A;  1GO3 F;  1RSO B;  1OCZ B;  1SER A;  1FS0 G;  2OCC B;  4NXN O;  3CCQ V;  2IU0 A;  2ZCE A;  3ICX A;  3JAW A;  2KKW A;  1PNL A;  1DF5 A;  2F43 G;  2ZT9 B;  3ABK C;  4X62 B;  4K8Z A;  3ASO B;  4AIL C;  4W4L A;  2B1I A;  3A2F A;  5KA5 A;  2E5L O;  3G4S V;  5LMU B;  1A32 A;  3K5L A;  2YC0 A;  1ZUQ A;  5B1O A;  3KCX A;  4NVP A;  2PZS A;  2QE7 G;  3R65 A;  3CRM A;  4R7C A;  4X8A A;  4LF5 O;  3MDS A;  4GKJ B;  5IYC O;  3CCR V;  3JAR A;  1GN6 A;  2GTS A;  2OTJ V;  1L0N H;  3M8A A;  1YCI A;  5GTH Z;  4WCE V;  2Q67 A;  5BZB A;  2ITC C;  1H8H G;  2DWD C;  3ZRW B;  1WB7 A;  3W7W A;  5CA0 A;  2Q6A A;  1YJ9 V;  2PUS A;  2OWO A;  4GX0 A;  2ZNJ A;  3KZI Z;  2DQ3 A;  1DGS A;  2AHZ A;  4F6E A;  3L71 H;  2WLM A;  2GTA A;  4UCU A;  5IYD O;  4HYO A;  2KB1 A;  2IH3 C;  1XIL A;  2WLN A;  1FXH A;  5BXZ A;  4JI6 B;  4MVM A;  1AP6 A;  1PL0 A;  1U96 A;  4PDV A;  4TOI A;  5DN6 G;  1NVP B;  4I9Q A;  1NU1 H;  3RYF A;  1Q86 W;  1FAF A;  2RDC A;  4TQF A;  3CRR A;  4LH7 A;  1QVG U;  2EX3 A;  4X1K A;  2BOC C;  3JSN A;  3OT7 A;  1H38 A;  4L87 A;  3ZED A;  4O4L B;  5IYZ B;  1CPY A;  2CH7 B;  4LP8 A;  3K06 A;  3K79 A;  2LGQ A;  2WA4 A;  1VQ4 V;  4K3A A;  4JV5 B;  2UUC O;  1SQB H;  2LP7 A;  4DV3 B;  4DK1 A;  3DC5 A;  1RM1 B;  3CB2 A;  1HNW B;  1N4C A;  3CXC U;  1E1R G; 
#chains in the Genus database with same CATH homology
 2EIK B;  2IW5 A;  1GTO A;  2JK5 C;  2XAQ A;  1P4R A;  3ABM B;  5KUK A;  3E8F A;  2K1E A;  2DWE C;  3K9A A;  3KG2 A;  2HJF C;  2B1G A;  1GM8 A;  4JTA B;  4OXS A;  2EIM B;  2DYR C;  3OEE G;  4GT1 A;  4ASU G;  1M56 B;  5C93 A;  3B8N A;  4ZKI A;  3ASN C;  3OMA B;  3W7X A;  1NR7 A;  3CCM V;  2ZXW B;  3JD1 A;  4UXN A;  1Q7Y W;  3RBZ A;  4UVB A;  3ZJZ A;  1VQO V;  1K4C C;  4G2K A;  1LNQ A;  2EBO A;  3T2M A;  3UM7 A;  3AG3 B;  3ZRV A;  3GWO A;  4PA3 A;  4H37 A;  3SPG A;  2ATK C;  4WFF A;  1ZWI C;  2GHY A;  3ETG A;  4HAM A;  4BIZ A;  1QBZ A;  2IJI A;  3OAA G;  2X6B A;  1KP3 A;  2YEV A;  3RVZ A;  4FK5 C;  1L1F A;  4CBC A;  1SES A;  2LFR A;  4F4L A;  4N21 A;  3CMA V;  1R3I C;  5FL7 G;  4P9O A;  1K92 A;  5B3S C;  3W7T A;  3ZMT A;  1VQN V;  3ZMU A;  4MW8 A;  3OGC C;  1NBM G;  5IDJ A;  3P32 A;  5CBG A;  2QEX V;  2WLI B;  3ZN1 A;  4MT8 A;  1THZ A;  3FB6 C;  2QM8 A;  1K73 W;  3SYA A;  1M90 W;  3MD0 A;  1KC8 W;  1OHH G;  1AI7 A;  4RO2 A;  3T1C A;  2XAS A;  5LBQ A;  4JTC B;  4H33 A;  4RUE A;  1IXM A;  4BIU A;  2HFE C;  2V1D A;  5B1N A;  1AJQ A;  3SPJ A;  3JCZ A;  4XDL A;  3FB7 C;  1B6Q A;  2Q68 A;  5H9C A;  1YI2 V;  3K04 A;  5E1A C;  1SRY A;  1YIT V;  1SZT A;  5L3G A;  2P90 A;  1KD1 W;  1R6K A;  1J95 A;  4P9P A;  4R6Z A;  3DGE A;  3RVY A;  3SPH A;  2Z3Y A;  3ZCC A;  4BAY A;  2QKS A;  1S76 D;  1NQT A;  4LBE C;  3I55 V;  1F23 A;  3ASO C;  1E1Q G;  5LHG A;  1W2B U;  1SET A;  2JDI G;  3NXS A;  3F5W C;  3ABK B;  1JVM A;  3E86 A;  4QJF B;  4PA4 A;  4PA9 A;  3ABL C;  3I56 V;  2Q69 A;  3RW0 A;  1JX9 A;  1JCH A;  4JAS A;  2ZR2 A;  1I5X A;  2EIJ C;  5CN0 A;  5EBL C;  3E8G A;  3TCU A;  4UVA A;  2OCC C;  3FB8 C;  2QA4 V;  3T4D A;  2JIZ G;  1VQL V;  1K97 A;  3AG4 B;  4UUJ C;  4JAV A;  3HB3 B;  3SYP A;  4DXW A;  1OCR C;  4JYC A;  5EC2 C;  3OEH G;  4WFB V;  4UVC A;  2HG5 C;  2WSS G;  2HLD G;  3ZMZ A;  5B1A B;  1VQ8 V;  3P30 A;  3JYC A;  1Q81 W;  1M9N A;  3AG3 C;  1OCO C;  1Q82 W;  4U7O A;  1WLE A;  3CYO A;  2W0F C;  4MVU A;  1YHQ V;  2CK3 G;  4R50 A;  1JJ2 U;  3OMI B;  1NH2 D;  5IY5 B;  3T4Z A;  2AHY A;  3LDE A;  4PA7 A;  1OCO B;  1XL6 A;  3E8B A;  1M56 C;  1GM7 A;  2JJ1 G;  2HKO A;  2JEX A;  4QE9 A;  5B1A C;  3CD6 V;  5J9P C;  3FYE B;  3EHB B;  4I5S A;  4P30 A;  3WFV A;  4Z1M G;  4FJC C;  1V54 B;  3K3W A;  3JD2 A;  3SPC A;  5HFL A;  3ZRW A;  3E83 A;  2WLH A;  3AG4 C;  3TET A;  2Y48 A;  2A9H A;  1AI4 A;  1PNM A;  3BY6 A;  1G4Y B;  1FXK B;  1ROP A;  2A79 B;  3OR7 C;  1R3J C;  4TT3 G;  4FPP A;  5IYB O;  3VOU A;  2EIL B;  5HFM A;  3OUS A;  2XND G;  3ETD A;  4G28 B;  3G71 V;  1P7B A;  1V55 C;  3QO8 A;  2XAF A;  1KKD A;  3OMN B;  3ABL B;  2X7R B;  4R8C A;  3SJQ C;  3PJS K;  4LC1 A;  1S3J A;  2WLK A;  1FXK C;  2V7Q G;  1AJN A;  4TSF G;  3A0R A;  5L3B A;  3CME V;  2QM7 A;  1V54 C;  3ZMS A;  3MHS C;  5H6R A;  4MSW C;  1FFT B;  4FMT A;  3G6E V;  2FTK A;  3ZMV A;  1OCC B;  5EC1 C;  1NKD A;  4MTX A;  2WWW A;  3OE7 G;  2IU3 A;  1EZJ A;  1AR1 B;  3LUT B;  5L3D A;  1BHB A;  2HR3 A;  1K4D C;  4PEL A;  3IC7 A;  3K0G A;  3JD4 A;  1F51 A;  4PDR A;  4GX5 A;  2P6J A;  2EZP A;  4RAI A;  3DTU B;  4BW5 A;  2H94 A;  3ABU A;  2P7T C;  3E2E A;  2HVK C;  2M7W A;  2X6C A;  3CCV V;  4HZ3 A;  1S77 D;  4QE7 A;  2MK3 A;  3H01 A;  4MVQ A;  1W0K G;  2W6I G;  3AG1 B;  1MAB G;  3E35 A;  5LHH A;  1GM9 A;  4WF9 V;  1DTO A;  1QCE A;  4X89 A;  2ZDI A;  3F7V C;  1AI6 A;  1OZ0 A;  5GW7 A;  3AG1 C;  5B3S B;  5DM6 V;  1H8E G;  1R73 A;  3FKS G;  1K5Q A;  3JD0 A;  4QPK A;  4KP4 A;  1N8R W;  1QR9 A;  1QLN A;  1GKF A;  4JPR A;  1E79 G;  3K08 A;  4E2L A;  4KUM A;  3QO5 A;  4WFA V;  5L3F A;  3X2Q C;  3OUF A;  1DLB A;  3OM3 B;  2OTL V;  1K5S A;  1QVF U;  4WFG A;  1MSW D;  3B8M A;  4UV9 A;  1K8A W;  3TK1 A;  3CCE V;  1VQ6 V;  3BEH A;  2XAG A;  4MTF A;  3W7S A;  1OCC C;  4YXW G;  1ENV A;  2DYR B;  2WPD G;  3ETE A;  2LFS A;  1F4M A;  2YEV B;  3K03 A;  3SYQ A;  1M57 B;  1VQP V;  2ITD C;  1S0V A;  4JF3 A;  3LDD A;  1R6N A;  3OR6 C;  4MVZ A;  3EFF K;  1YSC A;  5CBH A;  3JD3 A;  2NLJ C;  1RPO A;  3M99 B;  4I9W A;  4QPJ A;  4MVO A;  1EFR G;  1MG1 A;  1PNK A;  2PI4 A;  1PD3 A;  3CC7 V;  4PDL A;  2R9I A;  1QLE B;  3CP1 A;  1VQM V;  1VQ7 V;  1RM1 C;  3CC4 V;  1NR1 A;  4RUF A;  2WLI A;  5KUM A;  2BOB C;  3STL C;  3LSQ A;  2ZD9 A;  2EIL C;  1G8M A;  4PDM A;  3QO7 A;  4G27 B;  1ORQ C;  1NH2 B;  4JAU A;  1FXV A;  4UV8 A;  2XAJ A;  3WG7 B;  1FXK A;  4PA6 A;  1XL4 A;  3VBB A;  1EBO A;  2WAM A;  2ZR3 A;  3QNE A;  4U7N A;  4JTD B;  1BL8 A;  1YJW V;  2YSU B;  1WPX A;  2NNU A;  4WFE A;  1KEC A;  1YTF B;  1AJP A;  1KQS U;  5IY5 C;  2ZXW C;  2DYS C;  2R9R B;  2Y69 B;  2HVJ C;  2C2A A;  2D3O W;  1BHA A;  5EBM C;  1NJI W;  1KP2 A;  3WG7 C;  3ASN B;  2X0L A;  2EJR A;  1GMG A;  5B1B B;  3D3I A;  4MTO A;  1QR8 A;  4Q20 A;  1YTF D;  2GSM B;  2EIM C;  2P67 A;  4MTG A;  1Y66 A;  4WFH A;  2IJH A;  3ABT A;  3HPL C;  3IGA C;  5LHI A;  1M1K W;  1RPR A;  1OCR B;  1K34 A;  4QNH B;  1GO3 F;  1K9M W;  3ABM C;  2UXX A;  1OCZ B;  5LGT A;  4RQF A;  1SER A;  2PI5 A;  1FS0 G;  4XBF A;  1QLE C;  3GB7 C;  2OCC B;  5L3C A;  1UJW B;  2EIJ B;  1W0J G;  2Z5U A;  2OT5 A;  4MVR A;  3CCQ V;  2IU0 A;  1F4N A;  2IJK A;  4QIW F;  1PNL A;  4CZZ A;  1DF5 A;  2F43 G;  1AI5 A;  1R3L C;  3ABK C;  1M57 C;  3MHH C;  3FYI B;  3ASO B;  3ML0 A;  4MS2 A;  2B1I A;  1MOF A;  1CEZ A;  1VQ5 V;  1JOY A;  3SYO A;  2EIN C;  2W6J G;  5KA5 A;  5L3E A;  3AG2 B;  2UXN A;  4MW3 A;  4N23 A;  4ZBM A;  5CBF A;  1DF4 A;  3G4S V;  1I5Y A;  2ZDI C;  3E8H A;  2JEU A;  5LGU A;  1R3K C;  3ZIA G;  2JJ2 G;  2IH1 C;  5EK0 A;  5B1O A;  1K7D A;  3X2Q B;  3AG2 C;  1HWY A;  2QE7 G;  3R65 A;  1S72 V;  1K33 A;  4TWK A;  4R7C A;  3CCL V;  4X8A A;  5LGN A;  2XOK G;  2DW4 A;  2X6A A;  4XDK A;  5IYC O;  3CCR V;  2DQ0 A;  3LNM B;  2OTJ V;  2XAH A;  4WCE V;  4LCU C;  3CC2 V;  2Q67 A;  5BZB A;  2ITC C;  1H8H G;  2DWD C;  3E89 A;  3ZRW B;  1S5H C;  3W7W A;  2IJJ A;  2WLL A;  2Q6A A;  1YJ9 V;  2QTO A;  4RQE A;  4GX0 A;  3W7U A;  1NVP D;  5EBW C;  2DQ3 A;  1K3E A;  2AHZ A;  3CCJ V;  1OCZ C;  3K0D A;  4JYB A;  2WLM A;  5IYD O;  3STZ C;  4HYO A;  2KB1 A;  2IH3 C;  3ZRX A;  4GX2 A;  1COW G;  1FXH A;  2WLN A;  2WLJ A;  1Y4M A;  5B1B C;  4MVM A;  5H6Q A;  2B5U A;  1BMF G;  3FB5 C;  2H8P C;  1PL0 A;  2WLL B;  4PDV A;  1NVP B;  3IFX A;  5DN6 G;  3CCU V;  3OW2 U;  2Y69 C;  2DYS B;  3SPI A;  3UKM A;  1CP9 A;  1YJN V;  4KFM A;  5CA3 A;  1Q86 W;  1JPX A;  1PKX A;  3B77 A;  3CPW U;  1YIJ V;  3D36 A;  1QVG U;  4GCZ A;  1H2G A;  2ZQM A;  2BOC C;  3F7Y C;  3ZN0 A;  4GX1 A;  5CMU A;  4X88 A;  5KA6 A;  1JQ0 A;  3LDC A;  3AEI A;  2EIN B;  4J9Y B;  4MVS A;  1H38 A;  4L87 A;  1VQK V;  4J9Z B;  1GK9 A;  3OFN G;  1CPY A;  4LP8 A;  3K06 A;  3K79 A;  3SYC A;  4EKW A;  1VQ4 V;  1VQ9 V;  4XDJ A;  1ARO P;  4DO2 A;  2LP7 A;  1TUE B;  3LSS A;  2EZO A;  1RM1 B;  3ZRS A;  4FIP C;  3CCS V;  1V55 B;  2EIK C;  2A0L A;  3CXC U;  4P2Z A;  4JGS A;  1E1R G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...