2Q73A

Crystal structure of imazg from vibrio dat 722: ctag-imazg (p41212)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
MKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEKTHELKEVLNKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A putative house-cleaning enzyme encoded within an integron array: 1.8 A crystal structure defines a new MazG subtype.
pubmed doi rcsb
source organism Vibrio sp. dat722
molecule tags Hydrolase
molecule keywords Hypothetical protein
total genus 35
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.19: Transferred entry: 3.6.1.9.
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q73A00
2A3QA 4QGPA 2GTAA 1YVWA 2P06A 5IE9A 3C90A 2A7WA 2Q4PA 2Q73A 1VMGA 2YXHA 3CRAA 2Q9LA 3CRCA 2OIEA 1YXBA 1Y6XA 2OIGA 2Q5ZA
chains in the Genus database with same CATH superfamily
4DV4O 3LNMB 1GM8A 3LSQA 1BQ0A 4LFCB 1IBKO 2DYRC 2YI8A 1EN5A 5J2TB 4DK1A 5JJNB 1OCZB 5DECA 1S5LZ 4KHPB 1HR0B 1RSOB 4YIPA 4GX5A 1EZVH 2O57A 2Q9LA 4UV8A 3JD1A 3STZC 4JI3O 1NU1H 4PHZA 4WFFA 2LP7A 1P84F 2ZINA 1M1KW 3ZRXA 5IE9A 4G28B 2Q4PA 1JJ2U 1YJ9V 5IJ0A 2ZE6A 2UUBB 2WAMA 4HYOA 2YICA 2ITDC 1IDSA 4J42A 1H8HG 1VMGA 1OJHA 4JYBA 1DF4A 4FK5C 4PA7A 1SETA 1FFTB 3VQVA 1COWG 1N33O 1I0HA 5CBFA 2GHYA 1KECA 3K9AA 1WPXA 2IW5A 2YXYA 3QG5A 2BOBC 2VQFO 1AVMA 3JAKB 3ZRSA 4WBNB 1G1XB 5LYJB 4DV6O 4NXNB 3RYIA 2DQ3A 1KKCA 4B7KA 2WSSG 1F51A 1G4YB 2P4VA 3STLC 4J9YB 3S3WA 4MTOA 3JALA 1WAZA 1U96A 2IH1C 2AHZA 4X9QA 2OIGA 4NTYA 3HKCA 2PTMA 3CD6V 2VQEB 3JARB 2FYUH 3K5MA 4R7CA 4YJ2B 1XOUA 2AZ2A 1S5JA 3TXSA 3TGUH 3JARA 2NR5A 3CXHF 5CA1A 2Q5ZA 2V4DA 1K5QA 1W0JG 3RGBA 3AK1A 4TQFA 4JI2O 3TXQA 2VWJA 1AI6A 2VS0A 5IY5C 4ABMA 5LA6B 4B08A 5L3BA 4LF6O 1OCOB 2W6IG 2CTQA 3OM3B 3P32A 4AHCA 4B3SB 2Q68A 1WPBA 4LF4B 1SZTA 1KC8W 2Q0OC 3AK2A 3H1IH 3K03A 5GTHZ 2EIKC 3L73H 5KMGB 4JYYA 1Q81W 4O4HA 1R6NA 2LW7A 1JPXA 3BAAA 2R9AA 2LJ2A 1J5EB 4DR3B 4IIJA 4WFGA 2LGWA 4AILC 1CEZA 4DR7O 2R70A 4DV6B 5GONB 2KQXA 2ZM6B 1MA1A 2WLLA 1GKFA 2RMKB 3D3QA 2EJRA 4X1KB 1YVWA 4QE9A 1K8AW 1TGOA 1KB9F 5LP6C 3Q4HA 2P22C 1RFYA 3QTCA 3D36C 4DV1O 5KHJA 4NTWA 3K79A 3MAQA 3C90A 4K3AA 4NVPA 4X65B 4LFAO 1DTOA 2UUCO 4NXMB 2ARHA 2HVJC 1BMFG 2LO1A 5LHGA 4O4LA 1ZUQA 5CN0A 1M9NA 1Q8IA 1PNMA 3FYEB 3U0ZA 2H3OA 3ZMUA 2UXBB 1MNGA 1BHAA 4U7OA 3L70H 4QNHB 1QVGU 3C3TA 4O2BA 1GM7A 3MD0A 1XHZA 5K1XA 4JASA 1Q43A 3B8MA 3MHSC 3T4DA 1E1RG 2E75B 4JAUA 1GMGA 1Q7YW 4N23A 5B5EZ 3ABKB 2CK3G 4HBNA 1JA8A 4CS2A 4D7TA 1ZWIC 2NN4A 1JX9A 2B5UA 1NQTA 1IXBA 1LUVA 1GAXA 4PA9A 3CS5A 3ZIAG 4E4EA 3QF7A 3FX7A 5IDJA 4DUZB 2R72A 4TOIA 1VQPV 2WLIA 1ZX3A 2EBOA 1AR1B 1H2NA 2UXNA 4ZOLB 5L3EA 3G67A 3JSNA 3ABLC 4NXMO 4LF5O 2QWRB 1AILA 2JEXA 2A3QA 4GLXA 4YJ2A 1SQGA 4JYCA 2YDEA 2A9HA 2HFEC 3CHXA 3AG2B 3ZHSA 1V54C 3JALB 4JI5O 4I5SA 3E86A 1TUBA 1O9HA 1FFXB 2DW4A 3B09A 4MVZA 3HKCB 2Z5UA 4EFEA 3OEHG 3ASOB 1US6A 4BIZA 1NR1A 1WB8A 4JI7O 3SYAA 3K3WA 2F1MA 3ZCCA 1NTKH 1M4UA 1T5EA 5FNVA 3IFXA 5H2FZ 2DQ0A 1SKVA 5FL7G 1NTMH 4QE7A 1VEWA 4JV5O 1Z2GA 4WF9V 4UCOA 1IX9A 2DE0X 5KUMA 1DK1A 2JS5A 3G4SV 2D2CB 1NH2D 4IT5A 4QPKA 1HNXB 2PZSA 1KYOF 2CGOA 4LH6A 5IJ0B 2QM4A 1P7BA 1AR5A 4MVOA 4FFKA 5B1NA 3ASNB 4FVMA 2X6CA 1VQKV 2QM8A 2PF4E 2JGDA 4EB6A 3U11A 4FLWA 5IWAO 3ZMTA 2H94A 3CRMA 3VQWA 4IYHA 4XDKA 1N8RW 3ZJZA 1FJGO 3CJHA 5BZBA 4DV0B 1KP3A 1VQ4V 3CRRA 4Q20A 1I08A 4DW1A 3NXSA 2K1EA 1R1BA 1NKDA 1R6TA 1YI2V 5JJJB 2HJDA 4LF8B 4ZOLA 1EFRG 1JJOA 4X20A 2BE3A 3WB0A 3RYFA 3RFRA 4IL6Z 2WA4A 3EVKA 1BT8A 1FXKB 2BOCC 4MW8A 4J80A 1NTZH 2ZR2A 4I55A 1HNWO 2QTOA 3QO7A 2HJFC 4X1YB 1SRYA 1KUQA 1I5XA 2WLMA 2JJ1G 4UV9A 3CCJV 3MHHC 5LGTA 2UUCB 5LMUB 2XOKG 3E8GA 1EBOA 5KX5A 4U3JA 1NZ6A 4YY3O 3QVNA 2QWPB 1AP5A 2ZDIA 5IJ9A 1KD1W 2QWOB 1Y66A 1YTFD 5JJEB 3VOUA 2M7WA 3CC4V 1Q6HA 4QGPA 3K9SA 2HEPA 3DGEA 1OCRB 2QGNA 3KCYA 1CPYA 4FPPA 2OYQA 1BL8A 2JK5C 2P4KA 1K4CC 3BRCA 2YIBD 2XAQA 4Q6GA 2A79B 3X2QB 5JCOC 1NT2B 1PD3A 1PV0A 1FFXA 4AI8A 2AGAA 4GUNA 4DR6O 2HHHO 1FXVA 5A9GA 2YUAA 3IC9A 3JD0A 3T1YO 2JVDA 1PNLA 3B77A 3QNEA 3CCRV 1AROP 3OUFA 1ORQC 2JS3A 4RO2A 4DV4B 2MW2B 4OX9O 4A5UB 1SQXH 5EC2C 1OZ0A 4O4IB 1SA0A 1K9MW 4LC1A 1K4DC 1SQQH 4J41A 1Y6XA 4PDVA 1ENVA 2F23A 3LDDA 2EIKB 2OCCC 2ZD9A 4J7ZA 3RVZA 1VQ8V 2RN9A 5H9CA 4JZGA 3A0RA 3L75H 4JI0O 5H5NA 3RYCB 4PA4A 1QQCA 3ZRVA 2Q8VA 1V54B 4TV9B 2UUAO 4B3MO 2YSUB 3UT5B 4NR1A 1H2GA 5J2UA 5IYDO 2QR4A 2IJHA 4QIWF 5KUKA 1Z5WA 1MSDA 1GO3F 4ZI7B 4F6RA 2UXCB 1YZBA 4JPRA 4AQYB 4JAAA 1SA0B 4LF9O 2ZQMA 3IC7A 4LBEC 2HR3A 4X88A 4E2LA 1MG1A 1F23A 1AJNA 3JAWB 2PGGA 2CTRA 3HB3B 4JI1O 4LP8A 1RPRA 2YEVA 2D3OW 4LCUC 5L3GA 2CAZC 3K04A 3B4SA 3CRCA 3D36A 4YIOA 1L0NH 1GTOA 1SERA 2OT5A 2R9RB 3K5LA 2LQTA 3NR7A 4BW9A 4JV5B 1VQ7V 1F4NA 3AG3C 1L1FA 3ASNC 3ZMZA 2QKAA 3BHPA 4YHHO 2Z3YA 3A0HZ 2QWQB 1JQ0A 4JI6O 4GKJB 2A0LA 3A8TA 3OAAG 3DXRA 1PPJH 3GWKC 2UUAB 5LBQA 1NVPB 4FZ1A 1Q3EA 4DRXA 4LF8O 3DXRB 2EX3A 3AEIA 3ZMSA 2ITCC 4B3SO 3IJ4A 2CH7A 5EYPA 1VQMV 1K3EA 2W0FC 5GTIZ 3LDEA 3W7TA 2EIJB 2EZPA 4I9QA 3D3IA 4PV1B 4IHJB 1SQPH 5L3FA 1S5HC 1VF6A 4K0KB 2AW9A 3H1HH 1HNZO 5F2VO 5J2TA 3JAMN 3ML0A 5A2QN 5B1AC 3N2GA 5BY1A 4B3RB 3JAWA 3M8AA 1AI5A 3WG7C 1JFFA 2HG5C 2RNBA 1H2SB 3ASOC 2HVKC 3OD4A 1XBLA 1GK9A 3ZHUA 1D5NA 1S3JA 2Y69B 3OGIB 1IBLO 2CDYA 3JASA 2QWNB 1THZA 2UXBO 1W0KG 3M99B 4TV9A 2ILMA 5KLVH 2RQ6A 2Q67A 3SPJA 4X1IA 4EB6B 4DR1B 1XNQO 3CYOA 5JVDB 4BIUA 3I56V 4HNAB 1V9PA 5LYJA 1WJZA 4NKGB 1MSWD 2XT9A 2BSKB 1QLNA 4FLZA 1XNRB 2DOSA 2L35A 3JASB 1QLEC 3G71V 4OX9B 2DN9A 2FL4A 2QA4V 2DYSC 2F95B 2ZE8A 4P30A 1E1QG 3ZHVA 3SYPA 2VQFB 1Y67A 3FB6C 2E5LO 1JMKC 5LMUO 2QTSA 1M93A 2IU0A 4DR6B 1OCCC 4B7EA 4F4LA 3J81N 4LR3A 4JI2B 1XHXA 1VARA 1URFA 1VQNV 3I5DA 4IHJA 3WB1A 1M57B 5CB4B 2F66C 1NH2B 4IYIA 3KG2A 5BMVB 4EKWA 2XHBA 4JZ2A 1O9GA 1NS1A 2X7RB 1QR8A 1UFIA 1XREA 2LW1A 5EYPB 5H6RA 4XDLA 5JH7B 3ABMC 2VQEO 1BSMA 1RSOA 1P4RA 2QJ1A 3JD4A 2KKWA 3RWRD 1HW7A 3ZRWA 1K33A 1ROPA 3BFRA 3JD3A 3LSUA 3K5NA 4JI8O 1VP7A 1IURA 3OR7C 4MVQA 2ADPA 1OCZC 3K06A 2A06H 2JIZG 4GX2A 4JI7B 4R50A 4IIJB 4K8ZA 4U3FH 5FLXN 4DR7B 4I0XA 3N27A 5CA0B 2QEXV 1KP2A 3BCCH 5IJ9B 2VRZA 4DR1O 4UVCA 2GTAA 5KA5A 4LNUB 4HNAA 3AG4B 1SQVH 4U3JB 2E5LB 3E89A 4CZZA 4ZIBA 2GUZB 2E3CA 3JATA 4P9OA 4O2AA 4J11A 4I7ZB 2WLJA 4PDRA 4UVAA 2EIMC 1N0JA 1FYJA 2F43G 3RBZA 1UJWB 2IM9A 1G6UA 4PA3A 3E8FA 3RYFB 5DN6G 2BTOA 3L72H 4GKKO 5EC1C 4LFBB 4CH5A 4H33A 3H01A 5CA1B 4ZI7A 2EINB 4OPAA 4DYLA 3P30A 1QHTA 3B40A 2QM7A 2ZIMA 1XMQO 2N05A 4TWKA 4H13B 4YHHB 4O4LB 2DWDC 1PL0A 4ZKIA 2XAFA 5CA3A 1X59A 1AI7A 3RYCA 1FPOA 2RDCA 1B6QA 3JATB 2GUZA 3W7WA 3H9VA 4X64B 5LL6Y 2P06A 2CH7B 4W4KA 2JDIG 2P67A 4K0KO 3UM7A 3CP1A 4DRXB 4JTCB 1YJWV 4KUMA 4UUJC 4PI0A 1GN2A 3FB5C 2ATKC 4YJ3A 5KAIZ 2EILB 3F5TA 3U10A 2B1IA 1K92A 1QU7A 1N33B 5IT9N 3ETQA 4TV8B 4UCRA 3CB2A 3SPGA 4TUYB 2UXXA 5D5QA 5B3SC 5KMGA 4GKKB 2GBOA 1FS0G 2IJJA 3OEEG 3QO8A 2ZCEA 4ZBMA 5JH7A 4DV5O 2RJZA 3T1CA 3PN1A 3BVOA 3X2QC 5KAFZ 1VQ6V 2XAGA 1HP8A 2LFSA 3KKYA 1Y76B 1B04A 1P7GA 4DR4B 2ZT9B 2KB1A 4KL1A 1TUBB 2Q7EA 1Q6UA 5LP6A 3PJSK 1Z5VA 3SJQC 2BCCH 3W7UA 4PDLA 4CC6A 3J7AU 1QBZA 3HKEA 4U7NA 1QR9A 3GVMA 1XMQB 4KP4A 4XDJA 3ZMVA 4ZHQA 5E79Z 4LF6B 1SC5B 4QPJA 1OCCB 2JGUA 2QKCA 5ITZA 1MZFA 4P9PA 1Q5OA 2YXLA 3LSSA 4DR2B 3ZEDA 1NBMG 2OCCB 2ZNJA 3WG7B 1R6KA 5JWPA 4H44B 1N0NA 2FMLA 4X62O 3BEHA 3JYCA 1IBLB 3ZHQA 3RYIB 3CCQV 2ZNIA 4UB6Z 5B1OA 1N32B 2WA3A 4BW5A 3WB2A 4J9ZB 1YSCA 5LHIA 3TETA 1TA8A 3FKSG 2X0LA 4I0XB 1Y74A 5JCOA 4X64O 1SZXA 3OFNG 1R3IC 4UB8Z 3ABKC 1NR7A 3EFFK 2CTPA 3N2KB 2OCHA 4FLTA 3CC7V 4LF9B 1YJNV 5LHHA 1P49A 3K08A 4J7JA 4JI1B 1V55B 5CB4A 1HNXO 2ZDIC 2R9IA 2ZXWB 1M90W 2Z0AA 5FPRA 3BPZA 2G38A 3K0GA 4IGGA 3Q4HB 3LDCA 1LUWA 5L3CA 1G8MA 4TUYA 2UU9B 1Y4MA 4I4TB 2XNDG 3G6EV 3ZN0A 1M56C 4DW0A 1XL6A 3CRAA 4L8JA 4DUYO 4DV2B 1MMMA 3AG4C 1K7DA 1KU9A 2KSDA 4J7KA 4YJ3B 4FFBB 2YC0A 2HLDG 5FNVB 4JI3B 1L0LH 2P7TC 2EZOA 3E22A 2CTWA 2W0XA 3F5WC 4RQFA 1IBMB 4TT3G 2FB5A 3B8NA 4NB5A 2FTKA 4B3RO 1N4CA 3UQ8A 4C7UA 3UCSC 3H1JH 4X20B 2MK3A 1S76D 1K34A 1YIJV 1TVKA 5BR8O 4L87A 4PD4F 1XMOO 3HKEB 1V55C 1YF2A 1BZKA 1FXHA 5FPOA 2QKSA 2ODMA 4WCEV 5KHIA 2XASA 4PDMA 1WNSA 1I94O 2VWKA 4Z1VA 1TAEA 2WLIB 1EM1A 4ASUG 3J80N 5J2UB 3DSQA 5LP6B 5EBMC 2WWWA 4UCTA 5EIBC 2RCVA 2IBZH 1XQ8A 4FLYA 5J9PC 4MTXA 1KBHA 2FKXA 3B2EE 3T1YB 3CXCU 2EINC 4FLVA 1LR1A 1M5IA 1IBKB 2AXTZ 3A2FA 3SJCC 3SPHA 1XNQB 4FJCC 1WN7A 1U97A 3OTOO 2N74A 2ZE7A 4GT1A 4MVSA 3F7YC 2Y0PA 4X66O 4CH6A 2YI9A 3RN4A 1QVFU 2YIDA 2NNUA 3BA9A 4LF7O 1H2KA 4DV0O 1GRJA 1QNMA 3ZN1A 3DC6A 1XDCA 2F93B 4UXNA 3ZRWB 4JI0B 4DR2O 2PYJA 1VQ5V 5E1AC 1YTFB 4F6EA 1YCIA 4JI8B 3DTUB 3O9OA 1K5SA 3T4ZA 4JI4O 2XTAA 1BCCH 1NVPD 4TQDA 3UKMA 2LFRA 4MT8A 1W2BU 3RT3C 3E8HA 3ZS8C 5KA6A 2WLLB 4YXWG 1VIBA 1ZLZA 3ZHTA 1HWYA 3THOA 5C8YB 3T1HO 1FXKC 1TVKB 1XEQA 4UCVA 4X62B 3ZHRA 5BR8B 3BABA 2JEUA 1Y74B 3KCXA 3SDLA 5JQGA 2Y4UA 4FMTA 5EBLC 2CE4A 4GYCB 3EHBB 4OGQB 2OIEA 5KX5B 1MOFA 2KG7B 4QJFB 1DF5A 4O2AB 2EILC 3C3SA 1I94B 3SR2C 5LXTA 3SPIA 4LFBO 4G27B 4H37A 4JI6B 4GKJO 2UUBO 1WB7A 2XAJA 2BTQB 4DV3B 1EN6A 2ZXWC 4O2BB 3RYHA 4DV2O 2WLNA 4CH3A 4GZRB 4ZHQB 4FM2A 1KMIZ 2XAHA 4BR6A 3ABLB 3FAVA 3OMNB 1SQFA 3JCZA 5KHHA 2QDOA 2Y4TA 2ZR3A 1GN3A 5HFLA 3ZX6A 1H2LA 4PA6A 3SYCA 1AJQA 4CC5A 1K73W 5EIBD 3P3PA 3JSLA 1VQOV 4OPHA 3N2KA 3EXAA 3ETGA 4PJ0Z 4K35A 1F4MA 1EZJA 2XUMA 2WLKA 3RVYA 1VF6C 1AB3A 4DK0A 1BGYH 3HKDA 3RYHB 4RQEA 2UXCO 5B1BC 4WFAV 4O4HB 2CUGA 1AI4A 1VQLV 1R3LC 4HAMA 3VBBA 1SF9A 3ETDA 3RW0A 2PY5A 1FAFA 2L6LA 4FLUA 4DUYB 2PI5A 1R3JC 2CGNA 3W7XA 2K9PA 2YXHA 3OMAB 2ETNA 2QSAA 1DLBA 4X1IB 4PI2A 3IGAC 2P6JA 3OR6C 4LWSB 3WU2Z 5K1PA 4B3MB 3OW2U 1NJIW 3JD2A 3K58A 2ZIOA 3TCUA 4D6TH 1J5EO 3AG1B 1JOYA 1H2MA 1BE3H 2DWEC 3SJAC 4W4LA 5B66Z 1FJGB 3CCLV 3I55V 2V7QG 3S3XA 3CJHB 4CH4A 1BHBA 4DR5B 2GTSA 4X89A 2UXDO 4J10A 2X6BA 4GX1A 4I50A 1JCHA 3E35A 1R73A 2W6JG 1RM1C 2PI4A 1HR0O 4DO2A 2DMXA 5EBWC 1YEWA 5KHKA 1ZAUA 4LNUA 4JI4B 5B1AB 4XBFA 4JTDB 5IYZB 3APQA 5IYCO 1WLEA 4X8AA 3FFQA 4ICGA 1Q90D 1RP3B 4MSWC 5IYBO 2Q73A 4I4TA 5AG2A 3CCVV 1YITV 4O4IA 2B9ZA 3F7VC 1ZTEA 4KXRA 1AP6A 1D5AA 1H38A 3R65A 4WFHA 4RUEA 3GWOA 3OE7G 5H6QA 3DC5A 1GM9A 1BQZA 5BMVA 5GW7A 4JI5B 2JRIA 5IY5B 4K8XA 2YEVB 3CMAV 4UVBA 2DYRB 1SS3A 1IVSA 1PKXA 2Q7HA 4UCUA 1ZL8A 3SYOA 4NTXA 1VQ9V 2PUSA 3E8BA 1I5YA 2UXDB 1YHQV 5LMNB 2PYLA 3HKBB 2DYSB 1M56B 3QO5A 3JCUZ 4LH7A 4F6RB 2Q7GA 2F4VO 3UT5A 3CCMV 2HKOA 1B06A 2A7WA 3CC2V 3AK3A 4D7SA 3CCSV 3M7MX 4JYAB 5CMUA 1VF7A 4P2ZA 2ZM6O 3FYIB 2BSKA 2YIBA 2HHHB 3L74H 4DV3O 2M6YA 3SJBC 3FB7C 4R6ZA 3SPCA 3ABUA 1FKAO 1IBMO 4EFBA 4MVRA 2KG7A 3OTFA 4Z1MG 5LA6A 5TISZ 2AHYA 4NXNO 1FXKA 3CWBH 4JF3A 4JTAB 3E2EA 3K0DA 5JQGB 1A32A 2GSMB 4GCZA 1SQBH 4MTGA 2OWOA 4DR3O 1S72V 1YXBA 2B1GA 3W7SA 3ICXA 4DV7B 3SGIA 1B3QA 1XNRO 2Y0IA 3HKBA 5BXZA 1XMOB 2H8PC 4Z2WA 1M57C 3R66A 2Q69A 3N2GB 3BY6A 1F7YA 4CS3A 1ZL8B 3O65A 2E74B 4AQYO 2QE7G 3BA8A 4KFMA 4LFCO 1RPOA 5C93A 5EZYA 1CP9A 2IJKA 3ABTA 2EIJC 1PL4A 2NLJC 2JGDB 3FB8C 3OT7A 1XILA 5EK0A 4JYAO 5LOVA 3CEIA 4CS4A 5B1BB 4WBNA 1N34B 4LFAB 2HP8A 5L3DA 3A0BZ 3ETEA 3AG3B 3G6BA 3TJTA 5GONA 2X6AA 2YIAA 4FM1A 1IXMA 2C2AA 3UO2A 2OTJV 3LNNA 4DR4O 1VF5B 3OTOB 1D2DA 5IYZA 4WFEA 3VQYA 4I9WA 2ZE5A 3ZBHA 1S0VA 5LOVB 1EN4A 3K5OA 4RAIA 5JVDA 4FLXA 4PELA 5LMNO 4FM0A 1QCEA 1WA8B 4JAVA 5EZYB 2OTLV 2IJIA 4X1YA 4LF5B 4DUZO 3CMEV 1S77D 5CBHA 1ZSPA 1J95A 3MDSA 3APOA 5DM6V 1OV9A 1Q86W 1N36B 5KHGA 1L8DA 1JFFB 2P90A 5CBGA 1OCOC 5D5PA 2Y48A 2EULA 4B3TB 2E76B 1GN6A 1X4TA 1GN4A 3OMIB 3CX5F 4LWSA 3VQXA 3CSXA 4R8CA 3K57A 1Y76A 5B3SB 2ADQB 3T1HB 3CPWU 2Y69C 2YS8A 1WP8A 4RUFA 4BAYA 5LGNA 3KZIZ 1WA8A 2P5OA 1JVMA 1K97A 1AR4A 4CBCA 4RWUA 3AG7A 1OHHG 2WPDG 4MTFA 1XI1A 1NI8A 1YDXA 4NYKA 3JAKA 4DR5O 3HR0A 1KQSU 3WFVA 2IH3C 4TV8A 1I7FA 1W59A 5IWAB 1PM9A 4KHPO 5CA0A 1PP9H 3AG1C 4FFBA 4LF4O 3IAYA 1JR9A 1TUEB 4X65O 2WLHA 3E83A 1N34O 4DXWA 3HKDB 4H0LB 1GH6A 2N04A 2V1DA 1N36O 3G80A 2F4VB 3LUTB 4WFBV 5HFMA 2EIMB 3HPLC 4MS2A 3OGCC 1MABG 3L71H 3AG2C 3H1LH 2UU9O 4O4JB 3K59A 3TK1A 4B3TO 1XL4A 1Q82W 3SYQA 3P3NA 4GX0A 2AZ0A 4DV5B 3D8CA 1UPGA 4G2KA 1IZ3A 4O4JA 1HNWB 3FAVB 1QLEB 4UCSA 3OUSA 4N21A 3CE2A 2ZKOA 3GB7C 2GDSA 1MZEA 4DV1B 1HDJA 2JJ2G 2GV9A 4X1KA 1KKDA 1Q6IA 1LNQA 4DV7O 3ABMB 1H8EG 1R3KC 4YY3B 4TSFG 1PNKA 3FD9A 5LGUA 1E79G 2BTQA 4OXSA 4BWAA 4FIPC 1DGSA 4BIOA 3H1KH 5DEDA 3CCEV 4UFZA 2DJVA 2LGQA 3UO3A 4MVUA 5LXTB 1FD9A 1RM1B 4MVMA 2EJ7A 4EEQA 3T2MA 3CRQA 1AJPA 1XUQA 1N32O 2IU3A 4I50B 1BS3A 3E22B 4JGSA 1CXZB 4MW3A 4I55B 4X66B 5ITZB 2Q0AA 2Q6AA 3L9DA 5C8YA 1SESA 1OCRC 4FZ0A 4HZ3A 1HNZB 1WP7A 4LF7B 3CCUV
chains in the Genus database with same CATH topology
2A3QA 4QGPA 2GTAA 1YVWA 2P06A 5IE9A 3C90A 2A7WA 2Q4PA 2Q73A 1VMGA 2YXHA 3CRAA 2Q9LA 3CRCA 2OIEA 1YXBA 1Y6XA 2OIGA 2Q5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3Q A;  4QGP A;  2GTA A;  1YVW A;  2P06 A;  5IE9 A;  3C90 A;  2A7W A;  2Q4P A;  2Q73 A;  1VMG A;  2YXH A;  3CRA A;  2Q9L A;  3CRC A;  2OIE A;  1YXB A;  1Y6X A;  2OIG A;  2Q5Z A; 
#chains in the Genus database with same CATH topology
 4DV4 O;  3LNM B;  1GM8 A;  3LSQ A;  1BQ0 A;  4LFC B;  1IBK O;  2DYR C;  2YI8 A;  1EN5 A;  5J2T B;  4DK1 A;  5JJN B;  1OCZ B;  5DEC A;  1S5L Z;  4KHP B;  1HR0 B;  1RSO B;  4YIP A;  4GX5 A;  1EZV H;  2O57 A;  2Q9L A;  4UV8 A;  3JD1 A;  3STZ C;  4JI3 O;  1NU1 H;  4PHZ A;  4WFF A;  2LP7 A;  1P84 F;  2ZIN A;  1M1K W;  3ZRX A;  5IE9 A;  4G28 B;  2Q4P A;  1JJ2 U;  1YJ9 V;  5IJ0 A;  2ZE6 A;  2UUB B;  2WAM A;  4HYO A;  2YIC A;  2ITD C;  1IDS A;  4J42 A;  1H8H G;  1VMG A;  1OJH A;  4JYB A;  1DF4 A;  4FK5 C;  4PA7 A;  1SET A;  1FFT B;  3VQV A;  1COW G;  1N33 O;  1I0H A;  5CBF A;  2GHY A;  1KEC A;  3K9A A;  1WPX A;  2IW5 A;  2YXY A;  3QG5 A;  2BOB C;  2VQF O;  1AVM A;  3JAK B;  3ZRS A;  4WBN B;  1G1X B;  5LYJ B;  4DV6 O;  4NXN B;  3RYI A;  2DQ3 A;  1KKC A;  4B7K A;  2WSS G;  1F51 A;  1G4Y B;  2P4V A;  3STL C;  4J9Y B;  3S3W A;  4MTO A;  3JAL A;  1WAZ A;  1U96 A;  2IH1 C;  2AHZ A;  4X9Q A;  2OIG A;  4NTY A;  3HKC A;  2PTM A;  3CD6 V;  2VQE B;  3JAR B;  2FYU H;  3K5M A;  4R7C A;  4YJ2 B;  1XOU A;  2AZ2 A;  1S5J A;  3TXS A;  3TGU H;  3JAR A;  2NR5 A;  3CXH F;  5CA1 A;  2Q5Z A;  2V4D A;  1K5Q A;  1W0J G;  3RGB A;  3AK1 A;  4TQF A;  4JI2 O;  3TXQ A;  2VWJ A;  1AI6 A;  2VS0 A;  5IY5 C;  4ABM A;  5LA6 B;  4B08 A;  5L3B A;  4LF6 O;  1OCO B;  2W6I G;  2CTQ A;  3OM3 B;  3P32 A;  4AHC A;  4B3S B;  2Q68 A;  1WPB A;  4LF4 B;  1SZT A;  1KC8 W;  2Q0O C;  3AK2 A;  3H1I H;  3K03 A;  5GTH Z;  2EIK C;  3L73 H;  5KMG B;  4JYY A;  1Q81 W;  4O4H A;  1R6N A;  2LW7 A;  1JPX A;  3BAA A;  2R9A A;  2LJ2 A;  1J5E B;  4DR3 B;  4IIJ A;  4WFG A;  2LGW A;  4AIL C;  1CEZ A;  4DR7 O;  2R70 A;  4DV6 B;  5GON B;  2KQX A;  2ZM6 B;  1MA1 A;  2WLL A;  1GKF A;  2RMK B;  3D3Q A;  2EJR A;  4X1K B;  1YVW A;  4QE9 A;  1K8A W;  1TGO A;  1KB9 F;  5LP6 C;  3Q4H A;  2P22 C;  1RFY A;  3QTC A;  3D36 C;  4DV1 O;  5KHJ A;  4NTW A;  3K79 A;  3MAQ A;  3C90 A;  4K3A A;  4NVP A;  4X65 B;  4LFA O;  1DTO A;  2UUC O;  4NXM B;  2ARH A;  2HVJ C;  1BMF G;  2LO1 A;  5LHG A;  4O4L A;  1ZUQ A;  5CN0 A;  1M9N A;  1Q8I A;  1PNM A;  3FYE B;  3U0Z A;  2H3O A;  3ZMU A;  2UXB B;  1MNG A;  1BHA A;  4U7O A;  3L70 H;  4QNH B;  1QVG U;  3C3T A;  4O2B A;  1GM7 A;  3MD0 A;  1XHZ A;  5K1X A;  4JAS A;  1Q43 A;  3B8M A;  3MHS C;  3T4D A;  1E1R G;  2E75 B;  4JAU A;  1GMG A;  1Q7Y W;  4N23 A;  5B5E Z;  3ABK B;  2CK3 G;  4HBN A;  1JA8 A;  4CS2 A;  4D7T A;  1ZWI C;  2NN4 A;  1JX9 A;  2B5U A;  1NQT A;  1IXB A;  1LUV A;  1GAX A;  4PA9 A;  3CS5 A;  3ZIA G;  4E4E A;  3QF7 A;  3FX7 A;  5IDJ A;  4DUZ B;  2R72 A;  4TOI A;  1VQP V;  2WLI A;  1ZX3 A;  2EBO A;  1AR1 B;  1H2N A;  2UXN A;  4ZOL B;  5L3E A;  3G67 A;  3JSN A;  3ABL C;  4NXM O;  4LF5 O;  2QWR B;  1AIL A;  2JEX A;  2A3Q A;  4GLX A;  4YJ2 A;  1SQG A;  4JYC A;  2YDE A;  2A9H A;  2HFE C;  3CHX A;  3AG2 B;  3ZHS A;  1V54 C;  3JAL B;  4JI5 O;  4I5S A;  3E86 A;  1TUB A;  1O9H A;  1FFX B;  2DW4 A;  3B09 A;  4MVZ A;  3HKC B;  2Z5U A;  4EFE A;  3OEH G;  3ASO B;  1US6 A;  4BIZ A;  1NR1 A;  1WB8 A;  4JI7 O;  3SYA A;  3K3W A;  2F1M A;  3ZCC A;  1NTK H;  1M4U A;  1T5E A;  5FNV A;  3IFX A;  5H2F Z;  2DQ0 A;  1SKV A;  5FL7 G;  1NTM H;  4QE7 A;  1VEW A;  4JV5 O;  1Z2G A;  4WF9 V;  4UCO A;  1IX9 A;  2DE0 X;  5KUM A;  1DK1 A;  2JS5 A;  3G4S V;  2D2C B;  1NH2 D;  4IT5 A;  4QPK A;  1HNX B;  2PZS A;  1KYO F;  2CGO A;  4LH6 A;  5IJ0 B;  2QM4 A;  1P7B A;  1AR5 A;  4MVO A;  4FFK A;  5B1N A;  3ASN B;  4FVM A;  2X6C A;  1VQK V;  2QM8 A;  2PF4 E;  2JGD A;  4EB6 A;  3U11 A;  4FLW A;  5IWA O;  3ZMT A;  2H94 A;  3CRM A;  3VQW A;  4IYH A;  4XDK A;  1N8R W;  3ZJZ A;  1FJG O;  3CJH A;  5BZB A;  4DV0 B;  1KP3 A;  1VQ4 V;  3CRR A;  4Q20 A;  1I08 A;  4DW1 A;  3NXS A;  2K1E A;  1R1B A;  1NKD A;  1R6T A;  1YI2 V;  5JJJ B;  2HJD A;  4LF8 B;  4ZOL A;  1EFR G;  1JJO A;  4X20 A;  2BE3 A;  3WB0 A;  3RYF A;  3RFR A;  4IL6 Z;  2WA4 A;  3EVK A;  1BT8 A;  1FXK B;  2BOC C;  4MW8 A;  4J80 A;  1NTZ H;  2ZR2 A;  4I55 A;  1HNW O;  2QTO A;  3QO7 A;  2HJF C;  4X1Y B;  1SRY A;  1KUQ A;  1I5X A;  2WLM A;  2JJ1 G;  4UV9 A;  3CCJ V;  3MHH C;  5LGT A;  2UUC B;  5LMU B;  2XOK G;  3E8G A;  1EBO A;  5KX5 A;  4U3J A;  1NZ6 A;  4YY3 O;  3QVN A;  2QWP B;  1AP5 A;  2ZDI A;  5IJ9 A;  1KD1 W;  2QWO B;  1Y66 A;  1YTF D;  5JJE B;  3VOU A;  2M7W A;  3CC4 V;  1Q6H A;  4QGP A;  3K9S A;  2HEP A;  3DGE A;  1OCR B;  2QGN A;  3KCY A;  1CPY A;  4FPP A;  2OYQ A;  1BL8 A;  2JK5 C;  2P4K A;  1K4C C;  3BRC A;  2YIB D;  2XAQ A;  4Q6G A;  2A79 B;  3X2Q B;  5JCO C;  1NT2 B;  1PD3 A;  1PV0 A;  1FFX A;  4AI8 A;  2AGA A;  4GUN A;  4DR6 O;  2HHH O;  1FXV A;  5A9G A;  2YUA A;  3IC9 A;  3JD0 A;  3T1Y O;  2JVD A;  1PNL A;  3B77 A;  3QNE A;  3CCR V;  1ARO P;  3OUF A;  1ORQ C;  2JS3 A;  4RO2 A;  4DV4 B;  2MW2 B;  4OX9 O;  4A5U B;  1SQX H;  5EC2 C;  1OZ0 A;  4O4I B;  1SA0 A;  1K9M W;  4LC1 A;  1K4D C;  1SQQ H;  4J41 A;  1Y6X A;  4PDV A;  1ENV A;  2F23 A;  3LDD A;  2EIK B;  2OCC C;  2ZD9 A;  4J7Z A;  3RVZ A;  1VQ8 V;  2RN9 A;  5H9C A;  4JZG A;  3A0R A;  3L75 H;  4JI0 O;  5H5N A;  3RYC B;  4PA4 A;  1QQC A;  3ZRV A;  2Q8V A;  1V54 B;  4TV9 B;  2UUA O;  4B3M O;  2YSU B;  3UT5 B;  4NR1 A;  1H2G A;  5J2U A;  5IYD O;  2QR4 A;  2IJH A;  4QIW F;  5KUK A;  1Z5W A;  1MSD A;  1GO3 F;  4ZI7 B;  4F6R A;  2UXC B;  1YZB A;  4JPR A;  4AQY B;  4JAA A;  1SA0 B;  4LF9 O;  2ZQM A;  3IC7 A;  4LBE C;  2HR3 A;  4X88 A;  4E2L A;  1MG1 A;  1F23 A;  1AJN A;  3JAW B;  2PGG A;  2CTR A;  3HB3 B;  4JI1 O;  4LP8 A;  1RPR A;  2YEV A;  2D3O W;  4LCU C;  5L3G A;  2CAZ C;  3K04 A;  3B4S A;  3CRC A;  3D36 A;  4YIO A;  1L0N H;  1GTO A;  1SER A;  2OT5 A;  2R9R B;  3K5L A;  2LQT A;  3NR7 A;  4BW9 A;  4JV5 B;  1VQ7 V;  1F4N A;  3AG3 C;  1L1F A;  3ASN C;  3ZMZ A;  2QKA A;  3BHP A;  4YHH O;  2Z3Y A;  3A0H Z;  2QWQ B;  1JQ0 A;  4JI6 O;  4GKJ B;  2A0L A;  3A8T A;  3OAA G;  3DXR A;  1PPJ H;  3GWK C;  2UUA B;  5LBQ A;  1NVP B;  4FZ1 A;  1Q3E A;  4DRX A;  4LF8 O;  3DXR B;  2EX3 A;  3AEI A;  3ZMS A;  2ITC C;  4B3S O;  3IJ4 A;  2CH7 A;  5EYP A;  1VQM V;  1K3E A;  2W0F C;  5GTI Z;  3LDE A;  3W7T A;  2EIJ B;  2EZP A;  4I9Q A;  3D3I A;  4PV1 B;  4IHJ B;  1SQP H;  5L3F A;  1S5H C;  1VF6 A;  4K0K B;  2AW9 A;  3H1H H;  1HNZ O;  5F2V O;  5J2T A;  3JAM N;  3ML0 A;  5A2Q N;  5B1A C;  3N2G A;  5BY1 A;  4B3R B;  3JAW A;  3M8A A;  1AI5 A;  3WG7 C;  1JFF A;  2HG5 C;  2RNB A;  1H2S B;  3ASO C;  2HVK C;  3OD4 A;  1XBL A;  1GK9 A;  3ZHU A;  1D5N A;  1S3J A;  2Y69 B;  3OGI B;  1IBL O;  2CDY A;  3JAS A;  2QWN B;  1THZ A;  2UXB O;  1W0K G;  3M99 B;  4TV9 A;  2ILM A;  5KLV H;  2RQ6 A;  2Q67 A;  3SPJ A;  4X1I A;  4EB6 B;  4DR1 B;  1XNQ O;  3CYO A;  5JVD B;  4BIU A;  3I56 V;  4HNA B;  1V9P A;  5LYJ A;  1WJZ A;  4NKG B;  1MSW D;  2XT9 A;  2BSK B;  1QLN A;  4FLZ A;  1XNR B;  2DOS A;  2L35 A;  3JAS B;  1QLE C;  3G71 V;  4OX9 B;  2DN9 A;  2FL4 A;  2QA4 V;  2DYS C;  2F95 B;  2ZE8 A;  4P30 A;  1E1Q G;  3ZHV A;  3SYP A;  2VQF B;  1Y67 A;  3FB6 C;  2E5L O;  1JMK C;  5LMU O;  2QTS A;  1M93 A;  2IU0 A;  4DR6 B;  1OCC C;  4B7E A;  4F4L A;  3J81 N;  4LR3 A;  4JI2 B;  1XHX A;  1VAR A;  1URF A;  1VQN V;  3I5D A;  4IHJ A;  3WB1 A;  1M57 B;  5CB4 B;  2F66 C;  1NH2 B;  4IYI A;  3KG2 A;  5BMV B;  4EKW A;  2XHB A;  4JZ2 A;  1O9G A;  1NS1 A;  2X7R B;  1QR8 A;  1UFI A;  1XRE A;  2LW1 A;  5EYP B;  5H6R A;  4XDL A;  5JH7 B;  3ABM C;  2VQE O;  1BSM A;  1RSO A;  1P4R A;  2QJ1 A;  3JD4 A;  2KKW A;  3RWR D;  1HW7 A;  3ZRW A;  1K33 A;  1ROP A;  3BFR A;  3JD3 A;  3LSU A;  3K5N A;  4JI8 O;  1VP7 A;  1IUR A;  3OR7 C;  4MVQ A;  2ADP A;  1OCZ C;  3K06 A;  2A06 H;  2JIZ G;  4GX2 A;  4JI7 B;  4R50 A;  4IIJ B;  4K8Z A;  4U3F H;  5FLX N;  4DR7 B;  4I0X A;  3N27 A;  5CA0 B;  2QEX V;  1KP2 A;  3BCC H;  5IJ9 B;  2VRZ A;  4DR1 O;  4UVC A;  2GTA A;  5KA5 A;  4LNU B;  4HNA A;  3AG4 B;  1SQV H;  4U3J B;  2E5L B;  3E89 A;  4CZZ A;  4ZIB A;  2GUZ B;  2E3C A;  3JAT A;  4P9O A;  4O2A A;  4J11 A;  4I7Z B;  2WLJ A;  4PDR A;  4UVA A;  2EIM C;  1N0J A;  1FYJ A;  2F43 G;  3RBZ A;  1UJW B;  2IM9 A;  1G6U A;  4PA3 A;  3E8F A;  3RYF B;  5DN6 G;  2BTO A;  3L72 H;  4GKK O;  5EC1 C;  4LFB B;  4CH5 A;  4H33 A;  3H01 A;  5CA1 B;  4ZI7 A;  2EIN B;  4OPA A;  4DYL A;  3P30 A;  1QHT A;  3B40 A;  2QM7 A;  2ZIM A;  1XMQ O;  2N05 A;  4TWK A;  4H13 B;  4YHH B;  4O4L B;  2DWD C;  1PL0 A;  4ZKI A;  2XAF A;  5CA3 A;  1X59 A;  1AI7 A;  3RYC A;  1FPO A;  2RDC A;  1B6Q A;  3JAT B;  2GUZ A;  3W7W A;  3H9V A;  4X64 B;  5LL6 Y;  2P06 A;  2CH7 B;  4W4K A;  2JDI G;  2P67 A;  4K0K O;  3UM7 A;  3CP1 A;  4DRX B;  4JTC B;  1YJW V;  4KUM A;  4UUJ C;  4PI0 A;  1GN2 A;  3FB5 C;  2ATK C;  4YJ3 A;  5KAI Z;  2EIL B;  3F5T A;  3U10 A;  2B1I A;  1K92 A;  1QU7 A;  1N33 B;  5IT9 N;  3ETQ A;  4TV8 B;  4UCR A;  3CB2 A;  3SPG A;  4TUY B;  2UXX A;  5D5Q A;  5B3S C;  5KMG A;  4GKK B;  2GBO A;  1FS0 G;  2IJJ A;  3OEE G;  3QO8 A;  2ZCE A;  4ZBM A;  5JH7 A;  4DV5 O;  2RJZ A;  3T1C A;  3PN1 A;  3BVO A;  3X2Q C;  5KAF Z;  1VQ6 V;  2XAG A;  1HP8 A;  2LFS A;  3KKY A;  1Y76 B;  1B04 A;  1P7G A;  4DR4 B;  2ZT9 B;  2KB1 A;  4KL1 A;  1TUB B;  2Q7E A;  1Q6U A;  5LP6 A;  3PJS K;  1Z5V A;  3SJQ C;  2BCC H;  3W7U A;  4PDL A;  4CC6 A;  3J7A U;  1QBZ A;  3HKE A;  4U7N A;  1QR9 A;  3GVM A;  1XMQ B;  4KP4 A;  4XDJ A;  3ZMV A;  4ZHQ A;  5E79 Z;  4LF6 B;  1SC5 B;  4QPJ A;  1OCC B;  2JGU A;  2QKC A;  5ITZ A;  1MZF A;  4P9P A;  1Q5O A;  2YXL A;  3LSS A;  4DR2 B;  3ZED A;  1NBM G;  2OCC B;  2ZNJ A;  3WG7 B;  1R6K A;  5JWP A;  4H44 B;  1N0N A;  2FML A;  4X62 O;  3BEH A;  3JYC A;  1IBL B;  3ZHQ A;  3RYI B;  3CCQ V;  2ZNI A;  4UB6 Z;  5B1O A;  1N32 B;  2WA3 A;  4BW5 A;  3WB2 A;  4J9Z B;  1YSC A;  5LHI A;  3TET A;  1TA8 A;  3FKS G;  2X0L A;  4I0X B;  1Y74 A;  5JCO A;  4X64 O;  1SZX A;  3OFN G;  1R3I C;  4UB8 Z;  3ABK C;  1NR7 A;  3EFF K;  2CTP A;  3N2K B;  2OCH A;  4FLT A;  3CC7 V;  4LF9 B;  1YJN V;  5LHH A;  1P49 A;  3K08 A;  4J7J A;  4JI1 B;  1V55 B;  5CB4 A;  1HNX O;  2ZDI C;  2R9I A;  2ZXW B;  1M90 W;  2Z0A A;  5FPR A;  3BPZ A;  2G38 A;  3K0G A;  4IGG A;  3Q4H B;  3LDC A;  1LUW A;  5L3C A;  1G8M A;  4TUY A;  2UU9 B;  1Y4M A;  4I4T B;  2XND G;  3G6E V;  3ZN0 A;  1M56 C;  4DW0 A;  1XL6 A;  3CRA A;  4L8J A;  4DUY O;  4DV2 B;  1MMM A;  3AG4 C;  1K7D A;  1KU9 A;  2KSD A;  4J7K A;  4YJ3 B;  4FFB B;  2YC0 A;  2HLD G;  5FNV B;  4JI3 B;  1L0L H;  2P7T C;  2EZO A;  3E22 A;  2CTW A;  2W0X A;  3F5W C;  4RQF A;  1IBM B;  4TT3 G;  2FB5 A;  3B8N A;  4NB5 A;  2FTK A;  4B3R O;  1N4C A;  3UQ8 A;  4C7U A;  3UCS C;  3H1J H;  4X20 B;  2MK3 A;  1S76 D;  1K34 A;  1YIJ V;  1TVK A;  5BR8 O;  4L87 A;  4PD4 F;  1XMO O;  3HKE B;  1V55 C;  1YF2 A;  1BZK A;  1FXH A;  5FPO A;  2QKS A;  2ODM A;  4WCE V;  5KHI A;  2XAS A;  4PDM A;  1WNS A;  1I94 O;  2VWK A;  4Z1V A;  1TAE A;  2WLI B;  1EM1 A;  4ASU G;  3J80 N;  5J2U B;  3DSQ A;  5LP6 B;  5EBM C;  2WWW A;  4UCT A;  5EIB C;  2RCV A;  2IBZ H;  1XQ8 A;  4FLY A;  5J9P C;  4MTX A;  1KBH A;  2FKX A;  3B2E E;  3T1Y B;  3CXC U;  2EIN C;  4FLV A;  1LR1 A;  1M5I A;  1IBK B;  2AXT Z;  3A2F A;  3SJC C;  3SPH A;  1XNQ B;  4FJC C;  1WN7 A;  1U97 A;  3OTO O;  2N74 A;  2ZE7 A;  4GT1 A;  4MVS A;  3F7Y C;  2Y0P A;  4X66 O;  4CH6 A;  2YI9 A;  3RN4 A;  1QVF U;  2YID A;  2NNU A;  3BA9 A;  4LF7 O;  1H2K A;  4DV0 O;  1GRJ A;  1QNM A;  3ZN1 A;  3DC6 A;  1XDC A;  2F93 B;  4UXN A;  3ZRW B;  4JI0 B;  4DR2 O;  2PYJ A;  1VQ5 V;  5E1A C;  1YTF B;  4F6E A;  1YCI A;  4JI8 B;  3DTU B;  3O9O A;  1K5S A;  3T4Z A;  4JI4 O;  2XTA A;  1BCC H;  1NVP D;  4TQD A;  3UKM A;  2LFR A;  4MT8 A;  1W2B U;  3RT3 C;  3E8H A;  3ZS8 C;  5KA6 A;  2WLL B;  4YXW G;  1VIB A;  1ZLZ A;  3ZHT A;  1HWY A;  3THO A;  5C8Y B;  3T1H O;  1FXK C;  1TVK B;  1XEQ A;  4UCV A;  4X62 B;  3ZHR A;  5BR8 B;  3BAB A;  2JEU A;  1Y74 B;  3KCX A;  3SDL A;  5JQG A;  2Y4U A;  4FMT A;  5EBL C;  2CE4 A;  4GYC B;  3EHB B;  4OGQ B;  2OIE A;  5KX5 B;  1MOF A;  2KG7 B;  4QJF B;  1DF5 A;  4O2A B;  2EIL C;  3C3S A;  1I94 B;  3SR2 C;  5LXT A;  3SPI A;  4LFB O;  4G27 B;  4H37 A;  4JI6 B;  4GKJ O;  2UUB O;  1WB7 A;  2XAJ A;  2BTQ B;  4DV3 B;  1EN6 A;  2ZXW C;  4O2B B;  3RYH A;  4DV2 O;  2WLN A;  4CH3 A;  4GZR B;  4ZHQ B;  4FM2 A;  1KMI Z;  2XAH A;  4BR6 A;  3ABL B;  3FAV A;  3OMN B;  1SQF A;  3JCZ A;  5KHH A;  2QDO A;  2Y4T A;  2ZR3 A;  1GN3 A;  5HFL A;  3ZX6 A;  1H2L A;  4PA6 A;  3SYC A;  1AJQ A;  4CC5 A;  1K73 W;  5EIB D;  3P3P A;  3JSL A;  1VQO V;  4OPH A;  3N2K A;  3EXA A;  3ETG A;  4PJ0 Z;  4K35 A;  1F4M A;  1EZJ A;  2XUM A;  2WLK A;  3RVY A;  1VF6 C;  1AB3 A;  4DK0 A;  1BGY H;  3HKD A;  3RYH B;  4RQE A;  2UXC O;  5B1B C;  4WFA V;  4O4H B;  2CUG A;  1AI4 A;  1VQL V;  1R3L C;  4HAM A;  3VBB A;  1SF9 A;  3ETD A;  3RW0 A;  2PY5 A;  1FAF A;  2L6L A;  4FLU A;  4DUY B;  2PI5 A;  1R3J C;  2CGN A;  3W7X A;  2K9P A;  2YXH A;  3OMA B;  2ETN A;  2QSA A;  1DLB A;  4X1I B;  4PI2 A;  3IGA C;  2P6J A;  3OR6 C;  4LWS B;  3WU2 Z;  5K1P A;  4B3M B;  3OW2 U;  1NJI W;  3JD2 A;  3K58 A;  2ZIO A;  3TCU A;  4D6T H;  1J5E O;  3AG1 B;  1JOY A;  1H2M A;  1BE3 H;  2DWE C;  3SJA C;  4W4L A;  5B66 Z;  1FJG B;  3CCL V;  3I55 V;  2V7Q G;  3S3X A;  3CJH B;  4CH4 A;  1BHB A;  4DR5 B;  2GTS A;  4X89 A;  2UXD O;  4J10 A;  2X6B A;  4GX1 A;  4I50 A;  1JCH A;  3E35 A;  1R73 A;  2W6J G;  1RM1 C;  2PI4 A;  1HR0 O;  4DO2 A;  2DMX A;  5EBW C;  1YEW A;  5KHK A;  1ZAU A;  4LNU A;  4JI4 B;  5B1A B;  4XBF A;  4JTD B;  5IYZ B;  3APQ A;  5IYC O;  1WLE A;  4X8A A;  3FFQ A;  4ICG A;  1Q90 D;  1RP3 B;  4MSW C;  5IYB O;  2Q73 A;  4I4T A;  5AG2 A;  3CCV V;  1YIT V;  4O4I A;  2B9Z A;  3F7V C;  1ZTE A;  4KXR A;  1AP6 A;  1D5A A;  1H38 A;  3R65 A;  4WFH A;  4RUE A;  3GWO A;  3OE7 G;  5H6Q A;  3DC5 A;  1GM9 A;  1BQZ A;  5BMV A;  5GW7 A;  4JI5 B;  2JRI A;  5IY5 B;  4K8X A;  2YEV B;  3CMA V;  4UVB A;  2DYR B;  1SS3 A;  1IVS A;  1PKX A;  2Q7H A;  4UCU A;  1ZL8 A;  3SYO A;  4NTX A;  1VQ9 V;  2PUS A;  3E8B A;  1I5Y A;  2UXD B;  1YHQ V;  5LMN B;  2PYL A;  3HKB B;  2DYS B;  1M56 B;  3QO5 A;  3JCU Z;  4LH7 A;  4F6R B;  2Q7G A;  2F4V O;  3UT5 A;  3CCM V;  2HKO A;  1B06 A;  2A7W A;  3CC2 V;  3AK3 A;  4D7S A;  3CCS V;  3M7M X;  4JYA B;  5CMU A;  1VF7 A;  4P2Z A;  2ZM6 O;  3FYI B;  2BSK A;  2YIB A;  2HHH B;  3L74 H;  4DV3 O;  2M6Y A;  3SJB C;  3FB7 C;  4R6Z A;  3SPC A;  3ABU A;  1FKA O;  1IBM O;  4EFB A;  4MVR A;  2KG7 A;  3OTF A;  4Z1M G;  5LA6 A;  5TIS Z;  2AHY A;  4NXN O;  1FXK A;  3CWB H;  4JF3 A;  4JTA B;  3E2E A;  3K0D A;  5JQG B;  1A32 A;  2GSM B;  4GCZ A;  1SQB H;  4MTG A;  2OWO A;  4DR3 O;  1S72 V;  1YXB A;  2B1G A;  3W7S A;  3ICX A;  4DV7 B;  3SGI A;  1B3Q A;  1XNR O;  2Y0I A;  3HKB A;  5BXZ A;  1XMO B;  2H8P C;  4Z2W A;  1M57 C;  3R66 A;  2Q69 A;  3N2G B;  3BY6 A;  1F7Y A;  4CS3 A;  1ZL8 B;  3O65 A;  2E74 B;  4AQY O;  2QE7 G;  3BA8 A;  4KFM A;  4LFC O;  1RPO A;  5C93 A;  5EZY A;  1CP9 A;  2IJK A;  3ABT A;  2EIJ C;  1PL4 A;  2NLJ C;  2JGD B;  3FB8 C;  3OT7 A;  1XIL A;  5EK0 A;  4JYA O;  5LOV A;  3CEI A;  4CS4 A;  5B1B B;  4WBN A;  1N34 B;  4LFA B;  2HP8 A;  5L3D A;  3A0B Z;  3ETE A;  3AG3 B;  3G6B A;  3TJT A;  5GON A;  2X6A A;  2YIA A;  4FM1 A;  1IXM A;  2C2A A;  3UO2 A;  2OTJ V;  3LNN A;  4DR4 O;  1VF5 B;  3OTO B;  1D2D A;  5IYZ A;  4WFE A;  3VQY A;  4I9W A;  2ZE5 A;  3ZBH A;  1S0V A;  5LOV B;  1EN4 A;  3K5O A;  4RAI A;  5JVD A;  4FLX A;  4PEL A;  5LMN O;  4FM0 A;  1QCE A;  1WA8 B;  4JAV A;  5EZY B;  2OTL V;  2IJI A;  4X1Y A;  4LF5 B;  4DUZ O;  3CME V;  1S77 D;  5CBH A;  1ZSP A;  1J95 A;  3MDS A;  3APO A;  5DM6 V;  1OV9 A;  1Q86 W;  1N36 B;  5KHG A;  1L8D A;  1JFF B;  2P90 A;  5CBG A;  1OCO C;  5D5P A;  2Y48 A;  2EUL A;  4B3T B;  2E76 B;  1GN6 A;  1X4T A;  1GN4 A;  3OMI B;  3CX5 F;  4LWS A;  3VQX A;  3CSX A;  4R8C A;  3K57 A;  1Y76 A;  5B3S B;  2ADQ B;  3T1H B;  3CPW U;  2Y69 C;  2YS8 A;  1WP8 A;  4RUF A;  4BAY A;  5LGN A;  3KZI Z;  1WA8 A;  2P5O A;  1JVM A;  1K97 A;  1AR4 A;  4CBC A;  4RWU A;  3AG7 A;  1OHH G;  2WPD G;  4MTF A;  1XI1 A;  1NI8 A;  1YDX A;  4NYK A;  3JAK A;  4DR5 O;  3HR0 A;  1KQS U;  3WFV A;  2IH3 C;  4TV8 A;  1I7F A;  1W59 A;  5IWA B;  1PM9 A;  4KHP O;  5CA0 A;  1PP9 H;  3AG1 C;  4FFB A;  4LF4 O;  3IAY A;  1JR9 A;  1TUE B;  4X65 O;  2WLH A;  3E83 A;  1N34 O;  4DXW A;  3HKD B;  4H0L B;  1GH6 A;  2N04 A;  2V1D A;  1N36 O;  3G80 A;  2F4V B;  3LUT B;  4WFB V;  5HFM A;  2EIM B;  3HPL C;  4MS2 A;  3OGC C;  1MAB G;  3L71 H;  3AG2 C;  3H1L H;  2UU9 O;  4O4J B;  3K59 A;  3TK1 A;  4B3T O;  1XL4 A;  1Q82 W;  3SYQ A;  3P3N A;  4GX0 A;  2AZ0 A;  4DV5 B;  3D8C A;  1UPG A;  4G2K A;  1IZ3 A;  4O4J A;  1HNW B;  3FAV B;  1QLE B;  4UCS A;  3OUS A;  4N21 A;  3CE2 A;  2ZKO A;  3GB7 C;  2GDS A;  1MZE A;  4DV1 B;  1HDJ A;  2JJ2 G;  2GV9 A;  4X1K A;  1KKD A;  1Q6I A;  1LNQ A;  4DV7 O;  3ABM B;  1H8E G;  1R3K C;  4YY3 B;  4TSF G;  1PNK A;  3FD9 A;  5LGU A;  1E79 G;  2BTQ A;  4OXS A;  4BWA A;  4FIP C;  1DGS A;  4BIO A;  3H1K H;  5DED A;  3CCE V;  4UFZ A;  2DJV A;  2LGQ A;  3UO3 A;  4MVU A;  5LXT B;  1FD9 A;  1RM1 B;  4MVM A;  2EJ7 A;  4EEQ A;  3T2M A;  3CRQ A;  1AJP A;  1XUQ A;  1N32 O;  2IU3 A;  4I50 B;  1BS3 A;  3E22 B;  4JGS A;  1CXZ B;  4MW3 A;  4I55 B;  4X66 B;  5ITZ B;  2Q0A A;  2Q6A A;  3L9D A;  5C8Y A;  1SES A;  1OCR C;  4FZ0 A;  4HZ3 A;  1HNZ B;  1WP7 A;  4LF7 B;  3CCU V; 
#chains in the Genus database with same CATH homology
 2A3Q A;  4QGP A;  2GTA A;  1YVW A;  2P06 A;  5IE9 A;  3C90 A;  2A7W A;  2Q4P A;  2Q73 A;  1VMG A;  2YXH A;  3CRA A;  2Q9L A;  3CRC A;  2OIE A;  1YXB A;  1Y6X A;  2OIG A;  2Q5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...