1RP3B

Cocrystal structure of the flagellar sigma/anti-sigma complex, sigma-28/flgm
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
77
Chain Sequence
VNRIELSRLIGLLLETSGTNKIEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEFFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Flagellar Sigma/Anti-Sigma Complex Sigma(28)/FlgM Reveals an Intact Sigma Factor in an Inactive Conformation
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords RNA polymerase sigma factor SIGMA-28 (FliA)
total genus 23
structure length 77
sequence length 87
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04316 FlgM Anti-sigma-28 factor, FlgM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1160 Mainly Alpha Orthogonal Bundle Helix Hairpins Anti-sigma-28 factor FlgM 1rp3B02
1RP3B 1SC5B
chains in the Genus database with same CATH superfamily
3E8HA 3J81N 2UXBB 1YEWA 4JZ2A 2L35A 3A8TA 2OWOA 1FXKB 2XAGA 3AG4C 5LMUB 2R72A 1QCEA 5CA1A 3SJAC 1VQ8V 4DUYO 2XAQA 3SJQC 1XMQO 2M6YA 4K8ZA 3DTUB 4O4IA 3S3XA 1K9MW 4Q6GA 5B1BB 1H2MA 5JQGA 1AROP 1O9HA 1MOFA 4JYCA 4TV8A 2ZIMA 1KC8W 1PPJH 4YIOA 4U7OA 3TXQA 1IZ3A 4H0LB 4DV7O 1RM1B 4DR1B 4GKKO 3K9SA 4LF9O 4FLXA 3KKYA 4BIUA 4TV9B 3HKDA 1HDJA 2IBZH 4B3MB 3CB2A 2OIEA 1X59A 3UT5A 3RYFB 2YIAA 2B9ZA 1QU7A 1WB8A 2XAJA 1OCRB 2CGOA 5EZYA 3CCLV 4O2BA 1VQLV 4P9PA 3CCVV 4NKGB 3BFRA 1KUQA 3ABLC 1KYOF 2QWRB 3AG1B 1KKDA 4R7CA 3SYCA 3JCZA 3LSSA 4I9QA 1RFYA 4DR7B 1NTMH 2XTAA 1JFFB 1M57B 2QKAA 3SPCA 1N36O 3ZMTA 2A3QA 4CC5A 5K1XA 5IDJA 4GT1A 2BSKB 1MSDA 4OX9O 1LR1A 2HKOA 2WLNA 3A2FA 4R6ZA 1TGOA 3RBZA 2F95B 3ZHTA 1SERA 1QVFU 3HKDB 4B08A 4DV3B 2B5UA 4EFEA 4EB6A 1DF5A 2LGQA 2OIGA 1NBMG 1EM1A 3BHPA 2QTSA 4WFFA 4NXMO 1D5AA 1US6A 3E2EA 4OX9B 5KHHA 4PA9A 3IJ4A 3BPZA 1PM9A 4EB6B 3OR7C 3JSLA 1XNQO 5CB4A 1FFXB 4U7NA 2LJ2A 1CEZA 3ABTA 3VQVA 3E8FA 4PHZA 3PJSK 3VQYA 1GK9A 2VS0A 4NYKA 5KUKA 2BSKA 2AZ0A 3QO7A 1K73W 1Y4MA 2QEXV 1RP3B 4IIJB 3G80A 4YHHB 1YITV 2MW2B 2BE3A 1E1QG 4X1YA 2ZD9A 5B1BC 3RGBA 1FFTB 4FM1A 3G6EV 2XOKG 2DMXA 1S5HC 5KHKA 4B3SB 2Y0IA 4NR1A 1FXHA 3ABKC 5L3CA 2PTMA 2WLLB 1F4MA 4E2LA 5BXZA 4FMTA 4BW9A 4UCRA 2X0LA 3RYCB 1K5SA 3RYFA 3Q4HA 1SQBH 5BR8O 3CC4V 3E86A 4TV9A 1QLNA 1LUWA 3ETEA 1R6NA 2VRZA 1OCOB 4MTOA 1P84F 1GN2A 3JARA 1WN7A 2Y4UA 1U96A 2PZSA 1I7FA 1S5LZ 5EYPA 5LA6A 4FLYA 1N33B 1WLEA 1DK1A 4UB6Z 3ZX6A 2MK3A 1EBOA 1FXKA 3RVYA 3H1KH 1K33A 1MG1A 1Y66A 4F6RA 3I5DA 3WB1A 5LA6B 1YI2V 4UFZA 4LH6A 2UXBO 2FKXA 2RQ6A 1NVPD 4MTXA 4DRXA 4LR3A 1CXZB 5L3EA 4J9ZB 2W6JG 4DR3O 2EIKC 4MW3A 4I50B 1SQPH 4JGSA 2EJ7A 2DWDC 5IJ9A 5FPOA 3OUSA 5IYDO 5L3DA 2F66C 1MZEA 1FJGO 2XHBA 1AJPA 2F4VB 1VARA 2Q68A 1G6UA 1VEWA 1OJHA 3E89A 1GN6A 3AG3C 2VQFB 4LFBO 2WAMA 2YDEA 3OEEG 2CGNA 2JEUA 1WAZA 2D3OW 3OE7G 3JASA 3MDSA 5KX5A 4QPJA 2EINC 2ZKOA 4XDLA 2A7WA 1MMMA 4PJ0Z 1UPGA 4GYCB 3N2GA 5LGUA 2JS5A 4YHHO 3L75H 3T4ZA 2EZOA 5JJEB 2PGGA 2ADPA 2CTQA 1VQPV 4BIZA 4AQYO 5KX5B 4X64B 4JPRA 2Q9LA 3QG5A 4FLUA 1THZA 3HKEB 4G27B 1FYJA 1SF9A 2O57A 2JGDB 2RN9A 1GO3F 2IJKA 1XEQA 1U97A 1Q82W 1VQ5V 1QNMA 4QNHB 4D7SA 4FJCC 3GWOA 3UT5B 4EFBA 3P32A 1F4NA 3CRAA 1DLBA 5LP6B 5ITZB 2E3CA 3TJTA 3A0BZ 3BABA 1A32A 3TGUH 3W7TA 5IWAB 1N0JA 2BOCC 2DJVA 1AILA 5IYZB 2E5LO 2JK5C 1ZX3A 4MW8A 4JYAB 3CX5F 4GX5A 3ZBHA 1JX9A 2QA4V 1L0LH 4X1IA 4GX2A 1R1BA 4LF6B 5EC1C 1EZJA 4F6RB 4B3SO 1YCIA 1FS0G 3CRCA 3R66A 3WU2Z 2YEVA 4I5SA 2LFSA 2VQEO 1IDSA 4I4TB 4RO2A 1EN6A 2FB5A 1PV0A 5CMUA 4ZIBA 2B1IA 1PKXA 2ZNIA 2CAZC 3AEIA 1SA0A 4B3RB 2YS8A 3JALB 2VWJA 4NTWA 4DV2B 4JAVA 3F5WC 3ICXA 1K92A 2Q7HA 3HKCB 3I56V 4X66B 1NI8A 1Y6XA 3GVMA 3N2KB 1TAEA 3HR0A 4MVQA 4I0XA 1SQQH 1M90W 2W0FC 3QO5A 4KHPB 1HW7A 4O2AA 1B3QA 1BE3H 4B3MO 3TK1A 3ABUA 5B1AB 1RSOB 2QWQB 4H13B 1HNXB 3SJBC 4KFMA 4IGGA 4O4LB 3HKBA 1VIBA 5JQGB 4YIPA 4LFCB 3FKSG 5JH7B 2P06A 1B6QA 1PP9H 1ZTEA 3UKMA 1GM8A 4JAAA 4PDRA 2A79B 4JI2B 3OTFA 2JS3A 4RUEA 2ITDC 3RN4A 1PNMA 4ZBMA 5LL6Y 2YSUB 4IHJB 4LFCO 2WA3A 2JJ1G 1OCRC 2HJDA 4GKKB 4WFGA 5IYCO 5DECA 4Z1MG 4B3RO 5IT9N 4TWKA 4X1KB 5IYBO 2ZINA 5EC2C 5B3SC 4UUJC 3RFRA 4DV1O 3CYOA 3LNMB 1N36B 1NQTA 1TUBB 5HFLA 3DXRA 3DSQA 1Y74B 4FVMA 1P49A 1MSWD 1L8DA 3RYHB 1M4UA 1Q3EA 3FX7A 3S3WA 4ZHQB 5KAIZ 3APOA 4G28B 4JI5O 3ZJZA 2ZXWC 1OHHG 5GTIZ 4XDJA 4FK5C 3JALA 1BZKA 2DYRB 1E1RG 1GM9A 3FB6C 1YTFD 4J11A 2LO1A 1ZL8A 4JI1B 2WLIA 3QO8A 3B4SA 3F7YC 4K0KB 3BEHA 3ZRWB 1XL4A 3VQWA 2LW1A 5EIBC 4NXNB 4DV4O 4IIJA 3OR6C 4RUFA 4X1IB 1B04A 5CBFA 4LF7O 3B8MA 2ITCC 5LXTB 2Y48A 1NTKH 1JJ2U 2NLJC 3N2GB 4WFEA 3DC5A 5IJ9B 5FLXN 1V54C 3H1HH 2ZE8A 1WPXA 1FKAO 4PDLA 1COWG 1DF4A 4WCEV 4FLZA 3MD0A 4C7UA 4BIOA 4XBFA 5GONB 3W7SA 3DGEA 1AI6A 4WFAV 3LNNA 2JVDA 1KMIZ 1YVWA 3OD4A 4GKJB 4CH6A 3K04A 1BHAA 2KSDA 3D36C 4JYYA 4H44B 1GAXA 4Z2WA 2E75B 2ZXWB 1BQ0A 3C90A 5JCOC 1H8HG 4I50A 3RYIA 1W0KG 3T1CA 1N34B 2ZE6A 3BCCH 5D5PA 2ZR3A 1B06A 1WPBA 5LHGA 2BTOA 3FB7C 5C8YB 2BTQB 1PL0A 4CZZA 1YJNV 1BL8A 1AP5A 2QGNA 4B3TO 2HG5C 4O4HA 1KU9A 2YXYA 2IJHA 1FXVA 3WG7B 5CN0A 4Q20A 1Q6UA 5CA3A 1I94B 1FAFA 1H2LA 5AG2A 4IYHA 4J42A 1F23A 3CCJV 2UUBB 5IJ0B 3K08A 2C2AA 4JYBA 2VQFO 4PI0A 4JI4O 5JCOA 3OT7A 4TV8B 2EIMC 4FZ1A 4JTDB 2P67A 2ZQMA 2ETNA 2RJZA 4UVBA 3ABMC 3SPIA 3AG2B 2EBOA 4JI8O 5IY5C 4DW0A 5BMVA 3CCUV 2WLKA 2Y69C 3KG2A 2IM9A 3FYEB 1OCCC 1XI1A 5JVDA 4MS2A 4UVAA 4ZI7B 5B1AC 1MNGA 2B1GA 3J80N 5EBMC 1ROPA 4B7EA 4L87A 2Q67A 1VF5B 2GHYA 5LBQA 3SR2C 4LF8O 1EN5A 2EULA 2XASA 1KECA 5JJNB 4W4KA 2P5OA 4NXNO 2HVKC 3IC9A 4J80A 2KG7B 4DR5B 4O4LA 3CC2V 3E83A 3ZMSA 4HBNA 3ZRSA 3LDDA 4DR2B 1XMQB 2RNBA 4I4TA 3W7WA 3ZHUA 2YXHA 2DW4A 3JD2A 4R8CA 4AQYB 3BY6A 4WFBV 2QKCA 3JYCA 5LP6A 3J7AU 1VQ4V 3QTCA 2OCCB 3CS5A 2Q0AA 2ZE7A 5LXTA 3G71V 1JCHA 1UFIA 1SQXH 3AG2C 3DXRB 3T2MA 4DR5O 1OCOC 5IYZA 1QHTA 4TOIA 4LFAO 2UXDB 1HNZB 4U3JA 2OCCC 1O9GA 3VOUA 4DR6B 2WLJA 1IBKB 2JIZG 1QLEB 3M99B 4ZOLA 4UCVA 5CBHA 3A0HZ 4WBNA 4DXWA 3ZIAG 3CCMV 1Q6IA 3FB5C 4X20B 5LGNA 4X65B 5CA0B 1N32O 1MA1A 1Q7YW 1AI4A 3CRMA 3BVOA 1AJQA 3JD1A 3RVZA 1N8RW 1NKDA 1NR7A 4RWUA 1VP7A 3UCSC 3FAVA 4PV1B 3JD4A 3OFNG 2CH7B 4D7TA 3D8CA 4ICGA 4YJ2B 4JV5O 4ZI7A 3ZN0A 2P4VA 4JTCB 1OCZC 3K79A 4FFBA 3L70H 3KZIZ 4MVZA 2Y69B 3K06A 4LF9B 1ZL8B 2HHHB 4JTAB 4RQFA 1BT8A 5KHIA 5LHHA 1VMGA 3UQ8A 1Q5OA 3CPWU 2P22C 5F2VO 4FM0A 1AB3A 1X4TA 4W4LA 3ZS8C 2DE0X 3NR7A 1NR1A 5KUMA 2YI9A 3CJHB 2QSAA 3ZN1A 1Y74A 4N23A 5IJ0A 2KQXA 3IAYA 3SGIA 5J2TA 4JI6B 3ETGA 2QM8A 1HR0O 4KUMA 3CMEV 2K9PA 3OTOO 1JFFA 4DYLA 3ABLB 4LBEC 1K97A 1Y76A 4IL6Z 1IBMO 3BA8A 1J5EB 2ZCEA 1K3EA 1BS3A 1S0VA 3RYIB 3SPHA 3WB0A 1GKFA 4P2ZA 4O4JA 3BRCA 3W7XA 1K7DA 2GUZB 2HFEC 3CXHF 1JVMA 4UCOA 5J2UB 4JV5B 2YIBA 3OMNB 1H2SB 2FMLA 5GONA 1FPOA 3T1YB 4NB5A 5B1OA 4XDKA 1QBZA 2QM7A 5H5NA 4JI2O 1IURA 1GTOA 4F6EA 1VF6C 4OPAA 1AP6A 3STZC 1GM7A 2FYUH 4J7ZA 4FLTA 4TUYA 3NXSA 3K9AA 2IH1C 1YDXA 4DRXB 1Q6HA 2PY5A 4LNUA 1SETA 4GCZA 1V55B 4FZ0A 2QWPB 4OXSA 3AG1C 1TVKB 4CBCA 5KA6A 4TUYB 5IWAO 3SPJA 1LNQA 4LWSA 3P3NA 3CCEV 4DUYB 3QNEA 3UM7A 1QVGU 4E4EA 3JATB 2JDIG 4MVOA 2P6JA 4MTGA 1SQGA 1YSCA 5KHGA 1XMOB 4BWAA 2WLHA 1WP8A 2JGUA 2R9AA 1AR1B 1QR9A 3D3QA 5H2FZ 5J2TB 3TCUA 1VQ6V 3OM3B 4PD4F 5DN6G 4QPKA 1RPOA 3OEHG 1FD9A 2NR5A 1N32B 3OGIB 3IGAC 1Y67A 4DV7B 1M93A 1R6TA 4KXRA 1EN4A 2PYLA 1JJOA 3EHBB 3M7MX 2V4DA 4LF7B 2X6BA 2PI4A 2DQ0A 1IXMA 4J10A 2ODMA 1CPYA 2P7TC 5FPRA 2ZDIA 3OW2U 2KB1A 3B8NA 3EXAA 4WF9V 3JATA 1YZBA 2W6IG 4X88A 2JEXA 4J7JA 4U3JB 4TQFA 4K35A 3L71H 1TA8A 1HP8A 1NS1A 2Q0OC 3ZMZA 1AJNA 3RWRD 2Q7EA 5KAFZ 4ZOLB 2PF4E 1MABG 1YJWV 2F4VO 3TETA 2CDYA 4X62O 4DV2O 2ZT9B 2X7RB 3WFVA 2QTOA 5JH7A 4NTXA 1IXBA 1BSMA 3E8BA 1SQVH 5ITZA 4DR4O 5HFMA 1HNWO 4JASA 3W7UA 5J2UA 3G67A 4JZGA 4N21A 5BMVB 1TUBA 3JASB 4FLWA 4PA4A 3ZMVA 1AVMA 1PD3A 1UJWB 1J5EO 4X64O 1GRJA 5L3FA 1HNWB 3P3PA 2GUZA 2UUBO 1YTFB 1SC5B 3H9VA 1XILA 1JPXA 2R9RB 1IBLB 5C93A 1DGSA 1V9PA 1AR4A 1YXBA 2AGAA 1JOYA 3OGCC 2EILC 1OV9A 2DYSB 4TT3G 4X20A 3OUFA 2K1EA 5EIBD 1Z5VA 2ZDIC 2HJFC 4I0XB 3C3SA 3OMIB 5KA5A 4RQEA 2AW9A 2F43G 3L9DA 4AI8A 3RW0A 5E1AC 4YJ3B 3T1HO 1M1KW 2HLDG 5BZBA 3DC6A 3AG3B 2LGWA 3ABKB 1JMKC 4PA3A 3JSNA 3FB8C 4DR3B 2JRIA 3BA9A 3U10A 1Z5WA 1K8AW 5KHJA 4AHCA 2P4KA 4YJ3A 4QJFB 3K57A 2A06H 2ADQB 4D6TH 1I0HA 1N33O 1Q81W 2VWKA 4LFBB 3D3IA 5KLVH 1HWYA 3T1YO 2WWWA 2YIBD 5A2QN 2L6LA 1SA0B 3AK3A 2NNUA 3K5NA 5H9CA 4NXMB 1TUEB 4I55B 4UXNA 3FD9A 3CMAV 2QWNB 1N0NA 2IU3A 4FLVA 1SZXA 4ABMA 5GW7A 1S77D 4I9WA 2DN9A 4PELA 1WP7A 2LP7A 2UXNA 4HNAB 1QLEC 4KHPO 4CH4A 3JAKB 1NZ6A 1OCCB 3JAWB 2CUGA 2F93B 1I08A 5K1PA 4DUZO 4QE9A 3ABMB 4CS2A 5EBLC 3H1IH 4CC6A 3E8GA 3VQXA 3SYQA 1M57C 5EK0A 4DR1O 3KCYA 1Q8IA 4Z1VA 4G2KA 1BMFG 2AHZA 3SYAA 4PDMA 2DOSA 1Z2GA 3E35A 4UB8Z 1IVSA 3QVNA 2IW5A 1PL4A 2QE7G 1S3JA 2DYRC 2EILB 3WG7C 1XHXA 4EEQA 4MTFA 2H3OA 2Q69A 5LMNB 1PNKA 4HNAA 4HYOA 1S72V 1K5QA 1ZSPA 2Y0PA 1JQ0A 4OGQB 4O2BB 2GDSA 4KP4A 3THOA 5LOVB 2NN4A 1KBHA 5CA0A 3CXCU 3H1JH 1W59A 2F1MA 4JI6O 2UU9B 4CS4A 3D36A 2HVJC 1XNRO 3X2QC 5IY5B 1ZAUA 2AXTZ 3IC7A 5FNVA 4ZKIA 1NT2B 4DK1A 4LC1A 1M56B 2Z3YA 3ASOC 5B5EZ 1Q43A 4NTYA 3JAMN 1H2KA 3WB2A 2WPDG 1NH2D 1W0JG 2QR4A 2V7QG 4O4IB 1YHQV 5CBGA 3CD6V 1KP2A 1FXKC 4P9OA 2R70A 1M9NA 5KMGA 4JI7O 2DYSC 1KKCA 4F4LA 3CEIA 2XAFA 1HNXO 2Q73A 1JR9A 4UCTA 2OTLV 4DV5B 2AZ2A 4YY3B 2X6CA 4I55A 3CE2A 4CH5A 4GX1A 1TVKA 5H6RA 1ZLZA 3K58A 2QDOA 3ZHRA 1QR8A 2GBOA 4H37A 4TQDA 2YEVB 3ZRVA 2XAHA 3LSQA 1XMOO 1MZFA 4GX0A 2IU0A 5JJJB 4X8AA 5CB4B 1P7GA 2FTKA 2Q8VA 3CRQA 3LDCA 5DEDA 5TISZ 2QM4A 3RYCA 4JI0B 4X9QA 3L73H 4MSWC 1RM1C 2CE4A 4J9YB 5D5QA 1QQCA 4BW5A 2YIDA 3CWBH 4JI3O 1Q90D 5J9PC 1F51A 3CC7V 3ETQA 1S5JA 4J7KA 1FJGB 4MVRA 3F5TA 4J41A 3KCXA 4LF4O 4O2AB 3PN1A 3CHXA 3ZRWA 1VQMV 2DWEC 4PDVA 2M7WA 1H38A 1S76D 5GTHZ 4YY3O 3AG4B 3U11A 2X6AA 4A5UB 1XNQB 1BGYH 2BOBC 4LF6O 1IX9A 2CTWA 1M56C 3ASOB 1P7BA 1XHZA 4JI1O 3ZHVA 5KMGB 4DV1B 2OTJV 4UV8A 4X1YB 4IT5A 4YXWG 3M8AA 1BQZA 4CS3A 3RYHA 2H8PC 3L72H 5LYJA 4LF5B 3ZRXA 3SYPA 4B3TB 1KQSU 4LH7A 5IE9A 2Q6AA 1HNZO 2UXCO 2F23A 4B7KA 4DR6O 5LOVA 2P90A 2WA4A 3HPLC 1ZUQA 4FFBB 4DO2A 3O65A 4GLXA 4AILC 5LHIA 1VQNV 2UU9O 4YJ2A 3G4SV 3AK2A 2ZE5A 1SESA 3MHHC 4X65O 1XNRB 4MVUA 1E79G 2EINB 5EBWC 3FAVB 1DTOA 3HKEA 4TSFG 3K59A 1VQ9V 4LCUC 2IJIA 3I55V 5EYPB 4HZ3A 2ZM6B 2CH7A 1I5XA 3AG7A 1EZVH 3R65A 5FL7G 2GV9A 4JI0O 3JAWA 1G8MA 3K0GA 4K3AA 1YIJV 1SKVA 2RDCA 1WA8A 3T4DA 2OYQA 2N04A 3G6BA 2ATKC 1L1FA 1G4YB 2LFRA 2YC0A 1I5YA 1SQFA 5EZYB 1VF7A 2EZPA 4LF5O 1VF6A 4PA7A 1SS3A 5JVDB 3JCUZ 1LUVA 1D2DA 4OPHA 1IBLO 2BCCH 2UXCB 4KL1A 3X2QB 1XQ8A 5LP6C 4LF4B 3ML0A 2IJJA 1OCZB 2D2CB 4ZHQA 3STLC 4K0KO 1R3KC 5L3GA 3ZCCA 3CSXA 3IFXA 2UUAB 1R6KA 2WLMA 2UUCB 3APQA 2KG7A 3UO3A 3ZHSA 1KP3A 2EIJC 1VQ7V 4DV0O 4JI7B 1XL6A 2WLIB 3CP1A 3GB7C 2V1DA 1P4RA 5CA1B 3MHSC 4U3FH 1SZTA 1WJZA 2ZM6O 1XDCA 3JD0A 3RT3C 2EIMB 4L8JA 4UVCA 4MT8A 4JYAO 1NVPB 3CRRA 5DM6V 1D5NA 2UXXA 1V55C 2N74A 4MVSA 5B1NA 1YJ9V 4ASUG 1N34O 2N05A 3H01A 2DQ3A 4P30A 3LUTB 2CTRA 3CCQV 4JI8B 2GTSA 1AR5A 4DV6B 3O9OA 5B66Z 2Z0AA 1L0NH 3GWKC 4X89A 2CK3G 3JAKA 2WLLA 4PA6A 5LMNO 4K8XA 4LP8A 2LQTA 1Q86W 2GSMB 3E22B 3H1LH 1EFRG 4X62B 2OT5A 1IBKO 4JI3B 2FL4A 2Y4TA 1F7YA 1WB7A 3FFQA 3VBBA 3A0RA 1FFXA 3B77A 4LWSB 1Y76B 2PI5A 4FPPA 1ZWIC 2PUSA 2H94A 4MVMA 2ZNJA 4JI4B 1URFA 2Z5UA 1R73A 3HKCA 3CJHA 1RSOA 2LW7A 2QWOB 5FNVB 4DR2O 1R3IC 2VQEB 1VQKV 2JJ2G 2QJ1A 1WA8B 4JAUA 4RAIA 1AI5A 1V54B 1NJIW 3F7VC 5A9GA 2HEPA 2GTAA 3LSUA 3ASNC 3K0DA 3JARB 2YUAA 2Q4PA 5C8YA 4DK0A 2PYJA 1N4CA 5BR8B 3MAQA 3OTOB 3ASNB 3SJCC 5JWPA 3L74H 4GUNA 1R3JC 4DW1A 4QIWF 2ILMA 2A0LA 3JD3A 4LFAB 2UXDO 2E76B 1NU1H 2CTPA 2OCHA 4HAMA 4X66O 2EIKB 1W2BU 1I94O 4R50A 4DR7O 1XREA 4DV6O 4UCSA 4NVPA 2G38A 3C3TA 5L3BA 2RMKB 4CH3A 1K34A 3ETDA 2R9IA 2XNDG 2IH3C 3CCSV 5H6QA 4UCUA 2EJRA 4FIPC 3AK1A 3EFFK 4WBNB 3ZEDA 4IYIA 1VQOV 4EKWA 1XOUA 2E74B 2Q7GA 1M5IA 1ORQC 3K5LA 4LNUB 3K03A 1XUQA 3OMAB 3OAAG 3E22A 5B3SB 4JI5B 1GH6A 2XUMA 2UUAO 1GN3A 1YF2A 3EVKA 2W0XA 1ENVA 3ZHQA 4DV5O 3SYOA 3BAAA 3HKBB 3UO2A 1PNLA 1G1XB 2QKSA 1H8EG 2EX3A 3N2KA 5LGTA 2HP8A 3LDEA 2A9HA 2YICA 2Q5ZA 2ZIOA 1JA8A 4FFKA 4BR6A 4H33A 2YXLA 3K5MA 2HR3A 4QGPA 1AI7A 2WSSG 1OZ0A 3Q4HB 1HR0B 1GN4A 5LMUO 4IHJA 2JGDA 2RCVA 3B40A 2EIJB 3QF7A 3SPGA 2BTQA 3N27A 4LF8B 1SRYA 4X1KA 1CP9A 5E79Z 1BCCH 1KB9F 1IBMB 2KKWA 4FM2A 1H2GA 4O4HB 2AHYA 2HHHO 1XBLA 3FYIB 4PI2A 3TXSA 3CCRV 1BHBA 2UUCO 4DR4B 2YI8A 1K4DC 3ZMUA 3K5OA 3SDLA 5BY1A 4GKJO 4GZRB 1WNSA 4JF3A 4I7ZB 3T1HB 5LYJB 4O4JB 1NTZH 2XT9A 4DV0B 1R3LC 1RPRA 3B2EE 4BAYA 1NH2B 1KD1W 3U0ZA 1K4CC 4DV3O 1H2NA 4WFHA 4QE7A 2ZR2A 3P30A 4UV9A 4DV4B 3HB3B 3K3WA 2ARHA 1GMGA 1T5EA 3B09A 2E5LB 4DUZB 1J95A
chains in the Genus database with same CATH topology
1RP3B 1SC5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RP3 B;  1SC5 B; 
#chains in the Genus database with same CATH topology
 3E8H A;  3J81 N;  2UXB B;  1YEW A;  4JZ2 A;  2L35 A;  3A8T A;  2OWO A;  1FXK B;  2XAG A;  3AG4 C;  5LMU B;  2R72 A;  1QCE A;  5CA1 A;  3SJA C;  1VQ8 V;  4DUY O;  2XAQ A;  3SJQ C;  1XMQ O;  2M6Y A;  4K8Z A;  3DTU B;  4O4I A;  3S3X A;  1K9M W;  4Q6G A;  5B1B B;  1H2M A;  5JQG A;  1ARO P;  1O9H A;  1MOF A;  4JYC A;  4TV8 A;  2ZIM A;  1KC8 W;  1PPJ H;  4YIO A;  4U7O A;  3TXQ A;  1IZ3 A;  4H0L B;  4DV7 O;  1RM1 B;  4DR1 B;  4GKK O;  3K9S A;  4LF9 O;  4FLX A;  3KKY A;  4BIU A;  4TV9 B;  3HKD A;  1HDJ A;  2IBZ H;  4B3M B;  3CB2 A;  2OIE A;  1X59 A;  3UT5 A;  3RYF B;  2YIA A;  2B9Z A;  1QU7 A;  1WB8 A;  2XAJ A;  1OCR B;  2CGO A;  5EZY A;  3CCL V;  4O2B A;  1VQL V;  4P9P A;  3CCV V;  4NKG B;  3BFR A;  1KUQ A;  3ABL C;  1KYO F;  2QWR B;  3AG1 B;  1KKD A;  4R7C A;  3SYC A;  3JCZ A;  3LSS A;  4I9Q A;  1RFY A;  4DR7 B;  1NTM H;  2XTA A;  1JFF B;  1M57 B;  2QKA A;  3SPC A;  1N36 O;  3ZMT A;  2A3Q A;  4CC5 A;  5K1X A;  5IDJ A;  4GT1 A;  2BSK B;  1MSD A;  4OX9 O;  1LR1 A;  2HKO A;  2WLN A;  3A2F A;  4R6Z A;  1TGO A;  3RBZ A;  2F95 B;  3ZHT A;  1SER A;  1QVF U;  3HKD B;  4B08 A;  4DV3 B;  2B5U A;  4EFE A;  4EB6 A;  1DF5 A;  2LGQ A;  2OIG A;  1NBM G;  1EM1 A;  3BHP A;  2QTS A;  4WFF A;  4NXM O;  1D5A A;  1US6 A;  3E2E A;  4OX9 B;  5KHH A;  4PA9 A;  3IJ4 A;  3BPZ A;  1PM9 A;  4EB6 B;  3OR7 C;  3JSL A;  1XNQ O;  5CB4 A;  1FFX B;  4U7N A;  2LJ2 A;  1CEZ A;  3ABT A;  3VQV A;  3E8F A;  4PHZ A;  3PJS K;  3VQY A;  1GK9 A;  2VS0 A;  4NYK A;  5KUK A;  2BSK A;  2AZ0 A;  3QO7 A;  1K73 W;  1Y4M A;  2QEX V;  1RP3 B;  4IIJ B;  3G80 A;  4YHH B;  1YIT V;  2MW2 B;  2BE3 A;  1E1Q G;  4X1Y A;  2ZD9 A;  5B1B C;  3RGB A;  1FFT B;  4FM1 A;  3G6E V;  2XOK G;  2DMX A;  1S5H C;  5KHK A;  4B3S B;  2Y0I A;  4NR1 A;  1FXH A;  3ABK C;  5L3C A;  2PTM A;  2WLL B;  1F4M A;  4E2L A;  5BXZ A;  4FMT A;  4BW9 A;  4UCR A;  2X0L A;  3RYC B;  1K5S A;  3RYF A;  3Q4H A;  1SQB H;  5BR8 O;  3CC4 V;  3E86 A;  4TV9 A;  1QLN A;  1LUW A;  3ETE A;  1R6N A;  2VRZ A;  1OCO B;  4MTO A;  1P84 F;  1GN2 A;  3JAR A;  1WN7 A;  2Y4U A;  1U96 A;  2PZS A;  1I7F A;  1S5L Z;  5EYP A;  5LA6 A;  4FLY A;  1N33 B;  1WLE A;  1DK1 A;  4UB6 Z;  3ZX6 A;  2MK3 A;  1EBO A;  1FXK A;  3RVY A;  3H1K H;  1K33 A;  1MG1 A;  1Y66 A;  4F6R A;  3I5D A;  3WB1 A;  5LA6 B;  1YI2 V;  4UFZ A;  4LH6 A;  2UXB O;  2FKX A;  2RQ6 A;  1NVP D;  4MTX A;  4DRX A;  4LR3 A;  1CXZ B;  5L3E A;  4J9Z B;  2W6J G;  4DR3 O;  2EIK C;  4MW3 A;  4I50 B;  1SQP H;  4JGS A;  2EJ7 A;  2DWD C;  5IJ9 A;  5FPO A;  3OUS A;  5IYD O;  5L3D A;  2F66 C;  1MZE A;  1FJG O;  2XHB A;  1AJP A;  2F4V B;  1VAR A;  2Q68 A;  1G6U A;  1VEW A;  1OJH A;  3E89 A;  1GN6 A;  3AG3 C;  2VQF B;  4LFB O;  2WAM A;  2YDE A;  3OEE G;  2CGN A;  2JEU A;  1WAZ A;  2D3O W;  3OE7 G;  3JAS A;  3MDS A;  5KX5 A;  4QPJ A;  2EIN C;  2ZKO A;  4XDL A;  2A7W A;  1MMM A;  4PJ0 Z;  1UPG A;  4GYC B;  3N2G A;  5LGU A;  2JS5 A;  4YHH O;  3L75 H;  3T4Z A;  2EZO A;  5JJE B;  2PGG A;  2ADP A;  2CTQ A;  1VQP V;  4BIZ A;  4AQY O;  5KX5 B;  4X64 B;  4JPR A;  2Q9L A;  3QG5 A;  4FLU A;  1THZ A;  3HKE B;  4G27 B;  1FYJ A;  1SF9 A;  2O57 A;  2JGD B;  2RN9 A;  1GO3 F;  2IJK A;  1XEQ A;  1U97 A;  1Q82 W;  1VQ5 V;  1QNM A;  4QNH B;  4D7S A;  4FJC C;  3GWO A;  3UT5 B;  4EFB A;  3P32 A;  1F4N A;  3CRA A;  1DLB A;  5LP6 B;  5ITZ B;  2E3C A;  3TJT A;  3A0B Z;  3BAB A;  1A32 A;  3TGU H;  3W7T A;  5IWA B;  1N0J A;  2BOC C;  2DJV A;  1AIL A;  5IYZ B;  2E5L O;  2JK5 C;  1ZX3 A;  4MW8 A;  4JYA B;  3CX5 F;  4GX5 A;  3ZBH A;  1JX9 A;  2QA4 V;  1L0L H;  4X1I A;  4GX2 A;  1R1B A;  4LF6 B;  5EC1 C;  1EZJ A;  4F6R B;  4B3S O;  1YCI A;  1FS0 G;  3CRC A;  3R66 A;  3WU2 Z;  2YEV A;  4I5S A;  2LFS A;  2VQE O;  1IDS A;  4I4T B;  4RO2 A;  1EN6 A;  2FB5 A;  1PV0 A;  5CMU A;  4ZIB A;  2B1I A;  1PKX A;  2ZNI A;  2CAZ C;  3AEI A;  1SA0 A;  4B3R B;  2YS8 A;  3JAL B;  2VWJ A;  4NTW A;  4DV2 B;  4JAV A;  3F5W C;  3ICX A;  1K92 A;  2Q7H A;  3HKC B;  3I56 V;  4X66 B;  1NI8 A;  1Y6X A;  3GVM A;  3N2K B;  1TAE A;  3HR0 A;  4MVQ A;  4I0X A;  1SQQ H;  1M90 W;  2W0F C;  3QO5 A;  4KHP B;  1HW7 A;  4O2A A;  1B3Q A;  1BE3 H;  4B3M O;  3TK1 A;  3ABU A;  5B1A B;  1RSO B;  2QWQ B;  4H13 B;  1HNX B;  3SJB C;  4KFM A;  4IGG A;  4O4L B;  3HKB A;  1VIB A;  5JQG B;  4YIP A;  4LFC B;  3FKS G;  5JH7 B;  2P06 A;  1B6Q A;  1PP9 H;  1ZTE A;  3UKM A;  1GM8 A;  4JAA A;  4PDR A;  2A79 B;  4JI2 B;  3OTF A;  2JS3 A;  4RUE A;  2ITD C;  3RN4 A;  1PNM A;  4ZBM A;  5LL6 Y;  2YSU B;  4IHJ B;  4LFC O;  2WA3 A;  2JJ1 G;  1OCR C;  2HJD A;  4GKK B;  4WFG A;  5IYC O;  5DEC A;  4Z1M G;  4B3R O;  5IT9 N;  4TWK A;  4X1K B;  5IYB O;  2ZIN A;  5EC2 C;  5B3S C;  4UUJ C;  3RFR A;  4DV1 O;  3CYO A;  3LNM B;  1N36 B;  1NQT A;  1TUB B;  5HFL A;  3DXR A;  3DSQ A;  1Y74 B;  4FVM A;  1P49 A;  1MSW D;  1L8D A;  3RYH B;  1M4U A;  1Q3E A;  3FX7 A;  3S3W A;  4ZHQ B;  5KAI Z;  3APO A;  4G28 B;  4JI5 O;  3ZJZ A;  2ZXW C;  1OHH G;  5GTI Z;  4XDJ A;  4FK5 C;  3JAL A;  1BZK A;  2DYR B;  1E1R G;  1GM9 A;  3FB6 C;  1YTF D;  4J11 A;  2LO1 A;  1ZL8 A;  4JI1 B;  2WLI A;  3QO8 A;  3B4S A;  3F7Y C;  4K0K B;  3BEH A;  3ZRW B;  1XL4 A;  3VQW A;  2LW1 A;  5EIB C;  4NXN B;  4DV4 O;  4IIJ A;  3OR6 C;  4RUF A;  4X1I B;  1B04 A;  5CBF A;  4LF7 O;  3B8M A;  2ITC C;  5LXT B;  2Y48 A;  1NTK H;  1JJ2 U;  2NLJ C;  3N2G B;  4WFE A;  3DC5 A;  5IJ9 B;  5FLX N;  1V54 C;  3H1H H;  2ZE8 A;  1WPX A;  1FKA O;  4PDL A;  1COW G;  1DF4 A;  4WCE V;  4FLZ A;  3MD0 A;  4C7U A;  4BIO A;  4XBF A;  5GON B;  3W7S A;  3DGE A;  1AI6 A;  4WFA V;  3LNN A;  2JVD A;  1KMI Z;  1YVW A;  3OD4 A;  4GKJ B;  4CH6 A;  3K04 A;  1BHA A;  2KSD A;  3D36 C;  4JYY A;  4H44 B;  1GAX A;  4Z2W A;  2E75 B;  2ZXW B;  1BQ0 A;  3C90 A;  5JCO C;  1H8H G;  4I50 A;  3RYI A;  1W0K G;  3T1C A;  1N34 B;  2ZE6 A;  3BCC H;  5D5P A;  2ZR3 A;  1B06 A;  1WPB A;  5LHG A;  2BTO A;  3FB7 C;  5C8Y B;  2BTQ B;  1PL0 A;  4CZZ A;  1YJN V;  1BL8 A;  1AP5 A;  2QGN A;  4B3T O;  2HG5 C;  4O4H A;  1KU9 A;  2YXY A;  2IJH A;  1FXV A;  3WG7 B;  5CN0 A;  4Q20 A;  1Q6U A;  5CA3 A;  1I94 B;  1FAF A;  1H2L A;  5AG2 A;  4IYH A;  4J42 A;  1F23 A;  3CCJ V;  2UUB B;  5IJ0 B;  3K08 A;  2C2A A;  4JYB A;  2VQF O;  4PI0 A;  4JI4 O;  5JCO A;  3OT7 A;  4TV8 B;  2EIM C;  4FZ1 A;  4JTD B;  2P67 A;  2ZQM A;  2ETN A;  2RJZ A;  4UVB A;  3ABM C;  3SPI A;  3AG2 B;  2EBO A;  4JI8 O;  5IY5 C;  4DW0 A;  5BMV A;  3CCU V;  2WLK A;  2Y69 C;  3KG2 A;  2IM9 A;  3FYE B;  1OCC C;  1XI1 A;  5JVD A;  4MS2 A;  4UVA A;  4ZI7 B;  5B1A C;  1MNG A;  2B1G A;  3J80 N;  5EBM C;  1ROP A;  4B7E A;  4L87 A;  2Q67 A;  1VF5 B;  2GHY A;  5LBQ A;  3SR2 C;  4LF8 O;  1EN5 A;  2EUL A;  2XAS A;  1KEC A;  5JJN B;  4W4K A;  2P5O A;  4NXN O;  2HVK C;  3IC9 A;  4J80 A;  2KG7 B;  4DR5 B;  4O4L A;  3CC2 V;  3E83 A;  3ZMS A;  4HBN A;  3ZRS A;  3LDD A;  4DR2 B;  1XMQ B;  2RNB A;  4I4T A;  3W7W A;  3ZHU A;  2YXH A;  2DW4 A;  3JD2 A;  4R8C A;  4AQY B;  3BY6 A;  4WFB V;  2QKC A;  3JYC A;  5LP6 A;  3J7A U;  1VQ4 V;  3QTC A;  2OCC B;  3CS5 A;  2Q0A A;  2ZE7 A;  5LXT A;  3G71 V;  1JCH A;  1UFI A;  1SQX H;  3AG2 C;  3DXR B;  3T2M A;  4DR5 O;  1OCO C;  5IYZ A;  1QHT A;  4TOI A;  4LFA O;  2UXD B;  1HNZ B;  4U3J A;  2OCC C;  1O9G A;  3VOU A;  4DR6 B;  2WLJ A;  1IBK B;  2JIZ G;  1QLE B;  3M99 B;  4ZOL A;  4UCV A;  5CBH A;  3A0H Z;  4WBN A;  4DXW A;  3ZIA G;  3CCM V;  1Q6I A;  3FB5 C;  4X20 B;  5LGN A;  4X65 B;  5CA0 B;  1N32 O;  1MA1 A;  1Q7Y W;  1AI4 A;  3CRM A;  3BVO A;  1AJQ A;  3JD1 A;  3RVZ A;  1N8R W;  1NKD A;  1NR7 A;  4RWU A;  1VP7 A;  3UCS C;  3FAV A;  4PV1 B;  3JD4 A;  3OFN G;  2CH7 B;  4D7T A;  3D8C A;  4ICG A;  4YJ2 B;  4JV5 O;  4ZI7 A;  3ZN0 A;  2P4V A;  4JTC B;  1OCZ C;  3K79 A;  4FFB A;  3L70 H;  3KZI Z;  4MVZ A;  2Y69 B;  3K06 A;  4LF9 B;  1ZL8 B;  2HHH B;  4JTA B;  4RQF A;  1BT8 A;  5KHI A;  5LHH A;  1VMG A;  3UQ8 A;  1Q5O A;  3CPW U;  2P22 C;  5F2V O;  4FM0 A;  1AB3 A;  1X4T A;  4W4L A;  3ZS8 C;  2DE0 X;  3NR7 A;  1NR1 A;  5KUM A;  2YI9 A;  3CJH B;  2QSA A;  3ZN1 A;  1Y74 A;  4N23 A;  5IJ0 A;  2KQX A;  3IAY A;  3SGI A;  5J2T A;  4JI6 B;  3ETG A;  2QM8 A;  1HR0 O;  4KUM A;  3CME V;  2K9P A;  3OTO O;  1JFF A;  4DYL A;  3ABL B;  4LBE C;  1K97 A;  1Y76 A;  4IL6 Z;  1IBM O;  3BA8 A;  1J5E B;  2ZCE A;  1K3E A;  1BS3 A;  1S0V A;  3RYI B;  3SPH A;  3WB0 A;  1GKF A;  4P2Z A;  4O4J A;  3BRC A;  3W7X A;  1K7D A;  2GUZ B;  2HFE C;  3CXH F;  1JVM A;  4UCO A;  5J2U B;  4JV5 B;  2YIB A;  3OMN B;  1H2S B;  2FML A;  5GON A;  1FPO A;  3T1Y B;  4NB5 A;  5B1O A;  4XDK A;  1QBZ A;  2QM7 A;  5H5N A;  4JI2 O;  1IUR A;  1GTO A;  4F6E A;  1VF6 C;  4OPA A;  1AP6 A;  3STZ C;  1GM7 A;  2FYU H;  4J7Z A;  4FLT A;  4TUY A;  3NXS A;  3K9A A;  2IH1 C;  1YDX A;  4DRX B;  1Q6H A;  2PY5 A;  4LNU A;  1SET A;  4GCZ A;  1V55 B;  4FZ0 A;  2QWP B;  4OXS A;  3AG1 C;  1TVK B;  4CBC A;  5KA6 A;  4TUY B;  5IWA O;  3SPJ A;  1LNQ A;  4LWS A;  3P3N A;  3CCE V;  4DUY B;  3QNE A;  3UM7 A;  1QVG U;  4E4E A;  3JAT B;  2JDI G;  4MVO A;  2P6J A;  4MTG A;  1SQG A;  1YSC A;  5KHG A;  1XMO B;  4BWA A;  2WLH A;  1WP8 A;  2JGU A;  2R9A A;  1AR1 B;  1QR9 A;  3D3Q A;  5H2F Z;  5J2T B;  3TCU A;  1VQ6 V;  3OM3 B;  4PD4 F;  5DN6 G;  4QPK A;  1RPO A;  3OEH G;  1FD9 A;  2NR5 A;  1N32 B;  3OGI B;  3IGA C;  1Y67 A;  4DV7 B;  1M93 A;  1R6T A;  4KXR A;  1EN4 A;  2PYL A;  1JJO A;  3EHB B;  3M7M X;  2V4D A;  4LF7 B;  2X6B A;  2PI4 A;  2DQ0 A;  1IXM A;  4J10 A;  2ODM A;  1CPY A;  2P7T C;  5FPR A;  2ZDI A;  3OW2 U;  2KB1 A;  3B8N A;  3EXA A;  4WF9 V;  3JAT A;  1YZB A;  2W6I G;  4X88 A;  2JEX A;  4J7J A;  4U3J B;  4TQF A;  4K35 A;  3L71 H;  1TA8 A;  1HP8 A;  1NS1 A;  2Q0O C;  3ZMZ A;  1AJN A;  3RWR D;  2Q7E A;  5KAF Z;  4ZOL B;  2PF4 E;  1MAB G;  1YJW V;  2F4V O;  3TET A;  2CDY A;  4X62 O;  4DV2 O;  2ZT9 B;  2X7R B;  3WFV A;  2QTO A;  5JH7 A;  4NTX A;  1IXB A;  1BSM A;  3E8B A;  1SQV H;  5ITZ A;  4DR4 O;  5HFM A;  1HNW O;  4JAS A;  3W7U A;  5J2U A;  3G67 A;  4JZG A;  4N21 A;  5BMV B;  1TUB A;  3JAS B;  4FLW A;  4PA4 A;  3ZMV A;  1AVM A;  1PD3 A;  1UJW B;  1J5E O;  4X64 O;  1GRJ A;  5L3F A;  1HNW B;  3P3P A;  2GUZ A;  2UUB O;  1YTF B;  1SC5 B;  3H9V A;  1XIL A;  1JPX A;  2R9R B;  1IBL B;  5C93 A;  1DGS A;  1V9P A;  1AR4 A;  1YXB A;  2AGA A;  1JOY A;  3OGC C;  2EIL C;  1OV9 A;  2DYS B;  4TT3 G;  4X20 A;  3OUF A;  2K1E A;  5EIB D;  1Z5V A;  2ZDI C;  2HJF C;  4I0X B;  3C3S A;  3OMI B;  5KA5 A;  4RQE A;  2AW9 A;  2F43 G;  3L9D A;  4AI8 A;  3RW0 A;  5E1A C;  4YJ3 B;  3T1H O;  1M1K W;  2HLD G;  5BZB A;  3DC6 A;  3AG3 B;  2LGW A;  3ABK B;  1JMK C;  4PA3 A;  3JSN A;  3FB8 C;  4DR3 B;  2JRI A;  3BA9 A;  3U10 A;  1Z5W A;  1K8A W;  5KHJ A;  4AHC A;  2P4K A;  4YJ3 A;  4QJF B;  3K57 A;  2A06 H;  2ADQ B;  4D6T H;  1I0H A;  1N33 O;  1Q81 W;  2VWK A;  4LFB B;  3D3I A;  5KLV H;  1HWY A;  3T1Y O;  2WWW A;  2YIB D;  5A2Q N;  2L6L A;  1SA0 B;  3AK3 A;  2NNU A;  3K5N A;  5H9C A;  4NXM B;  1TUE B;  4I55 B;  4UXN A;  3FD9 A;  3CMA V;  2QWN B;  1N0N A;  2IU3 A;  4FLV A;  1SZX A;  4ABM A;  5GW7 A;  1S77 D;  4I9W A;  2DN9 A;  4PEL A;  1WP7 A;  2LP7 A;  2UXN A;  4HNA B;  1QLE C;  4KHP O;  4CH4 A;  3JAK B;  1NZ6 A;  1OCC B;  3JAW B;  2CUG A;  2F93 B;  1I08 A;  5K1P A;  4DUZ O;  4QE9 A;  3ABM B;  4CS2 A;  5EBL C;  3H1I H;  4CC6 A;  3E8G A;  3VQX A;  3SYQ A;  1M57 C;  5EK0 A;  4DR1 O;  3KCY A;  1Q8I A;  4Z1V A;  4G2K A;  1BMF G;  2AHZ A;  3SYA A;  4PDM A;  2DOS A;  1Z2G A;  3E35 A;  4UB8 Z;  1IVS A;  3QVN A;  2IW5 A;  1PL4 A;  2QE7 G;  1S3J A;  2DYR C;  2EIL B;  3WG7 C;  1XHX A;  4EEQ A;  4MTF A;  2H3O A;  2Q69 A;  5LMN B;  1PNK A;  4HNA A;  4HYO A;  1S72 V;  1K5Q A;  1ZSP A;  2Y0P A;  1JQ0 A;  4OGQ B;  4O2B B;  2GDS A;  4KP4 A;  3THO A;  5LOV B;  2NN4 A;  1KBH A;  5CA0 A;  3CXC U;  3H1J H;  1W59 A;  2F1M A;  4JI6 O;  2UU9 B;  4CS4 A;  3D36 A;  2HVJ C;  1XNR O;  3X2Q C;  5IY5 B;  1ZAU A;  2AXT Z;  3IC7 A;  5FNV A;  4ZKI A;  1NT2 B;  4DK1 A;  4LC1 A;  1M56 B;  2Z3Y A;  3ASO C;  5B5E Z;  1Q43 A;  4NTY A;  3JAM N;  1H2K A;  3WB2 A;  2WPD G;  1NH2 D;  1W0J G;  2QR4 A;  2V7Q G;  4O4I B;  1YHQ V;  5CBG A;  3CD6 V;  1KP2 A;  1FXK C;  4P9O A;  2R70 A;  1M9N A;  5KMG A;  4JI7 O;  2DYS C;  1KKC A;  4F4L A;  3CEI A;  2XAF A;  1HNX O;  2Q73 A;  1JR9 A;  4UCT A;  2OTL V;  4DV5 B;  2AZ2 A;  4YY3 B;  2X6C A;  4I55 A;  3CE2 A;  4CH5 A;  4GX1 A;  1TVK A;  5H6R A;  1ZLZ A;  3K58 A;  2QDO A;  3ZHR A;  1QR8 A;  2GBO A;  4H37 A;  4TQD A;  2YEV B;  3ZRV A;  2XAH A;  3LSQ A;  1XMO O;  1MZF A;  4GX0 A;  2IU0 A;  5JJJ B;  4X8A A;  5CB4 B;  1P7G A;  2FTK A;  2Q8V A;  3CRQ A;  3LDC A;  5DED A;  5TIS Z;  2QM4 A;  3RYC A;  4JI0 B;  4X9Q A;  3L73 H;  4MSW C;  1RM1 C;  2CE4 A;  4J9Y B;  5D5Q A;  1QQC A;  4BW5 A;  2YID A;  3CWB H;  4JI3 O;  1Q90 D;  5J9P C;  1F51 A;  3CC7 V;  3ETQ A;  1S5J A;  4J7K A;  1FJG B;  4MVR A;  3F5T A;  4J41 A;  3KCX A;  4LF4 O;  4O2A B;  3PN1 A;  3CHX A;  3ZRW A;  1VQM V;  2DWE C;  4PDV A;  2M7W A;  1H38 A;  1S76 D;  5GTH Z;  4YY3 O;  3AG4 B;  3U11 A;  2X6A A;  4A5U B;  1XNQ B;  1BGY H;  2BOB C;  4LF6 O;  1IX9 A;  2CTW A;  1M56 C;  3ASO B;  1P7B A;  1XHZ A;  4JI1 O;  3ZHV A;  5KMG B;  4DV1 B;  2OTJ V;  4UV8 A;  4X1Y B;  4IT5 A;  4YXW G;  3M8A A;  1BQZ A;  4CS3 A;  3RYH A;  2H8P C;  3L72 H;  5LYJ A;  4LF5 B;  3ZRX A;  3SYP A;  4B3T B;  1KQS U;  4LH7 A;  5IE9 A;  2Q6A A;  1HNZ O;  2UXC O;  2F23 A;  4B7K A;  4DR6 O;  5LOV A;  2P90 A;  2WA4 A;  3HPL C;  1ZUQ A;  4FFB B;  4DO2 A;  3O65 A;  4GLX A;  4AIL C;  5LHI A;  1VQN V;  2UU9 O;  4YJ2 A;  3G4S V;  3AK2 A;  2ZE5 A;  1SES A;  3MHH C;  4X65 O;  1XNR B;  4MVU A;  1E79 G;  2EIN B;  5EBW C;  3FAV B;  1DTO A;  3HKE A;  4TSF G;  3K59 A;  1VQ9 V;  4LCU C;  2IJI A;  3I55 V;  5EYP B;  4HZ3 A;  2ZM6 B;  2CH7 A;  1I5X A;  3AG7 A;  1EZV H;  3R65 A;  5FL7 G;  2GV9 A;  4JI0 O;  3JAW A;  1G8M A;  3K0G A;  4K3A A;  1YIJ V;  1SKV A;  2RDC A;  1WA8 A;  3T4D A;  2OYQ A;  2N04 A;  3G6B A;  2ATK C;  1L1F A;  1G4Y B;  2LFR A;  2YC0 A;  1I5Y A;  1SQF A;  5EZY B;  1VF7 A;  2EZP A;  4LF5 O;  1VF6 A;  4PA7 A;  1SS3 A;  5JVD B;  3JCU Z;  1LUV A;  1D2D A;  4OPH A;  1IBL O;  2BCC H;  2UXC B;  4KL1 A;  3X2Q B;  1XQ8 A;  5LP6 C;  4LF4 B;  3ML0 A;  2IJJ A;  1OCZ B;  2D2C B;  4ZHQ A;  3STL C;  4K0K O;  1R3K C;  5L3G A;  3ZCC A;  3CSX A;  3IFX A;  2UUA B;  1R6K A;  2WLM A;  2UUC B;  3APQ A;  2KG7 A;  3UO3 A;  3ZHS A;  1KP3 A;  2EIJ C;  1VQ7 V;  4DV0 O;  4JI7 B;  1XL6 A;  2WLI B;  3CP1 A;  3GB7 C;  2V1D A;  1P4R A;  5CA1 B;  3MHS C;  4U3F H;  1SZT A;  1WJZ A;  2ZM6 O;  1XDC A;  3JD0 A;  3RT3 C;  2EIM B;  4L8J A;  4UVC A;  4MT8 A;  4JYA O;  1NVP B;  3CRR A;  5DM6 V;  1D5N A;  2UXX A;  1V55 C;  2N74 A;  4MVS A;  5B1N A;  1YJ9 V;  4ASU G;  1N34 O;  2N05 A;  3H01 A;  2DQ3 A;  4P30 A;  3LUT B;  2CTR A;  3CCQ V;  4JI8 B;  2GTS A;  1AR5 A;  4DV6 B;  3O9O A;  5B66 Z;  2Z0A A;  1L0N H;  3GWK C;  4X89 A;  2CK3 G;  3JAK A;  2WLL A;  4PA6 A;  5LMN O;  4K8X A;  4LP8 A;  2LQT A;  1Q86 W;  2GSM B;  3E22 B;  3H1L H;  1EFR G;  4X62 B;  2OT5 A;  1IBK O;  4JI3 B;  2FL4 A;  2Y4T A;  1F7Y A;  1WB7 A;  3FFQ A;  3VBB A;  3A0R A;  1FFX A;  3B77 A;  4LWS B;  1Y76 B;  2PI5 A;  4FPP A;  1ZWI C;  2PUS A;  2H94 A;  4MVM A;  2ZNJ A;  4JI4 B;  1URF A;  2Z5U A;  1R73 A;  3HKC A;  3CJH A;  1RSO A;  2LW7 A;  2QWO B;  5FNV B;  4DR2 O;  1R3I C;  2VQE B;  1VQK V;  2JJ2 G;  2QJ1 A;  1WA8 B;  4JAU A;  4RAI A;  1AI5 A;  1V54 B;  1NJI W;  3F7V C;  5A9G A;  2HEP A;  2GTA A;  3LSU A;  3ASN C;  3K0D A;  3JAR B;  2YUA A;  2Q4P A;  5C8Y A;  4DK0 A;  2PYJ A;  1N4C A;  5BR8 B;  3MAQ A;  3OTO B;  3ASN B;  3SJC C;  5JWP A;  3L74 H;  4GUN A;  1R3J C;  4DW1 A;  4QIW F;  2ILM A;  2A0L A;  3JD3 A;  4LFA B;  2UXD O;  2E76 B;  1NU1 H;  2CTP A;  2OCH A;  4HAM A;  4X66 O;  2EIK B;  1W2B U;  1I94 O;  4R50 A;  4DR7 O;  1XRE A;  4DV6 O;  4UCS A;  4NVP A;  2G38 A;  3C3T A;  5L3B A;  2RMK B;  4CH3 A;  1K34 A;  3ETD A;  2R9I A;  2XND G;  2IH3 C;  3CCS V;  5H6Q A;  4UCU A;  2EJR A;  4FIP C;  3AK1 A;  3EFF K;  4WBN B;  3ZED A;  4IYI A;  1VQO V;  4EKW A;  1XOU A;  2E74 B;  2Q7G A;  1M5I A;  1ORQ C;  3K5L A;  4LNU B;  3K03 A;  1XUQ A;  3OMA B;  3OAA G;  3E22 A;  5B3S B;  4JI5 B;  1GH6 A;  2XUM A;  2UUA O;  1GN3 A;  1YF2 A;  3EVK A;  2W0X A;  1ENV A;  3ZHQ A;  4DV5 O;  3SYO A;  3BAA A;  3HKB B;  3UO2 A;  1PNL A;  1G1X B;  2QKS A;  1H8E G;  2EX3 A;  3N2K A;  5LGT A;  2HP8 A;  3LDE A;  2A9H A;  2YIC A;  2Q5Z A;  2ZIO A;  1JA8 A;  4FFK A;  4BR6 A;  4H33 A;  2YXL A;  3K5M A;  2HR3 A;  4QGP A;  1AI7 A;  2WSS G;  1OZ0 A;  3Q4H B;  1HR0 B;  1GN4 A;  5LMU O;  4IHJ A;  2JGD A;  2RCV A;  3B40 A;  2EIJ B;  3QF7 A;  3SPG A;  2BTQ A;  3N27 A;  4LF8 B;  1SRY A;  4X1K A;  1CP9 A;  5E79 Z;  1BCC H;  1KB9 F;  1IBM B;  2KKW A;  4FM2 A;  1H2G A;  4O4H B;  2AHY A;  2HHH O;  1XBL A;  3FYI B;  4PI2 A;  3TXS A;  3CCR V;  1BHB A;  2UUC O;  4DR4 B;  2YI8 A;  1K4D C;  3ZMU A;  3K5O A;  3SDL A;  5BY1 A;  4GKJ O;  4GZR B;  1WNS A;  4JF3 A;  4I7Z B;  3T1H B;  5LYJ B;  4O4J B;  1NTZ H;  2XT9 A;  4DV0 B;  1R3L C;  1RPR A;  3B2E E;  4BAY A;  1NH2 B;  1KD1 W;  3U0Z A;  1K4C C;  4DV3 O;  1H2N A;  4WFH A;  4QE7 A;  2ZR2 A;  3P30 A;  4UV9 A;  4DV4 B;  3HB3 B;  3K3W A;  2ARH A;  1GMG A;  1T5E A;  3B09 A;  2E5L B;  4DUZ B;  1J95 A; 
#chains in the Genus database with same CATH homology
 1RP3 B;  1SC5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...