3WFVA

Hiv-1 crf07 gp41
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
86
structure length
86
Chain Sequence
AGAGQSNDSGIVQQQSNLLRAIEAQQHLLQLTVWGIKQLQTRVLGGGGRWMQWDKEISNYTNTVYRLLEESQNQQERNEKDLLALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Envelope glycoprotein gp160
publication title The crystal structure of HIV CRF07 B'/C gp41 reveals a hyper-mutant site in the middle of HR2 heptad repeat
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 41
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2013-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3wfvA00
5CMUA 1DLBA 5CN0A 1JQ0A 1QR9A 4FIPC 1Y4MA 4JGSA 5H9CA 4JF3A 1DF4A 1QCEA 3B77A 2X7RB 5HFLA 1DF5A 1QBZA 1K33A 1SZTA 2OT5A 1JPXA 1MG1A 3P30A 3GWOA 4N21A 4FK5C 5HFMA 3B8NA 3CYOA 3CP1A 1I5YA 2MK3A 1QR8A 3WFVA 1F23A 3M99B 4N23A 5KA6A 1MOFA 1K34A 1I5XA 2EBOA 3H01A 1ENVA 2M7WA 3MHHC 4E2LA 2LP7A 1Y66A 2P6JA 5KA5A 4JPRA 4FJCC 2EZPA 3MHSC 2EZOA 3K9AA 4G2KA 3B8MA 1EBOA
chains in the Genus database with same CATH superfamily
3A0RA 2OCCC 2UU9B 2H3OA 2NN4A 5JVDA 2R70A 4YY3O 1NQTA 4NTXA 2ZXWC 3OR7C 3AG3C 2ZDIC 4I4TB 4DV4O 2OCHA 3CYOA 3TK1A 1WPXA 4X1YA 2BCCH 4UCUA 1PNMA 1YTFD 3SPCA 4OXSA 2B5UA 4X62B 3HPLC 2AZ2A 4DV0O 1HNXB 4TV9B 1OCZC 2WSSG 1AP6A 3FB5C 2QKCA 4DV5B 3K5NA 3RYCA 2JDIG 2Y0PA 2Y0IA 3CCVV 3ZN0A 1W0KG 5LYJB 3ZHSA 3OE7G 3CWBH 1R73A 5KHJA 5DECA 4BIZA 1R6TA 2Q4PA 2P5OA 4J11A 3JATB 2IJHA 3ZBHA 4K8ZA 5LXTA 2X6AA 1FPOA 2HKOA 1P84F 2CDYA 1VQLV 1J5EO 4UCOA 4TV8B 4GKJB 4GKKB 3KZIZ 5JCOC 5FPRA 1B3QA 1XL6A 3JASA 1M5IA 1QHTA 1KYOF 3K3WA 4YJ3A 2F43G 3CJHB 1Q81W 4QE7A 3B09A 3SJQC 2DN9A 2QR4A 3VQWA 3HKCA 4MVOA 2WLNA 3EHBB 3T1CA 2AGAA 2WWWA 3JD3A 4QNHB 1R6KA 2Q68A 1WP8A 1PNLA 2UUBO 2ZNIA 2OCCB 2WAMA 4O4LA 1KP2A 2EIJC 3OMNB 4HYOA 3F5TA 2ZXWB 3AG3B 4CH4A 4DR5O 1AI5A 1Q86W 1XOUA 1NJIW 3THOA 3SYCA 2B1GA 5C8YB 3OGCC 1JVMA 3MHHC 2C2AA 3CRRA 3I56V 1OCZB 5B5EZ 1VQ9V 5BMVB 1VF7A 1NVPB 4MTGA 2HP8A 1ZLZA 4B3TB 1HR0O 2ZE5A 2X7RB 3BHPA 1V54C 4ZI7B 2CTRA 3OEHG 4ZOLB 3LUTB 1XNQO 1BL8A 4LP8A 3DGEA 3SPHA 2Q73A 3BAAA 1KU9A 2L35A 1B04A 5BR8O 1Y66A 4LC1A 1XQ8A 2YC0A 1XMQB 4G27B 2K9PA 2PTMA 2QJ1A 4NYKA 3CSXA 4FLWA 4KFMA 4JYAO 4LFCB 1YJNV 4E4EA 5DN6G 5KHIA 3CCLV 1Y74A 4FLUA 3W7XA 4UVAA 2ZQMA 3O65A 1GN3A 3OMAB 3VQXA 1XL4A 4PELA 2QM7A 5L3GA 2Z0AA 5LMUB 4P30A 3RYIA 2HFEC 3RYFA 2X0LA 4LWSA 2IJKA 2YUAA 4EB6B 1HNXO 1B06A 4AQYO 4QGPA 3K5OA 5JJNB 1VF6C 5IYBO 3X2QC 4N21A 2JIZG 4YIOA 3GWOA 1FXHA 1QNMA 3LSSA 4X20B 1YEWA 2KG7A 3M8AA 1G1XB 3GB7C 1Y76B 3WU2Z 2ZM6O 3QO7A 3E22A 2Y4TA 2EILC 4FZ0A 4O4IB 1CXZB 2EIJB 1V9PA 1F4NA 4PA9A 4U3FH 1N33B 2PGGA 2OT5A 4EKWA 4FZ1A 2UXNA 2K1EA 3FYEB 4QE9A 2UUAB 3JAMN 2BTOA 1AR1B 5IYCO 4GKKO 4GKJO 3N27A 3G67A 3WB2A 4XBFA 3FFQA 3CC7V 4JAUA 2YIBA 4IGGA 5KX5B 4LFAB 2WLIA 1R3LC 4DR1O 4J41A 5IYDO 1V54B 5FNVB 1SZTA 2R9RB 1FD9A 4X1IA 4B3MB 4HNAA 2P22C 4RO2A 2W0FC 1VP7A 4BWAA 3W7TA 2IJIA 2XAQA 3JD4A 2DOSA 5LYJA 3ML0A 1DLBA 2YDEA 3APOA 1BHAA 4PJ0Z 1X4TA 4HZ3A 2XTAA 1JPXA 4H13B 5KUMA 4I9QA 1I0HA 3ASOC 3G80A 1EZJA 4DW1A 4I0XB 3AG1C 4UCTA 2EZOA 4UFZA 1OCCC 3CX5F 4TWKA 4TV8A 3T1YB 1MNGA 3CMEV 4DR6O 3X2QB 1OCOC 3G6EV 2FKXA 1G6UA 2Q67A 4PV1B 4I9WA 4O2AA 3GWKC 1K5QA 4FPPA 1E1QG 3CJHA 4X66B 4Z1VA 1QVFU 2UXDB 4NTWA 1IXBA 3OM3B 2EILB 1IBLB 2PYJA 4BIUA 1XMQO 3QO5A 3IGAC 5BY1A 4LFCO 2X6CA 1JA8A 4WCEV 5EBLC 1FXKA 1NH2D 1AI6A 1UJWB 2H94A 3ZMTA 1MSDA 4H37A 4P2ZA 1VQ4V 1IDSA 2UXBB 1SQVH 5EK0A 5KLVH 4K8XA 2ZDIA 5LP6C 3CCMV 5C8YA 4DK0A 1QQCA 2QE7G 1CEZA 4WFGA 2F23A 4WF9V 1K92A 3RYCB 1GMGA 4JASA 3ZHQA 4KP4A 2XASA 3UQ8A 1W0JG 4X1KB 4DW0A 1WP7A 3E86A 2YXYA 1Q90D 4ZOLA 1VARA 4UVBA 1H2KA 2OYQA 4DV2B 2V4DA 3K0GA 1WA8B 1ZWIC 2EINC 2CK3G 1KC8W 3ASOB 2G38A 2IM9A 4MVZA 1N33O 5KA6A 1VQ8V 3AG1B 2UUAO 5J9PC 5LHIA 1OJHA 1VIBA 3K9AA 1OCCB 2JS3A 3BY6A 1S5LZ 2MW2B 2P67A 5JCOA 1XHXA 1JX9A 1QCEA 2EJ7A 3HR0A 3L71H 1OCOB 1NS1A 5HFMA 4JI2B 1ZX3A 4FFBB 4EB6A 3HKCB 1YDXA 4B3MO 4DRXB 2QWPB 2E76B 5LA6A 3VQYA 2A7WA 3DC6A 1BGYH 1YI2V 4IYIA 4F6EA 1XREA 4X20A 3G71V 5E79Z 5L3CA 2RMKB 2KB1A 1Z5WA 2H8PC 4EFEA 2Q9LA 4D6TH 1GKFA 4GX0A 3SPIA 2EULA 2CE4A 2LFRA 2FTKA 5EBMC 2YICA 5CN0A 3UCSC 2A3QA 5LP6B 4NB5A 1XMOB 2UUCB 4FVMA 1YTFB 1D5NA 1L0LH 3T1YO 3CCRV 2BSKB 4J42A 3RGBA 4B3RB 1JJ2U 1OCRC 2YI8A 2N04A 5KHKA 4G28B 1KB9F 4FJCC 2PI5A 4LF5O 3B8MA 5FNVA 3HKEB 4P9OA 1RPRA 2DYSC 2UXDO 2CH7A 4X9QA 4JI6B 1T5EA 3F5WC 4LBEC 1IBLO 2EINB 3JARB 4PDLA 3ZEDA 4DV3O 2JGUA 4JV5B 3NR7A 4LCUC 4DV6O 2XAJA 2Q69A 4QPJA 4AI8A 2R72A 1YF2A 3DC5A 1S76D 3VQVA 1H2LA 4WBNA 4PI0A 2CGOA 3RYIB 2BTQB 4UB8Z 1Q6IA 1YVWA 1DF4A 1H2NA 2R9AA 3I5DA 2IJJA 2ITDC 4I0XA 1BMFG 1YCIA 4B3SB 3K04A 1L8DA 4H44B 1YJWV 2PZSA 1SC5B 2XAFA 3D8CA 3E2EA 1YZBA 4I55B 4JZGA 3CD6V 1VF6A 1MZEA 3W7WA 1N0NA 2KG7B 2ZE8A 4F4LA 1NT2B 3P32A 2ADQB 2Q6AA 1GTOA 5KUKA 3MAQA 1VQKV 3WB1A 2Q7EA 1TUBB 2YEVA 4O4JA 2QTSA 5LGNA 3SYPA 3AG4C 2WLMA 2P4VA 3LDEA 4JI3B 3BABA 3JYCA 2RNBA 5CA1B 5IWAO 2P6JA 3RVYA 5GTIZ 2OTLV 3L75H 3D36A 1XBLA 4GX2A 1FXKC 4ZBMA 4CC6A 4LF8B 4LF9B 3JAWB 3AK2A 1VEWA 4IHJA 4TQDA 1QR9A 1URFA 3J7AU 1K97A 2HG5C 1OCRB 2WLIB 1F23A 1IXMA 1I7FA 3H1HH 4JI2O 2QWRB 4IIJB 4X1IB 4JPRA 4DR3B 4HNAB 5KAFZ 1SERA 1PL4A 2DYSB 3ABKC 1S77D 1Q7YW 3CCEV 1H8HG 3BRCA 4MT8A 3L73H 1VF5B 3DTUB 2EIMC 4X1KA 4JI8B 2B1IA 1P7BA 4GT1A 4UXNA 1BE3H 1WA8A 4JI4B 2RDCA 2YSUB 1NR7A 4JGSA 4NXNB 2AW9A 1HNZB 2YI9A 2MK3A 1PKXA 1SETA 1THZA 4CBCA 2Q5ZA 4KHPB 1Y6XA 4LH6A 5FL7G 4B3RO 4X65O 4O2AB 3R65A 4BAYA 4FFBA 3JALA 2E75B 4K0KO 4PDVA 1MMMA 4X8AA 4RWUA 3K79A 2QA4V 1AROP 4LF6O 3RVZA 4DRXA 3B4SA 3BA8A 3AG4B 2GTAA 3IAYA 2FYUH 5IT9N 1XDCA 1ROPA 4JV5O 4J7KA 4BIOA 1SS3A 4L8JA 4FM0A 1FXKB 3HKDA 3OTOB 2ZD9A 4W4LA 3VOUA 4CS3A 1ZL8B 2HVKC 3ZS8C 4JAVA 2D2CB 3ZRXA 2V7QG 5LP6A 2NNUA 4RUEA 4B3SO 1ORQC 3EVKA 3N2GA 3H1KH 1NBMG 2ZINA 1TGOA 2BSKA 2ZIMA 3OR6C 4LFBO 3L9DA 3K57A 3ABKB 5L3EA 4LF4B 1SQQH 1KKCA 2CGNA 1GH6A 2ETNA 3LNMB 5FPOA 2EIMB 4Q20A 3KKYA 4ZKIA 2AHYA 3HKEA 1MA1A 4FLYA 3AK3A 1R6NA 3IFXA 4J9YB 4YJ2B 4JI3O 3JARA 3FX7A 4JTCB 3RN4A 3ETEA 1JMKC 3SYQA 2PY5A 4LF9O 3T4ZA 4LF8O 4PHZA 1MG1A 1N8RW 1RSOB 3RWRD 2UU9O 3QF7A 2IBZH 1NR1A 2BTQA 5KHGA 4J10A 2E74B 1XEQA 2AZ0A 2HVJC 1KKDA 4UCSA 1DTOA 2LJ2A 4X62O 1K8AW 2FB5A 3AK1A 4DR3O 3ZJZA 5HFLA 5LA6B 4MW8A 3ASNC 4U7OA 3K5LA 4DV5O 4I55A 4I7ZB 4MVRA 1AB3A 5H2FZ 3UO3A 1R3IC 4GYCB 3AEIA 2JGDA 2ZT9B 4LF7B 1TUBA 3FAVB 2LW1A 3O9OA 2DQ3A 4JI4O 2YXLA 4OX9B 3D36C 5CA1A 4NKGB 1QR8A 3BEHA 3CXHF 2AXTZ 1VQ7V 2LGQA 4UCVA 4H0LB 3RYHB 5EYPB 3CRCA 3JAWA 3JAKB 1F7YA 1B6QA 4JI1B 3U11A 1XNRB 4AHCA 2JS5A 1M93A 3JCUZ 3LNNA 4FLZA 5H5NA 2VWJA 4DR7B 5EZYB 2R9IA 2D3OW 2F66C 4GZRB 3JCZA 4IIJA 3ABUA 1GAXA 2CH7B 1GN6A 4JZ2A 2QTOA 4UV8A 2Y69C 1U97A 1O9HA 5DEDA 1SESA 2W6IG 2FMLA 2YXHA 3CPWU 1Q82W 1LNQA 4OPAA 2Q7HA 1AJQA 2XT9A 2ZR3A 3W7UA 3RBZA 1EZVH 4LNUB 3ZX6A 3OTOO 4WBNB 3FB6C 2F4VB 1NVPD 3F7YC 2L6LA 3H01A 3BCCH 2UXXA 4QPKA 4IYHA 3H9VA 3TXQA 4A5UB 1SQBH 1QLNA 3KCYA 2W6JG 3A8TA 3UT5B 3L74H 3ASNB 4I5SA 3R66A 3F7VC 4CZZA 1M57C 4B3TO 3STZC 3EXAA 4N23A 2LW7A 2E5LB 1X59A 1FFXA 2YEVB 4O4JB 1GM7A 4D7TA 4YHHB 5J2TB 2YIAA 2F93B 3ZMSA 1IX9A 3E83A 1H38A 4FLXA 2KQXA 5KMGA 2XUMA 3STLC 3CCQV 1K5SA 1M9NA 3ZMZA 5JH7A 5E1AC 3CP1A 4IL6Z 4IHJB 2ADPA 1Z2GA 3FKSG 1AP5A 3ETGA 2IH1C 4JI7B 1EFRG 5L3FA 1ZL8A 3HB3B 5LMUO 1R1BA 2OIGA 2DYRC 1GM9A 4PDRA 1LUWA 4CS2A 1QBZA 1P49A 2ILMA 3OUFA 5AG2A 1WB8A 5FLXN 3K0DA 1WB7A 3A2FA 5BZBA 2GUZB 1SF9A 1S5HC 4KXRA 1K73W 4HAMA 1S0VA 3QG5A 2Y69B 4JAAA 2M7WA 2DQ0A 5LL6Y 3MHSC 3ABTA 4DV1B 5B66Z 3L72H 3SYAA 1VQPV 2ZR2A 5JQGB 3ETDA 2LGWA 4LF7O 3K5MA 2DMXA 2JEXA 4HBNA 1EN6A 2N74A 4L87A 2P4KA 4YJ2A 4OX9O 1QVGU 1ZAUA 1ENVA 3T1HB 1A32A 5A2QN 4ZIBA 1RSOA 2PI4A 4JI1O 4GX1A 1Y67A 3VBBA 4CH6A 4X64B 3OTFA 4I50B 1L1FA 1RM1C 4LFAO 1M57B 1XI1A 3JALB 1VQ6V 4DR7O 3W7SA 1GK9A 5H6RA 1NTMH 3E8GA 2JJ2G 2CUGA 3K58A 4DV4B 1AJPA 3OMIB 2M6YA 4YXWG 3HKDB 2GBOA 5K1XA 1KUQA 3ZHUA 1SKVA 1WN7A 1CP9A 1O9GA 3FAVA 3S3WA 3N2KB 5EIBD 3MD0A 2ZCEA 1Q6UA 4J7ZA 4UVCA 3ZRWB 1IBMB 1R3JC 1PPJH 5LGTA 3ABMC 2DYRB 1EN4A 1PD3A 3N2GB 4WFBV 3RYHA 3BVOA 5EYPA 4CH3A 3JAKA 4JTAB 1PL0A 4UCRA 1S72V 1M1KW 4U3JA 1J5EB 5BXZA 3JD2A 1KQSU 3ZHTA 3OUSA 5EZYA 3K59A 1K3EA 4X66O 3E8HA 4R50A 5F2VO 2QM8A 4FIPC 2IU3A 4PI2A 4PA4A 4YHHO 3JD0A 2QKAA 4WFHA 4K3AA 3OT7A 4K35A 2ZIOA 4C7UA 1LUVA 4FFKA 2Y48A 4PA6A 5CB4A 2WLLB 1TVKB 4OGQB 1S3JA 2HR3A 1EBOA 1GN4A 4TQFA 4LNUA 1R3KC 4PA3A 4CH5A 1HDJA 3SPGA 2UXBO 3B77A 3CS5A 3CCJV 1VQ5V 2WA3A 2QSAA 1RM1B 1ZUQA 3ZCCA 5IYZB 5LBQA 1IURA 2UUBB 2EJRA 4AILC 3UM7A 2F1MA 3UT5A 4X89A 3TETA 1FFTB 5B1OA 1V55C 2JGDB 2WPDG 3ZRVA 3OGIB 2QWQB 5LGUA 4X88A 4DV1O 1N36B 1PNKA 3TCUA 2EX3A 4MVSA 4FLTA 1WNSA 4DV2O 4DUZB 3LDCA 5J2TA 2Q0OC 3OW2U 4JI5B 1FXVA 1UFIA 2GTSA 1Q6HA 4LR3A 3T1HO 3ABMB 2RJZA 4NR1A 1D5AA 1SQPH 1HP8A 1JOYA 1M56C 4EEQA 2WLHA 2OWOA 5CBHA 3M7MX 3TJTA 5A9GA 4GCZA 5LMNB 3G6BA 4X64O 1SQGA 5K1PA 3P3NA 1YXBA 1H2MA 1DGSA 3WG7C 3Q4HB 3BA9A 1FKAO 3JSLA 2HHHB 1H2GA 3FB7C 4NVPA 2GUZA 2NR5A 4DK1A 1WLEA 5CBGA 1FS0G 2CTWA 3H1IH 4DR2B 4RQEA 1SA0B 1XILA 3UKMA 3ZHRA 5J2UB 4JYCA 1NTKH 4AQYB 4GX5A 3PJSK 1COWG 4Z2WA 5JQGA 4O2BB 1OHHG 4O4HB 1IBMO 1Y4MA 5IJ0A 1XUQA 3CC2V 1OZ0A 1XMOO 4UV9A 2ZM6B 2UUCO 3HKBA 2W0XA 4GUNA 2QWOB 2DJVA 1RFYA 1YHQV 1GRJA 4JTDB 3J81N 3OAAG 3CB2A 2QM4A 4H33A 2CAZC 1V55B 3QNEA 4I50A 2XAHA 4CS4A 1FFXB 2VQEB 1NU1H 1G4YB 2LFSA 3J80N 1FAFA 2RN9A 1JFFB 1PV0A 1GM8A 1YITV 5EC2C 4JI6O 5KMGB 2CTPA 2XOKG 2WLJA 3SDLA 2XAGA 5JH7B 4DR1B 5CBFA 2EZPA 1VQNV 3AG7A 2IW5A 2VRZA 2UXCB 5LOVB 1AILA 4QIWF 3C3TA 3CRAA 1OV9A 2ODMA 1MZFA 2XNDG 3ZMVA 2IH3C 4DYLA 2KKWA 3N2KA 4FK5C 1M56B 1VQMV 3ZRWA 4ABMA 3CCSV 2ZE7A 4B08A 2P7TC 5GTHZ 2P90A 3IC9A 1KECA 1KD1W 1L0NH 2DW4A 3H1JH 2ZNJA 2QGNA 4MTXA 3WG7B 3E35A 3B2EE 4BR6A 2GDSA 2ITCC 3ZN1A 2HEPA 1DK1A 5ITZB 1GN2A 5LHHA 3K06A 1N36O 1IZ3A 4FMTA 4DUZO 4RUFA 4DR6B 4IT5A 2YIBD 2Q7GA 5IJ9B 4F6RA 1SZXA 5JJJB 4JI5O 3IC7A 2JK5C 1K9MW 3JD1A 1LR1A 1M4UA 1E79G 3L70H 2A0LA 3CRQA 4Z1MG 2WLLA 4JYYA 1TVKA 2GSMB 3T4DA 2PUSA 5D5QA 1BHBA 1AI4A 4D7SA 3ABLC 3U0ZA 1F4MA 5LMNO 1VQOV 2YS8A 4ICGA 5IYZA 4JF3A 4FM1A 5CA0A 1K33A 3NXSA 2VQFB 2ARHA 2HHHO 3SJCC 2QEXV 3OFNG 3P3PA 2Y4UA 4DR2O 2N05A 3DXRB 5L3DA 3BPZA 3RFRA 1KP3A 5CMUA 4JI8O 1NH2B 1HWYA 3IJ4A 4QJFB 1H2SB 2Z3YA 5KHHA 2DWEC 1AR4A 3D3QA 5EIBC 4DV7B 3CC4V 3B8NA 2QDOA 4JI0B 4NXNO 1HNZO 2CTQA 4XDLA 3BFRA 2VWKA 1Z5VA 1IBKB 4R8CA 4MSWC 1KBHA 1BZKA 2YIDA 4U3JB 1N0JA 4KHPO 2RQ6A 5C93A 2JEUA 4KUMA 3AG2C 4DUYB 2V1DA 2VQEO 1I5YA 1N4CA 1Q5OA 2HJFC 1P4RA 3Q4HA 3KG2A 4WFFA 3EFFK 1AR5A 1WAZA 5GONB 1VMGA 3CE2A 4XDJA 4XDKA 1JQ0A 4I4TA 3FD9A 1SA0A 5D5PA 4R7CA 5H9CA 5CB4B 5IY5C 3P30A 5J2UA 2UXCO 3I55V 1P7GA 4TV9A 3WFVA 4O2BA 1YSCA 1EM1A 3SJAC 2OIEA 4O4HA 3ABLB 2FL4A 2JRIA 4FLVA 1W2BU 4NTYA 5GW7A 3RW0A 1RPOA 3DSQA 4PD4F 1DF5A 1AVMA 3RT3C 2WLKA 3JATA 2IU0A 4RQFA 4W4KA 3ETQA 3CEIA 3LSQA 4LF4O 1CPYA 1MOFA 3CXCU 2ZKOA 1SQFA 2JJ1G 4J80A 1Q43A 3K08A 1FJGB 3TGUH 4ZHQB 1KMIZ 1E1RG 1JR9A 1JFFA 4DR4B 3D3IA 4TUYB 4MVUA 3E8BA 2BOBC 1WJZA 1M90W 1S5JA 2Q8VA 4LF5B 3UO2A 1TA8A 4U7NA 1D2DA 1U96A 3FYIB 3K9SA 5LOVA 2BOCC 3ZMUA 1ZTEA 2Q0AA 2A9HA 4J7JA 2A79B 2DE0X 2XHBA 4DV3B 5B3SC 5L3BA 3AG2B 5JWPA 4DV6B 5JJEB 1HNWB 3FB8C 3E89A 5JVDB 3CCUV 4B7EA 1W59A 3SGIA 4NXMB 5EBWC 2VQFO 4DXWA 1N34B 2QKSA 4CC5A 5KA5A 2PF4E 1AI7A 2ATKC 5EC1C 2O57A 4G2KA 4X1YB 1PM9A 3SR2C 5ITZA 3K03A 3QO8A 4LH7A 1I94B 3QVNA 4TSFG 1PP9H 5IY5B 1F51A 3B40A 1FYJA 3JSNA 1EN5A 2HLDG 1YJ9V 5IJ9A 4DV7O 5BMVA 1IVSA 5IJ0B 2A06H 2EIKC 3PN1A 3H1LH 4JI0O 1WPBA 3ZRSA 3HKBB 4ZI7A 4WFAV 2HJDA 2P06A 4J9ZB 1N32B 2B9ZA 1IBKO 3KCXA 5LXTB 1XNRO 4GLXA 4PDMA 4JYBA 2GV9A 5H6QA 5IWAB 1QLEC 4KL1A 5CA3A 4DUYO 2LO1A 2BE3A 3SPJA 3JASB 4YY3B 1Q3EA 3S3XA 4RAIA 5B1AC 1NTZH 2KSDA 2GHYA 4UB6Z 4PA7A 3T2MA 4R6ZA 4YJ3B 5IDJA 1K4DC 3LSUA 1US6A 1BT8A 3DXRA 4DV0B 3SYOA 3APQA 3OEEG 5KAIZ 1TAEA 2F95B 3OD4A 3GVMA 2F4VO 4MTOA 1GO3F 3WB0A 4P9PA 5B3SB 1MABG 4EFBA 5B1BC 4O4LB 1Y76A 5TISZ 4YIPA 2DWDC 4UUJC 4O4IA 4Q6GA 4E2LA 3ZIAG 3ZHVA 1NKDA 1AJNA 1BS3A 2AHZA 4DO2A 3LDDA 2E3CA 2E5LO 3SJBC 1BSMA 5IE9A 1FJGO 2VS0A 3QTCA 4F6RB 4MS2A 4DR4O 1BCCH 3MDSA 1ZSPA 4TOIA 5GONA 4X65B 3ICXA 2LQTA 3U10A 2JVDA 2EBOA 3A0BZ 5KX5A 2EIKB 2WA4A 1BQZA 1NI8A 4K0KB 1JCHA 4LF6B 1G8MA 3CRMA 4BW9A 1YIJV 4B7KA 4JI7O 4MVQA 1K4CC 1TUEB 4MW3A 1QLEB 2ZE6A 1MSWD 4OPHA 1I08A 1SQXH 1HNWO 2OTJV 5CA0B 1Y74B 1RP3B 1I5XA 3CHXA 4TT3G 2X6BA 4NXMO 1J95A 1N34O 4DR5B 3RYFB 3C3SA 5B1AB 3TXSA 4LWSB 1NZ6A 1XHZA 4FM2A 3C90A 1I94O 2RCVA 1QU7A 3M99B 4ZHQA 1SRYA 2QWNB 4LFBB 1UPGA 4TUYA 5LHGA 5DM6V 4WFEA 4ASUG 1BQ0A 1HW7A 1K7DA 1JJOA 4MTFA 1HR0B 4BW5A 1XNQB 5B1NA 3A0HZ 3E22B 5B1BB 2PYLA 4MVMA 3CMAV 1N32O 5BR8B 1H8EG 3G4SV 1Q8IA 2Z5UA 1K34A 2NLJC 2LP7A 4JYAB 3E8FA
chains in the Genus database with same CATH topology
3A0RA 2OCCC 3IC7A 1QLNA 2JK5C 1K9MW 2W6JG 1NQTA 3JD1A 3G71V 2ZXWC 1E79G 3OR7C 5L3CA 3AG3C 3ASNB 4I5SA 2ZDIC 2KB1A 2H8PC 2A0LA 3CYOA 3F7VC 3TK1A 4Z1MG 2WLLA 4CZZA 1M57C 1WPXA 1GKFA 4GX0A 3SPIA 3STZC 2GSMB 3T4DA 4N23A 1PNMA 1YTFD 2LFRA 3SPCA 4OXSA 2B5UA 1BHBA 3HPLC 1AI4A 2FTKA 2YEVB 5EBMC 1GM7A 1OCZC 2WSSG 3ABLC 1F4MA 3FB5C 5CN0A 3ZMSA 1VQOV 3E83A 1H38A 2JDIG 3CCVV 1YTFB 3ZN0A 1W0KG 3STLC 3CCQV 4JF3A 1K5SA 1K33A 1M9NA 3NXSA 3OE7G 3CCRV 1R73A 3ZMZA 4BIZA 5E1AC 2QEXV 3CP1A 3OFNG 1JJ2U 1OCRC 3FKSG 4G28B 5L3DA 3ETGA 2IH1C 2IJHA 4FJCC 2PI5A 1EFRG 5L3FA 2X6AA 1KP3A 3B8MA 3HB3B 5CMUA 2HKOA 4P9OA 1RPRA 1VQLV 2DYSC 1NH2B 1HWYA 4QJFB 2DYRC 1GM9A 2Z3YA 2DWEC 3F5WC 4LBEC 4PDRA 3CC4V 1QBZA 2EINB 3OUFA 4PDLA 1XL6A 3B8NA 3K0DA 5BZBA 1K73W 1S5HC 4LCUC 1S0VA 4HAMA 2XAJA 2Q69A 4QPJA 2Y69B 2M7WA 4XDLA 2DQ0A 3K3WA 3MHSC 1S76D 4R8CA 4MSWC 2F43G 3ABTA 1Q81W 4QE7A 3SYAA 5C93A 3SJQC 1VQPV 2JEUA 2ZR2A 4KUMA 3AG2C 3ETDA 1DF4A 2IJJA 2ITDC 1BMFG 2JEXA 2V1DA 3K04A 4MVOA 1I5YA 1YJWV 2WLNA 3EHBB 2HJFC 4L87A 3T1CA 2WWWA 3JD3A 1P4RA 1QVGU 2XAFA 4QNHB 1R6KA 3E2EA 3KG2A 2Q68A 4WFFA 1ENVA 3EFFK 3CD6V 1PNLA 4XDJA 3W7WA 4XDKA 2OCCB 2WAMA 1JQ0A 1KP2A 2EIJC 4F4LA 3P32A 2PI4A 4R7CA 4GX1A 2Q6AA 3OMNB 4HYOA 5H9CA 2ZXWB 1GTOA 5IY5C 5KUKA 3AG3B 3P30A 1VQKV 1AI5A 1Q86W 3VBBA 1NJIW 2YEVA 3SYCA 3I55V 1L1FA 5LGNA 3SYPA 1RM1C 2B1GA 1M57B 3WFVA 3OGCC 3AG4C 1YSCA 2WLMA 1JVMA 3LDEA 1VQ6V 3W7SA 3JYCA 3MHHC 1GK9A 2C2AA 5H6RA 3I56V 3E8GA 2P6JA 1OCZB 3ABLB 2JJ2G 3RVYA 2OTLV 1VQ9V 3D36A 4GX2A 1FXKC 4ZBMA 1W2BU 1NVPB 4MTGA 1QR9A 1AJPA 5GW7A 3RW0A 1RPOA 2X7RB 1V54C 1DF5A 3OMIB 4YXWG 2WLKA 1K97A 3OEHG 2IU0A 3LUTB 1BL8A 4LP8A 4RQFA 2HG5C 1OCRB 3DGEA 2WLIB 1CP9A 3LSQA 3SPHA 1F23A 1IXMA 1CPYA 1MOFA 3CXCU 2JJ1G 1Y66A 3MD0A 4LC1A 3ZRWB 4UVCA 4JPRA 3K08A 1R3JC 4G27B 1SERA 1E1RG 5LGTA 2DYSB 3D3IA 3ABMC 4KFMA 2DYRB 4MVUA 3E8BA 1YJNV 3ABKC 1S77D 1Q7YW 1PD3A 5DN6G 2BOBC 4WFBV 3CCEV 3CCLV 1H8HG 1M90W 3W7XA 4MT8A 4JTAB 4UVAA 2ZQMA 1PL0A 3DTUB 3OMAB 2EIMC 1XL4A 4PELA 2QM7A 5L3GA 1S72V 1M1KW 4U7NA 4P30A 2HFEC 3FYIB 2X0LA 2B1IA 1P7BA 4GT1A 4UXNA 2BOCC 3ZMUA 2A9HA 3JD2A 1KQSU 3OUSA 2A79B 2IJKA 2YSUB 1K3EA 3E8HA 4R50A 5B3SC 2QM8A 4FIPC 1NR7A 2IU3A 3AG2B 4JGSA 4PA4A 5L3BA 5IYBO 3X2QC 3JD0A 3FB8C 4WFHA 4N21A 2JIZG 3E89A 3GWOA 1FXHA 3LSSA 3CCUV 2MK3A 1PKXA 1SETA 1THZA 4CBCA 5EBWC 4DXWA 2Y48A 2QKSA 3GB7C 4PA6A 5FL7G 5KA5A 3QO7A 1AI7A 2WLLB 2ATKC 2EILC 5EC1C 2HR3A 1S3JA 4G2KA 1EBOA 2EIJB 3R65A 1F4NA 1R3KC 4PA3A 4BAYA 3K03A 3QO8A 3SPGA 4TSFG 4PA9A 3B77A 4PDVA 5IY5B 4X8AA 1F51A 3K79A 1AROP 2QA4V 2OT5A 4EKWA 3RVZA 3CCJV 1VQ5V 2UXNA 2K1EA 1RM1B 3ZCCA 3FYEB 4QE9A 2HLDG 1YJ9V 3AG4B 5LBQA 1AR1B 5IYCO 2EJRA 1ROPA 3UM7A 2EIKC 3ZRSA 4X89A 4XBFA 3TETA 3CC7V 1FXKB 4JAUA 4WFAV 1FFTB 5B1OA 1V55C 2WPDG 3ZRVA 4J9ZB 2WLIA 1R3LC 2ZD9A 3VOUA 5LGUA 5IYDO 1V54B 4X88A 2HVKC 1SZTA 2R9RB 1PNKA 4PDMA 4JYBA 3TCUA 5H6QA 4MVSA 1QLEC 4JAVA 5CA3A 3LDCA 3ZRXA 4RO2A 2V7QG 2W0FC 3OW2U 2NNUA 4RUEA 3W7TA 1FXVA 1ORQC 3SPJA 2IJIA 1NBMG 2XAQA 3JD4A 4RAIA 3ML0A 1DLBA 3OR6C 3ABMB 5B1AC 1BHAA 2GHYA 3ABKB 4PA7A 3T2MA 5L3EA 4HZ3A 4R6ZA 5IDJA 1K4DC 1JPXA 5KUMA 1JOYA 1M56C 3LNMB 3ASOC 3SYOA 2EIMB 1EZJA 4Q20A 2WLHA 3OEEG 4ZKIA 2AHYA 5CBHA 4GCZA 3AG1C 4MTOA 1GO3F 2EZOA 1R6NA 3IFXA 4J9YB 1OCCC 4TWKA 3WG7C 4P9PA 4JTCB 5B3SB 1MABG 3ETEA 1H2GA 3FB7C 3SYQA 3CMEV 3X2QB 1WLEA 5CBGA 1FS0G 3T4ZA 5B1BC 1OCOC 1MG1A 1N8RW 3G6EV 4RQEA 2Q67A 2DWDC 4UUJC 4I9WA 3UKMA 1K5QA 4FPPA 1E1QG 1NR1A 4JYCA 4E2LA 3ZIAG 1QVFU 4GX5A 3PJSK 1NKDA 1COWG 3OM3B 2EILB 1AJNA 2HVJC 2AHZA 1KKDA 1OHHG 4DO2A 1DTOA 3LDDA 1K8AW 3ZJZA 4BIUA 1Y4MA 5HFLA 3QO5A 3IGAC 4MW8A 3ASNC 4U7OA 4MS2A 3CC2V 1OZ0A 4MVRA 2X6CA 4UV9A 4WCEV 1R3IC 5EBLC 1FXKA 1NH2D 1AI6A 1UJWB 2H94A 3ZMTA 4H37A 1VQ4V 4P2ZA 3AEIA 2EBOA 2EIKB 1YHQV 4JTDB 1JCHA 3OAAG 4H33A 5EK0A 1G8MA 2ZDIA 1V55B 3QNEA 2XAHA 3CCMV 1YIJV 2DQ3A 4MVQA 2QE7G 1G4YB 1K4CC 1TUEB 2LFSA 1CEZA 4WFGA 4MW3A 1QLEB 4WF9V 1GM8A 1YITV 1K92A 5EC2C 1MSWD 1QR8A 3BEHA 1VQ7V 1GMGA 4JASA 2XOKG 2WLJA 4KP4A 2OTJV 1I5XA 2XAGA 2XASA 1B6QA 1W0JG 4TT3G 5CBFA 2EZPA 1VQNV 2X6BA 1J95A 3E86A 2IW5A 4UVBA 5B1AB 4QIWF 3K0GA 1ZWIC 2XNDG 3ZMVA 2EINC 2IH3C 2R9IA 2D3OW 2CK3G 4FK5C 1KC8W 1M56B 3JCZA 1VQMV 3ZRWA 3ASOB 3CCSV 3ABUA 2P7TC 4MVZA 3M99B 2QTOA 1SRYA 4UV8A 5KA6A 1VQ8V 2P90A 3AG1B 2Y69C 5LHGA 1KECA 1KD1W 5DM6V 4WFEA 4ASUG 5J9PC 5LHIA 2DW4A 1SESA 2W6IG 3K9AA 1OCCB 1K7DA 4MTXA 4MTFA 3WG7B 3BY6A 3CPWU 3E35A 2P67A 1LNQA 1Q82W 4BW5A 1AJQA 2ZR3A 5B1NA 2ITCC 3ZN1A 3W7UA 1JX9A 1QCEA 5B1BB 1OCOB 3RBZA 4MVMA 5HFMA 3CMAV 3FB6C 1H8EG 5LHHA 3G4SV 1NVPD 3K06A 2Z5UA 3F7YC 1K34A 2NLJC 3H01A 2LP7A 4FMTA 2UXXA 4QPKA 4RUFA 3E8FA 1YI2V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMU A;  1DLB A;  5CN0 A;  1JQ0 A;  1QR9 A;  4FIP C;  1Y4M A;  4JGS A;  5H9C A;  4JF3 A;  1DF4 A;  1QCE A;  3B77 A;  2X7R B;  5HFL A;  1DF5 A;  1QBZ A;  1K33 A;  1SZT A;  2OT5 A;  1JPX A;  1MG1 A;  3P30 A;  3GWO A;  4N21 A;  4FK5 C;  5HFM A;  3B8N A;  3CYO A;  3CP1 A;  1I5Y A;  2MK3 A;  1QR8 A;  3WFV A;  1F23 A;  3M99 B;  4N23 A;  5KA6 A;  1MOF A;  1K34 A;  1I5X A;  2EBO A;  3H01 A;  1ENV A;  2M7W A;  3MHH C;  4E2L A;  2LP7 A;  1Y66 A;  2P6J A;  5KA5 A;  4JPR A;  4FJC C;  2EZP A;  3MHS C;  2EZO A;  3K9A A;  4G2K A;  3B8M A;  1EBO A; 
#chains in the Genus database with same CATH topology
 3A0R A;  2OCC C;  2UU9 B;  2H3O A;  2NN4 A;  5JVD A;  2R70 A;  4YY3 O;  1NQT A;  4NTX A;  2ZXW C;  3OR7 C;  3AG3 C;  2ZDI C;  4I4T B;  4DV4 O;  2OCH A;  3CYO A;  3TK1 A;  1WPX A;  4X1Y A;  2BCC H;  4UCU A;  1PNM A;  1YTF D;  3SPC A;  4OXS A;  2B5U A;  4X62 B;  3HPL C;  2AZ2 A;  4DV0 O;  1HNX B;  4TV9 B;  1OCZ C;  2WSS G;  1AP6 A;  3FB5 C;  2QKC A;  4DV5 B;  3K5N A;  3RYC A;  2JDI G;  2Y0P A;  2Y0I A;  3CCV V;  3ZN0 A;  1W0K G;  5LYJ B;  3ZHS A;  3OE7 G;  3CWB H;  1R73 A;  5KHJ A;  5DEC A;  4BIZ A;  1R6T A;  2Q4P A;  2P5O A;  4J11 A;  3JAT B;  2IJH A;  3ZBH A;  4K8Z A;  5LXT A;  2X6A A;  1FPO A;  2HKO A;  1P84 F;  2CDY A;  1VQL V;  1J5E O;  4UCO A;  4TV8 B;  4GKJ B;  4GKK B;  3KZI Z;  5JCO C;  5FPR A;  1B3Q A;  1XL6 A;  3JAS A;  1M5I A;  1QHT A;  1KYO F;  3K3W A;  4YJ3 A;  2F43 G;  3CJH B;  1Q81 W;  4QE7 A;  3B09 A;  3SJQ C;  2DN9 A;  2QR4 A;  3VQW A;  3HKC A;  4MVO A;  2WLN A;  3EHB B;  3T1C A;  2AGA A;  2WWW A;  3JD3 A;  4QNH B;  1R6K A;  2Q68 A;  1WP8 A;  1PNL A;  2UUB O;  2ZNI A;  2OCC B;  2WAM A;  4O4L A;  1KP2 A;  2EIJ C;  3OMN B;  4HYO A;  3F5T A;  2ZXW B;  3AG3 B;  4CH4 A;  4DR5 O;  1AI5 A;  1Q86 W;  1XOU A;  1NJI W;  3THO A;  3SYC A;  2B1G A;  5C8Y B;  3OGC C;  1JVM A;  3MHH C;  2C2A A;  3CRR A;  3I56 V;  1OCZ B;  5B5E Z;  1VQ9 V;  5BMV B;  1VF7 A;  1NVP B;  4MTG A;  2HP8 A;  1ZLZ A;  4B3T B;  1HR0 O;  2ZE5 A;  2X7R B;  3BHP A;  1V54 C;  4ZI7 B;  2CTR A;  3OEH G;  4ZOL B;  3LUT B;  1XNQ O;  1BL8 A;  4LP8 A;  3DGE A;  3SPH A;  2Q73 A;  3BAA A;  1KU9 A;  2L35 A;  1B04 A;  5BR8 O;  1Y66 A;  4LC1 A;  1XQ8 A;  2YC0 A;  1XMQ B;  4G27 B;  2K9P A;  2PTM A;  2QJ1 A;  4NYK A;  3CSX A;  4FLW A;  4KFM A;  4JYA O;  4LFC B;  1YJN V;  4E4E A;  5DN6 G;  5KHI A;  3CCL V;  1Y74 A;  4FLU A;  3W7X A;  4UVA A;  2ZQM A;  3O65 A;  1GN3 A;  3OMA B;  3VQX A;  1XL4 A;  4PEL A;  2QM7 A;  5L3G A;  2Z0A A;  5LMU B;  4P30 A;  3RYI A;  2HFE C;  3RYF A;  2X0L A;  4LWS A;  2IJK A;  2YUA A;  4EB6 B;  1HNX O;  1B06 A;  4AQY O;  4QGP A;  3K5O A;  5JJN B;  1VF6 C;  5IYB O;  3X2Q C;  4N21 A;  2JIZ G;  4YIO A;  3GWO A;  1FXH A;  1QNM A;  3LSS A;  4X20 B;  1YEW A;  2KG7 A;  3M8A A;  1G1X B;  3GB7 C;  1Y76 B;  3WU2 Z;  2ZM6 O;  3QO7 A;  3E22 A;  2Y4T A;  2EIL C;  4FZ0 A;  4O4I B;  1CXZ B;  2EIJ B;  1V9P A;  1F4N A;  4PA9 A;  4U3F H;  1N33 B;  2PGG A;  2OT5 A;  4EKW A;  4FZ1 A;  2UXN A;  2K1E A;  3FYE B;  4QE9 A;  2UUA B;  3JAM N;  2BTO A;  1AR1 B;  5IYC O;  4GKK O;  4GKJ O;  3N27 A;  3G67 A;  3WB2 A;  4XBF A;  3FFQ A;  3CC7 V;  4JAU A;  2YIB A;  4IGG A;  5KX5 B;  4LFA B;  2WLI A;  1R3L C;  4DR1 O;  4J41 A;  5IYD O;  1V54 B;  5FNV B;  1SZT A;  2R9R B;  1FD9 A;  4X1I A;  4B3M B;  4HNA A;  2P22 C;  4RO2 A;  2W0F C;  1VP7 A;  4BWA A;  3W7T A;  2IJI A;  2XAQ A;  3JD4 A;  2DOS A;  5LYJ A;  3ML0 A;  1DLB A;  2YDE A;  3APO A;  1BHA A;  4PJ0 Z;  1X4T A;  4HZ3 A;  2XTA A;  1JPX A;  4H13 B;  5KUM A;  4I9Q A;  1I0H A;  3ASO C;  3G80 A;  1EZJ A;  4DW1 A;  4I0X B;  3AG1 C;  4UCT A;  2EZO A;  4UFZ A;  1OCC C;  3CX5 F;  4TWK A;  4TV8 A;  3T1Y B;  1MNG A;  3CME V;  4DR6 O;  3X2Q B;  1OCO C;  3G6E V;  2FKX A;  1G6U A;  2Q67 A;  4PV1 B;  4I9W A;  4O2A A;  3GWK C;  1K5Q A;  4FPP A;  1E1Q G;  3CJH A;  4X66 B;  4Z1V A;  1QVF U;  2UXD B;  4NTW A;  1IXB A;  3OM3 B;  2EIL B;  1IBL B;  2PYJ A;  4BIU A;  1XMQ O;  3QO5 A;  3IGA C;  5BY1 A;  4LFC O;  2X6C A;  1JA8 A;  4WCE V;  5EBL C;  1FXK A;  1NH2 D;  1AI6 A;  1UJW B;  2H94 A;  3ZMT A;  1MSD A;  4H37 A;  4P2Z A;  1VQ4 V;  1IDS A;  2UXB B;  1SQV H;  5EK0 A;  5KLV H;  4K8X A;  2ZDI A;  5LP6 C;  3CCM V;  5C8Y A;  4DK0 A;  1QQC A;  2QE7 G;  1CEZ A;  4WFG A;  2F23 A;  4WF9 V;  1K92 A;  3RYC B;  1GMG A;  4JAS A;  3ZHQ A;  4KP4 A;  2XAS A;  3UQ8 A;  1W0J G;  4X1K B;  4DW0 A;  1WP7 A;  3E86 A;  2YXY A;  1Q90 D;  4ZOL A;  1VAR A;  4UVB A;  1H2K A;  2OYQ A;  4DV2 B;  2V4D A;  3K0G A;  1WA8 B;  1ZWI C;  2EIN C;  2CK3 G;  1KC8 W;  3ASO B;  2G38 A;  2IM9 A;  4MVZ A;  1N33 O;  5KA6 A;  1VQ8 V;  3AG1 B;  2UUA O;  5J9P C;  5LHI A;  1OJH A;  1VIB A;  3K9A A;  1OCC B;  2JS3 A;  3BY6 A;  1S5L Z;  2MW2 B;  2P67 A;  5JCO A;  1XHX A;  1JX9 A;  1QCE A;  2EJ7 A;  3HR0 A;  3L71 H;  1OCO B;  1NS1 A;  5HFM A;  4JI2 B;  1ZX3 A;  4FFB B;  4EB6 A;  3HKC B;  1YDX A;  4B3M O;  4DRX B;  2QWP B;  2E76 B;  5LA6 A;  3VQY A;  2A7W A;  3DC6 A;  1BGY H;  1YI2 V;  4IYI A;  4F6E A;  1XRE A;  4X20 A;  3G71 V;  5E79 Z;  5L3C A;  2RMK B;  2KB1 A;  1Z5W A;  2H8P C;  4EFE A;  2Q9L A;  4D6T H;  1GKF A;  4GX0 A;  3SPI A;  2EUL A;  2CE4 A;  2LFR A;  2FTK A;  5EBM C;  2YIC A;  5CN0 A;  3UCS C;  2A3Q A;  5LP6 B;  4NB5 A;  1XMO B;  2UUC B;  4FVM A;  1YTF B;  1D5N A;  1L0L H;  3T1Y O;  3CCR V;  2BSK B;  4J42 A;  3RGB A;  4B3R B;  1JJ2 U;  1OCR C;  2YI8 A;  2N04 A;  5KHK A;  4G28 B;  1KB9 F;  4FJC C;  2PI5 A;  4LF5 O;  3B8M A;  5FNV A;  3HKE B;  4P9O A;  1RPR A;  2DYS C;  2UXD O;  2CH7 A;  4X9Q A;  4JI6 B;  1T5E A;  3F5W C;  4LBE C;  1IBL O;  2EIN B;  3JAR B;  4PDL A;  3ZED A;  4DV3 O;  2JGU A;  4JV5 B;  3NR7 A;  4LCU C;  4DV6 O;  2XAJ A;  2Q69 A;  4QPJ A;  4AI8 A;  2R72 A;  1YF2 A;  3DC5 A;  1S76 D;  3VQV A;  1H2L A;  4WBN A;  4PI0 A;  2CGO A;  3RYI B;  2BTQ B;  4UB8 Z;  1Q6I A;  1YVW A;  1DF4 A;  1H2N A;  2R9A A;  3I5D A;  2IJJ A;  2ITD C;  4I0X A;  1BMF G;  1YCI A;  4B3S B;  3K04 A;  1L8D A;  4H44 B;  1YJW V;  2PZS A;  1SC5 B;  2XAF A;  3D8C A;  3E2E A;  1YZB A;  4I55 B;  4JZG A;  3CD6 V;  1VF6 A;  1MZE A;  3W7W A;  1N0N A;  2KG7 B;  2ZE8 A;  4F4L A;  1NT2 B;  3P32 A;  2ADQ B;  2Q6A A;  1GTO A;  5KUK A;  3MAQ A;  1VQK V;  3WB1 A;  2Q7E A;  1TUB B;  2YEV A;  4O4J A;  2QTS A;  5LGN A;  3SYP A;  3AG4 C;  2WLM A;  2P4V A;  3LDE A;  4JI3 B;  3BAB A;  3JYC A;  2RNB A;  5CA1 B;  5IWA O;  2P6J A;  3RVY A;  5GTI Z;  2OTL V;  3L75 H;  3D36 A;  1XBL A;  4GX2 A;  1FXK C;  4ZBM A;  4CC6 A;  4LF8 B;  4LF9 B;  3JAW B;  3AK2 A;  1VEW A;  4IHJ A;  4TQD A;  1QR9 A;  1URF A;  3J7A U;  1K97 A;  2HG5 C;  1OCR B;  2WLI B;  1F23 A;  1IXM A;  1I7F A;  3H1H H;  4JI2 O;  2QWR B;  4IIJ B;  4X1I B;  4JPR A;  4DR3 B;  4HNA B;  5KAF Z;  1SER A;  1PL4 A;  2DYS B;  3ABK C;  1S77 D;  1Q7Y W;  3CCE V;  1H8H G;  3BRC A;  4MT8 A;  3L73 H;  1VF5 B;  3DTU B;  2EIM C;  4X1K A;  4JI8 B;  2B1I A;  1P7B A;  4GT1 A;  4UXN A;  1BE3 H;  1WA8 A;  4JI4 B;  2RDC A;  2YSU B;  1NR7 A;  4JGS A;  4NXN B;  2AW9 A;  1HNZ B;  2YI9 A;  2MK3 A;  1PKX A;  1SET A;  1THZ A;  4CBC A;  2Q5Z A;  4KHP B;  1Y6X A;  4LH6 A;  5FL7 G;  4B3R O;  4X65 O;  4O2A B;  3R65 A;  4BAY A;  4FFB A;  3JAL A;  2E75 B;  4K0K O;  4PDV A;  1MMM A;  4X8A A;  4RWU A;  3K79 A;  2QA4 V;  1ARO P;  4LF6 O;  3RVZ A;  4DRX A;  3B4S A;  3BA8 A;  3AG4 B;  2GTA A;  3IAY A;  2FYU H;  5IT9 N;  1XDC A;  1ROP A;  4JV5 O;  4J7K A;  4BIO A;  1SS3 A;  4L8J A;  4FM0 A;  1FXK B;  3HKD A;  3OTO B;  2ZD9 A;  4W4L A;  3VOU A;  4CS3 A;  1ZL8 B;  2HVK C;  3ZS8 C;  4JAV A;  2D2C B;  3ZRX A;  2V7Q G;  5LP6 A;  2NNU A;  4RUE A;  4B3S O;  1ORQ C;  3EVK A;  3N2G A;  3H1K H;  1NBM G;  2ZIN A;  1TGO A;  2BSK A;  2ZIM A;  3OR6 C;  4LFB O;  3L9D A;  3K57 A;  3ABK B;  5L3E A;  4LF4 B;  1SQQ H;  1KKC A;  2CGN A;  1GH6 A;  2ETN A;  3LNM B;  5FPO A;  2EIM B;  4Q20 A;  3KKY A;  4ZKI A;  2AHY A;  3HKE A;  1MA1 A;  4FLY A;  3AK3 A;  1R6N A;  3IFX A;  4J9Y B;  4YJ2 B;  4JI3 O;  3JAR A;  3FX7 A;  4JTC B;  3RN4 A;  3ETE A;  1JMK C;  3SYQ A;  2PY5 A;  4LF9 O;  3T4Z A;  4LF8 O;  4PHZ A;  1MG1 A;  1N8R W;  1RSO B;  3RWR D;  2UU9 O;  3QF7 A;  2IBZ H;  1NR1 A;  2BTQ A;  5KHG A;  4J10 A;  2E74 B;  1XEQ A;  2AZ0 A;  2HVJ C;  1KKD A;  4UCS A;  1DTO A;  2LJ2 A;  4X62 O;  1K8A W;  2FB5 A;  3AK1 A;  4DR3 O;  3ZJZ A;  5HFL A;  5LA6 B;  4MW8 A;  3ASN C;  4U7O A;  3K5L A;  4DV5 O;  4I55 A;  4I7Z B;  4MVR A;  1AB3 A;  5H2F Z;  3UO3 A;  1R3I C;  4GYC B;  3AEI A;  2JGD A;  2ZT9 B;  4LF7 B;  1TUB A;  3FAV B;  2LW1 A;  3O9O A;  2DQ3 A;  4JI4 O;  2YXL A;  4OX9 B;  3D36 C;  5CA1 A;  4NKG B;  1QR8 A;  3BEH A;  3CXH F;  2AXT Z;  1VQ7 V;  2LGQ A;  4UCV A;  4H0L B;  3RYH B;  5EYP B;  3CRC A;  3JAW A;  3JAK B;  1F7Y A;  1B6Q A;  4JI1 B;  3U11 A;  1XNR B;  4AHC A;  2JS5 A;  1M93 A;  3JCU Z;  3LNN A;  4FLZ A;  5H5N A;  2VWJ A;  4DR7 B;  5EZY B;  2R9I A;  2D3O W;  2F66 C;  4GZR B;  3JCZ A;  4IIJ A;  3ABU A;  1GAX A;  2CH7 B;  1GN6 A;  4JZ2 A;  2QTO A;  4UV8 A;  2Y69 C;  1U97 A;  1O9H A;  5DED A;  1SES A;  2W6I G;  2FML A;  2YXH A;  3CPW U;  1Q82 W;  1LNQ A;  4OPA A;  2Q7H A;  1AJQ A;  2XT9 A;  2ZR3 A;  3W7U A;  3RBZ A;  1EZV H;  4LNU B;  3ZX6 A;  3OTO O;  4WBN B;  3FB6 C;  2F4V B;  1NVP D;  3F7Y C;  2L6L A;  3H01 A;  3BCC H;  2UXX A;  4QPK A;  4IYH A;  3H9V A;  3TXQ A;  4A5U B;  1SQB H;  1QLN A;  3KCY A;  2W6J G;  3A8T A;  3UT5 B;  3L74 H;  3ASN B;  4I5S A;  3R66 A;  3F7V C;  4CZZ A;  1M57 C;  4B3T O;  3STZ C;  3EXA A;  4N23 A;  2LW7 A;  2E5L B;  1X59 A;  1FFX A;  2YEV B;  4O4J B;  1GM7 A;  4D7T A;  4YHH B;  5J2T B;  2YIA A;  2F93 B;  3ZMS A;  1IX9 A;  3E83 A;  1H38 A;  4FLX A;  2KQX A;  5KMG A;  2XUM A;  3STL C;  3CCQ V;  1K5S A;  1M9N A;  3ZMZ A;  5JH7 A;  5E1A C;  3CP1 A;  4IL6 Z;  4IHJ B;  2ADP A;  1Z2G A;  3FKS G;  1AP5 A;  3ETG A;  2IH1 C;  4JI7 B;  1EFR G;  5L3F A;  1ZL8 A;  3HB3 B;  5LMU O;  1R1B A;  2OIG A;  2DYR C;  1GM9 A;  4PDR A;  1LUW A;  4CS2 A;  1QBZ A;  1P49 A;  2ILM A;  3OUF A;  5AG2 A;  1WB8 A;  5FLX N;  3K0D A;  1WB7 A;  3A2F A;  5BZB A;  2GUZ B;  1SF9 A;  1S5H C;  4KXR A;  1K73 W;  4HAM A;  1S0V A;  3QG5 A;  2Y69 B;  4JAA A;  2M7W A;  2DQ0 A;  5LL6 Y;  3MHS C;  3ABT A;  4DV1 B;  5B66 Z;  3L72 H;  3SYA A;  1VQP V;  2ZR2 A;  5JQG B;  3ETD A;  2LGW A;  4LF7 O;  3K5M A;  2DMX A;  2JEX A;  4HBN A;  1EN6 A;  2N74 A;  4L87 A;  2P4K A;  4YJ2 A;  4OX9 O;  1QVG U;  1ZAU A;  1ENV A;  3T1H B;  1A32 A;  5A2Q N;  4ZIB A;  1RSO A;  2PI4 A;  4JI1 O;  4GX1 A;  1Y67 A;  3VBB A;  4CH6 A;  4X64 B;  3OTF A;  4I50 B;  1L1F A;  1RM1 C;  4LFA O;  1M57 B;  1XI1 A;  3JAL B;  1VQ6 V;  4DR7 O;  3W7S A;  1GK9 A;  5H6R A;  1NTM H;  3E8G A;  2JJ2 G;  2CUG A;  3K58 A;  4DV4 B;  1AJP A;  3OMI B;  2M6Y A;  4YXW G;  3HKD B;  2GBO A;  5K1X A;  1KUQ A;  3ZHU A;  1SKV A;  1WN7 A;  1CP9 A;  1O9G A;  3FAV A;  3S3W A;  3N2K B;  5EIB D;  3MD0 A;  2ZCE A;  1Q6U A;  4J7Z A;  4UVC A;  3ZRW B;  1IBM B;  1R3J C;  1PPJ H;  5LGT A;  3ABM C;  2DYR B;  1EN4 A;  1PD3 A;  3N2G B;  4WFB V;  3RYH A;  3BVO A;  5EYP A;  4CH3 A;  3JAK A;  4JTA B;  1PL0 A;  4UCR A;  1S72 V;  1M1K W;  4U3J A;  1J5E B;  5BXZ A;  3JD2 A;  1KQS U;  3ZHT A;  3OUS A;  5EZY A;  3K59 A;  1K3E A;  4X66 O;  3E8H A;  4R50 A;  5F2V O;  2QM8 A;  4FIP C;  2IU3 A;  4PI2 A;  4PA4 A;  4YHH O;  3JD0 A;  2QKA A;  4WFH A;  4K3A A;  3OT7 A;  4K35 A;  2ZIO A;  4C7U A;  1LUV A;  4FFK A;  2Y48 A;  4PA6 A;  5CB4 A;  2WLL B;  1TVK B;  4OGQ B;  1S3J A;  2HR3 A;  1EBO A;  1GN4 A;  4TQF A;  4LNU A;  1R3K C;  4PA3 A;  4CH5 A;  1HDJ A;  3SPG A;  2UXB O;  3B77 A;  3CS5 A;  3CCJ V;  1VQ5 V;  2WA3 A;  2QSA A;  1RM1 B;  1ZUQ A;  3ZCC A;  5IYZ B;  5LBQ A;  1IUR A;  2UUB B;  2EJR A;  4AIL C;  3UM7 A;  2F1M A;  3UT5 A;  4X89 A;  3TET A;  1FFT B;  5B1O A;  1V55 C;  2JGD B;  2WPD G;  3ZRV A;  3OGI B;  2QWQ B;  5LGU A;  4X88 A;  4DV1 O;  1N36 B;  1PNK A;  3TCU A;  2EX3 A;  4MVS A;  4FLT A;  1WNS A;  4DV2 O;  4DUZ B;  3LDC A;  5J2T A;  2Q0O C;  3OW2 U;  4JI5 B;  1FXV A;  1UFI A;  2GTS A;  1Q6H A;  4LR3 A;  3T1H O;  3ABM B;  2RJZ A;  4NR1 A;  1D5A A;  1SQP H;  1HP8 A;  1JOY A;  1M56 C;  4EEQ A;  2WLH A;  2OWO A;  5CBH A;  3M7M X;  3TJT A;  5A9G A;  4GCZ A;  5LMN B;  3G6B A;  4X64 O;  1SQG A;  5K1P A;  3P3N A;  1YXB A;  1H2M A;  1DGS A;  3WG7 C;  3Q4H B;  3BA9 A;  1FKA O;  3JSL A;  2HHH B;  1H2G A;  3FB7 C;  4NVP A;  2GUZ A;  2NR5 A;  4DK1 A;  1WLE A;  5CBG A;  1FS0 G;  2CTW A;  3H1I H;  4DR2 B;  4RQE A;  1SA0 B;  1XIL A;  3UKM A;  3ZHR A;  5J2U B;  4JYC A;  1NTK H;  4AQY B;  4GX5 A;  3PJS K;  1COW G;  4Z2W A;  5JQG A;  4O2B B;  1OHH G;  4O4H B;  1IBM O;  1Y4M A;  5IJ0 A;  1XUQ A;  3CC2 V;  1OZ0 A;  1XMO O;  4UV9 A;  2ZM6 B;  2UUC O;  3HKB A;  2W0X A;  4GUN A;  2QWO B;  2DJV A;  1RFY A;  1YHQ V;  1GRJ A;  4JTD B;  3J81 N;  3OAA G;  3CB2 A;  2QM4 A;  4H33 A;  2CAZ C;  1V55 B;  3QNE A;  4I50 A;  2XAH A;  4CS4 A;  1FFX B;  2VQE B;  1NU1 H;  1G4Y B;  2LFS A;  3J80 N;  1FAF A;  2RN9 A;  1JFF B;  1PV0 A;  1GM8 A;  1YIT V;  5EC2 C;  4JI6 O;  5KMG B;  2CTP A;  2XOK G;  2WLJ A;  3SDL A;  2XAG A;  5JH7 B;  4DR1 B;  5CBF A;  2EZP A;  1VQN V;  3AG7 A;  2IW5 A;  2VRZ A;  2UXC B;  5LOV B;  1AIL A;  4QIW F;  3C3T A;  3CRA A;  1OV9 A;  2ODM A;  1MZF A;  2XND G;  3ZMV A;  2IH3 C;  4DYL A;  2KKW A;  3N2K A;  4FK5 C;  1M56 B;  1VQM V;  3ZRW A;  4ABM A;  3CCS V;  2ZE7 A;  4B08 A;  2P7T C;  5GTH Z;  2P90 A;  3IC9 A;  1KEC A;  1KD1 W;  1L0N H;  2DW4 A;  3H1J H;  2ZNJ A;  2QGN A;  4MTX A;  3WG7 B;  3E35 A;  3B2E E;  4BR6 A;  2GDS A;  2ITC C;  3ZN1 A;  2HEP A;  1DK1 A;  5ITZ B;  1GN2 A;  5LHH A;  3K06 A;  1N36 O;  1IZ3 A;  4FMT A;  4DUZ O;  4RUF A;  4DR6 B;  4IT5 A;  2YIB D;  2Q7G A;  5IJ9 B;  4F6R A;  1SZX A;  5JJJ B;  4JI5 O;  3IC7 A;  2JK5 C;  1K9M W;  3JD1 A;  1LR1 A;  1M4U A;  1E79 G;  3L70 H;  2A0L A;  3CRQ A;  4Z1M G;  2WLL A;  4JYY A;  1TVK A;  2GSM B;  3T4D A;  2PUS A;  5D5Q A;  1BHB A;  1AI4 A;  4D7S A;  3ABL C;  3U0Z A;  1F4M A;  5LMN O;  1VQO V;  2YS8 A;  4ICG A;  5IYZ A;  4JF3 A;  4FM1 A;  5CA0 A;  1K33 A;  3NXS A;  2VQF B;  2ARH A;  2HHH O;  3SJC C;  2QEX V;  3OFN G;  3P3P A;  2Y4U A;  4DR2 O;  2N05 A;  3DXR B;  5L3D A;  3BPZ A;  3RFR A;  1KP3 A;  5CMU A;  4JI8 O;  1NH2 B;  1HWY A;  3IJ4 A;  4QJF B;  1H2S B;  2Z3Y A;  5KHH A;  2DWE C;  1AR4 A;  3D3Q A;  5EIB C;  4DV7 B;  3CC4 V;  3B8N A;  2QDO A;  4JI0 B;  4NXN O;  1HNZ O;  2CTQ A;  4XDL A;  3BFR A;  2VWK A;  1Z5V A;  1IBK B;  4R8C A;  4MSW C;  1KBH A;  1BZK A;  2YID A;  4U3J B;  1N0J A;  4KHP O;  2RQ6 A;  5C93 A;  2JEU A;  4KUM A;  3AG2 C;  4DUY B;  2V1D A;  2VQE O;  1I5Y A;  1N4C A;  1Q5O A;  2HJF C;  1P4R A;  3Q4H A;  3KG2 A;  4WFF A;  3EFF K;  1AR5 A;  1WAZ A;  5GON B;  1VMG A;  3CE2 A;  4XDJ A;  4XDK A;  1JQ0 A;  4I4T A;  3FD9 A;  1SA0 A;  5D5P A;  4R7C A;  5H9C A;  5CB4 B;  5IY5 C;  3P30 A;  5J2U A;  2UXC O;  3I55 V;  1P7G A;  4TV9 A;  3WFV A;  4O2B A;  1YSC A;  1EM1 A;  3SJA C;  2OIE A;  4O4H A;  3ABL B;  2FL4 A;  2JRI A;  4FLV A;  1W2B U;  4NTY A;  5GW7 A;  3RW0 A;  1RPO A;  3DSQ A;  4PD4 F;  1DF5 A;  1AVM A;  3RT3 C;  2WLK A;  3JAT A;  2IU0 A;  4RQF A;  4W4K A;  3ETQ A;  3CEI A;  3LSQ A;  4LF4 O;  1CPY A;  1MOF A;  3CXC U;  2ZKO A;  1SQF A;  2JJ1 G;  4J80 A;  1Q43 A;  3K08 A;  1FJG B;  3TGU H;  4ZHQ B;  1KMI Z;  1E1R G;  1JR9 A;  1JFF A;  4DR4 B;  3D3I A;  4TUY B;  4MVU A;  3E8B A;  2BOB C;  1WJZ A;  1M90 W;  1S5J A;  2Q8V A;  4LF5 B;  3UO2 A;  1TA8 A;  4U7N A;  1D2D A;  1U96 A;  3FYI B;  3K9S A;  5LOV A;  2BOC C;  3ZMU A;  1ZTE A;  2Q0A A;  2A9H A;  4J7J A;  2A79 B;  2DE0 X;  2XHB A;  4DV3 B;  5B3S C;  5L3B A;  3AG2 B;  5JWP A;  4DV6 B;  5JJE B;  1HNW B;  3FB8 C;  3E89 A;  5JVD B;  3CCU V;  4B7E A;  1W59 A;  3SGI A;  4NXM B;  5EBW C;  2VQF O;  4DXW A;  1N34 B;  2QKS A;  4CC5 A;  5KA5 A;  2PF4 E;  1AI7 A;  2ATK C;  5EC1 C;  2O57 A;  4G2K A;  4X1Y B;  1PM9 A;  3SR2 C;  5ITZ A;  3K03 A;  3QO8 A;  4LH7 A;  1I94 B;  3QVN A;  4TSF G;  1PP9 H;  5IY5 B;  1F51 A;  3B40 A;  1FYJ A;  3JSN A;  1EN5 A;  2HLD G;  1YJ9 V;  5IJ9 A;  4DV7 O;  5BMV A;  1IVS A;  5IJ0 B;  2A06 H;  2EIK C;  3PN1 A;  3H1L H;  4JI0 O;  1WPB A;  3ZRS A;  3HKB B;  4ZI7 A;  4WFA V;  2HJD A;  2P06 A;  4J9Z B;  1N32 B;  2B9Z A;  1IBK O;  3KCX A;  5LXT B;  1XNR O;  4GLX A;  4PDM A;  4JYB A;  2GV9 A;  5H6Q A;  5IWA B;  1QLE C;  4KL1 A;  5CA3 A;  4DUY O;  2LO1 A;  2BE3 A;  3SPJ A;  3JAS B;  4YY3 B;  1Q3E A;  3S3X A;  4RAI A;  5B1A C;  1NTZ H;  2KSD A;  2GHY A;  4UB6 Z;  4PA7 A;  3T2M A;  4R6Z A;  4YJ3 B;  5IDJ A;  1K4D C;  3LSU A;  1US6 A;  1BT8 A;  3DXR A;  4DV0 B;  3SYO A;  3APQ A;  3OEE G;  5KAI Z;  1TAE A;  2F95 B;  3OD4 A;  3GVM A;  2F4V O;  4MTO A;  1GO3 F;  3WB0 A;  4P9P A;  5B3S B;  1MAB G;  4EFB A;  5B1B C;  4O4L B;  1Y76 A;  5TIS Z;  4YIP A;  2DWD C;  4UUJ C;  4O4I A;  4Q6G A;  4E2L A;  3ZIA G;  3ZHV A;  1NKD A;  1AJN A;  1BS3 A;  2AHZ A;  4DO2 A;  3LDD A;  2E3C A;  2E5L O;  3SJB C;  1BSM A;  5IE9 A;  1FJG O;  2VS0 A;  3QTC A;  4F6R B;  4MS2 A;  4DR4 O;  1BCC H;  3MDS A;  1ZSP A;  4TOI A;  5GON A;  4X65 B;  3ICX A;  2LQT A;  3U10 A;  2JVD A;  2EBO A;  3A0B Z;  5KX5 A;  2EIK B;  2WA4 A;  1BQZ A;  1NI8 A;  4K0K B;  1JCH A;  4LF6 B;  1G8M A;  3CRM A;  4BW9 A;  1YIJ V;  4B7K A;  4JI7 O;  4MVQ A;  1K4C C;  1TUE B;  4MW3 A;  1QLE B;  2ZE6 A;  1MSW D;  4OPH A;  1I08 A;  1SQX H;  1HNW O;  2OTJ V;  5CA0 B;  1Y74 B;  1RP3 B;  1I5X A;  3CHX A;  4TT3 G;  2X6B A;  4NXM O;  1J95 A;  1N34 O;  4DR5 B;  3RYF B;  3C3S A;  5B1A B;  3TXS A;  4LWS B;  1NZ6 A;  1XHZ A;  4FM2 A;  3C90 A;  1I94 O;  2RCV A;  1QU7 A;  3M99 B;  4ZHQ A;  1SRY A;  2QWN B;  4LFB B;  1UPG A;  4TUY A;  5LHG A;  5DM6 V;  4WFE A;  4ASU G;  1BQ0 A;  1HW7 A;  1K7D A;  1JJO A;  4MTF A;  1HR0 B;  4BW5 A;  1XNQ B;  5B1N A;  3A0H Z;  3E22 B;  5B1B B;  2PYL A;  4MVM A;  3CMA V;  1N32 O;  5BR8 B;  1H8E G;  3G4S V;  1Q8I A;  2Z5U A;  1K34 A;  2NLJ C;  2LP7 A;  4JYA B;  3E8F A; 
#chains in the Genus database with same CATH homology
 3A0R A;  2OCC C;  3IC7 A;  1QLN A;  2JK5 C;  1K9M W;  2W6J G;  1NQT A;  3JD1 A;  3G71 V;  2ZXW C;  1E79 G;  3OR7 C;  5L3C A;  3AG3 C;  3ASN B;  4I5S A;  2ZDI C;  2KB1 A;  2H8P C;  2A0L A;  3CYO A;  3F7V C;  3TK1 A;  4Z1M G;  2WLL A;  4CZZ A;  1M57 C;  1WPX A;  1GKF A;  4GX0 A;  3SPI A;  3STZ C;  2GSM B;  3T4D A;  4N23 A;  1PNM A;  1YTF D;  2LFR A;  3SPC A;  4OXS A;  2B5U A;  1BHB A;  3HPL C;  1AI4 A;  2FTK A;  2YEV B;  5EBM C;  1GM7 A;  1OCZ C;  2WSS G;  3ABL C;  1F4M A;  3FB5 C;  5CN0 A;  3ZMS A;  1VQO V;  3E83 A;  1H38 A;  2JDI G;  3CCV V;  1YTF B;  3ZN0 A;  1W0K G;  3STL C;  3CCQ V;  4JF3 A;  1K5S A;  1K33 A;  1M9N A;  3NXS A;  3OE7 G;  3CCR V;  1R73 A;  3ZMZ A;  4BIZ A;  5E1A C;  2QEX V;  3CP1 A;  3OFN G;  1JJ2 U;  1OCR C;  3FKS G;  4G28 B;  5L3D A;  3ETG A;  2IH1 C;  2IJH A;  4FJC C;  2PI5 A;  1EFR G;  5L3F A;  2X6A A;  1KP3 A;  3B8M A;  3HB3 B;  5CMU A;  2HKO A;  4P9O A;  1RPR A;  1VQL V;  2DYS C;  1NH2 B;  1HWY A;  4QJF B;  2DYR C;  1GM9 A;  2Z3Y A;  2DWE C;  3F5W C;  4LBE C;  4PDR A;  3CC4 V;  1QBZ A;  2EIN B;  3OUF A;  4PDL A;  1XL6 A;  3B8N A;  3K0D A;  5BZB A;  1K73 W;  1S5H C;  4LCU C;  1S0V A;  4HAM A;  2XAJ A;  2Q69 A;  4QPJ A;  2Y69 B;  2M7W A;  4XDL A;  2DQ0 A;  3K3W A;  3MHS C;  1S76 D;  4R8C A;  4MSW C;  2F43 G;  3ABT A;  1Q81 W;  4QE7 A;  3SYA A;  5C93 A;  3SJQ C;  1VQP V;  2JEU A;  2ZR2 A;  4KUM A;  3AG2 C;  3ETD A;  1DF4 A;  2IJJ A;  2ITD C;  1BMF G;  2JEX A;  2V1D A;  3K04 A;  4MVO A;  1I5Y A;  1YJW V;  2WLN A;  3EHB B;  2HJF C;  4L87 A;  3T1C A;  2WWW A;  3JD3 A;  1P4R A;  1QVG U;  2XAF A;  4QNH B;  1R6K A;  3E2E A;  3KG2 A;  2Q68 A;  4WFF A;  1ENV A;  3EFF K;  3CD6 V;  1PNL A;  4XDJ A;  3W7W A;  4XDK A;  2OCC B;  2WAM A;  1JQ0 A;  1KP2 A;  2EIJ C;  4F4L A;  3P32 A;  2PI4 A;  4R7C A;  4GX1 A;  2Q6A A;  3OMN B;  4HYO A;  5H9C A;  2ZXW B;  1GTO A;  5IY5 C;  5KUK A;  3AG3 B;  3P30 A;  1VQK V;  1AI5 A;  1Q86 W;  3VBB A;  1NJI W;  2YEV A;  3SYC A;  3I55 V;  1L1F A;  5LGN A;  3SYP A;  1RM1 C;  2B1G A;  1M57 B;  3WFV A;  3OGC C;  3AG4 C;  1YSC A;  2WLM A;  1JVM A;  3LDE A;  1VQ6 V;  3W7S A;  3JYC A;  3MHH C;  1GK9 A;  2C2A A;  5H6R A;  3I56 V;  3E8G A;  2P6J A;  1OCZ B;  3ABL B;  2JJ2 G;  3RVY A;  2OTL V;  1VQ9 V;  3D36 A;  4GX2 A;  1FXK C;  4ZBM A;  1W2B U;  1NVP B;  4MTG A;  1QR9 A;  1AJP A;  5GW7 A;  3RW0 A;  1RPO A;  2X7R B;  1V54 C;  1DF5 A;  3OMI B;  4YXW G;  2WLK A;  1K97 A;  3OEH G;  2IU0 A;  3LUT B;  1BL8 A;  4LP8 A;  4RQF A;  2HG5 C;  1OCR B;  3DGE A;  2WLI B;  1CP9 A;  3LSQ A;  3SPH A;  1F23 A;  1IXM A;  1CPY A;  1MOF A;  3CXC U;  2JJ1 G;  1Y66 A;  3MD0 A;  4LC1 A;  3ZRW B;  4UVC A;  4JPR A;  3K08 A;  1R3J C;  4G27 B;  1SER A;  1E1R G;  5LGT A;  2DYS B;  3D3I A;  3ABM C;  4KFM A;  2DYR B;  4MVU A;  3E8B A;  1YJN V;  3ABK C;  1S77 D;  1Q7Y W;  1PD3 A;  5DN6 G;  2BOB C;  4WFB V;  3CCE V;  3CCL V;  1H8H G;  1M90 W;  3W7X A;  4MT8 A;  4JTA B;  4UVA A;  2ZQM A;  1PL0 A;  3DTU B;  3OMA B;  2EIM C;  1XL4 A;  4PEL A;  2QM7 A;  5L3G A;  1S72 V;  1M1K W;  4U7N A;  4P30 A;  2HFE C;  3FYI B;  2X0L A;  2B1I A;  1P7B A;  4GT1 A;  4UXN A;  2BOC C;  3ZMU A;  2A9H A;  3JD2 A;  1KQS U;  3OUS A;  2A79 B;  2IJK A;  2YSU B;  1K3E A;  3E8H A;  4R50 A;  5B3S C;  2QM8 A;  4FIP C;  1NR7 A;  2IU3 A;  3AG2 B;  4JGS A;  4PA4 A;  5L3B A;  5IYB O;  3X2Q C;  3JD0 A;  3FB8 C;  4WFH A;  4N21 A;  2JIZ G;  3E89 A;  3GWO A;  1FXH A;  3LSS A;  3CCU V;  2MK3 A;  1PKX A;  1SET A;  1THZ A;  4CBC A;  5EBW C;  4DXW A;  2Y48 A;  2QKS A;  3GB7 C;  4PA6 A;  5FL7 G;  5KA5 A;  3QO7 A;  1AI7 A;  2WLL B;  2ATK C;  2EIL C;  5EC1 C;  2HR3 A;  1S3J A;  4G2K A;  1EBO A;  2EIJ B;  3R65 A;  1F4N A;  1R3K C;  4PA3 A;  4BAY A;  3K03 A;  3QO8 A;  3SPG A;  4TSF G;  4PA9 A;  3B77 A;  4PDV A;  5IY5 B;  4X8A A;  1F51 A;  3K79 A;  1ARO P;  2QA4 V;  2OT5 A;  4EKW A;  3RVZ A;  3CCJ V;  1VQ5 V;  2UXN A;  2K1E A;  1RM1 B;  3ZCC A;  3FYE B;  4QE9 A;  2HLD G;  1YJ9 V;  3AG4 B;  5LBQ A;  1AR1 B;  5IYC O;  2EJR A;  1ROP A;  3UM7 A;  2EIK C;  3ZRS A;  4X89 A;  4XBF A;  3TET A;  3CC7 V;  1FXK B;  4JAU A;  4WFA V;  1FFT B;  5B1O A;  1V55 C;  2WPD G;  3ZRV A;  4J9Z B;  2WLI A;  1R3L C;  2ZD9 A;  3VOU A;  5LGU A;  5IYD O;  1V54 B;  4X88 A;  2HVK C;  1SZT A;  2R9R B;  1PNK A;  4PDM A;  4JYB A;  3TCU A;  5H6Q A;  4MVS A;  1QLE C;  4JAV A;  5CA3 A;  3LDC A;  3ZRX A;  4RO2 A;  2V7Q G;  2W0F C;  3OW2 U;  2NNU A;  4RUE A;  3W7T A;  1FXV A;  1ORQ C;  3SPJ A;  2IJI A;  1NBM G;  2XAQ A;  3JD4 A;  4RAI A;  3ML0 A;  1DLB A;  3OR6 C;  3ABM B;  5B1A C;  1BHA A;  2GHY A;  3ABK B;  4PA7 A;  3T2M A;  5L3E A;  4HZ3 A;  4R6Z A;  5IDJ A;  1K4D C;  1JPX A;  5KUM A;  1JOY A;  1M56 C;  3LNM B;  3ASO C;  3SYO A;  2EIM B;  1EZJ A;  4Q20 A;  2WLH A;  3OEE G;  4ZKI A;  2AHY A;  5CBH A;  4GCZ A;  3AG1 C;  4MTO A;  1GO3 F;  2EZO A;  1R6N A;  3IFX A;  4J9Y B;  1OCC C;  4TWK A;  3WG7 C;  4P9P A;  4JTC B;  5B3S B;  1MAB G;  3ETE A;  1H2G A;  3FB7 C;  3SYQ A;  3CME V;  3X2Q B;  1WLE A;  5CBG A;  1FS0 G;  3T4Z A;  5B1B C;  1OCO C;  1MG1 A;  1N8R W;  3G6E V;  4RQE A;  2Q67 A;  2DWD C;  4UUJ C;  4I9W A;  3UKM A;  1K5Q A;  4FPP A;  1E1Q G;  1NR1 A;  4JYC A;  4E2L A;  3ZIA G;  1QVF U;  4GX5 A;  3PJS K;  1NKD A;  1COW G;  3OM3 B;  2EIL B;  1AJN A;  2HVJ C;  2AHZ A;  1KKD A;  1OHH G;  4DO2 A;  1DTO A;  3LDD A;  1K8A W;  3ZJZ A;  4BIU A;  1Y4M A;  5HFL A;  3QO5 A;  3IGA C;  4MW8 A;  3ASN C;  4U7O A;  4MS2 A;  3CC2 V;  1OZ0 A;  4MVR A;  2X6C A;  4UV9 A;  4WCE V;  1R3I C;  5EBL C;  1FXK A;  1NH2 D;  1AI6 A;  1UJW B;  2H94 A;  3ZMT A;  4H37 A;  1VQ4 V;  4P2Z A;  3AEI A;  2EBO A;  2EIK B;  1YHQ V;  4JTD B;  1JCH A;  3OAA G;  4H33 A;  5EK0 A;  1G8M A;  2ZDI A;  1V55 B;  3QNE A;  2XAH A;  3CCM V;  1YIJ V;  2DQ3 A;  4MVQ A;  2QE7 G;  1G4Y B;  1K4C C;  1TUE B;  2LFS A;  1CEZ A;  4WFG A;  4MW3 A;  1QLE B;  4WF9 V;  1GM8 A;  1YIT V;  1K92 A;  5EC2 C;  1MSW D;  1QR8 A;  3BEH A;  1VQ7 V;  1GMG A;  4JAS A;  2XOK G;  2WLJ A;  4KP4 A;  2OTJ V;  1I5X A;  2XAG A;  2XAS A;  1B6Q A;  1W0J G;  4TT3 G;  5CBF A;  2EZP A;  1VQN V;  2X6B A;  1J95 A;  3E86 A;  2IW5 A;  4UVB A;  5B1A B;  4QIW F;  3K0G A;  1ZWI C;  2XND G;  3ZMV A;  2EIN C;  2IH3 C;  2R9I A;  2D3O W;  2CK3 G;  4FK5 C;  1KC8 W;  1M56 B;  3JCZ A;  1VQM V;  3ZRW A;  3ASO B;  3CCS V;  3ABU A;  2P7T C;  4MVZ A;  3M99 B;  2QTO A;  1SRY A;  4UV8 A;  5KA6 A;  1VQ8 V;  2P90 A;  3AG1 B;  2Y69 C;  5LHG A;  1KEC A;  1KD1 W;  5DM6 V;  4WFE A;  4ASU G;  5J9P C;  5LHI A;  2DW4 A;  1SES A;  2W6I G;  3K9A A;  1OCC B;  1K7D A;  4MTX A;  4MTF A;  3WG7 B;  3BY6 A;  3CPW U;  3E35 A;  2P67 A;  1LNQ A;  1Q82 W;  4BW5 A;  1AJQ A;  2ZR3 A;  5B1N A;  2ITC C;  3ZN1 A;  3W7U A;  1JX9 A;  1QCE A;  5B1B B;  1OCO B;  3RBZ A;  4MVM A;  5HFM A;  3CMA V;  3FB6 C;  1H8E G;  5LHH A;  3G4S V;  1NVP D;  3K06 A;  2Z5U A;  3F7Y C;  1K34 A;  2NLJ C;  3H01 A;  2LP7 A;  4FMT A;  2UXX A;  4QPK A;  4RUF A;  3E8F A;  1YI2 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...