1RP3B

Cocrystal structure of the flagellar sigma/anti-sigma complex, sigma-28/flgm
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
77
Chain Sequence
VNRIELSRLIGLLLETSGTNKIEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEFFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Flagellar Sigma/Anti-Sigma Complex Sigma(28)/FlgM Reveals an Intact Sigma Factor in an Inactive Conformation
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords RNA polymerase sigma factor SIGMA-28 (FliA)
total genus 23
structure length 77
sequence length 87
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04316 FlgM Anti-sigma-28 factor, FlgM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1160 Mainly Alpha Orthogonal Bundle Helix Hairpins Anti-sigma-28 factor FlgM 1rp3B02
1RP3B 1SC5B
chains in the Genus database with same CATH superfamily
1YVWA 4MT8A 3E8HA 5IYBO 2K1EA 2N05A 1RSOB 3ZMUA 1SZTA 1VQ6V 2QWPB 5GW7A 1KC8W 2DJVA 4IIJB 4JYAB 1SQXH 2ZIMA 3W7XA 3LNMB 1YF2A 1YIJV 1ENVA 4WF9V 3RYFA 1V55B 4GX0A 1MZEA 3W7WA 1O9GA 4LF9B 5EYPB 3O65A 3RW0A 3RYIA 5LOVB 4BW9A 1PM9A 2F93B 3RWRD 3M8AA 1OCOC 4LF5O 1S0VA 5ITZB 2R9RB 4QIWF 4DO2A 4CC5A 4HNAA 1P49A 2VRZA 4MTGA 4LFAB 4KFMA 1DGSA 1YZBA 5J2TB 1W2BU 3HKEB 4BR6A 3NXSA 2ADPA 1EFRG 1SETA 2MW2B 1M1KW 4UCOA 1GK9A 4BW5A 1AR4A 3JD1A 4JAVA 1EM1A 3RT3C 4PDVA 4O2BA 1GMGA 1YHQV 1GRJA 2IJKA 4LNUA 4J7KA 3AG4B 2HJFC 4BIOA 2NN4A 4YJ2A 1OCRC 1ZWIC 2ILMA 4FMTA 3G6BA 5DM6V 3ZRVA 3AG1C 3E83A 3FAVB 1MABG 2Q0AA 2JK5C 4O4IA 3OEHG 1JFFB 4LH7A 4R50A 4YHHB 2A7WA 2GSMB 2JGUA 2A06H 1M93A 4IHJB 3TJTA 2CUGA 5L3CA 4MW8A 2Y69C 4B3SO 5IJ9A 3R66A 2WPDG 5FLXN 3EVKA 4J7ZA 4GX2A 1CP9A 5FPOA 4JASA 5LMNB 4DW0A 3CP1A 5K1XA 3ZN1A 3CXCU 5BZBA 4OX9B 2QSAA 3K5LA 1WP8A 3E8BA 3ZHSA 4X64O 2LGWA 2F43G 2ZE8A 2GV9A 4B3MO 1SQGA 3K3WA 3R65A 3DTUB 4I0XB 3BFRA 2YIBD 4ZHQA 5JVDB 1FKAO 4X62O 4ZI7A 4TT3G 5EBMC 2HR3A 3N2GA 2EJRA 4DUZB 1RM1B 5EZYB 2C2AA 1N8RW 5J2UB 5C8YB 1VF5B 3CCRV 2UU9O 5GONB 4X88A 5EC2C 2QM7A 3E86A 4JTAB 4F6RA 4G28B 1SC5B 4Q6GA 2QM4A 1QR8A 1S72V 3VQWA 2EIJC 4IHJA 3BRCA 1H2MA 4RWUA 3LSUA 4UXNA 1PNMA 3A0RA 1R6TA 4FIPC 1YITV 1XQ8A 1XHZA 1GTOA 1VF7A 2QKCA 1KUQA 4DR3B 2JJ1G 3SJQC 4J41A 2Y0IA 2EILC 1SQBH 5KHKA 3C90A 3K0GA 3JALB 3SYAA 2Y0PA 3FYIB 3RYHB 5C93A 1HNZB 1TAEA 1XL6A 2WLJA 1H2SB 2JS3A 3ZIAG 1EZVH 4YY3O 2YI9A 4X1KA 1J5EB 1VIBA 4LH6A 3K5OA 4MVSA 2UUBB 3B2EE 1KMIZ 3IGAC 1NQTA 2JDIG 5B1BC 1KKCA 2P06A 2HFEC 3H1LH 2YIAA 2NNUA 4I55A 4NVPA 3N27A 2FB5A 2Q8VA 5IYCO 2WAMA 4JI2O 1E1RG 3D3IA 1BCCH 1R73A 1OJHA 4AI8A 3C3TA 5EZYA 5H5NA 4PV1B 4OPAA 4LR3A 1B3QA 3CRMA 5J9PC 3E89A 3CCMV 2XHBA 1M90W 1IDSA 2EIJB 4DK1A 3RYHA 1H2KA 5KHIA 1YJ9V 4NKGB 3PN1A 1FXVA 1RM1C 4UCRA 4NTYA 3MHSC 1Y66A 2Q0OC 4GZRB 1X4TA 3K03A 3OR6C 1EZJA 4O4LB 1EN5A 2V7QG 2Q6AA 3L75H 2OCCC 2BTQB 3JASA 3WB1A 4I4TA 3G71V 4DR2B 1N36O 2QTSA 3H1IH 1XMQO 1HR0B 1I7FA 1RP3B 2Q73A 1YCIA 1US6A 2HEPA 4FK5C 1HW7A 1KKDA 3B40A 4TQDA 2IJHA 5LYJA 2UXNA 5EK0A 5CMUA 4G27B 4UVCA 1IBMO 4LBEC 3FKSG 4I55B 2UUAB 5LOVA 3UM7A 3O9OA 1N4CA 5A9GA 3RVYA 4H44B 1FFTB 2QKAA 1VMGA 2QJ1A 1N0NA 4HNAB 4DV7O 3B8MA 2JGDB 1CEZA 4O2AB 5KUMA 4X1YA 3N2KA 1K3EA 3OTOB 2PYJA 4OX9O 5KMGA 5HFMA 4JI2B 2EZOA 3EXAA 5EBLC 3AG1B 3JAWA 1L8DA 4DRXA 3AG4C 4B3MB 1BMFG 1YTFD 3P32A 4LNUB 3L71H 4XDJA 4B3TO 1Y74B 2UXDO 5H6RA 4E4EA 2X6AA 3CXHF 4DV5B 1Y4MA 5H6QA 4DV6O 3JD4A 4I7ZB 1H2NA 2PI5A 1RPRA 2IJIA 1D2DA 2EINB 4GKKB 2ZR3A 2OIGA 3G4SV 4DV4B 1YDXA 3A2FA 4UCSA 2XAGA 4K8ZA 1XNQO 2IU3A 4PD4F 5LMUB 3OT7A 4LWSA 2XUMA 4UB8Z 1DF4A 1PL0A 1W59A 4DR7O 4BAYA 3ZN0A 3SPJA 1LUWA 4MVUA 1I0HA 1Y76A 1ZSPA 1TUBB 1SQFA 3B77A 3K9SA 1V55C 4MTFA 1NTKH 3CMEV 2CE4A 2R72A 4L87A 4UVAA 4X1IA 2KKWA 2ODMA 2P4VA 1HNWO 4DR4B 5JQGB 3GWKC 3BY6A 3SPGA 4YJ3A 4U7NA 4ZIBA 3ASNC 4GUNA 2CDYA 3FB7C 2YEVB 1Q82W 1MOFA 2AZ2A 3DSQA 2CTPA 1OZ0A 2OT5A 3EHBB 2XT9A 3RYFB 2JRIA 2O57A 3A0HZ 4LWSB 5IJ0A 2PI4A 5CB4A 1MG1A 3WB0A 4DV2B 3MHHC 5JWPA 2Q9LA 1HNXB 2QTOA 4UVBA 5BR8O 2AW9A 4FZ1A 4QE7A 3CCLV 3CRQA 3ZRXA 4CH4A 5TISZ 4F6RB 2LQTA 3IC7A 3SYOA 1PKXA 4DV0O 3IFXA 4IL6Z 2M6YA 4H0LB 1EN4A 1V54C 1KQSU 4TV9B 2GHYA 1M56B 1AJPA 3F7VC 2IU0A 2CAZC 1M4UA 5CA3A 5L3GA 4IYHA 3T1YB 2BE3A 1N0JA 1BS3A 4U7OA 4UV9A 4DV1O 4LF6O 4I9WA 2VQFO 3ZMSA 2WLLA 2P6JA 1H2GA 3UT5B 1QLEB 3U10A 1CXZB 4AILC 2B5UA 2OIEA 4AQYO 3WG7B 2WA3A 1JR9A 1HDJA 2PGGA 1YXBA 3H1HH 4DR5B 1OCZC 1NBMG 5E1AC 3ZEDA 1IVSA 4JI7O 1OCCC 1OCRB 3SJAC 2XTAA 5B3SC 3ML0A 3OFNG 4B3RB 1JX9A 1WB7A 4UB6Z 2P90A 2GTAA 4K8XA 4LF7O 2CTWA 2YXLA 4GT1A 4OPHA 2H8PC 3SYCA 5LHHA 1MA1A 4EFEA 4O4IB 4PDRA 5IWAO 1IBMB 1KP3A 3OMIB 4TUYA 3GB7C 5IY5C 2QWNB 2WLLB 4LP8A 1Q43A 2DQ3A 3K59A 4JV5B 1FYJA 2P67A 1H8EG 4FLXA 2ITCC 4PDMA 1QHTA 1F23A 4AHCA 4ZOLB 1WN7A 2HP8A 1NH2B 2RJZA 1FXHA 4EB6A 2QWRB 5B1NA 5JH7A 5FNVA 1FJGB 1MSDA 5LGNA 3ABMC 2Y69B 4DV0B 5CBGA 1AP5A 3K5NA 4PHZA 4CH6A 3M7MX 3EFFK 4EKWA 4MVZA 3CRRA 2AGAA 5GONA 1XMOB 4DV6B 4TUYB 1ZUQA 4DV3B 2CTQA 4LFBB 2R70A 3J7AU 4DUYB 1VQMV 4PJ0Z 4IGGA 2V4DA 4JPRA 1CPYA 4WFAV 1JVMA 3DC6A 3ZMTA 4JI3B 1AI6A 4IYIA 3AG2B 1M57C 2ZM6O 1OV9A 4JI6O 1F4MA 5JJJB 5KX5A 4GX5A 5JH7B 2FL4A 4JI1B 3ZRWA 4NB5A 1WB8A 2M7WA 1M9NA 1AROP 4LFCO 4DR7B 2KG7A 4TQFA 4UFZA 1VQKV 5L3BA 4X64B 1GN2A 1GKFA 1Z2GA 3C3SA 1FAFA 2UXXA 4DRXB 5BY1A 1BZKA 3SR2C 4TV8B 1HP8A 1JMKC 3H1KH 4LCUC 5B1BB 1DF5A 3LDDA 1VF6C 5JJNB 2QEXV 1Q6IA 4X62B 4O2BB 3T2MA 3JALA 1NU1H 4E2LA 2QR4A 2AXTZ 4J11A 1BL8A 2H94A 2IM9A 2WLNA 4QPKA 4FFBB 3RVZA 4B7EA 4FVMA 1URFA 1OHHG 4K35A 3TXSA 3FAVA 3OW2U 1VQ8V 4QPJA 3ZRWB 3ZHTA 1J5EO 1NVPD 4B08A 1PP9H 1HNXO 4LF4O 2QDOA 4CH3A 2OCCB 4FLUA 1R3LC 2LFSA 5A2QN 1Q6HA 1SF9A 2FKXA 3THOA 1S5LZ 1GN3A 1Q3EA 1KD1W 3E22B 1K9MW 1DK1A 3B8NA 1TUBA 2DOSA 2WSSG 2OWOA 1NVPB 3E35A 2DYSC 2AHYA 2VWKA 1Q7YW 1MNGA 3TXQA 4JI3O 1N32B 4RUEA 4FFBA 1QU7A 3ABKC 4KUMA 4MVQA 3P3PA 2VQFB 3D36A 4O4HA 1P84F 3D3QA 4D6TH 1IZ3A 1S76D 2WA4A 1XEQA 1VQ9V 3BAAA 5LGUA 4K3AA 2F1MA 5KLVH 5LP6C 5IYDO 2UU9B 2ADQB 1FJGO 2B1GA 4NYKA 3ZHRA 4KHPO 2YS8A 4C7UA 3JD3A 2Y4UA 1IXBA 4GX1A 1OCCB 3ZHQA 5DN6G 1R1BA 3ETQA 3N2KB 3CC4V 4I50A 4DV3O 5B1OA 4X9QA 2PYLA 2UUAO 3F7YC 1SQQH 3RYCA 2VWJA 1K4CC 4DR2O 4MVRA 1BE3H 4FLZA 5H9CA 1QVFU 4Z2WA 2RN9A 2UUBO 3VQYA 1PL4A 4JI1O 4EFBA 4O2AA 4PA6A 1AJQA 2ZKOA 1RSOA 3OTOO 4QJFB 1GH6A 4D7SA 1S77D 5E79Z 3ABMB 1G1XB 4JYYA 3D8CA 1R3KC 4OXSA 3E8FA 4LFBO 3HPLC 1IX9A 2ZE7A 3U11A 4DUYO 2ZINA 4X66O 3G80A 3TETA 1W0KG 3GWOA 3WFVA 1AI7A 3SPHA 2WWWA 4JI8B 1Q86W 4NR1A 5F2VO 3RYCB 5ITZA 3E2EA 3OUSA 4NXNB 4JYCA 3LSQA 4CH5A 1E1QG 1EBOA 2BSKA 1WLEA 1SQPH 2F66C 2CH7A 1WPBA 3APQA 2IW5A 4EB6B 4UUJC 3JARA 4KL1A 2EBOA 3KG2A 4B7KA 1HR0O 1EN6A 2Z3YA 1NKDA 4O4LA 2V1DA 2EIKC 2BTQA 3CE2A 3JASB 3IC9A 5IJ0B 2E3CA 1YSCA 3MD0A 4CZZA 4O4JA 4JF3A 3CS5A 5J2TA 4R7CA 4YJ3B 5EBWC 5KA5A 1QLEC 4JTCB 4ZKIA 1V9PA 2A0LA 2ZD9A 3WG7C 1ROPA 4BIZA 1K7DA 2GBOA 2D3OW 1L0LH 3L73H 3OAAG 4YJ2B 5B1AB 2ZNIA 1QLNA 1I94O 4I5SA 4DYLA 2W0XA 5IYZA 4FJCC 3APOA 1FXKB 4P30A 3JAMN 1XNRO 3E8GA 5CBHA 1I5YA 3CCEV 5CA0A 2BSKB 5IJ9B 4TV9A 2ATKC 2DYSB 4X1YB 1D5AA 1RPOA 4B3TB 3B4SA 1SERA 1TUEB 2XAFA 2CH7B 5L3FA 4XBFA 2PY5A 3L70H 2WLIA 3PJSK 2QA4V 1A32A 2DWEC 4D7TA 2A79B 3JARB 5LXTB 1WPXA 4I0XA 3CX5F 4DV1B 3ZMVA 4F4LA 3ZS8C 4ZHQB 3AK3A 2BOBC 4ZI7B 3OUFA 4NXMO 3ABKB 1XREA 3N2GB 1NR7A 4WBNA 1XI1A 1VQ4V 4QE9A 1LNQA 4JI5O 1AR5A 3ZMZA 1XDCA 2DW4A 3H01A 1XNQB 1Z5VA 5LA6A 3L9DA 2QWQB 4GCZA 2UXBO 4PELA 1FXKA 3ABLC 1THZA 3JCZA 1K5QA 3X2QC 5EIBC 3JCUZ 3CSXA 3E22A 3HR0A 3QTCA 2G38A 1G4YB 4HYOA 5D5QA 3HKEA 2CTRA 3SGIA 3QVNA 3CRAA 1GM8A 5B5EZ 1OCZB 1Q8IA 4YHHO 5LXTA 2VQEB 4LF6B 5LHGA 1AVMA 1HWYA 3J80N 1Y76B 4MW3A 2BOCC 1IXMA 1U97A 1FXKC 1IBLB 3A8TA 1XILA 4LF5B 4J10A 1SESA 1VF6A 2VS0A 4DR5O 3T1HB 2E5LB 3H1JH 3STZC 4YIOA 5FNVB 1BHBA 3AG2C 4FFKA 5BR8B 2OTJV 1B04A 2JIZG 1YI2V 3QNEA 1P7GA 3SJBC 5JCOA 4K0KO 5FL7G 1LUVA 4UCUA 3ASNB 3BABA 3VOUA 4X1KB 2X6BA 4JI4B 3SPIA 5LA6B 1NS1A 1PV0A 4TWKA 2EIMC 2W0FC 4CS2A 1QR9A 2P7TC 1JJOA 4ABMA 2H3OA 3K0DA 3I5DA 1FPOA 1BQZA 5LL6Y 3ETDA 4JI5B 3JD2A 5JCOC 2P5OA 3H9VA 5BMVA 4NTXA 1M56C 2F4VB 2R9AA 3Q4HB 4X20A 4UCTA 4PA3A 3CMAV 1NI8A 5JVDA 3A0BZ 3CCUV 2IH1C 2KQXA 3ABUA 4GKJB 1KBHA 3LUTB 1ZL8B 3HKDA 1IURA 2EINC 2RQ6A 1UPGA 3K57A 2P4KA 2VQEO 4Z1VA 4MTXA 2HG5C 2QE7G 4ASUG 3KKYA 3VBBA 1YTFB 1ZAUA 3K79A 3HKCA 4P9OA 3SYQA 2PZSA 4YY3B 4RAIA 2LO1A 3OR7C 3U0ZA 3I55V 3BHPA 1JCHA 1P4RA 5GTHZ 1SRYA 1K8AW 1UFIA 3G6EV 1WJZA 1H38A 1K97A 2IH3C 4R8CA 3FD9A 1N36B 1Q5OA 2DQ0A 4N23A 4O4HB 2UXBB 1BT8A 1SQVH 2EIMB 1XNRB 3OTFA 2YICA 4A5UB 3W7SA 3KCYA 2B1IA 3T4DA 4GYCB 1FFXA 4QNHB 1X59A 3CJHB 4U3FH 5DEDA 2YI8A 1AR1B 2Y4TA 2RCVA 4JAAA 1PNKA 1B6QA 1SA0A 3LNNA 1XMOO 1SZXA 4DR3O 1PPJH 3OM3B 4PI0A 3QO7A 3UQ8A 3K06A 1KECA 4NXMB 3K9AA 2UXCB 3L72H 1VP7A 4FLVA 4FLWA 3B09A 3S3XA 4CBCA 3OMNB 2LW7A 3P3NA 4X65O 1I5XA 3CEIA 1DLBA 1V54B 4GKJO 3FB8C 1GO3F 3FYEB 1VEWA 2Q67A 4LFCB 5IE9A 3DXRB 1Q6UA 2YUAA 4WFHA 2GDSA 4PI2A 5L3EA 5BXZA 1L1FA 1B06A 3QO5A 4MSWC 2L6LA 4KHPB 4I4TB 4ICGA 2XAJA 2A9HA 3X2QB 3ABLB 1ZX3A 2HHHB 1SA0B 3T1CA 2KG7B 4J9YB 4EEQA 4DV5O 2ZR2A 3LDCA 4J80A 4QGPA 3F5TA 4NTWA 1JPXA 1AI5A 2UUCB 4F6EA 3SPCA 1WAZA 3UO3A 3CCSV 4LFAO 4TV8A 1R3JC 3RGBA 1PD3A 3KCXA 4DV2O 2AHZA 3TGUH 2FYUH 4PA7A 4ZBMA 1VQOV 2FTKA 2EULA 5HFLA 5KHGA 4G2KA 3ZHUA 2LJ2A 3T1HO 2E5LO 5LGTA 3CCJV 3CCQV 4UV8A 1ZLZA 3CWBH 2F4VO 2EX3A 4KXRA 1GM9A 3OE7G 2KB1A 4MS2A 1R3IC 2RMKB 1NJIW 4UCVA 5GTIZ 2CGNA 2MK3A 2YIDA 3T4ZA 4N21A 4J42A 3MAQA 1Y67A 3MDSA 2QGNA 4JYAO 4H33A 4X89A 5LYJB 4DW1A 1IBKB 2QM8A 4FLYA 2D2CB 3CCVV 2HKOA 4RQFA 3FB6C 4X66B 2L35A 2PUSA 3K08A 4BWAA 4AQYB 3CC7V 2WLMA 1Y74A 4Z1MG 1VQNV 3S3WA 2YDEA 2EZPA 1BQ0A 4O4JB 5CN0A 5K1PA 2CK3G 2ZCEA 4JI7B 4WCEV 1AJNA 1MZFA 2IJJA 1TVKA 3JAWB 3UCSC 4LF8B 2EIKB 3ETGA 4PA9A 1H2LA 4XDKA 4TSFG 2W6IG 4WFEA 3F5WC 2X7RB 3ZCCA 2QKSA 4IT5A 1ZTEA 5KAFZ 2ZNJA 2FMLA 3J81N 1U96A 4DR6B 3HB3B 1I08A 2UUCO 3K5MA 3ZHVA 2HLDG 3VQXA 1GN4A 1YJWV 1BGYH 3AG3C 1XBLA 4J9ZB 2YC0A 3SDLA 2UXCO 3OMAB 4DV4O 4GLXA 5JQGA 3CD6V 2BTOA 3AEIA 1ORQC 5KUKA 3P30A 1E79G 2Y48A 5IY5B 2YEVA 1LR1A 4X8AA 2PTMA 4MTOA 5AG2A 4I9QA 2N04A 4CS4A 2XNDG 3HKBB 4FZ0A 4P2ZA 5EC1C 3W7TA 1F7YA 4DK0A 3ZX6A 3ZRSA 4DR1O 4YXWG 4OGQB 4B3RO 1JJ2U 2Q69A 2E75B 4ZOLA 1KB9F 3FFQA 5B3SB 1PNLA 1JFFA 2YSUB 3M99B 1SS3A 5LHIA 1WNSA 2WLIB 2HJDA 1HNWB 4DR4O 1TVKB 1KP2A 3JATA 1GAXA 4WFGA 1G8MA 3NR7A 4RO2A 2K9PA 4H13B 1N33O 4FM2A 1QBZA 4DUZO 3D36C 2BCCH 4X65B 1GN6A 2PF4E 5KAIZ 3CC2V 3L74H 4LF8O 4W4LA 4FLTA 2X0LA 1M5IA 2XAQA 2XASA 1Z5WA 3OGCC 2YXHA 1F51A 4HAMA 3CB2A 3UT5A 1VQ5V 1RFYA 1XHXA 1AP6A 4JYBA 5KHJA 5LP6A 3GVMA 1L0NH 2Z5UA 1MSWD 5KX5B 2JVDA 3JSLA 3CJHA 3QF7A 4XDLA 1NR1A 1IBKO 3JATB 1AILA 2NLJC 3LSSA 1YJNV 5JJEB 1JQ0A 3HKBA 1HNZO 3KZIZ 1NT2B 2GUZB 4HZ3A 2ZM6B 4LF4B 2NR5A 1S5HC 5J2UA 4TOIA 4P9PA 1JA8A 1COWG 4WFBV 3IAYA 3AK1A 5D5PA 1NZ6A 2ZE5A 4JI0B 2W6JG 2DYRB 4DR1B 1GM7A 3ASOB 3JSNA 3DXRA 2Q5ZA 1JOYA 1AB3A 2E76B 3WU2Z 3UO2A 5EYPA 1QVGU 3RYIB 1QNMA 5C8YA 3ABTA 5FPRA 4X20B 2DYRC 1R6NA 3BA8A 2F95B 4DR6O 4PA4A 3BCCH 1J95A 2Q4PA 1W0JG 2AZ0A 2ZDIA 4LC1A 4Q20A 2GUZA 1ZL8A 4RUFA 1N34O 3G67A 3RBZA 3ZJZA 1XUQA 5CA0B 2YXYA 2B9ZA 4JZ2A 1NTZH 2WLKA 1R6KA 4FPPA 3W7UA 1P7BA 2IBZH 2Q68A 3QO8A 3HKCB 1XMQB 5CA1B 2N74A 5KA6A 2EJ7A 3BPZA 3K04A 3K58A 2ZDIC 3HKDB 1VQPV 2DN9A 2ZXWB 3BVOA 3CPWU 2Q7EA 4LF9O 1TGOA 4MVOA 1XOUA 5CBFA 4L8JA 4GKKO 2OCHA 3DC5A 1TA8A 1UJWB 1N32O 4FM1A 2DMXA 3UKMA 1Y6XA 3FX7A 4WFFA 2XAHA 1H8HG 3ZBHA 3ETEA 1FFXB 1IBLO 3JYCA 3AK2A 2HVJC 1M57B 4DXWA 3JAKA 3I56V 2JS5A 2OTLV 4CC6A 4JI6B 4X1IB 3CRCA 5CA1A 1K4DC 1F4NA 3TCUA 1SKVA 3CHXA 2A3QA 4BIUA 3RFRA 3BEHA 3QG5A 4W4KA 1QCEA 1VQ7V 4K0KB 1NH2D 1BSMA 4YIPA 4JI8O 3RN4A 3TK1A 4JI4O 5IT9N 2LP7A 4R6ZA 3CYOA 1N34B 4U3JA 4NXNO 2WLHA 2XOKG 2JEUA 2LW1A 1N33B 1O9HA 2RNBA 2DE0X 4DV7B 2OYQA 1S3JA 1QQCA 4FM0A 3WB2A 1VQLV 3DGEA 4RQEA 2Q7HA 5KMGB 2Z0AA 5B66Z 5IDJA 3OGIB 5EIBD 4H37A 3BA9A 1FD9A 1XL4A 2ZE6A 3JD0A 2UXDB 5BMVB 1BHAA 3JAKB 3OEEG 2E74B 3Q4HA 1K33A 3VQVA 2JGDA 5H2FZ 4JTDB 1WA8A 4U3JB 2Q7GA 4JZGA 2ZXWC 2ZIOA 3IJ4A 4HBNA 4J7JA 1K5SA 4KP4A 1FS0G 4B3SB 2GTSA 3FB5C 4CS3A 2ARHA 2ITDC 4IIJA 3AG7A 1DTOA 1NTMH 3OD4A 3AG3B 1I94B 5LMNO 5LMUO 2JEXA 2ETNA 1K34A 2HVKC 1AI4A 4JI0O 3SJCC 5IYZB 2DWDC 1WP7A 2KSDA 2CGOA 4LF7B 2F23A 1OCOB 1KYOF 4JAUA 3SYPA 2EILB 2HHHO 1Q90D 5DECA 2ZT9B 5LP6B 2YIBA 2ZQMA 5B1AC 5LBQA 5IWAB 4PDLA 1MMMA 1VARA 2P22C 2RDCA 1WA8B 1YEWA 1T5EA 1D5NA 4I50B 5KHHA 5L3DA 1K73W 1G6UA 4MVMA 1Q81W 4JV5O 1S5JA 2JJ2G 3LDEA 2LGQA 4JGSA 3T1YO 3ICXA 3ASOC 3STLC 1KU9A 1K92A 4WBNB 5CB4B 2R9IA 2X6CA 2QWOB 2LFRA
chains in the Genus database with same CATH topology
1RP3B 1SC5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RP3 B;  1SC5 B; 
#chains in the Genus database with same CATH topology
 1YVW A;  4MT8 A;  3E8H A;  5IYB O;  2K1E A;  2N05 A;  1RSO B;  3ZMU A;  1SZT A;  1VQ6 V;  2QWP B;  5GW7 A;  1KC8 W;  2DJV A;  4IIJ B;  4JYA B;  1SQX H;  2ZIM A;  3W7X A;  3LNM B;  1YF2 A;  1YIJ V;  1ENV A;  4WF9 V;  3RYF A;  1V55 B;  4GX0 A;  1MZE A;  3W7W A;  1O9G A;  4LF9 B;  5EYP B;  3O65 A;  3RW0 A;  3RYI A;  5LOV B;  4BW9 A;  1PM9 A;  2F93 B;  3RWR D;  3M8A A;  1OCO C;  4LF5 O;  1S0V A;  5ITZ B;  2R9R B;  4QIW F;  4DO2 A;  4CC5 A;  4HNA A;  1P49 A;  2VRZ A;  4MTG A;  4LFA B;  4KFM A;  1DGS A;  1YZB A;  5J2T B;  1W2B U;  3HKE B;  4BR6 A;  3NXS A;  2ADP A;  1EFR G;  1SET A;  2MW2 B;  1M1K W;  4UCO A;  1GK9 A;  4BW5 A;  1AR4 A;  3JD1 A;  4JAV A;  1EM1 A;  3RT3 C;  4PDV A;  4O2B A;  1GMG A;  1YHQ V;  1GRJ A;  2IJK A;  4LNU A;  4J7K A;  3AG4 B;  2HJF C;  4BIO A;  2NN4 A;  4YJ2 A;  1OCR C;  1ZWI C;  2ILM A;  4FMT A;  3G6B A;  5DM6 V;  3ZRV A;  3AG1 C;  3E83 A;  3FAV B;  1MAB G;  2Q0A A;  2JK5 C;  4O4I A;  3OEH G;  1JFF B;  4LH7 A;  4R50 A;  4YHH B;  2A7W A;  2GSM B;  2JGU A;  2A06 H;  1M93 A;  4IHJ B;  3TJT A;  2CUG A;  5L3C A;  4MW8 A;  2Y69 C;  4B3S O;  5IJ9 A;  3R66 A;  2WPD G;  5FLX N;  3EVK A;  4J7Z A;  4GX2 A;  1CP9 A;  5FPO A;  4JAS A;  5LMN B;  4DW0 A;  3CP1 A;  5K1X A;  3ZN1 A;  3CXC U;  5BZB A;  4OX9 B;  2QSA A;  3K5L A;  1WP8 A;  3E8B A;  3ZHS A;  4X64 O;  2LGW A;  2F43 G;  2ZE8 A;  2GV9 A;  4B3M O;  1SQG A;  3K3W A;  3R65 A;  3DTU B;  4I0X B;  3BFR A;  2YIB D;  4ZHQ A;  5JVD B;  1FKA O;  4X62 O;  4ZI7 A;  4TT3 G;  5EBM C;  2HR3 A;  3N2G A;  2EJR A;  4DUZ B;  1RM1 B;  5EZY B;  2C2A A;  1N8R W;  5J2U B;  5C8Y B;  1VF5 B;  3CCR V;  2UU9 O;  5GON B;  4X88 A;  5EC2 C;  2QM7 A;  3E86 A;  4JTA B;  4F6R A;  4G28 B;  1SC5 B;  4Q6G A;  2QM4 A;  1QR8 A;  1S72 V;  3VQW A;  2EIJ C;  4IHJ A;  3BRC A;  1H2M A;  4RWU A;  3LSU A;  4UXN A;  1PNM A;  3A0R A;  1R6T A;  4FIP C;  1YIT V;  1XQ8 A;  1XHZ A;  1GTO A;  1VF7 A;  2QKC A;  1KUQ A;  4DR3 B;  2JJ1 G;  3SJQ C;  4J41 A;  2Y0I A;  2EIL C;  1SQB H;  5KHK A;  3C90 A;  3K0G A;  3JAL B;  3SYA A;  2Y0P A;  3FYI B;  3RYH B;  5C93 A;  1HNZ B;  1TAE A;  1XL6 A;  2WLJ A;  1H2S B;  2JS3 A;  3ZIA G;  1EZV H;  4YY3 O;  2YI9 A;  4X1K A;  1J5E B;  1VIB A;  4LH6 A;  3K5O A;  4MVS A;  2UUB B;  3B2E E;  1KMI Z;  3IGA C;  1NQT A;  2JDI G;  5B1B C;  1KKC A;  2P06 A;  2HFE C;  3H1L H;  2YIA A;  2NNU A;  4I55 A;  4NVP A;  3N27 A;  2FB5 A;  2Q8V A;  5IYC O;  2WAM A;  4JI2 O;  1E1R G;  3D3I A;  1BCC H;  1R73 A;  1OJH A;  4AI8 A;  3C3T A;  5EZY A;  5H5N A;  4PV1 B;  4OPA A;  4LR3 A;  1B3Q A;  3CRM A;  5J9P C;  3E89 A;  3CCM V;  2XHB A;  1M90 W;  1IDS A;  2EIJ B;  4DK1 A;  3RYH A;  1H2K A;  5KHI A;  1YJ9 V;  4NKG B;  3PN1 A;  1FXV A;  1RM1 C;  4UCR A;  4NTY A;  3MHS C;  1Y66 A;  2Q0O C;  4GZR B;  1X4T A;  3K03 A;  3OR6 C;  1EZJ A;  4O4L B;  1EN5 A;  2V7Q G;  2Q6A A;  3L75 H;  2OCC C;  2BTQ B;  3JAS A;  3WB1 A;  4I4T A;  3G71 V;  4DR2 B;  1N36 O;  2QTS A;  3H1I H;  1XMQ O;  1HR0 B;  1I7F A;  1RP3 B;  2Q73 A;  1YCI A;  1US6 A;  2HEP A;  4FK5 C;  1HW7 A;  1KKD A;  3B40 A;  4TQD A;  2IJH A;  5LYJ A;  2UXN A;  5EK0 A;  5CMU A;  4G27 B;  4UVC A;  1IBM O;  4LBE C;  3FKS G;  4I55 B;  2UUA B;  5LOV A;  3UM7 A;  3O9O A;  1N4C A;  5A9G A;  3RVY A;  4H44 B;  1FFT B;  2QKA A;  1VMG A;  2QJ1 A;  1N0N A;  4HNA B;  4DV7 O;  3B8M A;  2JGD B;  1CEZ A;  4O2A B;  5KUM A;  4X1Y A;  3N2K A;  1K3E A;  3OTO B;  2PYJ A;  4OX9 O;  5KMG A;  5HFM A;  4JI2 B;  2EZO A;  3EXA A;  5EBL C;  3AG1 B;  3JAW A;  1L8D A;  4DRX A;  3AG4 C;  4B3M B;  1BMF G;  1YTF D;  3P32 A;  4LNU B;  3L71 H;  4XDJ A;  4B3T O;  1Y74 B;  2UXD O;  5H6R A;  4E4E A;  2X6A A;  3CXH F;  4DV5 B;  1Y4M A;  5H6Q A;  4DV6 O;  3JD4 A;  4I7Z B;  1H2N A;  2PI5 A;  1RPR A;  2IJI A;  1D2D A;  2EIN B;  4GKK B;  2ZR3 A;  2OIG A;  3G4S V;  4DV4 B;  1YDX A;  3A2F A;  4UCS A;  2XAG A;  4K8Z A;  1XNQ O;  2IU3 A;  4PD4 F;  5LMU B;  3OT7 A;  4LWS A;  2XUM A;  4UB8 Z;  1DF4 A;  1PL0 A;  1W59 A;  4DR7 O;  4BAY A;  3ZN0 A;  3SPJ A;  1LUW A;  4MVU A;  1I0H A;  1Y76 A;  1ZSP A;  1TUB B;  1SQF A;  3B77 A;  3K9S A;  1V55 C;  4MTF A;  1NTK H;  3CME V;  2CE4 A;  2R72 A;  4L87 A;  4UVA A;  4X1I A;  2KKW A;  2ODM A;  2P4V A;  1HNW O;  4DR4 B;  5JQG B;  3GWK C;  3BY6 A;  3SPG A;  4YJ3 A;  4U7N A;  4ZIB A;  3ASN C;  4GUN A;  2CDY A;  3FB7 C;  2YEV B;  1Q82 W;  1MOF A;  2AZ2 A;  3DSQ A;  2CTP A;  1OZ0 A;  2OT5 A;  3EHB B;  2XT9 A;  3RYF B;  2JRI A;  2O57 A;  3A0H Z;  4LWS B;  5IJ0 A;  2PI4 A;  5CB4 A;  1MG1 A;  3WB0 A;  4DV2 B;  3MHH C;  5JWP A;  2Q9L A;  1HNX B;  2QTO A;  4UVB A;  5BR8 O;  2AW9 A;  4FZ1 A;  4QE7 A;  3CCL V;  3CRQ A;  3ZRX A;  4CH4 A;  5TIS Z;  4F6R B;  2LQT A;  3IC7 A;  3SYO A;  1PKX A;  4DV0 O;  3IFX A;  4IL6 Z;  2M6Y A;  4H0L B;  1EN4 A;  1V54 C;  1KQS U;  4TV9 B;  2GHY A;  1M56 B;  1AJP A;  3F7V C;  2IU0 A;  2CAZ C;  1M4U A;  5CA3 A;  5L3G A;  4IYH A;  3T1Y B;  2BE3 A;  1N0J A;  1BS3 A;  4U7O A;  4UV9 A;  4DV1 O;  4LF6 O;  4I9W A;  2VQF O;  3ZMS A;  2WLL A;  2P6J A;  1H2G A;  3UT5 B;  1QLE B;  3U10 A;  1CXZ B;  4AIL C;  2B5U A;  2OIE A;  4AQY O;  3WG7 B;  2WA3 A;  1JR9 A;  1HDJ A;  2PGG A;  1YXB A;  3H1H H;  4DR5 B;  1OCZ C;  1NBM G;  5E1A C;  3ZED A;  1IVS A;  4JI7 O;  1OCC C;  1OCR B;  3SJA C;  2XTA A;  5B3S C;  3ML0 A;  3OFN G;  4B3R B;  1JX9 A;  1WB7 A;  4UB6 Z;  2P90 A;  2GTA A;  4K8X A;  4LF7 O;  2CTW A;  2YXL A;  4GT1 A;  4OPH A;  2H8P C;  3SYC A;  5LHH A;  1MA1 A;  4EFE A;  4O4I B;  4PDR A;  5IWA O;  1IBM B;  1KP3 A;  3OMI B;  4TUY A;  3GB7 C;  5IY5 C;  2QWN B;  2WLL B;  4LP8 A;  1Q43 A;  2DQ3 A;  3K59 A;  4JV5 B;  1FYJ A;  2P67 A;  1H8E G;  4FLX A;  2ITC C;  4PDM A;  1QHT A;  1F23 A;  4AHC A;  4ZOL B;  1WN7 A;  2HP8 A;  1NH2 B;  2RJZ A;  1FXH A;  4EB6 A;  2QWR B;  5B1N A;  5JH7 A;  5FNV A;  1FJG B;  1MSD A;  5LGN A;  3ABM C;  2Y69 B;  4DV0 B;  5CBG A;  1AP5 A;  3K5N A;  4PHZ A;  4CH6 A;  3M7M X;  3EFF K;  4EKW A;  4MVZ A;  3CRR A;  2AGA A;  5GON A;  1XMO B;  4DV6 B;  4TUY B;  1ZUQ A;  4DV3 B;  2CTQ A;  4LFB B;  2R70 A;  3J7A U;  4DUY B;  1VQM V;  4PJ0 Z;  4IGG A;  2V4D A;  4JPR A;  1CPY A;  4WFA V;  1JVM A;  3DC6 A;  3ZMT A;  4JI3 B;  1AI6 A;  4IYI A;  3AG2 B;  1M57 C;  2ZM6 O;  1OV9 A;  4JI6 O;  1F4M A;  5JJJ B;  5KX5 A;  4GX5 A;  5JH7 B;  2FL4 A;  4JI1 B;  3ZRW A;  4NB5 A;  1WB8 A;  2M7W A;  1M9N A;  1ARO P;  4LFC O;  4DR7 B;  2KG7 A;  4TQF A;  4UFZ A;  1VQK V;  5L3B A;  4X64 B;  1GN2 A;  1GKF A;  1Z2G A;  3C3S A;  1FAF A;  2UXX A;  4DRX B;  5BY1 A;  1BZK A;  3SR2 C;  4TV8 B;  1HP8 A;  1JMK C;  3H1K H;  4LCU C;  5B1B B;  1DF5 A;  3LDD A;  1VF6 C;  5JJN B;  2QEX V;  1Q6I A;  4X62 B;  4O2B B;  3T2M A;  3JAL A;  1NU1 H;  4E2L A;  2QR4 A;  2AXT Z;  4J11 A;  1BL8 A;  2H94 A;  2IM9 A;  2WLN A;  4QPK A;  4FFB B;  3RVZ A;  4B7E A;  4FVM A;  1URF A;  1OHH G;  4K35 A;  3TXS A;  3FAV A;  3OW2 U;  1VQ8 V;  4QPJ A;  3ZRW B;  3ZHT A;  1J5E O;  1NVP D;  4B08 A;  1PP9 H;  1HNX O;  4LF4 O;  2QDO A;  4CH3 A;  2OCC B;  4FLU A;  1R3L C;  2LFS A;  5A2Q N;  1Q6H A;  1SF9 A;  2FKX A;  3THO A;  1S5L Z;  1GN3 A;  1Q3E A;  1KD1 W;  3E22 B;  1K9M W;  1DK1 A;  3B8N A;  1TUB A;  2DOS A;  2WSS G;  2OWO A;  1NVP B;  3E35 A;  2DYS C;  2AHY A;  2VWK A;  1Q7Y W;  1MNG A;  3TXQ A;  4JI3 O;  1N32 B;  4RUE A;  4FFB A;  1QU7 A;  3ABK C;  4KUM A;  4MVQ A;  3P3P A;  2VQF B;  3D36 A;  4O4H A;  1P84 F;  3D3Q A;  4D6T H;  1IZ3 A;  1S76 D;  2WA4 A;  1XEQ A;  1VQ9 V;  3BAA A;  5LGU A;  4K3A A;  2F1M A;  5KLV H;  5LP6 C;  5IYD O;  2UU9 B;  2ADQ B;  1FJG O;  2B1G A;  4NYK A;  3ZHR A;  4KHP O;  2YS8 A;  4C7U A;  3JD3 A;  2Y4U A;  1IXB A;  4GX1 A;  1OCC B;  3ZHQ A;  5DN6 G;  1R1B A;  3ETQ A;  3N2K B;  3CC4 V;  4I50 A;  4DV3 O;  5B1O A;  4X9Q A;  2PYL A;  2UUA O;  3F7Y C;  1SQQ H;  3RYC A;  2VWJ A;  1K4C C;  4DR2 O;  4MVR A;  1BE3 H;  4FLZ A;  5H9C A;  1QVF U;  4Z2W A;  2RN9 A;  2UUB O;  3VQY A;  1PL4 A;  4JI1 O;  4EFB A;  4O2A A;  4PA6 A;  1AJQ A;  2ZKO A;  1RSO A;  3OTO O;  4QJF B;  1GH6 A;  4D7S A;  1S77 D;  5E79 Z;  3ABM B;  1G1X B;  4JYY A;  3D8C A;  1R3K C;  4OXS A;  3E8F A;  4LFB O;  3HPL C;  1IX9 A;  2ZE7 A;  3U11 A;  4DUY O;  2ZIN A;  4X66 O;  3G80 A;  3TET A;  1W0K G;  3GWO A;  3WFV A;  1AI7 A;  3SPH A;  2WWW A;  4JI8 B;  1Q86 W;  4NR1 A;  5F2V O;  3RYC B;  5ITZ A;  3E2E A;  3OUS A;  4NXN B;  4JYC A;  3LSQ A;  4CH5 A;  1E1Q G;  1EBO A;  2BSK A;  1WLE A;  1SQP H;  2F66 C;  2CH7 A;  1WPB A;  3APQ A;  2IW5 A;  4EB6 B;  4UUJ C;  3JAR A;  4KL1 A;  2EBO A;  3KG2 A;  4B7K A;  1HR0 O;  1EN6 A;  2Z3Y A;  1NKD A;  4O4L A;  2V1D A;  2EIK C;  2BTQ A;  3CE2 A;  3JAS B;  3IC9 A;  5IJ0 B;  2E3C A;  1YSC A;  3MD0 A;  4CZZ A;  4O4J A;  4JF3 A;  3CS5 A;  5J2T A;  4R7C A;  4YJ3 B;  5EBW C;  5KA5 A;  1QLE C;  4JTC B;  4ZKI A;  1V9P A;  2A0L A;  2ZD9 A;  3WG7 C;  1ROP A;  4BIZ A;  1K7D A;  2GBO A;  2D3O W;  1L0L H;  3L73 H;  3OAA G;  4YJ2 B;  5B1A B;  2ZNI A;  1QLN A;  1I94 O;  4I5S A;  4DYL A;  2W0X A;  5IYZ A;  4FJC C;  3APO A;  1FXK B;  4P30 A;  3JAM N;  1XNR O;  3E8G A;  5CBH A;  1I5Y A;  3CCE V;  5CA0 A;  2BSK B;  5IJ9 B;  4TV9 A;  2ATK C;  2DYS B;  4X1Y B;  1D5A A;  1RPO A;  4B3T B;  3B4S A;  1SER A;  1TUE B;  2XAF A;  2CH7 B;  5L3F A;  4XBF A;  2PY5 A;  3L70 H;  2WLI A;  3PJS K;  2QA4 V;  1A32 A;  2DWE C;  4D7T A;  2A79 B;  3JAR B;  5LXT B;  1WPX A;  4I0X A;  3CX5 F;  4DV1 B;  3ZMV A;  4F4L A;  3ZS8 C;  4ZHQ B;  3AK3 A;  2BOB C;  4ZI7 B;  3OUF A;  4NXM O;  3ABK B;  1XRE A;  3N2G B;  1NR7 A;  4WBN A;  1XI1 A;  1VQ4 V;  4QE9 A;  1LNQ A;  4JI5 O;  1AR5 A;  3ZMZ A;  1XDC A;  2DW4 A;  3H01 A;  1XNQ B;  1Z5V A;  5LA6 A;  3L9D A;  2QWQ B;  4GCZ A;  2UXB O;  4PEL A;  1FXK A;  3ABL C;  1THZ A;  3JCZ A;  1K5Q A;  3X2Q C;  5EIB C;  3JCU Z;  3CSX A;  3E22 A;  3HR0 A;  3QTC A;  2G38 A;  1G4Y B;  4HYO A;  5D5Q A;  3HKE A;  2CTR A;  3SGI A;  3QVN A;  3CRA A;  1GM8 A;  5B5E Z;  1OCZ B;  1Q8I A;  4YHH O;  5LXT A;  2VQE B;  4LF6 B;  5LHG A;  1AVM A;  1HWY A;  3J80 N;  1Y76 B;  4MW3 A;  2BOC C;  1IXM A;  1U97 A;  1FXK C;  1IBL B;  3A8T A;  1XIL A;  4LF5 B;  4J10 A;  1SES A;  1VF6 A;  2VS0 A;  4DR5 O;  3T1H B;  2E5L B;  3H1J H;  3STZ C;  4YIO A;  5FNV B;  1BHB A;  3AG2 C;  4FFK A;  5BR8 B;  2OTJ V;  1B04 A;  2JIZ G;  1YI2 V;  3QNE A;  1P7G A;  3SJB C;  5JCO A;  4K0K O;  5FL7 G;  1LUV A;  4UCU A;  3ASN B;  3BAB A;  3VOU A;  4X1K B;  2X6B A;  4JI4 B;  3SPI A;  5LA6 B;  1NS1 A;  1PV0 A;  4TWK A;  2EIM C;  2W0F C;  4CS2 A;  1QR9 A;  2P7T C;  1JJO A;  4ABM A;  2H3O A;  3K0D A;  3I5D A;  1FPO A;  1BQZ A;  5LL6 Y;  3ETD A;  4JI5 B;  3JD2 A;  5JCO C;  2P5O A;  3H9V A;  5BMV A;  4NTX A;  1M56 C;  2F4V B;  2R9A A;  3Q4H B;  4X20 A;  4UCT A;  4PA3 A;  3CMA V;  1NI8 A;  5JVD A;  3A0B Z;  3CCU V;  2IH1 C;  2KQX A;  3ABU A;  4GKJ B;  1KBH A;  3LUT B;  1ZL8 B;  3HKD A;  1IUR A;  2EIN C;  2RQ6 A;  1UPG A;  3K57 A;  2P4K A;  2VQE O;  4Z1V A;  4MTX A;  2HG5 C;  2QE7 G;  4ASU G;  3KKY A;  3VBB A;  1YTF B;  1ZAU A;  3K79 A;  3HKC A;  4P9O A;  3SYQ A;  2PZS A;  4YY3 B;  4RAI A;  2LO1 A;  3OR7 C;  3U0Z A;  3I55 V;  3BHP A;  1JCH A;  1P4R A;  5GTH Z;  1SRY A;  1K8A W;  1UFI A;  3G6E V;  1WJZ A;  1H38 A;  1K97 A;  2IH3 C;  4R8C A;  3FD9 A;  1N36 B;  1Q5O A;  2DQ0 A;  4N23 A;  4O4H B;  2UXB B;  1BT8 A;  1SQV H;  2EIM B;  1XNR B;  3OTF A;  2YIC A;  4A5U B;  3W7S A;  3KCY A;  2B1I A;  3T4D A;  4GYC B;  1FFX A;  4QNH B;  1X59 A;  3CJH B;  4U3F H;  5DED A;  2YI8 A;  1AR1 B;  2Y4T A;  2RCV A;  4JAA A;  1PNK A;  1B6Q A;  1SA0 A;  3LNN A;  1XMO O;  1SZX A;  4DR3 O;  1PPJ H;  3OM3 B;  4PI0 A;  3QO7 A;  3UQ8 A;  3K06 A;  1KEC A;  4NXM B;  3K9A A;  2UXC B;  3L72 H;  1VP7 A;  4FLV A;  4FLW A;  3B09 A;  3S3X A;  4CBC A;  3OMN B;  2LW7 A;  3P3N A;  4X65 O;  1I5X A;  3CEI A;  1DLB A;  1V54 B;  4GKJ O;  3FB8 C;  1GO3 F;  3FYE B;  1VEW A;  2Q67 A;  4LFC B;  5IE9 A;  3DXR B;  1Q6U A;  2YUA A;  4WFH A;  2GDS A;  4PI2 A;  5L3E A;  5BXZ A;  1L1F A;  1B06 A;  3QO5 A;  4MSW C;  2L6L A;  4KHP B;  4I4T B;  4ICG A;  2XAJ A;  2A9H A;  3X2Q B;  3ABL B;  1ZX3 A;  2HHH B;  1SA0 B;  3T1C A;  2KG7 B;  4J9Y B;  4EEQ A;  4DV5 O;  2ZR2 A;  3LDC A;  4J80 A;  4QGP A;  3F5T A;  4NTW A;  1JPX A;  1AI5 A;  2UUC B;  4F6E A;  3SPC A;  1WAZ A;  3UO3 A;  3CCS V;  4LFA O;  4TV8 A;  1R3J C;  3RGB A;  1PD3 A;  3KCX A;  4DV2 O;  2AHZ A;  3TGU H;  2FYU H;  4PA7 A;  4ZBM A;  1VQO V;  2FTK A;  2EUL A;  5HFL A;  5KHG A;  4G2K A;  3ZHU A;  2LJ2 A;  3T1H O;  2E5L O;  5LGT A;  3CCJ V;  3CCQ V;  4UV8 A;  1ZLZ A;  3CWB H;  2F4V O;  2EX3 A;  4KXR A;  1GM9 A;  3OE7 G;  2KB1 A;  4MS2 A;  1R3I C;  2RMK B;  1NJI W;  4UCV A;  5GTI Z;  2CGN A;  2MK3 A;  2YID A;  3T4Z A;  4N21 A;  4J42 A;  3MAQ A;  1Y67 A;  3MDS A;  2QGN A;  4JYA O;  4H33 A;  4X89 A;  5LYJ B;  4DW1 A;  1IBK B;  2QM8 A;  4FLY A;  2D2C B;  3CCV V;  2HKO A;  4RQF A;  3FB6 C;  4X66 B;  2L35 A;  2PUS A;  3K08 A;  4BWA A;  4AQY B;  3CC7 V;  2WLM A;  1Y74 A;  4Z1M G;  1VQN V;  3S3W A;  2YDE A;  2EZP A;  1BQ0 A;  4O4J B;  5CN0 A;  5K1P A;  2CK3 G;  2ZCE A;  4JI7 B;  4WCE V;  1AJN A;  1MZF A;  2IJJ A;  1TVK A;  3JAW B;  3UCS C;  4LF8 B;  2EIK B;  3ETG A;  4PA9 A;  1H2L A;  4XDK A;  4TSF G;  2W6I G;  4WFE A;  3F5W C;  2X7R B;  3ZCC A;  2QKS A;  4IT5 A;  1ZTE A;  5KAF Z;  2ZNJ A;  2FML A;  3J81 N;  1U96 A;  4DR6 B;  3HB3 B;  1I08 A;  2UUC O;  3K5M A;  3ZHV A;  2HLD G;  3VQX A;  1GN4 A;  1YJW V;  1BGY H;  3AG3 C;  1XBL A;  4J9Z B;  2YC0 A;  3SDL A;  2UXC O;  3OMA B;  4DV4 O;  4GLX A;  5JQG A;  3CD6 V;  2BTO A;  3AEI A;  1ORQ C;  5KUK A;  3P30 A;  1E79 G;  2Y48 A;  5IY5 B;  2YEV A;  1LR1 A;  4X8A A;  2PTM A;  4MTO A;  5AG2 A;  4I9Q A;  2N04 A;  4CS4 A;  2XND G;  3HKB B;  4FZ0 A;  4P2Z A;  5EC1 C;  3W7T A;  1F7Y A;  4DK0 A;  3ZX6 A;  3ZRS A;  4DR1 O;  4YXW G;  4OGQ B;  4B3R O;  1JJ2 U;  2Q69 A;  2E75 B;  4ZOL A;  1KB9 F;  3FFQ A;  5B3S B;  1PNL A;  1JFF A;  2YSU B;  3M99 B;  1SS3 A;  5LHI A;  1WNS A;  2WLI B;  2HJD A;  1HNW B;  4DR4 O;  1TVK B;  1KP2 A;  3JAT A;  1GAX A;  4WFG A;  1G8M A;  3NR7 A;  4RO2 A;  2K9P A;  4H13 B;  1N33 O;  4FM2 A;  1QBZ A;  4DUZ O;  3D36 C;  2BCC H;  4X65 B;  1GN6 A;  2PF4 E;  5KAI Z;  3CC2 V;  3L74 H;  4LF8 O;  4W4L A;  4FLT A;  2X0L A;  1M5I A;  2XAQ A;  2XAS A;  1Z5W A;  3OGC C;  2YXH A;  1F51 A;  4HAM A;  3CB2 A;  3UT5 A;  1VQ5 V;  1RFY A;  1XHX A;  1AP6 A;  4JYB A;  5KHJ A;  5LP6 A;  3GVM A;  1L0N H;  2Z5U A;  1MSW D;  5KX5 B;  2JVD A;  3JSL A;  3CJH A;  3QF7 A;  4XDL A;  1NR1 A;  1IBK O;  3JAT B;  1AIL A;  2NLJ C;  3LSS A;  1YJN V;  5JJE B;  1JQ0 A;  3HKB A;  1HNZ O;  3KZI Z;  1NT2 B;  2GUZ B;  4HZ3 A;  2ZM6 B;  4LF4 B;  2NR5 A;  1S5H C;  5J2U A;  4TOI A;  4P9P A;  1JA8 A;  1COW G;  4WFB V;  3IAY A;  3AK1 A;  5D5P A;  1NZ6 A;  2ZE5 A;  4JI0 B;  2W6J G;  2DYR B;  4DR1 B;  1GM7 A;  3ASO B;  3JSN A;  3DXR A;  2Q5Z A;  1JOY A;  1AB3 A;  2E76 B;  3WU2 Z;  3UO2 A;  5EYP A;  1QVG U;  3RYI B;  1QNM A;  5C8Y A;  3ABT A;  5FPR A;  4X20 B;  2DYR C;  1R6N A;  3BA8 A;  2F95 B;  4DR6 O;  4PA4 A;  3BCC H;  1J95 A;  2Q4P A;  1W0J G;  2AZ0 A;  2ZDI A;  4LC1 A;  4Q20 A;  2GUZ A;  1ZL8 A;  4RUF A;  1N34 O;  3G67 A;  3RBZ A;  3ZJZ A;  1XUQ A;  5CA0 B;  2YXY A;  2B9Z A;  4JZ2 A;  1NTZ H;  2WLK A;  1R6K A;  4FPP A;  3W7U A;  1P7B A;  2IBZ H;  2Q68 A;  3QO8 A;  3HKC B;  1XMQ B;  5CA1 B;  2N74 A;  5KA6 A;  2EJ7 A;  3BPZ A;  3K04 A;  3K58 A;  2ZDI C;  3HKD B;  1VQP V;  2DN9 A;  2ZXW B;  3BVO A;  3CPW U;  2Q7E A;  4LF9 O;  1TGO A;  4MVO A;  1XOU A;  5CBF A;  4L8J A;  4GKK O;  2OCH A;  3DC5 A;  1TA8 A;  1UJW B;  1N32 O;  4FM1 A;  2DMX A;  3UKM A;  1Y6X A;  3FX7 A;  4WFF A;  2XAH A;  1H8H G;  3ZBH A;  3ETE A;  1FFX B;  1IBL O;  3JYC A;  3AK2 A;  2HVJ C;  1M57 B;  4DXW A;  3JAK A;  3I56 V;  2JS5 A;  2OTL V;  4CC6 A;  4JI6 B;  4X1I B;  3CRC A;  5CA1 A;  1K4D C;  1F4N A;  3TCU A;  1SKV A;  3CHX A;  2A3Q A;  4BIU A;  3RFR A;  3BEH A;  3QG5 A;  4W4K A;  1QCE A;  1VQ7 V;  4K0K B;  1NH2 D;  1BSM A;  4YIP A;  4JI8 O;  3RN4 A;  3TK1 A;  4JI4 O;  5IT9 N;  2LP7 A;  4R6Z A;  3CYO A;  1N34 B;  4U3J A;  4NXN O;  2WLH A;  2XOK G;  2JEU A;  2LW1 A;  1N33 B;  1O9H A;  2RNB A;  2DE0 X;  4DV7 B;  2OYQ A;  1S3J A;  1QQC A;  4FM0 A;  3WB2 A;  1VQL V;  3DGE A;  4RQE A;  2Q7H A;  5KMG B;  2Z0A A;  5B66 Z;  5IDJ A;  3OGI B;  5EIB D;  4H37 A;  3BA9 A;  1FD9 A;  1XL4 A;  2ZE6 A;  3JD0 A;  2UXD B;  5BMV B;  1BHA A;  3JAK B;  3OEE G;  2E74 B;  3Q4H A;  1K33 A;  3VQV A;  2JGD A;  5H2F Z;  4JTD B;  1WA8 A;  4U3J B;  2Q7G A;  4JZG A;  2ZXW C;  2ZIO A;  3IJ4 A;  4HBN A;  4J7J A;  1K5S A;  4KP4 A;  1FS0 G;  4B3S B;  2GTS A;  3FB5 C;  4CS3 A;  2ARH A;  2ITD C;  4IIJ A;  3AG7 A;  1DTO A;  1NTM H;  3OD4 A;  3AG3 B;  1I94 B;  5LMN O;  5LMU O;  2JEX A;  2ETN A;  1K34 A;  2HVK C;  1AI4 A;  4JI0 O;  3SJC C;  5IYZ B;  2DWD C;  1WP7 A;  2KSD A;  2CGO A;  4LF7 B;  2F23 A;  1OCO B;  1KYO F;  4JAU A;  3SYP A;  2EIL B;  2HHH O;  1Q90 D;  5DEC A;  2ZT9 B;  5LP6 B;  2YIB A;  2ZQM A;  5B1A C;  5LBQ A;  5IWA B;  4PDL A;  1MMM A;  1VAR A;  2P22 C;  2RDC A;  1WA8 B;  1YEW A;  1T5E A;  1D5N A;  4I50 B;  5KHH A;  5L3D A;  1K73 W;  1G6U A;  4MVM A;  1Q81 W;  4JV5 O;  1S5J A;  2JJ2 G;  3LDE A;  2LGQ A;  4JGS A;  3T1Y O;  3ICX A;  3ASO C;  3STL C;  1KU9 A;  1K92 A;  4WBN B;  5CB4 B;  2R9I A;  2X6C A;  2QWO B;  2LFR A; 
#chains in the Genus database with same CATH homology
 1RP3 B;  1SC5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...