2Q73A

Crystal structure of imazg from vibrio dat 722: ctag-imazg (p41212)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
MKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEKTHELKEVLNKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title A putative house-cleaning enzyme encoded within an integron array: 1.8 A crystal structure defines a new MazG subtype.
pubmed doi rcsb
source organism Vibrio sp. dat722
molecule tags Hydrolase
total genus 35
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.19: Transferred entry: 3.6.1.9.
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q73A00
2OIEA 2YXHA 1VMGA 3CRAA 2A7WA 4QGPA 2P06A 2Q73A 2GTAA 5IE9A 2OIGA 2Q9LA 2Q5ZA 1YVWA 3CRCA 3C90A 2A3QA 1YXBA 1Y6XA 2Q4PA
chains in the Genus database with same CATH superfamily
4X88A 5GONA 3AG3B 5C8YA 2YS8A 1AR4A 3ZMTA 3JD3A 4X1YA 1SERA 2IJKA 1NT2B 1XMQB 1KP3A 1ORQC 3O9OA 1XQ8A 3VQXA 1OCOB 2OTLV 5EBMC 1FXKB 4EB6B 4WCEV 2W6IG 1Q8IA 1THZA 3QVNA 3ZHVA 3ASNC 4MVRA 1M90W 2A06H 3ICXA 3E86A 4WFAV 2PZSA 4LC1A 1XUQA 3N27A 4DR4O 5KUKA 3ZRXA 2E74B 2A9HA 4UB8Z 5CBGA 1L0NH 4OPAA 4U3FH 2DWDC 4MVZA 1KMIZ 1I94O 2FKXA 3W7WA 3T1YB 1CPYA 2YI8A 3TETA 2WAMA 3OTOB 3W7SA 1VQ9V 4O2AB 2PY5A 2VQEO 3FYIB 4Z1MG 4ZKIA 2WA3A 3CD6V 4O4IB 2O57A 2CDYA 3W7TA 1MSDA 2FYUH 5LHHA 5JH7A 3JAMN 3AEIA 1Y66A 4DR7B 3MD0A 2KB1A 4NXMB 1AROP 1GM8A 3WB0A 2L6LA 4BR6A 1HNWO 1SETA 2QM4A 1OCOC 1NI8A 4J7KA 1FXKC 3LNNA 1XMOB 3B8MA 1GN4A 4ICGA 4PDVA 4DR5B 1AI5A 2X0LA 4DV2O 3SJCC 2Y48A 1W59A 3OEHG 4QJFB 1FXKA 4YHHO 1DK1A 1JCHA 2JJ1G 1P49A 4E2LA 3IJ4A 5LGTA 2ATKC 1GH6A 3OFNG 4IIJA 4X66O 4KHPB 3IC9A 1YF2A 3E8GA 3EXAA 5K1PA 1HNZO 1R6KA 2CAZC 3SYCA 4JI5O 4OXSA 5LMNB 3M99B 4J42A 2EIJB 2OCCB 4LF6B 1M5IA 3BFRA 3BVOA 4N21A 2XAHA 4FFBA 3GWKC 1K97A 5LMUO 3T4ZA 3PN1A 4DV7O 4O2AA 1VQ4V 4WFEA 4TQDA 3ASOB 1TGOA 3K5OA 1KU9A 4N23A 2PYJA 1P7GA 1V54C 3RN4A 5A9GA 4O4IA 3L70H 5ITZA 1QR9A 5IDJA 4PA6A 2NNUA 1NVPD 1NKDA 3D36A 4I4TB 4LF5O 5JCOA 2LFSA 2JGUA 4XDLA 2ZR3A 3TXSA 4JAAA 4DUZB 1IXMA 3FB6C 4TWKA 3JALB 4LF7B 3RWRD 1VF5B 3R65A 4X9QA 1EN4A 4MTFA 1NZ6A 2F43G 2ZR2A 1GN2A 2CTRA 3D3IA 1H8EG 2ETNA 4DR2B 3BY6A 3GWOA 5CA3A 4BAYA 1UJWB 2Q7GA 5BMVA 1MG1A 3T1HO 2EIJC 4JI3B 4YJ2B 2YDEA 4DV1O 1XI1A 4MW3A 4GT1A 1Q6HA 3ASOC 1Q6UA 4TV9B 5L3EA 5KA6A 3FB8C 1IBKB 1ZUQA 5FPOA 2Z0AA 4HNAB 3AG2B 4QPJA 5KMGB 1BGYH 4KUMA 2JJ2G 3DGEA 3OGCC 1J5EO 3K5LA 3BA9A 3ZMZA 2PYLA 5H9CA 2OIEA 4OX9O 2Q67A 2GV9A 5BXZA 2QKAA 3BABA 2DE0X 1V55B 2D3OW 4TQFA 3ABLB 5EBLC 4DXWA 3B2EE 4TUYB 4UXNA 5KHHA 1WJZA 3OUSA 4I4TA 3O65A 1FFTB 4FM0A 5EIBD 2IJIA 2P4KA 4UV9A 2E75B 1NR1A 3UO2A 5BY1A 2QGNA 1ZSPA 4UFZA 1EM1A 2RJZA 4CC5A 5J2TB 3CP1A 4XDJA 2UXBO 4PJ0Z 5KAFZ 2AHYA 4BIOA 3FB7C 5KHJA 4L8JA 3LUTB 4U7NA 5KHKA 4P9OA 2PTMA 3B4SA 2DW4A 1AI7A 4JGSA 1IZ3A 3OR6C 3ZHQA 4GKKB 3VQYA 2GBOA 4YJ2A 2ZE6A 4LH6A 3AG2C 1G8MA 4JASA 1Q86W 2EIMB 2QWPB 3F7VC 1PD3A 5EZYB 2EZPA 4PV1B 4TV9A 3ZMSA 4DR5O 1YI2V 2QJ1A 5H6QA 4IYIA 1IDSA 3JASA 1V55C 4HNAA 2BCCH 3ABLC 3U10A 4GZRB 4DV0O 2ODMA 2WA4A 4IHJB 4BIUA 5KMGA 2GTAA 4PDMA 4YXWG 2JK5C 4DK1A 3SPHA 5LOVA 3K5NA 4MT8A 3CX5F 4K35A 2R9RB 3SPIA 3F5WC 1DGSA 1GAXA 1YXBA 5A2QN 4K8ZA 5FLXN 4TUYA 4LF9O 4DR4B 3ML0A 3N2GB 1LNQA 2IBZH 1I94B 4GX5A 3LDDA 1K34A 2B1GA 5B1BB 1VQ7V 3K79A 1WA8B 1MMMA 2V1DA 5J2TA 1XHXA 4PHZA 1NTZH 4LR3A 2VQEB 1HWYA 1MNGA 2ADQB 1F7YA 3UCSC 2XUMA 3STZC 5DECA 2GUZB 3WB2A 2ZCEA 2JEUA 2XHBA 2EIMC 2XT9A 1QCEA 1XILA 3OMNB 3DXRA 1WN7A 1HNWB 1KP2A 4EFEA 2F1MA 1K7DA 1KQSU 1SF9A 1P4RA 4ZOLB 1MZEA 1G4YB 2MW2B 5FPRA 5JQGB 1OCCC 4QE9A 4Z1VA 4B3SO 3M8AA 4UB6Z 4ZHQA 4YHHB 3CRRA 4I50B 1N4CA 3ABKC 1OV9A 3Q4HB 4J9ZB 4DR2O 4NB5A 4O4JB 4WFHA 2XAJA 4X66B 3SYAA 4JI3O 3JD2A 1NVPB 4JTAB 4BIZA 1HNZB 1FFXB 1QLEB 5B1BC 3W7UA 2PUSA 2ADPA 2A3QA 2QTOA 4JI5B 4DUYO 1S0VA 3N2GA 2XAQA 2ZQMA 2LGWA 1XEQA 4FLZA 5LGNA 4H33A 3UKMA 2R72A 3F5TA 3G6BA 1IVSA 1WA8A 3OTFA 4JPRA 2ITCC 4DV7B 5LMUB 2LJ2A 5LA6B 2VWJA 3AG1B 4GX2A 4YY3O 5BZBA 1WLEA 2GUZA 2PF4E 1SRYA 2LQTA 1QR8A 4J9YB 2XTAA 4LF5B 3RYFB 5CN0A 3APOA 4FIPC 4TOIA 3FYEB 2ZNIA 4J7JA 2OWOA 1ZX3A 1J95A 3CRCA 3IAYA 2LW7A 4B3MO 2Q0OC 5C93A 4LH7A 3ZRWB 1SS3A 5J2UB 4UCUA 4W4LA 5IJ0B 4FLXA 5JQGA 3EFFK 1Z2GA 2LW1A 1YHQV 2JDIG 5LYJB 2JS3A 1QLEC 3Q4HA 4I7ZB 3K5MA 5JH7B 5LXTB 1R6TA 3IFXA 3ETDA 3UQ8A 3H1HH 4DR1O 3T1HB 3L72H 5D5PA 3E83A 2ITDC 2P67A 4LFAO 2NN4A 4DV1B 5B66Z 2ZM6O 1SQQH 1Y74B 1N8RW 4DV3O 4PDRA 1Q81W 4UCVA 1BL8A 3B40A 2RNBA 3AG1C 1COWG 4W4KA 3SPGA 4MTGA 4WFFA 5D5QA 2KG7B 1H8HG 1N0JA 2YXHA 1M57B 3L75H 5LA6A 1J5EB 4YIPA 2RDCA 2QWQB 1E79G 1OCRC 1B04A 1R3KC 4IIJB 3MDSA 1FJGO 1PNLA 4OX9B 4JI6O 4CBCA 4JI7O 3RGBA 4NXNO 3ETQA 1QBZA 1BE3H 4JZGA 2ZINA 3RYFA 4TT3G 3J80N 3ABMB 3M7MX 3AK3A 3H1LH 2H8PC 3ZRWA 1FXHA 1CEZA 5KAIZ 2HKOA 2UXBB 5J2UA 5IJ0A 1KBHA 4FFBB 1E1RG 5KX5B 2XAGA 1M1KW 4DR6O 5LYJA 1WNSA 5L3DA 5ITZB 1U96A 2GSMB 3AG3C 5EIBC 3T1CA 5LXTA 4JI4O 2KQXA 2R9IA 2XNDG 2QWOB 2X6BA 3ZHSA 4CZZA 3LSSA 1P84F 5IJ9A 5TISZ 1SKVA 1DF5A 5EBWC 5IYZA 4X1KA 3L74H 1Y74A 1M57C 4O4HB 2ZT9B 3K03A 2UXCO 2HP8A 1ZL8B 4DO2A 5IYCO 4AILC 1WP7A 4WBNA 2AGAA 4DYLA 2WLKA 2KG7A 4DV0B 4CS3A 5BR8O 3G4SV 3SGIA 4KFMA 3JD1A 1XOUA 5BMVB 2ILMA 3OMIB 5EC1C 5IYDO 4LBEC 2Q8VA 2YIAA 3ABMC 2LFRA 4UCRA 4F4LA 3CSXA 4GLXA 2HEPA 2BE3A 4LF9B 1PV0A 4FLUA 1FS0G 1SC5B 1VIBA 5FL7G 1YTFD 4U3JA 1IXBA 3KCXA 3CC7V 4LP8A 3SJAC 3HKCB 4X64O 3NR7A 3D8CA 4RQFA 1PPJH 3K04A 3JAKB 2RMKB 5EYPB 3BPZA 3G6EV 4NTXA 3D36C 3CCVV 5JCOC 2IU3A 1S72V 2G38A 5KX5A 1N0NA 4O2BB 2AZ0A 5IY5B 1KYOF 1CXZB 3CXHF 2M6YA 2Q6AA 5LHGA 4B3RO 1I7FA 3SDLA 5CMUA 3WG7B 2QTSA 1I0HA 2DN9A 1X4TA 3FB5C 4D7TA 4ZBMA 1BMFG 2HVJC 4DW0A 2IW5A 4O4HA 1ZL8A 2BTOA 4B3SB 1BCCH 5AG2A 4XBFA 1K33A 3BRCA 2YIBA 5B3SB 4OGQB 5CA1B 1CP9A 4DV5O 1O9GA 5H6RA 2E5LO 1ENVA 5EK0A 5B1OA 2DWEC 2OCCC 3W7XA 2VS0A 2WSSG 2IJHA 1P7BA 4AI8A 4AQYO 3P30A 4ASUG 3E22A 1Z5WA 5B1NA 4DUYB 2CTWA 3CRAA 4FMTA 4NKGB 3HKCA 1GO3F 1RPOA 3A0BZ 2CH7B 1HP8A 4G28B 2CK3G 3JAKA 3ZBHA 5LHIA 3SJBC 3KKYA 1GMGA 5H2FZ 1Y4MA 3JASB 1QU7A 2RQ6A 2JS5A 3SYPA 5EYPA 1XREA 4JYYA 1L0LH 1I5XA 2YI9A 3NXSA 5JVDA 4YY3B 4O4LB 1K3EA 2ZKOA 5KUMA 3JSLA 3IC7A 5LOVB 4O2BA 4B08A 5L3BA 1VQMV 2WLMA 4GX0A 4CH5A 4NVPA 4H44B 5KA5A 3CC4V 4JI8O 3PJSK 2WPDG 3ZCCA 3TJTA 1AR1B 1RP3B 3DTUB 1JJOA 1PNKA 2HVKC 2NLJC 4P30A 3JAWB 2RN9A 4RUFA 3RYHB 4B3MB 5B3SC 1F4NA 4R6ZA 1LR1A 5E1AC 2EILB 1TUBB 3CCRV 4GKJO 1PL0A 3MHSC 1GK9A 1NBMG 2Q5ZA 4TSFG 1A32A 3RT3C 1SQXH 2YIDA 4I9WA 1HNXO 5CA1A 3E89A 4DR1B 1XNRO 2A0LA 2EBOA 1GTOA 4Q20A 2P6JA 2XASA 3A0HZ 3DXRB 2A7WA 4LFAB 4X1IB 2Q7EA 1N36O 4MS2A 4JI0O 1JR9A 2IH3C 4FM2A 3J7AU 4RAIA 2ZM6B 4TV8A 2Q9LA 1SZTA 1AI6A 1UFIA 2QM8A 4DV3B 3HB3B 2QWRB 4MTOA 3X2QB 2HJDA 4LCUC 3VQWA 2QE7G 1G6UA 2CH7A 3E8BA 4ZHQB 4GUNA 2HLDG 1EN6A 4MVOA 3CRQA 4O4LA 3HKDB 3JATA 1FJGB 4JI6B 3ZMUA 1K4CC 4PD4F 4DR3O 4JI7B 4NXNB 3QNEA 3S3XA 3G80A 2EILC 2DMXA 3ZMVA 4YJ3B 3AG7A 4U7OA 5LP6A 4NR1A 1Q90D 4RO2A 1K4DC 4QNHB 1K92A 2UXXA 3JAWA 1JQ0A 3OMAB 3RYHA 2GTSA 2BOBC 1TUBA 4I0XA 4XDKA 1SA0B 2YIBD 5IYBO 1VMGA 4DR6B 3F7YC 2FB5A 1BT8A 4LF8O 1X59A 2VQFO 3STLC 2GDSA 1QLNA 4JI4B 4X65B 1RPRA 3UO3A 3U11A 4C7UA 3X2QC 5KHIA 4FVMA 1HR0O 1JA8A 1OHHG 4X1IA 2EZOA 1NR7A 3FD9A 4P9PA 1YTFB 3QF7A 4UVBA 2H3OA 1H2MA 1LUVA 2C2AA 1AP6A 1QVFU 2UXCB 3HR0A 2R70A 4B7KA 3GVMA 1VEWA 3CRMA 1VQPV 4GX1A 2F23A 2Y69B 1BHBA 3CCQV 3E2EA 4LFBB 4LFCO 1N33O 3KCYA 1WAZA 3LSQA 4DV6O 4FZ1A 4P2ZA 5L3CA 2JGDA 2YICA 2CUGA 2Q7HA 3OAAG 5BR8B 4Q6GA 3CMEV 1H2KA 1H2SB 3LDCA 1S5JA 3CXCU 3HKDA 1NTMH 1SQVH 1DTOA 1RSOB 3RYCA 5CBFA 3WFVA 4DRXB 3I56V 2JIZG 1FYJA 1VQLV 4UUJC 3T4DA 4UCSA 4F6RB 4X62O 1D2DA 3ZRSA 4YJ3A 1XL6A 3SPJA 3CB2A 3ZN0A 2W6JG 4X64B 1UPGA 1EFRG 1OJHA 1YSCA 1F4MA 5GW7A 1D5AA 2DYRB 4JYCA 2DQ0A 1W0KG 1YDXA 1S5LZ 4K0KO 4B3TO 1SA0A 3RFRA 3CWBH 1YITV 1WPBA 3CYOA 5B5EZ 1Q5OA 1YJ9V 4PA3A 4WF9V 1VQNV 3VQVA 2F4VO 1EN5A 1SESA 4QGPA 4B3RB 4JV5O 2Y69C 4R7CA 2EJ7A 3BA8A 2ARHA 4JAUA 2UXDO 4NYKA 3E35A 1JFFB 2IH1C 4CH3A 3K0DA 3K08A 1SQFA 2YEVB 2UUCO 2PI4A 2HHHO 2P22C 2QSAA 1LUWA 3RVYA 2P7TC 3BHPA 1AVMA 4IT5A 4LF4O 3WU2Z 2UU9B 3B8NA 1M9NA 4DV5B 1NTKH 2V4DA 2P90A 4A5UB 2E5LB 2YXYA 3K9SA 4PA4A 1RSOA 4MVQA 4DRXA 5IJ9B 3JD4A 4JYBA 2YUAA 3THOA 4CH4A 2DYRC 1XBLA 5IYZB 5H5NA 4AQYB 4X1KB 4F6RA 1B06A 2HFEC 3CCSV 5LBQA 1Q7YW 1Z5VA 1AB3A 1IBMO 5DN6G 2YC0A 4MTXA 4H13B 4FJCC 4QE7A 2EJRA 2A79B 3G71V 1EZJA 4WBNB 4BW9A 3T2MA 4JI1O 1AJPA 2WLHA 3AK2A 3QG5A 2WLLA 2OCHA 1K9MW 3SJQC 3WB1A 1VQKV 1XNQO 2F95B 4UV8A 2LGQA 1NH2B 5JJNB 1MABG 2FTKA 5J9PC 3H1JH 3K59A 4FLTA 3ZHUA 1N32O 4JI8B 3QTCA 1QQCA 5IWAO 4U3JB 3TCUA 4PA7A 3UT5A 1PL4A 1WB7A 1K5QA 3C3SA 2KSDA 1I08A 2CGOA 3CEIA 1JFFA 4NTYA 3L73H 1E1QG 1Q43A 2DQ3A 4F6EA 4GKJB 1SQPH 2PI5A 1XL4A 1YVWA 2YEVA 1ZAUA 4JYAO 3A0RA 1O9HA 1R1BA 2B9ZA 2ZD9A 4OPHA 2UXNA 2VRZA 2Y0IA 4PDLA 1HNXB 1VQ5V 3VBBA 4UVCA 1BSMA 1XNRB 4AHCA 4X65O 2ZIOA 1XHZA 3D3QA 4R50A 1N36B 1B6QA 1L1FA 1MA1A 2NR5A 2K9PA 4JI0B 1GKFA 2Z3YA 4UCTA 2FL4A 1WPXA 3B09A 4J10A 2YSUB 3CS5A 1FD9A 4FZ0A 1MOFA 1PNMA 4LFBO 1RM1B 1I5YA 4PA9A 3CE2A 2DJVA 3ABTA 4J7ZA 1V54B 4JI2O 5LL6Y 1IX9A 5E79Z 1MSWD 2XAFA 3ZHRA 4FLVA 2EIKB 3ZIAG 2UUBO 1FKAO 1TA8A 4MW8A 1VQ8V 2RCVA 4DR3B 1GN3A 1YCIA 3OE7G 4HBNA 2AXTZ 3DC6A 4RWUA 4EB6A 3E22B 2P5OA 1GRJA 5EC2C 4I55B 1JVMA 1FPOA 2BSKB 2CTPA 3HKBB 2Z5UA 3EHBB 4DW1A 5GTIZ 3HKEB 3FAVB 2QWNB 1TUEB 2Q68A 1B3QA 4D7SA 3IGAC 1KB9F 5JVDB 4L87A 4MVSA 3RBZA 2Y4TA 1URFA 4LF8B 2VQFB 1QHTA 1S77D 5B1AB 3GB7C 4HYOA 3P3NA 3JCZA 2UUAO 1HR0B 2HG5C 3K0GA 3ZJZA 1Q82W 1FAFA 2W0XA 2KKWA 4WFBV 2Q69A 1RM1C 1N34O 3K06A 2OYQA 2N04A 1DF4A 4I5SA 3ETGA 4YIOA 1GM7A 1H2LA 2E3CA 2JVDA 2LO1A 1NU1H 1TVKB 2EIKC 3UM7A 2E76B 2N05A 1H38A 4LFCB 3CCEV 1N33B 3OM3B 4DV6B 1IURA 4J80A 3HPLC 4J41A 2UU9O 3ZX6A 2P4VA 5IE9A 2QKSA 2X6CA 3VOUA 5JJJB 1QVGU 1AI4A 1KD1W 4IL6Z 2GHYA 3ETEA 1W2BU 2W0FC 3E8HA 3OGIB 4GYCB 1JOYA 5CBHA 2WLIB 4TV8B 4X62B 2Y0PA 5LGUA 3J81N 1IBLO 4G27B 1Q3EA 4I55A 2BSKA 1GN6A 4ZI7B 3CCLV 4FLYA 4WFGA 4JF3A 3SPCA 4ZIBA 4MSWC 1KUQA 3HKBA 2Q73A 2VWKA 4DV4O 3TXQA 4K8XA 3HKEA 3FAVA 2BTQB 5B1AC 1KECA 4FK5C 3B77A 5IY5C 3EVKA 1AP5A 4KXRA 3P32A 4K0KB 4B3TB 1BQZA 1AJQA 1QNMA 3S3WA 4Z2WA 3JATB 3WG7C 1US6A 5L3GA 3ABUA 3JARB 4HAMA 3CCUV 2WLNA 3LSUA 3DC5A 1XMQO 1TAEA 2F4VB 2F93B 5GTHZ 3OW2U 1YIJV 4JV5B 5HFMA 4UCOA 5LP6B 3C90A 4H0LB 1EZVH 2UXDB 1FXVA 1PKXA 1R3LC 5FNVB 2EINB 1D5NA 2B1IA 4BWAA 1K8AW 2IJJA 5K1XA 3K9AA 4JTCB 2OT5A 1TVKA 5F2VO 4I0XB 2JEXA 2UUCB 2CE4A 3RW0A 2HHHB 1S3JA 1T5EA 4LF4B 1NH2D 3CMAV 2B5UA 1SQBH 3JALA 3N2KB 2QDOA 3TGUH 3T1YO 3JD0A 3OTOO 5CA0B 1R6NA 2Y4UA 3OUFA 2P06A 2V7QG 3DSQA 3SR2C 2WLIA 1BZKA 3BAAA 3KZIZ 1IBMB 3E8FA 4X20B 4J11A 1YEWA 4ZI7A 1G1XB 4DR7O 1RFYA 1PM9A 1M93A 1M56B 2BTQA 3JCUZ 4NXMO 1Q6IA 1VF6C 3L71H 4JI1B 1KC8W 3ZRVA 4IYHA 4X8AA 3MHHC 3CCMV 2K1EA 3AG4B 2JGDB 1JX9A 2QEXV 3L9DA 2AZ2A 1XNQB 1XMOO 1K5SA 5LP6C 2CGNA 1VQOV 3JYCA 3H1KH 2H94A 3RYCB 1XDCA 3JARA 2QR4A 3H1IH 1S76D 3BCCH 3FFQA 4LNUB 2EINC 3G67A 1VF6A 2ZXWB 1N32B 5KLVH 1M4UA 3OD4A 4MVUA 5IWAB 1JPXA 2F66C 4JTDB 3APQA 1Y76B 2QKCA 4PI2A 5FNVA 1OCCB 3LDEA 4FM1A 1WB8A 2PGGA 3CJHB 3R66A 4KHPO 1YZBA 3QO7A 4H37A 4E4EA 4BW5A 3ABKB 1U97A 1HDJA 3QO8A 1Y6XA 2XOKG 1BQ0A 5KHGA 4JYAB 2M7WA 4RQEA 4EEQA 5LMNO 3LNMB 4K3AA 4IGGA 3H9VA 4LWSB 3K58A 2QM7A 4LF6O 3N2KA 5HFLA 2DYSB 1KKCA 3CPWU 5CA0A 1SZXA 1M56C 2N74A 3K57A 2LP7A 3CCJV 2EX3A 3AG4C 2WLJA 4DK0A 4X20A 4CS2A 1V9PA 1ROPA 2IU0A 4HZ3A 1PP9H 4GCZA 4KL1A 3CC2V 1W0JG 4CS4A 2ZXWC 4JI2B 3ZHTA 2YXLA 5IT9N 1MZFA 4DUZO 2DOSA 2FMLA 2Q4PA 3I5DA 3ZEDA 4LF7O 2UUBB 1KKDA 1S5HC 1H2GA 5EZYA 3SYOA 1K73W 5DM6V 4EFBA 1OZ0A 4DV2B 4LNUA 3TK1A 4QIWF 3OEEG 1AILA 1SQGA 4G2KA 5CB4B 3AK1A 2AW9A 5DEDA 3FKSG 1JJ2U 1VARA 4IHJA 3OR7C 4KP4A 3RYIB 1JMKC 2ZDIC 3CHXA 1Y76A 5JWPA 3CJHA 1F51A 1BHAA 4EKWA 3A2FA 4D6TH 2X6AA 4NTWA 4FLWA 2X7RB 1YJNV 2WLLB 2IM9A 2OIGA 5GONB 3C3TA 4X89A 5C8YB 1ZLZA 2DYSC 2L35A 2CTQA 1L8DA 2ZDIA 1GM9A 4R8CA 4X1YB 4LWSA 1AJNA 2ZIMA 2HJFC 3I55V 1EBOA 1OCZB 1IBKO 1DLBA 2UUAB 1VQ6V 2ZE7A 1VP7A 1F23A 5L3FA 1VF7A 3UT5B 1N34B 4PELA 1NS1A 2ZE8A 1Y67A 2R9AA 4UVAA 3JSNA 2MK3A 4QPKA 5JJEB 4MVMA 3ASNB 2JRIA 1OCRB 1R3JC 2HR3A 2ZE5A 1ZTEA 3MAQA 3SYQA 4CC6A 4RUEA 4ZOLA 2ZNJA 3QO5A 2Q0AA 1NJIW 4JZ2A 4ABMA 3P3PA 4FPPA 1ZWIC 3K3WA 1AR5A 3FX7A 3BEHA 1WP8A 2WWWA 4I50A 5CB4A 2AHZA 4I9QA 1BS3A 3ZN1A 2OTJV 1IBLB 1HW7A 2EULA 2BOCC 3OT7A 1H2NA 4O4JA 2QA4V 3RVZA 3RYIA 1YJWV 1R73A 4FFKA 4PI0A 1R3IC 4DV4B 3A8TA 4CH6A 4GKKO 3ZS8C 3U0ZA 3KG2A 4B7EA 2D2CB 1OCZC 1NQTA 1FFXA 3H01A 4JAVA
chains in the Genus database with same CATH topology
2OIEA 2YXHA 1VMGA 3CRAA 2A7WA 4QGPA 2P06A 2Q73A 2GTAA 5IE9A 2OIGA 2Q9LA 2Q5ZA 1YVWA 3CRCA 3C90A 2A3QA 1YXBA 1Y6XA 2Q4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OIE A;  2YXH A;  1VMG A;  3CRA A;  2A7W A;  4QGP A;  2P06 A;  2Q73 A;  2GTA A;  5IE9 A;  2OIG A;  2Q9L A;  2Q5Z A;  1YVW A;  3CRC A;  3C90 A;  2A3Q A;  1YXB A;  1Y6X A;  2Q4P A; 
#chains in the Genus database with same CATH topology
 4X88 A;  5GON A;  3AG3 B;  5C8Y A;  2YS8 A;  1AR4 A;  3ZMT A;  3JD3 A;  4X1Y A;  1SER A;  2IJK A;  1NT2 B;  1XMQ B;  1KP3 A;  1ORQ C;  3O9O A;  1XQ8 A;  3VQX A;  1OCO B;  2OTL V;  5EBM C;  1FXK B;  4EB6 B;  4WCE V;  2W6I G;  1Q8I A;  1THZ A;  3QVN A;  3ZHV A;  3ASN C;  4MVR A;  1M90 W;  2A06 H;  3ICX A;  3E86 A;  4WFA V;  2PZS A;  4LC1 A;  1XUQ A;  3N27 A;  4DR4 O;  5KUK A;  3ZRX A;  2E74 B;  2A9H A;  4UB8 Z;  5CBG A;  1L0N H;  4OPA A;  4U3F H;  2DWD C;  4MVZ A;  1KMI Z;  1I94 O;  2FKX A;  3W7W A;  3T1Y B;  1CPY A;  2YI8 A;  3TET A;  2WAM A;  3OTO B;  3W7S A;  1VQ9 V;  4O2A B;  2PY5 A;  2VQE O;  3FYI B;  4Z1M G;  4ZKI A;  2WA3 A;  3CD6 V;  4O4I B;  2O57 A;  2CDY A;  3W7T A;  1MSD A;  2FYU H;  5LHH A;  5JH7 A;  3JAM N;  3AEI A;  1Y66 A;  4DR7 B;  3MD0 A;  2KB1 A;  4NXM B;  1ARO P;  1GM8 A;  3WB0 A;  2L6L A;  4BR6 A;  1HNW O;  1SET A;  2QM4 A;  1OCO C;  1NI8 A;  4J7K A;  1FXK C;  3LNN A;  1XMO B;  3B8M A;  1GN4 A;  4ICG A;  4PDV A;  4DR5 B;  1AI5 A;  2X0L A;  4DV2 O;  3SJC C;  2Y48 A;  1W59 A;  3OEH G;  4QJF B;  1FXK A;  4YHH O;  1DK1 A;  1JCH A;  2JJ1 G;  1P49 A;  4E2L A;  3IJ4 A;  5LGT A;  2ATK C;  1GH6 A;  3OFN G;  4IIJ A;  4X66 O;  4KHP B;  3IC9 A;  1YF2 A;  3E8G A;  3EXA A;  5K1P A;  1HNZ O;  1R6K A;  2CAZ C;  3SYC A;  4JI5 O;  4OXS A;  5LMN B;  3M99 B;  4J42 A;  2EIJ B;  2OCC B;  4LF6 B;  1M5I A;  3BFR A;  3BVO A;  4N21 A;  2XAH A;  4FFB A;  3GWK C;  1K97 A;  5LMU O;  3T4Z A;  3PN1 A;  4DV7 O;  4O2A A;  1VQ4 V;  4WFE A;  4TQD A;  3ASO B;  1TGO A;  3K5O A;  1KU9 A;  4N23 A;  2PYJ A;  1P7G A;  1V54 C;  3RN4 A;  5A9G A;  4O4I A;  3L70 H;  5ITZ A;  1QR9 A;  5IDJ A;  4PA6 A;  2NNU A;  1NVP D;  1NKD A;  3D36 A;  4I4T B;  4LF5 O;  5JCO A;  2LFS A;  2JGU A;  4XDL A;  2ZR3 A;  3TXS A;  4JAA A;  4DUZ B;  1IXM A;  3FB6 C;  4TWK A;  3JAL B;  4LF7 B;  3RWR D;  1VF5 B;  3R65 A;  4X9Q A;  1EN4 A;  4MTF A;  1NZ6 A;  2F43 G;  2ZR2 A;  1GN2 A;  2CTR A;  3D3I A;  1H8E G;  2ETN A;  4DR2 B;  3BY6 A;  3GWO A;  5CA3 A;  4BAY A;  1UJW B;  2Q7G A;  5BMV A;  1MG1 A;  3T1H O;  2EIJ C;  4JI3 B;  4YJ2 B;  2YDE A;  4DV1 O;  1XI1 A;  4MW3 A;  4GT1 A;  1Q6H A;  3ASO C;  1Q6U A;  4TV9 B;  5L3E A;  5KA6 A;  3FB8 C;  1IBK B;  1ZUQ A;  5FPO A;  2Z0A A;  4HNA B;  3AG2 B;  4QPJ A;  5KMG B;  1BGY H;  4KUM A;  2JJ2 G;  3DGE A;  3OGC C;  1J5E O;  3K5L A;  3BA9 A;  3ZMZ A;  2PYL A;  5H9C A;  2OIE A;  4OX9 O;  2Q67 A;  2GV9 A;  5BXZ A;  2QKA A;  3BAB A;  2DE0 X;  1V55 B;  2D3O W;  4TQF A;  3ABL B;  5EBL C;  4DXW A;  3B2E E;  4TUY B;  4UXN A;  5KHH A;  1WJZ A;  3OUS A;  4I4T A;  3O65 A;  1FFT B;  4FM0 A;  5EIB D;  2IJI A;  2P4K A;  4UV9 A;  2E75 B;  1NR1 A;  3UO2 A;  5BY1 A;  2QGN A;  1ZSP A;  4UFZ A;  1EM1 A;  2RJZ A;  4CC5 A;  5J2T B;  3CP1 A;  4XDJ A;  2UXB O;  4PJ0 Z;  5KAF Z;  2AHY A;  4BIO A;  3FB7 C;  5KHJ A;  4L8J A;  3LUT B;  4U7N A;  5KHK A;  4P9O A;  2PTM A;  3B4S A;  2DW4 A;  1AI7 A;  4JGS A;  1IZ3 A;  3OR6 C;  3ZHQ A;  4GKK B;  3VQY A;  2GBO A;  4YJ2 A;  2ZE6 A;  4LH6 A;  3AG2 C;  1G8M A;  4JAS A;  1Q86 W;  2EIM B;  2QWP B;  3F7V C;  1PD3 A;  5EZY B;  2EZP A;  4PV1 B;  4TV9 A;  3ZMS A;  4DR5 O;  1YI2 V;  2QJ1 A;  5H6Q A;  4IYI A;  1IDS A;  3JAS A;  1V55 C;  4HNA A;  2BCC H;  3ABL C;  3U10 A;  4GZR B;  4DV0 O;  2ODM A;  2WA4 A;  4IHJ B;  4BIU A;  5KMG A;  2GTA A;  4PDM A;  4YXW G;  2JK5 C;  4DK1 A;  3SPH A;  5LOV A;  3K5N A;  4MT8 A;  3CX5 F;  4K35 A;  2R9R B;  3SPI A;  3F5W C;  1DGS A;  1GAX A;  1YXB A;  5A2Q N;  4K8Z A;  5FLX N;  4TUY A;  4LF9 O;  4DR4 B;  3ML0 A;  3N2G B;  1LNQ A;  2IBZ H;  1I94 B;  4GX5 A;  3LDD A;  1K34 A;  2B1G A;  5B1B B;  1VQ7 V;  3K79 A;  1WA8 B;  1MMM A;  2V1D A;  5J2T A;  1XHX A;  4PHZ A;  1NTZ H;  4LR3 A;  2VQE B;  1HWY A;  1MNG A;  2ADQ B;  1F7Y A;  3UCS C;  2XUM A;  3STZ C;  5DEC A;  2GUZ B;  3WB2 A;  2ZCE A;  2JEU A;  2XHB A;  2EIM C;  2XT9 A;  1QCE A;  1XIL A;  3OMN B;  3DXR A;  1WN7 A;  1HNW B;  1KP2 A;  4EFE A;  2F1M A;  1K7D A;  1KQS U;  1SF9 A;  1P4R A;  4ZOL B;  1MZE A;  1G4Y B;  2MW2 B;  5FPR A;  5JQG B;  1OCC C;  4QE9 A;  4Z1V A;  4B3S O;  3M8A A;  4UB6 Z;  4ZHQ A;  4YHH B;  3CRR A;  4I50 B;  1N4C A;  3ABK C;  1OV9 A;  3Q4H B;  4J9Z B;  4DR2 O;  4NB5 A;  4O4J B;  4WFH A;  2XAJ A;  4X66 B;  3SYA A;  4JI3 O;  3JD2 A;  1NVP B;  4JTA B;  4BIZ A;  1HNZ B;  1FFX B;  1QLE B;  5B1B C;  3W7U A;  2PUS A;  2ADP A;  2A3Q A;  2QTO A;  4JI5 B;  4DUY O;  1S0V A;  3N2G A;  2XAQ A;  2ZQM A;  2LGW A;  1XEQ A;  4FLZ A;  5LGN A;  4H33 A;  3UKM A;  2R72 A;  3F5T A;  3G6B A;  1IVS A;  1WA8 A;  3OTF A;  4JPR A;  2ITC C;  4DV7 B;  5LMU B;  2LJ2 A;  5LA6 B;  2VWJ A;  3AG1 B;  4GX2 A;  4YY3 O;  5BZB A;  1WLE A;  2GUZ A;  2PF4 E;  1SRY A;  2LQT A;  1QR8 A;  4J9Y B;  2XTA A;  4LF5 B;  3RYF B;  5CN0 A;  3APO A;  4FIP C;  4TOI A;  3FYE B;  2ZNI A;  4J7J A;  2OWO A;  1ZX3 A;  1J95 A;  3CRC A;  3IAY A;  2LW7 A;  4B3M O;  2Q0O C;  5C93 A;  4LH7 A;  3ZRW B;  1SS3 A;  5J2U B;  4UCU A;  4W4L A;  5IJ0 B;  4FLX A;  5JQG A;  3EFF K;  1Z2G A;  2LW1 A;  1YHQ V;  2JDI G;  5LYJ B;  2JS3 A;  1QLE C;  3Q4H A;  4I7Z B;  3K5M A;  5JH7 B;  5LXT B;  1R6T A;  3IFX A;  3ETD A;  3UQ8 A;  3H1H H;  4DR1 O;  3T1H B;  3L72 H;  5D5P A;  3E83 A;  2ITD C;  2P67 A;  4LFA O;  2NN4 A;  4DV1 B;  5B66 Z;  2ZM6 O;  1SQQ H;  1Y74 B;  1N8R W;  4DV3 O;  4PDR A;  1Q81 W;  4UCV A;  1BL8 A;  3B40 A;  2RNB A;  3AG1 C;  1COW G;  4W4K A;  3SPG A;  4MTG A;  4WFF A;  5D5Q A;  2KG7 B;  1H8H G;  1N0J A;  2YXH A;  1M57 B;  3L75 H;  5LA6 A;  1J5E B;  4YIP A;  2RDC A;  2QWQ B;  1E79 G;  1OCR C;  1B04 A;  1R3K C;  4IIJ B;  3MDS A;  1FJG O;  1PNL A;  4OX9 B;  4JI6 O;  4CBC A;  4JI7 O;  3RGB A;  4NXN O;  3ETQ A;  1QBZ A;  1BE3 H;  4JZG A;  2ZIN A;  3RYF A;  4TT3 G;  3J80 N;  3ABM B;  3M7M X;  3AK3 A;  3H1L H;  2H8P C;  3ZRW A;  1FXH A;  1CEZ A;  5KAI Z;  2HKO A;  2UXB B;  5J2U A;  5IJ0 A;  1KBH A;  4FFB B;  1E1R G;  5KX5 B;  2XAG A;  1M1K W;  4DR6 O;  5LYJ A;  1WNS A;  5L3D A;  5ITZ B;  1U96 A;  2GSM B;  3AG3 C;  5EIB C;  3T1C A;  5LXT A;  4JI4 O;  2KQX A;  2R9I A;  2XND G;  2QWO B;  2X6B A;  3ZHS A;  4CZZ A;  3LSS A;  1P84 F;  5IJ9 A;  5TIS Z;  1SKV A;  1DF5 A;  5EBW C;  5IYZ A;  4X1K A;  3L74 H;  1Y74 A;  1M57 C;  4O4H B;  2ZT9 B;  3K03 A;  2UXC O;  2HP8 A;  1ZL8 B;  4DO2 A;  5IYC O;  4AIL C;  1WP7 A;  4WBN A;  2AGA A;  4DYL A;  2WLK A;  2KG7 A;  4DV0 B;  4CS3 A;  5BR8 O;  3G4S V;  3SGI A;  4KFM A;  3JD1 A;  1XOU A;  5BMV B;  2ILM A;  3OMI B;  5EC1 C;  5IYD O;  4LBE C;  2Q8V A;  2YIA A;  3ABM C;  2LFR A;  4UCR A;  4F4L A;  3CSX A;  4GLX A;  2HEP A;  2BE3 A;  4LF9 B;  1PV0 A;  4FLU A;  1FS0 G;  1SC5 B;  1VIB A;  5FL7 G;  1YTF D;  4U3J A;  1IXB A;  3KCX A;  3CC7 V;  4LP8 A;  3SJA C;  3HKC B;  4X64 O;  3NR7 A;  3D8C A;  4RQF A;  1PPJ H;  3K04 A;  3JAK B;  2RMK B;  5EYP B;  3BPZ A;  3G6E V;  4NTX A;  3D36 C;  3CCV V;  5JCO C;  2IU3 A;  1S72 V;  2G38 A;  5KX5 A;  1N0N A;  4O2B B;  2AZ0 A;  5IY5 B;  1KYO F;  1CXZ B;  3CXH F;  2M6Y A;  2Q6A A;  5LHG A;  4B3R O;  1I7F A;  3SDL A;  5CMU A;  3WG7 B;  2QTS A;  1I0H A;  2DN9 A;  1X4T A;  3FB5 C;  4D7T A;  4ZBM A;  1BMF G;  2HVJ C;  4DW0 A;  2IW5 A;  4O4H A;  1ZL8 A;  2BTO A;  4B3S B;  1BCC H;  5AG2 A;  4XBF A;  1K33 A;  3BRC A;  2YIB A;  5B3S B;  4OGQ B;  5CA1 B;  1CP9 A;  4DV5 O;  1O9G A;  5H6R A;  2E5L O;  1ENV A;  5EK0 A;  5B1O A;  2DWE C;  2OCC C;  3W7X A;  2VS0 A;  2WSS G;  2IJH A;  1P7B A;  4AI8 A;  4AQY O;  3P30 A;  4ASU G;  3E22 A;  1Z5W A;  5B1N A;  4DUY B;  2CTW A;  3CRA A;  4FMT A;  4NKG B;  3HKC A;  1GO3 F;  1RPO A;  3A0B Z;  2CH7 B;  1HP8 A;  4G28 B;  2CK3 G;  3JAK A;  3ZBH A;  5LHI A;  3SJB C;  3KKY A;  1GMG A;  5H2F Z;  1Y4M A;  3JAS B;  1QU7 A;  2RQ6 A;  2JS5 A;  3SYP A;  5EYP A;  1XRE A;  4JYY A;  1L0L H;  1I5X A;  2YI9 A;  3NXS A;  5JVD A;  4YY3 B;  4O4L B;  1K3E A;  2ZKO A;  5KUM A;  3JSL A;  3IC7 A;  5LOV B;  4O2B A;  4B08 A;  5L3B A;  1VQM V;  2WLM A;  4GX0 A;  4CH5 A;  4NVP A;  4H44 B;  5KA5 A;  3CC4 V;  4JI8 O;  3PJS K;  2WPD G;  3ZCC A;  3TJT A;  1AR1 B;  1RP3 B;  3DTU B;  1JJO A;  1PNK A;  2HVK C;  2NLJ C;  4P30 A;  3JAW B;  2RN9 A;  4RUF A;  3RYH B;  4B3M B;  5B3S C;  1F4N A;  4R6Z A;  1LR1 A;  5E1A C;  2EIL B;  1TUB B;  3CCR V;  4GKJ O;  1PL0 A;  3MHS C;  1GK9 A;  1NBM G;  2Q5Z A;  4TSF G;  1A32 A;  3RT3 C;  1SQX H;  2YID A;  4I9W A;  1HNX O;  5CA1 A;  3E89 A;  4DR1 B;  1XNR O;  2A0L A;  2EBO A;  1GTO A;  4Q20 A;  2P6J A;  2XAS A;  3A0H Z;  3DXR B;  2A7W A;  4LFA B;  4X1I B;  2Q7E A;  1N36 O;  4MS2 A;  4JI0 O;  1JR9 A;  2IH3 C;  4FM2 A;  3J7A U;  4RAI A;  2ZM6 B;  4TV8 A;  2Q9L A;  1SZT A;  1AI6 A;  1UFI A;  2QM8 A;  4DV3 B;  3HB3 B;  2QWR B;  4MTO A;  3X2Q B;  2HJD A;  4LCU C;  3VQW A;  2QE7 G;  1G6U A;  2CH7 A;  3E8B A;  4ZHQ B;  4GUN A;  2HLD G;  1EN6 A;  4MVO A;  3CRQ A;  4O4L A;  3HKD B;  3JAT A;  1FJG B;  4JI6 B;  3ZMU A;  1K4C C;  4PD4 F;  4DR3 O;  4JI7 B;  4NXN B;  3QNE A;  3S3X A;  3G80 A;  2EIL C;  2DMX A;  3ZMV A;  4YJ3 B;  3AG7 A;  4U7O A;  5LP6 A;  4NR1 A;  1Q90 D;  4RO2 A;  1K4D C;  4QNH B;  1K92 A;  2UXX A;  3JAW A;  1JQ0 A;  3OMA B;  3RYH A;  2GTS A;  2BOB C;  1TUB A;  4I0X A;  4XDK A;  1SA0 B;  2YIB D;  5IYB O;  1VMG A;  4DR6 B;  3F7Y C;  2FB5 A;  1BT8 A;  4LF8 O;  1X59 A;  2VQF O;  3STL C;  2GDS A;  1QLN A;  4JI4 B;  4X65 B;  1RPR A;  3UO3 A;  3U11 A;  4C7U A;  3X2Q C;  5KHI A;  4FVM A;  1HR0 O;  1JA8 A;  1OHH G;  4X1I A;  2EZO A;  1NR7 A;  3FD9 A;  4P9P A;  1YTF B;  3QF7 A;  4UVB A;  2H3O A;  1H2M A;  1LUV A;  2C2A A;  1AP6 A;  1QVF U;  2UXC B;  3HR0 A;  2R70 A;  4B7K A;  3GVM A;  1VEW A;  3CRM A;  1VQP V;  4GX1 A;  2F23 A;  2Y69 B;  1BHB A;  3CCQ V;  3E2E A;  4LFB B;  4LFC O;  1N33 O;  3KCY A;  1WAZ A;  3LSQ A;  4DV6 O;  4FZ1 A;  4P2Z A;  5L3C A;  2JGD A;  2YIC A;  2CUG A;  2Q7H A;  3OAA G;  5BR8 B;  4Q6G A;  3CME V;  1H2K A;  1H2S B;  3LDC A;  1S5J A;  3CXC U;  3HKD A;  1NTM H;  1SQV H;  1DTO A;  1RSO B;  3RYC A;  5CBF A;  3WFV A;  4DRX B;  3I56 V;  2JIZ G;  1FYJ A;  1VQL V;  4UUJ C;  3T4D A;  4UCS A;  4F6R B;  4X62 O;  1D2D A;  3ZRS A;  4YJ3 A;  1XL6 A;  3SPJ A;  3CB2 A;  3ZN0 A;  2W6J G;  4X64 B;  1UPG A;  1EFR G;  1OJH A;  1YSC A;  1F4M A;  5GW7 A;  1D5A A;  2DYR B;  4JYC A;  2DQ0 A;  1W0K G;  1YDX A;  1S5L Z;  4K0K O;  4B3T O;  1SA0 A;  3RFR A;  3CWB H;  1YIT V;  1WPB A;  3CYO A;  5B5E Z;  1Q5O A;  1YJ9 V;  4PA3 A;  4WF9 V;  1VQN V;  3VQV A;  2F4V O;  1EN5 A;  1SES A;  4QGP A;  4B3R B;  4JV5 O;  2Y69 C;  4R7C A;  2EJ7 A;  3BA8 A;  2ARH A;  4JAU A;  2UXD O;  4NYK A;  3E35 A;  1JFF B;  2IH1 C;  4CH3 A;  3K0D A;  3K08 A;  1SQF A;  2YEV B;  2UUC O;  2PI4 A;  2HHH O;  2P22 C;  2QSA A;  1LUW A;  3RVY A;  2P7T C;  3BHP A;  1AVM A;  4IT5 A;  4LF4 O;  3WU2 Z;  2UU9 B;  3B8N A;  1M9N A;  4DV5 B;  1NTK H;  2V4D A;  2P90 A;  4A5U B;  2E5L B;  2YXY A;  3K9S A;  4PA4 A;  1RSO A;  4MVQ A;  4DRX A;  5IJ9 B;  3JD4 A;  4JYB A;  2YUA A;  3THO A;  4CH4 A;  2DYR C;  1XBL A;  5IYZ B;  5H5N A;  4AQY B;  4X1K B;  4F6R A;  1B06 A;  2HFE C;  3CCS V;  5LBQ A;  1Q7Y W;  1Z5V A;  1AB3 A;  1IBM O;  5DN6 G;  2YC0 A;  4MTX A;  4H13 B;  4FJC C;  4QE7 A;  2EJR A;  2A79 B;  3G71 V;  1EZJ A;  4WBN B;  4BW9 A;  3T2M A;  4JI1 O;  1AJP A;  2WLH A;  3AK2 A;  3QG5 A;  2WLL A;  2OCH A;  1K9M W;  3SJQ C;  3WB1 A;  1VQK V;  1XNQ O;  2F95 B;  4UV8 A;  2LGQ A;  1NH2 B;  5JJN B;  1MAB G;  2FTK A;  5J9P C;  3H1J H;  3K59 A;  4FLT A;  3ZHU A;  1N32 O;  4JI8 B;  3QTC A;  1QQC A;  5IWA O;  4U3J B;  3TCU A;  4PA7 A;  3UT5 A;  1PL4 A;  1WB7 A;  1K5Q A;  3C3S A;  2KSD A;  1I08 A;  2CGO A;  3CEI A;  1JFF A;  4NTY A;  3L73 H;  1E1Q G;  1Q43 A;  2DQ3 A;  4F6E A;  4GKJ B;  1SQP H;  2PI5 A;  1XL4 A;  1YVW A;  2YEV A;  1ZAU A;  4JYA O;  3A0R A;  1O9H A;  1R1B A;  2B9Z A;  2ZD9 A;  4OPH A;  2UXN A;  2VRZ A;  2Y0I A;  4PDL A;  1HNX B;  1VQ5 V;  3VBB A;  4UVC A;  1BSM A;  1XNR B;  4AHC A;  4X65 O;  2ZIO A;  1XHZ A;  3D3Q A;  4R50 A;  1N36 B;  1B6Q A;  1L1F A;  1MA1 A;  2NR5 A;  2K9P A;  4JI0 B;  1GKF A;  2Z3Y A;  4UCT A;  2FL4 A;  1WPX A;  3B09 A;  4J10 A;  2YSU B;  3CS5 A;  1FD9 A;  4FZ0 A;  1MOF A;  1PNM A;  4LFB O;  1RM1 B;  1I5Y A;  4PA9 A;  3CE2 A;  2DJV A;  3ABT A;  4J7Z A;  1V54 B;  4JI2 O;  5LL6 Y;  1IX9 A;  5E79 Z;  1MSW D;  2XAF A;  3ZHR A;  4FLV A;  2EIK B;  3ZIA G;  2UUB O;  1FKA O;  1TA8 A;  4MW8 A;  1VQ8 V;  2RCV A;  4DR3 B;  1GN3 A;  1YCI A;  3OE7 G;  4HBN A;  2AXT Z;  3DC6 A;  4RWU A;  4EB6 A;  3E22 B;  2P5O A;  1GRJ A;  5EC2 C;  4I55 B;  1JVM A;  1FPO A;  2BSK B;  2CTP A;  3HKB B;  2Z5U A;  3EHB B;  4DW1 A;  5GTI Z;  3HKE B;  3FAV B;  2QWN B;  1TUE B;  2Q68 A;  1B3Q A;  4D7S A;  3IGA C;  1KB9 F;  5JVD B;  4L87 A;  4MVS A;  3RBZ A;  2Y4T A;  1URF A;  4LF8 B;  2VQF B;  1QHT A;  1S77 D;  5B1A B;  3GB7 C;  4HYO A;  3P3N A;  3JCZ A;  2UUA O;  1HR0 B;  2HG5 C;  3K0G A;  3ZJZ A;  1Q82 W;  1FAF A;  2W0X A;  2KKW A;  4WFB V;  2Q69 A;  1RM1 C;  1N34 O;  3K06 A;  2OYQ A;  2N04 A;  1DF4 A;  4I5S A;  3ETG A;  4YIO A;  1GM7 A;  1H2L A;  2E3C A;  2JVD A;  2LO1 A;  1NU1 H;  1TVK B;  2EIK C;  3UM7 A;  2E76 B;  2N05 A;  1H38 A;  4LFC B;  3CCE V;  1N33 B;  3OM3 B;  4DV6 B;  1IUR A;  4J80 A;  3HPL C;  4J41 A;  2UU9 O;  3ZX6 A;  2P4V A;  5IE9 A;  2QKS A;  2X6C A;  3VOU A;  5JJJ B;  1QVG U;  1AI4 A;  1KD1 W;  4IL6 Z;  2GHY A;  3ETE A;  1W2B U;  2W0F C;  3E8H A;  3OGI B;  4GYC B;  1JOY A;  5CBH A;  2WLI B;  4TV8 B;  4X62 B;  2Y0P A;  5LGU A;  3J81 N;  1IBL O;  4G27 B;  1Q3E A;  4I55 A;  2BSK A;  1GN6 A;  4ZI7 B;  3CCL V;  4FLY A;  4WFG A;  4JF3 A;  3SPC A;  4ZIB A;  4MSW C;  1KUQ A;  3HKB A;  2Q73 A;  2VWK A;  4DV4 O;  3TXQ A;  4K8X A;  3HKE A;  3FAV A;  2BTQ B;  5B1A C;  1KEC A;  4FK5 C;  3B77 A;  5IY5 C;  3EVK A;  1AP5 A;  4KXR A;  3P32 A;  4K0K B;  4B3T B;  1BQZ A;  1AJQ A;  1QNM A;  3S3W A;  4Z2W A;  3JAT B;  3WG7 C;  1US6 A;  5L3G A;  3ABU A;  3JAR B;  4HAM A;  3CCU V;  2WLN A;  3LSU A;  3DC5 A;  1XMQ O;  1TAE A;  2F4V B;  2F93 B;  5GTH Z;  3OW2 U;  1YIJ V;  4JV5 B;  5HFM A;  4UCO A;  5LP6 B;  3C90 A;  4H0L B;  1EZV H;  2UXD B;  1FXV A;  1PKX A;  1R3L C;  5FNV B;  2EIN B;  1D5N A;  2B1I A;  4BWA A;  1K8A W;  2IJJ A;  5K1X A;  3K9A A;  4JTC B;  2OT5 A;  1TVK A;  5F2V O;  4I0X B;  2JEX A;  2UUC B;  2CE4 A;  3RW0 A;  2HHH B;  1S3J A;  1T5E A;  4LF4 B;  1NH2 D;  3CMA V;  2B5U A;  1SQB H;  3JAL A;  3N2K B;  2QDO A;  3TGU H;  3T1Y O;  3JD0 A;  3OTO O;  5CA0 B;  1R6N A;  2Y4U A;  3OUF A;  2P06 A;  2V7Q G;  3DSQ A;  3SR2 C;  2WLI A;  1BZK A;  3BAA A;  3KZI Z;  1IBM B;  3E8F A;  4X20 B;  4J11 A;  1YEW A;  4ZI7 A;  1G1X B;  4DR7 O;  1RFY A;  1PM9 A;  1M93 A;  1M56 B;  2BTQ A;  3JCU Z;  4NXM O;  1Q6I A;  1VF6 C;  3L71 H;  4JI1 B;  1KC8 W;  3ZRV A;  4IYH A;  4X8A A;  3MHH C;  3CCM V;  2K1E A;  3AG4 B;  2JGD B;  1JX9 A;  2QEX V;  3L9D A;  2AZ2 A;  1XNQ B;  1XMO O;  1K5S A;  5LP6 C;  2CGN A;  1VQO V;  3JYC A;  3H1K H;  2H94 A;  3RYC B;  1XDC A;  3JAR A;  2QR4 A;  3H1I H;  1S76 D;  3BCC H;  3FFQ A;  4LNU B;  2EIN C;  3G67 A;  1VF6 A;  2ZXW B;  1N32 B;  5KLV H;  1M4U A;  3OD4 A;  4MVU A;  5IWA B;  1JPX A;  2F66 C;  4JTD B;  3APQ A;  1Y76 B;  2QKC A;  4PI2 A;  5FNV A;  1OCC B;  3LDE A;  4FM1 A;  1WB8 A;  2PGG A;  3CJH B;  3R66 A;  4KHP O;  1YZB A;  3QO7 A;  4H37 A;  4E4E A;  4BW5 A;  3ABK B;  1U97 A;  1HDJ A;  3QO8 A;  1Y6X A;  2XOK G;  1BQ0 A;  5KHG A;  4JYA B;  2M7W A;  4RQE A;  4EEQ A;  5LMN O;  3LNM B;  4K3A A;  4IGG A;  3H9V A;  4LWS B;  3K58 A;  2QM7 A;  4LF6 O;  3N2K A;  5HFL A;  2DYS B;  1KKC A;  3CPW U;  5CA0 A;  1SZX A;  1M56 C;  2N74 A;  3K57 A;  2LP7 A;  3CCJ V;  2EX3 A;  3AG4 C;  2WLJ A;  4DK0 A;  4X20 A;  4CS2 A;  1V9P A;  1ROP A;  2IU0 A;  4HZ3 A;  1PP9 H;  4GCZ A;  4KL1 A;  3CC2 V;  1W0J G;  4CS4 A;  2ZXW C;  4JI2 B;  3ZHT A;  2YXL A;  5IT9 N;  1MZF A;  4DUZ O;  2DOS A;  2FML A;  2Q4P A;  3I5D A;  3ZED A;  4LF7 O;  2UUB B;  1KKD A;  1S5H C;  1H2G A;  5EZY A;  3SYO A;  1K73 W;  5DM6 V;  4EFB A;  1OZ0 A;  4DV2 B;  4LNU A;  3TK1 A;  4QIW F;  3OEE G;  1AIL A;  1SQG A;  4G2K A;  5CB4 B;  3AK1 A;  2AW9 A;  5DED A;  3FKS G;  1JJ2 U;  1VAR A;  4IHJ A;  3OR7 C;  4KP4 A;  3RYI B;  1JMK C;  2ZDI C;  3CHX A;  1Y76 A;  5JWP A;  3CJH A;  1F51 A;  1BHA A;  4EKW A;  3A2F A;  4D6T H;  2X6A A;  4NTW A;  4FLW A;  2X7R B;  1YJN V;  2WLL B;  2IM9 A;  2OIG A;  5GON B;  3C3T A;  4X89 A;  5C8Y B;  1ZLZ A;  2DYS C;  2L35 A;  2CTQ A;  1L8D A;  2ZDI A;  1GM9 A;  4R8C A;  4X1Y B;  4LWS A;  1AJN A;  2ZIM A;  2HJF C;  3I55 V;  1EBO A;  1OCZ B;  1IBK O;  1DLB A;  2UUA B;  1VQ6 V;  2ZE7 A;  1VP7 A;  1F23 A;  5L3F A;  1VF7 A;  3UT5 B;  1N34 B;  4PEL A;  1NS1 A;  2ZE8 A;  1Y67 A;  2R9A A;  4UVA A;  3JSN A;  2MK3 A;  4QPK A;  5JJE B;  4MVM A;  3ASN B;  2JRI A;  1OCR B;  1R3J C;  2HR3 A;  2ZE5 A;  1ZTE A;  3MAQ A;  3SYQ A;  4CC6 A;  4RUE A;  4ZOL A;  2ZNJ A;  3QO5 A;  2Q0A A;  1NJI W;  4JZ2 A;  4ABM A;  3P3P A;  4FPP A;  1ZWI C;  3K3W A;  1AR5 A;  3FX7 A;  3BEH A;  1WP8 A;  2WWW A;  4I50 A;  5CB4 A;  2AHZ A;  4I9Q A;  1BS3 A;  3ZN1 A;  2OTJ V;  1IBL B;  1HW7 A;  2EUL A;  2BOC C;  3OT7 A;  1H2N A;  4O4J A;  2QA4 V;  3RVZ A;  3RYI A;  1YJW V;  1R73 A;  4FFK A;  4PI0 A;  1R3I C;  4DV4 B;  3A8T A;  4CH6 A;  4GKK O;  3ZS8 C;  3U0Z A;  3KG2 A;  4B7E A;  2D2C B;  1OCZ C;  1NQT A;  1FFX A;  3H01 A;  4JAV A; 
#chains in the Genus database with same CATH homology
 2OIE A;  2YXH A;  1VMG A;  3CRA A;  2A7W A;  4QGP A;  2P06 A;  2Q73 A;  2GTA A;  5IE9 A;  2OIG A;  2Q9L A;  2Q5Z A;  1YVW A;  3CRC A;  3C90 A;  2A3Q A;  1YXB A;  1Y6X A;  2Q4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...