3UM7A

Crystal structure of the human two pore domain k+ ion channel traak (k2p4.1)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
266
structure length
259
Chain Sequence
RAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Crystal structure of the human K2P TRAAK, a lipid- and mechano-sensitive K+ ion channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 82
structure length 259
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3um7A01
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3um7A03
2WLNA 3RVYA 3E8FA 4LCUC 4MVSA 4R8CA 5KUMA 3WG7C 4WFHA 5J9PC 3LDEA 3F7YC 2ITCC 2HFEC 2WLLB 4X88A 2R9RB 3K0DA 3TCUA 2EIKC 2OCCC 2WLLA 3IFXA 1ORQC 2DWDC 2EINC 2WLMA 4R7CA 2JK5C 3FB6C 4GX5A 3ASOC 3K04A 4MTFA 3SYOA 2A0LA 1V55C 3STZC 2WLIB 4H33A 4LBEC 3RBZA 3RVZA 2BOCC 1J95A 1XL4A 4MW3A 2WLKA 3K0GA 4JTDB 2WLIA 3IGAC 4TWKA 5EBLC 4X8AA 3T1CA 4CBCA 1G4YB 2IH1C 2BOBC 4MTOA 2YEVA 5E1AC 4J9ZB 3LDCA 4MVRA 1S5HC 5B1BC 3LNMB 5EC1C 3UM7A 3OGCC 3K06A 5CBGA 4PDRA 4PDMA 4MS2A 3ASNC 2NLJC 2Q69A 2Q68A 2WLJA 5CBHA 4ZBMA 3JYCA 2EIMC 1M56C 3E89A 2DYRC 3EFFK 3SYPA 4OXSA 4JTAB 5KUKA 4PA7A 4XDJA 3E83A 4PA6A 3FB7C 1BL8A 1OCZC 4XDKA 3FB8C 3OR7C 1XL6A 2A9HA 3R65A 3E8GA 4G27B 4MVQA 4EKWA 3HPLC 4PA3A 1KKDA 5CBFA 3AG2C 2QTOA 3UKMA 4RO2A 2HVKC 2W0FC 2WLHA 4F4LA 4P9OA 4P30A 1K4DC 3T2MA 2EIJC 3FB5C 4QE9A 5EC2C 4PA4A 5BZBA 3LUTB 3AG3C 3OR6C 2AHZA 4GX2A 4G28B 4GX0A 3ABMC 1JVMA 4MVZA 2ATKC 3AG4C 3E8HA 2DWEC 4RUEA 3SYAA 2P7TC 4BW5A 4I9WA 3OUFA 2Q6AA 3T4ZA 1OCOC 3ZJZA 3TETA 4JTCB 3GB7C 3E8BA 3F5WC 4MVOA 4X89A 2EILC 3T4DA 3OUSA 4PDLA 4QE7A 3SYQA 3ZRSA 1ZWIC 2K1EA 5B3SC 2X6AA 3SYCA 4RUFA 4QNHB 4GX1A 4KFMA 4MW8A 3K03A 1R3IC 3SPHA 2HG5C 3AG1C 3E86A 3PJSK 2AHYA 3F7VC 3X2QC 1P7BA 4H37A 2QKSA 4J9YB 4WFFA 3RW0A 3K08A 1OCCC 5B1AC 4LP8A 1OCRC 3SPJA 2H8PC 2X6CA 5EBWC 2Y69C 5IY5C 3ABKC 3ABLC 4HZ3A 1R3LC 4XDLA 5EK0A 1K4CC 2Q67A 1V54C 2IH3C 2ITDC 3BEHA 4MSWC 5EBMC 4UUJC 4WFGA 4P9PA 2X6BA 2ZXWC 4MVUA 1R3KC 4HYOA 2ZD9A 3SJQC 4R6ZA 3VOUA 1QLEC 4MTGA 2DYSC 4MVMA 4WFEA 2HJFC 4PA9A 3SPIA 3SPGA 2HVJC 4PDVA 1M57C 3STLC 4P2ZA 1R3JC 4R50A 4DXWA 3LDDA 4RAIA 3SPCA 1LNQA 2A79B 2KB1A 3KG2A
chains in the Genus database with same CATH superfamily
3OTOO 1L0NH 1H2SB 5TISZ 1MG1A 3WG7C 4DUYB 1NTKH 4LF5O 1Q6UA 2GV9A 4NYKA 5JJNB 3TCUA 4GUNA 2JDIG 4I55A 2CTPA 4JV5B 2XAFA 2B9ZA 2ZE6A 2BCCH 2FMLA 4J9ZB 2PI4A 3S3XA 3ASNB 2Z0AA 4UCTA 3TK1A 2UUAB 5DM6V 1NTMH 1OCOB 4PDMA 4YXWG 5EZYB 2Q69A 3E89A 3BY6A 4OXSA 3SYPA 3SJAC 4CH5A 3TJTA 1S72V 2AGAA 3G4SV 2IJHA 4LF4O 1I94B 1K33A 2BTOA 5LOVB 3FX7A 3E22A 1IDSA 1HNWO 2EULA 3ZS8C 3RYHB 1XQ8A 3KCXA 3T2MA 3W7SA 4IYIA 2LJ2A 3DTUB 2QM7A 2PYJA 1AR1B 1PNKA 4GX2A 4B3MO 2BSKA 4JZGA 5GONA 2HHHO 1BHAA 1QLNA 5B5EZ 4QE7A 3OTFA 4JI6B 5B3SC 1ZWIC 2X6AA 5FPOA 1VQMV 4KFMA 2GBOA 3N27A 3AG1C 2DW4A 1OCRB 1Z5VA 3X2QC 3VQWA 3A0RA 2UXXA 3ZHRA 3NR7A 3ZIAG 3AEIA 4DR4B 1GN6A 3CC4V 1XOUA 2PGGA 3VOUA 4WFAV 1VF6C 2CUGA 4DR7O 4PDVA 1HNZB 3F5TA 5LHHA 2ZE7A 2MK3A 2QSAA 4Z1MG 1H38A 5A9GA 2PF4E 4JI1B 1G8MA 1L0LH 2WLNA 4LCUC 4K8XA 3F7YC 2JEUA 5JH7A 2R9RB 2OT5A 4FZ0A 5J2UB 1FJGO 1TVKA 3G6EV 5IJ9A 5JWPA 4U3FH 1XL4A 1Q7YW 2YIBD 5LMNO 1G6UA 5B1BC 3ZHSA 5LGTA 1N8RW 4B7EA 4RQEA 4WBNB 2NN4A 2WLJA 1OJHA 4X66B 2WSSG 1EBOA 3T1HO 4X62B 1AILA 1VQ5V 3M7MX 2P4VA 4LC1A 1O9HA 2Q7EA 2QTOA 2UUCO 1R6TA 3BCCH 3BHPA 4B3SB 1WB8A 1FXKA 1YDXA 3K5OA 4CS3A 1JVMA 3L71H 2ATKC 4CZZA 3JAKB 2P06A 1H2MA 1Q82W 3E8BA 2CGOA 3T4DA 3SGIA 1ZUQA 3WB2A 2R9IA 1BZKA 3CRMA 3P3PA 3CRAA 1NH2B 2Y0PA 3ABKB 3JCZA 2JS5A 1RFYA 4DR1O 5IY5C 1K7DA 4I5SA 4X20A 4I9QA 5LP6B 4ASUG 3OEHG 3HR0A 3UO3A 4FMTA 1PKXA 4DW1A 1J5EB 5EYPA 5FLXN 3BA9A 1XDCA 3UQ8A 2A79B 2PZSA 3JAWA 4DR5B 2QJ1A 4UB6Z 3CSXA 2X0LA 3TGUH 1VQKV 4R8CA 4LFCO 3E35A 1KD1W 1MZEA 1OCZB 2JS3A 4LR3A 1YVWA 4K8ZA 1V55C 1IBKO 3K5NA 1DLBA 2BOCC 2WLKA 4OX9O 1PL4A 1HR0B 1NVPB 2XAGA 2P4KA 3AG4B 1SZXA 2X7RB 4D7SA 4KHPB 4B08A 3I5DA 3JD0A 1Q86W 4JI2O 4FFBA 3BABA 2CH7A 4JAAA 1M5IA 3JATA 4E4EA 2EX3A 1QBZA 3E8GA 1E1RG 5LGUA 1M93A 1VARA 5H6RA 5KHKA 2RMKB 4X1IB 4TQFA 2A06H 3DXRB 3I55V 1AP5A 1SRYA 3A0BZ 2IJJA 3HKDB 4X65B 5LA6A 4I9WA 3OUFA 3T4ZA 4U7OA 2XTAA 4B3TB 1XI1A 3WB1A 2Z3YA 2QWPB 1KYOF 4LH7A 4WF9V 3D3QA 2IBZH 3F7VC 3HB3B 2QKSA 2B5UA 1CP9A 4O4IA 4TQDA 5B1AC 1XMQO 2UXBO 2UXDO 3ABLC 5A2QN 5LBQA 4LF7B 1R3KC 1VF6A 3B8MA 1XREA 1Y76A 3BA8A 5KAIZ 5KX5B 1B3QA 1XMOB 3SPCA 4TV8B 4DV3O 3TXSA 2HFEC 5D5PA 3G71V 3OD4A 1FAFA 2PUSA 1SA0B 1GKFA 3LSQA 2ZM6B 2EIKC 2WLLA 3IFXA 4CH3A 4JI3B 3ASOC 4E2LA 2A0LA 3OMIB 3QO5A 4K0KO 5BMVA 2RDCA 1GN3A 5IDJA 5KAFZ 4MTOA 5E1AC 1Y6XA 5EC1C 3ABTA 3HKCA 5GTHZ 2Y48A 2EIMC 1IBLO 2RCVA 1OV9A 3IAYA 3P3NA 3APQA 4PA7A 4WCEV 4PA6A 3K9AA 1WPBA 4G27B 3ZEDA 1E1QG 3K57A 5BR8O 2LW7A 4O4IB 4P9OA 2ZINA 1GTOA 3H1HH 5KLVH 4NXMB 4J7ZA 4UVAA 4YJ3B 4LFAB 2EILB 2QGNA 4DR3B 1W0KG 2AXTZ 3SJCC 5IJ0B 3SYQA 1BQZA 2VWJA 1URFA 4X64O 2XT9A 4YIPA 3VQXA 1IZ3A 1PP9H 2HR3A 4F6EA 4AQYB 1KC8W 3RW0A 1V54B 2HJDA 5CB4A 4QPJA 4HZ3A 3W7WA 3JD4A 2DMXA 3H9VA 2VQEB 1MOFA 2OTLV 2YIBA 4YJ2B 5IE9A 4GKJB 1RPRA 4MVMA 1IBMO 4ZKIA 4JF3A 2ARHA 3Q4HB 3CE2A 5EIBD 4DV5B 4GLXA 3EXAA 2ZNIA 4CC6A 3RYCA 4MVSA 1AI7A 2OCCB 4WFHA 2PYLA 4LFBB 5CA3A 3CEIA 2DQ3A 3HKEA 1SQFA 2L6LA 2QKCA 3STZC 4IHJB 4X1YB 1K92A 2OCHA 2QWRB 2WLIA 5LGNA 3CCJV 3L73H 2YXLA 4HBNA 1S77D 3ZHUA 1EFRG 2FKXA 3K06A 2C2AA 1R6KA 2NLJC 1NVPD 1K73W 2GTAA 2Q5ZA 3CRRA 4JI8B 3UT5B 2OWOA 1HNXO 1K8AW 4DV1O 2Q0AA 2YXHA 2ZKOA 3HPLC 4ZOLB 2EJRA 1M90W 2UU9B 3CRQA 4DV0B 1SQXH 1X59A 4FJCC 5LL6Y 1VQNV 1SQQH 5CA1A 1QR9A 4PELA 5LMUB 4DUYO 1N4CA 4UFZA 4IT5A 3T1YB 1XNRB 3F5WC 4X89A 4FFKA 4JPRA 4LF6B 4J42A 4L8JA 5DECA 2R72A 1ROPA 1OCCB 1QCEA 4JV5O 1VQLV 4BWAA 4WFFA 4JI5B 1N32O 3K08A 2VQFB 4ABMA 1AVMA 1EN6A 1YJNV 2ITDC 4JYAO 1SF9A 4WFGA 2K9PA 3CP1A 5FPRA 1DGSA 1K3EA 4F6RB 2HJFC 4EB6A 1YCIA 1WPXA 2N74A 2ZE8A 3CXHF 1Q43A 1I94O 2ZDIA 2RNBA 2HEPA 3OT7A 5IYDO 1S5LZ 1RSOA 2F4VB 2DWDC 2OTJV 3M99B 2EINC 2PY5A 4B3RB 1ENVA 4BR6A 3H1KH 4DW0A 4UV9A 5CA0B 4GZRB 4JI6O 1J95A 2CTRA 1QVFU 3K0GA 3IGAC 4TWKA 3SDLA 2GTSA 2P67A 4TUYB 2N05A 2YEVA 3LDCA 2QWNB 4UXNA 2Y0IA 1YF2A 3OGCC 3B40A 4KXRA 4MS2A 2W6IG 3JSLA 1NR1A 1MNGA 3K59A 1M56C 4TSFG 4X9QA 4O2AB 1L8DA 2DQ0A 2XAJA 3UKMA 1COWG 2YS8A 1JMKC 3ABMB 3ABLB 1HNZO 1MABG 1YJWV 4IIJA 5DN6G 4JI1O 1ZL8B 2D3OW 2KG7A 2NR5A 2P7TC 1SQVH 1U96A 4FZ1A 5CMUA 4PDLA 3OMAB 4I50A 4RUFA 2LO1A 3CRCA 5KMGB 4L87A 2XAQA 4QGPA 2F95B 1MA1A 1VEWA 4I4TA 1QLEB 4P9PA 4MTGA 1MSDA 1EN5A 2DYSC 4X66O 1Y66A 3TXQA 2XHBA 3APOA 1K97A 1JR9A 5ITZA 3LDDA 4X62O 4DV6O 4FPPA 2IW5A 3ZRWA 3C3TA 2UXCO 3ZRVA 3KG2A 1QHTA 3B4SA 1DF4A 4B3SO 4TV9A 4UCRA 4YIOA 4UVCA 3W7TA 2AZ2A 3G80A 3D36A 4I55B 3CPWU 1KP3A 1YIJV 2AW9A 4H0LB 1H8EG 1SZTA 3OTOB 3T1CA 1QVGU 1Y74A 3ML0A 3CCQV 1S5HC 4LF5B 5H9CA 2IU0A 3UM7A 2ETNA 1K9MW 2G38A 5CBHA 4ZBMA 5KA6A 4DUZB 1PL0A 2R9AA 1TA8A 2DYRC 2F66C 1PD3A 5L3DA 4UCOA 3MDSA 1F7YA 1VQ9V 3E22B 4BAYA 1J5EO 4PA3A 3AG2C 1RM1C 4JZ2A 5H2FZ 4YY3B 1BMFG 2BSKB 4DR5O 1FFXA 4O2BA 3SYAA 4LF9O 5GONB 1KMIZ 4JI7B 4JTCB 1IVSA 1HNWB 2WWWA 1XILA 4U7NA 4I0XA 4DK0A 2UUBB 2M7WA 1SETA 4PHZA 2CE4A 1GN2A 1HR0O 5C93A 1JFFA 4G2KA 1HDJA 3SPJA 2HHHB 1W0JG 2Y69C 2Q7GA 4Z1VA 5EK0A 1Z5WA 2YIDA 5EBMC 4DR2B 4O4HA 1XNQO 4UUJC 1NKDA 1IX9A 2NNUA 2ZD9A 3A2FA 1Q81W 1JX9A 2V1DA 3CCUV 4JI0B 3JD2A 1FFTB 5LYJA 3AK1A 1T5EA 4RWUA 3OFNG 3RVYA 2IM9A 2LGWA 2O57A 2QEXV 5JH7B 1N0JA 2ITCC 1YITV 1TVKB 5JQGA 2Q0OC 5IJ9B 4B7KA 4DR7B 3CX5F 2GUZA 3FB6C 4X65O 5KHGA 1IXBA 3K3WA 5LHGA 4MTFA 2ZNJA 1F4NA 5JJJB 4O4JA 1WP7A 1OZ0A 5LXTA 5DEDA 2BOBC 4MVRA 3CD6V 4HNAA 1N36B 4LNUA 3JALA 2EBOA 2FYUH 3CYOA 4OGQB 3GWKC 5FNVA 5BXZA 2QKAA 4W4KA 2Y4TA 2DN9A 1FKAO 4LF7O 4U3JA 5LMNB 4XDKA 3L74H 2QE7G 4DYLA 2A9HA 3R65A 4X1KA 1V9PA 1M1KW 2E75B 4GKKB 2HVKC 4TT3G 3RYFA 1FXKB 4TOIA 3LUTB 4GX0A 4NTWA 3ZMUA 1AR5A 2YI9A 4IL6Z 2YIAA 1NI8A 5K1XA 4UV8A 2EJ7A 3KCYA 3K03A 4JI3O 3E86A 1K5QA 1K34A 2AHYA 1SERA 1A32A 3NXSA 1P7BA 4J9YB 4FLVA 1R1BA 2M6YA 4ZHQA 3B8NA 1WLEA 2EINB 5IWAB 4X20B 3P32A 3RN4A 3W7UA 1K4CC 2GSMB 2KQXA 1SQGA 3ZHVA 2X6BA 2ZXWC 1JPXA 1ZSPA 2JIZG 5EYPB 2EZOA 3KKYA 2DOSA 4LH6A 3SPGA 1S3JA 3LNNA 4DXWA 4LWSA 3JAWB 4LNUB 3WG7B 1Q6IA 1X4TA 1CPYA 1W2BU 4YHHB 4FM0A 3OW2U 4NXMO 4UCUA 1TAEA 1WA8A 1SC5B 1ORQC 4LFAO 2JK5C 1VQ7V 1BCCH 4DV4O 3FKSG 1GK9A 4BIZA 4DR3O 4W4LA 3HKBA 4H33A 5IYZA 1Z2GA 2VRZA 2IH1C 4FLXA 2IU3A 5JVDA 3ZCCA 2ZDIC 4AQYO 4FFBB 1BE3H 2CH7B 2JGDA 4AHCA 2BTQA 1BQ0A 3ASNC 3BRCA 3JATB 2R70A 2YC0A 1NJIW 4PJ0Z 5GTIZ 5LHIA 4OX9B 2B1IA 2VQEO 4JI4O 3WB0A 5GW7A 4UCSA 3C90A 2Z5UA 4GKJO 3VBBA 4FM1A 2QWOB 1K4DC 3SJBC 1TUBA 3KZIZ 3OMNB 3ZHTA 2ZQMA 1FXVA 1GMGA 4A5UB 4MT8A 5LA6B 4RUEA 1SKVA 1Q8IA 1VIBA 2DYSB 3AG7A 4LFBO 5B3SB 3ZJZA 3TETA 2OYQA 3GB7C 4K35A 3THOA 3AG1B 1BS3A 4JAUA 1XEQA 2P22C 4GX1A 3FYEB 3X2QB 3DSQA 1R3IC 4DK1A 3PJSK 1P7GA 3DC6A 1KKCA 1YXBA 1OCRC 1OHHG 4EFBA 4FLYA 4ZI7A 3JASA 3RFRA 5HFLA 1Y76B 2FTKA 3HKBB 4NR1A 1HW7A 4WFEA 1SQBH 3JD1A 4JI8O 1R3JC 3VQVA 5KHJA 3BFRA 2UU9O 4DV0O 2WA4A 1S76D 2KB1A 3ZMTA 4ICGA 1P84F 2AZ0A 2DYRB 5C8YA 2WLLB 3A8TA 4JYCA 1FS0G 1IURA 1R6NA 2WLMA 3ETQA 1NH2D 4GX5A 2JJ2G 5LMUO 1FXHA 4AILC 3AG2B 1RM1B 2YUAA 3ETDA 3T1YO 1XNRO 4KUMA 3UCSC 5BMVB 3CC7V 3MD0A 5B1BB 1TUEB 4DV3B 4LF6O 3ETEA 4MW3A 3E2EA 2QA4V 2YSUB 2ADQB 1WN7A 1B6QA 2YXYA 4DRXA 1GRJA 3HKCB 5CBGA 4PDRA 3JARA 2WAMA 4FLWA 4JI5O 2VQFO 4BIUA 5JCOC 3EFFK 5J2TA 3E83A 3D36C 5B66Z 5CBFA 3CJHA 5L3BA 3QF7A 3ETGA 3ZN0A 2Y69B 2EIJC 1SESA 3FAVA 4PV1B 4PA4A 3AG3C 4G28B 4NVPA 3QVNA 3O9OA 5CN0A 4BW5A 3ZX6A 1XHXA 2F4VO 3OUSA 4PD4F 3S3WA 4LF8O 4MW8A 5IYBO 3WFVA 1NU1H 5IYCO 5IY5B 2GDSA 5CB4B 2HLDG 3U11A 2F23A 3ABKC 4XDLA 4BW9A 4MSWC 4HYOA 1E79G 4X64B 3P30A 1LUVA 2CAZC 2W0XA 3CMAV 5LP6C 3RGBA 4PA9A 3SPIA 1M57C 4FLZA 4P2ZA 5EIBC 2VS0A 4RAIA 3N2GA 3RYCB 1N33B 4EEQA 2N04A 2BE3A 1VQ4V 3GVMA 2XOKG 2UUAO 3HKEB 4DR6B 1IBMB 4RQFA 1V55B 2E76B 3R66A 2ZR2A 2WLIB 3K79A 3K9SA 4N23A 3L70H 2PTMA 4X8AA 1D5AA 1R73A 1I0HA 2P6JA 1Y67A 2B1GA 4J41A 4DV2B 3JD3A 3JYCA 5EZYA 4OPHA 1GM7A 4EKWA 1AI5A 3ICXA 5LOVA 3QG5A 4F4LA 3ZMSA 3CXCU 5B1OA 3RYHA 4J7JA 5CA1B 2E5LB 1D5NA 1AI6A 1D2DA 4MVZA 2Q8VA 2D2CB 4DV1B 1B04A 4DR4O 2F43G 1Y4MA 1YZBA 3SYCA 3CMEV 1P49A 4FK5C 1UJWB 2XNDG 5B1AB 3U10A 2LQTA 4LP8A 1UPGA 5AG2A 1R3LC 4NXNB 4UB8Z 4MTXA 3CS5A 4DUZO 4EB6B 1US6A 3CCEV 1VQ6V 1N32B 3K5MA 4PI0A 1N0NA 1Q90D 4JYAB 1RSOB 2EIKB 2H3OA 1VQPV 4YY3O 1BSMA 2JGUA 3ASOB 1EZJA 5J2UA 1AR4A 1PNLA 4JI7O 1DK1A 3D8CA 1QR8A 4KP4A 5KHHA 3CWBH 2LFRA 2LGQA 4JTDB 2YEVB 4J7KA 3SR2C 1N34B 2UUBO 1QNMA 3OM3B 3LNMB 2ZT9B 3C3SA 4DV7B 2EIMB 4NTXA 4CS2A 5JCOA 2YDEA 4WBNA 2Q7HA 3J7AU 3BVOA 4DR2O 5KUKA 2L35A 4XBFA 2P5OA 4MVQA 2OIEA 1PPJH 4JI0O 1VQ8V 1VF7A 2YI8A 2KKWA 4IIJB 4GYCB 2KG7B 1VP7A 4PI2A 3JAKA 1AP6A 1GAXA 4JYBA 4I50B 2EILC 1KQSU 3G6BA 4QNHB 1O9GA 2GHYA 3DGEA 3CB2A 2HG5C 2Q4PA 2HKOA 3OAAG 4H37A 3UO2A 1THZA 3CCLV 1YI2V 3L9DA 1IXMA 4I4TB 5BY1A 1AI4A 1N36O 2Q67A 1V54C 4IGGA 2A7WA 1M4UA 5LP6A 5K1PA 4LF4B 1KUQA 5ITZB 3GWOA 2YICA 3ZRWB 1NT2B 4UVBA 4B3MB 3BAAA 1NBMG 4CS4A 4GKKO 2RN9A 3E8FA 5KA5A 4TV9B 4H13B 4KHPO 3K0DA 2OCCC 1W59A 1YSCA 1AJNA 2CK3G 4DV6B 3K04A 1FD9A 2EIJB 4LBEC 4NB5A 3RBZA 1Y74B 1NR7A 2UXCB 5D5QA 2CTWA 1AB3A 3AG3B 1KECA 1G4YB 4NKGB 5KHIA 1YTFB 2QTSA 1S0VA 3PN1A 1GM8A 1JA8A 2MW2B 2ZIMA 5IWAO 2FB5A 3ZRXA 1HP8A 1M9NA 1XL6A 5FL7G 2Y4UA 4B3TO 4RO2A 4EFEA 3ZHQA 1NQTA 3OEEG 2FL4A 4X1IA 2AHZA 1FFXB 3DXRA 4FVMA 4O2BB 1FJGB 3M8AA 1GO3F 4YHHO 4QIWF 3HKDA 1M57B 1I5YA 4I0XB 3ZRSA 3SPHA 1JFFB 2XAHA 2H94A 3H1IH 1KP2A 4LF9B 1XMOO 1OCCC 1EN4A 1F4MA 2DJVA 1MSWD 4O4HB 2UXNA 3STLC 1P4RA 2IH3C 5E79Z 1MZFA 2PI5A 2CDYA 3T1HB 1H2LA 3VQYA 2ZR3A 1JQ0A 4HAMA 2ZM6O 2ODMA 3IC9A 5LYJB 1H2NA 1VMGA 4J10A 2UUCB 3ZN1A 4CH4A 4Q20A 2A3QA 5KX5A 3AK2A 2JVDA 4TV8A 1XNQB 1JOYA 1EM1A 5JQGB 2GUZB 4X88A 1SA0A 2RQ6A 3QO8A 4R7CA 2CTQA 1YEWA 1I5XA 2DE0X 4O4JB 2ILMA 3G67A 4CH6A 5LXTB 3RVZA 2LP7A 4CBCA 3L75H 4UCVA 4HNAB 3JALB 2QWQB 1G1XB 4DR1B 1AJQA 1WNSA 4FLTA 1FYJA 2QM8A 5FNVB 1M56B 3ZBHA 4D7TA 1JJOA 1MMMA 2JJ1G 2Q73A 1PNMA 4U3JB 3N2KA 4AI8A 4X1KB 3FB8C 1Q6HA 4QPKA 1KKDA 3RYFB 1ZX3A 1AROP 4P30A 4LFCB 3RT3C 2OIGA 4QE9A 4J80A 3L72H 1VF5B 2Q9LA 3ABMC 5B1NA 4DO2A 4CC5A 2DWEC 4NTYA 4KL1A 3B09A 4YJ3A 1OCOC 1UFIA 1IBKB 3IC7A 3A0HZ 1GN4A 1F51A 1NS1A 2XUMA 5IJ0A 3CCVV 2ADPA 5F2VO 3CCMV 4ZHQB 3J80N 1NTZH 1QU7A 4JI2B 3D3IA 2V7QG 2QR4A 4DV5O 2JEXA 3BEHA 4MVUA 1Q5OA 1QLEC 1F23A 1TGOA 4Q6GA 4YJ2A 2HVJC 1H8HG 3RYIA 4LWSB 3ZMZA 3RWRD 2W6JG 4I7ZB 3Q4HA 1XUQA 1BT8A 2WPDG 5J9PC 2HP8A 3LDEA 4JASA 1WA8B 2WA3A 3FFQA 1ZTEA 3N2KB 3I56V 3ABUA 3W7XA 1QQCA 5IT9N 4GT1A 5IYZB 4IHJA 3CCRV 4X1YA 5JVDB 1XMQB 2UXBB 2UXDB 3CHXA 2JGDB 1HWYA 2BTQB 1KU9A 1AJPA 4DV4B 3JCUZ 3CC2V 2JRIA 1YHQV 1YTFD 1DTOA 4XDJA 2KSDA 1BL8A 3UT5A 4BIOA 1I08A 1WJZA 4ZIBA 1TUBB 4ZOLA 2W0FC 3ZMVA 2F93B 3FB5C 3QO7A 1B06A 1PV0A 4OPAA 1N33O 3H1JH 3E8HA 3AK3A 3FD9A 1BGYH 2IJKA 2E74B 4JI4B 1SS3A 4DR6O 3RYIB 4K0KB 1I7FA 2K1EA 2QDOA 3EHBB 3BPZA 1H2KA 4IYHA 1DF5A 3WU2Z 3U0ZA 3JAMN 3QTCA 1LUWA 2H8PC 1IBLB 4ZI7B 2LFSA 1WAZA 3JASB 5L3FA 3OGIB 1GM9A 4DV2O 5L3CA 1CXZB 5JJEB 4F6RA 1K5SA 3B77A 5BR8B 3CCSV 4B3RO 4WFBV 1EZVH 3QNEA 2QM4A 2ZE5A 5L3GA 3H1LH 2IJIA 4H44B 1ZLZA 4O4LA 1WP8A 5KUMA 5C8YB 1NZ6A 2E5LO 3DC5A 2E3CA 1KB9F 5H5NA 2ZIOA 4QJFB 3K5LA 2CGNA 3SYOA 1FPOA 2VWKA 1S5JA 4JYYA 5EBLC 5CA0A 4GCZA 2RJZA 3LSUA 4DRXB 1ZAUA 4TUYA 3JARB 1WB7A 1H2GA 1L1FA 3O65A 2Q68A 3B2EE 4JGSA 5J2TB 3FYIB 3MHSC 4Z2WA 1U97A 1VQOV 4NXNO 4JTAB 4D6TH 4O2AA 4FM2A 3FB7C 1OCZC 4FLUA 3OR7C 1Q3EA 3CJHB 1JJ2U 1BHBA 4JAVA 3K58A 2WLHA 3MAQA 2EZPA 3FAVB 3JSNA 1GH6A 5EC2C 1KBHA 3MHHC 5BZBA 3OR6C 1XBLA 3AG4C 1FXKC 5HFMA 1ZL8A 2Q6AA 5L3EA 2ZCEA 4MVOA 1SQPH 4K3AA 1XHZA 4FIPC 1PM9A 2LW1A 1RP3B 4O4LB 1LR1A 3IJ4A 5KMGA 4N21A 1RPOA 3OE7G 3EVKA 1N34O 2V4DA 2ZXWB 2X6CA 5EBWC 1CEZA 1JCHA 3LSSA 4DV7O 3J81N 1YJ9V 1HNXB 5H6QA 2P90A 3SJQC 4LF8B 4R6ZA 4C7UA 4J11A 3H01A 3N2GB 2F1MA 4R50A 1LNQA 2XASA
chains in the Genus database with same CATH topology
3E8FA 4MVSA 1MG1A 3WG7C 5KA5A 1AI7A 2OCCB 4WFHA 1W2BU 3OW2U 3K0DA 3TCUA 2OCCC 1ORQC 1YSCA 5CA3A 1AJNA 2DQ3A 2JDIG 2JK5C 1VQ7V 3FKSG 2CK3G 3K04A 1GK9A 4BIZA 3STZC 2EIJB 4H33A 4LBEC 3RBZA 1NR7A 1K92A 2XAFA 2WLIA 3AG3B 5LGNA 3CCJV 1KECA 1G4YB 2IH1C 2PI4A 4J9ZB 2IU3A 3ASNB 1S77D 3ZCCA 1YTFB 3TK1A 2ZDIC 1EFRG 1S0VA 3K06A 5DM6V 2C2AA 1OCOB 1R6KA 1GM8A 4PDMA 4YXWG 3ASNC 2NLJC 2Q69A 1NVPD 1K73W 1NJIW 3E89A 3ZRXA 3BY6A 4OXSA 3SYPA 5LHIA 1K8AW 2B1IA 1S72V 5GW7A 3G4SV 2IJHA 1M9NA 1XL6A 5FL7G 2Z5UA 1K33A 3HPLC 3VBBA 1M90W 2EJRA 4RO2A 1K4DC 3T2MA 4FJCC 3W7SA 3OMNB 1NQTA 3DTUB 3OEEG 2QM7A 2ZQMA 1VQNV 1FXVA 1GMGA 1PNKA 2AHZA 4GX2A 1AR1B 4MT8A 1QR9A 4PELA 4RUEA 1GO3F 2DYSB 4QIWF 5B3SB 3ZJZA 3TETA 1BHAA 1M57B 1QLNA 1I5YA 3GB7C 3F5WC 4X89A 4JPRA 4QE7A 3AG1B 1ZWIC 3ZRSA 5B3SC 2X6AA 4JAUA 4GX1A 3FYEB 4KFMA 3X2QB 1VQMV 1R3IC 3SPHA 3AG1C 3PJSK 1ROPA 1OCCB 1QCEA 2DW4A 1OCRB 3X2QC 1VQLV 2XAHA 4WFFA 2H94A 3A0RA 1KP2A 2UXXA 3K08A 1OCCC 1OCRC 1F4MA 1OHHG 1MSWD 1YJNV 3ZIAG 3AEIA 2UXNA 3STLC 1P4RA 2IH3C 2ITDC 3CC4V 4WFGA 2PI5A 3CP1A 5HFLA 2ZR3A 2FTKA 3VOUA 1JQ0A 1K3EA 4HAMA 4WFAV 4WFEA 2HJFC 3JD1A 4PDVA 3ZN1A 1WPXA 1R3JC 5LHHA 4Q20A 2MK3A 2ZDIA 4Z1MG 1H38A 1S76D 2KB1A 3ZMTA 1G8MA 2WLNA 4LCUC 1JOYA 5IYDO 2DYRB 3F7YC 2JEUA 2WLLB 4JYCA 2R9RB 1FS0G 2OT5A 4X88A 2DWDC 2OTJV 3M99B 2EINC 3G6EV 1R6NA 2WLMA 3QO8A 4R7CA 4GX5A 1ENVA 2JJ2G 1NH2D 1FXHA 3AG2B 1RM1B 4UV9A 1I5XA 3ETDA 4KUMA 3CC7V 3MD0A 5B1BB 1TUEB 3RVZA 2LP7A 1J95A 3ETEA 1XL4A 4MW3A 1QVFU 3K0GA 2QA4V 3IGAC 4TWKA 4CBCA 1Q7YW 3E2EA 2YSUB 2P67A 5B1BC 2YEVA 3LDCA 1AJQA 5LGTA 4UXNA 1N8RW 1B6QA 4RQEA 3OGCC 5CBGA 4PDRA 4MS2A 2QM8A 2WAMA 1M56B 2W6IG 2WLJA 1NR1A 4BIUA 2JJ1G 1PNMA 1M56C 4TSFG 2WSSG 3EFFK 1EBOA 2DQ0A 3E83A 1VQ5V 3FB8C 2XAJA 4QPKA 4LC1A 1KKDA 5CBFA 2QTOA 1COWG 3UKMA 5L3BA 3ETGA 1AROP 4P30A 3ZN0A 2Y69B 3ABMB 3ABLB 2EIJC 4QE9A 1SESA 4PA4A 1MABG 3AG3C 4G28B 1FXKA 1YJWV 3ABMC 5B1NA 1JVMA 4DO2A 5DN6G 2ATKC 4CZZA 2DWEC 2D3OW 5CN0A 2P7TC 4BW5A 1Q82W 1OCOC 3E8BA 3IC7A 5CMUA 3T4DA 3OUSA 4PDLA 1F51A 3OMAB 4RUFA 3CCVV 2R9IA 4MW8A 5IYBO 3WFVA 4L87A 2XAQA 5IYCO 1NH2B 5IY5B 3CCMV 3ABKB 2HLDG 3D3IA 3JCZA 2V7QG 5IY5C 3ABKC 2JEXA 4XDLA 1K7DA 3BEHA 4I5SA 1QLEB 4MSWC 4P9PA 4MVUA 4ASUG 4HYOA 1E79G 3OEHG 3P30A 4FMTA 1PKXA 1F23A 1QLEC 4MTGA 3CMAV 2DYSC 4PA9A 3SPIA 1Y66A 1H8HG 2HVJC 1M57C 3ZMZA 4P2ZA 1K97A 3LDDA 4RAIA 2W6JG 2IW5A 4FPPA 3ZRWA 2A79B 3ZRVA 2X0LA 3KG2A 1VQKV 4R8CA 2WPDG 3E35A 5J9PC 1DF4A 3LDEA 1VQ4V 4JASA 1KD1W 2XOKG 4UVCA 3W7TA 1OCZB 4RQFA 3I56V 3ABUA 1V55B 3D36A 3W7XA 3CPWU 1KP3A 1YIJV 4GT1A 1V55C 2ZR2A 2WLIB 1H8EG 3K79A 1DLBA 2BOCC 4N23A 2WLKA 1SZTA 3T1CA 1QVGU 4X8AA 3CCRV 1NVPB 1R73A 2XAGA 3AG4B 3ML0A 3CCQV 1S5HC 2P6JA 2X7RB 5H9CA 2IU0A 2B1GA 3UM7A 1HWYA 3JD0A 1AJPA 1K9MW 1Q86W 3JD3A 4ZBMA 3JYCA 5CBHA 5KA6A 3CC2V 1PL0A 1YHQV 2DYRC 1YTFD 1DTOA 1PD3A 5L3DA 1GM7A 4XDJA 1BL8A 1QBZA 1VQ9V 3E8GA 4EKWA 4BAYA 1E1RG 4PA3A 5LGUA 3AG2C 1RM1C 1AI5A 5H6RA 2W0FC 4F4LA 3ZMSA 3ZMVA 3CXCU 5B1OA 3FB5C 3QO7A 1BMFG 3I55V 1AI6A 4MVZA 3E8HA 1SRYA 2IJJA 3SYAA 2IJKA 4I9WA 3OUFA 3T4ZA 4JTCB 4U7OA 2F43G 1Y4MA 2WWWA 4U7NA 2K1EA 3EHBB 3SYCA 3CMEV 2Z3YA 4FK5C 1UJWB 2XNDG 4WF9V 1DF5A 5B1AB 3F7VC 3HB3B 2M7WA 1SETA 2B5UA 2QKSA 1CP9A 5C93A 5B1AC 4G2KA 4LP8A 3SPJA 2H8PC 1W0JG 2LFSA 2Y69C 3ABLC 1R3LC 5EK0A 5EBMC 5L3FA 5LBQA 4UUJC 1NKDA 1R3KC 2NNUA 2ZD9A 1GM9A 4MTXA 1Q81W 1JX9A 2V1DA 3B8MA 3CCUV 5L3CA 3JD2A 1FFTB 1K5SA 3B77A 1VQ6V 3CCEV 3CCSV 4WFBV 3QNEA 3SPCA 5L3GA 2IJIA 2HFEC 3G71V 3OFNG 3RVYA 5KUMA 2EIKB 1VQPV 2QEXV 2ITCC 1YITV 1GKFA 3LSQA 2EIKC 2WLLA 3IFXA 3ASOB 1EZJA 3FB6C 4QJFB 1PNLA 3K3WA 5LHGA 3ASOC 4MTFA 1QR8A 3SYOA 4KP4A 4E2LA 2A0LA 3OMIB 2LFRA 3QO5A 1F4NA 1OZ0A 5EBLC 5IDJA 4JTDB 2YEVB 4GCZA 4MTOA 2BOBC 5E1AC 4MVRA 3CD6V 3OM3B 3LNMB 5EC1C 1H2GA 1L1FA 2EBOA 2EIMB 3CYOA 3ABTA 2Q68A 2Y48A 2EIMC 4JGSA 3FYIB 3MHSC 1VQOV 5KUKA 4JTAB 4PA7A 4WCEV 4PA6A 3K9AA 4XBFA 3FB7C 4XDKA 1OCZC 2QE7G 3OR7C 2A9HA 3R65A 4G27B 4MVQA 1JJ2U 1E1QG 1BHBA 1M1KW 1VQ8V 4JAVA 2HVKC 2WLHA 2EZPA 4P9OA 4TT3G 1GTOA 1FXKB 5EC2C 3MHHC 5BZBA 3LUTB 3OR6C 4GX0A 4UVAA 3ZMUA 3AG4C 1FXKC 5HFMA 2EILB 2Q6AA 5L3EA 1W0KG 4JYBA 4MVOA 2EILC 3SYQA 1KQSU 4UV8A 4QNHB 2GHYA 3DGEA 3K03A 4FIPC 2HG5C 3E86A 1K5QA 2HR3A 1K34A 2AHYA 2HKOA 1KC8W 1SERA 3OAAG 3NXSA 1P7BA 4H37A 4J9YB 1THZA 3RW0A 3CCLV 1YI2V 4N21A 1RPOA 1V54B 3OE7G 1IXMA 3B8NA 1WLEA 2EINB 4QPJA 1AI4A 2X6CA 2ZXWB 5EBWC 1JCHA 1CEZA 4HZ3A 3P32A 3LSSA 3W7UA 1K4CC 2GSMB 1V54C 2Q67A 3W7WA 3JD4A 2X6BA 1YJ9V 2ZXWC 5H6QA 1JPXA 1MOFA 2OTLV 2P90A 2JIZG 3SJQC 4R6ZA 2EZOA 1RPRA 4MVMA 4ZKIA 3SPGA 1S3JA 3H01A 3GWOA 4JF3A 4R50A 4DXWA 3ZRWB 1LNQA 3WG7B 4UVBA 1CPYA 2XASA 1NBMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLN A;  3RVY A;  3E8F A;  4LCU C;  4MVS A;  4R8C A;  5KUM A;  3WG7 C;  4WFH A;  5J9P C;  3LDE A;  3F7Y C;  2ITC C;  2HFE C;  2WLL B;  4X88 A;  2R9R B;  3K0D A;  3TCU A;  2EIK C;  2OCC C;  2WLL A;  3IFX A;  1ORQ C;  2DWD C;  2EIN C;  2WLM A;  4R7C A;  2JK5 C;  3FB6 C;  4GX5 A;  3ASO C;  3K04 A;  4MTF A;  3SYO A;  2A0L A;  1V55 C;  3STZ C;  2WLI B;  4H33 A;  4LBE C;  3RBZ A;  3RVZ A;  2BOC C;  1J95 A;  1XL4 A;  4MW3 A;  2WLK A;  3K0G A;  4JTD B;  2WLI A;  3IGA C;  4TWK A;  5EBL C;  4X8A A;  3T1C A;  4CBC A;  1G4Y B;  2IH1 C;  2BOB C;  4MTO A;  2YEV A;  5E1A C;  4J9Z B;  3LDC A;  4MVR A;  1S5H C;  5B1B C;  3LNM B;  5EC1 C;  3UM7 A;  3OGC C;  3K06 A;  5CBG A;  4PDR A;  4PDM A;  4MS2 A;  3ASN C;  2NLJ C;  2Q69 A;  2Q68 A;  2WLJ A;  5CBH A;  4ZBM A;  3JYC A;  2EIM C;  1M56 C;  3E89 A;  2DYR C;  3EFF K;  3SYP A;  4OXS A;  4JTA B;  5KUK A;  4PA7 A;  4XDJ A;  3E83 A;  4PA6 A;  3FB7 C;  1BL8 A;  1OCZ C;  4XDK A;  3FB8 C;  3OR7 C;  1XL6 A;  2A9H A;  3R65 A;  3E8G A;  4G27 B;  4MVQ A;  4EKW A;  3HPL C;  4PA3 A;  1KKD A;  5CBF A;  3AG2 C;  2QTO A;  3UKM A;  4RO2 A;  2HVK C;  2W0F C;  2WLH A;  4F4L A;  4P9O A;  4P30 A;  1K4D C;  3T2M A;  2EIJ C;  3FB5 C;  4QE9 A;  5EC2 C;  4PA4 A;  5BZB A;  3LUT B;  3AG3 C;  3OR6 C;  2AHZ A;  4GX2 A;  4G28 B;  4GX0 A;  3ABM C;  1JVM A;  4MVZ A;  2ATK C;  3AG4 C;  3E8H A;  2DWE C;  4RUE A;  3SYA A;  2P7T C;  4BW5 A;  4I9W A;  3OUF A;  2Q6A A;  3T4Z A;  1OCO C;  3ZJZ A;  3TET A;  4JTC B;  3GB7 C;  3E8B A;  3F5W C;  4MVO A;  4X89 A;  2EIL C;  3T4D A;  3OUS A;  4PDL A;  4QE7 A;  3SYQ A;  3ZRS A;  1ZWI C;  2K1E A;  5B3S C;  2X6A A;  3SYC A;  4RUF A;  4QNH B;  4GX1 A;  4KFM A;  4MW8 A;  3K03 A;  1R3I C;  3SPH A;  2HG5 C;  3AG1 C;  3E86 A;  3PJS K;  2AHY A;  3F7V C;  3X2Q C;  1P7B A;  4H37 A;  2QKS A;  4J9Y B;  4WFF A;  3RW0 A;  3K08 A;  1OCC C;  5B1A C;  4LP8 A;  1OCR C;  3SPJ A;  2H8P C;  2X6C A;  5EBW C;  2Y69 C;  5IY5 C;  3ABK C;  3ABL C;  4HZ3 A;  1R3L C;  4XDL A;  5EK0 A;  1K4C C;  2Q67 A;  1V54 C;  2IH3 C;  2ITD C;  3BEH A;  4MSW C;  5EBM C;  4UUJ C;  4WFG A;  4P9P A;  2X6B A;  2ZXW C;  4MVU A;  1R3K C;  4HYO A;  2ZD9 A;  3SJQ C;  4R6Z A;  3VOU A;  1QLE C;  4MTG A;  2DYS C;  4MVM A;  4WFE A;  2HJF C;  4PA9 A;  3SPI A;  3SPG A;  2HVJ C;  4PDV A;  1M57 C;  3STL C;  4P2Z A;  1R3J C;  4R50 A;  4DXW A;  3LDD A;  4RAI A;  3SPC A;  1LNQ A;  2A79 B;  2KB1 A;  3KG2 A; 
#chains in the Genus database with same CATH topology
 3OTO O;  1L0N H;  1H2S B;  5TIS Z;  1MG1 A;  3WG7 C;  4DUY B;  1NTK H;  4LF5 O;  1Q6U A;  2GV9 A;  4NYK A;  5JJN B;  3TCU A;  4GUN A;  2JDI G;  4I55 A;  2CTP A;  4JV5 B;  2XAF A;  2B9Z A;  2ZE6 A;  2BCC H;  2FML A;  4J9Z B;  2PI4 A;  3S3X A;  3ASN B;  2Z0A A;  4UCT A;  3TK1 A;  2UUA B;  5DM6 V;  1NTM H;  1OCO B;  4PDM A;  4YXW G;  5EZY B;  2Q69 A;  3E89 A;  3BY6 A;  4OXS A;  3SYP A;  3SJA C;  4CH5 A;  3TJT A;  1S72 V;  2AGA A;  3G4S V;  2IJH A;  4LF4 O;  1I94 B;  1K33 A;  2BTO A;  5LOV B;  3FX7 A;  3E22 A;  1IDS A;  1HNW O;  2EUL A;  3ZS8 C;  3RYH B;  1XQ8 A;  3KCX A;  3T2M A;  3W7S A;  4IYI A;  2LJ2 A;  3DTU B;  2QM7 A;  2PYJ A;  1AR1 B;  1PNK A;  4GX2 A;  4B3M O;  2BSK A;  4JZG A;  5GON A;  2HHH O;  1BHA A;  1QLN A;  5B5E Z;  4QE7 A;  3OTF A;  4JI6 B;  5B3S C;  1ZWI C;  2X6A A;  5FPO A;  1VQM V;  4KFM A;  2GBO A;  3N27 A;  3AG1 C;  2DW4 A;  1OCR B;  1Z5V A;  3X2Q C;  3VQW A;  3A0R A;  2UXX A;  3ZHR A;  3NR7 A;  3ZIA G;  3AEI A;  4DR4 B;  1GN6 A;  3CC4 V;  1XOU A;  2PGG A;  3VOU A;  4WFA V;  1VF6 C;  2CUG A;  4DR7 O;  4PDV A;  1HNZ B;  3F5T A;  5LHH A;  2ZE7 A;  2MK3 A;  2QSA A;  4Z1M G;  1H38 A;  5A9G A;  2PF4 E;  4JI1 B;  1G8M A;  1L0L H;  2WLN A;  4LCU C;  4K8X A;  3F7Y C;  2JEU A;  5JH7 A;  2R9R B;  2OT5 A;  4FZ0 A;  5J2U B;  1FJG O;  1TVK A;  3G6E V;  5IJ9 A;  5JWP A;  4U3F H;  1XL4 A;  1Q7Y W;  2YIB D;  5LMN O;  1G6U A;  5B1B C;  3ZHS A;  5LGT A;  1N8R W;  4B7E A;  4RQE A;  4WBN B;  2NN4 A;  2WLJ A;  1OJH A;  4X66 B;  2WSS G;  1EBO A;  3T1H O;  4X62 B;  1AIL A;  1VQ5 V;  3M7M X;  2P4V A;  4LC1 A;  1O9H A;  2Q7E A;  2QTO A;  2UUC O;  1R6T A;  3BCC H;  3BHP A;  4B3S B;  1WB8 A;  1FXK A;  1YDX A;  3K5O A;  4CS3 A;  1JVM A;  3L71 H;  2ATK C;  4CZZ A;  3JAK B;  2P06 A;  1H2M A;  1Q82 W;  3E8B A;  2CGO A;  3T4D A;  3SGI A;  1ZUQ A;  3WB2 A;  2R9I A;  1BZK A;  3CRM A;  3P3P A;  3CRA A;  1NH2 B;  2Y0P A;  3ABK B;  3JCZ A;  2JS5 A;  1RFY A;  4DR1 O;  5IY5 C;  1K7D A;  4I5S A;  4X20 A;  4I9Q A;  5LP6 B;  4ASU G;  3OEH G;  3HR0 A;  3UO3 A;  4FMT A;  1PKX A;  4DW1 A;  1J5E B;  5EYP A;  5FLX N;  3BA9 A;  1XDC A;  3UQ8 A;  2A79 B;  2PZS A;  3JAW A;  4DR5 B;  2QJ1 A;  4UB6 Z;  3CSX A;  2X0L A;  3TGU H;  1VQK V;  4R8C A;  4LFC O;  3E35 A;  1KD1 W;  1MZE A;  1OCZ B;  2JS3 A;  4LR3 A;  1YVW A;  4K8Z A;  1V55 C;  1IBK O;  3K5N A;  1DLB A;  2BOC C;  2WLK A;  4OX9 O;  1PL4 A;  1HR0 B;  1NVP B;  2XAG A;  2P4K A;  3AG4 B;  1SZX A;  2X7R B;  4D7S A;  4KHP B;  4B08 A;  3I5D A;  3JD0 A;  1Q86 W;  4JI2 O;  4FFB A;  3BAB A;  2CH7 A;  4JAA A;  1M5I A;  3JAT A;  4E4E A;  2EX3 A;  1QBZ A;  3E8G A;  1E1R G;  5LGU A;  1M93 A;  1VAR A;  5H6R A;  5KHK A;  2RMK B;  4X1I B;  4TQF A;  2A06 H;  3DXR B;  3I55 V;  1AP5 A;  1SRY A;  3A0B Z;  2IJJ A;  3HKD B;  4X65 B;  5LA6 A;  4I9W A;  3OUF A;  3T4Z A;  4U7O A;  2XTA A;  4B3T B;  1XI1 A;  3WB1 A;  2Z3Y A;  2QWP B;  1KYO F;  4LH7 A;  4WF9 V;  3D3Q A;  2IBZ H;  3F7V C;  3HB3 B;  2QKS A;  2B5U A;  1CP9 A;  4O4I A;  4TQD A;  5B1A C;  1XMQ O;  2UXB O;  2UXD O;  3ABL C;  5A2Q N;  5LBQ A;  4LF7 B;  1R3K C;  1VF6 A;  3B8M A;  1XRE A;  1Y76 A;  3BA8 A;  5KAI Z;  5KX5 B;  1B3Q A;  1XMO B;  3SPC A;  4TV8 B;  4DV3 O;  3TXS A;  2HFE C;  5D5P A;  3G71 V;  3OD4 A;  1FAF A;  2PUS A;  1SA0 B;  1GKF A;  3LSQ A;  2ZM6 B;  2EIK C;  2WLL A;  3IFX A;  4CH3 A;  4JI3 B;  3ASO C;  4E2L A;  2A0L A;  3OMI B;  3QO5 A;  4K0K O;  5BMV A;  2RDC A;  1GN3 A;  5IDJ A;  5KAF Z;  4MTO A;  5E1A C;  1Y6X A;  5EC1 C;  3ABT A;  3HKC A;  5GTH Z;  2Y48 A;  2EIM C;  1IBL O;  2RCV A;  1OV9 A;  3IAY A;  3P3N A;  3APQ A;  4PA7 A;  4WCE V;  4PA6 A;  3K9A A;  1WPB A;  4G27 B;  3ZED A;  1E1Q G;  3K57 A;  5BR8 O;  2LW7 A;  4O4I B;  4P9O A;  2ZIN A;  1GTO A;  3H1H H;  5KLV H;  4NXM B;  4J7Z A;  4UVA A;  4YJ3 B;  4LFA B;  2EIL B;  2QGN A;  4DR3 B;  1W0K G;  2AXT Z;  3SJC C;  5IJ0 B;  3SYQ A;  1BQZ A;  2VWJ A;  1URF A;  4X64 O;  2XT9 A;  4YIP A;  3VQX A;  1IZ3 A;  1PP9 H;  2HR3 A;  4F6E A;  4AQY B;  1KC8 W;  3RW0 A;  1V54 B;  2HJD A;  5CB4 A;  4QPJ A;  4HZ3 A;  3W7W A;  3JD4 A;  2DMX A;  3H9V A;  2VQE B;  1MOF A;  2OTL V;  2YIB A;  4YJ2 B;  5IE9 A;  4GKJ B;  1RPR A;  4MVM A;  1IBM O;  4ZKI A;  4JF3 A;  2ARH A;  3Q4H B;  3CE2 A;  5EIB D;  4DV5 B;  4GLX A;  3EXA A;  2ZNI A;  4CC6 A;  3RYC A;  4MVS A;  1AI7 A;  2OCC B;  4WFH A;  2PYL A;  4LFB B;  5CA3 A;  3CEI A;  2DQ3 A;  3HKE A;  1SQF A;  2L6L A;  2QKC A;  3STZ C;  4IHJ B;  4X1Y B;  1K92 A;  2OCH A;  2QWR B;  2WLI A;  5LGN A;  3CCJ V;  3L73 H;  2YXL A;  4HBN A;  1S77 D;  3ZHU A;  1EFR G;  2FKX A;  3K06 A;  2C2A A;  1R6K A;  2NLJ C;  1NVP D;  1K73 W;  2GTA A;  2Q5Z A;  3CRR A;  4JI8 B;  3UT5 B;  2OWO A;  1HNX O;  1K8A W;  4DV1 O;  2Q0A A;  2YXH A;  2ZKO A;  3HPL C;  4ZOL B;  2EJR A;  1M90 W;  2UU9 B;  3CRQ A;  4DV0 B;  1SQX H;  1X59 A;  4FJC C;  5LL6 Y;  1VQN V;  1SQQ H;  5CA1 A;  1QR9 A;  4PEL A;  5LMU B;  4DUY O;  1N4C A;  4UFZ A;  4IT5 A;  3T1Y B;  1XNR B;  3F5W C;  4X89 A;  4FFK A;  4JPR A;  4LF6 B;  4J42 A;  4L8J A;  5DEC A;  2R72 A;  1ROP A;  1OCC B;  1QCE A;  4JV5 O;  1VQL V;  4BWA A;  4WFF A;  4JI5 B;  1N32 O;  3K08 A;  2VQF B;  4ABM A;  1AVM A;  1EN6 A;  1YJN V;  2ITD C;  4JYA O;  1SF9 A;  4WFG A;  2K9P A;  3CP1 A;  5FPR A;  1DGS A;  1K3E A;  4F6R B;  2HJF C;  4EB6 A;  1YCI A;  1WPX A;  2N74 A;  2ZE8 A;  3CXH F;  1Q43 A;  1I94 O;  2ZDI A;  2RNB A;  2HEP A;  3OT7 A;  5IYD O;  1S5L Z;  1RSO A;  2F4V B;  2DWD C;  2OTJ V;  3M99 B;  2EIN C;  2PY5 A;  4B3R B;  1ENV A;  4BR6 A;  3H1K H;  4DW0 A;  4UV9 A;  5CA0 B;  4GZR B;  4JI6 O;  1J95 A;  2CTR A;  1QVF U;  3K0G A;  3IGA C;  4TWK A;  3SDL A;  2GTS A;  2P67 A;  4TUY B;  2N05 A;  2YEV A;  3LDC A;  2QWN B;  4UXN A;  2Y0I A;  1YF2 A;  3OGC C;  3B40 A;  4KXR A;  4MS2 A;  2W6I G;  3JSL A;  1NR1 A;  1MNG A;  3K59 A;  1M56 C;  4TSF G;  4X9Q A;  4O2A B;  1L8D A;  2DQ0 A;  2XAJ A;  3UKM A;  1COW G;  2YS8 A;  1JMK C;  3ABM B;  3ABL B;  1HNZ O;  1MAB G;  1YJW V;  4IIJ A;  5DN6 G;  4JI1 O;  1ZL8 B;  2D3O W;  2KG7 A;  2NR5 A;  2P7T C;  1SQV H;  1U96 A;  4FZ1 A;  5CMU A;  4PDL A;  3OMA B;  4I50 A;  4RUF A;  2LO1 A;  3CRC A;  5KMG B;  4L87 A;  2XAQ A;  4QGP A;  2F95 B;  1MA1 A;  1VEW A;  4I4T A;  1QLE B;  4P9P A;  4MTG A;  1MSD A;  1EN5 A;  2DYS C;  4X66 O;  1Y66 A;  3TXQ A;  2XHB A;  3APO A;  1K97 A;  1JR9 A;  5ITZ A;  3LDD A;  4X62 O;  4DV6 O;  4FPP A;  2IW5 A;  3ZRW A;  3C3T A;  2UXC O;  3ZRV A;  3KG2 A;  1QHT A;  3B4S A;  1DF4 A;  4B3S O;  4TV9 A;  4UCR A;  4YIO A;  4UVC A;  3W7T A;  2AZ2 A;  3G80 A;  3D36 A;  4I55 B;  3CPW U;  1KP3 A;  1YIJ V;  2AW9 A;  4H0L B;  1H8E G;  1SZT A;  3OTO B;  3T1C A;  1QVG U;  1Y74 A;  3ML0 A;  3CCQ V;  1S5H C;  4LF5 B;  5H9C A;  2IU0 A;  3UM7 A;  2ETN A;  1K9M W;  2G38 A;  5CBH A;  4ZBM A;  5KA6 A;  4DUZ B;  1PL0 A;  2R9A A;  1TA8 A;  2DYR C;  2F66 C;  1PD3 A;  5L3D A;  4UCO A;  3MDS A;  1F7Y A;  1VQ9 V;  3E22 B;  4BAY A;  1J5E O;  4PA3 A;  3AG2 C;  1RM1 C;  4JZ2 A;  5H2F Z;  4YY3 B;  1BMF G;  2BSK B;  4DR5 O;  1FFX A;  4O2B A;  3SYA A;  4LF9 O;  5GON B;  1KMI Z;  4JI7 B;  4JTC B;  1IVS A;  1HNW B;  2WWW A;  1XIL A;  4U7N A;  4I0X A;  4DK0 A;  2UUB B;  2M7W A;  1SET A;  4PHZ A;  2CE4 A;  1GN2 A;  1HR0 O;  5C93 A;  1JFF A;  4G2K A;  1HDJ A;  3SPJ A;  2HHH B;  1W0J G;  2Y69 C;  2Q7G A;  4Z1V A;  5EK0 A;  1Z5W A;  2YID A;  5EBM C;  4DR2 B;  4O4H A;  1XNQ O;  4UUJ C;  1NKD A;  1IX9 A;  2NNU A;  2ZD9 A;  3A2F A;  1Q81 W;  1JX9 A;  2V1D A;  3CCU V;  4JI0 B;  3JD2 A;  1FFT B;  5LYJ A;  3AK1 A;  1T5E A;  4RWU A;  3OFN G;  3RVY A;  2IM9 A;  2LGW A;  2O57 A;  2QEX V;  5JH7 B;  1N0J A;  2ITC C;  1YIT V;  1TVK B;  5JQG A;  2Q0O C;  5IJ9 B;  4B7K A;  4DR7 B;  3CX5 F;  2GUZ A;  3FB6 C;  4X65 O;  5KHG A;  1IXB A;  3K3W A;  5LHG A;  4MTF A;  2ZNJ A;  1F4N A;  5JJJ B;  4O4J A;  1WP7 A;  1OZ0 A;  5LXT A;  5DED A;  2BOB C;  4MVR A;  3CD6 V;  4HNA A;  1N36 B;  4LNU A;  3JAL A;  2EBO A;  2FYU H;  3CYO A;  4OGQ B;  3GWK C;  5FNV A;  5BXZ A;  2QKA A;  4W4K A;  2Y4T A;  2DN9 A;  1FKA O;  4LF7 O;  4U3J A;  5LMN B;  4XDK A;  3L74 H;  2QE7 G;  4DYL A;  2A9H A;  3R65 A;  4X1K A;  1V9P A;  1M1K W;  2E75 B;  4GKK B;  2HVK C;  4TT3 G;  3RYF A;  1FXK B;  4TOI A;  3LUT B;  4GX0 A;  4NTW A;  3ZMU A;  1AR5 A;  2YI9 A;  4IL6 Z;  2YIA A;  1NI8 A;  5K1X A;  4UV8 A;  2EJ7 A;  3KCY A;  3K03 A;  4JI3 O;  3E86 A;  1K5Q A;  1K34 A;  2AHY A;  1SER A;  1A32 A;  3NXS A;  1P7B A;  4J9Y B;  4FLV A;  1R1B A;  2M6Y A;  4ZHQ A;  3B8N A;  1WLE A;  2EIN B;  5IWA B;  4X20 B;  3P32 A;  3RN4 A;  3W7U A;  1K4C C;  2GSM B;  2KQX A;  1SQG A;  3ZHV A;  2X6B A;  2ZXW C;  1JPX A;  1ZSP A;  2JIZ G;  5EYP B;  2EZO A;  3KKY A;  2DOS A;  4LH6 A;  3SPG A;  1S3J A;  3LNN A;  4DXW A;  4LWS A;  3JAW B;  4LNU B;  3WG7 B;  1Q6I A;  1X4T A;  1CPY A;  1W2B U;  4YHH B;  4FM0 A;  3OW2 U;  4NXM O;  4UCU A;  1TAE A;  1WA8 A;  1SC5 B;  1ORQ C;  4LFA O;  2JK5 C;  1VQ7 V;  1BCC H;  4DV4 O;  3FKS G;  1GK9 A;  4BIZ A;  4DR3 O;  4W4L A;  3HKB A;  4H33 A;  5IYZ A;  1Z2G A;  2VRZ A;  2IH1 C;  4FLX A;  2IU3 A;  5JVD A;  3ZCC A;  2ZDI C;  4AQY O;  4FFB B;  1BE3 H;  2CH7 B;  2JGD A;  4AHC A;  2BTQ A;  1BQ0 A;  3ASN C;  3BRC A;  3JAT B;  2R70 A;  2YC0 A;  1NJI W;  4PJ0 Z;  5GTI Z;  5LHI A;  4OX9 B;  2B1I A;  2VQE O;  4JI4 O;  3WB0 A;  5GW7 A;  4UCS A;  3C90 A;  2Z5U A;  4GKJ O;  3VBB A;  4FM1 A;  2QWO B;  1K4D C;  3SJB C;  1TUB A;  3KZI Z;  3OMN B;  3ZHT A;  2ZQM A;  1FXV A;  1GMG A;  4A5U B;  4MT8 A;  5LA6 B;  4RUE A;  1SKV A;  1Q8I A;  1VIB A;  2DYS B;  3AG7 A;  4LFB O;  5B3S B;  3ZJZ A;  3TET A;  2OYQ A;  3GB7 C;  4K35 A;  3THO A;  3AG1 B;  1BS3 A;  4JAU A;  1XEQ A;  2P22 C;  4GX1 A;  3FYE B;  3X2Q B;  3DSQ A;  1R3I C;  4DK1 A;  3PJS K;  1P7G A;  3DC6 A;  1KKC A;  1YXB A;  1OCR C;  1OHH G;  4EFB A;  4FLY A;  4ZI7 A;  3JAS A;  3RFR A;  5HFL A;  1Y76 B;  2FTK A;  3HKB B;  4NR1 A;  1HW7 A;  4WFE A;  1SQB H;  3JD1 A;  4JI8 O;  1R3J C;  3VQV A;  5KHJ A;  3BFR A;  2UU9 O;  4DV0 O;  2WA4 A;  1S76 D;  2KB1 A;  3ZMT A;  4ICG A;  1P84 F;  2AZ0 A;  2DYR B;  5C8Y A;  2WLL B;  3A8T A;  4JYC A;  1FS0 G;  1IUR A;  1R6N A;  2WLM A;  3ETQ A;  1NH2 D;  4GX5 A;  2JJ2 G;  5LMU O;  1FXH A;  4AIL C;  3AG2 B;  1RM1 B;  2YUA A;  3ETD A;  3T1Y O;  1XNR O;  4KUM A;  3UCS C;  5BMV B;  3CC7 V;  3MD0 A;  5B1B B;  1TUE B;  4DV3 B;  4LF6 O;  3ETE A;  4MW3 A;  3E2E A;  2QA4 V;  2YSU B;  2ADQ B;  1WN7 A;  1B6Q A;  2YXY A;  4DRX A;  1GRJ A;  3HKC B;  5CBG A;  4PDR A;  3JAR A;  2WAM A;  4FLW A;  4JI5 O;  2VQF O;  4BIU A;  5JCO C;  3EFF K;  5J2T A;  3E83 A;  3D36 C;  5B66 Z;  5CBF A;  3CJH A;  5L3B A;  3QF7 A;  3ETG A;  3ZN0 A;  2Y69 B;  2EIJ C;  1SES A;  3FAV A;  4PV1 B;  4PA4 A;  3AG3 C;  4G28 B;  4NVP A;  3QVN A;  3O9O A;  5CN0 A;  4BW5 A;  3ZX6 A;  1XHX A;  2F4V O;  3OUS A;  4PD4 F;  3S3W A;  4LF8 O;  4MW8 A;  5IYB O;  3WFV A;  1NU1 H;  5IYC O;  5IY5 B;  2GDS A;  5CB4 B;  2HLD G;  3U11 A;  2F23 A;  3ABK C;  4XDL A;  4BW9 A;  4MSW C;  4HYO A;  1E79 G;  4X64 B;  3P30 A;  1LUV A;  2CAZ C;  2W0X A;  3CMA V;  5LP6 C;  3RGB A;  4PA9 A;  3SPI A;  1M57 C;  4FLZ A;  4P2Z A;  5EIB C;  2VS0 A;  4RAI A;  3N2G A;  3RYC B;  1N33 B;  4EEQ A;  2N04 A;  2BE3 A;  1VQ4 V;  3GVM A;  2XOK G;  2UUA O;  3HKE B;  4DR6 B;  1IBM B;  4RQF A;  1V55 B;  2E76 B;  3R66 A;  2ZR2 A;  2WLI B;  3K79 A;  3K9S A;  4N23 A;  3L70 H;  2PTM A;  4X8A A;  1D5A A;  1R73 A;  1I0H A;  2P6J A;  1Y67 A;  2B1G A;  4J41 A;  4DV2 B;  3JD3 A;  3JYC A;  5EZY A;  4OPH A;  1GM7 A;  4EKW A;  1AI5 A;  3ICX A;  5LOV A;  3QG5 A;  4F4L A;  3ZMS A;  3CXC U;  5B1O A;  3RYH A;  4J7J A;  5CA1 B;  2E5L B;  1D5N A;  1AI6 A;  1D2D A;  4MVZ A;  2Q8V A;  2D2C B;  4DV1 B;  1B04 A;  4DR4 O;  2F43 G;  1Y4M A;  1YZB A;  3SYC A;  3CME V;  1P49 A;  4FK5 C;  1UJW B;  2XND G;  5B1A B;  3U10 A;  2LQT A;  4LP8 A;  1UPG A;  5AG2 A;  1R3L C;  4NXN B;  4UB8 Z;  4MTX A;  3CS5 A;  4DUZ O;  4EB6 B;  1US6 A;  3CCE V;  1VQ6 V;  1N32 B;  3K5M A;  4PI0 A;  1N0N A;  1Q90 D;  4JYA B;  1RSO B;  2EIK B;  2H3O A;  1VQP V;  4YY3 O;  1BSM A;  2JGU A;  3ASO B;  1EZJ A;  5J2U A;  1AR4 A;  1PNL A;  4JI7 O;  1DK1 A;  3D8C A;  1QR8 A;  4KP4 A;  5KHH A;  3CWB H;  2LFR A;  2LGQ A;  4JTD B;  2YEV B;  4J7K A;  3SR2 C;  1N34 B;  2UUB O;  1QNM A;  3OM3 B;  3LNM B;  2ZT9 B;  3C3S A;  4DV7 B;  2EIM B;  4NTX A;  4CS2 A;  5JCO A;  2YDE A;  4WBN A;  2Q7H A;  3J7A U;  3BVO A;  4DR2 O;  5KUK A;  2L35 A;  4XBF A;  2P5O A;  4MVQ A;  2OIE A;  1PPJ H;  4JI0 O;  1VQ8 V;  1VF7 A;  2YI8 A;  2KKW A;  4IIJ B;  4GYC B;  2KG7 B;  1VP7 A;  4PI2 A;  3JAK A;  1AP6 A;  1GAX A;  4JYB A;  4I50 B;  2EIL C;  1KQS U;  3G6B A;  4QNH B;  1O9G A;  2GHY A;  3DGE A;  3CB2 A;  2HG5 C;  2Q4P A;  2HKO A;  3OAA G;  4H37 A;  3UO2 A;  1THZ A;  3CCL V;  1YI2 V;  3L9D A;  1IXM A;  4I4T B;  5BY1 A;  1AI4 A;  1N36 O;  2Q67 A;  1V54 C;  4IGG A;  2A7W A;  1M4U A;  5LP6 A;  5K1P A;  4LF4 B;  1KUQ A;  5ITZ B;  3GWO A;  2YIC A;  3ZRW B;  1NT2 B;  4UVB A;  4B3M B;  3BAA A;  1NBM G;  4CS4 A;  4GKK O;  2RN9 A;  3E8F A;  5KA5 A;  4TV9 B;  4H13 B;  4KHP O;  3K0D A;  2OCC C;  1W59 A;  1YSC A;  1AJN A;  2CK3 G;  4DV6 B;  3K04 A;  1FD9 A;  2EIJ B;  4LBE C;  4NB5 A;  3RBZ A;  1Y74 B;  1NR7 A;  2UXC B;  5D5Q A;  2CTW A;  1AB3 A;  3AG3 B;  1KEC A;  1G4Y B;  4NKG B;  5KHI A;  1YTF B;  2QTS A;  1S0V A;  3PN1 A;  1GM8 A;  1JA8 A;  2MW2 B;  2ZIM A;  5IWA O;  2FB5 A;  3ZRX A;  1HP8 A;  1M9N A;  1XL6 A;  5FL7 G;  2Y4U A;  4B3T O;  4RO2 A;  4EFE A;  3ZHQ A;  1NQT A;  3OEE G;  2FL4 A;  4X1I A;  2AHZ A;  1FFX B;  3DXR A;  4FVM A;  4O2B B;  1FJG B;  3M8A A;  1GO3 F;  4YHH O;  4QIW F;  3HKD A;  1M57 B;  1I5Y A;  4I0X B;  3ZRS A;  3SPH A;  1JFF B;  2XAH A;  2H94 A;  3H1I H;  1KP2 A;  4LF9 B;  1XMO O;  1OCC C;  1EN4 A;  1F4M A;  2DJV A;  1MSW D;  4O4H B;  2UXN A;  3STL C;  1P4R A;  2IH3 C;  5E79 Z;  1MZF A;  2PI5 A;  2CDY A;  3T1H B;  1H2L A;  3VQY A;  2ZR3 A;  1JQ0 A;  4HAM A;  2ZM6 O;  2ODM A;  3IC9 A;  5LYJ B;  1H2N A;  1VMG A;  4J10 A;  2UUC B;  3ZN1 A;  4CH4 A;  4Q20 A;  2A3Q A;  5KX5 A;  3AK2 A;  2JVD A;  4TV8 A;  1XNQ B;  1JOY A;  1EM1 A;  5JQG B;  2GUZ B;  4X88 A;  1SA0 A;  2RQ6 A;  3QO8 A;  4R7C A;  2CTQ A;  1YEW A;  1I5X A;  2DE0 X;  4O4J B;  2ILM A;  3G67 A;  4CH6 A;  5LXT B;  3RVZ A;  2LP7 A;  4CBC A;  3L75 H;  4UCV A;  4HNA B;  3JAL B;  2QWQ B;  1G1X B;  4DR1 B;  1AJQ A;  1WNS A;  4FLT A;  1FYJ A;  2QM8 A;  5FNV B;  1M56 B;  3ZBH A;  4D7T A;  1JJO A;  1MMM A;  2JJ1 G;  2Q73 A;  1PNM A;  4U3J B;  3N2K A;  4AI8 A;  4X1K B;  3FB8 C;  1Q6H A;  4QPK A;  1KKD A;  3RYF B;  1ZX3 A;  1ARO P;  4P30 A;  4LFC B;  3RT3 C;  2OIG A;  4QE9 A;  4J80 A;  3L72 H;  1VF5 B;  2Q9L A;  3ABM C;  5B1N A;  4DO2 A;  4CC5 A;  2DWE C;  4NTY A;  4KL1 A;  3B09 A;  4YJ3 A;  1OCO C;  1UFI A;  1IBK B;  3IC7 A;  3A0H Z;  1GN4 A;  1F51 A;  1NS1 A;  2XUM A;  5IJ0 A;  3CCV V;  2ADP A;  5F2V O;  3CCM V;  4ZHQ B;  3J80 N;  1NTZ H;  1QU7 A;  4JI2 B;  3D3I A;  2V7Q G;  2QR4 A;  4DV5 O;  2JEX A;  3BEH A;  4MVU A;  1Q5O A;  1QLE C;  1F23 A;  1TGO A;  4Q6G A;  4YJ2 A;  2HVJ C;  1H8H G;  3RYI A;  4LWS B;  3ZMZ A;  3RWR D;  2W6J G;  4I7Z B;  3Q4H A;  1XUQ A;  1BT8 A;  2WPD G;  5J9P C;  2HP8 A;  3LDE A;  4JAS A;  1WA8 B;  2WA3 A;  3FFQ A;  1ZTE A;  3N2K B;  3I56 V;  3ABU A;  3W7X A;  1QQC A;  5IT9 N;  4GT1 A;  5IYZ B;  4IHJ A;  3CCR V;  4X1Y A;  5JVD B;  1XMQ B;  2UXB B;  2UXD B;  3CHX A;  2JGD B;  1HWY A;  2BTQ B;  1KU9 A;  1AJP A;  4DV4 B;  3JCU Z;  3CC2 V;  2JRI A;  1YHQ V;  1YTF D;  1DTO A;  4XDJ A;  2KSD A;  1BL8 A;  3UT5 A;  4BIO A;  1I08 A;  1WJZ A;  4ZIB A;  1TUB B;  4ZOL A;  2W0F C;  3ZMV A;  2F93 B;  3FB5 C;  3QO7 A;  1B06 A;  1PV0 A;  4OPA A;  1N33 O;  3H1J H;  3E8H A;  3AK3 A;  3FD9 A;  1BGY H;  2IJK A;  2E74 B;  4JI4 B;  1SS3 A;  4DR6 O;  3RYI B;  4K0K B;  1I7F A;  2K1E A;  2QDO A;  3EHB B;  3BPZ A;  1H2K A;  4IYH A;  1DF5 A;  3WU2 Z;  3U0Z A;  3JAM N;  3QTC A;  1LUW A;  2H8P C;  1IBL B;  4ZI7 B;  2LFS A;  1WAZ A;  3JAS B;  5L3F A;  3OGI B;  1GM9 A;  4DV2 O;  5L3C A;  1CXZ B;  5JJE B;  4F6R A;  1K5S A;  3B77 A;  5BR8 B;  3CCS V;  4B3R O;  4WFB V;  1EZV H;  3QNE A;  2QM4 A;  2ZE5 A;  5L3G A;  3H1L H;  2IJI A;  4H44 B;  1ZLZ A;  4O4L A;  1WP8 A;  5KUM A;  5C8Y B;  1NZ6 A;  2E5L O;  3DC5 A;  2E3C A;  1KB9 F;  5H5N A;  2ZIO A;  4QJF B;  3K5L A;  2CGN A;  3SYO A;  1FPO A;  2VWK A;  1S5J A;  4JYY A;  5EBL C;  5CA0 A;  4GCZ A;  2RJZ A;  3LSU A;  4DRX B;  1ZAU A;  4TUY A;  3JAR B;  1WB7 A;  1H2G A;  1L1F A;  3O65 A;  2Q68 A;  3B2E E;  4JGS A;  5J2T B;  3FYI B;  3MHS C;  4Z2W A;  1U97 A;  1VQO V;  4NXN O;  4JTA B;  4D6T H;  4O2A A;  4FM2 A;  3FB7 C;  1OCZ C;  4FLU A;  3OR7 C;  1Q3E A;  3CJH B;  1JJ2 U;  1BHB A;  4JAV A;  3K58 A;  2WLH A;  3MAQ A;  2EZP A;  3FAV B;  3JSN A;  1GH6 A;  5EC2 C;  1KBH A;  3MHH C;  5BZB A;  3OR6 C;  1XBL A;  3AG4 C;  1FXK C;  5HFM A;  1ZL8 A;  2Q6A A;  5L3E A;  2ZCE A;  4MVO A;  1SQP H;  4K3A A;  1XHZ A;  4FIP C;  1PM9 A;  2LW1 A;  1RP3 B;  4O4L B;  1LR1 A;  3IJ4 A;  5KMG A;  4N21 A;  1RPO A;  3OE7 G;  3EVK A;  1N34 O;  2V4D A;  2ZXW B;  2X6C A;  5EBW C;  1CEZ A;  1JCH A;  3LSS A;  4DV7 O;  3J81 N;  1YJ9 V;  1HNX B;  5H6Q A;  2P90 A;  3SJQ C;  4LF8 B;  4R6Z A;  4C7U A;  4J11 A;  3H01 A;  3N2G B;  2F1M A;  4R50 A;  1LNQ A;  2XAS A; 
#chains in the Genus database with same CATH homology
 3E8F A;  4MVS A;  1MG1 A;  3WG7 C;  5KA5 A;  1AI7 A;  2OCC B;  4WFH A;  1W2B U;  3OW2 U;  3K0D A;  3TCU A;  2OCC C;  1ORQ C;  1YSC A;  5CA3 A;  1AJN A;  2DQ3 A;  2JDI G;  2JK5 C;  1VQ7 V;  3FKS G;  2CK3 G;  3K04 A;  1GK9 A;  4BIZ A;  3STZ C;  2EIJ B;  4H33 A;  4LBE C;  3RBZ A;  1NR7 A;  1K92 A;  2XAF A;  2WLI A;  3AG3 B;  5LGN A;  3CCJ V;  1KEC A;  1G4Y B;  2IH1 C;  2PI4 A;  4J9Z B;  2IU3 A;  3ASN B;  1S77 D;  3ZCC A;  1YTF B;  3TK1 A;  2ZDI C;  1EFR G;  1S0V A;  3K06 A;  5DM6 V;  2C2A A;  1OCO B;  1R6K A;  1GM8 A;  4PDM A;  4YXW G;  3ASN C;  2NLJ C;  2Q69 A;  1NVP D;  1K73 W;  1NJI W;  3E89 A;  3ZRX A;  3BY6 A;  4OXS A;  3SYP A;  5LHI A;  1K8A W;  2B1I A;  1S72 V;  5GW7 A;  3G4S V;  2IJH A;  1M9N A;  1XL6 A;  5FL7 G;  2Z5U A;  1K33 A;  3HPL C;  3VBB A;  1M90 W;  2EJR A;  4RO2 A;  1K4D C;  3T2M A;  4FJC C;  3W7S A;  3OMN B;  1NQT A;  3DTU B;  3OEE G;  2QM7 A;  2ZQM A;  1VQN V;  1FXV A;  1GMG A;  1PNK A;  2AHZ A;  4GX2 A;  1AR1 B;  4MT8 A;  1QR9 A;  4PEL A;  4RUE A;  1GO3 F;  2DYS B;  4QIW F;  5B3S B;  3ZJZ A;  3TET A;  1BHA A;  1M57 B;  1QLN A;  1I5Y A;  3GB7 C;  3F5W C;  4X89 A;  4JPR A;  4QE7 A;  3AG1 B;  1ZWI C;  3ZRS A;  5B3S C;  2X6A A;  4JAU A;  4GX1 A;  3FYE B;  4KFM A;  3X2Q B;  1VQM V;  1R3I C;  3SPH A;  3AG1 C;  3PJS K;  1ROP A;  1OCC B;  1QCE A;  2DW4 A;  1OCR B;  3X2Q C;  1VQL V;  2XAH A;  4WFF A;  2H94 A;  3A0R A;  1KP2 A;  2UXX A;  3K08 A;  1OCC C;  1OCR C;  1F4M A;  1OHH G;  1MSW D;  1YJN V;  3ZIA G;  3AEI A;  2UXN A;  3STL C;  1P4R A;  2IH3 C;  2ITD C;  3CC4 V;  4WFG A;  2PI5 A;  3CP1 A;  5HFL A;  2ZR3 A;  2FTK A;  3VOU A;  1JQ0 A;  1K3E A;  4HAM A;  4WFA V;  4WFE A;  2HJF C;  3JD1 A;  4PDV A;  3ZN1 A;  1WPX A;  1R3J C;  5LHH A;  4Q20 A;  2MK3 A;  2ZDI A;  4Z1M G;  1H38 A;  1S76 D;  2KB1 A;  3ZMT A;  1G8M A;  2WLN A;  4LCU C;  1JOY A;  5IYD O;  2DYR B;  3F7Y C;  2JEU A;  2WLL B;  4JYC A;  2R9R B;  1FS0 G;  2OT5 A;  4X88 A;  2DWD C;  2OTJ V;  3M99 B;  2EIN C;  3G6E V;  1R6N A;  2WLM A;  3QO8 A;  4R7C A;  4GX5 A;  1ENV A;  2JJ2 G;  1NH2 D;  1FXH A;  3AG2 B;  1RM1 B;  4UV9 A;  1I5X A;  3ETD A;  4KUM A;  3CC7 V;  3MD0 A;  5B1B B;  1TUE B;  3RVZ A;  2LP7 A;  1J95 A;  3ETE A;  1XL4 A;  4MW3 A;  1QVF U;  3K0G A;  2QA4 V;  3IGA C;  4TWK A;  4CBC A;  1Q7Y W;  3E2E A;  2YSU B;  2P67 A;  5B1B C;  2YEV A;  3LDC A;  1AJQ A;  5LGT A;  4UXN A;  1N8R W;  1B6Q A;  4RQE A;  3OGC C;  5CBG A;  4PDR A;  4MS2 A;  2QM8 A;  2WAM A;  1M56 B;  2W6I G;  2WLJ A;  1NR1 A;  4BIU A;  2JJ1 G;  1PNM A;  1M56 C;  4TSF G;  2WSS G;  3EFF K;  1EBO A;  2DQ0 A;  3E83 A;  1VQ5 V;  3FB8 C;  2XAJ A;  4QPK A;  4LC1 A;  1KKD A;  5CBF A;  2QTO A;  1COW G;  3UKM A;  5L3B A;  3ETG A;  1ARO P;  4P30 A;  3ZN0 A;  2Y69 B;  3ABM B;  3ABL B;  2EIJ C;  4QE9 A;  1SES A;  4PA4 A;  1MAB G;  3AG3 C;  4G28 B;  1FXK A;  1YJW V;  3ABM C;  5B1N A;  1JVM A;  4DO2 A;  5DN6 G;  2ATK C;  4CZZ A;  2DWE C;  2D3O W;  5CN0 A;  2P7T C;  4BW5 A;  1Q82 W;  1OCO C;  3E8B A;  3IC7 A;  5CMU A;  3T4D A;  3OUS A;  4PDL A;  1F51 A;  3OMA B;  4RUF A;  3CCV V;  2R9I A;  4MW8 A;  5IYB O;  3WFV A;  4L87 A;  2XAQ A;  5IYC O;  1NH2 B;  5IY5 B;  3CCM V;  3ABK B;  2HLD G;  3D3I A;  3JCZ A;  2V7Q G;  5IY5 C;  3ABK C;  2JEX A;  4XDL A;  1K7D A;  3BEH A;  4I5S A;  1QLE B;  4MSW C;  4P9P A;  4MVU A;  4ASU G;  4HYO A;  1E79 G;  3OEH G;  3P30 A;  4FMT A;  1PKX A;  1F23 A;  1QLE C;  4MTG A;  3CMA V;  2DYS C;  4PA9 A;  3SPI A;  1Y66 A;  1H8H G;  2HVJ C;  1M57 C;  3ZMZ A;  4P2Z A;  1K97 A;  3LDD A;  4RAI A;  2W6J G;  2IW5 A;  4FPP A;  3ZRW A;  2A79 B;  3ZRV A;  2X0L A;  3KG2 A;  1VQK V;  4R8C A;  2WPD G;  3E35 A;  5J9P C;  1DF4 A;  3LDE A;  1VQ4 V;  4JAS A;  1KD1 W;  2XOK G;  4UVC A;  3W7T A;  1OCZ B;  4RQF A;  3I56 V;  3ABU A;  1V55 B;  3D36 A;  3W7X A;  3CPW U;  1KP3 A;  1YIJ V;  4GT1 A;  1V55 C;  2ZR2 A;  2WLI B;  1H8E G;  3K79 A;  1DLB A;  2BOC C;  4N23 A;  2WLK A;  1SZT A;  3T1C A;  1QVG U;  4X8A A;  3CCR V;  1NVP B;  1R73 A;  2XAG A;  3AG4 B;  3ML0 A;  3CCQ V;  1S5H C;  2P6J A;  2X7R B;  5H9C A;  2IU0 A;  2B1G A;  3UM7 A;  1HWY A;  3JD0 A;  1AJP A;  1K9M W;  1Q86 W;  3JD3 A;  4ZBM A;  3JYC A;  5CBH A;  5KA6 A;  3CC2 V;  1PL0 A;  1YHQ V;  2DYR C;  1YTF D;  1DTO A;  1PD3 A;  5L3D A;  1GM7 A;  4XDJ A;  1BL8 A;  1QBZ A;  1VQ9 V;  3E8G A;  4EKW A;  4BAY A;  1E1R G;  4PA3 A;  5LGU A;  3AG2 C;  1RM1 C;  1AI5 A;  5H6R A;  2W0F C;  4F4L A;  3ZMS A;  3ZMV A;  3CXC U;  5B1O A;  3FB5 C;  3QO7 A;  1BMF G;  3I55 V;  1AI6 A;  4MVZ A;  3E8H A;  1SRY A;  2IJJ A;  3SYA A;  2IJK A;  4I9W A;  3OUF A;  3T4Z A;  4JTC B;  4U7O A;  2F43 G;  1Y4M A;  2WWW A;  4U7N A;  2K1E A;  3EHB B;  3SYC A;  3CME V;  2Z3Y A;  4FK5 C;  1UJW B;  2XND G;  4WF9 V;  1DF5 A;  5B1A B;  3F7V C;  3HB3 B;  2M7W A;  1SET A;  2B5U A;  2QKS A;  1CP9 A;  5C93 A;  5B1A C;  4G2K A;  4LP8 A;  3SPJ A;  2H8P C;  1W0J G;  2LFS A;  2Y69 C;  3ABL C;  1R3L C;  5EK0 A;  5EBM C;  5L3F A;  5LBQ A;  4UUJ C;  1NKD A;  1R3K C;  2NNU A;  2ZD9 A;  1GM9 A;  4MTX A;  1Q81 W;  1JX9 A;  2V1D A;  3B8M A;  3CCU V;  5L3C A;  3JD2 A;  1FFT B;  1K5S A;  3B77 A;  1VQ6 V;  3CCE V;  3CCS V;  4WFB V;  3QNE A;  3SPC A;  5L3G A;  2IJI A;  2HFE C;  3G71 V;  3OFN G;  3RVY A;  5KUM A;  2EIK B;  1VQP V;  2QEX V;  2ITC C;  1YIT V;  1GKF A;  3LSQ A;  2EIK C;  2WLL A;  3IFX A;  3ASO B;  1EZJ A;  3FB6 C;  4QJF B;  1PNL A;  3K3W A;  5LHG A;  3ASO C;  4MTF A;  1QR8 A;  3SYO A;  4KP4 A;  4E2L A;  2A0L A;  3OMI B;  2LFR A;  3QO5 A;  1F4N A;  1OZ0 A;  5EBL C;  5IDJ A;  4JTD B;  2YEV B;  4GCZ A;  4MTO A;  2BOB C;  5E1A C;  4MVR A;  3CD6 V;  3OM3 B;  3LNM B;  5EC1 C;  1H2G A;  1L1F A;  2EBO A;  2EIM B;  3CYO A;  3ABT A;  2Q68 A;  2Y48 A;  2EIM C;  4JGS A;  3FYI B;  3MHS C;  1VQO V;  5KUK A;  4JTA B;  4PA7 A;  4WCE V;  4PA6 A;  3K9A A;  4XBF A;  3FB7 C;  4XDK A;  1OCZ C;  2QE7 G;  3OR7 C;  2A9H A;  3R65 A;  4G27 B;  4MVQ A;  1JJ2 U;  1E1Q G;  1BHB A;  1M1K W;  1VQ8 V;  4JAV A;  2HVK C;  2WLH A;  2EZP A;  4P9O A;  4TT3 G;  1GTO A;  1FXK B;  5EC2 C;  3MHH C;  5BZB A;  3LUT B;  3OR6 C;  4GX0 A;  4UVA A;  3ZMU A;  3AG4 C;  1FXK C;  5HFM A;  2EIL B;  2Q6A A;  5L3E A;  1W0K G;  4JYB A;  4MVO A;  2EIL C;  3SYQ A;  1KQS U;  4UV8 A;  4QNH B;  2GHY A;  3DGE A;  3K03 A;  4FIP C;  2HG5 C;  3E86 A;  1K5Q A;  2HR3 A;  1K34 A;  2AHY A;  2HKO A;  1KC8 W;  1SER A;  3OAA G;  3NXS A;  1P7B A;  4H37 A;  4J9Y B;  1THZ A;  3RW0 A;  3CCL V;  1YI2 V;  4N21 A;  1RPO A;  1V54 B;  3OE7 G;  1IXM A;  3B8N A;  1WLE A;  2EIN B;  4QPJ A;  1AI4 A;  2X6C A;  2ZXW B;  5EBW C;  1JCH A;  1CEZ A;  4HZ3 A;  3P32 A;  3LSS A;  3W7U A;  1K4C C;  2GSM B;  1V54 C;  2Q67 A;  3W7W A;  3JD4 A;  2X6B A;  1YJ9 V;  2ZXW C;  5H6Q A;  1JPX A;  1MOF A;  2OTL V;  2P90 A;  2JIZ G;  3SJQ C;  4R6Z A;  2EZO A;  1RPR A;  4MVM A;  4ZKI A;  3SPG A;  1S3J A;  3H01 A;  3GWO A;  4JF3 A;  4R50 A;  4DXW A;  3ZRW B;  1LNQ A;  3WG7 B;  4UVB A;  1CPY A;  2XAS A;  1NBM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...