1RP3B

Cocrystal structure of the flagellar sigma/anti-sigma complex, sigma-28/flgm
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
77
Chain Sequence
VNRIELSRLIGLLLETSGTNKIEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEFFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor SIGMA-28 (FliA)
publication title Crystal Structure of the Flagellar Sigma/Anti-Sigma Complex Sigma(28)/FlgM Reveals an Intact Sigma Factor in an Inactive Conformation
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 23
structure length 77
sequence length 87
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04316 FlgM Anti-sigma-28 factor, FlgM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1160 Mainly Alpha Orthogonal Bundle Helix Hairpins Anti-sigma-28 factor FlgM 1rp3B02
1RP3B 1SC5B
chains in the Genus database with same CATH superfamily
4JI8O 3G6BA 1QVFU 1FFXA 2B9ZA 3T1HB 3OR6C 4IHJA 3CCUV 3VQWA 3AK2A 2UXBO 3AG7A 1E1RG 1XNQB 3J7AU 5FNVA 1WA8A 2ARHA 4JGSA 2UXCO 2IJJA 5JCOA 2A06H 2A7WA 1QR8A 5EZYB 4QJFB 4MVOA 2XAHA 4FFKA 3SJAC 3O9OA 2XAGA 2DQ3A 2DN9A 1HNZO 2OIGA 3SPHA 1WNSA 4MS2A 5GONA 4RQEA 2VWKA 3D36A 2HHHB 2ZNIA 1M56B 4DUYB 4OXSA 5EIBC 4DUZB 1OHHG 1TVKB 4X20B 1JJ2U 5J2UB 1WP7A 2E5LB 3OTOO 3CRRA 3ZRWB 4RUEA 5LMUB 1RP3B 4O4IB 4ZOLA 1ZTEA 3QO8A 4DV0O 3ZHUA 5C8YA 1BZKA 2RDCA 4D7TA 2OIEA 2Y0PA 4PELA 4WFEA 2ZR3A 1AVMA 3ZHRA 1QLEB 1LR1A 4U3JB 3ZHSA 1GM8A 1S5LZ 2Y69C 3E22B 4N21A 4AQYB 2CE4A 1AJNA 4YJ3A 2JGUA 3W7WA 1N32O 1Y76B 1BL8A 4WFAV 4O2BB 3RWRD 1XNRB 2QTSA 1BCCH 2YEVA 3SYPA 1PM9A 3OEHG 4LR3A 1NTZH 1Y67A 1R3IC 2P4VA 1K7DA 2EBOA 2JS5A 1QVGU 3LSQA 2F1MA 2M6YA 3FAVB 4FLZA 3QNEA 5LXTB 5GW7A 4EB6B 3LNNA 1M5IA 4ICGA 3WFVA 2H94A 3N27A 3E35A 4JI0O 4EFBA 4Z1MG 5B66Z 5GTIZ 5LHIA 4GKJB 4O4HA 4I4TA 5L3EA 3SPJA 3JSLA 2EILC 3P30A 4JI1O 4J42A 5ITZB 2OYQA 5KA5A 2Q0AA 3CS5A 1AILA 4J9ZB 4DV7B 5EBWC 4YY3B 5D5PA 4WF9V 5L3FA 3Q4HA 4HBNA 1W59A 2IW5A 1Y4MA 1EFRG 4QE9A 3W7UA 3OD4A 1CXZB 1IBMB 4K0KB 4D6TH 1IBLO 1FXKA 1GTOA 3EHBB 1LUVA 3ZMZA 3ABLC 3RYHA 3ZN1A 4DRXA 1N0NA 2R9AA 5CMUA 3E83A 3JAKB 1SA0B 1SQGA 2CTQA 2NN4A 2ITDC 3IFXA 2PYJA 4LFBB 4GKKO 4XDJA 1R3KC 3SYCA 4LF6O 2XOKG 3E89A 4R6ZA 3FYEB 1B06A 5DN6G 2YI8A 1KU9A 4I0XA 1JOYA 4Q20A 2V7QG 3SJBC 3E2EA 1K8AW 4ZIBA 3WG7B 4DV5O 1VEWA 5LHGA 4KHPO 4BIUA 4HYOA 4X62B 1GN2A 1PNMA 3TETA 3W7TA 5B1NA 3HKDA 2ZIOA 4CC6A 1YSCA 3JARA 3FD9A 3JD0A 3C90A 1N36B 1BQ0A 4XDKA 1HNWO 1PL4A 1SQQH 2QWRB 4I7ZB 2ZIMA 5LGNA 4J10A 3OT7A 2ETNA 2LW7A 1AI7A 3ZMVA 4FFBA 1VQNV 3B2EE 4LF8B 2DJVA 4LF5O 2HJDA 3H1IH 4U7NA 2EJ7A 3RYFA 3FB6C 4J9YB 2X0LA 3LUTB 1J5EB 3JAMN 2ZR2A 2QEXV 2ZE7A 2LFRA 2CUGA 1KUQA 4PA3A 5EYPB 2QSAA 3FB7C 1BS3A 2WLLA 1Q5OA 2K9PA 4J80A 5L3GA 5IYCO 2CTRA 1OCZB 2IBZH 2BOBC 4MTOA 2WLMA 1YZBA 3RVZA 2X6BA 3CRQA 5JJEB 4DR3B 5LYJA 4MT8A 5JVDA 4CH4A 4IIJB 2N04A 4ZBMA 2HG5C 4X66O 2GUZB 1JFFB 2CGNA 4JYAO 2C2AA 2CAZC 1IURA 2AW9A 2CTPA 2HLDG 2AZ2A 3T1HO 1AP5A 4U3FH 2VQEB 4BW9A 5DEDA 1ZLZA 1XNQO 4WFFA 4I9QA 4F6RB 1URFA 3AG2B 2IH3C 1KD1W 2YIBD 3K03A 4U7OA 4FMTA 5JQGB 2EIJC 2QE7G 4DV2O 3JATA 1M57B 3B8MA 5IWAO 1V55C 5JWPA 4TV9A 2ZQMA 1PP9H 5FPOA 1QLNA 1ZAUA 3KZIZ 4NR1A 1SZXA 3E8GA 1ZWIC 1F51A 2HHHO 2Q4PA 3L9DA 4DUYO 4DUZO 2VQFB 4BR6A 4MW3A 5KMGB 4JI5O 1KB9F 2JGDA 2HJFC 5JJJB 1US6A 2ZINA 1B3QA 4GT1A 2E5LO 2YIBA 1IXMA 4HAMA 2VS0A 5LMUO 3G67A 1J95A 4QE7A 2EINB 1QNMA 2WA4A 3OE7G 2R70A 3B8NA 5JJNB 4P30A 3CCEV 1KBHA 5IYDO 4CS2A 4MVMA 1HDJA 2JJ1G 3BA9A 4AQYO 4KL1A 3H9VA 2LO1A 2UUCB 1H2NA 4GX1A 4GLXA 2ZCEA 4MVQA 2Q68A 1Q90D 3CX5F 1T5EA 1S5HC 1W0KG 5A2QN 1XNRO 4QNHB 3RYIA 3ZIAG 4GX2A 5HFMA 1GK9A 1FS0G 3ABKC 2UUBO 2GV9A 4FLTA 4FIPC 2DWDC 1D2DA 2N74A 4UVBA 4G2KA 2HP8A 2WSSG 2PUSA 2UU9O 2D3OW 2E75B 5A9GA 3QO5A 5LP6C 3BCCH 3OM3B 1OCCC 1N8RW 1GO3F 2A3QA 4GCZA 4OGQB 4TT3G 1E79G 2JIZG 1EN5A 1I94B 1S5JA 1O9GA 2CGOA 1ZL8A 4DV4B 2F23A 4G27B 4B7EA 1SQBH 5LHHA 2W6JG 1A32A 1W2BU 3CD6V 3CE2A 3B09A 3H01A 5IJ0B 4DV1B 1DK1A 1K5QA 4DW1A 1YVWA 1XHXA 4AILC 2GTSA 2QWPB 4H0LB 4JI7O 3CCLV 1YIJV 3R65A 4YY3O 3LSUA 1FXVA 3ASOC 2QWNB 4O2AB 4B7KA 2LGWA 1GMGA 4UVAA 2FMLA 3EFFK 1OCZC 4H44B 2AZ0A 2Q9LA 3BA8A 5KX5A 3VQVA 4QPKA 1IBMO 3CMAV 3ETGA 4K0KO 3JD1A 1K73W 2P67A 1DTOA 3ZMUA 2BCCH 2EZPA 2PTMA 4MVRA 1MZEA 1R73A 1WB7A 1MMMA 5GONB 1OCOC 4GX0A 2A79B 2P4KA 3JD2A 5B3SC 1VP7A 4EFEA 3CHXA 4DV3B 2Y69B 2X7RB 2JEUA 3CCVV 3JAWA 3B40A 4Z2WA 2VWJA 2Q5ZA 1AR4A 4MTGA 4FLXA 2F4VB 3H1HH 4WFGA 1X4TA 1PNKA 1SQXH 5IYZB 2H8PC 4UXNA 4JI4B 4X8AA 5KAFZ 4X89A 4GZRB 4ZI7B 1OV9A 5L3CA 4PD4F 2OWOA 4X62O 2BTQB 3K5MA 1JVMA 4YJ3B 3H1LH 1AI5A 1NH2D 2YXLA 4PDRA 3P3PA 2LJ2A 2NNUA 1L1FA 2MK3A 2OCCB 2YIAA 2YEVB 1N36O 4X1KA 3FB5C 1SZTA 3K0GA 2IJHA 3I56V 4NKGB 1ZX3A 4LWSB 5LA6B 2QKSA 5H6QA 4NTYA 5FLXN 2P5OA 4DW0A 1Q81W 4PV1B 1QU7A 1Y74A 2XAQA 2JJ2G 5KLVH 2OTLV 3ETQA 4LH7A 5KHJA 1Z2GA 4TQDA 3RVYA 2RMKB 3LDEA 3HKEA 3ZRXA 1WAZA 3AK1A 1VQ5V 3IGAC 3RGBA 1AR1B 3N2GA 2BTOA 1QHTA 1KQSU 3JALA 2YXYA 2E74B 3BFRA 3ABLB 1VQ9V 4Z1VA 2QKCA 3M8AA 3UO3A 1M90W 1KKCA 1VQ7V 2YUAA 4FVMA 3WB0A 3ETEA 1M93A 1UPGA 4H13B 3ZX6A 5IJ9A 4X65B 1NI8A 3RYHB 4DRXB 2EIKC 2UXDB 2UXNA 3JD4A 1NTKH 5LOVA 2VQEO 3JASB 5B1AC 5KA6A 4DR1B 2QM7A 1MZFA 1NBMG 1UJWB 2ZNJA 4FZ0A 1WPXA 1N34B 2GSMB 2Q8VA 4F6EA 1TUEB 2ILMA 5JCOC 1SQVH 3T1YB 1I0HA 2QA4V 4DR2B 1JPXA 3QTCA 5CA1A 5BXZA 5CBFA 1NVPD 2P22C 4FK5C 3CRCA 2R9RB 4MW8A 3D36C 1KYOF 2LW1A 3SR2C 4NB5A 1SRYA 2VQFO 4LF4B 5IT9N 2KKWA 2Q7EA 1QCEA 3LDDA 4UV8A 4PA9A 1KKDA 4UCUA 4UCVA 2MW2B 4O4JA 1BQZA 4NXMB 3EVKA 4DR7B 4ZHQB 3DGEA 3K3WA 1FD9A 2W0FC 1YEWA 2L6LA 1FFTB 3HPLC 2RN9A 4OPAA 4KFMA 4PHZA 2UUCO 3EXAA 3ZRVA 4JV5B 2ZE8A 4UCOA 3RYFB 1RFYA 2DQ0A 4EEQA 3CCRV 1XUQA 2OCCC 3K5NA 4TSFG 4X64B 4JPRA 3TXSA 5L3DA 3F7YC 1XL4A 4DK0A 1YTFD 4J7KA 2WWWA 1XMOB 3ZN0A 3JYCA 1K3EA 5IDJA 4J7ZA 3UKMA 4E2LA 4LF7B 1ZSPA 1Q7YW 2AHZA 1I94O 5EC1C 3DC5A 5H6RA 4PDMA 1FAFA 4I50A 2DYRC 4DV4O 1BSMA 2QDOA 4YHHO 1RSOB 2QR4A 2BSKB 4YJ2B 4JI6B 4DV1O 2ZE5A 4RWUA 1HR0B 2EIJB 2PF4E 1H8HG 4TWKA 1V55B 4NXNB 5JH7B 3N2KB 4PDVA 3A8TA 3APQA 2XHBA 1FKAO 1GM7A 1XEQA 2LFSA 4P2ZA 4BIOA 3KCXA 2P6JA 4JTDB 1H2GA 3JATB 4DR6O 1GH6A 4X88A 2F95B 5LGTA 3THOA 1FXKC 3SPGA 1HP8A 5BMVB 1F7YA 1SS3A 5EZYA 4CH5A 3OW2U 5H2FZ 3KCYA 4O4LB 4JZGA 1HNXB 4J41A 3QF7A 3LSSA 4UB8Z 4F4LA 2ZM6B 2F4VO 4FLWA 1WPBA 2E3CA 4LNUA 4JI4O 1XOUA 1DF4A 5FL7G 3NXSA 3ZMTA 3ABKB 1IZ3A 2QM8A 1TVKA 5LMNB 3SGIA 5L3BA 2A0LA 5J2UA 3ZRWA 4KUMA 1KP3A 4LFCB 3HR0A 4O4IA 5LP6B 1OCCB 1WJZA 3CJHA 2UXXA 4HZ3A 4IYHA 3OMIB 3HKCB 3RYCB 4WFHA 3B4SA 3MD0A 2DYSB 3E22A 4D7SA 4P9PA 2JRIA 3CSXA 3UT5A 1VIBA 4UCRA 1XDCA 4O2BA 2CH7B 1JR9A 1GM9A 1KECA 4UV9A 4HNAA 5CBHA 4JF3A 1ZL8B 3ASOB 3G4SV 3FAVA 4JYBA 3JD3A 4MVZA 2DWEC 3K08A 3U0ZA 1HWYA 5LXTA 4B08A 4X1YA 2CTWA 4DYLA 4B3RB 4UCSA 4B3SB 1K92A 4L8JA 1F4NA 2UUAB 5J9PC 4B3MB 1MABG 4FLUA 3K79A 3JCZA 3A0RA 2Y4TA 1VF6A 1OCOB 1BMFG 3ZJZA 2ODMA 1H2SB 5KX5B 2Q67A 5B3SB 1K4DC 3L74H 1ROPA 4JI8B 3TK1A 5ITZA 1U96A 3STLC 4WBNB 4FM1A 3CPWU 4X65O 1Q6HA 3ZRSA 4YIOA 1JA8A 4I55B 4RQFA 3I5DA 4PA7A 1OCRB 3CRMA 2UXDO 5KHIA 5E1AC 2KQXA 4JYYA 4YIPA 1VQPV 3BEHA 2FL4A 1UFIA 3IJ4A 4DR1O 2YC0A 2ZXWC 4X1IB 3OFNG 2KSDA 4JAAA 1COWG 2NLJC 3OUFA 4XBFA 4A5UB 4EKWA 1QQCA 3VQYA 1SA0A 2WLIB 2R72A 1ZUQA 2IU3A 3OGIB 2RNBA 3J80N 4FM2A 4K35A 2EX3A 4AI8A 4LF4O 3OUSA 2N05A 1XHZA 4DR4B 3T2MA 2R9IA 4DV0B 4JI3B 2Q7GA 1AI4A 1QR9A 1VMGA 4NXMO 1VQKV 1THZA 5TISZ 3LNMB 5BR8B 4DR7O 1SERA 1NR7A 1M4UA 1YITV 3RT3C 1XREA 1NQTA 1V9PA 4E4EA 2L35A 1VF7A 1LNQA 2H3OA 1R3JC 4JV5O 2PYLA 3SPCA 3MHSC 2HEPA 3FB8C 4QIWF 3HKEB 3HKBB 4X64O 1IBKB 2K1EA 3P32A 1TUBA 3SDLA 3T1CA 3WU2Z 1R6NA 4PDLA 5J2TB 5EC2C 3N2GB 1K5SA 2DYSC 3S3WA 5CB4A 5B5EZ 4TV8A 4GKJO 1P49A 3JALB 3CC2V 4LCUC 2PZSA 2RCVA 4LF7O 1NZ6A 3SYAA 2EIKB 1FFXB 1QBZA 5C93A 2B5UA 2OT5A 4DV7O 4X9QA 3OTFA 1JJOA 4IHJB 5B1AB 1AJQA 1FXHA 3ZHQA 1VQMV 5IJ9B 4JI6O 1JCHA 1NR1A 1WB8A 3BABA 5FNVB 5IYBO 1WA8B 1HR0O 1CPYA 1NU1H 4JTCB 5LOVB 3ABMC 4NXNO 3G6EV 1VQOV 1AROP 4IIJA 3DSQA 1YI2V 1IBLB 2GUZA 3ML0A 2P90A 3E8BA 3ABUA 2DOSA 3K5LA 2V1DA 2O57A 3SYOA 1K34A 3WB2A 4XDLA 2JDIG 4LFBO 2IJIA 4LFAB 3F7VC 1B04A 1BGYH 1Q6UA 2QKAA 2FB5A 3ZHVA 4F6RA 5EBLC 2RJZA 4ZOLB 3K9SA 1OCRC 3K58A 3R66A 1IXBA 2ADPA 2IU0A 5B1OA 1N33B 3U10A 5C8YB 1AI6A 1S72V 1R6KA 2OCHA 1Q82W 3NR7A 1G1XB 4FJCC 2ZM6O 1V54B 2YDEA 4JYCA 1D5NA 3FFQA 4FLYA 3QO7A 1KMIZ 5KMGA 1Q6IA 2V4DA 1LUWA 2IM9A 1HNWB 3KG2A 1NJIW 4PA4A 2ZT9B 2EULA 2ZDIA 3W7XA 4DV6B 1NKDA 4R50A 4ASUG 4DXWA 3BPZA 4LF8O 1SKVA 4UCTA 2AXTZ 2WLHA 2DW4A 2DYRB 4I5SA 1Z5VA 1U97A 1RM1C 3FYIB 3D8CA 4CH6A 2ATKC 4I4TB 4O4HB 1J5EO 2YIDA 3O65A 4JI2B 3F5WC 3RBZA 2Q0OC 4TUYA 3KKYA 3L70H 2HVKC 1YJWV 3K0DA 1R6TA 3FKSG 2KG7A 4N23A 3Q4HB 2XTAA 4R8CA 4RO2A 4B3RO 2AGAA 2X6CA 2RQ6A 3L75H 4DR3O 5CN0A 4UFZA 4MVSA 4ABMA 4B3MO 2GBOA 2FYUH 1FXKB 5EIBD 3IAYA 1H2LA 3E86A 2WA3A 3S3XA 2HVJC 5IJ0A 3CXCU 1Y6XA 3M99B 4WCEV 1CP9A 1FJGB 2DMXA 4AHCA 3AG1B 1HW7A 3I55V 1CEZA 1PV0A 4CZZA 4O2AA 3E8HA 1DGSA 2F93B 2B1GA 1M9NA 4UUJC 3GB7C 1XMQB 4I0XB 5HFLA 1MSWD 3L73H 3SPIA 3ETDA 4DV2B 3L72H 3D3IA 2EZOA 5IWAB 3CCMV 2XUMA 1KP2A 4NVPA 4FM0A 2XAJA 1VARA 1EM1A 3GWOA 3HKDB 4LNUB 2BOCC 4FPPA 2ZKOA 3B77A 3JARB 3U11A 4JI5B 2HR3A 1I7FA 2QWOB 3LDCA 3MAQA 4IL6Z 1YJNV 1PD3A 1K4CC 5CA0A 4YXWG 2XNDG 4DR4O 1H2MA 5IYZA 4FFBB 4JI3O 3CJHB 4ZI7A 5BR8O 1YXBA 4PI0A 3TCUA 1I5YA 2BTQA 3DXRA 4QGPA 5KHHA 3UT5B 1NS1A 1V54C 2X6AA 2QGNA 4H33A 4GUNA 2ADQB 1N4CA 1MNGA 1RPRA 1EZJA 4WFBV 2Z5UA 2CK3G 4HNAB 1IDSA 5GTHZ 3PN1A 2UUBB 3L71H 2A9HA 2WLLB 4LWSA 5LA6A 2M7WA 2XT9A 3ASNC 3A0BZ 2NR5A 1BHBA 1EZVH 1IBKO 3M7MX 3ZBHA 2UU9B 4X1YB 1L0LH 3G71V 3J81N 4LH6A 5LYJB 1PNLA 5JVDB 3UO2A 2GHYA 5KAIZ 3A2FA 3ZMSA 2QTOA 1SQFA 3IC7A 1L0NH 5KHKA 1SC5B 3X2QC 2ITCC 3JCUZ 5CBGA 3ZHTA 4J7JA 1GN3A 1SESA 3ZEDA 2IH1C 4JI7B 4C7UA 4TOIA 5IY5C 2ZXWB 3CP1A 1EN6A 2YS8A 1FYJA 4R7CA 3TGUH 2LQTA 1PPJH 3UCSC 3T4DA 3CWBH 2EIMC 4P9OA 1F23A 5D5QA 1G4YB 1X59A 3F5TA 3ICXA 3AEIA 4TV9B 3K57A 2FTKA 1H38A 3K59A 1WP8A 3WB1A 3C3TA 3RN4A 2YXHA 3CCJV 1K9MW 3GVMA 2JVDA 3CEIA 2DE0X 2WLNA 1GN6A 2JGDB 2WLKA 1ORQC 5EBMC 3JASA 4LFAO 5LGUA 4DV3O 1EBOA 3AG1C 4IYIA 3CCSV 4OX9B 4Q6GA 4DK1A 1N33O 5K1XA 1XI1A 3UM7A 2WLJA 5KHGA 2JEXA 1I5XA 4NYKA 4FLVA 4X20A 3OMAB 3P3NA 2FKXA 3UQ8A 1K33A 3CXHF 3RYIB 1S76D 1M56C 5CA3A 5E79Z 4LF9B 3OAAG 1GN4A 4U3JA 1JX9A 1VQ6V 1DLBA 4ZHQA 4NTXA 4K8ZA 1Y76A 4DV6O 4DO2A 4CC5A 4B3TB 3MDSA 4MVUA 2F66C 4NTWA 4DR5B 1TUBB 1O9HA 1QLEC 3K06A 5CB4B 4TV8B 4JI2O 4TQFA 3STZC 1GKFA 4EB6A 4QPJA 3ABMB 3AK3A 1L8DA 2HFEC 3OEEG 3ZS8C 4BIZA 2Q6AA 1XBLA 5FPRA 2Q69A 5F2VO 3RFRA 2QJ1A 2W0XA 2GDSA 3W7SA 1P4RA 4JAUA 4MTFA 1AJPA 2UXBB 1VF6C 1RSOA 2BSKA 1MOFA 4YJ2A 1F4MA 2Y4UA 3CYOA 2B1IA 3SJQC 2UXCB 1MG1A 1SF9A 3K9AA 1FJGO 2PY5A 3TJTA 4KXRA 5JH7A 3N2KA 1MA1A 2Y0IA 1RPOA 1NT2B 1W0JG 3JAWB 1HNZB 1N34O 3CMEV 2XASA 1XMQO 2Z3YA 4FZ1A 3T1YO 3JAKA 5IE9A 4DR2O 5B1BB 4GX5A 1DF5A 2WAMA 1EN4A 3AG3B 1XQ8A 1VF5B 1S77D 3H1KH 4K8XA 2F43G 5BMVA 1P7BA 3OTOB 3BVOA 3OMNB 2JK5C 3AG4B 4MTXA 1KC8W 4RUFA 3APOA 3CRAA 4X1KB 4O4LA 2YI9A 1YJ9V 3HB3B 3JSNA 1RM1B 1GAXA 1I08A 1ENVA 3H1JH 3C3SA 1Q86W 1N32B 1K97A 1Y74B 4GYCB 3VQXA 2D2CB 1P84F 3BRCA 2ZE6A 2ZD9A 1R3LC 3WG7C 1B6QA 4W4KA 3D3QA 1NH2B 3CCQV 2P7TC 4L87A 1S0VA 5H5NA 5LP6A 4TUYB 2LGQA 3ABTA 4CS3A 4KP4A 1JMKC 3HKCA 3RYCA 4OPHA 2KG7B 1XMOO 1BE3H 1OZ0A 4JI0B 3CC7V 4IT5A 1XL6A 2XAFA 3IC9A 2CH7A 1MSDA 4BW5A 2YSUB 1OJHA 2OTJV 3RW0A 2GTAA 5EYPA 4JI1B 2QWQB 3BHPA 3BY6A 4IGGA 1G6UA 2P06A 1R1BA 4G28B 1D5AA 2EJRA 5LBQA 4YHHB 2Y48A 5BY1A 4W4LA 1XILA 4LC1A 1JQ0A 1AR5A 3VBBA 4BAYA 2Q73A 1AP6A 2AHYA 4LBEC 3CC4V 1JFFA 3QVNA 1IVSA 1AB3A 1Z5WA 1WLEA 1Q43A 4UB6Z 5CA1B 4DR6B 3T4ZA 3MHHC 4WBNA 1FPOA 4GKKB 2YICA 1Q8IA 4PJ0Z 4I55A 2LP7A 4LF6B 5K1PA 4UVCA 2PI5A 4JAVA 5KUMA 1TAEA 5JQGA 4I9WA 1WN7A 4JASA 3VOUA 5DECA 2Z0AA 1HNXO 3K5OA 3OR7C 1G8MA 2PGGA 4PA6A 3FX7A 3OGCC 3A0HZ 4O4JB 4X1IA 4DV5B 4OX9O 1TA8A 1YCIA 4KHPB 1E1QG 3AG2C 5CA0B 1PL0A 4ZKIA 5B1BC 1NVPB 2W6IG 1M57C 1H2KA 2WLIA 5LMNO 3BAAA 3AG3C 5DM6V 1H8EG 1VQLV 1TGOA 2PI4A 3SYQA 2IJKA 4PI2A 2JS3A 3ASNB 3DXRB 4LFCO 2HKOA 4J11A 1Y66A 1P7GA 3AG4C 5BZBA 4H37A 4CBCA 3DC6A 2QM4A 1N0JA 1M1KW 1NTMH 3CB2A 1VQ8V 4LF9O 5H9CA 4LF5B 2KB1A 1SQPH 4LP8A 3DTUB 3TXQA 2ZDIC 4B3TO 2EINC 3X2QB 5LL6Y 2BE3A 4JZ2A 4DR5O 1VQ4V 2EILB 5AG2A 3PJSK 1GRJA 1S3JA 1SETA 4I50B 1YF2A 3SJCC 5IY5B 3ZCCA 2G38A 2CDYA 1IX9A 4BWAA 4RAIA 2Q7HA 5KUKA 4CH3A 3QG5A 4B3SO 3HKBA 1BHAA 5EK0A 3GWKC 4K3AA 3G80A 1YTFB 1YDXA 2UUAO 4CS4A 2EIMB 1Q3EA 5J2TA 1PKXA 2WPDG 3K04A 4MSWC 1BT8A 4X66B 2VRZA 2E76B 4JYAB 1YHQV 4JTAB 3E8FA
chains in the Genus database with same CATH topology
1RP3B 1SC5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RP3 B;  1SC5 B; 
#chains in the Genus database with same CATH topology
 4JI8 O;  3G6B A;  1QVF U;  1FFX A;  2B9Z A;  3T1H B;  3OR6 C;  4IHJ A;  3CCU V;  3VQW A;  3AK2 A;  2UXB O;  3AG7 A;  1E1R G;  1XNQ B;  3J7A U;  5FNV A;  1WA8 A;  2ARH A;  4JGS A;  2UXC O;  2IJJ A;  5JCO A;  2A06 H;  2A7W A;  1QR8 A;  5EZY B;  4QJF B;  4MVO A;  2XAH A;  4FFK A;  3SJA C;  3O9O A;  2XAG A;  2DQ3 A;  2DN9 A;  1HNZ O;  2OIG A;  3SPH A;  1WNS A;  4MS2 A;  5GON A;  4RQE A;  2VWK A;  3D36 A;  2HHH B;  2ZNI A;  1M56 B;  4DUY B;  4OXS A;  5EIB C;  4DUZ B;  1OHH G;  1TVK B;  4X20 B;  1JJ2 U;  5J2U B;  1WP7 A;  2E5L B;  3OTO O;  3CRR A;  3ZRW B;  4RUE A;  5LMU B;  1RP3 B;  4O4I B;  4ZOL A;  1ZTE A;  3QO8 A;  4DV0 O;  3ZHU A;  5C8Y A;  1BZK A;  2RDC A;  4D7T A;  2OIE A;  2Y0P A;  4PEL A;  4WFE A;  2ZR3 A;  1AVM A;  3ZHR A;  1QLE B;  1LR1 A;  4U3J B;  3ZHS A;  1GM8 A;  1S5L Z;  2Y69 C;  3E22 B;  4N21 A;  4AQY B;  2CE4 A;  1AJN A;  4YJ3 A;  2JGU A;  3W7W A;  1N32 O;  1Y76 B;  1BL8 A;  4WFA V;  4O2B B;  3RWR D;  1XNR B;  2QTS A;  1BCC H;  2YEV A;  3SYP A;  1PM9 A;  3OEH G;  4LR3 A;  1NTZ H;  1Y67 A;  1R3I C;  2P4V A;  1K7D A;  2EBO A;  2JS5 A;  1QVG U;  3LSQ A;  2F1M A;  2M6Y A;  3FAV B;  4FLZ A;  3QNE A;  5LXT B;  5GW7 A;  4EB6 B;  3LNN A;  1M5I A;  4ICG A;  3WFV A;  2H94 A;  3N27 A;  3E35 A;  4JI0 O;  4EFB A;  4Z1M G;  5B66 Z;  5GTI Z;  5LHI A;  4GKJ B;  4O4H A;  4I4T A;  5L3E A;  3SPJ A;  3JSL A;  2EIL C;  3P30 A;  4JI1 O;  4J42 A;  5ITZ B;  2OYQ A;  5KA5 A;  2Q0A A;  3CS5 A;  1AIL A;  4J9Z B;  4DV7 B;  5EBW C;  4YY3 B;  5D5P A;  4WF9 V;  5L3F A;  3Q4H A;  4HBN A;  1W59 A;  2IW5 A;  1Y4M A;  1EFR G;  4QE9 A;  3W7U A;  3OD4 A;  1CXZ B;  1IBM B;  4K0K B;  4D6T H;  1IBL O;  1FXK A;  1GTO A;  3EHB B;  1LUV A;  3ZMZ A;  3ABL C;  3RYH A;  3ZN1 A;  4DRX A;  1N0N A;  2R9A A;  5CMU A;  3E83 A;  3JAK B;  1SA0 B;  1SQG A;  2CTQ A;  2NN4 A;  2ITD C;  3IFX A;  2PYJ A;  4LFB B;  4GKK O;  4XDJ A;  1R3K C;  3SYC A;  4LF6 O;  2XOK G;  3E89 A;  4R6Z A;  3FYE B;  1B06 A;  5DN6 G;  2YI8 A;  1KU9 A;  4I0X A;  1JOY A;  4Q20 A;  2V7Q G;  3SJB C;  3E2E A;  1K8A W;  4ZIB A;  3WG7 B;  4DV5 O;  1VEW A;  5LHG A;  4KHP O;  4BIU A;  4HYO A;  4X62 B;  1GN2 A;  1PNM A;  3TET A;  3W7T A;  5B1N A;  3HKD A;  2ZIO A;  4CC6 A;  1YSC A;  3JAR A;  3FD9 A;  3JD0 A;  3C90 A;  1N36 B;  1BQ0 A;  4XDK A;  1HNW O;  1PL4 A;  1SQQ H;  2QWR B;  4I7Z B;  2ZIM A;  5LGN A;  4J10 A;  3OT7 A;  2ETN A;  2LW7 A;  1AI7 A;  3ZMV A;  4FFB A;  1VQN V;  3B2E E;  4LF8 B;  2DJV A;  4LF5 O;  2HJD A;  3H1I H;  4U7N A;  2EJ7 A;  3RYF A;  3FB6 C;  4J9Y B;  2X0L A;  3LUT B;  1J5E B;  3JAM N;  2ZR2 A;  2QEX V;  2ZE7 A;  2LFR A;  2CUG A;  1KUQ A;  4PA3 A;  5EYP B;  2QSA A;  3FB7 C;  1BS3 A;  2WLL A;  1Q5O A;  2K9P A;  4J80 A;  5L3G A;  5IYC O;  2CTR A;  1OCZ B;  2IBZ H;  2BOB C;  4MTO A;  2WLM A;  1YZB A;  3RVZ A;  2X6B A;  3CRQ A;  5JJE B;  4DR3 B;  5LYJ A;  4MT8 A;  5JVD A;  4CH4 A;  4IIJ B;  2N04 A;  4ZBM A;  2HG5 C;  4X66 O;  2GUZ B;  1JFF B;  2CGN A;  4JYA O;  2C2A A;  2CAZ C;  1IUR A;  2AW9 A;  2CTP A;  2HLD G;  2AZ2 A;  3T1H O;  1AP5 A;  4U3F H;  2VQE B;  4BW9 A;  5DED A;  1ZLZ A;  1XNQ O;  4WFF A;  4I9Q A;  4F6R B;  1URF A;  3AG2 B;  2IH3 C;  1KD1 W;  2YIB D;  3K03 A;  4U7O A;  4FMT A;  5JQG B;  2EIJ C;  2QE7 G;  4DV2 O;  3JAT A;  1M57 B;  3B8M A;  5IWA O;  1V55 C;  5JWP A;  4TV9 A;  2ZQM A;  1PP9 H;  5FPO A;  1QLN A;  1ZAU A;  3KZI Z;  4NR1 A;  1SZX A;  3E8G A;  1ZWI C;  1F51 A;  2HHH O;  2Q4P A;  3L9D A;  4DUY O;  4DUZ O;  2VQF B;  4BR6 A;  4MW3 A;  5KMG B;  4JI5 O;  1KB9 F;  2JGD A;  2HJF C;  5JJJ B;  1US6 A;  2ZIN A;  1B3Q A;  4GT1 A;  2E5L O;  2YIB A;  1IXM A;  4HAM A;  2VS0 A;  5LMU O;  3G67 A;  1J95 A;  4QE7 A;  2EIN B;  1QNM A;  2WA4 A;  3OE7 G;  2R70 A;  3B8N A;  5JJN B;  4P30 A;  3CCE V;  1KBH A;  5IYD O;  4CS2 A;  4MVM A;  1HDJ A;  2JJ1 G;  3BA9 A;  4AQY O;  4KL1 A;  3H9V A;  2LO1 A;  2UUC B;  1H2N A;  4GX1 A;  4GLX A;  2ZCE A;  4MVQ A;  2Q68 A;  1Q90 D;  3CX5 F;  1T5E A;  1S5H C;  1W0K G;  5A2Q N;  1XNR O;  4QNH B;  3RYI A;  3ZIA G;  4GX2 A;  5HFM A;  1GK9 A;  1FS0 G;  3ABK C;  2UUB O;  2GV9 A;  4FLT A;  4FIP C;  2DWD C;  1D2D A;  2N74 A;  4UVB A;  4G2K A;  2HP8 A;  2WSS G;  2PUS A;  2UU9 O;  2D3O W;  2E75 B;  5A9G A;  3QO5 A;  5LP6 C;  3BCC H;  3OM3 B;  1OCC C;  1N8R W;  1GO3 F;  2A3Q A;  4GCZ A;  4OGQ B;  4TT3 G;  1E79 G;  2JIZ G;  1EN5 A;  1I94 B;  1S5J A;  1O9G A;  2CGO A;  1ZL8 A;  4DV4 B;  2F23 A;  4G27 B;  4B7E A;  1SQB H;  5LHH A;  2W6J G;  1A32 A;  1W2B U;  3CD6 V;  3CE2 A;  3B09 A;  3H01 A;  5IJ0 B;  4DV1 B;  1DK1 A;  1K5Q A;  4DW1 A;  1YVW A;  1XHX A;  4AIL C;  2GTS A;  2QWP B;  4H0L B;  4JI7 O;  3CCL V;  1YIJ V;  3R65 A;  4YY3 O;  3LSU A;  1FXV A;  3ASO C;  2QWN B;  4O2A B;  4B7K A;  2LGW A;  1GMG A;  4UVA A;  2FML A;  3EFF K;  1OCZ C;  4H44 B;  2AZ0 A;  2Q9L A;  3BA8 A;  5KX5 A;  3VQV A;  4QPK A;  1IBM O;  3CMA V;  3ETG A;  4K0K O;  3JD1 A;  1K73 W;  2P67 A;  1DTO A;  3ZMU A;  2BCC H;  2EZP A;  2PTM A;  4MVR A;  1MZE A;  1R73 A;  1WB7 A;  1MMM A;  5GON B;  1OCO C;  4GX0 A;  2A79 B;  2P4K A;  3JD2 A;  5B3S C;  1VP7 A;  4EFE A;  3CHX A;  4DV3 B;  2Y69 B;  2X7R B;  2JEU A;  3CCV V;  3JAW A;  3B40 A;  4Z2W A;  2VWJ A;  2Q5Z A;  1AR4 A;  4MTG A;  4FLX A;  2F4V B;  3H1H H;  4WFG A;  1X4T A;  1PNK A;  1SQX H;  5IYZ B;  2H8P C;  4UXN A;  4JI4 B;  4X8A A;  5KAF Z;  4X89 A;  4GZR B;  4ZI7 B;  1OV9 A;  5L3C A;  4PD4 F;  2OWO A;  4X62 O;  2BTQ B;  3K5M A;  1JVM A;  4YJ3 B;  3H1L H;  1AI5 A;  1NH2 D;  2YXL A;  4PDR A;  3P3P A;  2LJ2 A;  2NNU A;  1L1F A;  2MK3 A;  2OCC B;  2YIA A;  2YEV B;  1N36 O;  4X1K A;  3FB5 C;  1SZT A;  3K0G A;  2IJH A;  3I56 V;  4NKG B;  1ZX3 A;  4LWS B;  5LA6 B;  2QKS A;  5H6Q A;  4NTY A;  5FLX N;  2P5O A;  4DW0 A;  1Q81 W;  4PV1 B;  1QU7 A;  1Y74 A;  2XAQ A;  2JJ2 G;  5KLV H;  2OTL V;  3ETQ A;  4LH7 A;  5KHJ A;  1Z2G A;  4TQD A;  3RVY A;  2RMK B;  3LDE A;  3HKE A;  3ZRX A;  1WAZ A;  3AK1 A;  1VQ5 V;  3IGA C;  3RGB A;  1AR1 B;  3N2G A;  2BTO A;  1QHT A;  1KQS U;  3JAL A;  2YXY A;  2E74 B;  3BFR A;  3ABL B;  1VQ9 V;  4Z1V A;  2QKC A;  3M8A A;  3UO3 A;  1M90 W;  1KKC A;  1VQ7 V;  2YUA A;  4FVM A;  3WB0 A;  3ETE A;  1M93 A;  1UPG A;  4H13 B;  3ZX6 A;  5IJ9 A;  4X65 B;  1NI8 A;  3RYH B;  4DRX B;  2EIK C;  2UXD B;  2UXN A;  3JD4 A;  1NTK H;  5LOV A;  2VQE O;  3JAS B;  5B1A C;  5KA6 A;  4DR1 B;  2QM7 A;  1MZF A;  1NBM G;  1UJW B;  2ZNJ A;  4FZ0 A;  1WPX A;  1N34 B;  2GSM B;  2Q8V A;  4F6E A;  1TUE B;  2ILM A;  5JCO C;  1SQV H;  3T1Y B;  1I0H A;  2QA4 V;  4DR2 B;  1JPX A;  3QTC A;  5CA1 A;  5BXZ A;  5CBF A;  1NVP D;  2P22 C;  4FK5 C;  3CRC A;  2R9R B;  4MW8 A;  3D36 C;  1KYO F;  2LW1 A;  3SR2 C;  4NB5 A;  1SRY A;  2VQF O;  4LF4 B;  5IT9 N;  2KKW A;  2Q7E A;  1QCE A;  3LDD A;  4UV8 A;  4PA9 A;  1KKD A;  4UCU A;  4UCV A;  2MW2 B;  4O4J A;  1BQZ A;  4NXM B;  3EVK A;  4DR7 B;  4ZHQ B;  3DGE A;  3K3W A;  1FD9 A;  2W0F C;  1YEW A;  2L6L A;  1FFT B;  3HPL C;  2RN9 A;  4OPA A;  4KFM A;  4PHZ A;  2UUC O;  3EXA A;  3ZRV A;  4JV5 B;  2ZE8 A;  4UCO A;  3RYF B;  1RFY A;  2DQ0 A;  4EEQ A;  3CCR V;  1XUQ A;  2OCC C;  3K5N A;  4TSF G;  4X64 B;  4JPR A;  3TXS A;  5L3D A;  3F7Y C;  1XL4 A;  4DK0 A;  1YTF D;  4J7K A;  2WWW A;  1XMO B;  3ZN0 A;  3JYC A;  1K3E A;  5IDJ A;  4J7Z A;  3UKM A;  4E2L A;  4LF7 B;  1ZSP A;  1Q7Y W;  2AHZ A;  1I94 O;  5EC1 C;  3DC5 A;  5H6R A;  4PDM A;  1FAF A;  4I50 A;  2DYR C;  4DV4 O;  1BSM A;  2QDO A;  4YHH O;  1RSO B;  2QR4 A;  2BSK B;  4YJ2 B;  4JI6 B;  4DV1 O;  2ZE5 A;  4RWU A;  1HR0 B;  2EIJ B;  2PF4 E;  1H8H G;  4TWK A;  1V55 B;  4NXN B;  5JH7 B;  3N2K B;  4PDV A;  3A8T A;  3APQ A;  2XHB A;  1FKA O;  1GM7 A;  1XEQ A;  2LFS A;  4P2Z A;  4BIO A;  3KCX A;  2P6J A;  4JTD B;  1H2G A;  3JAT B;  4DR6 O;  1GH6 A;  4X88 A;  2F95 B;  5LGT A;  3THO A;  1FXK C;  3SPG A;  1HP8 A;  5BMV B;  1F7Y A;  1SS3 A;  5EZY A;  4CH5 A;  3OW2 U;  5H2F Z;  3KCY A;  4O4L B;  4JZG A;  1HNX B;  4J41 A;  3QF7 A;  3LSS A;  4UB8 Z;  4F4L A;  2ZM6 B;  2F4V O;  4FLW A;  1WPB A;  2E3C A;  4LNU A;  4JI4 O;  1XOU A;  1DF4 A;  5FL7 G;  3NXS A;  3ZMT A;  3ABK B;  1IZ3 A;  2QM8 A;  1TVK A;  5LMN B;  3SGI A;  5L3B A;  2A0L A;  5J2U A;  3ZRW A;  4KUM A;  1KP3 A;  4LFC B;  3HR0 A;  4O4I A;  5LP6 B;  1OCC B;  1WJZ A;  3CJH A;  2UXX A;  4HZ3 A;  4IYH A;  3OMI B;  3HKC B;  3RYC B;  4WFH A;  3B4S A;  3MD0 A;  2DYS B;  3E22 A;  4D7S A;  4P9P A;  2JRI A;  3CSX A;  3UT5 A;  1VIB A;  4UCR A;  1XDC A;  4O2B A;  2CH7 B;  1JR9 A;  1GM9 A;  1KEC A;  4UV9 A;  4HNA A;  5CBH A;  4JF3 A;  1ZL8 B;  3ASO B;  3G4S V;  3FAV A;  4JYB A;  3JD3 A;  4MVZ A;  2DWE C;  3K08 A;  3U0Z A;  1HWY A;  5LXT A;  4B08 A;  4X1Y A;  2CTW A;  4DYL A;  4B3R B;  4UCS A;  4B3S B;  1K92 A;  4L8J A;  1F4N A;  2UUA B;  5J9P C;  4B3M B;  1MAB G;  4FLU A;  3K79 A;  3JCZ A;  3A0R A;  2Y4T A;  1VF6 A;  1OCO B;  1BMF G;  3ZJZ A;  2ODM A;  1H2S B;  5KX5 B;  2Q67 A;  5B3S B;  1K4D C;  3L74 H;  1ROP A;  4JI8 B;  3TK1 A;  5ITZ A;  1U96 A;  3STL C;  4WBN B;  4FM1 A;  3CPW U;  4X65 O;  1Q6H A;  3ZRS A;  4YIO A;  1JA8 A;  4I55 B;  4RQF A;  3I5D A;  4PA7 A;  1OCR B;  3CRM A;  2UXD O;  5KHI A;  5E1A C;  2KQX A;  4JYY A;  4YIP A;  1VQP V;  3BEH A;  2FL4 A;  1UFI A;  3IJ4 A;  4DR1 O;  2YC0 A;  2ZXW C;  4X1I B;  3OFN G;  2KSD A;  4JAA A;  1COW G;  2NLJ C;  3OUF A;  4XBF A;  4A5U B;  4EKW A;  1QQC A;  3VQY A;  1SA0 A;  2WLI B;  2R72 A;  1ZUQ A;  2IU3 A;  3OGI B;  2RNB A;  3J80 N;  4FM2 A;  4K35 A;  2EX3 A;  4AI8 A;  4LF4 O;  3OUS A;  2N05 A;  1XHZ A;  4DR4 B;  3T2M A;  2R9I A;  4DV0 B;  4JI3 B;  2Q7G A;  1AI4 A;  1QR9 A;  1VMG A;  4NXM O;  1VQK V;  1THZ A;  5TIS Z;  3LNM B;  5BR8 B;  4DR7 O;  1SER A;  1NR7 A;  1M4U A;  1YIT V;  3RT3 C;  1XRE A;  1NQT A;  1V9P A;  4E4E A;  2L35 A;  1VF7 A;  1LNQ A;  2H3O A;  1R3J C;  4JV5 O;  2PYL A;  3SPC A;  3MHS C;  2HEP A;  3FB8 C;  4QIW F;  3HKE B;  3HKB B;  4X64 O;  1IBK B;  2K1E A;  3P32 A;  1TUB A;  3SDL A;  3T1C A;  3WU2 Z;  1R6N A;  4PDL A;  5J2T B;  5EC2 C;  3N2G B;  1K5S A;  2DYS C;  3S3W A;  5CB4 A;  5B5E Z;  4TV8 A;  4GKJ O;  1P49 A;  3JAL B;  3CC2 V;  4LCU C;  2PZS A;  2RCV A;  4LF7 O;  1NZ6 A;  3SYA A;  2EIK B;  1FFX B;  1QBZ A;  5C93 A;  2B5U A;  2OT5 A;  4DV7 O;  4X9Q A;  3OTF A;  1JJO A;  4IHJ B;  5B1A B;  1AJQ A;  1FXH A;  3ZHQ A;  1VQM V;  5IJ9 B;  4JI6 O;  1JCH A;  1NR1 A;  1WB8 A;  3BAB A;  5FNV B;  5IYB O;  1WA8 B;  1HR0 O;  1CPY A;  1NU1 H;  4JTC B;  5LOV B;  3ABM C;  4NXN O;  3G6E V;  1VQO V;  1ARO P;  4IIJ A;  3DSQ A;  1YI2 V;  1IBL B;  2GUZ A;  3ML0 A;  2P90 A;  3E8B A;  3ABU A;  2DOS A;  3K5L A;  2V1D A;  2O57 A;  3SYO A;  1K34 A;  3WB2 A;  4XDL A;  2JDI G;  4LFB O;  2IJI A;  4LFA B;  3F7V C;  1B04 A;  1BGY H;  1Q6U A;  2QKA A;  2FB5 A;  3ZHV A;  4F6R A;  5EBL C;  2RJZ A;  4ZOL B;  3K9S A;  1OCR C;  3K58 A;  3R66 A;  1IXB A;  2ADP A;  2IU0 A;  5B1O A;  1N33 B;  3U10 A;  5C8Y B;  1AI6 A;  1S72 V;  1R6K A;  2OCH A;  1Q82 W;  3NR7 A;  1G1X B;  4FJC C;  2ZM6 O;  1V54 B;  2YDE A;  4JYC A;  1D5N A;  3FFQ A;  4FLY A;  3QO7 A;  1KMI Z;  5KMG A;  1Q6I A;  2V4D A;  1LUW A;  2IM9 A;  1HNW B;  3KG2 A;  1NJI W;  4PA4 A;  2ZT9 B;  2EUL A;  2ZDI A;  3W7X A;  4DV6 B;  1NKD A;  4R50 A;  4ASU G;  4DXW A;  3BPZ A;  4LF8 O;  1SKV A;  4UCT A;  2AXT Z;  2WLH A;  2DW4 A;  2DYR B;  4I5S A;  1Z5V A;  1U97 A;  1RM1 C;  3FYI B;  3D8C A;  4CH6 A;  2ATK C;  4I4T B;  4O4H B;  1J5E O;  2YID A;  3O65 A;  4JI2 B;  3F5W C;  3RBZ A;  2Q0O C;  4TUY A;  3KKY A;  3L70 H;  2HVK C;  1YJW V;  3K0D A;  1R6T A;  3FKS G;  2KG7 A;  4N23 A;  3Q4H B;  2XTA A;  4R8C A;  4RO2 A;  4B3R O;  2AGA A;  2X6C A;  2RQ6 A;  3L75 H;  4DR3 O;  5CN0 A;  4UFZ A;  4MVS A;  4ABM A;  4B3M O;  2GBO A;  2FYU H;  1FXK B;  5EIB D;  3IAY A;  1H2L A;  3E86 A;  2WA3 A;  3S3X A;  2HVJ C;  5IJ0 A;  3CXC U;  1Y6X A;  3M99 B;  4WCE V;  1CP9 A;  1FJG B;  2DMX A;  4AHC A;  3AG1 B;  1HW7 A;  3I55 V;  1CEZ A;  1PV0 A;  4CZZ A;  4O2A A;  3E8H A;  1DGS A;  2F93 B;  2B1G A;  1M9N A;  4UUJ C;  3GB7 C;  1XMQ B;  4I0X B;  5HFL A;  1MSW D;  3L73 H;  3SPI A;  3ETD A;  4DV2 B;  3L72 H;  3D3I A;  2EZO A;  5IWA B;  3CCM V;  2XUM A;  1KP2 A;  4NVP A;  4FM0 A;  2XAJ A;  1VAR A;  1EM1 A;  3GWO A;  3HKD B;  4LNU B;  2BOC C;  4FPP A;  2ZKO A;  3B77 A;  3JAR B;  3U11 A;  4JI5 B;  2HR3 A;  1I7F A;  2QWO B;  3LDC A;  3MAQ A;  4IL6 Z;  1YJN V;  1PD3 A;  1K4C C;  5CA0 A;  4YXW G;  2XND G;  4DR4 O;  1H2M A;  5IYZ A;  4FFB B;  4JI3 O;  3CJH B;  4ZI7 A;  5BR8 O;  1YXB A;  4PI0 A;  3TCU A;  1I5Y A;  2BTQ A;  3DXR A;  4QGP A;  5KHH A;  3UT5 B;  1NS1 A;  1V54 C;  2X6A A;  2QGN A;  4H33 A;  4GUN A;  2ADQ B;  1N4C A;  1MNG A;  1RPR A;  1EZJ A;  4WFB V;  2Z5U A;  2CK3 G;  4HNA B;  1IDS A;  5GTH Z;  3PN1 A;  2UUB B;  3L71 H;  2A9H A;  2WLL B;  4LWS A;  5LA6 A;  2M7W A;  2XT9 A;  3ASN C;  3A0B Z;  2NR5 A;  1BHB A;  1EZV H;  1IBK O;  3M7M X;  3ZBH A;  2UU9 B;  4X1Y B;  1L0L H;  3G71 V;  3J81 N;  4LH6 A;  5LYJ B;  1PNL A;  5JVD B;  3UO2 A;  2GHY A;  5KAI Z;  3A2F A;  3ZMS A;  2QTO A;  1SQF A;  3IC7 A;  1L0N H;  5KHK A;  1SC5 B;  3X2Q C;  2ITC C;  3JCU Z;  5CBG A;  3ZHT A;  4J7J A;  1GN3 A;  1SES A;  3ZED A;  2IH1 C;  4JI7 B;  4C7U A;  4TOI A;  5IY5 C;  2ZXW B;  3CP1 A;  1EN6 A;  2YS8 A;  1FYJ A;  4R7C A;  3TGU H;  2LQT A;  1PPJ H;  3UCS C;  3T4D A;  3CWB H;  2EIM C;  4P9O A;  1F23 A;  5D5Q A;  1G4Y B;  1X59 A;  3F5T A;  3ICX A;  3AEI A;  4TV9 B;  3K57 A;  2FTK A;  1H38 A;  3K59 A;  1WP8 A;  3WB1 A;  3C3T A;  3RN4 A;  2YXH A;  3CCJ V;  1K9M W;  3GVM A;  2JVD A;  3CEI A;  2DE0 X;  2WLN A;  1GN6 A;  2JGD B;  2WLK A;  1ORQ C;  5EBM C;  3JAS A;  4LFA O;  5LGU A;  4DV3 O;  1EBO A;  3AG1 C;  4IYI A;  3CCS V;  4OX9 B;  4Q6G A;  4DK1 A;  1N33 O;  5K1X A;  1XI1 A;  3UM7 A;  2WLJ A;  5KHG A;  2JEX A;  1I5X A;  4NYK A;  4FLV A;  4X20 A;  3OMA B;  3P3N A;  2FKX A;  3UQ8 A;  1K33 A;  3CXH F;  3RYI B;  1S76 D;  1M56 C;  5CA3 A;  5E79 Z;  4LF9 B;  3OAA G;  1GN4 A;  4U3J A;  1JX9 A;  1VQ6 V;  1DLB A;  4ZHQ A;  4NTX A;  4K8Z A;  1Y76 A;  4DV6 O;  4DO2 A;  4CC5 A;  4B3T B;  3MDS A;  4MVU A;  2F66 C;  4NTW A;  4DR5 B;  1TUB B;  1O9H A;  1QLE C;  3K06 A;  5CB4 B;  4TV8 B;  4JI2 O;  4TQF A;  3STZ C;  1GKF A;  4EB6 A;  4QPJ A;  3ABM B;  3AK3 A;  1L8D A;  2HFE C;  3OEE G;  3ZS8 C;  4BIZ A;  2Q6A A;  1XBL A;  5FPR A;  2Q69 A;  5F2V O;  3RFR A;  2QJ1 A;  2W0X A;  2GDS A;  3W7S A;  1P4R A;  4JAU A;  4MTF A;  1AJP A;  2UXB B;  1VF6 C;  1RSO A;  2BSK A;  1MOF A;  4YJ2 A;  1F4M A;  2Y4U A;  3CYO A;  2B1I A;  3SJQ C;  2UXC B;  1MG1 A;  1SF9 A;  3K9A A;  1FJG O;  2PY5 A;  3TJT A;  4KXR A;  5JH7 A;  3N2K A;  1MA1 A;  2Y0I A;  1RPO A;  1NT2 B;  1W0J G;  3JAW B;  1HNZ B;  1N34 O;  3CME V;  2XAS A;  1XMQ O;  2Z3Y A;  4FZ1 A;  3T1Y O;  3JAK A;  5IE9 A;  4DR2 O;  5B1B B;  4GX5 A;  1DF5 A;  2WAM A;  1EN4 A;  3AG3 B;  1XQ8 A;  1VF5 B;  1S77 D;  3H1K H;  4K8X A;  2F43 G;  5BMV A;  1P7B A;  3OTO B;  3BVO A;  3OMN B;  2JK5 C;  3AG4 B;  4MTX A;  1KC8 W;  4RUF A;  3APO A;  3CRA A;  4X1K B;  4O4L A;  2YI9 A;  1YJ9 V;  3HB3 B;  3JSN A;  1RM1 B;  1GAX A;  1I08 A;  1ENV A;  3H1J H;  3C3S A;  1Q86 W;  1N32 B;  1K97 A;  1Y74 B;  4GYC B;  3VQX A;  2D2C B;  1P84 F;  3BRC A;  2ZE6 A;  2ZD9 A;  1R3L C;  3WG7 C;  1B6Q A;  4W4K A;  3D3Q A;  1NH2 B;  3CCQ V;  2P7T C;  4L87 A;  1S0V A;  5H5N A;  5LP6 A;  4TUY B;  2LGQ A;  3ABT A;  4CS3 A;  4KP4 A;  1JMK C;  3HKC A;  3RYC A;  4OPH A;  2KG7 B;  1XMO O;  1BE3 H;  1OZ0 A;  4JI0 B;  3CC7 V;  4IT5 A;  1XL6 A;  2XAF A;  3IC9 A;  2CH7 A;  1MSD A;  4BW5 A;  2YSU B;  1OJH A;  2OTJ V;  3RW0 A;  2GTA A;  5EYP A;  4JI1 B;  2QWQ B;  3BHP A;  3BY6 A;  4IGG A;  1G6U A;  2P06 A;  1R1B A;  4G28 B;  1D5A A;  2EJR A;  5LBQ A;  4YHH B;  2Y48 A;  5BY1 A;  4W4L A;  1XIL A;  4LC1 A;  1JQ0 A;  1AR5 A;  3VBB A;  4BAY A;  2Q73 A;  1AP6 A;  2AHY A;  4LBE C;  3CC4 V;  1JFF A;  3QVN A;  1IVS A;  1AB3 A;  1Z5W A;  1WLE A;  1Q43 A;  4UB6 Z;  5CA1 B;  4DR6 B;  3T4Z A;  3MHH C;  4WBN A;  1FPO A;  4GKK B;  2YIC A;  1Q8I A;  4PJ0 Z;  4I55 A;  2LP7 A;  4LF6 B;  5K1P A;  4UVC A;  2PI5 A;  4JAV A;  5KUM A;  1TAE A;  5JQG A;  4I9W A;  1WN7 A;  4JAS A;  3VOU A;  5DEC A;  2Z0A A;  1HNX O;  3K5O A;  3OR7 C;  1G8M A;  2PGG A;  4PA6 A;  3FX7 A;  3OGC C;  3A0H Z;  4O4J B;  4X1I A;  4DV5 B;  4OX9 O;  1TA8 A;  1YCI A;  4KHP B;  1E1Q G;  3AG2 C;  5CA0 B;  1PL0 A;  4ZKI A;  5B1B C;  1NVP B;  2W6I G;  1M57 C;  1H2K A;  2WLI A;  5LMN O;  3BAA A;  3AG3 C;  5DM6 V;  1H8E G;  1VQL V;  1TGO A;  2PI4 A;  3SYQ A;  2IJK A;  4PI2 A;  2JS3 A;  3ASN B;  3DXR B;  4LFC O;  2HKO A;  4J11 A;  1Y66 A;  1P7G A;  3AG4 C;  5BZB A;  4H37 A;  4CBC A;  3DC6 A;  2QM4 A;  1N0J A;  1M1K W;  1NTM H;  3CB2 A;  1VQ8 V;  4LF9 O;  5H9C A;  4LF5 B;  2KB1 A;  1SQP H;  4LP8 A;  3DTU B;  3TXQ A;  2ZDI C;  4B3T O;  2EIN C;  3X2Q B;  5LL6 Y;  2BE3 A;  4JZ2 A;  4DR5 O;  1VQ4 V;  2EIL B;  5AG2 A;  3PJS K;  1GRJ A;  1S3J A;  1SET A;  4I50 B;  1YF2 A;  3SJC C;  5IY5 B;  3ZCC A;  2G38 A;  2CDY A;  1IX9 A;  4BWA A;  4RAI A;  2Q7H A;  5KUK A;  4CH3 A;  3QG5 A;  4B3S O;  3HKB A;  1BHA A;  5EK0 A;  3GWK C;  4K3A A;  3G80 A;  1YTF B;  1YDX A;  2UUA O;  4CS4 A;  2EIM B;  1Q3E A;  5J2T A;  1PKX A;  2WPD G;  3K04 A;  4MSW C;  1BT8 A;  4X66 B;  2VRZ A;  2E76 B;  4JYA B;  1YHQ V;  4JTA B;  3E8F A; 
#chains in the Genus database with same CATH homology
 1RP3 B;  1SC5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...