2Q73A

Crystal structure of imazg from vibrio dat 722: ctag-imazg (p41212)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
MKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEKTHELKEVLNKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title A putative house-cleaning enzyme encoded within an integron array: 1.8 A crystal structure defines a new MazG subtype.
pubmed doi rcsb
source organism Vibrio sp. dat722
molecule tags Hydrolase
total genus 35
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.19: Transferred entry: 3.6.1.9.
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q73A00
2A3QA 3CRCA 1YVWA 2Q9LA 2P06A 5IE9A 2Q4PA 2GTAA 3CRAA 2YXHA 2Q73A 4QGPA 2A7WA 2OIGA 1Y6XA 3C90A 1VMGA 1YXBA 2OIEA 2Q5ZA
chains in the Genus database with same CATH superfamily
2WLLB 4FM0A 4K35A 2W6IG 4KUMA 4OGQB 1EN4A 4B7KA 3AG2B 2FKXA 4MVSA 5D5QA 2XTAA 4UXNA 1BL8A 4LF8B 4HYOA 2DW4A 2G38A 4GX5A 3TJTA 4EEQA 3ZBHA 5KMGA 4QPKA 4DK0A 4TUYB 1NS1A 1K34A 2EZOA 4BIUA 3B77A 1UFIA 1WP7A 1PNKA 2V1DA 1COWG 1BQ0A 3ZMUA 2LO1A 3CMAV 4B3MB 1MMMA 1PD3A 3SDLA 3ZEDA 3T4ZA 3MHSC 4P9OA 3W7UA 3VBBA 3E8HA 1Q6IA 4J7KA 2HKOA 4PJ0Z 1VQPV 4X1YA 4MTXA 4BW5A 5K1XA 1YXBA 1QNMA 4EFEA 2WSSG 5EZYB 4DV0O 2ZE8A 3LNMB 5IJ9B 2CTWA 4GX0A 3K9AA 4AI8A 1N8RW 3O65A 2YI9A 3DC5A 3OD4A 2ZE7A 4JAVA 3SYPA 5L3GA 5B1BB 2XUMA 1KMIZ 4BW9A 4J41A 4LFCB 4WFAV 1KB9F 2EULA 4DV0B 2LJ2A 4UB8Z 1VF6C 4JASA 4G28B 1SERA 3OR7C 2W0FC 1TVKA 3J7AU 2WWWA 4JZ2A 1GTOA 2LFRA 2JEUA 1KQSU 4A5UB 4GZRB 4K8ZA 1SA0A 3ZRWA 4XDKA 5IYDO 2QKAA 4I4TB 5LGUA 5JVDB 4LF5O 3F7VC 4LH7A 1VP7A 3P3NA 5BMVB 1JX9A 1MABG 1KU9A 2DQ0A 2KQXA 1VIBA 2EIJC 4ZBMA 2NR5A 1TA8A 4JGSA 5A9GA 2ZQMA 4AQYO 2YIBA 2Q0OC 1FXKC 2DYSC 3T1CA 4X88A 1HP8A 1WPBA 2WLIB 4UB6Z 1XNRO 3E86A 4LF5B 4WFGA 3OTFA 1RM1C 1HWYA 2Q73A 3RFRA 1XL4A 2XAGA 2Q0AA 4DUZO 3R65A 4RQFA 3N2KA 3BAAA 3LDDA 4AQYB 2PGGA 3K5LA 2QWPB 2ZNIA 3S3WA 3RYIB 4BIOA 3JAKB 4CH3A 3RGBA 1O9HA 1XNRB 3CC4V 4YJ3B 4DR7B 1JQ0A 3ZRVA 3JCUZ 1M5IA 4IT5A 4F6EA 3ZHUA 1GRJA 4DUZB 2QWQB 2EINB 1FFTB 1TUBB 1KD1W 4LBEC 1HNXO 1SZXA 3N2GB 2XAFA 3D36C 4TT3G 2ZIOA 4NXMO 5IT9N 1FJGO 4X1IB 5EYPA 4Q6GA 4F6RB 2ITDC 4FIPC 3H01A 1AJNA 2XAQA 1NU1H 4JPRA 1GN6A 1U96A 3D8CA 2EX3A 4O4JA 4NXNB 5IWAO 1P84F 3BFRA 3JCZA 1BCCH 3GWOA 2MW2B 1HNXB 3AG7A 1VF7A 1YVWA 2R9RB 3WFVA 5C8YB 1KC8W 3H1KH 1YTFD 2HVKC 1WNSA 5FPOA 3RVYA 1OCOC 3SPIA 4JAUA 1IBLO 1QLNA 5B5EZ 5JJEB 4X20A 1Q8IA 3F5TA 2A3QA 1N32O 1IXBA 4QE7A 4X1KA 1JCHA 5KUKA 4J9ZB 4MVZA 1ZUQA 5J9PC 2D3OW 3CRMA 3L71H 5B1BC 3UCSC 1P4RA 3SJCC 2JS5A 4DUYO 4FLTA 1E1RG 4K8XA 2HEPA 1IBLB 4UVAA 3K9SA 5KAIZ 2D2CB 2DYRB 5J2TB 2P90A 5CB4A 3SJAC 1N32B 2UUCO 2HLDG 5IYZA 5FPRA 5J2UB 1X59A 2GTAA 4IGGA 4G2KA 3VQXA 3I56V 2H8PC 1FFXB 2N74A 1BS3A 5GW7A 1KP3A 2YSUB 5LMNO 4BR6A 2ITCC 4L8JA 4LNUB 5LOVB 3ZMSA 2CUGA 1Q3EA 3A0HZ 1OCRB 4KL1A 1JOYA 2JRIA 4HNAB 1HR0O 3SPCA 3JAWB 1K4DC 4JI7B 2XT9A 3GB7C 1RSOA 2JJ1G 3VQWA 3ASNB 2UUCB 3RYHB 3F7YC 4WFHA 3O9OA 3I55V 4FK5C 2LW1A 4AHCA 3L75H 3AG1B 3AG3B 1F23A 1H2LA 5LMNB 3BVOA 5JWPA 3OTOO 4IHJA 3CMEV 3CJHB 5E1AC 1NJIW 1HR0B 1QCEA 3QTCA 4CS4A 4ZOLA 5BR8B 1Q6UA 1ORQC 1EFRG 2X6CA 2RQ6A 4FFKA 3DGEA 3R66A 4FLVA 2PI5A 4H37A 1N34O 3SR2C 3E8FA 3OTOB 3CB2A 2C2AA 2O57A 3CCSV 2E5LO 3K59A 2YS8A 2CH7A 3OUFA 4NR1A 1Y74A 5GTHZ 2P7TC 4X64O 4CH5A 3ETEA 4CZZA 4LCUC 4PDLA 2XHBA 2Q67A 2QDOA 4R6ZA 1N34B 4TQFA 1XHXA 2H3OA 3OFNG 3W7SA 2DN9A 5AG2A 3J80N 1FXHA 2IBZH 2NNUA 4X65O 4UVBA 5IE9A 5KX5B 2IJHA 4MVRA 5JJNB 2VRZA 1U97A 4HBNA 4U7NA 2LQTA 1BHBA 1NH2B 4J9YB 2B1GA 5BY1A 2ILMA 4ASUG 2IU0A 3HKEA 4E2LA 1H2GA 1E79G 4DV5O 3K5NA 1B6QA 4UCSA 3BHPA 2K9PA 3MHHC 1WJZA 3E22B 5EIBC 1XNQO 1VMGA 2JGDB 1PV0A 4B7EA 3W7XA 3QO5A 5KAFZ 3T2MA 1NT2B 1QQCA 3CRQA 1YITV 3KG2A 4AILC 3B4SA 2AW9A 1L1FA 4DV5B 2QEXV 4DR4O 1AR5A 1T5EA 1BMFG 1YI2V 5LP6A 4JI4O 4G27B 4JYAO 3ZIAG 1XNQB 5CA0B 3CC7V 1AR1B 2YICA 2AHYA 1NVPD 4KXRA 4DRXB 1P49A 1F51A 4LFAO 1Q90D 1WA8A 1XDCA 2Z3YA 2UXNA 4N23A 1XMQO 1OCRC 1BQZA 2X0LA 1R3LC 4DR4B 3HKBA 4PELA 1LNQA 3RYFA 1I0HA 4JI4B 2LP7A 2IU3A 3ASOB 1JFFB 1WN7A 2AXTZ 1AI7A 4TOIA 3HKCA 2WLKA 3ASNC 4QE9A 1K5QA 2UU9O 1VQ6V 3SYAA 5JH7A 2UUBO 1FPOA 4EKWA 2ARHA 1RPRA 2ODMA 2ZIMA 4ZHQA 4LFAB 2EIKB 4O4IB 2W6JG 2Q6AA 1NTMH 2XOKG 3RWRD 1SKVA 1I94O 2GV9A 1FXKB 3ABMC 2DYSB 3CRCA 3CSXA 5DN6G 1IX9A 2QSAA 3G67A 1LUWA 1Y76A 4YIPA 3APQA 2UU9B 2CTRA 3G71V 4E4EA 5B1AC 1K97A 5CBHA 1RM1B 3AK1A 1GM8A 2WLJA 2M7WA 4XDLA 4UCRA 1MSDA 3OMIB 1ZLZA 3CC2V 1XEQA 1F4MA 3LNNA 4DR3O 2DWDC 3K06A 2PZSA 1K4CC 4IIJA 1NR7A 2IH3C 3HPLC 1YJ9V 3T1HO 1N4CA 1I94B 4U3JB 2F23A 5LMUO 1QHTA 2KB1A 3IJ4A 4OXSA 3IFXA 1AB3A 4U7OA 1PNMA 3ETDA 4C7UA 1L0LH 1DF5A 4CH4A 2NLJC 1XUQA 3ZJZA 1S5HC 4DR3B 3SJBC 2P4KA 2AHZA 3K3WA 1JJ2U 2XASA 5H6RA 3RBZA 3T1HB 4JV5O 4P2ZA 3HKDA 2YIBD 5LMUB 3RYCA 1G1XB 1SQXH 3FAVB 4FFBA 4MTGA 1SQQH 5GONB 2IW5A 4BAYA 4JYCA 3G6BA 3JARA 1W0KG 5LGTA 2GDSA 1US6A 2FYUH 4W4LA 4O4HB 1H2NA 4UCUA 2Z5UA 3NR7A 3EFFK 4O2AB 3RVZA 3HR0A 1OCOB 4MTFA 3CEIA 1I08A 2RCVA 3WU2Z 1AI4A 2ZNJA 3JD0A 3BY6A 3JASB 2ZM6O 1EN5A 2Q4PA 1MZFA 2QTOA 2HHHO 1QR9A 1H8EG 2OTJV 2ATKC 2E3CA 3ETGA 4I55B 2GUZA 5EC1C 1M90W 4GUNA 2JJ2G 1QBZA 3OGIB 2OYQA 2Q8VA 2BCCH 2X6BA 2QTSA 4WBNB 3CXCU 5IYCO 3FB7C 1CPYA 5K1PA 1Y66A 5FNVB 1R6NA 1DLBA 2ZM6B 2R72A 4DR2O 1HNWO 4O4LB 1VQMV 3ZS8C 2KG7B 3DXRB 1ENVA 4EB6A 3ASOC 2YEVB 1AJPA 5IJ0B 2GBOA 4IL6Z 1XILA 1SQGA 4CS3A 3ZRSA 1S72V 2EIKC 1VQLV 1YDXA 4TV9B 4DR2B 3CCRV 1HNWB 2L6LA 5ITZB 3DSQA 1YTFB 3M99B 2OTLV 1TUEB 2BTQA 2EILB 2X6AA 4JTCB 4B3RO 1B06A 1JPXA 2F66C 1XMOO 4PA7A 1ZL8A 2OCCC 3OEEG 4PV1B 2ZR3A 3OUSA 4FPPA 5JCOA 1HW7A 4OPAA 4I50A 4ZI7B 1QR8A 2ZE6A 4B3RB 2UXXA 2WA3A 1UPGA 1MA1A 1AJQA 2HP8A 3MAQA 3UT5A 1XMOB 5LXTB 3FB8C 2N04A 4ZKIA 4ZIBA 4GT1A 2RDCA 5EC2C 4PI2A 4JI0O 1V54C 4MTOA 3OW2U 3K0GA 2OIEA 4O2BA 2JGUA 4L87A 4FLZA 4BWAA 3CCVV 1PNLA 3B40A 5LGNA 1Y4MA 3JATA 2KKWA 5TISZ 2FB5A 5FL7G 2PY5A 1PL0A 2IM9A 4JI0B 2QJ1A 1YF2A 5LYJA 5JQGA 3WB1A 4FLYA 1OCCC 3ABKB 2PF4E 3CCMV 4NXMB 4YJ2B 5CA1A 1FJGB 1RP3B 4I7ZB 4DV4O 4PDRA 3ZHVA 4FMTA 4B3SO 4J7JA 1X4TA 2Y0PA 2N05A 4X89A 2E76B 1I7FA 4NB5A 1AI6A 1CEZA 5IWAB 4DK1A 1W0JG 3K0DA 2WLLA 5KLVH 2QA4V 3IAYA 1VQ7V 1M4UA 1MOFA 2CK3G 4JI2O 4JYYA 4LP8A 3Q4HB 3SGIA 1PM9A 2QE7G 4LWSB 2F93B 3SYCA 3E35A 2LFSA 2JDIG 1N0NA 1MSWD 5LHHA 4B3SB 2YC0A 1H2SB 3K5OA 3D3IA 4TV8B 4TUYA 1VEWA 1R73A 1R3IC 5IYBO 2Q7EA 2HFEC 2P4VA 3CE2A 2M6YA 3UO2A 4JI2B 1CP9A 4DV1O 1URFA 1Q81W 1BSMA 2CAZC 2Q68A 5LBQA 5B66Z 2CTQA 1SQFA 4DUYB 3I5DA 5EZYA 1FKAO 1NI8A 1I5XA 3JAMN 3FD9A 3E2EA 4I0XB 1Y76B 5DEDA 1M56C 2B9ZA 2EBOA 1EN6A 5IJ9A 4CBCA 1JMKC 3E8GA 1K8AW 2Y4UA 4X62O 1K3EA 3W7TA 3IC7A 3EHBB 3K04A 2EILC 4WF9V 3J81N 3EVKA 5LA6B 2EIMB 3A0RA 5LL6Y 5L3DA 3EXAA 4J7ZA 3AG4B 3LUTB 1GH6A 1R3JC 3M8AA 3ABMB 4I9WA 4DV7O 2PYLA 5KA5A 2Y4TA 2ZKOA 3RT3C 4X62B 3JD2A 2Z0AA 3E83A 4P30A 3JALB 4Q20A 5B1AB 2YIDA 2ZR2A 1R6KA 4UCVA 2BSKB 4I4TA 5H2FZ 4ICGA 5JVDA 1O9GA 1IVSA 1ZX3A 2QGNA 2QKSA 3SYOA 2JEXA 5BMVA 3CCLV 1NTKH 2YXHA 4YIOA 5L3EA 3FFQA 4GKJO 4DV7B 2JS3A 4LFBO 3ETQA 1S5LZ 4LF9O 4GLXA 1KBHA 2HG5C 4H0LB 3ZRXA 5KMGB 4GYCB 1AR4A 4FZ1A 5CN0A 2WLIA 4HZ3A 2ZINA 1YSCA 3LSQA 1OJHA 4KHPO 2E5LB 5CA3A 3OEHG 4CC5A 3WB0A 2HR3A 5IDJA 4GKJB 3KZIZ 1S77D 1VQNV 1GN2A 1SESA 2H94A 4X64B 3TK1A 3SPJA 4X1YB 2P6JA 3RYIA 3JAKA 4R50A 3ABKC 2FL4A 1BE3H 4JI1O 2YI8A 4PA4A 2YUAA 2QM7A 4IYHA 4MT8A 2P06A 1VQ4V 4YJ3A 4KHPB 2R70A 3KCYA 4X65B 3A0BZ 5EBLC 2EZPA 2GSMB 4JTAB 5LP6C 4UV8A 3WG7C 5CBGA 2DMXA 3JYCA 1BT8A 1FS0G 4JI6O 4PI0A 3IGAC 4Z2WA 3T1YO 1IXMA 1VQOV 3N2GA 3ABTA 4DO2A 1Z2GA 4JI1B 2F4VO 3K03A 4X1IA 1SRYA 4F6RA 3TETA 5EBMC 2EJRA 1TVKB 1IDSA 3S3XA 4RUEA 1MZEA 2VQFO 4JI6B 4NTWA 3T1YB 1SA0B 3ZRWB 1QLEC 5C8YA 1Z5WA 1M1KW 2YIAA 4P9PA 2ETNA 1AROP 2P5OA 4BIZA 4YHHO 3L70H 1K5SA 3H1LH 2UUAO 3LDEA 1WAZA 4KP4A 1YEWA 5KHGA 2OWOA 1R1BA 4WCEV 1M57C 1B3QA 1MG1A 4JYAB 3OAAG 1VQKV 2RJZA 1ZL8B 5KUMA 4Z1VA 3M7MX 1LUVA 2DQ3A 2Q7HA 1S76D 3RW0A 3GVMA 4X66O 2EIMC 2UUAB 3N2KB 4B08A 3CPWU 1XMQB 2F95B 2OT5A 4JF3A 1FAFA 5HFMA 3BPZA 2UXCO 1DGSA 1N33O 3AG4C 4DR6O 2LW7A 5J2TA 3P30A 4PHZA 2K1EA 3K57A 2YXLA 1VARA 2VS0A 5J2UA 3FYEB 4UFZA 4FM2A 1VQ5V 3NXSA 1NH2D 2IH1C 2UUBB 2F1MA 3OT7A 4GCZA 1FFXA 2OCCB 2A9HA 3ICXA 3KKYA 5LOVA 4LNUA 1RPOA 4X66B 4I9QA 1JA8A 2UXDO 4QPJA 4FM1A 4HNAA 2UXCB 1M9NA 3JAWA 4D7TA 1GM7A 1N33B 3CCUV 2B5UA 3CWBH 3MD0A 3TGUH 3THOA 4RWUA 5EYPB 3RYHA 1AP6A 3CCQV 4NKGB 3BEHA 3UO3A 2QWOB 4LH6A 3ZCCA 5D5PA 1AP5A 2WLHA 4O4JB 3JD3A 1DTOA 3CJHA 1V54B 5CBFA 2BTOA 4MSWC 4QJFB 4PA6A 1S0VA 2QM8A 4GKKO 4D7SA 4RO2A 4LF8O 2Y69C 1YJWV 3X2QB 5B1OA 3U10A 4FJCC 4X9QA 1DK1A 4WFFA 4X20B 4PA9A 1SC5B 1H8HG 4B3MO 4UCOA 1BZKA 4X1KB 3G6EV 4WFBV 4JYBA 3CX5F 5H6QA 3U11A 4X8AA 5B1NA 4LC1A 1OCCB 4JV5B 4GKKB 5DM6V 2AZ0A 1K33A 3K58A 1KKCA 1SQPH 4LF7O 5C93A 1J5EO 1WB8A 2CE4A 4GX1A 5H9CA 4DV3O 2ZDIA 2HJFC 2NN4A 1S3JA 2A06H 1XHZA 4K3AA 1YCIA 1ZWIC 2FMLA 4CH6A 5CB4B 4JI8O 1SS3A 3H1IH 3FX7A 5IYZB 5KX5A 3UKMA 2PI4A 1OZ0A 1IZ3A 2RMKB 2PYJA 4J42A 1G6UA 4MW8A 2CDYA 2GHYA 1GKFA 3QNEA 4LF7B 4LFCO 1J5EB 2YXYA 4N21A 3H1HH 2CTPA 5FLXN 1WP8A 4DV3B 4QNHB 2QM4A 2B1IA 2P67A 4DR1O 3L72H 1RSOB 4JI8B 2HHHB 2EJ7A 3CD6V 2RN9A 3BA8A 3E22A 1S5JA 3G80A 2ZXWB 4IHJB 2JGDA 2WLNA 4F4LA 4ZOLB 5H5NA 2QR4A 4DR1B 2L35A 3CRAA 5JCOC 3ABLB 1M56B 2R9AA 1PL4A 1SQVH 3SPHA 3FB5C 4UCTA 3L74H 1G8MA 1M93A 2FTKA 5LHGA 5CA0A 1P7BA 1GN3A 1GMGA 1Q6HA 1UJWB 3STZC 4DRXA 2CH7B 3OGCC 4LF4O 2WLMA 1I5YA 5BXZA 1A32A 1VF6A 3AK2A 1Y74B 1GO3F 4DXWA 4JI5O 5L3BA 2IJJA 5KHKA 1Q43A 3TXSA 1JFFA 2BOBC 3W7WA 3ZMZA 1IBMO 1GN4A 3BA9A 4TQDA 5JJJB 1YZBA 1ZTEA 4DR7O 3QF7A 1K92A 4LF4B 1K73W 4O4IA 4NTXA 2Q7GA 2JVDA 1AVMA 1EZJA 1NQTA 3HB3B 4JI5B 1L8DA 2OCHA 2PUSA 3ZN1A 4TSFG 5B3SC 3LSSA 3QO8A 1N0JA 1Q5OA 1FXKA 2VWKA 1WPXA 3AEIA 3FYIB 1IBMB 3HKEB 4DR5O 3CYOA 4JI3O 4QGPA 3X2QC 3C3TA 3DC6A 3FB6C 2JK5C 5IY5B 4NXNO 5DECA 2E74B 1PPJH 1XBLA 1GM9A 3A2FA 1LR1A 4FLUA 1F4NA 2P22C 4U3JA 1ZAUA 3AG2C 2ZE5A 3RN4A 4DR5B 4RQEA 4JI3B 1EBOA 4H33A 4CC6A 1ROPA 3ABUA 5LP6B 1IBKO 3WG7B 1DF4A 4OPHA 2IJKA 4UVCA 1VQ8V 2XAHA 4H44B 1SETA 2VQEO 3D36A 1PP9H 3APOA 2QKCA 3FAVA 1WA8B 5L3FA 1TGOA 1W59A 4NTYA 3ZX6A 4DV4B 5GONA 3LDCA 1KKDA 4YY3O 3HKBB 1RFYA 3RYFB 2AZ2A 1IBKB 1HDJA 4RAIA 3H9VA 1SQBH 1CXZB 3HKCB 5JH7B 2VQEB 1QLEB 1OHHG 2Y48A 4ZHQB 4O4HA 3UQ8A 2ZXWC 2XNDG 3ZHSA 1QVFU 3STLC 4O2AA 4YY3B 1AILA 1KECA 4JI7O 1XL6A 1NZ6A 1OCZB 1V55B 2F43G 4R8CA 5GTIZ 1M57B 1J95A 1PKXA 3JASA 1Q82W 2ADPA 3ABLC 3U0ZA 2QWRB 1WB7A 2ADQB 4I55A 3TXQA 4DV1B 3OMNB 5A2QN 2A7WA 3DTUB 1NR1A 1H2KA 2CGNA 4WBNA 2DE0X 4IIJB 5EK0A 3L9DA 4D6TH 1W2BU 3K5MA 5BR8O 4LF6O 2GTSA 5FNVA 1IURA 4QIWF 3LSUA 3A8TA 2JIZG 4O4LA 1EZVH 2HVJC 4UUJC 1QU7A 2KG7A 3DXRA 3H1JH 4J80A 3GWKC 2YEVA 5IJ0A 3C90A 4PA3A 1N36O 1V9PA 1OV9A 3CP1A 4LF6B 1F7YA 3KCXA 3HKDB 4JZGA 1FXVA 4FLXA 3RYCB 1VF5B 4TV9A 1P7GA 5EIBD 5KA6A 1THZA 5ITZA 1HNZO 4FFBB 3QVNA 1NVPB 1SF9A 1H38A 3MDSA 5E79Z 5KHIA 3OM3B 4LR3A 3ZMVA 1MNGA 2ZT9B 3CS5A 2LGQA 1VQ9V 3B8MA 2WPDG 1N36B 3K08A 1Y67A 3JD4A 1K7DA 2XAJA 3JARB 5EBWC 4IYIA 3N27A 3K79A 5BZBA 5IY5C 1B04A 3OR6C 4XBFA 2EINC 4LFBB 5L3CA 2A0LA 1HNZB 4LF9B 2Y69B 2OIGA 1Y6XA 4ZI7A 1NKDA 5KHJA 4NVPA 1TAEA 1JR9A 1D5AA 2ZD9A 5LXTA 4R7CA 3BRCA 2DWEC 2KSDA 2GUZB 3FKSG 2CGOA 1SZTA 1TUBA 3ZN0A 2Q5ZA 4NYKA 4H13B 2E75B 1G4YB 2WA4A 4MW3A 4MVQA 1L0NH 4KFMA 4YXWG 1E1QG 4DV6O 3WB2A 4HAMA 2X7RB 3AK3A 3SPGA 1K9MW 4EB6B 3UM7A 4W4KA 3ZMTA 1BHAA 4GX2A 4J11A 4WFEA 4I5SA 4JAAA 4YJ2A 2F4VB 3JD1A 3VQVA 4DV6B 2Q69A 1ZSPA 3P3PA 3TCUA 1JVMA 1FYJA 4UV9A 4FLWA 2R9IA 5LHIA 2DYRC 1OCZC 1V55C 2DOSA 4PD4F 2BTQB 1EM1A 4MVMA 2VQFB 2BE3A 3BABA 4TWKA 5CMUA 1XI1A 1H2MA 3Q4HA 3VOUA 2MK3A 3QO7A 4LWSA 1AI5A 4EFBA 4YHHB 3D3QA 2YDEA 1YJNV 1BGYH 2DJVA 4MS2A 1Z5VA 3B2EE 4TV8A 2AGAA 3C3SA 4I50B 1JJOA 2W0XA 5KHHA 1GK9A 3SJQC 3SYQA 3G4SV 3CXHF 4DV2O 4CS2A 3BCCH 2HJDA 3UT5B 2PTMA 3CCJV 1R3KC 4FVMA 4FZ0A 1KUQA 3E89A 3L73H 3AG1C 3B09A 3AG3C 3JSNA 5F2VO 1GAXA 2V7QG 3JSLA 1WLEA 1D5NA 2EIJB 1XREA 3OE7G 4ABMA 2RNBA 4DYLA 3ML0A 3ZHRA 2IJIA 4O2BB 4B3TO 1QVGU 4I0XA 4DW0A 2A79B 2Q9LA 1KYOF 3ZHTA 4JTDB 4DR6B 4DV2B 1Q7YW 4RUFA 4PDMA 4K0KO 3T4DA 4J10A 2V4DA 3JATB 2QWNB 3IC9A 2UXBO 3VQYA 5HFLA 3CCEV 1YIJV 1NTZH 5LA6A 1XOUA 4OX9O 3PN1A 1NBMG 2UXDB 4PDVA 2VWJA 2BOCC 2WAMA 1D2DA 4B3TB 5JQGB 5B3SB 1KP2A 5LYJB 2ZCEA 3E8BA 1XQ8A 3B8NA 1YHQV 5CA1B 3CRRA 3P32A 4K0KB 3OMAB 1R6TA 3PJSK 1Q86W 4U3FH 2LGWA 3QG5A 2ZDIC 4Z1MG 2UXBB 1FD9A 2Y0IA 3CHXA 3ZHQA 3JALA 3F5WC 4MVUA 4MVOA 2BSKA 4OX9B 4XDJA 4DW1A
chains in the Genus database with same CATH topology
2A3QA 3CRCA 1YVWA 2Q9LA 2P06A 5IE9A 2Q4PA 2GTAA 3CRAA 2YXHA 2Q73A 4QGPA 2A7WA 2OIGA 1Y6XA 3C90A 1VMGA 1YXBA 2OIEA 2Q5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3Q A;  3CRC A;  1YVW A;  2Q9L A;  2P06 A;  5IE9 A;  2Q4P A;  2GTA A;  3CRA A;  2YXH A;  2Q73 A;  4QGP A;  2A7W A;  2OIG A;  1Y6X A;  3C90 A;  1VMG A;  1YXB A;  2OIE A;  2Q5Z A; 
#chains in the Genus database with same CATH topology
 2WLL B;  4FM0 A;  4K35 A;  2W6I G;  4KUM A;  4OGQ B;  1EN4 A;  4B7K A;  3AG2 B;  2FKX A;  4MVS A;  5D5Q A;  2XTA A;  4UXN A;  1BL8 A;  4LF8 B;  4HYO A;  2DW4 A;  2G38 A;  4GX5 A;  3TJT A;  4EEQ A;  3ZBH A;  5KMG A;  4QPK A;  4DK0 A;  4TUY B;  1NS1 A;  1K34 A;  2EZO A;  4BIU A;  3B77 A;  1UFI A;  1WP7 A;  1PNK A;  2V1D A;  1COW G;  1BQ0 A;  3ZMU A;  2LO1 A;  3CMA V;  4B3M B;  1MMM A;  1PD3 A;  3SDL A;  3ZED A;  3T4Z A;  3MHS C;  4P9O A;  3W7U A;  3VBB A;  3E8H A;  1Q6I A;  4J7K A;  2HKO A;  4PJ0 Z;  1VQP V;  4X1Y A;  4MTX A;  4BW5 A;  5K1X A;  1YXB A;  1QNM A;  4EFE A;  2WSS G;  5EZY B;  4DV0 O;  2ZE8 A;  3LNM B;  5IJ9 B;  2CTW A;  4GX0 A;  3K9A A;  4AI8 A;  1N8R W;  3O65 A;  2YI9 A;  3DC5 A;  3OD4 A;  2ZE7 A;  4JAV A;  3SYP A;  5L3G A;  5B1B B;  2XUM A;  1KMI Z;  4BW9 A;  4J41 A;  4LFC B;  4WFA V;  1KB9 F;  2EUL A;  4DV0 B;  2LJ2 A;  4UB8 Z;  1VF6 C;  4JAS A;  4G28 B;  1SER A;  3OR7 C;  2W0F C;  1TVK A;  3J7A U;  2WWW A;  4JZ2 A;  1GTO A;  2LFR A;  2JEU A;  1KQS U;  4A5U B;  4GZR B;  4K8Z A;  1SA0 A;  3ZRW A;  4XDK A;  5IYD O;  2QKA A;  4I4T B;  5LGU A;  5JVD B;  4LF5 O;  3F7V C;  4LH7 A;  1VP7 A;  3P3N A;  5BMV B;  1JX9 A;  1MAB G;  1KU9 A;  2DQ0 A;  2KQX A;  1VIB A;  2EIJ C;  4ZBM A;  2NR5 A;  1TA8 A;  4JGS A;  5A9G A;  2ZQM A;  4AQY O;  2YIB A;  2Q0O C;  1FXK C;  2DYS C;  3T1C A;  4X88 A;  1HP8 A;  1WPB A;  2WLI B;  4UB6 Z;  1XNR O;  3E86 A;  4LF5 B;  4WFG A;  3OTF A;  1RM1 C;  1HWY A;  2Q73 A;  3RFR A;  1XL4 A;  2XAG A;  2Q0A A;  4DUZ O;  3R65 A;  4RQF A;  3N2K A;  3BAA A;  3LDD A;  4AQY B;  2PGG A;  3K5L A;  2QWP B;  2ZNI A;  3S3W A;  3RYI B;  4BIO A;  3JAK B;  4CH3 A;  3RGB A;  1O9H A;  1XNR B;  3CC4 V;  4YJ3 B;  4DR7 B;  1JQ0 A;  3ZRV A;  3JCU Z;  1M5I A;  4IT5 A;  4F6E A;  3ZHU A;  1GRJ A;  4DUZ B;  2QWQ B;  2EIN B;  1FFT B;  1TUB B;  1KD1 W;  4LBE C;  1HNX O;  1SZX A;  3N2G B;  2XAF A;  3D36 C;  4TT3 G;  2ZIO A;  4NXM O;  5IT9 N;  1FJG O;  4X1I B;  5EYP A;  4Q6G A;  4F6R B;  2ITD C;  4FIP C;  3H01 A;  1AJN A;  2XAQ A;  1NU1 H;  4JPR A;  1GN6 A;  1U96 A;  3D8C A;  2EX3 A;  4O4J A;  4NXN B;  5IWA O;  1P84 F;  3BFR A;  3JCZ A;  1BCC H;  3GWO A;  2MW2 B;  1HNX B;  3AG7 A;  1VF7 A;  1YVW A;  2R9R B;  3WFV A;  5C8Y B;  1KC8 W;  3H1K H;  1YTF D;  2HVK C;  1WNS A;  5FPO A;  3RVY A;  1OCO C;  3SPI A;  4JAU A;  1IBL O;  1QLN A;  5B5E Z;  5JJE B;  4X20 A;  1Q8I A;  3F5T A;  2A3Q A;  1N32 O;  1IXB A;  4QE7 A;  4X1K A;  1JCH A;  5KUK A;  4J9Z B;  4MVZ A;  1ZUQ A;  5J9P C;  2D3O W;  3CRM A;  3L71 H;  5B1B C;  3UCS C;  1P4R A;  3SJC C;  2JS5 A;  4DUY O;  4FLT A;  1E1R G;  4K8X A;  2HEP A;  1IBL B;  4UVA A;  3K9S A;  5KAI Z;  2D2C B;  2DYR B;  5J2T B;  2P90 A;  5CB4 A;  3SJA C;  1N32 B;  2UUC O;  2HLD G;  5IYZ A;  5FPR A;  5J2U B;  1X59 A;  2GTA A;  4IGG A;  4G2K A;  3VQX A;  3I56 V;  2H8P C;  1FFX B;  2N74 A;  1BS3 A;  5GW7 A;  1KP3 A;  2YSU B;  5LMN O;  4BR6 A;  2ITC C;  4L8J A;  4LNU B;  5LOV B;  3ZMS A;  2CUG A;  1Q3E A;  3A0H Z;  1OCR B;  4KL1 A;  1JOY A;  2JRI A;  4HNA B;  1HR0 O;  3SPC A;  3JAW B;  1K4D C;  4JI7 B;  2XT9 A;  3GB7 C;  1RSO A;  2JJ1 G;  3VQW A;  3ASN B;  2UUC B;  3RYH B;  3F7Y C;  4WFH A;  3O9O A;  3I55 V;  4FK5 C;  2LW1 A;  4AHC A;  3L75 H;  3AG1 B;  3AG3 B;  1F23 A;  1H2L A;  5LMN B;  3BVO A;  5JWP A;  3OTO O;  4IHJ A;  3CME V;  3CJH B;  5E1A C;  1NJI W;  1HR0 B;  1QCE A;  3QTC A;  4CS4 A;  4ZOL A;  5BR8 B;  1Q6U A;  1ORQ C;  1EFR G;  2X6C A;  2RQ6 A;  4FFK A;  3DGE A;  3R66 A;  4FLV A;  2PI5 A;  4H37 A;  1N34 O;  3SR2 C;  3E8F A;  3OTO B;  3CB2 A;  2C2A A;  2O57 A;  3CCS V;  2E5L O;  3K59 A;  2YS8 A;  2CH7 A;  3OUF A;  4NR1 A;  1Y74 A;  5GTH Z;  2P7T C;  4X64 O;  4CH5 A;  3ETE A;  4CZZ A;  4LCU C;  4PDL A;  2XHB A;  2Q67 A;  2QDO A;  4R6Z A;  1N34 B;  4TQF A;  1XHX A;  2H3O A;  3OFN G;  3W7S A;  2DN9 A;  5AG2 A;  3J80 N;  1FXH A;  2IBZ H;  2NNU A;  4X65 O;  4UVB A;  5IE9 A;  5KX5 B;  2IJH A;  4MVR A;  5JJN B;  2VRZ A;  1U97 A;  4HBN A;  4U7N A;  2LQT A;  1BHB A;  1NH2 B;  4J9Y B;  2B1G A;  5BY1 A;  2ILM A;  4ASU G;  2IU0 A;  3HKE A;  4E2L A;  1H2G A;  1E79 G;  4DV5 O;  3K5N A;  1B6Q A;  4UCS A;  3BHP A;  2K9P A;  3MHH C;  1WJZ A;  3E22 B;  5EIB C;  1XNQ O;  1VMG A;  2JGD B;  1PV0 A;  4B7E A;  3W7X A;  3QO5 A;  5KAF Z;  3T2M A;  1NT2 B;  1QQC A;  3CRQ A;  1YIT V;  3KG2 A;  4AIL C;  3B4S A;  2AW9 A;  1L1F A;  4DV5 B;  2QEX V;  4DR4 O;  1AR5 A;  1T5E A;  1BMF G;  1YI2 V;  5LP6 A;  4JI4 O;  4G27 B;  4JYA O;  3ZIA G;  1XNQ B;  5CA0 B;  3CC7 V;  1AR1 B;  2YIC A;  2AHY A;  1NVP D;  4KXR A;  4DRX B;  1P49 A;  1F51 A;  4LFA O;  1Q90 D;  1WA8 A;  1XDC A;  2Z3Y A;  2UXN A;  4N23 A;  1XMQ O;  1OCR C;  1BQZ A;  2X0L A;  1R3L C;  4DR4 B;  3HKB A;  4PEL A;  1LNQ A;  3RYF A;  1I0H A;  4JI4 B;  2LP7 A;  2IU3 A;  3ASO B;  1JFF B;  1WN7 A;  2AXT Z;  1AI7 A;  4TOI A;  3HKC A;  2WLK A;  3ASN C;  4QE9 A;  1K5Q A;  2UU9 O;  1VQ6 V;  3SYA A;  5JH7 A;  2UUB O;  1FPO A;  4EKW A;  2ARH A;  1RPR A;  2ODM A;  2ZIM A;  4ZHQ A;  4LFA B;  2EIK B;  4O4I B;  2W6J G;  2Q6A A;  1NTM H;  2XOK G;  3RWR D;  1SKV A;  1I94 O;  2GV9 A;  1FXK B;  3ABM C;  2DYS B;  3CRC A;  3CSX A;  5DN6 G;  1IX9 A;  2QSA A;  3G67 A;  1LUW A;  1Y76 A;  4YIP A;  3APQ A;  2UU9 B;  2CTR A;  3G71 V;  4E4E A;  5B1A C;  1K97 A;  5CBH A;  1RM1 B;  3AK1 A;  1GM8 A;  2WLJ A;  2M7W A;  4XDL A;  4UCR A;  1MSD A;  3OMI B;  1ZLZ A;  3CC2 V;  1XEQ A;  1F4M A;  3LNN A;  4DR3 O;  2DWD C;  3K06 A;  2PZS A;  1K4C C;  4IIJ A;  1NR7 A;  2IH3 C;  3HPL C;  1YJ9 V;  3T1H O;  1N4C A;  1I94 B;  4U3J B;  2F23 A;  5LMU O;  1QHT A;  2KB1 A;  3IJ4 A;  4OXS A;  3IFX A;  1AB3 A;  4U7O A;  1PNM A;  3ETD A;  4C7U A;  1L0L H;  1DF5 A;  4CH4 A;  2NLJ C;  1XUQ A;  3ZJZ A;  1S5H C;  4DR3 B;  3SJB C;  2P4K A;  2AHZ A;  3K3W A;  1JJ2 U;  2XAS A;  5H6R A;  3RBZ A;  3T1H B;  4JV5 O;  4P2Z A;  3HKD A;  2YIB D;  5LMU B;  3RYC A;  1G1X B;  1SQX H;  3FAV B;  4FFB A;  4MTG A;  1SQQ H;  5GON B;  2IW5 A;  4BAY A;  4JYC A;  3G6B A;  3JAR A;  1W0K G;  5LGT A;  2GDS A;  1US6 A;  2FYU H;  4W4L A;  4O4H B;  1H2N A;  4UCU A;  2Z5U A;  3NR7 A;  3EFF K;  4O2A B;  3RVZ A;  3HR0 A;  1OCO B;  4MTF A;  3CEI A;  1I08 A;  2RCV A;  3WU2 Z;  1AI4 A;  2ZNJ A;  3JD0 A;  3BY6 A;  3JAS B;  2ZM6 O;  1EN5 A;  2Q4P A;  1MZF A;  2QTO A;  2HHH O;  1QR9 A;  1H8E G;  2OTJ V;  2ATK C;  2E3C A;  3ETG A;  4I55 B;  2GUZ A;  5EC1 C;  1M90 W;  4GUN A;  2JJ2 G;  1QBZ A;  3OGI B;  2OYQ A;  2Q8V A;  2BCC H;  2X6B A;  2QTS A;  4WBN B;  3CXC U;  5IYC O;  3FB7 C;  1CPY A;  5K1P A;  1Y66 A;  5FNV B;  1R6N A;  1DLB A;  2ZM6 B;  2R72 A;  4DR2 O;  1HNW O;  4O4L B;  1VQM V;  3ZS8 C;  2KG7 B;  3DXR B;  1ENV A;  4EB6 A;  3ASO C;  2YEV B;  1AJP A;  5IJ0 B;  2GBO A;  4IL6 Z;  1XIL A;  1SQG A;  4CS3 A;  3ZRS A;  1S72 V;  2EIK C;  1VQL V;  1YDX A;  4TV9 B;  4DR2 B;  3CCR V;  1HNW B;  2L6L A;  5ITZ B;  3DSQ A;  1YTF B;  3M99 B;  2OTL V;  1TUE B;  2BTQ A;  2EIL B;  2X6A A;  4JTC B;  4B3R O;  1B06 A;  1JPX A;  2F66 C;  1XMO O;  4PA7 A;  1ZL8 A;  2OCC C;  3OEE G;  4PV1 B;  2ZR3 A;  3OUS A;  4FPP A;  5JCO A;  1HW7 A;  4OPA A;  4I50 A;  4ZI7 B;  1QR8 A;  2ZE6 A;  4B3R B;  2UXX A;  2WA3 A;  1UPG A;  1MA1 A;  1AJQ A;  2HP8 A;  3MAQ A;  3UT5 A;  1XMO B;  5LXT B;  3FB8 C;  2N04 A;  4ZKI A;  4ZIB A;  4GT1 A;  2RDC A;  5EC2 C;  4PI2 A;  4JI0 O;  1V54 C;  4MTO A;  3OW2 U;  3K0G A;  2OIE A;  4O2B A;  2JGU A;  4L87 A;  4FLZ A;  4BWA A;  3CCV V;  1PNL A;  3B40 A;  5LGN A;  1Y4M A;  3JAT A;  2KKW A;  5TIS Z;  2FB5 A;  5FL7 G;  2PY5 A;  1PL0 A;  2IM9 A;  4JI0 B;  2QJ1 A;  1YF2 A;  5LYJ A;  5JQG A;  3WB1 A;  4FLY A;  1OCC C;  3ABK B;  2PF4 E;  3CCM V;  4NXM B;  4YJ2 B;  5CA1 A;  1FJG B;  1RP3 B;  4I7Z B;  4DV4 O;  4PDR A;  3ZHV A;  4FMT A;  4B3S O;  4J7J A;  1X4T A;  2Y0P A;  2N05 A;  4X89 A;  2E76 B;  1I7F A;  4NB5 A;  1AI6 A;  1CEZ A;  5IWA B;  4DK1 A;  1W0J G;  3K0D A;  2WLL A;  5KLV H;  2QA4 V;  3IAY A;  1VQ7 V;  1M4U A;  1MOF A;  2CK3 G;  4JI2 O;  4JYY A;  4LP8 A;  3Q4H B;  3SGI A;  1PM9 A;  2QE7 G;  4LWS B;  2F93 B;  3SYC A;  3E35 A;  2LFS A;  2JDI G;  1N0N A;  1MSW D;  5LHH A;  4B3S B;  2YC0 A;  1H2S B;  3K5O A;  3D3I A;  4TV8 B;  4TUY A;  1VEW A;  1R73 A;  1R3I C;  5IYB O;  2Q7E A;  2HFE C;  2P4V A;  3CE2 A;  2M6Y A;  3UO2 A;  4JI2 B;  1CP9 A;  4DV1 O;  1URF A;  1Q81 W;  1BSM A;  2CAZ C;  2Q68 A;  5LBQ A;  5B66 Z;  2CTQ A;  1SQF A;  4DUY B;  3I5D A;  5EZY A;  1FKA O;  1NI8 A;  1I5X A;  3JAM N;  3FD9 A;  3E2E A;  4I0X B;  1Y76 B;  5DED A;  1M56 C;  2B9Z A;  2EBO A;  1EN6 A;  5IJ9 A;  4CBC A;  1JMK C;  3E8G A;  1K8A W;  2Y4U A;  4X62 O;  1K3E A;  3W7T A;  3IC7 A;  3EHB B;  3K04 A;  2EIL C;  4WF9 V;  3J81 N;  3EVK A;  5LA6 B;  2EIM B;  3A0R A;  5LL6 Y;  5L3D A;  3EXA A;  4J7Z A;  3AG4 B;  3LUT B;  1GH6 A;  1R3J C;  3M8A A;  3ABM B;  4I9W A;  4DV7 O;  2PYL A;  5KA5 A;  2Y4T A;  2ZKO A;  3RT3 C;  4X62 B;  3JD2 A;  2Z0A A;  3E83 A;  4P30 A;  3JAL B;  4Q20 A;  5B1A B;  2YID A;  2ZR2 A;  1R6K A;  4UCV A;  2BSK B;  4I4T A;  5H2F Z;  4ICG A;  5JVD A;  1O9G A;  1IVS A;  1ZX3 A;  2QGN A;  2QKS A;  3SYO A;  2JEX A;  5BMV A;  3CCL V;  1NTK H;  2YXH A;  4YIO A;  5L3E A;  3FFQ A;  4GKJ O;  4DV7 B;  2JS3 A;  4LFB O;  3ETQ A;  1S5L Z;  4LF9 O;  4GLX A;  1KBH A;  2HG5 C;  4H0L B;  3ZRX A;  5KMG B;  4GYC B;  1AR4 A;  4FZ1 A;  5CN0 A;  2WLI A;  4HZ3 A;  2ZIN A;  1YSC A;  3LSQ A;  1OJH A;  4KHP O;  2E5L B;  5CA3 A;  3OEH G;  4CC5 A;  3WB0 A;  2HR3 A;  5IDJ A;  4GKJ B;  3KZI Z;  1S77 D;  1VQN V;  1GN2 A;  1SES A;  2H94 A;  4X64 B;  3TK1 A;  3SPJ A;  4X1Y B;  2P6J A;  3RYI A;  3JAK A;  4R50 A;  3ABK C;  2FL4 A;  1BE3 H;  4JI1 O;  2YI8 A;  4PA4 A;  2YUA A;  2QM7 A;  4IYH A;  4MT8 A;  2P06 A;  1VQ4 V;  4YJ3 A;  4KHP B;  2R70 A;  3KCY A;  4X65 B;  3A0B Z;  5EBL C;  2EZP A;  2GSM B;  4JTA B;  5LP6 C;  4UV8 A;  3WG7 C;  5CBG A;  2DMX A;  3JYC A;  1BT8 A;  1FS0 G;  4JI6 O;  4PI0 A;  3IGA C;  4Z2W A;  3T1Y O;  1IXM A;  1VQO V;  3N2G A;  3ABT A;  4DO2 A;  1Z2G A;  4JI1 B;  2F4V O;  3K03 A;  4X1I A;  1SRY A;  4F6R A;  3TET A;  5EBM C;  2EJR A;  1TVK B;  1IDS A;  3S3X A;  4RUE A;  1MZE A;  2VQF O;  4JI6 B;  4NTW A;  3T1Y B;  1SA0 B;  3ZRW B;  1QLE C;  5C8Y A;  1Z5W A;  1M1K W;  2YIA A;  4P9P A;  2ETN A;  1ARO P;  2P5O A;  4BIZ A;  4YHH O;  3L70 H;  1K5S A;  3H1L H;  2UUA O;  3LDE A;  1WAZ A;  4KP4 A;  1YEW A;  5KHG A;  2OWO A;  1R1B A;  4WCE V;  1M57 C;  1B3Q A;  1MG1 A;  4JYA B;  3OAA G;  1VQK V;  2RJZ A;  1ZL8 B;  5KUM A;  4Z1V A;  3M7M X;  1LUV A;  2DQ3 A;  2Q7H A;  1S76 D;  3RW0 A;  3GVM A;  4X66 O;  2EIM C;  2UUA B;  3N2K B;  4B08 A;  3CPW U;  1XMQ B;  2F95 B;  2OT5 A;  4JF3 A;  1FAF A;  5HFM A;  3BPZ A;  2UXC O;  1DGS A;  1N33 O;  3AG4 C;  4DR6 O;  2LW7 A;  5J2T A;  3P30 A;  4PHZ A;  2K1E A;  3K57 A;  2YXL A;  1VAR A;  2VS0 A;  5J2U A;  3FYE B;  4UFZ A;  4FM2 A;  1VQ5 V;  3NXS A;  1NH2 D;  2IH1 C;  2UUB B;  2F1M A;  3OT7 A;  4GCZ A;  1FFX A;  2OCC B;  2A9H A;  3ICX A;  3KKY A;  5LOV A;  4LNU A;  1RPO A;  4X66 B;  4I9Q A;  1JA8 A;  2UXD O;  4QPJ A;  4FM1 A;  4HNA A;  2UXC B;  1M9N A;  3JAW A;  4D7T A;  1GM7 A;  1N33 B;  3CCU V;  2B5U A;  3CWB H;  3MD0 A;  3TGU H;  3THO A;  4RWU A;  5EYP B;  3RYH A;  1AP6 A;  3CCQ V;  4NKG B;  3BEH A;  3UO3 A;  2QWO B;  4LH6 A;  3ZCC A;  5D5P A;  1AP5 A;  2WLH A;  4O4J B;  3JD3 A;  1DTO A;  3CJH A;  1V54 B;  5CBF A;  2BTO A;  4MSW C;  4QJF B;  4PA6 A;  1S0V A;  2QM8 A;  4GKK O;  4D7S A;  4RO2 A;  4LF8 O;  2Y69 C;  1YJW V;  3X2Q B;  5B1O A;  3U10 A;  4FJC C;  4X9Q A;  1DK1 A;  4WFF A;  4X20 B;  4PA9 A;  1SC5 B;  1H8H G;  4B3M O;  4UCO A;  1BZK A;  4X1K B;  3G6E V;  4WFB V;  4JYB A;  3CX5 F;  5H6Q A;  3U11 A;  4X8A A;  5B1N A;  4LC1 A;  1OCC B;  4JV5 B;  4GKK B;  5DM6 V;  2AZ0 A;  1K33 A;  3K58 A;  1KKC A;  1SQP H;  4LF7 O;  5C93 A;  1J5E O;  1WB8 A;  2CE4 A;  4GX1 A;  5H9C A;  4DV3 O;  2ZDI A;  2HJF C;  2NN4 A;  1S3J A;  2A06 H;  1XHZ A;  4K3A A;  1YCI A;  1ZWI C;  2FML A;  4CH6 A;  5CB4 B;  4JI8 O;  1SS3 A;  3H1I H;  3FX7 A;  5IYZ B;  5KX5 A;  3UKM A;  2PI4 A;  1OZ0 A;  1IZ3 A;  2RMK B;  2PYJ A;  4J42 A;  1G6U A;  4MW8 A;  2CDY A;  2GHY A;  1GKF A;  3QNE A;  4LF7 B;  4LFC O;  1J5E B;  2YXY A;  4N21 A;  3H1H H;  2CTP A;  5FLX N;  1WP8 A;  4DV3 B;  4QNH B;  2QM4 A;  2B1I A;  2P67 A;  4DR1 O;  3L72 H;  1RSO B;  4JI8 B;  2HHH B;  2EJ7 A;  3CD6 V;  2RN9 A;  3BA8 A;  3E22 A;  1S5J A;  3G80 A;  2ZXW B;  4IHJ B;  2JGD A;  2WLN A;  4F4L A;  4ZOL B;  5H5N A;  2QR4 A;  4DR1 B;  2L35 A;  3CRA A;  5JCO C;  3ABL B;  1M56 B;  2R9A A;  1PL4 A;  1SQV H;  3SPH A;  3FB5 C;  4UCT A;  3L74 H;  1G8M A;  1M93 A;  2FTK A;  5LHG A;  5CA0 A;  1P7B A;  1GN3 A;  1GMG A;  1Q6H A;  1UJW B;  3STZ C;  4DRX A;  2CH7 B;  3OGC C;  4LF4 O;  2WLM A;  1I5Y A;  5BXZ A;  1A32 A;  1VF6 A;  3AK2 A;  1Y74 B;  1GO3 F;  4DXW A;  4JI5 O;  5L3B A;  2IJJ A;  5KHK A;  1Q43 A;  3TXS A;  1JFF A;  2BOB C;  3W7W A;  3ZMZ A;  1IBM O;  1GN4 A;  3BA9 A;  4TQD A;  5JJJ B;  1YZB A;  1ZTE A;  4DR7 O;  3QF7 A;  1K92 A;  4LF4 B;  1K73 W;  4O4I A;  4NTX A;  2Q7G A;  2JVD A;  1AVM A;  1EZJ A;  1NQT A;  3HB3 B;  4JI5 B;  1L8D A;  2OCH A;  2PUS A;  3ZN1 A;  4TSF G;  5B3S C;  3LSS A;  3QO8 A;  1N0J A;  1Q5O A;  1FXK A;  2VWK A;  1WPX A;  3AEI A;  3FYI B;  1IBM B;  3HKE B;  4DR5 O;  3CYO A;  4JI3 O;  4QGP A;  3X2Q C;  3C3T A;  3DC6 A;  3FB6 C;  2JK5 C;  5IY5 B;  4NXN O;  5DEC A;  2E74 B;  1PPJ H;  1XBL A;  1GM9 A;  3A2F A;  1LR1 A;  4FLU A;  1F4N A;  2P22 C;  4U3J A;  1ZAU A;  3AG2 C;  2ZE5 A;  3RN4 A;  4DR5 B;  4RQE A;  4JI3 B;  1EBO A;  4H33 A;  4CC6 A;  1ROP A;  3ABU A;  5LP6 B;  1IBK O;  3WG7 B;  1DF4 A;  4OPH A;  2IJK A;  4UVC A;  1VQ8 V;  2XAH A;  4H44 B;  1SET A;  2VQE O;  3D36 A;  1PP9 H;  3APO A;  2QKC A;  3FAV A;  1WA8 B;  5L3F A;  1TGO A;  1W59 A;  4NTY A;  3ZX6 A;  4DV4 B;  5GON A;  3LDC A;  1KKD A;  4YY3 O;  3HKB B;  1RFY A;  3RYF B;  2AZ2 A;  1IBK B;  1HDJ A;  4RAI A;  3H9V A;  1SQB H;  1CXZ B;  3HKC B;  5JH7 B;  2VQE B;  1QLE B;  1OHH G;  2Y48 A;  4ZHQ B;  4O4H A;  3UQ8 A;  2ZXW C;  2XND G;  3ZHS A;  1QVF U;  3STL C;  4O2A A;  4YY3 B;  1AIL A;  1KEC A;  4JI7 O;  1XL6 A;  1NZ6 A;  1OCZ B;  1V55 B;  2F43 G;  4R8C A;  5GTI Z;  1M57 B;  1J95 A;  1PKX A;  3JAS A;  1Q82 W;  2ADP A;  3ABL C;  3U0Z A;  2QWR B;  1WB7 A;  2ADQ B;  4I55 A;  3TXQ A;  4DV1 B;  3OMN B;  5A2Q N;  2A7W A;  3DTU B;  1NR1 A;  1H2K A;  2CGN A;  4WBN A;  2DE0 X;  4IIJ B;  5EK0 A;  3L9D A;  4D6T H;  1W2B U;  3K5M A;  5BR8 O;  4LF6 O;  2GTS A;  5FNV A;  1IUR A;  4QIW F;  3LSU A;  3A8T A;  2JIZ G;  4O4L A;  1EZV H;  2HVJ C;  4UUJ C;  1QU7 A;  2KG7 A;  3DXR A;  3H1J H;  4J80 A;  3GWK C;  2YEV A;  5IJ0 A;  3C90 A;  4PA3 A;  1N36 O;  1V9P A;  1OV9 A;  3CP1 A;  4LF6 B;  1F7Y A;  3KCX A;  3HKD B;  4JZG A;  1FXV A;  4FLX A;  3RYC B;  1VF5 B;  4TV9 A;  1P7G A;  5EIB D;  5KA6 A;  1THZ A;  5ITZ A;  1HNZ O;  4FFB B;  3QVN A;  1NVP B;  1SF9 A;  1H38 A;  3MDS A;  5E79 Z;  5KHI A;  3OM3 B;  4LR3 A;  3ZMV A;  1MNG A;  2ZT9 B;  3CS5 A;  2LGQ A;  1VQ9 V;  3B8M A;  2WPD G;  1N36 B;  3K08 A;  1Y67 A;  3JD4 A;  1K7D A;  2XAJ A;  3JAR B;  5EBW C;  4IYI A;  3N27 A;  3K79 A;  5BZB A;  5IY5 C;  1B04 A;  3OR6 C;  4XBF A;  2EIN C;  4LFB B;  5L3C A;  2A0L A;  1HNZ B;  4LF9 B;  2Y69 B;  2OIG A;  1Y6X A;  4ZI7 A;  1NKD A;  5KHJ A;  4NVP A;  1TAE A;  1JR9 A;  1D5A A;  2ZD9 A;  5LXT A;  4R7C A;  3BRC A;  2DWE C;  2KSD A;  2GUZ B;  3FKS G;  2CGO A;  1SZT A;  1TUB A;  3ZN0 A;  2Q5Z A;  4NYK A;  4H13 B;  2E75 B;  1G4Y B;  2WA4 A;  4MW3 A;  4MVQ A;  1L0N H;  4KFM A;  4YXW G;  1E1Q G;  4DV6 O;  3WB2 A;  4HAM A;  2X7R B;  3AK3 A;  3SPG A;  1K9M W;  4EB6 B;  3UM7 A;  4W4K A;  3ZMT A;  1BHA A;  4GX2 A;  4J11 A;  4WFE A;  4I5S A;  4JAA A;  4YJ2 A;  2F4V B;  3JD1 A;  3VQV A;  4DV6 B;  2Q69 A;  1ZSP A;  3P3P A;  3TCU A;  1JVM A;  1FYJ A;  4UV9 A;  4FLW A;  2R9I A;  5LHI A;  2DYR C;  1OCZ C;  1V55 C;  2DOS A;  4PD4 F;  2BTQ B;  1EM1 A;  4MVM A;  2VQF B;  2BE3 A;  3BAB A;  4TWK A;  5CMU A;  1XI1 A;  1H2M A;  3Q4H A;  3VOU A;  2MK3 A;  3QO7 A;  4LWS A;  1AI5 A;  4EFB A;  4YHH B;  3D3Q A;  2YDE A;  1YJN V;  1BGY H;  2DJV A;  4MS2 A;  1Z5V A;  3B2E E;  4TV8 A;  2AGA A;  3C3S A;  4I50 B;  1JJO A;  2W0X A;  5KHH A;  1GK9 A;  3SJQ C;  3SYQ A;  3G4S V;  3CXH F;  4DV2 O;  4CS2 A;  3BCC H;  2HJD A;  3UT5 B;  2PTM A;  3CCJ V;  1R3K C;  4FVM A;  4FZ0 A;  1KUQ A;  3E89 A;  3L73 H;  3AG1 C;  3B09 A;  3AG3 C;  3JSN A;  5F2V O;  1GAX A;  2V7Q G;  3JSL A;  1WLE A;  1D5N A;  2EIJ B;  1XRE A;  3OE7 G;  4ABM A;  2RNB A;  4DYL A;  3ML0 A;  3ZHR A;  2IJI A;  4O2B B;  4B3T O;  1QVG U;  4I0X A;  4DW0 A;  2A79 B;  2Q9L A;  1KYO F;  3ZHT A;  4JTD B;  4DR6 B;  4DV2 B;  1Q7Y W;  4RUF A;  4PDM A;  4K0K O;  3T4D A;  4J10 A;  2V4D A;  3JAT B;  2QWN B;  3IC9 A;  2UXB O;  3VQY A;  5HFL A;  3CCE V;  1YIJ V;  1NTZ H;  5LA6 A;  1XOU A;  4OX9 O;  3PN1 A;  1NBM G;  2UXD B;  4PDV A;  2VWJ A;  2BOC C;  2WAM A;  1D2D A;  4B3T B;  5JQG B;  5B3S B;  1KP2 A;  5LYJ B;  2ZCE A;  3E8B A;  1XQ8 A;  3B8N A;  1YHQ V;  5CA1 B;  3CRR A;  3P32 A;  4K0K B;  3OMA B;  1R6T A;  3PJS K;  1Q86 W;  4U3F H;  2LGW A;  3QG5 A;  2ZDI C;  4Z1M G;  2UXB B;  1FD9 A;  2Y0I A;  3CHX A;  3ZHQ A;  3JAL A;  3F5W C;  4MVU A;  4MVO A;  2BSK A;  4OX9 B;  4XDJ A;  4DW1 A; 
#chains in the Genus database with same CATH homology
 2A3Q A;  3CRC A;  1YVW A;  2Q9L A;  2P06 A;  5IE9 A;  2Q4P A;  2GTA A;  3CRA A;  2YXH A;  2Q73 A;  4QGP A;  2A7W A;  2OIG A;  1Y6X A;  3C90 A;  1VMG A;  1YXB A;  2OIE A;  2Q5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...