1RP3B

Cocrystal structure of the flagellar sigma/anti-sigma complex, sigma-28/flgm
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
77
Chain Sequence
VNRIELSRLIGLLLETSGTNKIEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEFFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor SIGMA-28 (FliA)
publication title Crystal Structure of the Flagellar Sigma/Anti-Sigma Complex Sigma(28)/FlgM Reveals an Intact Sigma Factor in an Inactive Conformation
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 23
structure length 77
sequence length 87
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04316 FlgM Anti-sigma-28 factor, FlgM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1160 Mainly Alpha Orthogonal Bundle Helix Hairpins Anti-sigma-28 factor FlgM 1rp3B02
1RP3B 1SC5B
chains in the Genus database with same CATH superfamily
1NJIW 1S0VA 1VP7A 4FIPC 2ZIMA 2BSKA 1SA0A 5CMUA 4AHCA 4IYIA 4UXNA 1Q8IA 2IJHA 3RWRD 2HFEC 1YI2V 1S3JA 5DECA 2OT5A 3ASOB 3X2QC 1A32A 2VQFB 4W4KA 1CPYA 4D7TA 3FAVA 1VQLV 4JYAB 1HNXB 2Q0AA 4U3JB 1IBMB 2UUBO 1GTOA 1KB9F 4PDLA 1J5EO 5BR8B 3AG7A 2F95B 3CCEV 4WF9V 1QVGU 4ZOLA 4L87A 4TV8A 3B77A 3TXSA 5LMNO 2GV9A 3E22A 5CB4B 4DR2B 1TVKA 3RYFA 1AB3A 4RAIA 2ITCC 2YI8A 3IC9A 3VQYA 1KU9A 4PJ0Z 4Z2WA 2VRZA 3K5OA 2Q0OC 4FVMA 1QLNA 3JD0A 3QO7A 1URFA 3UO2A 1N34B 2E3CA 1I5YA 3X2QB 4B08A 2RN9A 1Y66A 4LF4O 4UCRA 1ZTEA 4P30A 2EULA 1SKVA 1WPXA 4WBNB 2NNUA 5KUMA 2ZE8A 5GONB 4J10A 1P7GA 3H1LH 5B66Z 4BR6A 4R50A 4K0KB 1H2NA 2ZR2A 3HKCB 4F6EA 5KLVH 3OMIB 3ZMZA 2Z0AA 3F5WC 4YHHO 1TA8A 4B3RB 5CN0A 5LOVA 1QLEC 3ABUA 3C3TA 3P3NA 3ZHSA 1SETA 3S3XA 3FB5C 2XAQA 5KMGA 2K1EA 1NKDA 2EIJC 3LDDA 4TWKA 4X20B 1MA1A 2QM8A 4X64O 1H2GA 4DR3B 2QKCA 4GX1A 2Q7HA 2JGDB 5IDJA 2H3OA 2D2CB 3ZJZA 1TUBA 4KUMA 1SQQH 2Y4TA 4QIWF 1NZ6A 3CE2A 4F6RA 3IJ4A 2JEUA 4AQYB 4U7OA 1F4MA 4NTXA 2Q9LA 2E75B 3LNNA 4J9ZB 3OEHG 3QF7A 2P6JA 3JD4A 5DEDA 4J41A 3RYHA 2QWNB 4LF4B 5EC1C 3IC7A 4I4TB 3K5LA 2NR5A 1K5SA 3L9DA 1KYOF 1XL4A 3D36A 1VQKV 3OUFA 1QLEB 2YIBD 4LH7A 4DR6O 5FNVA 1BGYH 5H2FZ 1L1FA 4FJCC 1GN3A 1IZ3A 2EIJB 3FB6C 3ZHTA 1XEQA 2N04A 2DN9A 4GUNA 1N4CA 2VQEB 4KL1A 1FXVA 4LF9B 2N74A 4B3TB 3LSUA 1L8DA 5D5QA 4DV4O 2UUAO 4OXSA 5EK0A 5CA1B 3EFFK 5C8YA 5JH7A 4EEQA 2JEXA 3CJHA 2UXBO 3BABA 1XREA 4O4JA 3CCJV 3UM7A 4P9PA 3TCUA 2HVKC 1BSMA 4LF6O 4ZHQA 4PV1B 2ZIOA 3VOUA 3SDLA 2AZ2A 3N2KB 1SERA 1EN4A 4LF8O 1Y76B 4UVAA 1BHAA 1AI4A 3H1HH 4O4IB 2XHBA 5B1OA 1SRYA 2PGGA 1IVSA 3T2MA 3H01A 4P9OA 2IU3A 2M7WA 4EB6A 5JVDA 2UXDO 3ZHVA 5CA3A 1IXBA 4GKKB 4MVUA 3J81N 1BCCH 1QU7A 2DE0X 2AGAA 1R6TA 4MVQA 5K1XA 3AG2C 4PDVA 4X1IA 1K8AW 1XI1A 2UUCB 4H13B 2Z5UA 3F7VC 2P22C 2K9PA 4DV7B 4P2ZA 2BTQB 2X6BA 2ZDIA 4Q6GA 4TQFA 3K9SA 3JD3A 3IFXA 4DV4B 2UUAB 1G1XB 3JSLA 4EKWA 3JAMN 1PV0A 3SPGA 1YCIA 4BW5A 2WAMA 5J9PC 1K34A 2IM9A 2PI5A 1FFXA 2UXBB 3DXRA 4X62O 2MW2B 4LF5O 5B1NA 3ZHUA 5KUKA 1QVFU 2XUMA 2LGWA 4B7EA 2Q5ZA 1I0HA 4KFMA 1D2DA 2EIMC 2KG7A 1UJWB 3APQA 2W0FC 4LF8B 3JATA 4K35A 2VS0A 3BY6A 4DV0O 1VQ6V 3STZC 2EJ7A 4H33A 1ZL8A 4HZ3A 1V55C 3UO3A 3ZHQA 1EFRG 3G71V 1TUEB 4FMTA 5KAFZ 3CRAA 3OFNG 4MVOA 4DV6O 3AG2B 3KG2A 5FPOA 2JJ2G 5LP6A 2BSKB 3ETEA 1VQPV 1SA0B 2UXDB 1KP3A 5JWPA 2ETNA 1OV9A 2HG5C 2DOSA 4F4LA 1RSOA 2A9HA 3CXHF 4KHPO 2E74B 4DV5O 1S72V 3RVYA 1K9MW 4NB5A 2E5LO 5GTIZ 1DTOA 3WB0A 1KP2A 3ZRXA 1F23A 4J80A 4LF7O 1Q82W 3ZHRA 1FPOA 1M9NA 4JI4O 1HP8A 5EBWC 3FAVB 3JD1A 2EIMB 3SPCA 1WNSA 1NQTA 3SJQC 4FLTA 1H38A 1D5NA 2HJFC 3E83A 2ZT9B 2WWWA 1V55B 1JA8A 4X62B 4UCVA 1LUWA 4LF5B 3ZCCA 3CB2A 1CXZB 4TV8B 3E22B 2ZD9A 5LMUO 4I0XA 4WFAV 1TVKB 3RYFB 1KQSU 5F2VO 4LFBO 4JI1O 2XAGA 2YIDA 3CPWU 3GVMA 5B5EZ 4J42A 1XBLA 4DR5B 5LGUA 1P7BA 3UT5A 1FXHA 4DV6B 4DR7O 4I9WA 4MVMA 3ZMSA 3LDCA 2P90A 3OT7A 3OGCC 4J7JA 3CCLV 3ABKC 1VQMV 4J7KA 5LYJA 4FLYA 2XAHA 2UXCO 5L3EA 1IDSA 5IY5C 3KCXA 4CS4A 2WLKA 3JCZA 4IT5A 2XAJA 1XNRO 2F23A 3STLC 1XNQO 4LF7B 1VARA 2HR3A 1BHBA 1GO3F 2JS5A 1WLEA 2OIEA 5BMVB 2KSDA 1AILA 2LO1A 3ICXA 4R7CA 1IURA 2X7RB 3D36C 5LOVB 4H0LB 2AHZA 2ODMA 5KMGB 4YY3O 3SPIA 1GH6A 2P4VA 4LFAO 4Z1VA 1THZA 2AW9A 3B8NA 2WSSG 5LMUB 3RYIA 2EX3A 5C93A 3L71H 4O4HA 4GX2A 5DM6V 1TUBB 3K5NA 3ABKB 1X59A 4U7NA 3K06A 3RYCB 2QA4V 2PTMA 4F6RB 5IY5B 3E2EA 4BIOA 1Y67A 1YEWA 1TGOA 1Z2GA 2UXXA 4DR7B 4JI7B 4J11A 5KX5A 3SJBC 3RYHB 1K7DA 4O2AA 3LSQA 5H6RA 2NLJC 5IYDO 2WPDG 3ABLC 4JYAO 2KB1A 1HNXO 4I50B 2UXCB 1R6NA 4PA3A 4JAAA 4CH6A 1YJNV 2LJ2A 1NT2B 5JJJB 1VQ5V 3G67A 1BT8A 3CRMA 2OTJV 1K3EA 3L72H 5FNVB 1Y4MA 1XNRB 4IGGA 1BE3H 3B40A 1FJGB 1XNQB 1ZAUA 3T1HB 3M99B 5KHIA 1QHTA 4DR2O 4OPAA 4WFGA 5LGTA 1RFYA 1YJWV 3CCMV 1R1BA 3JAWA 1GKFA 2FKXA 4FK5C 5C8YB 4FM2A 5JH7B 4HNAA 3CJHB 3K04A 2XTAA 4YY3B 3OTOO 4O4LA 4O4JB 2QKSA 1OCRC 1N34O 4JZ2A 1NTMH 1Q5OA 2QM7A 4LFAB 1SZXA 1WPBA 1ZLZA 3K9AA 2FMLA 4ZHQB 2Y0IA 2H8PC 3JARA 1R3KC 3BA8A 1YXBA 2ZDIC 3ABLB 4JI2B 3CCQV 5AG2A 5IE9A 1W2BU 4B3MO 2V7QG 3HKDB 3QVNA 1B06A 5EIBD 4G2KA 3LDEA 2OYQA 4K0KO 3RBZA 4PI0A 2YDEA 1VQ4V 1GN4A 3SYQA 1GK9A 1AI6A 4D6TH 3VBBA 4G27B 4EB6B 1ZX3A 3NR7A 5JVDB 1WP8A 4TV9A 4B3RO 3OUSA 3CC7V 1JQ0A 2ZCEA 1MOFA 2HP8A 1RPRA 3CMEV 4C7UA 4GCZA 1Q3EA 2RMKB 1FD9A 3TGUH 4X1IB 2FL4A 1BQ0A 5ITZA 2LW7A 1OCRB 1XILA 5LP6C 3EVKA 2BTOA 3NXSA 3BPZA 2PY5A 4DR3O 4DR1B 1KMIZ 1NTKH 1SQGA 3CCSV 3MDSA 4BWAA 5IJ9A 2W0XA 4L8JA 2EBOA 4RUEA 1L0NH 4JF3A 1E1QG 4AQYO 1M1KW 3ZEDA 1FFXB 4UV9A 3DXRB 4TT3G 3OTOB 1SZTA 4FZ1A 1Q86W 4DV1O 4ZI7A 2A0LA 4CC5A 1VF7A 2Q7GA 2KG7B 1PNKA 1YHQV 4FLVA 5EZYA 2F93B 4MVSA 4UCTA 3JATB 3K03A 3R66A 2DYRC 3AEIA 1ZL8B 3I5DA 4RQEA 5GW7A 3JD2A 4B3MB 3OMNB 1WA8A 2IH1C 1YTFD 5IYBO 2YEVA 2JJ1G 3H9VA 3CRCA 3QTCA 2YUAA 2YSUB 4BIZA 4TUYA 3E35A 4MW3A 5LP6B 4JI0O 4LFCO 1XMOO 1YSCA 4LP8A 2VQEO 1NR7A 2Y0PA 3HKBA 4MSWC 4LF9O 1M56C 4B3TO 2AZ0A 1MABG 2DYSC 3LNMB 1XMQB 1B6QA 4IL6Z 2EIKC 3TK1A 4H44B 1DF5A 2DW4A 5L3DA 3SJAC 4RQFA 2ADQB 2CK3G 4BIUA 3SJCC 1EBOA 4H37A 3SYAA 2PUSA 1T5EA 2RDCA 1V54C 5DN6G 5JCOA 4FFKA 2XNDG 3A0BZ 1K92A 4X66O 2C2AA 4J9YB 2DYRB 2DWEC 3FKSG 2JK5C 1IXMA 1OCCC 4DUYB 4FM1A 3CD6V 2F66C 5KHKA 4PI2A 4NXMO 1MSDA 4D7SA 1JFFA 2XAFA 4DV1B 1EZVH 4I55A 4I0XB 1H8HG 3W7XA 3ZN1A 2IW5A 3GWOA 2G38A 1VQ9V 4XDKA 4GKKO 1I94O 4K8XA 2P67A 1M56B 3PN1A 2DYSB 2EIKB 1XL6A 4UV8A 4DR4B 2F4VO 4LNUA 3I56V 2UUCO 1VEWA 3QNEA 4JI6O 4DV7O 2Y48A 3BCCH 2CAZC 4JI0B 4LFCB 3DGEA 1XMOB 1DF4A 2QSAA 4E4EA 2QEXV 4HBNA 3MHHC 1V54B 5LYJB 1WP7A 5IJ0B 1H2MA 1YIJV 5LA6A 2CH7A 2EINC 5KA6A 1HNZB 2IH3C 5BZBA 4QJFB 1OCCB 2HEPA 3FB7C 2QE7G 1J95A 2ATKC 2PF4E 3F7YC 3LSSA 2ZE5A 4DW0A 1PM9A 2MK3A 4YXWG 4X66B 2X0LA 1I5XA 5L3BA 2HLDG 3CMAV 2RCVA 3E86A 4NXMB 1Y6XA 1XQ8A 4CH5A 1PD3A 2KKWA 3P3PA 1IBKB 1Y74A 4X8AA 2M6YA 5J2TA 3RYIB 5BXZA 4B3SB 1GM9A 3JAKB 3HPLC 4DK1A 1I94B 4GYCB 3CX5F 1KD1W 3CEIA 3G6BA 2DWDC 4LWSA 1P49A 2F4VB 4GKJO 2EINB 2R70A 1GN6A 2H94A 2ZNJA 1IX9A 4JI6B 4PELA 4IHJA 5KX5B 2WLJA 1N0NA 1AJNA 4LC1A 1SQXH 5EC2C 3B4SA 2QM4A 3ABTA 4JI5B 1PL0A 2WLIA 3QO8A 1FKAO 3A2FA 2CTRA 4UCSA 3RFRA 5IYZA 3MD0A 4I9QA 5B1AC 2P7TC 4YIPA 4PDMA 3JAWB 5LXTA 4X1KB 5EYPA 1FAFA 4HNAB 4DR5O 2AXTZ 4O4LB 3RVZA 1B04A 1G6UA 1R73A 2GUZA 3KCYA 1R6KA 2IJIA 4N21A 1KECA 3JARB 2QWOB 2P06A 4MS2A 2PYJA 1K97A 1WB8A 3DC6A 4FFBA 2GTSA 5LHGA 4YIOA 3BA9A 3E8GA 4GKJB 2ZE7A 2NN4A 2R9IA 1F7YA 2ARHA 5LL6Y 4ZKIA 3AK3A 5LGNA 2XT9A 1O9HA 2EJRA 3CRQA 4MVRA 1QCEA 1LUVA 2Z3YA 1BS3A 5B1AB 2DQ3A 3EHBB 2ZM6O 4TV9B 2B9ZA 5JJEB 4DXWA 2Q69A 4ICGA 4ZOLB 1NU1H 4UCUA 5ITZB 3CXCU 1K4DC 4MTOA 4TOIA 4I7ZB 1COWG 3FYEB 4ABMA 5IJ9B 5FPRA 2YI9A 2A7WA 2B1IA 3OE7G 4CS2A 2UXNA 1K73W 4NXNB 5CA0A 2LP7A 3E8HA 2JDIG 2Y4UA 2IU0A 1S76D 1DK1A 1Z5VA 5J2UA 5IT9N 2ZE6A 1FYJA 4JI7O 3BAAA 4EFBA 3RW0A 1JJ2U 4I4TA 1U97A 4ZI7B 5JCOC 5KHGA 1XHXA 3ETDA 1Q81W 5EZYB 4E2LA 3T1CA 4ZIBA 4RO2A 3W7UA 4WFHA 1W59A 4DUZB 2JRIA 1NVPD 3ABMC 4JPRA 5GTHZ 1QR8A 1WA8B 2N05A 2YEVB 4X89A 1FJGO 3T1HO 4QGPA 1OJHA 3FX7A 3CRRA 4TUYB 3FFQA 3OAAG 3SPJA 3Q4HA 1R3LC 4PDRA 3K57A 1SESA 3G4SV 3HKBB 1HDJA 4K3AA 3K3WA 1YF2A 3APOA 3ZRWA 2ZM6B 4JTDB 4OX9B 2OTLV 2ZQMA 1N36B 3SGIA 4GZRB 2GBOA 5B1BC 1MMMA 5FLXN 4R6ZA 3CCUV 4N23A 4EFEA 1H2SB 1TAEA 2LFRA 1Y76A 2A3QA 2Q8VA 1S5HC 2LFSA 2QR4A 4JI2O 4CZZA 3G80A 1LNQA 2KQXA 1GRJA 1KUQA 1Q6HA 3ABMB 1K33A 3F5TA 5L3FA 5IWAB 2F1MA 3P30A 4CH4A 1MSWD 1JFFB 3B2EE 2YS8A 1AR5A 3OGIB 4I55B 4FPPA 2OCCC 4FM0A 1P4RA 3K79A 1OCOC 2LQTA 1VQ7V 1B3QA 2R72A 1VQNV 4BAYA 1AI7A 3ZMTA 3T4ZA 3VQXA 4A5UB 1OZ0A 3L74H 5B1BB 3B09A 3B8MA 1AR4A 1R3JC 2W6JG 4DR1O 2FYUH 4LCUC 5FL7G 5CBGA 3UQ8A 3OM3B 1GM7A 1AR1B 1GM8A 1SQPH 2LGQA 4QPJA 3K0DA 4JAVA 3ZRSA 4DRXA 2HHHB 3N2GA 4UCOA 5LA6B 2CH7B 1M93A 5L3GA 2LW1A 1VF6A 2ZKOA 3OR7C 4CC6A 3CYOA 3U0ZA 2HJDA 1XUQA 1P84F 1ENVA 4MW8A 4LH6A 2YC0A 1I08A 1N32B 1PL4A 2CDYA 2OCCB 1JMKC 5LHIA 4LBEC 1Q43A 2RNBA 4NTYA 2P4KA 3GWKC 2VWKA 1OCOB 3AK1A 4XDLA 2QTSA 3JASA 1N0JA 3JYCA 1FS0G 4CBCA 5EIBC 4DV3B 4JYBA 1Y74B 3OTFA 1FXKA 4JV5B 5LBQA 4HAMA 5J2TB 1W0JG 4W4LA 2L6LA 3CWBH 1OHHG 3JALA 5TISZ 1XMQO 1DLBA 1SC5B 1JX9A 4TSFG 1YVWA 1E79G 4LWSB 2X6AA 2Q67A 1SQFA 1L0LH 2QWQB 4RWUA 4GT1A 3K58A 2QDOA 4IHJB 1WN7A 1NBMG 3PJSK 3AG3C 4PA4A 3CC2V 3DC5A 5IYCO 3JCUZ 3CC4V 4MTXA 2ZR3A 4X1YA 2CTWA 1I7FA 3SPHA 2PZSA 2GDSA 3N27A 3SYOA 4FLZA 2CE4A 2WLIB 3L75H 3GB7C 3KZIZ 3BVOA 2OIGA 1ZWIC 4J7ZA 1NI8A 5EBLC 4DUYO 2Q4PA 4JGSA 2BE3A 5IYZB 3TETA 1M4UA 2UU9B 2A79B 3BEHA 1BL8A 2XASA 1Q6UA 2W6IG 3WG7C 4WCEV 5LHHA 1X4TA 3E8BA 5LXTB 3W7TA 1HNWB 1JOYA 2F43G 4Z1MG 2GHYA 5H6QA 1JJOA 5EYPB 4WFFA 4DR4O 1NH2D 2HKOA 3QO5A 3D8CA 4KP4A 2E76B 1HWYA 1S77D 1EN6A 4KXRA 2FB5A 3DTUB 2GUZB 3AG3B 1SQVH 4B7KA 2BOBC 5BY1A 1F51A 1RP3B 3SYPA 3WB2A 1RSOB 3AK2A 4FFBB 1PNLA 4PD4F 4ASUG 4BW9A 1G4YB 4FZ0A 5HFLA 3AG1C 1HNZO 4QE7A 5JQGA 1EM1A 4FLXA 5BMVA 3OR6C 2L35A 2YXHA 3CSXA 2UUBB 2WLLA 1J5EB 5H5NA 3M7MX 3WG7B 4IIJA 4DYLA 2JS3A 3BHPA 3ZMVA 1OCZC 5L3CA 5LMNB 3CHXA 3L70H 1IBKO 1NH2B 1YTFB 4FLWA 2QWPB 4YJ3A 3RYCA 4B3SO 1PKXA 1SS3A 1US6A 4R8CA 2R9RB 1U96A 1XDCA 1ZSPA 2CTPA 5CA0B 4GX5A 3FB8C 4O2BA 1HW7A 2DJVA 1VQ8V 3A0RA 3QG5A 2YXYA 1IBLO 4MT8A 4JAUA 3UT5B 5J2UB 2RQ6A 2DMXA 3AG1B 2ILMA 1KC8W 2Y69C 1WJZA 4MVZA 1MNGA 4I50A 3HKEA 4Q20A 4JI5O 2Q7EA 3EXAA 4NKGB 3ASNC 1UPGA 5A2QN 3A8TA 1M5IA 3WB1A 2VWJA 1QNMA 1H8EG 1OCZB 1K5QA 2EZOA 4OGQB 2EILC 1GAXA 4WFEA 4YHHB 3Q4HB 2QWRB 2YIAA 4YJ2A 1WAZA 1EZJA 3ZRWB 2WA4A 4PA7A 3ETQA 2WLHA 1JVMA 3IAYA 1MG1A 1S5JA 4HYOA 4XDJA 4X64B 4CH3A 1QBZA 2Y69B 1CP9A 1AROP 1D5AA 3THOA 3ZRVA 4O4HB 4X9QA 5D5PA 1RM1C 3HKDA 1F4NA 5CBFA 3CP1A 3KKYA 1WB7A 3CS5A 4UB6Z 1VF6C 1YITV 3SYCA 3ASNB 4G28B 1IBLB 1DGSA 2GSMB 1QQCA 2ZNIA 4JYCA 5K1PA 3U11A 3P32A 2EILB 4O2AB 3E8FA 2ZINA 4U3JA 1VMGA 1CEZA 3H1KH 3MHSC 1ORQC 5H9CA 3U10A 4DR6B 4RUFA 1AJPA 2PYLA 4QE9A 3OEEG 3OMAB 3CCVV 2V1DA 4QPKA 2ITDC 4DO2A 2D3OW 5KAIZ 5CB4A 3BRCA 4FLUA 3UKMA 4JI3O 4IYHA 1FXKC 5E1AC 1GN2A 2OWOA 2BCCH 2P5OA 4CS3A 4GLXA 3T4DA 2CTQA 1M57C 1YZBA 3WFVA 1ROPA 3ZIAG 4DRXB 3N2GB 1RM1B 4NXNO 3K0GA 1GMGA 3ZX6A 2O57A 4LF6B 3W7SA 2EZPA 3ZN0A 1W0KG 3H1JH 1AP6A 4JI8O 2IJJA 1Q90D 4GX0A 2ZXWC 1ZUQA 4WBNA 3HR0A 1V9PA 5GONA 1JPXA 4PA6A 3ETGA 4DUZO 2WLMA 3S3WA 1N33O 1Z5WA 3JASB 4UB8Z 3ZMUA 4PA9A 3FD9A 3HKCA 1NR1A 3G6EV 2HVJC 1HR0O 1VIBA 1FXKB 1JR9A 3K59A 3K08A 3OD4A 5EBMC 2A06H 3ZS8C 3JALB 1M57B 4OX9O 1N36O 1KKCA 1VF5B 4X20A 1H2KA 4DK0A 3SR2C 3VQWA 3WU2Z 2JGDA 4JI3B 4JYYA 4U3FH 3HB3B 4X88A 1YJ9V 2ZXWB 5B3SC 1QR9A 2AHYA 4UFZA 4X1YB 3E89A 3T1YO 1AVMA 5IWAO 2CUGA 3BFRA 1YDXA 3L73H 4TQDA 4JI8B 4DV2O 4DV0B 3TJTA 2WLNA 2CGNA 1JCHA 2DQ0A 4MTFA 5CBHA 3D3QA 3JSNA 1N33B 1G8MA 3O65A 1SQBH 3D3IA 4XBFA 3K5MA 1EN5A 2JVDA 3J7AU 1HR0B 2GTAA 4NVPA 4NTWA 5E79Z 1AJQA 2BOCC 5IJ0A 1SF9A 2QKAA 4X65O 5CA1A 4KHPB 5B3SB 3C3SA 4DV5B 2HHHO 1BZKA 1BQZA 4QNHB 5KHJA 2OCHA 2E5LB 1S5LZ 1R3IC 2QJ1A 3CCRV 3LUTB 2FTKA 2B5UA 3AG4C 5JQGB 4JI4B 3N2KA 4DW1A 1O9GA 3ML0A 1K4CC 3ZBHA 3O9OA 3C90A 4JTAB 1VQOV 1PPJH 2Q68A 1N32O 4UVCA 4NYKA 3MAQA 2IBZH 2R9AA 2WLLB 4IIJB 4O4IA 5A9GA 2YICA 5JJNB 3TXQA 3T1YB 2YIBA 2CGOA 1NTZH 1NVPB 3RGBA 4JZGA 4DV3O 3JAKA 3R65A 1LR1A 4DV2B 4LFBB 3UCSC 5KHHA 4JASA 4JI1B 4JV5O 3A0HZ 4YJ3B 3M8AA 4OPHA 2JIZG 1Q7YW 2Q73A 4JTCB 2QTOA 3RN4A 4LR3A 4I5SA 2RJZA 2VQFO 1UFIA 4O2BB 3W7WA 4MTGA 4NR1A 1KBHA 4LNUB 1XOUA 1NS1A 2JGUA 3FYIB 2BTQA 3AG4B 2PI4A 3DSQA 1KKDA 1IBMO 3IGAC 3HKEB 4X65B 2ADPA 1E1RG 2QGNA 4K8ZA 1MZEA 1MZFA 5BR8O 1PNMA 1FFTB 2V4DA 3ASOC 1PP9H 4UVBA 1BMFG 2YXLA 1AP5A 1RPOA 1M90W 1XHZA 1H2LA 2X6CA 2XOKG 3RT3C 3VQVA 3OW2U 2B1GA 5KA5A 1Q6IA 2UU9O 4PHZA 5HFMA 4AI8A 4ZBMA 4X1KA 4UUJC 4YJ2B 2IJKA 4WFBV 3I55V 1HNWO 2WA3A 2Q6AA 4AILC 1AI5A 1N8RW 3J80N 3H1IH
chains in the Genus database with same CATH topology
1RP3B 1SC5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RP3 B;  1SC5 B; 
#chains in the Genus database with same CATH topology
 1NJI W;  1S0V A;  1VP7 A;  4FIP C;  2ZIM A;  2BSK A;  1SA0 A;  5CMU A;  4AHC A;  4IYI A;  4UXN A;  1Q8I A;  2IJH A;  3RWR D;  2HFE C;  1YI2 V;  1S3J A;  5DEC A;  2OT5 A;  3ASO B;  3X2Q C;  1A32 A;  2VQF B;  4W4K A;  1CPY A;  4D7T A;  3FAV A;  1VQL V;  4JYA B;  1HNX B;  2Q0A A;  4U3J B;  1IBM B;  2UUB O;  1GTO A;  1KB9 F;  4PDL A;  1J5E O;  5BR8 B;  3AG7 A;  2F95 B;  3CCE V;  4WF9 V;  1QVG U;  4ZOL A;  4L87 A;  4TV8 A;  3B77 A;  3TXS A;  5LMN O;  2GV9 A;  3E22 A;  5CB4 B;  4DR2 B;  1TVK A;  3RYF A;  1AB3 A;  4RAI A;  2ITC C;  2YI8 A;  3IC9 A;  3VQY A;  1KU9 A;  4PJ0 Z;  4Z2W A;  2VRZ A;  3K5O A;  2Q0O C;  4FVM A;  1QLN A;  3JD0 A;  3QO7 A;  1URF A;  3UO2 A;  1N34 B;  2E3C A;  1I5Y A;  3X2Q B;  4B08 A;  2RN9 A;  1Y66 A;  4LF4 O;  4UCR A;  1ZTE A;  4P30 A;  2EUL A;  1SKV A;  1WPX A;  4WBN B;  2NNU A;  5KUM A;  2ZE8 A;  5GON B;  4J10 A;  1P7G A;  3H1L H;  5B66 Z;  4BR6 A;  4R50 A;  4K0K B;  1H2N A;  2ZR2 A;  3HKC B;  4F6E A;  5KLV H;  3OMI B;  3ZMZ A;  2Z0A A;  3F5W C;  4YHH O;  1TA8 A;  4B3R B;  5CN0 A;  5LOV A;  1QLE C;  3ABU A;  3C3T A;  3P3N A;  3ZHS A;  1SET A;  3S3X A;  3FB5 C;  2XAQ A;  5KMG A;  2K1E A;  1NKD A;  2EIJ C;  3LDD A;  4TWK A;  4X20 B;  1MA1 A;  2QM8 A;  4X64 O;  1H2G A;  4DR3 B;  2QKC A;  4GX1 A;  2Q7H A;  2JGD B;  5IDJ A;  2H3O A;  2D2C B;  3ZJZ A;  1TUB A;  4KUM A;  1SQQ H;  2Y4T A;  4QIW F;  1NZ6 A;  3CE2 A;  4F6R A;  3IJ4 A;  2JEU A;  4AQY B;  4U7O A;  1F4M A;  4NTX A;  2Q9L A;  2E75 B;  3LNN A;  4J9Z B;  3OEH G;  3QF7 A;  2P6J A;  3JD4 A;  5DED A;  4J41 A;  3RYH A;  2QWN B;  4LF4 B;  5EC1 C;  3IC7 A;  4I4T B;  3K5L A;  2NR5 A;  1K5S A;  3L9D A;  1KYO F;  1XL4 A;  3D36 A;  1VQK V;  3OUF A;  1QLE B;  2YIB D;  4LH7 A;  4DR6 O;  5FNV A;  1BGY H;  5H2F Z;  1L1F A;  4FJC C;  1GN3 A;  1IZ3 A;  2EIJ B;  3FB6 C;  3ZHT A;  1XEQ A;  2N04 A;  2DN9 A;  4GUN A;  1N4C A;  2VQE B;  4KL1 A;  1FXV A;  4LF9 B;  2N74 A;  4B3T B;  3LSU A;  1L8D A;  5D5Q A;  4DV4 O;  2UUA O;  4OXS A;  5EK0 A;  5CA1 B;  3EFF K;  5C8Y A;  5JH7 A;  4EEQ A;  2JEX A;  3CJH A;  2UXB O;  3BAB A;  1XRE A;  4O4J A;  3CCJ V;  3UM7 A;  4P9P A;  3TCU A;  2HVK C;  1BSM A;  4LF6 O;  4ZHQ A;  4PV1 B;  2ZIO A;  3VOU A;  3SDL A;  2AZ2 A;  3N2K B;  1SER A;  1EN4 A;  4LF8 O;  1Y76 B;  4UVA A;  1BHA A;  1AI4 A;  3H1H H;  4O4I B;  2XHB A;  5B1O A;  1SRY A;  2PGG A;  1IVS A;  3T2M A;  3H01 A;  4P9O A;  2IU3 A;  2M7W A;  4EB6 A;  5JVD A;  2UXD O;  3ZHV A;  5CA3 A;  1IXB A;  4GKK B;  4MVU A;  3J81 N;  1BCC H;  1QU7 A;  2DE0 X;  2AGA A;  1R6T A;  4MVQ A;  5K1X A;  3AG2 C;  4PDV A;  4X1I A;  1K8A W;  1XI1 A;  2UUC B;  4H13 B;  2Z5U A;  3F7V C;  2P22 C;  2K9P A;  4DV7 B;  4P2Z A;  2BTQ B;  2X6B A;  2ZDI A;  4Q6G A;  4TQF A;  3K9S A;  3JD3 A;  3IFX A;  4DV4 B;  2UUA B;  1G1X B;  3JSL A;  4EKW A;  3JAM N;  1PV0 A;  3SPG A;  1YCI A;  4BW5 A;  2WAM A;  5J9P C;  1K34 A;  2IM9 A;  2PI5 A;  1FFX A;  2UXB B;  3DXR A;  4X62 O;  2MW2 B;  4LF5 O;  5B1N A;  3ZHU A;  5KUK A;  1QVF U;  2XUM A;  2LGW A;  4B7E A;  2Q5Z A;  1I0H A;  4KFM A;  1D2D A;  2EIM C;  2KG7 A;  1UJW B;  3APQ A;  2W0F C;  4LF8 B;  3JAT A;  4K35 A;  2VS0 A;  3BY6 A;  4DV0 O;  1VQ6 V;  3STZ C;  2EJ7 A;  4H33 A;  1ZL8 A;  4HZ3 A;  1V55 C;  3UO3 A;  3ZHQ A;  1EFR G;  3G71 V;  1TUE B;  4FMT A;  5KAF Z;  3CRA A;  3OFN G;  4MVO A;  4DV6 O;  3AG2 B;  3KG2 A;  5FPO A;  2JJ2 G;  5LP6 A;  2BSK B;  3ETE A;  1VQP V;  1SA0 B;  2UXD B;  1KP3 A;  5JWP A;  2ETN A;  1OV9 A;  2HG5 C;  2DOS A;  4F4L A;  1RSO A;  2A9H A;  3CXH F;  4KHP O;  2E74 B;  4DV5 O;  1S72 V;  3RVY A;  1K9M W;  4NB5 A;  2E5L O;  5GTI Z;  1DTO A;  3WB0 A;  1KP2 A;  3ZRX A;  1F23 A;  4J80 A;  4LF7 O;  1Q82 W;  3ZHR A;  1FPO A;  1M9N A;  4JI4 O;  1HP8 A;  5EBW C;  3FAV B;  3JD1 A;  2EIM B;  3SPC A;  1WNS A;  1NQT A;  3SJQ C;  4FLT A;  1H38 A;  1D5N A;  2HJF C;  3E83 A;  2ZT9 B;  2WWW A;  1V55 B;  1JA8 A;  4X62 B;  4UCV A;  1LUW A;  4LF5 B;  3ZCC A;  3CB2 A;  1CXZ B;  4TV8 B;  3E22 B;  2ZD9 A;  5LMU O;  4I0X A;  4WFA V;  1TVK B;  3RYF B;  1KQS U;  5F2V O;  4LFB O;  4JI1 O;  2XAG A;  2YID A;  3CPW U;  3GVM A;  5B5E Z;  4J42 A;  1XBL A;  4DR5 B;  5LGU A;  1P7B A;  3UT5 A;  1FXH A;  4DV6 B;  4DR7 O;  4I9W A;  4MVM A;  3ZMS A;  3LDC A;  2P90 A;  3OT7 A;  3OGC C;  4J7J A;  3CCL V;  3ABK C;  1VQM V;  4J7K A;  5LYJ A;  4FLY A;  2XAH A;  2UXC O;  5L3E A;  1IDS A;  5IY5 C;  3KCX A;  4CS4 A;  2WLK A;  3JCZ A;  4IT5 A;  2XAJ A;  1XNR O;  2F23 A;  3STL C;  1XNQ O;  4LF7 B;  1VAR A;  2HR3 A;  1BHB A;  1GO3 F;  2JS5 A;  1WLE A;  2OIE A;  5BMV B;  2KSD A;  1AIL A;  2LO1 A;  3ICX A;  4R7C A;  1IUR A;  2X7R B;  3D36 C;  5LOV B;  4H0L B;  2AHZ A;  2ODM A;  5KMG B;  4YY3 O;  3SPI A;  1GH6 A;  2P4V A;  4LFA O;  4Z1V A;  1THZ A;  2AW9 A;  3B8N A;  2WSS G;  5LMU B;  3RYI A;  2EX3 A;  5C93 A;  3L71 H;  4O4H A;  4GX2 A;  5DM6 V;  1TUB B;  3K5N A;  3ABK B;  1X59 A;  4U7N A;  3K06 A;  3RYC B;  2QA4 V;  2PTM A;  4F6R B;  5IY5 B;  3E2E A;  4BIO A;  1Y67 A;  1YEW A;  1TGO A;  1Z2G A;  2UXX A;  4DR7 B;  4JI7 B;  4J11 A;  5KX5 A;  3SJB C;  3RYH B;  1K7D A;  4O2A A;  3LSQ A;  5H6R A;  2NLJ C;  5IYD O;  2WPD G;  3ABL C;  4JYA O;  2KB1 A;  1HNX O;  4I50 B;  2UXC B;  1R6N A;  4PA3 A;  4JAA A;  4CH6 A;  1YJN V;  2LJ2 A;  1NT2 B;  5JJJ B;  1VQ5 V;  3G67 A;  1BT8 A;  3CRM A;  2OTJ V;  1K3E A;  3L72 H;  5FNV B;  1Y4M A;  1XNR B;  4IGG A;  1BE3 H;  3B40 A;  1FJG B;  1XNQ B;  1ZAU A;  3T1H B;  3M99 B;  5KHI A;  1QHT A;  4DR2 O;  4OPA A;  4WFG A;  5LGT A;  1RFY A;  1YJW V;  3CCM V;  1R1B A;  3JAW A;  1GKF A;  2FKX A;  4FK5 C;  5C8Y B;  4FM2 A;  5JH7 B;  4HNA A;  3CJH B;  3K04 A;  2XTA A;  4YY3 B;  3OTO O;  4O4L A;  4O4J B;  2QKS A;  1OCR C;  1N34 O;  4JZ2 A;  1NTM H;  1Q5O A;  2QM7 A;  4LFA B;  1SZX A;  1WPB A;  1ZLZ A;  3K9A A;  2FML A;  4ZHQ B;  2Y0I A;  2H8P C;  3JAR A;  1R3K C;  3BA8 A;  1YXB A;  2ZDI C;  3ABL B;  4JI2 B;  3CCQ V;  5AG2 A;  5IE9 A;  1W2B U;  4B3M O;  2V7Q G;  3HKD B;  3QVN A;  1B06 A;  5EIB D;  4G2K A;  3LDE A;  2OYQ A;  4K0K O;  3RBZ A;  4PI0 A;  2YDE A;  1VQ4 V;  1GN4 A;  3SYQ A;  1GK9 A;  1AI6 A;  4D6T H;  3VBB A;  4G27 B;  4EB6 B;  1ZX3 A;  3NR7 A;  5JVD B;  1WP8 A;  4TV9 A;  4B3R O;  3OUS A;  3CC7 V;  1JQ0 A;  2ZCE A;  1MOF A;  2HP8 A;  1RPR A;  3CME V;  4C7U A;  4GCZ A;  1Q3E A;  2RMK B;  1FD9 A;  3TGU H;  4X1I B;  2FL4 A;  1BQ0 A;  5ITZ A;  2LW7 A;  1OCR B;  1XIL A;  5LP6 C;  3EVK A;  2BTO A;  3NXS A;  3BPZ A;  2PY5 A;  4DR3 O;  4DR1 B;  1KMI Z;  1NTK H;  1SQG A;  3CCS V;  3MDS A;  4BWA A;  5IJ9 A;  2W0X A;  4L8J A;  2EBO A;  4RUE A;  1L0N H;  4JF3 A;  1E1Q G;  4AQY O;  1M1K W;  3ZED A;  1FFX B;  4UV9 A;  3DXR B;  4TT3 G;  3OTO B;  1SZT A;  4FZ1 A;  1Q86 W;  4DV1 O;  4ZI7 A;  2A0L A;  4CC5 A;  1VF7 A;  2Q7G A;  2KG7 B;  1PNK A;  1YHQ V;  4FLV A;  5EZY A;  2F93 B;  4MVS A;  4UCT A;  3JAT B;  3K03 A;  3R66 A;  2DYR C;  3AEI A;  1ZL8 B;  3I5D A;  4RQE A;  5GW7 A;  3JD2 A;  4B3M B;  3OMN B;  1WA8 A;  2IH1 C;  1YTF D;  5IYB O;  2YEV A;  2JJ1 G;  3H9V A;  3CRC A;  3QTC A;  2YUA A;  2YSU B;  4BIZ A;  4TUY A;  3E35 A;  4MW3 A;  5LP6 B;  4JI0 O;  4LFC O;  1XMO O;  1YSC A;  4LP8 A;  2VQE O;  1NR7 A;  2Y0P A;  3HKB A;  4MSW C;  4LF9 O;  1M56 C;  4B3T O;  2AZ0 A;  1MAB G;  2DYS C;  3LNM B;  1XMQ B;  1B6Q A;  4IL6 Z;  2EIK C;  3TK1 A;  4H44 B;  1DF5 A;  2DW4 A;  5L3D A;  3SJA C;  4RQF A;  2ADQ B;  2CK3 G;  4BIU A;  3SJC C;  1EBO A;  4H37 A;  3SYA A;  2PUS A;  1T5E A;  2RDC A;  1V54 C;  5DN6 G;  5JCO A;  4FFK A;  2XND G;  3A0B Z;  1K92 A;  4X66 O;  2C2A A;  4J9Y B;  2DYR B;  2DWE C;  3FKS G;  2JK5 C;  1IXM A;  1OCC C;  4DUY B;  4FM1 A;  3CD6 V;  2F66 C;  5KHK A;  4PI2 A;  4NXM O;  1MSD A;  4D7S A;  1JFF A;  2XAF A;  4DV1 B;  1EZV H;  4I55 A;  4I0X B;  1H8H G;  3W7X A;  3ZN1 A;  2IW5 A;  3GWO A;  2G38 A;  1VQ9 V;  4XDK A;  4GKK O;  1I94 O;  4K8X A;  2P67 A;  1M56 B;  3PN1 A;  2DYS B;  2EIK B;  1XL6 A;  4UV8 A;  4DR4 B;  2F4V O;  4LNU A;  3I56 V;  2UUC O;  1VEW A;  3QNE A;  4JI6 O;  4DV7 O;  2Y48 A;  3BCC H;  2CAZ C;  4JI0 B;  4LFC B;  3DGE A;  1XMO B;  1DF4 A;  2QSA A;  4E4E A;  2QEX V;  4HBN A;  3MHH C;  1V54 B;  5LYJ B;  1WP7 A;  5IJ0 B;  1H2M A;  1YIJ V;  5LA6 A;  2CH7 A;  2EIN C;  5KA6 A;  1HNZ B;  2IH3 C;  5BZB A;  4QJF B;  1OCC B;  2HEP A;  3FB7 C;  2QE7 G;  1J95 A;  2ATK C;  2PF4 E;  3F7Y C;  3LSS A;  2ZE5 A;  4DW0 A;  1PM9 A;  2MK3 A;  4YXW G;  4X66 B;  2X0L A;  1I5X A;  5L3B A;  2HLD G;  3CMA V;  2RCV A;  3E86 A;  4NXM B;  1Y6X A;  1XQ8 A;  4CH5 A;  1PD3 A;  2KKW A;  3P3P A;  1IBK B;  1Y74 A;  4X8A A;  2M6Y A;  5J2T A;  3RYI B;  5BXZ A;  4B3S B;  1GM9 A;  3JAK B;  3HPL C;  4DK1 A;  1I94 B;  4GYC B;  3CX5 F;  1KD1 W;  3CEI A;  3G6B A;  2DWD C;  4LWS A;  1P49 A;  2F4V B;  4GKJ O;  2EIN B;  2R70 A;  1GN6 A;  2H94 A;  2ZNJ A;  1IX9 A;  4JI6 B;  4PEL A;  4IHJ A;  5KX5 B;  2WLJ A;  1N0N A;  1AJN A;  4LC1 A;  1SQX H;  5EC2 C;  3B4S A;  2QM4 A;  3ABT A;  4JI5 B;  1PL0 A;  2WLI A;  3QO8 A;  1FKA O;  3A2F A;  2CTR A;  4UCS A;  3RFR A;  5IYZ A;  3MD0 A;  4I9Q A;  5B1A C;  2P7T C;  4YIP A;  4PDM A;  3JAW B;  5LXT A;  4X1K B;  5EYP A;  1FAF A;  4HNA B;  4DR5 O;  2AXT Z;  4O4L B;  3RVZ A;  1B04 A;  1G6U A;  1R73 A;  2GUZ A;  3KCY A;  1R6K A;  2IJI A;  4N21 A;  1KEC A;  3JAR B;  2QWO B;  2P06 A;  4MS2 A;  2PYJ A;  1K97 A;  1WB8 A;  3DC6 A;  4FFB A;  2GTS A;  5LHG A;  4YIO A;  3BA9 A;  3E8G A;  4GKJ B;  2ZE7 A;  2NN4 A;  2R9I A;  1F7Y A;  2ARH A;  5LL6 Y;  4ZKI A;  3AK3 A;  5LGN A;  2XT9 A;  1O9H A;  2EJR A;  3CRQ A;  4MVR A;  1QCE A;  1LUV A;  2Z3Y A;  1BS3 A;  5B1A B;  2DQ3 A;  3EHB B;  2ZM6 O;  4TV9 B;  2B9Z A;  5JJE B;  4DXW A;  2Q69 A;  4ICG A;  4ZOL B;  1NU1 H;  4UCU A;  5ITZ B;  3CXC U;  1K4D C;  4MTO A;  4TOI A;  4I7Z B;  1COW G;  3FYE B;  4ABM A;  5IJ9 B;  5FPR A;  2YI9 A;  2A7W A;  2B1I A;  3OE7 G;  4CS2 A;  2UXN A;  1K73 W;  4NXN B;  5CA0 A;  2LP7 A;  3E8H A;  2JDI G;  2Y4U A;  2IU0 A;  1S76 D;  1DK1 A;  1Z5V A;  5J2U A;  5IT9 N;  2ZE6 A;  1FYJ A;  4JI7 O;  3BAA A;  4EFB A;  3RW0 A;  1JJ2 U;  4I4T A;  1U97 A;  4ZI7 B;  5JCO C;  5KHG A;  1XHX A;  3ETD A;  1Q81 W;  5EZY B;  4E2L A;  3T1C A;  4ZIB A;  4RO2 A;  3W7U A;  4WFH A;  1W59 A;  4DUZ B;  2JRI A;  1NVP D;  3ABM C;  4JPR A;  5GTH Z;  1QR8 A;  1WA8 B;  2N05 A;  2YEV B;  4X89 A;  1FJG O;  3T1H O;  4QGP A;  1OJH A;  3FX7 A;  3CRR A;  4TUY B;  3FFQ A;  3OAA G;  3SPJ A;  3Q4H A;  1R3L C;  4PDR A;  3K57 A;  1SES A;  3G4S V;  3HKB B;  1HDJ A;  4K3A A;  3K3W A;  1YF2 A;  3APO A;  3ZRW A;  2ZM6 B;  4JTD B;  4OX9 B;  2OTL V;  2ZQM A;  1N36 B;  3SGI A;  4GZR B;  2GBO A;  5B1B C;  1MMM A;  5FLX N;  4R6Z A;  3CCU V;  4N23 A;  4EFE A;  1H2S B;  1TAE A;  2LFR A;  1Y76 A;  2A3Q A;  2Q8V A;  1S5H C;  2LFS A;  2QR4 A;  4JI2 O;  4CZZ A;  3G80 A;  1LNQ A;  2KQX A;  1GRJ A;  1KUQ A;  1Q6H A;  3ABM B;  1K33 A;  3F5T A;  5L3F A;  5IWA B;  2F1M A;  3P30 A;  4CH4 A;  1MSW D;  1JFF B;  3B2E E;  2YS8 A;  1AR5 A;  3OGI B;  4I55 B;  4FPP A;  2OCC C;  4FM0 A;  1P4R A;  3K79 A;  1OCO C;  2LQT A;  1VQ7 V;  1B3Q A;  2R72 A;  1VQN V;  4BAY A;  1AI7 A;  3ZMT A;  3T4Z A;  3VQX A;  4A5U B;  1OZ0 A;  3L74 H;  5B1B B;  3B09 A;  3B8M A;  1AR4 A;  1R3J C;  2W6J G;  4DR1 O;  2FYU H;  4LCU C;  5FL7 G;  5CBG A;  3UQ8 A;  3OM3 B;  1GM7 A;  1AR1 B;  1GM8 A;  1SQP H;  2LGQ A;  4QPJ A;  3K0D A;  4JAV A;  3ZRS A;  4DRX A;  2HHH B;  3N2G A;  4UCO A;  5LA6 B;  2CH7 B;  1M93 A;  5L3G A;  2LW1 A;  1VF6 A;  2ZKO A;  3OR7 C;  4CC6 A;  3CYO A;  3U0Z A;  2HJD A;  1XUQ A;  1P84 F;  1ENV A;  4MW8 A;  4LH6 A;  2YC0 A;  1I08 A;  1N32 B;  1PL4 A;  2CDY A;  2OCC B;  1JMK C;  5LHI A;  4LBE C;  1Q43 A;  2RNB A;  4NTY A;  2P4K A;  3GWK C;  2VWK A;  1OCO B;  3AK1 A;  4XDL A;  2QTS A;  3JAS A;  1N0J A;  3JYC A;  1FS0 G;  4CBC A;  5EIB C;  4DV3 B;  4JYB A;  1Y74 B;  3OTF A;  1FXK A;  4JV5 B;  5LBQ A;  4HAM A;  5J2T B;  1W0J G;  4W4L A;  2L6L A;  3CWB H;  1OHH G;  3JAL A;  5TIS Z;  1XMQ O;  1DLB A;  1SC5 B;  1JX9 A;  4TSF G;  1YVW A;  1E79 G;  4LWS B;  2X6A A;  2Q67 A;  1SQF A;  1L0L H;  2QWQ B;  4RWU A;  4GT1 A;  3K58 A;  2QDO A;  4IHJ B;  1WN7 A;  1NBM G;  3PJS K;  3AG3 C;  4PA4 A;  3CC2 V;  3DC5 A;  5IYC O;  3JCU Z;  3CC4 V;  4MTX A;  2ZR3 A;  4X1Y A;  2CTW A;  1I7F A;  3SPH A;  2PZS A;  2GDS A;  3N27 A;  3SYO A;  4FLZ A;  2CE4 A;  2WLI B;  3L75 H;  3GB7 C;  3KZI Z;  3BVO A;  2OIG A;  1ZWI C;  4J7Z A;  1NI8 A;  5EBL C;  4DUY O;  2Q4P A;  4JGS A;  2BE3 A;  5IYZ B;  3TET A;  1M4U A;  2UU9 B;  2A79 B;  3BEH A;  1BL8 A;  2XAS A;  1Q6U A;  2W6I G;  3WG7 C;  4WCE V;  5LHH A;  1X4T A;  3E8B A;  5LXT B;  3W7T A;  1HNW B;  1JOY A;  2F43 G;  4Z1M G;  2GHY A;  5H6Q A;  1JJO A;  5EYP B;  4WFF A;  4DR4 O;  1NH2 D;  2HKO A;  3QO5 A;  3D8C A;  4KP4 A;  2E76 B;  1HWY A;  1S77 D;  1EN6 A;  4KXR A;  2FB5 A;  3DTU B;  2GUZ B;  3AG3 B;  1SQV H;  4B7K A;  2BOB C;  5BY1 A;  1F51 A;  1RP3 B;  3SYP A;  3WB2 A;  1RSO B;  3AK2 A;  4FFB B;  1PNL A;  4PD4 F;  4ASU G;  4BW9 A;  1G4Y B;  4FZ0 A;  5HFL A;  3AG1 C;  1HNZ O;  4QE7 A;  5JQG A;  1EM1 A;  4FLX A;  5BMV A;  3OR6 C;  2L35 A;  2YXH A;  3CSX A;  2UUB B;  2WLL A;  1J5E B;  5H5N A;  3M7M X;  3WG7 B;  4IIJ A;  4DYL A;  2JS3 A;  3BHP A;  3ZMV A;  1OCZ C;  5L3C A;  5LMN B;  3CHX A;  3L70 H;  1IBK O;  1NH2 B;  1YTF B;  4FLW A;  2QWP B;  4YJ3 A;  3RYC A;  4B3S O;  1PKX A;  1SS3 A;  1US6 A;  4R8C A;  2R9R B;  1U96 A;  1XDC A;  1ZSP A;  2CTP A;  5CA0 B;  4GX5 A;  3FB8 C;  4O2B A;  1HW7 A;  2DJV A;  1VQ8 V;  3A0R A;  3QG5 A;  2YXY A;  1IBL O;  4MT8 A;  4JAU A;  3UT5 B;  5J2U B;  2RQ6 A;  2DMX A;  3AG1 B;  2ILM A;  1KC8 W;  2Y69 C;  1WJZ A;  4MVZ A;  1MNG A;  4I50 A;  3HKE A;  4Q20 A;  4JI5 O;  2Q7E A;  3EXA A;  4NKG B;  3ASN C;  1UPG A;  5A2Q N;  3A8T A;  1M5I A;  3WB1 A;  2VWJ A;  1QNM A;  1H8E G;  1OCZ B;  1K5Q A;  2EZO A;  4OGQ B;  2EIL C;  1GAX A;  4WFE A;  4YHH B;  3Q4H B;  2QWR B;  2YIA A;  4YJ2 A;  1WAZ A;  1EZJ A;  3ZRW B;  2WA4 A;  4PA7 A;  3ETQ A;  2WLH A;  1JVM A;  3IAY A;  1MG1 A;  1S5J A;  4HYO A;  4XDJ A;  4X64 B;  4CH3 A;  1QBZ A;  2Y69 B;  1CP9 A;  1ARO P;  1D5A A;  3THO A;  3ZRV A;  4O4H B;  4X9Q A;  5D5P A;  1RM1 C;  3HKD A;  1F4N A;  5CBF A;  3CP1 A;  3KKY A;  1WB7 A;  3CS5 A;  4UB6 Z;  1VF6 C;  1YIT V;  3SYC A;  3ASN B;  4G28 B;  1IBL B;  1DGS A;  2GSM B;  1QQC A;  2ZNI A;  4JYC A;  5K1P A;  3U11 A;  3P32 A;  2EIL B;  4O2A B;  3E8F A;  2ZIN A;  4U3J A;  1VMG A;  1CEZ A;  3H1K H;  3MHS C;  1ORQ C;  5H9C A;  3U10 A;  4DR6 B;  4RUF A;  1AJP A;  2PYL A;  4QE9 A;  3OEE G;  3OMA B;  3CCV V;  2V1D A;  4QPK A;  2ITD C;  4DO2 A;  2D3O W;  5KAI Z;  5CB4 A;  3BRC A;  4FLU A;  3UKM A;  4JI3 O;  4IYH A;  1FXK C;  5E1A C;  1GN2 A;  2OWO A;  2BCC H;  2P5O A;  4CS3 A;  4GLX A;  3T4D A;  2CTQ A;  1M57 C;  1YZB A;  3WFV A;  1ROP A;  3ZIA G;  4DRX B;  3N2G B;  1RM1 B;  4NXN O;  3K0G A;  1GMG A;  3ZX6 A;  2O57 A;  4LF6 B;  3W7S A;  2EZP A;  3ZN0 A;  1W0K G;  3H1J H;  1AP6 A;  4JI8 O;  2IJJ A;  1Q90 D;  4GX0 A;  2ZXW C;  1ZUQ A;  4WBN A;  3HR0 A;  1V9P A;  5GON A;  1JPX A;  4PA6 A;  3ETG A;  4DUZ O;  2WLM A;  3S3W A;  1N33 O;  1Z5W A;  3JAS B;  4UB8 Z;  3ZMU A;  4PA9 A;  3FD9 A;  3HKC A;  1NR1 A;  3G6E V;  2HVJ C;  1HR0 O;  1VIB A;  1FXK B;  1JR9 A;  3K59 A;  3K08 A;  3OD4 A;  5EBM C;  2A06 H;  3ZS8 C;  3JAL B;  1M57 B;  4OX9 O;  1N36 O;  1KKC A;  1VF5 B;  4X20 A;  1H2K A;  4DK0 A;  3SR2 C;  3VQW A;  3WU2 Z;  2JGD A;  4JI3 B;  4JYY A;  4U3F H;  3HB3 B;  4X88 A;  1YJ9 V;  2ZXW B;  5B3S C;  1QR9 A;  2AHY A;  4UFZ A;  4X1Y B;  3E89 A;  3T1Y O;  1AVM A;  5IWA O;  2CUG A;  3BFR A;  1YDX A;  3L73 H;  4TQD A;  4JI8 B;  4DV2 O;  4DV0 B;  3TJT A;  2WLN A;  2CGN A;  1JCH A;  2DQ0 A;  4MTF A;  5CBH A;  3D3Q A;  3JSN A;  1N33 B;  1G8M A;  3O65 A;  1SQB H;  3D3I A;  4XBF A;  3K5M A;  1EN5 A;  2JVD A;  3J7A U;  1HR0 B;  2GTA A;  4NVP A;  4NTW A;  5E79 Z;  1AJQ A;  2BOC C;  5IJ0 A;  1SF9 A;  2QKA A;  4X65 O;  5CA1 A;  4KHP B;  5B3S B;  3C3S A;  4DV5 B;  2HHH O;  1BZK A;  1BQZ A;  4QNH B;  5KHJ A;  2OCH A;  2E5L B;  1S5L Z;  1R3I C;  2QJ1 A;  3CCR V;  3LUT B;  2FTK A;  2B5U A;  3AG4 C;  5JQG B;  4JI4 B;  3N2K A;  4DW1 A;  1O9G A;  3ML0 A;  1K4C C;  3ZBH A;  3O9O A;  3C90 A;  4JTA B;  1VQO V;  1PPJ H;  2Q68 A;  1N32 O;  4UVC A;  4NYK A;  3MAQ A;  2IBZ H;  2R9A A;  2WLL B;  4IIJ B;  4O4I A;  5A9G A;  2YIC A;  5JJN B;  3TXQ A;  3T1Y B;  2YIB A;  2CGO A;  1NTZ H;  1NVP B;  3RGB A;  4JZG A;  4DV3 O;  3JAK A;  3R65 A;  1LR1 A;  4DV2 B;  4LFB B;  3UCS C;  5KHH A;  4JAS A;  4JI1 B;  4JV5 O;  3A0H Z;  4YJ3 B;  3M8A A;  4OPH A;  2JIZ G;  1Q7Y W;  2Q73 A;  4JTC B;  2QTO A;  3RN4 A;  4LR3 A;  4I5S A;  2RJZ A;  2VQF O;  1UFI A;  4O2B B;  3W7W A;  4MTG A;  4NR1 A;  1KBH A;  4LNU B;  1XOU A;  1NS1 A;  2JGU A;  3FYI B;  2BTQ A;  3AG4 B;  2PI4 A;  3DSQ A;  1KKD A;  1IBM O;  3IGA C;  3HKE B;  4X65 B;  2ADP A;  1E1R G;  2QGN A;  4K8Z A;  1MZE A;  1MZF A;  5BR8 O;  1PNM A;  1FFT B;  2V4D A;  3ASO C;  1PP9 H;  4UVB A;  1BMF G;  2YXL A;  1AP5 A;  1RPO A;  1M90 W;  1XHZ A;  1H2L A;  2X6C A;  2XOK G;  3RT3 C;  3VQV A;  3OW2 U;  2B1G A;  5KA5 A;  1Q6I A;  2UU9 O;  4PHZ A;  5HFM A;  4AI8 A;  4ZBM A;  4X1K A;  4UUJ C;  4YJ2 B;  2IJK A;  4WFB V;  3I55 V;  1HNW O;  2WA3 A;  2Q6A A;  4AIL C;  1AI5 A;  1N8R W;  3J80 N;  3H1I H; 
#chains in the Genus database with same CATH homology
 1RP3 B;  1SC5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...