2Q73A

Crystal structure of imazg from vibrio dat 722: ctag-imazg (p41212)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
MKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEKTHELKEVLNKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hypothetical protein
publication title A putative house-cleaning enzyme encoded within an integron array: 1.8 A crystal structure defines a new MazG subtype.
pubmed doi rcsb
source organism Vibrio sp. dat722
total genus 35
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.19: Transferred entry: 3.6.1.9.
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q73A00
2P06A 1VMGA 2A3QA 4QGPA 5IE9A 3CRAA 2OIGA 2Q73A 3C90A 2OIEA 2A7WA 1YVWA 2YXHA 2Q5ZA 1YXBA 1Y6XA 2GTAA 3CRCA 2Q4PA 2Q9LA
chains in the Genus database with same CATH superfamily
4NKGB 4DUZO 5IWAO 3HKEA 3KCYA 2HJFC 2A3QA 3SPJA 1JQ0A 1RSOB 1GRJA 3RT3C 1PNMA 2QA4V 2QM7A 3UQ8A 1FPOA 4UVBA 1QNMA 2WSSG 4PA6A 4PJ0Z 4TSFG 3RWRD 4NXMO 5LMNB 1SQGA 2EIMC 2E74B 4LF7B 1BHAA 2E76B 3J7AU 2PYLA 4X1IB 4DR5B 2WLLA 1JX9A 1YI2V 3HR0A 4DR2B 1NZ6A 3H01A 3OW2U 2PI5A 1T5EA 2N05A 2YIBD 2H8PC 2P7TC 4I50A 1Q7YW 4U7NA 2P22C 1XL6A 3OTOB 1XI1A 3ZRWB 4EEQA 2DQ3A 2DJVA 5LA6B 2VQFB 1N0NA 1ZLZA 2CTWA 1EZJA 5IY5C 2GHYA 4QJFB 1JCHA 1OV9A 5KX5B 2QWRB 3QNEA 1FYJA 4BW9A 2X6AA 1SRYA 2Q67A 2G38A 3RGBA 3JASA 3H1JH 3KZIZ 3OMAB 4D6TH 5KA5A 3UKMA 3NXSA 1PD3A 3HKCA 3JAWB 4CH5A 3WB0A 4UXNA 5F2VO 1FKAO 3MDSA 2BE3A 5IYZB 1Q6UA 5J2UB 3ZMUA 1Q3EA 3OR6C 4TV8A 1H2MA 3X2QC 5LP6A 4DUYO 4X62O 1K97A 1MZFA 1P7BA 3BABA 2JK5C 4O4JB 3ZMTA 2AHYA 4GLXA 4Z1MG 3CC4V 3JD1A 1BT8A 2YDEA 4FFKA 1TVKB 4UUJC 2EINB 4EFEA 4PA3A 2UUCB 3L9DA 4WFHA 4DV7B 1VQLV 2FB5A 2UUAO 1FXKB 1YJWV 2ITDC 4W4LA 4UCUA 2Y4UA 1VMGA 1KP2A 2UU9O 2IU3A 5IJ0A 1WA8A 4RWUA 4DV5B 3E83A 4HBNA 3U10A 4X65O 1EN4A 1HR0O 2ZNJA 2IJJA 1B04A 2NLJC 1W0JG 4JTAB 1YXBA 5JCOC 2CTRA 1GMGA 4DV2B 2ZE6A 1EM1A 1TUEB 3Q4HA 4Q6GA 2ZT9B 4YIOA 2PI4A 4WF9V 5EIBD 2IJIA 1H2GA 2YICA 4B3TB 2N74A 5K1XA 4QE9A 2JIZG 3A0BZ 2YI8A 3CSXA 1N0JA 2Y4TA 3QVNA 3QG5A 4GKJO 4CS2A 2JGUA 4TUYB 1LR1A 2EJRA 4Z1VA 1N34O 4JV5B 1N33B 1IBKB 2BTOA 3BA8A 4YJ2A 1PL4A 3A0HZ 1IZ3A 1KB9F 3CE2A 3C90A 1VQ6V 2P67A 4YHHB 2Y48A 4JI1B 1N4CA 1G6UA 4DV4B 2DOSA 1S72V 4PHZA 5D5QA 4EB6B 1FJGB 1YITV 1CP9A 2R72A 5DECA 1IXMA 2Q9LA 1XOUA 1V54C 4ZI7B 4DV6B 1NR7A 3D8CA 2XAHA 1QLEC 3TXSA 4PDLA 1FFXA 4X1KB 5BR8B 4CC5A 4MT8A 2WA4A 3QO5A 5LMNO 3ZHVA 5JVDA 1SQXH 4LF7O 1V55B 3TJTA 2QEXV 2WWWA 3ZRSA 2RMKB 5KMGA 3JARB 4DR5O 3M8AA 4P9PA 4NTWA 3IFXA 1YJ9V 4DK0A 1QQCA 3AK1A 3JSNA 1YVWA 1OJHA 5JCOA 3T4ZA 1OCZB 5L3EA 1EN5A 2VQFO 4W4KA 4U3JA 4TOIA 1NR1A 2R9RB 2ZIOA 4X66B 1VQ7V 2PY5A 3SYOA 1JFFA 4I0XB 4BW5A 1YDXA 2BCCH 3GB7C 3K3WA 1EFRG 2V1DA 2HG5C 2RQ6A 1Y4MA 3C3SA 2ZKOA 4NR1A 1QR9A 1VP7A 3OM3B 5GONB 3ZHUA 4MTOA 2GDSA 4JYBA 5JWPA 4UCRA 2IM9A 4JI2B 4K8XA 3EHBB 5EYPB 2Y0IA 4ZOLA 4YIPA 2Y69B 3B77A 1M57C 5BMVB 1M93A 3KG2A 3JD0A 4TQFA 5FNVA 5B1OA 2ZD9A 2LFRA 1SA0A 4PDRA 1THZA 3STLC 5BXZA 3LNNA 3WU2Z 3BAAA 4MTGA 2EILC 5KHIA 4LNUB 2UUCO 1CEZA 1IBMB 4DV7O 3ABUA 5LXTB 4O2AA 4CS3A 5B1AC 2F4VB 4OX9B 4WBNA 1E1RG 1YIJV 2X6CA 4JI3B 5L3FA 2L35A 5JJNB 5B3SC 1YZBA 5CA1B 4DV0B 1R1BA 4X20B 3I55V 3EFFK 1HW7A 4DV2O 3K58A 4AQYB 1BMFG 4H44B 3U0ZA 3T4DA 1H8HG 4H37A 2QTOA 2LO1A 4O2BA 4FK5C 2XTAA 3ZMZA 2DN9A 4B3TO 3AG3C 2JS3A 2LP7A 3E35A 2JVDA 2N04A 1FD9A 3ETDA 4JI4B 1PL0A 3J81N 1K8AW 2ZM6B 2NN4A 3SYCA 4AI8A 4BIOA 3LSUA 3F7VC 1US6A 2ZXWB 4JV5O 3B09A 3DC5A 1IBKO 3SDLA 1Y76B 1RPOA 2WLKA 5B1BB 3ETGA 5KHKA 4FPPA 1RP3B 3CRCA 4GKKB 2KQXA 1KU9A 4JI1O 3FB5C 2ARHA 3JAKA 4DV4O 4H0LB 4LF6B 1F51A 4XDJA 3QO7A 3W7TA 1FJGO 2UXDB 3IC7A 2X0LA 3BY6A 3SYAA 3DXRB 5CBHA 3N27A 3K59A 1J5EB 5LBQA 1LUWA 4J11A 2YEVA 2MW2B 1Q6IA 2F66C 2P06A 2GUZA 4L87A 1QCEA 4XDKA 5CB4B 5BR8O 2BTQA 1B3QA 4KXRA 4OGQB 3P3NA 3IAYA 2K9PA 1S0VA 4FMTA 4FJCC 4I4TB 4P9OA 1I94B 3RYIB 1GO3F 3SYPA 4B3MB 4DXWA 3K5OA 1BL8A 1SKVA 3K9AA 1ZAUA 4ZHQB 4GX1A 3WB1A 2AGAA 4LP8A 2JGDB 4IL6Z 1M4UA 3OD4A 2OIGA 4O4HA 3N2GA 4OPAA 5A9GA 3RYHA 3AG7A 4X66O 2P90A 1NTKH 3BPZA 3OTFA 1PKXA 2FTKA 3OGIB 3P32A 2IJKA 2OT5A 3ZHSA 3HKDB 3TXQA 5IYDO 1GN6A 2UUAB 4TV9B 5ITZB 1U97A 4JZGA 1KP3A 1BQZA 3N2KA 2YXHA 1GN4A 4P30A 1QR8A 2QWQB 4XDLA 4LBEC 1UJWB 2UXXA 1NTZH 1RM1B 3RYCA 1N8RW 1P4RA 5LOVA 1L1FA 2YSUB 2CTQA 3UCSC 2R70A 3CCVV 4JI6B 3CCQV 4PA7A 3CS5A 1MG1A 3ZMVA 2E75B 2PGGA 4LH6A 3G4SV 1WLEA 4X88A 3CCRV 1VQ4V 2WAMA 4LH7A 2ZCEA 4X89A 5B1NA 1IBMO 5H2FZ 5H6RA 4X1YB 5B66Z 2DE0X 2IBZH 4FM1A 4GKJB 1ROPA 2F4VO 1S5HC 1G8MA 4OX9O 2AW9A 2RNBA 2OIEA 3JSLA 2F95B 1EBOA 4CBCA 1NI8A 1PM9A 1DF4A 4C7UA 3RFRA 4MVOA 2OWOA 1K5QA 1M90W 4MVRA 1RSOA 4JI3O 1JR9A 4JYCA 1S5LZ 4DV0O 2BOBC 3O65A 5JH7B 5LMUB 1VF5B 3AG1B 3OUFA 3UT5A 3ABKB 1M1KW 2EINC 2XAQA 4B7KA 1S3JA 3STZC 4AQYO 3FB8C 4JI5B 3LNMB 2E3CA 2HP8A 4UVAA 1FXKC 2P4VA 4X1IA 4UFZA 1YHQV 4JI4O 4QPKA 2ZM6O 4JI7B 2DMXA 3APQA 4A5UB 2WLJA 4FFBB 2EBOA 1K4DC 2EX3A 1VQ5V 3D3IA 3ZRWA 3B8MA 2WPDG 2QDOA 4GKKO 3HPLC 1KECA 2OTJV 3EVKA 2FYUH 1XMOB 5KX5A 1MNGA 4LF6O 2DYSB 4OPHA 4ASUG 4AILC 3OUSA 4LF8B 2UXCB 1YJNV 2UXDO 2WLHA 5KA6A 2CK3G 2QTSA 3GWOA 3HB3B 1MOFA 2YXYA 1XILA 1J5EO 3JAWA 4KHPO 1I7FA 4E2LA 3CWBH 4IIJA 3MAQA 2A06H 3CC2V 3U11A 2Q7GA 5IYZA 1COWG 5J2UA 2L6LA 1UFIA 4PA4A 1ZUQA 4CZZA 2D2CB 4UB6Z 3VBBA 1AI7A 1SQVH 4J80A 3SPCA 1JJOA 1I94O 1XNQB 3NR7A 4ZBMA 1TA8A 4B3MO 1I08A 4O4JA 3AG2B 4I50B 2XASA 2ZIMA 1IBLO 1ZL8B 1JJ2U 2IJHA 1SF9A 5LHIA 1TVKA 1GM8A 3SJAC 1SQFA 4JYAB 1J95A 1FXKA 1QBZA 1V55C 1JVMA 4B08A 3OMIB 1K33A 1K92A 3ZIAG 5DN6G 1DF5A 5KHGA 5LHHA 1F4NA 1KD1W 4J9YB 4UV8A 1Q6HA 5AG2A 2R9AA 3GVMA 4ICGA 4JI0B 4UCSA 2QM8A 3K06A 4LFAB 4ZIBA 3T1HB 1GTOA 4DV1B 2VWJA 1Q5OA 1OCZC 5C93A 4L8JA 4KUMA 2BSKB 1SZXA 3T1CA 5BZBA 3CCEV 1Y74B 1Y6XA 1F4MA 4JI6O 3RVYA 1O9GA 1AJQA 3O9OA 4I55B 2ZDIC 3ZCCA 2ZE8A 4MVUA 2FL4A 4LCUC 1N32B 4LF9B 4UCVA 2CAZC 1XNRB 2MK3A 2Y69C 4GZRB 4UCTA 4QPJA 4GYCB 2LFSA 1QVFU 4JGSA 3ZHQA 4U7OA 3B40A 4IYHA 3RVZA 4ZI7A 1AP5A 5LMUO 4X1KA 1GM9A 1HP8A 1GH6A 2W0FC 1WPBA 2ILMA 1M9NA 4JI5O 1ORQC 2PZSA 1URFA 2H94A 1BGYH 3ASOB 1BQ0A 5IE9A 2XHBA 5KLVH 3JARA 5GTHZ 3AEIA 1KQSU 5IYCO 4Q20A 2YIBA 4CH3A 5FPOA 3ZS8C 5JQGB 4FLVA 2Q5ZA 4JI7O 1XUQA 4YJ2B 2EIJB 2QE7G 1NT2B 2F23A 4BIUA 3A0RA 5EIBC 4R50A 2LQTA 4YJ3B 4MS2A 1VQMV 4QGPA 2CH7A 1K34A 3JALB 1M5IA 2HLDG 4X8AA 1BCCH 1XMOO 3FAVA 4I0XA 3I56V 4LF8O 2EIKB 2UXCO 3ABLB 3LSSA 4N23A 2CDYA 4YXWG 3AG4B 2LW7A 1FFXB 4WFEA 4D7SA 4ZKIA 3BHPA 2DQ0A 2OCCB 5GONA 3TCUA 1CXZB 3HKBB 1TUBB 2ZXWC 2ZDIA 2XT9A 2P5OA 2EJ7A 1P7GA 3FYIB 1XDCA 5B1BC 5EYPA 4BIZA 2A9HA 4FZ1A 1W2BU 3L70H 5B5EZ 3CRQA 3RBZA 2XAGA 2IH3C 2WLNA 5BMVA 3L72H 1XNQO 3CRMA 5J2TA 4YY3O 1D5NA 4Z2WA 1GM7A 4JYYA 1WAZA 1BE3H 4I5SA 3UO3A 3ZMSA 1P84F 1R73A 1XHXA 4X9QA 1U96A 3CMAV 4JYAO 1HNZB 4LNUA 3LSQA 4MVQA 5KHHA 2Z3YA 1JFFB 4MVZA 5LXTA 1NS1A 1NTMH 3AK3A 3B4SA 3ZRXA 2K1EA 3CCJV 4QNHB 4PD4F 3ETQA 1UPGA 3BRCA 4KFMA 2KG7A 4JI0O 1AR5A 1IURA 1ENVA 5CA1A 1VF7A 1VQKV 5KAIZ 5TISZ 4X20A 4LFAO 2FKXA 2HHHO 1PNLA 4B7EA 1GAXA 2KB1A 2IH1C 3T1HO 1L8DA 4J7JA 3CJHB 4EKWA 4DV1O 3ML0A 4H33A 4UVCA 4WFFA 3M7MX 1WP7A 3FX7A 3J80N 2JS5A 4DYLA 5EK0A 4O4IB 1KKCA 3WG7B 1HNXB 1B06A 1AR1B 3P3PA 1S76D 2H3OA 4O4LB 1H8EG 1VIBA 1D5AA 4DR6B 3PJSK 3VOUA 1YTFD 1X4TA 1BZKA 2AXTZ 4IYIA 1Y76A 4F6RB 5LGUA 1R3JC 2BOCC 1XL4A 1N32O 4LF9O 3JD2A 1RM1C 1SQQH 1XNRO 3R65A 1Q8IA 1W0KG 1K3EA 1Z2GA 3CPWU 1O9HA 1VQPV 1AI4A 1WP8A 1R3IC 1SZTA 3FB6C 3JYCA 2GTAA 3DXRA 2JRIA 5IJ9B 2EZPA 3DSQA 1Z5VA 4NXNB 2C2AA 5EZYB 3FD9A 1PP9H 2VS0A 1F7YA 3MHSC 1VARA 3ZJZA 1DLBA 4O2BB 5CB4A 3G6EV 2XOKG 3K03A 1PNKA 4LFCB 3OGCC 1H2NA 1Y66A 1B6QA 4I4TA 4UB8Z 3RYIA 4KHPB 2D3OW 2Q4PA 3WFVA 5JJJB 1WNSA 3TK1A 3K04A 3D3QA 3CRAA 4ZHQA 1NU1H 2YXLA 3SGIA 4G27B 1H38A 3L71H 3AG1C 5H5NA 1VQ8V 1WN7A 3ABKC 2ETNA 3PN1A 2ODMA 3JATB 4J9ZB 3K5MA 3M99B 1OCRB 4DV3O 1M56B 1IBLB 3E8BA 2IU0A 3JCUZ 4K35A 4LF5B 3CP1A 2WLIB 2QSAA 4BWAA 2DWEC 3OAAG 1BSMA 2QR4A 1XMQB 1VF6C 3HKDA 4RAIA 2V4DA 2JDIG 5BY1A 1MABG 1OHHG 4TV9A 5ITZA 4PI0A 5C8YB 3FKSG 3TGUH 5HFLA 3ZHTA 4KP4A 2PTMA 1TAEA 4DR4B 4I9WA 2V7QG 1JPXA 1I5YA 4LWSB 3E86A 3RYFB 5CA3A 1AROP 2Q69A 5LYJB 2DYSC 2CGOA 1D2DA 2P6JA 1OCCB 3F7YC 4DRXB 4K0KB 2HEPA 4HNAB 3G80A 3K79A 1SQPH 4J42A 1W59A 1A32A 1HNZO 2YIDA 4FZ0A 2P4KA 4JF3A 1FFTB 4X1YA 3K5NA 5DM6V 3SJBC 2Q68A 3E22B 3R66A 3LDDA 3CCSV 2X7RB 1DK1A 4U3FH 3JD3A 1NH2D 2KKWA 3OE7G 3P30A 5GTIZ 3AG2C 1IDSA 1IX9A 5CA0B 4LF4B 1VQ9V 4R7CA 1WJZA 3CB2A 3OEEG 5JH7A 4I7ZB 1KUQA 4JZ2A 3K08A 1LNQA 4J7ZA 3ASNB 2ADPA 3QTCA 3SJQC 4MW3A 3ZN0A 1PV0A 2QKAA 3ICXA 4D7TA 1G1XB 4BR6A 3W7SA 1HNXO 1SQBH 2HR3A 1VF6A 2YI9A 4N21A 1YTFB 4DR6O 4MVMA 5HFMA 4DR1B 2WLMA 2RN9A 2ZE5A 1P49A 4CC6A 1DGSA 1XHZA 1YEWA 3UO2A 2XAJA 4FFBA 5A2QN 2HVKC 1HDJA 5LHGA 3CYOA 4IHJB 1FXHA 2NR5A 3K57A 2UUBB 1Q90D 1NJIW 2X6BA 2OCHA 3KKYA 4UV9A 4FLZA 2CE4A 5IYBO 4X64B 5LA6A 3UT5B 4JPRA 2HFEC 1IXBA 3HKEB 3CEIA 2VQEB 4NXNO 4CS4A 5EBMC 1H2LA 3ZX6A 4LFCO 2DYRB 2Q73A 2DWDC 1MMMA 3FB7C 2B9ZA 3DGEA 4E4EA 4NVPA 2AZ0A 2DW4A 3CCUV 3THOA 2Z5UA 4LFBO 4MW8A 5L3GA 3ZRVA 1R6NA 4NYKA 4WCEV 4PI2A 1HNWB 3OEHG 5DEDA 1ZL8A 4NTYA 2WLLB 3L74H 1TGOA 5H9CA 4WFAV 2IW5A 2PF4E 1K9MW 1SC5B 4DR3B 4YY3B 2QWPB 3H9VA 3BA9A 2A7WA 5EBWC 3VQWA 3ABTA 3ASOC 5CMUA 2HJDA 4RUEA 1Q43A 1MA1A 5E79Z 4LF5O 1OCOB 2Q7HA 1XMQO 1S5JA 1K7DA 1WB8A 1L0LH 4IIJB 2QKCA 1Q86W 2EIJC 4LR3A 1EZVH 2HKOA 3D36C 3ABMB 1HWYA 4P2ZA 1R6TA 4DR4O 4FLYA 3JASB 1SERA 3RN4A 3HKCB 4GCZA 4J7KA 2BSKA 4FLTA 3G71V 3LDCA 4DO2A 4J41A 4HYOA 1H2SB 2Y0PA 3ZEDA 2PYJA 3GWKC 5EBLC 1Y74A 5KUMA 4TV8B 2HHHB 4XBFA 2EIKC 5LP6B 3ABLC 2QM4A 1QU7A 3AG4C 5EC2C 4TT3G 4K0KO 3T2MA 2OCCC 1SESA 4I55A 1FAFA 1XEQA 2Q0AA 3H1IH 4DR7B 3VQYA 2RCVA 2B1GA 4DW0A 2FMLA 3JCZA 2YIAA 3QO8A 1AP6A 1Q81W 1AB3A 1NH2B 1K73W 3JD4A 4TUYA 1GKFA 2F1MA 1JA8A 1MSWD 1RFYA 2EIMB 2QKSA 4MVSA 5CN0A 4LC1A 3T1YB 4LF4O 4B3SB 5IJ0B 1WA8B 1E79G 1XREA 4TWKA 3G67A 3S3XA 1XQ8A 1I5XA 4EB6A 5CBFA 4RQFA 3IC9A 1KKDA 4GUNA 5KAFZ 1ZTEA 3K0DA 3Q4HB 2AHZA 4CH4A 2XNDG 1JOYA 2YS8A 3CRRA 3OMNB 4GX2A 5IDJA 5IY5B 5JQGA 4DR1O 2ZR2A 3OFNG 1SETA 1NVPD 1GN2A 1ZWIC 2JEXA 2XUMA 1QLNA 4MTFA 3D36A 3ETEA 5K1PA 2GBOA 1EN6A 4YJ3A 1VQOV 2OTLV 2QJ1A 1AJPA 2LGWA 3JALA 4JAUA 2UUBO 1NQTA 4RUFA 1FS0G 3APOA 3WG7C 3X2QB 5LL6Y 5J9PC 3E8HA 1BHBA 4X64O 2JJ1G 2Z0AA 4RO2A 2ADQB 4DV3B 2CGNA 2VQEO 4I9QA 3BEHA 1TUBA 3HKBA 5FL7G 3B8NA 1R3LC 4JI8B 4EFBA 3K9SA 3CCMV 3E89A 3DC6A 2ATKC 4DR2O 2E5LB 4MSWC 1BS3A 3W7UA 3A8TA 5JVDB 3S3WA 3K5LA 2LGQA 4HZ3A 5LGNA 5KMGB 1HNWO 4JTDB 3MHHC 2Q0OC 3OTOO 3BCCH 2CH7B 4NB5A 3L73H 2Q7EA 4DR3O 3I5DA 1N36B 2AZ2A 1KBHA 1V9PA 4AHCA 3FAVB 3CHXA 1JMKC 3JAMN 3SPHA 3EXAA 4JTCB 3KCXA 5IT9N 1R6KA 1I0HA 4K8ZA 4U3JB 2YC0A 1AI6A 4IGGA 3E8FA 3SJCC 4WFBV 1XBLA 4B3RB 1QHTA 1NKDA 1MZEA 1K4CC 4GX0A 3SYQA 2F43G 3CJHA 3QF7A 3K0GA 4FM0A 5J2TB 1OCRC 4WFGA 2UXBB 2LJ2A 1M56C 3SPIA 5JJEB 4PDMA 1F23A 4O4IA 3G6BA 1K5SA 4ZOLB 4O4LA 2GTSA 3W7XA 2NNUA 3FYEB 4OXSA 2VWKA 2O57A 1S77D 4PV1B 5FNVB 3E8GA 2Q6AA 1SA0B 1X59A 2ZE7A 4DR7O 4F6RA 1V54B 1ZX3A 2B1IA 1QLEB 3CC7V 1WPXA 4DV5O 2JJ2G 4QIWF 1DTOA 2KG7B 2QGNA 4O2AB 1IVSA 4NTXA 1Z5WA 3T1YO 4UCOA 3H1HH 1OCCC 2ITCC 4B3SO 4WBNB 4DUZB 5IWAB 5IJ9A 1OZ0A 2UXNA 3WB2A 5EZYA 2GV9A 5E1AC 3CXCU 2LW1A 1PPJH 5GW7A 4GT1A 5L3BA 1H2KA 2ZINA 4F6EA 3CCLV 4G2KA 4NXMB 1GN3A 4FLXA 3CXHF 1NVPB 5KHJA 3ZBHA 1N33O 2CUGA 4JAAA 5L3DA 3VQXA 1QVGU 2YUAA 2B5UA 4JASA 1SS3A 4YHHO 2ZQMA 4DK1A 3OR7C 3ASNC 3JATA 3OT7A 4LFBB 3AK2A 3E2EA 2RJZA 2Q8VA 1YF2A 2JGDA 2W0XA 4F4LA 4PELA 2WLIA 3C3TA 2F93B 2QWOB 2ZR3A 5CBGA 4DV6O 2ZNIA 1Y67A 2M7WA 1M57B 3JAKB 1VQNV 4HAMA 3ZHRA 2EULA 1AJNA 5C8YA 4JAVA 3F5TA 3B2EE 5KUKA 3H1KH 3RW0A 4JI8O 2XAFA 3SPGA 4LWSA 3IJ4A 3LDEA 3RYFA 2YEVB 1KC8W 2EILB 1R3KC 2JEUA 4GX5A 1G4YB 4QE7A 2GUZB 4IT5A 2E5LO 5LYJA 4FLUA 2A0LA 2BTQB 2HVJC 3CD6V 5B1AB 4DUYB 1NBMG 3UM7A 3LUTB 4X62B 2CTPA 4PA9A 1CPYA 4H13B 4DRXA 2W6JG 4HNAA 3VQVA 3F5WC 4G28B 3A2FA 1AILA 5EC1C 4TQDA 5B3SB 3BVOA 4BAYA 1N36O 1ZSPA 4DW1A 1YCIA 4FLWA 2DYRC 4R8CA 3ZN1A 2OYQA 3E22A 1AVMA 4MTXA 4O4HB 3N2GB 2KSDA 2R9IA 3MD0A 3RYHB 3DTUB 5CA0A 2UU9B 4B3RO 3AG3B 5LGTA 1AI5A 3SR2C 5FLXN 2W6IG 4JI2O 1VEWA 2GSMB 5FPRA 4X65B 1HR0B 3CX5F 3BFRA 2PUSA 4FVMA 1AR4A 2M6YA 2UXBO 3N2KB 1MSDA 4J10A 1GK9A 2A79B 3IGAC 2VRZA 3H1LH 1LUVA 1YSCA 3RYCB 1OCOC 5LOVB 1E1QG 4FM2A 5L3CA 2WA3A 1Q82W 4PDVA 1FXVA 1KMIZ 3FFQA 3TETA 3L75H 3ABMC 2QWNB 1KYOF 4R6ZA 4FIPC 4IHJA 2EZOA 5D5PA 1N34B 4ABMA 3CMEV 4CH6A 4KL1A 2RDCA 4K3AA 1RPRA 4RQEA 1L0NH 5H6QA 5LP6C 3W7WA 1WB7A
chains in the Genus database with same CATH topology
2P06A 1VMGA 2A3QA 4QGPA 5IE9A 3CRAA 2OIGA 2Q73A 3C90A 2OIEA 2A7WA 1YVWA 2YXHA 2Q5ZA 1YXBA 1Y6XA 2GTAA 3CRCA 2Q4PA 2Q9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P06 A;  1VMG A;  2A3Q A;  4QGP A;  5IE9 A;  3CRA A;  2OIG A;  2Q73 A;  3C90 A;  2OIE A;  2A7W A;  1YVW A;  2YXH A;  2Q5Z A;  1YXB A;  1Y6X A;  2GTA A;  3CRC A;  2Q4P A;  2Q9L A; 
#chains in the Genus database with same CATH topology
 4NKG B;  4DUZ O;  5IWA O;  3HKE A;  3KCY A;  2HJF C;  2A3Q A;  3SPJ A;  1JQ0 A;  1RSO B;  1GRJ A;  3RT3 C;  1PNM A;  2QA4 V;  2QM7 A;  3UQ8 A;  1FPO A;  4UVB A;  1QNM A;  2WSS G;  4PA6 A;  4PJ0 Z;  4TSF G;  3RWR D;  4NXM O;  5LMN B;  1SQG A;  2EIM C;  2E74 B;  4LF7 B;  1BHA A;  2E76 B;  3J7A U;  2PYL A;  4X1I B;  4DR5 B;  2WLL A;  1JX9 A;  1YI2 V;  3HR0 A;  4DR2 B;  1NZ6 A;  3H01 A;  3OW2 U;  2PI5 A;  1T5E A;  2N05 A;  2YIB D;  2H8P C;  2P7T C;  4I50 A;  1Q7Y W;  4U7N A;  2P22 C;  1XL6 A;  3OTO B;  1XI1 A;  3ZRW B;  4EEQ A;  2DQ3 A;  2DJV A;  5LA6 B;  2VQF B;  1N0N A;  1ZLZ A;  2CTW A;  1EZJ A;  5IY5 C;  2GHY A;  4QJF B;  1JCH A;  1OV9 A;  5KX5 B;  2QWR B;  3QNE A;  1FYJ A;  4BW9 A;  2X6A A;  1SRY A;  2Q67 A;  2G38 A;  3RGB A;  3JAS A;  3H1J H;  3KZI Z;  3OMA B;  4D6T H;  5KA5 A;  3UKM A;  3NXS A;  1PD3 A;  3HKC A;  3JAW B;  4CH5 A;  3WB0 A;  4UXN A;  5F2V O;  1FKA O;  3MDS A;  2BE3 A;  5IYZ B;  1Q6U A;  5J2U B;  3ZMU A;  1Q3E A;  3OR6 C;  4TV8 A;  1H2M A;  3X2Q C;  5LP6 A;  4DUY O;  4X62 O;  1K97 A;  1MZF A;  1P7B A;  3BAB A;  2JK5 C;  4O4J B;  3ZMT A;  2AHY A;  4GLX A;  4Z1M G;  3CC4 V;  3JD1 A;  1BT8 A;  2YDE A;  4FFK A;  1TVK B;  4UUJ C;  2EIN B;  4EFE A;  4PA3 A;  2UUC B;  3L9D A;  4WFH A;  4DV7 B;  1VQL V;  2FB5 A;  2UUA O;  1FXK B;  1YJW V;  2ITD C;  4W4L A;  4UCU A;  2Y4U A;  1VMG A;  1KP2 A;  2UU9 O;  2IU3 A;  5IJ0 A;  1WA8 A;  4RWU A;  4DV5 B;  3E83 A;  4HBN A;  3U10 A;  4X65 O;  1EN4 A;  1HR0 O;  2ZNJ A;  2IJJ A;  1B04 A;  2NLJ C;  1W0J G;  4JTA B;  1YXB A;  5JCO C;  2CTR A;  1GMG A;  4DV2 B;  2ZE6 A;  1EM1 A;  1TUE B;  3Q4H A;  4Q6G A;  2ZT9 B;  4YIO A;  2PI4 A;  4WF9 V;  5EIB D;  2IJI A;  1H2G A;  2YIC A;  4B3T B;  2N74 A;  5K1X A;  4QE9 A;  2JIZ G;  3A0B Z;  2YI8 A;  3CSX A;  1N0J A;  2Y4T A;  3QVN A;  3QG5 A;  4GKJ O;  4CS2 A;  2JGU A;  4TUY B;  1LR1 A;  2EJR A;  4Z1V A;  1N34 O;  4JV5 B;  1N33 B;  1IBK B;  2BTO A;  3BA8 A;  4YJ2 A;  1PL4 A;  3A0H Z;  1IZ3 A;  1KB9 F;  3CE2 A;  3C90 A;  1VQ6 V;  2P67 A;  4YHH B;  2Y48 A;  4JI1 B;  1N4C A;  1G6U A;  4DV4 B;  2DOS A;  1S72 V;  4PHZ A;  5D5Q A;  4EB6 B;  1FJG B;  1YIT V;  1CP9 A;  2R72 A;  5DEC A;  1IXM A;  2Q9L A;  1XOU A;  1V54 C;  4ZI7 B;  4DV6 B;  1NR7 A;  3D8C A;  2XAH A;  1QLE C;  3TXS A;  4PDL A;  1FFX A;  4X1K B;  5BR8 B;  4CC5 A;  4MT8 A;  2WA4 A;  3QO5 A;  5LMN O;  3ZHV A;  5JVD A;  1SQX H;  4LF7 O;  1V55 B;  3TJT A;  2QEX V;  2WWW A;  3ZRS A;  2RMK B;  5KMG A;  3JAR B;  4DR5 O;  3M8A A;  4P9P A;  4NTW A;  3IFX A;  1YJ9 V;  4DK0 A;  1QQC A;  3AK1 A;  3JSN A;  1YVW A;  1OJH A;  5JCO A;  3T4Z A;  1OCZ B;  5L3E A;  1EN5 A;  2VQF O;  4W4K A;  4U3J A;  4TOI A;  1NR1 A;  2R9R B;  2ZIO A;  4X66 B;  1VQ7 V;  2PY5 A;  3SYO A;  1JFF A;  4I0X B;  4BW5 A;  1YDX A;  2BCC H;  3GB7 C;  3K3W A;  1EFR G;  2V1D A;  2HG5 C;  2RQ6 A;  1Y4M A;  3C3S A;  2ZKO A;  4NR1 A;  1QR9 A;  1VP7 A;  3OM3 B;  5GON B;  3ZHU A;  4MTO A;  2GDS A;  4JYB A;  5JWP A;  4UCR A;  2IM9 A;  4JI2 B;  4K8X A;  3EHB B;  5EYP B;  2Y0I A;  4ZOL A;  4YIP A;  2Y69 B;  3B77 A;  1M57 C;  5BMV B;  1M93 A;  3KG2 A;  3JD0 A;  4TQF A;  5FNV A;  5B1O A;  2ZD9 A;  2LFR A;  1SA0 A;  4PDR A;  1THZ A;  3STL C;  5BXZ A;  3LNN A;  3WU2 Z;  3BAA A;  4MTG A;  2EIL C;  5KHI A;  4LNU B;  2UUC O;  1CEZ A;  1IBM B;  4DV7 O;  3ABU A;  5LXT B;  4O2A A;  4CS3 A;  5B1A C;  2F4V B;  4OX9 B;  4WBN A;  1E1R G;  1YIJ V;  2X6C A;  4JI3 B;  5L3F A;  2L35 A;  5JJN B;  5B3S C;  1YZB A;  5CA1 B;  4DV0 B;  1R1B A;  4X20 B;  3I55 V;  3EFF K;  1HW7 A;  4DV2 O;  3K58 A;  4AQY B;  1BMF G;  4H44 B;  3U0Z A;  3T4D A;  1H8H G;  4H37 A;  2QTO A;  2LO1 A;  4O2B A;  4FK5 C;  2XTA A;  3ZMZ A;  2DN9 A;  4B3T O;  3AG3 C;  2JS3 A;  2LP7 A;  3E35 A;  2JVD A;  2N04 A;  1FD9 A;  3ETD A;  4JI4 B;  1PL0 A;  3J81 N;  1K8A W;  2ZM6 B;  2NN4 A;  3SYC A;  4AI8 A;  4BIO A;  3LSU A;  3F7V C;  1US6 A;  2ZXW B;  4JV5 O;  3B09 A;  3DC5 A;  1IBK O;  3SDL A;  1Y76 B;  1RPO A;  2WLK A;  5B1B B;  3ETG A;  5KHK A;  4FPP A;  1RP3 B;  3CRC A;  4GKK B;  2KQX A;  1KU9 A;  4JI1 O;  3FB5 C;  2ARH A;  3JAK A;  4DV4 O;  4H0L B;  4LF6 B;  1F51 A;  4XDJ A;  3QO7 A;  3W7T A;  1FJG O;  2UXD B;  3IC7 A;  2X0L A;  3BY6 A;  3SYA A;  3DXR B;  5CBH A;  3N27 A;  3K59 A;  1J5E B;  5LBQ A;  1LUW A;  4J11 A;  2YEV A;  2MW2 B;  1Q6I A;  2F66 C;  2P06 A;  2GUZ A;  4L87 A;  1QCE A;  4XDK A;  5CB4 B;  5BR8 O;  2BTQ A;  1B3Q A;  4KXR A;  4OGQ B;  3P3N A;  3IAY A;  2K9P A;  1S0V A;  4FMT A;  4FJC C;  4I4T B;  4P9O A;  1I94 B;  3RYI B;  1GO3 F;  3SYP A;  4B3M B;  4DXW A;  3K5O A;  1BL8 A;  1SKV A;  3K9A A;  1ZAU A;  4ZHQ B;  4GX1 A;  3WB1 A;  2AGA A;  4LP8 A;  2JGD B;  4IL6 Z;  1M4U A;  3OD4 A;  2OIG A;  4O4H A;  3N2G A;  4OPA A;  5A9G A;  3RYH A;  3AG7 A;  4X66 O;  2P90 A;  1NTK H;  3BPZ A;  3OTF A;  1PKX A;  2FTK A;  3OGI B;  3P32 A;  2IJK A;  2OT5 A;  3ZHS A;  3HKD B;  3TXQ A;  5IYD O;  1GN6 A;  2UUA B;  4TV9 B;  5ITZ B;  1U97 A;  4JZG A;  1KP3 A;  1BQZ A;  3N2K A;  2YXH A;  1GN4 A;  4P30 A;  1QR8 A;  2QWQ B;  4XDL A;  4LBE C;  1UJW B;  2UXX A;  1NTZ H;  1RM1 B;  3RYC A;  1N8R W;  1P4R A;  5LOV A;  1L1F A;  2YSU B;  2CTQ A;  3UCS C;  2R70 A;  3CCV V;  4JI6 B;  3CCQ V;  4PA7 A;  3CS5 A;  1MG1 A;  3ZMV A;  2E75 B;  2PGG A;  4LH6 A;  3G4S V;  1WLE A;  4X88 A;  3CCR V;  1VQ4 V;  2WAM A;  4LH7 A;  2ZCE A;  4X89 A;  5B1N A;  1IBM O;  5H2F Z;  5H6R A;  4X1Y B;  5B66 Z;  2DE0 X;  2IBZ H;  4FM1 A;  4GKJ B;  1ROP A;  2F4V O;  1S5H C;  1G8M A;  4OX9 O;  2AW9 A;  2RNB A;  2OIE A;  3JSL A;  2F95 B;  1EBO A;  4CBC A;  1NI8 A;  1PM9 A;  1DF4 A;  4C7U A;  3RFR A;  4MVO A;  2OWO A;  1K5Q A;  1M90 W;  4MVR A;  1RSO A;  4JI3 O;  1JR9 A;  4JYC A;  1S5L Z;  4DV0 O;  2BOB C;  3O65 A;  5JH7 B;  5LMU B;  1VF5 B;  3AG1 B;  3OUF A;  3UT5 A;  3ABK B;  1M1K W;  2EIN C;  2XAQ A;  4B7K A;  1S3J A;  3STZ C;  4AQY O;  3FB8 C;  4JI5 B;  3LNM B;  2E3C A;  2HP8 A;  4UVA A;  1FXK C;  2P4V A;  4X1I A;  4UFZ A;  1YHQ V;  4JI4 O;  4QPK A;  2ZM6 O;  4JI7 B;  2DMX A;  3APQ A;  4A5U B;  2WLJ A;  4FFB B;  2EBO A;  1K4D C;  2EX3 A;  1VQ5 V;  3D3I A;  3ZRW A;  3B8M A;  2WPD G;  2QDO A;  4GKK O;  3HPL C;  1KEC A;  2OTJ V;  3EVK A;  2FYU H;  1XMO B;  5KX5 A;  1MNG A;  4LF6 O;  2DYS B;  4OPH A;  4ASU G;  4AIL C;  3OUS A;  4LF8 B;  2UXC B;  1YJN V;  2UXD O;  2WLH A;  5KA6 A;  2CK3 G;  2QTS A;  3GWO A;  3HB3 B;  1MOF A;  2YXY A;  1XIL A;  1J5E O;  3JAW A;  4KHP O;  1I7F A;  4E2L A;  3CWB H;  4IIJ A;  3MAQ A;  2A06 H;  3CC2 V;  3U11 A;  2Q7G A;  5IYZ A;  1COW G;  5J2U A;  2L6L A;  1UFI A;  4PA4 A;  1ZUQ A;  4CZZ A;  2D2C B;  4UB6 Z;  3VBB A;  1AI7 A;  1SQV H;  4J80 A;  3SPC A;  1JJO A;  1I94 O;  1XNQ B;  3NR7 A;  4ZBM A;  1TA8 A;  4B3M O;  1I08 A;  4O4J A;  3AG2 B;  4I50 B;  2XAS A;  2ZIM A;  1IBL O;  1ZL8 B;  1JJ2 U;  2IJH A;  1SF9 A;  5LHI A;  1TVK A;  1GM8 A;  3SJA C;  1SQF A;  4JYA B;  1J95 A;  1FXK A;  1QBZ A;  1V55 C;  1JVM A;  4B08 A;  3OMI B;  1K33 A;  1K92 A;  3ZIA G;  5DN6 G;  1DF5 A;  5KHG A;  5LHH A;  1F4N A;  1KD1 W;  4J9Y B;  4UV8 A;  1Q6H A;  5AG2 A;  2R9A A;  3GVM A;  4ICG A;  4JI0 B;  4UCS A;  2QM8 A;  3K06 A;  4LFA B;  4ZIB A;  3T1H B;  1GTO A;  4DV1 B;  2VWJ A;  1Q5O A;  1OCZ C;  5C93 A;  4L8J A;  4KUM A;  2BSK B;  1SZX A;  3T1C A;  5BZB A;  3CCE V;  1Y74 B;  1Y6X A;  1F4M A;  4JI6 O;  3RVY A;  1O9G A;  1AJQ A;  3O9O A;  4I55 B;  2ZDI C;  3ZCC A;  2ZE8 A;  4MVU A;  2FL4 A;  4LCU C;  1N32 B;  4LF9 B;  4UCV A;  2CAZ C;  1XNR B;  2MK3 A;  2Y69 C;  4GZR B;  4UCT A;  4QPJ A;  4GYC B;  2LFS A;  1QVF U;  4JGS A;  3ZHQ A;  4U7O A;  3B40 A;  4IYH A;  3RVZ A;  4ZI7 A;  1AP5 A;  5LMU O;  4X1K A;  1GM9 A;  1HP8 A;  1GH6 A;  2W0F C;  1WPB A;  2ILM A;  1M9N A;  4JI5 O;  1ORQ C;  2PZS A;  1URF A;  2H94 A;  1BGY H;  3ASO B;  1BQ0 A;  5IE9 A;  2XHB A;  5KLV H;  3JAR A;  5GTH Z;  3AEI A;  1KQS U;  5IYC O;  4Q20 A;  2YIB A;  4CH3 A;  5FPO A;  3ZS8 C;  5JQG B;  4FLV A;  2Q5Z A;  4JI7 O;  1XUQ A;  4YJ2 B;  2EIJ B;  2QE7 G;  1NT2 B;  2F23 A;  4BIU A;  3A0R A;  5EIB C;  4R50 A;  2LQT A;  4YJ3 B;  4MS2 A;  1VQM V;  4QGP A;  2CH7 A;  1K34 A;  3JAL B;  1M5I A;  2HLD G;  4X8A A;  1BCC H;  1XMO O;  3FAV A;  4I0X A;  3I56 V;  4LF8 O;  2EIK B;  2UXC O;  3ABL B;  3LSS A;  4N23 A;  2CDY A;  4YXW G;  3AG4 B;  2LW7 A;  1FFX B;  4WFE A;  4D7S A;  4ZKI A;  3BHP A;  2DQ0 A;  2OCC B;  5GON A;  3TCU A;  1CXZ B;  3HKB B;  1TUB B;  2ZXW C;  2ZDI A;  2XT9 A;  2P5O A;  2EJ7 A;  1P7G A;  3FYI B;  1XDC A;  5B1B C;  5EYP A;  4BIZ A;  2A9H A;  4FZ1 A;  1W2B U;  3L70 H;  5B5E Z;  3CRQ A;  3RBZ A;  2XAG A;  2IH3 C;  2WLN A;  5BMV A;  3L72 H;  1XNQ O;  3CRM A;  5J2T A;  4YY3 O;  1D5N A;  4Z2W A;  1GM7 A;  4JYY A;  1WAZ A;  1BE3 H;  4I5S A;  3UO3 A;  3ZMS A;  1P84 F;  1R73 A;  1XHX A;  4X9Q A;  1U96 A;  3CMA V;  4JYA O;  1HNZ B;  4LNU A;  3LSQ A;  4MVQ A;  5KHH A;  2Z3Y A;  1JFF B;  4MVZ A;  5LXT A;  1NS1 A;  1NTM H;  3AK3 A;  3B4S A;  3ZRX A;  2K1E A;  3CCJ V;  4QNH B;  4PD4 F;  3ETQ A;  1UPG A;  3BRC A;  4KFM A;  2KG7 A;  4JI0 O;  1AR5 A;  1IUR A;  1ENV A;  5CA1 A;  1VF7 A;  1VQK V;  5KAI Z;  5TIS Z;  4X20 A;  4LFA O;  2FKX A;  2HHH O;  1PNL A;  4B7E A;  1GAX A;  2KB1 A;  2IH1 C;  3T1H O;  1L8D A;  4J7J A;  3CJH B;  4EKW A;  4DV1 O;  3ML0 A;  4H33 A;  4UVC A;  4WFF A;  3M7M X;  1WP7 A;  3FX7 A;  3J80 N;  2JS5 A;  4DYL A;  5EK0 A;  4O4I B;  1KKC A;  3WG7 B;  1HNX B;  1B06 A;  1AR1 B;  3P3P A;  1S76 D;  2H3O A;  4O4L B;  1H8E G;  1VIB A;  1D5A A;  4DR6 B;  3PJS K;  3VOU A;  1YTF D;  1X4T A;  1BZK A;  2AXT Z;  4IYI A;  1Y76 A;  4F6R B;  5LGU A;  1R3J C;  2BOC C;  1XL4 A;  1N32 O;  4LF9 O;  3JD2 A;  1RM1 C;  1SQQ H;  1XNR O;  3R65 A;  1Q8I A;  1W0K G;  1K3E A;  1Z2G A;  3CPW U;  1O9H A;  1VQP V;  1AI4 A;  1WP8 A;  1R3I C;  1SZT A;  3FB6 C;  3JYC A;  2GTA A;  3DXR A;  2JRI A;  5IJ9 B;  2EZP A;  3DSQ A;  1Z5V A;  4NXN B;  2C2A A;  5EZY B;  3FD9 A;  1PP9 H;  2VS0 A;  1F7Y A;  3MHS C;  1VAR A;  3ZJZ A;  1DLB A;  4O2B B;  5CB4 A;  3G6E V;  2XOK G;  3K03 A;  1PNK A;  4LFC B;  3OGC C;  1H2N A;  1Y66 A;  1B6Q A;  4I4T A;  4UB8 Z;  3RYI A;  4KHP B;  2D3O W;  2Q4P A;  3WFV A;  5JJJ B;  1WNS A;  3TK1 A;  3K04 A;  3D3Q A;  3CRA A;  4ZHQ A;  1NU1 H;  2YXL A;  3SGI A;  4G27 B;  1H38 A;  3L71 H;  3AG1 C;  5H5N A;  1VQ8 V;  1WN7 A;  3ABK C;  2ETN A;  3PN1 A;  2ODM A;  3JAT B;  4J9Z B;  3K5M A;  3M99 B;  1OCR B;  4DV3 O;  1M56 B;  1IBL B;  3E8B A;  2IU0 A;  3JCU Z;  4K35 A;  4LF5 B;  3CP1 A;  2WLI B;  2QSA A;  4BWA A;  2DWE C;  3OAA G;  1BSM A;  2QR4 A;  1XMQ B;  1VF6 C;  3HKD A;  4RAI A;  2V4D A;  2JDI G;  5BY1 A;  1MAB G;  1OHH G;  4TV9 A;  5ITZ A;  4PI0 A;  5C8Y B;  3FKS G;  3TGU H;  5HFL A;  3ZHT A;  4KP4 A;  2PTM A;  1TAE A;  4DR4 B;  4I9W A;  2V7Q G;  1JPX A;  1I5Y A;  4LWS B;  3E86 A;  3RYF B;  5CA3 A;  1ARO P;  2Q69 A;  5LYJ B;  2DYS C;  2CGO A;  1D2D A;  2P6J A;  1OCC B;  3F7Y C;  4DRX B;  4K0K B;  2HEP A;  4HNA B;  3G80 A;  3K79 A;  1SQP H;  4J42 A;  1W59 A;  1A32 A;  1HNZ O;  2YID A;  4FZ0 A;  2P4K A;  4JF3 A;  1FFT B;  4X1Y A;  3K5N A;  5DM6 V;  3SJB C;  2Q68 A;  3E22 B;  3R66 A;  3LDD A;  3CCS V;  2X7R B;  1DK1 A;  4U3F H;  3JD3 A;  1NH2 D;  2KKW A;  3OE7 G;  3P30 A;  5GTI Z;  3AG2 C;  1IDS A;  1IX9 A;  5CA0 B;  4LF4 B;  1VQ9 V;  4R7C A;  1WJZ A;  3CB2 A;  3OEE G;  5JH7 A;  4I7Z B;  1KUQ A;  4JZ2 A;  3K08 A;  1LNQ A;  4J7Z A;  3ASN B;  2ADP A;  3QTC A;  3SJQ C;  4MW3 A;  3ZN0 A;  1PV0 A;  2QKA A;  3ICX A;  4D7T A;  1G1X B;  4BR6 A;  3W7S A;  1HNX O;  1SQB H;  2HR3 A;  1VF6 A;  2YI9 A;  4N21 A;  1YTF B;  4DR6 O;  4MVM A;  5HFM A;  4DR1 B;  2WLM A;  2RN9 A;  2ZE5 A;  1P49 A;  4CC6 A;  1DGS A;  1XHZ A;  1YEW A;  3UO2 A;  2XAJ A;  4FFB A;  5A2Q N;  2HVK C;  1HDJ A;  5LHG A;  3CYO A;  4IHJ B;  1FXH A;  2NR5 A;  3K57 A;  2UUB B;  1Q90 D;  1NJI W;  2X6B A;  2OCH A;  3KKY A;  4UV9 A;  4FLZ A;  2CE4 A;  5IYB O;  4X64 B;  5LA6 A;  3UT5 B;  4JPR A;  2HFE C;  1IXB A;  3HKE B;  3CEI A;  2VQE B;  4NXN O;  4CS4 A;  5EBM C;  1H2L A;  3ZX6 A;  4LFC O;  2DYR B;  2Q73 A;  2DWD C;  1MMM A;  3FB7 C;  2B9Z A;  3DGE A;  4E4E A;  4NVP A;  2AZ0 A;  2DW4 A;  3CCU V;  3THO A;  2Z5U A;  4LFB O;  4MW8 A;  5L3G A;  3ZRV A;  1R6N A;  4NYK A;  4WCE V;  4PI2 A;  1HNW B;  3OEH G;  5DED A;  1ZL8 A;  4NTY A;  2WLL B;  3L74 H;  1TGO A;  5H9C A;  4WFA V;  2IW5 A;  2PF4 E;  1K9M W;  1SC5 B;  4DR3 B;  4YY3 B;  2QWP B;  3H9V A;  3BA9 A;  2A7W A;  5EBW C;  3VQW A;  3ABT A;  3ASO C;  5CMU A;  2HJD A;  4RUE A;  1Q43 A;  1MA1 A;  5E79 Z;  4LF5 O;  1OCO B;  2Q7H A;  1XMQ O;  1S5J A;  1K7D A;  1WB8 A;  1L0L H;  4IIJ B;  2QKC A;  1Q86 W;  2EIJ C;  4LR3 A;  1EZV H;  2HKO A;  3D36 C;  3ABM B;  1HWY A;  4P2Z A;  1R6T A;  4DR4 O;  4FLY A;  3JAS B;  1SER A;  3RN4 A;  3HKC B;  4GCZ A;  4J7K A;  2BSK A;  4FLT A;  3G71 V;  3LDC A;  4DO2 A;  4J41 A;  4HYO A;  1H2S B;  2Y0P A;  3ZED A;  2PYJ A;  3GWK C;  5EBL C;  1Y74 A;  5KUM A;  4TV8 B;  2HHH B;  4XBF A;  2EIK C;  5LP6 B;  3ABL C;  2QM4 A;  1QU7 A;  3AG4 C;  5EC2 C;  4TT3 G;  4K0K O;  3T2M A;  2OCC C;  1SES A;  4I55 A;  1FAF A;  1XEQ A;  2Q0A A;  3H1I H;  4DR7 B;  3VQY A;  2RCV A;  2B1G A;  4DW0 A;  2FML A;  3JCZ A;  2YIA A;  3QO8 A;  1AP6 A;  1Q81 W;  1AB3 A;  1NH2 B;  1K73 W;  3JD4 A;  4TUY A;  1GKF A;  2F1M A;  1JA8 A;  1MSW D;  1RFY A;  2EIM B;  2QKS A;  4MVS A;  5CN0 A;  4LC1 A;  3T1Y B;  4LF4 O;  4B3S B;  5IJ0 B;  1WA8 B;  1E79 G;  1XRE A;  4TWK A;  3G67 A;  3S3X A;  1XQ8 A;  1I5X A;  4EB6 A;  5CBF A;  4RQF A;  3IC9 A;  1KKD A;  4GUN A;  5KAF Z;  1ZTE A;  3K0D A;  3Q4H B;  2AHZ A;  4CH4 A;  2XND G;  1JOY A;  2YS8 A;  3CRR A;  3OMN B;  4GX2 A;  5IDJ A;  5IY5 B;  5JQG A;  4DR1 O;  2ZR2 A;  3OFN G;  1SET A;  1NVP D;  1GN2 A;  1ZWI C;  2JEX A;  2XUM A;  1QLN A;  4MTF A;  3D36 A;  3ETE A;  5K1P A;  2GBO A;  1EN6 A;  4YJ3 A;  1VQO V;  2OTL V;  2QJ1 A;  1AJP A;  2LGW A;  3JAL A;  4JAU A;  2UUB O;  1NQT A;  4RUF A;  1FS0 G;  3APO A;  3WG7 C;  3X2Q B;  5LL6 Y;  5J9P C;  3E8H A;  1BHB A;  4X64 O;  2JJ1 G;  2Z0A A;  4RO2 A;  2ADQ B;  4DV3 B;  2CGN A;  2VQE O;  4I9Q A;  3BEH A;  1TUB A;  3HKB A;  5FL7 G;  3B8N A;  1R3L C;  4JI8 B;  4EFB A;  3K9S A;  3CCM V;  3E89 A;  3DC6 A;  2ATK C;  4DR2 O;  2E5L B;  4MSW C;  1BS3 A;  3W7U A;  3A8T A;  5JVD B;  3S3W A;  3K5L A;  2LGQ A;  4HZ3 A;  5LGN A;  5KMG B;  1HNW O;  4JTD B;  3MHH C;  2Q0O C;  3OTO O;  3BCC H;  2CH7 B;  4NB5 A;  3L73 H;  2Q7E A;  4DR3 O;  3I5D A;  1N36 B;  2AZ2 A;  1KBH A;  1V9P A;  4AHC A;  3FAV B;  3CHX A;  1JMK C;  3JAM N;  3SPH A;  3EXA A;  4JTC B;  3KCX A;  5IT9 N;  1R6K A;  1I0H A;  4K8Z A;  4U3J B;  2YC0 A;  1AI6 A;  4IGG A;  3E8F A;  3SJC C;  4WFB V;  1XBL A;  4B3R B;  1QHT A;  1NKD A;  1MZE A;  1K4C C;  4GX0 A;  3SYQ A;  2F43 G;  3CJH A;  3QF7 A;  3K0G A;  4FM0 A;  5J2T B;  1OCR C;  4WFG A;  2UXB B;  2LJ2 A;  1M56 C;  3SPI A;  5JJE B;  4PDM A;  1F23 A;  4O4I A;  3G6B A;  1K5S A;  4ZOL B;  4O4L A;  2GTS A;  3W7X A;  2NNU A;  3FYE B;  4OXS A;  2VWK A;  2O57 A;  1S77 D;  4PV1 B;  5FNV B;  3E8G A;  2Q6A A;  1SA0 B;  1X59 A;  2ZE7 A;  4DR7 O;  4F6R A;  1V54 B;  1ZX3 A;  2B1I A;  1QLE B;  3CC7 V;  1WPX A;  4DV5 O;  2JJ2 G;  4QIW F;  1DTO A;  2KG7 B;  2QGN A;  4O2A B;  1IVS A;  4NTX A;  1Z5W A;  3T1Y O;  4UCO A;  3H1H H;  1OCC C;  2ITC C;  4B3S O;  4WBN B;  4DUZ B;  5IWA B;  5IJ9 A;  1OZ0 A;  2UXN A;  3WB2 A;  5EZY A;  2GV9 A;  5E1A C;  3CXC U;  2LW1 A;  1PPJ H;  5GW7 A;  4GT1 A;  5L3B A;  1H2K A;  2ZIN A;  4F6E A;  3CCL V;  4G2K A;  4NXM B;  1GN3 A;  4FLX A;  3CXH F;  1NVP B;  5KHJ A;  3ZBH A;  1N33 O;  2CUG A;  4JAA A;  5L3D A;  3VQX A;  1QVG U;  2YUA A;  2B5U A;  4JAS A;  1SS3 A;  4YHH O;  2ZQM A;  4DK1 A;  3OR7 C;  3ASN C;  3JAT A;  3OT7 A;  4LFB B;  3AK2 A;  3E2E A;  2RJZ A;  2Q8V A;  1YF2 A;  2JGD A;  2W0X A;  4F4L A;  4PEL A;  2WLI A;  3C3T A;  2F93 B;  2QWO B;  2ZR3 A;  5CBG A;  4DV6 O;  2ZNI A;  1Y67 A;  2M7W A;  1M57 B;  3JAK B;  1VQN V;  4HAM A;  3ZHR A;  2EUL A;  1AJN A;  5C8Y A;  4JAV A;  3F5T A;  3B2E E;  5KUK A;  3H1K H;  3RW0 A;  4JI8 O;  2XAF A;  3SPG A;  4LWS A;  3IJ4 A;  3LDE A;  3RYF A;  2YEV B;  1KC8 W;  2EIL B;  1R3K C;  2JEU A;  4GX5 A;  1G4Y B;  4QE7 A;  2GUZ B;  4IT5 A;  2E5L O;  5LYJ A;  4FLU A;  2A0L A;  2BTQ B;  2HVJ C;  3CD6 V;  5B1A B;  4DUY B;  1NBM G;  3UM7 A;  3LUT B;  4X62 B;  2CTP A;  4PA9 A;  1CPY A;  4H13 B;  4DRX A;  2W6J G;  4HNA A;  3VQV A;  3F5W C;  4G28 B;  3A2F A;  1AIL A;  5EC1 C;  4TQD A;  5B3S B;  3BVO A;  4BAY A;  1N36 O;  1ZSP A;  4DW1 A;  1YCI A;  4FLW A;  2DYR C;  4R8C A;  3ZN1 A;  2OYQ A;  3E22 A;  1AVM A;  4MTX A;  4O4H B;  3N2G B;  2KSD A;  2R9I A;  3MD0 A;  3RYH B;  3DTU B;  5CA0 A;  2UU9 B;  4B3R O;  3AG3 B;  5LGT A;  1AI5 A;  3SR2 C;  5FLX N;  2W6I G;  4JI2 O;  1VEW A;  2GSM B;  5FPR A;  4X65 B;  1HR0 B;  3CX5 F;  3BFR A;  2PUS A;  4FVM A;  1AR4 A;  2M6Y A;  2UXB O;  3N2K B;  1MSD A;  4J10 A;  1GK9 A;  2A79 B;  3IGA C;  2VRZ A;  3H1L H;  1LUV A;  1YSC A;  3RYC B;  1OCO C;  5LOV B;  1E1Q G;  4FM2 A;  5L3C A;  2WA3 A;  1Q82 W;  4PDV A;  1FXV A;  1KMI Z;  3FFQ A;  3TET A;  3L75 H;  3ABM C;  2QWN B;  1KYO F;  4R6Z A;  4FIP C;  4IHJ A;  2EZO A;  5D5P A;  1N34 B;  4ABM A;  3CME V;  4CH6 A;  4KL1 A;  2RDC A;  4K3A A;  1RPR A;  4RQE A;  1L0N H;  5H6Q A;  5LP6 C;  3W7W A;  1WB7 A; 
#chains in the Genus database with same CATH homology
 2P06 A;  1VMG A;  2A3Q A;  4QGP A;  5IE9 A;  3CRA A;  2OIG A;  2Q73 A;  3C90 A;  2OIE A;  2A7W A;  1YVW A;  2YXH A;  2Q5Z A;  1YXB A;  1Y6X A;  2GTA A;  3CRC A;  2Q4P A;  2Q9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...