3WFVA

Hiv-1 crf07 gp41
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
86
structure length
86
Chain Sequence
b'AGAGQSNDSGIVQQQSNLLRAIEAQQHLLQLTVWGIKQLQTRVLGGGGRWMQWDKEISNYTNTVYRLLEESQNQQERNEKDLLALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope glycoprotein gp160
publication title The crystal structure of HIV CRF07 B'/C gp41 reveals a hyper-mutant site in the middle of HR2 heptad repeat
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 41
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2013-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3wfvA00
3MHSC 3B8MA 5CMUA 2P6JA 1K33A 3MHHC 4G2KA 1QR9A 2M7WA 4FK5C 4JGSA 5KA5A 5HFMA 1DLBA 4FIPC 2OT5A 1MG1A 1K34A 5HFLA 3CP1A 5H9CA 2LP7A 1QBZA 2EBOA 3WFVA 2EZOA 2X7RB 1DF4A 3B8NA 3K9AA 3P30A 4FJCC 1I5XA 4N21A 1DF5A 3CYOA 4JPRA 4N23A 3H01A 4JF3A 5CN0A 1QCEA 1Y66A 1JQ0A 1SZTA 1ENVA 1Y4MA 3M99B 1I5YA 1EBOA 1F23A 1MOFA 1JPXA 3GWOA 4E2LA 5KA6A 2MK3A 2EZPA 3B77A 1QR8A
chains in the Genus database with same CATH superfamily
2DOSA 4IGGA 1R3IC 3H1HH 4LF9B 3C3TA 2UXNA 3KZIZ 4YXWG 3CS5A 2XUMA 5A9GA 3ICXA 1IBMB 3N2GB 1IDSA 4PHZA 4DV3B 3D3QA 5B1BB 5E79Z 5J2TB 4DUZB 3H01A 2V4DA 2Q7GA 1BMFG 2ZIOA 1H2MA 5FNVA 4FMTA 3BHPA 4J42A 3IGAC 4C7UA 2YUAA 2ZDIA 1COWG 4QIWF 1IXBA 3ZN1A 2LGQA 3HR0A 1MZFA 1VQKV 1NKDA 3M7MX 1CP9A 4P2ZA 4MVZA 3QNEA 5CBGA 2ZIMA 3DGEA 2YEVB 2E75B 3OM3B 4NXNO 3FFQA 4JI0O 4FLZA 1VQ8V 4EEQA 2P67A 4JI8B 3STZC 3L70H 1K92A 5LHIA 5BY1A 1K4DC 4J11A 1WPBA 4OX9B 3JCZA 1HP8A 5IJ0A 5B1AC 4QE7A 4KP4A 3E22A 2CUGA 4H13B 1Q81W 1KYOF 1VQLV 4IL6Z 3OAAG 3CJHB 4TUYB 1N36O 3SJBC 2QWOB 3T4DA 3G67A 4J80A 2VQFO 1ORQC 3ZHTA 3X2QC 2UUCO 1Q8IA 2IU3A 1TUBB 1ZSPA 1AR5A 2P22C 1YXBA 3CP1A 2F1MA 2BTQB 1ROPA 3UKMA 1S0VA 4W4LA 1O9HA 2EX3A 3LSQA 4E2LA 3ABLB 2L6LA 2Y48A 4B3RB 1PNMA 4P9OA 2D2CB 2WWWA 1Z2GA 4WFEA 1I94B 3OTOO 1JFFB 4WFFA 1PNLA 3PJSK 3RYCB 1BZKA 3ASNC 3JATB 2EULA 2OIEA 3UT5A 3ZMTA 4BW5A 2ZXWB 1IXMA 3JASA 4L87A 4DV3O 3VBBA 4PDLA 1AVMA 3LSUA 1BHBA 3HB3B 1HNXB 3OMAB 2PGGA 1G1XB 3K06A 2QR4A 2AGAA 4DV2O 1W59A 5GW7A 1R6KA 5EZYA 3ZMUA 1LUVA 3FYEB 4X8AA 1QNMA 2Y69B 1PNKA 4I5SA 3PN1A 2RDCA 3CC2V 3SGIA 3BAAA 3D8CA 4TUYA 1KKDA 3ZX6A 1YTFD 2QE7G 4UB8Z 2MK3A 4I4TA 3ABUA 3OUFA 1BQ0A 2WSSG 4IHJB 3BABA 2V7QG 2RJZA 1FFXA 1VMGA 4OX9O 4YJ2A 4ZHQA 3VQVA 2CH7B 4UCSA 2D3OW 3R65A 1US6A 3CRAA 1GN2A 3H1IH 4BWAA 1N0JA 3ZMZA 1D2DA 2P4VA 4FFBB 1AJPA 2FKXA 5H5NA 1L0NH 4RWUA 1K97A 4UV8A 2AZ0A 1V55B 3RW0A 1X59A 1SS3A 5EBWC 5CA1B 5IYZB 2VRZA 4IYHA 1DF5A 2HVJC 3VQYA 4DUYB 3AG3C 4MTFA 1AR1B 2P4KA 3AK2A 1EFRG 5H2FZ 2GTSA 5L3DA 2A0LA 2ADPA 1MA1A 1GM8A 2KKWA 4XDJA 3F5TA 1FFTB 4FVMA 1UJWB 1GN3A 4DV4O 1BE3H 5KHIA 5IY5C 5LXTB 2ZR2A 4JTAB 5CN0A 2F93B 3CC4V 2QTOA 4F4LA 4FLUA 1RM1C 1OCZC 4JAUA 4D6TH 1HNXO 1CPYA 4X65B 4H33A 2EBOA 2JVDA 4DR1B 1I5XA 4N21A 1FXKB 4JPRA 2WLMA 1N4CA 4UCTA 4UVCA 4J9ZB 2IM9A 2YIBA 4CC6A 1KP3A 3B77A 3H1JH 1OCRB 3LDCA 4PA9A 3EVKA 5KA5A 5H6RA 3I5DA 3JD2A 2N05A 2V1DA 2EIKC 3HKDB 3ZN0A 3RYHA 1HNWO 4ICGA 3RT3C 1I08A 3CYOA 4ZOLA 4O4HA 3CCQV 3CRQA 2ZDIC 4CC5A 1FD9A 2A06H 2IJKA 4JTCB 5B1AB 4GKKO 2IH1C 1KC8W 2DQ3A 2QWQB 3K04A 4DR2B 4XDLA 1QLEC 1YIJV 1QVGU 4NTXA 3CRMA 4DR6O 4LF6O 1P4RA 3IC7A 3FX7A 4MW3A 1IBLB 1YJWV 3BPZA 4HNAB 2HFEC 4E4EA 4JYYA 4JASA 3CMAV 1FAFA 4EFBA 1F4MA 1Q90D 1E1RG 4O2AA 1AROP 3CD6V 3CCLV 4JGSA 3H1LH 3CX5F 3D36C 1WA8B 1ZAUA 2QA4V 1VEWA 1BHAA 2ZE7A 2QWPB 2DYRB 1LNQA 4X64B 2XHBA 3BVOA 2YC0A 4FM1A 4D7SA 5CA0A 3L9DA 4F6RB 2R70A 1R6TA 3ASNB 4GX1A 2WLLB 4MVSA 1VIBA 4XDKA 4ZIBA 4PELA 3OMIB 4W4KA 4X1IB 3G6BA 3JD4A 5JWPA 5GONB 4DXWA 5KUKA 2HP8A 2A9HA 2Q73A 2PY5A 4B3TO 2JGDA 2DW4A 2UU9B 4WFHA 4O2BA 4RAIA 1N0NA 3GWOA 3BY6A 4YIOA 4YJ3B 4B3MO 4UXNA 1I0HA 2IJIA 5JQGA 4X1KB 3O65A 5IT9N 1SZXA 1RFYA 1THZA 1BCCH 3L73H 4K0KO 2UXCB 1DF4A 1N34B 5KHHA 1Y76A 1YCIA 1S72V 1BL8A 1GK9A 2OIGA 1PPJH 1H2NA 5FL7G 3WB1A 4R8CA 3JALB 2F23A 2DYSC 3CB2A 2RCVA 1GKFA 4JZGA 4DR2O 4MT8A 1Q6HA 2XOKG 3KKYA 1VQ7V 1EN6A 2X0LA 1GMGA 1VF5B 4I50A 5IYDO 1CXZB 2Q7EA 1QR8A 5B1NA 2F66C 1H2GA 5LOVA 4IYIA 4PDVA 3ETGA 4YIPA 2ZQMA 2OTLV 2A3QA 2F43G 2PTMA 1KMIZ 1VQNV 3P3NA 4WFBV 1M93A 1K3EA 3K58A 4U3JB 4LWSA 1AP5A 4NR1A 3RVYA 3GWKC 4J41A 5BMVA 3W7UA 1WJZA 5EYPB 1ENVA 1M90W 4UVAA 5B3SC 3LSSA 5KHKA 4X20B 3SYAA 5BZBA 3OEHG 1ZL8B 2DE0X 1HR0B 5IY5B 3DSQA 3ETDA 1SF9A 5JH7A 4N23A 2QTSA 3ZHRA 1RM1B 2Q68A 2QM4A 1XMOO 5CA3A 1OCZB 3JCUZ 2XAFA 3UM7A 4DYLA 2H8PC 3T1YO 2XNDG 2X6AA 1D5AA 4MVOA 1GO3F 2VQEO 5HFLA 4FFKA 4L8JA 3RN4A 2BSKA 3AG1C 4LFBO 3BFRA 4PA7A 2XTAA 2BCCH 4JF3A 4HAMA 3T1HB 4LF5O 2YIDA 4UCUA 4MTOA 3MAQA 4GT1A 1AI7A 2QDOA 2EIKB 1JA8A 3EFFK 3SPHA 5FNVB 3OTFA 2NLJC 1EZJA 4EKWA 3TXQA 5A2QN 1XL4A 1EN5A 1AJNA 1SETA 1YVWA 3FB8C 2HVKC 1QLEB 1AI4A 4BIOA 4Z2WA 4JI5O 1YF2A 3T2MA 4RUEA 4YHHO 3A0RA 1MZEA 1SQVH 3HKBA 5DECA 1R3JC 5IJ0B 3SYOA 2ZNJA 4I9QA 5GTHZ 3TGUH 5J2UA 3E22B 5ITZA 2WA4A 4LFCB 1V54C 4TV9A 2B1GA 2YI9A 1WLEA 3OR6C 4JI3O 3N2KA 4WF9V 1N32B 4WBNA 1HR0O 4JI6B 1GAXA 2A7WA 5LMUB 1Y6XA 4ASUG 3R66A 2Q67A 1WB8A 3ZRVA 2HHHO 5EC2C 1VQ5V 4RQFA 2XAGA 3CHXA 2KSDA 1ZX3A 3LNNA 5JJNB 5BR8O 3K9SA 1F4NA 4DV7O 1BGYH 1FS0G 1ZWIC 2Q6AA 1XNQB 4WFAV 1GM9A 3CEIA 3VQXA 3UT5B 2EZPA 3SJQC 1N33O 3S3XA 2CGOA 3JASB 1QR9A 1VF6C 2XAJA 2HKOA 1CEZA 3VOUA 4LF8O 3E35A 5KMGA 2ZD9A 5IDJA 5LMNB 5TISZ 1L8DA 3D36A 4LFAO 1P84F 5EZYB 3ZHUA 3A8TA 1H8EG 2DYSB 4H44B 4O4IA 4AQYB 4LR3A 4DR5B 3MHHC 1XUQA 4X1YA 4LNUA 3K57A 3J7AU 2QSAA 1S3JA 2DJVA 4LCUC 4NXMB 2DQ0A 2WLJA 4I4TB 4X89A 3JAMN 1VQPV 3N27A 4LF7B 1XHZA 1WNSA 4DR3B 1I7FA 2DMXA 2JDIG 1VARA 1FFXB 1M56B 3RWRD 4YJ2B 4ZHQB 1IBKB 1L0LH 4TOIA 5CMUA 3ETEA 4LFCO 1F7YA 4FIPC 2Y0PA 1M4UA 3L71H 1YITV 4LF9O 5B3SB 2VWJA 2ADQB 1XBLA 2CAZC 4G28B 2R9AA 1IBMO 1JQ0A 4JI6O 5KHGA 2YSUB 3QO7A 3CE2A 4DUZO 3TCUA 4DV6B 2UUBB 5HFMA 4G27B 1BSMA 3K5MA 1FKAO 4GKJB 4IIJA 1XNRB 1GN6A 2LFSA 3AEIA 1ZTEA 2AHZA 2W6JG 3ABTA 4EFEA 3FYIB 1BT8A 1E79G 3AG4C 2HJDA 1Q5OA 3J80N 2IW5A 3ABKC 1SRYA 4JYAB 2CTRA 5KX5A 3HKCA 3JD1A 1HNZB 2GBOA 3AG1B 3HPLC 4JI8O 4ZI7A 3EXAA 2OCCC 4EB6A 3D3IA 3K5LA 1URFA 2X6BA 3GVMA 2L35A 1W0KG 3K08A 1G6UA 1B06A 4PI0A 2Y4UA 5FLXN 2RNBA 2UUAB 4NB5A 4NYKA 1X4TA 3I56V 4UFZA 5KAFZ 4MTGA 2GDSA 1J5EB 4P30A 5LGTA 4U3FH 5DN6G 4LBEC 1KBHA 3C3SA 3JAKA 4RUFA 3RYHB 4R6ZA 1K5SA 5KA6A 1SA0A 4ZOLB 4O4HB 1IURA 2YXHA 2FTKA 5EBMC 2FB5A 1IBKO 4WFGA 2IBZH 4UUJC 4B3RO 4GYCB 1Q6UA 3MDSA 1I94O 3QF7A 2WAMA 2BE3A 4CS2A 4DW1A 1V54B 4X62B 4QE9A 3OUSA 4DR4B 1FJGB 2QEXV 1OCCC 4MS2A 4JI7B 2PUSA 3WG7C 3FB6C 2CTWA 4O2AB 3H9VA 4JI1B 3ZHQA 4I0XB 3ZRWA 1WP7A 4UCRA 4P9PA 3O9OA 1I5YA 3TETA 1H2SB 1PD3A 3WB0A 5CA0B 1Q7YW 2Q5ZA 2CTQA 2RN9A 1HNZO 1M9NA 3H1KH 3NXSA 4DV1B 2B1IA 3APOA 3B2EE 4J9YB 5JCOA 2ZM6B 1GN4A 5LP6A 1SQQH 2XAQA 4HBNA 1Y66A 1NU1H 3U11A 1K9MW 1GTOA 4KL1A 2JGDB 1FXVA 2UXXA 1NZ6A 2Q69A 4O2BB 4YY3B 2E5LB 2UUAO 3Q4HA 5JQGB 4BAYA 4JTDB 5LGNA 1XL6A 2YXYA 1HW7A 1NQTA 5CB4A 4DUYO 2Q9LA 3A0BZ 5L3CA 1Y76B 1WPXA 1B3QA 3X2QB 3ZRSA 4JI4B 2P6JA 1Z5WA 3HKEA 1M1KW 3JARA 1NI8A 3ASOC 1OJHA 1FPOA 4TV8A 2F4VB 3K3WA 5D5QA 3SYCA 4I0XA 3W7TA 1VQ6V 5LA6B 1KP2A 2H94A 2EZOA 2ZR3A 2NNUA 1SQGA 3W7XA 2UXDB 3SYQA 2CE4A 1TGOA 2P90A 1NH2B 3CSXA 3T1CA 1KU9A 1XREA 2AXTZ 1FJGO 4LF4B 4I50B 4JI7O 2DN9A 5LOVB 4DK1A 2QGNA 1H38A 3JSNA 4LC1A 2QM7A 5KHJA 3K79A 1VF6A 4X65O 4CZZA 3ZHSA 5J9PC 3UCSC 4IT5A 3ABMC 4LWSB 5B1BC 4DR1O 4K8ZA 2CGNA 4J7JA 2EILC 4O4LA 5BMVB 1RSOA 1H8HG 1AP6A 1OCOC 4CH5A 3SJCC 2PYLA 1SESA 1XHXA 4X9QA 3SYPA 1Q43A 2X7RB 2Z5UA 2PYJA 4DR7B 4FJCC 4GX2A 5CBFA 1N8RW 1XEQA 4TQFA 5IJ9A 4QPKA 4B3SB 3K5OA 1PP9H 3ABKB 4O4JA 1Y67A 1NVPB 1SKVA 1RPOA 5JH7B 2Q7HA 2ITDC 4AI8A 5LA6A 5EK0A 2WLKA 2XT9A 2OYQA 2YIBD 4J10A 4Q20A 2IJHA 2VWKA 3OW2U 3K5NA 2E5LO 1SERA 1AILA 4K8XA 2YICA 1YJNV 4FLYA 4PDRA 3QVNA 3VQWA 1QLNA 2BSKB 1XI1A 5B1OA 3C90A 2ZT9B 3I55V 4PA4A 1IBLO 3ZS8C 2GUZA 1E1QG 4JI4O 4NTYA 3ZJZA 4HYOA 1P7BA 1K73W 3AG3B 2HR3A 1JR9A 2KG7A 3B4SA 3SJAC 4DV0B 4FLXA 3E8HA 1S76D 2PZSA 2UXDO 3CRCA 4DK0A 4X64O 2ZE6A 1OHHG 2W0FC 3K0GA 1R3LC 3ABLC 4MVQA 4CH4A 4LF4O 3UQ8A 5EIBC 3OEEG 5LHGA 2UXBB 3JAWA 1H2KA 5LYJA 2MW2B 1OCCB 1QHTA 5IE9A 1QCEA 1D5NA 3HKBB 2ZXWC 4I7ZB 1KQSU 1B04A 5J2UB 2UU9O 5ITZB 1R3KC 3LDEA 3ZHVA 3ETQA 1DLBA 4TV9B 1MG1A 4JI2B 1LUWA 5IWAB 1LR1A 2GHYA 3K9AA 3N2KB 2Y0IA 3K03A 3SPGA 4BR6A 2ARHA 4DR7O 2HG5C 2UXCO 2FL4A 4WBNB 1N34O 3E8FA 4CS4A 2QM8A 1WAZA 3STLC 1S77D 1Q86W 1VP7A 2B5UA 1TVKA 5JVDB 1K5QA 4UB6Z 4KXRA 2K9PA 4NXNB 3SPIA 3APQA 3RVZA 4JI0B 2AZ2A 2WLIA 1PKXA 4ZKIA 1EBOA 2C2AA 4TWKA 1GM7A 3KCYA 3AG2C 5JCOC 5LP6C 1B6QA 1DGSA 2EIMC 2OT5A 3OFNG 3ZRXA 1Y74A 5IYCO 4B7KA 3MD0A 1V55C 2P7TC 3AG7A 3FD9A 3W7WA 5KMGB 1N36B 3ASOB 2VQFB 2ZNIA 5C93A 1YDXA 1U96A 3THOA 1NH2D 1MSWD 4B7EA 1FXHA 3CCJV 2DWDC 2RQ6A 4O4IB 3ZMVA 1JMKC 4X1YB 4LNUB 3WFVA 4MW8A 2IJJA 3TJTA 2ZE5A 4LP8A 2JK5C 1AI6A 3F7VC 1H2LA 5B66Z 1WB7A 1IVSA 1SQPH 3M99B 5KAIZ 5L3BA 3OTOB 1S5HC 3FB5C 2QKAA 5FPRA 3CPWU 4PDMA 5JVDA 2WLHA 3SR2C 4DRXA 3TXSA 3KCXA 1VQ9V 4JAAA 1K34A 2IH3C 2YI8A 3FAVA 3ABMB 4JI2O 2WA3A 5IWAO 1MABG 2EILB 4R50A 4OXSA 5LGUA 3UO2A 1FXKC 1OCOB 4DV2B 4I9WA 4JYCA 1NVPD 4FLWA 5IYBO 4PA6A 2QWNB 3T1HO 4QPJA 3OD4A 1OCRC 1PL0A 5C8YA 4MVRA 1YEWA 2ILMA 5DM6V 3G71V 3DXRA 4BIZA 4AILC 5JJEB 1VQMV 3S3WA 2JEXA 3G4SV 4IIJB 4MSWC 4GCZA 4KFMA 2HJFC 1VF7A 3RYFA 1HDJA 3SDLA 2ODMA 3E89A 3IAYA 3ZIAG 4NVPA 1NJIW 1YSCA 5KX5B 2ZKOA 3HKCB 3G6EV 2Z3YA 5B5EZ 1BQZA 2KB1A 3WU2Z 1JJOA 4ZI7B 5DEDA 3CCSV 4EB6B 1A32A 4H37A 5KUMA 2XAHA 3N2GA 1WP8A 5J2TA 3ZBHA 4R7CA 1VQOV 3JYCA 3U0ZA 3BRCA 1N32O 3E8GA 2DYRC 3P3PA 5K1PA 2LJ2A 2YIAA 2JS3A 3M8AA 5LMUO 2BOCC 1XQ8A 2EINC 2IU0A 3JAKB 5AG2A 1S5LZ 1SA0B 1JOYA 4DV4B 3RBZA 3E83A 2YEVA 2B9ZA 4FLVA 3F7YC 5H6QA 4D7TA 2QKCA 2PF4E 2YDEA 3CCRV 1XNQO 1QU7A 1RPRA 3L74H 2DWEC 3BCCH 1BS3A 2R9IA 4B08A 1P7GA 2YXLA 3B8NA 4QJFB 2JIZG 1KKCA 2Q0AA 3CJHA 4CS3A 4F6EA 1JCHA 4UCVA 4QGPA 3JSLA 3ZRWB 5LMNO 1TUBA 1PL4A 4RO2A 2PI5A 2BTQA 2OTJV 1HNWB 4AQYO 2F95B 2OCHA 4FLTA 1SC5B 4DR5O 4Q6GA 2HLDG 2XASA 2LFRA 1P49A 3CXHF 3P32A 2G38A 4NXMO 4J7ZA 4LF7O 5BXZA 4DR3O 1SZTA 3AG2B 3CCMV 4GKKB 4UVBA 5LP6B 4OPHA 1F51A 2EIMB 1JFFA 3B8MA 3RYCA 2EIJC 1K33A 2N04A 3JATA 1VQ4V 3AK1A 4DR6B 4LF6B 3WB2A 4LH6A 3AK3A 3ZCCA 3W7SA 1TA8A 3RGBA 3Q4HB 4NKGB 4FZ1A 3BA8A 4LH7A 1QVFU 3CCVV 3OMNB 3CXCU 2GV9A 3QG5A 3L72H 5CB4B 4DV6O 3HKEB 2UUBO 1K8AW 3JARB 4ZBMA 5D5PA 3JD3A 1U97A 2CK3G 1JVMA 4NTWA 2ITCC 2JRIA 4TV8B 2ETNA 2JGUA 3BEHA 4AHCA 1SQBH 4GKJO 1XNRO 4ABMA 1Y4MA 3CCEV 4IHJA 1R73A 2ZCEA 2M7WA 3K0DA 1Q6IA 2M6YA 2E74B 1MNGA 2R9RB 2LQTA 4KUMA 1XOUA 5LBQA 2CH7A 1XDCA 4JYAO 2EJ7A 4B3TB 4QNHB 1PM9A 1DTOA 4WCEV 4B3MB 1K7DA 1TAEA 4JAVA 4FFBA 3BA9A 5LL6Y 3OE7G 4KHPB 2A79B 3CWBH 4K0KB 1IZ3A 5CA1A 2QJ1A 5IYZA 3DTUB 3IFXA 1UFIA 4O4LB 1RSOB 1NTKH 4X66B 1M57C 1UPGA 4PJ0Z 2WPDG 1J5EO 4JV5B 2AHYA 5IJ9B 3QO5A 1AB3A 5F2VO 4O4JB 2ZINA 4G2KA 3OGCC 1R6NA 1YJ9V 4PV1B 1XILA 3RYIB 5LXTA 2E76B 1XMQB 1IX9A 5LHHA 1OZ0A 2AW9A 4X62O 1ZLZA 4I55B 3ZEDA 5L3GA 4DR4O 3T4ZA 2GTAA 4TSFG 1G8MA 1FXKA 4H0LB 1Q82W 2QKSA 4GZRB 2W0XA 2GUZB 1DK1A 4TQDA 3ZMSA 3NR7A 1QBZA 5EIBD 1HWYA 3EHBB 2EINB 4DW0A 2ATKC 3ML0A 2KG7B 1AI5A 3CC7V 3KG2A 4JI1O 2EJRA 2RMKB 1PV0A 3HKDA 4Z1MG 2R72A 4J7KA 5CBHA 3AG4B 4FM2A 1XMOB 2P5OA 1W2BU 4DV1O 3GB7C 4CH3A 2YS8A 2ZM6O 4BIUA 3T1YB 2OWOA 3JAWB 1KD1W 4OGQB 5LYJB 4DV5B 3A2FA 2VQEB 1Z5VA 2JJ2G 3RYIA 1NT2B 4HZ3A 1JJ2U 2OCCB 4KHPO 4LFBB 3OGIB 1O9GA 1M5IA 2QWRB 3DC5A 3B40A 4HNAA 4YY3O 3FB7C 1GRJA 4PA3A 4LF5B 1T5EA 1K4CC 4FPPA 5L3EA 4X66O 2Q8VA 4PD4F 4I55A 1EM1A 5JJJB 4U7OA 3K59A 1WA8A 4TT3G 2KQXA 5GTIZ 4JV5O 2ZE8A 1YHQV 4MTXA 2N74A 1JX9A 1G4YB 3A0HZ 2BTOA 4UCOA 1NTMH 1MSDA 1S5JA 2NN4A 4K35A 3F5WC 3P30A 4A5UB 3SPJA 2F4VO 4GX5A 1SQXH 1XMQO 1TVKB 3QTCA 4F6RA 3LNMB 2EIJB 1QQCA 1KECA 1OV9A 2FYUH 2WLLA 4JYBA 3CCUV 1M56C 4PI2A 2WLIB 4JI5B 2FMLA 4YHHB 2W6IG 1AR4A 4X1IA 1YI2V 5GONA 2K1EA 4RQEA 5L3FA 5H9CA 5FPOA 2LP7A 1V9PA 2LW7A 2Q4PA 2CTPA 1NBMG 3DC6A 1Y74B 4YJ3A 4MVUA 2BOBC 2H3OA 2X6CA 2Z0AA 3CRRA 4JI3B 3CMEV 4X1KA 5EBLC 4JZ2A 4CBCA 3WG7B 4U7NA 4FZ0A 4K3AA 2O57A 2NR5A 3TK1A 1KUQA 3B09A 2LGWA 2Y4TA 2Q0OC 1TUEB 3L75H 2P06A 2JJ1G 3IC9A 4Z1VA 4OPAA 3E86A 1L1FA 1ZUQA 1W0JG 4UV9A 2JS5A 2HHHB 2LW1A 2Y69C 5K1XA 3JALA 1F23A 2LO1A 2JEUA 4B3SO 5BR8B 1GH6A 4X88A 4DV7B 3UO3A 1NR7A 4DV5O 3OR7C 1AJQA 1EN4A 2GSMB 1NS1A 1YZBA 1RP3B 4DRXB 4MVMA 1YTFB 1N33B 1WN7A 3E8BA 3RFRA 3FAVB 1EZVH 1JPXA 1MOFA 3G80A 3MHSC 4LF8B 1FYJA 4FK5C 4U3JA 3IJ4A 1M57B 4LFAB 4XBFA 5EYPA 4FM0A 1MMMA 4BW9A 4X20A 5C8YB 5KLVH 4GX0A 3U10A 3DXRB 1ZL8A 4DV0O 2UUCB 5EC1C 3JD0A 2PI4A 1Q3EA 3OT7A 3J81N 1SQFA 1NR1A 3RYFB 2E3CA 3LDDA 2WLNA 3LUTB 2CDYA 3E2EA 3SPCA 1KB9F 5E1AC 2HEPA 4DO2A 4GUNA 4CH6A 2UXBO 4GLXA 1R1BA 3QO8A 1J95A 2VS0A 3FKSG 1NTZH
chains in the Genus database with same CATH topology
5B1NA 1FXVA 1H2GA 2UXXA 1R3IC 1RPRA 2Q69A 4PDVA 2UXNA 3ETGA 4YXWG 2DWEC 2ZQMA 2OTLV 2R9IA 2F43G 1VQNV 4WFBV 1K3EA 4BAYA 3B8NA 4QJFB 2JIZG 5B1BB 3RVYA 4JTDB 3H01A 5LGNA 3W7UA 1XL6A 1JCHA 1BMFG 1ENVA 1NQTA 1M90W 4UVAA 5B3SC 3LSSA 3ZRWB 4FMTA 5L3CA 3ZRSA 1WPXA 3X2QB 2P6JA 4RO2A 2PI5A 3IGAC 1M1KW 3SYAA 2OTJV 3ASOC 2ZDIA 3OEHG 5BZBA 1COWG 3K3WA 5IY5B 4QIWF 3SYCA 3W7TA 1VQ6V 2HLDG 2XASA 3ZN1A 3ETDA 1KP2A 2H94A 2LFRA 2EZOA 2ZR3A 2NNUA 3P32A 3W7XA 1VQKV 4N23A 1NKDA 3SYQA 1CP9A 4P2ZA 4MVZA 1RM1B 3QNEA 2Q68A 1SZTA 2P90A 3AG2B 2YEVB 3DGEA 5CBGA 3OM3B 5CA3A 3CCMV 1NH2B 4UVBA 1OCZB 3T1CA 1F51A 2EIMB 1VQ8V 3B8MA 2P67A 2XAFA 3UM7A 2EIJC 1K33A 2H8PC 3STZC 1K92A 5LHIA 1VQ4V 2XNDG 1K4DC 2X6AA 3JCZA 4MVOA 1GO3F 5HFLA 5B1AC 4QE7A 4KP4A 1H38A 3ZCCA 4LC1A 3W7SA 2QM7A 3AG1C 3K79A 4CZZA 4PA7A 4JF3A 5J9PC 1Q81W 4HAMA 3ABMC 5B1BC 1VQLV 1QVFU 3CCVV 2EILC 4MTOA 3OMNB 3OAAG 3CXCU 1H8HG 4GT1A 1AI7A 3T4DA 1OCOC 2EIKB 3EFFK 1ORQC 3SPHA 3X2QC 2IU3A 2NLJC 1EZJA 1SESA 3CP1A 4EKWA 1K8AW 3SYPA 4ZBMA 2X7RB 2Z5UA 3JD3A 1ROPA 1JVMA 2CK3G 4FJCC 4GX2A 2ITCC 5CBFA 1N8RW 1XL4A 3UKMA 1S0VA 1AJNA 3BEHA 1SETA 4QPKA 3ABKB 3LSQA 1NVPB 1Y4MA 1RPOA 2ITDC 4E2LA 3ABLB 3FB8C 2HVKC 2Y48A 3CCEV 1PNMA 4P9OA 1R73A 2WWWA 2M7WA 1QLEB 3K0DA 4WFEA 5EK0A 2R9RB 4KUMA 2WLKA 1AI4A 1PNLA 3PJSK 4WFFA 5LBQA 4Q20A 2IJHA 3ASNC 4RUEA 3T2MA 3A0RA 4QNHB 3OW2U 1SERA 1DTOA 3ZMTA 4BW5A 4WCEV 1YJNV 2ZXWB 1R3JC 3SYOA 1K7DA 1IXMA 4JAVA 4PDRA 4L87A 1QLNA 3VBBA 4PDLA 1V54C 3OE7G 5B1OA 3I55V 2B1GA 4PA4A 3HB3B 2A79B 1BHBA 1WLEA 1E1QG 3OR6C 3OMAB 3K06A 3DTUB 3IFXA 4WF9V 5GW7A 1R6KA 3ZJZA 4HYOA 1P7BA 1K73W 3AG3B 2HR3A 3ZMUA 3FYEB 4X8AA 2Y69B 4I5SA 1PNKA 1M57C 3CC2V 2WPDG 4ASUG 2Q67A 1KKDA 3E8HA 1S76D 1YTFD 2QE7G 3ZRVA 2MK3A 2AHYA 3QO5A 5EC2C 1OHHG 1VQ5V 2W0FC 3K0GA 3ABUA 4G2KA 4RQFA 1R3LC 3ABLC 3OGCC 2XAGA 4MVQA 3OUFA 1R6NA 1YJ9V 2WSSG 1F4NA 2V7QG 3OEEG 5LHGA 1FS0G 1ZWIC 5LHHA 2Q6AA 1OCCB 2D3OW 1QCEA 4WFAV 1GM9A 3R65A 1OZ0A 2ZXWC 1KQSU 2EZPA 3ZMZA 3SJQC 5L3GA 1AJPA 1QR9A 2XAJA 3T4ZA 2HKOA 1R3KC 3LDEA 1CEZA 4TSFG 1DLBA 1G8MA 1FXKA 1K97A 1MG1A 4UV8A 3VOUA 1V55B 2QKSA 1Q82W 3RW0A 5EBWC 3ZMSA 3E35A 1QBZA 1HWYA 3EHBB 2ZD9A 2GHYA 3K9AA 5IDJA 1DF5A 2HVJC 3AG3C 3K03A 4MTFA 3SPGA 1AR1B 3D36A 2HG5C 1EFRG 2EINB 2ATKC 3ML0A 1AI5A 3CC7V 3KG2A 1H8EG 5L3DA 3E8FA 2DYSB 2QM8A 2A0LA 2EJRA 3MHHC 3STLC 1S77D 1Q86W 1S3JA 4LCUC 4Z1MG 1GM8A 4XDJA 2DQ0A 2WLJA 2B5UA 4X89A 1VQPV 1FFTB 1K5QA 5CBHA 3AG4B 1UJWB 1W2BU 3SPIA 2JDIG 5IY5C 3RVZA 2ZR2A 4JTAB 1M56B 2WLIA 1PKXA 3GB7C 5CN0A 4ZKIA 4BIUA 1EBOA 1KD1W 3CC4V 2QTOA 2C2AA 4TWKA 1GM7A 5CMUA 4F4LA 1RM1C 2JJ2G 3AG2C 3ETEA 4HZ3A 1JJ2U 1B6QA 1OCZC 2OCCB 4JAUA 4FIPC 2EIMC 2OT5A 3OFNG 3ZRXA 1CPYA 5IYCO 1YITV 4H33A 2EBOA 3MD0A 3FB7C 1V55C 1I5XA 4PA3A 2P7TC 1FXKB 4N21A 5B3SB 4JPRA 1K4CC 4FPPA 5L3EA 2WLMA 3W7WA 4UVCA 4G28B 4J9ZB 1JQ0A 1KP3A 3ASOB 2YSUB 4U7OA 3B77A 3QO7A 4TT3G 1OCRB 3TCUA 5C93A 3LDCA 4PA9A 1YHQV 1NH2D 1MSWD 4MTXA 1FXHA 5KA5A 3CCJV 2DWDC 1JX9A 5HFMA 1G4YB 5H6RA 4G27B 3ZMVA 3JD2A 2V1DA 2EIKC 3ZN0A 3WFVA 4MW8A 2IJJA 3F5WC 2LFSA 3P30A 3AEIA 2W6JG 2AHZA 3ABTA 3CYOA 4LP8A 4GX5A 3SPJA 2JK5C 1AI6A 3FYIB 1E79G 3F7VC 3AG4C 3CCQV 3LNMB 2EIJB 2ZDIC 3M99B 5L3BA 1KECA 2WLLA 4JYBA 1S5HC 3CCUV 1M56C 2IW5A 2IJKA 3FB5C 4JTCB 3ABKC 2WLIB 3CPWU 1SRYA 5B1AB 2W6IG 3JD1A 4PDMA 2WLHA 2IH1C 3AG1B 1YI2V 1KC8W 2DQ3A 2K1EA 3K04A 3HPLC 1VQ9V 1K34A 4XDLA 4RQEA 5L3FA 1QLEC 2IH3C 2LP7A 2OCCC 5H9CA 1YIJV 1QVGU 3D3IA 3ABMB 2X6BA 1P4RA 1NBMG 1MABG 2EILB 4MVUA 3IC7A 4MW3A 4R50A 2BOBC 1W0KG 3K08A 2X6CA 1YJWV 4OXSA 5LGUA 1FXKC 3CMEV 5EBLC 1OCOB 2HFEC 4CBCA 4JASA 4I9WA 4U7NA 3WG7B 4JYCA 3CMAV 1NVPD 1F4MA 5IYBO 1E1RG 4PA6A 4QPJA 1AROP 3TK1A 3CCLV 4JGSA 3CD6V 1OCRC 3I56V 2QA4V 1PL0A 1TUEB 4MTGA 1BHAA 4MVRA 5DM6V 2DYRB 4P30A 2JJ1G 5LGTA 3G71V 1LNQA 3E86A 1L1FA 5DN6G 4LBEC 4BIZA 1W0JG 4UV9A 1VQMV 4RUFA 2JEXA 3G4SV 2Y69C 4GCZA 4MSWC 1K5SA 4R6ZA 4KFMA 5KA6A 1F23A 2HJFC 2JEUA 5EBMC 2FTKA 4X88A 4WFGA 3ASNB 3E89A 4GX1A 3ZIAG 1NR7A 2WLLB 3OR7C 4MVSA 1AJQA 4UUJC 2GSMB 4XDKA 1NJIW 4PELA 1YSCA 3OMIB 3G6EV 2Z3YA 3JD4A 4MVMA 2WAMA 4DXWA 1V54B 2KB1A 5KUKA 4QE9A 1YTFB 2A9HA 3OUSA 3CCSV 2DW4A 3E8BA 4H37A 4WFHA 5KUMA 4RAIA 1MOFA 1JPXA 3GWOA 2QEXV 2XAHA 3BY6A 1OCCC 4UXNA 4MS2A 3MHSC 2IJIA 4FK5C 3WG7C 3FB6C 1THZA 1M57B 4R7CA 1VQOV 3JYCA 4XBFA 1DF4A 3ZRWA 3E8GA 2DYRC 4P9PA 1S72V 1BL8A 4GX0A 1GK9A 1I5YA 3TETA 2BOCC 1PD3A 2EINC 5EC1C 3JD0A 2IU0A 2PI4A 5FL7G 4R8CA 1Q7YW 1JOYA 2DYSC 1NR1A 3RBZA 3LDDA 1M9NA 2WLNA 3E83A 3LUTB 3NXSA 1GKFA 3E2EA 2B1IA 2YEVA 4J9YB 3SPCA 4MT8A 3F7YC 2XOKG 5E1AC 5H6QA 2XAQA 4DO2A 1VQ7V 1Y66A 1K9MW 1GTOA 2X0LA 1GMGA 3QO8A 1J95A 5IYDO 3CCRV 3FKSG 1QR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS C;  3B8M A;  5CMU A;  2P6J A;  1K33 A;  3MHH C;  4G2K A;  1QR9 A;  2M7W A;  4FK5 C;  4JGS A;  5KA5 A;  5HFM A;  1DLB A;  4FIP C;  2OT5 A;  1MG1 A;  1K34 A;  5HFL A;  3CP1 A;  5H9C A;  2LP7 A;  1QBZ A;  2EBO A;  3WFV A;  2EZO A;  2X7R B;  1DF4 A;  3B8N A;  3K9A A;  3P30 A;  4FJC C;  1I5X A;  4N21 A;  1DF5 A;  3CYO A;  4JPR A;  4N23 A;  3H01 A;  4JF3 A;  5CN0 A;  1QCE A;  1Y66 A;  1JQ0 A;  1SZT A;  1ENV A;  1Y4M A;  3M99 B;  1I5Y A;  1EBO A;  1F23 A;  1MOF A;  1JPX A;  3GWO A;  4E2L A;  5KA6 A;  2MK3 A;  2EZP A;  3B77 A;  1QR8 A; 
#chains in the Genus database with same CATH topology
 2DOS A;  4IGG A;  1R3I C;  3H1H H;  4LF9 B;  3C3T A;  2UXN A;  3KZI Z;  4YXW G;  3CS5 A;  2XUM A;  5A9G A;  3ICX A;  1IBM B;  3N2G B;  1IDS A;  4PHZ A;  4DV3 B;  3D3Q A;  5B1B B;  5E79 Z;  5J2T B;  4DUZ B;  3H01 A;  2V4D A;  2Q7G A;  1BMF G;  2ZIO A;  1H2M A;  5FNV A;  4FMT A;  3BHP A;  4J42 A;  3IGA C;  4C7U A;  2YUA A;  2ZDI A;  1COW G;  4QIW F;  1IXB A;  3ZN1 A;  2LGQ A;  3HR0 A;  1MZF A;  1VQK V;  1NKD A;  3M7M X;  1CP9 A;  4P2Z A;  4MVZ A;  3QNE A;  5CBG A;  2ZIM A;  3DGE A;  2YEV B;  2E75 B;  3OM3 B;  4NXN O;  3FFQ A;  4JI0 O;  4FLZ A;  1VQ8 V;  4EEQ A;  2P67 A;  4JI8 B;  3STZ C;  3L70 H;  1K92 A;  5LHI A;  5BY1 A;  1K4D C;  4J11 A;  1WPB A;  4OX9 B;  3JCZ A;  1HP8 A;  5IJ0 A;  5B1A C;  4QE7 A;  4KP4 A;  3E22 A;  2CUG A;  4H13 B;  1Q81 W;  1KYO F;  1VQL V;  4IL6 Z;  3OAA G;  3CJH B;  4TUY B;  1N36 O;  3SJB C;  2QWO B;  3T4D A;  3G67 A;  4J80 A;  2VQF O;  1ORQ C;  3ZHT A;  3X2Q C;  2UUC O;  1Q8I A;  2IU3 A;  1TUB B;  1ZSP A;  1AR5 A;  2P22 C;  1YXB A;  3CP1 A;  2F1M A;  2BTQ B;  1ROP A;  3UKM A;  1S0V A;  4W4L A;  1O9H A;  2EX3 A;  3LSQ A;  4E2L A;  3ABL B;  2L6L A;  2Y48 A;  4B3R B;  1PNM A;  4P9O A;  2D2C B;  2WWW A;  1Z2G A;  4WFE A;  1I94 B;  3OTO O;  1JFF B;  4WFF A;  1PNL A;  3PJS K;  3RYC B;  1BZK A;  3ASN C;  3JAT B;  2EUL A;  2OIE A;  3UT5 A;  3ZMT A;  4BW5 A;  2ZXW B;  1IXM A;  3JAS A;  4L87 A;  4DV3 O;  3VBB A;  4PDL A;  1AVM A;  3LSU A;  1BHB A;  3HB3 B;  1HNX B;  3OMA B;  2PGG A;  1G1X B;  3K06 A;  2QR4 A;  2AGA A;  4DV2 O;  1W59 A;  5GW7 A;  1R6K A;  5EZY A;  3ZMU A;  1LUV A;  3FYE B;  4X8A A;  1QNM A;  2Y69 B;  1PNK A;  4I5S A;  3PN1 A;  2RDC A;  3CC2 V;  3SGI A;  3BAA A;  3D8C A;  4TUY A;  1KKD A;  3ZX6 A;  1YTF D;  2QE7 G;  4UB8 Z;  2MK3 A;  4I4T A;  3ABU A;  3OUF A;  1BQ0 A;  2WSS G;  4IHJ B;  3BAB A;  2V7Q G;  2RJZ A;  1FFX A;  1VMG A;  4OX9 O;  4YJ2 A;  4ZHQ A;  3VQV A;  2CH7 B;  4UCS A;  2D3O W;  3R65 A;  1US6 A;  3CRA A;  1GN2 A;  3H1I H;  4BWA A;  1N0J A;  3ZMZ A;  1D2D A;  2P4V A;  4FFB B;  1AJP A;  2FKX A;  5H5N A;  1L0N H;  4RWU A;  1K97 A;  4UV8 A;  2AZ0 A;  1V55 B;  3RW0 A;  1X59 A;  1SS3 A;  5EBW C;  5CA1 B;  5IYZ B;  2VRZ A;  4IYH A;  1DF5 A;  2HVJ C;  3VQY A;  4DUY B;  3AG3 C;  4MTF A;  1AR1 B;  2P4K A;  3AK2 A;  1EFR G;  5H2F Z;  2GTS A;  5L3D A;  2A0L A;  2ADP A;  1MA1 A;  1GM8 A;  2KKW A;  4XDJ A;  3F5T A;  1FFT B;  4FVM A;  1UJW B;  1GN3 A;  4DV4 O;  1BE3 H;  5KHI A;  5IY5 C;  5LXT B;  2ZR2 A;  4JTA B;  5CN0 A;  2F93 B;  3CC4 V;  2QTO A;  4F4L A;  4FLU A;  1RM1 C;  1OCZ C;  4JAU A;  4D6T H;  1HNX O;  1CPY A;  4X65 B;  4H33 A;  2EBO A;  2JVD A;  4DR1 B;  1I5X A;  4N21 A;  1FXK B;  4JPR A;  2WLM A;  1N4C A;  4UCT A;  4UVC A;  4J9Z B;  2IM9 A;  2YIB A;  4CC6 A;  1KP3 A;  3B77 A;  3H1J H;  1OCR B;  3LDC A;  4PA9 A;  3EVK A;  5KA5 A;  5H6R A;  3I5D A;  3JD2 A;  2N05 A;  2V1D A;  2EIK C;  3HKD B;  3ZN0 A;  3RYH A;  1HNW O;  4ICG A;  3RT3 C;  1I08 A;  3CYO A;  4ZOL A;  4O4H A;  3CCQ V;  3CRQ A;  2ZDI C;  4CC5 A;  1FD9 A;  2A06 H;  2IJK A;  4JTC B;  5B1A B;  4GKK O;  2IH1 C;  1KC8 W;  2DQ3 A;  2QWQ B;  3K04 A;  4DR2 B;  4XDL A;  1QLE C;  1YIJ V;  1QVG U;  4NTX A;  3CRM A;  4DR6 O;  4LF6 O;  1P4R A;  3IC7 A;  3FX7 A;  4MW3 A;  1IBL B;  1YJW V;  3BPZ A;  4HNA B;  2HFE C;  4E4E A;  4JYY A;  4JAS A;  3CMA V;  1FAF A;  4EFB A;  1F4M A;  1Q90 D;  1E1R G;  4O2A A;  1ARO P;  3CD6 V;  3CCL V;  4JGS A;  3H1L H;  3CX5 F;  3D36 C;  1WA8 B;  1ZAU A;  2QA4 V;  1VEW A;  1BHA A;  2ZE7 A;  2QWP B;  2DYR B;  1LNQ A;  4X64 B;  2XHB A;  3BVO A;  2YC0 A;  4FM1 A;  4D7S A;  5CA0 A;  3L9D A;  4F6R B;  2R70 A;  1R6T A;  3ASN B;  4GX1 A;  2WLL B;  4MVS A;  1VIB A;  4XDK A;  4ZIB A;  4PEL A;  3OMI B;  4W4K A;  4X1I B;  3G6B A;  3JD4 A;  5JWP A;  5GON B;  4DXW A;  5KUK A;  2HP8 A;  2A9H A;  2Q73 A;  2PY5 A;  4B3T O;  2JGD A;  2DW4 A;  2UU9 B;  4WFH A;  4O2B A;  4RAI A;  1N0N A;  3GWO A;  3BY6 A;  4YIO A;  4YJ3 B;  4B3M O;  4UXN A;  1I0H A;  2IJI A;  5JQG A;  4X1K B;  3O65 A;  5IT9 N;  1SZX A;  1RFY A;  1THZ A;  1BCC H;  3L73 H;  4K0K O;  2UXC B;  1DF4 A;  1N34 B;  5KHH A;  1Y76 A;  1YCI A;  1S72 V;  1BL8 A;  1GK9 A;  2OIG A;  1PPJ H;  1H2N A;  5FL7 G;  3WB1 A;  4R8C A;  3JAL B;  2F23 A;  2DYS C;  3CB2 A;  2RCV A;  1GKF A;  4JZG A;  4DR2 O;  4MT8 A;  1Q6H A;  2XOK G;  3KKY A;  1VQ7 V;  1EN6 A;  2X0L A;  1GMG A;  1VF5 B;  4I50 A;  5IYD O;  1CXZ B;  2Q7E A;  1QR8 A;  5B1N A;  2F66 C;  1H2G A;  5LOV A;  4IYI A;  4PDV A;  3ETG A;  4YIP A;  2ZQM A;  2OTL V;  2A3Q A;  2F43 G;  2PTM A;  1KMI Z;  1VQN V;  3P3N A;  4WFB V;  1M93 A;  1K3E A;  3K58 A;  4U3J B;  4LWS A;  1AP5 A;  4NR1 A;  3RVY A;  3GWK C;  4J41 A;  5BMV A;  3W7U A;  1WJZ A;  5EYP B;  1ENV A;  1M90 W;  4UVA A;  5B3S C;  3LSS A;  5KHK A;  4X20 B;  3SYA A;  5BZB A;  3OEH G;  1ZL8 B;  2DE0 X;  1HR0 B;  5IY5 B;  3DSQ A;  3ETD A;  1SF9 A;  5JH7 A;  4N23 A;  2QTS A;  3ZHR A;  1RM1 B;  2Q68 A;  2QM4 A;  1XMO O;  5CA3 A;  1OCZ B;  3JCU Z;  2XAF A;  3UM7 A;  4DYL A;  2H8P C;  3T1Y O;  2XND G;  2X6A A;  1D5A A;  4MVO A;  1GO3 F;  2VQE O;  5HFL A;  4FFK A;  4L8J A;  3RN4 A;  2BSK A;  3AG1 C;  4LFB O;  3BFR A;  4PA7 A;  2XTA A;  2BCC H;  4JF3 A;  4HAM A;  3T1H B;  4LF5 O;  2YID A;  4UCU A;  4MTO A;  3MAQ A;  4GT1 A;  1AI7 A;  2QDO A;  2EIK B;  1JA8 A;  3EFF K;  3SPH A;  5FNV B;  3OTF A;  2NLJ C;  1EZJ A;  4EKW A;  3TXQ A;  5A2Q N;  1XL4 A;  1EN5 A;  1AJN A;  1SET A;  1YVW A;  3FB8 C;  2HVK C;  1QLE B;  1AI4 A;  4BIO A;  4Z2W A;  4JI5 O;  1YF2 A;  3T2M A;  4RUE A;  4YHH O;  3A0R A;  1MZE A;  1SQV H;  3HKB A;  5DEC A;  1R3J C;  5IJ0 B;  3SYO A;  2ZNJ A;  4I9Q A;  5GTH Z;  3TGU H;  5J2U A;  3E22 B;  5ITZ A;  2WA4 A;  4LFC B;  1V54 C;  4TV9 A;  2B1G A;  2YI9 A;  1WLE A;  3OR6 C;  4JI3 O;  3N2K A;  4WF9 V;  1N32 B;  4WBN A;  1HR0 O;  4JI6 B;  1GAX A;  2A7W A;  5LMU B;  1Y6X A;  4ASU G;  3R66 A;  2Q67 A;  1WB8 A;  3ZRV A;  2HHH O;  5EC2 C;  1VQ5 V;  4RQF A;  2XAG A;  3CHX A;  2KSD A;  1ZX3 A;  3LNN A;  5JJN B;  5BR8 O;  3K9S A;  1F4N A;  4DV7 O;  1BGY H;  1FS0 G;  1ZWI C;  2Q6A A;  1XNQ B;  4WFA V;  1GM9 A;  3CEI A;  3VQX A;  3UT5 B;  2EZP A;  3SJQ C;  1N33 O;  3S3X A;  2CGO A;  3JAS B;  1QR9 A;  1VF6 C;  2XAJ A;  2HKO A;  1CEZ A;  3VOU A;  4LF8 O;  3E35 A;  5KMG A;  2ZD9 A;  5IDJ A;  5LMN B;  5TIS Z;  1L8D A;  3D36 A;  4LFA O;  1P84 F;  5EZY B;  3ZHU A;  3A8T A;  1H8E G;  2DYS B;  4H44 B;  4O4I A;  4AQY B;  4LR3 A;  4DR5 B;  3MHH C;  1XUQ A;  4X1Y A;  4LNU A;  3K57 A;  3J7A U;  2QSA A;  1S3J A;  2DJV A;  4LCU C;  4NXM B;  2DQ0 A;  2WLJ A;  4I4T B;  4X89 A;  3JAM N;  1VQP V;  3N27 A;  4LF7 B;  1XHZ A;  1WNS A;  4DR3 B;  1I7F A;  2DMX A;  2JDI G;  1VAR A;  1FFX B;  1M56 B;  3RWR D;  4YJ2 B;  4ZHQ B;  1IBK B;  1L0L H;  4TOI A;  5CMU A;  3ETE A;  4LFC O;  1F7Y A;  4FIP C;  2Y0P A;  1M4U A;  3L71 H;  1YIT V;  4LF9 O;  5B3S B;  2VWJ A;  2ADQ B;  1XBL A;  2CAZ C;  4G28 B;  2R9A A;  1IBM O;  1JQ0 A;  4JI6 O;  5KHG A;  2YSU B;  3QO7 A;  3CE2 A;  4DUZ O;  3TCU A;  4DV6 B;  2UUB B;  5HFM A;  4G27 B;  1BSM A;  3K5M A;  1FKA O;  4GKJ B;  4IIJ A;  1XNR B;  1GN6 A;  2LFS A;  3AEI A;  1ZTE A;  2AHZ A;  2W6J G;  3ABT A;  4EFE A;  3FYI B;  1BT8 A;  1E79 G;  3AG4 C;  2HJD A;  1Q5O A;  3J80 N;  2IW5 A;  3ABK C;  1SRY A;  4JYA B;  2CTR A;  5KX5 A;  3HKC A;  3JD1 A;  1HNZ B;  2GBO A;  3AG1 B;  3HPL C;  4JI8 O;  4ZI7 A;  3EXA A;  2OCC C;  4EB6 A;  3D3I A;  3K5L A;  1URF A;  2X6B A;  3GVM A;  2L35 A;  1W0K G;  3K08 A;  1G6U A;  1B06 A;  4PI0 A;  2Y4U A;  5FLX N;  2RNB A;  2UUA B;  4NB5 A;  4NYK A;  1X4T A;  3I56 V;  4UFZ A;  5KAF Z;  4MTG A;  2GDS A;  1J5E B;  4P30 A;  5LGT A;  4U3F H;  5DN6 G;  4LBE C;  1KBH A;  3C3S A;  3JAK A;  4RUF A;  3RYH B;  4R6Z A;  1K5S A;  5KA6 A;  1SA0 A;  4ZOL B;  4O4H B;  1IUR A;  2YXH A;  2FTK A;  5EBM C;  2FB5 A;  1IBK O;  4WFG A;  2IBZ H;  4UUJ C;  4B3R O;  4GYC B;  1Q6U A;  3MDS A;  1I94 O;  3QF7 A;  2WAM A;  2BE3 A;  4CS2 A;  4DW1 A;  1V54 B;  4X62 B;  4QE9 A;  3OUS A;  4DR4 B;  1FJG B;  2QEX V;  1OCC C;  4MS2 A;  4JI7 B;  2PUS A;  3WG7 C;  3FB6 C;  2CTW A;  4O2A B;  3H9V A;  4JI1 B;  3ZHQ A;  4I0X B;  3ZRW A;  1WP7 A;  4UCR A;  4P9P A;  3O9O A;  1I5Y A;  3TET A;  1H2S B;  1PD3 A;  3WB0 A;  5CA0 B;  1Q7Y W;  2Q5Z A;  2CTQ A;  2RN9 A;  1HNZ O;  1M9N A;  3H1K H;  3NXS A;  4DV1 B;  2B1I A;  3APO A;  3B2E E;  4J9Y B;  5JCO A;  2ZM6 B;  1GN4 A;  5LP6 A;  1SQQ H;  2XAQ A;  4HBN A;  1Y66 A;  1NU1 H;  3U11 A;  1K9M W;  1GTO A;  4KL1 A;  2JGD B;  1FXV A;  2UXX A;  1NZ6 A;  2Q69 A;  4O2B B;  4YY3 B;  2E5L B;  2UUA O;  3Q4H A;  5JQG B;  4BAY A;  4JTD B;  5LGN A;  1XL6 A;  2YXY A;  1HW7 A;  1NQT A;  5CB4 A;  4DUY O;  2Q9L A;  3A0B Z;  5L3C A;  1Y76 B;  1WPX A;  1B3Q A;  3X2Q B;  3ZRS A;  4JI4 B;  2P6J A;  1Z5W A;  3HKE A;  1M1K W;  3JAR A;  1NI8 A;  3ASO C;  1OJH A;  1FPO A;  4TV8 A;  2F4V B;  3K3W A;  5D5Q A;  3SYC A;  4I0X A;  3W7T A;  1VQ6 V;  5LA6 B;  1KP2 A;  2H94 A;  2EZO A;  2ZR3 A;  2NNU A;  1SQG A;  3W7X A;  2UXD B;  3SYQ A;  2CE4 A;  1TGO A;  2P90 A;  1NH2 B;  3CSX A;  3T1C A;  1KU9 A;  1XRE A;  2AXT Z;  1FJG O;  4LF4 B;  4I50 B;  4JI7 O;  2DN9 A;  5LOV B;  4DK1 A;  2QGN A;  1H38 A;  3JSN A;  4LC1 A;  2QM7 A;  5KHJ A;  3K79 A;  1VF6 A;  4X65 O;  4CZZ A;  3ZHS A;  5J9P C;  3UCS C;  4IT5 A;  3ABM C;  4LWS B;  5B1B C;  4DR1 O;  4K8Z A;  2CGN A;  4J7J A;  2EIL C;  4O4L A;  5BMV B;  1RSO A;  1H8H G;  1AP6 A;  1OCO C;  4CH5 A;  3SJC C;  2PYL A;  1SES A;  1XHX A;  4X9Q A;  3SYP A;  1Q43 A;  2X7R B;  2Z5U A;  2PYJ A;  4DR7 B;  4FJC C;  4GX2 A;  5CBF A;  1N8R W;  1XEQ A;  4TQF A;  5IJ9 A;  4QPK A;  4B3S B;  3K5O A;  1PP9 H;  3ABK B;  4O4J A;  1Y67 A;  1NVP B;  1SKV A;  1RPO A;  5JH7 B;  2Q7H A;  2ITD C;  4AI8 A;  5LA6 A;  5EK0 A;  2WLK A;  2XT9 A;  2OYQ A;  2YIB D;  4J10 A;  4Q20 A;  2IJH A;  2VWK A;  3OW2 U;  3K5N A;  2E5L O;  1SER A;  1AIL A;  4K8X A;  2YIC A;  1YJN V;  4FLY A;  4PDR A;  3QVN A;  3VQW A;  1QLN A;  2BSK B;  1XI1 A;  5B1O A;  3C90 A;  2ZT9 B;  3I55 V;  4PA4 A;  1IBL O;  3ZS8 C;  2GUZ A;  1E1Q G;  4JI4 O;  4NTY A;  3ZJZ A;  4HYO A;  1P7B A;  1K73 W;  3AG3 B;  2HR3 A;  1JR9 A;  2KG7 A;  3B4S A;  3SJA C;  4DV0 B;  4FLX A;  3E8H A;  1S76 D;  2PZS A;  2UXD O;  3CRC A;  4DK0 A;  4X64 O;  2ZE6 A;  1OHH G;  2W0F C;  3K0G A;  1R3L C;  3ABL C;  4MVQ A;  4CH4 A;  4LF4 O;  3UQ8 A;  5EIB C;  3OEE G;  5LHG A;  2UXB B;  3JAW A;  1H2K A;  5LYJ A;  2MW2 B;  1OCC B;  1QHT A;  5IE9 A;  1QCE A;  1D5N A;  3HKB B;  2ZXW C;  4I7Z B;  1KQS U;  1B04 A;  5J2U B;  2UU9 O;  5ITZ B;  1R3K C;  3LDE A;  3ZHV A;  3ETQ A;  1DLB A;  4TV9 B;  1MG1 A;  4JI2 B;  1LUW A;  5IWA B;  1LR1 A;  2GHY A;  3K9A A;  3N2K B;  2Y0I A;  3K03 A;  3SPG A;  4BR6 A;  2ARH A;  4DR7 O;  2HG5 C;  2UXC O;  2FL4 A;  4WBN B;  1N34 O;  3E8F A;  4CS4 A;  2QM8 A;  1WAZ A;  3STL C;  1S77 D;  1Q86 W;  1VP7 A;  2B5U A;  1TVK A;  5JVD B;  1K5Q A;  4UB6 Z;  4KXR A;  2K9P A;  4NXN B;  3SPI A;  3APQ A;  3RVZ A;  4JI0 B;  2AZ2 A;  2WLI A;  1PKX A;  4ZKI A;  1EBO A;  2C2A A;  4TWK A;  1GM7 A;  3KCY A;  3AG2 C;  5JCO C;  5LP6 C;  1B6Q A;  1DGS A;  2EIM C;  2OT5 A;  3OFN G;  3ZRX A;  1Y74 A;  5IYC O;  4B7K A;  3MD0 A;  1V55 C;  2P7T C;  3AG7 A;  3FD9 A;  3W7W A;  5KMG B;  1N36 B;  3ASO B;  2VQF B;  2ZNI A;  5C93 A;  1YDX A;  1U96 A;  3THO A;  1NH2 D;  1MSW D;  4B7E A;  1FXH A;  3CCJ V;  2DWD C;  2RQ6 A;  4O4I B;  3ZMV A;  1JMK C;  4X1Y B;  4LNU B;  3WFV A;  4MW8 A;  2IJJ A;  3TJT A;  2ZE5 A;  4LP8 A;  2JK5 C;  1AI6 A;  3F7V C;  1H2L A;  5B66 Z;  1WB7 A;  1IVS A;  1SQP H;  3M99 B;  5KAI Z;  5L3B A;  3OTO B;  1S5H C;  3FB5 C;  2QKA A;  5FPR A;  3CPW U;  4PDM A;  5JVD A;  2WLH A;  3SR2 C;  4DRX A;  3TXS A;  3KCX A;  1VQ9 V;  4JAA A;  1K34 A;  2IH3 C;  2YI8 A;  3FAV A;  3ABM B;  4JI2 O;  2WA3 A;  5IWA O;  1MAB G;  2EIL B;  4R50 A;  4OXS A;  5LGU A;  3UO2 A;  1FXK C;  1OCO B;  4DV2 B;  4I9W A;  4JYC A;  1NVP D;  4FLW A;  5IYB O;  4PA6 A;  2QWN B;  3T1H O;  4QPJ A;  3OD4 A;  1OCR C;  1PL0 A;  5C8Y A;  4MVR A;  1YEW A;  2ILM A;  5DM6 V;  3G71 V;  3DXR A;  4BIZ A;  4AIL C;  5JJE B;  1VQM V;  3S3W A;  2JEX A;  3G4S V;  4IIJ B;  4MSW C;  4GCZ A;  4KFM A;  2HJF C;  1VF7 A;  3RYF A;  1HDJ A;  3SDL A;  2ODM A;  3E89 A;  3IAY A;  3ZIA G;  4NVP A;  1NJI W;  1YSC A;  5KX5 B;  2ZKO A;  3HKC B;  3G6E V;  2Z3Y A;  5B5E Z;  1BQZ A;  2KB1 A;  3WU2 Z;  1JJO A;  4ZI7 B;  5DED A;  3CCS V;  4EB6 B;  1A32 A;  4H37 A;  5KUM A;  2XAH A;  3N2G A;  1WP8 A;  5J2T A;  3ZBH A;  4R7C A;  1VQO V;  3JYC A;  3U0Z A;  3BRC A;  1N32 O;  3E8G A;  2DYR C;  3P3P A;  5K1P A;  2LJ2 A;  2YIA A;  2JS3 A;  3M8A A;  5LMU O;  2BOC C;  1XQ8 A;  2EIN C;  2IU0 A;  3JAK B;  5AG2 A;  1S5L Z;  1SA0 B;  1JOY A;  4DV4 B;  3RBZ A;  3E83 A;  2YEV A;  2B9Z A;  4FLV A;  3F7Y C;  5H6Q A;  4D7T A;  2QKC A;  2PF4 E;  2YDE A;  3CCR V;  1XNQ O;  1QU7 A;  1RPR A;  3L74 H;  2DWE C;  3BCC H;  1BS3 A;  2R9I A;  4B08 A;  1P7G A;  2YXL A;  3B8N A;  4QJF B;  2JIZ G;  1KKC A;  2Q0A A;  3CJH A;  4CS3 A;  4F6E A;  1JCH A;  4UCV A;  4QGP A;  3JSL A;  3ZRW B;  5LMN O;  1TUB A;  1PL4 A;  4RO2 A;  2PI5 A;  2BTQ A;  2OTJ V;  1HNW B;  4AQY O;  2F95 B;  2OCH A;  4FLT A;  1SC5 B;  4DR5 O;  4Q6G A;  2HLD G;  2XAS A;  2LFR A;  1P49 A;  3CXH F;  3P32 A;  2G38 A;  4NXM O;  4J7Z A;  4LF7 O;  5BXZ A;  4DR3 O;  1SZT A;  3AG2 B;  3CCM V;  4GKK B;  4UVB A;  5LP6 B;  4OPH A;  1F51 A;  2EIM B;  1JFF A;  3B8M A;  3RYC A;  2EIJ C;  1K33 A;  2N04 A;  3JAT A;  1VQ4 V;  3AK1 A;  4DR6 B;  4LF6 B;  3WB2 A;  4LH6 A;  3AK3 A;  3ZCC A;  3W7S A;  1TA8 A;  3RGB A;  3Q4H B;  4NKG B;  4FZ1 A;  3BA8 A;  4LH7 A;  1QVF U;  3CCV V;  3OMN B;  3CXC U;  2GV9 A;  3QG5 A;  3L72 H;  5CB4 B;  4DV6 O;  3HKE B;  2UUB O;  1K8A W;  3JAR B;  4ZBM A;  5D5P A;  3JD3 A;  1U97 A;  2CK3 G;  1JVM A;  4NTW A;  2ITC C;  2JRI A;  4TV8 B;  2ETN A;  2JGU A;  3BEH A;  4AHC A;  1SQB H;  4GKJ O;  1XNR O;  4ABM A;  1Y4M A;  3CCE V;  4IHJ A;  1R73 A;  2ZCE A;  2M7W A;  3K0D A;  1Q6I A;  2M6Y A;  2E74 B;  1MNG A;  2R9R B;  2LQT A;  4KUM A;  1XOU A;  5LBQ A;  2CH7 A;  1XDC A;  4JYA O;  2EJ7 A;  4B3T B;  4QNH B;  1PM9 A;  1DTO A;  4WCE V;  4B3M B;  1K7D A;  1TAE A;  4JAV A;  4FFB A;  3BA9 A;  5LL6 Y;  3OE7 G;  4KHP B;  2A79 B;  3CWB H;  4K0K B;  1IZ3 A;  5CA1 A;  2QJ1 A;  5IYZ A;  3DTU B;  3IFX A;  1UFI A;  4O4L B;  1RSO B;  1NTK H;  4X66 B;  1M57 C;  1UPG A;  4PJ0 Z;  2WPD G;  1J5E O;  4JV5 B;  2AHY A;  5IJ9 B;  3QO5 A;  1AB3 A;  5F2V O;  4O4J B;  2ZIN A;  4G2K A;  3OGC C;  1R6N A;  1YJ9 V;  4PV1 B;  1XIL A;  3RYI B;  5LXT A;  2E76 B;  1XMQ B;  1IX9 A;  5LHH A;  1OZ0 A;  2AW9 A;  4X62 O;  1ZLZ A;  4I55 B;  3ZED A;  5L3G A;  4DR4 O;  3T4Z A;  2GTA A;  4TSF G;  1G8M A;  1FXK A;  4H0L B;  1Q82 W;  2QKS A;  4GZR B;  2W0X A;  2GUZ B;  1DK1 A;  4TQD A;  3ZMS A;  3NR7 A;  1QBZ A;  5EIB D;  1HWY A;  3EHB B;  2EIN B;  4DW0 A;  2ATK C;  3ML0 A;  2KG7 B;  1AI5 A;  3CC7 V;  3KG2 A;  4JI1 O;  2EJR A;  2RMK B;  1PV0 A;  3HKD A;  4Z1M G;  2R72 A;  4J7K A;  5CBH A;  3AG4 B;  4FM2 A;  1XMO B;  2P5O A;  1W2B U;  4DV1 O;  3GB7 C;  4CH3 A;  2YS8 A;  2ZM6 O;  4BIU A;  3T1Y B;  2OWO A;  3JAW B;  1KD1 W;  4OGQ B;  5LYJ B;  4DV5 B;  3A2F A;  2VQE B;  1Z5V A;  2JJ2 G;  3RYI A;  1NT2 B;  4HZ3 A;  1JJ2 U;  2OCC B;  4KHP O;  4LFB B;  3OGI B;  1O9G A;  1M5I A;  2QWR B;  3DC5 A;  3B40 A;  4HNA A;  4YY3 O;  3FB7 C;  1GRJ A;  4PA3 A;  4LF5 B;  1T5E A;  1K4C C;  4FPP A;  5L3E A;  4X66 O;  2Q8V A;  4PD4 F;  4I55 A;  1EM1 A;  5JJJ B;  4U7O A;  3K59 A;  1WA8 A;  4TT3 G;  2KQX A;  5GTI Z;  4JV5 O;  2ZE8 A;  1YHQ V;  4MTX A;  2N74 A;  1JX9 A;  1G4Y B;  3A0H Z;  2BTO A;  4UCO A;  1NTM H;  1MSD A;  1S5J A;  2NN4 A;  4K35 A;  3F5W C;  3P30 A;  4A5U B;  3SPJ A;  2F4V O;  4GX5 A;  1SQX H;  1XMQ O;  1TVK B;  3QTC A;  4F6R A;  3LNM B;  2EIJ B;  1QQC A;  1KEC A;  1OV9 A;  2FYU H;  2WLL A;  4JYB A;  3CCU V;  1M56 C;  4PI2 A;  2WLI B;  4JI5 B;  2FML A;  4YHH B;  2W6I G;  1AR4 A;  4X1I A;  1YI2 V;  5GON A;  2K1E A;  4RQE A;  5L3F A;  5H9C A;  5FPO A;  2LP7 A;  1V9P A;  2LW7 A;  2Q4P A;  2CTP A;  1NBM G;  3DC6 A;  1Y74 B;  4YJ3 A;  4MVU A;  2BOB C;  2H3O A;  2X6C A;  2Z0A A;  3CRR A;  4JI3 B;  3CME V;  4X1K A;  5EBL C;  4JZ2 A;  4CBC A;  3WG7 B;  4U7N A;  4FZ0 A;  4K3A A;  2O57 A;  2NR5 A;  3TK1 A;  1KUQ A;  3B09 A;  2LGW A;  2Y4T A;  2Q0O C;  1TUE B;  3L75 H;  2P06 A;  2JJ1 G;  3IC9 A;  4Z1V A;  4OPA A;  3E86 A;  1L1F A;  1ZUQ A;  1W0J G;  4UV9 A;  2JS5 A;  2HHH B;  2LW1 A;  2Y69 C;  5K1X A;  3JAL A;  1F23 A;  2LO1 A;  2JEU A;  4B3S O;  5BR8 B;  1GH6 A;  4X88 A;  4DV7 B;  3UO3 A;  1NR7 A;  4DV5 O;  3OR7 C;  1AJQ A;  1EN4 A;  2GSM B;  1NS1 A;  1YZB A;  1RP3 B;  4DRX B;  4MVM A;  1YTF B;  1N33 B;  1WN7 A;  3E8B A;  3RFR A;  3FAV B;  1EZV H;  1JPX A;  1MOF A;  3G80 A;  3MHS C;  4LF8 B;  1FYJ A;  4FK5 C;  4U3J A;  3IJ4 A;  1M57 B;  4LFA B;  4XBF A;  5EYP A;  4FM0 A;  1MMM A;  4BW9 A;  4X20 A;  5C8Y B;  5KLV H;  4GX0 A;  3U10 A;  3DXR B;  1ZL8 A;  4DV0 O;  2UUC B;  5EC1 C;  3JD0 A;  2PI4 A;  1Q3E A;  3OT7 A;  3J81 N;  1SQF A;  1NR1 A;  3RYF B;  2E3C A;  3LDD A;  2WLN A;  3LUT B;  2CDY A;  3E2E A;  3SPC A;  1KB9 F;  5E1A C;  2HEP A;  4DO2 A;  4GUN A;  4CH6 A;  2UXB O;  4GLX A;  1R1B A;  3QO8 A;  1J95 A;  2VS0 A;  3FKS G;  1NTZ H; 
#chains in the Genus database with same CATH homology
 5B1N A;  1FXV A;  1H2G A;  2UXX A;  1R3I C;  1RPR A;  2Q69 A;  4PDV A;  2UXN A;  3ETG A;  4YXW G;  2DWE C;  2ZQM A;  2OTL V;  2R9I A;  2F43 G;  1VQN V;  4WFB V;  1K3E A;  4BAY A;  3B8N A;  4QJF B;  2JIZ G;  5B1B B;  3RVY A;  4JTD B;  3H01 A;  5LGN A;  3W7U A;  1XL6 A;  1JCH A;  1BMF G;  1ENV A;  1NQT A;  1M90 W;  4UVA A;  5B3S C;  3LSS A;  3ZRW B;  4FMT A;  5L3C A;  3ZRS A;  1WPX A;  3X2Q B;  2P6J A;  4RO2 A;  2PI5 A;  3IGA C;  1M1K W;  3SYA A;  2OTJ V;  3ASO C;  2ZDI A;  3OEH G;  5BZB A;  1COW G;  3K3W A;  5IY5 B;  4QIW F;  3SYC A;  3W7T A;  1VQ6 V;  2HLD G;  2XAS A;  3ZN1 A;  3ETD A;  1KP2 A;  2H94 A;  2LFR A;  2EZO A;  2ZR3 A;  2NNU A;  3P32 A;  3W7X A;  1VQK V;  4N23 A;  1NKD A;  3SYQ A;  1CP9 A;  4P2Z A;  4MVZ A;  1RM1 B;  3QNE A;  2Q68 A;  1SZT A;  2P90 A;  3AG2 B;  2YEV B;  3DGE A;  5CBG A;  3OM3 B;  5CA3 A;  3CCM V;  1NH2 B;  4UVB A;  1OCZ B;  3T1C A;  1F51 A;  2EIM B;  1VQ8 V;  3B8M A;  2P67 A;  2XAF A;  3UM7 A;  2EIJ C;  1K33 A;  2H8P C;  3STZ C;  1K92 A;  5LHI A;  1VQ4 V;  2XND G;  1K4D C;  2X6A A;  3JCZ A;  4MVO A;  1GO3 F;  5HFL A;  5B1A C;  4QE7 A;  4KP4 A;  1H38 A;  3ZCC A;  4LC1 A;  3W7S A;  2QM7 A;  3AG1 C;  3K79 A;  4CZZ A;  4PA7 A;  4JF3 A;  5J9P C;  1Q81 W;  4HAM A;  3ABM C;  5B1B C;  1VQL V;  1QVF U;  3CCV V;  2EIL C;  4MTO A;  3OMN B;  3OAA G;  3CXC U;  1H8H G;  4GT1 A;  1AI7 A;  3T4D A;  1OCO C;  2EIK B;  3EFF K;  1ORQ C;  3SPH A;  3X2Q C;  2IU3 A;  2NLJ C;  1EZJ A;  1SES A;  3CP1 A;  4EKW A;  1K8A W;  3SYP A;  4ZBM A;  2X7R B;  2Z5U A;  3JD3 A;  1ROP A;  1JVM A;  2CK3 G;  4FJC C;  4GX2 A;  2ITC C;  5CBF A;  1N8R W;  1XL4 A;  3UKM A;  1S0V A;  1AJN A;  3BEH A;  1SET A;  4QPK A;  3ABK B;  3LSQ A;  1NVP B;  1Y4M A;  1RPO A;  2ITD C;  4E2L A;  3ABL B;  3FB8 C;  2HVK C;  2Y48 A;  3CCE V;  1PNM A;  4P9O A;  1R73 A;  2WWW A;  2M7W A;  1QLE B;  3K0D A;  4WFE A;  5EK0 A;  2R9R B;  4KUM A;  2WLK A;  1AI4 A;  1PNL A;  3PJS K;  4WFF A;  5LBQ A;  4Q20 A;  2IJH A;  3ASN C;  4RUE A;  3T2M A;  3A0R A;  4QNH B;  3OW2 U;  1SER A;  1DTO A;  3ZMT A;  4BW5 A;  4WCE V;  1YJN V;  2ZXW B;  1R3J C;  3SYO A;  1K7D A;  1IXM A;  4JAV A;  4PDR A;  4L87 A;  1QLN A;  3VBB A;  4PDL A;  1V54 C;  3OE7 G;  5B1O A;  3I55 V;  2B1G A;  4PA4 A;  3HB3 B;  2A79 B;  1BHB A;  1WLE A;  1E1Q G;  3OR6 C;  3OMA B;  3K06 A;  3DTU B;  3IFX A;  4WF9 V;  5GW7 A;  1R6K A;  3ZJZ A;  4HYO A;  1P7B A;  1K73 W;  3AG3 B;  2HR3 A;  3ZMU A;  3FYE B;  4X8A A;  2Y69 B;  4I5S A;  1PNK A;  1M57 C;  3CC2 V;  2WPD G;  4ASU G;  2Q67 A;  1KKD A;  3E8H A;  1S76 D;  1YTF D;  2QE7 G;  3ZRV A;  2MK3 A;  2AHY A;  3QO5 A;  5EC2 C;  1OHH G;  1VQ5 V;  2W0F C;  3K0G A;  3ABU A;  4G2K A;  4RQF A;  1R3L C;  3ABL C;  3OGC C;  2XAG A;  4MVQ A;  3OUF A;  1R6N A;  1YJ9 V;  2WSS G;  1F4N A;  2V7Q G;  3OEE G;  5LHG A;  1FS0 G;  1ZWI C;  5LHH A;  2Q6A A;  1OCC B;  2D3O W;  1QCE A;  4WFA V;  1GM9 A;  3R65 A;  1OZ0 A;  2ZXW C;  1KQS U;  2EZP A;  3ZMZ A;  3SJQ C;  5L3G A;  1AJP A;  1QR9 A;  2XAJ A;  3T4Z A;  2HKO A;  1R3K C;  3LDE A;  1CEZ A;  4TSF G;  1DLB A;  1G8M A;  1FXK A;  1K97 A;  1MG1 A;  4UV8 A;  3VOU A;  1V55 B;  2QKS A;  1Q82 W;  3RW0 A;  5EBW C;  3ZMS A;  3E35 A;  1QBZ A;  1HWY A;  3EHB B;  2ZD9 A;  2GHY A;  3K9A A;  5IDJ A;  1DF5 A;  2HVJ C;  3AG3 C;  3K03 A;  4MTF A;  3SPG A;  1AR1 B;  3D36 A;  2HG5 C;  1EFR G;  2EIN B;  2ATK C;  3ML0 A;  1AI5 A;  3CC7 V;  3KG2 A;  1H8E G;  5L3D A;  3E8F A;  2DYS B;  2QM8 A;  2A0L A;  2EJR A;  3MHH C;  3STL C;  1S77 D;  1Q86 W;  1S3J A;  4LCU C;  4Z1M G;  1GM8 A;  4XDJ A;  2DQ0 A;  2WLJ A;  2B5U A;  4X89 A;  1VQP V;  1FFT B;  1K5Q A;  5CBH A;  3AG4 B;  1UJW B;  1W2B U;  3SPI A;  2JDI G;  5IY5 C;  3RVZ A;  2ZR2 A;  4JTA B;  1M56 B;  2WLI A;  1PKX A;  3GB7 C;  5CN0 A;  4ZKI A;  4BIU A;  1EBO A;  1KD1 W;  3CC4 V;  2QTO A;  2C2A A;  4TWK A;  1GM7 A;  5CMU A;  4F4L A;  1RM1 C;  2JJ2 G;  3AG2 C;  3ETE A;  4HZ3 A;  1JJ2 U;  1B6Q A;  1OCZ C;  2OCC B;  4JAU A;  4FIP C;  2EIM C;  2OT5 A;  3OFN G;  3ZRX A;  1CPY A;  5IYC O;  1YIT V;  4H33 A;  2EBO A;  3MD0 A;  3FB7 C;  1V55 C;  1I5X A;  4PA3 A;  2P7T C;  1FXK B;  4N21 A;  5B3S B;  4JPR A;  1K4C C;  4FPP A;  5L3E A;  2WLM A;  3W7W A;  4UVC A;  4G28 B;  4J9Z B;  1JQ0 A;  1KP3 A;  3ASO B;  2YSU B;  4U7O A;  3B77 A;  3QO7 A;  4TT3 G;  1OCR B;  3TCU A;  5C93 A;  3LDC A;  4PA9 A;  1YHQ V;  1NH2 D;  1MSW D;  4MTX A;  1FXH A;  5KA5 A;  3CCJ V;  2DWD C;  1JX9 A;  5HFM A;  1G4Y B;  5H6R A;  4G27 B;  3ZMV A;  3JD2 A;  2V1D A;  2EIK C;  3ZN0 A;  3WFV A;  4MW8 A;  2IJJ A;  3F5W C;  2LFS A;  3P30 A;  3AEI A;  2W6J G;  2AHZ A;  3ABT A;  3CYO A;  4LP8 A;  4GX5 A;  3SPJ A;  2JK5 C;  1AI6 A;  3FYI B;  1E79 G;  3F7V C;  3AG4 C;  3CCQ V;  3LNM B;  2EIJ B;  2ZDI C;  3M99 B;  5L3B A;  1KEC A;  2WLL A;  4JYB A;  1S5H C;  3CCU V;  1M56 C;  2IW5 A;  2IJK A;  3FB5 C;  4JTC B;  3ABK C;  2WLI B;  3CPW U;  1SRY A;  5B1A B;  2W6I G;  3JD1 A;  4PDM A;  2WLH A;  2IH1 C;  3AG1 B;  1YI2 V;  1KC8 W;  2DQ3 A;  2K1E A;  3K04 A;  3HPL C;  1VQ9 V;  1K34 A;  4XDL A;  4RQE A;  5L3F A;  1QLE C;  2IH3 C;  2LP7 A;  2OCC C;  5H9C A;  1YIJ V;  1QVG U;  3D3I A;  3ABM B;  2X6B A;  1P4R A;  1NBM G;  1MAB G;  2EIL B;  4MVU A;  3IC7 A;  4MW3 A;  4R50 A;  2BOB C;  1W0K G;  3K08 A;  2X6C A;  1YJW V;  4OXS A;  5LGU A;  1FXK C;  3CME V;  5EBL C;  1OCO B;  2HFE C;  4CBC A;  4JAS A;  4I9W A;  4U7N A;  3WG7 B;  4JYC A;  3CMA V;  1NVP D;  1F4M A;  5IYB O;  1E1R G;  4PA6 A;  4QPJ A;  1ARO P;  3TK1 A;  3CCL V;  4JGS A;  3CD6 V;  1OCR C;  3I56 V;  2QA4 V;  1PL0 A;  1TUE B;  4MTG A;  1BHA A;  4MVR A;  5DM6 V;  2DYR B;  4P30 A;  2JJ1 G;  5LGT A;  3G71 V;  1LNQ A;  3E86 A;  1L1F A;  5DN6 G;  4LBE C;  4BIZ A;  1W0J G;  4UV9 A;  1VQM V;  4RUF A;  2JEX A;  3G4S V;  2Y69 C;  4GCZ A;  4MSW C;  1K5S A;  4R6Z A;  4KFM A;  5KA6 A;  1F23 A;  2HJF C;  2JEU A;  5EBM C;  2FTK A;  4X88 A;  4WFG A;  3ASN B;  3E89 A;  4GX1 A;  3ZIA G;  1NR7 A;  2WLL B;  3OR7 C;  4MVS A;  1AJQ A;  4UUJ C;  2GSM B;  4XDK A;  1NJI W;  4PEL A;  1YSC A;  3OMI B;  3G6E V;  2Z3Y A;  3JD4 A;  4MVM A;  2WAM A;  4DXW A;  1V54 B;  2KB1 A;  5KUK A;  4QE9 A;  1YTF B;  2A9H A;  3OUS A;  3CCS V;  2DW4 A;  3E8B A;  4H37 A;  4WFH A;  5KUM A;  4RAI A;  1MOF A;  1JPX A;  3GWO A;  2QEX V;  2XAH A;  3BY6 A;  1OCC C;  4UXN A;  4MS2 A;  3MHS C;  2IJI A;  4FK5 C;  3WG7 C;  3FB6 C;  1THZ A;  1M57 B;  4R7C A;  1VQO V;  3JYC A;  4XBF A;  1DF4 A;  3ZRW A;  3E8G A;  2DYR C;  4P9P A;  1S72 V;  1BL8 A;  4GX0 A;  1GK9 A;  1I5Y A;  3TET A;  2BOC C;  1PD3 A;  2EIN C;  5EC1 C;  3JD0 A;  2IU0 A;  2PI4 A;  5FL7 G;  4R8C A;  1Q7Y W;  1JOY A;  2DYS C;  1NR1 A;  3RBZ A;  3LDD A;  1M9N A;  2WLN A;  3E83 A;  3LUT B;  3NXS A;  1GKF A;  3E2E A;  2B1I A;  2YEV A;  4J9Y B;  3SPC A;  4MT8 A;  3F7Y C;  2XOK G;  5E1A C;  5H6Q A;  2XAQ A;  4DO2 A;  1VQ7 V;  1Y66 A;  1K9M W;  1GTO A;  2X0L A;  1GMG A;  3QO8 A;  1J95 A;  5IYD O;  3CCR V;  3FKS G;  1QR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...