3UM7A

Crystal structure of the human two pore domain k+ ion channel traak (k2p4.1)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
266
structure length
259
Chain Sequence
b'RAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human K2P TRAAK, a lipid- and mechano-sensitive K+ ion channel.
pubmed doi rcsb
molecule keywords Potassium channel subfamily K member 4
source organism Homo sapiens
molecule tags Metal transport
total genus 82
structure length 259
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3um7A01
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3um7A03
2DWEC 4R8CA 4H37A 4PA3A 2P7TC 2WLNA 4RO2A 3SYAA 3SPHA 4MVQA 2A79B 2WLJA 1J95A 5B1AC 3OUFA 3TETA 2HG5C 4MVRA 1R3KC 5IY5C 3T2MA 3VOUA 2HVKC 2AHZA 3JYCA 3X2QC 4MVUA 2EIKC 3OUSA 3T4DA 2WLLA 4WFHA 4MTGA 1G4YB 2NLJC 2ZXWC 4MW3A 3F7YC 3RVYA 3ASNC 2DWDC 2Q68A 3AG2C 4WFGA 3OGCC 3E86A 2IH1C 3LDDA 3LUTB 4MW8A 3OR7C 4PA7A 3RBZA 3FB7C 4EKWA 4QNHB 4MTFA 4WFEA 5KUMA 2IH3C 3E8HA 2AHYA 4J9YB 2BOCC 2BOBC 1OCCC 4PDVA 1BL8A 3ZJZA 1R3LC 4MVSA 5CBHA 1QLEC 3IGAC 4JTAB 4X8AA 5B1BC 3UM7A 1V55C 3T4ZA 4R7CA 3F5WC 2DYRC 5EC1C 3LNMB 3K0GA 4KFMA 2QKSA 3EFFK 4GX2A 1P7BA 3K04A 3LDCA 4HYOA 4MSWC 4PA9A 4XDKA 3BEHA 2X6AA 3ABLC 4QE7A 4PDMA 4R6ZA 4TWKA 2A9HA 3FB6C 3E89A 2W0FC 1R3IC 3FB5C 3E83A 4MVZA 3SPGA 4RUFA 4G28B 2WLMA 4BW5A 1JVMA 1OCRC 4JTDB 4XDLA 1OCOC 5B3SC 2X6BA 4P30A 2EIJC 2KB1A 5EC2C 2WLHA 4MS2A 4WFFA 3SYQA 2ATKC 3LDEA 5EBLC 3AG4C 4PDLA 3SPJA 2HVJC 2WLLB 2HFEC 2QTOA 3K06A 4P9PA 3ASOC 2HJFC 2WLIA 1S5HC 3OR6C 4RAIA 2EINC 3SYCA 3R65A 3IFXA 2X6CA 3F7VC 5EBMC 3ZRSA 1M56C 3PJSK 4PA4A 4PA6A 2EIMC 2JK5C 3E8FA 1R3JC 2ITDC 4DXWA 4MTOA 4MVOA 1ZWIC 3AG3C 4R50A 1K4CC 2K1EA 1OCZC 2DYSC 4GX5A 2EILC 2OCCC 3UKMA 1M57C 2ZD9A 4H33A 3RVZA 4XDJA 3SPCA 2ITCC 2Y69C 3ABKC 5EBWC 1XL4A 4P9OA 4RUEA 5KUKA 4X88A 4OXSA 3SYOA 1V54C 2Q6AA 4JTCB 2H8PC 3E8GA 4G27B 1K4DC 5EK0A 4LP8A 1KKDA 5E1AC 3KG2A 2Q67A 3RW0A 4F4LA 3K03A 3HPLC 3SJQC 3STLC 3FB8C 4X89A 3ABMC 4HZ3A 4LBEC 1ORQC 5CBGA 2A0LA 4GX1A 2YEVA 5CBFA 3WG7C 4MVMA 4UUJC 5J9PC 1LNQA 2Q69A 3SPIA 3AG1C 4QE9A 1XL6A 3STZC 2R9RB 2WLIB 3SYPA 4GX0A 4PDRA 4J9ZB 4I9WA 3TCUA 3T1CA 2WLKA 3GB7C 4CBCA 4P2ZA 4LCUC 5BZBA 3E8BA 3K08A 4ZBMA 3K0DA
chains in the Genus database with same CATH superfamily
4PA3A 3JALB 1NQTA 2E74B 4RQEA 4DR7O 1Q82W 4LFAO 1WNSA 1W2BU 2LP7A 4U3JB 5IY5C 1NS1A 4YJ3A 4CH3A 4JI3O 4LFBO 4U7OA 3H9VA 1URFA 1DLBA 2CTQA 4MW8A 3GWOA 3NR7A 3SGIA 2JGUA 2Q9LA 2Z3YA 4PDVA 3RYFB 3EHBB 4O2BB 4CH4A 3QG5A 3W7XA 4FLTA 2UUAB 1FJGB 2DYRC 2YDEA 5H2FZ 3EXAA 5KHIA 1BSMA 1XQ8A 3UO2A 2IJJA 5B3SB 2XAGA 4G28B 2WLMA 5B3SC 4JTDB 1EN4A 3CC7V 4DV2O 3THOA 4WFFA 4UCTA 5LMUB 3CMAV 1BQZA 2E5LB 1QBZA 1R1BA 4B3RB 3JARB 2BSKA 2ZINA 3CS5A 2FL4A 4W4KA 1SS3A 2RNBA 1AB3A 1Q5OA 1WN7A 1ZWIC 4GX5A 1FXVA 4FFBA 2GBOA 4YHHB 2K9PA 4DRXA 2H8PC 3E8GA 3K3WA 2RJZA 4UCRA 1Y6XA 2DN9A 5LA6A 4JGSA 2WA3A 4GX1A 3CB2A 5IJ0B 3B77A 2CTRA 4Z1VA 4X20A 4CH6A 4QE9A 5LHIA 3ZMZA 4DR7B 3DGEA 4LFAB 1ENVA 2EILB 3C90A 4CBCA 1HWYA 5JCOA 3TXSA 4X64O 1A32A 2OCHA 1GMGA 4TT3G 2JEXA 1U96A 5LP6C 4LFBB 4LF7O 4B3MB 5EIBD 1Y67A 3J7AU 4WBNB 3VOUA 2AHZA 3HR0A 2JEUA 1MSWD 2Q8VA 3H1JH 5CB4A 2OIGA 2Q68A 1QQCA 2YIAA 3OE7G 2R70A 4K0KO 4IGGA 2P67A 3P32A 5FL7G 2UUCO 2ODMA 2QWPB 4CS2A 2QKSA 3B2EE 1UJWB 4DV2B 4TWKA 2D2CB 3L71H 4DV4B 3H01A 4JZ2A 4BW5A 3AEIA 3PN1A 3MHSC 1FFXA 1D5AA 1E1RG 3P3PA 4N21A 3L9DA 1DK1A 1QLEB 1PPJH 1XDCA 2F23A 5JJNB 3MAQA 4I55B 5LMNO 1QCEA 3BCCH 5B1NA 4BWAA 2VQEO 3CSXA 4WFBV 2EIMB 5BXZA 4UB6Z 2UXDO 2EIMC 2ITDC 1SERA 3AG3C 4WCEV 5JJEB 5DEDA 1Z5VA 2Y4TA 2QR4A 1V54C 5CA3A 1G8MA 2ILMA 4X65O 3FB8C 1QR8A 1SQBH 2PTMA 5IJ9B 2A0LA 1JCHA 1MA1A 1R6KA 2DQ3A 3JASB 1PNKA 4LWSA 3JSNA 1AI6A 3CMEV 2UUBO 4LF4O 5JWPA 3JATA 3SDLA 4LF7B 3S3XA 2QTSA 2Y69B 4ZBMA 4R8CA 4FLWA 4JI0O 2PY5A 4LF8O 2LFSA 2YSUB 4FZ0A 3L72H 1HNXO 1G1XB 4TQDA 4K0KB 1F4MA 2XASA 2ZIOA 2Z0AA 4X62O 4DV1O 5CA0A 1K9MW 2UUCB 1S5JA 2HJDA 2DWDC 5F2VO 1Q43A 5LHGA 5IYBO 4IT5A 3E8HA 2AHYA 3RFRA 1IBKB 4MVSA 3IGAC 4JTAB 2IW5A 3UM7A 2ZM6O 3JAWA 5IT9N 1ZL8B 3HKCB 2HEPA 2OTJV 4ZOLB 5J2UA 2PI4A 2ZXWB 5KHJA 3ZHUA 1AR1B 4ICGA 2HHHO 5LMNB 4TSFG 3CX5F 3K5NA 1WPBA 2ATKC 2PGGA 5EBLC 2XAQA 3VQWA 1YHQV 4AHCA 2NNUA 2UXDB 3OR6C 3R65A 1JX9A 3FAVB 3JALA 2QSAA 4PA6A 1SC5B 1SZXA 3S3WA 4DXWA 4QPJA 3L70H 2JJ1G 4U3JA 4FM2A 4X65B 5H5NA 3OTFA 4BAYA 2N74A 3OMAB 5DECA 1BCCH 5EBWC 1NTKH 1BZKA 1AI7A 2CUGA 1VIBA 4UCSA 1OHHG 3SJQC 1VQLV 2M6YA 4LBEC 2UUBB 4LF4B 1DF4A 1ZAUA 3RYFA 3E22B 1P4RA 2Q69A 2PF4E 1KUQA 4B3TB 4O2BA 2CE4A 1O9HA 2YIBD 2ZT9B 3JAKB 3QTCA 1HNXB 4GT1A 3LNNA 1J95A 5B1AC 1HNWB 3HKBB 4DV1B 1N8RW 4UXNA 2XAHA 1KP3A 3BY6A 3JD0A 3ZCCA 4FFKA 4DR1O 2EZPA 3RVYA 4JASA 4B7KA 3JARA 5KHHA 2ZM6B 1K5SA 2H94A 3G6BA 1JA8A 5JH7B 3CRRA 4JI5O 1EFRG 1VF7A 4X8AA 3UT5B 1QR9A 3HB3B 3OD4A 1H8HG 2F66C 5A9GA 1P49A 5HFMA 1RPOA 5ITZB 1V9PA 1BHAA 1FXKC 4MVZA 1K73W 1JVMA 5KHKA 1YTFD 3E35A 5IJ0A 1IZ3A 1N0JA 2WLLB 3KZIZ 1PKXA 3OGIB 1YJNV 1AJPA 5IYDO 1HR0O 2AXTZ 1T5EA 2E75B 2YICA 3B4SA 1TVKB 1M4UA 5KA6A 4CS4A 4J41A 1S0VA 1OCZC 5EZYB 1GN3A 4WBNA 4PI0A 4WF9V 1JJOA 1PL0A 3C3SA 3T1HO 5FPOA 4O4JB 1DTOA 3GVMA 3ASOB 4JTCB 1N36O 1K5QA 2Q67A 3RW0A 3ABMC 1RM1B 1ORQC 4DR6O 3CP1A 4PV1B 2L6LA 2L35A 2ETNA 1BS3A 1LNQA 1HNZO 4K8ZA 1FXHA 3MD0A 2OCCB 4ZKIA 4LCUC 2ZCEA 4W4LA 5J2TB 2GTSA 2DWEC 4BIUA 2ZIMA 2XAJA 3ZN1A 4DR1B 3TETA 4B7EA 1UPGA 4IHJB 3ETEA 5L3DA 3AK2A 1VQMV 4JI6O 3WG7B 3X2QC 1H2SB 1I5YA 3EVKA 3OUSA 3KCYA 4I55A 3F7YC 3E86A 2IH1C 3J81N 1R6TA 1QNMA 1KYOF 2BOCC 1YXBA 2YEVB 3ZBHA 1RSOB 1WAZA 2Y48A 3K5LA 2YUAA 1NR1A 5KHGA 3QO8A 1BHBA 2Q73A 1P7BA 2F4VO 3WFVA 4LF6O 1PM9A 3K5MA 5BMVB 4F6RB 4LFCB 5KMGB 3J80N 2X6BA 1Y74B 4YXWG 5IJ9A 3VQYA 1HR0B 1KBHA 3P30A 3JASA 3O9OA 2LW7A 3QO5A 2DMXA 2QDOA 2QM7A 4FLUA 5B1BB 1W0JG 2RDCA 2EINC 1XOUA 3IC7A 3PJSK 3BABA 2F43G 1XUQA 4WFAV 2P5OA 4UV8A 3T1HB 2P06A 1THZA 4H44B 3L75H 1N36B 1M57B 5B1OA 3B8NA 1M57C 4UFZA 1VQNV 4TV8B 4D7SA 4DR6B 1AJQA 4I5SA 2VQFO 3W7UA 4B08A 2RCVA 4G27B 1HNZB 5L3BA 1BMFG 1XNRO 4DW0A 1JPXA 5LOVB 4BIOA 3U11A 3QF7A 5CBFA 5A2QN 3K79A 1L0LH 1K92A 2WLIB 4GX0A 4I9WA 5BZBA 1KMIZ 2YXYA 1ZL8A 3HKCA 4ZOLA 2WLNA 2YI9A 4JI6B 2UU9B 5LXTA 1IBMO 2HG5C 3CCVV 2NN4A 2R72A 3IJ4A 2A06H 1YSCA 5EIBC 4TQFA 1G4YB 2GV9A 2NLJC 2BCCH 2AGAA 3A2FA 4H13B 1XMOB 1NVPB 3FB7C 5BY1A 4WFEA 1F51A 4U3FH 3CPWU 1OCCC 3FAVA 4LF6B 3ZJZA 5IYZB 4RWUA 1XI1A 1VMGA 1N4CA 4JYAO 5IY5B 1XMQB 4MSWC 1NZ6A 3ZRWB 3RGBA 2Q4PA 3QNEA 1Q6HA 5GW7A 3FB6C 2E3CA 1H2KA 2W0FC 1HDJA 4B3MO 3A8TA 2JS3A 3RYCB 2CTPA 3AG4C 3E22A 2FKXA 1WP7A 2DYRB 4RAIA 2FMLA 2WSSG 2QGNA 1MABG 3JAKA 3ABTA 3ZHQA 2HP8A 2CTWA 2VQFB 2ZE5A 2GUZB 2QWRB 4JZGA 1NJIW 3OFNG 2ZE7A 1N32O 1XNRB 4DV7O 4DV4O 3ABKC 1NH2B 4P9OA 5KUKA 2HKOA 1Q6UA 4Q20A 3BAAA 4MT8A 1ZTEA 2ZKOA 5JJJB 1OJHA 1S76D 3TK1A 3CEIA 5JH7A 3TXQA 2NR5A 4GYCB 2AW9A 4EEQA 1QU7A 4DUYO 3UT5A 1Q6IA 1SQVH 1IBMB 1GTOA 1NBMG 3E8BA 1K8AW 2PUSA 2Q0AA 4RO2A 3OMNB 3ZMUA 3OEHG 4JPRA 5ITZA 1D5NA 4UVBA 1B06A 5LBQA 2BE3A 1R3KC 3NXSA 3TGUH 3SJBC 4ZI7B 2EULA 2WLLA 4JAVA 2YXLA 3SR2C 1RP3B 3N2GB 1VQ4V 1MG1A 3LUTB 4JYAB 3M99B 1JFFB 2V4DA 1BL8A 1E79G 5B66Z 1L0NH 5LP6B 4RQFA 1TVKA 2VWKA 2G38A 1H2NA 5GONB 3A0RA 3LNMB 5EZYA 3F5TA 2WAMA 3G67A 2QKCA 2A9HA 4O4JA 2ZNJA 1R3IC 2CAZC 1OCRC 3HKEB 3BFRA 2W6JG 2Q7GA 2A7WA 4PDLA 2OYQA 2YIDA 4BW9A 4O4HB 1M93A 2QM8A 5J2TA 4PJ0Z 1N32B 1IBKO 4DV7B 4J11A 3WU2Z 2DYSB 4IHJA 4MTOA 4R50A 2DYSC 4YIPA 3ZMVA 1XL4A 4RUEA 3ETDA 5KAFZ 5KAIZ 1SA0B 3P3NA 1SQFA 3K03A 3STLC 2XOKG 4DUYB 2EZOA 4UCOA 2OWOA 3B40A 2YEVA 1RSOA 2EJ7A 1AR4A 1XL6A 2R9RB 3AG3B 3L73H 3GB7C 1GRJA 2P7TC 3D36A 3A0BZ 1V54B 5BMVA 1Q86W 3OUFA 2IJIA 5CA1B 4F6RA 1S5LZ 1Y74A 3T2MA 1VF6A 3UCSC 2HVKC 1JMKC 1MZFA 2X0LA 1KKCA 2B1GA 2CK3G 3OAAG 4MTGA 2QKAA 3K59A 4GLXA 4MW3A 5EYPB 1SRYA 4PD4F 4LF5O 2R9AA 3H1IH 4QJFB 2IJHA 1B04A 1NT2B 2ADPA 4B3TO 2JGDB 1SQGA 4KFMA 4HYOA 4R6ZA 1VQ7V 4TV8A 3E89A 1HNWO 3H1KH 4FM0A 4P30A 3CRQA 2QWNB 2FTKA 3BRCA 1YTFB 4DR4O 4LC1A 5LOVA 1AP5A 3SPJA 5LGUA 4NR1A 1H2LA 2E76B 1WA8B 2LO1A 2WLIA 2XAFA 3W7SA 4FVMA 1K34A 2WPDG 2ZDIC 5K1PA 4PELA 4ASUG 1YF2A 3JAMN 3A0HZ 4UCVA 1GKFA 5FPRA 1WJZA 3LSQA 4G2KA 3BA9A 4GKJB 4YJ2B 3JCUZ 4I4TB 2QM4A 1SZTA 1ZUQA 4LNUA 5JVDB 4OPAA 3CCMV 1EBOA 5IYZA 4IYHA 1GAXA 3MDSA 3DXRB 1W0KG 4DV0O 2LW1A 3ZRWA 4H33A 4H37A 1VQ9V 2XNDG 1PD3A 1FAFA 4UVAA 1FS0G 4X1YB 1GM8A 4ZHQB 1D2DA 4MVUA 3RYCA 3VQXA 1PNMA 5C8YB 4LF5B 3G80A 3W7TA 1AILA 3CRCA 3AG2C 3RBZA 4EKWA 4OPHA 1YJ9V 5B1AB 5CBHA 3OT7A 4FLYA 2KQXA 3D8CA 2GUZA 3T1YB 1SQPH 1EM1A 4XDKA 1RFYA 1N33B 4DR4B 3SJAC 1GM9A 1Q8IA 1N34B 4X9QA 3E83A 2OTLV 4JV5O 4NYKA 4X66O 4MS2A 3KKYA 3RYIB 3CWBH 2Q5ZA 3ZHRA 1U97A 1GH6A 4P9PA 2HJFC 3ZHTA 1WP8A 2X6CA 4KL1A 3CYOA 3ZRXA 1FXKB 2UXBO 4I50B 4JI7B 4JYCA 4EB6B 1Z5WA 4DK1A 4ZI7A 1S3JA 3SYOA 1K3EA 1KKDA 4LFCO 1IDSA 5E1AC 2JIZG 3N2GA 1JFFA 4DV0B 2B1IA 1X4TA 1KU9A 3AG1C 5LP6A 5IWAB 1JJ2U 3WB0A 4XBFA 1OCZB 5GONA 2Y4UA 3VQVA 1I0HA 2LQTA 4AQYO 4J80A 3E2EA 3RYHB 1F23A 1Q7YW 5K1XA 3Q4HB 2Z5UA 2XHBA 4MVRA 3HKEA 4GKKO 3ABMB 4BR6A 2CGNA 5JCOC 2EIKB 2EIKC 1US6A 3ASNC 2YI8A 4O4HA 4K8XA 2ADQB 4NXNB 4J7KA 4TV9B 3I55V 3K9AA 3F5WC 4JV5B 4D6TH 3X2QB 4X66B 1B6QA 3ABLC 1J5EO 4I9QA 2UU9O 1FYJA 1QHTA 1SA0A 3CC4V 5LGTA 2EIJC 4IL6Z 2V7QG 2MK3A 4B3SB 2QTOA 2UXBB 4L8JA 1XMOO 4O2AB 2GSMB 4I0XB 1QLNA 1M56C 2R9IA 2DOSA 4PA4A 2QWOB 5CA1A 3ZHSA 3W7WA 1XMQO 3BA8A 2UXXA 5LHHA 3CCJV 4UVCA 2DJVA 1CP9A 4IIJB 2ZD9A 3M8AA 3SPCA 2OIEA 5HFLA 3CCEV 1UFIA 3ZEDA 2PYLA 2XUMA 3AG7A 5EK0A 5EYPA 4LP8A 2EINB 1H2MA 1YIJV 4X89A 1JOYA 3ZRVA 1CXZB 1S72V 1Y66A 4LR3A 4FLXA 2QE7G 4AQYB 2LGQA 1YZBA 5C93A 2JGDA 2IJKA 4HAMA 5GTHZ 3RN4A 4PDRA 4J9ZB 1K33A 2XT9A 2WLKA 2UXNA 1KB9F 3K08A 4GKKB 1TUEB 3U10A 4D7TA 1KQSU 3SPHA 4MVQA 4O4LB 1FD9A 2N05A 1L8DA 3UO3A 4CC5A 3G6EV 1FKAO 2W6IG 1WA8A 3CCQV 2F93B 2FYUH 1WB7A 4QNHB 4MTFA 2IH3C 3QVNA 1M9NA 5L3GA 1J5EB 1AVMA 2RN9A 1NTZH 1SQXH 1KC8W 2X7RB 1V55C 3CRMA 3T4ZA 4JF3A 3R66A 1Q90D 2IBZH 2PZSA 4YJ2A 4I4TA 1JR9A 1Q81W 3SPGA 4XDLA 1OCOC 2MW2B 1KD1W 1NR7A 5JVDA 2KB1A 3CC2V 1OCCB 2KKWA 4DYLA 1ZX3A 3DXRA 2PYJA 2ZR3A 4UB8Z 1EZJA 1IXBA 4H0LB 3CHXA 3BHPA 1R3JC 2BTOA 1PP9H 4MVOA 4I7ZB 2F95B 2K1EA 4X1YA 4ZHQA 3AG4B 4XDJA 4ABMA 2ITCC 5C8YA 4Z2WA 4FLZA 2Q6AA 4JYBA 3ICXA 3KG2A 5B5EZ 3DC6A 3D3IA 5JQGB 4TOIA 3RWRD 4JI2O 3HKBA 1WPXA 4DV6O 2LJ2A 3TCUA 4L87A 4P2ZA 3CD6V 3ABKB 3JSLA 3CJHB 1TGOA 2A79B 3SJCC 4N23A 5IE9A 1EN6A 4TUYB 4FMTA 1I94O 1QVGU 1K7DA 3RYIA 3FKSG 3L74H 4NXMO 1CPYA 1H8EG 1WB8A 5GTIZ 2V1DA 2KG7B 4JI1B 1RPRA 1VARA 4HBNA 3CCRV 3HKDB 1KECA 1SF9A 3DC5A 4Q6GA 1G6UA 1FXKA 4NTXA 1R3LC 4I50A 4DV3O 2IU3A 4R7CA 1AR5A 3EFFK 3ZIAG 1IX9A 1PNLA 2WA4A 1TUBB 2Q7HA 4DR3O 1AI4A 4EB6A 1Y76B 2FB5A 1CEZA 4CS3A 1YDXA 2HLDG 2AZ0A 4JAAA 4A5UB 4CC6A 3LDEA 1NKDA 2Y0PA 2HVJC 1AROP 4FPPA 1S5HC 4DR5O 3JCZA 5CMUA 3ZHVA 1BQ0A 5EBMC 3F7VC 2QA4V 3FD9A 5L3EA 3RYHA 5H9CA 4QIWF 1OCRB 3G4SV 3C3TA 3Q4HA 5KA5A 1BGYH 3K58A 4K3AA 1VF5B 2EILC 3RVZA 3K9SA 2CGOA 2CH7B 4OXSA 4UV9A 4JI3B 4F4LA 4JI2B 4HZ3A 4DV6B 4TV9A 4QPKA 3ZN0A 2PI5A 2XTAA 4MVMA 4UUJC 5DM6V 3I56V 1NVPD 1IVSA 2B9ZA 4DK0A 3N27A 1I94B 4KXRA 2IU0A 4NXMB 3WB2A 1XHZA 4GKJO 5FLXN 1B3QA 3N2KB 4K35A 4NTYA 3JD2A 1N0NA 4DV3B 4NVPA 4O2AA 4I0XA 3D3QA 4DR3B 1YEWA 1QLEC 2JVDA 4FM1A 2VS0A 5KMGA 2H3OA 4IIJA 2X6AA 3JD1A 3CXHF 3U0ZA 2A3QA 1VP7A 1BT8A 2D3OW 4HNAB 1YI2V 3B09A 1YJWV 4J42A 1Y4MA 4DR5B 5EC2C 1NH2D 4JI4O 4LH6A 1COWG 4GCZA 3K06A 3ZMTA 2ARHA 2BTQB 1SQQH 3M7MX 4X1IB 4X64B 5LYJB 4J7ZA 1KP2A 4GUNA 1XILA 3AK1A 2EJRA 3CRAA 4J7JA 3I5DA 3T1YO 4O4LA 1K4CC 2YC0A 2F1MA 1N33O 2QEXV 3OTOO 2Y69C 1N34O 2P22C 1I5XA 3LSUA 4F6EA 1K4DC 3LSSA 1I08A 1F7YA 1XBLA 1OZ0A 2QWQB 1LUVA 2EX3A 2Q0OC 4EFBA 4YY3O 3UQ8A 2UXCO 1HW7A 1H2GA 3K0DA 2O57A 3ABUA 4AI8A 1VEWA 4JI7O 3DTUB 1GN6A 1VQKV 1NU1H 1VQ8V 1AP6A 1FPOA 5FNVB 1M1KW 4MTXA 3ETGA 3T4DA 4WFHA 1AI5A 5LXTB 1MMMA 2ZXWC 4JI8O 1F4NA 2P4VA 1SESA 4X1KB 4PA7A 4O4IB 1VQOV 4J9YB 2VQEB 2BOBC 4FZ1A 5IWAO 2P90A 3K0GA 3ETQA 1EN5A 5KX5B 4GX2A 4DO2A 3K04A 1X59A 4JI4B 1L1FA 1LR1A 3FB5C 3AG2B 1PL4A 3WB1A 4YJ3B 3SYQA 2RQ6A 5JQGA 1R73A 2VRZA 1YITV 4NXNO 3RT3C 3SYCA 2HR3A 1BE3H 4KHPO 1MZEA 3ML0A 3CJHA 2W0XA 4IYIA 3CXCU 3H1LH 3OTOB 4JI0B 1GO3F 3E8FA 4LF8B 4TUYA 1GN2A 2LFRA 2YS8A 4X88A 4X62B 1IBLO 2DQ0A 2M7WA 1M5IA 2KG7A 1E1QG 3HKDA 5E79Z 5L3CA 5CBGA 4YY3B 1ZLZA 2UXCB 4B3SO 5D5PA 3ZMSA 5CN0A 2LGWA 1XNQO 3TJTA 2BSKB 2GHYA 5LGNA 1GK9A 1TUBA 2DE0X 3CCSV 3SYAA 2WLJA 3IAYA 1Y76A 1DGSA 3K5OA 1LUWA 4EFEA 4QGPA 1HP8A 2Y0IA 2HHHB 4JI8B 4FFBB 3ZX6A 3JYCA 3OEEG 3AG1B 2RMKB 3OMIB 1ROPA 4DRXB 3KCXA 1P7GA 4WFGA 1PV0A 4DW1A 3G71V 3OR7C 5LA6B 1MSDA 4X20B 2KSDA 3BVOA 3K57A 5EC1C 2WWWA 3ZS8C 3LDCA 4QE7A 4PDMA 1W59A 5H6RA 2CH7A 2N04A 1OV9A 3ASNB 4RUFA 1S77D 1EZVH 3OM3B 1DF5A 1R6NA 1FFTB 1WLEA 3QO7A 2GDSA 4KHPB 5CB4B 2HFEC 1Q3EA 3ASOC 1YCIA 4ZIBA 1TA8A 3ABLB 3MHHC 4NKGB 4FK5C 4DR2O 1RM1C 4PI2A 3B8MA 1QVFU 2AZ2A 1IBLB 2CDYA 2EIJB 4OX9O 2OCCC 3UKMA 2DW4A 3DSQA 5KLVH 3GWKC 1SKVA 3APQA 4DV5O 2P6JA 2ZQMA 4C7UA 1VQ5V 3N2KA 1TAEA 5DN6G 1XNQB 2JS5A 3BPZA 3CE2A 1FFXB 1GN4A 3JD4A 1M56B 5BR8O 4E4EA 5LL6Y 3FFQA 1XHXA 2YIBA 3WG7C 2ZNIA 5J9PC 3FYEB 3SPIA 4JI5B 3STZC 1K97A 5H6QA 4DUZO 2VWJA 3T1CA 4E2LA 4UCUA 4LF9O 5AG2A 1JQ0A 1Z2GA 1IXMA 3H1HH 4PHZA 4JYYA 3CCLV 4BIZA 2Q7EA 4HNAA 2P4KA 1NTMH 1IURA 1YVWA 2YXHA 1NI8A 1AJNA 3D36C 1MOFA 3APOA 4CZZA 2GTAA 1ZSPA 2C2AA 2BTQA 3OGCC 3LDDA 4X1IA 3OW2U 5KUMA 1VF6C 5LYJA 4KP4A 4FJCC 4LWSB 2ZE6A 4J10A 4OGQB 4CH5A 5B1BC 1I7FA 3JATB 5D5QA 4FIPC 4PA9A 4AILC 3BEHA 2JJ2G 3JD3A 4NB5A 1O9GA 2UUAO 1FJGO 1H38A 5IDJA 3IC9A 5L3FA 2ZDIA 2WLHA 2JDIG 2IM9A 2OT5A 4DR2B 5CA0B 4JI1O 1VQPV 5IYCO 1V55B 1VQ6V 3IFXA 3ZRSA 4OX9B 5LMUO 2B5UA 2E5LO 2JK5C 2ZE8A 4YIOA 4DV5B 1OCOB 4B3RO 3FYIB 4GZRB 3AK3A 3JAWB 4LH7A 5FNVA 3O65A 2QJ1A 5J2UB 5BR8B 4Z1MG 2JRIA 4JAUA 4FLVA 1M90W 2ZR2A 1P84F 3CCUV 3HPLC 1SETA 4X1KA 4NTWA 4O4IA 4DUZB 4YHHO 4LF9B 2EBOA 1XREA 5TISZ 1XEQA 1MNGA 4LNUB 3SYPA 3VBBA 3FX7A 5KX5A 4U7NA 4KUMA 2F4VB 1GM7A
chains in the Genus database with same CATH topology
2DWEC 4H37A 4PA3A 4BIUA 1VQ9V 1NQTA 2XAJA 2XNDG 1PD3A 3ZN1A 4RQEA 1Q82W 3TETA 2IU0A 1W2BU 3ETEA 2LP7A 4UVAA 5IY5C 1FS0G 1GM8A 5L3DA 1VQMV 3WG7B 3X2QC 1I5YA 4MVUA 1PNMA 3OUSA 3W7TA 4U7OA 3F7YC 1DLBA 3AG2C 3JD2A 3E86A 2IH1C 4MW8A 3RBZA 4EKWA 3GWOA 1YJ9V 2BOCC 2YEVB 2Z3YA 4PDVA 5B1AB 2Y48A 5CBHA 3EHBB 1QLEC 3W7XA 1NR1A 2DYRC 3QO8A 1BHBA 1P7BA 4XDKA 2X6AA 2IJJA 3JD1A 3WFVA 1GM9A 5B3SB 3E83A 2XAGA 4G28B 2WLMA 5B3SC 4JTDB 1YI2V 2D3OW 2OTLV 3CC7V 2X6BA 1YJWV 1Y4MA 4YXWG 5EC2C 1NH2D 4MS2A 4WFFA 1COWG 3P30A 4GCZA 3QO5A 3CMAV 2QM7A 5B1BB 1W0JG 3K06A 4P9PA 3ZMTA 2HJFC 1QBZA 2EINC 3IC7A 2X6CA 3PJSK 3CYOA 2F43G 4WFAV 3ZRXA 1FXKB 4UV8A 1KP2A 1THZA 2EJRA 1ZWIC 1M57B 4JYCA 1K4CC 5B1OA 4GX5A 1FXVA 3B8NA 1M57C 1VQNV 2QEXV 2Y69C 1AJQA 4I5SA 1I5XA 1S3JA 3SYOA 1K3EA 3W7UA 2H8PC 3E8GA 3K3WA 1K4DC 4G27B 1KKDA 5E1AC 3LSSA 2JIZG 5L3BA 1BMFG 1JPXA 2B1IA 4JGSA 4GX1A 5CBFA 3B77A 3K79A 3AG1C 1OZ0A 4QE9A 1JJ2U 5LHIA 1K92A 3ZMZA 2WLIB 4XBFA 1OCZB 4GX0A 3DGEA 1ENVA 2EILB 4I9WA 5BZBA 4CBCA 1HWYA 1H2GA 3K0DA 3E2EA 3ABUA 2WLNA 1GMGA 1F23A 1Q7YW 3DTUB 2JEXA 4TT3G 1VQKV 2Z5UA 2HG5C 4MVRA 3CCVV 1VQ8V 3ABMB 1M1KW 2EIKB 3VOUA 1YSCA 2AHZA 4MTXA 3ETGA 2EIKC 2JEUA 1MSWD 3T4DA 4WFHA 1AI5A 1G4YB 2NLJC 2ZXWC 1F4NA 3ASNC 2Q68A 1SESA 3OE7G 4PA7A 1NVPB 3FB7C 4WFEA 1F51A 1VQOV 2P67A 4J9YB 3I55V 3CPWU 2BOBC 3P32A 1OCCC 3K9AA 5FL7G 3ZJZA 2P90A 5IY5B 3F5WC 3K0GA 2QKSA 1UJWB 4GX2A 4DO2A 3K04A 4MSWC 3X2QB 1B6QA 3ABLC 3ZRWB 4TWKA 3QNEA 5GW7A 1L1FA 3FB6C 2W0FC 3H01A 3FB5C 3AG2B 4BW5A 3AEIA 3CC4V 5LGTA 3MHSC 2EIJC 3SYQA 1E1RG 4N21A 2V7QG 3AG4C 1QLEB 2MK3A 1R73A 2QTOA 1QCEA 2DYRB 4RAIA 1YITV 5B1NA 3SYCA 2HR3A 2WSSG 2GSMB 1QLNA 1M56C 1MABG 2R9IA 4WFBV 3ML0A 4PA4A 2EIMB 3CXCU 3ABTA 2EIMC 1GO3F 3E8FA 2ITDC 1SERA 3W7WA 3AG3C 2UXXA 5LHHA 4WCEV 3CCJV 1NJIW 4UVCA 3OFNG 2LFRA 1CP9A 2ZD9A 3SPCA 5HFLA 3ABKC 1NH2B 4P9OA 3CCEV 5KUKA 4X88A 2DQ0A 1V54C 2M7WA 2HKOA 5CA3A 5EK0A 4Q20A 1G8MA 4LP8A 1E1QG 2EINB 1YIJV 4MT8A 3FB8C 1QR8A 4X89A 5L3CA 1JOYA 5CBGA 3ZRVA 1S76D 2A0LA 3TK1A 1JCHA 1S72V 1R6KA 1Y66A 2DQ3A 2QE7G 1PNKA 3ZMSA 5CN0A 5C93A 2IJKA 4HAMA 1AI6A 3CMEV 4PDRA 4J9ZB 1K33A 2GHYA 2WLKA 2UXNA 1GTOA 5LGNA 1GK9A 1NBMG 3E8BA 3K08A 1K8AW 2Y69B 3CCSV 4ZBMA 4RO2A 4R8CA 1TUEB 1KQSU 3OMNB 3ZMUA 3OEHG 4JPRA 3SPHA 4MVQA 3SYAA 2WLJA 4UVBA 5LBQA 2LFSA 1R3KC 3NXSA 2YSUB 1F4MA 2XASA 3JYCA 3OEEG 3G6EV 3AG1B 4JAVA 2WLLA 1ROPA 3OMIB 1K9MW 2W6IG 3CCQV 2DWDC 4WFGA 1VQ4V 3G71V 1MG1A 3LUTB 3OR7C 5LHGA 5IYBO 3M99B 4QNHB 4MTFA 2IH3C 3E8HA 2AHYA 1M9NA 5L3GA 1BL8A 1E79G 4MVSA 4RQFA 3IGAC 1KC8W 4JTAB 2IW5A 2X7RB 1V55C 3T4ZA 3UM7A 5EC1C 3A0RA 3LNMB 4JF3A 2WWWA 3LDCA 4QE7A 4PDMA 2WAMA 2OTJV 5H6RA 2A9HA 2PI4A 2ZXWB 1R3IC 1AR1B 1Q81W 3ASNB 3SPGA 4RUFA 1S77D 1OCRC 3OM3B 4XDLA 1DF5A 1OCOC 4TSFG 1R6NA 1KD1W 1NR7A 1FFTB 1WLEA 2KB1A 2W6JG 3CC2V 1OCCB 2ATKC 5EBLC 3QO7A 4PDLA 2XAQA 1YHQV 2HFEC 2NNUA 3ASOC 3OR6C 3R65A 1JX9A 3ABLB 3MHHC 2ZR3A 4FK5C 2QM8A 1RM1C 1EZJA 3B8MA 1QVFU 4PA6A 1R3JC 2DYSB 4DXWA 4MTOA 4MVOA 4QPJA 2EIJB 4R50A 2JJ1G 2K1EA 2DYSC 2OCCC 3UKMA 3ZMVA 2DW4A 3AG4B 4XDJA 2ITCC 3OMAB 4BAYA 5EBWC 1XL4A 4RUEA 2P6JA 2ZQMA 3ETDA 1VQ5V 2Q6AA 1AI7A 4JYBA 3KG2A 5DN6G 3K03A 1OHHG 2XOKG 3SJQC 3STLC 1VQLV 3JD4A 1M56B 4LBEC 2EZOA 1DF4A 3D3IA 2YEVA 3WG7C 5J9PC 1P4RA 2Q69A 3FYEB 3SPIA 1XL6A 3STZC 2R9RB 3AG3B 1K97A 5H6QA 1WPXA 3TCUA 3T1CA 4E2LA 3GB7C 4L87A 4P2ZA 1JQ0A 3CD6V 1IXMA 3ABKB 2P7TC 3D36A 4GT1A 3CCLV 1V54B 2A79B 1Q86W 1J95A 5B1AC 3OUFA 2IJIA 4BIZA 1N8RW 4UXNA 4N23A 2XAHA 3T2MA 4FMTA 1KP3A 1QVGU 3BY6A 2HVKC 1K7DA 3FKSG 3JD0A 2X0LA 3ZCCA 1AJNA 2B1GA 2CK3G 2EZPA 3OAAG 4MTGA 1CPYA 1H8EG 1MOFA 2V1DA 4MW3A 3RVYA 4CZZA 1SRYA 4JASA 1RPRA 3CCRV 2C2AA 3OGCC 3LDDA 1KECA 3OW2U 5KUMA 1K5SA 2H94A 4QJFB 4KP4A 2IJHA 4FJCC 1FXKA 1R3LC 1EFRG 4X8AA 2IU3A 5B1BC 1QR9A 3HB3B 4R7CA 4KFMA 3EFFK 3ZIAG 4HYOA 4FIPC 4PA9A 1PNLA 3BEHA 4R6ZA 1VQ7V 1H8HG 2JJ2G 3JD3A 1AI4A 5HFMA 1RPOA 3E89A 1BHAA 1FXKC 4MVZA 1K73W 1H38A 1CEZA 1JVMA 5IDJA 5L3FA 1YTFD 4P30A 2FTKA 2HLDG 1YTFB 2ZDIA 2WLHA 2JDIG 4LC1A 3LDEA 3E35A 2OT5A 1NKDA 3SPJA 5LGUA 2HVJC 1AROP 2WLLB 1PKXA 4FPPA 1VQPV 5IYCO 1V55B 1YJNV 1AJPA 1S5HC 2WLIA 2XAFA 1VQ6V 3W7SA 5IYDO 3IFXA 3JCZA 5CMUA 5EBMC 3F7VC 1K34A 2WPDG 3ZRSA 2QA4V 2ZDIC 5L3EA 4PELA 4ASUG 2B5UA 5H9CA 2JK5C 4QIWF 1OCRB 1OCOB 3G4SV 3FYIB 5KA5A 5KA6A 1GKFA 1S0VA 1OCZC 3LSQA 4G2KA 2EILC 4WF9V 3RVZA 1PL0A 4Z1MG 1DTOA 4JAUA 4OXSA 4UV9A 3ASOB 4JTCB 1K5QA 1SZTA 1M90W 2Q67A 2ZR2A 3RW0A 4F4LA 3CCUV 3HPLC 1SETA 3ABMC 4HZ3A 1RM1B 1ORQC 3CCMV 3CP1A 4QPKA 1EBOA 2EBOA 3ZN0A 2PI5A 4MVMA 4UUJC 1LNQA 5DM6V 1FXHA 3MD0A 3I56V 1NVPD 3VBBA 3SYPA 2OCCB 1W0KG 4ZKIA 4LCUC 4U7NA 4KUMA 3ZRWA 1GM7A 4H33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWE C;  4R8C A;  4H37 A;  4PA3 A;  2P7T C;  2WLN A;  4RO2 A;  3SYA A;  3SPH A;  4MVQ A;  2A79 B;  2WLJ A;  1J95 A;  5B1A C;  3OUF A;  3TET A;  2HG5 C;  4MVR A;  1R3K C;  5IY5 C;  3T2M A;  3VOU A;  2HVK C;  2AHZ A;  3JYC A;  3X2Q C;  4MVU A;  2EIK C;  3OUS A;  3T4D A;  2WLL A;  4WFH A;  4MTG A;  1G4Y B;  2NLJ C;  2ZXW C;  4MW3 A;  3F7Y C;  3RVY A;  3ASN C;  2DWD C;  2Q68 A;  3AG2 C;  4WFG A;  3OGC C;  3E86 A;  2IH1 C;  3LDD A;  3LUT B;  4MW8 A;  3OR7 C;  4PA7 A;  3RBZ A;  3FB7 C;  4EKW A;  4QNH B;  4MTF A;  4WFE A;  5KUM A;  2IH3 C;  3E8H A;  2AHY A;  4J9Y B;  2BOC C;  2BOB C;  1OCC C;  4PDV A;  1BL8 A;  3ZJZ A;  1R3L C;  4MVS A;  5CBH A;  1QLE C;  3IGA C;  4JTA B;  4X8A A;  5B1B C;  3UM7 A;  1V55 C;  3T4Z A;  4R7C A;  3F5W C;  2DYR C;  5EC1 C;  3LNM B;  3K0G A;  4KFM A;  2QKS A;  3EFF K;  4GX2 A;  1P7B A;  3K04 A;  3LDC A;  4HYO A;  4MSW C;  4PA9 A;  4XDK A;  3BEH A;  2X6A A;  3ABL C;  4QE7 A;  4PDM A;  4R6Z A;  4TWK A;  2A9H A;  3FB6 C;  3E89 A;  2W0F C;  1R3I C;  3FB5 C;  3E83 A;  4MVZ A;  3SPG A;  4RUF A;  4G28 B;  2WLM A;  4BW5 A;  1JVM A;  1OCR C;  4JTD B;  4XDL A;  1OCO C;  5B3S C;  2X6B A;  4P30 A;  2EIJ C;  2KB1 A;  5EC2 C;  2WLH A;  4MS2 A;  4WFF A;  3SYQ A;  2ATK C;  3LDE A;  5EBL C;  3AG4 C;  4PDL A;  3SPJ A;  2HVJ C;  2WLL B;  2HFE C;  2QTO A;  3K06 A;  4P9P A;  3ASO C;  2HJF C;  2WLI A;  1S5H C;  3OR6 C;  4RAI A;  2EIN C;  3SYC A;  3R65 A;  3IFX A;  2X6C A;  3F7V C;  5EBM C;  3ZRS A;  1M56 C;  3PJS K;  4PA4 A;  4PA6 A;  2EIM C;  2JK5 C;  3E8F A;  1R3J C;  2ITD C;  4DXW A;  4MTO A;  4MVO A;  1ZWI C;  3AG3 C;  4R50 A;  1K4C C;  2K1E A;  1OCZ C;  2DYS C;  4GX5 A;  2EIL C;  2OCC C;  3UKM A;  1M57 C;  2ZD9 A;  4H33 A;  3RVZ A;  4XDJ A;  3SPC A;  2ITC C;  2Y69 C;  3ABK C;  5EBW C;  1XL4 A;  4P9O A;  4RUE A;  5KUK A;  4X88 A;  4OXS A;  3SYO A;  1V54 C;  2Q6A A;  4JTC B;  2H8P C;  3E8G A;  4G27 B;  1K4D C;  5EK0 A;  4LP8 A;  1KKD A;  5E1A C;  3KG2 A;  2Q67 A;  3RW0 A;  4F4L A;  3K03 A;  3HPL C;  3SJQ C;  3STL C;  3FB8 C;  4X89 A;  3ABM C;  4HZ3 A;  4LBE C;  1ORQ C;  5CBG A;  2A0L A;  4GX1 A;  2YEV A;  5CBF A;  3WG7 C;  4MVM A;  4UUJ C;  5J9P C;  1LNQ A;  2Q69 A;  3SPI A;  3AG1 C;  4QE9 A;  1XL6 A;  3STZ C;  2R9R B;  2WLI B;  3SYP A;  4GX0 A;  4PDR A;  4J9Z B;  4I9W A;  3TCU A;  3T1C A;  2WLK A;  3GB7 C;  4CBC A;  4P2Z A;  4LCU C;  5BZB A;  3E8B A;  3K08 A;  4ZBM A;  3K0D A; 
#chains in the Genus database with same CATH topology
 4PA3 A;  3JAL B;  1NQT A;  2E74 B;  4RQE A;  4DR7 O;  1Q82 W;  4LFA O;  1WNS A;  1W2B U;  2LP7 A;  4U3J B;  5IY5 C;  1NS1 A;  4YJ3 A;  4CH3 A;  4JI3 O;  4LFB O;  4U7O A;  3H9V A;  1URF A;  1DLB A;  2CTQ A;  4MW8 A;  3GWO A;  3NR7 A;  3SGI A;  2JGU A;  2Q9L A;  2Z3Y A;  4PDV A;  3RYF B;  3EHB B;  4O2B B;  4CH4 A;  3QG5 A;  3W7X A;  4FLT A;  2UUA B;  1FJG B;  2DYR C;  2YDE A;  5H2F Z;  3EXA A;  5KHI A;  1BSM A;  1XQ8 A;  3UO2 A;  2IJJ A;  5B3S B;  2XAG A;  4G28 B;  2WLM A;  5B3S C;  4JTD B;  1EN4 A;  3CC7 V;  4DV2 O;  3THO A;  4WFF A;  4UCT A;  5LMU B;  3CMA V;  1BQZ A;  2E5L B;  1QBZ A;  1R1B A;  4B3R B;  3JAR B;  2BSK A;  2ZIN A;  3CS5 A;  2FL4 A;  4W4K A;  1SS3 A;  2RNB A;  1AB3 A;  1Q5O A;  1WN7 A;  1ZWI C;  4GX5 A;  1FXV A;  4FFB A;  2GBO A;  4YHH B;  2K9P A;  4DRX A;  2H8P C;  3E8G A;  3K3W A;  2RJZ A;  4UCR A;  1Y6X A;  2DN9 A;  5LA6 A;  4JGS A;  2WA3 A;  4GX1 A;  3CB2 A;  5IJ0 B;  3B77 A;  2CTR A;  4Z1V A;  4X20 A;  4CH6 A;  4QE9 A;  5LHI A;  3ZMZ A;  4DR7 B;  3DGE A;  4LFA B;  1ENV A;  2EIL B;  3C90 A;  4CBC A;  1HWY A;  5JCO A;  3TXS A;  4X64 O;  1A32 A;  2OCH A;  1GMG A;  4TT3 G;  2JEX A;  1U96 A;  5LP6 C;  4LFB B;  4LF7 O;  4B3M B;  5EIB D;  1Y67 A;  3J7A U;  4WBN B;  3VOU A;  2AHZ A;  3HR0 A;  2JEU A;  1MSW D;  2Q8V A;  3H1J H;  5CB4 A;  2OIG A;  2Q68 A;  1QQC A;  2YIA A;  3OE7 G;  2R70 A;  4K0K O;  4IGG A;  2P67 A;  3P32 A;  5FL7 G;  2UUC O;  2ODM A;  2QWP B;  4CS2 A;  2QKS A;  3B2E E;  1UJW B;  4DV2 B;  4TWK A;  2D2C B;  3L71 H;  4DV4 B;  3H01 A;  4JZ2 A;  4BW5 A;  3AEI A;  3PN1 A;  3MHS C;  1FFX A;  1D5A A;  1E1R G;  3P3P A;  4N21 A;  3L9D A;  1DK1 A;  1QLE B;  1PPJ H;  1XDC A;  2F23 A;  5JJN B;  3MAQ A;  4I55 B;  5LMN O;  1QCE A;  3BCC H;  5B1N A;  4BWA A;  2VQE O;  3CSX A;  4WFB V;  2EIM B;  5BXZ A;  4UB6 Z;  2UXD O;  2EIM C;  2ITD C;  1SER A;  3AG3 C;  4WCE V;  5JJE B;  5DED A;  1Z5V A;  2Y4T A;  2QR4 A;  1V54 C;  5CA3 A;  1G8M A;  2ILM A;  4X65 O;  3FB8 C;  1QR8 A;  1SQB H;  2PTM A;  5IJ9 B;  2A0L A;  1JCH A;  1MA1 A;  1R6K A;  2DQ3 A;  3JAS B;  1PNK A;  4LWS A;  3JSN A;  1AI6 A;  3CME V;  2UUB O;  4LF4 O;  5JWP A;  3JAT A;  3SDL A;  4LF7 B;  3S3X A;  2QTS A;  2Y69 B;  4ZBM A;  4R8C A;  4FLW A;  4JI0 O;  2PY5 A;  4LF8 O;  2LFS A;  2YSU B;  4FZ0 A;  3L72 H;  1HNX O;  1G1X B;  4TQD A;  4K0K B;  1F4M A;  2XAS A;  2ZIO A;  2Z0A A;  4X62 O;  4DV1 O;  5CA0 A;  1K9M W;  2UUC B;  1S5J A;  2HJD A;  2DWD C;  5F2V O;  1Q43 A;  5LHG A;  5IYB O;  4IT5 A;  3E8H A;  2AHY A;  3RFR A;  1IBK B;  4MVS A;  3IGA C;  4JTA B;  2IW5 A;  3UM7 A;  2ZM6 O;  3JAW A;  5IT9 N;  1ZL8 B;  3HKC B;  2HEP A;  2OTJ V;  4ZOL B;  5J2U A;  2PI4 A;  2ZXW B;  5KHJ A;  3ZHU A;  1AR1 B;  4ICG A;  2HHH O;  5LMN B;  4TSF G;  3CX5 F;  3K5N A;  1WPB A;  2ATK C;  2PGG A;  5EBL C;  2XAQ A;  3VQW A;  1YHQ V;  4AHC A;  2NNU A;  2UXD B;  3OR6 C;  3R65 A;  1JX9 A;  3FAV B;  3JAL A;  2QSA A;  4PA6 A;  1SC5 B;  1SZX A;  3S3W A;  4DXW A;  4QPJ A;  3L70 H;  2JJ1 G;  4U3J A;  4FM2 A;  4X65 B;  5H5N A;  3OTF A;  4BAY A;  2N74 A;  3OMA B;  5DEC A;  1BCC H;  5EBW C;  1NTK H;  1BZK A;  1AI7 A;  2CUG A;  1VIB A;  4UCS A;  1OHH G;  3SJQ C;  1VQL V;  2M6Y A;  4LBE C;  2UUB B;  4LF4 B;  1DF4 A;  1ZAU A;  3RYF A;  3E22 B;  1P4R A;  2Q69 A;  2PF4 E;  1KUQ A;  4B3T B;  4O2B A;  2CE4 A;  1O9H A;  2YIB D;  2ZT9 B;  3JAK B;  3QTC A;  1HNX B;  4GT1 A;  3LNN A;  1J95 A;  5B1A C;  1HNW B;  3HKB B;  4DV1 B;  1N8R W;  4UXN A;  2XAH A;  1KP3 A;  3BY6 A;  3JD0 A;  3ZCC A;  4FFK A;  4DR1 O;  2EZP A;  3RVY A;  4JAS A;  4B7K A;  3JAR A;  5KHH A;  2ZM6 B;  1K5S A;  2H94 A;  3G6B A;  1JA8 A;  5JH7 B;  3CRR A;  4JI5 O;  1EFR G;  1VF7 A;  4X8A A;  3UT5 B;  1QR9 A;  3HB3 B;  3OD4 A;  1H8H G;  2F66 C;  5A9G A;  1P49 A;  5HFM A;  1RPO A;  5ITZ B;  1V9P A;  1BHA A;  1FXK C;  4MVZ A;  1K73 W;  1JVM A;  5KHK A;  1YTF D;  3E35 A;  5IJ0 A;  1IZ3 A;  1N0J A;  2WLL B;  3KZI Z;  1PKX A;  3OGI B;  1YJN V;  1AJP A;  5IYD O;  1HR0 O;  2AXT Z;  1T5E A;  2E75 B;  2YIC A;  3B4S A;  1TVK B;  1M4U A;  5KA6 A;  4CS4 A;  4J41 A;  1S0V A;  1OCZ C;  5EZY B;  1GN3 A;  4WBN A;  4PI0 A;  4WF9 V;  1JJO A;  1PL0 A;  3C3S A;  3T1H O;  5FPO A;  4O4J B;  1DTO A;  3GVM A;  3ASO B;  4JTC B;  1N36 O;  1K5Q A;  2Q67 A;  3RW0 A;  3ABM C;  1RM1 B;  1ORQ C;  4DR6 O;  3CP1 A;  4PV1 B;  2L6L A;  2L35 A;  2ETN A;  1BS3 A;  1LNQ A;  1HNZ O;  4K8Z A;  1FXH A;  3MD0 A;  2OCC B;  4ZKI A;  4LCU C;  2ZCE A;  4W4L A;  5J2T B;  2GTS A;  2DWE C;  4BIU A;  2ZIM A;  2XAJ A;  3ZN1 A;  4DR1 B;  3TET A;  4B7E A;  1UPG A;  4IHJ B;  3ETE A;  5L3D A;  3AK2 A;  1VQM V;  4JI6 O;  3WG7 B;  3X2Q C;  1H2S B;  1I5Y A;  3EVK A;  3OUS A;  3KCY A;  4I55 A;  3F7Y C;  3E86 A;  2IH1 C;  3J81 N;  1R6T A;  1QNM A;  1KYO F;  2BOC C;  1YXB A;  2YEV B;  3ZBH A;  1RSO B;  1WAZ A;  2Y48 A;  3K5L A;  2YUA A;  1NR1 A;  5KHG A;  3QO8 A;  1BHB A;  2Q73 A;  1P7B A;  2F4V O;  3WFV A;  4LF6 O;  1PM9 A;  3K5M A;  5BMV B;  4F6R B;  4LFC B;  5KMG B;  3J80 N;  2X6B A;  1Y74 B;  4YXW G;  5IJ9 A;  3VQY A;  1HR0 B;  1KBH A;  3P30 A;  3JAS A;  3O9O A;  2LW7 A;  3QO5 A;  2DMX A;  2QDO A;  2QM7 A;  4FLU A;  5B1B B;  1W0J G;  2RDC A;  2EIN C;  1XOU A;  3IC7 A;  3PJS K;  3BAB A;  2F43 G;  1XUQ A;  4WFA V;  2P5O A;  4UV8 A;  3T1H B;  2P06 A;  1THZ A;  4H44 B;  3L75 H;  1N36 B;  1M57 B;  5B1O A;  3B8N A;  1M57 C;  4UFZ A;  1VQN V;  4TV8 B;  4D7S A;  4DR6 B;  1AJQ A;  4I5S A;  2VQF O;  3W7U A;  4B08 A;  2RCV A;  4G27 B;  1HNZ B;  5L3B A;  1BMF G;  1XNR O;  4DW0 A;  1JPX A;  5LOV B;  4BIO A;  3U11 A;  3QF7 A;  5CBF A;  5A2Q N;  3K79 A;  1L0L H;  1K92 A;  2WLI B;  4GX0 A;  4I9W A;  5BZB A;  1KMI Z;  2YXY A;  1ZL8 A;  3HKC A;  4ZOL A;  2WLN A;  2YI9 A;  4JI6 B;  2UU9 B;  5LXT A;  1IBM O;  2HG5 C;  3CCV V;  2NN4 A;  2R72 A;  3IJ4 A;  2A06 H;  1YSC A;  5EIB C;  4TQF A;  1G4Y B;  2GV9 A;  2NLJ C;  2BCC H;  2AGA A;  3A2F A;  4H13 B;  1XMO B;  1NVP B;  3FB7 C;  5BY1 A;  4WFE A;  1F51 A;  4U3F H;  3CPW U;  1OCC C;  3FAV A;  4LF6 B;  3ZJZ A;  5IYZ B;  4RWU A;  1XI1 A;  1VMG A;  1N4C A;  4JYA O;  5IY5 B;  1XMQ B;  4MSW C;  1NZ6 A;  3ZRW B;  3RGB A;  2Q4P A;  3QNE A;  1Q6H A;  5GW7 A;  3FB6 C;  2E3C A;  1H2K A;  2W0F C;  1HDJ A;  4B3M O;  3A8T A;  2JS3 A;  3RYC B;  2CTP A;  3AG4 C;  3E22 A;  2FKX A;  1WP7 A;  2DYR B;  4RAI A;  2FML A;  2WSS G;  2QGN A;  1MAB G;  3JAK A;  3ABT A;  3ZHQ A;  2HP8 A;  2CTW A;  2VQF B;  2ZE5 A;  2GUZ B;  2QWR B;  4JZG A;  1NJI W;  3OFN G;  2ZE7 A;  1N32 O;  1XNR B;  4DV7 O;  4DV4 O;  3ABK C;  1NH2 B;  4P9O A;  5KUK A;  2HKO A;  1Q6U A;  4Q20 A;  3BAA A;  4MT8 A;  1ZTE A;  2ZKO A;  5JJJ B;  1OJH A;  1S76 D;  3TK1 A;  3CEI A;  5JH7 A;  3TXQ A;  2NR5 A;  4GYC B;  2AW9 A;  4EEQ A;  1QU7 A;  4DUY O;  3UT5 A;  1Q6I A;  1SQV H;  1IBM B;  1GTO A;  1NBM G;  3E8B A;  1K8A W;  2PUS A;  2Q0A A;  4RO2 A;  3OMN B;  3ZMU A;  3OEH G;  4JPR A;  5ITZ A;  1D5N A;  4UVB A;  1B06 A;  5LBQ A;  2BE3 A;  1R3K C;  3NXS A;  3TGU H;  3SJB C;  4ZI7 B;  2EUL A;  2WLL A;  4JAV A;  2YXL A;  3SR2 C;  1RP3 B;  3N2G B;  1VQ4 V;  1MG1 A;  3LUT B;  4JYA B;  3M99 B;  1JFF B;  2V4D A;  1BL8 A;  1E79 G;  5B66 Z;  1L0N H;  5LP6 B;  4RQF A;  1TVK A;  2VWK A;  2G38 A;  1H2N A;  5GON B;  3A0R A;  3LNM B;  5EZY A;  3F5T A;  2WAM A;  3G67 A;  2QKC A;  2A9H A;  4O4J A;  2ZNJ A;  1R3I C;  2CAZ C;  1OCR C;  3HKE B;  3BFR A;  2W6J G;  2Q7G A;  2A7W A;  4PDL A;  2OYQ A;  2YID A;  4BW9 A;  4O4H B;  1M93 A;  2QM8 A;  5J2T A;  4PJ0 Z;  1N32 B;  1IBK O;  4DV7 B;  4J11 A;  3WU2 Z;  2DYS B;  4IHJ A;  4MTO A;  4R50 A;  2DYS C;  4YIP A;  3ZMV A;  1XL4 A;  4RUE A;  3ETD A;  5KAF Z;  5KAI Z;  1SA0 B;  3P3N A;  1SQF A;  3K03 A;  3STL C;  2XOK G;  4DUY B;  2EZO A;  4UCO A;  2OWO A;  3B40 A;  2YEV A;  1RSO A;  2EJ7 A;  1AR4 A;  1XL6 A;  2R9R B;  3AG3 B;  3L73 H;  3GB7 C;  1GRJ A;  2P7T C;  3D36 A;  3A0B Z;  1V54 B;  5BMV A;  1Q86 W;  3OUF A;  2IJI A;  5CA1 B;  4F6R A;  1S5L Z;  1Y74 A;  3T2M A;  1VF6 A;  3UCS C;  2HVK C;  1JMK C;  1MZF A;  2X0L A;  1KKC A;  2B1G A;  2CK3 G;  3OAA G;  4MTG A;  2QKA A;  3K59 A;  4GLX A;  4MW3 A;  5EYP B;  1SRY A;  4PD4 F;  4LF5 O;  2R9A A;  3H1I H;  4QJF B;  2IJH A;  1B04 A;  1NT2 B;  2ADP A;  4B3T O;  2JGD B;  1SQG A;  4KFM A;  4HYO A;  4R6Z A;  1VQ7 V;  4TV8 A;  3E89 A;  1HNW O;  3H1K H;  4FM0 A;  4P30 A;  3CRQ A;  2QWN B;  2FTK A;  3BRC A;  1YTF B;  4DR4 O;  4LC1 A;  5LOV A;  1AP5 A;  3SPJ A;  5LGU A;  4NR1 A;  1H2L A;  2E76 B;  1WA8 B;  2LO1 A;  2WLI A;  2XAF A;  3W7S A;  4FVM A;  1K34 A;  2WPD G;  2ZDI C;  5K1P A;  4PEL A;  4ASU G;  1YF2 A;  3JAM N;  3A0H Z;  4UCV A;  1GKF A;  5FPR A;  1WJZ A;  3LSQ A;  4G2K A;  3BA9 A;  4GKJ B;  4YJ2 B;  3JCU Z;  4I4T B;  2QM4 A;  1SZT A;  1ZUQ A;  4LNU A;  5JVD B;  4OPA A;  3CCM V;  1EBO A;  5IYZ A;  4IYH A;  1GAX A;  3MDS A;  3DXR B;  1W0K G;  4DV0 O;  2LW1 A;  3ZRW A;  4H33 A;  4H37 A;  1VQ9 V;  2XND G;  1PD3 A;  1FAF A;  4UVA A;  1FS0 G;  4X1Y B;  1GM8 A;  4ZHQ B;  1D2D A;  4MVU A;  3RYC A;  3VQX A;  1PNM A;  5C8Y B;  4LF5 B;  3G80 A;  3W7T A;  1AIL A;  3CRC A;  3AG2 C;  3RBZ A;  4EKW A;  4OPH A;  1YJ9 V;  5B1A B;  5CBH A;  3OT7 A;  4FLY A;  2KQX A;  3D8C A;  2GUZ A;  3T1Y B;  1SQP H;  1EM1 A;  4XDK A;  1RFY A;  1N33 B;  4DR4 B;  3SJA C;  1GM9 A;  1Q8I A;  1N34 B;  4X9Q A;  3E83 A;  2OTL V;  4JV5 O;  4NYK A;  4X66 O;  4MS2 A;  3KKY A;  3RYI B;  3CWB H;  2Q5Z A;  3ZHR A;  1U97 A;  1GH6 A;  4P9P A;  2HJF C;  3ZHT A;  1WP8 A;  2X6C A;  4KL1 A;  3CYO A;  3ZRX A;  1FXK B;  2UXB O;  4I50 B;  4JI7 B;  4JYC A;  4EB6 B;  1Z5W A;  4DK1 A;  4ZI7 A;  1S3J A;  3SYO A;  1K3E A;  1KKD A;  4LFC O;  1IDS A;  5E1A C;  2JIZ G;  3N2G A;  1JFF A;  4DV0 B;  2B1I A;  1X4T A;  1KU9 A;  3AG1 C;  5LP6 A;  5IWA B;  1JJ2 U;  3WB0 A;  4XBF A;  1OCZ B;  5GON A;  2Y4U A;  3VQV A;  1I0H A;  2LQT A;  4AQY O;  4J80 A;  3E2E A;  3RYH B;  1F23 A;  1Q7Y W;  5K1X A;  3Q4H B;  2Z5U A;  2XHB A;  4MVR A;  3HKE A;  4GKK O;  3ABM B;  4BR6 A;  2CGN A;  5JCO C;  2EIK B;  2EIK C;  1US6 A;  3ASN C;  2YI8 A;  4O4H A;  4K8X A;  2ADQ B;  4NXN B;  4J7K A;  4TV9 B;  3I55 V;  3K9A A;  3F5W C;  4JV5 B;  4D6T H;  3X2Q B;  4X66 B;  1B6Q A;  3ABL C;  1J5E O;  4I9Q A;  2UU9 O;  1FYJ A;  1QHT A;  1SA0 A;  3CC4 V;  5LGT A;  2EIJ C;  4IL6 Z;  2V7Q G;  2MK3 A;  4B3S B;  2QTO A;  2UXB B;  4L8J A;  1XMO O;  4O2A B;  2GSM B;  4I0X B;  1QLN A;  1M56 C;  2R9I A;  2DOS A;  4PA4 A;  2QWO B;  5CA1 A;  3ZHS A;  3W7W A;  1XMQ O;  3BA8 A;  2UXX A;  5LHH A;  3CCJ V;  4UVC A;  2DJV A;  1CP9 A;  4IIJ B;  2ZD9 A;  3M8A A;  3SPC A;  2OIE A;  5HFL A;  3CCE V;  1UFI A;  3ZED A;  2PYL A;  2XUM A;  3AG7 A;  5EK0 A;  5EYP A;  4LP8 A;  2EIN B;  1H2M A;  1YIJ V;  4X89 A;  1JOY A;  3ZRV A;  1CXZ B;  1S72 V;  1Y66 A;  4LR3 A;  4FLX A;  2QE7 G;  4AQY B;  2LGQ A;  1YZB A;  5C93 A;  2JGD A;  2IJK A;  4HAM A;  5GTH Z;  3RN4 A;  4PDR A;  4J9Z B;  1K33 A;  2XT9 A;  2WLK A;  2UXN A;  1KB9 F;  3K08 A;  4GKK B;  1TUE B;  3U10 A;  4D7T A;  1KQS U;  3SPH A;  4MVQ A;  4O4L B;  1FD9 A;  2N05 A;  1L8D A;  3UO3 A;  4CC5 A;  3G6E V;  1FKA O;  2W6I G;  1WA8 A;  3CCQ V;  2F93 B;  2FYU H;  1WB7 A;  4QNH B;  4MTF A;  2IH3 C;  3QVN A;  1M9N A;  5L3G A;  1J5E B;  1AVM A;  2RN9 A;  1NTZ H;  1SQX H;  1KC8 W;  2X7R B;  1V55 C;  3CRM A;  3T4Z A;  4JF3 A;  3R66 A;  1Q90 D;  2IBZ H;  2PZS A;  4YJ2 A;  4I4T A;  1JR9 A;  1Q81 W;  3SPG A;  4XDL A;  1OCO C;  2MW2 B;  1KD1 W;  1NR7 A;  5JVD A;  2KB1 A;  3CC2 V;  1OCC B;  2KKW A;  4DYL A;  1ZX3 A;  3DXR A;  2PYJ A;  2ZR3 A;  4UB8 Z;  1EZJ A;  1IXB A;  4H0L B;  3CHX A;  3BHP A;  1R3J C;  2BTO A;  1PP9 H;  4MVO A;  4I7Z B;  2F95 B;  2K1E A;  4X1Y A;  4ZHQ A;  3AG4 B;  4XDJ A;  4ABM A;  2ITC C;  5C8Y A;  4Z2W A;  4FLZ A;  2Q6A A;  4JYB A;  3ICX A;  3KG2 A;  5B5E Z;  3DC6 A;  3D3I A;  5JQG B;  4TOI A;  3RWR D;  4JI2 O;  3HKB A;  1WPX A;  4DV6 O;  2LJ2 A;  3TCU A;  4L87 A;  4P2Z A;  3CD6 V;  3ABK B;  3JSL A;  3CJH B;  1TGO A;  2A79 B;  3SJC C;  4N23 A;  5IE9 A;  1EN6 A;  4TUY B;  4FMT A;  1I94 O;  1QVG U;  1K7D A;  3RYI A;  3FKS G;  3L74 H;  4NXM O;  1CPY A;  1H8E G;  1WB8 A;  5GTI Z;  2V1D A;  2KG7 B;  4JI1 B;  1RPR A;  1VAR A;  4HBN A;  3CCR V;  3HKD B;  1KEC A;  1SF9 A;  3DC5 A;  4Q6G A;  1G6U A;  1FXK A;  4NTX A;  1R3L C;  4I50 A;  4DV3 O;  2IU3 A;  4R7C A;  1AR5 A;  3EFF K;  3ZIA G;  1IX9 A;  1PNL A;  2WA4 A;  1TUB B;  2Q7H A;  4DR3 O;  1AI4 A;  4EB6 A;  1Y76 B;  2FB5 A;  1CEZ A;  4CS3 A;  1YDX A;  2HLD G;  2AZ0 A;  4JAA A;  4A5U B;  4CC6 A;  3LDE A;  1NKD A;  2Y0P A;  2HVJ C;  1ARO P;  4FPP A;  1S5H C;  4DR5 O;  3JCZ A;  5CMU A;  3ZHV A;  1BQ0 A;  5EBM C;  3F7V C;  2QA4 V;  3FD9 A;  5L3E A;  3RYH A;  5H9C A;  4QIW F;  1OCR B;  3G4S V;  3C3T A;  3Q4H A;  5KA5 A;  1BGY H;  3K58 A;  4K3A A;  1VF5 B;  2EIL C;  3RVZ A;  3K9S A;  2CGO A;  2CH7 B;  4OXS A;  4UV9 A;  4JI3 B;  4F4L A;  4JI2 B;  4HZ3 A;  4DV6 B;  4TV9 A;  4QPK A;  3ZN0 A;  2PI5 A;  2XTA A;  4MVM A;  4UUJ C;  5DM6 V;  3I56 V;  1NVP D;  1IVS A;  2B9Z A;  4DK0 A;  3N27 A;  1I94 B;  4KXR A;  2IU0 A;  4NXM B;  3WB2 A;  1XHZ A;  4GKJ O;  5FLX N;  1B3Q A;  3N2K B;  4K35 A;  4NTY A;  3JD2 A;  1N0N A;  4DV3 B;  4NVP A;  4O2A A;  4I0X A;  3D3Q A;  4DR3 B;  1YEW A;  1QLE C;  2JVD A;  4FM1 A;  2VS0 A;  5KMG A;  2H3O A;  4IIJ A;  2X6A A;  3JD1 A;  3CXH F;  3U0Z A;  2A3Q A;  1VP7 A;  1BT8 A;  2D3O W;  4HNA B;  1YI2 V;  3B09 A;  1YJW V;  4J42 A;  1Y4M A;  4DR5 B;  5EC2 C;  1NH2 D;  4JI4 O;  4LH6 A;  1COW G;  4GCZ A;  3K06 A;  3ZMT A;  2ARH A;  2BTQ B;  1SQQ H;  3M7M X;  4X1I B;  4X64 B;  5LYJ B;  4J7Z A;  1KP2 A;  4GUN A;  1XIL A;  3AK1 A;  2EJR A;  3CRA A;  4J7J A;  3I5D A;  3T1Y O;  4O4L A;  1K4C C;  2YC0 A;  2F1M A;  1N33 O;  2QEX V;  3OTO O;  2Y69 C;  1N34 O;  2P22 C;  1I5X A;  3LSU A;  4F6E A;  1K4D C;  3LSS A;  1I08 A;  1F7Y A;  1XBL A;  1OZ0 A;  2QWQ B;  1LUV A;  2EX3 A;  2Q0O C;  4EFB A;  4YY3 O;  3UQ8 A;  2UXC O;  1HW7 A;  1H2G A;  3K0D A;  2O57 A;  3ABU A;  4AI8 A;  1VEW A;  4JI7 O;  3DTU B;  1GN6 A;  1VQK V;  1NU1 H;  1VQ8 V;  1AP6 A;  1FPO A;  5FNV B;  1M1K W;  4MTX A;  3ETG A;  3T4D A;  4WFH A;  1AI5 A;  5LXT B;  1MMM A;  2ZXW C;  4JI8 O;  1F4N A;  2P4V A;  1SES A;  4X1K B;  4PA7 A;  4O4I B;  1VQO V;  4J9Y B;  2VQE B;  2BOB C;  4FZ1 A;  5IWA O;  2P90 A;  3K0G A;  3ETQ A;  1EN5 A;  5KX5 B;  4GX2 A;  4DO2 A;  3K04 A;  1X59 A;  4JI4 B;  1L1F A;  1LR1 A;  3FB5 C;  3AG2 B;  1PL4 A;  3WB1 A;  4YJ3 B;  3SYQ A;  2RQ6 A;  5JQG A;  1R73 A;  2VRZ A;  1YIT V;  4NXN O;  3RT3 C;  3SYC A;  2HR3 A;  1BE3 H;  4KHP O;  1MZE A;  3ML0 A;  3CJH A;  2W0X A;  4IYI A;  3CXC U;  3H1L H;  3OTO B;  4JI0 B;  1GO3 F;  3E8F A;  4LF8 B;  4TUY A;  1GN2 A;  2LFR A;  2YS8 A;  4X88 A;  4X62 B;  1IBL O;  2DQ0 A;  2M7W A;  1M5I A;  2KG7 A;  1E1Q G;  3HKD A;  5E79 Z;  5L3C A;  5CBG A;  4YY3 B;  1ZLZ A;  2UXC B;  4B3S O;  5D5P A;  3ZMS A;  5CN0 A;  2LGW A;  1XNQ O;  3TJT A;  2BSK B;  2GHY A;  5LGN A;  1GK9 A;  1TUB A;  2DE0 X;  3CCS V;  3SYA A;  2WLJ A;  3IAY A;  1Y76 A;  1DGS A;  3K5O A;  1LUW A;  4EFE A;  4QGP A;  1HP8 A;  2Y0I A;  2HHH B;  4JI8 B;  4FFB B;  3ZX6 A;  3JYC A;  3OEE G;  3AG1 B;  2RMK B;  3OMI B;  1ROP A;  4DRX B;  3KCX A;  1P7G A;  4WFG A;  1PV0 A;  4DW1 A;  3G71 V;  3OR7 C;  5LA6 B;  1MSD A;  4X20 B;  2KSD A;  3BVO A;  3K57 A;  5EC1 C;  2WWW A;  3ZS8 C;  3LDC A;  4QE7 A;  4PDM A;  1W59 A;  5H6R A;  2CH7 A;  2N04 A;  1OV9 A;  3ASN B;  4RUF A;  1S77 D;  1EZV H;  3OM3 B;  1DF5 A;  1R6N A;  1FFT B;  1WLE A;  3QO7 A;  2GDS A;  4KHP B;  5CB4 B;  2HFE C;  1Q3E A;  3ASO C;  1YCI A;  4ZIB A;  1TA8 A;  3ABL B;  3MHH C;  4NKG B;  4FK5 C;  4DR2 O;  1RM1 C;  4PI2 A;  3B8M A;  1QVF U;  2AZ2 A;  1IBL B;  2CDY A;  2EIJ B;  4OX9 O;  2OCC C;  3UKM A;  2DW4 A;  3DSQ A;  5KLV H;  3GWK C;  1SKV A;  3APQ A;  4DV5 O;  2P6J A;  2ZQM A;  4C7U A;  1VQ5 V;  3N2K A;  1TAE A;  5DN6 G;  1XNQ B;  2JS5 A;  3BPZ A;  3CE2 A;  1FFX B;  1GN4 A;  3JD4 A;  1M56 B;  5BR8 O;  4E4E A;  5LL6 Y;  3FFQ A;  1XHX A;  2YIB A;  3WG7 C;  2ZNI A;  5J9P C;  3FYE B;  3SPI A;  4JI5 B;  3STZ C;  1K97 A;  5H6Q A;  4DUZ O;  2VWJ A;  3T1C A;  4E2L A;  4UCU A;  4LF9 O;  5AG2 A;  1JQ0 A;  1Z2G A;  1IXM A;  3H1H H;  4PHZ A;  4JYY A;  3CCL V;  4BIZ A;  2Q7E A;  4HNA A;  2P4K A;  1NTM H;  1IUR A;  1YVW A;  2YXH A;  1NI8 A;  1AJN A;  3D36 C;  1MOF A;  3APO A;  4CZZ A;  2GTA A;  1ZSP A;  2C2A A;  2BTQ A;  3OGC C;  3LDD A;  4X1I A;  3OW2 U;  5KUM A;  1VF6 C;  5LYJ A;  4KP4 A;  4FJC C;  4LWS B;  2ZE6 A;  4J10 A;  4OGQ B;  4CH5 A;  5B1B C;  1I7F A;  3JAT B;  5D5Q A;  4FIP C;  4PA9 A;  4AIL C;  3BEH A;  2JJ2 G;  3JD3 A;  4NB5 A;  1O9G A;  2UUA O;  1FJG O;  1H38 A;  5IDJ A;  3IC9 A;  5L3F A;  2ZDI A;  2WLH A;  2JDI G;  2IM9 A;  2OT5 A;  4DR2 B;  5CA0 B;  4JI1 O;  1VQP V;  5IYC O;  1V55 B;  1VQ6 V;  3IFX A;  3ZRS A;  4OX9 B;  5LMU O;  2B5U A;  2E5L O;  2JK5 C;  2ZE8 A;  4YIO A;  4DV5 B;  1OCO B;  4B3R O;  3FYI B;  4GZR B;  3AK3 A;  3JAW B;  4LH7 A;  5FNV A;  3O65 A;  2QJ1 A;  5J2U B;  5BR8 B;  4Z1M G;  2JRI A;  4JAU A;  4FLV A;  1M90 W;  2ZR2 A;  1P84 F;  3CCU V;  3HPL C;  1SET A;  4X1K A;  4NTW A;  4O4I A;  4DUZ B;  4YHH O;  4LF9 B;  2EBO A;  1XRE A;  5TIS Z;  1XEQ A;  1MNG A;  4LNU B;  3SYP A;  3VBB A;  3FX7 A;  5KX5 A;  4U7N A;  4KUM A;  2F4V B;  1GM7 A; 
#chains in the Genus database with same CATH homology
 2DWE C;  4H37 A;  4PA3 A;  4BIU A;  1VQ9 V;  1NQT A;  2XAJ A;  2XND G;  1PD3 A;  3ZN1 A;  4RQE A;  1Q82 W;  3TET A;  2IU0 A;  1W2B U;  3ETE A;  2LP7 A;  4UVA A;  5IY5 C;  1FS0 G;  1GM8 A;  5L3D A;  1VQM V;  3WG7 B;  3X2Q C;  1I5Y A;  4MVU A;  1PNM A;  3OUS A;  3W7T A;  4U7O A;  3F7Y C;  1DLB A;  3AG2 C;  3JD2 A;  3E86 A;  2IH1 C;  4MW8 A;  3RBZ A;  4EKW A;  3GWO A;  1YJ9 V;  2BOC C;  2YEV B;  2Z3Y A;  4PDV A;  5B1A B;  2Y48 A;  5CBH A;  3EHB B;  1QLE C;  3W7X A;  1NR1 A;  2DYR C;  3QO8 A;  1BHB A;  1P7B A;  4XDK A;  2X6A A;  2IJJ A;  3JD1 A;  3WFV A;  1GM9 A;  5B3S B;  3E83 A;  2XAG A;  4G28 B;  2WLM A;  5B3S C;  4JTD B;  1YI2 V;  2D3O W;  2OTL V;  3CC7 V;  2X6B A;  1YJW V;  1Y4M A;  4YXW G;  5EC2 C;  1NH2 D;  4MS2 A;  4WFF A;  1COW G;  3P30 A;  4GCZ A;  3QO5 A;  3CMA V;  2QM7 A;  5B1B B;  1W0J G;  3K06 A;  4P9P A;  3ZMT A;  2HJF C;  1QBZ A;  2EIN C;  3IC7 A;  2X6C A;  3PJS K;  3CYO A;  2F43 G;  4WFA V;  3ZRX A;  1FXK B;  4UV8 A;  1KP2 A;  1THZ A;  2EJR A;  1ZWI C;  1M57 B;  4JYC A;  1K4C C;  5B1O A;  4GX5 A;  1FXV A;  3B8N A;  1M57 C;  1VQN V;  2QEX V;  2Y69 C;  1AJQ A;  4I5S A;  1I5X A;  1S3J A;  3SYO A;  1K3E A;  3W7U A;  2H8P C;  3E8G A;  3K3W A;  1K4D C;  4G27 B;  1KKD A;  5E1A C;  3LSS A;  2JIZ G;  5L3B A;  1BMF G;  1JPX A;  2B1I A;  4JGS A;  4GX1 A;  5CBF A;  3B77 A;  3K79 A;  3AG1 C;  1OZ0 A;  4QE9 A;  1JJ2 U;  5LHI A;  1K92 A;  3ZMZ A;  2WLI B;  4XBF A;  1OCZ B;  4GX0 A;  3DGE A;  1ENV A;  2EIL B;  4I9W A;  5BZB A;  4CBC A;  1HWY A;  1H2G A;  3K0D A;  3E2E A;  3ABU A;  2WLN A;  1GMG A;  1F23 A;  1Q7Y W;  3DTU B;  2JEX A;  4TT3 G;  1VQK V;  2Z5U A;  2HG5 C;  4MVR A;  3CCV V;  1VQ8 V;  3ABM B;  1M1K W;  2EIK B;  3VOU A;  1YSC A;  2AHZ A;  4MTX A;  3ETG A;  2EIK C;  2JEU A;  1MSW D;  3T4D A;  4WFH A;  1AI5 A;  1G4Y B;  2NLJ C;  2ZXW C;  1F4N A;  3ASN C;  2Q68 A;  1SES A;  3OE7 G;  4PA7 A;  1NVP B;  3FB7 C;  4WFE A;  1F51 A;  1VQO V;  2P67 A;  4J9Y B;  3I55 V;  3CPW U;  2BOB C;  3P32 A;  1OCC C;  3K9A A;  5FL7 G;  3ZJZ A;  2P90 A;  5IY5 B;  3F5W C;  3K0G A;  2QKS A;  1UJW B;  4GX2 A;  4DO2 A;  3K04 A;  4MSW C;  3X2Q B;  1B6Q A;  3ABL C;  3ZRW B;  4TWK A;  3QNE A;  5GW7 A;  1L1F A;  3FB6 C;  2W0F C;  3H01 A;  3FB5 C;  3AG2 B;  4BW5 A;  3AEI A;  3CC4 V;  5LGT A;  3MHS C;  2EIJ C;  3SYQ A;  1E1R G;  4N21 A;  2V7Q G;  3AG4 C;  1QLE B;  2MK3 A;  1R73 A;  2QTO A;  1QCE A;  2DYR B;  4RAI A;  1YIT V;  5B1N A;  3SYC A;  2HR3 A;  2WSS G;  2GSM B;  1QLN A;  1M56 C;  1MAB G;  2R9I A;  4WFB V;  3ML0 A;  4PA4 A;  2EIM B;  3CXC U;  3ABT A;  2EIM C;  1GO3 F;  3E8F A;  2ITD C;  1SER A;  3W7W A;  3AG3 C;  2UXX A;  5LHH A;  4WCE V;  3CCJ V;  1NJI W;  4UVC A;  3OFN G;  2LFR A;  1CP9 A;  2ZD9 A;  3SPC A;  5HFL A;  3ABK C;  1NH2 B;  4P9O A;  3CCE V;  5KUK A;  4X88 A;  2DQ0 A;  1V54 C;  2M7W A;  2HKO A;  5CA3 A;  5EK0 A;  4Q20 A;  1G8M A;  4LP8 A;  1E1Q G;  2EIN B;  1YIJ V;  4MT8 A;  3FB8 C;  1QR8 A;  4X89 A;  5L3C A;  1JOY A;  5CBG A;  3ZRV A;  1S76 D;  2A0L A;  3TK1 A;  1JCH A;  1S72 V;  1R6K A;  1Y66 A;  2DQ3 A;  2QE7 G;  1PNK A;  3ZMS A;  5CN0 A;  5C93 A;  2IJK A;  4HAM A;  1AI6 A;  3CME V;  4PDR A;  4J9Z B;  1K33 A;  2GHY A;  2WLK A;  2UXN A;  1GTO A;  5LGN A;  1GK9 A;  1NBM G;  3E8B A;  3K08 A;  1K8A W;  2Y69 B;  3CCS V;  4ZBM A;  4RO2 A;  4R8C A;  1TUE B;  1KQS U;  3OMN B;  3ZMU A;  3OEH G;  4JPR A;  3SPH A;  4MVQ A;  3SYA A;  2WLJ A;  4UVB A;  5LBQ A;  2LFS A;  1R3K C;  3NXS A;  2YSU B;  1F4M A;  2XAS A;  3JYC A;  3OEE G;  3G6E V;  3AG1 B;  4JAV A;  2WLL A;  1ROP A;  3OMI B;  1K9M W;  2W6I G;  3CCQ V;  2DWD C;  4WFG A;  1VQ4 V;  3G71 V;  1MG1 A;  3LUT B;  3OR7 C;  5LHG A;  5IYB O;  3M99 B;  4QNH B;  4MTF A;  2IH3 C;  3E8H A;  2AHY A;  1M9N A;  5L3G A;  1BL8 A;  1E79 G;  4MVS A;  4RQF A;  3IGA C;  1KC8 W;  4JTA B;  2IW5 A;  2X7R B;  1V55 C;  3T4Z A;  3UM7 A;  5EC1 C;  3A0R A;  3LNM B;  4JF3 A;  2WWW A;  3LDC A;  4QE7 A;  4PDM A;  2WAM A;  2OTJ V;  5H6R A;  2A9H A;  2PI4 A;  2ZXW B;  1R3I C;  1AR1 B;  1Q81 W;  3ASN B;  3SPG A;  4RUF A;  1S77 D;  1OCR C;  3OM3 B;  4XDL A;  1DF5 A;  1OCO C;  4TSF G;  1R6N A;  1KD1 W;  1NR7 A;  1FFT B;  1WLE A;  2KB1 A;  2W6J G;  3CC2 V;  1OCC B;  2ATK C;  5EBL C;  3QO7 A;  4PDL A;  2XAQ A;  1YHQ V;  2HFE C;  2NNU A;  3ASO C;  3OR6 C;  3R65 A;  1JX9 A;  3ABL B;  3MHH C;  2ZR3 A;  4FK5 C;  2QM8 A;  1RM1 C;  1EZJ A;  3B8M A;  1QVF U;  4PA6 A;  1R3J C;  2DYS B;  4DXW A;  4MTO A;  4MVO A;  4QPJ A;  2EIJ B;  4R50 A;  2JJ1 G;  2K1E A;  2DYS C;  2OCC C;  3UKM A;  3ZMV A;  2DW4 A;  3AG4 B;  4XDJ A;  2ITC C;  3OMA B;  4BAY A;  5EBW C;  1XL4 A;  4RUE A;  2P6J A;  2ZQM A;  3ETD A;  1VQ5 V;  2Q6A A;  1AI7 A;  4JYB A;  3KG2 A;  5DN6 G;  3K03 A;  1OHH G;  2XOK G;  3SJQ C;  3STL C;  1VQL V;  3JD4 A;  1M56 B;  4LBE C;  2EZO A;  1DF4 A;  3D3I A;  2YEV A;  3WG7 C;  5J9P C;  1P4R A;  2Q69 A;  3FYE B;  3SPI A;  1XL6 A;  3STZ C;  2R9R B;  3AG3 B;  1K97 A;  5H6Q A;  1WPX A;  3TCU A;  3T1C A;  4E2L A;  3GB7 C;  4L87 A;  4P2Z A;  1JQ0 A;  3CD6 V;  1IXM A;  3ABK B;  2P7T C;  3D36 A;  4GT1 A;  3CCL V;  1V54 B;  2A79 B;  1Q86 W;  1J95 A;  5B1A C;  3OUF A;  2IJI A;  4BIZ A;  1N8R W;  4UXN A;  4N23 A;  2XAH A;  3T2M A;  4FMT A;  1KP3 A;  1QVG U;  3BY6 A;  2HVK C;  1K7D A;  3FKS G;  3JD0 A;  2X0L A;  3ZCC A;  1AJN A;  2B1G A;  2CK3 G;  2EZP A;  3OAA G;  4MTG A;  1CPY A;  1H8E G;  1MOF A;  2V1D A;  4MW3 A;  3RVY A;  4CZZ A;  1SRY A;  4JAS A;  1RPR A;  3CCR V;  2C2A A;  3OGC C;  3LDD A;  1KEC A;  3OW2 U;  5KUM A;  1K5S A;  2H94 A;  4QJF B;  4KP4 A;  2IJH A;  4FJC C;  1FXK A;  1R3L C;  1EFR G;  4X8A A;  2IU3 A;  5B1B C;  1QR9 A;  3HB3 B;  4R7C A;  4KFM A;  3EFF K;  3ZIA G;  4HYO A;  4FIP C;  4PA9 A;  1PNL A;  3BEH A;  4R6Z A;  1VQ7 V;  1H8H G;  2JJ2 G;  3JD3 A;  1AI4 A;  5HFM A;  1RPO A;  3E89 A;  1BHA A;  1FXK C;  4MVZ A;  1K73 W;  1H38 A;  1CEZ A;  1JVM A;  5IDJ A;  5L3F A;  1YTF D;  4P30 A;  2FTK A;  2HLD G;  1YTF B;  2ZDI A;  2WLH A;  2JDI G;  4LC1 A;  3LDE A;  3E35 A;  2OT5 A;  1NKD A;  3SPJ A;  5LGU A;  2HVJ C;  1ARO P;  2WLL B;  1PKX A;  4FPP A;  1VQP V;  5IYC O;  1V55 B;  1YJN V;  1AJP A;  1S5H C;  2WLI A;  2XAF A;  1VQ6 V;  3W7S A;  5IYD O;  3IFX A;  3JCZ A;  5CMU A;  5EBM C;  3F7V C;  1K34 A;  2WPD G;  3ZRS A;  2QA4 V;  2ZDI C;  5L3E A;  4PEL A;  4ASU G;  2B5U A;  5H9C A;  2JK5 C;  4QIW F;  1OCR B;  1OCO B;  3G4S V;  3FYI B;  5KA5 A;  5KA6 A;  1GKF A;  1S0V A;  1OCZ C;  3LSQ A;  4G2K A;  2EIL C;  4WF9 V;  3RVZ A;  1PL0 A;  4Z1M G;  1DTO A;  4JAU A;  4OXS A;  4UV9 A;  3ASO B;  4JTC B;  1K5Q A;  1SZT A;  1M90 W;  2Q67 A;  2ZR2 A;  3RW0 A;  4F4L A;  3CCU V;  3HPL C;  1SET A;  3ABM C;  4HZ3 A;  1RM1 B;  1ORQ C;  3CCM V;  3CP1 A;  4QPK A;  1EBO A;  2EBO A;  3ZN0 A;  2PI5 A;  4MVM A;  4UUJ C;  1LNQ A;  5DM6 V;  1FXH A;  3MD0 A;  3I56 V;  1NVP D;  3VBB A;  3SYP A;  2OCC B;  1W0K G;  4ZKI A;  4LCU C;  4U7N A;  4KUM A;  3ZRW A;  1GM7 A;  4H33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...