3UM7A

Crystal structure of the human two pore domain k+ ion channel traak (k2p4.1)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
266
structure length
259
Chain Sequence
RAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human K2P TRAAK, a lipid- and mechano-sensitive K+ ion channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
total genus 82
structure length 259
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3um7A01
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3um7A03
3ASOC 2Q6AA 3JYCA 1LNQA 1ZWIC 4PDRA 3TETA 4XDKA 3SYPA 3KG2A 3OUSA 5EC2C 3F7YC 4PDLA 4PDVA 3RVYA 3E83A 3WG7C 4BW5A 2ATKC 1KKDA 4GX2A 2EIJC 4PA7A 2X6CA 4LCUC 4R8CA 3AG1C 3SYOA 2DWEC 2KB1A 4MVMA 4MW3A 4JTDB 1BL8A 2WLIB 4J9ZB 3ABLC 2DYSC 4WFHA 3UM7A 4P9PA 3ABKC 4QE9A 3R65A 1XL4A 3E86A 5J9PC 4MTOA 4P30A 3SPJA 3SJQC 4MVSA 3FB6C 3K03A 4R6ZA 5IY5C 3RW0A 3K08A 4LP8A 3OGCC 5CBGA 5EBWC 4R7CA 4JTCB 3E89A 3EFFK 4EKWA 3ZJZA 2WLHA 2NLJC 4MW8A 2HVKC 4P9OA 5BZBA 2QKSA 3T4DA 4WFFA 5B1AC 2QTOA 3K06A 3X2QC 1OCCC 1XL6A 4R50A 3ABMC 4ZBMA 2A79B 2R9RB 4HYOA 5EK0A 2JK5C 2H8PC 3BEHA 4GX5A 2HFEC 3SYCA 2Q68A 3T2MA 4PA4A 2K1EA 2EINC 2WLLB 3AG2C 2W0FC 4PA6A 1R3JC 3LDEA 2AHYA 4WFGA 3SPIA 2HG5C 3OR7C 4KFMA 3LDDA 4DXWA 3T1CA 2WLMA 4PA9A 3OUFA 5EBMC 3GB7C 2ITCC 2ZXWC 3K0DA 4X8AA 4PA3A 3F7VC 4MVQA 3SYAA 2Q69A 3ASNC 2AHZA 3F5WC 2WLLA 3K04A 4MVUA 4XDLA 1G4YB 2WLJA 3FB5C 2WLKA 3PJSK 3RVZA 5B3SC 3AG4C 3LNMB 4GX0A 3LDCA 4X88A 2WLNA 2X6AA 4MTGA 4UUJC 1OCRC 5KUKA 4J9YB 2DYRC 5EBLC 3FB8C 2OCCC 1P7BA 3K0GA 4RUEA 4RAIA 3SPCA 5CBFA 2ITDC 2EIMC 2EIKC 4GX1A 4OXSA 3STLC 1R3KC 3E8GA 4MTFA 3T4ZA 1JVMA 3FB7C 1M56C 4CBCA 2WLIA 4QNHB 1R3IC 2EILC 4WFEA 2A0LA 3ZRSA 4F4LA 4H37A 4H33A 3E8BA 4X89A 1OCOC 2DWDC 2HVJC 3E8FA 2Q67A 1ORQC 2A9HA 3OR6C 3IFXA 4MVZA 4XDJA 3UKMA 4LBEC 1V54C 3E8HA 1K4CC 4MS2A 3IGAC 4RO2A 4PDMA 5CBHA 4G28B 1S5HC 2X6BA 2IH1C 4MVRA 3SPHA 3AG3C 1J95A 4QE7A 5KUMA 2P7TC 3SPGA 4P2ZA 2BOCC 2Y69C 1V55C 1K4DC 1R3LC 5E1AC 2BOBC 3LUTB 4MVOA 1OCZC 3STZC 4G27B 2ZD9A 4TWKA 4I9WA 3RBZA 4MSWC 3TCUA 3VOUA 5EC1C 1QLEC 4HZ3A 5B1BC 3SYQA 1M57C 2YEVA 2IH3C 3HPLC 4RUFA 4JTAB 2HJFC
chains in the Genus database with same CATH superfamily
1WB7A 3TETA 3T1HO 3ZHSA 1HW7A 1NVPB 2QWNB 5LA6A 4BIUA 1RPRA 4LCUC 3AG1C 4LF7B 1HNXO 1JR9A 4I4TB 2QE7G 2WLIB 1H8EG 1XI1A 4ZHQA 4X66B 1D2DA 4DV5B 2GBOA 2YXLA 4MVSA 1R73A 3FB6C 4R6ZA 1FAFA 1MSDA 4FLXA 4X1IB 1WPBA 3VQVA 4AI8A 3ABKB 3ZJZA 2RJZA 2QTOA 1Y76B 3ZRVA 1MSWD 4HYOA 1NR1A 1KECA 3BEHA 3ZX6A 1RM1B 4O2AB 3G6BA 5KX5B 2HG5C 1SERA 3JD3A 4Z1MG 2WLMA 1CEZA 2ZCEA 4JASA 3TJTA 3AG2B 4JI0B 3QVNA 1VMGA 5KHHA 4J9YB 4TOIA 1EN5A 1LUWA 2EIKB 2UXDB 2DWDC 4BIOA 4DR2B 1GTOA 1WPXA 1JOYA 4MS2A 4G28B 1W0JG 1L0LH 2JVDA 4TUYA 3SJCC 1J5EB 3CD6V 1SQFA 1OCZC 1FYJA 2ZD9A 5CA0B 5EC1C 3VBBA 1M57C 2IH3C 3NR7A 5LMUO 1B06A 3ZN0A 3JYCA 3T1HB 2QGNA 1XNRB 2CAZC 5D5PA 2VQFO 2ZKOA 1F4MA 3BA9A 2DWEC 4JPRA 5GONB 1RFYA 4B3SB 2YXHA 1GN4A 2Y69B 3K5OA 2EBOA 1GN3A 3APQA 3TK1A 1RP3B 4OPHA 3ZHVA 1NR7A 2QKSA 2JIZG 4ZKIA 1KC8W 2ZXWB 4B3TB 3ABMC 2JJ1G 4OPAA 2GHYA 3HKDA 2AHYA 3FKSG 1HDJA 1BCCH 1X59A 4TQFA 5H9CA 4TV8B 2QWOB 5LXTA 2CE4A 2R9AA 1L1FA 4JZ2A 3E22A 4PA3A 3F7VC 3ASNC 4XDLA 1G4YB 3H1HH 2ETNA 2BTOA 2JGDB 3LNMB 2YIBA 4TUYB 4WFBV 2LFSA 1VQMV 3K0GA 1PKXA 3L71H 4LF4B 1XNRO 1URFA 2QWRB 3A8TA 3T1YO 4CBCA 5FLXN 2Q8VA 3RYHB 1VQ4V 3WFVA 2QKAA 2A0LA 1NH2D 4NTYA 3E8BA 2XT9A 1FXKB 4CS4A 3ABLB 3OR6C 3UKMA 2B1IA 5IJ9A 3VQXA 1QQCA 2B9ZA 3MAQA 3J80N 3R66A 1N33B 4WBNA 3SPGA 1AB3A 1I0HA 1IZ3A 4DV0O 1NU1H 4LF5B 3TCUA 4PI2A 1GH6A 4LH7A 2ZIOA 3EXAA 1PL0A 4DRXA 5CA1A 3ETGA 3M99B 4PDVA 1V55B 4D7TA 2LO1A 1ZSPA 5JJEB 2EJ7A 4UCTA 1LR1A 2RN9A 4PV1B 2GUZA 4EFBA 4JI6O 1GK9A 4BAYA 3RWRD 5J9PC 4P30A 1GRJA 1UPGA 2GTAA 1SETA 5LGNA 4JTCB 4FM2A 2F4VO 3CRCA 3CCUV 4LF9B 3CMEV 4O4JB 1KB9F 4KUMA 2PTMA 1Z5WA 4CH5A 2WLLB 3AG2C 4NR1A 4JAUA 3CCSV 4A5UB 1GO3F 2IJKA 3LDDA 5KX5A 4NB5A 3CP1A 4Z1VA 4O2AA 1VF5B 2HKOA 1NT2B 3GVMA 2YS8A 2CH7B 3CJHA 3MHSC 5FL7G 1TGOA 2WLLA 3KCXA 3WB1A 5KHJA 2UUCO 3OD4A 1OCRC 1N32B 5H6QA 1H2KA 2ZE5A 1E1RG 5CN0A 1VIBA 2ITDC 2V7QG 2WLIA 4QNHB 3WB2A 4DR2O 1YITV 1ZAUA 1WN7A 4F4LA 5KAIZ 1FXVA 4H37A 4JYBA 1PP9H 2NR5A 1R6KA 2F4VB 1M56B 4UFZA 2L35A 4OX9O 2F43G 1PM9A 2GUZB 4EEQA 4J7ZA 1JFFB 1WJZA 3D36C 3E22B 2JEUA 4O4LB 2FTKA 4CH4A 3LUTB 5L3BA 3STZC 1MZEA 4G27B 2OCHA 3AG4B 3SGIA 3AK2A 1QVGU 2AW9A 4JI0O 4LFAB 3A0HZ 2Z5UA 2BSKB 3FYEB 4CS2A 4JI7O 3SJBC 3SYPA 4JI5B 4DR1B 5EC2C 3CC2V 4BIZA 4WBNB 1FXHA 2X6CA 1TA8A 4I50A 1V54B 1SZXA 1XREA 3X2QB 3SJAC 1RSOB 4AQYB 3SJQC 2GV9A 1WB8A 4HBNA 1OCCB 1WA8B 3RYHA 1YEWA 1K34A 4LP8A 2ZE6A 4R7CA 1TUEB 5CA3A 3Q4HA 5DEDA 1T5EA 1VEWA 4GKJB 3P30A 1G6UA 5B1AC 2W6JG 2JDIG 1IBKO 5EIBC 2DOSA 4DV1B 1PV0A 1VQKV 4U3FH 1W0KG 2W0FC 1KD1W 1U97A 3N2KB 1K73W 4GLXA 2ZXWC 3N27A 1XMQO 4I7ZB 3SYAA 2L6LA 4YJ2A 2DQ3A 1P84F 3PJSK 2ADPA 3IJ4A 1JJOA 2UXNA 4DV6O 5CB4A 4ICGA 2UXXA 2XUMA 3W7TA 1WLEA 4WFEA 1YJNV 1NTKH 4YHHB 1FFXA 2DYRB 1OZ0A 1PNKA 2LGWA 3GWKC 2VS0A 2X6BA 3CYOA 1IX9A 2OTLV 2F1MA 2Y69C 2UXCB 4Q20A 4JI8B 1NKDA 4CH3A 4DV2B 4HZ3A 1YDXA 1H8HG 3PN1A 5DN6G 2HJFC 3ZHUA 4LH6A 2FB5A 4DUZO 1VQLV 1O9GA 1YJWV 1K5SA 5FNVB 2ZIMA 4FZ0A 1KU9A 3JATA 4MVMA 3Q4HB 3U11A 2VQEB 2JS5A 3M7MX 4GUNA 2ZT9B 4NKGB 2FL4A 3JAWB 2Q7GA 4IYIA 1BHAA 3UT5A 3OMAB 3OTOO 4CC6A 2P67A 3P3NA 1IBLB 3DSQA 3FX7A 3DTUB 1VF7A 5BZBA 1OCCC 1H38A 2RQ6A 4UB6Z 5KHGA 4WFGA 4JV5O 1BQZA 3K3WA 2QM7A 4B3MO 2QR4A 3CPWU 3CEIA 2M6YA 3QO8A 3AG7A 4U3JA 2P4VA 4B3RB 1QLEB 2G38A 1JFFA 4J11A 1IDSA 2DYSB 3ZHTA 1WNSA 4RUEA 1MG1A 3CCVV 1AJNA 3E8GA 5DECA 3DXRA 1VQ6V 3CS5A 1AI5A 1ZL8B 2JJ2G 4TV9B 4I55A 3B77A 4I4TA 2QA4V 3ML0A 5JH7A 3W7SA 1I5YA 4ZOLA 1QBZA 2IH1C 2QWQB 4QE7A 3D36A 3ZMZA 4P2ZA 5LA6B 1MMMA 2HP8A 1BZKA 3K9SA 2UU9O 2QEXV 1Y74B 1XDCA 4Q6GA 2YIDA 1NS1A 4FIPC 5GTHZ 3ZRXA 1FJGO 4GKJO 4PDRA 1P7GA 2VRZA 3KG2A 1RM1C 2Y48A 2H94A 3RYCB 2BTQA 4BW5A 1ZL8A 4NYKA 2E5LB 3CHXA 3ZEDA 3SDLA 3ZMTA 2GTSA 4MW3A 4JTDB 4J9ZB 2Q0AA 3OEHG 3R65A 4CZZA 3LSUA 2CDYA 1OCRB 4LC1A 4JI1O 4NVPA 3E89A 4JI7B 3H1IH 2LGQA 1KP3A 1HNWB 4R50A 4QGPA 3RN4A 2JK5C 1E1QG 5FPOA 2Q68A 4KP4A 1JMKC 5LGTA 1IBMB 4E2LA 1NJIW 4JV5B 1K97A 1OCZB 5EBMC 4IHJA 2AHZA 3F5WC 3WU2Z 3A0RA 3RYIB 2N74A 2WLJA 4QPJA 5JCOA 1KQSU 1Q86W 3AK3A 1UFIA 5IY5B 2EIKC 4DV1O 3FB7C 3JAWA 1K5QA 1CP9A 2HLDG 2OIGA 5LGUA 3ZMVA 4IGGA 4JI4O 1YI2V 5LP6C 4NXNB 3IFXA 2VQFB 4JI3B 5B5EZ 4EB6A 1EN4A 1J95A 2CTRA 3WG7B 4TWKA 4B08A 3BY6A 1AP6A 3HKCB 1P4RA 5IYZB 4JI4B 1HNZO 2CTWA 1VQ9V 4GCZA 3AG3B 1Z2GA 3U0ZA 4PDLA 2LFRA 1NH2B 2A06H 2YIAA 1VQ8V 3JD2A 5TISZ 3E35A 4GX2A 4DR3O 5IJ0B 4N21A 1F4NA 1XMQB 2YI9A 4WFHA 1Q43A 4QPKA 3W7XA 1NBMG 1ZTEA 1NTMH 1GM9A 2O57A 3DC5A 4MTXA 5IWAO 2WLHA 1JPXA 1TUBA 4RQEA 1IBKB 1GN6A 1HNZB 1I7FA 1HNXB 2WWWA 4KHPB 1MABG 2XOKG 2HFEC 4B7KA 3JASB 1Q6IA 4XBFA 2LQTA 4LF8O 3OR7C 4DXWA 3CWBH 5L3GA 3ETEA 4YXWG 3RGBA 1G8MA 4YIPA 3CMAV 2QWPB 5B1BB 4NXNO 3FB5C 3C3TA 1SRYA 4JI2B 3O9OA 4ABMA 5LBQA 1O9HA 4FLWA 2KG7A 4RAIA 3JSLA 5CBFA 4DV4B 3DC6A 1W59A 5L3EA 2UUBO 1CXZB 3C3SA 4FPPA 2IBZH 4I50B 4W4KA 1JX9A 4U7NA 1GAXA 4JYAB 1YF2A 4H33A 5LP6A 2RMKB 5K1PA 3UQ8A 4UCVA 2BCCH 4O2BB 2MW2B 1A32A 4LR3A 3UCSC 3AG3C 2EZOA 4FM0A 3KZIZ 1GMGA 1Q7YW 1M93A 5H2FZ 2YSUB 3QO5A 3ABUA 1S5JA 2KKWA 4DR5O 2XAHA 1LNQA 3CCJV 3MDSA 4NTWA 4QIWF 2ADQB 3AK1A 2YC0A 2UXBO 2ZE7A 3JALA 3SYOA 4DV3O 5ITZA 4X1IA 2Q7HA 3HKEB 4K8ZA 3B8MA 3JARB 5H6RA 4NTXA 2NNUA 3H9VA 4I0XA 4MTOA 2FKXA 5IY5C 5K1XA 1H2LA 1KP2A 3OGCC 5B1OA 1N0JA 3EFFK 3I56V 2FYUH 3UT5B 2UUCB 1BMFG 5FPRA 3K9AA 1VQOV 4LF6B 1YCIA 3MHHC 2N04A 2VQEO 3K5LA 2H8PC 1IURA 4JF3A 2EINC 3OGIB 3CCEV 1KYOF 1Z5VA 1R3JC 5LMNO 2QSAA 5LHHA 2AZ0A 1VQ7V 4K3AA 2Y0PA 3WB0A 2E76B 4UB8Z 4LFCO 2DE0X 2JEXA 1AI6A 1KBHA 4KL1A 4C7UA 2HEPA 3RT3C 4LNUB 3U10A 3HR0A 3HKBB 1COWG 1I5XA 5DM6V 4GKKB 2C2AA 1VQ5V 3B8NA 4GX1A 4GYCB 5L3DA 2WA3A 4O4HB 2ZM6O 3N2GB 4LF8B 3L74H 1MZFA 4OGQB 1NQTA 1YIJV 1EN6A 1SA0B 1KUQA 4UCRA 4J10A 5HFMA 4NXMO 4XDJA 2EX3A 2P5OA 5LMNB 3IGAC 5CBHA 4B3MB 2F66C 1S5LZ 4GZRB 5KLVH 3OMNB 4B3RO 1OHHG 1CPYA 2YUAA 1SESA 1B3QA 4J42A 4DW0A 1AR4A 3W7UA 3F7YC 1KKCA 1H2GA 4DUYB 5KAFZ 4PA7A 2JRIA 4DV7B 1BL8A 2UXBB 5F2VO 1N4CA 1S76D 2IU3A 2UUBB 4P9PA 5JCOC 3VQYA 3RW0A 3K08A 1ZUQA 4UXNA 3IAYA 1XNQB 2Q0OC 4JI2O 4LF9O 3T4DA 4CC5A 1MA1A 4B3TO 1YTFB 1Y66A 5EK0A 3TXQA 5KHKA 2PZSA 3SYCA 3JALB 2ODMA 3ASOB 2UXCO 2HR3A 4HNAB 4KFMA 5EZYA 5BR8B 3HKDB 1V9PA 3OMIB 5D5QA 2QM8A 3SR2C 2AZ2A 1U96A 2ITCC 1SQGA 2JS3A 3OTFA 2Q73A 3K04A 4LFAO 5IYZA 3FAVA 1P49A 1PNMA 3LDCA 1PNLA 2X6AA 4IYHA 1AROP 5EBLC 4X62B 4I9QA 1G1XB 1L8DA 2RCVA 4DR1O 5LYJA 4OXSA 2PGGA 4O2BA 4MTFA 4F6RA 1L0NH 3CX5F 4DV0B 5LMUB 2PYJA 1IXMA 4FFBA 1S3JA 2GDSA 3ZS8C 2ZE8A 4X20A 3AG1B 4DV7O 2MK3A 5E79Z 3ICXA 4K35A 3F5TA 1K8AW 2P90A 2ZINA 1GKFA 2PY5A 3ZMSA 1AVMA 1EFRG 3BPZA 3SPHA 4MVRA 3ZHQA 1N33O 3H1KH 3RYCA 2BOBC 3RBZA 4AHCA 2ZDIA 1FKAO 2QKCA 1QLEC 2YEVA 1VF6C 4RUFA 5LHIA 1ZWIC 1QU7A 4UVCA 1SQQH 2ZNJA 3THOA 3CRRA 1QVFU 3K5NA 3JCZA 4X65B 4DR7B 2Y0IA 5J2UB 2CUGA 5J2TA 2LW7A 1JCHA 1OCOB 2DYSC 3BVOA 3UM7A 4DR6O 3FYIB 1ROPA 2UU9B 4FZ1A 1XL4A 3B09A 3JARA 1QR9A 2E3CA 3K03A 1B04A 2M7WA 5CBGA 4JYCA 4DK1A 4H0LB 2XHBA 4ZI7A 5LHGA 3P32A 4X1KB 4O4IB 3OT7A 4LNUA 2HHHO 4LFCB 4J80A 1YZBA 4UV8A 4PA9A 4DRXB 4TQDA 3K0DA 1ZX3A 4MVUA 1M9NA 3QO7A 1XNQO 2VWKA 4OX9B 3D8CA 2OCCC 3L9DA 2YI8A 4FK5C 2F23A 2EIMC 4UCOA 3STLC 2A7WA 3B2EE 5JJNB 4FLZA 3K79A 3HB3B 5A9GA 3ZRSA 2EIJB 3P3PA 3HKEA 4FFBB 3A2FA 4G2KA 4LF4O 4E4EA 3E8HA 1IBMO 1X4TA 4D6TH 4PDMA 2IM9A 1FJGB 5KUMA 2Q5ZA 2K9PA 2XAJA 3L70H 2R72A 4LFBB 3ZMUA 3UO3A 5KMGB 1MNGA 3EHBB 4DR4B 4X1YA 3M8AA 3ASOC 3JASA 4K0KO 1D5AA 2OWOA 4J7KA 2JGUA 5BMVA 1XEQA 5KA5A 3GWOA 1F23A 2D2CB 2DW4A 4X62O 3ETQA 1ZLZA 5CMUA 5LP6B 1JQ0A 2YIBD 3CXCU 4DR3B 3RYFB 5LYJB 4BW9A 1IBLO 5GW7A 1SC5B 4JAAA 4DV4O 4O4HA 1TVKB 2NLJC 5BR8O 2KG7B 2DN9A 2QDOA 4UVBA 5BMVB 3IC7A 3BRCA 3CC7V 3CRQA 4PA4A 4UCUA 3T1CA 1Q6HA 1SQVH 1PD3A 3L75H 1DTOA 1SQBH 1VP7A 4B3SO 2IJHA 1OV9A 4DV3B 3BHPA 4X66O 1H2MA 1NZ6A 4MTGA 2A3QA 4LF7O 4X20B 4ZIBA 1JA8A 3SPCA 4D7SA 1XUQA 3JAKA 4I55B 3ABTA 5IT9N 4I0XB 3S3WA 4CH6A 1OCOC 3K5MA 3DXRB 1SQXH 3E8FA 5JVDA 4PELA 2AGAA 4JYYA 2R70A 1M1KW 1R3LC 4MVOA 2HJDA 4YJ3A 3VQWA 3HKBA 5L3CA 2UUAO 5B1NA 4DYLA 3CE2A 2Q7EA 4YJ3B 5B1BC 2PYLA 2DMXA 3CRMA 2XAGA 4X1YB 3ZIAG 4U3JB 4GKKO 3OTOB 3OUSA 1BE3H 4X1KA 2D3OW 3H1JH 2Z3YA 2BE3A 5LOVB 2IJIA 4WFAV 1SA0A 4LF5O 2ARHA 1Y76A 1VARA 4X64O 4RWUA 2ZQMA 2OCCB 4W4LA 4DO2A 2XAQA 5EBWC 1WA8A 3H1LH 1F51A 1GM8A 5LL6Y 4UCSA 3K06A 2BTQB 1DF5A 4X65O 4Z2WA 5B66Z 1XMOB 1BS3A 1N34O 4GX5A 1NVPD 3K59A 5C93A 3LDEA 2P6JA 2W6IG 3OM3B 4FM1A 1R6NA 3L73H 4X8AA 2BSKA 1EBOA 3H01A 1N32O 1AJPA 2UUAB 2XAFA 2ZDIC 2IJJA 5IWAB 2OT5A 2CGNA 4TV9A 1N0NA 1K9MW 4ZI7B 1P7BA 3CCLV 2ZR2A 2QM4A 1FD9A 1VQPV 2DQ0A 4L87A 4WCEV 2PF4E 1WP8A 1GN2A 1K33A 2HVJC 1HR0O 5EIBD 4IIJB 2ZM6B 2IU0A 1R1BA 1V54C 1US6A 4PD4F 4RO2A 1EM1A 1XMOO 3QG5A 2E75B 3C90A 1NI8A 1JJ2U 4CS3A 2WA4A 4FVMA 3VOUA 5IE9A 1BQ0A 2LP7A 2WSSG 4HNAA 4YY3B 2QJ1A 3RVYA 4PI0A 1RPOA 3E83A 2IW5A 3B40A 3J81N 4LWSB 1KKDA 1XHZA 5IDJA 3CCRV 1N8RW 2YXYA 3LSSA 4B7EA 1DF4A 1FXKA 2VWJA 2V1DA 5BY1A 1AI7A 3IC9A 3K58A 3CSXA 2E74B 4P9OA 1SS3A 2X7RB 1YVWA 5L3FA 4DW1A 3ZCCA 2CTPA 3T2MA 4TT3G 2PI4A 2YICA 4IHJB 2EULA 3J7AU 5CA1B 1SKVA 1BT8A 4JAVA 4O4IA 1HWYA 3OUFA 4DR5B 3MD0A 2P06A 4MVQA 2Q69A 1Q5OA 1PPJH 5AG2A 1S72V 5JVDB 5KUKA 2WPDG 1N36B 1WAZA 4UVAA 1BHBA 1WP7A 1K92A 2EILC 2EIMB 4JYAO 1ORQC 2OTJV 2PI5A 5GONA 3OFNG 2LW1A 3JATB 3G4SV 1V55C 1K4DC 5JJJB 4YY3O 3NXSA 4HAMA 5B1AB 4I9WA 3ZN1A 5KMGA 2RDCA 2Z0AA 3D3IA 3HPLC 4DK0A 2Q6AA 1YXBA 5CA0A 1OJHA 1N36O 4TV8A 5LXTB 3WG7C 2N05A 1TUBB 4N23A 4LF6O 4ZOLB 1TVKA 2XNDG 5JH7B 3BABA 1Q8IA 4KHPO 3BCCH 4YHHO 2EZPA 2Q4PA 3DGEA 3ABLC 3T1YB 3ABKC 5IYDO 3QF7A 2LJ2A 4K0KB 4JI5O 2W0XA 1S0VA 1FPOA 1H2NA 4J7JA 2Y4TA 1HR0B 4EKWA 4NXMB 1QNMA 3OW2U 3RYIA 1EZJA 4MW8A 5IJ0A 2CK3G 2YDEA 4MT8A 4WFFA 3X2QC 3AEIA 3TGUH 5JQGB 4ZBMA 2R9RB 4JI1B 1UJWB 1LUVA 1AILA 3G6EV 4YJ2B 4PA6A 1TAEA 2KQXA 5EZYB 1ENVA 2OYQA 4PHZA 4FLYA 5GTIZ 3ZHRA 3N2KA 5BXZA 3BAAA 4O4LA 4GT1A 3ETDA 4EB6B 1YTFD 3W7WA 3LNNA 5B3SC 3RVZA 3AG4C 4PJ0Z 4X88A 1M4UA 2P4KA 4FMTA 4UUJC 3I5DA 3JD1A 1XQ8A 4DUZB 1AR1B 4EFEA 4FLVA 1JVMA 1XILA 4DR6B 3KCYA 5HFLA 4QJFB 4AQYO 5J2TB 4X89A 4X64B 3CB2A 1HP8A 2A9HA 3APOA 5ITZB 4DR7O 1AR5A 2HHHB 1FFTB 1Q81W 3JCUZ 5KHIA 3JD4A 2XTAA 2BOCC 1QCEA 1NTZH 2CTQA 2DJVA 2JGDA 1YHQV 1FS0G 2KSDA 3SYQA 3E2EA 4JTAB 4XDKA 3FFQA 1Q82W 4BWAA 3BFRA 1MOFA 2Y4UA 4DUYO 4K8XA 2ATKC 4O4JA 1XHXA 4R8CA 2CGOA 3A0BZ 1YSCA 5JQGA 2FMLA 3N2GA 1H2SB 4UV9A 1FXKC 2B1GA 3SPJA 4JGSA 1BGYH 2AXTZ 4FFKA 1SZTA 2OIEA 5CB4B 3UO2A 4DV5O 2HVKC 2V4DA 1GM7A 5J2UA 3L72H 4ZHQB 1I94B 1XL6A 1IXBA 1HNWO 4DR4O 1M57B 4FLUA 2K1EA 4LFBO 5JWPA 2YEVB 1R6TA 1DK1A 5C8YA 2UXDO 1Q90D 2ILMA 3GB7C 4H13B 1QR8A 3BA8A 4X9QA 3G80A 2F93B 4GX0A 1VF6A 1DGSA 5EYPA 2DYRC 3FB8C 4FJCC 4IL6Z 3JAMN 1M90W 1THZA 1QLNA 1I08A 2F95B 1M56C 4AILC 5IYBO 1SF9A 1XBLA 3B4SA 4F6RB 1I94O 3ZRWB 5LOVA 5FNVA 4IT5A 4FLTA 2ZR3A 4U7OA 4JI6B 3JD0A 3QNEA 4DV2O 2NN4A 3RFRA 1K4CC 4JI8O 1Y67A 3FAVB 4KXRA 2Q9LA 1K7DA 2P7TC 3G71V 4F6EA 5E1AC 4JZGA 4MSWC 5IYCO 1EZVH 2EINB 2X0LA 3HKCA 1SQPH 3TXSA 1XOUA 1Q3EA 1DLBA 3CCMV 3CRAA 2EIJC 2EJRA 4J41A 2GSMB 2KB1A 5IJ9B 1KMIZ 3OAAG 3QTCA 3CC4V 3JAKB 3OEEG 4WF9V 2R9IA 4QE9A 3ZRWA 3E86A 3OE7G 4JI3O 5H5NA 5KA6A 1Q6UA 1F7YA 1B6QA 2RNBA 4H44B 3CXHF 1M5IA 2A79B 4RQFA 1N34B 2PUSA 1AI4A 1J5EO 4TSFG 4LWSA 3SPIA 3CCQV 4ASUG 3CJHB 1Y74A 5C8YB 1S77D 4I5SA 1VQNV 1K3EA 1PL4A 4BR6A 3K57A 2QTSA 2WLKA 3D3QA 2WLNA 1FFXB 1W2BU 3JSNA 3G67A 3RYFA 1RSOA 1R3KC 4L8JA 3T4ZA 1BSMA 1AJQA 2XASA 5A2QN 1R3IC 4IIJA 1QHTA 4YIOA 3ZBHA 1IVSA 1Y6XA 3ABMB 4MVZA 2Q67A 2EILB 1AP5A 1E79G 2B5UA 4LBEC 3O65A 1YJ9V 3LSQA 1S5HC 4DV6B 3KKYA 5EYPB 3I55V 1Y4MA 5B3SB 2WAMA 2P22C 2H3OA 1D5NA 3ASNB 2ZNIA 3FD9A 3EVKA 2CH7A 3S3XA 2E5LO
chains in the Genus database with same CATH topology
3TETA 3W7UA 1VQLV 1NVPB 3RVYA 3F7YC 1RPOA 3E83A 1YJWV 1H2GA 2IW5A 4BIUA 1K5SA 1KKDA 1RPRA 4LCUC 4PA7A 5IDJA 3AG1C 3CCRV 4MVMA 1N8RW 2QE7G 1BL8A 2WLIB 1H8EG 3LSSA 1S76D 1BHAA 2IU3A 1DF4A 1FXKA 4P9PA 2V1DA 1AI7A 3OMAB 1R73A 3FB6C 4MVSA 4R6ZA 3RW0A 2P67A 3K08A 4UXNA 3DTUB 3ABKB 3ZJZA 5BZBA 4P9OA 3T4DA 2QTOA 1OCCC 2X7RB 1YTFB 1Y66A 3ZRVA 1MSWD 5EK0A 4HYOA 1NR1A 1KECA 5L3FA 1H38A 3SYCA 3BEHA 3ZCCA 1RM1B 3T2MA 4TT3G 2PI4A 3ASOB 2HR3A 4WFGA 2HG5C 4KFMA 3K3WA 1SERA 2QM7A 3OMIB 3CPWU 3JD3A 4Z1MG 2WLMA 4JAVA 1CEZA 1HWYA 3OUFA 2QM8A 3MD0A 3QO8A 2ITCC 4JASA 4MVQA 1QLEB 2Q69A 3K04A 3AG2B 1PNMA 1S72V 3LDCA 1PNLA 2DYSB 2X6AA 5KUKA 4J9YB 1AROP 5EBLC 2WPDG 4RUEA 1MG1A 3CCVV 1AJNA 4OXSA 3E8GA 4UVAA 1BHBA 4MTFA 1IXMA 1K92A 2EILC 1VQ6V 2EIMB 2EIKB 1S3JA 1AI5A 2DWDC 3AG1B 1ORQC 2JJ2G 2MK3A 2OTJV 2PI5A 3B77A 2QA4V 1GTOA 3OFNG 3ML0A 3W7SA 1K8AW 1WPXA 1I5YA 1GKFA 2P90A 4MS2A 3ZMSA 1JOYA 1EFRG 4G28B 1QBZA 3G4SV 3SPHA 2IH1C 1W0JG 4MVRA 4QE7A 3D36A 3ZMZA 4P2ZA 1V55C 1K4DC 3CD6V 2BOBC 1OCZC 3NXSA 4HAMA 5B1AB 2ZD9A 4I9WA 2QEXV 3RBZA 3ZN1A 2ZDIA 5EC1C 1QLEC 3VBBA 3D3IA 1M57C 2YEVA 2IH3C 3HPLC 4RUFA 4FIPC 5LHIA 3ZRXA 3ZN0A 2Q6AA 3JYCA 4PDRA 1ZWIC 3KG2A 4UVCA 1RM1C 2Y48A 2H94A 1QVFU 3WG7C 4BW5A 3JCZA 4N23A 1F4MA 2DWEC 2XNDG 4JPRA 3ZMTA 4MW3A 4JTDB 1JCHA 2EZPA 3DGEA 4J9ZB 3ABLC 1OCOB 2DYSC 3UM7A 3ABKC 5IYDO 3FYIB 1ROPA 3OEHG 3R65A 1XL4A 1QR9A 4CZZA 2Y69B 3K03A 2EBOA 2M7WA 5CBGA 3TK1A 1OCRB 4JYCA 4LC1A 1S0VA 3E89A 4EKWA 1NR7A 3OW2U 1EZJA 4MW8A 2CK3G 1KP3A 2QKSA 2JIZG 4MT8A 4WFFA 3X2QC 4ZKIA 3AEIA 2ZXWB 4R50A 1KC8W 3ABMC 4ZBMA 2R9RB 3P32A 5LHGA 1UJWB 2JJ1G 2JK5C 1E1QG 2Q68A 3G6EV 4KP4A 2GHYA 5LGTA 4PA6A 4E2LA 1NJIW 2AHYA 3FKSG 1ENVA 5H9CA 4UV8A 1K97A 4PA9A 1L1FA 1OCZB 5EBMC 3K0DA 4PA3A 3F7VC 3ASNC 4MVUA 2AHZA 3F5WC 1M9NA 3ETDA 3QO7A 4GT1A 4XDLA 3A0RA 1YTFD 1G4YB 2WLJA 4QPJA 3W7WA 5B3SC 3RVZA 3AG4C 3LNMB 1KQSU 4X88A 4UUJC 4FMTA 1Q86W 4WFBV 2LFSA 2OCCC 3JD1A 1VQMV 4FK5C 3K0GA 5IY5B 1PKXA 2EIMC 2EIKC 1AR1B 3STLC 1JVMA 3FB7C 1K5QA 4CBCA 1CP9A 2HLDG 3K79A 3HB3B 5HFLA 4QJFB 3ZMVA 5LGUA 1VQ4V 3WFVA 2A0LA 3ZRSA 1NH2D 1YI2V 2EIJB 3E8BA 1FXKB 4X89A 3ABLB 3OR6C 2A9HA 3UKMA 3IFXA 2B1IA 4G2KA 3E8HA 1FFTB 4PDMA 1Q81W 1J95A 3JD4A 5KUMA 3SPGA 2BOCC 2XAJA 1QCEA 3WG7B 3ZMUA 1YHQV 1FS0G 4TWKA 3BY6A 3EHBB 3TCUA 1P4RA 3SYQA 1PL0A 3E2EA 4JTAB 3ASOC 1VQ9V 4GCZA 3AG3B 4XDKA 3ETGA 3M99B 1Q82W 4PDLA 4PDVA 1MOFA 1V55B 2LFRA 1NH2B 1VQ8V 3JD2A 2ATKC 3E35A 4GX2A 5KA5A 3GWOA 4R8CA 1F23A 4N21A 2DW4A 1YSCA 1F4NA 1GK9A 4UV9A 5CMUA 4BAYA 1FXKC 1JQ0A 4WFHA 3CXCU 2B1GA 5J9PC 4P30A 3SPJA 4JGSA 4QPKA 5GW7A 3W7XA 1SETA 5LGNA 1NBMG 1SZTA 4JTCB 1GM9A 4MTXA 2WLHA 1JPXA 2NLJC 2HVKC 3CMEV 3CCUV 1GM7A 4UVBA 4RQEA 4KUMA 1XL6A 3IC7A 2WWWA 1M57B 1MABG 2XOKG 2HFEC 3CC7V 4PA4A 2K1EA 2WLLB 3AG2C 4XBFA 4JAUA 3CCSV 2YEVB 3OR7C 1GO3F 2IJKA 3LDDA 4DXWA 5L3GA 3ETEA 3CP1A 4YXWG 3T1CA 1PD3A 1G8MA 2HKOA 3GB7C 1DTOA 3CMAV 3MHSC 1QR8A 5FL7G 2IJHA 5B1BB 2WLLA 3FB5C 1SRYA 4GX0A 4MTGA 5LBQA 1OCRC 2DYRC 5H6QA 3FB8C 4FJCC 1E1RG 4RAIA 5CN0A 3SPCA 5CBFA 1M90W 2ITDC 1THZA 1QLNA 2V7QG 5L3EA 1M56C 2WLIA 4QNHB 5IYBO 4FPPA 1YITV 3ABTA 1JX9A 4U7NA 4F4LA 3ZRWB 1FXVA 4H37A 4H33A 4JYBA 1OCOC 2ZR3A 4U7OA 1R6KA 3E8FA 3JD0A 1M56B 3QNEA 1K4CC 2F43G 4PELA 3AG3C 2EZOA 1K7DA 2P7TC 3G71V 1GMGA 2JEUA 5E1AC 1M1KW 1R3LC 2FTKA 3LUTB 4MVOA 5L3BA 3STZC 1Q7YW 4G27B 3AG4B 5L3CA 2YSUB 1QVGU 5B1NA 3QO5A 4MSWC 3ABUA 5B1BC 2Z5UA 2XAGA 3ZIAG 5IYCO 3FYEB 2EINB 2XAHA 2X0LA 1LNQA 3CCJV 3SYPA 4QIWF 3OUSA 2D3OW 5EC2C 3CC2V 1DLBA 4BIZA 3CCMV 2Z3YA 1FXHA 2EIJC 2X6CA 2EJRA 3SYOA 2GSMB 2IJIA 4WFAV 2KB1A 1V54B 3OAAG 3CC4V 3X2QB 3OEEG 2ZQMA 3B8MA 5H6RA 4WF9V 2R9IA 4QE9A 3ZRWA 2NNUA 3E86A 4MTOA 3SJQC 2OCCB 5IY5C 1OCCB 3OE7G 4DO2A 1KP2A 1K34A 4LP8A 3OGCC 2XAQA 5EBWC 5KA6A 4R7CA 5B1OA 1TUEB 5CA3A 1B6QA 3EFFK 3I56V 3P30A 1BMFG 1F51A 1GM8A 3K9AA 1VQOV 5B1AC 3K06A 2W6JG 3MHHC 2JDIG 1DF5A 2A79B 4RQFA 2H8PC 4GX5A 4JF3A 1VQKV 1AI4A 1W0KG 2EINC 4TSFG 3CCEV 1NVPD 5C93A 2W0FC 1R3JC 3LDEA 3SPIA 3CCQV 2P6JA 4ASUG 1KD1W 5LHHA 1VQ7V 2W6IG 3OM3B 1R6NA 1K73W 1S77D 4I5SA 1VQNV 1K3EA 2ZXWC 4X8AA 1EBOA 3H01A 2JEXA 1AI6A 3SYAA 1AJPA 2XAFA 2ZDIC 2IJJA 2DQ3A 3PJSK 2WLKA 2OT5A 1COWG 2WLNA 1I5XA 5DM6V 1K9MW 2UXNA 1P7BA 2C2AA 1W2BU 1VQ5V 3B8NA 3CCLV 4GX1A 5L3DA 1R3KC 2ZR2A 3T4ZA 2UXXA 1AJQA 2XASA 1VQPV 2DQ0A 1R3IC 1NQTA 3W7TA 1WLEA 1YIJV 4L87A 4WCEV 4WFEA 1YJNV 3ABMB 1K33A 2HVJC 5HFMA 2DYRB 2Q67A 1OZ0A 1PNKA 4MVZA 2EILB 4XDJA 2IU0A 1E79G 2B5UA 4LBEC 1V54C 1YJ9V 3IGAC 4RO2A 3LSQA 5CBHA 1S5HC 2X6BA 3CYOA 2OTLV 2Y69C 3OMNB 1OHHG 1CPYA 4Q20A 1Y4MA 5B3SB 3I55V 1JJ2U 2WAMA 1NKDA 3VOUA 1SESA 3ASNB 4HZ3A 1H8HG 2LP7A 2WSSG 5DN6G 2HJFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASO C;  2Q6A A;  3JYC A;  1LNQ A;  1ZWI C;  4PDR A;  3TET A;  4XDK A;  3SYP A;  3KG2 A;  3OUS A;  5EC2 C;  3F7Y C;  4PDL A;  4PDV A;  3RVY A;  3E83 A;  3WG7 C;  4BW5 A;  2ATK C;  1KKD A;  4GX2 A;  2EIJ C;  4PA7 A;  2X6C A;  4LCU C;  4R8C A;  3AG1 C;  3SYO A;  2DWE C;  2KB1 A;  4MVM A;  4MW3 A;  4JTD B;  1BL8 A;  2WLI B;  4J9Z B;  3ABL C;  2DYS C;  4WFH A;  3UM7 A;  4P9P A;  3ABK C;  4QE9 A;  3R65 A;  1XL4 A;  3E86 A;  5J9P C;  4MTO A;  4P30 A;  3SPJ A;  3SJQ C;  4MVS A;  3FB6 C;  3K03 A;  4R6Z A;  5IY5 C;  3RW0 A;  3K08 A;  4LP8 A;  3OGC C;  5CBG A;  5EBW C;  4R7C A;  4JTC B;  3E89 A;  3EFF K;  4EKW A;  3ZJZ A;  2WLH A;  2NLJ C;  4MW8 A;  2HVK C;  4P9O A;  5BZB A;  2QKS A;  3T4D A;  4WFF A;  5B1A C;  2QTO A;  3K06 A;  3X2Q C;  1OCC C;  1XL6 A;  4R50 A;  3ABM C;  4ZBM A;  2A79 B;  2R9R B;  4HYO A;  5EK0 A;  2JK5 C;  2H8P C;  3BEH A;  4GX5 A;  2HFE C;  3SYC A;  2Q68 A;  3T2M A;  4PA4 A;  2K1E A;  2EIN C;  2WLL B;  3AG2 C;  2W0F C;  4PA6 A;  1R3J C;  3LDE A;  2AHY A;  4WFG A;  3SPI A;  2HG5 C;  3OR7 C;  4KFM A;  3LDD A;  4DXW A;  3T1C A;  2WLM A;  4PA9 A;  3OUF A;  5EBM C;  3GB7 C;  2ITC C;  2ZXW C;  3K0D A;  4X8A A;  4PA3 A;  3F7V C;  4MVQ A;  3SYA A;  2Q69 A;  3ASN C;  2AHZ A;  3F5W C;  2WLL A;  3K04 A;  4MVU A;  4XDL A;  1G4Y B;  2WLJ A;  3FB5 C;  2WLK A;  3PJS K;  3RVZ A;  5B3S C;  3AG4 C;  3LNM B;  4GX0 A;  3LDC A;  4X88 A;  2WLN A;  2X6A A;  4MTG A;  4UUJ C;  1OCR C;  5KUK A;  4J9Y B;  2DYR C;  5EBL C;  3FB8 C;  2OCC C;  1P7B A;  3K0G A;  4RUE A;  4RAI A;  3SPC A;  5CBF A;  2ITD C;  2EIM C;  2EIK C;  4GX1 A;  4OXS A;  3STL C;  1R3K C;  3E8G A;  4MTF A;  3T4Z A;  1JVM A;  3FB7 C;  1M56 C;  4CBC A;  2WLI A;  4QNH B;  1R3I C;  2EIL C;  4WFE A;  2A0L A;  3ZRS A;  4F4L A;  4H37 A;  4H33 A;  3E8B A;  4X89 A;  1OCO C;  2DWD C;  2HVJ C;  3E8F A;  2Q67 A;  1ORQ C;  2A9H A;  3OR6 C;  3IFX A;  4MVZ A;  4XDJ A;  3UKM A;  4LBE C;  1V54 C;  3E8H A;  1K4C C;  4MS2 A;  3IGA C;  4RO2 A;  4PDM A;  5CBH A;  4G28 B;  1S5H C;  2X6B A;  2IH1 C;  4MVR A;  3SPH A;  3AG3 C;  1J95 A;  4QE7 A;  5KUM A;  2P7T C;  3SPG A;  4P2Z A;  2BOC C;  2Y69 C;  1V55 C;  1K4D C;  1R3L C;  5E1A C;  2BOB C;  3LUT B;  4MVO A;  1OCZ C;  3STZ C;  4G27 B;  2ZD9 A;  4TWK A;  4I9W A;  3RBZ A;  4MSW C;  3TCU A;  3VOU A;  5EC1 C;  1QLE C;  4HZ3 A;  5B1B C;  3SYQ A;  1M57 C;  2YEV A;  2IH3 C;  3HPL C;  4RUF A;  4JTA B;  2HJF C; 
#chains in the Genus database with same CATH topology
 1WB7 A;  3TET A;  3T1H O;  3ZHS A;  1HW7 A;  1NVP B;  2QWN B;  5LA6 A;  4BIU A;  1RPR A;  4LCU C;  3AG1 C;  4LF7 B;  1HNX O;  1JR9 A;  4I4T B;  2QE7 G;  2WLI B;  1H8E G;  1XI1 A;  4ZHQ A;  4X66 B;  1D2D A;  4DV5 B;  2GBO A;  2YXL A;  4MVS A;  1R73 A;  3FB6 C;  4R6Z A;  1FAF A;  1MSD A;  4FLX A;  4X1I B;  1WPB A;  3VQV A;  4AI8 A;  3ABK B;  3ZJZ A;  2RJZ A;  2QTO A;  1Y76 B;  3ZRV A;  1MSW D;  4HYO A;  1NR1 A;  1KEC A;  3BEH A;  3ZX6 A;  1RM1 B;  4O2A B;  3G6B A;  5KX5 B;  2HG5 C;  1SER A;  3JD3 A;  4Z1M G;  2WLM A;  1CEZ A;  2ZCE A;  4JAS A;  3TJT A;  3AG2 B;  4JI0 B;  3QVN A;  1VMG A;  5KHH A;  4J9Y B;  4TOI A;  1EN5 A;  1LUW A;  2EIK B;  2UXD B;  2DWD C;  4BIO A;  4DR2 B;  1GTO A;  1WPX A;  1JOY A;  4MS2 A;  4G28 B;  1W0J G;  1L0L H;  2JVD A;  4TUY A;  3SJC C;  1J5E B;  3CD6 V;  1SQF A;  1OCZ C;  1FYJ A;  2ZD9 A;  5CA0 B;  5EC1 C;  3VBB A;  1M57 C;  2IH3 C;  3NR7 A;  5LMU O;  1B06 A;  3ZN0 A;  3JYC A;  3T1H B;  2QGN A;  1XNR B;  2CAZ C;  5D5P A;  2VQF O;  2ZKO A;  1F4M A;  3BA9 A;  2DWE C;  4JPR A;  5GON B;  1RFY A;  4B3S B;  2YXH A;  1GN4 A;  2Y69 B;  3K5O A;  2EBO A;  1GN3 A;  3APQ A;  3TK1 A;  1RP3 B;  4OPH A;  3ZHV A;  1NR7 A;  2QKS A;  2JIZ G;  4ZKI A;  1KC8 W;  2ZXW B;  4B3T B;  3ABM C;  2JJ1 G;  4OPA A;  2GHY A;  3HKD A;  2AHY A;  3FKS G;  1HDJ A;  1BCC H;  1X59 A;  4TQF A;  5H9C A;  4TV8 B;  2QWO B;  5LXT A;  2CE4 A;  2R9A A;  1L1F A;  4JZ2 A;  3E22 A;  4PA3 A;  3F7V C;  3ASN C;  4XDL A;  1G4Y B;  3H1H H;  2ETN A;  2BTO A;  2JGD B;  3LNM B;  2YIB A;  4TUY B;  4WFB V;  2LFS A;  1VQM V;  3K0G A;  1PKX A;  3L71 H;  4LF4 B;  1XNR O;  1URF A;  2QWR B;  3A8T A;  3T1Y O;  4CBC A;  5FLX N;  2Q8V A;  3RYH B;  1VQ4 V;  3WFV A;  2QKA A;  2A0L A;  1NH2 D;  4NTY A;  3E8B A;  2XT9 A;  1FXK B;  4CS4 A;  3ABL B;  3OR6 C;  3UKM A;  2B1I A;  5IJ9 A;  3VQX A;  1QQC A;  2B9Z A;  3MAQ A;  3J80 N;  3R66 A;  1N33 B;  4WBN A;  3SPG A;  1AB3 A;  1I0H A;  1IZ3 A;  4DV0 O;  1NU1 H;  4LF5 B;  3TCU A;  4PI2 A;  1GH6 A;  4LH7 A;  2ZIO A;  3EXA A;  1PL0 A;  4DRX A;  5CA1 A;  3ETG A;  3M99 B;  4PDV A;  1V55 B;  4D7T A;  2LO1 A;  1ZSP A;  5JJE B;  2EJ7 A;  4UCT A;  1LR1 A;  2RN9 A;  4PV1 B;  2GUZ A;  4EFB A;  4JI6 O;  1GK9 A;  4BAY A;  3RWR D;  5J9P C;  4P30 A;  1GRJ A;  1UPG A;  2GTA A;  1SET A;  5LGN A;  4JTC B;  4FM2 A;  2F4V O;  3CRC A;  3CCU V;  4LF9 B;  3CME V;  4O4J B;  1KB9 F;  4KUM A;  2PTM A;  1Z5W A;  4CH5 A;  2WLL B;  3AG2 C;  4NR1 A;  4JAU A;  3CCS V;  4A5U B;  1GO3 F;  2IJK A;  3LDD A;  5KX5 A;  4NB5 A;  3CP1 A;  4Z1V A;  4O2A A;  1VF5 B;  2HKO A;  1NT2 B;  3GVM A;  2YS8 A;  2CH7 B;  3CJH A;  3MHS C;  5FL7 G;  1TGO A;  2WLL A;  3KCX A;  3WB1 A;  5KHJ A;  2UUC O;  3OD4 A;  1OCR C;  1N32 B;  5H6Q A;  1H2K A;  2ZE5 A;  1E1R G;  5CN0 A;  1VIB A;  2ITD C;  2V7Q G;  2WLI A;  4QNH B;  3WB2 A;  4DR2 O;  1YIT V;  1ZAU A;  1WN7 A;  4F4L A;  5KAI Z;  1FXV A;  4H37 A;  4JYB A;  1PP9 H;  2NR5 A;  1R6K A;  2F4V B;  1M56 B;  4UFZ A;  2L35 A;  4OX9 O;  2F43 G;  1PM9 A;  2GUZ B;  4EEQ A;  4J7Z A;  1JFF B;  1WJZ A;  3D36 C;  3E22 B;  2JEU A;  4O4L B;  2FTK A;  4CH4 A;  3LUT B;  5L3B A;  3STZ C;  1MZE A;  4G27 B;  2OCH A;  3AG4 B;  3SGI A;  3AK2 A;  1QVG U;  2AW9 A;  4JI0 O;  4LFA B;  3A0H Z;  2Z5U A;  2BSK B;  3FYE B;  4CS2 A;  4JI7 O;  3SJB C;  3SYP A;  4JI5 B;  4DR1 B;  5EC2 C;  3CC2 V;  4BIZ A;  4WBN B;  1FXH A;  2X6C A;  1TA8 A;  4I50 A;  1V54 B;  1SZX A;  1XRE A;  3X2Q B;  3SJA C;  1RSO B;  4AQY B;  3SJQ C;  2GV9 A;  1WB8 A;  4HBN A;  1OCC B;  1WA8 B;  3RYH A;  1YEW A;  1K34 A;  4LP8 A;  2ZE6 A;  4R7C A;  1TUE B;  5CA3 A;  3Q4H A;  5DED A;  1T5E A;  1VEW A;  4GKJ B;  3P30 A;  1G6U A;  5B1A C;  2W6J G;  2JDI G;  1IBK O;  5EIB C;  2DOS A;  4DV1 B;  1PV0 A;  1VQK V;  4U3F H;  1W0K G;  2W0F C;  1KD1 W;  1U97 A;  3N2K B;  1K73 W;  4GLX A;  2ZXW C;  3N27 A;  1XMQ O;  4I7Z B;  3SYA A;  2L6L A;  4YJ2 A;  2DQ3 A;  1P84 F;  3PJS K;  2ADP A;  3IJ4 A;  1JJO A;  2UXN A;  4DV6 O;  5CB4 A;  4ICG A;  2UXX A;  2XUM A;  3W7T A;  1WLE A;  4WFE A;  1YJN V;  1NTK H;  4YHH B;  1FFX A;  2DYR B;  1OZ0 A;  1PNK A;  2LGW A;  3GWK C;  2VS0 A;  2X6B A;  3CYO A;  1IX9 A;  2OTL V;  2F1M A;  2Y69 C;  2UXC B;  4Q20 A;  4JI8 B;  1NKD A;  4CH3 A;  4DV2 B;  4HZ3 A;  1YDX A;  1H8H G;  3PN1 A;  5DN6 G;  2HJF C;  3ZHU A;  4LH6 A;  2FB5 A;  4DUZ O;  1VQL V;  1O9G A;  1YJW V;  1K5S A;  5FNV B;  2ZIM A;  4FZ0 A;  1KU9 A;  3JAT A;  4MVM A;  3Q4H B;  3U11 A;  2VQE B;  2JS5 A;  3M7M X;  4GUN A;  2ZT9 B;  4NKG B;  2FL4 A;  3JAW B;  2Q7G A;  4IYI A;  1BHA A;  3UT5 A;  3OMA B;  3OTO O;  4CC6 A;  2P67 A;  3P3N A;  1IBL B;  3DSQ A;  3FX7 A;  3DTU B;  1VF7 A;  5BZB A;  1OCC C;  1H38 A;  2RQ6 A;  4UB6 Z;  5KHG A;  4WFG A;  4JV5 O;  1BQZ A;  3K3W A;  2QM7 A;  4B3M O;  2QR4 A;  3CPW U;  3CEI A;  2M6Y A;  3QO8 A;  3AG7 A;  4U3J A;  2P4V A;  4B3R B;  1QLE B;  2G38 A;  1JFF A;  4J11 A;  1IDS A;  2DYS B;  3ZHT A;  1WNS A;  4RUE A;  1MG1 A;  3CCV V;  1AJN A;  3E8G A;  5DEC A;  3DXR A;  1VQ6 V;  3CS5 A;  1AI5 A;  1ZL8 B;  2JJ2 G;  4TV9 B;  4I55 A;  3B77 A;  4I4T A;  2QA4 V;  3ML0 A;  5JH7 A;  3W7S A;  1I5Y A;  4ZOL A;  1QBZ A;  2IH1 C;  2QWQ B;  4QE7 A;  3D36 A;  3ZMZ A;  4P2Z A;  5LA6 B;  1MMM A;  2HP8 A;  1BZK A;  3K9S A;  2UU9 O;  2QEX V;  1Y74 B;  1XDC A;  4Q6G A;  2YID A;  1NS1 A;  4FIP C;  5GTH Z;  3ZRX A;  1FJG O;  4GKJ O;  4PDR A;  1P7G A;  2VRZ A;  3KG2 A;  1RM1 C;  2Y48 A;  2H94 A;  3RYC B;  2BTQ A;  4BW5 A;  1ZL8 A;  4NYK A;  2E5L B;  3CHX A;  3ZED A;  3SDL A;  3ZMT A;  2GTS A;  4MW3 A;  4JTD B;  4J9Z B;  2Q0A A;  3OEH G;  3R65 A;  4CZZ A;  3LSU A;  2CDY A;  1OCR B;  4LC1 A;  4JI1 O;  4NVP A;  3E89 A;  4JI7 B;  3H1I H;  2LGQ A;  1KP3 A;  1HNW B;  4R50 A;  4QGP A;  3RN4 A;  2JK5 C;  1E1Q G;  5FPO A;  2Q68 A;  4KP4 A;  1JMK C;  5LGT A;  1IBM B;  4E2L A;  1NJI W;  4JV5 B;  1K97 A;  1OCZ B;  5EBM C;  4IHJ A;  2AHZ A;  3F5W C;  3WU2 Z;  3A0R A;  3RYI B;  2N74 A;  2WLJ A;  4QPJ A;  5JCO A;  1KQS U;  1Q86 W;  3AK3 A;  1UFI A;  5IY5 B;  2EIK C;  4DV1 O;  3FB7 C;  3JAW A;  1K5Q A;  1CP9 A;  2HLD G;  2OIG A;  5LGU A;  3ZMV A;  4IGG A;  4JI4 O;  1YI2 V;  5LP6 C;  4NXN B;  3IFX A;  2VQF B;  4JI3 B;  5B5E Z;  4EB6 A;  1EN4 A;  1J95 A;  2CTR A;  3WG7 B;  4TWK A;  4B08 A;  3BY6 A;  1AP6 A;  3HKC B;  1P4R A;  5IYZ B;  4JI4 B;  1HNZ O;  2CTW A;  1VQ9 V;  4GCZ A;  3AG3 B;  1Z2G A;  3U0Z A;  4PDL A;  2LFR A;  1NH2 B;  2A06 H;  2YIA A;  1VQ8 V;  3JD2 A;  5TIS Z;  3E35 A;  4GX2 A;  4DR3 O;  5IJ0 B;  4N21 A;  1F4N A;  1XMQ B;  2YI9 A;  4WFH A;  1Q43 A;  4QPK A;  3W7X A;  1NBM G;  1ZTE A;  1NTM H;  1GM9 A;  2O57 A;  3DC5 A;  4MTX A;  5IWA O;  2WLH A;  1JPX A;  1TUB A;  4RQE A;  1IBK B;  1GN6 A;  1HNZ B;  1I7F A;  1HNX B;  2WWW A;  4KHP B;  1MAB G;  2XOK G;  2HFE C;  4B7K A;  3JAS B;  1Q6I A;  4XBF A;  2LQT A;  4LF8 O;  3OR7 C;  4DXW A;  3CWB H;  5L3G A;  3ETE A;  4YXW G;  3RGB A;  1G8M A;  4YIP A;  3CMA V;  2QWP B;  5B1B B;  4NXN O;  3FB5 C;  3C3T A;  1SRY A;  4JI2 B;  3O9O A;  4ABM A;  5LBQ A;  1O9H A;  4FLW A;  2KG7 A;  4RAI A;  3JSL A;  5CBF A;  4DV4 B;  3DC6 A;  1W59 A;  5L3E A;  2UUB O;  1CXZ B;  3C3S A;  4FPP A;  2IBZ H;  4I50 B;  4W4K A;  1JX9 A;  4U7N A;  1GAX A;  4JYA B;  1YF2 A;  4H33 A;  5LP6 A;  2RMK B;  5K1P A;  3UQ8 A;  4UCV A;  2BCC H;  4O2B B;  2MW2 B;  1A32 A;  4LR3 A;  3UCS C;  3AG3 C;  2EZO A;  4FM0 A;  3KZI Z;  1GMG A;  1Q7Y W;  1M93 A;  5H2F Z;  2YSU B;  3QO5 A;  3ABU A;  1S5J A;  2KKW A;  4DR5 O;  2XAH A;  1LNQ A;  3CCJ V;  3MDS A;  4NTW A;  4QIW F;  2ADQ B;  3AK1 A;  2YC0 A;  2UXB O;  2ZE7 A;  3JAL A;  3SYO A;  4DV3 O;  5ITZ A;  4X1I A;  2Q7H A;  3HKE B;  4K8Z A;  3B8M A;  3JAR B;  5H6R A;  4NTX A;  2NNU A;  3H9V A;  4I0X A;  4MTO A;  2FKX A;  5IY5 C;  5K1X A;  1H2L A;  1KP2 A;  3OGC C;  5B1O A;  1N0J A;  3EFF K;  3I56 V;  2FYU H;  3UT5 B;  2UUC B;  1BMF G;  5FPR A;  3K9A A;  1VQO V;  4LF6 B;  1YCI A;  3MHH C;  2N04 A;  2VQE O;  3K5L A;  2H8P C;  1IUR A;  4JF3 A;  2EIN C;  3OGI B;  3CCE V;  1KYO F;  1Z5V A;  1R3J C;  5LMN O;  2QSA A;  5LHH A;  2AZ0 A;  1VQ7 V;  4K3A A;  2Y0P A;  3WB0 A;  2E76 B;  4UB8 Z;  4LFC O;  2DE0 X;  2JEX A;  1AI6 A;  1KBH A;  4KL1 A;  4C7U A;  2HEP A;  3RT3 C;  4LNU B;  3U10 A;  3HR0 A;  3HKB B;  1COW G;  1I5X A;  5DM6 V;  4GKK B;  2C2A A;  1VQ5 V;  3B8N A;  4GX1 A;  4GYC B;  5L3D A;  2WA3 A;  4O4H B;  2ZM6 O;  3N2G B;  4LF8 B;  3L74 H;  1MZF A;  4OGQ B;  1NQT A;  1YIJ V;  1EN6 A;  1SA0 B;  1KUQ A;  4UCR A;  4J10 A;  5HFM A;  4NXM O;  4XDJ A;  2EX3 A;  2P5O A;  5LMN B;  3IGA C;  5CBH A;  4B3M B;  2F66 C;  1S5L Z;  4GZR B;  5KLV H;  3OMN B;  4B3R O;  1OHH G;  1CPY A;  2YUA A;  1SES A;  1B3Q A;  4J42 A;  4DW0 A;  1AR4 A;  3W7U A;  3F7Y C;  1KKC A;  1H2G A;  4DUY B;  5KAF Z;  4PA7 A;  2JRI A;  4DV7 B;  1BL8 A;  2UXB B;  5F2V O;  1N4C A;  1S76 D;  2IU3 A;  2UUB B;  4P9P A;  5JCO C;  3VQY A;  3RW0 A;  3K08 A;  1ZUQ A;  4UXN A;  3IAY A;  1XNQ B;  2Q0O C;  4JI2 O;  4LF9 O;  3T4D A;  4CC5 A;  1MA1 A;  4B3T O;  1YTF B;  1Y66 A;  5EK0 A;  3TXQ A;  5KHK A;  2PZS A;  3SYC A;  3JAL B;  2ODM A;  3ASO B;  2UXC O;  2HR3 A;  4HNA B;  4KFM A;  5EZY A;  5BR8 B;  3HKD B;  1V9P A;  3OMI B;  5D5Q A;  2QM8 A;  3SR2 C;  2AZ2 A;  1U96 A;  2ITC C;  1SQG A;  2JS3 A;  3OTF A;  2Q73 A;  3K04 A;  4LFA O;  5IYZ A;  3FAV A;  1P49 A;  1PNM A;  3LDC A;  1PNL A;  2X6A A;  4IYH A;  1ARO P;  5EBL C;  4X62 B;  4I9Q A;  1G1X B;  1L8D A;  2RCV A;  4DR1 O;  5LYJ A;  4OXS A;  2PGG A;  4O2B A;  4MTF A;  4F6R A;  1L0N H;  3CX5 F;  4DV0 B;  5LMU B;  2PYJ A;  1IXM A;  4FFB A;  1S3J A;  2GDS A;  3ZS8 C;  2ZE8 A;  4X20 A;  3AG1 B;  4DV7 O;  2MK3 A;  5E79 Z;  3ICX A;  4K35 A;  3F5T A;  1K8A W;  2P90 A;  2ZIN A;  1GKF A;  2PY5 A;  3ZMS A;  1AVM A;  1EFR G;  3BPZ A;  3SPH A;  4MVR A;  3ZHQ A;  1N33 O;  3H1K H;  3RYC A;  2BOB C;  3RBZ A;  4AHC A;  2ZDI A;  1FKA O;  2QKC A;  1QLE C;  2YEV A;  1VF6 C;  4RUF A;  5LHI A;  1ZWI C;  1QU7 A;  4UVC A;  1SQQ H;  2ZNJ A;  3THO A;  3CRR A;  1QVF U;  3K5N A;  3JCZ A;  4X65 B;  4DR7 B;  2Y0I A;  5J2U B;  2CUG A;  5J2T A;  2LW7 A;  1JCH A;  1OCO B;  2DYS C;  3BVO A;  3UM7 A;  4DR6 O;  3FYI B;  1ROP A;  2UU9 B;  4FZ1 A;  1XL4 A;  3B09 A;  3JAR A;  1QR9 A;  2E3C A;  3K03 A;  1B04 A;  2M7W A;  5CBG A;  4JYC A;  4DK1 A;  4H0L B;  2XHB A;  4ZI7 A;  5LHG A;  3P32 A;  4X1K B;  4O4I B;  3OT7 A;  4LNU A;  2HHH O;  4LFC B;  4J80 A;  1YZB A;  4UV8 A;  4PA9 A;  4DRX B;  4TQD A;  3K0D A;  1ZX3 A;  4MVU A;  1M9N A;  3QO7 A;  1XNQ O;  2VWK A;  4OX9 B;  3D8C A;  2OCC C;  3L9D A;  2YI8 A;  4FK5 C;  2F23 A;  2EIM C;  4UCO A;  3STL C;  2A7W A;  3B2E E;  5JJN B;  4FLZ A;  3K79 A;  3HB3 B;  5A9G A;  3ZRS A;  2EIJ B;  3P3P A;  3HKE A;  4FFB B;  3A2F A;  4G2K A;  4LF4 O;  4E4E A;  3E8H A;  1IBM O;  1X4T A;  4D6T H;  4PDM A;  2IM9 A;  1FJG B;  5KUM A;  2Q5Z A;  2K9P A;  2XAJ A;  3L70 H;  2R72 A;  4LFB B;  3ZMU A;  3UO3 A;  5KMG B;  1MNG A;  3EHB B;  4DR4 B;  4X1Y A;  3M8A A;  3ASO C;  3JAS A;  4K0K O;  1D5A A;  2OWO A;  4J7K A;  2JGU A;  5BMV A;  1XEQ A;  5KA5 A;  3GWO A;  1F23 A;  2D2C B;  2DW4 A;  4X62 O;  3ETQ A;  1ZLZ A;  5CMU A;  5LP6 B;  1JQ0 A;  2YIB D;  3CXC U;  4DR3 B;  3RYF B;  5LYJ B;  4BW9 A;  1IBL O;  5GW7 A;  1SC5 B;  4JAA A;  4DV4 O;  4O4H A;  1TVK B;  2NLJ C;  5BR8 O;  2KG7 B;  2DN9 A;  2QDO A;  4UVB A;  5BMV B;  3IC7 A;  3BRC A;  3CC7 V;  3CRQ A;  4PA4 A;  4UCU A;  3T1C A;  1Q6H A;  1SQV H;  1PD3 A;  3L75 H;  1DTO A;  1SQB H;  1VP7 A;  4B3S O;  2IJH A;  1OV9 A;  4DV3 B;  3BHP A;  4X66 O;  1H2M A;  1NZ6 A;  4MTG A;  2A3Q A;  4LF7 O;  4X20 B;  4ZIB A;  1JA8 A;  3SPC A;  4D7S A;  1XUQ A;  3JAK A;  4I55 B;  3ABT A;  5IT9 N;  4I0X B;  3S3W A;  4CH6 A;  1OCO C;  3K5M A;  3DXR B;  1SQX H;  3E8F A;  5JVD A;  4PEL A;  2AGA A;  4JYY A;  2R70 A;  1M1K W;  1R3L C;  4MVO A;  2HJD A;  4YJ3 A;  3VQW A;  3HKB A;  5L3C A;  2UUA O;  5B1N A;  4DYL A;  3CE2 A;  2Q7E A;  4YJ3 B;  5B1B C;  2PYL A;  2DMX A;  3CRM A;  2XAG A;  4X1Y B;  3ZIA G;  4U3J B;  4GKK O;  3OTO B;  3OUS A;  1BE3 H;  4X1K A;  2D3O W;  3H1J H;  2Z3Y A;  2BE3 A;  5LOV B;  2IJI A;  4WFA V;  1SA0 A;  4LF5 O;  2ARH A;  1Y76 A;  1VAR A;  4X64 O;  4RWU A;  2ZQM A;  2OCC B;  4W4L A;  4DO2 A;  2XAQ A;  5EBW C;  1WA8 A;  3H1L H;  1F51 A;  1GM8 A;  5LL6 Y;  4UCS A;  3K06 A;  2BTQ B;  1DF5 A;  4X65 O;  4Z2W A;  5B66 Z;  1XMO B;  1BS3 A;  1N34 O;  4GX5 A;  1NVP D;  3K59 A;  5C93 A;  3LDE A;  2P6J A;  2W6I G;  3OM3 B;  4FM1 A;  1R6N A;  3L73 H;  4X8A A;  2BSK A;  1EBO A;  3H01 A;  1N32 O;  1AJP A;  2UUA B;  2XAF A;  2ZDI C;  2IJJ A;  5IWA B;  2OT5 A;  2CGN A;  4TV9 A;  1N0N A;  1K9M W;  4ZI7 B;  1P7B A;  3CCL V;  2ZR2 A;  2QM4 A;  1FD9 A;  1VQP V;  2DQ0 A;  4L87 A;  4WCE V;  2PF4 E;  1WP8 A;  1GN2 A;  1K33 A;  2HVJ C;  1HR0 O;  5EIB D;  4IIJ B;  2ZM6 B;  2IU0 A;  1R1B A;  1V54 C;  1US6 A;  4PD4 F;  4RO2 A;  1EM1 A;  1XMO O;  3QG5 A;  2E75 B;  3C90 A;  1NI8 A;  1JJ2 U;  4CS3 A;  2WA4 A;  4FVM A;  3VOU A;  5IE9 A;  1BQ0 A;  2LP7 A;  2WSS G;  4HNA A;  4YY3 B;  2QJ1 A;  3RVY A;  4PI0 A;  1RPO A;  3E83 A;  2IW5 A;  3B40 A;  3J81 N;  4LWS B;  1KKD A;  1XHZ A;  5IDJ A;  3CCR V;  1N8R W;  2YXY A;  3LSS A;  4B7E A;  1DF4 A;  1FXK A;  2VWJ A;  2V1D A;  5BY1 A;  1AI7 A;  3IC9 A;  3K58 A;  3CSX A;  2E74 B;  4P9O A;  1SS3 A;  2X7R B;  1YVW A;  5L3F A;  4DW1 A;  3ZCC A;  2CTP A;  3T2M A;  4TT3 G;  2PI4 A;  2YIC A;  4IHJ B;  2EUL A;  3J7A U;  5CA1 B;  1SKV A;  1BT8 A;  4JAV A;  4O4I A;  1HWY A;  3OUF A;  4DR5 B;  3MD0 A;  2P06 A;  4MVQ A;  2Q69 A;  1Q5O A;  1PPJ H;  5AG2 A;  1S72 V;  5JVD B;  5KUK A;  2WPD G;  1N36 B;  1WAZ A;  4UVA A;  1BHB A;  1WP7 A;  1K92 A;  2EIL C;  2EIM B;  4JYA O;  1ORQ C;  2OTJ V;  2PI5 A;  5GON A;  3OFN G;  2LW1 A;  3JAT B;  3G4S V;  1V55 C;  1K4D C;  5JJJ B;  4YY3 O;  3NXS A;  4HAM A;  5B1A B;  4I9W A;  3ZN1 A;  5KMG A;  2RDC A;  2Z0A A;  3D3I A;  3HPL C;  4DK0 A;  2Q6A A;  1YXB A;  5CA0 A;  1OJH A;  1N36 O;  4TV8 A;  5LXT B;  3WG7 C;  2N05 A;  1TUB B;  4N23 A;  4LF6 O;  4ZOL B;  1TVK A;  2XND G;  5JH7 B;  3BAB A;  1Q8I A;  4KHP O;  3BCC H;  4YHH O;  2EZP A;  2Q4P A;  3DGE A;  3ABL C;  3T1Y B;  3ABK C;  5IYD O;  3QF7 A;  2LJ2 A;  4K0K B;  4JI5 O;  2W0X A;  1S0V A;  1FPO A;  1H2N A;  4J7J A;  2Y4T A;  1HR0 B;  4EKW A;  4NXM B;  1QNM A;  3OW2 U;  3RYI A;  1EZJ A;  4MW8 A;  5IJ0 A;  2CK3 G;  2YDE A;  4MT8 A;  4WFF A;  3X2Q C;  3AEI A;  3TGU H;  5JQG B;  4ZBM A;  2R9R B;  4JI1 B;  1UJW B;  1LUV A;  1AIL A;  3G6E V;  4YJ2 B;  4PA6 A;  1TAE A;  2KQX A;  5EZY B;  1ENV A;  2OYQ A;  4PHZ A;  4FLY A;  5GTI Z;  3ZHR A;  3N2K A;  5BXZ A;  3BAA A;  4O4L A;  4GT1 A;  3ETD A;  4EB6 B;  1YTF D;  3W7W A;  3LNN A;  5B3S C;  3RVZ A;  3AG4 C;  4PJ0 Z;  4X88 A;  1M4U A;  2P4K A;  4FMT A;  4UUJ C;  3I5D A;  3JD1 A;  1XQ8 A;  4DUZ B;  1AR1 B;  4EFE A;  4FLV A;  1JVM A;  1XIL A;  4DR6 B;  3KCY A;  5HFL A;  4QJF B;  4AQY O;  5J2T B;  4X89 A;  4X64 B;  3CB2 A;  1HP8 A;  2A9H A;  3APO A;  5ITZ B;  4DR7 O;  1AR5 A;  2HHH B;  1FFT B;  1Q81 W;  3JCU Z;  5KHI A;  3JD4 A;  2XTA A;  2BOC C;  1QCE A;  1NTZ H;  2CTQ A;  2DJV A;  2JGD A;  1YHQ V;  1FS0 G;  2KSD A;  3SYQ A;  3E2E A;  4JTA B;  4XDK A;  3FFQ A;  1Q82 W;  4BWA A;  3BFR A;  1MOF A;  2Y4U A;  4DUY O;  4K8X A;  2ATK C;  4O4J A;  1XHX A;  4R8C A;  2CGO A;  3A0B Z;  1YSC A;  5JQG A;  2FML A;  3N2G A;  1H2S B;  4UV9 A;  1FXK C;  2B1G A;  3SPJ A;  4JGS A;  1BGY H;  2AXT Z;  4FFK A;  1SZT A;  2OIE A;  5CB4 B;  3UO2 A;  4DV5 O;  2HVK C;  2V4D A;  1GM7 A;  5J2U A;  3L72 H;  4ZHQ B;  1I94 B;  1XL6 A;  1IXB A;  1HNW O;  4DR4 O;  1M57 B;  4FLU A;  2K1E A;  4LFB O;  5JWP A;  2YEV B;  1R6T A;  1DK1 A;  5C8Y A;  2UXD O;  1Q90 D;  2ILM A;  3GB7 C;  4H13 B;  1QR8 A;  3BA8 A;  4X9Q A;  3G80 A;  2F93 B;  4GX0 A;  1VF6 A;  1DGS A;  5EYP A;  2DYR C;  3FB8 C;  4FJC C;  4IL6 Z;  3JAM N;  1M90 W;  1THZ A;  1QLN A;  1I08 A;  2F95 B;  1M56 C;  4AIL C;  5IYB O;  1SF9 A;  1XBL A;  3B4S A;  4F6R B;  1I94 O;  3ZRW B;  5LOV A;  5FNV A;  4IT5 A;  4FLT A;  2ZR3 A;  4U7O A;  4JI6 B;  3JD0 A;  3QNE A;  4DV2 O;  2NN4 A;  3RFR A;  1K4C C;  4JI8 O;  1Y67 A;  3FAV B;  4KXR A;  2Q9L A;  1K7D A;  2P7T C;  3G71 V;  4F6E A;  5E1A C;  4JZG A;  4MSW C;  5IYC O;  1EZV H;  2EIN B;  2X0L A;  3HKC A;  1SQP H;  3TXS A;  1XOU A;  1Q3E A;  1DLB A;  3CCM V;  3CRA A;  2EIJ C;  2EJR A;  4J41 A;  2GSM B;  2KB1 A;  5IJ9 B;  1KMI Z;  3OAA G;  3QTC A;  3CC4 V;  3JAK B;  3OEE G;  4WF9 V;  2R9I A;  4QE9 A;  3ZRW A;  3E86 A;  3OE7 G;  4JI3 O;  5H5N A;  5KA6 A;  1Q6U A;  1F7Y A;  1B6Q A;  2RNB A;  4H44 B;  3CXH F;  1M5I A;  2A79 B;  4RQF A;  1N34 B;  2PUS A;  1AI4 A;  1J5E O;  4TSF G;  4LWS A;  3SPI A;  3CCQ V;  4ASU G;  3CJH B;  1Y74 A;  5C8Y B;  1S77 D;  4I5S A;  1VQN V;  1K3E A;  1PL4 A;  4BR6 A;  3K57 A;  2QTS A;  2WLK A;  3D3Q A;  2WLN A;  1FFX B;  1W2B U;  3JSN A;  3G67 A;  3RYF A;  1RSO A;  1R3K C;  4L8J A;  3T4Z A;  1BSM A;  1AJQ A;  2XAS A;  5A2Q N;  1R3I C;  4IIJ A;  1QHT A;  4YIO A;  3ZBH A;  1IVS A;  1Y6X A;  3ABM B;  4MVZ A;  2Q67 A;  2EIL B;  1AP5 A;  1E79 G;  2B5U A;  4LBE C;  3O65 A;  1YJ9 V;  3LSQ A;  1S5H C;  4DV6 B;  3KKY A;  5EYP B;  3I55 V;  1Y4M A;  5B3S B;  2WAM A;  2P22 C;  2H3O A;  1D5N A;  3ASN B;  2ZNI A;  3FD9 A;  3EVK A;  2CH7 A;  3S3X A;  2E5L O; 
#chains in the Genus database with same CATH homology
 3TET A;  3W7U A;  1VQL V;  1NVP B;  3RVY A;  3F7Y C;  1RPO A;  3E83 A;  1YJW V;  1H2G A;  2IW5 A;  4BIU A;  1K5S A;  1KKD A;  1RPR A;  4LCU C;  4PA7 A;  5IDJ A;  3AG1 C;  3CCR V;  4MVM A;  1N8R W;  2QE7 G;  1BL8 A;  2WLI B;  1H8E G;  3LSS A;  1S76 D;  1BHA A;  2IU3 A;  1DF4 A;  1FXK A;  4P9P A;  2V1D A;  1AI7 A;  3OMA B;  1R73 A;  3FB6 C;  4MVS A;  4R6Z A;  3RW0 A;  2P67 A;  3K08 A;  4UXN A;  3DTU B;  3ABK B;  3ZJZ A;  5BZB A;  4P9O A;  3T4D A;  2QTO A;  1OCC C;  2X7R B;  1YTF B;  1Y66 A;  3ZRV A;  1MSW D;  5EK0 A;  4HYO A;  1NR1 A;  1KEC A;  5L3F A;  1H38 A;  3SYC A;  3BEH A;  3ZCC A;  1RM1 B;  3T2M A;  4TT3 G;  2PI4 A;  3ASO B;  2HR3 A;  4WFG A;  2HG5 C;  4KFM A;  3K3W A;  1SER A;  2QM7 A;  3OMI B;  3CPW U;  3JD3 A;  4Z1M G;  2WLM A;  4JAV A;  1CEZ A;  1HWY A;  3OUF A;  2QM8 A;  3MD0 A;  3QO8 A;  2ITC C;  4JAS A;  4MVQ A;  1QLE B;  2Q69 A;  3K04 A;  3AG2 B;  1PNM A;  1S72 V;  3LDC A;  1PNL A;  2DYS B;  2X6A A;  5KUK A;  4J9Y B;  1ARO P;  5EBL C;  2WPD G;  4RUE A;  1MG1 A;  3CCV V;  1AJN A;  4OXS A;  3E8G A;  4UVA A;  1BHB A;  4MTF A;  1IXM A;  1K92 A;  2EIL C;  1VQ6 V;  2EIM B;  2EIK B;  1S3J A;  1AI5 A;  2DWD C;  3AG1 B;  1ORQ C;  2JJ2 G;  2MK3 A;  2OTJ V;  2PI5 A;  3B77 A;  2QA4 V;  1GTO A;  3OFN G;  3ML0 A;  3W7S A;  1K8A W;  1WPX A;  1I5Y A;  1GKF A;  2P90 A;  4MS2 A;  3ZMS A;  1JOY A;  1EFR G;  4G28 B;  1QBZ A;  3G4S V;  3SPH A;  2IH1 C;  1W0J G;  4MVR A;  4QE7 A;  3D36 A;  3ZMZ A;  4P2Z A;  1V55 C;  1K4D C;  3CD6 V;  2BOB C;  1OCZ C;  3NXS A;  4HAM A;  5B1A B;  2ZD9 A;  4I9W A;  2QEX V;  3RBZ A;  3ZN1 A;  2ZDI A;  5EC1 C;  1QLE C;  3VBB A;  3D3I A;  1M57 C;  2YEV A;  2IH3 C;  3HPL C;  4RUF A;  4FIP C;  5LHI A;  3ZRX A;  3ZN0 A;  2Q6A A;  3JYC A;  4PDR A;  1ZWI C;  3KG2 A;  4UVC A;  1RM1 C;  2Y48 A;  2H94 A;  1QVF U;  3WG7 C;  4BW5 A;  3JCZ A;  4N23 A;  1F4M A;  2DWE C;  2XND G;  4JPR A;  3ZMT A;  4MW3 A;  4JTD B;  1JCH A;  2EZP A;  3DGE A;  4J9Z B;  3ABL C;  1OCO B;  2DYS C;  3UM7 A;  3ABK C;  5IYD O;  3FYI B;  1ROP A;  3OEH G;  3R65 A;  1XL4 A;  1QR9 A;  4CZZ A;  2Y69 B;  3K03 A;  2EBO A;  2M7W A;  5CBG A;  3TK1 A;  1OCR B;  4JYC A;  4LC1 A;  1S0V A;  3E89 A;  4EKW A;  1NR7 A;  3OW2 U;  1EZJ A;  4MW8 A;  2CK3 G;  1KP3 A;  2QKS A;  2JIZ G;  4MT8 A;  4WFF A;  3X2Q C;  4ZKI A;  3AEI A;  2ZXW B;  4R50 A;  1KC8 W;  3ABM C;  4ZBM A;  2R9R B;  3P32 A;  5LHG A;  1UJW B;  2JJ1 G;  2JK5 C;  1E1Q G;  2Q68 A;  3G6E V;  4KP4 A;  2GHY A;  5LGT A;  4PA6 A;  4E2L A;  1NJI W;  2AHY A;  3FKS G;  1ENV A;  5H9C A;  4UV8 A;  1K97 A;  4PA9 A;  1L1F A;  1OCZ B;  5EBM C;  3K0D A;  4PA3 A;  3F7V C;  3ASN C;  4MVU A;  2AHZ A;  3F5W C;  1M9N A;  3ETD A;  3QO7 A;  4GT1 A;  4XDL A;  3A0R A;  1YTF D;  1G4Y B;  2WLJ A;  4QPJ A;  3W7W A;  5B3S C;  3RVZ A;  3AG4 C;  3LNM B;  1KQS U;  4X88 A;  4UUJ C;  4FMT A;  1Q86 W;  4WFB V;  2LFS A;  2OCC C;  3JD1 A;  1VQM V;  4FK5 C;  3K0G A;  5IY5 B;  1PKX A;  2EIM C;  2EIK C;  1AR1 B;  3STL C;  1JVM A;  3FB7 C;  1K5Q A;  4CBC A;  1CP9 A;  2HLD G;  3K79 A;  3HB3 B;  5HFL A;  4QJF B;  3ZMV A;  5LGU A;  1VQ4 V;  3WFV A;  2A0L A;  3ZRS A;  1NH2 D;  1YI2 V;  2EIJ B;  3E8B A;  1FXK B;  4X89 A;  3ABL B;  3OR6 C;  2A9H A;  3UKM A;  3IFX A;  2B1I A;  4G2K A;  3E8H A;  1FFT B;  4PDM A;  1Q81 W;  1J95 A;  3JD4 A;  5KUM A;  3SPG A;  2BOC C;  2XAJ A;  1QCE A;  3WG7 B;  3ZMU A;  1YHQ V;  1FS0 G;  4TWK A;  3BY6 A;  3EHB B;  3TCU A;  1P4R A;  3SYQ A;  1PL0 A;  3E2E A;  4JTA B;  3ASO C;  1VQ9 V;  4GCZ A;  3AG3 B;  4XDK A;  3ETG A;  3M99 B;  1Q82 W;  4PDL A;  4PDV A;  1MOF A;  1V55 B;  2LFR A;  1NH2 B;  1VQ8 V;  3JD2 A;  2ATK C;  3E35 A;  4GX2 A;  5KA5 A;  3GWO A;  4R8C A;  1F23 A;  4N21 A;  2DW4 A;  1YSC A;  1F4N A;  1GK9 A;  4UV9 A;  5CMU A;  4BAY A;  1FXK C;  1JQ0 A;  4WFH A;  3CXC U;  2B1G A;  5J9P C;  4P30 A;  3SPJ A;  4JGS A;  4QPK A;  5GW7 A;  3W7X A;  1SET A;  5LGN A;  1NBM G;  1SZT A;  4JTC B;  1GM9 A;  4MTX A;  2WLH A;  1JPX A;  2NLJ C;  2HVK C;  3CME V;  3CCU V;  1GM7 A;  4UVB A;  4RQE A;  4KUM A;  1XL6 A;  3IC7 A;  2WWW A;  1M57 B;  1MAB G;  2XOK G;  2HFE C;  3CC7 V;  4PA4 A;  2K1E A;  2WLL B;  3AG2 C;  4XBF A;  4JAU A;  3CCS V;  2YEV B;  3OR7 C;  1GO3 F;  2IJK A;  3LDD A;  4DXW A;  5L3G A;  3ETE A;  3CP1 A;  4YXW G;  3T1C A;  1PD3 A;  1G8M A;  2HKO A;  3GB7 C;  1DTO A;  3CMA V;  3MHS C;  1QR8 A;  5FL7 G;  2IJH A;  5B1B B;  2WLL A;  3FB5 C;  1SRY A;  4GX0 A;  4MTG A;  5LBQ A;  1OCR C;  2DYR C;  5H6Q A;  3FB8 C;  4FJC C;  1E1R G;  4RAI A;  5CN0 A;  3SPC A;  5CBF A;  1M90 W;  2ITD C;  1THZ A;  1QLN A;  2V7Q G;  5L3E A;  1M56 C;  2WLI A;  4QNH B;  5IYB O;  4FPP A;  1YIT V;  3ABT A;  1JX9 A;  4U7N A;  4F4L A;  3ZRW B;  1FXV A;  4H37 A;  4H33 A;  4JYB A;  1OCO C;  2ZR3 A;  4U7O A;  1R6K A;  3E8F A;  3JD0 A;  1M56 B;  3QNE A;  1K4C C;  2F43 G;  4PEL A;  3AG3 C;  2EZO A;  1K7D A;  2P7T C;  3G71 V;  1GMG A;  2JEU A;  5E1A C;  1M1K W;  1R3L C;  2FTK A;  3LUT B;  4MVO A;  5L3B A;  3STZ C;  1Q7Y W;  4G27 B;  3AG4 B;  5L3C A;  2YSU B;  1QVG U;  5B1N A;  3QO5 A;  4MSW C;  3ABU A;  5B1B C;  2Z5U A;  2XAG A;  3ZIA G;  5IYC O;  3FYE B;  2EIN B;  2XAH A;  2X0L A;  1LNQ A;  3CCJ V;  3SYP A;  4QIW F;  3OUS A;  2D3O W;  5EC2 C;  3CC2 V;  1DLB A;  4BIZ A;  3CCM V;  2Z3Y A;  1FXH A;  2EIJ C;  2X6C A;  2EJR A;  3SYO A;  2GSM B;  2IJI A;  4WFA V;  2KB1 A;  1V54 B;  3OAA G;  3CC4 V;  3X2Q B;  3OEE G;  2ZQM A;  3B8M A;  5H6R A;  4WF9 V;  2R9I A;  4QE9 A;  3ZRW A;  2NNU A;  3E86 A;  4MTO A;  3SJQ C;  2OCC B;  5IY5 C;  1OCC B;  3OE7 G;  4DO2 A;  1KP2 A;  1K34 A;  4LP8 A;  3OGC C;  2XAQ A;  5EBW C;  5KA6 A;  4R7C A;  5B1O A;  1TUE B;  5CA3 A;  1B6Q A;  3EFF K;  3I56 V;  3P30 A;  1BMF G;  1F51 A;  1GM8 A;  3K9A A;  1VQO V;  5B1A C;  3K06 A;  2W6J G;  3MHH C;  2JDI G;  1DF5 A;  2A79 B;  4RQF A;  2H8P C;  4GX5 A;  4JF3 A;  1VQK V;  1AI4 A;  1W0K G;  2EIN C;  4TSF G;  3CCE V;  1NVP D;  5C93 A;  2W0F C;  1R3J C;  3LDE A;  3SPI A;  3CCQ V;  2P6J A;  4ASU G;  1KD1 W;  5LHH A;  1VQ7 V;  2W6I G;  3OM3 B;  1R6N A;  1K73 W;  1S77 D;  4I5S A;  1VQN V;  1K3E A;  2ZXW C;  4X8A A;  1EBO A;  3H01 A;  2JEX A;  1AI6 A;  3SYA A;  1AJP A;  2XAF A;  2ZDI C;  2IJJ A;  2DQ3 A;  3PJS K;  2WLK A;  2OT5 A;  1COW G;  2WLN A;  1I5X A;  5DM6 V;  1K9M W;  2UXN A;  1P7B A;  2C2A A;  1W2B U;  1VQ5 V;  3B8N A;  3CCL V;  4GX1 A;  5L3D A;  1R3K C;  2ZR2 A;  3T4Z A;  2UXX A;  1AJQ A;  2XAS A;  1VQP V;  2DQ0 A;  1R3I C;  1NQT A;  3W7T A;  1WLE A;  1YIJ V;  4L87 A;  4WCE V;  4WFE A;  1YJN V;  3ABM B;  1K33 A;  2HVJ C;  5HFM A;  2DYR B;  2Q67 A;  1OZ0 A;  1PNK A;  4MVZ A;  2EIL B;  4XDJ A;  2IU0 A;  1E79 G;  2B5U A;  4LBE C;  1V54 C;  1YJ9 V;  3IGA C;  4RO2 A;  3LSQ A;  5CBH A;  1S5H C;  2X6B A;  3CYO A;  2OTL V;  2Y69 C;  3OMN B;  1OHH G;  1CPY A;  4Q20 A;  1Y4M A;  5B3S B;  3I55 V;  1JJ2 U;  2WAM A;  1NKD A;  3VOU A;  1SES A;  3ASN B;  4HZ3 A;  1H8H G;  2LP7 A;  2WSS G;  5DN6 G;  2HJF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...