1RP3B

Cocrystal structure of the flagellar sigma/anti-sigma complex, sigma-28/flgm
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
77
Chain Sequence
VNRIELSRLIGLLLETSGTNKIEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEFFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase sigma factor SIGMA-28 (FliA)
publication title Crystal Structure of the Flagellar Sigma/Anti-Sigma Complex Sigma(28)/FlgM Reveals an Intact Sigma Factor in an Inactive Conformation
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 23
structure length 77
sequence length 87
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04316 FlgM Anti-sigma-28 factor, FlgM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1160 Mainly Alpha Orthogonal Bundle Helix Hairpins Anti-sigma-28 factor FlgM 1rp3B02
1SC5B 1RP3B
chains in the Genus database with same CATH superfamily
1PV0A 3OE7G 3ZMZA 2FYUH 3EHBB 3FFQA 4ABMA 1F7YA 4TQDA 3BRCA 2PF4E 2Z5UA 1QNMA 4CC6A 5BZBA 5BR8B 1XMOB 3WG7B 3MDSA 4H37A 2UUCB 4LNUA 2JGDA 2R72A 4MVQA 1FJGB 5JH7A 2XUMA 3OMAB 4LF8B 3QTCA 4GCZA 1GK9A 3JD1A 4WFEA 4XDKA 3OR6C 1NVPB 5IY5B 4CBCA 3AG1C 1N34B 2HVKC 3JARA 1NS1A 4DV5B 1FS0G 2A7WA 1VIBA 3UT5A 1QLNA 5B1BB 4KP4A 3CSXA 5LMNB 5CN0A 3L72H 4ZOLA 4I5SA 4JASA 3SYCA 2JJ2G 3JATA 1K34A 2HP8A 1NTKH 2DJVA 2QWNB 1VQKV 1P7GA 3W7SA 3C3TA 3RVYA 5BR8O 1XMOO 1JR9A 1FFXB 2UUCO 1JFFA 2Q73A 2CTRA 1K73W 4PA3A 4PDVA 1FJGO 4BW5A 1Q3EA 2P5OA 4UCTA 3NXSA 3IFXA 3JALA 4LF8O 3OFNG 1WP8A 1ZX3A 5IWAO 1BSMA 2CK3G 1XUQA 2ZD9A 3CCLV 4B3TB 1Q6IA 1N34O 2R9AA 3STLC 1ENVA 2P67A 1HR0B 1YTFB 1NJIW 4LBEC 4DV5O 5LHHA 4ZBMA 3L73H 2UXBO 2FKXA 1NTZH 5LMNO 4JAUA 1XQ8A 1VQLV 1KP3A 1AR5A 1N4CA 2D2CB 1VF5B 4JYCA 2LFRA 5BY1A 2RN9A 2W6IG 1M56C 1BQZA 1QQCA 3FB7C 4R7CA 3ABMC 4D7SA 1WB7A 4JI4B 4QPJA 4X66B 2YEVB 2DWDC 3C90A 5IJ0A 1MZEA 1S3JA 1MOFA 1TUBB 3ZRSA 1Q43A 1W59A 3J7AU 4O4JA 1OZ0A 4B3TO 1GN4A 4NB5A 3STZC 4BW9A 1ZUQA 4LC1A 1HR0O 1M5IA 4FFKA 1Q6HA 3E8BA 3FKSG 4DV1B 3L71H 3TXSA 1KMIZ 5LMUB 2EIMB 2ZE7A 5B66Z 2EIJB 2XTAA 1JCHA 1XHXA 2F93B 2L6LA 2KQXA 5DM6V 5KHHA 5ITZB 2Z0AA 4KXRA 2EINC 3RYCA 2AZ0A 1Y67A 1MSDA 1XREA 2IH1C 4X1YA 2UUBB 3BAAA 4JI4O 3B4SA 3EVKA 4X66O 3W7TA 1J95A 1M1KW 3SR2C 3G80A 3H1JH 3RYHB 3I56V 1PL0A 2HVJC 1S76D 5KMGA 4HYOA 2YIDA 1M57B 5B1OA 1D5AA 3A0RA 3OUSA 1ZL8B 1N33B 1VQMV 1EN6A 1I5XA 1GN3A 3SPCA 1VF6C 1I5YA 4DV1O 1KB9F 2Y69B 4HBNA 2BCCH 1IBLB 5LMUO 1N32B 1ZAUA 4J41A 3EFFK 1S0VA 1I94B 1Q5OA 3CE2A 5JWPA 1FPOA 1ZL8A 1PL4A 3ZJZA 4L8JA 4A5UB 1KQSU 1FXVA 3A0BZ 4QE9A 2ZR3A 4TUYA 5TISZ 2UUBO 2X7RB 3ZN1A 3OTOB 2RQ6A 2YIBD 3K08A 3AK3A 1SETA 2QM7A 5A9GA 3OM3B 4LFBB 2BOBC 1H2NA 4ASUG 1AJPA 3ZMSA 4FLVA 3K5LA 2PI5A 3B8NA 1EM1A 5AG2A 2HJDA 5J2UA 1P49A 4P30A 3RVZA 5IYCO 4IYIA 4JTCB 1N33O 1GM8A 1OCRC 1QLEC 2ZKOA 1R3LC 5CMUA 1Z5VA 3AK1A 5EBWC 5A2QN 4DV7B 4JTDB 4RO2A 4YY3B 1I08A 3UCSC 3P3PA 3A0HZ 1SS3A 1IBLO 1N32O 1I94O 2IW5A 2UXDB 2QWRB 4YJ3A 1VQ7V 2Q7EA 2WPDG 2QSAA 3LNNA 4FPPA 1M93A 4I55B 3CCRV 1U97A 2BSKA 3CRQA 3B8MA 1K92A 2Q5ZA 2YDEA 4KUMA 3OTOO 1OCOB 1SESA 3G6EV 2FL4A 2E76B 4LFBO 3S3WA 2F1MA 2Y0IA 3MHSC 2WLMA 5IJ9A 3ABLB 1US6A 4I55A 5C8YA 1VQPV 2PY5A 2QWOB 4HZ3A 3X2QC 1E79G 3UKMA 4DR7B 3IC9A 2WA4A 3ZRVA 1NT2B 3PN1A 4BAYA 1GRJA 1NH2D 3S3XA 1NQTA 1YSCA 3CRMA 3P30A 2WSSG 3CX5F 4DV7O 4DR4B 4YY3O 5LL6Y 5L3DA 3ML0A 3M7MX 4LF4B 4X65B 1L0NH 4EKWA 2UXDO 2PUSA 1BS3A 1TGOA 4PV1B 1GAXA 5IYZB 4DR5B 3WG7C 1LNQA 2JK5C 3ASNB 2QWPB 1ZSPA 2IH3C 2P4VA 5L3EA 4O2AA 2A06H 5IY5C 4DR7O 4ZI7A 2ZINA 1AR1B 1CEZA 1QR8A 4DR4O 1OCCB 4NKGB 5B1BC 4YJ2A 2OIGA 4QNHB 2JJ1G 2DYSB 2ZIOA 1SA0A 3D8CA 4LF4O 3HKDA 2P22C 2GUZB 3HKCB 5LOVB 4DR5O 3OTFA 1MG1A 1XMQB 1YJWV 2Y4UA 4JI0B 2CH7B 3D3IA 2WLLA 4PJ0Z 4GZRB 1N8RW 4IIJB 1Q7YW 3CCSV 1DGSA 2DOSA 3MD0A 1MZFA 1P4RA 5E1AC 4DV3B 4RUFA 1BZKA 1BMFG 1PNKA 5L3FA 3RGBA 5JQGB 1HNXB 1HP8A 3IAYA 1CP9A 2IU3A 5LHGA 1VF7A 1H38A 3SJQC 2K9PA 3K3WA 4J9ZB 3E22B 1XMQO 4KHPB 3RYIB 4JI0O 1VF6A 2OWOA 1UPGA 4IL6Z 4DRXA 2LJ2A 5EYPA 2E3CA 1P7BA 3K58A 2XAFA 3IGAC 3CXCU 1K97A 3ZHTA 1J5EB 2NR5A 1FXKB 2AW9A 3E22A 3ABUA 3ETGA 1K4DC 1ZWIC 4IHJB 2EBOA 3RFRA 4CH3A 1KYOF 3CCQV 1R3JC 2YSUB 1HNXO 5FLXN 4CS2A 5EZYB 4TOIA 2PGGA 4K8ZA 2BE3A 2F4VB 1KECA 5D5QA 3OGCC 1AJQA 5J2TB 4EB6B 2WAMA 3F7VC 3CMEV 4PA4A 1Y76B 3QO5A 4H13B 4X88A 2QDOA 5EK0A 4KHPO 1T5EA 4K35A 1H8EG 3U0ZA 2YC0A 5EIBC 1X59A 4WFGA 5KX5A 4UVBA 5GONA 3TCUA 5CA1B 1W2BU 4I4TA 4CZZA 2DWEC 2B1GA 1JJOA 1WPBA 3RBZA 4D7TA 4DR2O 1VEWA 2ZCEA 3K06A 3RYFA 4TV8B 5JJEB 5LXTB 1J5EO 4GX0A 1NU1H 4U7NA 2Q4PA 1M57C 4WBNB 4LF6B 2GSMB 4BIZA 1DF4A 5L3GA 3BFRA 1B6QA 1IDSA 5LGUA 3B09A 1NH2B 4JI2B 2LFSA 5CA1A 5EC1C 3CJHA 2PI4A 1D2DA 2Y69C 5CA0B 3SDLA 1I7FA 4TV8A 5F2VO 2F4VO 1LUVA 5LXTA 4X1IB 2W6JG 4B7KA 4XBFA 1KD1W 4I50B 3ZMVA 1S5HC 2ZE8A 4JF3A 2ADPA 1R1BA 1B04A 3ETDA 2XAQA 5CA0A 2NN4A 1W0JG 3WU2Z 4AI8A 4FLUA 4I50A 5C93A 2A9HA 1JQ0A 5LA6B 3K9AA 1LUWA 3UM7A 3DXRB 5IWAB 4LF6O 5GTHZ 2XNDG 2VRZA 4DR1B 1HNWB 4JI2O 1Y74B 1AR4A 4JI8B 3BCCH 4Z1VA 2B9ZA 3DC6A 3QF7A 5IYDO 2UXBB 1NBMG 2ARHA 2AHZA 3DXRA 2DQ3A 1PP9H 5DN6G 5H6QA 2V7QG 5LYJB 3JAWB 2DYRB 2IU0A 2XT9A 4I9WA 1RM1B 3K79A 3WB1A 1KKCA 1BL8A 4MS2A 4TQFA 4W4LA 3E86A 5DEDA 4E2LA 1OCOC 3AG4B 4O4LB 2E75B 4O2BB 5JVDB 3H1KH 1IX9A 4JAVA 3OGIB 3Q4HB 1YJ9V 4K0KB 2ETNA 5IYBO 3SPJA 2YXYA 4DV6B 1S5JA 2QEXV 2RDCA 2JS3A 3QO8A 5LP6B 2BTOA 1FFXA 2IJIA 1XHZA 3L74H 4DR1O 4NTYA 1HNWO 1K3EA 4JI8O 3QVNA 3Q4HA 4I0XB 5IDJA 4JYAB 5DECA 3ABKB 3ICXA 3G67A 1YDXA 4U3FH 3CCEV 2QWQB 2LO1A 3JCUZ 4PD4F 1AVMA 4JYYA 1XOUA 4YHHB 2EULA 4JAAA 5FPRA 1Q86W 3T2MA 1XL6A 4GLXA 3T1HB 1G4YB 3SYQA 2JEXA 4EEQA 3ASNC 3ZRWB 4GUNA 1GN6A 1XDCA 2ITCC 1S72V 3TJTA 4H0LB 3N2GB 4PA9A 3KZIZ 3CC2V 4K0KO 1JPXA 2HLDG 5LGNA 2E74B 4DUZB 2OYQA 4ZIBA 4DV6O 3K57A 4NTWA 4XDJA 5KHGA 2IJHA 5B5EZ 4MVSA 3ABTA 1Z5WA 5KHJA 1FFTB 4MTXA 4GT1A 4FFBB 2N04A 2YEVA 3N2GA 5GW7A 4MVUA 1OCCC 1MSWD 2ZDIA 1TUBA 2VS0A 2KB1A 2DYSC 4JYAO 2QGNA 3E2EA 3BPZA 1BHAA 1QHTA 1QBZA 2Z3YA 1ZLZA 4DV4B 2NLJC 4DO2A 4YHHO 2NNUA 2V4DA 1H2KA 4CS4A 2QKCA 3KCXA 3T1HO 2DMXA 2ZR2A 4WFHA 4QIWF 4K3AA 1Y4MA 2QR4A 1N36B 5JCOC 3SJBC 1V54B 3VOUA 5K1XA 1R6TA 4DUZO 3AK2A 1XNRB 4HAMA 4LH7A 1XEQA 1NI8A 5ITZA 1DTOA 3HKEB 3HPLC 1BE3H 1OCZB 4MSWC 1EZJA 5H9CA 4N21A 4JZ2A 3RN4A 1KBHA 4JI1B 3U10A 3RYHA 4LFAB 3CCVV 2KSDA 1YJNV 4NXNB 3BA8A 3LSSA 2QE7G 5CBGA 4DV4O 2F43G 3TK1A 3MAQA 4MW3A 1XBLA 4EFEA 2CE4A 3ASOB 3SJCC 2P90A 3JASB 1N36O 4HNAB 2R9IA 2Q8VA 4NTXA 4PDLA 1U96A 1XL4A 1SQPH 1FXKC 4U3JB 1XNRO 2ZNIA 1EZVH 1SQBH 2H3OA 2P4KA 3ZN0A 2G38A 1TVKB 1YEWA 1NR7A 1Q90D 3R66A 2PTMA 3K59A 1I0HA 1H2MA 4J80A 2M6YA 2VWKA 3HKBB 4DV2O 2YIAA 4X8AA 1WA8B 1R3IC 4JI1O 3WFVA 3H1HH 4LFAO 2HFEC 4NXNO 3N2KB 2Q9LA 4FK5C 2XHBA 4DUYB 2OTJV 1P84F 2DW4A 2F23A 2W0XA 4CH6A 3K03A 1HDJA 3FB6C 1N0NA 1M9NA 3ZX6A 4DK1A 3RT3C 3J81N 4PI2A 1MMMA 1DK1A 5BMVB 3NR7A 1PD3A 3OMIB 1D5NA 3HR0A 1M90W 2Y4TA 4CC5A 4MTGA 4FMTA 2RJZA 1Q82W 3E8FA 4NVPA 3APOA 2Q68A 3ZHQA 3UO2A 4EFBA 4YXWG 1H2GA 1R6NA 1H2LA 3CRAA 3F5TA 3LDEA 3QNEA 2GBOA 5BMVA 2IBZH 2H94A 3BEHA 2X6AA 3T4ZA 4UCOA 4DV0B 4JYBA 1H2SB 1JX9A 1VQ6V 3O9OA 4XDLA 1F23A 4KL1A 4DUYO 1YF2A 4X62B 3CMAV 4RAIA 2B5UA 1VQ9V 1RSOB 4UVAA 4JI6B 3GWKC 1PM9A 4MVZA 1V55B 4BR6A 4PA6A 1HWYA 4IT5A 5KA5A 3FX7A 3KCYA 1IBMB 4J10A 2YUAA 1DLBA 3CYOA 1YZBA 2Q0AA 3LUTB 1PNMA 1VARA 4JGSA 4LWSB 5IYZA 4BIUA 1L0LH 4DXWA 1YIJV 3M99B 3OR7C 3SPGA 1ORQC 4DV0O 5D5PA 1SF9A 4O4HB 5EBLC 5HFLA 3G6BA 3CEIA 4X62O 4FM1A 4WFBV 3BVOA 2DYRC 2N05A 1SQGA 4J7JA 1NVPD 1QR9A 1KU9A 4JPRA 2HG5C 2RMKB 2WLHA 1RM1C 3QO7A 4PDMA 2UXXA 4JI6O 1VMGA 4UCUA 4X20B 4CH4A 3AG4C 3KG2A 3U11A 3JAKB 5JJNB 3FD9A 3LDDA 4IGGA 1IBMO 3LSQA 1AILA 2GUZA 2ZM6B 2F95B 2PZSA 1SC5B 3HKCA 5LOVA 2QKAA 5LP6C 4TT3G 2WLIB 3FAVB 1EN4A 3IJ4A 2CH7A 2EINB 3ZHSA 4LF9B 4GYCB 4UCVA 5CB4B 5KAFZ 5J9PC 2FMLA 1O9GA 4IIJA 2VQFB 1O9HA 2VWJA 3OT7A 4UB8Z 2HR3A 5JCOA 3ABKC 1JVMA 5IE9A 4GKKB 2Q7GA 3AG7A 2WLIA 2OTLV 1FKAO 4RWUA 4GKJB 1R3KC 2Q67A 1VQNV 4CS3A 2XAHA 1K4CC 5JQGA 1YTFD 3VQYA 2YI9A 2EIKB 4B3MB 2HKOA 3A8TA 4L87A 3TXQA 1ZTEA 2ZDIC 2QM8A 1F51A 3G71V 2JVDA 1RFYA 4DR2B 5B1NA 2ZM6O 4I7ZB 4D6TH 3A2FA 5CBFA 3BY6A 2UXCB 1F4MA 3AG2B 3RYIA 4NXMB 4MTOA 4LF9O 3OAAG 3ZHUA 3L9DA 1GTOA 2YIBA 3QG5A 3ZMUA 1YITV 4FIPC 2VQFO 2EZPA 3CC4V 4Z2WA 3E8HA 4GKKO 2EIMC 4X1KB 2EIJC 2KG7B 4ZHQB 1FXKA 4O4IB 3BA9A 1CXZB 4JI5B 4FLXA 1IBKB 4FLWA 2OCCB 3F7YC 4GKJO 4IHJA 4X9QA 4YIPA 4B3MO 5CBHA 5EZYA 2ZNJA 1IXBA 4DW0A 2VQEB 2KG7A 2UUAB 3H9VA 1V54C 1Y66A 3LDCA 5J2TA 1THZA 4EB6A 4BWAA 1L1FA 2LGWA 1Y76A 2XOKG 2DQ0A 2UXCO 2BTQB 1OCZC 4MVRA 4NXMO 4X89A 1GH6A 3E83A 3OUFA 2ZT9B 1N0JA 4OGQB 3D3QA 4DR6O 5KAIZ 4UCRA 5KHIA 2XAJA 3GWOA 4AILC 1HW7A 1K5QA 1WNSA 3F5WC 4JI5O 2ZIMA 3JCZA 4B08A 4WBNA 1IBKO 4B3RB 1YCIA 3K9SA 1AB3A 3ASOC 5B3SB 2LGQA 3HB3B 2GV9A 2Y48A 3H1LH 3IC7A 4LNUB 2VQEO 2UUAO 2JGDB 2EILB 4X1IA 3ZBHA 5JH7B 4F6RB 2QKSA 1K8AW 1VP7A 3BHPA 3K5NA 5EC2C 2CGOA 4QPKA 2X0LA 4F4LA 3JD0A 2EX3A 4C7UA 3JARB 4F6RA 2QTSA 2JDIG 3UO3A 1L8DA 5LA6A 1QVGU 3UT5B 2JRIA 3L75H 3ZEDA 4TWKA 4ZOLB 2AZ2A 4B3RO 3JATB 2A79B 1XI1A 2Q6AA 1X4TA 1Y74A 2C2AA 2QJ1A 4PELA 1EN5A 1FAFA 4MTFA 4DR3B 3JYCA 1SZTA 2JIZG 2IJKA 3SYOA 1AP5A 1JFFB 3DTUB 2ZE5A 3T1YB 5LYJA 3JAWA 4MVOA 5LBQA 3ABLC 3JALB 3ZCCA 4LF7B 5LHIA 5EBMC 3DGEA 1PKXA 1WPXA 4GX2A 3K0DA 4CH5A 4O4LA 3AG3B 2P7TC 3MHHC 4O2BA 4OXSA 5JVDA 3FYEB 4TV9B 3K5OA 3CRCA 3CCUV 5KUMA 2YXLA 3CXHF 4MT8A 1OHHG 3ZHVA 4I9QA 5H6RA 3KKYA 5LP6A 3THOA 1TAEA 3B40A 4TV9A 4R6ZA 1V55C 2WLNA 2JS5A 4I0XA 4H33A 4DR3O 1SZXA 4P9PA 3VQWA 4FLYA 5BXZA 1S5LZ 1TUEB 4J9YB 3CPWU 1G8MA 2GTSA 1BT8A 1LR1A 5IT9N 3T1YO 2E5LB 4WCEV 5IJ0B 4QGPA 3EXAA 4LF7O 3L70H 4J7ZA 1WN7A 1VQ5V 1WB8A 4O4JB 1QCEA 5KUKA 1BHBA 3LNMB 3LSUA 5KA6A 4RQEA 3ZRWA 1R6KA 2F66C 1YI2V 1GN2A 1B06A 3SJAC 1OV9A 2OIEA 3GVMA 5HFMA 4P2ZA 3ZRXA 2LW7A 2HJFC 2EJRA 5B1AB 3I55V 1BGYH 3FB5C 4PHZA 1WJZA 3JD2A 2Y0PA 2RCVA 1A32A 4FM2A 2Q69A 4FFBA 1NKDA 3ZIAG 3RYCB 2N74A 2EJ7A 4X1YB 2IJJA 1G1XB 2ZXWB 3SPIA 4FJCC 3DSQA 1JMKC 2E5LO 1RPRA 3E35A 1VQ8V 3J80N 4WFFA 2WLJA 5JJJB 4G28B 2ZQMA 4LR3A 3H01A 2PYJA 2V1DA 5KMGB 3D36C 4DK0A 4G27B 2LQTA 2LP7A 4JTAB 2CTPA 1JJ2U 4Q6GA 3AEIA 2YXHA 3WB2A 1MA1A 3TGUH 3JAMN 4MVMA 4DV2B 5FNVB 1AP6A 4TSFG 3CS5A 1YXBA 4UFZA 3HKEA 1NTMH 1KC8W 1AI6A 1FXHA 1RPOA 4RQFA 2EIKC 3CC7V 3VQXA 4W4KA 3P3NA 2UU9B 3T4DA 4FZ1A 5FNVA 2XASA 4TUYB 3CHXA 1H8HG 4NYKA 4DW1A 5KLVH 1NZ6A 2MK3A 4UXNA 1K33A 4FLZA 5CA3A 3AG2C 1Q81W 4LFCB 2JEUA 5J2UB 2FB5A 1BQ0A 3FYIB 3CCMV 4R8CA 3SYPA 3ETEA 3JASA 5FL7G 4HNAA 4Z1MG 4JZGA 1VQOV 1QU7A 2QTOA 2GHYA 1XILA 5H2FZ 2GDSA 4LCUC 4U3JA 2OCCC 1TVKA 3K0GA 4P9OA 3W7UA 2CGNA 4YJ3B 2ZE6A 3AG1B 1YVWA 1UJWB 1AI5A 3HKBA 2BSKB 2UU9O 1WA8A 4UB6Z 2CTQA 5FPOA 1RP3B 3CD6V 3N2KA 2YICA 4K8XA 2LW1A 2OT5A 5IJ9B 2HHHB 4JV5B 1URFA 1GKFA 5C8YB 4FLTA 4LFCO 1NR1A 2WWWA 3P32A 1QVFU 4QJFB 2MW2B 1TA8A 1KUQA 4JI3B 3CCJV 3OEEG 3H1IH 2P6JA 4B3SB 3E89A 1EBOA 3N27A 5LGTA 3OEHG 2X6CA 2AGAA 4YIOA 3OD4A 4H44B 1V9PA 3G4SV 5B3SC 2P06A 5H5NA 2YI8A 1SRYA 4N23A 1W0KG 3SPHA 3APQA 4UV8A 2EILC 1AROP 1HNZB 2AXTZ 2A3QA 1GM9A 1RSOA 2JGUA 1EFRG 4O2AB 2HHHO 1Q8IA 1S77D 4JV5O 4X64B 1M56B 1PNLA 3CP1A 2W0FC 3ABMB 3B2EE 4ZI7B 1WLEA 1JOYA 2YS8A 3RWRD 5K1PA 4JI3O 2D3OW 1VQ4V 4KFMA 4RUEA 4B3SO 4GX5A 1GM7A 4YJ2B 4LWSA 3ZS8C 1SA0B 1SQVH 3SYAA 4PI0A 1Y6XA 3HKDB 4UV9A 1M4UA 2KKWA 2UXNA 2QM4A 5GTIZ 1E1RG 1COWG 1FYJA 1SKVA 4O4HA 3W7XA 1WAZA 3FB8C 2L35A 4OX9B 1GO3F 1HNZO 2WLLB 2B1IA 4X65O 3PJSK 1IVSA 3JSNA 3WB0A 4PDRA 4ICGA 3BABA 2M7WA 4LP8A 2FTKA 2H8PC 4X64O 3CWBH 3K5MA 4X20A 2DN9A 3SGIA 3AG3C 2ATKC 4WFAV 3K04A 2GTAA 3JAKA 1AI4A 2O57A 2XAGA 2ADQB 2X6BA 2ITDC 1SERA 2WLKA 3FAVA 4F6EA 3JD4A 1IZ3A 3D36A 4B7EA 1OJHA 5CB4A 2R9RB 4ZKIA 4LH6A 2Q7HA 5L3CA 1F4NA 4J11A 1AI7A 2IM9A 3OMNB 4DRXB 4G2KA 4OX9O 4FVMA 4UCSA 5EYPB 1IXMA 4FM0A 1R73A 1E1QG 4WF9V 4FZ0A 3VBBA 1K7DA 1SQQH 2R70A 1Z2GA 3UQ8A 4JI7B 3CB2A 3T1CA 2ILMA 3DC5A 1MABG 4MW8A 2PYLA 2EZOA 1K5SA 4DR6B 1FD9A 3B77A 2OCHA 5B1AC 4AQYB 4J7KA 1GMGA 2HEPA 3OW2U 3JSLA 1ROPA 2BOCC 4BIOA 4U7OA 3CRRA 3ZMTA 1CPYA 1XNQB 4DV3O 2K1EA 1G6UA 4GX1A 4LF5B 3JD3A 4QE7A 1IURA 2CAZC 2RNBA 1OCRB 1MNGA 2Q0OC 1QLEB 3W7WA 3ZHRA 1KKDA 2ZXWC 5KX5B 1SQXH 2WA3A 4X1KA 5GONB 1DF5A 4ZHQA 5E79Z 4I4TB 4O4IA 3GB7C 1B3QA 3ETQA 4OPHA 3RYFB 1Q6UA 4JI7O 1JA8A 4Q20A 2CTWA 1BCCH 3RW0A 1WP7A 3O65A 2AHYA 3TETA 4J42A 2A0LA 4OPAA 2ODMA 4IYHA 3C3SA 4E4EA 5EIBD 5L3BA 4UUJC 3CJHB 4AHCA 4DYLA 4AQYO 3I5DA 3R65A 1PPJH 1K9MW 4UVCA 2BTQA 1XNQO 1UFIA 4NR1A 4LF5O 2DE0X 3X2QB 2QA4V 3VQVA 3M8AA 1KP2A 5KHKA 1YHQV 1AJNA 4PA7A 2CUGA 2CDYA 1SQFA 3E8GA 4R50A
chains in the Genus database with same CATH topology
1SC5B 1RP3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SC5 B;  1RP3 B; 
#chains in the Genus database with same CATH topology
 1PV0 A;  3OE7 G;  3ZMZ A;  2FYU H;  3EHB B;  3FFQ A;  4ABM A;  1F7Y A;  4TQD A;  3BRC A;  2PF4 E;  2Z5U A;  1QNM A;  4CC6 A;  5BZB A;  5BR8 B;  1XMO B;  3WG7 B;  3MDS A;  4H37 A;  2UUC B;  4LNU A;  2JGD A;  2R72 A;  4MVQ A;  1FJG B;  5JH7 A;  2XUM A;  3OMA B;  4LF8 B;  3QTC A;  4GCZ A;  1GK9 A;  3JD1 A;  4WFE A;  4XDK A;  3OR6 C;  1NVP B;  5IY5 B;  4CBC A;  3AG1 C;  1N34 B;  2HVK C;  3JAR A;  1NS1 A;  4DV5 B;  1FS0 G;  2A7W A;  1VIB A;  3UT5 A;  1QLN A;  5B1B B;  4KP4 A;  3CSX A;  5LMN B;  5CN0 A;  3L72 H;  4ZOL A;  4I5S A;  4JAS A;  3SYC A;  2JJ2 G;  3JAT A;  1K34 A;  2HP8 A;  1NTK H;  2DJV A;  2QWN B;  1VQK V;  1P7G A;  3W7S A;  3C3T A;  3RVY A;  5BR8 O;  1XMO O;  1JR9 A;  1FFX B;  2UUC O;  1JFF A;  2Q73 A;  2CTR A;  1K73 W;  4PA3 A;  4PDV A;  1FJG O;  4BW5 A;  1Q3E A;  2P5O A;  4UCT A;  3NXS A;  3IFX A;  3JAL A;  4LF8 O;  3OFN G;  1WP8 A;  1ZX3 A;  5IWA O;  1BSM A;  2CK3 G;  1XUQ A;  2ZD9 A;  3CCL V;  4B3T B;  1Q6I A;  1N34 O;  2R9A A;  3STL C;  1ENV A;  2P67 A;  1HR0 B;  1YTF B;  1NJI W;  4LBE C;  4DV5 O;  5LHH A;  4ZBM A;  3L73 H;  2UXB O;  2FKX A;  1NTZ H;  5LMN O;  4JAU A;  1XQ8 A;  1VQL V;  1KP3 A;  1AR5 A;  1N4C A;  2D2C B;  1VF5 B;  4JYC A;  2LFR A;  5BY1 A;  2RN9 A;  2W6I G;  1M56 C;  1BQZ A;  1QQC A;  3FB7 C;  4R7C A;  3ABM C;  4D7S A;  1WB7 A;  4JI4 B;  4QPJ A;  4X66 B;  2YEV B;  2DWD C;  3C90 A;  5IJ0 A;  1MZE A;  1S3J A;  1MOF A;  1TUB B;  3ZRS A;  1Q43 A;  1W59 A;  3J7A U;  4O4J A;  1OZ0 A;  4B3T O;  1GN4 A;  4NB5 A;  3STZ C;  4BW9 A;  1ZUQ A;  4LC1 A;  1HR0 O;  1M5I A;  4FFK A;  1Q6H A;  3E8B A;  3FKS G;  4DV1 B;  3L71 H;  3TXS A;  1KMI Z;  5LMU B;  2EIM B;  2ZE7 A;  5B66 Z;  2EIJ B;  2XTA A;  1JCH A;  1XHX A;  2F93 B;  2L6L A;  2KQX A;  5DM6 V;  5KHH A;  5ITZ B;  2Z0A A;  4KXR A;  2EIN C;  3RYC A;  2AZ0 A;  1Y67 A;  1MSD A;  1XRE A;  2IH1 C;  4X1Y A;  2UUB B;  3BAA A;  4JI4 O;  3B4S A;  3EVK A;  4X66 O;  3W7T A;  1J95 A;  1M1K W;  3SR2 C;  3G80 A;  3H1J H;  3RYH B;  3I56 V;  1PL0 A;  2HVJ C;  1S76 D;  5KMG A;  4HYO A;  2YID A;  1M57 B;  5B1O A;  1D5A A;  3A0R A;  3OUS A;  1ZL8 B;  1N33 B;  1VQM V;  1EN6 A;  1I5X A;  1GN3 A;  3SPC A;  1VF6 C;  1I5Y A;  4DV1 O;  1KB9 F;  2Y69 B;  4HBN A;  2BCC H;  1IBL B;  5LMU O;  1N32 B;  1ZAU A;  4J41 A;  3EFF K;  1S0V A;  1I94 B;  1Q5O A;  3CE2 A;  5JWP A;  1FPO A;  1ZL8 A;  1PL4 A;  3ZJZ A;  4L8J A;  4A5U B;  1KQS U;  1FXV A;  3A0B Z;  4QE9 A;  2ZR3 A;  4TUY A;  5TIS Z;  2UUB O;  2X7R B;  3ZN1 A;  3OTO B;  2RQ6 A;  2YIB D;  3K08 A;  3AK3 A;  1SET A;  2QM7 A;  5A9G A;  3OM3 B;  4LFB B;  2BOB C;  1H2N A;  4ASU G;  1AJP A;  3ZMS A;  4FLV A;  3K5L A;  2PI5 A;  3B8N A;  1EM1 A;  5AG2 A;  2HJD A;  5J2U A;  1P49 A;  4P30 A;  3RVZ A;  5IYC O;  4IYI A;  4JTC B;  1N33 O;  1GM8 A;  1OCR C;  1QLE C;  2ZKO A;  1R3L C;  5CMU A;  1Z5V A;  3AK1 A;  5EBW C;  5A2Q N;  4DV7 B;  4JTD B;  4RO2 A;  4YY3 B;  1I08 A;  3UCS C;  3P3P A;  3A0H Z;  1SS3 A;  1IBL O;  1N32 O;  1I94 O;  2IW5 A;  2UXD B;  2QWR B;  4YJ3 A;  1VQ7 V;  2Q7E A;  2WPD G;  2QSA A;  3LNN A;  4FPP A;  1M93 A;  4I55 B;  3CCR V;  1U97 A;  2BSK A;  3CRQ A;  3B8M A;  1K92 A;  2Q5Z A;  2YDE A;  4KUM A;  3OTO O;  1OCO B;  1SES A;  3G6E V;  2FL4 A;  2E76 B;  4LFB O;  3S3W A;  2F1M A;  2Y0I A;  3MHS C;  2WLM A;  5IJ9 A;  3ABL B;  1US6 A;  4I55 A;  5C8Y A;  1VQP V;  2PY5 A;  2QWO B;  4HZ3 A;  3X2Q C;  1E79 G;  3UKM A;  4DR7 B;  3IC9 A;  2WA4 A;  3ZRV A;  1NT2 B;  3PN1 A;  4BAY A;  1GRJ A;  1NH2 D;  3S3X A;  1NQT A;  1YSC A;  3CRM A;  3P30 A;  2WSS G;  3CX5 F;  4DV7 O;  4DR4 B;  4YY3 O;  5LL6 Y;  5L3D A;  3ML0 A;  3M7M X;  4LF4 B;  4X65 B;  1L0N H;  4EKW A;  2UXD O;  2PUS A;  1BS3 A;  1TGO A;  4PV1 B;  1GAX A;  5IYZ B;  4DR5 B;  3WG7 C;  1LNQ A;  2JK5 C;  3ASN B;  2QWP B;  1ZSP A;  2IH3 C;  2P4V A;  5L3E A;  4O2A A;  2A06 H;  5IY5 C;  4DR7 O;  4ZI7 A;  2ZIN A;  1AR1 B;  1CEZ A;  1QR8 A;  4DR4 O;  1OCC B;  4NKG B;  5B1B C;  4YJ2 A;  2OIG A;  4QNH B;  2JJ1 G;  2DYS B;  2ZIO A;  1SA0 A;  3D8C A;  4LF4 O;  3HKD A;  2P22 C;  2GUZ B;  3HKC B;  5LOV B;  4DR5 O;  3OTF A;  1MG1 A;  1XMQ B;  1YJW V;  2Y4U A;  4JI0 B;  2CH7 B;  3D3I A;  2WLL A;  4PJ0 Z;  4GZR B;  1N8R W;  4IIJ B;  1Q7Y W;  3CCS V;  1DGS A;  2DOS A;  3MD0 A;  1MZF A;  1P4R A;  5E1A C;  4DV3 B;  4RUF A;  1BZK A;  1BMF G;  1PNK A;  5L3F A;  3RGB A;  5JQG B;  1HNX B;  1HP8 A;  3IAY A;  1CP9 A;  2IU3 A;  5LHG A;  1VF7 A;  1H38 A;  3SJQ C;  2K9P A;  3K3W A;  4J9Z B;  3E22 B;  1XMQ O;  4KHP B;  3RYI B;  4JI0 O;  1VF6 A;  2OWO A;  1UPG A;  4IL6 Z;  4DRX A;  2LJ2 A;  5EYP A;  2E3C A;  1P7B A;  3K58 A;  2XAF A;  3IGA C;  3CXC U;  1K97 A;  3ZHT A;  1J5E B;  2NR5 A;  1FXK B;  2AW9 A;  3E22 A;  3ABU A;  3ETG A;  1K4D C;  1ZWI C;  4IHJ B;  2EBO A;  3RFR A;  4CH3 A;  1KYO F;  3CCQ V;  1R3J C;  2YSU B;  1HNX O;  5FLX N;  4CS2 A;  5EZY B;  4TOI A;  2PGG A;  4K8Z A;  2BE3 A;  2F4V B;  1KEC A;  5D5Q A;  3OGC C;  1AJQ A;  5J2T B;  4EB6 B;  2WAM A;  3F7V C;  3CME V;  4PA4 A;  1Y76 B;  3QO5 A;  4H13 B;  4X88 A;  2QDO A;  5EK0 A;  4KHP O;  1T5E A;  4K35 A;  1H8E G;  3U0Z A;  2YC0 A;  5EIB C;  1X59 A;  4WFG A;  5KX5 A;  4UVB A;  5GON A;  3TCU A;  5CA1 B;  1W2B U;  4I4T A;  4CZZ A;  2DWE C;  2B1G A;  1JJO A;  1WPB A;  3RBZ A;  4D7T A;  4DR2 O;  1VEW A;  2ZCE A;  3K06 A;  3RYF A;  4TV8 B;  5JJE B;  5LXT B;  1J5E O;  4GX0 A;  1NU1 H;  4U7N A;  2Q4P A;  1M57 C;  4WBN B;  4LF6 B;  2GSM B;  4BIZ A;  1DF4 A;  5L3G A;  3BFR A;  1B6Q A;  1IDS A;  5LGU A;  3B09 A;  1NH2 B;  4JI2 B;  2LFS A;  5CA1 A;  5EC1 C;  3CJH A;  2PI4 A;  1D2D A;  2Y69 C;  5CA0 B;  3SDL A;  1I7F A;  4TV8 A;  5F2V O;  2F4V O;  1LUV A;  5LXT A;  4X1I B;  2W6J G;  4B7K A;  4XBF A;  1KD1 W;  4I50 B;  3ZMV A;  1S5H C;  2ZE8 A;  4JF3 A;  2ADP A;  1R1B A;  1B04 A;  3ETD A;  2XAQ A;  5CA0 A;  2NN4 A;  1W0J G;  3WU2 Z;  4AI8 A;  4FLU A;  4I50 A;  5C93 A;  2A9H A;  1JQ0 A;  5LA6 B;  3K9A A;  1LUW A;  3UM7 A;  3DXR B;  5IWA B;  4LF6 O;  5GTH Z;  2XND G;  2VRZ A;  4DR1 B;  1HNW B;  4JI2 O;  1Y74 B;  1AR4 A;  4JI8 B;  3BCC H;  4Z1V A;  2B9Z A;  3DC6 A;  3QF7 A;  5IYD O;  2UXB B;  1NBM G;  2ARH A;  2AHZ A;  3DXR A;  2DQ3 A;  1PP9 H;  5DN6 G;  5H6Q A;  2V7Q G;  5LYJ B;  3JAW B;  2DYR B;  2IU0 A;  2XT9 A;  4I9W A;  1RM1 B;  3K79 A;  3WB1 A;  1KKC A;  1BL8 A;  4MS2 A;  4TQF A;  4W4L A;  3E86 A;  5DED A;  4E2L A;  1OCO C;  3AG4 B;  4O4L B;  2E75 B;  4O2B B;  5JVD B;  3H1K H;  1IX9 A;  4JAV A;  3OGI B;  3Q4H B;  1YJ9 V;  4K0K B;  2ETN A;  5IYB O;  3SPJ A;  2YXY A;  4DV6 B;  1S5J A;  2QEX V;  2RDC A;  2JS3 A;  3QO8 A;  5LP6 B;  2BTO A;  1FFX A;  2IJI A;  1XHZ A;  3L74 H;  4DR1 O;  4NTY A;  1HNW O;  1K3E A;  4JI8 O;  3QVN A;  3Q4H A;  4I0X B;  5IDJ A;  4JYA B;  5DEC A;  3ABK B;  3ICX A;  3G67 A;  1YDX A;  4U3F H;  3CCE V;  2QWQ B;  2LO1 A;  3JCU Z;  4PD4 F;  1AVM A;  4JYY A;  1XOU A;  4YHH B;  2EUL A;  4JAA A;  5FPR A;  1Q86 W;  3T2M A;  1XL6 A;  4GLX A;  3T1H B;  1G4Y B;  3SYQ A;  2JEX A;  4EEQ A;  3ASN C;  3ZRW B;  4GUN A;  1GN6 A;  1XDC A;  2ITC C;  1S72 V;  3TJT A;  4H0L B;  3N2G B;  4PA9 A;  3KZI Z;  3CC2 V;  4K0K O;  1JPX A;  2HLD G;  5LGN A;  2E74 B;  4DUZ B;  2OYQ A;  4ZIB A;  4DV6 O;  3K57 A;  4NTW A;  4XDJ A;  5KHG A;  2IJH A;  5B5E Z;  4MVS A;  3ABT A;  1Z5W A;  5KHJ A;  1FFT B;  4MTX A;  4GT1 A;  4FFB B;  2N04 A;  2YEV A;  3N2G A;  5GW7 A;  4MVU A;  1OCC C;  1MSW D;  2ZDI A;  1TUB A;  2VS0 A;  2KB1 A;  2DYS C;  4JYA O;  2QGN A;  3E2E A;  3BPZ A;  1BHA A;  1QHT A;  1QBZ A;  2Z3Y A;  1ZLZ A;  4DV4 B;  2NLJ C;  4DO2 A;  4YHH O;  2NNU A;  2V4D A;  1H2K A;  4CS4 A;  2QKC A;  3KCX A;  3T1H O;  2DMX A;  2ZR2 A;  4WFH A;  4QIW F;  4K3A A;  1Y4M A;  2QR4 A;  1N36 B;  5JCO C;  3SJB C;  1V54 B;  3VOU A;  5K1X A;  1R6T A;  4DUZ O;  3AK2 A;  1XNR B;  4HAM A;  4LH7 A;  1XEQ A;  1NI8 A;  5ITZ A;  1DTO A;  3HKE B;  3HPL C;  1BE3 H;  1OCZ B;  4MSW C;  1EZJ A;  5H9C A;  4N21 A;  4JZ2 A;  3RN4 A;  1KBH A;  4JI1 B;  3U10 A;  3RYH A;  4LFA B;  3CCV V;  2KSD A;  1YJN V;  4NXN B;  3BA8 A;  3LSS A;  2QE7 G;  5CBG A;  4DV4 O;  2F43 G;  3TK1 A;  3MAQ A;  4MW3 A;  1XBL A;  4EFE A;  2CE4 A;  3ASO B;  3SJC C;  2P90 A;  3JAS B;  1N36 O;  4HNA B;  2R9I A;  2Q8V A;  4NTX A;  4PDL A;  1U96 A;  1XL4 A;  1SQP H;  1FXK C;  4U3J B;  1XNR O;  2ZNI A;  1EZV H;  1SQB H;  2H3O A;  2P4K A;  3ZN0 A;  2G38 A;  1TVK B;  1YEW A;  1NR7 A;  1Q90 D;  3R66 A;  2PTM A;  3K59 A;  1I0H A;  1H2M A;  4J80 A;  2M6Y A;  2VWK A;  3HKB B;  4DV2 O;  2YIA A;  4X8A A;  1WA8 B;  1R3I C;  4JI1 O;  3WFV A;  3H1H H;  4LFA O;  2HFE C;  4NXN O;  3N2K B;  2Q9L A;  4FK5 C;  2XHB A;  4DUY B;  2OTJ V;  1P84 F;  2DW4 A;  2F23 A;  2W0X A;  4CH6 A;  3K03 A;  1HDJ A;  3FB6 C;  1N0N A;  1M9N A;  3ZX6 A;  4DK1 A;  3RT3 C;  3J81 N;  4PI2 A;  1MMM A;  1DK1 A;  5BMV B;  3NR7 A;  1PD3 A;  3OMI B;  1D5N A;  3HR0 A;  1M90 W;  2Y4T A;  4CC5 A;  4MTG A;  4FMT A;  2RJZ A;  1Q82 W;  3E8F A;  4NVP A;  3APO A;  2Q68 A;  3ZHQ A;  3UO2 A;  4EFB A;  4YXW G;  1H2G A;  1R6N A;  1H2L A;  3CRA A;  3F5T A;  3LDE A;  3QNE A;  2GBO A;  5BMV A;  2IBZ H;  2H94 A;  3BEH A;  2X6A A;  3T4Z A;  4UCO A;  4DV0 B;  4JYB A;  1H2S B;  1JX9 A;  1VQ6 V;  3O9O A;  4XDL A;  1F23 A;  4KL1 A;  4DUY O;  1YF2 A;  4X62 B;  3CMA V;  4RAI A;  2B5U A;  1VQ9 V;  1RSO B;  4UVA A;  4JI6 B;  3GWK C;  1PM9 A;  4MVZ A;  1V55 B;  4BR6 A;  4PA6 A;  1HWY A;  4IT5 A;  5KA5 A;  3FX7 A;  3KCY A;  1IBM B;  4J10 A;  2YUA A;  1DLB A;  3CYO A;  1YZB A;  2Q0A A;  3LUT B;  1PNM A;  1VAR A;  4JGS A;  4LWS B;  5IYZ A;  4BIU A;  1L0L H;  4DXW A;  1YIJ V;  3M99 B;  3OR7 C;  3SPG A;  1ORQ C;  4DV0 O;  5D5P A;  1SF9 A;  4O4H B;  5EBL C;  5HFL A;  3G6B A;  3CEI A;  4X62 O;  4FM1 A;  4WFB V;  3BVO A;  2DYR C;  2N05 A;  1SQG A;  4J7J A;  1NVP D;  1QR9 A;  1KU9 A;  4JPR A;  2HG5 C;  2RMK B;  2WLH A;  1RM1 C;  3QO7 A;  4PDM A;  2UXX A;  4JI6 O;  1VMG A;  4UCU A;  4X20 B;  4CH4 A;  3AG4 C;  3KG2 A;  3U11 A;  3JAK B;  5JJN B;  3FD9 A;  3LDD A;  4IGG A;  1IBM O;  3LSQ A;  1AIL A;  2GUZ A;  2ZM6 B;  2F95 B;  2PZS A;  1SC5 B;  3HKC A;  5LOV A;  2QKA A;  5LP6 C;  4TT3 G;  2WLI B;  3FAV B;  1EN4 A;  3IJ4 A;  2CH7 A;  2EIN B;  3ZHS A;  4LF9 B;  4GYC B;  4UCV A;  5CB4 B;  5KAF Z;  5J9P C;  2FML A;  1O9G A;  4IIJ A;  2VQF B;  1O9H A;  2VWJ A;  3OT7 A;  4UB8 Z;  2HR3 A;  5JCO A;  3ABK C;  1JVM A;  5IE9 A;  4GKK B;  2Q7G A;  3AG7 A;  2WLI A;  2OTL V;  1FKA O;  4RWU A;  4GKJ B;  1R3K C;  2Q67 A;  1VQN V;  4CS3 A;  2XAH A;  1K4C C;  5JQG A;  1YTF D;  3VQY A;  2YI9 A;  2EIK B;  4B3M B;  2HKO A;  3A8T A;  4L87 A;  3TXQ A;  1ZTE A;  2ZDI C;  2QM8 A;  1F51 A;  3G71 V;  2JVD A;  1RFY A;  4DR2 B;  5B1N A;  2ZM6 O;  4I7Z B;  4D6T H;  3A2F A;  5CBF A;  3BY6 A;  2UXC B;  1F4M A;  3AG2 B;  3RYI A;  4NXM B;  4MTO A;  4LF9 O;  3OAA G;  3ZHU A;  3L9D A;  1GTO A;  2YIB A;  3QG5 A;  3ZMU A;  1YIT V;  4FIP C;  2VQF O;  2EZP A;  3CC4 V;  4Z2W A;  3E8H A;  4GKK O;  2EIM C;  4X1K B;  2EIJ C;  2KG7 B;  4ZHQ B;  1FXK A;  4O4I B;  3BA9 A;  1CXZ B;  4JI5 B;  4FLX A;  1IBK B;  4FLW A;  2OCC B;  3F7Y C;  4GKJ O;  4IHJ A;  4X9Q A;  4YIP A;  4B3M O;  5CBH A;  5EZY A;  2ZNJ A;  1IXB A;  4DW0 A;  2VQE B;  2KG7 A;  2UUA B;  3H9V A;  1V54 C;  1Y66 A;  3LDC A;  5J2T A;  1THZ A;  4EB6 A;  4BWA A;  1L1F A;  2LGW A;  1Y76 A;  2XOK G;  2DQ0 A;  2UXC O;  2BTQ B;  1OCZ C;  4MVR A;  4NXM O;  4X89 A;  1GH6 A;  3E83 A;  3OUF A;  2ZT9 B;  1N0J A;  4OGQ B;  3D3Q A;  4DR6 O;  5KAI Z;  4UCR A;  5KHI A;  2XAJ A;  3GWO A;  4AIL C;  1HW7 A;  1K5Q A;  1WNS A;  3F5W C;  4JI5 O;  2ZIM A;  3JCZ A;  4B08 A;  4WBN A;  1IBK O;  4B3R B;  1YCI A;  3K9S A;  1AB3 A;  3ASO C;  5B3S B;  2LGQ A;  3HB3 B;  2GV9 A;  2Y48 A;  3H1L H;  3IC7 A;  4LNU B;  2VQE O;  2UUA O;  2JGD B;  2EIL B;  4X1I A;  3ZBH A;  5JH7 B;  4F6R B;  2QKS A;  1K8A W;  1VP7 A;  3BHP A;  3K5N A;  5EC2 C;  2CGO A;  4QPK A;  2X0L A;  4F4L A;  3JD0 A;  2EX3 A;  4C7U A;  3JAR B;  4F6R A;  2QTS A;  2JDI G;  3UO3 A;  1L8D A;  5LA6 A;  1QVG U;  3UT5 B;  2JRI A;  3L75 H;  3ZED A;  4TWK A;  4ZOL B;  2AZ2 A;  4B3R O;  3JAT B;  2A79 B;  1XI1 A;  2Q6A A;  1X4T A;  1Y74 A;  2C2A A;  2QJ1 A;  4PEL A;  1EN5 A;  1FAF A;  4MTF A;  4DR3 B;  3JYC A;  1SZT A;  2JIZ G;  2IJK A;  3SYO A;  1AP5 A;  1JFF B;  3DTU B;  2ZE5 A;  3T1Y B;  5LYJ A;  3JAW A;  4MVO A;  5LBQ A;  3ABL C;  3JAL B;  3ZCC A;  4LF7 B;  5LHI A;  5EBM C;  3DGE A;  1PKX A;  1WPX A;  4GX2 A;  3K0D A;  4CH5 A;  4O4L A;  3AG3 B;  2P7T C;  3MHH C;  4O2B A;  4OXS A;  5JVD A;  3FYE B;  4TV9 B;  3K5O A;  3CRC A;  3CCU V;  5KUM A;  2YXL A;  3CXH F;  4MT8 A;  1OHH G;  3ZHV A;  4I9Q A;  5H6R A;  3KKY A;  5LP6 A;  3THO A;  1TAE A;  3B40 A;  4TV9 A;  4R6Z A;  1V55 C;  2WLN A;  2JS5 A;  4I0X A;  4H33 A;  4DR3 O;  1SZX A;  4P9P A;  3VQW A;  4FLY A;  5BXZ A;  1S5L Z;  1TUE B;  4J9Y B;  3CPW U;  1G8M A;  2GTS A;  1BT8 A;  1LR1 A;  5IT9 N;  3T1Y O;  2E5L B;  4WCE V;  5IJ0 B;  4QGP A;  3EXA A;  4LF7 O;  3L70 H;  4J7Z A;  1WN7 A;  1VQ5 V;  1WB8 A;  4O4J B;  1QCE A;  5KUK A;  1BHB A;  3LNM B;  3LSU A;  5KA6 A;  4RQE A;  3ZRW A;  1R6K A;  2F66 C;  1YI2 V;  1GN2 A;  1B06 A;  3SJA C;  1OV9 A;  2OIE A;  3GVM A;  5HFM A;  4P2Z A;  3ZRX A;  2LW7 A;  2HJF C;  2EJR A;  5B1A B;  3I55 V;  1BGY H;  3FB5 C;  4PHZ A;  1WJZ A;  3JD2 A;  2Y0P A;  2RCV A;  1A32 A;  4FM2 A;  2Q69 A;  4FFB A;  1NKD A;  3ZIA G;  3RYC B;  2N74 A;  2EJ7 A;  4X1Y B;  2IJJ A;  1G1X B;  2ZXW B;  3SPI A;  4FJC C;  3DSQ A;  1JMK C;  2E5L O;  1RPR A;  3E35 A;  1VQ8 V;  3J80 N;  4WFF A;  2WLJ A;  5JJJ B;  4G28 B;  2ZQM A;  4LR3 A;  3H01 A;  2PYJ A;  2V1D A;  5KMG B;  3D36 C;  4DK0 A;  4G27 B;  2LQT A;  2LP7 A;  4JTA B;  2CTP A;  1JJ2 U;  4Q6G A;  3AEI A;  2YXH A;  3WB2 A;  1MA1 A;  3TGU H;  3JAM N;  4MVM A;  4DV2 B;  5FNV B;  1AP6 A;  4TSF G;  3CS5 A;  1YXB A;  4UFZ A;  3HKE A;  1NTM H;  1KC8 W;  1AI6 A;  1FXH A;  1RPO A;  4RQF A;  2EIK C;  3CC7 V;  3VQX A;  4W4K A;  3P3N A;  2UU9 B;  3T4D A;  4FZ1 A;  5FNV A;  2XAS A;  4TUY B;  3CHX A;  1H8H G;  4NYK A;  4DW1 A;  5KLV H;  1NZ6 A;  2MK3 A;  4UXN A;  1K33 A;  4FLZ A;  5CA3 A;  3AG2 C;  1Q81 W;  4LFC B;  2JEU A;  5J2U B;  2FB5 A;  1BQ0 A;  3FYI B;  3CCM V;  4R8C A;  3SYP A;  3ETE A;  3JAS A;  5FL7 G;  4HNA A;  4Z1M G;  4JZG A;  1VQO V;  1QU7 A;  2QTO A;  2GHY A;  1XIL A;  5H2F Z;  2GDS A;  4LCU C;  4U3J A;  2OCC C;  1TVK A;  3K0G A;  4P9O A;  3W7U A;  2CGN A;  4YJ3 B;  2ZE6 A;  3AG1 B;  1YVW A;  1UJW B;  1AI5 A;  3HKB A;  2BSK B;  2UU9 O;  1WA8 A;  4UB6 Z;  2CTQ A;  5FPO A;  1RP3 B;  3CD6 V;  3N2K A;  2YIC A;  4K8X A;  2LW1 A;  2OT5 A;  5IJ9 B;  2HHH B;  4JV5 B;  1URF A;  1GKF A;  5C8Y B;  4FLT A;  4LFC O;  1NR1 A;  2WWW A;  3P32 A;  1QVF U;  4QJF B;  2MW2 B;  1TA8 A;  1KUQ A;  4JI3 B;  3CCJ V;  3OEE G;  3H1I H;  2P6J A;  4B3S B;  3E89 A;  1EBO A;  3N27 A;  5LGT A;  3OEH G;  2X6C A;  2AGA A;  4YIO A;  3OD4 A;  4H44 B;  1V9P A;  3G4S V;  5B3S C;  2P06 A;  5H5N A;  2YI8 A;  1SRY A;  4N23 A;  1W0K G;  3SPH A;  3APQ A;  4UV8 A;  2EIL C;  1ARO P;  1HNZ B;  2AXT Z;  2A3Q A;  1GM9 A;  1RSO A;  2JGU A;  1EFR G;  4O2A B;  2HHH O;  1Q8I A;  1S77 D;  4JV5 O;  4X64 B;  1M56 B;  1PNL A;  3CP1 A;  2W0F C;  3ABM B;  3B2E E;  4ZI7 B;  1WLE A;  1JOY A;  2YS8 A;  3RWR D;  5K1P A;  4JI3 O;  2D3O W;  1VQ4 V;  4KFM A;  4RUE A;  4B3S O;  4GX5 A;  1GM7 A;  4YJ2 B;  4LWS A;  3ZS8 C;  1SA0 B;  1SQV H;  3SYA A;  4PI0 A;  1Y6X A;  3HKD B;  4UV9 A;  1M4U A;  2KKW A;  2UXN A;  2QM4 A;  5GTI Z;  1E1R G;  1COW G;  1FYJ A;  1SKV A;  4O4H A;  3W7X A;  1WAZ A;  3FB8 C;  2L35 A;  4OX9 B;  1GO3 F;  1HNZ O;  2WLL B;  2B1I A;  4X65 O;  3PJS K;  1IVS A;  3JSN A;  3WB0 A;  4PDR A;  4ICG A;  3BAB A;  2M7W A;  4LP8 A;  2FTK A;  2H8P C;  4X64 O;  3CWB H;  3K5M A;  4X20 A;  2DN9 A;  3SGI A;  3AG3 C;  2ATK C;  4WFA V;  3K04 A;  2GTA A;  3JAK A;  1AI4 A;  2O57 A;  2XAG A;  2ADQ B;  2X6B A;  2ITD C;  1SER A;  2WLK A;  3FAV A;  4F6E A;  3JD4 A;  1IZ3 A;  3D36 A;  4B7E A;  1OJH A;  5CB4 A;  2R9R B;  4ZKI A;  4LH6 A;  2Q7H A;  5L3C A;  1F4N A;  4J11 A;  1AI7 A;  2IM9 A;  3OMN B;  4DRX B;  4G2K A;  4OX9 O;  4FVM A;  4UCS A;  5EYP B;  1IXM A;  4FM0 A;  1R73 A;  1E1Q G;  4WF9 V;  4FZ0 A;  3VBB A;  1K7D A;  1SQQ H;  2R70 A;  1Z2G A;  3UQ8 A;  4JI7 B;  3CB2 A;  3T1C A;  2ILM A;  3DC5 A;  1MAB G;  4MW8 A;  2PYL A;  2EZO A;  1K5S A;  4DR6 B;  1FD9 A;  3B77 A;  2OCH A;  5B1A C;  4AQY B;  4J7K A;  1GMG A;  2HEP A;  3OW2 U;  3JSL A;  1ROP A;  2BOC C;  4BIO A;  4U7O A;  3CRR A;  3ZMT A;  1CPY A;  1XNQ B;  4DV3 O;  2K1E A;  1G6U A;  4GX1 A;  4LF5 B;  3JD3 A;  4QE7 A;  1IUR A;  2CAZ C;  2RNB A;  1OCR B;  1MNG A;  2Q0O C;  1QLE B;  3W7W A;  3ZHR A;  1KKD A;  2ZXW C;  5KX5 B;  1SQX H;  2WA3 A;  4X1K A;  5GON B;  1DF5 A;  4ZHQ A;  5E79 Z;  4I4T B;  4O4I A;  3GB7 C;  1B3Q A;  3ETQ A;  4OPH A;  3RYF B;  1Q6U A;  4JI7 O;  1JA8 A;  4Q20 A;  2CTW A;  1BCC H;  3RW0 A;  1WP7 A;  3O65 A;  2AHY A;  3TET A;  4J42 A;  2A0L A;  4OPA A;  2ODM A;  4IYH A;  3C3S A;  4E4E A;  5EIB D;  5L3B A;  4UUJ C;  3CJH B;  4AHC A;  4DYL A;  4AQY O;  3I5D A;  3R65 A;  1PPJ H;  1K9M W;  4UVC A;  2BTQ A;  1XNQ O;  1UFI A;  4NR1 A;  4LF5 O;  2DE0 X;  3X2Q B;  2QA4 V;  3VQV A;  3M8A A;  1KP2 A;  5KHK A;  1YHQ V;  1AJN A;  4PA7 A;  2CUG A;  2CDY A;  1SQF A;  3E8G A;  4R50 A; 
#chains in the Genus database with same CATH homology
 1SC5 B;  1RP3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...