2Q73A

Crystal structure of imazg from vibrio dat 722: ctag-imazg (p41212)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
MKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEKTHELKEVLNKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A putative house-cleaning enzyme encoded within an integron array: 1.8 A crystal structure defines a new MazG subtype.
pubmed doi rcsb
source organism Vibrio sp. dat722
molecule tags Hydrolase
molecule keywords Hypothetical protein
total genus 35
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.19: Transferred entry: 3.6.1.9.
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q73A00
2Q73A 5IE9A 2A3QA 1VMGA 1Y6XA 2Q9LA 3C90A 2A7WA 2Q5ZA 3CRAA 2P06A 4QGPA 1YXBA 1YVWA 2YXHA 2GTAA 3CRCA 2OIGA 2Q4PA 2OIEA
chains in the Genus database with same CATH superfamily
3UO3A 5KHKA 5LGNA 2XOKG 4NB5A 3CCVV 3E8GA 4FLUA 1E1QG 2WLJA 3IGAC 5JVDB 4J42A 1XMQO 5GONB 2E3CA 3FB8C 2YIBA 3B2EE 3OAAG 4HAMA 1V55C 2JS3A 3JD0A 3L72H 4GCZA 2DW4A 1XOUA 1N32O 2EIKC 1SQPH 4B08A 5LMNB 3AG2B 2N74A 1OZ0A 5K1XA 2CTPA 4QJFB 5EC2C 2QEXV 4KFMA 4EKWA 2ZE5A 4WFGA 3RFRA 4XDKA 2X6CA 4ZHQA 3L71H 4JYAO 1N33O 1K7DA 1DF5A 1LUWA 3ICXA 4X66B 2QTSA 3X2QB 2JEXA 1EN6A 3ETGA 4O4HB 3ABLB 3K79A 2DQ0A 3CCEV 1XMOO 4LFBO 2BCCH 2Y69C 4LWSA 1XNRO 3L75H 4OPAA 1FXVA 3F5TA 1QU7A 2W6JG 4K8XA 4MVZA 2JDIG 3JCZA 3OGCC 2DYSC 4LFAO 1YVWA 4UV8A 2IJHA 4C7UA 4DR5B 1RSOB 5JJNB 3MHSC 5BMVA 1NTMH 3CCUV 2KQXA 4JI0B 2JGDB 4JYCA 1WA8B 1HNZO 3AG1B 2DMXA 4Z1MG 3G71V 1FD9A 3TGUH 1S0VA 1Q43A 3FB7C 4G2KA 5IYBO 5J2TB 3JAKB 3CRRA 3K57A 2WLIB 2F95B 1B3QA 4GX2A 3ZN1A 1JCHA 5CN0A 3UO2A 1HWYA 1EN4A 3H1LH 2JK5C 2ZDIA 4MVUA 1R73A 2JRIA 3S3WA 3K5NA 3P32A 3B8NA 2RCVA 2QWPB 1SESA 4JV5B 2RQ6A 1M57C 5IWAB 3OD4A 1G1XB 4ICGA 4YXWG 3SJQC 1NH2B 4DUYO 2IM9A 1M93A 4YHHO 2EJRA 4ASUG 1M5IA 5KMGB 4UUJC 4BW5A 2EJ7A 4DR4O 3SPCA 1ZX3A 4D7TA 3T1HO 3N2GA 1LUVA 5FPOA 1BZKA 1OV9A 1FXKC 1DLBA 2Q0AA 1KB9F 4IYHA 3RWRD 3KKYA 4WFEA 1BCCH 4RAIA 2GTAA 3QO8A 4MW8A 5H5NA 2QTOA 2EIJC 1SQGA 4JASA 1LNQA 3RYFB 4TV8A 2UU9B 4LF7B 1N36B 2HP8A 4O4HA 3ABTA 4CH3A 4ZBMA 2XAJA 3SPGA 3N27A 2IBZH 3VQYA 4OPHA 1MG1A 3JAWB 3CCJV 1WAZA 1VF6A 1IBKO 4KHPB 1GH6A 2HEPA 2ATKC 1GK9A 5KUMA 2XHBA 1TUEB 2YI8A 4N23A 1AB3A 3ETQA 2ZR3A 3ETDA 2EINB 5IYDO 4JI6B 2PYLA 4LR3A 3JALB 2GDSA 4EFEA 2CH7B 2UXXA 1FYJA 1IX9A 4WFAV 4DV3O 4JZGA 1R1BA 1X59A 5B1BB 4DV1B 3WFVA 2ZQMA 4JTAB 4RUFA 1AROP 4PA4A 1GM7A 2LP7A 1NZ6A 3I5DA 2X0LA 3EVKA 4IGGA 4DYLA 4GX0A 4FVMA 4ZIBA 3FKSG 2VQFO 1GN6A 4QE7A 2EIKB 3GWOA 3W7XA 3CRAA 3QVNA 3E8HA 1HR0O 2WLIA 3U10A 1YIJV 1TA8A 1NQTA 1XL4A 3RYCA 1FXHA 4JI2O 3BHPA 2YXYA 1YI2V 1F4NA 3THOA 4L8JA 4P30A 4K35A 3TXQA 4LF6O 5CA0A 2UXBO 4DW0A 4I55A 3BPZA 2UUCO 1I0HA 4DUZO 4LF9O 4LNUA 2IH1C 4JI8B 1BMFG 3OFNG 1D2DA 2AHZA 4TQDA 1IDSA 3AG3B 1QBZA 5BY1A 3LSUA 4FM0A 5B1OA 4X89A 3N2GB 5HFLA 2K1EA 3LDCA 3UKMA 2WLMA 4X1YB 5F2VO 1HNXB 1BT8A 1SKVA 2P4VA 4O2AB 5GONA 3KCXA 2QA4V 2LGQA 4TUYB 2P7TC 4JI6O 1NR7A 2ODMA 3SPIA 3JYCA 1K5QA 2KKWA 2LO1A 2A9HA 2QGNA 1XMOB 3B77A 2H3OA 3N2KA 2ADQB 2UXCB 3G67A 2BTOA 1J95A 2ZXWB 2Q7EA 2CTQA 3ABKC 5FL7G 4DR2B 4H37A 3R65A 3MDSA 2W0FC 5IDJA 1P4RA 4UCOA 1KU9A 3ZRWB 2F23A 1AR5A 1I5YA 4NXNB 4PDMA 4LF7O 3CPWU 5JQGA 4NR1A 2JVDA 3ASOB 2DWEC 1DF4A 5B1AC 4UVAA 2UXDO 1H2GA 1MZEA 3ZHQA 3UQ8A 4J9ZB 1N34O 1JFFA 4JAVA 2ZKOA 4BWAA 1XMQB 3BY6A 5D5QA 1OJHA 1PV0A 1XHZA 4MTOA 5LGTA 4Z1VA 4DR1B 4MW3A 4JI7B 2UUBB 3QTCA 4I0XB 3ABKB 4DV2O 4QNHB 4DR4B 2Y0IA 2LJ2A 1VEWA 4FPPA 2GSMB 3IJ4A 1KC8W 5KLVH 1Q5OA 2PI5A 3A0BZ 2K9PA 4U3FH 3CD6V 3JAWA 3CXCU 1OCCB 5KHIA 1VQ9V 5JWPA 3ZMSA 3ZBHA 5LHHA 3H9VA 3JATB 1BSMA 4JF3A 4UCUA 2HHHB 4L87A 2UXCO 1BL8A 4XDJA 4JAAA 4LF8B 3ZCCA 1NH2D 3K03A 4MTGA 4NXNO 1KP2A 1JPXA 2CGOA 1IURA 3CRCA 4GUNA 1AJNA 1ZL8B 4UB6Z 1FFXA 4I4TB 4DO2A 4X20A 4CS3A 4FFKA 4GKJB 1JJOA 3B8MA 2QKAA 2QJ1A 2UUAO 2Y0PA 4FLVA 3ABLC 2PY5A 2Q73A 1JA8A 5FNVA 2YUAA 3M8AA 2Z5UA 3ZIAG 5K1PA 2YS8A 5B1AB 4Z2WA 2Q67A 4O4JA 1PKXA 5CB4B 4WFBV 3ABMC 1Q7YW 1RSOA 5EZYA 1Y76B 5KHHA 2KSDA 1M4UA 1GN4A 2FTKA 2FMLA 4B3SO 4QPJA 5JVDA 1HW7A 1H2NA 2ZNJA 4DR6B 1PPJH 4UVBA 4PI0A 3T4ZA 3I55V 2UXBB 1GN2A 3K04A 3JCUZ 3G80A 1FXKA 4O4IB 4G28B 3BRCA 3DXRA 2E74B 3SYQA 1BQZA 1Q86W 4MSWC 3W7UA 2ZE7A 1YJWV 1V55B 3C90A 1XILA 2A06H 4LF9B 4J9YB 5GTIZ 2ZD9A 1W2BU 4DV5O 3CEIA 3FAVA 2BSKA 2HG5C 5L3DA 3A2FA 1QR9A 2ETNA 1EBOA 4QIWF 3ASNB 3RVYA 1QVGU 3OEEG 4K3AA 3CCRV 1Q8IA 3D3QA 3JATA 3M99B 2A3QA 2WA3A 4WCEV 1VQ8V 3FX7A 2VWJA 1HNWB 4KUMA 2QWNB 3TETA 3TK1A 1HR0B 5ITZB 1XI1A 1Q6IA 4MVSA 5LMUB 2IU0A 3STLC 1KYOF 2X6AA 3RW0A 3K0GA 1VQNV 2A79B 1VQMV 4MVQA 4JI1O 2NNUA 4MT8A 1FAFA 4UVCA 5LYJA 4U7NA 4OXSA 5H6RA 3RGBA 2JS5A 5EIBD 3JD2A 1AR4A 1H2KA 2ADPA 5IYZA 5GTHZ 4BIOA 2QWQB 5B66Z 5LXTA 2UU9O 2XAGA 1YEWA 4EB6B 3RYHA 4LC1A 3RN4A 1VQ7V 4LF8O 2AZ2A 3G6EV 1SRYA 3W7TA 4IYIA 2L6LA 4K0KB 4I9QA 4R7CA 1NJIW 2JJ2G 2VWKA 2ZIOA 2XT9A 1P49A 3KCYA 5EBMC 4X1IA 3GWKC 1KKCA 4DR7B 5BXZA 1AP5A 4YJ2B 2YEVA 5LOVA 2DN9A 4PI2A 3ZHUA 4TV9A 4JPRA 2OTJV 4O2BB 1BQ0A 2WLLA 3C3TA 2VQEB 5LMUO 4TSFG 2CTWA 3D36A 1BHAA 4JI4B 2ZM6O 2PZSA 2JEUA 3T1HB 1RPRA 3E89A 4PDLA 1S5HC 3E22A 4DR1O 1HNWO 2ZNIA 3L70H 3ZEDA 1PL0A 1XREA 1SZXA 1ZUQA 2JGUA 4X64O 2M7WA 3U11A 1BHBA 4F4LA 1NTZH 1YDXA 1QVFU 5IJ0A 4DRXB 4RUEA 2HR3A 1K8AW 1N34B 4X1KA 1H38A 4E2LA 2EILB 5FLXN 1O9GA 4CH5A 4CC6A 4YY3O 3CYOA 1IZ3A 5LP6A 3CX5F 5BR8B 3H1KH 2OCCB 3BVOA 1TUBB 3ETEA 2HJDA 4HZ3A 4DR7O 3SYPA 4I50B 2E5LB 2DJVA 4DR2O 1F23A 4CS4A 4X65B 4AILC 1XEQA 3E83A 1FFXB 4GKKB 4OX9O 4UXNA 1Z5WA 3VQWA 3DGEA 5JH7A 4YIOA 5J2UB 1GN3A 4TV8B 5IY5C 4BR6A 3I56V 4PHZA 3WU2Z 1MSWD 2CGNA 5KX5B 1SS3A 1V9PA 3K9SA 3DC6A 1KBHA 1HNXO 4FZ1A 1XNRB 3OT7A 1XBLA 4PDVA 2PGGA 2F93B 2KB1A 1QR8A 2AHYA 2FYUH 4HBNA 1QCEA 3AG4C 4HNAA 2V1DA 4F6EA 2XNDG 1P84F 3ML0A 4NXMB 1OCOB 4AQYB 2BE3A 4JYBA 5IE9A 2UUCB 3K06A 5D5PA 3SYCA 1L0LH 1JR9A 1K5SA 4MVRA 4UCSA 4OX9B 3JASA 4NTWA 2ZXWC 2QSAA 3JARB 2AZ0A 1Y74B 4O4JB 4B3MB 3SR2C 1S5JA 2XTAA 4X1YA 4FK5C 4GYCB 3J7AU 3JAMN 2P22C 4WF9V 5EYPB 5C8YB 3IAYA 5BR8O 2R9AA 4LCUC 2MW2B 4X9QA 1B06A 1I08A 3K5OA 1O9HA 1OCOC 3OE7G 2F66C 2BTQB 4DR6O 4KXRA 3ZRXA 4DV2B 4JI7O 1TVKA 2JGDA 3AG4B 4LF4O 3WB2A 3ZMZA 1N32B 5KAIZ 4KL1A 5A9GA 3CJHA 3NR7A 1W0JG 2EIMC 3CMEV 4IT5A 1U97A 3A8TA 3ZN0A 4G27B 5LA6B 2L35A 3AG3C 1K4CC 2QM4A 2PYJA 3WG7B 1KUQA 4X1KB 4P9OA 5H9CA 3CB2A 1R6KA 3KZIZ 4ABMA 3OTOB 2OWOA 2LGWA 1AJQA 4DV7O 3LUTB 5CA1A 1WB8A 2HLDG 1H2MA 1SERA 5EYPA 1NR1A 1XQ8A 3EXAA 5IY5B 1NBMG 3LDDA 1YJ9V 1OCZB 3X2QC 4WBNB 4MVOA 4RWUA 1K9MW 1M1KW 3AK1A 1MSDA 1YTFB 3TXSA 1DGSA 2GTSA 5LBQA 1L0NH 1HNZB 1WNSA 4OGQB 2FL4A 4TWKA 1NTKH 2YEVB 1BS3A 1VF6C 5LOVB 1DK1A 3OUSA 4FLYA 3CP1A 2ITCC 1LR1A 2GHYA 1AI6A 1WB7A 1RP3B 2R9RB 4LFAB 2Z3YA 4JI1B 4YJ3A 4GX5A 4LF4B 1H2SB 5L3FA 4B3RO 1FFTB 4NVPA 2A7WA 2OCHA 4TT3G 2GBOA 3UT5B 2Z0AA 3HKCA 4J7JA 3ZHRA 3ZRWA 3MAQA 1KKDA 3UT5A 4W4LA 2EULA 1GM8A 2YSUB 4FJCC 1M9NA 4MTFA 4I9WA 4RQFA 2PI4A 1S5LZ 1MOFA 2N05A 2RMKB 2IW5A 4JI8O 2XASA 3DSQA 4J7KA 1SZTA 3BA9A 2QE7G 5E1AC 2HVKC 2LW1A 2W0XA 3WG7C 1B6QA 2WLHA 4DV5B 1SETA 1RM1C 2ZDIC 1Y4MA 3E8BA 3LSQA 3AG2C 4IHJB 2GUZA 5DECA 1VP7A 2Y48A 1KQSU 2Y4UA 3ZJZA 4IHJA 2VQFB 3CCLV 4JGSA 3OMIB 2OIGA 1AVMA 5B1BC 3O9OA 5JJJB 1F7YA 3BCCH 1NU1H 4DV6B 4I5SA 2P67A 4UCTA 2R72A 4ZI7B 1JJ2U 1MNGA 3O65A 3B40A 1XNQB 2FB5A 3HKDA 1GAXA 2EINC 2DYRB 1X4TA 2RJZA 2G38A 1GTOA 3JD4A 4MVMA 5CMUA 2M6YA 3RVZA 1NT2B 4CZZA 3CSXA 2Q0OC 1GKFA 1OHHG 4UB8Z 5DM6V 1RM1B 1D5NA 4TOIA 4R50A 2RN9A 1IXBA 5JQGB 2YDEA 4DRXA 4LBEC 2DYSB 3W7WA 3FAVB 3OGIB 5KAFZ 1S77D 1H8HG 1IBKB 4KHPO 3SJAC 3RYIA 2IJIA 1SA0B 4A5UB 4TV9B 3IFXA 3FD9A 1U96A 4J80A 3ZRSA 3T1YB 3TJTA 4ZOLA 3AK2A 4QPKA 4O4LA 4YY3B 3JASB 3JARA 3IC9A 2D2CB 1XDCA 2KG7A 2PTMA 4JAUA 5LMNO 1KECA 2HHHO 1WP8A 1YCIA 4UV9A 3A0RA 4X20B 4O4LB 1IXMA 1PL4A 5B1NA 1KD1W 3D8CA 4H44B 3E2EA 1HDJA 1JMKC 1Z2GA 3EFFK 1YF2A 5FPRA 4X64B 4FLWA 3S3XA 3HKDB 4HYOA 1NKDA 5KA6A 5FNVB 4F6RA 1W0KG 3HKEB 2UXDB 2DE0X 4P2ZA 3OUFA 1MA1A 3UM7A 2QWRB 2LW7A 1I94O 2KG7B 4I7ZB 1PNMA 3HKCB 1M90W 4WBNA 1R3KC 2VQEO 2DOSA 1E79G 1AR1B 5H6QA 2Q68A 3ABMB 1IBLO 3J80N 2RNBA 1XL6A 4YHHB 1B04A 3GB7C 3W7SA 3OW2U 4IIJB 2BOCC 4D6TH 5CA1B 1RPOA 2XAFA 4WFFA 4FM1A 1SQVH 4EB6A 2W6IG 5HFMA 3QG5A 1UPGA 3HB3B 1AI5A 1G8MA 3AG7A 2ZE8A 4AQYO 1QLEB 2F1MA 2B1IA 1YHQV 5TISZ 5A2QN 1OCRC 4FFBA 2ZT9B 3G4SV 1VQ6V 1SQBH 2CAZC 3CJHB 4I50A 3B09A 2ARHA 5LYJB 2QKSA 4DXWA 4B7EA 4GX1A 4DV0B 2VRZA 3BEHA 2QDOA 2YIDA 4NYKA 1VF5B 1M56B 2F4VO 1FS0G 5EBLC 1K73W 2R9IA 4AHCA 2BOBC 4F6RB 3E86A 2A0LA 1V54C 1R6NA 4YJ3B 1Q3EA 1US6A 2YICA 2N04A 1L1FA 2Q9LA 2PUSA 1MMMA 1VQ5V 5CB4A 2D3OW 3R66A 4DR3O 1EN5A 3SDLA 3P3NA 4NTYA 4UCRA 5LP6C 1HP8A 4R8CA 1QLEC 2V4DA 1F51A 3OMNB 4QGPA 3STZC 1AILA 2C2AA 4X65O 1EZVH 1RFYA 1PM9A 1URFA 3PJSK 4EEQA 1UJWB 1QQCA 1Q90D 3AK3A 3BA8A 4X88A 3L73H 5GW7A 3APOA 4FFBB 4PV1B 1N0JA 3IC7A 3SYOA 5B3SC 4Q20A 3OEHG 1YTFD 3Q4HA 1NS1A 3CC4V 5LHIA 5E79Z 3FB6C 5CA3A 3FYIB 3H01A 4LF6B 1Y66A 1YZBA 3C3SA 4K8ZA 1OCCC 1SQXH 1MZFA 1K34A 1J5EB 2WLNA 1ORQC 2QM8A 2DWDC 1PNKA 4PD4F 1SF9A 3QO7A 2CTRA 3RBZA 2ZR2A 4RQEA 2ILMA 1T5EA 2HKOA 2WSSG 4PELA 4ZI7A 2EZOA 3ZS8C 5LHGA 5IT9N 2EX3A 1S72V 2OYQA 2ZCEA 1I94B 4FMTA 2ZM6B 2UUAB 2IU3A 1K33A 2NR5A 5KMGA 1VMGA 2PF4E 4U3JB 4XDLA 3HR0A 4GKJO 4LNUB 4BW9A 4DV4O 4DR5O 2GUZB 2O57A 3K5MA 5B3SB 3T4DA 3ABUA 1M57B 4PA3A 1JOYA 3JSNA 3ZHSA 1K92A 3GVMA 3K5LA 1ROPA 3F7YC 4K0KO 1TVKB 1ZWIC 3CXHF 5CA0B 1NI8A 2XAHA 3RT3C 2F43G 1GO3F 3B4SA 3APQA 3RYCB 3Q4HB 3K9AA 5LA6A 5IYCO 2OTLV 4H33A 4NTXA 2X7RB 2CK3G 4H0LB 4YJ2A 4JYAB 4U7OA 1K4DC 3ZHVA 2FKXA 2Q8VA 1GM9A 3L9DA 4PA7A 4ZKIA 2BTQA 1R3IC 3CCSV 4JI5O 4DV7B 4J41A 2XAQA 2P5OA 1AI4A 2LQTA 2HFEC 2UUBO 3SJBC 1ZAUA 3DTUB 4JI3B 4PA9A 1M56C 5KHJA 5KHGA 1TGOA 1W59A 3L74H 3P30A 2HVJC 3D36C 4CC5A 1K97A 3QNEA 4HNAB 1J5EO 4Q6GA 4JV5O 4AI8A 1IBLB 4DK1A 3AEIA 2ZINA 2ZIMA 3T2MA 2EILC 3PN1A 3HPLC 4BIUA 5IYZB 1R6TA 4DW1A 2JJ1G 2Q7HA 4JYYA 2WLLB 1CXZB 4J11A 1FPOA 3K08A 4N21A 1IBMB 1WPXA 3SGIA 2P4KA 3P3PA 1KP3A 1ZLZA 4BAYA 3G6BA 1UFIA 2P90A 2Q7GA 3H1HH 3OM3B 4X1IB 3WB0A 3OR7C 1COWG 5IWAO 5LGUA 4D7SA 3CC2V 4X62O 3VOUA 4FLTA 3ZRVA 5JH7B 3T1CA 3CRMA 4TUYA 1Z5VA 1N8RW 1L8DA 5L3CA 1MABG 1KMIZ 4IIJA 2Q4PA 5CBFA 3OMAB 4FZ0A 1WPBA 1BE3H 1S3JA 4CH4A 1PNLA 3T1YO 2H94A 2E75B 1WP7A 2OT5A 3ASOC 3ASNC 2DYRC 1BGYH 3K3WA 1G6UA 3DXRB 1H8EG 1CP9A 1SQFA 1EZJA 4I0XA 5L3GA 2BSKB 1OCRB 2IJKA 3SPHA 4LH6A 2F4VB 4CS2A 5DN6G 2CDYA 2XUMA 4X66O 5ITZA 3CCMV 2WA4A 1N33B 3FYEB 2YI9A 1PP9H 4IL6Z 4PJ0Z 1FXKB 4MTXA 4O4IA 2EIMB 1WA8A 3KG2A 1Y74A 5KA5A 2ZE6A 2UXNA 1XNQO 4LFBB 4X62B 5LL6Y 1SQQH 5JJEB 4GKKO 3ZX6A 3J81N 1THZA 1Q82W 2QWOB 3F5WC 5EBWC 5EZYB 4FIPC 3VQXA 2Q5ZA 4JTCB 2AGAA 4ZOLB 1QHTA 3D3IA 4KP4A 1XHXA 2YXHA 1ZSPA 3LDEA 1SA0A 1I5XA 1VQKV 1QLNA 3RYIB 1F4MA 1VIBA 3FB5C 2B1GA 1CEZA 5C93A 1VARA 3ZHTA 3N2KB 2V7QG 3QO5A 3ZMTA 4LFCO 5LXTB 3LNNA 4DV1O 4PDRA 4ZHQB 5KX5A 4GT1A 4FLZA 4DV3B 4DUYB 4TQFA 5CBHA 3EHBB 3H1IH 4B3TO 1GRJA 4JI3O 1EM1A 3OTFA 1YJNV 3AG1C 4I55B 4LF5O 2OIEA 2YXLA 4LFCB 1P7BA 3VQVA 3ZMVA 1G4YB 1Y6XA 4PA6A 1V54B 4JI4O 1S76D 1WN7A 2MK3A 4WFHA 3E35A 5JCOA 2AW9A 5JCOC 5L3BA 1AP6A 1ENVA 1IVSA 4CH6A 2NLJC 5EK0A 2DQ3A 5LP6B 1JFFB 2YC0A 4B3MO 4J10A 4B7KA 4H13B 3HKBB 4YIPA 3CS5A 1Q6UA 1N36O 1R3LC 3LNMB 5CBGA 2QR4A 3CHXA 1PD3A 1YSCA 3K58A 1SC5B 1QNMA 5IJ0B 3DC5A 4NKGB 2QM7A 1DTOA 2NN4A 1AI7A 3CRQA 5J2TA 1JX9A 4E4EA 1NVPB 3WB1A 1JVMA 2R70A 3E22B 3A0HZ 5H2FZ 4DV4B 1TUBA 2B5UA 1Q81W 1JQ0A 2OCCC 1VQPV 3U0ZA 4QE9A 1Y67A 1A32A 5KUKA 3CCQV 5IJ9A 1N0NA 2ITDC 3M7MX 2X6BA 3OTOO 4J7ZA 1H2LA 5BMVB 1VQLV 3K0DA 4DV0O 3NXSA 4B3TB 2CE4A 1FJGB 1I7FA 2WAMA 3MHHC 5DEDA 1ZL8A 5B5EZ 2Q69A 1GMGA 4DUZB 3JALA 3LSSA 1OCZC 3RYFA 4LWSB 3JSLA 5EIBC 3SPJA 3BFRA 4UFZA 1K3EA 3RYHB 3HKBA 4DV6O 4JZ2A 3OR6C 1D5AA 1AJPA 3H1JH 2Q6AA 5AG2A 2E5LO 1ZTEA 3JD1A 4JI2B 4O2AA 3VBBA 2JIZG 3JAKA 1FJGO 2EZPA 1P7GA 3QF7A 4CBCA 2AXTZ 3FFQA 4I4TA 2VS0A 1IBMO 2GV9A 3ZMUA 2LFSA 4FM2A 4JI0O 2WLKA 3CWBH 3BAAA 4B3RB 4B3SB 2EBOA 2RDCA 2H8PC 4FLXA 4NXMO 2LFRA 4BIZA 4DR3B 1WLEA 4XBFA 4X8AA 1R3JC 1N4CA 2P06A 1E1RG 2HJFC 4DK0A 3MD0A 5EC1C 2P6JA 2EIJB 5J2UA 3CC7V 4U3JA 1Q6HA 3SYAA 4JI5B 4O2BA 3E8FA 1YXBA 3TCUA 4EFBA 3K59A 4R6ZA 3HKEA 4JTDB 5C8YA 5J9PC 3BABA 2CH7A 4GZRB 4GLXA 1CPYA 4RO2A 1VQ4V 2Y69B 4LP8A 2YIBD 1EFRG 2IH3C 3CE2A 4MS2A 2WWWA 2WPDG 1XUQA 4W4KA 1VQOV 4LF5B 2E76B 1VF7A 4P9PA 3F7VC 1FKAO 1Y76A 1TAEA 2B9ZA 3SJCC 4LH7A 3JD3A 2Y4TA 3CMAV 3UCSC 1WJZA 2CUGA 2QKCA 2IJJA 1YITV 4UCVA 2YIAA 1NVPD 5L3EA 5IJ9B 5BZBA
chains in the Genus database with same CATH topology
2Q73A 5IE9A 2A3QA 1VMGA 1Y6XA 2Q9LA 3C90A 2A7WA 2Q5ZA 3CRAA 2P06A 4QGPA 1YXBA 1YVWA 2YXHA 2GTAA 3CRCA 2OIGA 2Q4PA 2OIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q73 A;  5IE9 A;  2A3Q A;  1VMG A;  1Y6X A;  2Q9L A;  3C90 A;  2A7W A;  2Q5Z A;  3CRA A;  2P06 A;  4QGP A;  1YXB A;  1YVW A;  2YXH A;  2GTA A;  3CRC A;  2OIG A;  2Q4P A;  2OIE A; 
#chains in the Genus database with same CATH topology
 3UO3 A;  5KHK A;  5LGN A;  2XOK G;  4NB5 A;  3CCV V;  3E8G A;  4FLU A;  1E1Q G;  2WLJ A;  3IGA C;  5JVD B;  4J42 A;  1XMQ O;  5GON B;  2E3C A;  3FB8 C;  2YIB A;  3B2E E;  3OAA G;  4HAM A;  1V55 C;  2JS3 A;  3JD0 A;  3L72 H;  4GCZ A;  2DW4 A;  1XOU A;  1N32 O;  2EIK C;  1SQP H;  4B08 A;  5LMN B;  3AG2 B;  2N74 A;  1OZ0 A;  5K1X A;  2CTP A;  4QJF B;  5EC2 C;  2QEX V;  4KFM A;  4EKW A;  2ZE5 A;  4WFG A;  3RFR A;  4XDK A;  2X6C A;  4ZHQ A;  3L71 H;  4JYA O;  1N33 O;  1K7D A;  1DF5 A;  1LUW A;  3ICX A;  4X66 B;  2QTS A;  3X2Q B;  2JEX A;  1EN6 A;  3ETG A;  4O4H B;  3ABL B;  3K79 A;  2DQ0 A;  3CCE V;  1XMO O;  4LFB O;  2BCC H;  2Y69 C;  4LWS A;  1XNR O;  3L75 H;  4OPA A;  1FXV A;  3F5T A;  1QU7 A;  2W6J G;  4K8X A;  4MVZ A;  2JDI G;  3JCZ A;  3OGC C;  2DYS C;  4LFA O;  1YVW A;  4UV8 A;  2IJH A;  4C7U A;  4DR5 B;  1RSO B;  5JJN B;  3MHS C;  5BMV A;  1NTM H;  3CCU V;  2KQX A;  4JI0 B;  2JGD B;  4JYC A;  1WA8 B;  1HNZ O;  3AG1 B;  2DMX A;  4Z1M G;  3G71 V;  1FD9 A;  3TGU H;  1S0V A;  1Q43 A;  3FB7 C;  4G2K A;  5IYB O;  5J2T B;  3JAK B;  3CRR A;  3K57 A;  2WLI B;  2F95 B;  1B3Q A;  4GX2 A;  3ZN1 A;  1JCH A;  5CN0 A;  3UO2 A;  1HWY A;  1EN4 A;  3H1L H;  2JK5 C;  2ZDI A;  4MVU A;  1R73 A;  2JRI A;  3S3W A;  3K5N A;  3P32 A;  3B8N A;  2RCV A;  2QWP B;  1SES A;  4JV5 B;  2RQ6 A;  1M57 C;  5IWA B;  3OD4 A;  1G1X B;  4ICG A;  4YXW G;  3SJQ C;  1NH2 B;  4DUY O;  2IM9 A;  1M93 A;  4YHH O;  2EJR A;  4ASU G;  1M5I A;  5KMG B;  4UUJ C;  4BW5 A;  2EJ7 A;  4DR4 O;  3SPC A;  1ZX3 A;  4D7T A;  3T1H O;  3N2G A;  1LUV A;  5FPO A;  1BZK A;  1OV9 A;  1FXK C;  1DLB A;  2Q0A A;  1KB9 F;  4IYH A;  3RWR D;  3KKY A;  4WFE A;  1BCC H;  4RAI A;  2GTA A;  3QO8 A;  4MW8 A;  5H5N A;  2QTO A;  2EIJ C;  1SQG A;  4JAS A;  1LNQ A;  3RYF B;  4TV8 A;  2UU9 B;  4LF7 B;  1N36 B;  2HP8 A;  4O4H A;  3ABT A;  4CH3 A;  4ZBM A;  2XAJ A;  3SPG A;  3N27 A;  2IBZ H;  3VQY A;  4OPH A;  1MG1 A;  3JAW B;  3CCJ V;  1WAZ A;  1VF6 A;  1IBK O;  4KHP B;  1GH6 A;  2HEP A;  2ATK C;  1GK9 A;  5KUM A;  2XHB A;  1TUE B;  2YI8 A;  4N23 A;  1AB3 A;  3ETQ A;  2ZR3 A;  3ETD A;  2EIN B;  5IYD O;  4JI6 B;  2PYL A;  4LR3 A;  3JAL B;  2GDS A;  4EFE A;  2CH7 B;  2UXX A;  1FYJ A;  1IX9 A;  4WFA V;  4DV3 O;  4JZG A;  1R1B A;  1X59 A;  5B1B B;  4DV1 B;  3WFV A;  2ZQM A;  4JTA B;  4RUF A;  1ARO P;  4PA4 A;  1GM7 A;  2LP7 A;  1NZ6 A;  3I5D A;  2X0L A;  3EVK A;  4IGG A;  4DYL A;  4GX0 A;  4FVM A;  4ZIB A;  3FKS G;  2VQF O;  1GN6 A;  4QE7 A;  2EIK B;  3GWO A;  3W7X A;  3CRA A;  3QVN A;  3E8H A;  1HR0 O;  2WLI A;  3U10 A;  1YIJ V;  1TA8 A;  1NQT A;  1XL4 A;  3RYC A;  1FXH A;  4JI2 O;  3BHP A;  2YXY A;  1YI2 V;  1F4N A;  3THO A;  4L8J A;  4P30 A;  4K35 A;  3TXQ A;  4LF6 O;  5CA0 A;  2UXB O;  4DW0 A;  4I55 A;  3BPZ A;  2UUC O;  1I0H A;  4DUZ O;  4LF9 O;  4LNU A;  2IH1 C;  4JI8 B;  1BMF G;  3OFN G;  1D2D A;  2AHZ A;  4TQD A;  1IDS A;  3AG3 B;  1QBZ A;  5BY1 A;  3LSU A;  4FM0 A;  5B1O A;  4X89 A;  3N2G B;  5HFL A;  2K1E A;  3LDC A;  3UKM A;  2WLM A;  4X1Y B;  5F2V O;  1HNX B;  1BT8 A;  1SKV A;  2P4V A;  4O2A B;  5GON A;  3KCX A;  2QA4 V;  2LGQ A;  4TUY B;  2P7T C;  4JI6 O;  1NR7 A;  2ODM A;  3SPI A;  3JYC A;  1K5Q A;  2KKW A;  2LO1 A;  2A9H A;  2QGN A;  1XMO B;  3B77 A;  2H3O A;  3N2K A;  2ADQ B;  2UXC B;  3G67 A;  2BTO A;  1J95 A;  2ZXW B;  2Q7E A;  2CTQ A;  3ABK C;  5FL7 G;  4DR2 B;  4H37 A;  3R65 A;  3MDS A;  2W0F C;  5IDJ A;  1P4R A;  4UCO A;  1KU9 A;  3ZRW B;  2F23 A;  1AR5 A;  1I5Y A;  4NXN B;  4PDM A;  4LF7 O;  3CPW U;  5JQG A;  4NR1 A;  2JVD A;  3ASO B;  2DWE C;  1DF4 A;  5B1A C;  4UVA A;  2UXD O;  1H2G A;  1MZE A;  3ZHQ A;  3UQ8 A;  4J9Z B;  1N34 O;  1JFF A;  4JAV A;  2ZKO A;  4BWA A;  1XMQ B;  3BY6 A;  5D5Q A;  1OJH A;  1PV0 A;  1XHZ A;  4MTO A;  5LGT A;  4Z1V A;  4DR1 B;  4MW3 A;  4JI7 B;  2UUB B;  3QTC A;  4I0X B;  3ABK B;  4DV2 O;  4QNH B;  4DR4 B;  2Y0I A;  2LJ2 A;  1VEW A;  4FPP A;  2GSM B;  3IJ4 A;  1KC8 W;  5KLV H;  1Q5O A;  2PI5 A;  3A0B Z;  2K9P A;  4U3F H;  3CD6 V;  3JAW A;  3CXC U;  1OCC B;  5KHI A;  1VQ9 V;  5JWP A;  3ZMS A;  3ZBH A;  5LHH A;  3H9V A;  3JAT B;  1BSM A;  4JF3 A;  4UCU A;  2HHH B;  4L87 A;  2UXC O;  1BL8 A;  4XDJ A;  4JAA A;  4LF8 B;  3ZCC A;  1NH2 D;  3K03 A;  4MTG A;  4NXN O;  1KP2 A;  1JPX A;  2CGO A;  1IUR A;  3CRC A;  4GUN A;  1AJN A;  1ZL8 B;  4UB6 Z;  1FFX A;  4I4T B;  4DO2 A;  4X20 A;  4CS3 A;  4FFK A;  4GKJ B;  1JJO A;  3B8M A;  2QKA A;  2QJ1 A;  2UUA O;  2Y0P A;  4FLV A;  3ABL C;  2PY5 A;  2Q73 A;  1JA8 A;  5FNV A;  2YUA A;  3M8A A;  2Z5U A;  3ZIA G;  5K1P A;  2YS8 A;  5B1A B;  4Z2W A;  2Q67 A;  4O4J A;  1PKX A;  5CB4 B;  4WFB V;  3ABM C;  1Q7Y W;  1RSO A;  5EZY A;  1Y76 B;  5KHH A;  2KSD A;  1M4U A;  1GN4 A;  2FTK A;  2FML A;  4B3S O;  4QPJ A;  5JVD A;  1HW7 A;  1H2N A;  2ZNJ A;  4DR6 B;  1PPJ H;  4UVB A;  4PI0 A;  3T4Z A;  3I55 V;  2UXB B;  1GN2 A;  3K04 A;  3JCU Z;  3G80 A;  1FXK A;  4O4I B;  4G28 B;  3BRC A;  3DXR A;  2E74 B;  3SYQ A;  1BQZ A;  1Q86 W;  4MSW C;  3W7U A;  2ZE7 A;  1YJW V;  1V55 B;  3C90 A;  1XIL A;  2A06 H;  4LF9 B;  4J9Y B;  5GTI Z;  2ZD9 A;  1W2B U;  4DV5 O;  3CEI A;  3FAV A;  2BSK A;  2HG5 C;  5L3D A;  3A2F A;  1QR9 A;  2ETN A;  1EBO A;  4QIW F;  3ASN B;  3RVY A;  1QVG U;  3OEE G;  4K3A A;  3CCR V;  1Q8I A;  3D3Q A;  3JAT A;  3M99 B;  2A3Q A;  2WA3 A;  4WCE V;  1VQ8 V;  3FX7 A;  2VWJ A;  1HNW B;  4KUM A;  2QWN B;  3TET A;  3TK1 A;  1HR0 B;  5ITZ B;  1XI1 A;  1Q6I A;  4MVS A;  5LMU B;  2IU0 A;  3STL C;  1KYO F;  2X6A A;  3RW0 A;  3K0G A;  1VQN V;  2A79 B;  1VQM V;  4MVQ A;  4JI1 O;  2NNU A;  4MT8 A;  1FAF A;  4UVC A;  5LYJ A;  4U7N A;  4OXS A;  5H6R A;  3RGB A;  2JS5 A;  5EIB D;  3JD2 A;  1AR4 A;  1H2K A;  2ADP A;  5IYZ A;  5GTH Z;  4BIO A;  2QWQ B;  5B66 Z;  5LXT A;  2UU9 O;  2XAG A;  1YEW A;  4EB6 B;  3RYH A;  4LC1 A;  3RN4 A;  1VQ7 V;  4LF8 O;  2AZ2 A;  3G6E V;  1SRY A;  3W7T A;  4IYI A;  2L6L A;  4K0K B;  4I9Q A;  4R7C A;  1NJI W;  2JJ2 G;  2VWK A;  2ZIO A;  2XT9 A;  1P49 A;  3KCY A;  5EBM C;  4X1I A;  3GWK C;  1KKC A;  4DR7 B;  5BXZ A;  1AP5 A;  4YJ2 B;  2YEV A;  5LOV A;  2DN9 A;  4PI2 A;  3ZHU A;  4TV9 A;  4JPR A;  2OTJ V;  4O2B B;  1BQ0 A;  2WLL A;  3C3T A;  2VQE B;  5LMU O;  4TSF G;  2CTW A;  3D36 A;  1BHA A;  4JI4 B;  2ZM6 O;  2PZS A;  2JEU A;  3T1H B;  1RPR A;  3E89 A;  4PDL A;  1S5H C;  3E22 A;  4DR1 O;  1HNW O;  2ZNI A;  3L70 H;  3ZED A;  1PL0 A;  1XRE A;  1SZX A;  1ZUQ A;  2JGU A;  4X64 O;  2M7W A;  3U11 A;  1BHB A;  4F4L A;  1NTZ H;  1YDX A;  1QVF U;  5IJ0 A;  4DRX B;  4RUE A;  2HR3 A;  1K8A W;  1N34 B;  4X1K A;  1H38 A;  4E2L A;  2EIL B;  5FLX N;  1O9G A;  4CH5 A;  4CC6 A;  4YY3 O;  3CYO A;  1IZ3 A;  5LP6 A;  3CX5 F;  5BR8 B;  3H1K H;  2OCC B;  3BVO A;  1TUB B;  3ETE A;  2HJD A;  4HZ3 A;  4DR7 O;  3SYP A;  4I50 B;  2E5L B;  2DJV A;  4DR2 O;  1F23 A;  4CS4 A;  4X65 B;  4AIL C;  1XEQ A;  3E83 A;  1FFX B;  4GKK B;  4OX9 O;  4UXN A;  1Z5W A;  3VQW A;  3DGE A;  5JH7 A;  4YIO A;  5J2U B;  1GN3 A;  4TV8 B;  5IY5 C;  4BR6 A;  3I56 V;  4PHZ A;  3WU2 Z;  1MSW D;  2CGN A;  5KX5 B;  1SS3 A;  1V9P A;  3K9S A;  3DC6 A;  1KBH A;  1HNX O;  4FZ1 A;  1XNR B;  3OT7 A;  1XBL A;  4PDV A;  2PGG A;  2F93 B;  2KB1 A;  1QR8 A;  2AHY A;  2FYU H;  4HBN A;  1QCE A;  3AG4 C;  4HNA A;  2V1D A;  4F6E A;  2XND G;  1P84 F;  3ML0 A;  4NXM B;  1OCO B;  4AQY B;  2BE3 A;  4JYB A;  5IE9 A;  2UUC B;  3K06 A;  5D5P A;  3SYC A;  1L0L H;  1JR9 A;  1K5S A;  4MVR A;  4UCS A;  4OX9 B;  3JAS A;  4NTW A;  2ZXW C;  2QSA A;  3JAR B;  2AZ0 A;  1Y74 B;  4O4J B;  4B3M B;  3SR2 C;  1S5J A;  2XTA A;  4X1Y A;  4FK5 C;  4GYC B;  3J7A U;  3JAM N;  2P22 C;  4WF9 V;  5EYP B;  5C8Y B;  3IAY A;  5BR8 O;  2R9A A;  4LCU C;  2MW2 B;  4X9Q A;  1B06 A;  1I08 A;  3K5O A;  1O9H A;  1OCO C;  3OE7 G;  2F66 C;  2BTQ B;  4DR6 O;  4KXR A;  3ZRX A;  4DV2 B;  4JI7 O;  1TVK A;  2JGD A;  3AG4 B;  4LF4 O;  3WB2 A;  3ZMZ A;  1N32 B;  5KAI Z;  4KL1 A;  5A9G A;  3CJH A;  3NR7 A;  1W0J G;  2EIM C;  3CME V;  4IT5 A;  1U97 A;  3A8T A;  3ZN0 A;  4G27 B;  5LA6 B;  2L35 A;  3AG3 C;  1K4C C;  2QM4 A;  2PYJ A;  3WG7 B;  1KUQ A;  4X1K B;  4P9O A;  5H9C A;  3CB2 A;  1R6K A;  3KZI Z;  4ABM A;  3OTO B;  2OWO A;  2LGW A;  1AJQ A;  4DV7 O;  3LUT B;  5CA1 A;  1WB8 A;  2HLD G;  1H2M A;  1SER A;  5EYP A;  1NR1 A;  1XQ8 A;  3EXA A;  5IY5 B;  1NBM G;  3LDD A;  1YJ9 V;  1OCZ B;  3X2Q C;  4WBN B;  4MVO A;  4RWU A;  1K9M W;  1M1K W;  3AK1 A;  1MSD A;  1YTF B;  3TXS A;  1DGS A;  2GTS A;  5LBQ A;  1L0N H;  1HNZ B;  1WNS A;  4OGQ B;  2FL4 A;  4TWK A;  1NTK H;  2YEV B;  1BS3 A;  1VF6 C;  5LOV B;  1DK1 A;  3OUS A;  4FLY A;  3CP1 A;  2ITC C;  1LR1 A;  2GHY A;  1AI6 A;  1WB7 A;  1RP3 B;  2R9R B;  4LFA B;  2Z3Y A;  4JI1 B;  4YJ3 A;  4GX5 A;  4LF4 B;  1H2S B;  5L3F A;  4B3R O;  1FFT B;  4NVP A;  2A7W A;  2OCH A;  4TT3 G;  2GBO A;  3UT5 B;  2Z0A A;  3HKC A;  4J7J A;  3ZHR A;  3ZRW A;  3MAQ A;  1KKD A;  3UT5 A;  4W4L A;  2EUL A;  1GM8 A;  2YSU B;  4FJC C;  1M9N A;  4MTF A;  4I9W A;  4RQF A;  2PI4 A;  1S5L Z;  1MOF A;  2N05 A;  2RMK B;  2IW5 A;  4JI8 O;  2XAS A;  3DSQ A;  4J7K A;  1SZT A;  3BA9 A;  2QE7 G;  5E1A C;  2HVK C;  2LW1 A;  2W0X A;  3WG7 C;  1B6Q A;  2WLH A;  4DV5 B;  1SET A;  1RM1 C;  2ZDI C;  1Y4M A;  3E8B A;  3LSQ A;  3AG2 C;  4IHJ B;  2GUZ A;  5DEC A;  1VP7 A;  2Y48 A;  1KQS U;  2Y4U A;  3ZJZ A;  4IHJ A;  2VQF B;  3CCL V;  4JGS A;  3OMI B;  2OIG A;  1AVM A;  5B1B C;  3O9O A;  5JJJ B;  1F7Y A;  3BCC H;  1NU1 H;  4DV6 B;  4I5S A;  2P67 A;  4UCT A;  2R72 A;  4ZI7 B;  1JJ2 U;  1MNG A;  3O65 A;  3B40 A;  1XNQ B;  2FB5 A;  3HKD A;  1GAX A;  2EIN C;  2DYR B;  1X4T A;  2RJZ A;  2G38 A;  1GTO A;  3JD4 A;  4MVM A;  5CMU A;  2M6Y A;  3RVZ A;  1NT2 B;  4CZZ A;  3CSX A;  2Q0O C;  1GKF A;  1OHH G;  4UB8 Z;  5DM6 V;  1RM1 B;  1D5N A;  4TOI A;  4R50 A;  2RN9 A;  1IXB A;  5JQG B;  2YDE A;  4DRX A;  4LBE C;  2DYS B;  3W7W A;  3FAV B;  3OGI B;  5KAF Z;  1S77 D;  1H8H G;  1IBK B;  4KHP O;  3SJA C;  3RYI A;  2IJI A;  1SA0 B;  4A5U B;  4TV9 B;  3IFX A;  3FD9 A;  1U96 A;  4J80 A;  3ZRS A;  3T1Y B;  3TJT A;  4ZOL A;  3AK2 A;  4QPK A;  4O4L A;  4YY3 B;  3JAS B;  3JAR A;  3IC9 A;  2D2C B;  1XDC A;  2KG7 A;  2PTM A;  4JAU A;  5LMN O;  1KEC A;  2HHH O;  1WP8 A;  1YCI A;  4UV9 A;  3A0R A;  4X20 B;  4O4L B;  1IXM A;  1PL4 A;  5B1N A;  1KD1 W;  3D8C A;  4H44 B;  3E2E A;  1HDJ A;  1JMK C;  1Z2G A;  3EFF K;  1YF2 A;  5FPR A;  4X64 B;  4FLW A;  3S3X A;  3HKD B;  4HYO A;  1NKD A;  5KA6 A;  5FNV B;  4F6R A;  1W0K G;  3HKE B;  2UXD B;  2DE0 X;  4P2Z A;  3OUF A;  1MA1 A;  3UM7 A;  2QWR B;  2LW7 A;  1I94 O;  2KG7 B;  4I7Z B;  1PNM A;  3HKC B;  1M90 W;  4WBN A;  1R3K C;  2VQE O;  2DOS A;  1E79 G;  1AR1 B;  5H6Q A;  2Q68 A;  3ABM B;  1IBL O;  3J80 N;  2RNB A;  1XL6 A;  4YHH B;  1B04 A;  3GB7 C;  3W7S A;  3OW2 U;  4IIJ B;  2BOC C;  4D6T H;  5CA1 B;  1RPO A;  2XAF A;  4WFF A;  4FM1 A;  1SQV H;  4EB6 A;  2W6I G;  5HFM A;  3QG5 A;  1UPG A;  3HB3 B;  1AI5 A;  1G8M A;  3AG7 A;  2ZE8 A;  4AQY O;  1QLE B;  2F1M A;  2B1I A;  1YHQ V;  5TIS Z;  5A2Q N;  1OCR C;  4FFB A;  2ZT9 B;  3G4S V;  1VQ6 V;  1SQB H;  2CAZ C;  3CJH B;  4I50 A;  3B09 A;  2ARH A;  5LYJ B;  2QKS A;  4DXW A;  4B7E A;  4GX1 A;  4DV0 B;  2VRZ A;  3BEH A;  2QDO A;  2YID A;  4NYK A;  1VF5 B;  1M56 B;  2F4V O;  1FS0 G;  5EBL C;  1K73 W;  2R9I A;  4AHC A;  2BOB C;  4F6R B;  3E86 A;  2A0L A;  1V54 C;  1R6N A;  4YJ3 B;  1Q3E A;  1US6 A;  2YIC A;  2N04 A;  1L1F A;  2Q9L A;  2PUS A;  1MMM A;  1VQ5 V;  5CB4 A;  2D3O W;  3R66 A;  4DR3 O;  1EN5 A;  3SDL A;  3P3N A;  4NTY A;  4UCR A;  5LP6 C;  1HP8 A;  4R8C A;  1QLE C;  2V4D A;  1F51 A;  3OMN B;  4QGP A;  3STZ C;  1AIL A;  2C2A A;  4X65 O;  1EZV H;  1RFY A;  1PM9 A;  1URF A;  3PJS K;  4EEQ A;  1UJW B;  1QQC A;  1Q90 D;  3AK3 A;  3BA8 A;  4X88 A;  3L73 H;  5GW7 A;  3APO A;  4FFB B;  4PV1 B;  1N0J A;  3IC7 A;  3SYO A;  5B3S C;  4Q20 A;  3OEH G;  1YTF D;  3Q4H A;  1NS1 A;  3CC4 V;  5LHI A;  5E79 Z;  3FB6 C;  5CA3 A;  3FYI B;  3H01 A;  4LF6 B;  1Y66 A;  1YZB A;  3C3S A;  4K8Z A;  1OCC C;  1SQX H;  1MZF A;  1K34 A;  1J5E B;  2WLN A;  1ORQ C;  2QM8 A;  2DWD C;  1PNK A;  4PD4 F;  1SF9 A;  3QO7 A;  2CTR A;  3RBZ A;  2ZR2 A;  4RQE A;  2ILM A;  1T5E A;  2HKO A;  2WSS G;  4PEL A;  4ZI7 A;  2EZO A;  3ZS8 C;  5LHG A;  5IT9 N;  2EX3 A;  1S72 V;  2OYQ A;  2ZCE A;  1I94 B;  4FMT A;  2ZM6 B;  2UUA B;  2IU3 A;  1K33 A;  2NR5 A;  5KMG A;  1VMG A;  2PF4 E;  4U3J B;  4XDL A;  3HR0 A;  4GKJ O;  4LNU B;  4BW9 A;  4DV4 O;  4DR5 O;  2GUZ B;  2O57 A;  3K5M A;  5B3S B;  3T4D A;  3ABU A;  1M57 B;  4PA3 A;  1JOY A;  3JSN A;  3ZHS A;  1K92 A;  3GVM A;  3K5L A;  1ROP A;  3F7Y C;  4K0K O;  1TVK B;  1ZWI C;  3CXH F;  5CA0 B;  1NI8 A;  2XAH A;  3RT3 C;  2F43 G;  1GO3 F;  3B4S A;  3APQ A;  3RYC B;  3Q4H B;  3K9A A;  5LA6 A;  5IYC O;  2OTL V;  4H33 A;  4NTX A;  2X7R B;  2CK3 G;  4H0L B;  4YJ2 A;  4JYA B;  4U7O A;  1K4D C;  3ZHV A;  2FKX A;  2Q8V A;  1GM9 A;  3L9D A;  4PA7 A;  4ZKI A;  2BTQ A;  1R3I C;  3CCS V;  4JI5 O;  4DV7 B;  4J41 A;  2XAQ A;  2P5O A;  1AI4 A;  2LQT A;  2HFE C;  2UUB O;  3SJB C;  1ZAU A;  3DTU B;  4JI3 B;  4PA9 A;  1M56 C;  5KHJ A;  5KHG A;  1TGO A;  1W59 A;  3L74 H;  3P30 A;  2HVJ C;  3D36 C;  4CC5 A;  1K97 A;  3QNE A;  4HNA B;  1J5E O;  4Q6G A;  4JV5 O;  4AI8 A;  1IBL B;  4DK1 A;  3AEI A;  2ZIN A;  2ZIM A;  3T2M A;  2EIL C;  3PN1 A;  3HPL C;  4BIU A;  5IYZ B;  1R6T A;  4DW1 A;  2JJ1 G;  2Q7H A;  4JYY A;  2WLL B;  1CXZ B;  4J11 A;  1FPO A;  3K08 A;  4N21 A;  1IBM B;  1WPX A;  3SGI A;  2P4K A;  3P3P A;  1KP3 A;  1ZLZ A;  4BAY A;  3G6B A;  1UFI A;  2P90 A;  2Q7G A;  3H1H H;  3OM3 B;  4X1I B;  3WB0 A;  3OR7 C;  1COW G;  5IWA O;  5LGU A;  4D7S A;  3CC2 V;  4X62 O;  3VOU A;  4FLT A;  3ZRV A;  5JH7 B;  3T1C A;  3CRM A;  4TUY A;  1Z5V A;  1N8R W;  1L8D A;  5L3C A;  1MAB G;  1KMI Z;  4IIJ A;  2Q4P A;  5CBF A;  3OMA B;  4FZ0 A;  1WPB A;  1BE3 H;  1S3J A;  4CH4 A;  1PNL A;  3T1Y O;  2H94 A;  2E75 B;  1WP7 A;  2OT5 A;  3ASO C;  3ASN C;  2DYR C;  1BGY H;  3K3W A;  1G6U A;  3DXR B;  1H8E G;  1CP9 A;  1SQF A;  1EZJ A;  4I0X A;  5L3G A;  2BSK B;  1OCR B;  2IJK A;  3SPH A;  4LH6 A;  2F4V B;  4CS2 A;  5DN6 G;  2CDY A;  2XUM A;  4X66 O;  5ITZ A;  3CCM V;  2WA4 A;  1N33 B;  3FYE B;  2YI9 A;  1PP9 H;  4IL6 Z;  4PJ0 Z;  1FXK B;  4MTX A;  4O4I A;  2EIM B;  1WA8 A;  3KG2 A;  1Y74 A;  5KA5 A;  2ZE6 A;  2UXN A;  1XNQ O;  4LFB B;  4X62 B;  5LL6 Y;  1SQQ H;  5JJE B;  4GKK O;  3ZX6 A;  3J81 N;  1THZ A;  1Q82 W;  2QWO B;  3F5W C;  5EBW C;  5EZY B;  4FIP C;  3VQX A;  2Q5Z A;  4JTC B;  2AGA A;  4ZOL B;  1QHT A;  3D3I A;  4KP4 A;  1XHX A;  2YXH A;  1ZSP A;  3LDE A;  1SA0 A;  1I5X A;  1VQK V;  1QLN A;  3RYI B;  1F4M A;  1VIB A;  3FB5 C;  2B1G A;  1CEZ A;  5C93 A;  1VAR A;  3ZHT A;  3N2K B;  2V7Q G;  3QO5 A;  3ZMT A;  4LFC O;  5LXT B;  3LNN A;  4DV1 O;  4PDR A;  4ZHQ B;  5KX5 A;  4GT1 A;  4FLZ A;  4DV3 B;  4DUY B;  4TQF A;  5CBH A;  3EHB B;  3H1I H;  4B3T O;  1GRJ A;  4JI3 O;  1EM1 A;  3OTF A;  1YJN V;  3AG1 C;  4I55 B;  4LF5 O;  2OIE A;  2YXL A;  4LFC B;  1P7B A;  3VQV A;  3ZMV A;  1G4Y B;  1Y6X A;  4PA6 A;  1V54 B;  4JI4 O;  1S76 D;  1WN7 A;  2MK3 A;  4WFH A;  3E35 A;  5JCO A;  2AW9 A;  5JCO C;  5L3B A;  1AP6 A;  1ENV A;  1IVS A;  4CH6 A;  2NLJ C;  5EK0 A;  2DQ3 A;  5LP6 B;  1JFF B;  2YC0 A;  4B3M O;  4J10 A;  4B7K A;  4H13 B;  3HKB B;  4YIP A;  3CS5 A;  1Q6U A;  1N36 O;  1R3L C;  3LNM B;  5CBG A;  2QR4 A;  3CHX A;  1PD3 A;  1YSC A;  3K58 A;  1SC5 B;  1QNM A;  5IJ0 B;  3DC5 A;  4NKG B;  2QM7 A;  1DTO A;  2NN4 A;  1AI7 A;  3CRQ A;  5J2T A;  1JX9 A;  4E4E A;  1NVP B;  3WB1 A;  1JVM A;  2R70 A;  3E22 B;  3A0H Z;  5H2F Z;  4DV4 B;  1TUB A;  2B5U A;  1Q81 W;  1JQ0 A;  2OCC C;  1VQP V;  3U0Z A;  4QE9 A;  1Y67 A;  1A32 A;  5KUK A;  3CCQ V;  5IJ9 A;  1N0N A;  2ITD C;  3M7M X;  2X6B A;  3OTO O;  4J7Z A;  1H2L A;  5BMV B;  1VQL V;  3K0D A;  4DV0 O;  3NXS A;  4B3T B;  2CE4 A;  1FJG B;  1I7F A;  2WAM A;  3MHH C;  5DED A;  1ZL8 A;  5B5E Z;  2Q69 A;  1GMG A;  4DUZ B;  3JAL A;  3LSS A;  1OCZ C;  3RYF A;  4LWS B;  3JSL A;  5EIB C;  3SPJ A;  3BFR A;  4UFZ A;  1K3E A;  3RYH B;  3HKB A;  4DV6 O;  4JZ2 A;  3OR6 C;  1D5A A;  1AJP A;  3H1J H;  2Q6A A;  5AG2 A;  2E5L O;  1ZTE A;  3JD1 A;  4JI2 B;  4O2A A;  3VBB A;  2JIZ G;  3JAK A;  1FJG O;  2EZP A;  1P7G A;  3QF7 A;  4CBC A;  2AXT Z;  3FFQ A;  4I4T A;  2VS0 A;  1IBM O;  2GV9 A;  3ZMU A;  2LFS A;  4FM2 A;  4JI0 O;  2WLK A;  3CWB H;  3BAA A;  4B3R B;  4B3S B;  2EBO A;  2RDC A;  2H8P C;  4FLX A;  4NXM O;  2LFR A;  4BIZ A;  4DR3 B;  1WLE A;  4XBF A;  4X8A A;  1R3J C;  1N4C A;  2P06 A;  1E1R G;  2HJF C;  4DK0 A;  3MD0 A;  5EC1 C;  2P6J A;  2EIJ B;  5J2U A;  3CC7 V;  4U3J A;  1Q6H A;  3SYA A;  4JI5 B;  4O2B A;  3E8F A;  1YXB A;  3TCU A;  4EFB A;  3K59 A;  4R6Z A;  3HKE A;  4JTD B;  5C8Y A;  5J9P C;  3BAB A;  2CH7 A;  4GZR B;  4GLX A;  1CPY A;  4RO2 A;  1VQ4 V;  2Y69 B;  4LP8 A;  2YIB D;  1EFR G;  2IH3 C;  3CE2 A;  4MS2 A;  2WWW A;  2WPD G;  1XUQ A;  4W4K A;  1VQO V;  4LF5 B;  2E76 B;  1VF7 A;  4P9P A;  3F7V C;  1FKA O;  1Y76 A;  1TAE A;  2B9Z A;  3SJC C;  4LH7 A;  3JD3 A;  2Y4T A;  3CMA V;  3UCS C;  1WJZ A;  2CUG A;  2QKC A;  2IJJ A;  1YIT V;  4UCV A;  2YIA A;  1NVP D;  5L3E A;  5IJ9 B;  5BZB A; 
#chains in the Genus database with same CATH homology
 2Q73 A;  5IE9 A;  2A3Q A;  1VMG A;  1Y6X A;  2Q9L A;  3C90 A;  2A7W A;  2Q5Z A;  3CRA A;  2P06 A;  4QGP A;  1YXB A;  1YVW A;  2YXH A;  2GTA A;  3CRC A;  2OIG A;  2Q4P A;  2OIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...