3UM7A

Crystal structure of the human two pore domain k+ ion channel traak (k2p4.1)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
266
structure length
259
Chain Sequence
RAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
publication title Crystal structure of the human K2P TRAAK, a lipid- and mechano-sensitive K+ ion channel.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 259
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3um7A01
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3um7A03
5B1AC 4R50A 2AHYA 4BW5A 2EIKC 1R3JC 2EINC 3OR6C 4LBEC 2WLJA 3TETA 4MTFA 4MTGA 4MW3A 4ZBMA 3SYCA 4MS2A 4PDLA 4QE9A 1M56C 2WLKA 3F5WC 3OGCC 3AG1C 4PDMA 5EBMC 4PDRA 4XDLA 5CBHA 4LCUC 3BEHA 2HG5C 2IH1C 1LNQA 3F7YC 4MVOA 4JTAB 2WLIA 3LDEA 4HYOA 1P7BA 3LUTB 3OUSA 2WLNA 4GX1A 3FB8C 3T2MA 1R3KC 3OUFA 2R9RB 4MVQA 2WLHA 4OXSA 4PDVA 4TWKA 3SPJA 2ZXWC 3LDDA 2YEVA 1QLEC 3K0GA 3SJQC 2WLLA 4QE7A 4PA4A 5CBFA 1J95A 3SPIA 4RO2A 2Q67A 4G28B 4MVMA 5EC1C 3AG3C 4GX2A 1JVMA 4CBCA 1R3LC 4MVUA 4QNHB 4X88A 2A79B 2Q69A 4PA3A 4R7CA 1M57C 3FB5C 1V54C 3RVZA 3STZC 3T1CA 3ZRSA 5CBGA 2Q6AA 3K0DA 4MVRA 3E89A 4J9YB 3ASNC 2Q68A 3JYCA 3LNMB 2EILC 3UKMA 4XDJA 5B1BC 2QKSA 5EBLC 2HFEC 2A9HA 4EKWA 5J9PC 2X6BA 2K1EA 1S5HC 3KG2A 2DWDC 2EIMC 5EBWC 3SPHA 4RAIA 4HZ3A 2X6CA 3RW0A 3E8FA 3SYAA 5KUMA 3E8BA 3SYOA 5EC2C 4WFGA 3FB7C 4WFEA 3E83A 2EIJC 3IGAC 2DWEC 4UUJC 2OCCC 2DYRC 3OR7C 4H33A 3STLC 3E8GA 3TCUA 3T4DA 5KUKA 3E86A 2ZD9A 3HPLC 5E1AC 4J9ZB 2A0LA 4XDKA 1BL8A 2P7TC 2NLJC 2W0FC 4MVZA 3RVYA 4RUEA 2ITCC 4F4LA 2ITDC 4WFHA 3ABKC 3AG4C 4MSWC 3F7VC 2BOCC 3LDCA 4X89A 4JTDB 1OCZC 1KKDA 3SYQA 4LP8A 3K04A 3T4ZA 2AHZA 1G4YB 4MTOA 2HJFC 3SPGA 4PA6A 4WFFA 4DXWA 3AG2C 3SYPA 1ZWIC 1OCOC 3EFFK 4JTCB 4R6ZA 1OCRC 3UM7A 3ZJZA 1K4DC 5B3SC 2JK5C 3VOUA 4GX0A 4MW8A 2ATKC 1OCCC 2HVKC 2Y69C 4G27B 3K08A 3K06A 3GB7C 3ABLC 3FB6C 4X8AA 3WG7C 5BZBA 1V55C 4I9WA 5EK0A 4R8CA 3SPCA 3ABMC 3R65A 3IFXA 3K03A 2BOBC 4P9OA 3RBZA 2DYSC 5IY5C 4P30A 1R3IC 3E8HA 4MVSA 2IH3C 2X6AA 4PA9A 1ORQC 4P9PA 4P2ZA 3X2QC 2WLIB 3ASOC 2QTOA 4KFMA 1K4CC 1XL4A 2KB1A 3PJSK 2HVJC 2H8PC 4H37A 2WLLB 1XL6A 4GX5A 4RUFA 2WLMA 4PA7A
chains in the Genus database with same CATH superfamily
1AP5A 4BW5A 1MG1A 3APQA 2Z0AA 4GLXA 4JAVA 1Q81W 2Y48A 4I9QA 1Y74B 4DV4B 2LW7A 4GX1A 5EIBD 5BMVB 4KP4A 4U3FH 1DLBA 4IIJA 4X1IA 4EB6A 3ZHTA 1JVMA 4X88A 3JAKB 3RVZA 4BIZA 1TGOA 5FLXN 1ZSPA 4FZ1A 4ABMA 3AG3B 2VRZA 4G2KA 4J41A 3CS5A 1XMOO 3JAWA 2VS0A 1VF6A 3LSQA 3ZMSA 1FXHA 2FL4A 3N2GB 2AW9A 3GWKC 3ETEA 2PGGA 1N34B 3UQ8A 1EM1A 4UCTA 4LF7B 3OEEG 4JI3O 5CMUA 1THZA 3U11A 4XDKA 1M4UA 4O2BB 2YICA 1GKFA 2BOCC 3QTCA 3OTOB 1W59A 3CCEV 5J2UA 1WN7A 3OMAB 1EN6A 1KU9A 2Y69C 4B7EA 1KB9F 2CTRA 4O4HA 5CB4B 1XNQB 2QR4A 1N33B 3N2KB 1Y76B 2RN9A 2YXHA 1WPBA 1IXMA 1F23A 4KFMA 4DO2A 4CZZA 4FM2A 4Z1MG 1XL4A 4YXWG 2H94A 2KB1A 4ZI7B 3CXCU 1MOFA 3CCJV 1TA8A 2UXBO 1N0NA 1YJ9V 2E76B 2V7QG 4J42A 4ZBMA 2AGAA 1B3QA 1F4NA 5B1AB 3QF7A 1XI1A 3U0ZA 1F51A 2GHYA 2WLIA 3CPWU 3T1HB 4O2AB 1VQLV 2Q7EA 4D7TA 2RMKB 1QLEC 1U96A 3K0GA 2ZM6B 2IW5A 4L87A 1URFA 3CSXA 1FS0G 4CBCA 1R3LC 4JI4B 3ZRSA 5FL7G 1PNLA 2Q6AA 3JATB 1KQSU 1R1BA 1Z2GA 2E5LO 1GM7A 3W7SA 2VQEO 3VQWA 1K7DA 3A0RA 1YJNV 3ASNB 3K57A 4LF4B 4DR6B 2X6CA 3G67A 4X64O 1LUVA 2XHBA 5KA6A 1S3JA 2V1DA 4NVPA 1G8MA 3TCUA 4NB5A 1D2DA 3EXAA 1NTKH 1JR9A 3W7WA 2QTSA 1N36O 4CC6A 4B3TO 1VQ6V 3JD1A 3ABKB 1S76D 3ZJZA 4PI0A 3CRRA 3W7TA 2RJZA 4RWUA 2QDOA 3ABLC 4LFBB 1YJWV 2JVDA 3H9VA 2LFSA 3CEIA 3B2EE 2QKCA 4A5UB 2CH7A 2F4VO 3JASA 5EIBC 1ORQC 1YCIA 4UCSA 3NXSA 3RYHA 3VBBA 5LP6C 5C93A 3HKDA 3H01A 4C7UA 1BQZA 3DC6A 1SKVA 4FLZA 5LYJB 2PTMA 2BSKB 1BGYH 2IJIA 3SYCA 2EZOA 2Q4PA 1RSOA 3OGIB 2P90A 2Y69B 2WWWA 4HNAB 1RPOA 1SQGA 1YHQV 2HP8A 4YJ2B 3ETDA 2LJ2A 1NTMH 2IJHA 1IBMO 1Y67A 4J80A 3K58A 4G28B 5J2TB 4O4JA 3U10A 5LMUB 2A79B 1AJQA 1ZTEA 1V54C 3QO5A 4FFKA 1JFFB 4MVRA 3ZHRA 2EILC 3OFNG 5L3CA 3SR2C 2EIMC 3OD4A 2P5OA 2UXDB 4ZOLB 3BCCH 4DUZB 4UFZA 2Q9LA 2QSAA 1ZLZA 2IJKA 1M1KW 3G80A 2LO1A 3CX5F 2ZE6A 1QLEB 2BTQA 1BSMA 4LNUB 2ODMA 2B9ZA 5FPOA 2GUZB 1AI5A 3I5DA 3AG4C 4MSWC 2EX3A 1NKDA 2L6LA 3T4ZA 5IJ0A 1J5EB 1KC8W 3ZMZA 4O4LB 3RYCB 1LUWA 3M7MX 1GM8A 4MW8A 2HVKC 4DV4O 1OV9A 2YUAA 4ICGA 3RFRA 2FTKA 1Q8IA 3JCUZ 1Q6UA 1ZL8B 1ZX3A 1SQPH 2QTOA 2YIDA 1K73W 2GV9A 4OPHA 5IY5B 1WA8B 3PJSK 3H1HH 4TOIA 1XL6A 2WLMA 3JARA 4KHPB 1SQXH 4DR7B 3DXRA 1XMQO 2ZIMA 1R6KA 4LF6O 1N34O 3IC7A 2XAQA 1AR5A 2EINB 1LNQA 1BHBA 3L75H 1YIJV 2DQ3A 3GVMA 4JTAB 2WLNA 1MSDA 4OXSA 3ZMUA 2WLHA 3E35A 4O4IA 4EEQA 3AK3A 3ZBHA 2ZDIA 4MT8A 1J95A 4TUYB 4RO2A 5JCOC 2P4KA 2JGDB 3AG7A 1SC5B 3OTOO 4H13B 1RFYA 2ARHA 3L9DA 5IYBO 1DF5A 5LP6B 3K5MA 4LF5B 3B8MA 3CJHB 4J7JA 5IJ9B 3ABUA 4GCZA 4YIOA 4X65B 4XDJA 4K8ZA 3OMIB 4JI8O 2HFEC 4IHJA 4RQEA 2X6BA 1XNQO 3ZMTA 1N33O 1P49A 4Q6GA 5KUMA 2DOSA 4LFCO 2B1GA 1MMMA 1D5NA 3JCZA 3PN1A 1JCHA 1UFIA 3G71V 3STLC 3E8GA 4I50A 3E86A 4AHCA 3RVYA 1V54B 5KHKA 3CC7V 1H2MA 1QR8A 2XAHA 2FMLA 2JIZG 1GN3A 2QJ1A 3BA8A 2A06H 1OCOC 3EFFK 5EZYA 4DV2B 1BE3H 4G27B 1NS1A 3T1HO 2PYLA 3RBZA 5A2QN 2ZM6O 3W7XA 4FLWA 2X6AA 5K1PA 3X2QC 4BR6A 2XOKG 2JRIA 5H9CA 1VQPV 3CWBH 3ZRWB 1FXKC 1GN2A 2OCHA 3IJ4A 3QNEA 4I0XA 1VQ7V 1EN5A 5B1OA 3ZHQA 4LF4O 3A8TA 2ZR3A 4MW3A 4JI5B 4PDLA 3QO7A 4PJ0Z 4PDRA 1IXBA 2EIKB 4LCUC 2OT5A 1B06A 5FNVA 3MHHC 1HW7A 2ZT9B 4FM1A 2Q7GA 1Q3EA 4UB6Z 4CS3A 3SJCC 3AG3C 5L3BA 3P3NA 3STZC 3T1CA 3LNNA 2JS3A 3ZN1A 2NN4A 2RCVA 3A0BZ 1B6QA 2W0XA 4FMTA 4LFBO 4GKJO 4RAIA 1TVKA 3E8FA 2K9PA 4JI1O 3UO3A 5KAFZ 1Z5WA 1K92A 1AVMA 4YY3B 4OGQB 4TQFA 1K5QA 2HEPA 1BHAA 4X1YB 5LHIA 1M93A 3RYFA 4PD4F 5KMGB 4JV5B 2JK5C 2QEXV 2CDYA 2IU3A 4DV6B 1SS3A 4IGGA 5BZBA 3ZHVA 5IE9A 3HKBB 4MVSA 1K33A 3FX7A 5LMUO 1YSCA 4NXNO 3ABMB 4DYLA 1BT8A 4H37A 4UV9A 4IIJB 4X1IB 4TQDA 4WFHA 5B1AC 2YXLA 2UXDO 3P30A 5LGTA 4WCEV 2Y4UA 3JAWB 1XNRB 2JS5A 3E22A 1M56B 1I7FA 4MVOA 1P7BA 4FFBA 1S72V 4TV9A 3THOA 5IYDO 5CBFA 3TGUH 3SPIA 2W6IG 1US6A 1Q5OA 5K1XA 5IYZA 1J5EO 1FXKB 3CRCA 4DR2B 3E89A 4KL1A 3SDLA 3ASNC 4LFAO 3JYCA 4LF8B 3CCRV 3SGIA 2N04A 3ZRXA 4BAYA 3K59A 2UUBB 5J9PC 5J2UB 3FAVA 1BZKA 1IBLB 4HAMA 1GO3F 2YXYA 5BR8O 1ZUQA 1SA0A 3J80N 4UVCA 4WFBV 5C8YA 4O4HB 1K9MW 4DR1O 2UU9O 3HPLC 1H2SB 4UB8Z 4KHPO 3LSSA 2W0FC 1WPXA 5CA0A 1FD9A 1F4MA 4IT5A 3ABKC 3F7VC 2QWOB 4IL6Z 2M7WA 2CTPA 4AILC 1RP3B 5LMNO 4MTOA 4DXWA 2E75B 1VQ8V 3KKYA 2F66C 1FFXA 2DE0X 1I94B 1I5XA 2MW2B 2E74B 1HNWB 3IFXA 1OCCB 1HDJA 4BIUA 1K5SA 2OWOA 4JAAA 1I0HA 2WLIB 1K3EA 4QPJA 2OYQA 1DTOA 2P67A 3ICXA 2YDEA 4FZ0A 2FKXA 4XBFA 1H8EG 2WLJA 2PF4E 2WLKA 3F5WC 5B1NA 4JYAB 4DR5O 2LGWA 4DV0B 2KG7A 1Y74A 4N23A 3RW0A 2ADPA 3Q4HA 4PDVA 5KHGA 1IURA 3L74H 1IBKB 2YEVB 3FD9A 2WLLA 4QE7A 2DMXA 4EFEA 3RT3C 2O57A 2KKWA 2KQXA 5ITZA 2RNBA 1WLEA 4HBNA 2XASA 2XUMA 1H2KA 3EHBB 3A0HZ 1H38A 3LNMB 4DV2O 2MK3A 1QVFU 4EKWA 4IYHA 1GAXA 5LHHA 1S5HC 1FYJA 2DWDC 4QIWF 2HJDA 4X62B 4FIPC 2A3QA 4WFGA 1WB8A 4UUJC 1GH6A 1JJ2U 4X20A 3ZRVA 2HKOA 2A0LA 1BL8A 4DUYO 2CH7B 3JASB 1I5YA 3RYHB 1Q90D 4JI5O 1D5AA 1XQ8A 1G4YB 3D36A 3OEHG 4JZ2A 2UUCB 3HKDB 1ZWIC 3IC9A 2X0LA 1VIBA 2X7RB 1WP8A 3K06A 1T5EA 5CB4A 4N21A 1RSOB 4DRXA 5LGUA 4ZHQA 5IY5C 1EZVH 2D3OW 4B3SB 1SESA 1S5LZ 4P2ZA 4CH6A 1R6NA 3GWOA 3NR7A 1L1FA 3DTUB 4K8XA 2DJVA 3BHPA 3JALA 4K0KB 3ASOB 2GDSA 1NI8A 4O4JB 1AJNA 2BCCH 2AHYA 4MTXA 2F93B 2EINC 5A9GA 1N0JA 3VQYA 1GK9A 2UXNA 1XREA 2LGQA 4YHHO 1R6TA 2GSMB 1VQ9V 4CH3A 1K8AW 4OX9O 3JD0A 4NKGB 4JI0O 3T2MA 4YY3O 1PPJH 3L72H 4YJ3A 4RQFA 4GZRB 2ILMA 4PA4A 2Y4TA 3CCMV 3CP1A 4MVUA 3ZHUA 4FLXA 3ZHSA 1AROP 3K0DA 2AZ0A 3ZX6A 1K34A 2VWKA 5IJ0B 3CXHF 4JYCA 5LOVA 1VEWA 3TK1A 1XHXA 1Y4MA 2EJ7A 2PZSA 4PV1B 2YSUB 1JA8A 5H5NA 4JAUA 5L3GA 1BCCH 2Y0PA 4DV3B 1IVSA 4DV1B 1X59A 4MVZA 5KAIZ 2QKAA 2P06A 1W0JG 4JTDB 2OIEA 4TV8A 3W7UA 3ZMVA 3DSQA 1JPXA 5JVDA 3CRMA 5JQGB 5B66Z 5BXZA 4E4EA 3JARB 1OCZB 3DXRB 5B5EZ 2ATKC 1QBZA 1XDCA 4LR3A 4U3JA 3T1YB 3N27A 2BOBC 4P9OA 2XT9A 2NNUA 2V4DA 4J10A 3E8HA 3WG7B 3B77A 1PP9H 4PA9A 4DW1A 1OJHA 1S0VA 1BMFG 4J7ZA 2BE3A 2DYSB 5JJNB 2G38A 3KCYA 4O4IB 4LF8O 3D3IA 1WB7A 1YEWA 3OE7G 2UUBO 1HR0B 2CTQA 3F5TA 2EIKC 2N05A 2BSKA 3HB3B 4MS2A 4I7ZB 3OGCC 4B7KA 1FJGB 2QWNB 4XDLA 2WPDG 5LA6A 1E79G 2LFRA 4FLYA 3BPZA 4DR3B 2R9RB 2DW4A 2VQFB 1MZFA 5HFMA 2XAFA 5CBGA 4I50B 1G6UA 3H1IH 2AZ2A 4J9YB 2Q68A 3CCSV 1LR1A 4LF7O 5B1BC 1I94O 1N4CA 1PNMA 5EBLC 4JYBA 1GTOA 1HNWO 4F6EA 2A7WA 4X1KA 2EZPA 1RPRA 3K3WA 1KECA 5EZYB 1ZAUA 3KZIZ 1O9HA 2Z3YA 1M5IA 3E83A 1NZ6A 1Q86W 3T4DA 2NLJC 3OW2U 2OCCB 2ITDC 1Q7YW 1B04A 3LDCA 1COWG 4NTYA 1VF5B 4JYAO 5KX5A 1Q6HA 1HNXB 1OHHG 3SJBC 4I0XB 1QNMA 3FB6C 1OCRB 3HKCA 1AI4A 3ABMC 3WB2A 4NTXA 4UCRA 1SERA 3ZN0A 1FAFA 3BABA 2PI4A 3C3SA 5FNVB 1K4CC 3FYIB 1AR4A 1EN4A 4FVMA 3RGBA 2HR3A 4PA7A 2LQTA 4R50A 4F6RB 2HLDG 1R3JC 3OR6C 1O9GA 3OM3B 4MTFA 4JF3A 1VF6C 4X62O 1M56C 4PDMA 1AR1B 3S3XA 1AB3A 2CAZC 2F23A 4JI4O 1CEZA 3LDEA 1H2GA 1MNGA 1TVKB 2F43G 4CS2A 1CPYA 2Q67A 4NR1A 4LC1A 1IDSA 1NT2B 4YIPA 3B09A 5KHJA 4R7CA 1VQKV 2ZCEA 5LP6A 4JZGA 4DR6O 2UUCO 5LXTA 3FYEB 2QWPB 1QU7A 4DW0A 2YIBA 3RYFB 2K1EA 3OMNB 5EBWC 3RYIA 1WNSA 5JWPA 3CC2V 3SYAA 4UCUA 4JI2B 4B3SO 2JDIG 2E5LB 1L0LH 4JI6B 2E3CA 2JGUA 2ZE7A 4D6TH 1IX9A 4K0KO 4UVAA 5E79Z 4I4TA 1FXVA 3C90A 2Q8VA 1GMGA 2P6JA 2WA4A 4DR4B 3ZS8C 4GUNA 4X89A 4BW9A 4FM0A 1TUEB 1QVGU 4WFFA 4EFBA 5B1BB 1XEQA 3FKSG 1EFRG 1OCCC 1L8DA 4DK1A 2W6JG 1JJOA 3K08A 4AQYB 4X8AA 5JH7A 4D7SA 1EZJA 2QM4A 3HR0A 3OT7A 1VMGA 3E22B 1X4TA 1AI6A 1PL4A 4TV9B 5KHIA 3ZCCA 4WBNA 1XOUA 1M9NA 2F4VB 2CTWA 1SZTA 1PM9A 4LH7A 3D8CA 1QR9A 1N8RW 4U7NA 1G1XB 4JGSA 1WJZA 2OTJV 4Z1VA 4JPRA 1NH2D 2LP7A 2QM8A 3O9OA 3LUTB 3FAVB 4IYIA 3QG5A 4TWKA 3TJTA 1QQCA 2WSSG 3A2FA 4DV1O 2ZINA 5CA1A 4EB6B 1Q82W 1SA0B 2F95B 1YI2V 3SJAC 3CE2A 5AG2A 5F2VO 4X66B 3HKEA 2B5UA 4DUZO 1NR1A 5IWAB 1QCEA 3ZIAG 1VARA 1TUBA 3T1YO 1RM1B 5D5QA 5DM6V 3I56V 1DK1A 3BFRA 2IM9A 4I55A 4LWSA 1I08A 1SQFA 5EC2C 1FFXB 4AI8A 1L0NH 1YITV 1MA1A 4QJFB 3WU2Z 1NVPD 5JCOA 2EIJB 4F4LA 2WA3A 3SPGA 1FJGO 2GTSA 4R6ZA 3UM7A 1AI7A 1K4DC 4FJCC 4E2LA 3RN4A 1CP9A 1R73A 4DR3O 3S3WA 3AG2B 5JJEB 3K5LA 1E1QG 5B3SB 5EK0A 5EYPA 2AXTZ 4R8CA 2ETNA 2VQFO 3K03A 3HKBA 4DR7O 2KG7B 4J7KA 2QGNA 1GM9A 2R70A 3CRAA 1VQOV 2VWJA 3ASOC 2C2AA 3Q4HB 2CE4A 1Q6IA 2WLLB 3EVKA 2M6YA 4FLUA 5ITZB 2OTLV 1WP7A 3UT5A 2P22C 3K9AA 1QHTA 4LF9B 3CCUV 4QE9A 1MABG 2Z5UA 5GONA 2YIBD 2ZR2A 3QVNA 1XMQB 4KXRA 1WAZA 3AG1B 4LF5O 4NTWA 4LF6B 1P4RA 1P7GA 4MVQA 4B3MB 3B40A 3K79A 2KSDA 2PI5A 4X65O 3CC4V 4GX2A 4UCVA 4QNHB 2Q69A 4PA3A 2CK3G 4X20B 3IAYA 1FXKA 1HNXO 1W2BU 2IBZH 3TXSA 5DEDA 2F1MA 2QM7A 2QE7G 3SPHA 5BMVA 2PUSA 2ZE8A 3FFQA 1JQ0A 3E8BA 1BQ0A 4DV5B 4WFEA 4JI8B 1KBHA 3JSNA 3JAKA 2UUAB 4DRXB 4ZHQB 3KCXA 1PD3A 2P7TC 2DYRB 4LFCB 4FK5C 2DQ0A 3MDSA 2RQ6A 1OCZC 3B8NA 3N2GA 1SETA 2CUGA 2PY5A 3JALB 4JI7B 1NTZH 2P4VA 3AEIA 3JAMN 3CMAV 3WG7C 2GTAA 2DYSC 2HHHB 3CHXA 1XHZA 4O2BA 3CB2A 1OZ0A 2ZDIC 1AJPA 1YZBA 3OAAG 2Q7HA 5CN0A 5GTIZ 4YJ3B 5HFLA 2OIGA 1VQ5V 1V9PA 1K97A 5H6RA 3UCSC 4JI2O 3N2KA 1AILA 1Y76A 4GT1A 1SRYA 3OTFA 2HG5C 2IH1C 1YVWA 4JI6O 4DK0A 4HYOA 3FB8C 5LOVB 5TISZ 4ZI7A 2YEVA 4DR4O 4DV7B 4B3RB 3J7AU 1SZXA 1FPOA 1F7YA 1YTFD 1ENVA 5KA5A 3UKMA 3K5OA 4AQYO 3RWRD 2A9HA 2ZIOA 4TV8B 3KG2A 5JVDB 4JASA 4OPAA 4O2AA 4NXMB 3SYOA 3IGAC 2OCCC 4U3JB 3WB0A 3CCLV 3D3QA 5LHGA 2YIAA 4UXNA 4JV5O 3TXQA 1M90W 4GKJB 4QPKA 2BTQB 4FPPA 5E1AC 2PYJA 4J9ZB 2D2CB 3G6BA 1VQMV 3JATA 2ZKOA 1GN6A 1H2LA 4RUEA 4JI1B 4GYCB 1KMIZ 4DV6O 1HNZB 1KUQA 3K9SA 3JD3A 2B1IA 2AHZA 2HJFC 1TAEA 1OCRC 3MD0A 3QO8A 1NR7A 1Y66A 5IDJA 2JEUA 1UPGA 1R3IC 5LA6B 2CGNA 2EBOA 1SQBH 1PV0A 4X66O 4CS4A 1BS3A 4X9QA 5IWAO 2NR5A 5GW7A 1XNRO 4H0LB 4PI2A 4GKKB 4NXNB 4LBEC 3TETA 1YDXA 4MTGA 2Q0OC 1NBMG 3CCQV 1GN4A 2UXCB 3C3TA 4BWAA 4X1KB 5BY1A 3L73H 1NH2B 4DR2O 3OUFA 4BIOA 3SPJA 3BA9A 5IYCO 4KUMA 5L3DA 3MAQA 2QWQB 4K3AA 1M57C 2BTOA 2ZNJA 5LYJA 1E1RG 1IBLO 5GTHZ 2R72A 1KP3A 1NJIW 3H1LH 4HNAA 2QKSA 3JD4A 4IHJB 1N32B 4YJ2A 1P84F 2FYUH 4H44B 2YI8A 5KX5B 2JJ2G 3G6EV 4LFAB 3ETGA 3L70H 5J2TA 2Q0AA 3FB7C 4H33A 2YC0A 3OR7C 5KUKA 1UJWB 1MSWD 3HKCB 2QWRB 5LGNA 1JFFA 2RDCA 4B08A 1NVPB 5LL6Y 2ITCC 5BR8B 1VF7A 4CC5A 4U7OA 1KKDA 3SYQA 4LF9O 3H1JH 2XNDG 4DR1B 2UU9B 1ROPA 4ZOLA 5JQGA 3UO2A 1Y6XA 4CH5A 3ML0A 1SF9A 1XMOB 2R9AA 4B3MO 4K35A 1V55C 4I9WA 5H2FZ 1HWYA 5LMNB 2IU0A 3R65A 2DN9A 4LNUA 4FLVA 3ABLB 2IH3C 2GUZA 4P9PA 4JI3B 5KHHA 1KYOF 4UV8A 4PHZA 4GX5A 1MZEA 4O4LA 3RYCA 4DV0O 3DGEA 1HP8A 4W4KA 4PELA 2XTAA 4NYKA 5LXTB 5EBMC 1IBKO 1YXBA 4DV5O 3J81N 1PKXA 3BEHA 5CA3A 1ZL8A 3F7YC 2H3OA 2UUAO 1DGSA 3RYIB 1R3KC 1VP7A 1WA8A 3BAAA 5DN6G 2GBOA 2ZXWC 3LDDA 4DR5B 2FB5A 3M8AA 4LH6A 4TSFG 3G4SV 3FB5C 1PNKA 4JI7O 3WB1A 3ZEDA 4I4TB 5KLVH 1RM1C 1GRJA 3H1KH 2L35A 4I5SA 2ADQB 2JJ1G 2UXBB 2LW1A 4UVBA 5LBQA 3DC5A 2EILB 2HHHO 3P3PA 4TUYA 2EIMB 2JGDA 3VQXA 3K5NA 2EIJC 2DWEC 5DECA 5JH7B 1U97A 5H6QA 3CJHA 5IJ9A 1H2NA 3JSLA 1YF2A 1M57B 2YI9A 4FLTA 3CRQA 3K04A 2XAGA 1VQNV 4TT3G 3CD6V 3AG2C 2ZE5A 3AG4B 3SYPA 4JTCB 4WBNB 4ZIBA 4Q20A 3ABTA 5B3SC 4DUYB 4GX0A 4WFAV 2VQEB 5IT9N 4DV7O 5JJJB 4B3RO 4P30A 3AK2A 4X64B 1KD1W 1S77D 2WAMA 1IZ3A 4JYYA 1NU1H 3I55V 1H8HG 2HVJC 2H8PC 3CYOA 1A32A 5CA1B 1NQTA 4Z2WA 1SQQH 4F6RA 1SQVH 1EBOA 3ETQA 5L3FA 1VQ4V 3HKEB 4NXMO 1CXZB 1JMKC 1N36B 2ZQMA 3AG1C 4B3TB 5CBHA 3VQVA 3LSUA 1TUBB 1V55B 4QGPA 3JD2A 3OUSA 4W4LA 1DF4A 4FFBB 3CCVV 2UXXA 3ZRWA 3P32A 3SJQC 5D5PA 4I55B 2N74A 4LWSB 1AP6A 3BRCA 3B4SA 4MVMA 1HNZO 5EC1C 4YHHB 1QLNA 5IYZB 2YS8A 4OX9B 4JI0B 1XUQA 2JEXA 3L71H 1Z5VA 1FKAO 3O65A 3D36C 3WFVA 1YTFB 1JOYA 4DV3O 4HZ3A 2EULA 2ZNIA 3APOA 1W0KG 2EJRA 3MHSC 2Y0IA 2DYRC 2QA4V 1Q43A 2ZXWB 5EYPB 5C8YB 2ZD9A 2CGOA 3BVOA 5CA0B 1IBMB 1KP2A 1S5JA 4GKKO 4J11A 4LP8A 1JX9A 1FFTB 2Q5ZA 3E2EA 4PA6A 3BY6A 3R66A 4L8JA 2UXCO 3VOUA 2IJJA 1XBLA 3GB7C 3UT5B 1KKCA 1OCOB 3AK1A 3SPCA 2Q73A 5GONB 2R9IA 5FPRA 4WF9V 4ASUG 1HR0O 3CMEV 4ZKIA 2XAJA 4X1YA 3M99B 4CH4A 5KMGA 5L3EA 3X2QB 4RUFA 4UCOA 1XILA 1PL0A 1N32O
chains in the Genus database with same CATH topology
5B1OA 4BW5A 1K97A 2EIKC 1MG1A 5H6RA 2ZR3A 3HB3B 4MW3A 4MS2A 4PDLA 3OGCC 3QO7A 4PDRA 4XDLA 4JAVA 2EIKB 2WPDG 4GT1A 1SRYA 4LCUC 1Q81W 2HG5C 1E79G 2IH1C 2LFRA 2Y48A 2OT5A 4HYOA 4GX1A 3FB8C 3MHHC 2R9RB 2DW4A 4KP4A 2YEVA 1DLBA 5HFMA 3AG3C 1JVMA 5L3BA 4X88A 2XAFA 3STZC 3RVZA 5CBGA 3T1CA 4BIZA 3ZN1A 1YTFD 3AG3B 4J9YB 2Q68A 4G2KA 3CCSV 1ENVA 5KA5A 3UKMA 5B1BC 1PNMA 5EBLC 4JYBA 1GTOA 2A9HA 3LSQA 3ZMSA 1FXHA 1B6QA 4FMTA 3KG2A 2EZPA 4RAIA 1RPRA 3ETEA 1KECA 3K3WA 4JASA 3E8FA 3SYOA 3OEEG 2Z3YA 3E83A 3IGAC 5CMUA 2OCCC 1Q86W 1THZA 3CCLV 1K92A 3T4DA 5LHGA 4UXNA 1M90W 4QPKA 4FPPA 5E1AC 1K5QA 4J9ZB 4XDKA 1VQMV 2NLJC 3OW2U 2OCCB 4RUEA 1BHAA 2ITDC 1Q7YW 1GKFA 2BOCC 3LDCA 5LHIA 1COWG 3OE7G 3JD3A 3CCEV 2B1IA 2AHZA 2HJFC 1OHHG 3OMAB 1OCRC 2JK5C 2QEXV 3MD0A 3QO8A 1NR7A 2IU3A 1Y66A 2Y69C 3FB6C 5IDJA 5BZBA 1OCRB 2JEUA 1AI4A 3ABMC 1R3IC 1SERA 1IXMA 2EBOA 1K33A 4MVSA 3ZN0A 2PI4A 1F23A 1YSCA 4KFMA 3ABMB 4DO2A 4CZZA 1K4CC 3FYIB 4Z1MG 1XL4A 4YXWG 2H94A 2KB1A 3CXCU 1MOFA 4H37A 3CCJV 4UV9A 2HR3A 4PA7A 4WFHA 5B1AC 5GW7A 4R50A 2HLDG 1YJ9V 1R3JC 3OR6C 4LBEC 3OM3B 2V7QG 3TETA 4MTFA 4MTGA 4JF3A 4ZBMA 3P30A 1M56C 4PDMA 1F4NA 1AR1B 5B1AB 1NBMG 5LGTA 3CCQV 4WCEV 1M56B 4MVOA 1F51A 2GHYA 2WLIA 3LDEA 1P7BA 1CEZA 1H2GA 1NH2B 1S72V 3CPWU 3OUFA 5IYDO 2F43G 3SPJA 1VQLV 1CPYA 5IYCO 1QLEC 3K0GA 5CBFA 2IW5A 4L87A 3SPIA 2Q67A 2W6IG 1FS0G 4LC1A 4KUMA 5L3DA 4CBCA 1R3LC 4R7CA 1M57C 1VQKV 3ZRSA 1FXKB 5FL7G 1PNLA 1E1RG 2Q6AA 3E89A 3ASNC 1KQSU 3FYEB 3JYCA 1KP3A 3CCRV 1NJIW 1GM7A 2QKSA 3W7SA 3ZRXA 4BAYA 1K7DA 3JD4A 3A0RA 5J9PC 1YJNV 2K1EA 3ASNB 3OMNB 5EBWC 2JJ2G 2X6CA 4HAMA 3G6EV 1GO3F 3CC2V 3SYAA 2JDIG 3ETGA 3FB7C 5KA6A 1S3JA 2V1DA 4UVCA 4H33A 3OR7C 1G8MA 3TCUA 5KUKA 1UJWB 4WFBV 1K9MW 1MSWD 5LGNA 3HPLC 4UVAA 3LSSA 1FXVA 2W0FC 1WPXA 3W7WA 1NVPB 1GMGA 2P6JA 2ITCC 1F4MA 3ABKC 3F7VC 4U7OA 4X89A 2M7WA 1KKDA 3SYQA 1TUEB 2XNDG 1ROPA 1QVGU 4MTOA 1VQ6V 3JD1A 4WFFA 4DXWA 5B1BB 3ABKB 1S76D 1VQ8V 3ZJZA 3ML0A 3FKSG 1EFRG 3W7TA 1OCCC 2W6JG 3K08A 1I5XA 3ABLC 4X8AA 1V55C 4I9WA 1YJWV 1HWYA 2LFSA 3R65A 3IFXA 1EZJA 2IU0A 1OCCB 4BIUA 1K5SA 3ABLB 2IH3C 1ORQC 4P9PA 2WLIB 1K3EA 3NXSA 4QPJA 3VBBA 1AI6A 1DTOA 4UV8A 3ZCCA 2P67A 4GX5A 5C93A 3H01A 1M9NA 3DGEA 1SZTA 4PELA 4XBFA 1H8EG 1QR9A 1N8RW 2WLJA 2IJIA 3SYCA 4U7NA 2EZOA 2WLKA 3F5WC 5EBMC 5B1NA 4JGSA 2P90A 2Y69B 2WWWA 1PKXA 1RPOA 3BEHA 2OTJV 5CA3A 1YHQV 4JPRA 1NH2D 2LP7A 2QM8A 3F7YC 3ETDA 4N23A 3RW0A 3LUTB 1R3KC 4PDVA 4TWKA 5DN6G 2WSSG 2ZXWC 3LDDA 2IJHA 2YEVB 2WLLA 4QE7A 4G28B 1Q82W 4TSFG 3G4SV 1YI2V 2A79B 1AJQA 1WLEA 3FB5C 1V54C 2XASA 1PNKA 3QO5A 2B5UA 3EHBB 4MVRA 1NR1A 1H38A 3LNMB 1RM1C 1QCEA 2EILC 3OFNG 2JJ1G 2MK3A 4I5SA 3ZIAG 5L3CA 1QVFU 4EKWA 4UVBA 5LHHA 1S5HC 5LBQA 1RM1B 2DWDC 2EIMC 4QIWF 5DM6V 2EILB 3I56V 4FIPC 5EC2C 2EIMB 2IJKA 4WFGA 1M1KW 2EIJC 4UUJC 2DWEC 5H6QA 1YITV 1JJ2U 4QJFB 3ZRVA 1QLEB 2HKOA 1NVPD 2A0LA 1BL8A 2EIJB 1I5YA 1AI5A 4F4LA 1M57B 3AG4C 4MSWC 1NKDA 3K04A 3T4ZA 2XAGA 1VQNV 4TT3G 3CD6V 1G4YB 3D36A 3SPGA 3OEHG 1KC8W 3ZMZA 3AG2C 3AG4B 3SYPA 1ZWIC 4JTCB 4R6ZA 3UM7A 4Q20A 3ABTA 1AI7A 5B3SC 1K4DC 2X0LA 2X7RB 4GX0A 1GM8A 4FJCC 4E2LA 4MW8A 4WFAV 2HVKC 1CP9A 1R73A 3K06A 3AG2B 1E1QG 5B3SB 4N21A 5EK0A 4R8CA 3K03A 5LGUA 2FTKA 5IY5C 4P30A 2D3OW 1SESA 1KD1W 1GM9A 2WAMA 4P2ZA 1VQOV 1S77D 3ASOC 2QTOA 1R6NA 3GWOA 1L1FA 2C2AA 1K73W 5IY5B 3I55V 1H8HG 3PJSK 2HVJC 2H8PC 3CYOA 3DTUB 2WLLB 1XL6A 2WLMA 3ASOB 1NQTA 1AJNA 2OTLV 2AHYA 4MTXA 1EBOA 1R6KA 2EINC 5L3FA 3K9AA 1VQ4V 1GK9A 3CCUV 4QE9A 2UXNA 1MABG 2Z5UA 2ZQMA 3AG1C 5CBHA 3IC7A 2XAQA 2EINB 2ZR2A 2GSMB 1LNQA 1V55B 1VQ9V 1K8AW 1BHBA 1YIJV 2DQ3A 3JD0A 3AG1B 4JTAB 3T2MA 3JD2A 3OUSA 2WLNA 1DF4A 3CCVV 1P4RA 4MVQA 4OXSA 2UXXA 2WLHA 3E35A 3ZMUA 3ZRWA 3K79A 3P32A 4RQFA 2ZDIA 4MT8A 3SJQC 2PI5A 4PA4A 3CCMV 1J95A 4RO2A 4MVMA 3CC4V 5EC1C 4GX2A 3CP1A 1QLNA 4MVUA 4QNHB 2Q69A 4PA3A 2CK3G 1FXKA 5IYBO 1DF5A 2JEXA 1W2BU 3B8MA 1AROP 3K0DA 3ABUA 4GCZA 3WFVA 4XDJA 1YTFB 3OMIB 1K34A 1JOYA 2HFEC 4RQEA 2QM7A 2X6BA 2QE7G 3ZMTA 3SPHA 4HZ3A 4JYCA 1JQ0A 5KUMA 3E8BA 1W0KG 2EJRA 3TK1A 2B1GA 3MHSC 1Y4MA 3JCZA 4WFEA 1JCHA 2YSUB 3G71V 4JAUA 2DYRC 3STLC 5L3GA 2QA4V 3E8GA 2ZXWB 3E86A 2ZD9A 1PD3A 2P7TC 4MVZA 3RVYA 2DYRB 1W0JG 4FK5C 1KP2A 1V54B 2DQ0A 4JTDB 1OCZC 3CC7V 3W7UA 4LP8A 1JX9A 3B8NA 1QR8A 1SETA 3ZMVA 1FFTB 1JPXA 2XAHA 2JIZG 3E2EA 4PA6A 3BY6A 1OCOC 3EFFK 1OCZB 3VOUA 2ATKC 1QBZA 2IJJA 3AEIA 4G27B 3CMAV 3GB7C 3WG7C 1OCOB 3SPCA 3RBZA 2BOBC 4P9OA 2DYSC 2NNUA 2R9IA 3E8HA 3WG7B 3W7XA 3B77A 4WF9V 1OZ0A 2X6AA 2ZDIC 4PA9A 1AJPA 3OAAG 3X2QC 4ASUG 1S0VA 3CMEV 2XOKG 5H9CA 1BMFG 4ZKIA 2XAJA 2DYSB 3M99B 5CN0A 1VQPV 3ZRWB 5L3EA 5HFLA 1FXKC 3D3IA 3X2QB 4RUFA 1VQ5V 3QNEA 1PL0A 1VQ7V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1A C;  4R50 A;  2AHY A;  4BW5 A;  2EIK C;  1R3J C;  2EIN C;  3OR6 C;  4LBE C;  2WLJ A;  3TET A;  4MTF A;  4MTG A;  4MW3 A;  4ZBM A;  3SYC A;  4MS2 A;  4PDL A;  4QE9 A;  1M56 C;  2WLK A;  3F5W C;  3OGC C;  3AG1 C;  4PDM A;  5EBM C;  4PDR A;  4XDL A;  5CBH A;  4LCU C;  3BEH A;  2HG5 C;  2IH1 C;  1LNQ A;  3F7Y C;  4MVO A;  4JTA B;  2WLI A;  3LDE A;  4HYO A;  1P7B A;  3LUT B;  3OUS A;  2WLN A;  4GX1 A;  3FB8 C;  3T2M A;  1R3K C;  3OUF A;  2R9R B;  4MVQ A;  2WLH A;  4OXS A;  4PDV A;  4TWK A;  3SPJ A;  2ZXW C;  3LDD A;  2YEV A;  1QLE C;  3K0G A;  3SJQ C;  2WLL A;  4QE7 A;  4PA4 A;  5CBF A;  1J95 A;  3SPI A;  4RO2 A;  2Q67 A;  4G28 B;  4MVM A;  5EC1 C;  3AG3 C;  4GX2 A;  1JVM A;  4CBC A;  1R3L C;  4MVU A;  4QNH B;  4X88 A;  2A79 B;  2Q69 A;  4PA3 A;  4R7C A;  1M57 C;  3FB5 C;  1V54 C;  3RVZ A;  3STZ C;  3T1C A;  3ZRS A;  5CBG A;  2Q6A A;  3K0D A;  4MVR A;  3E89 A;  4J9Y B;  3ASN C;  2Q68 A;  3JYC A;  3LNM B;  2EIL C;  3UKM A;  4XDJ A;  5B1B C;  2QKS A;  5EBL C;  2HFE C;  2A9H A;  4EKW A;  5J9P C;  2X6B A;  2K1E A;  1S5H C;  3KG2 A;  2DWD C;  2EIM C;  5EBW C;  3SPH A;  4RAI A;  4HZ3 A;  2X6C A;  3RW0 A;  3E8F A;  3SYA A;  5KUM A;  3E8B A;  3SYO A;  5EC2 C;  4WFG A;  3FB7 C;  4WFE A;  3E83 A;  2EIJ C;  3IGA C;  2DWE C;  4UUJ C;  2OCC C;  2DYR C;  3OR7 C;  4H33 A;  3STL C;  3E8G A;  3TCU A;  3T4D A;  5KUK A;  3E86 A;  2ZD9 A;  3HPL C;  5E1A C;  4J9Z B;  2A0L A;  4XDK A;  1BL8 A;  2P7T C;  2NLJ C;  2W0F C;  4MVZ A;  3RVY A;  4RUE A;  2ITC C;  4F4L A;  2ITD C;  4WFH A;  3ABK C;  3AG4 C;  4MSW C;  3F7V C;  2BOC C;  3LDC A;  4X89 A;  4JTD B;  1OCZ C;  1KKD A;  3SYQ A;  4LP8 A;  3K04 A;  3T4Z A;  2AHZ A;  1G4Y B;  4MTO A;  2HJF C;  3SPG A;  4PA6 A;  4WFF A;  4DXW A;  3AG2 C;  3SYP A;  1ZWI C;  1OCO C;  3EFF K;  4JTC B;  4R6Z A;  1OCR C;  3UM7 A;  3ZJZ A;  1K4D C;  5B3S C;  2JK5 C;  3VOU A;  4GX0 A;  4MW8 A;  2ATK C;  1OCC C;  2HVK C;  2Y69 C;  4G27 B;  3K08 A;  3K06 A;  3GB7 C;  3ABL C;  3FB6 C;  4X8A A;  3WG7 C;  5BZB A;  1V55 C;  4I9W A;  5EK0 A;  4R8C A;  3SPC A;  3ABM C;  3R65 A;  3IFX A;  3K03 A;  2BOB C;  4P9O A;  3RBZ A;  2DYS C;  5IY5 C;  4P30 A;  1R3I C;  3E8H A;  4MVS A;  2IH3 C;  2X6A A;  4PA9 A;  1ORQ C;  4P9P A;  4P2Z A;  3X2Q C;  2WLI B;  3ASO C;  2QTO A;  4KFM A;  1K4C C;  1XL4 A;  2KB1 A;  3PJS K;  2HVJ C;  2H8P C;  4H37 A;  2WLL B;  1XL6 A;  4GX5 A;  4RUF A;  2WLM A;  4PA7 A; 
#chains in the Genus database with same CATH topology
 1AP5 A;  4BW5 A;  1MG1 A;  3APQ A;  2Z0A A;  4GLX A;  4JAV A;  1Q81 W;  2Y48 A;  4I9Q A;  1Y74 B;  4DV4 B;  2LW7 A;  4GX1 A;  5EIB D;  5BMV B;  4KP4 A;  4U3F H;  1DLB A;  4IIJ A;  4X1I A;  4EB6 A;  3ZHT A;  1JVM A;  4X88 A;  3JAK B;  3RVZ A;  4BIZ A;  1TGO A;  5FLX N;  1ZSP A;  4FZ1 A;  4ABM A;  3AG3 B;  2VRZ A;  4G2K A;  4J41 A;  3CS5 A;  1XMO O;  3JAW A;  2VS0 A;  1VF6 A;  3LSQ A;  3ZMS A;  1FXH A;  2FL4 A;  3N2G B;  2AW9 A;  3GWK C;  3ETE A;  2PGG A;  1N34 B;  3UQ8 A;  1EM1 A;  4UCT A;  4LF7 B;  3OEE G;  4JI3 O;  5CMU A;  1THZ A;  3U11 A;  4XDK A;  1M4U A;  4O2B B;  2YIC A;  1GKF A;  2BOC C;  3QTC A;  3OTO B;  1W59 A;  3CCE V;  5J2U A;  1WN7 A;  3OMA B;  1EN6 A;  1KU9 A;  2Y69 C;  4B7E A;  1KB9 F;  2CTR A;  4O4H A;  5CB4 B;  1XNQ B;  2QR4 A;  1N33 B;  3N2K B;  1Y76 B;  2RN9 A;  2YXH A;  1WPB A;  1IXM A;  1F23 A;  4KFM A;  4DO2 A;  4CZZ A;  4FM2 A;  4Z1M G;  1XL4 A;  4YXW G;  2H94 A;  2KB1 A;  4ZI7 B;  3CXC U;  1MOF A;  3CCJ V;  1TA8 A;  2UXB O;  1N0N A;  1YJ9 V;  2E76 B;  2V7Q G;  4J42 A;  4ZBM A;  2AGA A;  1B3Q A;  1F4N A;  5B1A B;  3QF7 A;  1XI1 A;  3U0Z A;  1F51 A;  2GHY A;  2WLI A;  3CPW U;  3T1H B;  4O2A B;  1VQL V;  2Q7E A;  4D7T A;  2RMK B;  1QLE C;  1U96 A;  3K0G A;  2ZM6 B;  2IW5 A;  4L87 A;  1URF A;  3CSX A;  1FS0 G;  4CBC A;  1R3L C;  4JI4 B;  3ZRS A;  5FL7 G;  1PNL A;  2Q6A A;  3JAT B;  1KQS U;  1R1B A;  1Z2G A;  2E5L O;  1GM7 A;  3W7S A;  2VQE O;  3VQW A;  1K7D A;  3A0R A;  1YJN V;  3ASN B;  3K57 A;  4LF4 B;  4DR6 B;  2X6C A;  3G67 A;  4X64 O;  1LUV A;  2XHB A;  5KA6 A;  1S3J A;  2V1D A;  4NVP A;  1G8M A;  3TCU A;  4NB5 A;  1D2D A;  3EXA A;  1NTK H;  1JR9 A;  3W7W A;  2QTS A;  1N36 O;  4CC6 A;  4B3T O;  1VQ6 V;  3JD1 A;  3ABK B;  1S76 D;  3ZJZ A;  4PI0 A;  3CRR A;  3W7T A;  2RJZ A;  4RWU A;  2QDO A;  3ABL C;  4LFB B;  1YJW V;  2JVD A;  3H9V A;  2LFS A;  3CEI A;  3B2E E;  2QKC A;  4A5U B;  2CH7 A;  2F4V O;  3JAS A;  5EIB C;  1ORQ C;  1YCI A;  4UCS A;  3NXS A;  3RYH A;  3VBB A;  5LP6 C;  5C93 A;  3HKD A;  3H01 A;  4C7U A;  1BQZ A;  3DC6 A;  1SKV A;  4FLZ A;  5LYJ B;  2PTM A;  2BSK B;  1BGY H;  2IJI A;  3SYC A;  2EZO A;  2Q4P A;  1RSO A;  3OGI B;  2P90 A;  2Y69 B;  2WWW A;  4HNA B;  1RPO A;  1SQG A;  1YHQ V;  2HP8 A;  4YJ2 B;  3ETD A;  2LJ2 A;  1NTM H;  2IJH A;  1IBM O;  1Y67 A;  4J80 A;  3K58 A;  4G28 B;  5J2T B;  4O4J A;  3U10 A;  5LMU B;  2A79 B;  1AJQ A;  1ZTE A;  1V54 C;  3QO5 A;  4FFK A;  1JFF B;  4MVR A;  3ZHR A;  2EIL C;  3OFN G;  5L3C A;  3SR2 C;  2EIM C;  3OD4 A;  2P5O A;  2UXD B;  4ZOL B;  3BCC H;  4DUZ B;  4UFZ A;  2Q9L A;  2QSA A;  1ZLZ A;  2IJK A;  1M1K W;  3G80 A;  2LO1 A;  3CX5 F;  2ZE6 A;  1QLE B;  2BTQ A;  1BSM A;  4LNU B;  2ODM A;  2B9Z A;  5FPO A;  2GUZ B;  1AI5 A;  3I5D A;  3AG4 C;  4MSW C;  2EX3 A;  1NKD A;  2L6L A;  3T4Z A;  5IJ0 A;  1J5E B;  1KC8 W;  3ZMZ A;  4O4L B;  3RYC B;  1LUW A;  3M7M X;  1GM8 A;  4MW8 A;  2HVK C;  4DV4 O;  1OV9 A;  2YUA A;  4ICG A;  3RFR A;  2FTK A;  1Q8I A;  3JCU Z;  1Q6U A;  1ZL8 B;  1ZX3 A;  1SQP H;  2QTO A;  2YID A;  1K73 W;  2GV9 A;  4OPH A;  5IY5 B;  1WA8 B;  3PJS K;  3H1H H;  4TOI A;  1XL6 A;  2WLM A;  3JAR A;  4KHP B;  1SQX H;  4DR7 B;  3DXR A;  1XMQ O;  2ZIM A;  1R6K A;  4LF6 O;  1N34 O;  3IC7 A;  2XAQ A;  1AR5 A;  2EIN B;  1LNQ A;  1BHB A;  3L75 H;  1YIJ V;  2DQ3 A;  3GVM A;  4JTA B;  2WLN A;  1MSD A;  4OXS A;  3ZMU A;  2WLH A;  3E35 A;  4O4I A;  4EEQ A;  3AK3 A;  3ZBH A;  2ZDI A;  4MT8 A;  1J95 A;  4TUY B;  4RO2 A;  5JCO C;  2P4K A;  2JGD B;  3AG7 A;  1SC5 B;  3OTO O;  4H13 B;  1RFY A;  2ARH A;  3L9D A;  5IYB O;  1DF5 A;  5LP6 B;  3K5M A;  4LF5 B;  3B8M A;  3CJH B;  4J7J A;  5IJ9 B;  3ABU A;  4GCZ A;  4YIO A;  4X65 B;  4XDJ A;  4K8Z A;  3OMI B;  4JI8 O;  2HFE C;  4IHJ A;  4RQE A;  2X6B A;  1XNQ O;  3ZMT A;  1N33 O;  1P49 A;  4Q6G A;  5KUM A;  2DOS A;  4LFC O;  2B1G A;  1MMM A;  1D5N A;  3JCZ A;  3PN1 A;  1JCH A;  1UFI A;  3G71 V;  3STL C;  3E8G A;  4I50 A;  3E86 A;  4AHC A;  3RVY A;  1V54 B;  5KHK A;  3CC7 V;  1H2M A;  1QR8 A;  2XAH A;  2FML A;  2JIZ G;  1GN3 A;  2QJ1 A;  3BA8 A;  2A06 H;  1OCO C;  3EFF K;  5EZY A;  4DV2 B;  1BE3 H;  4G27 B;  1NS1 A;  3T1H O;  2PYL A;  3RBZ A;  5A2Q N;  2ZM6 O;  3W7X A;  4FLW A;  2X6A A;  5K1P A;  3X2Q C;  4BR6 A;  2XOK G;  2JRI A;  5H9C A;  1VQP V;  3CWB H;  3ZRW B;  1FXK C;  1GN2 A;  2OCH A;  3IJ4 A;  3QNE A;  4I0X A;  1VQ7 V;  1EN5 A;  5B1O A;  3ZHQ A;  4LF4 O;  3A8T A;  2ZR3 A;  4MW3 A;  4JI5 B;  4PDL A;  3QO7 A;  4PJ0 Z;  4PDR A;  1IXB A;  2EIK B;  4LCU C;  2OT5 A;  1B06 A;  5FNV A;  3MHH C;  1HW7 A;  2ZT9 B;  4FM1 A;  2Q7G A;  1Q3E A;  4UB6 Z;  4CS3 A;  3SJC C;  3AG3 C;  5L3B A;  3P3N A;  3STZ C;  3T1C A;  3LNN A;  2JS3 A;  3ZN1 A;  2NN4 A;  2RCV A;  3A0B Z;  1B6Q A;  2W0X A;  4FMT A;  4LFB O;  4GKJ O;  4RAI A;  1TVK A;  3E8F A;  2K9P A;  4JI1 O;  3UO3 A;  5KAF Z;  1Z5W A;  1K92 A;  1AVM A;  4YY3 B;  4OGQ B;  4TQF A;  1K5Q A;  2HEP A;  1BHA A;  4X1Y B;  5LHI A;  1M93 A;  3RYF A;  4PD4 F;  5KMG B;  4JV5 B;  2JK5 C;  2QEX V;  2CDY A;  2IU3 A;  4DV6 B;  1SS3 A;  4IGG A;  5BZB A;  3ZHV A;  5IE9 A;  3HKB B;  4MVS A;  1K33 A;  3FX7 A;  5LMU O;  1YSC A;  4NXN O;  3ABM B;  4DYL A;  1BT8 A;  4H37 A;  4UV9 A;  4IIJ B;  4X1I B;  4TQD A;  4WFH A;  5B1A C;  2YXL A;  2UXD O;  3P30 A;  5LGT A;  4WCE V;  2Y4U A;  3JAW B;  1XNR B;  2JS5 A;  3E22 A;  1M56 B;  1I7F A;  4MVO A;  1P7B A;  4FFB A;  1S72 V;  4TV9 A;  3THO A;  5IYD O;  5CBF A;  3TGU H;  3SPI A;  2W6I G;  1US6 A;  1Q5O A;  5K1X A;  5IYZ A;  1J5E O;  1FXK B;  3CRC A;  4DR2 B;  3E89 A;  4KL1 A;  3SDL A;  3ASN C;  4LFA O;  3JYC A;  4LF8 B;  3CCR V;  3SGI A;  2N04 A;  3ZRX A;  4BAY A;  3K59 A;  2UUB B;  5J9P C;  5J2U B;  3FAV A;  1BZK A;  1IBL B;  4HAM A;  1GO3 F;  2YXY A;  5BR8 O;  1ZUQ A;  1SA0 A;  3J80 N;  4UVC A;  4WFB V;  5C8Y A;  4O4H B;  1K9M W;  4DR1 O;  2UU9 O;  3HPL C;  1H2S B;  4UB8 Z;  4KHP O;  3LSS A;  2W0F C;  1WPX A;  5CA0 A;  1FD9 A;  1F4M A;  4IT5 A;  3ABK C;  3F7V C;  2QWO B;  4IL6 Z;  2M7W A;  2CTP A;  4AIL C;  1RP3 B;  5LMN O;  4MTO A;  4DXW A;  2E75 B;  1VQ8 V;  3KKY A;  2F66 C;  1FFX A;  2DE0 X;  1I94 B;  1I5X A;  2MW2 B;  2E74 B;  1HNW B;  3IFX A;  1OCC B;  1HDJ A;  4BIU A;  1K5S A;  2OWO A;  4JAA A;  1I0H A;  2WLI B;  1K3E A;  4QPJ A;  2OYQ A;  1DTO A;  2P67 A;  3ICX A;  2YDE A;  4FZ0 A;  2FKX A;  4XBF A;  1H8E G;  2WLJ A;  2PF4 E;  2WLK A;  3F5W C;  5B1N A;  4JYA B;  4DR5 O;  2LGW A;  4DV0 B;  2KG7 A;  1Y74 A;  4N23 A;  3RW0 A;  2ADP A;  3Q4H A;  4PDV A;  5KHG A;  1IUR A;  3L74 H;  1IBK B;  2YEV B;  3FD9 A;  2WLL A;  4QE7 A;  2DMX A;  4EFE A;  3RT3 C;  2O57 A;  2KKW A;  2KQX A;  5ITZ A;  2RNB A;  1WLE A;  4HBN A;  2XAS A;  2XUM A;  1H2K A;  3EHB B;  3A0H Z;  1H38 A;  3LNM B;  4DV2 O;  2MK3 A;  1QVF U;  4EKW A;  4IYH A;  1GAX A;  5LHH A;  1S5H C;  1FYJ A;  2DWD C;  4QIW F;  2HJD A;  4X62 B;  4FIP C;  2A3Q A;  4WFG A;  1WB8 A;  4UUJ C;  1GH6 A;  1JJ2 U;  4X20 A;  3ZRV A;  2HKO A;  2A0L A;  1BL8 A;  4DUY O;  2CH7 B;  3JAS B;  1I5Y A;  3RYH B;  1Q90 D;  4JI5 O;  1D5A A;  1XQ8 A;  1G4Y B;  3D36 A;  3OEH G;  4JZ2 A;  2UUC B;  3HKD B;  1ZWI C;  3IC9 A;  2X0L A;  1VIB A;  2X7R B;  1WP8 A;  3K06 A;  1T5E A;  5CB4 A;  4N21 A;  1RSO B;  4DRX A;  5LGU A;  4ZHQ A;  5IY5 C;  1EZV H;  2D3O W;  4B3S B;  1SES A;  1S5L Z;  4P2Z A;  4CH6 A;  1R6N A;  3GWO A;  3NR7 A;  1L1F A;  3DTU B;  4K8X A;  2DJV A;  3BHP A;  3JAL A;  4K0K B;  3ASO B;  2GDS A;  1NI8 A;  4O4J B;  1AJN A;  2BCC H;  2AHY A;  4MTX A;  2F93 B;  2EIN C;  5A9G A;  1N0J A;  3VQY A;  1GK9 A;  2UXN A;  1XRE A;  2LGQ A;  4YHH O;  1R6T A;  2GSM B;  1VQ9 V;  4CH3 A;  1K8A W;  4OX9 O;  3JD0 A;  4NKG B;  4JI0 O;  3T2M A;  4YY3 O;  1PPJ H;  3L72 H;  4YJ3 A;  4RQF A;  4GZR B;  2ILM A;  4PA4 A;  2Y4T A;  3CCM V;  3CP1 A;  4MVU A;  3ZHU A;  4FLX A;  3ZHS A;  1ARO P;  3K0D A;  2AZ0 A;  3ZX6 A;  1K34 A;  2VWK A;  5IJ0 B;  3CXH F;  4JYC A;  5LOV A;  1VEW A;  3TK1 A;  1XHX A;  1Y4M A;  2EJ7 A;  2PZS A;  4PV1 B;  2YSU B;  1JA8 A;  5H5N A;  4JAU A;  5L3G A;  1BCC H;  2Y0P A;  4DV3 B;  1IVS A;  4DV1 B;  1X59 A;  4MVZ A;  5KAI Z;  2QKA A;  2P06 A;  1W0J G;  4JTD B;  2OIE A;  4TV8 A;  3W7U A;  3ZMV A;  3DSQ A;  1JPX A;  5JVD A;  3CRM A;  5JQG B;  5B66 Z;  5BXZ A;  4E4E A;  3JAR B;  1OCZ B;  3DXR B;  5B5E Z;  2ATK C;  1QBZ A;  1XDC A;  4LR3 A;  4U3J A;  3T1Y B;  3N27 A;  2BOB C;  4P9O A;  2XT9 A;  2NNU A;  2V4D A;  4J10 A;  3E8H A;  3WG7 B;  3B77 A;  1PP9 H;  4PA9 A;  4DW1 A;  1OJH A;  1S0V A;  1BMF G;  4J7Z A;  2BE3 A;  2DYS B;  5JJN B;  2G38 A;  3KCY A;  4O4I B;  4LF8 O;  3D3I A;  1WB7 A;  1YEW A;  3OE7 G;  2UUB O;  1HR0 B;  2CTQ A;  3F5T A;  2EIK C;  2N05 A;  2BSK A;  3HB3 B;  4MS2 A;  4I7Z B;  3OGC C;  4B7K A;  1FJG B;  2QWN B;  4XDL A;  2WPD G;  5LA6 A;  1E79 G;  2LFR A;  4FLY A;  3BPZ A;  4DR3 B;  2R9R B;  2DW4 A;  2VQF B;  1MZF A;  5HFM A;  2XAF A;  5CBG A;  4I50 B;  1G6U A;  3H1I H;  2AZ2 A;  4J9Y B;  2Q68 A;  3CCS V;  1LR1 A;  4LF7 O;  5B1B C;  1I94 O;  1N4C A;  1PNM A;  5EBL C;  4JYB A;  1GTO A;  1HNW O;  4F6E A;  2A7W A;  4X1K A;  2EZP A;  1RPR A;  3K3W A;  1KEC A;  5EZY B;  1ZAU A;  3KZI Z;  1O9H A;  2Z3Y A;  1M5I A;  3E83 A;  1NZ6 A;  1Q86 W;  3T4D A;  2NLJ C;  3OW2 U;  2OCC B;  2ITD C;  1Q7Y W;  1B04 A;  3LDC A;  1COW G;  4NTY A;  1VF5 B;  4JYA O;  5KX5 A;  1Q6H A;  1HNX B;  1OHH G;  3SJB C;  4I0X B;  1QNM A;  3FB6 C;  1OCR B;  3HKC A;  1AI4 A;  3ABM C;  3WB2 A;  4NTX A;  4UCR A;  1SER A;  3ZN0 A;  1FAF A;  3BAB A;  2PI4 A;  3C3S A;  5FNV B;  1K4C C;  3FYI B;  1AR4 A;  1EN4 A;  4FVM A;  3RGB A;  2HR3 A;  4PA7 A;  2LQT A;  4R50 A;  4F6R B;  2HLD G;  1R3J C;  3OR6 C;  1O9G A;  3OM3 B;  4MTF A;  4JF3 A;  1VF6 C;  4X62 O;  1M56 C;  4PDM A;  1AR1 B;  3S3X A;  1AB3 A;  2CAZ C;  2F23 A;  4JI4 O;  1CEZ A;  3LDE A;  1H2G A;  1MNG A;  1TVK B;  2F43 G;  4CS2 A;  1CPY A;  2Q67 A;  4NR1 A;  4LC1 A;  1IDS A;  1NT2 B;  4YIP A;  3B09 A;  5KHJ A;  4R7C A;  1VQK V;  2ZCE A;  5LP6 A;  4JZG A;  4DR6 O;  2UUC O;  5LXT A;  3FYE B;  2QWP B;  1QU7 A;  4DW0 A;  2YIB A;  3RYF B;  2K1E A;  3OMN B;  5EBW C;  3RYI A;  1WNS A;  5JWP A;  3CC2 V;  3SYA A;  4UCU A;  4JI2 B;  4B3S O;  2JDI G;  2E5L B;  1L0L H;  4JI6 B;  2E3C A;  2JGU A;  2ZE7 A;  4D6T H;  1IX9 A;  4K0K O;  4UVA A;  5E79 Z;  4I4T A;  1FXV A;  3C90 A;  2Q8V A;  1GMG A;  2P6J A;  2WA4 A;  4DR4 B;  3ZS8 C;  4GUN A;  4X89 A;  4BW9 A;  4FM0 A;  1TUE B;  1QVG U;  4WFF A;  4EFB A;  5B1B B;  1XEQ A;  3FKS G;  1EFR G;  1OCC C;  1L8D A;  4DK1 A;  2W6J G;  1JJO A;  3K08 A;  4AQY B;  4X8A A;  5JH7 A;  4D7S A;  1EZJ A;  2QM4 A;  3HR0 A;  3OT7 A;  1VMG A;  3E22 B;  1X4T A;  1AI6 A;  1PL4 A;  4TV9 B;  5KHI A;  3ZCC A;  4WBN A;  1XOU A;  1M9N A;  2F4V B;  2CTW A;  1SZT A;  1PM9 A;  4LH7 A;  3D8C A;  1QR9 A;  1N8R W;  4U7N A;  1G1X B;  4JGS A;  1WJZ A;  2OTJ V;  4Z1V A;  4JPR A;  1NH2 D;  2LP7 A;  2QM8 A;  3O9O A;  3LUT B;  3FAV B;  4IYI A;  3QG5 A;  4TWK A;  3TJT A;  1QQC A;  2WSS G;  3A2F A;  4DV1 O;  2ZIN A;  5CA1 A;  4EB6 B;  1Q82 W;  1SA0 B;  2F95 B;  1YI2 V;  3SJA C;  3CE2 A;  5AG2 A;  5F2V O;  4X66 B;  3HKE A;  2B5U A;  4DUZ O;  1NR1 A;  5IWA B;  1QCE A;  3ZIA G;  1VAR A;  1TUB A;  3T1Y O;  1RM1 B;  5D5Q A;  5DM6 V;  3I56 V;  1DK1 A;  3BFR A;  2IM9 A;  4I55 A;  4LWS A;  1I08 A;  1SQF A;  5EC2 C;  1FFX B;  4AI8 A;  1L0N H;  1YIT V;  1MA1 A;  4QJF B;  3WU2 Z;  1NVP D;  5JCO A;  2EIJ B;  4F4L A;  2WA3 A;  3SPG A;  1FJG O;  2GTS A;  4R6Z A;  3UM7 A;  1AI7 A;  1K4D C;  4FJC C;  4E2L A;  3RN4 A;  1CP9 A;  1R73 A;  4DR3 O;  3S3W A;  3AG2 B;  5JJE B;  3K5L A;  1E1Q G;  5B3S B;  5EK0 A;  5EYP A;  2AXT Z;  4R8C A;  2ETN A;  2VQF O;  3K03 A;  3HKB A;  4DR7 O;  2KG7 B;  4J7K A;  2QGN A;  1GM9 A;  2R70 A;  3CRA A;  1VQO V;  2VWJ A;  3ASO C;  2C2A A;  3Q4H B;  2CE4 A;  1Q6I A;  2WLL B;  3EVK A;  2M6Y A;  4FLU A;  5ITZ B;  2OTL V;  1WP7 A;  3UT5 A;  2P22 C;  3K9A A;  1QHT A;  4LF9 B;  3CCU V;  4QE9 A;  1MAB G;  2Z5U A;  5GON A;  2YIB D;  2ZR2 A;  3QVN A;  1XMQ B;  4KXR A;  1WAZ A;  3AG1 B;  4LF5 O;  4NTW A;  4LF6 B;  1P4R A;  1P7G A;  4MVQ A;  4B3M B;  3B40 A;  3K79 A;  2KSD A;  2PI5 A;  4X65 O;  3CC4 V;  4GX2 A;  4UCV A;  4QNH B;  2Q69 A;  4PA3 A;  2CK3 G;  4X20 B;  3IAY A;  1FXK A;  1HNX O;  1W2B U;  2IBZ H;  3TXS A;  5DED A;  2F1M A;  2QM7 A;  2QE7 G;  3SPH A;  5BMV A;  2PUS A;  2ZE8 A;  3FFQ A;  1JQ0 A;  3E8B A;  1BQ0 A;  4DV5 B;  4WFE A;  4JI8 B;  1KBH A;  3JSN A;  3JAK A;  2UUA B;  4DRX B;  4ZHQ B;  3KCX A;  1PD3 A;  2P7T C;  2DYR B;  4LFC B;  4FK5 C;  2DQ0 A;  3MDS A;  2RQ6 A;  1OCZ C;  3B8N A;  3N2G A;  1SET A;  2CUG A;  2PY5 A;  3JAL B;  4JI7 B;  1NTZ H;  2P4V A;  3AEI A;  3JAM N;  3CMA V;  3WG7 C;  2GTA A;  2DYS C;  2HHH B;  3CHX A;  1XHZ A;  4O2B A;  3CB2 A;  1OZ0 A;  2ZDI C;  1AJP A;  1YZB A;  3OAA G;  2Q7H A;  5CN0 A;  5GTI Z;  4YJ3 B;  5HFL A;  2OIG A;  1VQ5 V;  1V9P A;  1K97 A;  5H6R A;  3UCS C;  4JI2 O;  3N2K A;  1AIL A;  1Y76 A;  4GT1 A;  1SRY A;  3OTF A;  2HG5 C;  2IH1 C;  1YVW A;  4JI6 O;  4DK0 A;  4HYO A;  3FB8 C;  5LOV B;  5TIS Z;  4ZI7 A;  2YEV A;  4DR4 O;  4DV7 B;  4B3R B;  3J7A U;  1SZX A;  1FPO A;  1F7Y A;  1YTF D;  1ENV A;  5KA5 A;  3UKM A;  3K5O A;  4AQY O;  3RWR D;  2A9H A;  2ZIO A;  4TV8 B;  3KG2 A;  5JVD B;  4JAS A;  4OPA A;  4O2A A;  4NXM B;  3SYO A;  3IGA C;  2OCC C;  4U3J B;  3WB0 A;  3CCL V;  3D3Q A;  5LHG A;  2YIA A;  4UXN A;  4JV5 O;  3TXQ A;  1M90 W;  4GKJ B;  4QPK A;  2BTQ B;  4FPP A;  5E1A C;  2PYJ A;  4J9Z B;  2D2C B;  3G6B A;  1VQM V;  3JAT A;  2ZKO A;  1GN6 A;  1H2L A;  4RUE A;  4JI1 B;  4GYC B;  1KMI Z;  4DV6 O;  1HNZ B;  1KUQ A;  3K9S A;  3JD3 A;  2B1I A;  2AHZ A;  2HJF C;  1TAE A;  1OCR C;  3MD0 A;  3QO8 A;  1NR7 A;  1Y66 A;  5IDJ A;  2JEU A;  1UPG A;  1R3I C;  5LA6 B;  2CGN A;  2EBO A;  1SQB H;  1PV0 A;  4X66 O;  4CS4 A;  1BS3 A;  4X9Q A;  5IWA O;  2NR5 A;  5GW7 A;  1XNR O;  4H0L B;  4PI2 A;  4GKK B;  4NXN B;  4LBE C;  3TET A;  1YDX A;  4MTG A;  2Q0O C;  1NBM G;  3CCQ V;  1GN4 A;  2UXC B;  3C3T A;  4BWA A;  4X1K B;  5BY1 A;  3L73 H;  1NH2 B;  4DR2 O;  3OUF A;  4BIO A;  3SPJ A;  3BA9 A;  5IYC O;  4KUM A;  5L3D A;  3MAQ A;  2QWQ B;  4K3A A;  1M57 C;  2BTO A;  2ZNJ A;  5LYJ A;  1E1R G;  1IBL O;  5GTH Z;  2R72 A;  1KP3 A;  1NJI W;  3H1L H;  4HNA A;  2QKS A;  3JD4 A;  4IHJ B;  1N32 B;  4YJ2 A;  1P84 F;  2FYU H;  4H44 B;  2YI8 A;  5KX5 B;  2JJ2 G;  3G6E V;  4LFA B;  3ETG A;  3L70 H;  5J2T A;  2Q0A A;  3FB7 C;  4H33 A;  2YC0 A;  3OR7 C;  5KUK A;  1UJW B;  1MSW D;  3HKC B;  2QWR B;  5LGN A;  1JFF A;  2RDC A;  4B08 A;  1NVP B;  5LL6 Y;  2ITC C;  5BR8 B;  1VF7 A;  4CC5 A;  4U7O A;  1KKD A;  3SYQ A;  4LF9 O;  3H1J H;  2XND G;  4DR1 B;  2UU9 B;  1ROP A;  4ZOL A;  5JQG A;  3UO2 A;  1Y6X A;  4CH5 A;  3ML0 A;  1SF9 A;  1XMO B;  2R9A A;  4B3M O;  4K35 A;  1V55 C;  4I9W A;  5H2F Z;  1HWY A;  5LMN B;  2IU0 A;  3R65 A;  2DN9 A;  4LNU A;  4FLV A;  3ABL B;  2IH3 C;  2GUZ A;  4P9P A;  4JI3 B;  5KHH A;  1KYO F;  4UV8 A;  4PHZ A;  4GX5 A;  1MZE A;  4O4L A;  3RYC A;  4DV0 O;  3DGE A;  1HP8 A;  4W4K A;  4PEL A;  2XTA A;  4NYK A;  5LXT B;  5EBM C;  1IBK O;  1YXB A;  4DV5 O;  3J81 N;  1PKX A;  3BEH A;  5CA3 A;  1ZL8 A;  3F7Y C;  2H3O A;  2UUA O;  1DGS A;  3RYI B;  1R3K C;  1VP7 A;  1WA8 A;  3BAA A;  5DN6 G;  2GBO A;  2ZXW C;  3LDD A;  4DR5 B;  2FB5 A;  3M8A A;  4LH6 A;  4TSF G;  3G4S V;  3FB5 C;  1PNK A;  4JI7 O;  3WB1 A;  3ZED A;  4I4T B;  5KLV H;  1RM1 C;  1GRJ A;  3H1K H;  2L35 A;  4I5S A;  2ADQ B;  2JJ1 G;  2UXB B;  2LW1 A;  4UVB A;  5LBQ A;  3DC5 A;  2EIL B;  2HHH O;  3P3P A;  4TUY A;  2EIM B;  2JGD A;  3VQX A;  3K5N A;  2EIJ C;  2DWE C;  5DEC A;  5JH7 B;  1U97 A;  5H6Q A;  3CJH A;  5IJ9 A;  1H2N A;  3JSL A;  1YF2 A;  1M57 B;  2YI9 A;  4FLT A;  3CRQ A;  3K04 A;  2XAG A;  1VQN V;  4TT3 G;  3CD6 V;  3AG2 C;  2ZE5 A;  3AG4 B;  3SYP A;  4JTC B;  4WBN B;  4ZIB A;  4Q20 A;  3ABT A;  5B3S C;  4DUY B;  4GX0 A;  4WFA V;  2VQE B;  5IT9 N;  4DV7 O;  5JJJ B;  4B3R O;  4P30 A;  3AK2 A;  4X64 B;  1KD1 W;  1S77 D;  2WAM A;  1IZ3 A;  4JYY A;  1NU1 H;  3I55 V;  1H8H G;  2HVJ C;  2H8P C;  3CYO A;  1A32 A;  5CA1 B;  1NQT A;  4Z2W A;  1SQQ H;  4F6R A;  1SQV H;  1EBO A;  3ETQ A;  5L3F A;  1VQ4 V;  3HKE B;  4NXM O;  1CXZ B;  1JMK C;  1N36 B;  2ZQM A;  3AG1 C;  4B3T B;  5CBH A;  3VQV A;  3LSU A;  1TUB B;  1V55 B;  4QGP A;  3JD2 A;  3OUS A;  4W4L A;  1DF4 A;  4FFB B;  3CCV V;  2UXX A;  3ZRW A;  3P32 A;  3SJQ C;  5D5P A;  4I55 B;  2N74 A;  4LWS B;  1AP6 A;  3BRC A;  3B4S A;  4MVM A;  1HNZ O;  5EC1 C;  4YHH B;  1QLN A;  5IYZ B;  2YS8 A;  4OX9 B;  4JI0 B;  1XUQ A;  2JEX A;  3L71 H;  1Z5V A;  1FKA O;  3O65 A;  3D36 C;  3WFV A;  1YTF B;  1JOY A;  4DV3 O;  4HZ3 A;  2EUL A;  2ZNI A;  3APO A;  1W0K G;  2EJR A;  3MHS C;  2Y0I A;  2DYR C;  2QA4 V;  1Q43 A;  2ZXW B;  5EYP B;  5C8Y B;  2ZD9 A;  2CGO A;  3BVO A;  5CA0 B;  1IBM B;  1KP2 A;  1S5J A;  4GKK O;  4J11 A;  4LP8 A;  1JX9 A;  1FFT B;  2Q5Z A;  3E2E A;  4PA6 A;  3BY6 A;  3R66 A;  4L8J A;  2UXC O;  3VOU A;  2IJJ A;  1XBL A;  3GB7 C;  3UT5 B;  1KKC A;  1OCO B;  3AK1 A;  3SPC A;  2Q73 A;  5GON B;  2R9I A;  5FPR A;  4WF9 V;  4ASU G;  1HR0 O;  3CME V;  4ZKI A;  2XAJ A;  4X1Y A;  3M99 B;  4CH4 A;  5KMG A;  5L3E A;  3X2Q B;  4RUF A;  4UCO A;  1XIL A;  1PL0 A;  1N32 O; 
#chains in the Genus database with same CATH homology
 5B1O A;  4BW5 A;  1K97 A;  2EIK C;  1MG1 A;  5H6R A;  2ZR3 A;  3HB3 B;  4MW3 A;  4MS2 A;  4PDL A;  3OGC C;  3QO7 A;  4PDR A;  4XDL A;  4JAV A;  2EIK B;  2WPD G;  4GT1 A;  1SRY A;  4LCU C;  1Q81 W;  2HG5 C;  1E79 G;  2IH1 C;  2LFR A;  2Y48 A;  2OT5 A;  4HYO A;  4GX1 A;  3FB8 C;  3MHH C;  2R9R B;  2DW4 A;  4KP4 A;  2YEV A;  1DLB A;  5HFM A;  3AG3 C;  1JVM A;  5L3B A;  4X88 A;  2XAF A;  3STZ C;  3RVZ A;  5CBG A;  3T1C A;  4BIZ A;  3ZN1 A;  1YTF D;  3AG3 B;  4J9Y B;  2Q68 A;  4G2K A;  3CCS V;  1ENV A;  5KA5 A;  3UKM A;  5B1B C;  1PNM A;  5EBL C;  4JYB A;  1GTO A;  2A9H A;  3LSQ A;  3ZMS A;  1FXH A;  1B6Q A;  4FMT A;  3KG2 A;  2EZP A;  4RAI A;  1RPR A;  3ETE A;  1KEC A;  3K3W A;  4JAS A;  3E8F A;  3SYO A;  3OEE G;  2Z3Y A;  3E83 A;  3IGA C;  5CMU A;  2OCC C;  1Q86 W;  1THZ A;  3CCL V;  1K92 A;  3T4D A;  5LHG A;  4UXN A;  1M90 W;  4QPK A;  4FPP A;  5E1A C;  1K5Q A;  4J9Z B;  4XDK A;  1VQM V;  2NLJ C;  3OW2 U;  2OCC B;  4RUE A;  1BHA A;  2ITD C;  1Q7Y W;  1GKF A;  2BOC C;  3LDC A;  5LHI A;  1COW G;  3OE7 G;  3JD3 A;  3CCE V;  2B1I A;  2AHZ A;  2HJF C;  1OHH G;  3OMA B;  1OCR C;  2JK5 C;  2QEX V;  3MD0 A;  3QO8 A;  1NR7 A;  2IU3 A;  1Y66 A;  2Y69 C;  3FB6 C;  5IDJ A;  5BZB A;  1OCR B;  2JEU A;  1AI4 A;  3ABM C;  1R3I C;  1SER A;  1IXM A;  2EBO A;  1K33 A;  4MVS A;  3ZN0 A;  2PI4 A;  1F23 A;  1YSC A;  4KFM A;  3ABM B;  4DO2 A;  4CZZ A;  1K4C C;  3FYI B;  4Z1M G;  1XL4 A;  4YXW G;  2H94 A;  2KB1 A;  3CXC U;  1MOF A;  4H37 A;  3CCJ V;  4UV9 A;  2HR3 A;  4PA7 A;  4WFH A;  5B1A C;  5GW7 A;  4R50 A;  2HLD G;  1YJ9 V;  1R3J C;  3OR6 C;  4LBE C;  3OM3 B;  2V7Q G;  3TET A;  4MTF A;  4MTG A;  4JF3 A;  4ZBM A;  3P30 A;  1M56 C;  4PDM A;  1F4N A;  1AR1 B;  5B1A B;  1NBM G;  5LGT A;  3CCQ V;  4WCE V;  1M56 B;  4MVO A;  1F51 A;  2GHY A;  2WLI A;  3LDE A;  1P7B A;  1CEZ A;  1H2G A;  1NH2 B;  1S72 V;  3CPW U;  3OUF A;  5IYD O;  2F43 G;  3SPJ A;  1VQL V;  1CPY A;  5IYC O;  1QLE C;  3K0G A;  5CBF A;  2IW5 A;  4L87 A;  3SPI A;  2Q67 A;  2W6I G;  1FS0 G;  4LC1 A;  4KUM A;  5L3D A;  4CBC A;  1R3L C;  4R7C A;  1M57 C;  1VQK V;  3ZRS A;  1FXK B;  5FL7 G;  1PNL A;  1E1R G;  2Q6A A;  3E89 A;  3ASN C;  1KQS U;  3FYE B;  3JYC A;  1KP3 A;  3CCR V;  1NJI W;  1GM7 A;  2QKS A;  3W7S A;  3ZRX A;  4BAY A;  1K7D A;  3JD4 A;  3A0R A;  5J9P C;  1YJN V;  2K1E A;  3ASN B;  3OMN B;  5EBW C;  2JJ2 G;  2X6C A;  4HAM A;  3G6E V;  1GO3 F;  3CC2 V;  3SYA A;  2JDI G;  3ETG A;  3FB7 C;  5KA6 A;  1S3J A;  2V1D A;  4UVC A;  4H33 A;  3OR7 C;  1G8M A;  3TCU A;  5KUK A;  1UJW B;  4WFB V;  1K9M W;  1MSW D;  5LGN A;  3HPL C;  4UVA A;  3LSS A;  1FXV A;  2W0F C;  1WPX A;  3W7W A;  1NVP B;  1GMG A;  2P6J A;  2ITC C;  1F4M A;  3ABK C;  3F7V C;  4U7O A;  4X89 A;  2M7W A;  1KKD A;  3SYQ A;  1TUE B;  2XND G;  1ROP A;  1QVG U;  4MTO A;  1VQ6 V;  3JD1 A;  4WFF A;  4DXW A;  5B1B B;  3ABK B;  1S76 D;  1VQ8 V;  3ZJZ A;  3ML0 A;  3FKS G;  1EFR G;  3W7T A;  1OCC C;  2W6J G;  3K08 A;  1I5X A;  3ABL C;  4X8A A;  1V55 C;  4I9W A;  1YJW V;  1HWY A;  2LFS A;  3R65 A;  3IFX A;  1EZJ A;  2IU0 A;  1OCC B;  4BIU A;  1K5S A;  3ABL B;  2IH3 C;  1ORQ C;  4P9P A;  2WLI B;  1K3E A;  3NXS A;  4QPJ A;  3VBB A;  1AI6 A;  1DTO A;  4UV8 A;  3ZCC A;  2P67 A;  4GX5 A;  5C93 A;  3H01 A;  1M9N A;  3DGE A;  1SZT A;  4PEL A;  4XBF A;  1H8E G;  1QR9 A;  1N8R W;  2WLJ A;  2IJI A;  3SYC A;  4U7N A;  2EZO A;  2WLK A;  3F5W C;  5EBM C;  5B1N A;  4JGS A;  2P90 A;  2Y69 B;  2WWW A;  1PKX A;  1RPO A;  3BEH A;  2OTJ V;  5CA3 A;  1YHQ V;  4JPR A;  1NH2 D;  2LP7 A;  2QM8 A;  3F7Y C;  3ETD A;  4N23 A;  3RW0 A;  3LUT B;  1R3K C;  4PDV A;  4TWK A;  5DN6 G;  2WSS G;  2ZXW C;  3LDD A;  2IJH A;  2YEV B;  2WLL A;  4QE7 A;  4G28 B;  1Q82 W;  4TSF G;  3G4S V;  1YI2 V;  2A79 B;  1AJQ A;  1WLE A;  3FB5 C;  1V54 C;  2XAS A;  1PNK A;  3QO5 A;  2B5U A;  3EHB B;  4MVR A;  1NR1 A;  1H38 A;  3LNM B;  1RM1 C;  1QCE A;  2EIL C;  3OFN G;  2JJ1 G;  2MK3 A;  4I5S A;  3ZIA G;  5L3C A;  1QVF U;  4EKW A;  4UVB A;  5LHH A;  1S5H C;  5LBQ A;  1RM1 B;  2DWD C;  2EIM C;  4QIW F;  5DM6 V;  2EIL B;  3I56 V;  4FIP C;  5EC2 C;  2EIM B;  2IJK A;  4WFG A;  1M1K W;  2EIJ C;  4UUJ C;  2DWE C;  5H6Q A;  1YIT V;  1JJ2 U;  4QJF B;  3ZRV A;  1QLE B;  2HKO A;  1NVP D;  2A0L A;  1BL8 A;  2EIJ B;  1I5Y A;  1AI5 A;  4F4L A;  1M57 B;  3AG4 C;  4MSW C;  1NKD A;  3K04 A;  3T4Z A;  2XAG A;  1VQN V;  4TT3 G;  3CD6 V;  1G4Y B;  3D36 A;  3SPG A;  3OEH G;  1KC8 W;  3ZMZ A;  3AG2 C;  3AG4 B;  3SYP A;  1ZWI C;  4JTC B;  4R6Z A;  3UM7 A;  4Q20 A;  3ABT A;  1AI7 A;  5B3S C;  1K4D C;  2X0L A;  2X7R B;  4GX0 A;  1GM8 A;  4FJC C;  4E2L A;  4MW8 A;  4WFA V;  2HVK C;  1CP9 A;  1R73 A;  3K06 A;  3AG2 B;  1E1Q G;  5B3S B;  4N21 A;  5EK0 A;  4R8C A;  3K03 A;  5LGU A;  2FTK A;  5IY5 C;  4P30 A;  2D3O W;  1SES A;  1KD1 W;  1GM9 A;  2WAM A;  4P2Z A;  1VQO V;  1S77 D;  3ASO C;  2QTO A;  1R6N A;  3GWO A;  1L1F A;  2C2A A;  1K73 W;  5IY5 B;  3I55 V;  1H8H G;  3PJS K;  2HVJ C;  2H8P C;  3CYO A;  3DTU B;  2WLL B;  1XL6 A;  2WLM A;  3ASO B;  1NQT A;  1AJN A;  2OTL V;  2AHY A;  4MTX A;  1EBO A;  1R6K A;  2EIN C;  5L3F A;  3K9A A;  1VQ4 V;  1GK9 A;  3CCU V;  4QE9 A;  2UXN A;  1MAB G;  2Z5U A;  2ZQM A;  3AG1 C;  5CBH A;  3IC7 A;  2XAQ A;  2EIN B;  2ZR2 A;  2GSM B;  1LNQ A;  1V55 B;  1VQ9 V;  1K8A W;  1BHB A;  1YIJ V;  2DQ3 A;  3JD0 A;  3AG1 B;  4JTA B;  3T2M A;  3JD2 A;  3OUS A;  2WLN A;  1DF4 A;  3CCV V;  1P4R A;  4MVQ A;  4OXS A;  2UXX A;  2WLH A;  3E35 A;  3ZMU A;  3ZRW A;  3K79 A;  3P32 A;  4RQF A;  2ZDI A;  4MT8 A;  3SJQ C;  2PI5 A;  4PA4 A;  3CCM V;  1J95 A;  4RO2 A;  4MVM A;  3CC4 V;  5EC1 C;  4GX2 A;  3CP1 A;  1QLN A;  4MVU A;  4QNH B;  2Q69 A;  4PA3 A;  2CK3 G;  1FXK A;  5IYB O;  1DF5 A;  2JEX A;  1W2B U;  3B8M A;  1ARO P;  3K0D A;  3ABU A;  4GCZ A;  3WFV A;  4XDJ A;  1YTF B;  3OMI B;  1K34 A;  1JOY A;  2HFE C;  4RQE A;  2QM7 A;  2X6B A;  2QE7 G;  3ZMT A;  3SPH A;  4HZ3 A;  4JYC A;  1JQ0 A;  5KUM A;  3E8B A;  1W0K G;  2EJR A;  3TK1 A;  2B1G A;  3MHS C;  1Y4M A;  3JCZ A;  4WFE A;  1JCH A;  2YSU B;  3G71 V;  4JAU A;  2DYR C;  3STL C;  5L3G A;  2QA4 V;  3E8G A;  2ZXW B;  3E86 A;  2ZD9 A;  1PD3 A;  2P7T C;  4MVZ A;  3RVY A;  2DYR B;  1W0J G;  4FK5 C;  1KP2 A;  1V54 B;  2DQ0 A;  4JTD B;  1OCZ C;  3CC7 V;  3W7U A;  4LP8 A;  1JX9 A;  3B8N A;  1QR8 A;  1SET A;  3ZMV A;  1FFT B;  1JPX A;  2XAH A;  2JIZ G;  3E2E A;  4PA6 A;  3BY6 A;  1OCO C;  3EFF K;  1OCZ B;  3VOU A;  2ATK C;  1QBZ A;  2IJJ A;  3AEI A;  4G27 B;  3CMA V;  3GB7 C;  3WG7 C;  1OCO B;  3SPC A;  3RBZ A;  2BOB C;  4P9O A;  2DYS C;  2NNU A;  2R9I A;  3E8H A;  3WG7 B;  3W7X A;  3B77 A;  4WF9 V;  1OZ0 A;  2X6A A;  2ZDI C;  4PA9 A;  1AJP A;  3OAA G;  3X2Q C;  4ASU G;  1S0V A;  3CME V;  2XOK G;  5H9C A;  1BMF G;  4ZKI A;  2XAJ A;  2DYS B;  3M99 B;  5CN0 A;  1VQP V;  3ZRW B;  5L3E A;  5HFL A;  1FXK C;  3D3I A;  3X2Q B;  4RUF A;  1VQ5 V;  3QNE A;  1PL0 A;  1VQ7 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...