3K06A

Crystal structure of cng mimicking nak mutant, nak-ntpp, k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGNTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k06A00
3SPHA 2WLNA 4PDRA 2BOBC 4R50A 3ZJZA 2X6AA 3OUSA 4MTOA 4TWKA 4MVRA 3OR7C 3E8HA 4R6ZA 4PDLA 5EK0A 2WLLA 4MVUA 3X2QC 4GX1A 2A9HA 2KB1A 4GX5A 1R3KC 2Q6AA 4MVQA 2HG5C 2X6CA 3ABLC 4MS2A 5CBGA 2WLKA 2BOCC 1V55C 4MVOA 3SYQA 5EC1C 4JTDB 1OCZC 4ZBMA 2OCCC 3ABMC 3ABKC 1J95A 4WFFA 1G4YB 3SPJA 3E83A 3F7YC 4H37A 3OR6C 4MSWC 1V54C 2EINC 4I9WA 1JVMA 4GX0A 4HYOA 2NLJC 2W0FC 3HPLC 3JYCA 2Q67A 4P9OA 5B3SC 1KKDA 4P9PA 3SYPA 1R3JC 3SJQC 2Q69A 4QE7A 4RUEA 2AHZA 3K0GA 5CBFA 4R7CA 3R65A 3F7VC 1QLEC 2ZXWC 2WLIA 3AG1C 4PA9A 4OXSA 4RO2A 3EFFK 2WLJA 2WLMA 2X6BA 3BEHA 3FB8C 1ORQC 3LNMB 2DYSC 2A79B 3OUFA 4J9YB 2A0LA 3F5WC 3E8FA 3ZRSA 3AG4C 3TETA 2ZD9A 3OGCC 3UKMA 4P30A 4DXWA 3SPIA 4MVZA 3FB7C 4JTCB 3LDEA 4XDKA 3E8BA 3IGAC 2P7TC 1OCRC 2ITCC 4WFHA 4MVMA 4KFMA 2Y69C 3E89A 4PDMA 5EC2C 2DYRC 3GB7C 4MVSA 1OCOC 1R3IC 5CBHA 2Q68A 4LCUC 4XDJA 2K1EA 4F4LA 3VOUA 3PJSK 2QKSA 4PA6A 2EIJC 2EIKC 2H8PC 3KG2A 2HVJC 5EBLC 4MTFA 4WFEA 3K04A 3SPCA 3LUTB 3T4DA 3RBZA 3STLC 1OCCC 2ATKC 3K03A 2YEVA 4J9ZB 4RAIA 2JK5C 3RVYA 3RVZA 3T2MA 5KUKA 3K0DA 3K06A 4X89A 2HJFC 5J9PC 4X8AA 3LDDA 3T1CA 4PDVA 4PA3A 1M56C 4JTAB 4RUFA 3UM7A 4EKWA 1XL4A 1ZWIC 1P7BA 2QTOA 2ITDC 4CBCA 2EILC 4MTGA 3K08A 3RW0A 5E1AC 1S5HC 4WFGA 5EBWC 4MW3A 5B1BC 2R9RB 2IH3C 4LP8A 2WLHA 3FB5C 1K4CC 2DWEC 4UUJC 1LNQA 4QE9A 3TCUA 3WG7C 2DWDC 3IFXA 4QNHB 2HVKC 3E8GA 3ASOC 5KUMA 4HZ3A 4X88A 3E86A 5B1AC 3SYAA 3T4ZA 3FB6C 4GX2A 3SYOA 3AG2C 2EIMC 3ASNC 1BL8A 3LDCA 1R3LC 2HFEC 2WLLB 4XDLA 3SPGA 2WLIB 4P2ZA 3STZC 3SYCA 5BZBA 3AG3C 5IY5C 1XL6A 4G28B 4PA7A 5EBMC 4H33A 4R8CA 2AHYA 4BW5A 2IH1C 1M57C 4MW8A 1K4DC 4LBEC 4PA4A 4G27B
chains in the Genus database with same CATH superfamily
1BHBA 1JPXA 2X6AA 3OUSA 2Q73A 1BMFG 4UCUA 1R3KC 2A06H 3DSQA 2BE3A 1Z2GA 4JI4B 1OCRB 2UUAB 3SYQA 3CCQV 1H8HG 2DW4A 4WFFA 1G4YB 5CA3A 3F7YC 3ZS8C 3OR6C 5FNVB 4JI7O 3ETGA 4ZIBA 4A5UB 4P9PA 3ZMTA 4YIOA 5K1PA 1SQQH 4E4EA 4FLTA 2QWRB 3HB3B 2ZXWC 4PA9A 2LW7A 4WCEV 2GDSA 2Q0AA 1URFA 3UKMA 1UJWB 2RQ6A 4MVZA 2JDIG 1KECA 5FLXN 1GO3F 4DR3B 1BSMA 1M4UA 4F4LA 4X1KB 2EIJC 3N2GB 2WPDG 1T5EA 1OCCC 5CA0A 3K03A 1I5XA 2Q7EA 3ZMUA 5LMUB 1F23A 2ZE5A 3IAYA 1M56C 4CC6A 4ZI7B 2UUCO 2ITDC 2EILC 4DV2O 4I5SA 2YICA 4GLXA 3AG4B 4GCZA 4DR2O 1K4CC 4K0KB 4QE9A 2R72A 3IFXA 1M9NA 3HKBA 1E1QG 4JI6O 4YIPA 3I55V 3UCSC 4JYAB 2Q7GA 3ASNC 2Y69B 1IBLB 5HFMA 3ZHSA 1OCOB 4NYKA 2EZPA 2RCVA 5BY1A 4X65B 3A0HZ 3GWKC 1MABG 4R50A 4X1YA 3W7SA 4CH5A 1Z5VA 3H1LH 2H3OA 2QSAA 1YCIA 2BOCC 1XBLA 4J7ZA 2GSMB 5KMGA 2YS8A 2Y48A 1VF7A 4JASA 2CTPA 5EYPA 1JVMA 2QKAA 2W0FC 1FKAO 3J80N 4DV5O 5H5NA 3L71H 5KA6A 1VQNV 2A7WA 1OCCB 1BE3H 4I55A 3CJHA 4JGSA 4I9QA 5IJ0A 2R9IA 3LNMB 5L3FA 2A79B 1M56B 1SESA 1KMIZ 2UUAO 3A0BZ 1IVSA 4O2BB 2EILB 1AILA 4DR5O 3MDSA 2ZR3A 2QWOB 3OTOO 4DV3B 4XDJA 1ZAUA 4NTYA 1AI4A 4LFAB 3VOUA 3RYHB 5KA5A 3G6BA 3ASNB 2F1MA 2VQFB 4MTFA 3B40A 5LGUA 1WB8A 3ZCCA 1Y6XA 5J9PC 3H1HH 5IT9N 1PL4A 2Y4UA 3CCRV 4ASUG 3K79A 1HNZO 4DR6B 1NKDA 3JD0A 4UCVA 4IIJA 2Z5UA 1E79G 4PI2A 4BIOA 2XHBA 3WG7C 1Q86W 5KUMA 5LXTB 4L87A 5B1AC 1HNXB 1H2KA 3B4SA 1K97A 5BMVA 2E76B 2HFEC 3K58A 1VP7A 3STZC 1AVMA 2E74B 1N8RW 4R8CA 4X9QA 3T1YB 2AW9A 2P90A 5H2FZ 2VQEO 3L73H 3K57A 1DLBA 1W2BU 2HHHB 3CYOA 3JCUZ 2Y0PA 2OCCC 5LMNO 4KHPO 1DGSA 3ABMC 4U7NA 1AP6A 5L3CA 1SQFA 4X65O 2WA3A 2F43G 3KCYA 4UCSA 2GBOA 1IDSA 2QJ1A 1NTZH 2GTSA 4K8XA 1SRYA 2EBOA 2LP7A 4KP4A 2MK3A 4ABMA 1VQOV 3QF7A 1WA8B 4U3FH 1Q3EA 4PELA 5CA0B 3JSNA 1TGOA 3RWRD 1M5IA 4FMTA 3IJ4A 2K1EA 1I08A 2GV9A 4PHZA 3T4DA 1US6A 4IT5A 3BA9A 3Q4HA 1GTOA 3QO7A 4DV6B 3BAAA 2F95B 2PF4E 2BCCH 4FZ0A 4X8AA 5JVDA 4DUZO 1BHAA 4Q20A 3HKBB 4YHHO 1ZWIC 3K59A 3K08A 5IJ9A 1S5HC 4DV3O 2YXHA 4LFAO 1FPOA 3ETDA 3U11A 5GTHZ 2DWEC 3C3TA 1H38A 4NTXA 4PI0A 2OCCB 4X1YB 3ABMB 1VQ5V 3ETEA 4J41A 3L72H 5IDJA 3N2KB 3CD6V 1FJGO 3ZRWB 1MSDA 1NVPB 3OGIB 5KMGB 5LHIA 4LH6A 2LFRA 1MA1A 3NR7A 3M7MX 4Z1VA 3CC7V 4PJ0Z 3JAKA 4CH6A 4MVQA 1LUWA 4IHJB 5HFLA 1HNXO 1N36B 1XNQO 1H2LA 1I5YA 4H37A 3THOA 2CTQA 4NR1A 4IL6Z 3ZN1A 4TV8A 3FX7A 4RUEA 1W0JG 2ZE6A 5LYJA 1WPXA 4I50A 3CB2A 5IY5B 2JJ2G 2DYSC 2A0LA 2RMKB 1GKFA 3ABTA 1M1KW 2HHHO 2F4VO 5JQGB 2XTAA 4FFBA 4H0LB 4DR7O 4H44B 4JI5O 3I5DA 4BAYA 2FKXA 2XNDG 2ZCEA 4JI1B 4J80A 2RN9A 1EZJA 5CMUA 1N0NA 5D5QA 4ICGA 3DXRA 5EBLC 1Q6UA 2CTWA 1W59A 2WWWA 3WU2Z 1R6NA 2EULA 4X89A 1OV9A 1Q90D 3S3WA 3CPWU 4JI0O 1SA0A 1O9HA 1XMOB 4W4KA 1G6UA 1HNWO 3NXSA 1IBKB 4MTGA 2RNBA 1TA8A 5JJNB 2LGWA 1KD1W 1M90W 4WFGA 1SQXH 1Q82W 1JQ0A 3VBBA 5KHJA 4DV0O 2YDEA 3H1JH 2DWDC 3JD1A 2PI5A 3EXAA 3CP1A 1NZ6A 4EEQA 1VQMV 1WNSA 2B1GA 3TJTA 4DV6O 2QM8A 3ZMVA 3QO5A 4LBEC 3JAMN 4NB5A 3N2GA 4LFCO 3LSUA 5KLVH 4TQFA 1TUBA 1F51A 3E8HA 2WLLA 2A9HA 4JYBA 2HG5C 2X6CA 3ABLC 4TV9B 1CPYA 4ZI7A 4MVOA 3BRCA 1XEQA 4X66O 1FYJA 1EN5A 1DK1A 4UV9A 2QKCA 4HYOA 3H9VA 2UUBO 2N05A 1AROP 4Z2WA 4YJ3B 4QE7A 2CGNA 3AG1C 5IYDO 2N04A 4JYYA 3MAQA 1MZFA 2GUZB 3E8FA 4DW1A 3B8NA 3VQXA 4UVBA 4XDKA 1NTKH 4LF8O 5FPRA 3CCJV 4MVSA 3TK1A 5JVDB 3HKDA 1XREA 3L70H 2OIGA 2DJVA 2UXBO 1B06A 2RJZA 5IJ9B 4IYHA 2JS5A 2EINB 1L8DA 1Q6IA 5E79Z 4DR4O 3K5OA 1YTFB 2UUCB 1K92A 2IU0A 1K8AW 5E1AC 4DV2B 2V7QG 1FXKB 2LO1A 2WLHA 4O2BA 4DR2B 3FYIB 5DEDA 1R3LC 5KHKA 1N0JA 5KHGA 4XDLA 3RYCA 1M93A 4BR6A 3K9SA 4MW8A 3RYHA 4RAIA 4D7SA 2IJHA 1HR0O 3OR7C 2C2AA 3G71V 5LGNA 1K33A 1RSOB 1L0NH 4TV8B 2ZNJA 3JAWA 4I50B 2Y0IA 2QM4A 1WB7A 3DC6A 5H6QA 1KBHA 2WA4A 3MD0A 2PZSA 1SQPH 5LXTA 4DV5B 4FFBB 2Q69A 1H2SB 1PL0A 2AHZA 5B5EZ 4CS2A 4JV5B 1VQ4V 1JOYA 1GM9A 3WB2A 4AI8A 1P49A 3AG4C 1S3JA 5LL6Y 3DXRB 3LDEA 3SGIA 4X62O 4DR5B 1XNRO 1EN6A 3OTOB 5B66Z 2Y69C 4HNAA 4CZZA 1OCOC 1SA0B 1SQBH 2B5UA 2ZM6O 5AG2A 2P06A 5B1OA 2YIBA 2H8PC 4O2AB 3FFQA 5LGTA 4DV4O 1RM1C 3CXHF 5C8YA 2FYUH 2ZDIA 1HNZB 1LR1A 1R6TA 2IJIA 4B3RO 4MW3A 1JX9A 3SJBC 2ZE7A 4EFEA 1K7DA 3ZBHA 2ZINA 1WA8A 1UFIA 1TUBB 4DO2A 4GKJO 2DN9A 2WLLB 4LFBO 2DYRB 1AR4A 2W6IG 4N21A 2YC0A 5KAIZ 2D2CB 4B3SB 1VF6A 4G27B 2DQ3A 2IU3A 2M7WA 1N34O 4GKKO 4UB6Z 1EM1A 4YXWG 3TXSA 3LNNA 4PDLA 2VQEB 2AZ2A 1NU1H 2P22C 4LNUA 4LF5O 2PTMA 3CMAV 2XAHA 1OCZC 4KHPB 5LMNB 3JD3A 3ZMZA 3OW2U 3K5NA 2E75B 1P7GA 3HKEB 1RM1B 3RFRA 4R7CA 4OXSA 3RN4A 3N2KA 1ORQC 2B1IA 3HKDB 3ZRWA 3BA8A 2CH7A 1YI2V 3G4SV 2OTLV 2R70A 1B04A 3APQA 1ZUQA 2JGDA 4KFMA 1NH2B 2WAMA 2XAJA 1VMGA 2XAQA 4IHJA 2Q68A 2QEXV 5H9CA 2QR4A 1F7YA 1KP3A 1WJZA 4JI3O 2PYLA 4JV5O 4OPHA 2CUGA 3K9AA 3T2MA 1QU7A 1Q7YW 4DV1B 1GN3A 3K3WA 2DQ0A 4DUZB 2QWQB 4YHHB 4B7KA 1P84F 2Q7HA 3QG5A 4RWUA 2AZ0A 3RYCB 4E2LA 2YXYA 4UVCA 4DRXB 5JQGA 2ZDIC 3B8MA 1OCZB 2HLDG 4J7KA 3APOA 2ARHA 2DMXA 4P2ZA 3AG3C 2CAZC 2YI9A 2W0XA 1B3QA 3ML0A 1FJGB 2OIEA 4FZ1A 3K5LA 1SQGA 3JAWB 4FLUA 4MVRA 2FTKA 2KB1A 1B6QA 2OCHA 4LF6O 1QNMA 3FYEB 3VQYA 2WLKA 1AJNA 3AK1A 2O57A 2IJKA 1XNQB 1VF6C 5GTIZ 4OGQB 4TUYA 1YF2A 1GN2A 4K8ZA 4C7UA 1NI8A 4B3SO 4LF4O 1RPOA 5J2TA 4WF9V 5IYZA 1NTMH 4L8JA 5CBFA 2UXXA 3R65A 3F7VC 2IW5A 4HNAB 4FFKA 1MMMA 1XOUA 2F4VB 4J7JA 3UO2A 4DR7B 1PNMA 4JI5B 1N4CA 3JATB 5C8YB 1UPGA 1PD3A 1R3IC 2ADPA 1TVKA 4TV9A 2JEUA 3JD2A 4KL1A 1FD9A 1KP2A 2IBZH 3OMNB 4EB6A 5CN0A 4F6EA 4JI2O 3AG3B 1QVGU 1MOFA 1XILA 4JI0B 4YJ3A 4UCRA 5L3EA 2QTOA 1HNWB 4I0XA 3ZHVA 2JRIA 2QE7G 3EHBB 3B77A 3P3NA 2GUZA 4DV7O 1LUVA 4DV0B 3TCUA 4IGGA 1BQ0A 3ASOC 1XDCA 3CRCA 2VWJA 1BL8A 4DV1O 4B08A 3FD9A 5IY5C 1QBZA 4LNUB 1F4MA 4H33A 1KB9F 4BW5A 2QM7A 1K4DC 4AQYO 2RDCA 2JGUA 4LFCB 2BOBC 2ZT9B 1YJNV 1JJ2U 3PN1A 3CRQA 3X2QC 1CEZA 3ZN0A 2Q8VA 2XASA 1ZX3A 1VQLV 1SETA 1BZKA 1TUEB 2JJ1G 1MZEA 5BR8B 1SS3A 5EC1C 1FXVA 2N74A 4X66B 2KQXA 4GT1A 1FXKA 2PUSA 2H94A 2L6LA 1IBMO 4MSWC 2W6JG 2ETNA 4I9WA 1KKDA 2CH7B 2UUBB 2Z3YA 4OPAA 2JGDB 3OEHG 5GONA 1PNKA 1M57B 4X1IA 3ZRVA 3CEIA 3SPIA 5LHGA 1HWYA 4JTCB 2Q5ZA 4YJ2A 1AJQA 1S5LZ 3IGAC 2ITCC 1RP3B 2IJJA 4LF8B 1RSOA 4QGPA 1Y66A 4RQEA 3DTUB 5CA1A 3ASOB 3CX5F 4K3AA 3VQWA 2OYQA 3ZHRA 1YJWV 2UXBB 1IURA 1P4RA 3KG2A 2B9ZA 3K04A 4BIZA 2V1DA 1J5EO 2Z0AA 4UV8A 4CH3A 3K06A 1BCCH 2QTSA 2VRZA 2CE4A 2P67A 1KQSU 3ZIAG 4DR4B 4RUFA 4FLZA 1YEWA 3BCCH 3X2QB 3EVKA 2YXLA 3B2EE 4FVMA 2R9RB 4W4LA 4OX9O 1FS0G 1AI5A 2GTAA 4CS4A 5A9GA 2JVDA 2KKWA 4GX2A 3JASA 4JF3A 4FLWA 5GW7A 4JI8O 2P4VA 3I56V 2E5LO 3QVNA 2XT9A 1YIJV 4LC1A 1VEWA 3SPHA 4O2AA 1KU9A 1R1BA 3ZJZA 1HR0B 3AK3A 4TUYB 2Q6AA 1JA8A 1K9MW 1HP8A 5CB4B 4MS2A 2OTJV 5J2TB 4D7TA 4NXNO 5IYZB 2YI8A 1XQ8A 3N27A 1N33O 3D3IA 3JALA 5DN6G 3IC7A 2JEXA 2Q0OC 4WBNA 1G1XB 2EINC 1FAFA 5DECA 4FLVA 1ZSPA 5LA6A 3D8CA 5H6RA 2UU9O 3D3QA 2UXDO 2WLJA 4LWSB 3CRRA 1FXKC 1FFXA 1K5QA 2LFSA 1TVKB 5BR8O 3TETA 1WN7A 2HR3A 4EB6B 4X62B 1XNRB 1SZXA 4MVMA 2K9PA 1YJ9V 2P5OA 5ITZA 4TOIA 4CH4A 4LF9O 2XAGA 4I4TA 1JR9A 5KHHA 2ZM6B 4PA6A 3CCMV 4I0XB 1S0VA 4WFEA 3LUTB 5JJJB 4DV4B 1DF5A 3LDDA 1GMGA 3HKEA 2PYJA 3ICXA 1P7BA 1VQ8V 5LBQA 5JH7A 4BW9A 5EBWC 4B3RB 2ZE8A 1Z5WA 1DTOA 1VF5B 1WAZA 4X20B 2OT5A 2AXTZ 3FB6C 3SYOA 4O4JA 4GKJB 1OHHG 5FL7G 4LFBB 5BZBA 3SYCA 5L3BA 4PA7A 4IYIA 4WFBV 1Q43A 3OEEG 3JSLA 2WLNA 3W7XA 4MTOA 2YIAA 3ZRXA 3BPZA 1N34B 1H2MA 4GKKB 3OE7G 3JD4A 2ZR2A 4UVAA 1NVPD 1VQKV 4LF5B 3W7TA 4O4IA 5DM6V 4JZGA 4JTDB 2PY5A 4TT3G 3CC2V 1Q6HA 1AB3A 1I0HA 3SPJA 2YSUB 1EZVH 4H13B 4AHCA 5GONB 2Q9LA 4DRXA 2EZOA 3A8TA 4X1IB 2Q67A 1IX9A 4YJ2B 1PPJH 3K0GA 1Q81W 3ZX6A 3L75H 4RO2A 1YZBA 3S3XA 5CA1B 2CGOA 1ENVA 4J9YB 3OM3B 1K73W 4P30A 1ZL8B 2R9AA 4ZHQA 1XHZA 1XUQA 1NS1A 4QIWF 2DYRC 1D5NA 4LCUC 2KG7B 2AGAA 4HAMA 1BS3A 2KSDA 1VQ7V 3P30A 1S77D 3M8AA 3ABKB 4JI3B 3IC9A 3STLC 2IM9A 2Q4PA 4HBNA 2LW1A 4TQDA 3E2EA 3ZEDA 1QVFU 3CHXA 1SZTA 4DW0A 1XMQB 1SQVH 3BVOA 1IXBA 1XL4A 4MTXA 2QWNB 2ZIMA 3JASB 1NJIW 3BY6A 3RW0A 3MHSC 2F66C 1JJOA 1QLNA 4UFZA 5EZYA 3FB5C 4DUYB 4NTWA 2D3OW 4UUJC 1LNQA 4U3JA 2HVKC 3RYIB 1R73A 2HKOA 5LHHA 2M6YA 4BIUA 3JATA 4DR1B 1YSCA 2UXCO 3AK2A 3FAVB 5EBMC 3SR2C 1WLEA 2L35A 1OZ0A 1F4NA 2IH1C 4PA4A 3JALB 4TWKA 4J42A 3OFNG 4WBNB 1GN6A 5JCOA 1VQPV 4LF6B 2EJRA 3QO8A 5LA6B 2NR5A 3QTCA 1NBMG 3L9DA 4QPJA 4D6TH 3JARB 1FFXB 1XI1A 3CXCU 4LF4B 1NQTA 3SYPA 3SJQC 3FKSG 3J81N 4CS3A 3T1HO 5K1XA 3FB8C 5ITZB 1K3EA 2BSKA 4I4TB 4DYLA 1NR7A 1IXMA 3JCZA 1VQ9V 3E8BA 1HDJA 2QGNA 1N32O 2HEPA 2ADQB 3SPCA 5JH7B 2HVJC 1KUQA 1KKCA 5LP6A 4JI2B 2ZKOA 1KYOF 3K0DA 1SC5B 1WPBA 5KX5A 1QR8A 1V9PA 2BTQB 4PDVA 3AG7A 4PA3A 3DC5A 3G6EV 5EIBC 4O4JB 2ZXWB 3CE2A 3HKCA 1FFTB 5B1BC 3SDLA 2XOKG 4F6RA 1HW7A 2QA4V 1S76D 4DV7B 1YTFD 4LH7A 1EN4A 4B3TB 2WLIB 1XMQO 4JYCA 2YIDA 2BTOA 5TISZ 1S5JA 4FK5C 3ETQA 4O4IB 3MHHC 4AQYB 2EIJB 3ZMSA 3CRAA 4PD4F 5EK0A 4DUYO 2DE0X 1D5AA 4JZ2A 4O4LB 5CBGA 4JI4O 4NXMB 2YUAA 2X7RB 2EX3A 3B09A 3CRMA 4DR1O 2JS3A 2YEVB 1X59A 1IBMB 4P9OA 2NLJC 5JCOC 3ZHUA 1R3JC 3RYFA 4ZHQB 5JWPA 2ILMA 5J2UA 2GHYA 1OJHA 1QLEC 4UXNA 1TAEA 2X6BA 4AILC 4G2KA 2F93B 3J7AU 1WP7A 2OWOA 4JAUA 1QHTA 3E22A 4FM2A 5B1BB 4XBFA 1GRJA 3E89A 4PDMA 3GB7C 5CB4A 1NR1A 1R6KA 5IYCO 4DR3O 3O65A 1YDXA 2HP8A 3E35A 3PJSK 1AP5A 3RBZA 1J5EB 1QR9A 2HJFC 5EZYB 3ZHTA 5LMUO 1QQCA 1THZA 1I94B 4U3JB 4WFAV 1BQZA 2VS0A 4CBCA 3KCXA 4LWSA 5LP6C 3CCEV 1L0LH 4DK0A 4OX9B 4LP8A 4FIPC 4K0KO 4ZKIA 3H01A 3CCVV 1Y76A 2CK3G 4NKGB 3ZHQA 4JYAO 3AG2C 1PP9H 2EIMC 3LDCA 1IBLO 3LSQA 2LJ2A 1RPRA 2Y4TA 1NT2B 4JI8B 1E1RG 2E5LB 1EFRG 3G67A 4LF7B 1M57C 3WB1A 5LOVA 5L3GA 4PDRA 1JFFA 1QLEB 1U97A 4TSFG 1YHQV 1L1FA 4NXNB 1ZTEA 4FM1A 4RQFA 4B3TO 1N33B 3OT7A 1MSWD 3DGEA 3UT5A 4FM0A 4X64B 2G38A 3GVMA 3F5TA 2BSKB 2ZQMA 3RT3C 3WG7B 4X20A 3VQVA 5B1AB 4YY3B 1K5SA 2UU9B 5IWAB 2UXDB 1GAXA 1Y74A 2NN4A 3EFFK 3C3SA 4NXMO 4JAAA 5KAFZ 4J10A 3F5WC 4BWAA 3OGCC 4DXWA 5B1NA 4N23A 1JMKC 4QJFB 5LP6B 2DOSA 2FB5A 5IYBO 4NVPA 3A2FA 2A3QA 5CBHA 1RFYA 5KX5B 2FMLA 1H8EG 4LF9B 3AG2B 2QKSA 2EIMB 1COWG 2VQFO 2EIKC 1YITV 4UCOA 1NH2D 4KXRA 3HKCB 2P4KA 2JK5C 2VWKA 5KUKA 1X4TA 3U0ZA 4F6RB 1AJPA 4J11A 4GUNA 2QWPB 3TGUH 2PGGA 3UM7A 4DR6O 4UB8Z 4ZOLA 1DF4A 4KUMA 4Q6GA 3WFVA 1SERA 5EYPB 1W0KG 2QDOA 4EFBA 1ZL8A 1GM8A 3E8GA 3CMEV 1S72V 3E86A 3SYAA 4I55B 3CJHB 1XHXA 3P32A 3SPGA 5IJ0B 1I94O 4G28B 2KG7A 3RGBA 3H1KH 1JCHA 3T1YO 1YVWA 2WSSG 4GYCB 4R6ZA 4O4HA 4MVUA 4FLXA 2JIZG 2LQTA 3RYFB 1V55C 5J2UB 3D36A 1FXHA 1AR1B 1J95A 4FJCC 1MG1A 1O9GA 1EBOA 4LF7O 4B3MB 2LGQA 4GX0A 3ABUA 3H1IH 3HPLC 3JYCA 1PM9A 3RYIA 2EIKB 5EIBD 3OMIB 5C93A 3U10A 3OAAG 3E22B 1GH6A 1PNLA 2E3CA 3FAVA 2WLMA 3BEHA 1IZ3A 4JPRA 5FNVA 3W7UA 2ZD9A 4IIJB 1G8MA 3FB7C 1AI6A 5FPOA 4B7EA 2P7TC 3WB0A 4X64O 4WFHA 5F2VO 5BMVB 2ZIOA 3HR0A 3SJAC 4U7OA 3UQ8A 1VIBA 4YY3O 3UO3A 2YIBD 5IWAO 1U96A 3JARA 2ATKC 4FLYA 4K35A 2NNUA 1Y76B 3T1CA 5L3DA 4X1KA 3L74H 2PI4A 1SKVA 2DYSB 1H2GA 2IH3C 4UCTA 1KC8W 1V55B 4DK1A 5LOVB 3BFRA 3CCUV 2V4DA 4HZ3A 1JFFB 2F23A 1K34A 1Q8IA 2XAFA 3A0RA 2X0LA 4CC5A 2UXCB 4JI7B 3TXQA 5IE9A 1CP9A 1Q5OA 3QNEA 2EJ7A 5D5PA 3UT5B 4GX1A 3CSXA 1YXBA 1VARA 4GX5A 2UXNA 2P6JA 2BTQA 1ZLZA 1N36O 1D2DA 3BABA 3G80A 4ZBMA 5BXZA 3ABKC 1ROPA 1Y74B 1Y4MA 3O9OA 3E83A 3Q4HB 3CS5A 1PV0A 3R66A 3CCLV 1V54C 3OD4A 4I7ZB 5B3SC 3BHPA 2MW2B 2CTRA 1PKXA 2XUMA 3D36C 3T1HB 2ZNIA 2WLIA 1H2NA 3OUFA 2ODMA 1Y67A 1MNGA 3ZRSA 1AI7A 1GN4A 3AEIA 4MT8A 1QCEA 4Z1MG 1OCRC 3KKYA 3CCSV 5EC2C 4B3MO 4JI1O 3K5MA 1N32B 3ABLB 4O4LA 4ZOLB 1SF9A 1BT8A 4JI6B 3CC4V 4J9ZB 3W7WA 2YEVA 3RVYA 3RVZA 3C90A 3KZIZ 3JAKB 3OMAB 2FL4A 4FPPA 1XMOO 4EKWA 4JTAB 4GZRB 1IBKO 1VQ6V 2CDYA 4QPKA 3CWBH 1WP8A 3AG1B 3OTFA 1I7FA 4LR3A 3GWOA 2HJDA 3M99B 4JAVA 1A32A 4QNHB 5JJEB 4X88A 5A2QN 3T4ZA 1CXZB 5LYJB 1AR5A 3LSSA 4O4HB 5KHIA 3P3PA 1V54B 5B3SB 1BGYH 1XL6A 1GM7A 4PV1B 3SJCC 2AHYA 1GK9A
chains in the Genus database with same CATH topology
1BHBA 2BOBC 1JPXA 2X6AA 3OUSA 1YJNV 1F51A 3E8HA 1JJ2U 5EK0A 1BMFG 2WLLA 3X2QC 2A9HA 1R3KC 1CEZA 3ZN0A 4JYBA 2XASA 1VQLV 2HG5C 2X6CA 3ABLC 1SETA 5CBGA 1TUEB 1CPYA 2JJ1G 2X7RB 1OCRB 4MVOA 3SYQA 5EC1C 1FXVA 3CCQV 1H8HG 2DW4A 4WFFA 1G4YB 4GT1A 1FXKA 3F7YC 5CA3A 2YEVB 2H94A 3OR6C 4MSWC 2W6JG 4UV9A 4I9WA 3ETGA 4P9OA 4HYOA 2NLJC 1KKDA 1AROP 4P9PA 3ZMTA 2Z3YA 1R3JC 4QE7A 2GHYA 3OEHG 3HB3B 1QLEC 2ZXWC 4UXNA 3AG1C 4PA9A 2X6BA 4WCEV 4G2KA 5IYDO 1PNKA 1M57B 3E8FA 3ZRVA 3UKMA 1UJWB 3SPIA 5LHGA 4JAUA 1HWYA 3B8NA 4MVZA 4JTCB 2JDIG 4UVBA 1AJQA 3IGAC 4XDKA 2ITCC 1KECA 5B1BB 2IJJA 4XBFA 3E89A 4PDMA 3CCJV 1GO3F 3GB7C 4MVSA 3TK1A 1NR1A 1R6KA 1Y66A 3DTUB 5IYCO 4RQEA 3ASOB 3E35A 4F4LA 3PJSK 2EIJC 1YJWV 2WPDG 1P4RA 3KG2A 3K04A 4BIZA 2V1DA 3RBZA 1OCCC 3K03A 4UV8A 1I5XA 1QR9A 3K06A 2HJFC 2EINB 3ZMUA 1THZA 1F23A 2P67A 4WFAV 1KQSU 3ZIAG 1M56C 4RUFA 1YTFB 2ITDC 4CBCA 2EILC 1K92A 3X2QB 2IU0A 1K8AW 5E1AC 4I5SA 2V7QG 1FXKB 3CCEV 2R9RB 1FS0G 4LP8A 1AI5A 2WLHA 4FIPC 3AG4B 4GCZA 4ZKIA 1K4CC 3H01A 3CCVV 4QE9A 2CK3G 3IFXA 1M9NA 3FYIB 1E1QG 4GX2A 3I55V 4JF3A 3AG2C 2EIMC 3ASNC 3LDCA 3LSQA 1R3LC 2Y69B 5HFMA 4XDLA 5GW7A 1RPRA 1OCOB 2EZPA 3I56V 1E1RG 1EFRG 1YIJV 1M57C 1MABG 4MW8A 4LC1A 5L3GA 4RAIA 4R50A 3SPHA 3W7SA 4PDRA 2IJHA 1QLEB 3ZJZA 3OR7C 2C2AA 3G71V 2Q6AA 5LGNA 1K33A 1K9MW 4MS2A 4TSFG 1YHQV 2OTJV 1L1FA 2BOCC 2GSMB 4RQFA 3D3IA 5DN6G 1MSWD 3IC7A 2JEXA 3DGEA 5H6QA 2Y48A 4JASA 2EINC 1JVMA 2W0FC 2ZQMA 3MD0A 3WG7B 5KA6A 1VQNV 5B1AB 2Q69A 5H6RA 1OCCB 1K5SA 1PL0A 2AHZA 4JGSA 1VQ4V 3EFFK 2WLJA 2R9IA 1JOYA 3LNMB 5L3FA 1FXKC 1GM9A 2A79B 1K5QA 1M56B 2LFSA 1SESA 3TETA 3F5WC 3AG4C 1S3JA 3OGCC 4DXWA 5B1NA 2EILB 2HR3A 4N23A 3LDEA 4QJFB 2ZR3A 4MVMA 5IYBO 2Y69C 4CZZA 1YJ9V 1OCOC 5CBHA 4XDJA 1H8EG 1AI4A 3VOUA 2B5UA 2XAGA 3AG2B 2QKSA 2EIMB 4PA6A 1COWG 3ASNB 5B1OA 5KA5A 3CCMV 2EIKC 1S0VA 2H8PC 1YITV 1NH2D 4MTFA 4WFEA 3LUTB 5LGUA 5LGTA 1RM1C 2JK5C 3ZCCA 1DF5A 5KUKA 5J9PC 2ZDIA 3CCRV 3LDDA 1GMGA 1AJPA 4ASUG 3UM7A 3K79A 1P7BA 1DF4A 1VQ8V 5LBQA 4KUMA 2IJIA 5EBWC 4MW3A 1NKDA 1JX9A 3JD0A 3WFVA 1SERA 1W0KG 2Z5UA 1E79G 1DTOA 1K7DA 3WG7C 1GM8A 3E8GA 3CMEV 1S72V 5KUMA 2OT5A 1Q86W 3E86A 4L87A 5B1AC 3SYAA 3FB6C 3SYOA 4DO2A 1K97A 1OHHG 2HFEC 2WLLB 5FL7G 3P32A 2DYRB 3SPGA 3STZC 5BZBA 3SYCA 5L3BA 4G28B 4PA7A 2W6IG 1N8RW 4R8CA 4N21A 4WFBV 1JCHA 3OEEG 4G27B 2WSSG 2DQ3A 2WLNA 2IU3A 3W7XA 2M7WA 4MTOA 3ZRXA 2P90A 4YXWG 4R6ZA 3OE7G 4PDLA 4MVUA 3JD4A 2ZR2A 2JIZG 4UVAA 1NVPD 1VQKV 3CMAV 3W7TA 1DLBA 5DM6V 1W2BU 1V55C 2XAHA 3CYOA 3D36A 4JTDB 1FXHA 1OCZC 4TT3G 2OCCC 3CC2V 3ABMC 1AR1B 1J95A 4U7NA 3JD3A 3SPJA 4FJCC 3ZMZA 2YSUB 5L3CA 1MG1A 2F43G 1EBOA 3OW2U 4GX0A 3ABUA 2EZOA 3HPLC 3JYCA 2Q67A 2EIKB 3OMIB 5C93A 3OAAG 1RM1B 1PNLA 3K0GA 1Q81W 4R7CA 1SRYA 2EBOA 4OXSA 4RO2A 2WLMA 3BEHA 1ORQC 2B1IA 4JPRA 2LP7A 1ENVA 4J9YB 3OM3B 3ZRWA 3W7UA 1K73W 2ZD9A 1YI2V 3G4SV 4P30A 2OTLV 1G8MA 3FB7C 1AI6A 4KP4A 2MK3A 1VQOV 2P7TC 4WFHA 4PELA 4KFMA 1NH2B 2WAMA 4QIWF 2DYRC 2XAJA 4FMTA 2XAQA 2Q68A 2QEXV 4LCUC 2K1EA 4HAMA 4U7OA 5H9CA 1VQ7V 1KP3A 3P30A 1S77D 3ABKB 3T4DA 3K9AA 3STLC 2ATKC 3T2MA 1GTOA 3QO7A 1Q7YW 2NNUA 3E2EA 3K3WA 1QVFU 2DQ0A 4X8AA 1SZTA 1BHAA 3T1CA 4Q20A 1XL4A 1ZWIC 4MTXA 5L3DA 1NJIW 3K08A 3BY6A 3RW0A 2PI4A 3MHSC 1S5HC 2DYSB 4E2LA 1QLNA 1H2GA 2IH3C 3ETDA 3FB5C 1KC8W 2D3OW 4UVCA 1V55B 2DWEC 4UUJC 2ZDIC 1LNQA 3B8MA 1H38A 1OCZB 2HLDG 2HVKC 2OCCB 3CCUV 4HZ3A 3ABMB 1VQ5V 3ETEA 1R73A 2HKOA 5LHHA 1K34A 2XAFA 4BIUA 1YSCA 3A0RA 2X0LA 4P2ZA 5IDJA 3AG3C 5EBMC 1WLEA 3CD6V 1OZ0A 3ZRWB 1F4NA 2IH1C 3ML0A 1NVPB 4PA4A 1CP9A 3QNEA 5LHIA 4TWKA 4MVRA 2LFRA 2FTKA 3CC7V 3OFNG 4GX1A 2KB1A 4GX5A 1B6QA 2UXNA 4MVQA 2P6JA 3FYEB 1VQPV 2EJRA 5HFLA 3QO8A 2WLKA 1AJNA 2IJKA 4ZBMA 1NBMG 3ABKC 4QPJA 1ROPA 1Y4MA 1I5YA 3E83A 4H37A 3CCLV 1V54C 5B3SC 3CXCU 1RPOA 1NQTA 3SYPA 3ZN1A 4WF9V 1PKXA 3SJQC 4RUEA 1W0JG 1WPXA 3FKSG 5CBFA 2UXXA 3R65A 3F7VC 2IW5A 2WLIA 5IY5B 3FB8C 3OUFA 2JJ2G 2DYSC 1K3EA 2A0LA 1GKFA 3ABTA 3ZRSA 1M1KW 1AI7A 3AEIA 4MT8A 1NR7A 1QCEA 1IXMA 4Z1MG 3JCZA 1VQ9V 1PNMA 3E8BA 1OCRC 4BAYA 3CCSV 2XNDG 5EC2C 1PD3A 1R3IC 3ABLB 1EZJA 2JEUA 5CMUA 3JD2A 1KP2A 3OMNB 3SPCA 2HVJC 5CN0A 5EBLC 3CC4V 3AG3B 4J9ZB 2WWWA 2YEVA 3W7WA 3RVYA 1R6NA 1MOFA 3RVZA 1QVGU 3K0DA 4X89A 3CPWU 3OMAB 4FPPA 1QR8A 4PDVA 4PA3A 4EKWA 4JTAB 5L3EA 1VQ6V 2QTOA 3NXSA 3G6EV 4MTGA 4QPKA 2ZXWB 3AG1B 1KD1W 1M90W 2QE7G 4WFGA 1Q82W 1FFTB 5B1BC 1JQ0A 2XOKG 3EHBB 3B77A 3GWOA 3VBBA 2QA4V 1S76D 3M99B 4JAVA 3TCUA 4QNHB 1YTFD 3JD1A 2DWDC 2PI5A 3CP1A 3ASOC 4X88A 3T4ZA 1VQMV 2B1GA 1BL8A 3LSSA 1V54B 5B3SB 2WLIB 4JYCA 5IY5C 2QM8A 3ZMVA 1QBZA 1XL6A 1F4MA 1GM7A 3QO5A 4H33A 4FK5C 2AHYA 4BW5A 2QM7A 1GK9A 1K4DC 4LBEC 3MHHC 2EIJB 3ZMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPH A;  2WLN A;  4PDR A;  2BOB C;  4R50 A;  3ZJZ A;  2X6A A;  3OUS A;  4MTO A;  4TWK A;  4MVR A;  3OR7 C;  3E8H A;  4R6Z A;  4PDL A;  5EK0 A;  2WLL A;  4MVU A;  3X2Q C;  4GX1 A;  2A9H A;  2KB1 A;  4GX5 A;  1R3K C;  2Q6A A;  4MVQ A;  2HG5 C;  2X6C A;  3ABL C;  4MS2 A;  5CBG A;  2WLK A;  2BOC C;  1V55 C;  4MVO A;  3SYQ A;  5EC1 C;  4JTD B;  1OCZ C;  4ZBM A;  2OCC C;  3ABM C;  3ABK C;  1J95 A;  4WFF A;  1G4Y B;  3SPJ A;  3E83 A;  3F7Y C;  4H37 A;  3OR6 C;  4MSW C;  1V54 C;  2EIN C;  4I9W A;  1JVM A;  4GX0 A;  4HYO A;  2NLJ C;  2W0F C;  3HPL C;  3JYC A;  2Q67 A;  4P9O A;  5B3S C;  1KKD A;  4P9P A;  3SYP A;  1R3J C;  3SJQ C;  2Q69 A;  4QE7 A;  4RUE A;  2AHZ A;  3K0G A;  5CBF A;  4R7C A;  3R65 A;  3F7V C;  1QLE C;  2ZXW C;  2WLI A;  3AG1 C;  4PA9 A;  4OXS A;  4RO2 A;  3EFF K;  2WLJ A;  2WLM A;  2X6B A;  3BEH A;  3FB8 C;  1ORQ C;  3LNM B;  2DYS C;  2A79 B;  3OUF A;  4J9Y B;  2A0L A;  3F5W C;  3E8F A;  3ZRS A;  3AG4 C;  3TET A;  2ZD9 A;  3OGC C;  3UKM A;  4P30 A;  4DXW A;  3SPI A;  4MVZ A;  3FB7 C;  4JTC B;  3LDE A;  4XDK A;  3E8B A;  3IGA C;  2P7T C;  1OCR C;  2ITC C;  4WFH A;  4MVM A;  4KFM A;  2Y69 C;  3E89 A;  4PDM A;  5EC2 C;  2DYR C;  3GB7 C;  4MVS A;  1OCO C;  1R3I C;  5CBH A;  2Q68 A;  4LCU C;  4XDJ A;  2K1E A;  4F4L A;  3VOU A;  3PJS K;  2QKS A;  4PA6 A;  2EIJ C;  2EIK C;  2H8P C;  3KG2 A;  2HVJ C;  5EBL C;  4MTF A;  4WFE A;  3K04 A;  3SPC A;  3LUT B;  3T4D A;  3RBZ A;  3STL C;  1OCC C;  2ATK C;  3K03 A;  2YEV A;  4J9Z B;  4RAI A;  2JK5 C;  3RVY A;  3RVZ A;  3T2M A;  5KUK A;  3K0D A;  3K06 A;  4X89 A;  2HJF C;  5J9P C;  4X8A A;  3LDD A;  3T1C A;  4PDV A;  4PA3 A;  1M56 C;  4JTA B;  4RUF A;  3UM7 A;  4EKW A;  1XL4 A;  1ZWI C;  1P7B A;  2QTO A;  2ITD C;  4CBC A;  2EIL C;  4MTG A;  3K08 A;  3RW0 A;  5E1A C;  1S5H C;  4WFG A;  5EBW C;  4MW3 A;  5B1B C;  2R9R B;  2IH3 C;  4LP8 A;  2WLH A;  3FB5 C;  1K4C C;  2DWE C;  4UUJ C;  1LNQ A;  4QE9 A;  3TCU A;  3WG7 C;  2DWD C;  3IFX A;  4QNH B;  2HVK C;  3E8G A;  3ASO C;  5KUM A;  4HZ3 A;  4X88 A;  3E86 A;  5B1A C;  3SYA A;  3T4Z A;  3FB6 C;  4GX2 A;  3SYO A;  3AG2 C;  2EIM C;  3ASN C;  1BL8 A;  3LDC A;  1R3L C;  2HFE C;  2WLL B;  4XDL A;  3SPG A;  2WLI B;  4P2Z A;  3STZ C;  3SYC A;  5BZB A;  3AG3 C;  5IY5 C;  1XL6 A;  4G28 B;  4PA7 A;  5EBM C;  4H33 A;  4R8C A;  2AHY A;  4BW5 A;  2IH1 C;  1M57 C;  4MW8 A;  1K4D C;  4LBE C;  4PA4 A;  4G27 B; 
#chains in the Genus database with same CATH topology
 1BHB A;  1JPX A;  2X6A A;  3OUS A;  2Q73 A;  1BMF G;  4UCU A;  1R3K C;  2A06 H;  3DSQ A;  2BE3 A;  1Z2G A;  4JI4 B;  1OCR B;  2UUA B;  3SYQ A;  3CCQ V;  1H8H G;  2DW4 A;  4WFF A;  1G4Y B;  5CA3 A;  3F7Y C;  3ZS8 C;  3OR6 C;  5FNV B;  4JI7 O;  3ETG A;  4ZIB A;  4A5U B;  4P9P A;  3ZMT A;  4YIO A;  5K1P A;  1SQQ H;  4E4E A;  4FLT A;  2QWR B;  3HB3 B;  2ZXW C;  4PA9 A;  2LW7 A;  4WCE V;  2GDS A;  2Q0A A;  1URF A;  3UKM A;  1UJW B;  2RQ6 A;  4MVZ A;  2JDI G;  1KEC A;  5FLX N;  1GO3 F;  4DR3 B;  1BSM A;  1M4U A;  4F4L A;  4X1K B;  2EIJ C;  3N2G B;  2WPD G;  1T5E A;  1OCC C;  5CA0 A;  3K03 A;  1I5X A;  2Q7E A;  3ZMU A;  5LMU B;  1F23 A;  2ZE5 A;  3IAY A;  1M56 C;  4CC6 A;  4ZI7 B;  2UUC O;  2ITD C;  2EIL C;  4DV2 O;  4I5S A;  2YIC A;  4GLX A;  3AG4 B;  4GCZ A;  4DR2 O;  1K4C C;  4K0K B;  4QE9 A;  2R72 A;  3IFX A;  1M9N A;  3HKB A;  1E1Q G;  4JI6 O;  4YIP A;  3I55 V;  3UCS C;  4JYA B;  2Q7G A;  3ASN C;  2Y69 B;  1IBL B;  5HFM A;  3ZHS A;  1OCO B;  4NYK A;  2EZP A;  2RCV A;  5BY1 A;  4X65 B;  3A0H Z;  3GWK C;  1MAB G;  4R50 A;  4X1Y A;  3W7S A;  4CH5 A;  1Z5V A;  3H1L H;  2H3O A;  2QSA A;  1YCI A;  2BOC C;  1XBL A;  4J7Z A;  2GSM B;  5KMG A;  2YS8 A;  2Y48 A;  1VF7 A;  4JAS A;  2CTP A;  5EYP A;  1JVM A;  2QKA A;  2W0F C;  1FKA O;  3J80 N;  4DV5 O;  5H5N A;  3L71 H;  5KA6 A;  1VQN V;  2A7W A;  1OCC B;  1BE3 H;  4I55 A;  3CJH A;  4JGS A;  4I9Q A;  5IJ0 A;  2R9I A;  3LNM B;  5L3F A;  2A79 B;  1M56 B;  1SES A;  1KMI Z;  2UUA O;  3A0B Z;  1IVS A;  4O2B B;  2EIL B;  1AIL A;  4DR5 O;  3MDS A;  2ZR3 A;  2QWO B;  3OTO O;  4DV3 B;  4XDJ A;  1ZAU A;  4NTY A;  1AI4 A;  4LFA B;  3VOU A;  3RYH B;  5KA5 A;  3G6B A;  3ASN B;  2F1M A;  2VQF B;  4MTF A;  3B40 A;  5LGU A;  1WB8 A;  3ZCC A;  1Y6X A;  5J9P C;  3H1H H;  5IT9 N;  1PL4 A;  2Y4U A;  3CCR V;  4ASU G;  3K79 A;  1HNZ O;  4DR6 B;  1NKD A;  3JD0 A;  4UCV A;  4IIJ A;  2Z5U A;  1E79 G;  4PI2 A;  4BIO A;  2XHB A;  3WG7 C;  1Q86 W;  5KUM A;  5LXT B;  4L87 A;  5B1A C;  1HNX B;  1H2K A;  3B4S A;  1K97 A;  5BMV A;  2E76 B;  2HFE C;  3K58 A;  1VP7 A;  3STZ C;  1AVM A;  2E74 B;  1N8R W;  4R8C A;  4X9Q A;  3T1Y B;  2AW9 A;  2P90 A;  5H2F Z;  2VQE O;  3L73 H;  3K57 A;  1DLB A;  1W2B U;  2HHH B;  3CYO A;  3JCU Z;  2Y0P A;  2OCC C;  5LMN O;  4KHP O;  1DGS A;  3ABM C;  4U7N A;  1AP6 A;  5L3C A;  1SQF A;  4X65 O;  2WA3 A;  2F43 G;  3KCY A;  4UCS A;  2GBO A;  1IDS A;  2QJ1 A;  1NTZ H;  2GTS A;  4K8X A;  1SRY A;  2EBO A;  2LP7 A;  4KP4 A;  2MK3 A;  4ABM A;  1VQO V;  3QF7 A;  1WA8 B;  4U3F H;  1Q3E A;  4PEL A;  5CA0 B;  3JSN A;  1TGO A;  3RWR D;  1M5I A;  4FMT A;  3IJ4 A;  2K1E A;  1I08 A;  2GV9 A;  4PHZ A;  3T4D A;  1US6 A;  4IT5 A;  3BA9 A;  3Q4H A;  1GTO A;  3QO7 A;  4DV6 B;  3BAA A;  2F95 B;  2PF4 E;  2BCC H;  4FZ0 A;  4X8A A;  5JVD A;  4DUZ O;  1BHA A;  4Q20 A;  3HKB B;  4YHH O;  1ZWI C;  3K59 A;  3K08 A;  5IJ9 A;  1S5H C;  4DV3 O;  2YXH A;  4LFA O;  1FPO A;  3ETD A;  3U11 A;  5GTH Z;  2DWE C;  3C3T A;  1H38 A;  4NTX A;  4PI0 A;  2OCC B;  4X1Y B;  3ABM B;  1VQ5 V;  3ETE A;  4J41 A;  3L72 H;  5IDJ A;  3N2K B;  3CD6 V;  1FJG O;  3ZRW B;  1MSD A;  1NVP B;  3OGI B;  5KMG B;  5LHI A;  4LH6 A;  2LFR A;  1MA1 A;  3NR7 A;  3M7M X;  4Z1V A;  3CC7 V;  4PJ0 Z;  3JAK A;  4CH6 A;  4MVQ A;  1LUW A;  4IHJ B;  5HFL A;  1HNX O;  1N36 B;  1XNQ O;  1H2L A;  1I5Y A;  4H37 A;  3THO A;  2CTQ A;  4NR1 A;  4IL6 Z;  3ZN1 A;  4TV8 A;  3FX7 A;  4RUE A;  1W0J G;  2ZE6 A;  5LYJ A;  1WPX A;  4I50 A;  3CB2 A;  5IY5 B;  2JJ2 G;  2DYS C;  2A0L A;  2RMK B;  1GKF A;  3ABT A;  1M1K W;  2HHH O;  2F4V O;  5JQG B;  2XTA A;  4FFB A;  4H0L B;  4DR7 O;  4H44 B;  4JI5 O;  3I5D A;  4BAY A;  2FKX A;  2XND G;  2ZCE A;  4JI1 B;  4J80 A;  2RN9 A;  1EZJ A;  5CMU A;  1N0N A;  5D5Q A;  4ICG A;  3DXR A;  5EBL C;  1Q6U A;  2CTW A;  1W59 A;  2WWW A;  3WU2 Z;  1R6N A;  2EUL A;  4X89 A;  1OV9 A;  1Q90 D;  3S3W A;  3CPW U;  4JI0 O;  1SA0 A;  1O9H A;  1XMO B;  4W4K A;  1G6U A;  1HNW O;  3NXS A;  1IBK B;  4MTG A;  2RNB A;  1TA8 A;  5JJN B;  2LGW A;  1KD1 W;  1M90 W;  4WFG A;  1SQX H;  1Q82 W;  1JQ0 A;  3VBB A;  5KHJ A;  4DV0 O;  2YDE A;  3H1J H;  2DWD C;  3JD1 A;  2PI5 A;  3EXA A;  3CP1 A;  1NZ6 A;  4EEQ A;  1VQM V;  1WNS A;  2B1G A;  3TJT A;  4DV6 O;  2QM8 A;  3ZMV A;  3QO5 A;  4LBE C;  3JAM N;  4NB5 A;  3N2G A;  4LFC O;  3LSU A;  5KLV H;  4TQF A;  1TUB A;  1F51 A;  3E8H A;  2WLL A;  2A9H A;  4JYB A;  2HG5 C;  2X6C A;  3ABL C;  4TV9 B;  1CPY A;  4ZI7 A;  4MVO A;  3BRC A;  1XEQ A;  4X66 O;  1FYJ A;  1EN5 A;  1DK1 A;  4UV9 A;  2QKC A;  4HYO A;  3H9V A;  2UUB O;  2N05 A;  1ARO P;  4Z2W A;  4YJ3 B;  4QE7 A;  2CGN A;  3AG1 C;  5IYD O;  2N04 A;  4JYY A;  3MAQ A;  1MZF A;  2GUZ B;  3E8F A;  4DW1 A;  3B8N A;  3VQX A;  4UVB A;  4XDK A;  1NTK H;  4LF8 O;  5FPR A;  3CCJ V;  4MVS A;  3TK1 A;  5JVD B;  3HKD A;  1XRE A;  3L70 H;  2OIG A;  2DJV A;  2UXB O;  1B06 A;  2RJZ A;  5IJ9 B;  4IYH A;  2JS5 A;  2EIN B;  1L8D A;  1Q6I A;  5E79 Z;  4DR4 O;  3K5O A;  1YTF B;  2UUC B;  1K92 A;  2IU0 A;  1K8A W;  5E1A C;  4DV2 B;  2V7Q G;  1FXK B;  2LO1 A;  2WLH A;  4O2B A;  4DR2 B;  3FYI B;  5DED A;  1R3L C;  5KHK A;  1N0J A;  5KHG A;  4XDL A;  3RYC A;  1M93 A;  4BR6 A;  3K9S A;  4MW8 A;  3RYH A;  4RAI A;  4D7S A;  2IJH A;  1HR0 O;  3OR7 C;  2C2A A;  3G71 V;  5LGN A;  1K33 A;  1RSO B;  1L0N H;  4TV8 B;  2ZNJ A;  3JAW A;  4I50 B;  2Y0I A;  2QM4 A;  1WB7 A;  3DC6 A;  5H6Q A;  1KBH A;  2WA4 A;  3MD0 A;  2PZS A;  1SQP H;  5LXT A;  4DV5 B;  4FFB B;  2Q69 A;  1H2S B;  1PL0 A;  2AHZ A;  5B5E Z;  4CS2 A;  4JV5 B;  1VQ4 V;  1JOY A;  1GM9 A;  3WB2 A;  4AI8 A;  1P49 A;  3AG4 C;  1S3J A;  5LL6 Y;  3DXR B;  3LDE A;  3SGI A;  4X62 O;  4DR5 B;  1XNR O;  1EN6 A;  3OTO B;  5B66 Z;  2Y69 C;  4HNA A;  4CZZ A;  1OCO C;  1SA0 B;  1SQB H;  2B5U A;  2ZM6 O;  5AG2 A;  2P06 A;  5B1O A;  2YIB A;  2H8P C;  4O2A B;  3FFQ A;  5LGT A;  4DV4 O;  1RM1 C;  3CXH F;  5C8Y A;  2FYU H;  2ZDI A;  1HNZ B;  1LR1 A;  1R6T A;  2IJI A;  4B3R O;  4MW3 A;  1JX9 A;  3SJB C;  2ZE7 A;  4EFE A;  1K7D A;  3ZBH A;  2ZIN A;  1WA8 A;  1UFI A;  1TUB B;  4DO2 A;  4GKJ O;  2DN9 A;  2WLL B;  4LFB O;  2DYR B;  1AR4 A;  2W6I G;  4N21 A;  2YC0 A;  5KAI Z;  2D2C B;  4B3S B;  1VF6 A;  4G27 B;  2DQ3 A;  2IU3 A;  2M7W A;  1N34 O;  4GKK O;  4UB6 Z;  1EM1 A;  4YXW G;  3TXS A;  3LNN A;  4PDL A;  2VQE B;  2AZ2 A;  1NU1 H;  2P22 C;  4LNU A;  4LF5 O;  2PTM A;  3CMA V;  2XAH A;  1OCZ C;  4KHP B;  5LMN B;  3JD3 A;  3ZMZ A;  3OW2 U;  3K5N A;  2E75 B;  1P7G A;  3HKE B;  1RM1 B;  3RFR A;  4R7C A;  4OXS A;  3RN4 A;  3N2K A;  1ORQ C;  2B1I A;  3HKD B;  3ZRW A;  3BA8 A;  2CH7 A;  1YI2 V;  3G4S V;  2OTL V;  2R70 A;  1B04 A;  3APQ A;  1ZUQ A;  2JGD A;  4KFM A;  1NH2 B;  2WAM A;  2XAJ A;  1VMG A;  2XAQ A;  4IHJ A;  2Q68 A;  2QEX V;  5H9C A;  2QR4 A;  1F7Y A;  1KP3 A;  1WJZ A;  4JI3 O;  2PYL A;  4JV5 O;  4OPH A;  2CUG A;  3K9A A;  3T2M A;  1QU7 A;  1Q7Y W;  4DV1 B;  1GN3 A;  3K3W A;  2DQ0 A;  4DUZ B;  2QWQ B;  4YHH B;  4B7K A;  1P84 F;  2Q7H A;  3QG5 A;  4RWU A;  2AZ0 A;  3RYC B;  4E2L A;  2YXY A;  4UVC A;  4DRX B;  5JQG A;  2ZDI C;  3B8M A;  1OCZ B;  2HLD G;  4J7K A;  3APO A;  2ARH A;  2DMX A;  4P2Z A;  3AG3 C;  2CAZ C;  2YI9 A;  2W0X A;  1B3Q A;  3ML0 A;  1FJG B;  2OIE A;  4FZ1 A;  3K5L A;  1SQG A;  3JAW B;  4FLU A;  4MVR A;  2FTK A;  2KB1 A;  1B6Q A;  2OCH A;  4LF6 O;  1QNM A;  3FYE B;  3VQY A;  2WLK A;  1AJN A;  3AK1 A;  2O57 A;  2IJK A;  1XNQ B;  1VF6 C;  5GTI Z;  4OGQ B;  4TUY A;  1YF2 A;  1GN2 A;  4K8Z A;  4C7U A;  1NI8 A;  4B3S O;  4LF4 O;  1RPO A;  5J2T A;  4WF9 V;  5IYZ A;  1NTM H;  4L8J A;  5CBF A;  2UXX A;  3R65 A;  3F7V C;  2IW5 A;  4HNA B;  4FFK A;  1MMM A;  1XOU A;  2F4V B;  4J7J A;  3UO2 A;  4DR7 B;  1PNM A;  4JI5 B;  1N4C A;  3JAT B;  5C8Y B;  1UPG A;  1PD3 A;  1R3I C;  2ADP A;  1TVK A;  4TV9 A;  2JEU A;  3JD2 A;  4KL1 A;  1FD9 A;  1KP2 A;  2IBZ H;  3OMN B;  4EB6 A;  5CN0 A;  4F6E A;  4JI2 O;  3AG3 B;  1QVG U;  1MOF A;  1XIL A;  4JI0 B;  4YJ3 A;  4UCR A;  5L3E A;  2QTO A;  1HNW B;  4I0X A;  3ZHV A;  2JRI A;  2QE7 G;  3EHB B;  3B77 A;  3P3N A;  2GUZ A;  4DV7 O;  1LUV A;  4DV0 B;  3TCU A;  4IGG A;  1BQ0 A;  3ASO C;  1XDC A;  3CRC A;  2VWJ A;  1BL8 A;  4DV1 O;  4B08 A;  3FD9 A;  5IY5 C;  1QBZ A;  4LNU B;  1F4M A;  4H33 A;  1KB9 F;  4BW5 A;  2QM7 A;  1K4D C;  4AQY O;  2RDC A;  2JGU A;  4LFC B;  2BOB C;  2ZT9 B;  1YJN V;  1JJ2 U;  3PN1 A;  3CRQ A;  3X2Q C;  1CEZ A;  3ZN0 A;  2Q8V A;  2XAS A;  1ZX3 A;  1VQL V;  1SET A;  1BZK A;  1TUE B;  2JJ1 G;  1MZE A;  5BR8 B;  1SS3 A;  5EC1 C;  1FXV A;  2N74 A;  4X66 B;  2KQX A;  4GT1 A;  1FXK A;  2PUS A;  2H94 A;  2L6L A;  1IBM O;  4MSW C;  2W6J G;  2ETN A;  4I9W A;  1KKD A;  2CH7 B;  2UUB B;  2Z3Y A;  4OPA A;  2JGD B;  3OEH G;  5GON A;  1PNK A;  1M57 B;  4X1I A;  3ZRV A;  3CEI A;  3SPI A;  5LHG A;  1HWY A;  4JTC B;  2Q5Z A;  4YJ2 A;  1AJQ A;  1S5L Z;  3IGA C;  2ITC C;  1RP3 B;  2IJJ A;  4LF8 B;  1RSO A;  4QGP A;  1Y66 A;  4RQE A;  3DTU B;  5CA1 A;  3ASO B;  3CX5 F;  4K3A A;  3VQW A;  2OYQ A;  3ZHR A;  1YJW V;  2UXB B;  1IUR A;  1P4R A;  3KG2 A;  2B9Z A;  3K04 A;  4BIZ A;  2V1D A;  1J5E O;  2Z0A A;  4UV8 A;  4CH3 A;  3K06 A;  1BCC H;  2QTS A;  2VRZ A;  2CE4 A;  2P67 A;  1KQS U;  3ZIA G;  4DR4 B;  4RUF A;  4FLZ A;  1YEW A;  3BCC H;  3X2Q B;  3EVK A;  2YXL A;  3B2E E;  4FVM A;  2R9R B;  4W4L A;  4OX9 O;  1FS0 G;  1AI5 A;  2GTA A;  4CS4 A;  5A9G A;  2JVD A;  2KKW A;  4GX2 A;  3JAS A;  4JF3 A;  4FLW A;  5GW7 A;  4JI8 O;  2P4V A;  3I56 V;  2E5L O;  3QVN A;  2XT9 A;  1YIJ V;  4LC1 A;  1VEW A;  3SPH A;  4O2A A;  1KU9 A;  1R1B A;  3ZJZ A;  1HR0 B;  3AK3 A;  4TUY B;  2Q6A A;  1JA8 A;  1K9M W;  1HP8 A;  5CB4 B;  4MS2 A;  2OTJ V;  5J2T B;  4D7T A;  4NXN O;  5IYZ B;  2YI8 A;  1XQ8 A;  3N27 A;  1N33 O;  3D3I A;  3JAL A;  5DN6 G;  3IC7 A;  2JEX A;  2Q0O C;  4WBN A;  1G1X B;  2EIN C;  1FAF A;  5DEC A;  4FLV A;  1ZSP A;  5LA6 A;  3D8C A;  5H6R A;  2UU9 O;  3D3Q A;  2UXD O;  2WLJ A;  4LWS B;  3CRR A;  1FXK C;  1FFX A;  1K5Q A;  2LFS A;  1TVK B;  5BR8 O;  3TET A;  1WN7 A;  2HR3 A;  4EB6 B;  4X62 B;  1XNR B;  1SZX A;  4MVM A;  2K9P A;  1YJ9 V;  2P5O A;  5ITZ A;  4TOI A;  4CH4 A;  4LF9 O;  2XAG A;  4I4T A;  1JR9 A;  5KHH A;  2ZM6 B;  4PA6 A;  3CCM V;  4I0X B;  1S0V A;  4WFE A;  3LUT B;  5JJJ B;  4DV4 B;  1DF5 A;  3LDD A;  1GMG A;  3HKE A;  2PYJ A;  3ICX A;  1P7B A;  1VQ8 V;  5LBQ A;  5JH7 A;  4BW9 A;  5EBW C;  4B3R B;  2ZE8 A;  1Z5W A;  1DTO A;  1VF5 B;  1WAZ A;  4X20 B;  2OT5 A;  2AXT Z;  3FB6 C;  3SYO A;  4O4J A;  4GKJ B;  1OHH G;  5FL7 G;  4LFB B;  5BZB A;  3SYC A;  5L3B A;  4PA7 A;  4IYI A;  4WFB V;  1Q43 A;  3OEE G;  3JSL A;  2WLN A;  3W7X A;  4MTO A;  2YIA A;  3ZRX A;  3BPZ A;  1N34 B;  1H2M A;  4GKK B;  3OE7 G;  3JD4 A;  2ZR2 A;  4UVA A;  1NVP D;  1VQK V;  4LF5 B;  3W7T A;  4O4I A;  5DM6 V;  4JZG A;  4JTD B;  2PY5 A;  4TT3 G;  3CC2 V;  1Q6H A;  1AB3 A;  1I0H A;  3SPJ A;  2YSU B;  1EZV H;  4H13 B;  4AHC A;  5GON B;  2Q9L A;  4DRX A;  2EZO A;  3A8T A;  4X1I B;  2Q67 A;  1IX9 A;  4YJ2 B;  1PPJ H;  3K0G A;  1Q81 W;  3ZX6 A;  3L75 H;  4RO2 A;  1YZB A;  3S3X A;  5CA1 B;  2CGO A;  1ENV A;  4J9Y B;  3OM3 B;  1K73 W;  4P30 A;  1ZL8 B;  2R9A A;  4ZHQ A;  1XHZ A;  1XUQ A;  1NS1 A;  4QIW F;  2DYR C;  1D5N A;  4LCU C;  2KG7 B;  2AGA A;  4HAM A;  1BS3 A;  2KSD A;  1VQ7 V;  3P30 A;  1S77 D;  3M8A A;  3ABK B;  4JI3 B;  3IC9 A;  3STL C;  2IM9 A;  2Q4P A;  4HBN A;  2LW1 A;  4TQD A;  3E2E A;  3ZED A;  1QVF U;  3CHX A;  1SZT A;  4DW0 A;  1XMQ B;  1SQV H;  3BVO A;  1IXB A;  1XL4 A;  4MTX A;  2QWN B;  2ZIM A;  3JAS B;  1NJI W;  3BY6 A;  3RW0 A;  3MHS C;  2F66 C;  1JJO A;  1QLN A;  4UFZ A;  5EZY A;  3FB5 C;  4DUY B;  4NTW A;  2D3O W;  4UUJ C;  1LNQ A;  4U3J A;  2HVK C;  3RYI B;  1R73 A;  2HKO A;  5LHH A;  2M6Y A;  4BIU A;  3JAT A;  4DR1 B;  1YSC A;  2UXC O;  3AK2 A;  3FAV B;  5EBM C;  3SR2 C;  1WLE A;  2L35 A;  1OZ0 A;  1F4N A;  2IH1 C;  4PA4 A;  3JAL B;  4TWK A;  4J42 A;  3OFN G;  4WBN B;  1GN6 A;  5JCO A;  1VQP V;  4LF6 B;  2EJR A;  3QO8 A;  5LA6 B;  2NR5 A;  3QTC A;  1NBM G;  3L9D A;  4QPJ A;  4D6T H;  3JAR B;  1FFX B;  1XI1 A;  3CXC U;  4LF4 B;  1NQT A;  3SYP A;  3SJQ C;  3FKS G;  3J81 N;  4CS3 A;  3T1H O;  5K1X A;  3FB8 C;  5ITZ B;  1K3E A;  2BSK A;  4I4T B;  4DYL A;  1NR7 A;  1IXM A;  3JCZ A;  1VQ9 V;  3E8B A;  1HDJ A;  2QGN A;  1N32 O;  2HEP A;  2ADQ B;  3SPC A;  5JH7 B;  2HVJ C;  1KUQ A;  1KKC A;  5LP6 A;  4JI2 B;  2ZKO A;  1KYO F;  3K0D A;  1SC5 B;  1WPB A;  5KX5 A;  1QR8 A;  1V9P A;  2BTQ B;  4PDV A;  3AG7 A;  4PA3 A;  3DC5 A;  3G6E V;  5EIB C;  4O4J B;  2ZXW B;  3CE2 A;  3HKC A;  1FFT B;  5B1B C;  3SDL A;  2XOK G;  4F6R A;  1HW7 A;  2QA4 V;  1S76 D;  4DV7 B;  1YTF D;  4LH7 A;  1EN4 A;  4B3T B;  2WLI B;  1XMQ O;  4JYC A;  2YID A;  2BTO A;  5TIS Z;  1S5J A;  4FK5 C;  3ETQ A;  4O4I B;  3MHH C;  4AQY B;  2EIJ B;  3ZMS A;  3CRA A;  4PD4 F;  5EK0 A;  4DUY O;  2DE0 X;  1D5A A;  4JZ2 A;  4O4L B;  5CBG A;  4JI4 O;  4NXM B;  2YUA A;  2X7R B;  2EX3 A;  3B09 A;  3CRM A;  4DR1 O;  2JS3 A;  2YEV B;  1X59 A;  1IBM B;  4P9O A;  2NLJ C;  5JCO C;  3ZHU A;  1R3J C;  3RYF A;  4ZHQ B;  5JWP A;  2ILM A;  5J2U A;  2GHY A;  1OJH A;  1QLE C;  4UXN A;  1TAE A;  2X6B A;  4AIL C;  4G2K A;  2F93 B;  3J7A U;  1WP7 A;  2OWO A;  4JAU A;  1QHT A;  3E22 A;  4FM2 A;  5B1B B;  4XBF A;  1GRJ A;  3E89 A;  4PDM A;  3GB7 C;  5CB4 A;  1NR1 A;  1R6K A;  5IYC O;  4DR3 O;  3O65 A;  1YDX A;  2HP8 A;  3E35 A;  3PJS K;  1AP5 A;  3RBZ A;  1J5E B;  1QR9 A;  2HJF C;  5EZY B;  3ZHT A;  5LMU O;  1QQC A;  1THZ A;  1I94 B;  4U3J B;  4WFA V;  1BQZ A;  2VS0 A;  4CBC A;  3KCX A;  4LWS A;  5LP6 C;  3CCE V;  1L0L H;  4DK0 A;  4OX9 B;  4LP8 A;  4FIP C;  4K0K O;  4ZKI A;  3H01 A;  3CCV V;  1Y76 A;  2CK3 G;  4NKG B;  3ZHQ A;  4JYA O;  3AG2 C;  1PP9 H;  2EIM C;  3LDC A;  1IBL O;  3LSQ A;  2LJ2 A;  1RPR A;  2Y4T A;  1NT2 B;  4JI8 B;  1E1R G;  2E5L B;  1EFR G;  3G67 A;  4LF7 B;  1M57 C;  3WB1 A;  5LOV A;  5L3G A;  4PDR A;  1JFF A;  1QLE B;  1U97 A;  4TSF G;  1YHQ V;  1L1F A;  4NXN B;  1ZTE A;  4FM1 A;  4RQF A;  4B3T O;  1N33 B;  3OT7 A;  1MSW D;  3DGE A;  3UT5 A;  4FM0 A;  4X64 B;  2G38 A;  3GVM A;  3F5T A;  2BSK B;  2ZQM A;  3RT3 C;  3WG7 B;  4X20 A;  3VQV A;  5B1A B;  4YY3 B;  1K5S A;  2UU9 B;  5IWA B;  2UXD B;  1GAX A;  1Y74 A;  2NN4 A;  3EFF K;  3C3S A;  4NXM O;  4JAA A;  5KAF Z;  4J10 A;  3F5W C;  4BWA A;  3OGC C;  4DXW A;  5B1N A;  4N23 A;  1JMK C;  4QJF B;  5LP6 B;  2DOS A;  2FB5 A;  5IYB O;  4NVP A;  3A2F A;  2A3Q A;  5CBH A;  1RFY A;  5KX5 B;  2FML A;  1H8E G;  4LF9 B;  3AG2 B;  2QKS A;  2EIM B;  1COW G;  2VQF O;  2EIK C;  1YIT V;  4UCO A;  1NH2 D;  4KXR A;  3HKC B;  2P4K A;  2JK5 C;  2VWK A;  5KUK A;  1X4T A;  3U0Z A;  4F6R B;  1AJP A;  4J11 A;  4GUN A;  2QWP B;  3TGU H;  2PGG A;  3UM7 A;  4DR6 O;  4UB8 Z;  4ZOL A;  1DF4 A;  4KUM A;  4Q6G A;  3WFV A;  1SER A;  5EYP B;  1W0K G;  2QDO A;  4EFB A;  1ZL8 A;  1GM8 A;  3E8G A;  3CME V;  1S72 V;  3E86 A;  3SYA A;  4I55 B;  3CJH B;  1XHX A;  3P32 A;  3SPG A;  5IJ0 B;  1I94 O;  4G28 B;  2KG7 A;  3RGB A;  3H1K H;  1JCH A;  3T1Y O;  1YVW A;  2WSS G;  4GYC B;  4R6Z A;  4O4H A;  4MVU A;  4FLX A;  2JIZ G;  2LQT A;  3RYF B;  1V55 C;  5J2U B;  3D36 A;  1FXH A;  1AR1 B;  1J95 A;  4FJC C;  1MG1 A;  1O9G A;  1EBO A;  4LF7 O;  4B3M B;  2LGQ A;  4GX0 A;  3ABU A;  3H1I H;  3HPL C;  3JYC A;  1PM9 A;  3RYI A;  2EIK B;  5EIB D;  3OMI B;  5C93 A;  3U10 A;  3OAA G;  3E22 B;  1GH6 A;  1PNL A;  2E3C A;  3FAV A;  2WLM A;  3BEH A;  1IZ3 A;  4JPR A;  5FNV A;  3W7U A;  2ZD9 A;  4IIJ B;  1G8M A;  3FB7 C;  1AI6 A;  5FPO A;  4B7E A;  2P7T C;  3WB0 A;  4X64 O;  4WFH A;  5F2V O;  5BMV B;  2ZIO A;  3HR0 A;  3SJA C;  4U7O A;  3UQ8 A;  1VIB A;  4YY3 O;  3UO3 A;  2YIB D;  5IWA O;  1U96 A;  3JAR A;  2ATK C;  4FLY A;  4K35 A;  2NNU A;  1Y76 B;  3T1C A;  5L3D A;  4X1K A;  3L74 H;  2PI4 A;  1SKV A;  2DYS B;  1H2G A;  2IH3 C;  4UCT A;  1KC8 W;  1V55 B;  4DK1 A;  5LOV B;  3BFR A;  3CCU V;  2V4D A;  4HZ3 A;  1JFF B;  2F23 A;  1K34 A;  1Q8I A;  2XAF A;  3A0R A;  2X0L A;  4CC5 A;  2UXC B;  4JI7 B;  3TXQ A;  5IE9 A;  1CP9 A;  1Q5O A;  3QNE A;  2EJ7 A;  5D5P A;  3UT5 B;  4GX1 A;  3CSX A;  1YXB A;  1VAR A;  4GX5 A;  2UXN A;  2P6J A;  2BTQ A;  1ZLZ A;  1N36 O;  1D2D A;  3BAB A;  3G80 A;  4ZBM A;  5BXZ A;  3ABK C;  1ROP A;  1Y74 B;  1Y4M A;  3O9O A;  3E83 A;  3Q4H B;  3CS5 A;  1PV0 A;  3R66 A;  3CCL V;  1V54 C;  3OD4 A;  4I7Z B;  5B3S C;  3BHP A;  2MW2 B;  2CTR A;  1PKX A;  2XUM A;  3D36 C;  3T1H B;  2ZNI A;  2WLI A;  1H2N A;  3OUF A;  2ODM A;  1Y67 A;  1MNG A;  3ZRS A;  1AI7 A;  1GN4 A;  3AEI A;  4MT8 A;  1QCE A;  4Z1M G;  1OCR C;  3KKY A;  3CCS V;  5EC2 C;  4B3M O;  4JI1 O;  3K5M A;  1N32 B;  3ABL B;  4O4L A;  4ZOL B;  1SF9 A;  1BT8 A;  4JI6 B;  3CC4 V;  4J9Z B;  3W7W A;  2YEV A;  3RVY A;  3RVZ A;  3C90 A;  3KZI Z;  3JAK B;  3OMA B;  2FL4 A;  4FPP A;  1XMO O;  4EKW A;  4JTA B;  4GZR B;  1IBK O;  1VQ6 V;  2CDY A;  4QPK A;  3CWB H;  1WP8 A;  3AG1 B;  3OTF A;  1I7F A;  4LR3 A;  3GWO A;  2HJD A;  3M99 B;  4JAV A;  1A32 A;  4QNH B;  5JJE B;  4X88 A;  5A2Q N;  3T4Z A;  1CXZ B;  5LYJ B;  1AR5 A;  3LSS A;  4O4H B;  5KHI A;  3P3P A;  1V54 B;  5B3S B;  1BGY H;  1XL6 A;  1GM7 A;  4PV1 B;  3SJC C;  2AHY A;  1GK9 A; 
#chains in the Genus database with same CATH homology
 1BHB A;  2BOB C;  1JPX A;  2X6A A;  3OUS A;  1YJN V;  1F51 A;  3E8H A;  1JJ2 U;  5EK0 A;  1BMF G;  2WLL A;  3X2Q C;  2A9H A;  1R3K C;  1CEZ A;  3ZN0 A;  4JYB A;  2XAS A;  1VQL V;  2HG5 C;  2X6C A;  3ABL C;  1SET A;  5CBG A;  1TUE B;  1CPY A;  2JJ1 G;  2X7R B;  1OCR B;  4MVO A;  3SYQ A;  5EC1 C;  1FXV A;  3CCQ V;  1H8H G;  2DW4 A;  4WFF A;  1G4Y B;  4GT1 A;  1FXK A;  3F7Y C;  5CA3 A;  2YEV B;  2H94 A;  3OR6 C;  4MSW C;  2W6J G;  4UV9 A;  4I9W A;  3ETG A;  4P9O A;  4HYO A;  2NLJ C;  1KKD A;  1ARO P;  4P9P A;  3ZMT A;  2Z3Y A;  1R3J C;  4QE7 A;  2GHY A;  3OEH G;  3HB3 B;  1QLE C;  2ZXW C;  4UXN A;  3AG1 C;  4PA9 A;  2X6B A;  4WCE V;  4G2K A;  5IYD O;  1PNK A;  1M57 B;  3E8F A;  3ZRV A;  3UKM A;  1UJW B;  3SPI A;  5LHG A;  4JAU A;  1HWY A;  3B8N A;  4MVZ A;  4JTC B;  2JDI G;  4UVB A;  1AJQ A;  3IGA C;  4XDK A;  2ITC C;  1KEC A;  5B1B B;  2IJJ A;  4XBF A;  3E89 A;  4PDM A;  3CCJ V;  1GO3 F;  3GB7 C;  4MVS A;  3TK1 A;  1NR1 A;  1R6K A;  1Y66 A;  3DTU B;  5IYC O;  4RQE A;  3ASO B;  3E35 A;  4F4L A;  3PJS K;  2EIJ C;  1YJW V;  2WPD G;  1P4R A;  3KG2 A;  3K04 A;  4BIZ A;  2V1D A;  3RBZ A;  1OCC C;  3K03 A;  4UV8 A;  1I5X A;  1QR9 A;  3K06 A;  2HJF C;  2EIN B;  3ZMU A;  1THZ A;  1F23 A;  2P67 A;  4WFA V;  1KQS U;  3ZIA G;  1M56 C;  4RUF A;  1YTF B;  2ITD C;  4CBC A;  2EIL C;  1K92 A;  3X2Q B;  2IU0 A;  1K8A W;  5E1A C;  4I5S A;  2V7Q G;  1FXK B;  3CCE V;  2R9R B;  1FS0 G;  4LP8 A;  1AI5 A;  2WLH A;  4FIP C;  3AG4 B;  4GCZ A;  4ZKI A;  1K4C C;  3H01 A;  3CCV V;  4QE9 A;  2CK3 G;  3IFX A;  1M9N A;  3FYI B;  1E1Q G;  4GX2 A;  3I55 V;  4JF3 A;  3AG2 C;  2EIM C;  3ASN C;  3LDC A;  3LSQ A;  1R3L C;  2Y69 B;  5HFM A;  4XDL A;  5GW7 A;  1RPR A;  1OCO B;  2EZP A;  3I56 V;  1E1R G;  1EFR G;  1YIJ V;  1M57 C;  1MAB G;  4MW8 A;  4LC1 A;  5L3G A;  4RAI A;  4R50 A;  3SPH A;  3W7S A;  4PDR A;  2IJH A;  1QLE B;  3ZJZ A;  3OR7 C;  2C2A A;  3G71 V;  2Q6A A;  5LGN A;  1K33 A;  1K9M W;  4MS2 A;  4TSF G;  1YHQ V;  2OTJ V;  1L1F A;  2BOC C;  2GSM B;  4RQF A;  3D3I A;  5DN6 G;  1MSW D;  3IC7 A;  2JEX A;  3DGE A;  5H6Q A;  2Y48 A;  4JAS A;  2EIN C;  1JVM A;  2W0F C;  2ZQM A;  3MD0 A;  3WG7 B;  5KA6 A;  1VQN V;  5B1A B;  2Q69 A;  5H6R A;  1OCC B;  1K5S A;  1PL0 A;  2AHZ A;  4JGS A;  1VQ4 V;  3EFF K;  2WLJ A;  2R9I A;  1JOY A;  3LNM B;  5L3F A;  1FXK C;  1GM9 A;  2A79 B;  1K5Q A;  1M56 B;  2LFS A;  1SES A;  3TET A;  3F5W C;  3AG4 C;  1S3J A;  3OGC C;  4DXW A;  5B1N A;  2EIL B;  2HR3 A;  4N23 A;  3LDE A;  4QJF B;  2ZR3 A;  4MVM A;  5IYB O;  2Y69 C;  4CZZ A;  1YJ9 V;  1OCO C;  5CBH A;  4XDJ A;  1H8E G;  1AI4 A;  3VOU A;  2B5U A;  2XAG A;  3AG2 B;  2QKS A;  2EIM B;  4PA6 A;  1COW G;  3ASN B;  5B1O A;  5KA5 A;  3CCM V;  2EIK C;  1S0V A;  2H8P C;  1YIT V;  1NH2 D;  4MTF A;  4WFE A;  3LUT B;  5LGU A;  5LGT A;  1RM1 C;  2JK5 C;  3ZCC A;  1DF5 A;  5KUK A;  5J9P C;  2ZDI A;  3CCR V;  3LDD A;  1GMG A;  1AJP A;  4ASU G;  3UM7 A;  3K79 A;  1P7B A;  1DF4 A;  1VQ8 V;  5LBQ A;  4KUM A;  2IJI A;  5EBW C;  4MW3 A;  1NKD A;  1JX9 A;  3JD0 A;  3WFV A;  1SER A;  1W0K G;  2Z5U A;  1E79 G;  1DTO A;  1K7D A;  3WG7 C;  1GM8 A;  3E8G A;  3CME V;  1S72 V;  5KUM A;  2OT5 A;  1Q86 W;  3E86 A;  4L87 A;  5B1A C;  3SYA A;  3FB6 C;  3SYO A;  4DO2 A;  1K97 A;  1OHH G;  2HFE C;  2WLL B;  5FL7 G;  3P32 A;  2DYR B;  3SPG A;  3STZ C;  5BZB A;  3SYC A;  5L3B A;  4G28 B;  4PA7 A;  2W6I G;  1N8R W;  4R8C A;  4N21 A;  4WFB V;  1JCH A;  3OEE G;  4G27 B;  2WSS G;  2DQ3 A;  2WLN A;  2IU3 A;  3W7X A;  2M7W A;  4MTO A;  3ZRX A;  2P90 A;  4YXW G;  4R6Z A;  3OE7 G;  4PDL A;  4MVU A;  3JD4 A;  2ZR2 A;  2JIZ G;  4UVA A;  1NVP D;  1VQK V;  3CMA V;  3W7T A;  1DLB A;  5DM6 V;  1W2B U;  1V55 C;  2XAH A;  3CYO A;  3D36 A;  4JTD B;  1FXH A;  1OCZ C;  4TT3 G;  2OCC C;  3CC2 V;  3ABM C;  1AR1 B;  1J95 A;  4U7N A;  3JD3 A;  3SPJ A;  4FJC C;  3ZMZ A;  2YSU B;  5L3C A;  1MG1 A;  2F43 G;  1EBO A;  3OW2 U;  4GX0 A;  3ABU A;  2EZO A;  3HPL C;  3JYC A;  2Q67 A;  2EIK B;  3OMI B;  5C93 A;  3OAA G;  1RM1 B;  1PNL A;  3K0G A;  1Q81 W;  4R7C A;  1SRY A;  2EBO A;  4OXS A;  4RO2 A;  2WLM A;  3BEH A;  1ORQ C;  2B1I A;  4JPR A;  2LP7 A;  1ENV A;  4J9Y B;  3OM3 B;  3ZRW A;  3W7U A;  1K73 W;  2ZD9 A;  1YI2 V;  3G4S V;  4P30 A;  2OTL V;  1G8M A;  3FB7 C;  1AI6 A;  4KP4 A;  2MK3 A;  1VQO V;  2P7T C;  4WFH A;  4PEL A;  4KFM A;  1NH2 B;  2WAM A;  4QIW F;  2DYR C;  2XAJ A;  4FMT A;  2XAQ A;  2Q68 A;  2QEX V;  4LCU C;  2K1E A;  4HAM A;  4U7O A;  5H9C A;  1VQ7 V;  1KP3 A;  3P30 A;  1S77 D;  3ABK B;  3T4D A;  3K9A A;  3STL C;  2ATK C;  3T2M A;  1GTO A;  3QO7 A;  1Q7Y W;  2NNU A;  3E2E A;  3K3W A;  1QVF U;  2DQ0 A;  4X8A A;  1SZT A;  1BHA A;  3T1C A;  4Q20 A;  1XL4 A;  1ZWI C;  4MTX A;  5L3D A;  1NJI W;  3K08 A;  3BY6 A;  3RW0 A;  2PI4 A;  3MHS C;  1S5H C;  2DYS B;  4E2L A;  1QLN A;  1H2G A;  2IH3 C;  3ETD A;  3FB5 C;  1KC8 W;  2D3O W;  4UVC A;  1V55 B;  2DWE C;  4UUJ C;  2ZDI C;  1LNQ A;  3B8M A;  1H38 A;  1OCZ B;  2HLD G;  2HVK C;  2OCC B;  3CCU V;  4HZ3 A;  3ABM B;  1VQ5 V;  3ETE A;  1R73 A;  2HKO A;  5LHH A;  1K34 A;  2XAF A;  4BIU A;  1YSC A;  3A0R A;  2X0L A;  4P2Z A;  5IDJ A;  3AG3 C;  5EBM C;  1WLE A;  3CD6 V;  1OZ0 A;  3ZRW B;  1F4N A;  2IH1 C;  3ML0 A;  1NVP B;  4PA4 A;  1CP9 A;  3QNE A;  5LHI A;  4TWK A;  4MVR A;  2LFR A;  2FTK A;  3CC7 V;  3OFN G;  4GX1 A;  2KB1 A;  4GX5 A;  1B6Q A;  2UXN A;  4MVQ A;  2P6J A;  3FYE B;  1VQP V;  2EJR A;  5HFL A;  3QO8 A;  2WLK A;  1AJN A;  2IJK A;  4ZBM A;  1NBM G;  3ABK C;  4QPJ A;  1ROP A;  1Y4M A;  1I5Y A;  3E83 A;  4H37 A;  3CCL V;  1V54 C;  5B3S C;  3CXC U;  1RPO A;  1NQT A;  3SYP A;  3ZN1 A;  4WF9 V;  1PKX A;  3SJQ C;  4RUE A;  1W0J G;  1WPX A;  3FKS G;  5CBF A;  2UXX A;  3R65 A;  3F7V C;  2IW5 A;  2WLI A;  5IY5 B;  3FB8 C;  3OUF A;  2JJ2 G;  2DYS C;  1K3E A;  2A0L A;  1GKF A;  3ABT A;  3ZRS A;  1M1K W;  1AI7 A;  3AEI A;  4MT8 A;  1NR7 A;  1QCE A;  1IXM A;  4Z1M G;  3JCZ A;  1VQ9 V;  1PNM A;  3E8B A;  1OCR C;  4BAY A;  3CCS V;  2XND G;  5EC2 C;  1PD3 A;  1R3I C;  3ABL B;  1EZJ A;  2JEU A;  5CMU A;  3JD2 A;  1KP2 A;  3OMN B;  3SPC A;  2HVJ C;  5CN0 A;  5EBL C;  3CC4 V;  3AG3 B;  4J9Z B;  2WWW A;  2YEV A;  3W7W A;  3RVY A;  1R6N A;  1MOF A;  3RVZ A;  1QVG U;  3K0D A;  4X89 A;  3CPW U;  3OMA B;  4FPP A;  1QR8 A;  4PDV A;  4PA3 A;  4EKW A;  4JTA B;  5L3E A;  1VQ6 V;  2QTO A;  3NXS A;  3G6E V;  4MTG A;  4QPK A;  2ZXW B;  3AG1 B;  1KD1 W;  1M90 W;  2QE7 G;  4WFG A;  1Q82 W;  1FFT B;  5B1B C;  1JQ0 A;  2XOK G;  3EHB B;  3B77 A;  3GWO A;  3VBB A;  2QA4 V;  1S76 D;  3M99 B;  4JAV A;  3TCU A;  4QNH B;  1YTF D;  3JD1 A;  2DWD C;  2PI5 A;  3CP1 A;  3ASO C;  4X88 A;  3T4Z A;  1VQM V;  2B1G A;  1BL8 A;  3LSS A;  1V54 B;  5B3S B;  2WLI B;  4JYC A;  5IY5 C;  2QM8 A;  3ZMV A;  1QBZ A;  1XL6 A;  1F4M A;  1GM7 A;  3QO5 A;  4H33 A;  4FK5 C;  2AHY A;  4BW5 A;  2QM7 A;  1GK9 A;  1K4D C;  4LBE C;  3MHH C;  2EIJ B;  3ZMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...