3WFVA

Hiv-1 crf07 gp41
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
86
structure length
86
Chain Sequence
AGAGQSNDSGIVQQQSNLLRAIEAQQHLLQLTVWGIKQLQTRVLGGGGRWMQWDKEISNYTNTVYRLLEESQNQQERNEKDLLALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope glycoprotein gp160
publication title The crystal structure of HIV CRF07 B'/C gp41 reveals a hyper-mutant site in the middle of HR2 heptad repeat
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 41
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2013-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3wfvA00
1Y66A 5KA6A 2X7RB 2EBOA 3B8MA 3K9AA 1F23A 1SZTA 1QR9A 1DF4A 5HFMA 2OT5A 1QBZA 2M7WA 3CYOA 1QR8A 2EZPA 3GWOA 1EBOA 4FJCC 4FK5C 4E2LA 4G2KA 4JGSA 1MOFA 2EZOA 3B77A 4FIPC 1Y4MA 1DLBA 1I5YA 3M99B 1JPXA 1DF5A 4N23A 3CP1A 5HFLA 5CMUA 1K34A 3B8NA 1QCEA 1K33A 4JF3A 1I5XA 2P6JA 3MHSC 1JQ0A 1ENVA 5H9CA 5KA5A 1MG1A 2LP7A 3H01A 4N21A 3WFVA 2MK3A 4JPRA 3P30A 5CN0A 3MHHC
chains in the Genus database with same CATH superfamily
3ETGA 4XDJA 1XMQB 2OT5A 4NVPA 1H2GA 2QE7G 2ZE5A 2KQXA 1M57C 2VWJA 3A8TA 2IW5A 4WF9V 1K92A 3AK3A 5KA5A 2ZE7A 3SYPA 2L6LA 1GK9A 1M4UA 4LF6O 3FYIB 2E3CA 3T1YO 5CA1A 1R3LC 3RVYA 1N4CA 2GBOA 1VQ8V 5GONB 3PN1A 1Q86W 4DUZB 3CS5A 4EB6A 4O4JA 2VQEO 4CC6A 3AG4B 1N34O 1YJWV 4JI3O 2XNDG 2WLLA 1YIJV 3OAAG 4LH7A 3N27A 5CBGA 4LF9O 4GKJO 4CC5A 1IBKO 3ABMB 3JD2A 4P9OA 2Q68A 3BRCA 4JI7O 2AHZA 3DXRA 1MNGA 3HKBA 1KD1W 2JGUA 1OZ0A 2ZE8A 1WB7A 3CEIA 3B2EE 3CMAV 1PL0A 1KQSU 2UXXA 3L72H 1IURA 1YZBA 5KUMA 3ZBHA 2W0XA 4YY3O 3ETEA 3J7AU 4U7NA 1YTFD 3RYIA 2VS0A 4K0KB 2JRIA 3G80A 1WPBA 4LFAO 4FM0A 1P7GA 3A0RA 3SPJA 2YIAA 2HVKC 2XAFA 1HWYA 1FPOA 2W0FC 2DOSA 3K57A 1AR4A 2HLDG 3HPLC 3OTOO 5B5EZ 3JD3A 3RYFB 1RSOA 4LF5O 4UVCA 4GCZA 4JI8B 2KKWA 3EHBB 1HW7A 4CH5A 4PHZA 4MW8A 4O4HA 4JV5B 4FFKA 3F7VC 3BFRA 1YCIA 1D5NA 2GUZA 3RVZA 4ZIBA 2PI5A 1HNZB 1P84F 4MVQA 1N8RW 3EXAA 1FJGB 2IH1C 4JAVA 1COWG 3CCUV 5IJ0B 3ABLB 3UQ8A 4DV7B 1I7FA 4X9QA 5CB4B 5J2TB 1WPXA 1XEQA 3CCMV 5BR8B 2UUCB 2LGWA 2YIBA 2Q7GA 3UCSC 1FXKC 4KHPO 4GKKB 1TAEA 4JI0B 3T2MA 4WFHA 3E8BA 2QKSA 3N2KA 3ZHQA 4JGSA 5JVDB 2Q0AA 1KP3A 3STZC 4EFEA 4N23A 3L74H 4XDLA 2HHHB 3B8NA 1BCCH 3OMAB 2IJHA 2YXLA 2DMXA 5E79Z 1N33O 4B3TO 1IX9A 3M7MX 1OCRC 5CA1B 5KHJA 3AEIA 1N32B 4NTXA 2XAGA 3BEHA 1V54C 3ZRWA 5B1AC 2OCHA 1SQBH 4EB6B 4CS2A 4DV4B 4O4JB 1SQXH 4HNAA 5KUKA 1V55C 3IAYA 3ETQA 2EILC 3OMIB 4JI1B 2WLLB 4U3FH 3OR6C 1OCOC 1J5EO 4X1IB 4DW0A 1ZL8B 5EYPB 4I9WA 4PD4F 2Q9LA 4DR2B 3CB2A 2UU9B 3UO2A 1Z2GA 1SC5B 1SQVH 2QGNA 2GTAA 4KXRA 4PJ0Z 4FLWA 1B3QA 3CXHF 5EC1C 2NR5A 3B09A 4FK5C 1Q7YW 5IJ9A 2WSSG 4IHJA 4TV8B 1AJPA 1Y76A 1JPXA 4X8AA 2FL4A 3RYIB 4LF4O 4HYOA 1YSCA 3BVOA 1WNSA 3FAVA 2A9HA 1IBLB 2EINC 1GTOA 3MHHC 3UKMA 1FXVA 1G1XB 3MDSA 3A0HZ 2NNUA 2R72A 3JAKA 1RSOB 2ADQB 4U3JA 2ZM6O 3D36C 4UCVA 2D3OW 5H5NA 2EIMB 4JASA 4JI2B 4O4HB 2BSKA 3NXSA 1QCEA 1OCCC 2E5LB 2ZR2A 5K1PA 3ZHRA 5EBLC 3B8MA 5EK0A 3SPHA 1NU1H 2V7QG 4CZZA 1Q5OA 5B1BB 3CCSV 2IU0A 3VOUA 2P90A 4LP8A 3MD0A 2P22C 4J9YB 3K3WA 2QKCA 2E76B 1TUEB 4JI4B 2C2AA 4UCRA 1BSMA 3BPZA 3TETA 2EIJC 1HR0O 1GMGA 4MVZA 1GM9A 1LUVA 3ZEDA 1EN5A 1SA0A 3JATB 3K9SA 4QPJA 3OEEG 4YJ2A 2YDEA 4JYCA 4QE7A 2R9AA 3JCUZ 4TWKA 2XASA 2ZT9B 1VQ5V 2RCVA 1CP9A 2X7RB 1O9HA 1M90W 3E86A 4X1KB 4ZI7A 4WBNA 1I94O 4J10A 2VQFO 3ZRWB 1K3EA 4P9PA 4DO2A 4JTAB 5C8YA 2XT9A 4HNAB 4I55A 3JAMN 1AI6A 1RPOA 2VRZA 1D5AA 5LMNO 3WU2Z 3ASNC 1ZLZA 3QO7A 2PGGA 1X4TA 2Q4PA 2AZ0A 2F4VO 5GTIZ 1PPJH 3TXQA 2NLJC 3HKCA 3LDDA 4QJFB 2PUSA 4EKWA 4B7EA 4WFBV 1I08A 5IJ9B 1WLEA 3L71H 4IHJB 3IC7A 1Y76B 1O9GA 1QBZA 4YHHO 1IBMO 2YUAA 3RBZA 3H1LH 3C3TA 2QSAA 2UUBB 4G28B 5EBWC 5F2VO 3OGIB 4DUYB 4ZBMA 4DV6O 4W4LA 3RGBA 3K0GA 1D2DA 4FLUA 1VEWA 4H44B 1N0JA 3X2QC 1Z5WA 5A9GA 3WFVA 3JAKB 1KB9F 1YJNV 3SYOA 1ORQC 2EBOA 4DR1B 1F23A 2PYJA 4TQDA 3D3QA 3OT7A 5LGNA 3K04A 5LHHA 4JYAO 2BSKB 2YXHA 3ETDA 3FB7C 1G6UA 1S77D 2OTLV 3SR2C 4LF7O 1QLEB 1MSWD 2Q7EA 4L87A 1IZ3A 1KYOF 1NR1A 1XNRB 2G38A 3OM3B 2JJ1G 4U7OA 2WLIA 5L3BA 3EVKA 4I0XA 2QWQB 2AXTZ 4FLXA 2LQTA 3BY6A 1DLBA 1Q8IA 3CCJV 4JZGA 2CH7B 1VQ6V 3VQVA 1SQQH 4H13B 3AG2C 2D2CB 3F5WC 2MW2B 4I5SA 5CN0A 2PY5A 2X6BA 2OCCC 5D5PA 3CSXA 1Q82W 1KC8W 2ITCC 1Q43A 4H37A 2CAZC 3VQYA 3LNNA 2YI9A 5JWPA 3UO3A 1XILA 1N0NA 1OHHG 1SA0B 4OPAA 1HNXO 1DF5A 2ILMA 1ZAUA 1M5IA 1ZUQA 3RT3C 1MA1A 1M56C 3CPWU 3ICXA 4ZI7B 1F7YA 4XBFA 2CE4A 4B3RB 3ZHUA 4PI0A 2V4DA 5L3GA 2DYRC 1SQFA 2LJ2A 2XAQA 3O65A 2ETNA 2NN4A 4I55B 3P3PA 3OEHG 4MS2A 4NTYA 2YXYA 1KU9A 5B3SB 4F6EA 4DV2B 4DR6B 3SGIA 4O4IB 1U97A 3RYFA 4OX9O 1GN3A 3C3SA 4X66O 2QWRB 3K03A 2DYSC 2EZPA 3ZHVA 4P2ZA 1GO3F 3ZX6A 3FB5C 5L3EA 2EIKB 4X65B 3GWKC 3JCZA 4FVMA 4DXWA 4KUMA 5KAIZ 4PI2A 3CMEV 4DK1A 2CTWA 1GN4A 2ATKC 3J80N 1RM1B 3K5OA 3WG7B 4OGQB 5BXZA 3OMNB 2YEVA 1P49A 2FMLA 4MVSA 4RQEA 4JV5O 3RFRA 1K97A 4I50A 3JALB 4CH3A 5EIBC 2XOKG 1KECA 3E35A 1FXKA 4Z2WA 3LDCA 4JI6O 2UXBB 1GRJA 4X62B 2B5UA 1LNQA 2GSMB 2Q6AA 2ZCEA 3K5LA 4FJCC 2QR4A 4YIPA 4DV7O 3JARA 5GTHZ 3OE7G 3SPIA 5LP6A 2UUCO 5LOVA 4X1YB 2WA3A 4IGGA 3ABTA 4F6RA 4JI0O 2WLIB 4DR4O 2E75B 4I0XB 5IDJA 1M57B 1VQKV 1S72V 1NJIW 4AI8A 4ZOLB 2XAHA 1PP9H 2ARHA 5LA6A 4DV3O 1VF6C 4KFMA 1JJOA 3K5MA 4DR7B 2BTOA 4FPPA 2N04A 1XMOB 1VIBA 1VQMV 1W59A 4X1IA 1ZL8A 5EYPA 4FM2A 2A7WA 1LR1A 3LSQA 5FPRA 2OTJV 1N32O 3HB3B 4PA4A 2QEXV 3H9VA 3A2FA 3R65A 4NXNO 5LGTA 3IGAC 2H8PC 3J81N 1YJ9V 4TV8A 1BHAA 2ZDIA 3E2EA 1L0LH 3AG3C 1AI7A 2QM7A 4BWAA 3HKDA 1NBMG 2ZIOA 3K9AA 2WLHA 3P3NA 4CS4A 5IYDO 2HG5C 1EBOA 1R3JC 2RQ6A 1VQ9V 4DR2O 3K79A 2JVDA 1VQNV 5KLVH 2YSUB 3HKEA 5LHIA 3C90A 1AJNA 4AQYO 1GN6A 3AK1A 3ZRXA 1MMMA 3HR0A 3BABA 3LSUA 4C7UA 1PNMA 1JMKC 1BE3H 4GUNA 3ZS8C 2Q73A 4H0LB 2QKAA 3D36A 5LYJA 4DV1O 3T1CA 2O57A 1EM1A 3DTUB 1DGSA 2UXCO 3SDLA 4LFBB 3H1KH 1S3JA 1XNQB 4UVBA 4X89A 4JTDB 4LH6A 2YEVB 2LFRA 4GT1A 4UCTA 2Y4UA 4A5UB 2DE0X 5JCOA 3CCRV 4I50B 5EIBD 2RJZA 3QO8A 1FXKB 2BOCC 2QWNB 4BIUA 4JAAA 4LBEC 1YXBA 1MZEA 1SQPH 2CTPA 4BAYA 1VQLV 3JARB 5GW7A 3JATA 1PD3A 5LP6B 3AG7A 1UJWB 5LOVB 1ZSPA 3CRRA 3F7YC 4EEQA 2EZOA 4F6RB 4K35A 4X1KA 2QDOA 1JQ0A 5DECA 5H9CA 1N34B 2UUAO 4JI3B 2CTQA 4DV5O 5LA6B 5KMGA 1NVPB 4NKGB 4LF9B 2WA4A 4GKJB 1IBKB 2QTSA 1QR9A 5HFMA 3SYAA 3CWBH 5FLXN 4JI7B 3SPCA 2OIEA 1VF7A 1K7DA 2LFSA 3ML0A 1SS3A 4UCSA 1V55B 1AI4A 2GHYA 5IWAB 4CH4A 1XI1A 4ZHQA 4YY3B 1AR5A 5IYCO 1OCOB 2OYQA 4J11A 2JS5A 5H6QA 1H2MA 2A0LA 1JOYA 1JA8A 4MTOA 2HP8A 1XBLA 5L3CA 1IXBA 3R66A 4LF8O 4DV0O 2QM8A 3CP1A 1K4DC 2Y48A 3A0BZ 1KMIZ 2Y4TA 3HKDB 4F4LA 1PNLA 3QF7A 2H3OA 4TUYA 4PV1B 3APQA 4NB5A 5KX5A 1Y67A 4BIOA 1IVSA 1F4NA 1K73W 3HKEB 1BZKA 2QJ1A 2EJRA 1NH2D 1Y6XA 2DN9A 3O9OA 1ZWIC 3JAWA 4DR5O 3DGEA 2ZIMA 5CA0A 1GM8A 2ZD9A 4IIJA 1TVKB 4QNHB 2JK5C 5LYJB 4RQFA 1GAXA 1GH6A 1YITV 1OCCB 5K1XA 3ABKC 2DJVA 1NTZH 2IJIA 4O2AA 5IYBO 4IYHA 1BT8A 1S5LZ 1FD9A 1FS0G 1YEWA 1MG1A 5IY5B 4DR1O 3W7XA 1BS3A 5EZYA 2CH7A 1KUQA 4RUFA 5BY1A 2P7TC 1XREA 1SETA 4MT8A 1UPGA 2F95B 1XL6A 4UCUA 4MVUA 1N33B 2WLKA 2KSDA 4B3TB 4HZ3A 5J9PC 3ZRSA 3BHPA 1MABG 1B6QA 3TK1A 2GDSA 4JYYA 1ZX3A 1AILA 2EIJB 2ZNJA 5IE9A 1KKDA 5IYZB 1YF2A 4HAMA 1QR8A 2E74B 2XTAA 1S5JA 1HNWO 3GB7C 4UB6Z 3T1HO 1S76D 3L73H 2HEPA 1Z5VA 3OUSA 3W7UA 2EULA 4O4LA 2YI8A 1R3KC 5KMGB 4X64B 4GYCB 2KG7B 1J5EB 2LP7A 2HJDA 4JYBA 1WP8A 2QWOB 5JJEB 2X6CA 2KB1A 3ZMUA 5D5QA 4O4IA 4FM1A 3ZMVA 3RYHA 3CRCA 2Y69B 3D3IA 4ZHQB 4DRXA 3OW2U 3ZRVA 4I7ZB 1R3IC 5E1AC 2Z3YA 4FMTA 1K8AW 4JI5O 1H2SB 4LF4B 2X6AA 2P5OA 1P4RA 4GX2A 2PZSA 4E2LA 4Q6GA 4MTGA 4DV2O 4YIOA 3ZN0A 2N05A 4TUYB 1YVWA 3AG1C 4J42A 2ZM6B 2ODMA 3JD1A 3L70H 5H2FZ 5KX5B 4UB8Z 1WA8A 4NXMO 3JALA 1OJHA 3CRMA 4E4EA 3X2QB 4FFBA 2ZXWB 3JAWB 4R7CA 2K9PA 2HR3A 4PA3A 5CA0B 5B1OA 3JASB 4IIJB 2Y0IA 3E8FA 5DM6V 4B3MB 4MSWC 4WFFA 3ASOC 3OR7C 4PDLA 3CX5F 2BCCH 1QLEC 4KP4A 1YHQV 3K06A 4LFCO 4X1YA 4YJ3A 4O2AB 3K0DA 3QG5A 3IC9A 3KCYA 4NR1A 1M93A 1W0KG 2F1MA 3BA9A 1AP5A 3ZCCA 2DW4A 1N36B 2CK3G 5LMUO 4ZOLA 4OPHA 4MVOA 1R6KA 2YIBD 1W2BU 5LXTB 5EZYB 1HR0B 1ENVA 1HDJA 5JJJB 3SJAC 2ZE6A 4X62O 2V1DA 1XMQO 1G8MA 1OCZC 1NZ6A 1KBHA 1F4MA 1XHXA 2HFEC 2F43G 4B7KA 3AG2B 4GZRB 1QVFU 5JQGB 2P6JA 1VMGA 2Y0PA 4LNUA 3EFFK 3JD0A 4MTFA 4WFEA 2VQFB 1AI5A 1SKVA 1NI8A 4CH6A 5KHGA 1BHBA 3RN4A 4DK0A 4DUZO 4O4LB 5FNVA 1L1FA 1IDSA 4K3AA 4J7KA 1XMOO 1M56B 2UXDB 4BW5A 3RYCA 1H8HG 1SF9A 1VF5B 3OGCC 3DSQA 2F4VB 3KG2A 1DTOA 1YTFB 2FB5A 3FYEB 2DYRB 5DN6G 1QVGU 1SQGA 2ZR3A 4DR3B 3RYHB 3FFQA 3W7WA 3QO5A 2OWOA 3K59A 4DRXB 1QU7A 2F23A 1NKDA 4YHHB 1IBMB 4FLVA 4I9QA 3RWRD 1Y74A 2BE3A 2R70A 4K0KO 1L0NH 3CE2A 4DV6B 1AP6A 2DYSB 2MK3A 1QNMA 2IBZH 3VQXA 2EX3A 4QIWF 1GM7A 4GLXA 2CTRA 3AK2A 4B3SB 2GV9A 4X88A 2ITDC 3NR7A 3B77A 4UV9A 1WA8B 3CJHA 4JI8O 3SJBC 1I5YA 4PDMA 1XDCA 3E8GA 1RP3B 4X20A 4LF7B 1BGYH 5C93A 3LUTB 4GX5A 1JJ2U 1HNZO 4MTXA 1NR7A 4FFBB 2QA4V 2QM4A 1FJGO 2WPDG 1DF4A 2H94A 2Z5UA 2PI4A 1H38A 5TISZ 2JDIG 4K8XA 5BR8O 1EZJA 1K5SA 2ZQMA 1H2NA 1Q6HA 4YJ3B 1CPYA 4TOIA 4GKKO 1FYJA 3MAQA 1IXMA 1J95A 2QWPB 3CCEV 1BQ0A 5IT9N 5ITZA 5KHKA 3GWOA 3CYOA 2EJ7A 1MSDA 2HHHO 4CS3A 1XHZA 1K33A 1HNXB 1EZVH 2X0LA 2WLMA 1VQ7V 3AG4C 1Q3EA 2Q0OC 2BOBC 1BMFG 1FKAO 4G27B 1AVMA 2L35A 1VQPV 4LNUB 3E8HA 3ABMC 3FX7A 2PTMA 5KHHA 1VP7A 4GX1A 2YIDA 3ABUA 2HKOA 3K58A 2YS8A 4PDRA 2DQ3A 4DV4O 4EFBA 5FNVB 4R8CA 5LL6Y 3LSSA 3QNEA 4JI1O 4OX9B 4X66B 3RYCB 3BA8A 1S0VA 1FXHA 2CGNA 2UU9O 3ZJZA 1SRYA 3AG3B 2JIZG 5IWAO 2WLNA 1JVMA 4UXNA 2W6JG 2JEUA 1QQCA 2AGAA 5J2UB 3JSNA 3ZMSA 2FTKA 2W6IG 1WJZA 2AW9A 1KKCA 4W4KA 2WLJA 3LNMB 4Q20A 5LBQA 1PL4A 1TVKA 1WP7A 1X59A 1Y74B 2JGDA 3DC6A 1NH2B 1GKFA 4D6TH 4J41A 3G67A 1SESA 3CRQA 4OXSA 1W0JG 4BR6A 1BQZA 1LUWA 1IBLO 3FKSG 1JFFA 4LWSA 2IU3A 3ABLC 2IJKA 3S3WA 5JH7A 3CJHB 1TGOA 4JI6B 1TUBA 3T4DA 4JI2O 2UXNA 4GX0A 4X20B 3CC2V 1RPRA 5CBHA 2ZNIA 2E5LO 3CC7V 4JPRA 3RW0A 2F93B 4IYIA 1VQ4V 4DR4B 1FFXB 1GN2A 3CHXA 4LF6B 3T1YB 4RUEA 2AHYA 1CEZA 2M7WA 5FPOA 3TXSA 4L8JA 1Y4MA 2VWKA 3IJ4A 4DV3B 5IYZA 5LP6C 2Q67A 4LR3A 4YXWG 2VQEB 4MW3A 4DW1A 4JI4O 1JR9A 5ITZB 3G6BA 1EN6A 1E79G 1L8DA 1BL8A 3G4SV 4Z1MG 2KG7A 1VARA 4KL1A 1OCRB 1THZA 2RN9A 2LO1A 1V54B 4BIZA 5B1AB 1Q6UA 3U10A 4JF3A 5BMVA 4ABMA 2IH3C 2GTSA 4NXNB 2EILB 4D7TA 4PA9A 5FL7G 3CXCU 1KP2A 3VBBA 3SJQC 5JJNB 2Q7HA 1R1BA 5KHIA 3CCVV 4LFAB 3SYQA 4X64O 4WFGA 4P30A 4R6ZA 2Q5ZA 4PDVA 2B1IA 1WN7A 1Q81W 2HVJC 3OTOB 3L75H 2Q69A 2DWEC 3DXRB 2IM9A 3HKBB 2A79B 3W7TA 4LF5B 4AQYB 4QPKA 2ZDIC 4R50A 4QE9A 4RO2A 1M9NA 3S3XA 2AZ2A 1VQOV 4NTWA 2LW7A 2Q8VA 3E22A 2YC0A 3UT5A 3B4SA 1JCHA 3H1JH 2EINB 2ZINA 4DV1B 2PYLA 1R73A 4IL6Z 2UXCB 4UV8A 2EIMC 4FZ1A 1F51A 4LCUC 3JASA 4PA6A 2JGDB 3APOA 5EC2C 2PF4E 1EN4A 2UUBO 3CD6V 2OIGA 4DUYO 4KHPB 1PKXA 4JAUA 1NT2B 1JFFB 2JJ2G 4LWSB 4MVMA 2DQ0A 1WAZA 1E1RG 5JH7B 3G6EV 2GUZB 4IT5A 3ABKB 1TUBB 5B1BC 1K5QA 4Z1VA 5LXTA 1K4CC 2FKXA 5IY5C 3I56V 5JCOC 2N74A 3H1HH 1DK1A 3ZN1A 1US6A 4DYLA 1Q6IA 3LDEA 1B04A 4B3MO 2JEXA 1E1QG 5DEDA 1K34A 2R9IA 4TSFG 1R6NA 3P32A 1XNRO 3H01A 3OUFA 3N2KB 2R9RB 2UUAB 3K5NA 5JQGA 1N36O 3CCQV 4DV5B 3IFXA 5AG2A 2M6YA 3PJSK 3Q4HA 1I0HA 3KZIZ 1V9PA 3FB8C 3SYCA 3GVMA 2WWWA 1K9MW 4RAIA 4N21A 3JSLA 1U96A 4B08A 1NVPD 3FD9A 5KA6A 1PNKA 1SZTA 1EFRG 1MZFA 4NYKA 1JX9A 3M8AA 1SZXA 2BTQA 4UVAA 1URFA 5BMVB 4FIPC 1Q90D 3M99B 1YI2V 2DWDC 1TA8A 4LF8B 3I5DA 4DV0B 3E89A 5LHGA 2Y69C 3UM7A 4FLTA 2JS3A 3ASNB 4B3RO 1UFIA 3KKYA 5EBMC 2P67A 3THOA 3TJTA 2UXDO 1AROP 1ROPA 4HBNA 3STLC 3CC4V 4O2BA 4LC1A 4DR6O 3QTCA 4J7ZA 4TV9A 4AILC 1I5XA 1S5HC 3OD4A 4DR3O 4D7SA 5LGUA 2HJFC 4FLYA 2XAJA 1G4YB 1NTMH 3E22B 3CRAA 4DR5B 3UT5B 2RNBA 3U11A 3AG1B 2CUGA 2RMKB 4TT3G 3ZMZA 1XUQA 3JYCA 3OTFA 3G71V 3BCCH 3N2GA 3FAVB 4X65O 3ZIAG 4I4TA 5HFLA 4UCOA 2CGOA 2ZXWC 4K8ZA 3P30A 1Y66A 4U3JB 4B3SO 2P4VA 3WB2A 2Z0AA 3D8CA 1M1KW 1OV9A 3ASOB 1XL4A 4ASUG 4FLZA 2B9ZA 2K1EA 5L3FA 5CBFA 2UXBO 5B1NA 1AB3A 4J9ZB 2A06H 4TQFA 4PELA 4UFZA 1RFYA 3WB1A 1VF6A 1AR1B 2IJJA 1T5EA 3TGUH 4MVRA 3E83A 5GONA 1FFTB 2OCCB 1HNWB 3T1HB 1SERA 1OCZB 2LW1A 1I94B 2XHBA 1QHTA 3B40A 3L9DA 1QLNA 3K08A 5B66Z 3Q4HB 3KCXA 4WFAV 1P7BA 3U0ZA 1B06A 3DC5A 4DR7O 4JTCB 4WCEV 1XQ8A 4J7JA 4CBCA 5LMNB 1AJQA 4YJ2B 3I55V 4JZ2A 5CMUA 3VQWA 2LGQA 2XUMA 2BTQB 4JI5B 4UUJC 3JD4A 4WBNB 1NTKH 2A3QA 5B3SC 5J2UA 4PA7A 5C8YB 4XDKA 2P06A 1A32A 5CA3A 3T4ZA 3TCUA 5A2QN 3F5TA 1WB8A 3MHSC 3CCLV 1NS1A 3WB0A 3BAAA 5BZBA 4ICGA 3SJCC 3OFNG 4QGPA 4J80A 1PM9A 2EIKC 4RWUA 1YDXA 4O2BB 5KAFZ 1H2LA 4TV9B 4ZKIA 3FB6C 1PV0A 4NXMB 4G2KA 2QTOA 2RDCA 3HKCB 1ZTEA 4JYAB 2CDYA 1RM1C 3H1IH 3ZHSA 3WG7C 2FYUH 5IJ0A 1NQTA 1FAFA 3ZMTA 3SPGA 2WAMA 5J2TA 5CB4A 4H33A 1HP8A 3N2GB 1R6TA 4I4TB 4LFCB 2P4KA 4AHCA 1MOFA 1XOUA 1H2KA 1FFXA 3ZHTA 2ADPA 2YICA 2ZKOA 4LFBO 3W7SA 5LMUB 4FZ0A 5JVDA 2B1GA 1XNQO 1H8EG 1CXZB 3QVNA 5L3DA 2F66C 5H6RA 4BW9A
chains in the Genus database with same CATH topology
3OM3B 4RUFA 1VQ4V 2P7TC 2JJ1G 3ETGA 2WLIA 4U7OA 5L3BA 4XDJA 2OT5A 2AHYA 4RUEA 1CEZA 2M7WA 1H2GA 2QE7G 1M57C 1SETA 4MT8A 3BY6A 1Y4MA 2IW5A 4WF9V 1DLBA 1XL6A 1K92A 4MVUA 2WLKA 2Q67A 4HZ3A 3CCJV 5J9PC 1VQ6V 3ZRSA 1MABG 1B6QA 4YXWG 5KA5A 3TK1A 4MW3A 3AG2C 3SYPA 1GK9A 4I5SA 3F5WC 3FYIB 5CN0A 1E79G 2OCCC 1R3LC 2X6BA 3RVYA 1BL8A 3G4SV 1Q82W 2EIJB 2ITCC 4Z1MG 1KC8W 4H37A 1KKDA 1OCRB 4HAMA 1VQ8V 1THZA 1QR8A 1Q86W 1OHHG 3GB7C 1V54B 1S76D 3OUSA 3AG4B 4BIZA 3W7UA 1YJWV 1DF5A 1R3KC 5B1AB 2XNDG 2WLLA 4JF3A 1YIJV 3OAAG 2LP7A 5CBGA 2IH3C 4JYBA 2EILB 1M56C 4PA9A 5FL7G 3CXCU 3ABMB 3CPWU 1KP2A 3JD2A 3VBBA 2X6CA 2KB1A 2Q68A 4P9OA 3SJQC 3ZMUA 4XBFA 2AHZA 1KD1W 3ZMVA 5L3GA 2DYRC 1OZ0A 3CCVV 3SYQA 2XAQA 4WFGA 3CMAV 4P30A 2Y69B 4R6ZA 1PL0A 1KQSU 3D3IA 3OEHG 4MS2A 4PDVA 2B1IA 2UXXA 3ZRVA 3OW2U 1Q81W 2HVJC 5KUMA 1R3IC 5E1AC 2Z3YA 4FMTA 3ETEA 5B3SB 1K8AW 2Q69A 4U7NA 2DWEC 2X6AA 1YTFD 2A79B 3W7TA 4QPKA 2ZDIC 4R50A 4QE9A 4RO2A 1M9NA 3A0RA 3SPJA 1VQOV 3K03A 1P4RA 4GX2A 2DYSC 2HVKC 2EZPA 2XAFA 4E2LA 1HWYA 2W0FC 4P2ZA 3HPLC 2HLDG 4MTGA 1JCHA 3ZN0A 3JD3A 2EINB 1GO3F 3AG1C 3JD1A 3FB5C 4UVCA 5L3EA 4GCZA 2EIKB 1R73A 3EHBB 3JCZA 4MW8A 4DXWA 4UV8A 2EIMC 3F7VC 4KUMA 3CMEV 1F51A 4LCUC 4PA6A 2ATKC 3RVZA 5EC2C 2PI5A 1RM1B 4MVQA 1N8RW 3CD6V 3WG7B 3X2QB 1PKXA 4JAUA 2ZXWB 2IH1C 4JAVA 1COWG 4R7CA 3OMNB 2YEVA 3CCUV 3ABLB 2HR3A 4MVSA 2JJ2G 4PA3A 4RQEA 4MVMA 2DQ0A 5B1OA 1E1RG 3CCMV 1WPXA 1K97A 3G6EV 3E8FA 5DM6V 4MSWC 4WFFA 3ASOC 3OR7C 4PDLA 2XOKG 1KECA 3E35A 1QLEC 1FXKA 3ABKB 4KP4A 5B1BC 1YHQV 3K06A 1K5QA 1FXKC 3LDCA 1K4CC 3T2MA 3K0DA 5IY5C 4WFHA 3E8BA 2B5UA 1LNQA 1W0KG 2QKSA 2GSMB 2Q6AA 3ZCCA 3I56V 4FJCC 2DW4A 2CK3G 4JGSA 3OE7G 1KP3A 3ZN1A 3STZC 3LDEA 3SPIA 4MVOA 2JEXA 1E1QG 1R6KA 4N23A 4XDLA 1W2BU 1K34A 3B8NA 2R9IA 1ENVA 3ABTA 1R6NA 3P32A 4TSFG 3H01A 3OUFA 2WLIB 3OMAB 2IJHA 2R9RB 5IDJA 1M57B 2V1DA 1VQKV 1S72V 1NJIW 3CCQV 1G8MA 1OCZC 3IFXA 2XAHA 1F4MA 2HFEC 3PJSK 3FB8C 2F43G 4KFMA 3AG2B 3SYCA 1QVFU 4FPPA 2WWWA 1OCRC 1K9MW 3AEIA 2P6JA 3EFFK 3JD0A 4RAIA 2XAGA 4MTFA 4WFEA 3BEHA 1V54C 1AI5A 1VQMV 4N21A 3ZRWA 5B1AC 1NVPD 1BHBA 5KA6A 1PNKA 3LSQA 1SZTA 5KUKA 1V55C 1EFRG 2EILC 3OMIB 1JX9A 1L1FA 2WLLB 4UVAA 2OTJV 3HB3B 3OR6C 1OCOC 4FIPC 4PA4A 1M56B 2QEXV 3M99B 4BW5A 1H8HG 1YI2V 4I9WA 3R65A 2DWDC 3OGCC 5LGTA 3KG2A 3IGAC 1DTOA 2H8PC 3E89A 1YTFB 3FYEB 2DYRB 1YJ9V 5DN6G 5LHGA 2Y69C 1QVGU 3UM7A 1BHAA 3ASNB 2ZR3A 2ZDIA 3E2EA 3AG3C 1AI7A 2QM7A 1NBMG 5EBMC 3K9AA 2WLHA 3W7WA 2P67A 3QO5A 5IYDO 5EC1C 2HG5C 4FK5C 1EBOA 1AROP 1R3JC 1ROPA 1VQ9V 1Q7YW 1NKDA 3K79A 3STLC 2WSSG 3CC4V 1VQNV 1AJPA 4LC1A 1JPXA 4X8AA 2YSUB 4HYOA 5LHIA 1I5XA 1S5HC 1YSCA 1AJNA 5LGUA 2HJFC 3ZRXA 2XAJA 2DYSB 1G4YB 1PNMA 2MK3A 2A9HA 2EINC 1GTOA 3MHHC 3UKMA 1FXVA 2NNUA 3AG1B 4QIWF 1GM7A 4TT3G 3D36A 3ZMZA 4X88A 2ITDC 3JYCA 3B77A 3G71V 3T1CA 2D3OW 4UV9A 2EIMB 4JASA 1I5YA 4PDMA 3E8GA 3DTUB 3ZIAG 5HFLA 3NXSA 1QCEA 1OCCC 2ZXWC 5C93A 3LUTB 4GX5A 1S3JA 3P30A 2ZR2A 1JJ2U 4UVBA 1Y66A 4X89A 4MTXA 1NR7A 4JTDB 2QA4V 5EBLC 3B8MA 2YEVB 2WPDG 2LFRA 4GT1A 1DF4A 5EK0A 3SPHA 2H94A 2Z5UA 1M1KW 2V7QG 3CCRV 2PI4A 3ASOB 1XL4A 1H38A 4ASUG 4CZZA 5B1BB 3CCSV 2JDIG 2IU0A 3QO8A 3VOUA 1FXKB 2K1EA 2P90A 5L3FA 4LP8A 3MD0A 2BOCC 1EZJA 5CBFA 1K5SA 2ZQMA 4BIUA 1CPYA 4J9YB 3K3WA 4LBEC 4BAYA 5B1NA 1VQLV 4J9ZB 1TUEB 1IXMA 5GW7A 1J95A 4PELA 3CCEV 1PD3A 2C2AA 1UJWB 3GWOA 3CYOA 1AR1B 2IJJA 3F7YC 3TETA 2EZOA 2EIJC 1GMGA 4MVZA 4MVRA 3E83A 1GM9A 1FFTB 2OCCB 1K33A 1SERA 1OCZB 1JQ0A 5H9CA 2X0LA 4QPJA 3OEEG 2WLMA 1VQ7V 1QLNA 3K08A 3AG4C 4JYCA 4QE7A 4WFAV 4TWKA 1NVPB 2XASA 2BOBC 1VQ5V 2X7RB 1CP9A 1P7BA 1BMFG 1M90W 1QR9A 5HFMA 4G27B 3E86A 3SYAA 4JTCB 1VQPV 4WCEV 3E8HA 3ABMC 3SPCA 4CBCA 3ZRWB 1K3EA 1AJQA 1K7DA 2LFSA 3I55V 3ML0A 4P9PA 4DO2A 4GX1A 4JTAB 5CMUA 3ABUA 2HKOA 1V55B 1AI4A 2GHYA 4PDRA 2DQ3A 1AI6A 4R8CA 5IYCO 1OCOB 1RPOA 4UUJC 3JD4A 3LSSA 3QNEA 5B3SC 4PA7A 5H6QA 2A0LA 4XDKA 3ASNC 3QO7A 1JOYA 5CA3A 4MTOA 3T4ZA 5L3CA 1S0VA 1FXHA 3ZJZA 1SRYA 3AG3B 2JIZG 3TCUA 2WLNA 2QM8A 1JVMA 3CP1A 1K4DC 2Y48A 4UXNA 2W6JG 3MHSC 3CCLV 2JEUA 4F4LA 1PNLA 5BZBA 2NLJC 3OFNG 3LDDA 3ZMSA 4QJFB 2FTKA 2W6IG 2WLJA 4EKWA 4WFBV 3LNMB 2EIKC 1WLEA 3IC7A 4Q20A 1QBZA 1F4NA 1K73W 4ZKIA 5LBQA 3FB6C 3RBZA 4G2KA 1NH2B 1GKFA 2QTOA 2EJRA 1NH2D 1SESA 4G28B 4OXSA 5EBWC 1W0JG 4ZBMA 3K0GA 1ZWIC 1RM1C 3FKSG 3WG7C 3X2QC 1NQTA 3ZMTA 3SPGA 3WFVA 3DGEA 2IU3A 1GM8A 2ZD9A 2WAMA 3ABLC 2IJKA 4QNHB 1YJNV 2JK5C 3SYOA 1ORQC 2EBOA 4H33A 1F23A 5LGNA 3K04A 5LHHA 4RQFA 3ETDA 1YITV 3FB7C 3T4DA 1OCCB 2UXNA 4GX0A 3ABKC 3CC2V 1MOFA 2IJIA 1S77D 5IYBO 2OTLV 1QLEB 1MSWD 3W7SA 1RPRA 1FS0G 5CBHA 4L87A 2B1GA 3CC7V 1MG1A 5IY5B 1H8EG 5L3DA 3W7XA 4JPRA 3RW0A 5H6RA 1NR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y66 A;  5KA6 A;  2X7R B;  2EBO A;  3B8M A;  3K9A A;  1F23 A;  1SZT A;  1QR9 A;  1DF4 A;  5HFM A;  2OT5 A;  1QBZ A;  2M7W A;  3CYO A;  1QR8 A;  2EZP A;  3GWO A;  1EBO A;  4FJC C;  4FK5 C;  4E2L A;  4G2K A;  4JGS A;  1MOF A;  2EZO A;  3B77 A;  4FIP C;  1Y4M A;  1DLB A;  1I5Y A;  3M99 B;  1JPX A;  1DF5 A;  4N23 A;  3CP1 A;  5HFL A;  5CMU A;  1K34 A;  3B8N A;  1QCE A;  1K33 A;  4JF3 A;  1I5X A;  2P6J A;  3MHS C;  1JQ0 A;  1ENV A;  5H9C A;  5KA5 A;  1MG1 A;  2LP7 A;  3H01 A;  4N21 A;  3WFV A;  2MK3 A;  4JPR A;  3P30 A;  5CN0 A;  3MHH C; 
#chains in the Genus database with same CATH topology
 3ETG A;  4XDJ A;  1XMQ B;  2OT5 A;  4NVP A;  1H2G A;  2QE7 G;  2ZE5 A;  2KQX A;  1M57 C;  2VWJ A;  3A8T A;  2IW5 A;  4WF9 V;  1K92 A;  3AK3 A;  5KA5 A;  2ZE7 A;  3SYP A;  2L6L A;  1GK9 A;  1M4U A;  4LF6 O;  3FYI B;  2E3C A;  3T1Y O;  5CA1 A;  1R3L C;  3RVY A;  1N4C A;  2GBO A;  1VQ8 V;  5GON B;  3PN1 A;  1Q86 W;  4DUZ B;  3CS5 A;  4EB6 A;  4O4J A;  2VQE O;  4CC6 A;  3AG4 B;  1N34 O;  1YJW V;  4JI3 O;  2XND G;  2WLL A;  1YIJ V;  3OAA G;  4LH7 A;  3N27 A;  5CBG A;  4LF9 O;  4GKJ O;  4CC5 A;  1IBK O;  3ABM B;  3JD2 A;  4P9O A;  2Q68 A;  3BRC A;  4JI7 O;  2AHZ A;  3DXR A;  1MNG A;  3HKB A;  1KD1 W;  2JGU A;  1OZ0 A;  2ZE8 A;  1WB7 A;  3CEI A;  3B2E E;  3CMA V;  1PL0 A;  1KQS U;  2UXX A;  3L72 H;  1IUR A;  1YZB A;  5KUM A;  3ZBH A;  2W0X A;  4YY3 O;  3ETE A;  3J7A U;  4U7N A;  1YTF D;  3RYI A;  2VS0 A;  4K0K B;  2JRI A;  3G80 A;  1WPB A;  4LFA O;  4FM0 A;  1P7G A;  3A0R A;  3SPJ A;  2YIA A;  2HVK C;  2XAF A;  1HWY A;  1FPO A;  2W0F C;  2DOS A;  3K57 A;  1AR4 A;  2HLD G;  3HPL C;  3OTO O;  5B5E Z;  3JD3 A;  3RYF B;  1RSO A;  4LF5 O;  4UVC A;  4GCZ A;  4JI8 B;  2KKW A;  3EHB B;  1HW7 A;  4CH5 A;  4PHZ A;  4MW8 A;  4O4H A;  4JV5 B;  4FFK A;  3F7V C;  3BFR A;  1YCI A;  1D5N A;  2GUZ A;  3RVZ A;  4ZIB A;  2PI5 A;  1HNZ B;  1P84 F;  4MVQ A;  1N8R W;  3EXA A;  1FJG B;  2IH1 C;  4JAV A;  1COW G;  3CCU V;  5IJ0 B;  3ABL B;  3UQ8 A;  4DV7 B;  1I7F A;  4X9Q A;  5CB4 B;  5J2T B;  1WPX A;  1XEQ A;  3CCM V;  5BR8 B;  2UUC B;  2LGW A;  2YIB A;  2Q7G A;  3UCS C;  1FXK C;  4KHP O;  4GKK B;  1TAE A;  4JI0 B;  3T2M A;  4WFH A;  3E8B A;  2QKS A;  3N2K A;  3ZHQ A;  4JGS A;  5JVD B;  2Q0A A;  1KP3 A;  3STZ C;  4EFE A;  4N23 A;  3L74 H;  4XDL A;  2HHH B;  3B8N A;  1BCC H;  3OMA B;  2IJH A;  2YXL A;  2DMX A;  5E79 Z;  1N33 O;  4B3T O;  1IX9 A;  3M7M X;  1OCR C;  5CA1 B;  5KHJ A;  3AEI A;  1N32 B;  4NTX A;  2XAG A;  3BEH A;  1V54 C;  3ZRW A;  5B1A C;  2OCH A;  1SQB H;  4EB6 B;  4CS2 A;  4DV4 B;  4O4J B;  1SQX H;  4HNA A;  5KUK A;  1V55 C;  3IAY A;  3ETQ A;  2EIL C;  3OMI B;  4JI1 B;  2WLL B;  4U3F H;  3OR6 C;  1OCO C;  1J5E O;  4X1I B;  4DW0 A;  1ZL8 B;  5EYP B;  4I9W A;  4PD4 F;  2Q9L A;  4DR2 B;  3CB2 A;  2UU9 B;  3UO2 A;  1Z2G A;  1SC5 B;  1SQV H;  2QGN A;  2GTA A;  4KXR A;  4PJ0 Z;  4FLW A;  1B3Q A;  3CXH F;  5EC1 C;  2NR5 A;  3B09 A;  4FK5 C;  1Q7Y W;  5IJ9 A;  2WSS G;  4IHJ A;  4TV8 B;  1AJP A;  1Y76 A;  1JPX A;  4X8A A;  2FL4 A;  3RYI B;  4LF4 O;  4HYO A;  1YSC A;  3BVO A;  1WNS A;  3FAV A;  2A9H A;  1IBL B;  2EIN C;  1GTO A;  3MHH C;  3UKM A;  1FXV A;  1G1X B;  3MDS A;  3A0H Z;  2NNU A;  2R72 A;  3JAK A;  1RSO B;  2ADQ B;  4U3J A;  2ZM6 O;  3D36 C;  4UCV A;  2D3O W;  5H5N A;  2EIM B;  4JAS A;  4JI2 B;  4O4H B;  2BSK A;  3NXS A;  1QCE A;  1OCC C;  2E5L B;  2ZR2 A;  5K1P A;  3ZHR A;  5EBL C;  3B8M A;  5EK0 A;  3SPH A;  1NU1 H;  2V7Q G;  4CZZ A;  1Q5O A;  5B1B B;  3CCS V;  2IU0 A;  3VOU A;  2P90 A;  4LP8 A;  3MD0 A;  2P22 C;  4J9Y B;  3K3W A;  2QKC A;  2E76 B;  1TUE B;  4JI4 B;  2C2A A;  4UCR A;  1BSM A;  3BPZ A;  3TET A;  2EIJ C;  1HR0 O;  1GMG A;  4MVZ A;  1GM9 A;  1LUV A;  3ZED A;  1EN5 A;  1SA0 A;  3JAT B;  3K9S A;  4QPJ A;  3OEE G;  4YJ2 A;  2YDE A;  4JYC A;  4QE7 A;  2R9A A;  3JCU Z;  4TWK A;  2XAS A;  2ZT9 B;  1VQ5 V;  2RCV A;  1CP9 A;  2X7R B;  1O9H A;  1M90 W;  3E86 A;  4X1K B;  4ZI7 A;  4WBN A;  1I94 O;  4J10 A;  2VQF O;  3ZRW B;  1K3E A;  4P9P A;  4DO2 A;  4JTA B;  5C8Y A;  2XT9 A;  4HNA B;  4I55 A;  3JAM N;  1AI6 A;  1RPO A;  2VRZ A;  1D5A A;  5LMN O;  3WU2 Z;  3ASN C;  1ZLZ A;  3QO7 A;  2PGG A;  1X4T A;  2Q4P A;  2AZ0 A;  2F4V O;  5GTI Z;  1PPJ H;  3TXQ A;  2NLJ C;  3HKC A;  3LDD A;  4QJF B;  2PUS A;  4EKW A;  4B7E A;  4WFB V;  1I08 A;  5IJ9 B;  1WLE A;  3L71 H;  4IHJ B;  3IC7 A;  1Y76 B;  1O9G A;  1QBZ A;  4YHH O;  1IBM O;  2YUA A;  3RBZ A;  3H1L H;  3C3T A;  2QSA A;  2UUB B;  4G28 B;  5EBW C;  5F2V O;  3OGI B;  4DUY B;  4ZBM A;  4DV6 O;  4W4L A;  3RGB A;  3K0G A;  1D2D A;  4FLU A;  1VEW A;  4H44 B;  1N0J A;  3X2Q C;  1Z5W A;  5A9G A;  3WFV A;  3JAK B;  1KB9 F;  1YJN V;  3SYO A;  1ORQ C;  2EBO A;  4DR1 B;  1F23 A;  2PYJ A;  4TQD A;  3D3Q A;  3OT7 A;  5LGN A;  3K04 A;  5LHH A;  4JYA O;  2BSK B;  2YXH A;  3ETD A;  3FB7 C;  1G6U A;  1S77 D;  2OTL V;  3SR2 C;  4LF7 O;  1QLE B;  1MSW D;  2Q7E A;  4L87 A;  1IZ3 A;  1KYO F;  1NR1 A;  1XNR B;  2G38 A;  3OM3 B;  2JJ1 G;  4U7O A;  2WLI A;  5L3B A;  3EVK A;  4I0X A;  2QWQ B;  2AXT Z;  4FLX A;  2LQT A;  3BY6 A;  1DLB A;  1Q8I A;  3CCJ V;  4JZG A;  2CH7 B;  1VQ6 V;  3VQV A;  1SQQ H;  4H13 B;  3AG2 C;  2D2C B;  3F5W C;  2MW2 B;  4I5S A;  5CN0 A;  2PY5 A;  2X6B A;  2OCC C;  5D5P A;  3CSX A;  1Q82 W;  1KC8 W;  2ITC C;  1Q43 A;  4H37 A;  2CAZ C;  3VQY A;  3LNN A;  2YI9 A;  5JWP A;  3UO3 A;  1XIL A;  1N0N A;  1OHH G;  1SA0 B;  4OPA A;  1HNX O;  1DF5 A;  2ILM A;  1ZAU A;  1M5I A;  1ZUQ A;  3RT3 C;  1MA1 A;  1M56 C;  3CPW U;  3ICX A;  4ZI7 B;  1F7Y A;  4XBF A;  2CE4 A;  4B3R B;  3ZHU A;  4PI0 A;  2V4D A;  5L3G A;  2DYR C;  1SQF A;  2LJ2 A;  2XAQ A;  3O65 A;  2ETN A;  2NN4 A;  4I55 B;  3P3P A;  3OEH G;  4MS2 A;  4NTY A;  2YXY A;  1KU9 A;  5B3S B;  4F6E A;  4DV2 B;  4DR6 B;  3SGI A;  4O4I B;  1U97 A;  3RYF A;  4OX9 O;  1GN3 A;  3C3S A;  4X66 O;  2QWR B;  3K03 A;  2DYS C;  2EZP A;  3ZHV A;  4P2Z A;  1GO3 F;  3ZX6 A;  3FB5 C;  5L3E A;  2EIK B;  4X65 B;  3GWK C;  3JCZ A;  4FVM A;  4DXW A;  4KUM A;  5KAI Z;  4PI2 A;  3CME V;  4DK1 A;  2CTW A;  1GN4 A;  2ATK C;  3J80 N;  1RM1 B;  3K5O A;  3WG7 B;  4OGQ B;  5BXZ A;  3OMN B;  2YEV A;  1P49 A;  2FML A;  4MVS A;  4RQE A;  4JV5 O;  3RFR A;  1K97 A;  4I50 A;  3JAL B;  4CH3 A;  5EIB C;  2XOK G;  1KEC A;  3E35 A;  1FXK A;  4Z2W A;  3LDC A;  4JI6 O;  2UXB B;  1GRJ A;  4X62 B;  2B5U A;  1LNQ A;  2GSM B;  2Q6A A;  2ZCE A;  3K5L A;  4FJC C;  2QR4 A;  4YIP A;  4DV7 O;  3JAR A;  5GTH Z;  3OE7 G;  3SPI A;  5LP6 A;  2UUC O;  5LOV A;  4X1Y B;  2WA3 A;  4IGG A;  3ABT A;  4F6R A;  4JI0 O;  2WLI B;  4DR4 O;  2E75 B;  4I0X B;  5IDJ A;  1M57 B;  1VQK V;  1S72 V;  1NJI W;  4AI8 A;  4ZOL B;  2XAH A;  1PP9 H;  2ARH A;  5LA6 A;  4DV3 O;  1VF6 C;  4KFM A;  1JJO A;  3K5M A;  4DR7 B;  2BTO A;  4FPP A;  2N04 A;  1XMO B;  1VIB A;  1VQM V;  1W59 A;  4X1I A;  1ZL8 A;  5EYP A;  4FM2 A;  2A7W A;  1LR1 A;  3LSQ A;  5FPR A;  2OTJ V;  1N32 O;  3HB3 B;  4PA4 A;  2QEX V;  3H9V A;  3A2F A;  3R65 A;  4NXN O;  5LGT A;  3IGA C;  2H8P C;  3J81 N;  1YJ9 V;  4TV8 A;  1BHA A;  2ZDI A;  3E2E A;  1L0L H;  3AG3 C;  1AI7 A;  2QM7 A;  4BWA A;  3HKD A;  1NBM G;  2ZIO A;  3K9A A;  2WLH A;  3P3N A;  4CS4 A;  5IYD O;  2HG5 C;  1EBO A;  1R3J C;  2RQ6 A;  1VQ9 V;  4DR2 O;  3K79 A;  2JVD A;  1VQN V;  5KLV H;  2YSU B;  3HKE A;  5LHI A;  3C90 A;  1AJN A;  4AQY O;  1GN6 A;  3AK1 A;  3ZRX A;  1MMM A;  3HR0 A;  3BAB A;  3LSU A;  4C7U A;  1PNM A;  1JMK C;  1BE3 H;  4GUN A;  3ZS8 C;  2Q73 A;  4H0L B;  2QKA A;  3D36 A;  5LYJ A;  4DV1 O;  3T1C A;  2O57 A;  1EM1 A;  3DTU B;  1DGS A;  2UXC O;  3SDL A;  4LFB B;  3H1K H;  1S3J A;  1XNQ B;  4UVB A;  4X89 A;  4JTD B;  4LH6 A;  2YEV B;  2LFR A;  4GT1 A;  4UCT A;  2Y4U A;  4A5U B;  2DE0 X;  5JCO A;  3CCR V;  4I50 B;  5EIB D;  2RJZ A;  3QO8 A;  1FXK B;  2BOC C;  2QWN B;  4BIU A;  4JAA A;  4LBE C;  1YXB A;  1MZE A;  1SQP H;  2CTP A;  4BAY A;  1VQL V;  3JAR B;  5GW7 A;  3JAT A;  1PD3 A;  5LP6 B;  3AG7 A;  1UJW B;  5LOV B;  1ZSP A;  3CRR A;  3F7Y C;  4EEQ A;  2EZO A;  4F6R B;  4K35 A;  4X1K A;  2QDO A;  1JQ0 A;  5DEC A;  5H9C A;  1N34 B;  2UUA O;  4JI3 B;  2CTQ A;  4DV5 O;  5LA6 B;  5KMG A;  1NVP B;  4NKG B;  4LF9 B;  2WA4 A;  4GKJ B;  1IBK B;  2QTS A;  1QR9 A;  5HFM A;  3SYA A;  3CWB H;  5FLX N;  4JI7 B;  3SPC A;  2OIE A;  1VF7 A;  1K7D A;  2LFS A;  3ML0 A;  1SS3 A;  4UCS A;  1V55 B;  1AI4 A;  2GHY A;  5IWA B;  4CH4 A;  1XI1 A;  4ZHQ A;  4YY3 B;  1AR5 A;  5IYC O;  1OCO B;  2OYQ A;  4J11 A;  2JS5 A;  5H6Q A;  1H2M A;  2A0L A;  1JOY A;  1JA8 A;  4MTO A;  2HP8 A;  1XBL A;  5L3C A;  1IXB A;  3R66 A;  4LF8 O;  4DV0 O;  2QM8 A;  3CP1 A;  1K4D C;  2Y48 A;  3A0B Z;  1KMI Z;  2Y4T A;  3HKD B;  4F4L A;  1PNL A;  3QF7 A;  2H3O A;  4TUY A;  4PV1 B;  3APQ A;  4NB5 A;  5KX5 A;  1Y67 A;  4BIO A;  1IVS A;  1F4N A;  1K73 W;  3HKE B;  1BZK A;  2QJ1 A;  2EJR A;  1NH2 D;  1Y6X A;  2DN9 A;  3O9O A;  1ZWI C;  3JAW A;  4DR5 O;  3DGE A;  2ZIM A;  5CA0 A;  1GM8 A;  2ZD9 A;  4IIJ A;  1TVK B;  4QNH B;  2JK5 C;  5LYJ B;  4RQF A;  1GAX A;  1GH6 A;  1YIT V;  1OCC B;  5K1X A;  3ABK C;  2DJV A;  1NTZ H;  2IJI A;  4O2A A;  5IYB O;  4IYH A;  1BT8 A;  1S5L Z;  1FD9 A;  1FS0 G;  1YEW A;  1MG1 A;  5IY5 B;  4DR1 O;  3W7X A;  1BS3 A;  5EZY A;  2CH7 A;  1KUQ A;  4RUF A;  5BY1 A;  2P7T C;  1XRE A;  1SET A;  4MT8 A;  1UPG A;  2F95 B;  1XL6 A;  4UCU A;  4MVU A;  1N33 B;  2WLK A;  2KSD A;  4B3T B;  4HZ3 A;  5J9P C;  3ZRS A;  3BHP A;  1MAB G;  1B6Q A;  3TK1 A;  2GDS A;  4JYY A;  1ZX3 A;  1AIL A;  2EIJ B;  2ZNJ A;  5IE9 A;  1KKD A;  5IYZ B;  1YF2 A;  4HAM A;  1QR8 A;  2E74 B;  2XTA A;  1S5J A;  1HNW O;  3GB7 C;  4UB6 Z;  3T1H O;  1S76 D;  3L73 H;  2HEP A;  1Z5V A;  3OUS A;  3W7U A;  2EUL A;  4O4L A;  2YI8 A;  1R3K C;  5KMG B;  4X64 B;  4GYC B;  2KG7 B;  1J5E B;  2LP7 A;  2HJD A;  4JYB A;  1WP8 A;  2QWO B;  5JJE B;  2X6C A;  2KB1 A;  3ZMU A;  5D5Q A;  4O4I A;  4FM1 A;  3ZMV A;  3RYH A;  3CRC A;  2Y69 B;  3D3I A;  4ZHQ B;  4DRX A;  3OW2 U;  3ZRV A;  4I7Z B;  1R3I C;  5E1A C;  2Z3Y A;  4FMT A;  1K8A W;  4JI5 O;  1H2S B;  4LF4 B;  2X6A A;  2P5O A;  1P4R A;  4GX2 A;  2PZS A;  4E2L A;  4Q6G A;  4MTG A;  4DV2 O;  4YIO A;  3ZN0 A;  2N05 A;  4TUY B;  1YVW A;  3AG1 C;  4J42 A;  2ZM6 B;  2ODM A;  3JD1 A;  3L70 H;  5H2F Z;  5KX5 B;  4UB8 Z;  1WA8 A;  4NXM O;  3JAL A;  1OJH A;  3CRM A;  4E4E A;  3X2Q B;  4FFB A;  2ZXW B;  3JAW B;  4R7C A;  2K9P A;  2HR3 A;  4PA3 A;  5CA0 B;  5B1O A;  3JAS B;  4IIJ B;  2Y0I A;  3E8F A;  5DM6 V;  4B3M B;  4MSW C;  4WFF A;  3ASO C;  3OR7 C;  4PDL A;  3CX5 F;  2BCC H;  1QLE C;  4KP4 A;  1YHQ V;  3K06 A;  4LFC O;  4X1Y A;  4YJ3 A;  4O2A B;  3K0D A;  3QG5 A;  3IC9 A;  3KCY A;  4NR1 A;  1M93 A;  1W0K G;  2F1M A;  3BA9 A;  1AP5 A;  3ZCC A;  2DW4 A;  1N36 B;  2CK3 G;  5LMU O;  4ZOL A;  4OPH A;  4MVO A;  1R6K A;  2YIB D;  1W2B U;  5LXT B;  5EZY B;  1HR0 B;  1ENV A;  1HDJ A;  5JJJ B;  3SJA C;  2ZE6 A;  4X62 O;  2V1D A;  1XMQ O;  1G8M A;  1OCZ C;  1NZ6 A;  1KBH A;  1F4M A;  1XHX A;  2HFE C;  2F43 G;  4B7K A;  3AG2 B;  4GZR B;  1QVF U;  5JQG B;  2P6J A;  1VMG A;  2Y0P A;  4LNU A;  3EFF K;  3JD0 A;  4MTF A;  4WFE A;  2VQF B;  1AI5 A;  1SKV A;  1NI8 A;  4CH6 A;  5KHG A;  1BHB A;  3RN4 A;  4DK0 A;  4DUZ O;  4O4L B;  5FNV A;  1L1F A;  1IDS A;  4K3A A;  4J7K A;  1XMO O;  1M56 B;  2UXD B;  4BW5 A;  3RYC A;  1H8H G;  1SF9 A;  1VF5 B;  3OGC C;  3DSQ A;  2F4V B;  3KG2 A;  1DTO A;  1YTF B;  2FB5 A;  3FYE B;  2DYR B;  5DN6 G;  1QVG U;  1SQG A;  2ZR3 A;  4DR3 B;  3RYH B;  3FFQ A;  3W7W A;  3QO5 A;  2OWO A;  3K59 A;  4DRX B;  1QU7 A;  2F23 A;  1NKD A;  4YHH B;  1IBM B;  4FLV A;  4I9Q A;  3RWR D;  1Y74 A;  2BE3 A;  2R70 A;  4K0K O;  1L0N H;  3CE2 A;  4DV6 B;  1AP6 A;  2DYS B;  2MK3 A;  1QNM A;  2IBZ H;  3VQX A;  2EX3 A;  4QIW F;  1GM7 A;  4GLX A;  2CTR A;  3AK2 A;  4B3S B;  2GV9 A;  4X88 A;  2ITD C;  3NR7 A;  3B77 A;  4UV9 A;  1WA8 B;  3CJH A;  4JI8 O;  3SJB C;  1I5Y A;  4PDM A;  1XDC A;  3E8G A;  1RP3 B;  4X20 A;  4LF7 B;  1BGY H;  5C93 A;  3LUT B;  4GX5 A;  1JJ2 U;  1HNZ O;  4MTX A;  1NR7 A;  4FFB B;  2QA4 V;  2QM4 A;  1FJG O;  2WPD G;  1DF4 A;  2H94 A;  2Z5U A;  2PI4 A;  1H38 A;  5TIS Z;  2JDI G;  4K8X A;  5BR8 O;  1EZJ A;  1K5S A;  2ZQM A;  1H2N A;  1Q6H A;  4YJ3 B;  1CPY A;  4TOI A;  4GKK O;  1FYJ A;  3MAQ A;  1IXM A;  1J95 A;  2QWP B;  3CCE V;  1BQ0 A;  5IT9 N;  5ITZ A;  5KHK A;  3GWO A;  3CYO A;  2EJ7 A;  1MSD A;  2HHH O;  4CS3 A;  1XHZ A;  1K33 A;  1HNX B;  1EZV H;  2X0L A;  2WLM A;  1VQ7 V;  3AG4 C;  1Q3E A;  2Q0O C;  2BOB C;  1BMF G;  1FKA O;  4G27 B;  1AVM A;  2L35 A;  1VQP V;  4LNU B;  3E8H A;  3ABM C;  3FX7 A;  2PTM A;  5KHH A;  1VP7 A;  4GX1 A;  2YID A;  3ABU A;  2HKO A;  3K58 A;  2YS8 A;  4PDR A;  2DQ3 A;  4DV4 O;  4EFB A;  5FNV B;  4R8C A;  5LL6 Y;  3LSS A;  3QNE A;  4JI1 O;  4OX9 B;  4X66 B;  3RYC B;  3BA8 A;  1S0V A;  1FXH A;  2CGN A;  2UU9 O;  3ZJZ A;  1SRY A;  3AG3 B;  2JIZ G;  5IWA O;  2WLN A;  1JVM A;  4UXN A;  2W6J G;  2JEU A;  1QQC A;  2AGA A;  5J2U B;  3JSN A;  3ZMS A;  2FTK A;  2W6I G;  1WJZ A;  2AW9 A;  1KKC A;  4W4K A;  2WLJ A;  3LNM B;  4Q20 A;  5LBQ A;  1PL4 A;  1TVK A;  1WP7 A;  1X59 A;  1Y74 B;  2JGD A;  3DC6 A;  1NH2 B;  1GKF A;  4D6T H;  4J41 A;  3G67 A;  1SES A;  3CRQ A;  4OXS A;  1W0J G;  4BR6 A;  1BQZ A;  1LUW A;  1IBL O;  3FKS G;  1JFF A;  4LWS A;  2IU3 A;  3ABL C;  2IJK A;  3S3W A;  5JH7 A;  3CJH B;  1TGO A;  4JI6 B;  1TUB A;  3T4D A;  4JI2 O;  2UXN A;  4GX0 A;  4X20 B;  3CC2 V;  1RPR A;  5CBH A;  2ZNI A;  2E5L O;  3CC7 V;  4JPR A;  3RW0 A;  2F93 B;  4IYI A;  1VQ4 V;  4DR4 B;  1FFX B;  1GN2 A;  3CHX A;  4LF6 B;  3T1Y B;  4RUE A;  2AHY A;  1CEZ A;  2M7W A;  5FPO A;  3TXS A;  4L8J A;  1Y4M A;  2VWK A;  3IJ4 A;  4DV3 B;  5IYZ A;  5LP6 C;  2Q67 A;  4LR3 A;  4YXW G;  2VQE B;  4MW3 A;  4DW1 A;  4JI4 O;  1JR9 A;  5ITZ B;  3G6B A;  1EN6 A;  1E79 G;  1L8D A;  1BL8 A;  3G4S V;  4Z1M G;  2KG7 A;  1VAR A;  4KL1 A;  1OCR B;  1THZ A;  2RN9 A;  2LO1 A;  1V54 B;  4BIZ A;  5B1A B;  1Q6U A;  3U10 A;  4JF3 A;  5BMV A;  4ABM A;  2IH3 C;  2GTS A;  4NXN B;  2EIL B;  4D7T A;  4PA9 A;  5FL7 G;  3CXC U;  1KP2 A;  3VBB A;  3SJQ C;  5JJN B;  2Q7H A;  1R1B A;  5KHI A;  3CCV V;  4LFA B;  3SYQ A;  4X64 O;  4WFG A;  4P30 A;  4R6Z A;  2Q5Z A;  4PDV A;  2B1I A;  1WN7 A;  1Q81 W;  2HVJ C;  3OTO B;  3L75 H;  2Q69 A;  2DWE C;  3DXR B;  2IM9 A;  3HKB B;  2A79 B;  3W7T A;  4LF5 B;  4AQY B;  4QPK A;  2ZDI C;  4R50 A;  4QE9 A;  4RO2 A;  1M9N A;  3S3X A;  2AZ2 A;  1VQO V;  4NTW A;  2LW7 A;  2Q8V A;  3E22 A;  2YC0 A;  3UT5 A;  3B4S A;  1JCH A;  3H1J H;  2EIN B;  2ZIN A;  4DV1 B;  2PYL A;  1R73 A;  4IL6 Z;  2UXC B;  4UV8 A;  2EIM C;  4FZ1 A;  1F51 A;  4LCU C;  3JAS A;  4PA6 A;  2JGD B;  3APO A;  5EC2 C;  2PF4 E;  1EN4 A;  2UUB O;  3CD6 V;  2OIG A;  4DUY O;  4KHP B;  1PKX A;  4JAU A;  1NT2 B;  1JFF B;  2JJ2 G;  4LWS B;  4MVM A;  2DQ0 A;  1WAZ A;  1E1R G;  5JH7 B;  3G6E V;  2GUZ B;  4IT5 A;  3ABK B;  1TUB B;  5B1B C;  1K5Q A;  4Z1V A;  5LXT A;  1K4C C;  2FKX A;  5IY5 C;  3I56 V;  5JCO C;  2N74 A;  3H1H H;  1DK1 A;  3ZN1 A;  1US6 A;  4DYL A;  1Q6I A;  3LDE A;  1B04 A;  4B3M O;  2JEX A;  1E1Q G;  5DED A;  1K34 A;  2R9I A;  4TSF G;  1R6N A;  3P32 A;  1XNR O;  3H01 A;  3OUF A;  3N2K B;  2R9R B;  2UUA B;  3K5N A;  5JQG A;  1N36 O;  3CCQ V;  4DV5 B;  3IFX A;  5AG2 A;  2M6Y A;  3PJS K;  3Q4H A;  1I0H A;  3KZI Z;  1V9P A;  3FB8 C;  3SYC A;  3GVM A;  2WWW A;  1K9M W;  4RAI A;  4N21 A;  3JSL A;  1U96 A;  4B08 A;  1NVP D;  3FD9 A;  5KA6 A;  1PNK A;  1SZT A;  1EFR G;  1MZF A;  4NYK A;  1JX9 A;  3M8A A;  1SZX A;  2BTQ A;  4UVA A;  1URF A;  5BMV B;  4FIP C;  1Q90 D;  3M99 B;  1YI2 V;  2DWD C;  1TA8 A;  4LF8 B;  3I5D A;  4DV0 B;  3E89 A;  5LHG A;  2Y69 C;  3UM7 A;  4FLT A;  2JS3 A;  3ASN B;  4B3R O;  1UFI A;  3KKY A;  5EBM C;  2P67 A;  3THO A;  3TJT A;  2UXD O;  1ARO P;  1ROP A;  4HBN A;  3STL C;  3CC4 V;  4O2B A;  4LC1 A;  4DR6 O;  3QTC A;  4J7Z A;  4TV9 A;  4AIL C;  1I5X A;  1S5H C;  3OD4 A;  4DR3 O;  4D7S A;  5LGU A;  2HJF C;  4FLY A;  2XAJ A;  1G4Y B;  1NTM H;  3E22 B;  3CRA A;  4DR5 B;  3UT5 B;  2RNB A;  3U11 A;  3AG1 B;  2CUG A;  2RMK B;  4TT3 G;  3ZMZ A;  1XUQ A;  3JYC A;  3OTF A;  3G71 V;  3BCC H;  3N2G A;  3FAV B;  4X65 O;  3ZIA G;  4I4T A;  5HFL A;  4UCO A;  2CGO A;  2ZXW C;  4K8Z A;  3P30 A;  1Y66 A;  4U3J B;  4B3S O;  2P4V A;  3WB2 A;  2Z0A A;  3D8C A;  1M1K W;  1OV9 A;  3ASO B;  1XL4 A;  4ASU G;  4FLZ A;  2B9Z A;  2K1E A;  5L3F A;  5CBF A;  2UXB O;  5B1N A;  1AB3 A;  4J9Z B;  2A06 H;  4TQF A;  4PEL A;  4UFZ A;  1RFY A;  3WB1 A;  1VF6 A;  1AR1 B;  2IJJ A;  1T5E A;  3TGU H;  4MVR A;  3E83 A;  5GON A;  1FFT B;  2OCC B;  1HNW B;  3T1H B;  1SER A;  1OCZ B;  2LW1 A;  1I94 B;  2XHB A;  1QHT A;  3B40 A;  3L9D A;  1QLN A;  3K08 A;  5B66 Z;  3Q4H B;  3KCX A;  4WFA V;  1P7B A;  3U0Z A;  1B06 A;  3DC5 A;  4DR7 O;  4JTC B;  4WCE V;  1XQ8 A;  4J7J A;  4CBC A;  5LMN B;  1AJQ A;  4YJ2 B;  3I55 V;  4JZ2 A;  5CMU A;  3VQW A;  2LGQ A;  2XUM A;  2BTQ B;  4JI5 B;  4UUJ C;  3JD4 A;  4WBN B;  1NTK H;  2A3Q A;  5B3S C;  5J2U A;  4PA7 A;  5C8Y B;  4XDK A;  2P06 A;  1A32 A;  5CA3 A;  3T4Z A;  3TCU A;  5A2Q N;  3F5T A;  1WB8 A;  3MHS C;  3CCL V;  1NS1 A;  3WB0 A;  3BAA A;  5BZB A;  4ICG A;  3SJC C;  3OFN G;  4QGP A;  4J80 A;  1PM9 A;  2EIK C;  4RWU A;  1YDX A;  4O2B B;  5KAF Z;  1H2L A;  4TV9 B;  4ZKI A;  3FB6 C;  1PV0 A;  4NXM B;  4G2K A;  2QTO A;  2RDC A;  3HKC B;  1ZTE A;  4JYA B;  2CDY A;  1RM1 C;  3H1I H;  3ZHS A;  3WG7 C;  2FYU H;  5IJ0 A;  1NQT A;  1FAF A;  3ZMT A;  3SPG A;  2WAM A;  5J2T A;  5CB4 A;  4H33 A;  1HP8 A;  3N2G B;  1R6T A;  4I4T B;  4LFC B;  2P4K A;  4AHC A;  1MOF A;  1XOU A;  1H2K A;  1FFX A;  3ZHT A;  2ADP A;  2YIC A;  2ZKO A;  4LFB O;  3W7S A;  5LMU B;  4FZ0 A;  5JVD A;  2B1G A;  1XNQ O;  1H8E G;  1CXZ B;  3QVN A;  5L3D A;  2F66 C;  5H6R A;  4BW9 A; 
#chains in the Genus database with same CATH homology
 3OM3 B;  4RUF A;  1VQ4 V;  2P7T C;  2JJ1 G;  3ETG A;  2WLI A;  4U7O A;  5L3B A;  4XDJ A;  2OT5 A;  2AHY A;  4RUE A;  1CEZ A;  2M7W A;  1H2G A;  2QE7 G;  1M57 C;  1SET A;  4MT8 A;  3BY6 A;  1Y4M A;  2IW5 A;  4WF9 V;  1DLB A;  1XL6 A;  1K92 A;  4MVU A;  2WLK A;  2Q67 A;  4HZ3 A;  3CCJ V;  5J9P C;  1VQ6 V;  3ZRS A;  1MAB G;  1B6Q A;  4YXW G;  5KA5 A;  3TK1 A;  4MW3 A;  3AG2 C;  3SYP A;  1GK9 A;  4I5S A;  3F5W C;  3FYI B;  5CN0 A;  1E79 G;  2OCC C;  1R3L C;  2X6B A;  3RVY A;  1BL8 A;  3G4S V;  1Q82 W;  2EIJ B;  2ITC C;  4Z1M G;  1KC8 W;  4H37 A;  1KKD A;  1OCR B;  4HAM A;  1VQ8 V;  1THZ A;  1QR8 A;  1Q86 W;  1OHH G;  3GB7 C;  1V54 B;  1S76 D;  3OUS A;  3AG4 B;  4BIZ A;  3W7U A;  1YJW V;  1DF5 A;  1R3K C;  5B1A B;  2XND G;  2WLL A;  4JF3 A;  1YIJ V;  3OAA G;  2LP7 A;  5CBG A;  2IH3 C;  4JYB A;  2EIL B;  1M56 C;  4PA9 A;  5FL7 G;  3CXC U;  3ABM B;  3CPW U;  1KP2 A;  3JD2 A;  3VBB A;  2X6C A;  2KB1 A;  2Q68 A;  4P9O A;  3SJQ C;  3ZMU A;  4XBF A;  2AHZ A;  1KD1 W;  3ZMV A;  5L3G A;  2DYR C;  1OZ0 A;  3CCV V;  3SYQ A;  2XAQ A;  4WFG A;  3CMA V;  4P30 A;  2Y69 B;  4R6Z A;  1PL0 A;  1KQS U;  3D3I A;  3OEH G;  4MS2 A;  4PDV A;  2B1I A;  2UXX A;  3ZRV A;  3OW2 U;  1Q81 W;  2HVJ C;  5KUM A;  1R3I C;  5E1A C;  2Z3Y A;  4FMT A;  3ETE A;  5B3S B;  1K8A W;  2Q69 A;  4U7N A;  2DWE C;  2X6A A;  1YTF D;  2A79 B;  3W7T A;  4QPK A;  2ZDI C;  4R50 A;  4QE9 A;  4RO2 A;  1M9N A;  3A0R A;  3SPJ A;  1VQO V;  3K03 A;  1P4R A;  4GX2 A;  2DYS C;  2HVK C;  2EZP A;  2XAF A;  4E2L A;  1HWY A;  2W0F C;  4P2Z A;  3HPL C;  2HLD G;  4MTG A;  1JCH A;  3ZN0 A;  3JD3 A;  2EIN B;  1GO3 F;  3AG1 C;  3JD1 A;  3FB5 C;  4UVC A;  5L3E A;  4GCZ A;  2EIK B;  1R73 A;  3EHB B;  3JCZ A;  4MW8 A;  4DXW A;  4UV8 A;  2EIM C;  3F7V C;  4KUM A;  3CME V;  1F51 A;  4LCU C;  4PA6 A;  2ATK C;  3RVZ A;  5EC2 C;  2PI5 A;  1RM1 B;  4MVQ A;  1N8R W;  3CD6 V;  3WG7 B;  3X2Q B;  1PKX A;  4JAU A;  2ZXW B;  2IH1 C;  4JAV A;  1COW G;  4R7C A;  3OMN B;  2YEV A;  3CCU V;  3ABL B;  2HR3 A;  4MVS A;  2JJ2 G;  4PA3 A;  4RQE A;  4MVM A;  2DQ0 A;  5B1O A;  1E1R G;  3CCM V;  1WPX A;  1K97 A;  3G6E V;  3E8F A;  5DM6 V;  4MSW C;  4WFF A;  3ASO C;  3OR7 C;  4PDL A;  2XOK G;  1KEC A;  3E35 A;  1QLE C;  1FXK A;  3ABK B;  4KP4 A;  5B1B C;  1YHQ V;  3K06 A;  1K5Q A;  1FXK C;  3LDC A;  1K4C C;  3T2M A;  3K0D A;  5IY5 C;  4WFH A;  3E8B A;  2B5U A;  1LNQ A;  1W0K G;  2QKS A;  2GSM B;  2Q6A A;  3ZCC A;  3I56 V;  4FJC C;  2DW4 A;  2CK3 G;  4JGS A;  3OE7 G;  1KP3 A;  3ZN1 A;  3STZ C;  3LDE A;  3SPI A;  4MVO A;  2JEX A;  1E1Q G;  1R6K A;  4N23 A;  4XDL A;  1W2B U;  1K34 A;  3B8N A;  2R9I A;  1ENV A;  3ABT A;  1R6N A;  3P32 A;  4TSF G;  3H01 A;  3OUF A;  2WLI B;  3OMA B;  2IJH A;  2R9R B;  5IDJ A;  1M57 B;  2V1D A;  1VQK V;  1S72 V;  1NJI W;  3CCQ V;  1G8M A;  1OCZ C;  3IFX A;  2XAH A;  1F4M A;  2HFE C;  3PJS K;  3FB8 C;  2F43 G;  4KFM A;  3AG2 B;  3SYC A;  1QVF U;  4FPP A;  2WWW A;  1OCR C;  1K9M W;  3AEI A;  2P6J A;  3EFF K;  3JD0 A;  4RAI A;  2XAG A;  4MTF A;  4WFE A;  3BEH A;  1V54 C;  1AI5 A;  1VQM V;  4N21 A;  3ZRW A;  5B1A C;  1NVP D;  1BHB A;  5KA6 A;  1PNK A;  3LSQ A;  1SZT A;  5KUK A;  1V55 C;  1EFR G;  2EIL C;  3OMI B;  1JX9 A;  1L1F A;  2WLL B;  4UVA A;  2OTJ V;  3HB3 B;  3OR6 C;  1OCO C;  4FIP C;  4PA4 A;  1M56 B;  2QEX V;  3M99 B;  4BW5 A;  1H8H G;  1YI2 V;  4I9W A;  3R65 A;  2DWD C;  3OGC C;  5LGT A;  3KG2 A;  3IGA C;  1DTO A;  2H8P C;  3E89 A;  1YTF B;  3FYE B;  2DYR B;  1YJ9 V;  5DN6 G;  5LHG A;  2Y69 C;  1QVG U;  3UM7 A;  1BHA A;  3ASN B;  2ZR3 A;  2ZDI A;  3E2E A;  3AG3 C;  1AI7 A;  2QM7 A;  1NBM G;  5EBM C;  3K9A A;  2WLH A;  3W7W A;  2P67 A;  3QO5 A;  5IYD O;  5EC1 C;  2HG5 C;  4FK5 C;  1EBO A;  1ARO P;  1R3J C;  1ROP A;  1VQ9 V;  1Q7Y W;  1NKD A;  3K79 A;  3STL C;  2WSS G;  3CC4 V;  1VQN V;  1AJP A;  4LC1 A;  1JPX A;  4X8A A;  2YSU B;  4HYO A;  5LHI A;  1I5X A;  1S5H C;  1YSC A;  1AJN A;  5LGU A;  2HJF C;  3ZRX A;  2XAJ A;  2DYS B;  1G4Y B;  1PNM A;  2MK3 A;  2A9H A;  2EIN C;  1GTO A;  3MHH C;  3UKM A;  1FXV A;  2NNU A;  3AG1 B;  4QIW F;  1GM7 A;  4TT3 G;  3D36 A;  3ZMZ A;  4X88 A;  2ITD C;  3JYC A;  3B77 A;  3G71 V;  3T1C A;  2D3O W;  4UV9 A;  2EIM B;  4JAS A;  1I5Y A;  4PDM A;  3E8G A;  3DTU B;  3ZIA G;  5HFL A;  3NXS A;  1QCE A;  1OCC C;  2ZXW C;  5C93 A;  3LUT B;  4GX5 A;  1S3J A;  3P30 A;  2ZR2 A;  1JJ2 U;  4UVB A;  1Y66 A;  4X89 A;  4MTX A;  1NR7 A;  4JTD B;  2QA4 V;  5EBL C;  3B8M A;  2YEV B;  2WPD G;  2LFR A;  4GT1 A;  1DF4 A;  5EK0 A;  3SPH A;  2H94 A;  2Z5U A;  1M1K W;  2V7Q G;  3CCR V;  2PI4 A;  3ASO B;  1XL4 A;  1H38 A;  4ASU G;  4CZZ A;  5B1B B;  3CCS V;  2JDI G;  2IU0 A;  3QO8 A;  3VOU A;  1FXK B;  2K1E A;  2P90 A;  5L3F A;  4LP8 A;  3MD0 A;  2BOC C;  1EZJ A;  5CBF A;  1K5S A;  2ZQM A;  4BIU A;  1CPY A;  4J9Y B;  3K3W A;  4LBE C;  4BAY A;  5B1N A;  1VQL V;  4J9Z B;  1TUE B;  1IXM A;  5GW7 A;  1J95 A;  4PEL A;  3CCE V;  1PD3 A;  2C2A A;  1UJW B;  3GWO A;  3CYO A;  1AR1 B;  2IJJ A;  3F7Y C;  3TET A;  2EZO A;  2EIJ C;  1GMG A;  4MVZ A;  4MVR A;  3E83 A;  1GM9 A;  1FFT B;  2OCC B;  1K33 A;  1SER A;  1OCZ B;  1JQ0 A;  5H9C A;  2X0L A;  4QPJ A;  3OEE G;  2WLM A;  1VQ7 V;  1QLN A;  3K08 A;  3AG4 C;  4JYC A;  4QE7 A;  4WFA V;  4TWK A;  1NVP B;  2XAS A;  2BOB C;  1VQ5 V;  2X7R B;  1CP9 A;  1P7B A;  1BMF G;  1M90 W;  1QR9 A;  5HFM A;  4G27 B;  3E86 A;  3SYA A;  4JTC B;  1VQP V;  4WCE V;  3E8H A;  3ABM C;  3SPC A;  4CBC A;  3ZRW B;  1K3E A;  1AJQ A;  1K7D A;  2LFS A;  3I55 V;  3ML0 A;  4P9P A;  4DO2 A;  4GX1 A;  4JTA B;  5CMU A;  3ABU A;  2HKO A;  1V55 B;  1AI4 A;  2GHY A;  4PDR A;  2DQ3 A;  1AI6 A;  4R8C A;  5IYC O;  1OCO B;  1RPO A;  4UUJ C;  3JD4 A;  3LSS A;  3QNE A;  5B3S C;  4PA7 A;  5H6Q A;  2A0L A;  4XDK A;  3ASN C;  3QO7 A;  1JOY A;  5CA3 A;  4MTO A;  3T4Z A;  5L3C A;  1S0V A;  1FXH A;  3ZJZ A;  1SRY A;  3AG3 B;  2JIZ G;  3TCU A;  2WLN A;  2QM8 A;  1JVM A;  3CP1 A;  1K4D C;  2Y48 A;  4UXN A;  2W6J G;  3MHS C;  3CCL V;  2JEU A;  4F4L A;  1PNL A;  5BZB A;  2NLJ C;  3OFN G;  3LDD A;  3ZMS A;  4QJF B;  2FTK A;  2W6I G;  2WLJ A;  4EKW A;  4WFB V;  3LNM B;  2EIK C;  1WLE A;  3IC7 A;  4Q20 A;  1QBZ A;  1F4N A;  1K73 W;  4ZKI A;  5LBQ A;  3FB6 C;  3RBZ A;  4G2K A;  1NH2 B;  1GKF A;  2QTO A;  2EJR A;  1NH2 D;  1SES A;  4G28 B;  4OXS A;  5EBW C;  1W0J G;  4ZBM A;  3K0G A;  1ZWI C;  1RM1 C;  3FKS G;  3WG7 C;  3X2Q C;  1NQT A;  3ZMT A;  3SPG A;  3WFV A;  3DGE A;  2IU3 A;  1GM8 A;  2ZD9 A;  2WAM A;  3ABL C;  2IJK A;  4QNH B;  1YJN V;  2JK5 C;  3SYO A;  1ORQ C;  2EBO A;  4H33 A;  1F23 A;  5LGN A;  3K04 A;  5LHH A;  4RQF A;  3ETD A;  1YIT V;  3FB7 C;  3T4D A;  1OCC B;  2UXN A;  4GX0 A;  3ABK C;  3CC2 V;  1MOF A;  2IJI A;  1S77 D;  5IYB O;  2OTL V;  1QLE B;  1MSW D;  3W7S A;  1RPR A;  1FS0 G;  5CBH A;  4L87 A;  2B1G A;  3CC7 V;  1MG1 A;  5IY5 B;  1H8E G;  5L3D A;  3W7X A;  4JPR A;  3RW0 A;  5H6R A;  1NR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...