3K06A

Crystal structure of cng mimicking nak mutant, nak-ntpp, k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGNTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k06A00
2WLHA 2K1EA 3VOUA 2YEVA 3SPJA 3FB7C 4F4LA 4GX5A 5B1AC 3E8HA 4WFFA 2WLMA 5KUMA 5EK0A 1OCCC 1QLEC 3T2MA 4H33A 2DWDC 3SPIA 2P7TC 1V55C 3X2QC 3T1CA 2R9RB 1K4DC 2EINC 2WLJA 3R65A 3RBZA 1ZWIC 4CBCA 2NLJC 5E1AC 2BOBC 4PA4A 3ZRSA 1J95A 4WFEA 3T4ZA 2WLIA 4I9WA 5CBFA 4R8CA 1R3JC 3K06A 4P9PA 2IH3C 2X6AA 2W0FC 3EFFK 3K03A 3STLC 3OR7C 4MVQA 3E89A 2EILC 1R3LC 3K04A 1K4CC 3OR6C 4MS2A 4MW8A 4PDRA 3ABMC 3FB6C 3F7YC 1G4YB 3HPLC 4H37A 2ZXWC 3RVYA 2WLLA 2A0LA 3LDCA 4PA6A 4P9OA 2EIJC 3FB8C 2DWEC 4RO2A 4WFHA 1OCRC 3F7VC 2HVJC 3TCUA 2Q68A 4PA9A 4GX2A 3SYQA 3K0GA 4RAIA 4PDLA 3E8FA 3IGAC 3SYCA 3AG1C 1P7BA 4MTFA 3ABKC 3E83A 4TWKA 3AG2C 4XDLA 4PA3A 2H8PC 2ITDC 2EIMC 3OUFA 4JTDB 2IH1C 3KG2A 4QE7A 5KUKA 4MVUA 2X6BA 3K08A 4HYOA 4R50A 3STZC 2OCCC 1R3KC 3OGCC 3GB7C 5EBWC 3RW0A 2Q69A 5CBHA 2Y69C 2HJFC 5BZBA 3UM7A 2WLKA 4R7CA 2DYSC 2HG5C 3FB5C 1LNQA 4GX1A 5EC2C 4MVMA 4HZ3A 4QNHB 2EIKC 4J9YB 3SJQC 5B1BC 3E8BA 2QTOA 1S5HC 2A9HA 3F5WC 4DXWA 1BL8A 3T4DA 1V54C 4J9ZB 4LCUC 4JTAB 5EBMC 3ZJZA 2KB1A 2BOCC 3TETA 3E86A 5J9PC 1ORQC 3RVZA 2WLIB 4OXSA 4P2ZA 4PDMA 2ATKC 3SYPA 3UKMA 3LDDA 4BW5A 3LNMB 4MSWC 4X88A 2HFEC 4PA7A 4MTGA 3LDEA 2Q6AA 4MTOA 4MVOA 4LP8A 4QE9A 2ITCC 1OCOC 2WLNA 5B3SC 4MVRA 5EC1C 2WLLB 2Q67A 5CBGA 4LBEC 4MVSA 3SPGA 3AG3C 4KFMA 4MVZA 5EBLC 1OCZC 3K0DA 4MW3A 4R6ZA 4ZBMA 2QKSA 4RUFA 1M57C 3ABLC 3E8GA 1R3IC 3IFXA 3SPCA 3BEHA 1M56C 3SYOA 4XDJA 4RUEA 4JTCB 3ASOC 4WFGA 3LUTB 3SPHA 1JVMA 4PDVA 1XL6A 2A79B 3WG7C 3SYAA 4X8AA 2AHYA 4G28B 4EKWA 4UUJC 2ZD9A 3OUSA 4X89A 2AHZA 5IY5C 2JK5C 2DYRC 3AG4C 3ASNC 4G27B 1XL4A 3JYCA 2X6CA 4GX0A 4P30A 2HVKC 3PJSK 1KKDA 4XDKA
chains in the Genus database with same CATH superfamily
3P30A 2M6YA 2JGDB 1ENVA 4Z1MG 1QLEB 2ZIOA 4FM1A 1N34O 3T1CA 4EEQA 2JJ1G 2NLJC 1GN3A 5KA5A 5LOVB 2UUAO 1S72V 3P3PA 1UPGA 2EULA 2ODMA 5TISZ 1E1RG 1QVFU 3ABMB 1K4CC 3BFRA 1PD3A 4FK5C 1BMFG 4GZRB 1GN2A 2QWRB 2ZR3A 4DRXA 4RO2A 3KCYA 4YIOA 2HVJC 4NXNO 4W4LA 5BMVA 1XHZA 3E8FA 5CA1B 3AG1B 3K9SA 1FXKC 2P06A 1I08A 4GLXA 3OUFA 4LFCO 2C2AA 4DR3O 1Q3EA 1K8AW 3O9OA 4O4IA 2UXNA 1H2NA 2WLKA 4JI6B 1HNXO 2DYSC 4GX1A 1PNLA 1I0HA 4FJCC 1T5EA 5CA0A 3ZMZA 3ZJZA 4WF9V 4WBNA 5J9PC 2ZE6A 1WP8A 1KKCA 2DYRB 4DV6O 3ZN0A 3G67A 1DF4A 2HP8A 4DV2B 2ZR2A 4MTOA 3KCXA 1I5XA 3T1YO 2QEXV 3B4SA 2QWQB 4TUYB 4MVRA 3AG3B 5K1PA 2ZQMA 2PGGA 4ZBMA 1XQ8A 1MMMA 1QR8A 2EINB 3JALA 1GAXA 4TV8B 2CTQA 2F1MA 3FD9A 1E1QG 1XL6A 1A32A 1YTFB 3CWBH 3K5OA 3J80N 2Q73A 3J81N 1PP9H 2HVKC 2OYQA 4Q6GA 1XREA 4LF4B 4I50B 3HKDB 5EYPB 4BIUA 1OCCB 3ZRWB 3X2QB 5EK0A 1IBKB 1WJZA 1AI7A 3BPZA 2LJ2A 5FL7G 3CCUV 4D7TA 2X6AA 2LO1A 1AJNA 2AZ0A 4GCZA 1BS3A 1FYJA 3QO8A 3CC4V 1XMQB 1SF9A 3ZHUA 1Q82W 3PN1A 4DV5B 4E2LA 1OCRB 2JDIG 4OGQB 5IWAO 4PDLA 4NB5A 2CTPA 1Z2GA 3CRCA 3RN4A 1TAEA 2H8PC 5JQGB 1OHHG 4DR5B 2KG7B 4ZOLB 5IJ0B 1W0KG 2Q0AA 4OPHA 3ABTA 4CS4A 4O2BB 3OTFA 2Y69C 3QO7A 4RWUA 1EZVH 1CEZA 4U3JA 5FPOA 1IBLB 5KMGA 3JARA 2P6JA 3K5MA 2QGNA 2HFEC 3ABUA 2Q6AA 1BCCH 1QNMA 3K9AA 4J41A 4B3TO 3AK3A 4GYCB 2Q67A 3CCEV 1EFRG 1M57B 1UFIA 2B9ZA 1R3IC 4JTCB 3K5NA 4B3SB 4K35A 3CE2A 1Q5OA 1EN4A 2GUZA 2ZM6B 2ETNA 3ETDA 3AG4B 3BABA 1K9MW 3CB2A 2X6CA 4P30A 1PKXA 2F66C 4JI3O 3SPJA 5LP6B 1N0NA 4ZKIA 5IYBO 1QLEC 3T2MA 5FNVA 5JJNB 3VBBA 5H5NA 5LHIA 1K4DC 5LA6B 2VQEO 3FAVB 1YXBA 2RCVA 2WLIA 4UB8Z 3D36A 2UXCB 2WA4A 2DOSA 1XI1A 1K92A 1YF2A 4JI8B 3ABMC 3RVYA 4U3FH 3FB8C 2UXBO 2LW7A 3IJ4A 3F7VC 4AHCA 4CH5A 4F6RB 2IW5A 1N4CA 3H1KH 4FFKA 3AG1C 5KHIA 3WFVA 1J5EO 1YJWV 4O4HA 4Z2WA 2Q9LA 1VQ4V 4UVCA 5D5PA 4MVUA 3K08A 1AROP 5FPRA 4JI5O 4GKJO 2AXTZ 1R3KC 3RW0A 3GB7C 2HHHO 4OX9B 3HKBA 1M5IA 2HG5C 3H1JH 4IHJB 1XDCA 4MVMA 3DC5A 3C3TA 3L74H 1AR1B 4DR1B 4BAYA 4X1YB 2Q4PA 5LBQA 2ATKC 1TUEB 1KUQA 1AVMA 4MVOA 1Y6XA 2E5LO 3AG3C 1HP8A 1Q86W 3Q4HA 1O9HA 3SYOA 1X4TA 1N34B 5IE9A 4EB6B 4GKKO 4F6EA 3W7UA 3ASNB 1TVKA 1JJ2U 4HNAB 3IAYA 2UUAB 2GSMB 1VF6A 5C8YB 5JJJB 4DUYO 1M1KW 3GWOA 4H0LB 1YIJV 3GVMA 1NQTA 4UV8A 4FFBB 3GWKC 4YJ2A 2RMKB 3JAWA 5LGUA 1OCCC 3X2QC 1SQVH 4PV1B 4NXNB 3G6BA 2BOBC 4JYAO 2M7WA 5IYZB 4WFEA 4O4LB 5EIBC 3CRAA 1EBOA 4LWSA 2RN9A 3JASB 1K97A 2XTAA 1FJGO 1JMKC 2YIBD 3G6EV 5B5EZ 4LFCB 2LP7A 3OMNB 1F4MA 4JAAA 4DR3B 1G4YB 2EIJB 1HNXB 3NXSA 1OCRC 3TCUA 4JYCA 1Y76A 1TA8A 3RFRA 1XNRO 2ZE7A 4UCRA 1DLBA 2EIMB 4XDLA 3WB0A 1S3JA 4LF6O 1US6A 2QTSA 1P7GA 4X1KB 4DV6B 1DK1A 1JFFA 2V7QG 1SA0A 2YEVB 1S5LZ 2W0XA 3T1YB 5LGTA 1M93A 3ZX6A 5L3CA 3HKEA 1H8HG 3CPWU 3CCMV 5KHHA 4O4JB 3ZRXA 1AI5A 2BOCC 3RYHA 2BCCH 3CSXA 1VIBA 1CXZB 1NH2B 4UV9A 5ITZA 3SJBC 1SERA 2A7WA 4LBEC 3SPGA 2BTQB 4ZIBA 2IBZH 4R6ZA 4IGGA 2L6LA 1JR9A 1M57C 3TXSA 2GTAA 4LF9O 4X1IB 4WFGA 4UCUA 1X59A 1AP5A 1YITV 1KYOF 1HNWO 4EFEA 4X8AA 2L35A 4YJ3A 3DXRB 3ETQA 4IIJB 3AG4C 1AR5A 4X9QA 3UT5A 5JWPA 2WSSG 1FKAO 3PJSK 5KHKA 1L1FA 3CJHA 3APQA 3JD0A 1EM1A 5LP6C 3H1LH 5JVDA 1JCHA 5IWAB 5E1AC 2VQFO 1SQFA 5CB4A 2CTWA 3N2GA 1MOFA 2YI9A 1PNMA 4P9PA 1IURA 3EFFK 1W2BU 2VWJA 3UO3A 2EZOA 4DV1O 4YHHO 2Y48A 2NN4A 3F7YC 4H37A 4ZHQB 2E3CA 5BY1A 2Q7HA 4TQFA 3W7WA 4RAIA 1L0LH 5J2UA 2ZKOA 4MTFA 2YXHA 1JQ0A 2ITDC 2NR5A 3D3QA 1VMGA 5KUKA 1SZXA 2OCCC 3OGCC 1G6UA 1WP7A 5IDJA 2P90A 3M7MX 1BZKA 4B3TB 3N2KA 1Z5WA 1SESA 2ZT9B 3SJQC 5CA3A 4ABMA 3CCVV 2AGAA 2QTOA 4LCUC 5BR8O 1QLNA 3RYFB 2DJVA 2AW9A 1ZLZA 1K3EA 5GTIZ 3CRQA 4XBFA 5H2FZ 4CH6A 2LFSA 2WWWA 1THZA 2UUCO 2UU9O 3NR7A 4JI3B 3ASOB 3DGEA 4RUEA 3RYIA 5E79Z 4FLZA 1JVMA 3QO5A 2VQEB 1SRYA 1NTKH 3SDLA 3ASNC 3CRRA 1F4NA 1SQGA 4QPJA 1VQ6V 1R1BA 1JA8A 4XDKA 2IM9A 1YTFD 2YUAA 3N27A 4WFFA 2WLMA 2FL4A 4DR6O 2UXBB 1Q6IA 2R9RB 4CBCA 4NKGB 2YS8A 1JX9A 1J5EB 3JATA 3QVNA 1NT2B 3K06A 1ZX3A 1S0VA 3WB2A 4X66O 4JI5B 4GKJB 3CHXA 3JD4A 2HHHB 5EIBD 2XUMA 2A0LA 2EIJC 2JGUA 4PA9A 3I55V 3SYQA 3JCZA 2WPDG 4BIZA 1BE3H 2IU3A 3OGIB 4LC1A 3ZHTA 1P4RA 4J80A 4TWKA 3CC2V 2EIMC 2EX3A 3BCCH 2GBOA 4LNUA 2P22C 4J7ZA 3ZEDA 1TUBB 1H38A 2E5LB 2OTJV 3BHPA 4A5UB 2KB1A 5J2TA 3MHSC 2XNDG 3K58A 1K33A 4B3RO 1P49A 4B08A 4MSWC 2CK3G 2CH7B 4U7NA 5GW7A 4GKKB 4NYKA 4X65O 1XMOO 4BIOA 4FPPA 2ZDIA 1ZAUA 4JI4O 4FZ1A 4DUYB 3WU2Z 2WLLB 2AZ2A 4MVSA 4QIWF 4KFMA 4IHJA 4JI7O 3OAAG 3OE7G 4DW0A 2QKSA 2YI8A 2JS3A 3G71V 1QHTA 4PDVA 2OWOA 2H3OA 3B09A 5CMUA 1CPYA 5IYDO 3OUSA 3W7XA 4JYAB 4G27B 3JYCA 4FLXA 1GM8A 4GX0A 4UCOA 1FJGB 5KX5A 4EFBA 4JYYA 3APOA 1S5JA 4DV3O 4CC5A 4DO2A 1FFTB 4I0XB 3KKYA 2E75B 2PUSA 3K57A 1FFXB 2WLJA 1QQCA 1BQZA 3QTCA 2A3QA 1XNRB 5H6RA 2CGNA 3T4ZA 4PD4F 4LFBO 3U11A 4LF6B 1H2MA 3HR0A 2QJ1A 1G1XB 4MW8A 2MW2B 2G38A 3FB6C 3SJAC 2R70A 2YIDA 3ZBHA 1M9NA 1QU7A 4AQYO 3F5TA 2Q68A 3HKCA 3ZS8C 3CS5A 1HR0O 1COWG 4I9QA 3ABKB 3AG2C 3QG5A 5KHJA 3CCLV 3U0ZA 5LHGA 2Z5UA 4JTDB 4HYOA 4GT1A 4CH4A 3G4SV 1IX9A 4NR1A 4R7CA 5LXTB 1K34A 1QCEA 1NTMH 1OV9A 1YSCA 4LFAO 1ORQC 4LF9B 4YIPA 4TV9B 4TT3G 3LNMB 2WAMA 1HNWB 4MTGA 1WA8A 2IJHA 5IJ9A 4MTXA 3BVOA 1GTOA 4WFAV 1RSOA 3K0DA 3ABLB 4MW3A 2ZCEA 4DV7O 1SQQH 3ZMTA 3ASOC 5H9CA 2VRZA 3K79A 2QDOA 2UUBO 4GUNA 2XAGA 2VQFB 1FXKA 1S76D 2JK5C 4X20A 3B40A 4JV5O 4J7JA 1K5QA 1LUWA 2YC0A 4K3AA 5DEDA 2RJZA 3JAKB 1KBHA 2YICA 4DV1B 1KC8W 4YHHB 3FB7C 1U97A 3IC9A 5KAFZ 1W0JG 1IBMO 2XAHA 1I5YA 4X1IA 3A8TA 5LYJB 4UCSA 5LL6Y 4FLYA 3WB1A 1NR1A 4O2AA 3RWRD 1NJIW 4D6TH 5GONA 1GM9A 5EZYA 1BGYH 1R3LC 3M8AA 2QKCA 2EIKB 3HB3B 3FYIB 1BHAA 3CEIA 4ZI7B 1VQLV 5JH7A 5A9GA 3KZIZ 5BR8B 3SYCA 2PYLA 3E83A 1ZL8B 2LQTA 2FYUH 4I4TA 1QR9A 1URFA 4R50A 1B6QA 4DV4O 2YIAA 3ZRVA 2UUCB 2F4VO 2UU9B 3M99B 3RYCA 2OIGA 2BSKA 4J9ZB 3E35A 5LMUO 2YIBA 3JSNA 5BXZA 3JAMN 2E76B 1YCIA 1Z5VA 3I56V 1B06A 4K0KO 1OCOB 1YEWA 4AI8A 1WB8A 1WPBA 1S77D 4DRXB 1WAZA 1Y66A 3SPCA 5BMVB 2QWPB 2RNBA 1Q6HA 1NVPB 5A2QN 2XAQA 2YXLA 3SJCC 1NH2D 4DR6B 1JOYA 1Y74A 2A79B 3C90A 3H1HH 2N05A 4JAVA 1VQPV 1XILA 2ZD9A 2DYRC 5FLXN 1XEQA 3CC7V 1KU9A 4O4IB 2KSDA 1L0NH 5DN6G 1GK9A 4X66B 1FXVA 4ICGA 2WLHA 3D8CA 2P5OA 5CA0B 4IL6Z 2PYJA 4WBNB 4I55A 3SPIA 3MDSA 2EINC 4KL1A 2PF4E 3ZRSA 1K73W 4R8CA 2XAJA 5D5QA 1ROPA 3OEHG 3B8NA 4J7KA 2Q7EA 2HLDG 3LDCA 1KP2A 3CCJV 3JALB 5B1NA 4JAUA 4FZ0A 4W4KA 3ABKC 2CDYA 4OPAA 3E22A 1GM7A 1MG1A 4B3RB 2Q69A 5CBHA 3FX7A 4X65B 1XMOB 3UM7A 3L71H 2Z3YA 4JI4B 1D2DA 4JI7B 2JGDA 1HWYA 1IXBA 3TETA 1VQ5V 3S3XA 2F43G 3DTUB 4FM0A 5C93A 1VP7A 4U7OA 5LOVA 4QE9A 4UFZA 1JJOA 2ZE5A 5L3BA 2WLNA 1TUBA 4B3MO 2GTSA 4DV3B 3ABLC 5LGNA 1YZBA 1AP6A 1VEWA 3WG7B 4YY3O 1KB9F 5L3DA 5CA1A 4JZ2A 4UUJC 4X89A 4DW1A 3ML0A 3EHBB 4J11A 4LFBB 4U3JB 2YXYA 3MHHC 5KMGB 2ADQB 2R72A 5H6QA 5B1AB 3L73H 4F4LA 2JJ2G 2QM7A 2DQ0A 4UCTA 3JD3A 1V55B 3JARB 4AQYB 2FMLA 2ZE8A 2HJDA 1Y67A 3R65A 1ZWIC 1GN4A 4FLWA 2JIZG 1HR0B 4JF3A 2Y0PA 1R73A 2O57A 3OW2U 4X64O 2OT5A 5JCOC 1HDJA 4KP4A 5L3GA 5IT9N 1GO3F 2JEXA 3CD6V 4TUYA 1Q90D 2V4DA 3CP1A 3IGAC 2GUZB 2CGOA 1N36O 4TV8A 4LFAB 3JCUZ 3BRCA 3TXQA 1YDXA 1WB7A 1R6KA 1OJHA 4E4EA 2HKOA 2LW1A 1VARA 4QNHB 3CX5F 3K3WA 4I50A 3HKDA 5FNVB 5EYPA 3F5WC 1S5HC 1H2KA 1VF7A 3ZRWA 4DV7B 2OTLV 2WLIB 4OXSA 1AR4A 1SQBH 4FIPC 2YDEA 3THOA 2UUBB 2Y4UA 4Q20A 4K8ZA 1OCOC 1IDSA 2WA3A 4CS3A 1AB3A 4JV5B 4CH3A 1O9GA 3ZHRA 3E8GA 3BEHA 1AILA 1H2GA 1NTZH 4O4HB 1IBMB 2PZSA 1RP3B 3SYAA 2AHYA 4EKWA 5IY5B 4PELA 4NTWA 3G80A 5JQGA 2UXXA 4NTYA 3HKBB 5CN0A 2KG7A 4ZOLA 5IJ0A 2Z0AA 2HR3A 4O2BA 3ZCCA 2X7RB 4DR4O 2QWNB 3E8HA 1MSDA 1FS0G 2DWDC 3RBZA 2IU0A 5AG2A 1J95A 5F2VO 1IZ3A 2Y69B 2Q7GA 2EILB 1WN7A 4DUZO 4DV4B 1VQ8V 3Q4HB 4PA6A 1BSMA 2F4VB 2LGWA 5KAIZ 3SGIA 5LMUB 1CP9A 4H13B 1TVKB 3AG7A 4LH7A 1SC5B 1PPJH 1SZTA 3DC6A 1Q81W 4NXMO 2EZPA 3STZC 3OFNG 4K0KB 4YXWG 4YJ2B 3JAWB 1L8DA 5B1BB 5LP6A 3CXHF 3P32A 4UXNA 2A9HA 1BL8A 4CC6A 2ZIMA 3OMIB 1Y4MA 3A2FA 2UXDO 2OCHA 4P2ZA 5LA6A 5KLVH 4LWSB 4X88A 3FAVA 4PA7A 3CCQV 1RFYA 5B3SB 1SS3A 5CBGA 2YSUB 1I94O 3K59A 4I5SA 4LF5O 1Y76B 2QM8A 4DR2O 4F6RA 3FKSG 3WG7C 1JFFB 2F23A 1SA0B 2A06H 4PI0A 1KKDA 3HKEB 3CCSV 3VOUA 1XNQO 4BW9A 3LNNA 2Q0OC 5B1AC 3A0BZ 4H33A 1V55C 3B2EE 4X1YA 3RYHB 4I9WA 1XOUA 1MZEA 5ITZB 4JI1O 3R66A 1F23A 4D7SA 1IXMA 1D5NA 2B5UA 3ZMVA 4RQEA 3ICXA 1P7BA 4YJ3B 3TJTA 2IH1C 4EB6A 2PY5A 3UT5B 1K7DA 3L70H 4HNAA 2P67A 3CJHB 5C8YA 1PL0A 1NR7A 2HJFC 1H8EG 4DV0O 1NS1A 4WCEV 1LR1A 2D2CB 2NNUA 3CMEV 5JVDB 3CYOA 1LUVA 4FFBA 4FLVA 4B3MB 1NKDA 2W6IG 5EBMC 1N32O 3B8MA 3E86A 5CB4B 2XOKG 3N2GB 3T1HO 4YY3B 1RM1B 5IYZA 4O4LA 1ZTEA 3D36C 2OIEA 4JGSA 3W7TA 3JASA 1IVSA 3U10A 3UO2A 5EBLC 1QVGU 2GDSA 5J2UB 1AJPA 2JEUA 2QE7G 2R9AA 3H1IH 1WNSA 3L75H 4UCVA 3EXAA 5IY5C 2DMXA 4X1KA 1NVPD 4X64B 1NU1H 4IYHA 3K5LA 3N2KB 4JI2O 1EZJA 2YEVA 2B1GA 1N33O 2BE3A 1HW7A 1Q7YW 2QWOB 4O4JA 1MABG 4QGPA 4LH6A 5JJEB 2XAFA 4BR6A 1N36B 4KHPO 1XHXA 3UCSC 2IH3C 4FLTA 2FB5A 3ZIAG 4MVQA 3E89A 2EILC 2DN9A 4MS2A 5IYCO 2ZXWB 1VQKV 1OZ0A 1M90W 1FAFA 4P9OA 1EN5A 2BTQA 3RYIB 4LF8O 3K0GA 4IT5A 4KXRA 5KHGA 4DR7O 1VF5B 2X0LA 2EJ7A 1VF6C 1U96A 3DXRA 5EBWC 4IIJA 1R6NA 2N74A 5BZBA 5EC2C 4B7KA 2XASA 3ETEA 5B1BC 4LF7O 4X62O 1HNZO 4PJ0Z 5L3FA 2JRIA 3SYPA 3JATB 2B1IA 4LP8A 1N0JA 5HFLA 3L9DA 5B3SC 1OCZB 2DW4A 1R6TA 2ZNIA 1VQOV 2R9IA 4JZGA 3IFXA 4DR4B 1GKFA 4ZHQA 4DK1A 4FVMA 4XDJA 5B66Z 1VQNV 2ZNJA 2VS0A 3QF7A 2Y4TA 4G28B 2PTMA 4LNUB 1KP3A 4Z1VA 3OTOO 4HAMA 1YVWA 2XT9A 1DF5A 3AEIA 4JI0O 2EJRA 4DUZB 2VWKA 4CZZA 1D5AA 1UJWB 5J2TB 3J7AU 3RGBA 5LMNO 1KD1W 3DSQA 1RPOA 3JSLA 3RYFA 1AI4A 3S3WA 1R3JC 2OCCB 2D3OW 3OT7A 3K03A 3STLC 4IYIA 4NXMB 4N21A 5L3EA 1BHBA 4TSFG 3OR6C 5DECA 3ZMUA 4DK0A 4L87A 4WFHA 2EBOA 3I5DA 3LSUA 4GX2A 3RT3C 4FLUA 1F7YA 4PHZA 2GV9A 1ZUQA 2LGQA 3BA9A 2DQ3A 1H2SB 4J42A 2UXDB 3KG2A 2QA4V 5KX5B 1TGOA 3H01A 1MNGA 1B04A 2CUGA 5LHHA 1DTOA 3AK2A 2MK3A 4HZ3A 4NTXA 1I94B 3IC7A 4TOIA 1V54B 2ZINA 1GH6A 4LF5B 4JTAB 4QPKA 3RVZA 4DR2B 4PDMA 4PI2A 1RM1C 1SQPH 4UVBA 5HFMA 1Q8IA 2ILMA 4JI6O 1AJQA 1GN6A 1Q43A 5KA6A 1G8MA 2HEPA 1XNQB 3HKCB 1M56B 1YJNV 2XHBA 1KMIZ 4LR3A 4DV2O 1PM9A 2JVDA 1EN6A 3CMAV 1MSWD 2N04A 3A0RA 3JD2A 1SKVA 1GRJA 4JI1B 3C3SA 2RDCA 4RQFA 4TQDA 5KUMA 1PNKA 1BT8A 2P7TC 2H94A 2FKXA 1PL4A 1QBZA 1WA8B 3CRMA 5CBFA 3EVKA 4HBNA 1F51A 1NI8A 2W0FC 5IJ9B 2CTRA 2CH7A 4L8JA 4LF4O 4PDRA 1FXHA 1RSOB 3SR2C 4WFBV 4DV0B 3HPLC 2ZXWC 3UQ8A 2WLLA 2PI4A 1IBKO 3O65A 1YHQV 2Q8VA 1I7FA 4FMTA 1GMGA 1KECA 1N32B 1MA1A 1FXKB 3P3NA 1AI6A 4NVPA 4PA3A 2P4KA 3T1HB 4X20B 2X6BA 3ZHVA 1XMQO 1DGSA 1Q6UA 2DYSB 4DV5O 3FB5C 4QJFB 2KQXA 2EIKC 3E8BA 3L72H 3BAAA 1YI2V 4I0XA 1K5SA 1WLEA 1V9PA 3MAQA 2LFRA 1FFXA 4O2AB 4DR5O 3H9VA 3QNEA 3LDDA 4BWAA 5K1XA 5GONB 3JD1A 3LDEA 1PV0A 2FTKA 3OMAB 5EZYB 2ITCC 1MZFA 4DYLA 1RPRA 2IJIA 3LSQA 4JPRA 1IBLO 5EC1C 4MVZA 4JI2B 4I7ZB 2CE4A 1OCZC 4RUFA 5B1OA 5JH7B 1N33B 2ARHA 2IJKA 4AILC 3LUTB 1M4UA 2BTOA 4MT8A 2RQ6A 3FYEB 4I4TB 1JPXA 4C7UA 4KHPB 2QKAA 1XUQA 1FPOA 2K1EA 1WPXA 3RYCB 2BSKB 4GX5A 3ZHQA 5LXTA 4B3SO 4B7EA 1VQ9V 4LF8B 2ZM6O 3ZN1A 2JS5A 3AG2B 1N8RW 4PA4A 4DR7B 1W59A 1SQXH 4TV9A 2PI5A 3B77A 1VQ7V 2GHYA 4CS2A 3VQYA 1B3QA 2ADPA 2ZDIC 3OR7C 1P84F 2QR4A 3K04A 4UVAA 2F93B 1ZSPA 2DWEC 3VQWA 1E79G 4G2KA 1Y74B 4LF7B 2QSAA 3FFQA 4X62B 1HNZB 3AK1A 3OD4A 2CAZC 3MD0A 4N23A 2UXCO 4UB6Z 4QE7A 1NBMG 2F95B 3D3IA 3BY6A 2W6JG 4JI8O 3TGUH 3E2EA 4K8XA 3A0HZ 2KKWA 2Q5ZA 1FD9A 1XBLA 1LNQA 5DM6V 3OM3B 2QM4A 3JAKA 4J10A 4J9YB 3VQXA 3ETGA 4I55B 4KUMA 3TK1A 4DXWA 3T4DA 1V54C 1KQSU 1NZ6A 3CXCU 3VQVA 2Y0IA 3UKMA 2DE0X 4BW5A 5LYJA 3LSSA 5GTHZ 4OX9O 5JCOA 3OTOB 2K9PA 2V1DA 4JYBA 4H44B 1H2LA 4JI0B 4DR1O 3OEEG 1BQ0A 4FM2A 1M56C 3BA8A 2IJJA 2E74B 1YJ9V 4ASUG 3SPHA 4ZI7A 3CCRV 4JASA 3E22B 3W7SA 5LMNB 3ZMSA 2AHZA 1ZL8A 3ZHSA 1VQMV 1XL4A 2P4VA 1SETA
chains in the Genus database with same CATH topology
2WLHA 1EZJA 2YEVA 3P30A 3JD0A 2B1GA 1ENVA 4Z1MG 1QLEB 1Q7YW 3SPIA 1JCHA 3T1CA 1MABG 2EINC 2JJ1G 2NLJC 5E1AC 3ZRSA 5KA5A 1K73W 2XAFA 1S72V 4R8CA 1MOFA 2XAJA 1PNMA 4P9PA 2IH3C 3EFFK 1W2BU 1ROPA 3OEHG 3ZIAG 4MVQA 3E89A 3B8NA 2EZOA 2EILC 1E1RG 1QVFU 3ABMB 1K4CC 2Y48A 4MS2A 1PD3A 2HLDG 5IYCO 2ZXWB 4FK5C 1VQKV 1OZ0A 3F7YC 1BMFG 4H37A 1M90W 3LDCA 1KP2A 3CCJV 2ZR3A 4P9OA 4RO2A 5B1NA 4JAUA 2HVJC 3W7WA 3K0GA 4RAIA 3E8FA 3AG1B 4MTFA 3ABKC 1FXKC 2X0LA 1JQ0A 2ITDC 3OUFA 1GM7A 1MG1A 5KUKA 2C2AA 2OCCC 3OGCC 5EBWC 2Q69A 5CBHA 1R6NA 1K8AW 5IDJA 5BZBA 2UXNA 3UM7A 2P90A 2WLKA 2DYSC 4GX1A 5EC2C 1PNLA 2Z3YA 2XASA 1SESA 4FJCC 3PJSK 3SJQC 5CA3A 3ETEA 3CCVV 5B1BC 2QTOA 3ZMZA 1HWYA 4LCUC 1QLNA 3ZJZA 4WF9V 3TETA 1VQ5V 5J9PC 2F43G 3DTUB 5L3FA 3SYPA 5C93A 2DYRB 3ZN0A 1K3EA 4U7OA 1DF4A 2B1IA 2ZR2A 4MTOA 4XBFA 4LP8A 4QE9A 5HFLA 1I5XA 5L3BA 2LFSA 2WWWA 2QEXV 2WLNA 1THZA 5B3SC 4MVRA 3AG3B 2ZQMA 1OCZB 2DW4A 4ZBMA 2R9IA 1VQOV 3ABLC 3IFXA 1QR8A 3ASOB 1GKFA 3DGEA 2EINB 4XDJA 4RUEA 5LGNA 1VQNV 1JVMA 1E1QG 3WG7B 1XL6A 5L3DA 3QO5A 1YTFB 4G28B 4UUJC 1SRYA 4X89A 1KP3A 3EHBB 3ML0A 3ASNC 4HAMA 1F4NA 4QPJA 1VQ6V 1DF5A 2HVKC 3AEIA 3MHHC 4XDKA 2EJRA 1YTFD 5H6QA 5B1AB 4BIUA 2JJ2G 4CZZA 4F4LA 4WFFA 1OCCB 2QM7A 2WLMA 2DQ0A 3ZRWB 3X2QB 5EK0A 1UJWB 3JD3A 1V55B 1AI7A 2R9RB 4CBCA 3R65A 1RPOA 1ZWIC 1KD1W 5FL7G 2JIZG 3CCUV 1AI4A 1JX9A 1R3JC 2OCCB 3K06A 4JF3A 3OW2U 1R73A 2X6AA 2D3OW 1S0VA 2OT5A 3K03A 1AJNA 4KP4A 3STLC 4GCZA 4N21A 5L3EA 5L3GA 1BHBA 1GO3F 3QO8A 4TSFG 3JD4A 3OR6C 3ZMUA 3CC4V 2JEXA 4L87A 3CD6V 1Q82W 2A0LA 4E2LA 1OCRB 2EIJC 4WFHA 2JDIG 2EBOA 4PA9A 3I55V 4GX2A 3SYQA 3CP1A 3JCZA 2WPDG 4BIZA 4PDLA 3IGAC 2IU3A 4LC1A 2DQ3A 1P4RA 4TWKA 3CC2V 2H8PC 1OHHG 2EIMC 3KG2A 1W0KG 2QA4V 3ABTA 3H01A 1R6KA 2Y69C 5LHHA 3QO7A 1DTOA 2HKOA 1CEZA 1H38A 2MK3A 4HZ3A 4QNHB 3K3WA 3IC7A 1V54B 3F5WC 1S5HC 2OTJV 4JTAB 4QPKA 3ZRWA 2KB1A 2OTLV 3MHSC 2P6JA 2XNDG 3RVZA 2WLIB 1K33A 4OXSA 4PDMA 4FIPC 4MSWC 3ABUA 2HFEC 2CK3G 4Q20A 1RM1C 4UVBA 4U7NA 5GW7A 2Q6AA 3K9AA 5HFMA 4FPPA 1OCOC 2ZDIA 1AJQA 2WLLB 2Q67A 4MVSA 4QIWF 5KA6A 3CCEV 4KFMA 1G8MA 3OAAG 1EFRG 1M57B 3OE7G 2QKSA 1M56B 3E8GA 1R3IC 3BEHA 1YJNV 4JTCB 3G71V 1H2GA 4PDVA 5CMUA 1CPYA 3SYAA 5IYDO 2AHYA 4EKWA 3ETDA 5IY5B 4PELA 3OUSA 3W7XA 3AG4B 1K9MW 3CMAV 1MSWD 2UXXA 5CN0A 4G27B 3JYCA 3A0RA 1GM8A 2X6CA 3JD2A 4GX0A 4P30A 1PKXA 2HR3A 3ZCCA 3SPJA 2X7RB 4DO2A 4RQFA 1FFTB 3E8HA 5KUMA 1PNKA 1FS0G 4ZKIA 5IYBO 1QLEC 3T2MA 2DWDC 2P7TC 3VBBA 2H94A 5LHIA 1K4DC 2WLJA 3RBZA 2IU0A 5H6RA 1QBZA 1J95A 3T4ZA 2WLIA 5CBFA 1F51A 2W0FC 2Y69B 3D36A 2EILB 1K92A 4PDRA 1FXHA 4MW8A 4WFBV 3ABMC 3FB6C 1VQ8V 3HPLC 2ZXWC 3RVYA 2WLLA 4PA6A 1M9NA 3FB8C 2PI4A 3F7VC 1YHQV 2Q68A 2IW5A 4FMTA 1COWG 1GMGA 1KECA 3AG1C 3ABKB 1FXKB 1AI6A 1CP9A 3WFVA 1YJWV 3AG2C 4PA3A 3CCLV 5LHGA 1SZTA 2Z5UA 4JTDB 1VQ4V 1Q81W 4UVCA 2EZPA 4MVUA 2X6BA 1AROP 3K08A 4HYOA 3STZC 4GT1A 1R3KC 3OFNG 3GB7C 3RW0A 4YXWG 3G4SV 2DYSB 4R7CA 2HG5C 3FB5C 4QJFB 4MVMA 2EIKC 5B1BB 3P32A 3E8BA 1AR1B 4UXNA 2A9HA 1YI2V 1BL8A 4BAYA 1K34A 1QCEA 1K5SA 3OMIB 1YSCA 1WLEA 1ORQC 1Y4MA 2LFRA 4P2ZA 5LBQA 2ATKC 3QNEA 3LDDA 4TT3G 3LNMB 4X88A 3JD1A 2WAMA 4PA7A 1TUEB 4MTGA 3LDEA 2FTKA 3OMAB 3CCQV 4MVOA 2ITCC 2IJHA 5B3SB 1RPRA 2IJIA 3LSQA 4JPRA 4MTXA 5EC1C 5CBGA 1GTOA 2YSUB 3AG3C 4MVZA 4WFAV 1OCZC 3K0DA 3ABLB 4MW3A 4I5SA 4RUFA 5B1OA 1Q86W 2QM8A 3SYOA 3ZMTA 2IJKA 3ASOC 5H9CA 3LUTB 3K79A 3FKSG 4MT8A 3WG7C 2XAGA 3FYEB 1FXKA 3W7UA 1S76D 1JPXA 2JK5C 3ASNB 1JJ2U 2GSMB 1M1KW 1K5QA 1KKDA 3GWOA 3CCSV 1YIJV 2K1EA 3VOUA 1NQTA 4UV8A 1WPXA 1KC8W 3FB7C 4GX5A 5B1AC 5LGUA 1OCCC 1W0JG 4H33A 3X2QC 1VQ9V 1V55C 2XAHA 1I5YA 3ZN1A 3AG2B 2BOBC 4PA4A 1N8RW 2M7WA 4WFEA 1NR1A 4I9WA 1EBOA 1NJIW 2PI5A 3B77A 1VQ7V 1K97A 2GHYA 1GM9A 3G6EV 3OR7C 2ZDIC 2LP7A 3OMNB 1R3LC 3K04A 1F4MA 4UVAA 1F23A 3HB3B 2EIKB 1G4YB 1IXMA 2EIJB 3NXSA 2DWEC 3FYIB 2B5UA 1OCRC 1BHAA 3TCUA 4JYCA 1E79G 4G2KA 3ZMVA 1VQLV 4RQEA 3SYCA 1DLBA 1P7BA 3E83A 3MD0A 2EIMB 4XDLA 1S3JA 4N23A 2IH1C 4QE7A 1NBMG 3D3IA 1QR9A 3BY6A 1K7DA 2V7QG 4R50A 2W6JG 3E2EA 1B6QA 2P67A 1PL0A 1NR7A 2HJFC 2YEVB 1H8EG 3ZRVA 5LGTA 4WCEV 1LNQA 5DM6V 3OM3B 5L3CA 1H8HG 2NNUA 3CMEV 3CPWU 3M99B 3CYOA 4J9YB 3ETGA 4KUMA 3CCMV 1NKDA 3TK1A 4DXWA 2W6IG 3T4DA 1V54C 4J9ZB 5EBMC 3ZRXA 3E35A 1AI5A 1KQSU 2BOCC 3CXCU 3B8MA 3E86A 2XOKG 3UKMA 4BW5A 3I56V 1RM1B 3LSSA 4JGSA 3W7TA 1OCOB 1NH2B 4UV9A 1SERA 1S77D 4LBEC 3SPGA 2V1DA 4JYBA 5EBLC 4R6ZA 3OEEG 1QVGU 1M57C 1Y66A 3SPCA 1AJPA 1M56C 2JEUA 2QE7G 1NVPB 2IJJA 4WFGA 1YJ9V 2XAQA 4ASUG 1NH2D 3SPHA 1JOYA 3CCRV 2A79B 4JASA 4JAVA 1YITV 3W7SA 1VQPV 4X8AA 2ZD9A 3ZMSA 2AHZA 5IY5C 2DYRC 3AG4C 1VQMV 3CC7V 1XL4A 1NVPD 5DN6G 1SETA 1GK9A 2WSSG 1FXVA 1L1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLH A;  2K1E A;  3VOU A;  2YEV A;  3SPJ A;  3FB7 C;  4F4L A;  4GX5 A;  5B1A C;  3E8H A;  4WFF A;  2WLM A;  5KUM A;  5EK0 A;  1OCC C;  1QLE C;  3T2M A;  4H33 A;  2DWD C;  3SPI A;  2P7T C;  1V55 C;  3X2Q C;  3T1C A;  2R9R B;  1K4D C;  2EIN C;  2WLJ A;  3R65 A;  3RBZ A;  1ZWI C;  4CBC A;  2NLJ C;  5E1A C;  2BOB C;  4PA4 A;  3ZRS A;  1J95 A;  4WFE A;  3T4Z A;  2WLI A;  4I9W A;  5CBF A;  4R8C A;  1R3J C;  3K06 A;  4P9P A;  2IH3 C;  2X6A A;  2W0F C;  3EFF K;  3K03 A;  3STL C;  3OR7 C;  4MVQ A;  3E89 A;  2EIL C;  1R3L C;  3K04 A;  1K4C C;  3OR6 C;  4MS2 A;  4MW8 A;  4PDR A;  3ABM C;  3FB6 C;  3F7Y C;  1G4Y B;  3HPL C;  4H37 A;  2ZXW C;  3RVY A;  2WLL A;  2A0L A;  3LDC A;  4PA6 A;  4P9O A;  2EIJ C;  3FB8 C;  2DWE C;  4RO2 A;  4WFH A;  1OCR C;  3F7V C;  2HVJ C;  3TCU A;  2Q68 A;  4PA9 A;  4GX2 A;  3SYQ A;  3K0G A;  4RAI A;  4PDL A;  3E8F A;  3IGA C;  3SYC A;  3AG1 C;  1P7B A;  4MTF A;  3ABK C;  3E83 A;  4TWK A;  3AG2 C;  4XDL A;  4PA3 A;  2H8P C;  2ITD C;  2EIM C;  3OUF A;  4JTD B;  2IH1 C;  3KG2 A;  4QE7 A;  5KUK A;  4MVU A;  2X6B A;  3K08 A;  4HYO A;  4R50 A;  3STZ C;  2OCC C;  1R3K C;  3OGC C;  3GB7 C;  5EBW C;  3RW0 A;  2Q69 A;  5CBH A;  2Y69 C;  2HJF C;  5BZB A;  3UM7 A;  2WLK A;  4R7C A;  2DYS C;  2HG5 C;  3FB5 C;  1LNQ A;  4GX1 A;  5EC2 C;  4MVM A;  4HZ3 A;  4QNH B;  2EIK C;  4J9Y B;  3SJQ C;  5B1B C;  3E8B A;  2QTO A;  1S5H C;  2A9H A;  3F5W C;  4DXW A;  1BL8 A;  3T4D A;  1V54 C;  4J9Z B;  4LCU C;  4JTA B;  5EBM C;  3ZJZ A;  2KB1 A;  2BOC C;  3TET A;  3E86 A;  5J9P C;  1ORQ C;  3RVZ A;  2WLI B;  4OXS A;  4P2Z A;  4PDM A;  2ATK C;  3SYP A;  3UKM A;  3LDD A;  4BW5 A;  3LNM B;  4MSW C;  4X88 A;  2HFE C;  4PA7 A;  4MTG A;  3LDE A;  2Q6A A;  4MTO A;  4MVO A;  4LP8 A;  4QE9 A;  2ITC C;  1OCO C;  2WLN A;  5B3S C;  4MVR A;  5EC1 C;  2WLL B;  2Q67 A;  5CBG A;  4LBE C;  4MVS A;  3SPG A;  3AG3 C;  4KFM A;  4MVZ A;  5EBL C;  1OCZ C;  3K0D A;  4MW3 A;  4R6Z A;  4ZBM A;  2QKS A;  4RUF A;  1M57 C;  3ABL C;  3E8G A;  1R3I C;  3IFX A;  3SPC A;  3BEH A;  1M56 C;  3SYO A;  4XDJ A;  4RUE A;  4JTC B;  3ASO C;  4WFG A;  3LUT B;  3SPH A;  1JVM A;  4PDV A;  1XL6 A;  2A79 B;  3WG7 C;  3SYA A;  4X8A A;  2AHY A;  4G28 B;  4EKW A;  4UUJ C;  2ZD9 A;  3OUS A;  4X89 A;  2AHZ A;  5IY5 C;  2JK5 C;  2DYR C;  3AG4 C;  3ASN C;  4G27 B;  1XL4 A;  3JYC A;  2X6C A;  4GX0 A;  4P30 A;  2HVK C;  3PJS K;  1KKD A;  4XDK A; 
#chains in the Genus database with same CATH topology
 3P30 A;  2M6Y A;  2JGD B;  1ENV A;  4Z1M G;  1QLE B;  2ZIO A;  4FM1 A;  1N34 O;  3T1C A;  4EEQ A;  2JJ1 G;  2NLJ C;  1GN3 A;  5KA5 A;  5LOV B;  2UUA O;  1S72 V;  3P3P A;  1UPG A;  2EUL A;  2ODM A;  5TIS Z;  1E1R G;  1QVF U;  3ABM B;  1K4C C;  3BFR A;  1PD3 A;  4FK5 C;  1BMF G;  4GZR B;  1GN2 A;  2QWR B;  2ZR3 A;  4DRX A;  4RO2 A;  3KCY A;  4YIO A;  2HVJ C;  4NXN O;  4W4L A;  5BMV A;  1XHZ A;  3E8F A;  5CA1 B;  3AG1 B;  3K9S A;  1FXK C;  2P06 A;  1I08 A;  4GLX A;  3OUF A;  4LFC O;  2C2A A;  4DR3 O;  1Q3E A;  1K8A W;  3O9O A;  4O4I A;  2UXN A;  1H2N A;  2WLK A;  4JI6 B;  1HNX O;  2DYS C;  4GX1 A;  1PNL A;  1I0H A;  4FJC C;  1T5E A;  5CA0 A;  3ZMZ A;  3ZJZ A;  4WF9 V;  4WBN A;  5J9P C;  2ZE6 A;  1WP8 A;  1KKC A;  2DYR B;  4DV6 O;  3ZN0 A;  3G67 A;  1DF4 A;  2HP8 A;  4DV2 B;  2ZR2 A;  4MTO A;  3KCX A;  1I5X A;  3T1Y O;  2QEX V;  3B4S A;  2QWQ B;  4TUY B;  4MVR A;  3AG3 B;  5K1P A;  2ZQM A;  2PGG A;  4ZBM A;  1XQ8 A;  1MMM A;  1QR8 A;  2EIN B;  3JAL A;  1GAX A;  4TV8 B;  2CTQ A;  2F1M A;  3FD9 A;  1E1Q G;  1XL6 A;  1A32 A;  1YTF B;  3CWB H;  3K5O A;  3J80 N;  2Q73 A;  3J81 N;  1PP9 H;  2HVK C;  2OYQ A;  4Q6G A;  1XRE A;  4LF4 B;  4I50 B;  3HKD B;  5EYP B;  4BIU A;  1OCC B;  3ZRW B;  3X2Q B;  5EK0 A;  1IBK B;  1WJZ A;  1AI7 A;  3BPZ A;  2LJ2 A;  5FL7 G;  3CCU V;  4D7T A;  2X6A A;  2LO1 A;  1AJN A;  2AZ0 A;  4GCZ A;  1BS3 A;  1FYJ A;  3QO8 A;  3CC4 V;  1XMQ B;  1SF9 A;  3ZHU A;  1Q82 W;  3PN1 A;  4DV5 B;  4E2L A;  1OCR B;  2JDI G;  4OGQ B;  5IWA O;  4PDL A;  4NB5 A;  2CTP A;  1Z2G A;  3CRC A;  3RN4 A;  1TAE A;  2H8P C;  5JQG B;  1OHH G;  4DR5 B;  2KG7 B;  4ZOL B;  5IJ0 B;  1W0K G;  2Q0A A;  4OPH A;  3ABT A;  4CS4 A;  4O2B B;  3OTF A;  2Y69 C;  3QO7 A;  4RWU A;  1EZV H;  1CEZ A;  4U3J A;  5FPO A;  1IBL B;  5KMG A;  3JAR A;  2P6J A;  3K5M A;  2QGN A;  2HFE C;  3ABU A;  2Q6A A;  1BCC H;  1QNM A;  3K9A A;  4J41 A;  4B3T O;  3AK3 A;  4GYC B;  2Q67 A;  3CCE V;  1EFR G;  1M57 B;  1UFI A;  2B9Z A;  1R3I C;  4JTC B;  3K5N A;  4B3S B;  4K35 A;  3CE2 A;  1Q5O A;  1EN4 A;  2GUZ A;  2ZM6 B;  2ETN A;  3ETD A;  3AG4 B;  3BAB A;  1K9M W;  3CB2 A;  2X6C A;  4P30 A;  1PKX A;  2F66 C;  4JI3 O;  3SPJ A;  5LP6 B;  1N0N A;  4ZKI A;  5IYB O;  1QLE C;  3T2M A;  5FNV A;  5JJN B;  3VBB A;  5H5N A;  5LHI A;  1K4D C;  5LA6 B;  2VQE O;  3FAV B;  1YXB A;  2RCV A;  2WLI A;  4UB8 Z;  3D36 A;  2UXC B;  2WA4 A;  2DOS A;  1XI1 A;  1K92 A;  1YF2 A;  4JI8 B;  3ABM C;  3RVY A;  4U3F H;  3FB8 C;  2UXB O;  2LW7 A;  3IJ4 A;  3F7V C;  4AHC A;  4CH5 A;  4F6R B;  2IW5 A;  1N4C A;  3H1K H;  4FFK A;  3AG1 C;  5KHI A;  3WFV A;  1J5E O;  1YJW V;  4O4H A;  4Z2W A;  2Q9L A;  1VQ4 V;  4UVC A;  5D5P A;  4MVU A;  3K08 A;  1ARO P;  5FPR A;  4JI5 O;  4GKJ O;  2AXT Z;  1R3K C;  3RW0 A;  3GB7 C;  2HHH O;  4OX9 B;  3HKB A;  1M5I A;  2HG5 C;  3H1J H;  4IHJ B;  1XDC A;  4MVM A;  3DC5 A;  3C3T A;  3L74 H;  1AR1 B;  4DR1 B;  4BAY A;  4X1Y B;  2Q4P A;  5LBQ A;  2ATK C;  1TUE B;  1KUQ A;  1AVM A;  4MVO A;  1Y6X A;  2E5L O;  3AG3 C;  1HP8 A;  1Q86 W;  3Q4H A;  1O9H A;  3SYO A;  1X4T A;  1N34 B;  5IE9 A;  4EB6 B;  4GKK O;  4F6E A;  3W7U A;  3ASN B;  1TVK A;  1JJ2 U;  4HNA B;  3IAY A;  2UUA B;  2GSM B;  1VF6 A;  5C8Y B;  5JJJ B;  4DUY O;  1M1K W;  3GWO A;  4H0L B;  1YIJ V;  3GVM A;  1NQT A;  4UV8 A;  4FFB B;  3GWK C;  4YJ2 A;  2RMK B;  3JAW A;  5LGU A;  1OCC C;  3X2Q C;  1SQV H;  4PV1 B;  4NXN B;  3G6B A;  2BOB C;  4JYA O;  2M7W A;  5IYZ B;  4WFE A;  4O4L B;  5EIB C;  3CRA A;  1EBO A;  4LWS A;  2RN9 A;  3JAS B;  1K97 A;  2XTA A;  1FJG O;  1JMK C;  2YIB D;  3G6E V;  5B5E Z;  4LFC B;  2LP7 A;  3OMN B;  1F4M A;  4JAA A;  4DR3 B;  1G4Y B;  2EIJ B;  1HNX B;  3NXS A;  1OCR C;  3TCU A;  4JYC A;  1Y76 A;  1TA8 A;  3RFR A;  1XNR O;  2ZE7 A;  4UCR A;  1DLB A;  2EIM B;  4XDL A;  3WB0 A;  1S3J A;  4LF6 O;  1US6 A;  2QTS A;  1P7G A;  4X1K B;  4DV6 B;  1DK1 A;  1JFF A;  2V7Q G;  1SA0 A;  2YEV B;  1S5L Z;  2W0X A;  3T1Y B;  5LGT A;  1M93 A;  3ZX6 A;  5L3C A;  3HKE A;  1H8H G;  3CPW U;  3CCM V;  5KHH A;  4O4J B;  3ZRX A;  1AI5 A;  2BOC C;  3RYH A;  2BCC H;  3CSX A;  1VIB A;  1CXZ B;  1NH2 B;  4UV9 A;  5ITZ A;  3SJB C;  1SER A;  2A7W A;  4LBE C;  3SPG A;  2BTQ B;  4ZIB A;  2IBZ H;  4R6Z A;  4IGG A;  2L6L A;  1JR9 A;  1M57 C;  3TXS A;  2GTA A;  4LF9 O;  4X1I B;  4WFG A;  4UCU A;  1X59 A;  1AP5 A;  1YIT V;  1KYO F;  1HNW O;  4EFE A;  4X8A A;  2L35 A;  4YJ3 A;  3DXR B;  3ETQ A;  4IIJ B;  3AG4 C;  1AR5 A;  4X9Q A;  3UT5 A;  5JWP A;  2WSS G;  1FKA O;  3PJS K;  5KHK A;  1L1F A;  3CJH A;  3APQ A;  3JD0 A;  1EM1 A;  5LP6 C;  3H1L H;  5JVD A;  1JCH A;  5IWA B;  5E1A C;  2VQF O;  1SQF A;  5CB4 A;  2CTW A;  3N2G A;  1MOF A;  2YI9 A;  1PNM A;  4P9P A;  1IUR A;  3EFF K;  1W2B U;  2VWJ A;  3UO3 A;  2EZO A;  4DV1 O;  4YHH O;  2Y48 A;  2NN4 A;  3F7Y C;  4H37 A;  4ZHQ B;  2E3C A;  5BY1 A;  2Q7H A;  4TQF A;  3W7W A;  4RAI A;  1L0L H;  5J2U A;  2ZKO A;  4MTF A;  2YXH A;  1JQ0 A;  2ITD C;  2NR5 A;  3D3Q A;  1VMG A;  5KUK A;  1SZX A;  2OCC C;  3OGC C;  1G6U A;  1WP7 A;  5IDJ A;  2P90 A;  3M7M X;  1BZK A;  4B3T B;  3N2K A;  1Z5W A;  1SES A;  2ZT9 B;  3SJQ C;  5CA3 A;  4ABM A;  3CCV V;  2AGA A;  2QTO A;  4LCU C;  5BR8 O;  1QLN A;  3RYF B;  2DJV A;  2AW9 A;  1ZLZ A;  1K3E A;  5GTI Z;  3CRQ A;  4XBF A;  5H2F Z;  4CH6 A;  2LFS A;  2WWW A;  1THZ A;  2UUC O;  2UU9 O;  3NR7 A;  4JI3 B;  3ASO B;  3DGE A;  4RUE A;  3RYI A;  5E79 Z;  4FLZ A;  1JVM A;  3QO5 A;  2VQE B;  1SRY A;  1NTK H;  3SDL A;  3ASN C;  3CRR A;  1F4N A;  1SQG A;  4QPJ A;  1VQ6 V;  1R1B A;  1JA8 A;  4XDK A;  2IM9 A;  1YTF D;  2YUA A;  3N27 A;  4WFF A;  2WLM A;  2FL4 A;  4DR6 O;  2UXB B;  1Q6I A;  2R9R B;  4CBC A;  4NKG B;  2YS8 A;  1JX9 A;  1J5E B;  3JAT A;  3QVN A;  1NT2 B;  3K06 A;  1ZX3 A;  1S0V A;  3WB2 A;  4X66 O;  4JI5 B;  4GKJ B;  3CHX A;  3JD4 A;  2HHH B;  5EIB D;  2XUM A;  2A0L A;  2EIJ C;  2JGU A;  4PA9 A;  3I55 V;  3SYQ A;  3JCZ A;  2WPD G;  4BIZ A;  1BE3 H;  2IU3 A;  3OGI B;  4LC1 A;  3ZHT A;  1P4R A;  4J80 A;  4TWK A;  3CC2 V;  2EIM C;  2EX3 A;  3BCC H;  2GBO A;  4LNU A;  2P22 C;  4J7Z A;  3ZED A;  1TUB B;  1H38 A;  2E5L B;  2OTJ V;  3BHP A;  4A5U B;  2KB1 A;  5J2T A;  3MHS C;  2XND G;  3K58 A;  1K33 A;  4B3R O;  1P49 A;  4B08 A;  4MSW C;  2CK3 G;  2CH7 B;  4U7N A;  5GW7 A;  4GKK B;  4NYK A;  4X65 O;  1XMO O;  4BIO A;  4FPP A;  2ZDI A;  1ZAU A;  4JI4 O;  4FZ1 A;  4DUY B;  3WU2 Z;  2WLL B;  2AZ2 A;  4MVS A;  4QIW F;  4KFM A;  4IHJ A;  4JI7 O;  3OAA G;  3OE7 G;  4DW0 A;  2QKS A;  2YI8 A;  2JS3 A;  3G71 V;  1QHT A;  4PDV A;  2OWO A;  2H3O A;  3B09 A;  5CMU A;  1CPY A;  5IYD O;  3OUS A;  3W7X A;  4JYA B;  4G27 B;  3JYC A;  4FLX A;  1GM8 A;  4GX0 A;  4UCO A;  1FJG B;  5KX5 A;  4EFB A;  4JYY A;  3APO A;  1S5J A;  4DV3 O;  4CC5 A;  4DO2 A;  1FFT B;  4I0X B;  3KKY A;  2E75 B;  2PUS A;  3K57 A;  1FFX B;  2WLJ A;  1QQC A;  1BQZ A;  3QTC A;  2A3Q A;  1XNR B;  5H6R A;  2CGN A;  3T4Z A;  4PD4 F;  4LFB O;  3U11 A;  4LF6 B;  1H2M A;  3HR0 A;  2QJ1 A;  1G1X B;  4MW8 A;  2MW2 B;  2G38 A;  3FB6 C;  3SJA C;  2R70 A;  2YID A;  3ZBH A;  1M9N A;  1QU7 A;  4AQY O;  3F5T A;  2Q68 A;  3HKC A;  3ZS8 C;  3CS5 A;  1HR0 O;  1COW G;  4I9Q A;  3ABK B;  3AG2 C;  3QG5 A;  5KHJ A;  3CCL V;  3U0Z A;  5LHG A;  2Z5U A;  4JTD B;  4HYO A;  4GT1 A;  4CH4 A;  3G4S V;  1IX9 A;  4NR1 A;  4R7C A;  5LXT B;  1K34 A;  1QCE A;  1NTM H;  1OV9 A;  1YSC A;  4LFA O;  1ORQ C;  4LF9 B;  4YIP A;  4TV9 B;  4TT3 G;  3LNM B;  2WAM A;  1HNW B;  4MTG A;  1WA8 A;  2IJH A;  5IJ9 A;  4MTX A;  3BVO A;  1GTO A;  4WFA V;  1RSO A;  3K0D A;  3ABL B;  4MW3 A;  2ZCE A;  4DV7 O;  1SQQ H;  3ZMT A;  3ASO C;  5H9C A;  2VRZ A;  3K79 A;  2QDO A;  2UUB O;  4GUN A;  2XAG A;  2VQF B;  1FXK A;  1S76 D;  2JK5 C;  4X20 A;  3B40 A;  4JV5 O;  4J7J A;  1K5Q A;  1LUW A;  2YC0 A;  4K3A A;  5DED A;  2RJZ A;  3JAK B;  1KBH A;  2YIC A;  4DV1 B;  1KC8 W;  4YHH B;  3FB7 C;  1U97 A;  3IC9 A;  5KAF Z;  1W0J G;  1IBM O;  2XAH A;  1I5Y A;  4X1I A;  3A8T A;  5LYJ B;  4UCS A;  5LL6 Y;  4FLY A;  3WB1 A;  1NR1 A;  4O2A A;  3RWR D;  1NJI W;  4D6T H;  5GON A;  1GM9 A;  5EZY A;  1BGY H;  1R3L C;  3M8A A;  2QKC A;  2EIK B;  3HB3 B;  3FYI B;  1BHA A;  3CEI A;  4ZI7 B;  1VQL V;  5JH7 A;  5A9G A;  3KZI Z;  5BR8 B;  3SYC A;  2PYL A;  3E83 A;  1ZL8 B;  2LQT A;  2FYU H;  4I4T A;  1QR9 A;  1URF A;  4R50 A;  1B6Q A;  4DV4 O;  2YIA A;  3ZRV A;  2UUC B;  2F4V O;  2UU9 B;  3M99 B;  3RYC A;  2OIG A;  2BSK A;  4J9Z B;  3E35 A;  5LMU O;  2YIB A;  3JSN A;  5BXZ A;  3JAM N;  2E76 B;  1YCI A;  1Z5V A;  3I56 V;  1B06 A;  4K0K O;  1OCO B;  1YEW A;  4AI8 A;  1WB8 A;  1WPB A;  1S77 D;  4DRX B;  1WAZ A;  1Y66 A;  3SPC A;  5BMV B;  2QWP B;  2RNB A;  1Q6H A;  1NVP B;  5A2Q N;  2XAQ A;  2YXL A;  3SJC C;  1NH2 D;  4DR6 B;  1JOY A;  1Y74 A;  2A79 B;  3C90 A;  3H1H H;  2N05 A;  4JAV A;  1VQP V;  1XIL A;  2ZD9 A;  2DYR C;  5FLX N;  1XEQ A;  3CC7 V;  1KU9 A;  4O4I B;  2KSD A;  1L0N H;  5DN6 G;  1GK9 A;  4X66 B;  1FXV A;  4ICG A;  2WLH A;  3D8C A;  2P5O A;  5CA0 B;  4IL6 Z;  2PYJ A;  4WBN B;  4I55 A;  3SPI A;  3MDS A;  2EIN C;  4KL1 A;  2PF4 E;  3ZRS A;  1K73 W;  4R8C A;  2XAJ A;  5D5Q A;  1ROP A;  3OEH G;  3B8N A;  4J7K A;  2Q7E A;  2HLD G;  3LDC A;  1KP2 A;  3CCJ V;  3JAL B;  5B1N A;  4JAU A;  4FZ0 A;  4W4K A;  3ABK C;  2CDY A;  4OPA A;  3E22 A;  1GM7 A;  1MG1 A;  4B3R B;  2Q69 A;  5CBH A;  3FX7 A;  4X65 B;  1XMO B;  3UM7 A;  3L71 H;  2Z3Y A;  4JI4 B;  1D2D A;  4JI7 B;  2JGD A;  1HWY A;  1IXB A;  3TET A;  1VQ5 V;  3S3X A;  2F43 G;  3DTU B;  4FM0 A;  5C93 A;  1VP7 A;  4U7O A;  5LOV A;  4QE9 A;  4UFZ A;  1JJO A;  2ZE5 A;  5L3B A;  2WLN A;  1TUB A;  4B3M O;  2GTS A;  4DV3 B;  3ABL C;  5LGN A;  1YZB A;  1AP6 A;  1VEW A;  3WG7 B;  4YY3 O;  1KB9 F;  5L3D A;  5CA1 A;  4JZ2 A;  4UUJ C;  4X89 A;  4DW1 A;  3ML0 A;  3EHB B;  4J11 A;  4LFB B;  4U3J B;  2YXY A;  3MHH C;  5KMG B;  2ADQ B;  2R72 A;  5H6Q A;  5B1A B;  3L73 H;  4F4L A;  2JJ2 G;  2QM7 A;  2DQ0 A;  4UCT A;  3JD3 A;  1V55 B;  3JAR B;  4AQY B;  2FML A;  2ZE8 A;  2HJD A;  1Y67 A;  3R65 A;  1ZWI C;  1GN4 A;  4FLW A;  2JIZ G;  1HR0 B;  4JF3 A;  2Y0P A;  1R73 A;  2O57 A;  3OW2 U;  4X64 O;  2OT5 A;  5JCO C;  1HDJ A;  4KP4 A;  5L3G A;  5IT9 N;  1GO3 F;  2JEX A;  3CD6 V;  4TUY A;  1Q90 D;  2V4D A;  3CP1 A;  3IGA C;  2GUZ B;  2CGO A;  1N36 O;  4TV8 A;  4LFA B;  3JCU Z;  3BRC A;  3TXQ A;  1YDX A;  1WB7 A;  1R6K A;  1OJH A;  4E4E A;  2HKO A;  2LW1 A;  1VAR A;  4QNH B;  3CX5 F;  3K3W A;  4I50 A;  3HKD A;  5FNV B;  5EYP A;  3F5W C;  1S5H C;  1H2K A;  1VF7 A;  3ZRW A;  4DV7 B;  2OTL V;  2WLI B;  4OXS A;  1AR4 A;  1SQB H;  4FIP C;  2YDE A;  3THO A;  2UUB B;  2Y4U A;  4Q20 A;  4K8Z A;  1OCO C;  1IDS A;  2WA3 A;  4CS3 A;  1AB3 A;  4JV5 B;  4CH3 A;  1O9G A;  3ZHR A;  3E8G A;  3BEH A;  1AIL A;  1H2G A;  1NTZ H;  4O4H B;  1IBM B;  2PZS A;  1RP3 B;  3SYA A;  2AHY A;  4EKW A;  5IY5 B;  4PEL A;  4NTW A;  3G80 A;  5JQG A;  2UXX A;  4NTY A;  3HKB B;  5CN0 A;  2KG7 A;  4ZOL A;  5IJ0 A;  2Z0A A;  2HR3 A;  4O2B A;  3ZCC A;  2X7R B;  4DR4 O;  2QWN B;  3E8H A;  1MSD A;  1FS0 G;  2DWD C;  3RBZ A;  2IU0 A;  5AG2 A;  1J95 A;  5F2V O;  1IZ3 A;  2Y69 B;  2Q7G A;  2EIL B;  1WN7 A;  4DUZ O;  4DV4 B;  1VQ8 V;  3Q4H B;  4PA6 A;  1BSM A;  2F4V B;  2LGW A;  5KAI Z;  3SGI A;  5LMU B;  1CP9 A;  4H13 B;  1TVK B;  3AG7 A;  4LH7 A;  1SC5 B;  1PPJ H;  1SZT A;  3DC6 A;  1Q81 W;  4NXM O;  2EZP A;  3STZ C;  3OFN G;  4K0K B;  4YXW G;  4YJ2 B;  3JAW B;  1L8D A;  5B1B B;  5LP6 A;  3CXH F;  3P32 A;  4UXN A;  2A9H A;  1BL8 A;  4CC6 A;  2ZIM A;  3OMI B;  1Y4M A;  3A2F A;  2UXD O;  2OCH A;  4P2Z A;  5LA6 A;  5KLV H;  4LWS B;  4X88 A;  3FAV A;  4PA7 A;  3CCQ V;  1RFY A;  5B3S B;  1SS3 A;  5CBG A;  2YSU B;  1I94 O;  3K59 A;  4I5S A;  4LF5 O;  1Y76 B;  2QM8 A;  4DR2 O;  4F6R A;  3FKS G;  3WG7 C;  1JFF B;  2F23 A;  1SA0 B;  2A06 H;  4PI0 A;  1KKD A;  3HKE B;  3CCS V;  3VOU A;  1XNQ O;  4BW9 A;  3LNN A;  2Q0O C;  5B1A C;  3A0B Z;  4H33 A;  1V55 C;  3B2E E;  4X1Y A;  3RYH B;  4I9W A;  1XOU A;  1MZE A;  5ITZ B;  4JI1 O;  3R66 A;  1F23 A;  4D7S A;  1IXM A;  1D5N A;  2B5U A;  3ZMV A;  4RQE A;  3ICX A;  1P7B A;  4YJ3 B;  3TJT A;  2IH1 C;  4EB6 A;  2PY5 A;  3UT5 B;  1K7D A;  3L70 H;  4HNA A;  2P67 A;  3CJH B;  5C8Y A;  1PL0 A;  1NR7 A;  2HJF C;  1H8E G;  4DV0 O;  1NS1 A;  4WCE V;  1LR1 A;  2D2C B;  2NNU A;  3CME V;  5JVD B;  3CYO A;  1LUV A;  4FFB A;  4FLV A;  4B3M B;  1NKD A;  2W6I G;  5EBM C;  1N32 O;  3B8M A;  3E86 A;  5CB4 B;  2XOK G;  3N2G B;  3T1H O;  4YY3 B;  1RM1 B;  5IYZ A;  4O4L A;  1ZTE A;  3D36 C;  2OIE A;  4JGS A;  3W7T A;  3JAS A;  1IVS A;  3U10 A;  3UO2 A;  5EBL C;  1QVG U;  2GDS A;  5J2U B;  1AJP A;  2JEU A;  2QE7 G;  2R9A A;  3H1I H;  1WNS A;  3L75 H;  4UCV A;  3EXA A;  5IY5 C;  2DMX A;  4X1K A;  1NVP D;  4X64 B;  1NU1 H;  4IYH A;  3K5L A;  3N2K B;  4JI2 O;  1EZJ A;  2YEV A;  2B1G A;  1N33 O;  2BE3 A;  1HW7 A;  1Q7Y W;  2QWO B;  4O4J A;  1MAB G;  4QGP A;  4LH6 A;  5JJE B;  2XAF A;  4BR6 A;  1N36 B;  4KHP O;  1XHX A;  3UCS C;  2IH3 C;  4FLT A;  2FB5 A;  3ZIA G;  4MVQ A;  3E89 A;  2EIL C;  2DN9 A;  4MS2 A;  5IYC O;  2ZXW B;  1VQK V;  1OZ0 A;  1M90 W;  1FAF A;  4P9O A;  1EN5 A;  2BTQ A;  3RYI B;  4LF8 O;  3K0G A;  4IT5 A;  4KXR A;  5KHG A;  4DR7 O;  1VF5 B;  2X0L A;  2EJ7 A;  1VF6 C;  1U96 A;  3DXR A;  5EBW C;  4IIJ A;  1R6N A;  2N74 A;  5BZB A;  5EC2 C;  4B7K A;  2XAS A;  3ETE A;  5B1B C;  4LF7 O;  4X62 O;  1HNZ O;  4PJ0 Z;  5L3F A;  2JRI A;  3SYP A;  3JAT B;  2B1I A;  4LP8 A;  1N0J A;  5HFL A;  3L9D A;  5B3S C;  1OCZ B;  2DW4 A;  1R6T A;  2ZNI A;  1VQO V;  2R9I A;  4JZG A;  3IFX A;  4DR4 B;  1GKF A;  4ZHQ A;  4DK1 A;  4FVM A;  4XDJ A;  5B66 Z;  1VQN V;  2ZNJ A;  2VS0 A;  3QF7 A;  2Y4T A;  4G28 B;  2PTM A;  4LNU B;  1KP3 A;  4Z1V A;  3OTO O;  4HAM A;  1YVW A;  2XT9 A;  1DF5 A;  3AEI A;  4JI0 O;  2EJR A;  4DUZ B;  2VWK A;  4CZZ A;  1D5A A;  1UJW B;  5J2T B;  3J7A U;  3RGB A;  5LMN O;  1KD1 W;  3DSQ A;  1RPO A;  3JSL A;  3RYF A;  1AI4 A;  3S3W A;  1R3J C;  2OCC B;  2D3O W;  3OT7 A;  3K03 A;  3STL C;  4IYI A;  4NXM B;  4N21 A;  5L3E A;  1BHB A;  4TSF G;  3OR6 C;  5DEC A;  3ZMU A;  4DK0 A;  4L87 A;  4WFH A;  2EBO A;  3I5D A;  3LSU A;  4GX2 A;  3RT3 C;  4FLU A;  1F7Y A;  4PHZ A;  2GV9 A;  1ZUQ A;  2LGQ A;  3BA9 A;  2DQ3 A;  1H2S B;  4J42 A;  2UXD B;  3KG2 A;  2QA4 V;  5KX5 B;  1TGO A;  3H01 A;  1MNG A;  1B04 A;  2CUG A;  5LHH A;  1DTO A;  3AK2 A;  2MK3 A;  4HZ3 A;  4NTX A;  1I94 B;  3IC7 A;  4TOI A;  1V54 B;  2ZIN A;  1GH6 A;  4LF5 B;  4JTA B;  4QPK A;  3RVZ A;  4DR2 B;  4PDM A;  4PI2 A;  1RM1 C;  1SQP H;  4UVB A;  5HFM A;  1Q8I A;  2ILM A;  4JI6 O;  1AJQ A;  1GN6 A;  1Q43 A;  5KA6 A;  1G8M A;  2HEP A;  1XNQ B;  3HKC B;  1M56 B;  1YJN V;  2XHB A;  1KMI Z;  4LR3 A;  4DV2 O;  1PM9 A;  2JVD A;  1EN6 A;  3CMA V;  1MSW D;  2N04 A;  3A0R A;  3JD2 A;  1SKV A;  1GRJ A;  4JI1 B;  3C3S A;  2RDC A;  4RQF A;  4TQD A;  5KUM A;  1PNK A;  1BT8 A;  2P7T C;  2H94 A;  2FKX A;  1PL4 A;  1QBZ A;  1WA8 B;  3CRM A;  5CBF A;  3EVK A;  4HBN A;  1F51 A;  1NI8 A;  2W0F C;  5IJ9 B;  2CTR A;  2CH7 A;  4L8J A;  4LF4 O;  4PDR A;  1FXH A;  1RSO B;  3SR2 C;  4WFB V;  4DV0 B;  3HPL C;  2ZXW C;  3UQ8 A;  2WLL A;  2PI4 A;  1IBK O;  3O65 A;  1YHQ V;  2Q8V A;  1I7F A;  4FMT A;  1GMG A;  1KEC A;  1N32 B;  1MA1 A;  1FXK B;  3P3N A;  1AI6 A;  4NVP A;  4PA3 A;  2P4K A;  3T1H B;  4X20 B;  2X6B A;  3ZHV A;  1XMQ O;  1DGS A;  1Q6U A;  2DYS B;  4DV5 O;  3FB5 C;  4QJF B;  2KQX A;  2EIK C;  3E8B A;  3L72 H;  3BAA A;  1YI2 V;  4I0X A;  1K5S A;  1WLE A;  1V9P A;  3MAQ A;  2LFR A;  1FFX A;  4O2A B;  4DR5 O;  3H9V A;  3QNE A;  3LDD A;  4BWA A;  5K1X A;  5GON B;  3JD1 A;  3LDE A;  1PV0 A;  2FTK A;  3OMA B;  5EZY B;  2ITC C;  1MZF A;  4DYL A;  1RPR A;  2IJI A;  3LSQ A;  4JPR A;  1IBL O;  5EC1 C;  4MVZ A;  4JI2 B;  4I7Z B;  2CE4 A;  1OCZ C;  4RUF A;  5B1O A;  5JH7 B;  1N33 B;  2ARH A;  2IJK A;  4AIL C;  3LUT B;  1M4U A;  2BTO A;  4MT8 A;  2RQ6 A;  3FYE B;  4I4T B;  1JPX A;  4C7U A;  4KHP B;  2QKA A;  1XUQ A;  1FPO A;  2K1E A;  1WPX A;  3RYC B;  2BSK B;  4GX5 A;  3ZHQ A;  5LXT A;  4B3S O;  4B7E A;  1VQ9 V;  4LF8 B;  2ZM6 O;  3ZN1 A;  2JS5 A;  3AG2 B;  1N8R W;  4PA4 A;  4DR7 B;  1W59 A;  1SQX H;  4TV9 A;  2PI5 A;  3B77 A;  1VQ7 V;  2GHY A;  4CS2 A;  3VQY A;  1B3Q A;  2ADP A;  2ZDI C;  3OR7 C;  1P84 F;  2QR4 A;  3K04 A;  4UVA A;  2F93 B;  1ZSP A;  2DWE C;  3VQW A;  1E79 G;  4G2K A;  1Y74 B;  4LF7 B;  2QSA A;  3FFQ A;  4X62 B;  1HNZ B;  3AK1 A;  3OD4 A;  2CAZ C;  3MD0 A;  4N23 A;  2UXC O;  4UB6 Z;  4QE7 A;  1NBM G;  2F95 B;  3D3I A;  3BY6 A;  2W6J G;  4JI8 O;  3TGU H;  3E2E A;  4K8X A;  3A0H Z;  2KKW A;  2Q5Z A;  1FD9 A;  1XBL A;  1LNQ A;  5DM6 V;  3OM3 B;  2QM4 A;  3JAK A;  4J10 A;  4J9Y B;  3VQX A;  3ETG A;  4I55 B;  4KUM A;  3TK1 A;  4DXW A;  3T4D A;  1V54 C;  1KQS U;  1NZ6 A;  3CXC U;  3VQV A;  2Y0I A;  3UKM A;  2DE0 X;  4BW5 A;  5LYJ A;  3LSS A;  5GTH Z;  4OX9 O;  5JCO A;  3OTO B;  2K9P A;  2V1D A;  4JYB A;  4H44 B;  1H2L A;  4JI0 B;  4DR1 O;  3OEE G;  1BQ0 A;  4FM2 A;  1M56 C;  3BA8 A;  2IJJ A;  2E74 B;  1YJ9 V;  4ASU G;  3SPH A;  4ZI7 A;  3CCR V;  4JAS A;  3E22 B;  3W7S A;  5LMN B;  3ZMS A;  2AHZ A;  1ZL8 A;  3ZHS A;  1VQM V;  1XL4 A;  2P4V A;  1SET A; 
#chains in the Genus database with same CATH homology
 2WLH A;  1EZJ A;  2YEV A;  3P30 A;  3JD0 A;  2B1G A;  1ENV A;  4Z1M G;  1QLE B;  1Q7Y W;  3SPI A;  1JCH A;  3T1C A;  1MAB G;  2EIN C;  2JJ1 G;  2NLJ C;  5E1A C;  3ZRS A;  5KA5 A;  1K73 W;  2XAF A;  1S72 V;  4R8C A;  1MOF A;  2XAJ A;  1PNM A;  4P9P A;  2IH3 C;  3EFF K;  1W2B U;  1ROP A;  3OEH G;  3ZIA G;  4MVQ A;  3E89 A;  3B8N A;  2EZO A;  2EIL C;  1E1R G;  1QVF U;  3ABM B;  1K4C C;  2Y48 A;  4MS2 A;  1PD3 A;  2HLD G;  5IYC O;  2ZXW B;  4FK5 C;  1VQK V;  1OZ0 A;  3F7Y C;  1BMF G;  4H37 A;  1M90 W;  3LDC A;  1KP2 A;  3CCJ V;  2ZR3 A;  4P9O A;  4RO2 A;  5B1N A;  4JAU A;  2HVJ C;  3W7W A;  3K0G A;  4RAI A;  3E8F A;  3AG1 B;  4MTF A;  3ABK C;  1FXK C;  2X0L A;  1JQ0 A;  2ITD C;  3OUF A;  1GM7 A;  1MG1 A;  5KUK A;  2C2A A;  2OCC C;  3OGC C;  5EBW C;  2Q69 A;  5CBH A;  1R6N A;  1K8A W;  5IDJ A;  5BZB A;  2UXN A;  3UM7 A;  2P90 A;  2WLK A;  2DYS C;  4GX1 A;  5EC2 C;  1PNL A;  2Z3Y A;  2XAS A;  1SES A;  4FJC C;  3PJS K;  3SJQ C;  5CA3 A;  3ETE A;  3CCV V;  5B1B C;  2QTO A;  3ZMZ A;  1HWY A;  4LCU C;  1QLN A;  3ZJZ A;  4WF9 V;  3TET A;  1VQ5 V;  5J9P C;  2F43 G;  3DTU B;  5L3F A;  3SYP A;  5C93 A;  2DYR B;  3ZN0 A;  1K3E A;  4U7O A;  1DF4 A;  2B1I A;  2ZR2 A;  4MTO A;  4XBF A;  4LP8 A;  4QE9 A;  5HFL A;  1I5X A;  5L3B A;  2LFS A;  2WWW A;  2QEX V;  2WLN A;  1THZ A;  5B3S C;  4MVR A;  3AG3 B;  2ZQM A;  1OCZ B;  2DW4 A;  4ZBM A;  2R9I A;  1VQO V;  3ABL C;  3IFX A;  1QR8 A;  3ASO B;  1GKF A;  3DGE A;  2EIN B;  4XDJ A;  4RUE A;  5LGN A;  1VQN V;  1JVM A;  1E1Q G;  3WG7 B;  1XL6 A;  5L3D A;  3QO5 A;  1YTF B;  4G28 B;  4UUJ C;  1SRY A;  4X89 A;  1KP3 A;  3EHB B;  3ML0 A;  3ASN C;  4HAM A;  1F4N A;  4QPJ A;  1VQ6 V;  1DF5 A;  2HVK C;  3AEI A;  3MHH C;  4XDK A;  2EJR A;  1YTF D;  5H6Q A;  5B1A B;  4BIU A;  2JJ2 G;  4CZZ A;  4F4L A;  4WFF A;  1OCC B;  2QM7 A;  2WLM A;  2DQ0 A;  3ZRW B;  3X2Q B;  5EK0 A;  1UJW B;  3JD3 A;  1V55 B;  1AI7 A;  2R9R B;  4CBC A;  3R65 A;  1RPO A;  1ZWI C;  1KD1 W;  5FL7 G;  2JIZ G;  3CCU V;  1AI4 A;  1JX9 A;  1R3J C;  2OCC B;  3K06 A;  4JF3 A;  3OW2 U;  1R73 A;  2X6A A;  2D3O W;  1S0V A;  2OT5 A;  3K03 A;  1AJN A;  4KP4 A;  3STL C;  4GCZ A;  4N21 A;  5L3E A;  5L3G A;  1BHB A;  1GO3 F;  3QO8 A;  4TSF G;  3JD4 A;  3OR6 C;  3ZMU A;  3CC4 V;  2JEX A;  4L87 A;  3CD6 V;  1Q82 W;  2A0L A;  4E2L A;  1OCR B;  2EIJ C;  4WFH A;  2JDI G;  2EBO A;  4PA9 A;  3I55 V;  4GX2 A;  3SYQ A;  3CP1 A;  3JCZ A;  2WPD G;  4BIZ A;  4PDL A;  3IGA C;  2IU3 A;  4LC1 A;  2DQ3 A;  1P4R A;  4TWK A;  3CC2 V;  2H8P C;  1OHH G;  2EIM C;  3KG2 A;  1W0K G;  2QA4 V;  3ABT A;  3H01 A;  1R6K A;  2Y69 C;  5LHH A;  3QO7 A;  1DTO A;  2HKO A;  1CEZ A;  1H38 A;  2MK3 A;  4HZ3 A;  4QNH B;  3K3W A;  3IC7 A;  1V54 B;  3F5W C;  1S5H C;  2OTJ V;  4JTA B;  4QPK A;  3ZRW A;  2KB1 A;  2OTL V;  3MHS C;  2P6J A;  2XND G;  3RVZ A;  2WLI B;  1K33 A;  4OXS A;  4PDM A;  4FIP C;  4MSW C;  3ABU A;  2HFE C;  2CK3 G;  4Q20 A;  1RM1 C;  4UVB A;  4U7N A;  5GW7 A;  2Q6A A;  3K9A A;  5HFM A;  4FPP A;  1OCO C;  2ZDI A;  1AJQ A;  2WLL B;  2Q67 A;  4MVS A;  4QIW F;  5KA6 A;  3CCE V;  4KFM A;  1G8M A;  3OAA G;  1EFR G;  1M57 B;  3OE7 G;  2QKS A;  1M56 B;  3E8G A;  1R3I C;  3BEH A;  1YJN V;  4JTC B;  3G71 V;  1H2G A;  4PDV A;  5CMU A;  1CPY A;  3SYA A;  5IYD O;  2AHY A;  4EKW A;  3ETD A;  5IY5 B;  4PEL A;  3OUS A;  3W7X A;  3AG4 B;  1K9M W;  3CMA V;  1MSW D;  2UXX A;  5CN0 A;  4G27 B;  3JYC A;  3A0R A;  1GM8 A;  2X6C A;  3JD2 A;  4GX0 A;  4P30 A;  1PKX A;  2HR3 A;  3ZCC A;  3SPJ A;  2X7R B;  4DO2 A;  4RQF A;  1FFT B;  3E8H A;  5KUM A;  1PNK A;  1FS0 G;  4ZKI A;  5IYB O;  1QLE C;  3T2M A;  2DWD C;  2P7T C;  3VBB A;  2H94 A;  5LHI A;  1K4D C;  2WLJ A;  3RBZ A;  2IU0 A;  5H6R A;  1QBZ A;  1J95 A;  3T4Z A;  2WLI A;  5CBF A;  1F51 A;  2W0F C;  2Y69 B;  3D36 A;  2EIL B;  1K92 A;  4PDR A;  1FXH A;  4MW8 A;  4WFB V;  3ABM C;  3FB6 C;  1VQ8 V;  3HPL C;  2ZXW C;  3RVY A;  2WLL A;  4PA6 A;  1M9N A;  3FB8 C;  2PI4 A;  3F7V C;  1YHQ V;  2Q68 A;  2IW5 A;  4FMT A;  1COW G;  1GMG A;  1KEC A;  3AG1 C;  3ABK B;  1FXK B;  1AI6 A;  1CP9 A;  3WFV A;  1YJW V;  3AG2 C;  4PA3 A;  3CCL V;  5LHG A;  1SZT A;  2Z5U A;  4JTD B;  1VQ4 V;  1Q81 W;  4UVC A;  2EZP A;  4MVU A;  2X6B A;  1ARO P;  3K08 A;  4HYO A;  3STZ C;  4GT1 A;  1R3K C;  3OFN G;  3GB7 C;  3RW0 A;  4YXW G;  3G4S V;  2DYS B;  4R7C A;  2HG5 C;  3FB5 C;  4QJF B;  4MVM A;  2EIK C;  5B1B B;  3P32 A;  3E8B A;  1AR1 B;  4UXN A;  2A9H A;  1YI2 V;  1BL8 A;  4BAY A;  1K34 A;  1QCE A;  1K5S A;  3OMI B;  1YSC A;  1WLE A;  1ORQ C;  1Y4M A;  2LFR A;  4P2Z A;  5LBQ A;  2ATK C;  3QNE A;  3LDD A;  4TT3 G;  3LNM B;  4X88 A;  3JD1 A;  2WAM A;  4PA7 A;  1TUE B;  4MTG A;  3LDE A;  2FTK A;  3OMA B;  3CCQ V;  4MVO A;  2ITC C;  2IJH A;  5B3S B;  1RPR A;  2IJI A;  3LSQ A;  4JPR A;  4MTX A;  5EC1 C;  5CBG A;  1GTO A;  2YSU B;  3AG3 C;  4MVZ A;  4WFA V;  1OCZ C;  3K0D A;  3ABL B;  4MW3 A;  4I5S A;  4RUF A;  5B1O A;  1Q86 W;  2QM8 A;  3SYO A;  3ZMT A;  2IJK A;  3ASO C;  5H9C A;  3LUT B;  3K79 A;  3FKS G;  4MT8 A;  3WG7 C;  2XAG A;  3FYE B;  1FXK A;  3W7U A;  1S76 D;  1JPX A;  2JK5 C;  3ASN B;  1JJ2 U;  2GSM B;  1M1K W;  1K5Q A;  1KKD A;  3GWO A;  3CCS V;  1YIJ V;  2K1E A;  3VOU A;  1NQT A;  4UV8 A;  1WPX A;  1KC8 W;  3FB7 C;  4GX5 A;  5B1A C;  5LGU A;  1OCC C;  1W0J G;  4H33 A;  3X2Q C;  1VQ9 V;  1V55 C;  2XAH A;  1I5Y A;  3ZN1 A;  3AG2 B;  2BOB C;  4PA4 A;  1N8R W;  2M7W A;  4WFE A;  1NR1 A;  4I9W A;  1EBO A;  1NJI W;  2PI5 A;  3B77 A;  1VQ7 V;  1K97 A;  2GHY A;  1GM9 A;  3G6E V;  3OR7 C;  2ZDI C;  2LP7 A;  3OMN B;  1R3L C;  3K04 A;  1F4M A;  4UVA A;  1F23 A;  3HB3 B;  2EIK B;  1G4Y B;  1IXM A;  2EIJ B;  3NXS A;  2DWE C;  3FYI B;  2B5U A;  1OCR C;  1BHA A;  3TCU A;  4JYC A;  1E79 G;  4G2K A;  3ZMV A;  1VQL V;  4RQE A;  3SYC A;  1DLB A;  1P7B A;  3E83 A;  3MD0 A;  2EIM B;  4XDL A;  1S3J A;  4N23 A;  2IH1 C;  4QE7 A;  1NBM G;  3D3I A;  1QR9 A;  3BY6 A;  1K7D A;  2V7Q G;  4R50 A;  2W6J G;  3E2E A;  1B6Q A;  2P67 A;  1PL0 A;  1NR7 A;  2HJF C;  2YEV B;  1H8E G;  3ZRV A;  5LGT A;  4WCE V;  1LNQ A;  5DM6 V;  3OM3 B;  5L3C A;  1H8H G;  2NNU A;  3CME V;  3CPW U;  3M99 B;  3CYO A;  4J9Y B;  3ETG A;  4KUM A;  3CCM V;  1NKD A;  3TK1 A;  4DXW A;  2W6I G;  3T4D A;  1V54 C;  4J9Z B;  5EBM C;  3ZRX A;  3E35 A;  1AI5 A;  1KQS U;  2BOC C;  3CXC U;  3B8M A;  3E86 A;  2XOK G;  3UKM A;  4BW5 A;  3I56 V;  1RM1 B;  3LSS A;  4JGS A;  3W7T A;  1OCO B;  1NH2 B;  4UV9 A;  1SER A;  1S77 D;  4LBE C;  3SPG A;  2V1D A;  4JYB A;  5EBL C;  4R6Z A;  3OEE G;  1QVG U;  1M57 C;  1Y66 A;  3SPC A;  1AJP A;  1M56 C;  2JEU A;  2QE7 G;  1NVP B;  2IJJ A;  4WFG A;  1YJ9 V;  2XAQ A;  4ASU G;  1NH2 D;  3SPH A;  1JOY A;  3CCR V;  2A79 B;  4JAS A;  4JAV A;  1YIT V;  3W7S A;  1VQP V;  4X8A A;  2ZD9 A;  3ZMS A;  2AHZ A;  5IY5 C;  2DYR C;  3AG4 C;  1VQM V;  3CC7 V;  1XL4 A;  1NVP D;  5DN6 G;  1SET A;  1GK9 A;  2WSS G;  1FXV A;  1L1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...