3UM7A

Crystal structure of the human two pore domain k+ ion channel traak (k2p4.1)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
266
structure length
259
Chain Sequence
b'RAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Crystal structure of the human K2P TRAAK, a lipid- and mechano-sensitive K+ ion channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 82
structure length 259
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3um7A01
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3um7A03
4MVZA 1XL4A 2KB1A 4RAIA 3T4ZA 5E1AC 3FB7C 3OR7C 2QTOA 3VOUA 4GX0A 3FB8C 3AG2C 2DYSC 2AHZA 2ITDC 4G28B 3RBZA 1OCOC 5IY5C 2BOCC 2BOBC 2P7TC 2ZD9A 3E86A 5B1BC 4EKWA 2DYRC 3R65A 3SPHA 4QNHB 3AG4C 3RVYA 4KFMA 2HVKC 3AG3C 3ABKC 4PA6A 4PDLA 3SJQC 1P7BA 4JTAB 3SYOA 4HZ3A 4TWKA 4X89A 4XDLA 4G27B 3UM7A 3IFXA 3E83A 3OR6C 3TETA 3K06A 5B1AC 4GX5A 1R3LC 3SPJA 5B3SC 4MVMA 2Q68A 2K1EA 5BZBA 1J95A 4HYOA 4QE9A 3T2MA 4P30A 1QLEC 4XDJA 4WFEA 5EC1C 4PA3A 3EFFK 4BW5A 2WLNA 4PDRA 4WFGA 3HPLC 4MVSA 4R50A 2ATKC 3STLC 2X6AA 3ASOC 2R9RB 4MS2A 1KKDA 2IH3C 3E89A 2ITCC 3T1CA 3E8GA 4PA7A 4UUJC 4PA4A 4XDKA 3K04A 3K08A 2Y69C 4ZBMA 1ORQC 3STZC 2EILC 4RUFA 3BEHA 4P2ZA 4LCUC 3SYPA 3ZJZA 4MSWC 3X2QC 3LDDA 2Q67A 4GX2A 4J9YB 1V55C 3RW0A 3SYAA 4MVRA 1OCZC 1R3JC 3TCUA 1G4YB 2IH1C 3RVZA 2HJFC 3UKMA 4DXWA 4GX1A 2HVJC 2QKSA 2EIJC 3GB7C 4MTOA 2WLMA 1M57C 2JK5C 4WFHA 3OUSA 4X8AA 4P9PA 3SPCA 3LDCA 2X6BA 3OGCC 4R7CA 5EBWC 4I9WA 3E8HA 4MVUA 1LNQA 2WLLB 4QE7A 5KUKA 2WLHA 4OXSA 4JTCB 2Q69A 1JVMA 5EBMC 1OCRC 1R3KC 4JTDB 2A9HA 5CBFA 2HG5C 3PJSK 4LBEC 2YEVA 3ABLC 3ABMC 4P9OA 4F4LA 2EIMC 4MTFA 2X6CA 2WLLA 1S5HC 4MVOA 2AHYA 4PDVA 4PDMA 2A79B 2HFEC 2WLIA 1K4DC 2EINC 5J9PC 2DWEC 3K0GA 4PA9A 4RO2A 3SPIA 4MW3A 3SPGA 4MW8A 1R3IC 5KUMA 4WFFA 1K4CC 3FB5C 5EK0A 4RUEA 1XL6A 3T4DA 3LUTB 2H8PC 2W0FC 3E8BA 2NLJC 3ASNC 3K0DA 3LDEA 4H33A 2A0LA 2WLJA 3WG7C 3AG1C 2DWDC 3IGAC 3F7VC 1OCCC 2OCCC 4H37A 1V54C 3FB6C 1BL8A 3KG2A 4R6ZA 3SYCA 4J9ZB 5EC2C 5CBGA 4MTGA 4R8CA 3JYCA 1ZWIC 2ZXWC 3OUFA 4X88A 2WLIB 4CBCA 3E8FA 4MVQA 2WLKA 5EBLC 5CBHA 3LNMB 3F7YC 2EIKC 4LP8A 3K03A 3SYQA 3ZRSA 2Q6AA 1M56C 3F5WC
chains in the Genus database with same CATH superfamily
4J41A 3RYIB 3K9SA 1JFFB 1N0NA 5B1BC 2CGNA 2BTQB 2DE0X 4NXNO 5KA6A 1X4TA 2ZM6O 2EIKB 4LFBB 4RWUA 5KHIA 2RQ6A 3P3NA 4H44B 2PYJA 4GZRB 4B3SB 3TETA 3LNNA 4U7NA 5B3SC 4EFBA 4ASUG 1DLBA 5IYZB 1RSOB 1JQ0A 1H2MA 1AP5A 1AI4A 1S5JA 4IYHA 1TVKB 5B1BB 4GYCB 4P30A 2OT5A 3QO7A 5FPOA 4PA3A 2HHHO 3HKCB 3SJCC 3CCJV 4ICGA 2ZDIA 2E5LO 4K0KB 1P84F 3T1CA 3OMNB 2Y69C 4KP4A 2PUSA 4O2AA 3QTCA 4YJ3A 2KSDA 4KUMA 2ZE5A 3IJ4A 4DK1A 1QVFU 2Q7EA 1FXKA 4K8XA 4P9PA 2WWWA 4J7KA 2Y69B 5JCOA 3L71H 5LHGA 3P30A 1JVMA 1YITV 1Q43A 1R3KC 2A7WA 3UO3A 1K9MW 2EZPA 4JI2O 4ZKIA 3RN4A 1BS3A 2X6CA 4EB6A 5J9PC 2HFEC 2EINC 1PNLA 4DV1O 5FNVB 3H1LH 3CYOA 3WB2A 1GK9A 3K0DA 3ASNC 4H13B 2A0LA 5A9GA 1NTKH 1A32A 5GW7A 2HLDG 4Z2WA 3CCQV 2NN4A 4X88A 1LUWA 4CBCA 1E1QG 2WAMA 2WLKA 2EZOA 2XAGA 4A5UB 1N33O 1EN6A 4IT5A 4TV8B 3L74H 1Y4MA 4FFBB 4PELA 4DO2A 2PGGA 2VQEO 1YHQV 2M6YA 5E1AC 1KP2A 4JASA 1O9HA 1OJHA 1R6TA 3VOUA 1NT2B 2AHZA 4KXRA 4F6RA 2HR3A 2FL4A 2QM4A 2UXBB 3ABLB 3ZHSA 4B3RO 4AQYO 2ZNJA 4UVCA 1Z5WA 3G6EV 5D5PA 1IXMA 1D5AA 1GH6A 5JH7B 4FJCC 2QWQB 4J42A 3O65A 1MZEA 4I55B 4UUJC 4PA4A 5L3BA 2KQXA 5IJ9B 4LF5B 4MVRA 1N32B 3JARA 4IL6Z 1Q3EA 2QKSA 4L8JA 5IJ0A 4DR3O 3OUSA 2H94A 1XHXA 1SF9A 3APQA 4QE7A 1K5QA 1NVPB 1ROPA 2LFRA 1J5EB 4JI6O 1I94B 3A0BZ 1RP3B 2JRIA 3OW2U 2OTJV 3N2KA 4AHCA 4Z1MG 3BA9A 4PDVA 1EZVH 5L3GA 3BABA 1NU1H 3SPIA 1Y74B 3FB5C 3D3IA 4ZIBA 1SKVA 2WLJA 5C8YA 4O2BA 3AG1C 1OCCC 2GTSA 3ZHVA 1IBLO 4JF3A 1ZWIC 2WLIB 1KKCA 1THZA 5A2QN 1M90W 4U3JA 3LNMB 4KL1A 3FX7A 2PTMA 2IU0A 3AK1A 1QCEA 3DTUB 1I0HA 1JJOA 4MVZA 1Q6UA 1BHAA 5KX5A 3AG1B 4YJ2A 4JI5O 1OCCB 2P4VA 5IWAB 5KHKA 3RYCA 4K8ZA 4X20A 4JV5O 1S72V 5H5NA 1HR0B 2HVKC 3VBBA 2Z3YA 4X66B 4UCOA 5B1AC 3W7SA 2GSMB 4LFAO 1AR5A 2YDEA 3ZRXA 2CH7B 3IAYA 4I50A 1S77D 1IX9A 1NH2B 5BY1A 3EFFK 1LR1A 3QF7A 3E89A 3OEHG 4PA7A 5B1AB 4ZBMA 1ORQC 3FAVB 3JSLA 3ZJZA 1G1XB 4KHPO 4ZHQB 3ZRWA 2QEXV 1Y67A 4DV6O 5IYBO 3GVMA 4LR3A 4GX1A 4IGGA 1PD3A 1ZX3A 3QO5A 4WFHA 3ABTA 3FYIB 3GWKC 4I9WA 4UB6Z 5BR8O 2WLHA 3DC6A 3JALB 4JI4B 1R6NA 2Q9LA 5IYCO 4BIOA 1K92A 4LC1A 3K5MA 5KAIZ 3JD0A 1URFA 5IE9A 4HNAB 1GTOA 2F93B 1EN5A 3ZN0A 3JATB 1IBMO 3CRMA 5LHIA 5BMVB 1I08A 3SPGA 5KMGB 3W7XA 2YICA 1F4NA 2PI5A 1I7FA 2UUBO 1HNZB 2LW7A 2QR4A 2GV9A 1YVWA 5EBLC 3M8AA 5DM6V 4LP8A 3ZN1A 1Q7YW 1QLNA 4K35A 3D36C 1Y66A 2Q6AA 1MSDA 2GBOA 4RAIA 3CC7V 2QWRB 4CH4A 1BSMA 2QTOA 2DJVA 4X62O 2PI4A 1BZKA 3E86A 2LFSA 3P3PA 4B3MB 4LF6O 2W6IG 1N34B 2B1GA 1YJWV 3AG3C 4YY3B 3HKDA 4PDLA 4DR5B 4G27B 4XBFA 1SESA 2K1EA 2RDCA 1QR8A 1KU9A 2EULA 3UT5B 5LOVB 3AG3B 1MSWD 3VQVA 2Z5UA 1BHBA 3Q4HB 1SQVH 4J7ZA 4ZI7B 3E8GA 2F4VO 2LW1A 4FVMA 4DV5O 1EFRG 4P2ZA 4MSWC 3SYAA 2RJZA 4IIJB 3CRRA 5J2UA 3K9AA 2UXDO 4I0XA 2WLMA 2Q5ZA 2DQ0A 2IJKA 1EN4A 3RYHB 4JI0B 4ABMA 3OGCC 1F7YA 1ZUQA 5B66Z 2WLLB 2Q7GA 1YDXA 1XREA 3SJBC 2L35A 1AP6A 1EZJA 4JTDB 2A9HA 3JAWA 1SQXH 3L72H 2LP7A 5KHGA 2ZINA 3N2GB 3ZMVA 1P4RA 1OZ0A 5EZYB 1GMGA 3DXRA 4WFFA 3ZMTA 1M4UA 1L1FA 1K3EA 1XNRO 3RYFB 5KHHA 4H37A 3RYIA 3JAMN 3EVKA 4GKKB 3E8FA 4FIPC 1MNGA 2BTQA 2W0XA 3CD6V 2UUCO 2YXLA 3F5WC 1TUBB 2ZQMA 3B8NA 1M1KW 2BOCC 1RSOA 1KECA 3T1HB 1XNQO 1TVKA 3TK1A 5H6QA 2RCVA 3D8CA 2YC0A 1UPGA 3SYOA 4B3TB 1P7BA 3HKCA 1G6UA 5KAFZ 1VQ8V 4FFKA 4BR6A 1KUQA 4PJ0Z 4FM1A 4DR7O 5H2FZ 1H2KA 3T2MA 1N4CA 4JYAB 1PPJH 3KZIZ 4J80A 5ITZB 4R50A 3CHXA 2X6AA 3ASOC 1SS3A 3KCYA 2Q0OC 4TUYB 3N27A 4RUFA 3SYPA 3X2QC 3LDDA 5LYJB 1H8EG 1VQMV 3I55V 5IDJA 1MOFA 1M57C 2IJJA 3ASOB 2R70A 1Y6XA 1Y76B 5B1NA 3LDCA 4I9QA 3ZBHA 4R7CA 1GKFA 5FNVA 4UCRA 3X2QB 3EXAA 2OIEA 2JJ1G 1KC8W 1Q82W 4P9OA 5LMUB 4B7KA 2PYLA 1M57B 1Z5VA 4LFBO 2N04A 4NTXA 4TV8A 4FFBA 5EK0A 4DW0A 3CCSV 4B3SO 2ZR3A 2JGDB 4YXWG 4UV8A 1QHTA 2LO1A 5LP6C 1VQ7V 3OE7G 1N8RW 1WN7A 3OUFA 3THOA 4YHHO 1HW7A 1VEWA 3CSXA 1PNMA 3SYQA 1WPBA 3CCMV 1SC5B 4X64B 3AK3A 4E4EA 5HFMA 5LP6B 1SZTA 1FJGO 1AILA 3B2EE 3JASA 2EIMB 5JH7A 3BY6A 4DUZO 5EYPB 1YJNV 3IC9A 3IFXA 4QGPA 4I55A 3K5OA 4FLUA 4QE9A 1QLEC 5IJ9A 3HKBB 2YS8A 3ZRVA 1V9PA 3A8TA 4MVSA 4DR6B 1KKDA 2C2AA 1RPOA 3K08A 1W0KG 1PP9H 1SQBH 3BEHA 4LCUC 3OTOO 2Q67A 1QLEB 3HB3B 5LMNO 1FXVA 1SQGA 1VP7A 4UVBA 4PHZA 1ZAUA 4O4JB 4X8AA 5LGNA 3JAKA 2HKOA 1YTFD 4BIUA 1IBKB 1SERA 1OV9A 4LBEC 2ZKOA 5J2TB 5B3SB 2F95B 1SQQH 4O4HB 2AHYA 1HNXO 4DR4B 2IJHA 2WLIA 2KG7B 3CXCU 1S76D 2QWPB 4DW1A 3LUTB 2ZNIA 2DWDC 2P4KA 2A3QA 5LBQA 3W7UA 4H0LB 1YI2V 2E3CA 4JI7B 1F23A 3A0HZ 3K79A 2HEPA 4DUYB 1N36B 1AR4A 2CTPA 5LL6Y 4I7ZB 2CTQA 4AI8A 3CEIA 4DV4B 3TXQA 3MHSC 4LF5O 5LA6B 4JI1B 2CH7A 1IVSA 2L6LA 4DR2O 1H8HG 4X1IB 4X89A 2EINB 1SQFA 3DSQA 3RT3C 2ARHA 3C3TA 2A06H 1NTMH 4PI2A 4NXNB 2JEUA 4FK5C 4O4IB 2XNDG 4TV9B 3ASNB 3FAVA 5IYDO 2UXNA 4DR1O 4UFZA 3ZX6A 3STLC 3TGUH 1KP3A 4XDKA 4D7SA 1VF5B 1QBZA 4I4TB 1V55C 2HHHB 3RW0A 4RQEA 4JZ2A 1F51A 3W7WA 3ZMZA 3M7MX 4LF4O 3F5TA 1FAFA 1W0JG 2E5LB 2FTKA 4O4LB 4WF9V 3I5DA 2ZT9B 1RFYA 3JATA 2JIZG 5H6RA 1RPRA 5BMVA 2YI8A 1QU7A 2D3OW 3CRAA 5L3DA 1K97A 1FFXA 3OFNG 1V55B 3U11A 1EM1A 1FFTB 1K8AW 1TGOA 4DV3O 5H9CA 2QKAA 4RO2A 4MW3A 4J10A 5KUMA 4RQFA 2CTWA 1XL6A 1NR7A 2FB5A 2NLJC 3J80N 3CJHB 3F7VC 3CP1A 1GM9A 4NYKA 4MTGA 1QQCA 5KA5A 4DV1B 2PY5A 2E76B 2YSUB 5TISZ 2N05A 4NXMO 4FZ0A 5LXTA 2BCCH 2YIBA 3PN1A 2DYSC 1N33B 2ZDIC 3LSQA 4PD4F 2OYQA 1MA1A 2DYRC 3BRCA 3MAQA 5LOVA 1MABG 4OX9O 2IU3A 1R73A 4WCEV 1KB9F 3E2EA 3CXHF 2JEXA 3OR6C 4JI4O 2DYSB 2Q8VA 5GONA 2YXHA 4B3RB 2DYRB 1VF6C 4G2KA 4AQYB 5JCOC 4FMTA 3H1JH 1WP8A 4IIJA 4PDRA 2XTAA 3SGIA 3U10A 4LWSB 3RYHA 3K04A 3STZC 4WFAV 1H2SB 1JX9A 2AZ2A 1AJPA 4JGSA 1EBOA 3SDLA 1WP7A 4X1YB 1HNZO 1DGSA 5JQGA 1R3JC 5JVDA 1G4YB 3UKMA 2HJFC 3ETGA 4UCVA 4GUNA 2W6JG 1B3QA 1AI5A 1QR9A 1E79G 5EBWC 3SR2C 4LF7B 2B1IA 3G80A 2F43G 1VQKV 5EBMC 4C7UA 4FLVA 3RYFA 4DR3B 4B3MO 2QDOA 1S5HC 5CA3A 2MW2B 4JI3O 3DC5A 2OIGA 4YY3O 1L8DA 2IJIA 3TJTA 3BPZA 2UU9O 3G6BA 4LFCO 1K4CC 1VQ5V 4BWAA 4H33A 2YUAA 3WG7C 4JI6B 2IM9A 2EX3A 1WNSA 2IBZH 3AG7A 3QVNA 3ZMSA 1YF2A 5L3EA 2VQFB 4WFBV 2UUAB 1ENVA 1NS1A 4FM0A 4F6RB 3CE2A 3UO2A 2UXCO 3T4ZA 3OGIB 1IBLB 5CA1B 4PV1B 4GX0A 3K57A 3AG2C 1L0LH 2QA4V 4QPJA 5CB4B 3CCEV 2JJ2G 4QNHB 4FM2A 3FFQA 4IHJB 1NR1A 3KKYA 1TUEB 3ZHQA 3AG2B 4GX5A 1WB7A 3OEEG 4YIOA 4JV5B 1GM8A 4YIPA 4DRXB 1OHHG 4W4KA 5LYJA 4WFEA 1YXBA 2Y48A 5KLVH 5JJNB 3CC4V 1FKAO 5D5QA 4LFAB 3JARB 1WA8B 1MG1A 2DQ3A 1GN4A 4UVAA 5GTIZ 2GHYA 2H3OA 2ZE6A 3A0RA 3TCUA 2GUZB 2KKWA 5IT9N 3CC2V 4TOIA 1S3JA 1LUVA 3QNEA 4KHPB 4NTYA 3ETDA 4DV6B 3A2FA 4UCSA 3L75H 4JI8O 1AI6A 1WAZA 2ODMA 4W4LA 3R66A 4DK0A 2JGDA 3G67A 4NR1A 3T1HO 2QTSA 1I5XA 2QWOB 4X1KB 4O2BB 1B06A 4PA9A 4B3TO 4U7OA 3ZMUA 2P5OA 1SQPH 1ZSPA 3ZEDA 2BSKB 4U3JB 2FYUH 3FB6C 3HKEB 1M5IA 4LF8B 4R8CA 2LJ2A 3BVOA 4GT1A 5KX5B 3LSUA 3RYCB 1IXBA 4UV9A 4QJFB 1MZFA 5AG2A 5EYPA 2UUBB 1YTFB 4G28B 2VRZA 3WB1A 1HDJA 2VWKA 3RFRA 4DV7O 1NQTA 2AXTZ 1XEQA 1R1BA 3HKBA 1VIBA 1FS0G 1JFFA 4TWKA 1HP8A 3E83A 4DV0B 1AJQA 4LF6B 1H2LA 4DV2B 4OGQB 4J7JA 2XAQA 2YIDA 3ML0A 2JVDA 5IYZA 2QGNA 1RM1C 2R9RB 1NI8A 4O4JA 1FXHA 3B40A 1AJNA 4GCZA 1FD9A 3VQXA 3ETEA 3LSSA 5FL7G 1Q81W 1OCZC 1HNWO 2CK3G 2QM8A 5J2TA 4L87A 2Y0IA 3C3SA 2Q0AA 4B08A 4O4HA 2F4VB 1RM1B 2JK5C 2ZE8A 2P06A 2Q4PA 1YIJV 4X64O 1IZ3A 2KG7A 5KUKA 1LNQA 2Q69A 2XOKG 3T1YO 1OCRC 3MDSA 2ILMA 1XMQO 1G8MA 2UXDB 1CPYA 4CH5A 1OCZB 3ABMC 1PNKA 3E35A 3EHBB 1XMOB 3CRCA 1H2NA 4PDMA 2CUGA 3ZIAG 1R3IC 4IYIA 3L70H 4LF9B 2W0FC 1OCRB 4PI0A 2XHBA 4CS2A 2QSAA 3ABMB 4JZGA 4UXNA 4X9QA 2OWOA 5CA0B 1XNRB 4LH6A 3VQWA 3H01A 1YZBA 1NKDA 3OT7A 1OCOC 1ZTEA 4TT3G 2XT9A 2AZ0A 4N21A 5L3CA 2ZD9A 4EEQA 1DTOA 4O4IA 4TV9A 1K73W 3SPHA 4CH3A 3K59A 2X0LA 3ABKC 1K33A 1GO3F 4JPRA 2R9AA 3K58A 4CH6A 4K0KO 1OCOB 4MVMA 5B1OA 1XNQB 3E22B 3B8MA 4CS3A 2VWJA 2WA4A 4I4TA 3B09A 4BW5A 3K3WA 4DR4O 2F66C 3ABKB 1CP9A 3HPLC 4WFGA 2E74B 1BMFG 4O4LA 4MS2A 1U96A 2FMLA 1YEWA 4DR7B 2XAFA 4JAVA 3KCXA 4Q20A 3B4SA 4DXWA 1S5LZ 2ZIMA 1QNMA 5B5EZ 2QE7G 1JPXA 2LGWA 4OXSA 1P7GA 5K1PA 3CCRV 3JD1A 4GKJB 2JS5A 4NKGB 1L0NH 1SRYA 5C93A 3ICXA 3CJHA 2ZIOA 3ZS8C 3HR0A 1WB8A 1AI7A 1VQLV 1BCCH 1D2DA 2GDSA 2WPDG 1CXZB 1JMKC 2K9PA 4RUEA 3E8BA 1MMMA 2YEVB 1W59A 3IGAC 3OAAG 1Y74A 1VQ9V 2AGAA 1T5EA 3DGEA 3CMEV 2UXBO 5L3FA 1M56C 4NTWA 3FB7C 1GN6A 4X65B 4YHHB 1XDCA 4MTXA 1DF4A 2YIAA 2DW4A 4FLXA 3OM3B 5FPRA 3K5NA 2QKCA 1M56B 3CCLV 2RMKB 2P67A 4LNUB 1BQ0A 4LWSA 3FKSG 3BAAA 1YJ9V 4AILC 1FJGB 2RNBA 1M9NA 5CN0A 1B6QA 4F6EA 4DUZB 1BGYH 1VF6A 4X1YA 1KYOF 2Y4UA 1XI1A 3RWRD 3WU2Z 1SA0B 1N32O 1H38A 1KBHA 4UCUA 2NNUA 3K5LA 4ZOLB 3OD4A 2QJ1A 5JJEB 4Q6GA 1K34A 1WJZA 3ZHTA 4WBNB 1X59A 4FPPA 3RGBA 1J5EO 3GB7C 1I94O 4ZHQA 2ZM6B 4JAAA 1D5NA 4QIWF 3WB0A 2R72A 3J7AU 3OTOB 3E8HA 4JTCB 2UXXA 3JD2A 2MK3A 5LMNB 3PJSK 3ABLC 1Q6IA 2B5UA 3JALA 1KD1W 1GN2A 1XHZA 2DWEC 2HJDA 3D3QA 3CS5A 3T4DA 2QM7A 2H8PC 2DOSA 4HNAA 5DEDA 1VQ4V 4LH7A 5CA1A 1V54C 1BL8A 5KMGA 1GM7A 1HNXB 5CBGA 5IWAO 1U97A 5EIBC 4OPHA 5CB4A 2E75B 2V1DA 1AR1B 1GAXA 3F7YC 5HFLA 4IHJA 3ZRSA 2P6JA 1HR0O 2OTLV 2PF4E 3GWOA 1XL4A 2KB1A 3JASB 4X66O 3OR7C 1NTZH 2Q73A 1ZL8B 1V54B 1NBMG 4CZZA 2BOBC 3U0ZA 2P7TC 4HAMA 4JI2B 4I5SA 3B77A 4DRXA 3VQYA 3H1KH 1VQ6V 2CTRA 3FYEB 3H1HH 4LF7O 3UM7A 2F23A 2Q68A 3JCZA 4JYBA 3C90A 3D36A 1WA8A 1KQSU 1GN3A 2DN9A 4DR2B 2YXYA 1SZXA 3CX5F 4FLYA 2GUZA 1SETA 3NR7A 1VARA 1DF5A 2VQEB 2F1MA 3UT5A 2EILC 4DR1B 2B9ZA 2EJ7A 4J9YB 2VQFO 2ADQB 3Q4HA 4ZI7A 2UUAO 3JAKB 1Q8IA 3G4SV 1FXKC 4X1KA 3SPCA 2EILB 3BHPA 4LF4B 2CE4A 4O2AB 1XBLA 4YJ3B 2BSKA 2N74A 3HKEA 2WLLA 4MVOA 2Y0PA 1FXKB 2LGQA 4CS4A 2CDYA 3CRQA 3I56V 3N2GA 2OCCC 4Z1VA 5EZYA 4EB6B 4J9ZB 4DV3B 3JYCA 2RN9A 1Q5OA 1I5YA 5CBHA 3H1IH 2OCHA 2ZCEA 1N34O 4HBNA 1VF7A 3WFVA 1VQPV 3CMAV 4TQFA 3AK2A 2OCCB 4DR5O 3RBZA 4D6TH 5K1XA 1M93A 2XUMA 3SJAC 4EFEA 4EKWA 4NXMB 1COWG 1TUBA 3SJQC 4JTAB 4XDLA 4CC5A 2YI9A 3SPJA 1JJ2U 4N23A 1UFIA 1Q6HA 2CGOA 3TXSA 3WG7B 1JCHA 3CPWU 4OX9B 2M7WA 2V4DA 1NJIW 3OMAB 1XOUA 1JOYA 2ITCC 1PL4A 1TAEA 4JI0O 1WLEA 5ITZA 4JI5B 4GX2A 4LF8O 1VQNV 3BFRA 2QWNB 4B7EA 4TUYA 4FLWA 3CB2A 2HVJC 1FFXB 3M99B 1PM9A 1K5SA 4MVUA 1B04A 2ETNA 2IW5A 4JYCA 1E1RG 2HG5C 1Y76A 4F4LA 4BW9A 5LGTA 2JS3A 5IJ0B 4E2LA 4JAUA 4JYYA 3K0GA 4GKKO 1FPOA 3CCUV 4MW8A 4DV0O 5CA0A 3ZCCA 3NXSA 3UCSC 2G38A 3SYCA 3KG2A 5KHJA 3N2KB 4JI3B 5EC2C 3QG5A 4DV2O 2Z0AA 3JD3A 2ZXWC 5LXTB 3AEIA 2UU9B 2V7QG 4LFCB 5EIBD 1YCIA 3BA8A 1ZLZA 3K03A 4FLTA 2O57A 1PKXA 2EBOA 1PV0A 5C8YB 1W2BU 5BR8B 3FB8C 3UQ8A 2ITDC 2D2CB 3FD9A 2ZXWB 3E22A 2CAZC 3AG4C 3RVYA 5GONB 4JYAO 3CWBH 2UXCB 5LP6A 4MT8A 1IBMB 1KMIZ 4UCTA 2WA3A 4YJ2B 3S3XA 2JDIG 1NVPD 4OPAA 5DN6G 4X20B 1AB3A 1J95A 3IC7A 2EJRA 1BT8A 1S0VA 5F2VO 4K3AA 3AG4B 3APOA 3JCUZ 3OTFA 4XDJA 1XMOO 1XUQA 2WLNA 4D7TA 1K7DA 3CCVV 5JQGB 4LF9O 1H2GA 2XASA 5JVDB 2ZR2A 1JA8A 3J81N 4I50B 3P32A 4X62B 3JSNA 3W7TA 2BE3A 4QPKA 1VQOV 2IH1C 3RVZA 2GTAA 2P22C 5CMUA 2EIJC 4MTOA 5LMUO 1F4MA 1IURA 3ZRWB 5GTHZ 1N0JA 1WPXA 2XAHA 2YEVA 2ZE7A 1US6A 1JR9A 1BE3H 3OMIB 4MTFA 4FZ1A 1YSCA 2EIJB 3MD0A 2Y4TA 1K4DC 2P90A 4JI8B 1CEZA 2JGUA 3L73H 2LQTA 4UB8Z 4U3FH 4DV5B 1TA8A 4TSFG 2HP8A 4R6ZA 1NH2D 4CC6A 3S3WA 1XQ8A 4NB5A 1Z2GA 4LNUA 4GLXA 4DYLA 5IY5C 5LGUA 1FYJA 2FKXA 1XILA 3R65A 4KFMA 1VMGA 3H9VA 3L9DA 4PA6A 3QO8A 5LA6A 1SA0A 5JWPA 4HZ3A 4GKJO 4DR6O 2R9IA 3K06A 4DV7B 1R3LC 5IY5B 5BZBA 4X1IA 3ZHRA 4ZOLA 4HYOA 1HWYA 1Q86W 5EC1C 3HKDB 1BQZA 2XAJA 4WBNA 3O9OA 3ZHUA 2ATKC 4NVPA 2IH3C 1QVGU 2UUCB 2VS0A 3ETQA 2PZSA 2AW9A 1IBKO 5E79Z 5FLXN 4FLZA 1AVMA 1P49A 1UJWB 1GRJA 4J11A 2X6BA 5DECA 2ADPA 3G71V 4X65O 1HNWB 5CBFA 2WSSG 4TQDA 5J2UB 2Q7HA 2EIMC 1O9GA 2NR5A 4I0XB 5BXZA 2BTOA 1PL0A 3ABUA 2A79B 2YIBD 1NZ6A 3T1YB 1IDSA 1DK1A 4BIZA 1XMQB 4JI7O 4BAYA 3JD4A 4DUYO 3JAWB 3LDEA 1N36O 5JJJB 4DV4O 1ZL8A 4MVQA 2DMXA 4JI1O 5LHHA 1R6KA 3DXRB 2X7RB 3MHHC 2EIKC 1AROP 1Q90D 3BCCH
chains in the Genus database with same CATH topology
3GWOA 1XL4A 2KB1A 3T4ZA 3OR7C 4GX0A 3AG2C 2ZQMA 3B8NA 1V54B 2QA4V 1NBMG 1M1KW 4CZZA 2BOCC 4QPJA 2BOBC 2P7TC 4HAMA 1KECA 5B1BC 4I5SA 3CCEV 2JJ2G 4QNHB 3B77A 3TK1A 5KA6A 5H6QA 2EIKB 1NR1A 1VQ6V 3SYOA 1P7BA 1TUEB 3FYEB 1VQ8V 3UM7A 3TETA 3AG2B 4U7NA 4GX5A 5B3SC 4ASUG 1DLBA 2Q68A 3OEEG 1JQ0A 3JCZA 4JYBA 3D36A 1AI4A 1KQSU 1GM8A 5B1BB 3T2MA 4P30A 1OHHG 2OT5A 3QO7A 4WFEA 4PA3A 2Y48A 3CC4V 4R50A 3CCJV 1SETA 2X6AA 2ZDIA 3ASOC 1DF5A 3T1CA 3OMNB 2Y69C 4KP4A 2EILC 1MG1A 2DQ3A 4RUFA 4UVAA 3SYPA 3X2QC 3LDDA 2GHYA 4J9YB 1H8EG 1VQMV 3A0RA 3TCUA 3I55V 5IDJA 1MOFA 4KUMA 3G4SV 1QVFU 1M57C 2IJJA 3ASOB 1FXKC 3CC2V 1FXKA 4P9PA 1S3JA 2WWWA 3LDCA 3QNEA 5B1NA 2Y69B 4R7CA 3SPCA 1GKFA 2EILB 3ETDA 5LHGA 3P30A 1AI6A 3X2QB 1JVMA 1YITV 2JJ1G 1R3KC 1KC8W 1K9MW 2EZPA 1Q82W 4ZKIA 4P9OA 1I5XA 2X6CA 2WLLA 4MVOA 1M57B 1FXKB 5J9PC 2HFEC 2EINC 1PNLA 4PA9A 4U7OA 3CYOA 3ZMUA 5EK0A 3CCSV 1GK9A 3K0DA 2ZR3A 3ASNC 2A0LA 3I56V 4YXWG 4UV8A 2OCCC 3FB6C 5GW7A 2HLDG 1VQ7V 4J9ZB 3OE7G 3CCQV 1N8RW 4R8CA 4X88A 3JYCA 3OUFA 1E1QG 2WAMA 4GT1A 4CBCA 2WLKA 2EZOA 2XAGA 1I5YA 5CBHA 1Y4MA 4UV9A 4PELA 4DO2A 1PNMA 4QJFB 3SYQA 1YHQV 3WFVA 3CCMV 5E1AC 3CMAV 1KP2A 1VQPV 4JASA 3VOUA 2OCCB 1YTFB 2AHZA 5HFMA 4G28B 3RBZA 2HR3A 1SZTA 1NQTA 4EKWA 3ABLB 1COWG 2EIMB 3BY6A 4UVCA 1FS0G 1YJNV 3SJQC 3G6EV 4JTAB 4XDLA 4TWKA 3IFXA 3E83A 1IXMA 3SPJA 1JJ2U 4N23A 1AJQA 3WG7B 1JCHA 4QE9A 3CPWU 1QLEC 4FJCC 2M7WA 3ZRVA 2XAQA 3ML0A 4MVSA 1NJIW 3OMAB 1RM1C 2R9RB 1KKDA 1JOYA 2ITCC 4UUJC 4PA4A 2C2AA 1RPOA 3K08A 1FXHA 1W0KG 5L3BA 1WLEA 1AJNA 4GCZA 3BEHA 4LCUC 3ETEA 2Q67A 3LSSA 4GX2A 1VQNV 1QLEB 5FL7G 1Q81W 3HB3B 4MVRA 1OCZC 2CK3G 2QM8A 1FXVA 4L87A 2HVJC 2QKSA 3M99B 4UVBA 1RM1B 2JK5C 4X8AA 3OUSA 5LGNA 1YIJV 2H94A 1K5SA 1LNQA 4MVUA 2HKOA 1K5QA 4QE7A 5KUKA 2Q69A 2IW5A 2XOKG 1NVPB 1YTFD 4BIUA 1ROPA 1OCRC 1SERA 4JYCA 2LFRA 1E1RG 2HG5C 1G8MA 1CPYA 4LBEC 5B3SB 1OCZB 3ABMC 1PNKA 4F4LA 5LGTA 3E35A 4E2LA 3EHBB 4JAUA 3OW2U 2OTJV 4Z1MG 2AHYA 4PDVA 4PDMA 2IJHA 5L3GA 2WLIA 3ZIAG 3K0GA 3SPIA 3CXCU 3CCUV 1S76D 4MW8A 1R3IC 3FB5C 3D3IA 3LUTB 2W0FC 1OCRB 2WLJA 3AG1C 2DWDC 3ZCCA 1OCCC 3NXSA 5LBQA 3W7UA 3ABMB 3SYCA 3KG2A 5EC2C 4JF3A 3JD3A 1ZWIC 2ZXWC 4UXNA 2WLIB 3AEIA 1THZA 2V7QG 1YI2V 1M90W 1F23A 3LNMB 3K79A 3K03A 2IU0A 1PKXA 2EBOA 1QCEA 3H01A 3DTUB 4MVZA 1BHAA 1W2BU 3AG1B 3MHSC 1NKDA 1OCCB 3FB8C 2ITDC 1OCOC 4TT3G 4N21A 5L3CA 2ZD9A 2ZXWB 1DTOA 1K73W 3SPHA 3AG4C 3RVYA 1S72V 2X0LA 2HVKC 3VBBA 2Z3YA 1H8HG 3ABKC 4MT8A 1K33A 1GO3F 4JPRA 4X89A 2EINB 2JDIG 1NVPD 5DN6G 5B1AC 3W7SA 2GSMB 1OCOB 4MVMA 5B1OA 2JEUA 4FK5C 2XNDG 3ASNB 3B8MA 3ZRXA 1J95A 3IC7A 2UXNA 5IYDO 2EJRA 1S0VA 1S77D 3AG4B 4XDJA 1NH2B 3EFFK 3K3WA 2WLNA 4BW5A 3ABKB 4WFGA 1CP9A 3HPLC 1K7DA 1BMFG 3STLC 4MS2A 1KP3A 3CCVV 3E89A 3OEHG 4PA7A 1H2GA 2XASA 4XDKA 5B1AB 4ZBMA 2ZR2A 1ORQC 2XAFA 4JAVA 3ZJZA 3ZRWA 1QBZA 3P32A 2QEXV 1V55C 3W7TA 3RW0A 4RQEA 5IYBO 1F51A 3W7WA 3ZMZA 4QPKA 1VQOV 2IH1C 1W0JG 4Q20A 3RVZA 2FTKA 4DXWA 4GX1A 5CMUA 4WF9V 1PD3A 2EIJC 4MTOA 3QO5A 1F4MA 4WFHA 3ABTA 3FYIB 2QE7G 2JIZG 1JPXA 4I9WA 5H6RA 1RPRA 2WLHA 4OXSA 3ZRWB 3CCRV 3JD1A 2D3OW 5L3DA 1K97A 1R6NA 5IYCO 3OFNG 1K92A 1V55B 4LC1A 1WPXA 2XAHA 2YEVA 1SRYA 5C93A 3JD0A 3OMIB 4MTFA 1YSCA 2EIJB 1FFTB 3MD0A 1K8AW 1GTOA 3ZN0A 1K4DC 1AI7A 5H9CA 1VQLV 2P90A 4RO2A 4MW3A 5LHIA 2WPDG 3SPGA 5KUMA 3W7XA 4RQFA 1CEZA 4RUEA 1XL6A 3E8BA 1F4NA 1NR7A 2NLJC 2YEVB 2PI5A 3IGAC 3F7VC 3OAAG 3CP1A 4TSFG 1GM9A 4R6ZA 1VQ9V 1NH2D 4MTGA 5KA5A 2YSUB 5EBLC 3DGEA 3CMEV 5DM6V 4LP8A 3ZN1A 1Q7YW 1QLNA 1Y66A 5L3FA 2Q6AA 1M56C 4RAIA 3CC7V 3FB7C 2QTOA 2DYSC 2PI4A 5IY5C 5LGUA 4MTXA 1DF4A 2ZDIC 3E86A 2LFSA 3LSQA 2DYRC 3R65A 2DW4A 2W6IG 2B1GA 3OM3B 4KFMA 1YJWV 3AG3C 1MABG 4PA6A 4PDLA 1M56B 2IU3A 3QO8A 3CCLV 1R73A 4HZ3A 2P67A 4WCEV 4G27B 4XBFA 3E2EA 2JEXA 3OR6C 2R9IA 3K06A 2DYSB 1R3LC 3FKSG 1YJ9V 5IY5B 1SESA 2K1EA 1M9NA 5BZBA 5CN0A 1QR8A 1B6QA 4HYOA 2DYRB 1HWYA 4G2KA 1Q86W 5EC1C 4FMTA 3AG3B 4PDRA 2XAJA 1MSWD 2Z5UA 2ATKC 1BHBA 2IH3C 1H38A 3E8GA 1QVGU 3K04A 3STZC 4WFAV 2NNUA 1JX9A 1EFRG 1AJPA 4P2ZA 4MSWC 4JGSA 1EBOA 3SYAA 1K34A 1R3JC 1G4YB 3K9AA 3UKMA 2HJFC 3ETGA 4FPPA 3GB7C 1UJWB 2WLMA 2DQ0A 2IJKA 2W6JG 4QIWF 1AI5A 1QR9A 1E79G 2X6BA 3OGCC 5EBWC 3E8HA 2WLLB 2B1IA 4JTCB 3G71V 2UXXA 3JD2A 2F43G 1VQKV 2MK3A 5EBMC 1EZJA 4JTDB 2A9HA 5CBFA 2WSSG 3PJSK 3ABLC 2EIMC 2B5UA 2LP7A 1S5HC 5CA3A 1PL0A 3ABUA 1KD1W 3ZMVA 2A79B 1P4RA 2DWEC 1OZ0A 2IJIA 1GMGA 4WFFA 1K4CC 4BIZA 1VQ5V 3ZMTA 4BAYA 3JD4A 3T4DA 2QM7A 2H8PC 4H33A 3WG7C 3LDEA 1L1FA 1K3EA 1VQ4V 4H37A 1V54C 1BL8A 1GM7A 3ZMSA 5L3EA 5CBGA 4WFBV 1ENVA 3E8FA 4FIPC 4MVQA 5LHHA 1R6KA 2V1DA 1AR1B 2X7RB 3MHHC 3F7YC 2EIKC 5HFLA 2OTLV 3ZRSA 2P6JA 3CD6V 1AROP 3F5WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVZ A;  1XL4 A;  2KB1 A;  4RAI A;  3T4Z A;  5E1A C;  3FB7 C;  3OR7 C;  2QTO A;  3VOU A;  4GX0 A;  3FB8 C;  3AG2 C;  2DYS C;  2AHZ A;  2ITD C;  4G28 B;  3RBZ A;  1OCO C;  5IY5 C;  2BOC C;  2BOB C;  2P7T C;  2ZD9 A;  3E86 A;  5B1B C;  4EKW A;  2DYR C;  3R65 A;  3SPH A;  4QNH B;  3AG4 C;  3RVY A;  4KFM A;  2HVK C;  3AG3 C;  3ABK C;  4PA6 A;  4PDL A;  3SJQ C;  1P7B A;  4JTA B;  3SYO A;  4HZ3 A;  4TWK A;  4X89 A;  4XDL A;  4G27 B;  3UM7 A;  3IFX A;  3E83 A;  3OR6 C;  3TET A;  3K06 A;  5B1A C;  4GX5 A;  1R3L C;  3SPJ A;  5B3S C;  4MVM A;  2Q68 A;  2K1E A;  5BZB A;  1J95 A;  4HYO A;  4QE9 A;  3T2M A;  4P30 A;  1QLE C;  4XDJ A;  4WFE A;  5EC1 C;  4PA3 A;  3EFF K;  4BW5 A;  2WLN A;  4PDR A;  4WFG A;  3HPL C;  4MVS A;  4R50 A;  2ATK C;  3STL C;  2X6A A;  3ASO C;  2R9R B;  4MS2 A;  1KKD A;  2IH3 C;  3E89 A;  2ITC C;  3T1C A;  3E8G A;  4PA7 A;  4UUJ C;  4PA4 A;  4XDK A;  3K04 A;  3K08 A;  2Y69 C;  4ZBM A;  1ORQ C;  3STZ C;  2EIL C;  4RUF A;  3BEH A;  4P2Z A;  4LCU C;  3SYP A;  3ZJZ A;  4MSW C;  3X2Q C;  3LDD A;  2Q67 A;  4GX2 A;  4J9Y B;  1V55 C;  3RW0 A;  3SYA A;  4MVR A;  1OCZ C;  1R3J C;  3TCU A;  1G4Y B;  2IH1 C;  3RVZ A;  2HJF C;  3UKM A;  4DXW A;  4GX1 A;  2HVJ C;  2QKS A;  2EIJ C;  3GB7 C;  4MTO A;  2WLM A;  1M57 C;  2JK5 C;  4WFH A;  3OUS A;  4X8A A;  4P9P A;  3SPC A;  3LDC A;  2X6B A;  3OGC C;  4R7C A;  5EBW C;  4I9W A;  3E8H A;  4MVU A;  1LNQ A;  2WLL B;  4QE7 A;  5KUK A;  2WLH A;  4OXS A;  4JTC B;  2Q69 A;  1JVM A;  5EBM C;  1OCR C;  1R3K C;  4JTD B;  2A9H A;  5CBF A;  2HG5 C;  3PJS K;  4LBE C;  2YEV A;  3ABL C;  3ABM C;  4P9O A;  4F4L A;  2EIM C;  4MTF A;  2X6C A;  2WLL A;  1S5H C;  4MVO A;  2AHY A;  4PDV A;  4PDM A;  2A79 B;  2HFE C;  2WLI A;  1K4D C;  2EIN C;  5J9P C;  2DWE C;  3K0G A;  4PA9 A;  4RO2 A;  3SPI A;  4MW3 A;  3SPG A;  4MW8 A;  1R3I C;  5KUM A;  4WFF A;  1K4C C;  3FB5 C;  5EK0 A;  4RUE A;  1XL6 A;  3T4D A;  3LUT B;  2H8P C;  2W0F C;  3E8B A;  2NLJ C;  3ASN C;  3K0D A;  3LDE A;  4H33 A;  2A0L A;  2WLJ A;  3WG7 C;  3AG1 C;  2DWD C;  3IGA C;  3F7V C;  1OCC C;  2OCC C;  4H37 A;  1V54 C;  3FB6 C;  1BL8 A;  3KG2 A;  4R6Z A;  3SYC A;  4J9Z B;  5EC2 C;  5CBG A;  4MTG A;  4R8C A;  3JYC A;  1ZWI C;  2ZXW C;  3OUF A;  4X88 A;  2WLI B;  4CBC A;  3E8F A;  4MVQ A;  2WLK A;  5EBL C;  5CBH A;  3LNM B;  3F7Y C;  2EIK C;  4LP8 A;  3K03 A;  3SYQ A;  3ZRS A;  2Q6A A;  1M56 C;  3F5W C; 
#chains in the Genus database with same CATH topology
 4J41 A;  3RYI B;  3K9S A;  1JFF B;  1N0N A;  5B1B C;  2CGN A;  2BTQ B;  2DE0 X;  4NXN O;  5KA6 A;  1X4T A;  2ZM6 O;  2EIK B;  4LFB B;  4RWU A;  5KHI A;  2RQ6 A;  3P3N A;  4H44 B;  2PYJ A;  4GZR B;  4B3S B;  3TET A;  3LNN A;  4U7N A;  5B3S C;  4EFB A;  4ASU G;  1DLB A;  5IYZ B;  1RSO B;  1JQ0 A;  1H2M A;  1AP5 A;  1AI4 A;  1S5J A;  4IYH A;  1TVK B;  5B1B B;  4GYC B;  4P30 A;  2OT5 A;  3QO7 A;  5FPO A;  4PA3 A;  2HHH O;  3HKC B;  3SJC C;  3CCJ V;  4ICG A;  2ZDI A;  2E5L O;  4K0K B;  1P84 F;  3T1C A;  3OMN B;  2Y69 C;  4KP4 A;  2PUS A;  4O2A A;  3QTC A;  4YJ3 A;  2KSD A;  4KUM A;  2ZE5 A;  3IJ4 A;  4DK1 A;  1QVF U;  2Q7E A;  1FXK A;  4K8X A;  4P9P A;  2WWW A;  4J7K A;  2Y69 B;  5JCO A;  3L71 H;  5LHG A;  3P30 A;  1JVM A;  1YIT V;  1Q43 A;  1R3K C;  2A7W A;  3UO3 A;  1K9M W;  2EZP A;  4JI2 O;  4ZKI A;  3RN4 A;  1BS3 A;  2X6C A;  4EB6 A;  5J9P C;  2HFE C;  2EIN C;  1PNL A;  4DV1 O;  5FNV B;  3H1L H;  3CYO A;  3WB2 A;  1GK9 A;  3K0D A;  3ASN C;  4H13 B;  2A0L A;  5A9G A;  1NTK H;  1A32 A;  5GW7 A;  2HLD G;  4Z2W A;  3CCQ V;  2NN4 A;  4X88 A;  1LUW A;  4CBC A;  1E1Q G;  2WAM A;  2WLK A;  2EZO A;  2XAG A;  4A5U B;  1N33 O;  1EN6 A;  4IT5 A;  4TV8 B;  3L74 H;  1Y4M A;  4FFB B;  4PEL A;  4DO2 A;  2PGG A;  2VQE O;  1YHQ V;  2M6Y A;  5E1A C;  1KP2 A;  4JAS A;  1O9H A;  1OJH A;  1R6T A;  3VOU A;  1NT2 B;  2AHZ A;  4KXR A;  4F6R A;  2HR3 A;  2FL4 A;  2QM4 A;  2UXB B;  3ABL B;  3ZHS A;  4B3R O;  4AQY O;  2ZNJ A;  4UVC A;  1Z5W A;  3G6E V;  5D5P A;  1IXM A;  1D5A A;  1GH6 A;  5JH7 B;  4FJC C;  2QWQ B;  4J42 A;  3O65 A;  1MZE A;  4I55 B;  4UUJ C;  4PA4 A;  5L3B A;  2KQX A;  5IJ9 B;  4LF5 B;  4MVR A;  1N32 B;  3JAR A;  4IL6 Z;  1Q3E A;  2QKS A;  4L8J A;  5IJ0 A;  4DR3 O;  3OUS A;  2H94 A;  1XHX A;  1SF9 A;  3APQ A;  4QE7 A;  1K5Q A;  1NVP B;  1ROP A;  2LFR A;  1J5E B;  4JI6 O;  1I94 B;  3A0B Z;  1RP3 B;  2JRI A;  3OW2 U;  2OTJ V;  3N2K A;  4AHC A;  4Z1M G;  3BA9 A;  4PDV A;  1EZV H;  5L3G A;  3BAB A;  1NU1 H;  3SPI A;  1Y74 B;  3FB5 C;  3D3I A;  4ZIB A;  1SKV A;  2WLJ A;  5C8Y A;  4O2B A;  3AG1 C;  1OCC C;  2GTS A;  3ZHV A;  1IBL O;  4JF3 A;  1ZWI C;  2WLI B;  1KKC A;  1THZ A;  5A2Q N;  1M90 W;  4U3J A;  3LNM B;  4KL1 A;  3FX7 A;  2PTM A;  2IU0 A;  3AK1 A;  1QCE A;  3DTU B;  1I0H A;  1JJO A;  4MVZ A;  1Q6U A;  1BHA A;  5KX5 A;  3AG1 B;  4YJ2 A;  4JI5 O;  1OCC B;  2P4V A;  5IWA B;  5KHK A;  3RYC A;  4K8Z A;  4X20 A;  4JV5 O;  1S72 V;  5H5N A;  1HR0 B;  2HVK C;  3VBB A;  2Z3Y A;  4X66 B;  4UCO A;  5B1A C;  3W7S A;  2GSM B;  4LFA O;  1AR5 A;  2YDE A;  3ZRX A;  2CH7 B;  3IAY A;  4I50 A;  1S77 D;  1IX9 A;  1NH2 B;  5BY1 A;  3EFF K;  1LR1 A;  3QF7 A;  3E89 A;  3OEH G;  4PA7 A;  5B1A B;  4ZBM A;  1ORQ C;  3FAV B;  3JSL A;  3ZJZ A;  1G1X B;  4KHP O;  4ZHQ B;  3ZRW A;  2QEX V;  1Y67 A;  4DV6 O;  5IYB O;  3GVM A;  4LR3 A;  4GX1 A;  4IGG A;  1PD3 A;  1ZX3 A;  3QO5 A;  4WFH A;  3ABT A;  3FYI B;  3GWK C;  4I9W A;  4UB6 Z;  5BR8 O;  2WLH A;  3DC6 A;  3JAL B;  4JI4 B;  1R6N A;  2Q9L A;  5IYC O;  4BIO A;  1K92 A;  4LC1 A;  3K5M A;  5KAI Z;  3JD0 A;  1URF A;  5IE9 A;  4HNA B;  1GTO A;  2F93 B;  1EN5 A;  3ZN0 A;  3JAT B;  1IBM O;  3CRM A;  5LHI A;  5BMV B;  1I08 A;  3SPG A;  5KMG B;  3W7X A;  2YIC A;  1F4N A;  2PI5 A;  1I7F A;  2UUB O;  1HNZ B;  2LW7 A;  2QR4 A;  2GV9 A;  1YVW A;  5EBL C;  3M8A A;  5DM6 V;  4LP8 A;  3ZN1 A;  1Q7Y W;  1QLN A;  4K35 A;  3D36 C;  1Y66 A;  2Q6A A;  1MSD A;  2GBO A;  4RAI A;  3CC7 V;  2QWR B;  4CH4 A;  1BSM A;  2QTO A;  2DJV A;  4X62 O;  2PI4 A;  1BZK A;  3E86 A;  2LFS A;  3P3P A;  4B3M B;  4LF6 O;  2W6I G;  1N34 B;  2B1G A;  1YJW V;  3AG3 C;  4YY3 B;  3HKD A;  4PDL A;  4DR5 B;  4G27 B;  4XBF A;  1SES A;  2K1E A;  2RDC A;  1QR8 A;  1KU9 A;  2EUL A;  3UT5 B;  5LOV B;  3AG3 B;  1MSW D;  3VQV A;  2Z5U A;  1BHB A;  3Q4H B;  1SQV H;  4J7Z A;  4ZI7 B;  3E8G A;  2F4V O;  2LW1 A;  4FVM A;  4DV5 O;  1EFR G;  4P2Z A;  4MSW C;  3SYA A;  2RJZ A;  4IIJ B;  3CRR A;  5J2U A;  3K9A A;  2UXD O;  4I0X A;  2WLM A;  2Q5Z A;  2DQ0 A;  2IJK A;  1EN4 A;  3RYH B;  4JI0 B;  4ABM A;  3OGC C;  1F7Y A;  1ZUQ A;  5B66 Z;  2WLL B;  2Q7G A;  1YDX A;  1XRE A;  3SJB C;  2L35 A;  1AP6 A;  1EZJ A;  4JTD B;  2A9H A;  3JAW A;  1SQX H;  3L72 H;  2LP7 A;  5KHG A;  2ZIN A;  3N2G B;  3ZMV A;  1P4R A;  1OZ0 A;  5EZY B;  1GMG A;  3DXR A;  4WFF A;  3ZMT A;  1M4U A;  1L1F A;  1K3E A;  1XNR O;  3RYF B;  5KHH A;  4H37 A;  3RYI A;  3JAM N;  3EVK A;  4GKK B;  3E8F A;  4FIP C;  1MNG A;  2BTQ A;  2W0X A;  3CD6 V;  2UUC O;  2YXL A;  3F5W C;  1TUB B;  2ZQM A;  3B8N A;  1M1K W;  2BOC C;  1RSO A;  1KEC A;  3T1H B;  1XNQ O;  1TVK A;  3TK1 A;  5H6Q A;  2RCV A;  3D8C A;  2YC0 A;  1UPG A;  3SYO A;  4B3T B;  1P7B A;  3HKC A;  1G6U A;  5KAF Z;  1VQ8 V;  4FFK A;  4BR6 A;  1KUQ A;  4PJ0 Z;  4FM1 A;  4DR7 O;  5H2F Z;  1H2K A;  3T2M A;  1N4C A;  4JYA B;  1PPJ H;  3KZI Z;  4J80 A;  5ITZ B;  4R50 A;  3CHX A;  2X6A A;  3ASO C;  1SS3 A;  3KCY A;  2Q0O C;  4TUY B;  3N27 A;  4RUF A;  3SYP A;  3X2Q C;  3LDD A;  5LYJ B;  1H8E G;  1VQM V;  3I55 V;  5IDJ A;  1MOF A;  1M57 C;  2IJJ A;  3ASO B;  2R70 A;  1Y6X A;  1Y76 B;  5B1N A;  3LDC A;  4I9Q A;  3ZBH A;  4R7C A;  1GKF A;  5FNV A;  4UCR A;  3X2Q B;  3EXA A;  2OIE A;  2JJ1 G;  1KC8 W;  1Q82 W;  4P9O A;  5LMU B;  4B7K A;  2PYL A;  1M57 B;  1Z5V A;  4LFB O;  2N04 A;  4NTX A;  4TV8 A;  4FFB A;  5EK0 A;  4DW0 A;  3CCS V;  4B3S O;  2ZR3 A;  2JGD B;  4YXW G;  4UV8 A;  1QHT A;  2LO1 A;  5LP6 C;  1VQ7 V;  3OE7 G;  1N8R W;  1WN7 A;  3OUF A;  3THO A;  4YHH O;  1HW7 A;  1VEW A;  3CSX A;  1PNM A;  3SYQ A;  1WPB A;  3CCM V;  1SC5 B;  4X64 B;  3AK3 A;  4E4E A;  5HFM A;  5LP6 B;  1SZT A;  1FJG O;  1AIL A;  3B2E E;  3JAS A;  2EIM B;  5JH7 A;  3BY6 A;  4DUZ O;  5EYP B;  1YJN V;  3IC9 A;  3IFX A;  4QGP A;  4I55 A;  3K5O A;  4FLU A;  4QE9 A;  1QLE C;  5IJ9 A;  3HKB B;  2YS8 A;  3ZRV A;  1V9P A;  3A8T A;  4MVS A;  4DR6 B;  1KKD A;  2C2A A;  1RPO A;  3K08 A;  1W0K G;  1PP9 H;  1SQB H;  3BEH A;  4LCU C;  3OTO O;  2Q67 A;  1QLE B;  3HB3 B;  5LMN O;  1FXV A;  1SQG A;  1VP7 A;  4UVB A;  4PHZ A;  1ZAU A;  4O4J B;  4X8A A;  5LGN A;  3JAK A;  2HKO A;  1YTF D;  4BIU A;  1IBK B;  1SER A;  1OV9 A;  4LBE C;  2ZKO A;  5J2T B;  5B3S B;  2F95 B;  1SQQ H;  4O4H B;  2AHY A;  1HNX O;  4DR4 B;  2IJH A;  2WLI A;  2KG7 B;  3CXC U;  1S76 D;  2QWP B;  4DW1 A;  3LUT B;  2ZNI A;  2DWD C;  2P4K A;  2A3Q A;  5LBQ A;  3W7U A;  4H0L B;  1YI2 V;  2E3C A;  4JI7 B;  1F23 A;  3A0H Z;  3K79 A;  2HEP A;  4DUY B;  1N36 B;  1AR4 A;  2CTP A;  5LL6 Y;  4I7Z B;  2CTQ A;  4AI8 A;  3CEI A;  4DV4 B;  3TXQ A;  3MHS C;  4LF5 O;  5LA6 B;  4JI1 B;  2CH7 A;  1IVS A;  2L6L A;  4DR2 O;  1H8H G;  4X1I B;  4X89 A;  2EIN B;  1SQF A;  3DSQ A;  3RT3 C;  2ARH A;  3C3T A;  2A06 H;  1NTM H;  4PI2 A;  4NXN B;  2JEU A;  4FK5 C;  4O4I B;  2XND G;  4TV9 B;  3ASN B;  3FAV A;  5IYD O;  2UXN A;  4DR1 O;  4UFZ A;  3ZX6 A;  3STL C;  3TGU H;  1KP3 A;  4XDK A;  4D7S A;  1VF5 B;  1QBZ A;  4I4T B;  1V55 C;  2HHH B;  3RW0 A;  4RQE A;  4JZ2 A;  1F51 A;  3W7W A;  3ZMZ A;  3M7M X;  4LF4 O;  3F5T A;  1FAF A;  1W0J G;  2E5L B;  2FTK A;  4O4L B;  4WF9 V;  3I5D A;  2ZT9 B;  1RFY A;  3JAT A;  2JIZ G;  5H6R A;  1RPR A;  5BMV A;  2YI8 A;  1QU7 A;  2D3O W;  3CRA A;  5L3D A;  1K97 A;  1FFX A;  3OFN G;  1V55 B;  3U11 A;  1EM1 A;  1FFT B;  1K8A W;  1TGO A;  4DV3 O;  5H9C A;  2QKA A;  4RO2 A;  4MW3 A;  4J10 A;  5KUM A;  4RQF A;  2CTW A;  1XL6 A;  1NR7 A;  2FB5 A;  2NLJ C;  3J80 N;  3CJH B;  3F7V C;  3CP1 A;  1GM9 A;  4NYK A;  4MTG A;  1QQC A;  5KA5 A;  4DV1 B;  2PY5 A;  2E76 B;  2YSU B;  5TIS Z;  2N05 A;  4NXM O;  4FZ0 A;  5LXT A;  2BCC H;  2YIB A;  3PN1 A;  2DYS C;  1N33 B;  2ZDI C;  3LSQ A;  4PD4 F;  2OYQ A;  1MA1 A;  2DYR C;  3BRC A;  3MAQ A;  5LOV A;  1MAB G;  4OX9 O;  2IU3 A;  1R73 A;  4WCE V;  1KB9 F;  3E2E A;  3CXH F;  2JEX A;  3OR6 C;  4JI4 O;  2DYS B;  2Q8V A;  5GON A;  2YXH A;  4B3R B;  2DYR B;  1VF6 C;  4G2K A;  4AQY B;  5JCO C;  4FMT A;  3H1J H;  1WP8 A;  4IIJ A;  4PDR A;  2XTA A;  3SGI A;  3U10 A;  4LWS B;  3RYH A;  3K04 A;  3STZ C;  4WFA V;  1H2S B;  1JX9 A;  2AZ2 A;  1AJP A;  4JGS A;  1EBO A;  3SDL A;  1WP7 A;  4X1Y B;  1HNZ O;  1DGS A;  5JQG A;  1R3J C;  5JVD A;  1G4Y B;  3UKM A;  2HJF C;  3ETG A;  4UCV A;  4GUN A;  2W6J G;  1B3Q A;  1AI5 A;  1QR9 A;  1E79 G;  5EBW C;  3SR2 C;  4LF7 B;  2B1I A;  3G80 A;  2F43 G;  1VQK V;  5EBM C;  4C7U A;  4FLV A;  3RYF A;  4DR3 B;  4B3M O;  2QDO A;  1S5H C;  5CA3 A;  2MW2 B;  4JI3 O;  3DC5 A;  2OIG A;  4YY3 O;  1L8D A;  2IJI A;  3TJT A;  3BPZ A;  2UU9 O;  3G6B A;  4LFC O;  1K4C C;  1VQ5 V;  4BWA A;  4H33 A;  2YUA A;  3WG7 C;  4JI6 B;  2IM9 A;  2EX3 A;  1WNS A;  2IBZ H;  3AG7 A;  3QVN A;  3ZMS A;  1YF2 A;  5L3E A;  2VQF B;  4WFB V;  2UUA B;  1ENV A;  1NS1 A;  4FM0 A;  4F6R B;  3CE2 A;  3UO2 A;  2UXC O;  3T4Z A;  3OGI B;  1IBL B;  5CA1 B;  4PV1 B;  4GX0 A;  3K57 A;  3AG2 C;  1L0L H;  2QA4 V;  4QPJ A;  5CB4 B;  3CCE V;  2JJ2 G;  4QNH B;  4FM2 A;  3FFQ A;  4IHJ B;  1NR1 A;  3KKY A;  1TUE B;  3ZHQ A;  3AG2 B;  4GX5 A;  1WB7 A;  3OEE G;  4YIO A;  4JV5 B;  1GM8 A;  4YIP A;  4DRX B;  1OHH G;  4W4K A;  5LYJ A;  4WFE A;  1YXB A;  2Y48 A;  5KLV H;  5JJN B;  3CC4 V;  1FKA O;  5D5Q A;  4LFA B;  3JAR B;  1WA8 B;  1MG1 A;  2DQ3 A;  1GN4 A;  4UVA A;  5GTI Z;  2GHY A;  2H3O A;  2ZE6 A;  3A0R A;  3TCU A;  2GUZ B;  2KKW A;  5IT9 N;  3CC2 V;  4TOI A;  1S3J A;  1LUV A;  3QNE A;  4KHP B;  4NTY A;  3ETD A;  4DV6 B;  3A2F A;  4UCS A;  3L75 H;  4JI8 O;  1AI6 A;  1WAZ A;  2ODM A;  4W4L A;  3R66 A;  4DK0 A;  2JGD A;  3G67 A;  4NR1 A;  3T1H O;  2QTS A;  1I5X A;  2QWO B;  4X1K B;  4O2B B;  1B06 A;  4PA9 A;  4B3T O;  4U7O A;  3ZMU A;  2P5O A;  1SQP H;  1ZSP A;  3ZED A;  2BSK B;  4U3J B;  2FYU H;  3FB6 C;  3HKE B;  1M5I A;  4LF8 B;  4R8C A;  2LJ2 A;  3BVO A;  4GT1 A;  5KX5 B;  3LSU A;  3RYC B;  1IXB A;  4UV9 A;  4QJF B;  1MZF A;  5AG2 A;  5EYP A;  2UUB B;  1YTF B;  4G28 B;  2VRZ A;  3WB1 A;  1HDJ A;  2VWK A;  3RFR A;  4DV7 O;  1NQT A;  2AXT Z;  1XEQ A;  1R1B A;  3HKB A;  1VIB A;  1FS0 G;  1JFF A;  4TWK A;  1HP8 A;  3E83 A;  4DV0 B;  1AJQ A;  4LF6 B;  1H2L A;  4DV2 B;  4OGQ B;  4J7J A;  2XAQ A;  2YID A;  3ML0 A;  2JVD A;  5IYZ A;  2QGN A;  1RM1 C;  2R9R B;  1NI8 A;  4O4J A;  1FXH A;  3B40 A;  1AJN A;  4GCZ A;  1FD9 A;  3VQX A;  3ETE A;  3LSS A;  5FL7 G;  1Q81 W;  1OCZ C;  1HNW O;  2CK3 G;  2QM8 A;  5J2T A;  4L87 A;  2Y0I A;  3C3S A;  2Q0A A;  4B08 A;  4O4H A;  2F4V B;  1RM1 B;  2JK5 C;  2ZE8 A;  2P06 A;  2Q4P A;  1YIJ V;  4X64 O;  1IZ3 A;  2KG7 A;  5KUK A;  1LNQ A;  2Q69 A;  2XOK G;  3T1Y O;  1OCR C;  3MDS A;  2ILM A;  1XMQ O;  1G8M A;  2UXD B;  1CPY A;  4CH5 A;  1OCZ B;  3ABM C;  1PNK A;  3E35 A;  3EHB B;  1XMO B;  3CRC A;  1H2N A;  4PDM A;  2CUG A;  3ZIA G;  1R3I C;  4IYI A;  3L70 H;  4LF9 B;  2W0F C;  1OCR B;  4PI0 A;  2XHB A;  4CS2 A;  2QSA A;  3ABM B;  4JZG A;  4UXN A;  4X9Q A;  2OWO A;  5CA0 B;  1XNR B;  4LH6 A;  3VQW A;  3H01 A;  1YZB A;  1NKD A;  3OT7 A;  1OCO C;  1ZTE A;  4TT3 G;  2XT9 A;  2AZ0 A;  4N21 A;  5L3C A;  2ZD9 A;  4EEQ A;  1DTO A;  4O4I A;  4TV9 A;  1K73 W;  3SPH A;  4CH3 A;  3K59 A;  2X0L A;  3ABK C;  1K33 A;  1GO3 F;  4JPR A;  2R9A A;  3K58 A;  4CH6 A;  4K0K O;  1OCO B;  4MVM A;  5B1O A;  1XNQ B;  3E22 B;  3B8M A;  4CS3 A;  2VWJ A;  2WA4 A;  4I4T A;  3B09 A;  4BW5 A;  3K3W A;  4DR4 O;  2F66 C;  3ABK B;  1CP9 A;  3HPL C;  4WFG A;  2E74 B;  1BMF G;  4O4L A;  4MS2 A;  1U96 A;  2FML A;  1YEW A;  4DR7 B;  2XAF A;  4JAV A;  3KCX A;  4Q20 A;  3B4S A;  4DXW A;  1S5L Z;  2ZIM A;  1QNM A;  5B5E Z;  2QE7 G;  1JPX A;  2LGW A;  4OXS A;  1P7G A;  5K1P A;  3CCR V;  3JD1 A;  4GKJ B;  2JS5 A;  4NKG B;  1L0N H;  1SRY A;  5C93 A;  3ICX A;  3CJH A;  2ZIO A;  3ZS8 C;  3HR0 A;  1WB8 A;  1AI7 A;  1VQL V;  1BCC H;  1D2D A;  2GDS A;  2WPD G;  1CXZ B;  1JMK C;  2K9P A;  4RUE A;  3E8B A;  1MMM A;  2YEV B;  1W59 A;  3IGA C;  3OAA G;  1Y74 A;  1VQ9 V;  2AGA A;  1T5E A;  3DGE A;  3CME V;  2UXB O;  5L3F A;  1M56 C;  4NTW A;  3FB7 C;  1GN6 A;  4X65 B;  4YHH B;  1XDC A;  4MTX A;  1DF4 A;  2YIA A;  2DW4 A;  4FLX A;  3OM3 B;  5FPR A;  3K5N A;  2QKC A;  1M56 B;  3CCL V;  2RMK B;  2P67 A;  4LNU B;  1BQ0 A;  4LWS A;  3FKS G;  3BAA A;  1YJ9 V;  4AIL C;  1FJG B;  2RNB A;  1M9N A;  5CN0 A;  1B6Q A;  4F6E A;  4DUZ B;  1BGY H;  1VF6 A;  4X1Y A;  1KYO F;  2Y4U A;  1XI1 A;  3RWR D;  3WU2 Z;  1SA0 B;  1N32 O;  1H38 A;  1KBH A;  4UCU A;  2NNU A;  3K5L A;  4ZOL B;  3OD4 A;  2QJ1 A;  5JJE B;  4Q6G A;  1K34 A;  1WJZ A;  3ZHT A;  4WBN B;  1X59 A;  4FPP A;  3RGB A;  1J5E O;  3GB7 C;  1I94 O;  4ZHQ A;  2ZM6 B;  4JAA A;  1D5N A;  4QIW F;  3WB0 A;  2R72 A;  3J7A U;  3OTO B;  3E8H A;  4JTC B;  2UXX A;  3JD2 A;  2MK3 A;  5LMN B;  3PJS K;  3ABL C;  1Q6I A;  2B5U A;  3JAL A;  1KD1 W;  1GN2 A;  1XHZ A;  2DWE C;  2HJD A;  3D3Q A;  3CS5 A;  3T4D A;  2QM7 A;  2H8P C;  2DOS A;  4HNA A;  5DED A;  1VQ4 V;  4LH7 A;  5CA1 A;  1V54 C;  1BL8 A;  5KMG A;  1GM7 A;  1HNX B;  5CBG A;  5IWA O;  1U97 A;  5EIB C;  4OPH A;  5CB4 A;  2E75 B;  2V1D A;  1AR1 B;  1GAX A;  3F7Y C;  5HFL A;  4IHJ A;  3ZRS A;  2P6J A;  1HR0 O;  2OTL V;  2PF4 E;  3GWO A;  1XL4 A;  2KB1 A;  3JAS B;  4X66 O;  3OR7 C;  1NTZ H;  2Q73 A;  1ZL8 B;  1V54 B;  1NBM G;  4CZZ A;  2BOB C;  3U0Z A;  2P7T C;  4HAM A;  4JI2 B;  4I5S A;  3B77 A;  4DRX A;  3VQY A;  3H1K H;  1VQ6 V;  2CTR A;  3FYE B;  3H1H H;  4LF7 O;  3UM7 A;  2F23 A;  2Q68 A;  3JCZ A;  4JYB A;  3C90 A;  3D36 A;  1WA8 A;  1KQS U;  1GN3 A;  2DN9 A;  4DR2 B;  2YXY A;  1SZX A;  3CX5 F;  4FLY A;  2GUZ A;  1SET A;  3NR7 A;  1VAR A;  1DF5 A;  2VQE B;  2F1M A;  3UT5 A;  2EIL C;  4DR1 B;  2B9Z A;  2EJ7 A;  4J9Y B;  2VQF O;  2ADQ B;  3Q4H A;  4ZI7 A;  2UUA O;  3JAK B;  1Q8I A;  3G4S V;  1FXK C;  4X1K A;  3SPC A;  2EIL B;  3BHP A;  4LF4 B;  2CE4 A;  4O2A B;  1XBL A;  4YJ3 B;  2BSK A;  2N74 A;  3HKE A;  2WLL A;  4MVO A;  2Y0P A;  1FXK B;  2LGQ A;  4CS4 A;  2CDY A;  3CRQ A;  3I56 V;  3N2G A;  2OCC C;  4Z1V A;  5EZY A;  4EB6 B;  4J9Z B;  4DV3 B;  3JYC A;  2RN9 A;  1Q5O A;  1I5Y A;  5CBH A;  3H1I H;  2OCH A;  2ZCE A;  1N34 O;  4HBN A;  1VF7 A;  3WFV A;  1VQP V;  3CMA V;  4TQF A;  3AK2 A;  2OCC B;  4DR5 O;  3RBZ A;  4D6T H;  5K1X A;  1M93 A;  2XUM A;  3SJA C;  4EFE A;  4EKW A;  4NXM B;  1COW G;  1TUB A;  3SJQ C;  4JTA B;  4XDL A;  4CC5 A;  2YI9 A;  3SPJ A;  1JJ2 U;  4N23 A;  1UFI A;  1Q6H A;  2CGO A;  3TXS A;  3WG7 B;  1JCH A;  3CPW U;  4OX9 B;  2M7W A;  2V4D A;  1NJI W;  3OMA B;  1XOU A;  1JOY A;  2ITC C;  1PL4 A;  1TAE A;  4JI0 O;  1WLE A;  5ITZ A;  4JI5 B;  4GX2 A;  4LF8 O;  1VQN V;  3BFR A;  2QWN B;  4B7E A;  4TUY A;  4FLW A;  3CB2 A;  2HVJ C;  1FFX B;  3M99 B;  1PM9 A;  1K5S A;  4MVU A;  1B04 A;  2ETN A;  2IW5 A;  4JYC A;  1E1R G;  2HG5 C;  1Y76 A;  4F4L A;  4BW9 A;  5LGT A;  2JS3 A;  5IJ0 B;  4E2L A;  4JAU A;  4JYY A;  3K0G A;  4GKK O;  1FPO A;  3CCU V;  4MW8 A;  4DV0 O;  5CA0 A;  3ZCC A;  3NXS A;  3UCS C;  2G38 A;  3SYC A;  3KG2 A;  5KHJ A;  3N2K B;  4JI3 B;  5EC2 C;  3QG5 A;  4DV2 O;  2Z0A A;  3JD3 A;  2ZXW C;  5LXT B;  3AEI A;  2UU9 B;  2V7Q G;  4LFC B;  5EIB D;  1YCI A;  3BA8 A;  1ZLZ A;  3K03 A;  4FLT A;  2O57 A;  1PKX A;  2EBO A;  1PV0 A;  5C8Y B;  1W2B U;  5BR8 B;  3FB8 C;  3UQ8 A;  2ITD C;  2D2C B;  3FD9 A;  2ZXW B;  3E22 A;  2CAZ C;  3AG4 C;  3RVY A;  5GON B;  4JYA O;  3CWB H;  2UXC B;  5LP6 A;  4MT8 A;  1IBM B;  1KMI Z;  4UCT A;  2WA3 A;  4YJ2 B;  3S3X A;  2JDI G;  1NVP D;  4OPA A;  5DN6 G;  4X20 B;  1AB3 A;  1J95 A;  3IC7 A;  2EJR A;  1BT8 A;  1S0V A;  5F2V O;  4K3A A;  3AG4 B;  3APO A;  3JCU Z;  3OTF A;  4XDJ A;  1XMO O;  1XUQ A;  2WLN A;  4D7T A;  1K7D A;  3CCV V;  5JQG B;  4LF9 O;  1H2G A;  2XAS A;  5JVD B;  2ZR2 A;  1JA8 A;  3J81 N;  4I50 B;  3P32 A;  4X62 B;  3JSN A;  3W7T A;  2BE3 A;  4QPK A;  1VQO V;  2IH1 C;  3RVZ A;  2GTA A;  2P22 C;  5CMU A;  2EIJ C;  4MTO A;  5LMU O;  1F4M A;  1IUR A;  3ZRW B;  5GTH Z;  1N0J A;  1WPX A;  2XAH A;  2YEV A;  2ZE7 A;  1US6 A;  1JR9 A;  1BE3 H;  3OMI B;  4MTF A;  4FZ1 A;  1YSC A;  2EIJ B;  3MD0 A;  2Y4T A;  1K4D C;  2P90 A;  4JI8 B;  1CEZ A;  2JGU A;  3L73 H;  2LQT A;  4UB8 Z;  4U3F H;  4DV5 B;  1TA8 A;  4TSF G;  2HP8 A;  4R6Z A;  1NH2 D;  4CC6 A;  3S3W A;  1XQ8 A;  4NB5 A;  1Z2G A;  4LNU A;  4GLX A;  4DYL A;  5IY5 C;  5LGU A;  1FYJ A;  2FKX A;  1XIL A;  3R65 A;  4KFM A;  1VMG A;  3H9V A;  3L9D A;  4PA6 A;  3QO8 A;  5LA6 A;  1SA0 A;  5JWP A;  4HZ3 A;  4GKJ O;  4DR6 O;  2R9I A;  3K06 A;  4DV7 B;  1R3L C;  5IY5 B;  5BZB A;  4X1I A;  3ZHR A;  4ZOL A;  4HYO A;  1HWY A;  1Q86 W;  5EC1 C;  3HKD B;  1BQZ A;  2XAJ A;  4WBN A;  3O9O A;  3ZHU A;  2ATK C;  4NVP A;  2IH3 C;  1QVG U;  2UUC B;  2VS0 A;  3ETQ A;  2PZS A;  2AW9 A;  1IBK O;  5E79 Z;  5FLX N;  4FLZ A;  1AVM A;  1P49 A;  1UJW B;  1GRJ A;  4J11 A;  2X6B A;  5DEC A;  2ADP A;  3G71 V;  4X65 O;  1HNW B;  5CBF A;  2WSS G;  4TQD A;  5J2U B;  2Q7H A;  2EIM C;  1O9G A;  2NR5 A;  4I0X B;  5BXZ A;  2BTO A;  1PL0 A;  3ABU A;  2A79 B;  2YIB D;  1NZ6 A;  3T1Y B;  1IDS A;  1DK1 A;  4BIZ A;  1XMQ B;  4JI7 O;  4BAY A;  3JD4 A;  4DUY O;  3JAW B;  3LDE A;  1N36 O;  5JJJ B;  4DV4 O;  1ZL8 A;  4MVQ A;  2DMX A;  4JI1 O;  5LHH A;  1R6K A;  3DXR B;  2X7R B;  3MHH C;  2EIK C;  1ARO P;  1Q90 D;  3BCC H; 
#chains in the Genus database with same CATH homology
 3GWO A;  1XL4 A;  2KB1 A;  3T4Z A;  3OR7 C;  4GX0 A;  3AG2 C;  2ZQM A;  3B8N A;  1V54 B;  2QA4 V;  1NBM G;  1M1K W;  4CZZ A;  2BOC C;  4QPJ A;  2BOB C;  2P7T C;  4HAM A;  1KEC A;  5B1B C;  4I5S A;  3CCE V;  2JJ2 G;  4QNH B;  3B77 A;  3TK1 A;  5KA6 A;  5H6Q A;  2EIK B;  1NR1 A;  1VQ6 V;  3SYO A;  1P7B A;  1TUE B;  3FYE B;  1VQ8 V;  3UM7 A;  3TET A;  3AG2 B;  4U7N A;  4GX5 A;  5B3S C;  4ASU G;  1DLB A;  2Q68 A;  3OEE G;  1JQ0 A;  3JCZ A;  4JYB A;  3D36 A;  1AI4 A;  1KQS U;  1GM8 A;  5B1B B;  3T2M A;  4P30 A;  1OHH G;  2OT5 A;  3QO7 A;  4WFE A;  4PA3 A;  2Y48 A;  3CC4 V;  4R50 A;  3CCJ V;  1SET A;  2X6A A;  2ZDI A;  3ASO C;  1DF5 A;  3T1C A;  3OMN B;  2Y69 C;  4KP4 A;  2EIL C;  1MG1 A;  2DQ3 A;  4RUF A;  4UVA A;  3SYP A;  3X2Q C;  3LDD A;  2GHY A;  4J9Y B;  1H8E G;  1VQM V;  3A0R A;  3TCU A;  3I55 V;  5IDJ A;  1MOF A;  4KUM A;  3G4S V;  1QVF U;  1M57 C;  2IJJ A;  3ASO B;  1FXK C;  3CC2 V;  1FXK A;  4P9P A;  1S3J A;  2WWW A;  3LDC A;  3QNE A;  5B1N A;  2Y69 B;  4R7C A;  3SPC A;  1GKF A;  2EIL B;  3ETD A;  5LHG A;  3P30 A;  1AI6 A;  3X2Q B;  1JVM A;  1YIT V;  2JJ1 G;  1R3K C;  1KC8 W;  1K9M W;  2EZP A;  1Q82 W;  4ZKI A;  4P9O A;  1I5X A;  2X6C A;  2WLL A;  4MVO A;  1M57 B;  1FXK B;  5J9P C;  2HFE C;  2EIN C;  1PNL A;  4PA9 A;  4U7O A;  3CYO A;  3ZMU A;  5EK0 A;  3CCS V;  1GK9 A;  3K0D A;  2ZR3 A;  3ASN C;  2A0L A;  3I56 V;  4YXW G;  4UV8 A;  2OCC C;  3FB6 C;  5GW7 A;  2HLD G;  1VQ7 V;  4J9Z B;  3OE7 G;  3CCQ V;  1N8R W;  4R8C A;  4X88 A;  3JYC A;  3OUF A;  1E1Q G;  2WAM A;  4GT1 A;  4CBC A;  2WLK A;  2EZO A;  2XAG A;  1I5Y A;  5CBH A;  1Y4M A;  4UV9 A;  4PEL A;  4DO2 A;  1PNM A;  4QJF B;  3SYQ A;  1YHQ V;  3WFV A;  3CCM V;  5E1A C;  3CMA V;  1KP2 A;  1VQP V;  4JAS A;  3VOU A;  2OCC B;  1YTF B;  2AHZ A;  5HFM A;  4G28 B;  3RBZ A;  2HR3 A;  1SZT A;  1NQT A;  4EKW A;  3ABL B;  1COW G;  2EIM B;  3BY6 A;  4UVC A;  1FS0 G;  1YJN V;  3SJQ C;  3G6E V;  4JTA B;  4XDL A;  4TWK A;  3IFX A;  3E83 A;  1IXM A;  3SPJ A;  1JJ2 U;  4N23 A;  1AJQ A;  3WG7 B;  1JCH A;  4QE9 A;  3CPW U;  1QLE C;  4FJC C;  2M7W A;  3ZRV A;  2XAQ A;  3ML0 A;  4MVS A;  1NJI W;  3OMA B;  1RM1 C;  2R9R B;  1KKD A;  1JOY A;  2ITC C;  4UUJ C;  4PA4 A;  2C2A A;  1RPO A;  3K08 A;  1FXH A;  1W0K G;  5L3B A;  1WLE A;  1AJN A;  4GCZ A;  3BEH A;  4LCU C;  3ETE A;  2Q67 A;  3LSS A;  4GX2 A;  1VQN V;  1QLE B;  5FL7 G;  1Q81 W;  3HB3 B;  4MVR A;  1OCZ C;  2CK3 G;  2QM8 A;  1FXV A;  4L87 A;  2HVJ C;  2QKS A;  3M99 B;  4UVB A;  1RM1 B;  2JK5 C;  4X8A A;  3OUS A;  5LGN A;  1YIJ V;  2H94 A;  1K5S A;  1LNQ A;  4MVU A;  2HKO A;  1K5Q A;  4QE7 A;  5KUK A;  2Q69 A;  2IW5 A;  2XOK G;  1NVP B;  1YTF D;  4BIU A;  1ROP A;  1OCR C;  1SER A;  4JYC A;  2LFR A;  1E1R G;  2HG5 C;  1G8M A;  1CPY A;  4LBE C;  5B3S B;  1OCZ B;  3ABM C;  1PNK A;  4F4L A;  5LGT A;  3E35 A;  4E2L A;  3EHB B;  4JAU A;  3OW2 U;  2OTJ V;  4Z1M G;  2AHY A;  4PDV A;  4PDM A;  2IJH A;  5L3G A;  2WLI A;  3ZIA G;  3K0G A;  3SPI A;  3CXC U;  3CCU V;  1S76 D;  4MW8 A;  1R3I C;  3FB5 C;  3D3I A;  3LUT B;  2W0F C;  1OCR B;  2WLJ A;  3AG1 C;  2DWD C;  3ZCC A;  1OCC C;  3NXS A;  5LBQ A;  3W7U A;  3ABM B;  3SYC A;  3KG2 A;  5EC2 C;  4JF3 A;  3JD3 A;  1ZWI C;  2ZXW C;  4UXN A;  2WLI B;  3AEI A;  1THZ A;  2V7Q G;  1YI2 V;  1M90 W;  1F23 A;  3LNM B;  3K79 A;  3K03 A;  2IU0 A;  1PKX A;  2EBO A;  1QCE A;  3H01 A;  3DTU B;  4MVZ A;  1BHA A;  1W2B U;  3AG1 B;  3MHS C;  1NKD A;  1OCC B;  3FB8 C;  2ITD C;  1OCO C;  4TT3 G;  4N21 A;  5L3C A;  2ZD9 A;  2ZXW B;  1DTO A;  1K73 W;  3SPH A;  3AG4 C;  3RVY A;  1S72 V;  2X0L A;  2HVK C;  3VBB A;  2Z3Y A;  1H8H G;  3ABK C;  4MT8 A;  1K33 A;  1GO3 F;  4JPR A;  4X89 A;  2EIN B;  2JDI G;  1NVP D;  5DN6 G;  5B1A C;  3W7S A;  2GSM B;  1OCO B;  4MVM A;  5B1O A;  2JEU A;  4FK5 C;  2XND G;  3ASN B;  3B8M A;  3ZRX A;  1J95 A;  3IC7 A;  2UXN A;  5IYD O;  2EJR A;  1S0V A;  1S77 D;  3AG4 B;  4XDJ A;  1NH2 B;  3EFF K;  3K3W A;  2WLN A;  4BW5 A;  3ABK B;  4WFG A;  1CP9 A;  3HPL C;  1K7D A;  1BMF G;  3STL C;  4MS2 A;  1KP3 A;  3CCV V;  3E89 A;  3OEH G;  4PA7 A;  1H2G A;  2XAS A;  4XDK A;  5B1A B;  4ZBM A;  2ZR2 A;  1ORQ C;  2XAF A;  4JAV A;  3ZJZ A;  3ZRW A;  1QBZ A;  3P32 A;  2QEX V;  1V55 C;  3W7T A;  3RW0 A;  4RQE A;  5IYB O;  1F51 A;  3W7W A;  3ZMZ A;  4QPK A;  1VQO V;  2IH1 C;  1W0J G;  4Q20 A;  3RVZ A;  2FTK A;  4DXW A;  4GX1 A;  5CMU A;  4WF9 V;  1PD3 A;  2EIJ C;  4MTO A;  3QO5 A;  1F4M A;  4WFH A;  3ABT A;  3FYI B;  2QE7 G;  2JIZ G;  1JPX A;  4I9W A;  5H6R A;  1RPR A;  2WLH A;  4OXS A;  3ZRW B;  3CCR V;  3JD1 A;  2D3O W;  5L3D A;  1K97 A;  1R6N A;  5IYC O;  3OFN G;  1K92 A;  1V55 B;  4LC1 A;  1WPX A;  2XAH A;  2YEV A;  1SRY A;  5C93 A;  3JD0 A;  3OMI B;  4MTF A;  1YSC A;  2EIJ B;  1FFT B;  3MD0 A;  1K8A W;  1GTO A;  3ZN0 A;  1K4D C;  1AI7 A;  5H9C A;  1VQL V;  2P90 A;  4RO2 A;  4MW3 A;  5LHI A;  2WPD G;  3SPG A;  5KUM A;  3W7X A;  4RQF A;  1CEZ A;  4RUE A;  1XL6 A;  3E8B A;  1F4N A;  1NR7 A;  2NLJ C;  2YEV B;  2PI5 A;  3IGA C;  3F7V C;  3OAA G;  3CP1 A;  4TSF G;  1GM9 A;  4R6Z A;  1VQ9 V;  1NH2 D;  4MTG A;  5KA5 A;  2YSU B;  5EBL C;  3DGE A;  3CME V;  5DM6 V;  4LP8 A;  3ZN1 A;  1Q7Y W;  1QLN A;  1Y66 A;  5L3F A;  2Q6A A;  1M56 C;  4RAI A;  3CC7 V;  3FB7 C;  2QTO A;  2DYS C;  2PI4 A;  5IY5 C;  5LGU A;  4MTX A;  1DF4 A;  2ZDI C;  3E86 A;  2LFS A;  3LSQ A;  2DYR C;  3R65 A;  2DW4 A;  2W6I G;  2B1G A;  3OM3 B;  4KFM A;  1YJW V;  3AG3 C;  1MAB G;  4PA6 A;  4PDL A;  1M56 B;  2IU3 A;  3QO8 A;  3CCL V;  1R73 A;  4HZ3 A;  2P67 A;  4WCE V;  4G27 B;  4XBF A;  3E2E A;  2JEX A;  3OR6 C;  2R9I A;  3K06 A;  2DYS B;  1R3L C;  3FKS G;  1YJ9 V;  5IY5 B;  1SES A;  2K1E A;  1M9N A;  5BZB A;  5CN0 A;  1QR8 A;  1B6Q A;  4HYO A;  2DYR B;  1HWY A;  4G2K A;  1Q86 W;  5EC1 C;  4FMT A;  3AG3 B;  4PDR A;  2XAJ A;  1MSW D;  2Z5U A;  2ATK C;  1BHB A;  2IH3 C;  1H38 A;  3E8G A;  1QVG U;  3K04 A;  3STZ C;  4WFA V;  2NNU A;  1JX9 A;  1EFR G;  1AJP A;  4P2Z A;  4MSW C;  4JGS A;  1EBO A;  3SYA A;  1K34 A;  1R3J C;  1G4Y B;  3K9A A;  3UKM A;  2HJF C;  3ETG A;  4FPP A;  3GB7 C;  1UJW B;  2WLM A;  2DQ0 A;  2IJK A;  2W6J G;  4QIW F;  1AI5 A;  1QR9 A;  1E79 G;  2X6B A;  3OGC C;  5EBW C;  3E8H A;  2WLL B;  2B1I A;  4JTC B;  3G71 V;  2UXX A;  3JD2 A;  2F43 G;  1VQK V;  2MK3 A;  5EBM C;  1EZJ A;  4JTD B;  2A9H A;  5CBF A;  2WSS G;  3PJS K;  3ABL C;  2EIM C;  2B5U A;  2LP7 A;  1S5H C;  5CA3 A;  1PL0 A;  3ABU A;  1KD1 W;  3ZMV A;  2A79 B;  1P4R A;  2DWE C;  1OZ0 A;  2IJI A;  1GMG A;  4WFF A;  1K4C C;  4BIZ A;  1VQ5 V;  3ZMT A;  4BAY A;  3JD4 A;  3T4D A;  2QM7 A;  2H8P C;  4H33 A;  3WG7 C;  3LDE A;  1L1F A;  1K3E A;  1VQ4 V;  4H37 A;  1V54 C;  1BL8 A;  1GM7 A;  3ZMS A;  5L3E A;  5CBG A;  4WFB V;  1ENV A;  3E8F A;  4FIP C;  4MVQ A;  5LHH A;  1R6K A;  2V1D A;  1AR1 B;  2X7R B;  3MHH C;  3F7Y C;  2EIK C;  5HFL A;  2OTL V;  3ZRS A;  2P6J A;  3CD6 V;  1ARO P;  3F5W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...