4DR1O

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr1O00
5BR8O 2ZKOA 4KHPO 4JI1O 4JI3O 3J7AU 3F5TA 4X66O 1XMOO 1N34O 3RT3C 5BY1A 4AQYO 5LMNO 5LL6Y 4JYAO 2VQEO 4K0KO 4B3TO 4JI4O 4LF7O 4YHHO 4DV0O 4JI5O 1IBMO 4B3MO 4GKKO 4JI8O 1N32O 2UXDO 5BXZA 1N36O 4X65O 5H5NA 1I94O 2Z0AA 2UUCO 1NS1A 4X64O 1DK1A 4DV1O 3JAMN 1HNZO 2ZM6O 1XNRO 4NXMO 4DR1O 4JI7O 4DV6O 1G1XB 1F7YA 5FLXN 1XEQA 1A32A 2DJVA 5IT9N 1FYJA 2FKXA 4A5UB 3T1YO 2N74A 3M8AA 1IBLO 1XMQO 4LF9O 4DV7O 1FJGO 3J80N 3OTOO 4LF6O 4DV4O 1R6TA 4DR2O 3O65A 4NXNO 1HNXO 4YY3O 1X59A 1YZBA 4OPHA 1N33O 3SDLA 4DV3O 4DUZO 4JI0O 2UUAO 5IWAO 3R66A 4LF5O 2UXBO 2HHHO 4OPAA 2UUBO 4LFCO 1J5EO 4OX9O 2VQFO 4LFBO 4LF8O 4DR3O 4B3SO 4JI6O 4DV2O 4GKJO 2LW7A 2E5LO 4DUYO 1HR0O 1FKAO 1IBKO 1KUQA 2AGAA 5A2QN 2UU9O 4DR6O 4DR4O 2JRIA 4LFAO 4DR5O 1XNQO 5LMUO 2F4VO 4JV5O 4JI2O 4B3RO 4DR7O 1AILA 3J81N 1HNWO 1AB3A 4DV5O 2DOSA 3T1HO 4X62O 4LF4O 1D2DA 2UXCO 1R1BA
chains in the Genus database with same CATH superfamily
1LUWA 2GTAA 3W7SA 4I55A 2DWEC 1BZKA 1Q43A 4J10A 2ZQMA 1XI1A 4GLXA 1KYOF 2W6JG 5B5EZ 3LSUA 4PJ0Z 4EKWA 4JI5O 5LXTB 2HR3A 1QBZA 3OGCC 1M90W 1BMFG 1KP2A 3ASOB 3EFFK 1Q5OA 2K9PA 4YJ3B 3WFVA 2XUMA 3B77A 1XL6A 1VARA 2W0FC 1Q7YW 3E8FA 4JI4B 1FJGB 1M9NA 1L0NH 4GUNA 5GW7A 1N0NA 2B1GA 1P7GA 3KCYA 3RYHA 5CBGA 4CS3A 2NR5A 3O65A 1I94B 3ZRWB 1GAXA 5FNVA 2A9HA 4JGSA 2KKWA 2ODMA 3JYCA 1XREA 3FKSG 4TV9B 1N8RW 4O2BA 4LH6A 5BMVA 2WA4A 4DR2B 4XBFA 2Y48A 4IHJA 2A06H 4LF8O 1G6UA 4MVQA 1THZA 5L3BA 1N0JA 3VQVA 3AG2C 5KMGB 1VQ7V 2ZE7A 4LF5B 4ZOLA 3CXHF 4C7UA 4MVZA 1SETA 3BFRA 4DW1A 4FPPA 2UUBB 3AK3A 5CB4B 2WLJA 4RUFA 4DO2A 5EIBC 2VWKA 3CRCA 2CTQA 2XTAA 4LCUC 3D3QA 5JJNB 4O2AB 4LFAB 4DR5B 3F5TA 2FYUH 5B1AC 4MVMA 4TQDA 4HNAA 2Z3YA 3LSSA 4JI4O 1YI2V 3FYEB 4I4TB 3RW0A 5JWPA 1EFRG 2LW1A 4GYCB 2HJFC 2WSSG 4KHPB 4JI1B 4JI3B 1YHQV 3UT5B 1VQ6V 4IIJA 2HG5C 3F7YC 5DN6G 1I94O 4PDRA 1Y67A 4O4IB 5EBLC 3CHXA 1FXVA 1SQBH 3CCQV 4EEQA 1B3QA 5JQGB 1F7YA 1QVGU 2P90A 5IT9N 2N74A 1VIBA 4CH5A 4DR2O 1Q6IA 5L3GA 2QEXV 5JCOA 2IJIA 3I56V 3B8MA 4LF5O 1XILA 1K73W 4FLXA 2ZCEA 4DV7B 3T2MA 2UUBO 4P9PA 4CS2A 4QJFB 5EC1C 4OX9O 5AG2A 1K5SA 4EB6A 1SERA 2MW2B 1VQOV 2LW7A 2Q0AA 2FL4A 1NT2B 1KUQA 1SQQH 2EIJB 2XAQA 2F1MA 3ZHRA 4DR5O 3AG4B 4LFAO 5BZBA 1Q81W 3JALB 1MNGA 2HHHB 1HNWB 3N2KA 2BTQB 3CJHA 4LFCB 4G2KA 1J5EB 4H13B 3T1CA 1RM1B 1L8DA 1NQTA 2CK3G 4AHCA 4DR3B 2UXCB 3ZHUA 5HFMA 5H9CA 2YS8A 1PL4A 4UV8A 5IYCO 2GDSA 3GWOA 1BCCH 4DR4B 1YXBA 1QQCA 4P2ZA 4KHPO 2JGDA 4JI1O 4JI3O 4CH3A 4JASA 1JA8A 3RYIB 2EBOA 2DYRC 3RT3C 5JH7B 1BQZA 4K35A 4PDMA 5EYPB 4B3MB 3A0BZ 4YJ2A 2XAHA 3SYOA 1WPBA 1BHAA 5J2UA 4X88A 2CDYA 4KXRA 3STZC 3D3IA 1IURA 2FB5A 1YEWA 4JYAB 2A7WA 3W7UA 1G8MA 4RWUA 4H0LB 2DYSB 1NBMG 2DJVA 3JD2A 2FKXA 1S5JA 2Q73A 4DV7O 4LF6O 3K5MA 1TA8A 3H1IH 4FLVA 1Y4MA 1N33B 4JTDB 4LWSB 4JZ2A 3ZHSA 4DV3O 4DV6B 1AVMA 5B1OA 2UXBO 3DC6A 1D5NA 3ABUA 2HHHO 1H2SB 3ABLC 4LFCO 1J5EO 1AI4A 3TJTA 2PY5A 2EJ7A 4DR3O 1H2NA 1L1FA 1AI7A 3JD1A 5B3SB 5LMUB 3WU2Z 1WPXA 4DR4O 4CC6A 1FFXA 3S3WA 2HEPA 1VF5B 3FB7C 1BGYH 2CE4A 4WFFA 3DSQA 3A0HZ 2G38A 2BOBC 4RO2A 1FAFA 3NXSA 4FZ0A 3ZN0A 2Q0OC 4B08A 5J2TA 5LOVB 5CA0A 2LGWA 1R3KC 1RFYA 2P67A 4MTOA 2YEVA 3JSNA 4W4LA 5LL6Y 1S0VA 3M7MX 3W7WA 4JYAO 3QVNA 2ZDIA 2H94A 4PV1B 3E2EA 4O4JB 4U3JB 3ZMTA 4JPRA 1IBMO 3K0GA 3AK1A 2LJ2A 4JF3A 1WA8A 5BXZA 3S3XA 3ZRXA 3ETDA 2Q68A 4ZBMA 2AZ2A 1QLNA 4BW5A 4P9OA 2HP8A 3DXRA 1YTFD 4DV6O 3QF7A 2QE7G 3HB3B 2AW9A 5LYJB 4G28B 3AG2B 4BAYA 4NXNB 3WB1A 3CCUV 4UCTA 4GZRB 1OCCC 1Q8IA 2PUSA 1E1RG 3OEHG 1S72V 1NTMH 1GO3F 1GK9A 2VS0A 1Y76A 1QVFU 3SDLA 4DUZO 5H6RA 3T4DA 1GN4A 1MMMA 1AI5A 4X1KB 2ZNJA 4QIWF 4PA9A 2KSDA 2EIKB 1COWG 5KX5B 4FFBB 3JAWA 4OXSA 2NNUA 4DYLA 2OCHA 3ZN1A 4R6ZA 4WFHA 1OCRB 4JI0B 4U7NA 1MA1A 2KQXA 2FTKA 3K5OA 3SJBC 2JRIA 4ZI7A 1XNQO 1ZL8A 1AILA 5GTIZ 3ICXA 3A0RA 3G67A 3VQYA 1GM7A 2B5UA 5IYZA 3K58A 2OWOA 2ZXWC 1AR4A 1NVPD 1W0JG 3T4ZA 2BSKA 1Q3EA 5F2VO 4JV5B 3CD6V 2QWPB 5IJ0A 4NTYA 3B4SA 5IY5C 4B3TB 1WP8A 1Y74A 3FX7A 4LNUA 3WB0A 2EZPA 2QTSA 1K97A 4J7KA 2F95B 1AP6A 2PYJA 3UO2A 1Q6UA 3G6EV 3WG7C 4Z1MG 3A8TA 2Q7EA 2ZM6O 1P84F 3TXSA 1G1XB 3RYFA 2QM8A 2Y4TA 1ORQC 2IH3C 2KG7A 2YI8A 4LF9O 4Q6GA 4WBNA 3J80N 5KHGA 4YXWG 2IW5A 3VQWA 4UV9A 3EXAA 4MSWC 4X65B 2Y0PA 4JYBA 1FS0G 2W6IG 4OPHA 3KKYA 2QDOA 5IWAB 3O9OA 3K06A 4JI0O 1NI8A 1VMGA 2EX3A 4GX0A 4CC5A 5EBMC 1FD9A 1SQVH 4J11A 1SKVA 1ZLZA 1FXKB 2DYRB 5LXTA 2HJDA 1EM1A 3L70H 4WFBV 3IJ4A 2F4VB 3KZIZ 4PHZA 2F23A 1YCIA 4YJ3A 4HAMA 3L9DA 4QGPA 1Q86W 5LP6B 4JV5O 3VQXA 1JPXA 4K3AA 1M4UA 2Q69A 1JR9A 2KB1A 3H9VA 4UVBA 4TSFG 2WPDG 2CH7A 1IBKB 1R1BA 2X7RB 2WLLB 5B1BB 3ZRVA 2ILMA 1YJ9V 3LUTB 4JAVA 2RMKB 2QKCA 2DQ0A 1YITV 3BPZA 3Q4HA 4NR1A 4FM2A 4TV9A 1NZ6A 5JCOC 2ZNIA 2V4DA 1IVSA 1TAEA 3T1HB 1SA0B 4TV8B 4ZHQA 2Q6AA 5BR8B 3AEIA 4QPKA 3I55V 4WF9V 1N36O 5LHIA 1WAZA 1XL4A 4X65O 4NXMB 2CTPA 1SZTA 5KUMA 2EILB 2F43G 1QNMA 2P6JA 2IH1C 1CPYA 3CMEV 5CB4A 1HNXB 4N23A 3JASB 5FPOA 3JAKB 4WFEA 1EN4A 3RBZA 3UKMA 1HW7A 3IAYA 3OM3B 5ITZB 4O2AA 4I50A 5K1PA 2LGQA 3E35A 2OCCB 1YJNV 3BVOA 3A2FA 4DV2B 3HKBB 1GRJA 4I4TA 4KL1A 3UT5A 5DM6V 1IBKO 1NJIW 4TWKA 1PKXA 1U97A 1JCHA 1K34A 1ZAUA 3OMIB 5L3EA 4O4IA 1NTKH 3CRRA 1JVMA 4JI2O 1NTZH 3B40A 1JQ0A 4J42A 3AG3C 3B09A 4ASUG 5JQGA 3HKEA 1KB9F 1AB3A 4B3SB 2RN9A 5K1XA 1V54C 1Z5VA 1KECA 3T1HO 2QWNB 1BT8A 3DC5A 3HKDB 2ZE6A 3ZCCA 5BR8O 4ABMA 1PPJH 4N21A 3H1KH 3CRMA 4LC1A 4JYYA 5CA1A 1S5HC 3K08A 4IYHA 3DTUB 3ZHQA 5DEDA 2CTWA 1T5EA 2VWJA 2NN4A 4UB8Z 3MHSC 2WLHA 5L3FA 4K8ZA 2CAZC 3ABKC 1VF7A 1NS1A 3OE7G 3AG1C 3JALA 2BTQA 2M6YA 4QE7A 2LQTA 1V9PA 3MDSA 3K9SA 1FFTB 3CYOA 1FJGO 2DMXA 2QM7A 2UXDB 1TUBB 5JJJB 3DGEA 2DWDC 1XQ8A 2XT9A 3RYCB 4QE9A 1AJPA 4X1YB 1M93A 3N27A 4MVSA 2JK5C 3RVYA 5L3DA 5JH7A 2ZXWB 3RYHB 1SQPH 3CRAA 4PDLA 3ZMZA 4X1IB 2ZDIC 4B3SO 1JOYA 3BRCA 3BABA 4NB5A 1VQ5V 3ZHVA 2BOCC 4O2BB 3J81N 5BMVB 4DV5B 2GV9A 1CEZA 4PA6A 1M5IA 1MSWD 3ZJZA 2VQFB 4IHJB 4UCRA 4WCEV 3U10A 4DUYB 2Y4UA 4UVCA 4FM1A 3M99B 2JJ2G 3JARA 4WFGA 3L72H 3P3PA 4LWSA 1RP3B 4FZ1A 3JATB 2X6BA 1U96A 2AXTZ 1SQFA 1OCOC 5H6QA 2HVKC 2R9AA 1XHXA 3ABMB 1QCEA 1K8AW 4PELA 1S3JA 1KC8W 3CCJV 3OR6C 1EZJA 2UXDO 3LNNA 4X20B 2W0XA 5C8YA 3WB2A 4Z2WA 1DK1A 3EVKA 1ZWIC 3CP1A 3X2QB 1H2GA 4HNAB 2YIDA 4O4LA 3THOA 1M57B 2ZINA 4A5UB 2WWWA 2A3QA 4LR3A 3CWBH 2D2CB 4IIJB 5LOVA 1HWYA 2XASA 3RFRA 4I9WA 1HNZB 3P32A 2JGUA 1XNRB 4JI7B 3LDCA 5LA6A 5H2FZ 3ZHTA 5JJEB 3ASNC 4J41A 1IBLB 2EIMC 4BIOA 3ABTA 4U3JA 2VQFO 1QHTA 1R6KA 2GUZB 5CBHA 5D5QA 5B66Z 1RSOB 4DUYO 1EN5A 2AGAA 4DR7B 3E83A 2WLNA 3CX5F 2NLJC 4HZ3A 4J9YB 1PNKA 4LBEC 4CH6A 1HNWO 4QNHB 2LFRA 2EINC 2IJKA 5LYJA 4JI6B 5KHIA 1MZFA 1IXMA 2P7TC 4MTFA 1UJWB 2UXCO 1ZUQA 3H1HH 1XMOB 5IYBO 1GMGA 2R70A 4PA7A 2Y69C 1NU1H 3J7AU 1KBHA 3N2KB 3F7VC 1Z2GA 2V1DA 1NR7A 4DXWA 4RQFA 1K4DC 4PD4F 5GONB 4H44B 1V55C 4X1KA 4UFZA 2Q5ZA 3SYAA 1VQLV 1PM9A 2A0LA 2C2AA 2RNBA 5EZYB 3ETQA 2P5OA 1M56C 4FFBA 1VP7A 4AILC 1B6QA 4B3MO 2HKOA 4CH4A 1EN6A 3U0ZA 2JGDB 4L8JA 3VOUA 4J7ZA 4W4KA 5J9PC 1JMKC 1K5QA 1X4TA 3BEHA 1HNZO 2PI4A 1XNRO 2PI5A 4K0KB 1JJOA 4JI7O 1NH2B 1OV9A 4YJ2B 5KA6A 1IBLO 1QU7A 4GKKB 1N32B 1JFFA 5CA3A 1OZ0A 4FFKA 4R8CA 3BHPA 3K5LA 4BWAA 3IGAC 2XAJA 1N33O 3K5NA 2Y0IA 5LGNA 3K57A 2GBOA 1GH6A 2JEUA 2QSAA 2ZE8A 4EFBA 5IJ9B 1PL0A 3MAQA 4DV4B 1ZSPA 1DTOA 2YXHA 1AROP 4JI6O 1BS3A 1Y6XA 2XAGA 4FLUA 3VBBA 1YSCA 3HPLC 3U11A 5LMUO 1OHHG 3D36A 4FM0A 3JD4A 3E22A 1K9MW 3ABKB 4B7KA 2IJJA 3ZS8C 3BCCH 2WA3A 5TISZ 5B1AB 3FB8C 3QG5A 1FXHA 3CB2A 4WFAV 3K04A 4B3RB 2ADQB 5FL7G 4R50A 1SS3A 1H2MA 1W0KG 2QTOA 2UXNA 4MT8A 1P7BA 2Q7HA 4MVUA 3CCRV 1F4MA 4K0KO 1URFA 4J7JA 5J2TB 5KHKA 2IBZH 3BA8A 1WJZA 1KMIZ 1FXKA 4GKKO 1N32O 1DF4A 2H3OA 3CCVV 4GX1A 2Z0AA 4TUYB 1GKFA 1S76D 2QKAA 3I5DA 1VF6A 2JJ1G 2VQEB 3TETA 3FB5C 5LP6A 1O9HA 3M8AA 5CBFA 1WB7A 4BIZA 4MW3A 2D3OW 3CPWU 4DV4O 4NXNO 3UM7A 3OFNG 2X6AA 4NVPA 2HFEC 2P06A 1S77D 3UQ8A 1YZBA 2AHYA 1H8EG 3AK2A 3IC7A 2WLLA 4DRXA 4ZIBA 3G6BA 3LDEA 5EBWC 4JYCA 4I0XB 2PTMA 1XMQB 1ZTEA 3E8BA 3LNMB 4JTAB 4KFMA 1N4CA 3BY6A 3SYQA 4UXNA 5B1NA 1SA0A 2AHZA 3C3TA 4KP4A 2ZR3A 3CC2V 4F6RB 1Y76B 4BR6A 3CS5A 4GCZA 3IC9A 3SYCA 4B3RO 1OJHA 3K79A 4FLTA 2EIJC 1LNQA 3FB6C 3QO5A 4LFBB 1W2BU 1ZX3A 5GTHZ 1BE3H 4JAUA 4GX5A 3JAKA 4BIUA 1Q82W 1SESA 2XNDG 4PDVA 1NKDA 3SPHA 5ITZA 3CXCU 4FLZA 3OEEG 4F4LA 2P4KA 4H33A 4FLYA 2XHBA 1PV0A 2WLMA 1PP9H 3UCSC 1JJ2U 2VQEO 4B3TO 3GWKC 1TVKB 3TXQA 1H38A 1L0LH 2BSKB 4O4HB 2GSMB 1RPRA 3ZRWA 4AQYB 1RPOA 4Z1VA 4IYIA 1OCZC 1US6A 4P30A 3OUSA 3SJAC 1SF9A 1I08A 1WN7A 4YHHB 2LFSA 4DV0B 2V7QG 5KAIZ 3CCEV 1XMQO 4KUMA 3K0DA 1Q6HA 2L35A 4YIPA 2DYSC 4DV1B 2BCCH 1AR5A 3OR7C 3ABLB 4DR1B 2X6CA 4J80A 5KMGA 3G4SV 2IM9A 4FVMA 4MS2A 3RYFB 5IWAO 4B7EA 3K59A 3T1YB 2KG7B 3RN4A 2ITDC 4Q20A 5LHGA 5A9GA 3N2GB 1O9GA 4WBNB 4DK1A 3PJSK 3OMAB 4K8XA 3H01A 3ZMSA 2CGOA 1LUVA 3IFXA 5D5PA 4LFBO 3ZMUA 2EJRA 2QWQB 1V55B 1ROPA 4PA3A 1W59A 3APQA 3ZX6A 1M56B 5B3SC 2F4VO 1CXZB 4PI0A 1K33A 3G80A 1H8HG 3SPJA 2Z5UA 2P4VA 4CBCA 3K9AA 3K03A 3TCUA 1TUBA 2YC0A 2UU9B 1DGSA 3JCZA 1XOUA 1H2LA 2YXLA 3RYCA 4AQYO 4OGQB 4X1YA 2X0LA 3UO3A 2RQ6A 5EK0A 3B8NA 4MTXA 2WLIB 3STLC 2OIEA 3KCXA 5LGTA 1YTFB 3FAVB 3ZRSA 1XHZA 4NYKA 4I7ZB 2CH7B 2ZT9B 2CGNA 4YHHO 4DV0O 1IXBA 3L74H 1GN2A 3CSXA 4X1IA 3KG2A 3CRQA 3P30A 3F5WC 4DV1O 3Q4HB 1NH2D 3BAAA 2R9IA 4R7CA 2HLDG 4DR1O 4NXMO 1OCCB 4YIOA 5JVDB 3HKCB 4FJCC 5FLXN 1FPOA 3T1YO 1F23A 4FIPC 2H8PC 4ZHQB 1R6TA 5KA5A 4ZKIA 1HNXO 1E79G 4J9ZB 1WB8A 4X64B 1SQGA 4I55B 3ETGA 3R65A 2FMLA 1KU9A 1TGOA 3JATA 4OX9B 3R66A 4JTCB 2YDEA 1TUEB 3OTOB 4MVOA 1UFIA 4I9QA 3GB7C 1EZVH 4DV2O 4TT3G 5LGUA 4I50B 1QLEC 4FLWA 2EIKC 5EIBD 4IL6Z 2E3CA 4RUEA 2UU9O 1NVPB 4X20A 4ICGA 2UUAB 3E89A 3E86A 4UCSA 3RYIA 1OCRC 2K1EA 1AP5A 3H1JH 5CN0A 2PF4E 1SC5B 1P49A 1AJNA 2B1IA 2AZ0A 5EYPA 2R9RB 3OT7A 4NKGB 1ENVA 5FNVB 1D2DA 4DR6B 2PGGA 2YSUB 5IY5B 4FMTA 3SR2C 5E79Z 3P3NA 5KUKA 1R3IC 3BA9A 3SJQC 2ATKC 3HKEB 2Q4PA 3WG7B 1YVWA 2PYLA 1AR1B 1QR9A 4L87A 4FK5C 2GUZA 1R3LC 1MABG 2F93B 2EZOA 2WLKA 5EC2C 1RSOA 1WNSA 4IGGA 1IX9A 4X64O 4ZOLB 4F6EA 5CA1B 3RWRD 2OYQA 4XDJA 2BE3A 4LF6B 4LF7B 4E4EA 5CMUA 2XAFA 3OTFA 3D36C 3OTOO 4D7TA 1BQ0A 2BTOA 2DE0X 2JDIG 4DV3B 2OTJV 1X59A 2B9ZA 2O57A 2ARHA 3ZBHA 2UXBB 2ETNA 1B06A 3CMAV 3OD4A 2UUAO 2ZIMA 5GONA 1M1KW 4OPAA 3D8CA 3L71H 4MW8A 3C3SA 5EZYA 1HP8A 5KLVH 3SYPA 4YY3B 1VQPV 3CEIA 2YXYA 1H2KA 4DR6O 1BSMA 1FXKC 2LO1A 2YIBD 4H37A 2MK3A 3QTCA 3ZMVA 5LHHA 3TK1A 1K4CC 3CCSV 2OIGA 3FYIB 1R3JC 3E8GA 1VF6C 4DV5O 2Q7GA 1OCZB 2YICA 5LP6C 2DOSA 1AJQA 4O4JA 4UCOA 3FD9A 3C90A 3G71V 3ZIAG 2JEXA 4TOIA 3TGUH 1XBLA 4MTGA 1WP7A 4TQFA 4GX2A 5B1BC 1IBMB 5IJ9A 4U3FH 1UPGA 2ZE5A 4EB6B 4CZZA 4LF7O 1KP3A 4PI2A 4RAIA 1MOFA 3JARB 1YDXA 5FPRA 4X66B 2OTLV 1GTOA 1N34B 3H1LH 5LMNB 2RCVA 3CJHB 3SPGA 4GT1A 1MG1A 4DW0A 3L73H 2R72A 1NR1A 2ZD9A 2EILC 2YUAA 1VQNV 4UB6Z 2E74B 5KX5A 2ZR2A 3QNEA 5C8YB 2JS5A 4DUZB 4YY3O 3APOA 2F66C 3QO8A 1S5LZ 4AI8A 2IJHA 4UUJC 4HBNA 4IT5A 2JS3A 4O4LB 2YI9A 3ASOC 4G27B 4DK0A 3ML0A 3MHHC 5E1AC 1J95A 2QM4A 5KAFZ 4LP8A 2OT5A 1CP9A 1WLEA 3SGIA 1VQMV 2OCCC 1QR8A 5J2UB 1D5AA 1VQ9V 1XNQB 1MZEA 3AG3B 1FKAO 2M7WA 3OW2U 5LA6B 2QGNA 4TUYA 1GM8A 1V54B 4DR7O 3CCLV 1VQ4V 2QJ1A 1SQXH 1YF2A 5LBQA 1E1QG 4CS4A 2E5LB 1Z5WA 3QO7A 4I5SA 5DECA 2IU0A 3W7TA 2ZIOA 2QWOB 4X66O 3CC4V 3CCMV 1PD3A 1XMOO 1N34O 3E8HA 5LMNO 1GN3A 4I0XA 1VEWA 2JVDA 1I7FA 3AG1B 2A79B 2UXXA 1G4YB 1PNMA 1LR1A 1FFXB 4F6RA 2ZM6B 5H5NA 2DQ3A 3PN1A 3JAMN 5C93A 4EFEA 5IE9A 1P4RA 4LF9B 3LDDA 2YIBA 1FYJA 1A32A 1QLEB 1JX9A 1BL8A 4JI8B 1Y66A 5CA0B 1KKDA 2ITCC 2QKSA 3CE2A 4XDLA 4MVRA 1IDSA 2UUCB 4NTWA 3GVMA 5IYDO 2YEVB 1KKCA 4HYOA 2VRZA 3FFQA 1SRYA 2JIZG 2P22C 2YIAA 1I5XA 1I5YA 3L75H 1JFFB 1TVKA 5KHJA 1KQSU 1WA8B 1SZXA 2Q67A 4LH7A 5HFLA 2E5LO 1F4NA 4O4HA 5A2QN 2L6LA 1K7DA 3MD0A 3SPIA 1K92A 3JD3A 3AG7A 3K3WA 3DXRB 3RVZA 4X9QA 4X8AA 1HDJA 3EHBB 4UVAA 1YIJV 1EBOA 1IZ3A 2RJZA 5IDJA 4GKJB 2EULA 2GTSA 3JCUZ 3JD0A 4PA4A 4TV8A 1HR0B 4RQEA 2ZKOA 3CC7V 3LSQA 2QA4V 1XUQA 1OCOB 2DW4A 5BY1A 4UCUA 3E22B 1VQ8V 2CUGA 3B2EE 1KD1W 3N2GA 3AG4C 3JAWB 4X62B 4LF4B 1VQKV 2LP7A 1N36B 1GM9A 3JASA 4JI8O 1R73A 2N04A 1RM1C 1MSDA 4ZI7B 3ABMC 2UUCO 2N05A 3NR7A 1ZL8B 4JAAA 1PNLA 1Q90D 3W7XA 3RGBA 2DN9A 4NTXA 1XEQA 4JI5B 3OGIB 4XDKA 3ZEDA 1DLBA 3X2QC 2QWRB 4JZGA 5IYZB 3HKBA 3JSLA 1BHBA 1M57C 3SPCA 2RDCA 3ASNB 2XOKG 4E2LA 2ADPA 5IJ0B 4UCVA 3ETEA 2EIMB 2Q8VA 4X89A 4U7OA 1Y74B 4LNUB 4D7SA 2E76B 2PZSA 2WLIA 3SJCC 3FAVA 1GN6A 1DF5A 5KHHA 2HVJC 5L3CA 1F51A 1B04A 4GKJO 2Q9LA 3OMNB 1HR0O 4DRXB 3HR0A 3HKDA 4JI2B 2CTRA 1AI6A 2QR4A 4QPJA 1YJWV 4D6TH 2EINB 2IU3A 1XDCA 3OUFA 1I0HA 2E75B 5JVDA 2WAMA 4BW9A 3HKCA 4LF8B 3OAAG 1K3EA 1R6NA 2Y69B 4X62O 4LF4O 2GHYA
chains in the Genus database with same CATH topology
5BR8O 2ZKOA 4KHPO 4JI1O 4JI3O 3J7AU 3F5TA 4X66O 1XMOO 1N34O 3RT3C 5BY1A 4AQYO 5LMNO 5LL6Y 4JYAO 2VQEO 4K0KO 4B3TO 4JI4O 4LF7O 4YHHO 4DV0O 4JI5O 1IBMO 4B3MO 4GKKO 4JI8O 1N32O 2UXDO 5BXZA 1N36O 4X65O 5H5NA 1I94O 2Z0AA 2UUCO 1NS1A 4X64O 1DK1A 4DV1O 3JAMN 1HNZO 2ZM6O 1XNRO 4NXMO 4DR1O 4JI7O 4DV6O 1G1XB 1F7YA 5FLXN 1XEQA 1A32A 2DJVA 5IT9N 1FYJA 2FKXA 4A5UB 3T1YO 2N74A 3M8AA 1IBLO 1XMQO 4LF9O 4DV7O 1FJGO 3J80N 3OTOO 4LF6O 4DV4O 1R6TA 4DR2O 3O65A 4NXNO 1HNXO 4YY3O 1X59A 1YZBA 4OPHA 1N33O 3SDLA 4DV3O 4DUZO 4JI0O 2UUAO 5IWAO 3R66A 4LF5O 2UXBO 2HHHO 4OPAA 2UUBO 4LFCO 1J5EO 4OX9O 2VQFO 4LFBO 4LF8O 4DR3O 4B3SO 4JI6O 4DV2O 4GKJO 2LW7A 2E5LO 4DUYO 1HR0O 1FKAO 1IBKO 1KUQA 2AGAA 5A2QN 2UU9O 4DR6O 4DR4O 2JRIA 4LFAO 4DR5O 1XNQO 5LMUO 2F4VO 4JV5O 4JI2O 4B3RO 4DR7O 1AILA 3J81N 1HNWO 1AB3A 4DV5O 2DOSA 3T1HO 4X62O 4LF4O 1D2DA 2UXCO 1R1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 O;  2ZKO A;  4KHP O;  4JI1 O;  4JI3 O;  3J7A U;  3F5T A;  4X66 O;  1XMO O;  1N34 O;  3RT3 C;  5BY1 A;  4AQY O;  5LMN O;  5LL6 Y;  4JYA O;  2VQE O;  4K0K O;  4B3T O;  4JI4 O;  4LF7 O;  4YHH O;  4DV0 O;  4JI5 O;  1IBM O;  4B3M O;  4GKK O;  4JI8 O;  1N32 O;  2UXD O;  5BXZ A;  1N36 O;  4X65 O;  5H5N A;  1I94 O;  2Z0A A;  2UUC O;  1NS1 A;  4X64 O;  1DK1 A;  4DV1 O;  3JAM N;  1HNZ O;  2ZM6 O;  1XNR O;  4NXM O;  4DR1 O;  4JI7 O;  4DV6 O;  1G1X B;  1F7Y A;  5FLX N;  1XEQ A;  1A32 A;  2DJV A;  5IT9 N;  1FYJ A;  2FKX A;  4A5U B;  3T1Y O;  2N74 A;  3M8A A;  1IBL O;  1XMQ O;  4LF9 O;  4DV7 O;  1FJG O;  3J80 N;  3OTO O;  4LF6 O;  4DV4 O;  1R6T A;  4DR2 O;  3O65 A;  4NXN O;  1HNX O;  4YY3 O;  1X59 A;  1YZB A;  4OPH A;  1N33 O;  3SDL A;  4DV3 O;  4DUZ O;  4JI0 O;  2UUA O;  5IWA O;  3R66 A;  4LF5 O;  2UXB O;  2HHH O;  4OPA A;  2UUB O;  4LFC O;  1J5E O;  4OX9 O;  2VQF O;  4LFB O;  4LF8 O;  4DR3 O;  4B3S O;  4JI6 O;  4DV2 O;  4GKJ O;  2LW7 A;  2E5L O;  4DUY O;  1HR0 O;  1FKA O;  1IBK O;  1KUQ A;  2AGA A;  5A2Q N;  2UU9 O;  4DR6 O;  4DR4 O;  2JRI A;  4LFA O;  4DR5 O;  1XNQ O;  5LMU O;  2F4V O;  4JV5 O;  4JI2 O;  4B3R O;  4DR7 O;  1AIL A;  3J81 N;  1HNW O;  1AB3 A;  4DV5 O;  2DOS A;  3T1H O;  4X62 O;  4LF4 O;  1D2D A;  2UXC O;  1R1B A; 
#chains in the Genus database with same CATH topology
 1LUW A;  2GTA A;  3W7S A;  4I55 A;  2DWE C;  1BZK A;  1Q43 A;  4J10 A;  2ZQM A;  1XI1 A;  4GLX A;  1KYO F;  2W6J G;  5B5E Z;  3LSU A;  4PJ0 Z;  4EKW A;  4JI5 O;  5LXT B;  2HR3 A;  1QBZ A;  3OGC C;  1M90 W;  1BMF G;  1KP2 A;  3ASO B;  3EFF K;  1Q5O A;  2K9P A;  4YJ3 B;  3WFV A;  2XUM A;  3B77 A;  1XL6 A;  1VAR A;  2W0F C;  1Q7Y W;  3E8F A;  4JI4 B;  1FJG B;  1M9N A;  1L0N H;  4GUN A;  5GW7 A;  1N0N A;  2B1G A;  1P7G A;  3KCY A;  3RYH A;  5CBG A;  4CS3 A;  2NR5 A;  3O65 A;  1I94 B;  3ZRW B;  1GAX A;  5FNV A;  2A9H A;  4JGS A;  2KKW A;  2ODM A;  3JYC A;  1XRE A;  3FKS G;  4TV9 B;  1N8R W;  4O2B A;  4LH6 A;  5BMV A;  2WA4 A;  4DR2 B;  4XBF A;  2Y48 A;  4IHJ A;  2A06 H;  4LF8 O;  1G6U A;  4MVQ A;  1THZ A;  5L3B A;  1N0J A;  3VQV A;  3AG2 C;  5KMG B;  1VQ7 V;  2ZE7 A;  4LF5 B;  4ZOL A;  3CXH F;  4C7U A;  4MVZ A;  1SET A;  3BFR A;  4DW1 A;  4FPP A;  2UUB B;  3AK3 A;  5CB4 B;  2WLJ A;  4RUF A;  4DO2 A;  5EIB C;  2VWK A;  3CRC A;  2CTQ A;  2XTA A;  4LCU C;  3D3Q A;  5JJN B;  4O2A B;  4LFA B;  4DR5 B;  3F5T A;  2FYU H;  5B1A C;  4MVM A;  4TQD A;  4HNA A;  2Z3Y A;  3LSS A;  4JI4 O;  1YI2 V;  3FYE B;  4I4T B;  3RW0 A;  5JWP A;  1EFR G;  2LW1 A;  4GYC B;  2HJF C;  2WSS G;  4KHP B;  4JI1 B;  4JI3 B;  1YHQ V;  3UT5 B;  1VQ6 V;  4IIJ A;  2HG5 C;  3F7Y C;  5DN6 G;  1I94 O;  4PDR A;  1Y67 A;  4O4I B;  5EBL C;  3CHX A;  1FXV A;  1SQB H;  3CCQ V;  4EEQ A;  1B3Q A;  5JQG B;  1F7Y A;  1QVG U;  2P90 A;  5IT9 N;  2N74 A;  1VIB A;  4CH5 A;  4DR2 O;  1Q6I A;  5L3G A;  2QEX V;  5JCO A;  2IJI A;  3I56 V;  3B8M A;  4LF5 O;  1XIL A;  1K73 W;  4FLX A;  2ZCE A;  4DV7 B;  3T2M A;  2UUB O;  4P9P A;  4CS2 A;  4QJF B;  5EC1 C;  4OX9 O;  5AG2 A;  1K5S A;  4EB6 A;  1SER A;  2MW2 B;  1VQO V;  2LW7 A;  2Q0A A;  2FL4 A;  1NT2 B;  1KUQ A;  1SQQ H;  2EIJ B;  2XAQ A;  2F1M A;  3ZHR A;  4DR5 O;  3AG4 B;  4LFA O;  5BZB A;  1Q81 W;  3JAL B;  1MNG A;  2HHH B;  1HNW B;  3N2K A;  2BTQ B;  3CJH A;  4LFC B;  4G2K A;  1J5E B;  4H13 B;  3T1C A;  1RM1 B;  1L8D A;  1NQT A;  2CK3 G;  4AHC A;  4DR3 B;  2UXC B;  3ZHU A;  5HFM A;  5H9C A;  2YS8 A;  1PL4 A;  4UV8 A;  5IYC O;  2GDS A;  3GWO A;  1BCC H;  4DR4 B;  1YXB A;  1QQC A;  4P2Z A;  4KHP O;  2JGD A;  4JI1 O;  4JI3 O;  4CH3 A;  4JAS A;  1JA8 A;  3RYI B;  2EBO A;  2DYR C;  3RT3 C;  5JH7 B;  1BQZ A;  4K35 A;  4PDM A;  5EYP B;  4B3M B;  3A0B Z;  4YJ2 A;  2XAH A;  3SYO A;  1WPB A;  1BHA A;  5J2U A;  4X88 A;  2CDY A;  4KXR A;  3STZ C;  3D3I A;  1IUR A;  2FB5 A;  1YEW A;  4JYA B;  2A7W A;  3W7U A;  1G8M A;  4RWU A;  4H0L B;  2DYS B;  1NBM G;  2DJV A;  3JD2 A;  2FKX A;  1S5J A;  2Q73 A;  4DV7 O;  4LF6 O;  3K5M A;  1TA8 A;  3H1I H;  4FLV A;  1Y4M A;  1N33 B;  4JTD B;  4LWS B;  4JZ2 A;  3ZHS A;  4DV3 O;  4DV6 B;  1AVM A;  5B1O A;  2UXB O;  3DC6 A;  1D5N A;  3ABU A;  2HHH O;  1H2S B;  3ABL C;  4LFC O;  1J5E O;  1AI4 A;  3TJT A;  2PY5 A;  2EJ7 A;  4DR3 O;  1H2N A;  1L1F A;  1AI7 A;  3JD1 A;  5B3S B;  5LMU B;  3WU2 Z;  1WPX A;  4DR4 O;  4CC6 A;  1FFX A;  3S3W A;  2HEP A;  1VF5 B;  3FB7 C;  1BGY H;  2CE4 A;  4WFF A;  3DSQ A;  3A0H Z;  2G38 A;  2BOB C;  4RO2 A;  1FAF A;  3NXS A;  4FZ0 A;  3ZN0 A;  2Q0O C;  4B08 A;  5J2T A;  5LOV B;  5CA0 A;  2LGW A;  1R3K C;  1RFY A;  2P67 A;  4MTO A;  2YEV A;  3JSN A;  4W4L A;  5LL6 Y;  1S0V A;  3M7M X;  3W7W A;  4JYA O;  3QVN A;  2ZDI A;  2H94 A;  4PV1 B;  3E2E A;  4O4J B;  4U3J B;  3ZMT A;  4JPR A;  1IBM O;  3K0G A;  3AK1 A;  2LJ2 A;  4JF3 A;  1WA8 A;  5BXZ A;  3S3X A;  3ZRX A;  3ETD A;  2Q68 A;  4ZBM A;  2AZ2 A;  1QLN A;  4BW5 A;  4P9O A;  2HP8 A;  3DXR A;  1YTF D;  4DV6 O;  3QF7 A;  2QE7 G;  3HB3 B;  2AW9 A;  5LYJ B;  4G28 B;  3AG2 B;  4BAY A;  4NXN B;  3WB1 A;  3CCU V;  4UCT A;  4GZR B;  1OCC C;  1Q8I A;  2PUS A;  1E1R G;  3OEH G;  1S72 V;  1NTM H;  1GO3 F;  1GK9 A;  2VS0 A;  1Y76 A;  1QVF U;  3SDL A;  4DUZ O;  5H6R A;  3T4D A;  1GN4 A;  1MMM A;  1AI5 A;  4X1K B;  2ZNJ A;  4QIW F;  4PA9 A;  2KSD A;  2EIK B;  1COW G;  5KX5 B;  4FFB B;  3JAW A;  4OXS A;  2NNU A;  4DYL A;  2OCH A;  3ZN1 A;  4R6Z A;  4WFH A;  1OCR B;  4JI0 B;  4U7N A;  1MA1 A;  2KQX A;  2FTK A;  3K5O A;  3SJB C;  2JRI A;  4ZI7 A;  1XNQ O;  1ZL8 A;  1AIL A;  5GTI Z;  3ICX A;  3A0R A;  3G67 A;  3VQY A;  1GM7 A;  2B5U A;  5IYZ A;  3K58 A;  2OWO A;  2ZXW C;  1AR4 A;  1NVP D;  1W0J G;  3T4Z A;  2BSK A;  1Q3E A;  5F2V O;  4JV5 B;  3CD6 V;  2QWP B;  5IJ0 A;  4NTY A;  3B4S A;  5IY5 C;  4B3T B;  1WP8 A;  1Y74 A;  3FX7 A;  4LNU A;  3WB0 A;  2EZP A;  2QTS A;  1K97 A;  4J7K A;  2F95 B;  1AP6 A;  2PYJ A;  3UO2 A;  1Q6U A;  3G6E V;  3WG7 C;  4Z1M G;  3A8T A;  2Q7E A;  2ZM6 O;  1P84 F;  3TXS A;  1G1X B;  3RYF A;  2QM8 A;  2Y4T A;  1ORQ C;  2IH3 C;  2KG7 A;  2YI8 A;  4LF9 O;  4Q6G A;  4WBN A;  3J80 N;  5KHG A;  4YXW G;  2IW5 A;  3VQW A;  4UV9 A;  3EXA A;  4MSW C;  4X65 B;  2Y0P A;  4JYB A;  1FS0 G;  2W6I G;  4OPH A;  3KKY A;  2QDO A;  5IWA B;  3O9O A;  3K06 A;  4JI0 O;  1NI8 A;  1VMG A;  2EX3 A;  4GX0 A;  4CC5 A;  5EBM C;  1FD9 A;  1SQV H;  4J11 A;  1SKV A;  1ZLZ A;  1FXK B;  2DYR B;  5LXT A;  2HJD A;  1EM1 A;  3L70 H;  4WFB V;  3IJ4 A;  2F4V B;  3KZI Z;  4PHZ A;  2F23 A;  1YCI A;  4YJ3 A;  4HAM A;  3L9D A;  4QGP A;  1Q86 W;  5LP6 B;  4JV5 O;  3VQX A;  1JPX A;  4K3A A;  1M4U A;  2Q69 A;  1JR9 A;  2KB1 A;  3H9V A;  4UVB A;  4TSF G;  2WPD G;  2CH7 A;  1IBK B;  1R1B A;  2X7R B;  2WLL B;  5B1B B;  3ZRV A;  2ILM A;  1YJ9 V;  3LUT B;  4JAV A;  2RMK B;  2QKC A;  2DQ0 A;  1YIT V;  3BPZ A;  3Q4H A;  4NR1 A;  4FM2 A;  4TV9 A;  1NZ6 A;  5JCO C;  2ZNI A;  2V4D A;  1IVS A;  1TAE A;  3T1H B;  1SA0 B;  4TV8 B;  4ZHQ A;  2Q6A A;  5BR8 B;  3AEI A;  4QPK A;  3I55 V;  4WF9 V;  1N36 O;  5LHI A;  1WAZ A;  1XL4 A;  4X65 O;  4NXM B;  2CTP A;  1SZT A;  5KUM A;  2EIL B;  2F43 G;  1QNM A;  2P6J A;  2IH1 C;  1CPY A;  3CME V;  5CB4 A;  1HNX B;  4N23 A;  3JAS B;  5FPO A;  3JAK B;  4WFE A;  1EN4 A;  3RBZ A;  3UKM A;  1HW7 A;  3IAY A;  3OM3 B;  5ITZ B;  4O2A A;  4I50 A;  5K1P A;  2LGQ A;  3E35 A;  2OCC B;  1YJN V;  3BVO A;  3A2F A;  4DV2 B;  3HKB B;  1GRJ A;  4I4T A;  4KL1 A;  3UT5 A;  5DM6 V;  1IBK O;  1NJI W;  4TWK A;  1PKX A;  1U97 A;  1JCH A;  1K34 A;  1ZAU A;  3OMI B;  5L3E A;  4O4I A;  1NTK H;  3CRR A;  1JVM A;  4JI2 O;  1NTZ H;  3B40 A;  1JQ0 A;  4J42 A;  3AG3 C;  3B09 A;  4ASU G;  5JQG A;  3HKE A;  1KB9 F;  1AB3 A;  4B3S B;  2RN9 A;  5K1X A;  1V54 C;  1Z5V A;  1KEC A;  3T1H O;  2QWN B;  1BT8 A;  3DC5 A;  3HKD B;  2ZE6 A;  3ZCC A;  5BR8 O;  4ABM A;  1PPJ H;  4N21 A;  3H1K H;  3CRM A;  4LC1 A;  4JYY A;  5CA1 A;  1S5H C;  3K08 A;  4IYH A;  3DTU B;  3ZHQ A;  5DED A;  2CTW A;  1T5E A;  2VWJ A;  2NN4 A;  4UB8 Z;  3MHS C;  2WLH A;  5L3F A;  4K8Z A;  2CAZ C;  3ABK C;  1VF7 A;  1NS1 A;  3OE7 G;  3AG1 C;  3JAL A;  2BTQ A;  2M6Y A;  4QE7 A;  2LQT A;  1V9P A;  3MDS A;  3K9S A;  1FFT B;  3CYO A;  1FJG O;  2DMX A;  2QM7 A;  2UXD B;  1TUB B;  5JJJ B;  3DGE A;  2DWD C;  1XQ8 A;  2XT9 A;  3RYC B;  4QE9 A;  1AJP A;  4X1Y B;  1M93 A;  3N27 A;  4MVS A;  2JK5 C;  3RVY A;  5L3D A;  5JH7 A;  2ZXW B;  3RYH B;  1SQP H;  3CRA A;  4PDL A;  3ZMZ A;  4X1I B;  2ZDI C;  4B3S O;  1JOY A;  3BRC A;  3BAB A;  4NB5 A;  1VQ5 V;  3ZHV A;  2BOC C;  4O2B B;  3J81 N;  5BMV B;  4DV5 B;  2GV9 A;  1CEZ A;  4PA6 A;  1M5I A;  1MSW D;  3ZJZ A;  2VQF B;  4IHJ B;  4UCR A;  4WCE V;  3U10 A;  4DUY B;  2Y4U A;  4UVC A;  4FM1 A;  3M99 B;  2JJ2 G;  3JAR A;  4WFG A;  3L72 H;  3P3P A;  4LWS A;  1RP3 B;  4FZ1 A;  3JAT B;  2X6B A;  1U96 A;  2AXT Z;  1SQF A;  1OCO C;  5H6Q A;  2HVK C;  2R9A A;  1XHX A;  3ABM B;  1QCE A;  1K8A W;  4PEL A;  1S3J A;  1KC8 W;  3CCJ V;  3OR6 C;  1EZJ A;  2UXD O;  3LNN A;  4X20 B;  2W0X A;  5C8Y A;  3WB2 A;  4Z2W A;  1DK1 A;  3EVK A;  1ZWI C;  3CP1 A;  3X2Q B;  1H2G A;  4HNA B;  2YID A;  4O4L A;  3THO A;  1M57 B;  2ZIN A;  4A5U B;  2WWW A;  2A3Q A;  4LR3 A;  3CWB H;  2D2C B;  4IIJ B;  5LOV A;  1HWY A;  2XAS A;  3RFR A;  4I9W A;  1HNZ B;  3P32 A;  2JGU A;  1XNR B;  4JI7 B;  3LDC A;  5LA6 A;  5H2F Z;  3ZHT A;  5JJE B;  3ASN C;  4J41 A;  1IBL B;  2EIM C;  4BIO A;  3ABT A;  4U3J A;  2VQF O;  1QHT A;  1R6K A;  2GUZ B;  5CBH A;  5D5Q A;  5B66 Z;  1RSO B;  4DUY O;  1EN5 A;  2AGA A;  4DR7 B;  3E83 A;  2WLN A;  3CX5 F;  2NLJ C;  4HZ3 A;  4J9Y B;  1PNK A;  4LBE C;  4CH6 A;  1HNW O;  4QNH B;  2LFR A;  2EIN C;  2IJK A;  5LYJ A;  4JI6 B;  5KHI A;  1MZF A;  1IXM A;  2P7T C;  4MTF A;  1UJW B;  2UXC O;  1ZUQ A;  3H1H H;  1XMO B;  5IYB O;  1GMG A;  2R70 A;  4PA7 A;  2Y69 C;  1NU1 H;  3J7A U;  1KBH A;  3N2K B;  3F7V C;  1Z2G A;  2V1D A;  1NR7 A;  4DXW A;  4RQF A;  1K4D C;  4PD4 F;  5GON B;  4H44 B;  1V55 C;  4X1K A;  4UFZ A;  2Q5Z A;  3SYA A;  1VQL V;  1PM9 A;  2A0L A;  2C2A A;  2RNB A;  5EZY B;  3ETQ A;  2P5O A;  1M56 C;  4FFB A;  1VP7 A;  4AIL C;  1B6Q A;  4B3M O;  2HKO A;  4CH4 A;  1EN6 A;  3U0Z A;  2JGD B;  4L8J A;  3VOU A;  4J7Z A;  4W4K A;  5J9P C;  1JMK C;  1K5Q A;  1X4T A;  3BEH A;  1HNZ O;  2PI4 A;  1XNR O;  2PI5 A;  4K0K B;  1JJO A;  4JI7 O;  1NH2 B;  1OV9 A;  4YJ2 B;  5KA6 A;  1IBL O;  1QU7 A;  4GKK B;  1N32 B;  1JFF A;  5CA3 A;  1OZ0 A;  4FFK A;  4R8C A;  3BHP A;  3K5L A;  4BWA A;  3IGA C;  2XAJ A;  1N33 O;  3K5N A;  2Y0I A;  5LGN A;  3K57 A;  2GBO A;  1GH6 A;  2JEU A;  2QSA A;  2ZE8 A;  4EFB A;  5IJ9 B;  1PL0 A;  3MAQ A;  4DV4 B;  1ZSP A;  1DTO A;  2YXH A;  1ARO P;  4JI6 O;  1BS3 A;  1Y6X A;  2XAG A;  4FLU A;  3VBB A;  1YSC A;  3HPL C;  3U11 A;  5LMU O;  1OHH G;  3D36 A;  4FM0 A;  3JD4 A;  3E22 A;  1K9M W;  3ABK B;  4B7K A;  2IJJ A;  3ZS8 C;  3BCC H;  2WA3 A;  5TIS Z;  5B1A B;  3FB8 C;  3QG5 A;  1FXH A;  3CB2 A;  4WFA V;  3K04 A;  4B3R B;  2ADQ B;  5FL7 G;  4R50 A;  1SS3 A;  1H2M A;  1W0K G;  2QTO A;  2UXN A;  4MT8 A;  1P7B A;  2Q7H A;  4MVU A;  3CCR V;  1F4M A;  4K0K O;  1URF A;  4J7J A;  5J2T B;  5KHK A;  2IBZ H;  3BA8 A;  1WJZ A;  1KMI Z;  1FXK A;  4GKK O;  1N32 O;  1DF4 A;  2H3O A;  3CCV V;  4GX1 A;  2Z0A A;  4TUY B;  1GKF A;  1S76 D;  2QKA A;  3I5D A;  1VF6 A;  2JJ1 G;  2VQE B;  3TET A;  3FB5 C;  5LP6 A;  1O9H A;  3M8A A;  5CBF A;  1WB7 A;  4BIZ A;  4MW3 A;  2D3O W;  3CPW U;  4DV4 O;  4NXN O;  3UM7 A;  3OFN G;  2X6A A;  4NVP A;  2HFE C;  2P06 A;  1S77 D;  3UQ8 A;  1YZB A;  2AHY A;  1H8E G;  3AK2 A;  3IC7 A;  2WLL A;  4DRX A;  4ZIB A;  3G6B A;  3LDE A;  5EBW C;  4JYC A;  4I0X B;  2PTM A;  1XMQ B;  1ZTE A;  3E8B A;  3LNM B;  4JTA B;  4KFM A;  1N4C A;  3BY6 A;  3SYQ A;  4UXN A;  5B1N A;  1SA0 A;  2AHZ A;  3C3T A;  4KP4 A;  2ZR3 A;  3CC2 V;  4F6R B;  1Y76 B;  4BR6 A;  3CS5 A;  4GCZ A;  3IC9 A;  3SYC A;  4B3R O;  1OJH A;  3K79 A;  4FLT A;  2EIJ C;  1LNQ A;  3FB6 C;  3QO5 A;  4LFB B;  1W2B U;  1ZX3 A;  5GTH Z;  1BE3 H;  4JAU A;  4GX5 A;  3JAK A;  4BIU A;  1Q82 W;  1SES A;  2XND G;  4PDV A;  1NKD A;  3SPH A;  5ITZ A;  3CXC U;  4FLZ A;  3OEE G;  4F4L A;  2P4K A;  4H33 A;  4FLY A;  2XHB A;  1PV0 A;  2WLM A;  1PP9 H;  3UCS C;  1JJ2 U;  2VQE O;  4B3T O;  3GWK C;  1TVK B;  3TXQ A;  1H38 A;  1L0L H;  2BSK B;  4O4H B;  2GSM B;  1RPR A;  3ZRW A;  4AQY B;  1RPO A;  4Z1V A;  4IYI A;  1OCZ C;  1US6 A;  4P30 A;  3OUS A;  3SJA C;  1SF9 A;  1I08 A;  1WN7 A;  4YHH B;  2LFS A;  4DV0 B;  2V7Q G;  5KAI Z;  3CCE V;  1XMQ O;  4KUM A;  3K0D A;  1Q6H A;  2L35 A;  4YIP A;  2DYS C;  4DV1 B;  2BCC H;  1AR5 A;  3OR7 C;  3ABL B;  4DR1 B;  2X6C A;  4J80 A;  5KMG A;  3G4S V;  2IM9 A;  4FVM A;  4MS2 A;  3RYF B;  5IWA O;  4B7E A;  3K59 A;  3T1Y B;  2KG7 B;  3RN4 A;  2ITD C;  4Q20 A;  5LHG A;  5A9G A;  3N2G B;  1O9G A;  4WBN B;  4DK1 A;  3PJS K;  3OMA B;  4K8X A;  3H01 A;  3ZMS A;  2CGO A;  1LUV A;  3IFX A;  5D5P A;  4LFB O;  3ZMU A;  2EJR A;  2QWQ B;  1V55 B;  1ROP A;  4PA3 A;  1W59 A;  3APQ A;  3ZX6 A;  1M56 B;  5B3S C;  2F4V O;  1CXZ B;  4PI0 A;  1K33 A;  3G80 A;  1H8H G;  3SPJ A;  2Z5U A;  2P4V A;  4CBC A;  3K9A A;  3K03 A;  3TCU A;  1TUB A;  2YC0 A;  2UU9 B;  1DGS A;  3JCZ A;  1XOU A;  1H2L A;  2YXL A;  3RYC A;  4AQY O;  4OGQ B;  4X1Y A;  2X0L A;  3UO3 A;  2RQ6 A;  5EK0 A;  3B8N A;  4MTX A;  2WLI B;  3STL C;  2OIE A;  3KCX A;  5LGT A;  1YTF B;  3FAV B;  3ZRS A;  1XHZ A;  4NYK A;  4I7Z B;  2CH7 B;  2ZT9 B;  2CGN A;  4YHH O;  4DV0 O;  1IXB A;  3L74 H;  1GN2 A;  3CSX A;  4X1I A;  3KG2 A;  3CRQ A;  3P30 A;  3F5W C;  4DV1 O;  3Q4H B;  1NH2 D;  3BAA A;  2R9I A;  4R7C A;  2HLD G;  4DR1 O;  4NXM O;  1OCC B;  4YIO A;  5JVD B;  3HKC B;  4FJC C;  5FLX N;  1FPO A;  3T1Y O;  1F23 A;  4FIP C;  2H8P C;  4ZHQ B;  1R6T A;  5KA5 A;  4ZKI A;  1HNX O;  1E79 G;  4J9Z B;  1WB8 A;  4X64 B;  1SQG A;  4I55 B;  3ETG A;  3R65 A;  2FML A;  1KU9 A;  1TGO A;  3JAT A;  4OX9 B;  3R66 A;  4JTC B;  2YDE A;  1TUE B;  3OTO B;  4MVO A;  1UFI A;  4I9Q A;  3GB7 C;  1EZV H;  4DV2 O;  4TT3 G;  5LGU A;  4I50 B;  1QLE C;  4FLW A;  2EIK C;  5EIB D;  4IL6 Z;  2E3C A;  4RUE A;  2UU9 O;  1NVP B;  4X20 A;  4ICG A;  2UUA B;  3E89 A;  3E86 A;  4UCS A;  3RYI A;  1OCR C;  2K1E A;  1AP5 A;  3H1J H;  5CN0 A;  2PF4 E;  1SC5 B;  1P49 A;  1AJN A;  2B1I A;  2AZ0 A;  5EYP A;  2R9R B;  3OT7 A;  4NKG B;  1ENV A;  5FNV B;  1D2D A;  4DR6 B;  2PGG A;  2YSU B;  5IY5 B;  4FMT A;  3SR2 C;  5E79 Z;  3P3N A;  5KUK A;  1R3I C;  3BA9 A;  3SJQ C;  2ATK C;  3HKE B;  2Q4P A;  3WG7 B;  1YVW A;  2PYL A;  1AR1 B;  1QR9 A;  4L87 A;  4FK5 C;  2GUZ A;  1R3L C;  1MAB G;  2F93 B;  2EZO A;  2WLK A;  5EC2 C;  1RSO A;  1WNS A;  4IGG A;  1IX9 A;  4X64 O;  4ZOL B;  4F6E A;  5CA1 B;  3RWR D;  2OYQ A;  4XDJ A;  2BE3 A;  4LF6 B;  4LF7 B;  4E4E A;  5CMU A;  2XAF A;  3OTF A;  3D36 C;  3OTO O;  4D7T A;  1BQ0 A;  2BTO A;  2DE0 X;  2JDI G;  4DV3 B;  2OTJ V;  1X59 A;  2B9Z A;  2O57 A;  2ARH A;  3ZBH A;  2UXB B;  2ETN A;  1B06 A;  3CMA V;  3OD4 A;  2UUA O;  2ZIM A;  5GON A;  1M1K W;  4OPA A;  3D8C A;  3L71 H;  4MW8 A;  3C3S A;  5EZY A;  1HP8 A;  5KLV H;  3SYP A;  4YY3 B;  1VQP V;  3CEI A;  2YXY A;  1H2K A;  4DR6 O;  1BSM A;  1FXK C;  2LO1 A;  2YIB D;  4H37 A;  2MK3 A;  3QTC A;  3ZMV A;  5LHH A;  3TK1 A;  1K4C C;  3CCS V;  2OIG A;  3FYI B;  1R3J C;  3E8G A;  1VF6 C;  4DV5 O;  2Q7G A;  1OCZ B;  2YIC A;  5LP6 C;  2DOS A;  1AJQ A;  4O4J A;  4UCO A;  3FD9 A;  3C90 A;  3G71 V;  3ZIA G;  2JEX A;  4TOI A;  3TGU H;  1XBL A;  4MTG A;  1WP7 A;  4TQF A;  4GX2 A;  5B1B C;  1IBM B;  5IJ9 A;  4U3F H;  1UPG A;  2ZE5 A;  4EB6 B;  4CZZ A;  4LF7 O;  1KP3 A;  4PI2 A;  4RAI A;  1MOF A;  3JAR B;  1YDX A;  5FPR A;  4X66 B;  2OTL V;  1GTO A;  1N34 B;  3H1L H;  5LMN B;  2RCV A;  3CJH B;  3SPG A;  4GT1 A;  1MG1 A;  4DW0 A;  3L73 H;  2R72 A;  1NR1 A;  2ZD9 A;  2EIL C;  2YUA A;  1VQN V;  4UB6 Z;  2E74 B;  5KX5 A;  2ZR2 A;  3QNE A;  5C8Y B;  2JS5 A;  4DUZ B;  4YY3 O;  3APO A;  2F66 C;  3QO8 A;  1S5L Z;  4AI8 A;  2IJH A;  4UUJ C;  4HBN A;  4IT5 A;  2JS3 A;  4O4L B;  2YI9 A;  3ASO C;  4G27 B;  4DK0 A;  3ML0 A;  3MHH C;  5E1A C;  1J95 A;  2QM4 A;  5KAF Z;  4LP8 A;  2OT5 A;  1CP9 A;  1WLE A;  3SGI A;  1VQM V;  2OCC C;  1QR8 A;  5J2U B;  1D5A A;  1VQ9 V;  1XNQ B;  1MZE A;  3AG3 B;  1FKA O;  2M7W A;  3OW2 U;  5LA6 B;  2QGN A;  4TUY A;  1GM8 A;  1V54 B;  4DR7 O;  3CCL V;  1VQ4 V;  2QJ1 A;  1SQX H;  1YF2 A;  5LBQ A;  1E1Q G;  4CS4 A;  2E5L B;  1Z5W A;  3QO7 A;  4I5S A;  5DEC A;  2IU0 A;  3W7T A;  2ZIO A;  2QWO B;  4X66 O;  3CC4 V;  3CCM V;  1PD3 A;  1XMO O;  1N34 O;  3E8H A;  5LMN O;  1GN3 A;  4I0X A;  1VEW A;  2JVD A;  1I7F A;  3AG1 B;  2A79 B;  2UXX A;  1G4Y B;  1PNM A;  1LR1 A;  1FFX B;  4F6R A;  2ZM6 B;  5H5N A;  2DQ3 A;  3PN1 A;  3JAM N;  5C93 A;  4EFE A;  5IE9 A;  1P4R A;  4LF9 B;  3LDD A;  2YIB A;  1FYJ A;  1A32 A;  1QLE B;  1JX9 A;  1BL8 A;  4JI8 B;  1Y66 A;  5CA0 B;  1KKD A;  2ITC C;  2QKS A;  3CE2 A;  4XDL A;  4MVR A;  1IDS A;  2UUC B;  4NTW A;  3GVM A;  5IYD O;  2YEV B;  1KKC A;  4HYO A;  2VRZ A;  3FFQ A;  1SRY A;  2JIZ G;  2P22 C;  2YIA A;  1I5X A;  1I5Y A;  3L75 H;  1JFF B;  1TVK A;  5KHJ A;  1KQS U;  1WA8 B;  1SZX A;  2Q67 A;  4LH7 A;  5HFL A;  2E5L O;  1F4N A;  4O4H A;  5A2Q N;  2L6L A;  1K7D A;  3MD0 A;  3SPI A;  1K92 A;  3JD3 A;  3AG7 A;  3K3W A;  3DXR B;  3RVZ A;  4X9Q A;  4X8A A;  1HDJ A;  3EHB B;  4UVA A;  1YIJ V;  1EBO A;  1IZ3 A;  2RJZ A;  5IDJ A;  4GKJ B;  2EUL A;  2GTS A;  3JCU Z;  3JD0 A;  4PA4 A;  4TV8 A;  1HR0 B;  4RQE A;  2ZKO A;  3CC7 V;  3LSQ A;  2QA4 V;  1XUQ A;  1OCO B;  2DW4 A;  5BY1 A;  4UCU A;  3E22 B;  1VQ8 V;  2CUG A;  3B2E E;  1KD1 W;  3N2G A;  3AG4 C;  3JAW B;  4X62 B;  4LF4 B;  1VQK V;  2LP7 A;  1N36 B;  1GM9 A;  3JAS A;  4JI8 O;  1R73 A;  2N04 A;  1RM1 C;  1MSD A;  4ZI7 B;  3ABM C;  2UUC O;  2N05 A;  3NR7 A;  1ZL8 B;  4JAA A;  1PNL A;  1Q90 D;  3W7X A;  3RGB A;  2DN9 A;  4NTX A;  1XEQ A;  4JI5 B;  3OGI B;  4XDK A;  3ZED A;  1DLB A;  3X2Q C;  2QWR B;  4JZG A;  5IYZ B;  3HKB A;  3JSL A;  1BHB A;  1M57 C;  3SPC A;  2RDC A;  3ASN B;  2XOK G;  4E2L A;  2ADP A;  5IJ0 B;  4UCV A;  3ETE A;  2EIM B;  2Q8V A;  4X89 A;  4U7O A;  1Y74 B;  4LNU B;  4D7S A;  2E76 B;  2PZS A;  2WLI A;  3SJC C;  3FAV A;  1GN6 A;  1DF5 A;  5KHH A;  2HVJ C;  5L3C A;  1F51 A;  1B04 A;  4GKJ O;  2Q9L A;  3OMN B;  1HR0 O;  4DRX B;  3HR0 A;  3HKD A;  4JI2 B;  2CTR A;  1AI6 A;  2QR4 A;  4QPJ A;  1YJW V;  4D6T H;  2EIN B;  2IU3 A;  1XDC A;  3OUF A;  1I0H A;  2E75 B;  5JVD A;  2WAM A;  4BW9 A;  3HKC A;  4LF8 B;  3OAA G;  1K3E A;  1R6N A;  2Y69 B;  4X62 O;  4LF4 O;  2GHY A; 
#chains in the Genus database with same CATH homology
 5BR8 O;  2ZKO A;  4KHP O;  4JI1 O;  4JI3 O;  3J7A U;  3F5T A;  4X66 O;  1XMO O;  1N34 O;  3RT3 C;  5BY1 A;  4AQY O;  5LMN O;  5LL6 Y;  4JYA O;  2VQE O;  4K0K O;  4B3T O;  4JI4 O;  4LF7 O;  4YHH O;  4DV0 O;  4JI5 O;  1IBM O;  4B3M O;  4GKK O;  4JI8 O;  1N32 O;  2UXD O;  5BXZ A;  1N36 O;  4X65 O;  5H5N A;  1I94 O;  2Z0A A;  2UUC O;  1NS1 A;  4X64 O;  1DK1 A;  4DV1 O;  3JAM N;  1HNZ O;  2ZM6 O;  1XNR O;  4NXM O;  4DR1 O;  4JI7 O;  4DV6 O;  1G1X B;  1F7Y A;  5FLX N;  1XEQ A;  1A32 A;  2DJV A;  5IT9 N;  1FYJ A;  2FKX A;  4A5U B;  3T1Y O;  2N74 A;  3M8A A;  1IBL O;  1XMQ O;  4LF9 O;  4DV7 O;  1FJG O;  3J80 N;  3OTO O;  4LF6 O;  4DV4 O;  1R6T A;  4DR2 O;  3O65 A;  4NXN O;  1HNX O;  4YY3 O;  1X59 A;  1YZB A;  4OPH A;  1N33 O;  3SDL A;  4DV3 O;  4DUZ O;  4JI0 O;  2UUA O;  5IWA O;  3R66 A;  4LF5 O;  2UXB O;  2HHH O;  4OPA A;  2UUB O;  4LFC O;  1J5E O;  4OX9 O;  2VQF O;  4LFB O;  4LF8 O;  4DR3 O;  4B3S O;  4JI6 O;  4DV2 O;  4GKJ O;  2LW7 A;  2E5L O;  4DUY O;  1HR0 O;  1FKA O;  1IBK O;  1KUQ A;  2AGA A;  5A2Q N;  2UU9 O;  4DR6 O;  4DR4 O;  2JRI A;  4LFA O;  4DR5 O;  1XNQ O;  5LMU O;  2F4V O;  4JV5 O;  4JI2 O;  4B3R O;  4DR7 O;  1AIL A;  3J81 N;  1HNW O;  1AB3 A;  4DV5 O;  2DOS A;  3T1H O;  4X62 O;  4LF4 O;  1D2D A;  2UXC O;  1R1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...