4DR1O

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr1O00
5FLXN 1R1BA 2AGAA 4JI2O 4DV3O 4JI8O 5BY1A 2Z0AA 4DR2O 2UUBO 4JI0O 4DR3O 3T1HO 4LFAO 1N34O 3J7AU 4DR7O 4KHPO 4X64O 4JI1O 3O65A 1FYJA 3F5TA 1XMOO 4B3TO 4JYAO 1G1XB 4LF5O 1AB3A 4JI3O 1IBMO 1A32A 1YZBA 2JRIA 1J5EO 2HHHO 4DV4O 4YHHO 4DV1O 2VQEO 4JI4O 4DR5O 1N32O 1XNRO 2E5LO 4DUYO 2UUCO 3M8AA 4LF9O 2UXBO 4AQYO 1DK1A 2UU9O 1HNXO 5H5NA 1IBKO 4LF4O 4NXMO 5BXZA 1D2DA 2UXCO 1IBLO 3OTOO 2F4VO 1F7YA 2UXDO 5LL6Y 5LMUO 4DV6O 2ZKOA 4B3RO 3T1YO 1XEQA 2VQFO 1R6TA 2N74A 4LF6O 4LFCO 4B3MO 2FKXA 1FJGO 1AILA 4OPAA 4LF7O 1XNQO 4GKJO 4JI5O 4OX9O 5LMNO 1NS1A 4LF8O 3J80N 2DOSA 4B3SO 4A5UB 1HNZO 4JI6O 3J81N 4NXNO 2LW7A 4X62O 4DR4O 1X59A 2UUAO 4DR1O 4LFBO 4X65O 1N36O 1HNWO 5A2QN 4GKKO 1HR0O 4DV5O 5BR8O 4JV5O 3R66A 4DV0O 4DR6O 4DUZO 4OPHA 5IWAO 3JAMN 2ZM6O 4K0KO 4DV7O 4YY3O 4X66O 4DV2O 1FKAO 1N33O 5IT9N 1XMQO 2DJVA 4JI7O 1I94O 1KUQA 3RT3C 3SDLA
chains in the Genus database with same CATH superfamily
5LHIA 4PI2A 4DV2B 4X1KA 2EJ7A 3ETQA 5B3SB 2B1GA 4DR3O 3QTCA 4KHPO 5CN0A 4Q6GA 3S3WA 5C8YB 2BCCH 2HJFC 5EZYA 4DV3B 4JZ2A 2ZDIA 3EHBB 2YXLA 3R65A 4DXWA 3APQA 1G1XB 4UCVA 3SJAC 4JI3O 2K1EA 2HP8A 4YJ3B 1BE3H 2RCVA 4DR5O 1N32O 4JAUA 3CX5F 4BIOA 5BMVB 4DV4B 4AQYO 1ZWIC 1YF2A 2Y48A 2WWWA 2CH7A 2YDEA 5LP6A 4FLXA 1WA8A 2ADQB 4HYOA 1TA8A 1NR1A 3T4ZA 2A9HA 1P49A 2ZR3A 3E8FA 4DO2A 3ZMUA 2ZINA 4F6RA 4FVMA 1GM9A 2JVDA 2H8PC 5FNVA 5EZYB 3QF7A 4UV9A 4EFEA 1AILA 2UUAB 3G80A 4PI0A 4GKJO 2W6IG 2Q73A 1VQLV 2GTAA 3H1IH 2IU0A 1NS1A 1S77D 1XL4A 3J80N 3OEEG 3MDSA 1H2NA 3N27A 2BE3A 4KP4A 3B40A 4QGPA 1X59A 1FXKA 1WAZA 4J9ZB 5F2VO 1US6A 2PI5A 1JQ0A 3OW2U 3AG1C 2ZR2A 2Q8VA 2CH7B 3CCUV 4HNAA 1WA8B 5GONB 2ZM6O 4GYCB 4DV0B 2IH1C 4CS2A 1OCRB 3OUSA 5FLXN 1VQKV 5BY1A 2QWNB 5FNVB 3C90A 4TQDA 2IJKA 4CBCA 2AXTZ 2QTSA 3UKMA 2OT5A 4E4EA 4DR3B 1XREA 4UCUA 4DUYB 1YXBA 2UXNA 2WLIA 4WF9V 3RYCA 1H2KA 5IYDO 4KHPB 1WPBA 1COWG 4JYAO 2WLJA 3OT7A 1M9NA 3ZRSA 1IBKB 2XAJA 1A32A 1FXKB 3TK1A 2EBOA 1ZX3A 1WPXA 3CCQV 2F4VB 2XAQA 5JCOA 2CK3G 1CP9A 2JEXA 3ML0A 5L3CA 2ZIMA 4UCRA 4HNAB 1DK1A 2YIDA 3WG7C 1QR9A 2YXHA 4DR5B 1N32B 3LUTB 1WP8A 5GTHZ 2PGGA 2X7RB 4YIOA 1YVWA 3IGAC 1NKDA 5LA6A 3ZHQA 3UCSC 2R72A 4NTWA 3K9SA 4IL6Z 1NTKH 1RSOA 1IVSA 5J2UA 2WLIB 1AR4A 2VWJA 1TUEB 1Q8IA 3K58A 1IURA 1KKCA 4B3SO 4RUEA 3L71H 4EB6A 1P84F 4IYHA 1QHTA 2F93B 3MHSC 4U3FH 2QM4A 1OJHA 3ETDA 4ABMA 4D6TH 1S5JA 3E22A 3LSQA 5JVDA 2GHYA 4PDVA 5KX5A 1VEWA 2Y4TA 5FL7G 1IXMA 2EILB 1VF6C 1EZVH 3FX7A 3WB0A 1N33O 3HR0A 4ZHQA 3C3TA 5LA6B 4JI7O 1KUQA 1GM8A 2GDSA 5KHGA 4WFFA 1RSOB 2KQXA 2QA4V 4DR7O 2E75B 2QGNA 1SETA 2Q7HA 3O65A 1VMGA 5J2TA 1F51A 5HFLA 3VQYA 2H3OA 3CCVV 4YIPA 4GX1A 4EB6B 3ZHSA 4I7ZB 2BSKB 5B66Z 3CCSV 1RM1C 2HHHO 3UM7A 3BA8A 3E22B 2LQTA 5JVDB 4PA6A 5KX5B 4KL1A 1EN5A 5DEDA 1AJQA 1FFTB 2WA3A 2PI4A 2UXCO 4ASUG 3VQVA 4YJ2A 1KD1W 3ABMB 1R6NA 3M99B 1V9PA 1K4CC 3X2QC 5J2TB 3F5WC 5EYPA 1G6UA 4CC5A 2HVKC 1MSWD 1R3IC 1Y66A 1Y76B 3ZN0A 3KCYA 2VWKA 2W6JG 4K0KB 2LO1A 2YXYA 2HVJC 4BW9A 4DR4O 3ASOB 3ZIAG 4B3SB 4CZZA 1WN7A 1MNGA 4G28B 4JV5O 5BR8O 1PP9H 3A0RA 1VQOV 4GX0A 4DR6O 3IC9A 5D5PA 1BHBA 3JYCA 4DV7O 2A0LA 4YJ2B 3BA9A 2PZSA 4UFZA 1SA0B 2BOBC 3SDLA 4ZKIA 2MW2B 1H38A 2JIZG 2YI9A 4PA4A 2PUSA 2UUBO 1V55C 4JI7B 4TV8B 4LR3A 2PYJA 1VF7A 5EYPB 3EFFK 2QWPB 4Q20A 1BL8A 1M93A 3LDEA 5BZBA 2E5LB 3JARB 4DR7B 3G71V 1E1RG 1MABG 2UXBB 1E1QG 2XAFA 1AR5A 4LF4B 1AB3A 3ABKC 4YHHO 2AHYA 4DV1O 3TJTA 3VOUA 1XNRO 2DYRC 4MVQA 5EK0A 1OCCC 2HHHB 1M57C 4QPKA 1I7FA 2IBZH 2QKSA 1HNXO 4CH6A 3CE2A 4J11A 1BGYH 4QNHB 1SERA 5KUMA 4DRXA 3GWKC 3BABA 2UXCB 2ADPA 1QLEC 3K5NA 5KHHA 3ZHUA 1WNSA 2RMKB 1WLEA 3FYEB 1MZFA 5CA1B 1Q81W 3LDCA 1VQPV 3CCMV 2WLNA 3E8HA 3TCUA 3UO2A 3SPGA 2L6LA 1EFRG 2EULA 4FFBA 4LCUC 2LFSA 5LHGA 3KG2A 2V4DA 1Q6UA 4DR4B 4OPHA 5B1NA 1OHHG 1ZTEA 3K57A 4DW1A 3QG5A 4XDJA 3JCUZ 2R9IA 2DWDC 5BR8B 4JV5B 4UCSA 3C3SA 2LGQA 2FB5A 4DR6B 4JASA 2WLHA 1AJNA 5JQGA 1XHZA 4JYCA 4X9QA 1YJNV 2AGAA 4RUFA 2PTMA 4PELA 1TGOA 1BMFG 4J7ZA 4O4IA 4X64O 3ZMVA 5H6QA 2ZE6A 4NYKA 5D5QA 4WFBV 1K5SA 2UUBB 2E76B 1JVMA 3W7SA 1DF5A 4JGSA 1XMOO 2QWOB 1IZ3A 1FFXA 2P67A 5IYBO 2ODMA 4BAYA 4TUYA 3FFQA 1I0HA 4WFAV 3QO7A 3CC4V 2UUCO 4NTXA 4YHHB 4U3JB 4LF6B 2Q6AA 1SQPH 3K3WA 3L74H 3WB2A 1XNRB 3BFRA 1G4YB 5JQGB 4JF3A 1JMKC 1HNXB 2RNBA 3ICXA 4MVZA 1S5LZ 1SESA 3K9AA 1V54B 3JD4A 4O4IB 2VS0A 4LF7O 4RQEA 4Z1VA 3ASNC 3UQ8A 1I08A 4JI5O 1SF9A 3CRRA 2JJ1G 4CH3A 5KHIA 5LGNA 4TUYB 4NXNO 3SYCA 2UUAO 1LUVA 1HR0O 4DV5O 3SPHA 2QM8A 1VQNV 4TT3G 4DYLA 2N04A 3DXRA 1K97A 3SJQC 2V7QG 3TETA 5LGTA 3MD0A 1N4CA 2EIMB 1AR1B 3SR2C 4I9QA 4TSFG 1M56C 2Z0AA 4DR2O 4FFKA 4LFAO 4H0LB 4FMTA 4JAAA 4UV8A 2P4KA 3LNNA 3WFVA 2NLJC 3LSUA 3T2MA 3OAAG 2BOCC 2UXXA 4X64B 3F5TA 2JGUA 4JYYA 2P06A 3I5DA 1IDSA 2OCHA 2Q68A 4J7JA 1YZBA 3A2FA 1SC5B 2JGDA 3CJHA 1XMOB 1E79G 3CB2A 1SRYA 1G8MA 5LOVA 2Y69B 2WA4A 4JI4O 4X88A 4AI8A 4DUYO 1XBLA 5JJJB 2JS5A 1GH6A 1X4TA 2EINC 1IBKO 3E83A 2UUCB 3OTOO 3AEIA 3CCRV 2F4VO 4UB6Z 5FPRA 1IX9A 4OX9B 1GKFA 2NR5A 2CTRA 4LF8B 1L8DA 3FAVA 3HB3B 5CBFA 3OFNG 2DYRB 2YICA 1BSMA 2G38A 5LYJB 2OIGA 1K34A 1XILA 2FKXA 1YI2V 4J80A 3U11A 1NVPB 3SGIA 3E89A 1UPGA 1WB8A 4LF7B 4MS2A 5JJEB 1YHQV 4JI5B 2JGDB 3CJHB 5K1XA 1QLEB 5KAFZ 4X1KB 5LOVB 2P7TC 4X62O 3F7VC 1K9MW 4C7UA 3BVOA 2XNDG 1N36O 1GRJA 1FAFA 5IYCO 3R66A 4NXNB 4I50A 3FB8C 1AVMA 4MSWC 2A79B 1HR0B 5ITZA 4DV5B 4K8XA 5IY5C 1W59A 4X66O 2P22C 2PY5A 3VBBA 1DF4A 3RT3C 3FAVB 4J9YB 3CPWU 3BRCA 2CGNA 4WCEV 3CXHF 4UB8Z 2LGWA 3CC2V 4DR2B 2YIAA 5LP6B 4LFAB 1FYJA 1DTOA 4GUNA 1GM7A 2M6YA 1B04A 2XT9A 4F6RB 1GK9A 1H2MA 4ZBMA 3D8CA 5H9CA 4I50B 4LBEC 3OMAB 3T1YB 2WLKA 2IJHA 3DC6A 5ITZB 5L3GA 4JI4B 3OEHG 3AG3C 3G4SV 4IHJA 1IBLO 1OZ0A 1JJOA 2EIKC 4B3RO 3JD0A 4B7KA 3OTOB 4DK0A 4B3MO 5DECA 4O4JA 3D3QA 5LXTA 2ZE5A 1KC8W 3CSXA 2YC0A 3AG2B 4P9OA 1SQQH 4UVAA 2R70A 1QU7A 4X8AA 4OXSA 4A5UB 4J10A 4ZOLA 1HNZO 3ZHVA 2B1IA 3OTFA 2LW7A 4QJFB 4FZ0A 1YTFB 2F95B 4DK1A 4JI8B 4X62B 2H94A 1PKXA 2ZIOA 2ETNA 1N36B 4IHJB 2YIBD 3RYCB 1SQFA 4K0KO 1O9GA 2RJZA 1XMQO 1BT8A 2LJ2A 2Q0AA 4UUJC 3HPLC 1PV0A 2GTSA 4X66B 3CRQA 3QO5A 4O4JB 1N0NA 5LXTB 1NU1H 2FTKA 1MOFA 1VQMV 1HWYA 2DQ3A 3P32A 2ITCC 1YCIA 5CA0A 1DLBA 4ZOLB 1NQTA 3K79A 2CTWA 5L3FA 1NT2B 2JRIA 1KP3A 3H1HH 1NTZH 2DYSC 2Z5UA 5LMUB 2IJJA 1BCCH 1GN3A 2E5LO 1GN6A 2WLLA 2YSUB 1ZLZA 2X6AA 5J2UB 2UXBO 2GSMB 4X89A 4NXMO 4LF4O 1WP7A 4H13B 3E8BA 4E2LA 5DM6V 2DWEC 5EBLC 1IBLB 4EKWA 1XEQA 1PM9A 4CS4A 2X0LA 4FLUA 4B3RB 2W0XA 1SQGA 1GN2A 5KMGA 1SS3A 1CPYA 4TQFA 5CA0B 2L35A 3G6EV 4B3MB 2W0FC 1NI8A 3ZHTA 5JWPA 2EZOA 3CXCU 3RWRD 3M7MX 2EIJC 4NB5A 4ZHQB 4PA7A 1O9HA 1ORQC 1H2SB 2ZXWC 4X20A 3J81N 4LWSA 5EBWC 5CB4A 2GUZA 3U10A 2WLLB 3A8TA 1HNZB 2OCCC 3MHHC 1BQ0A 1MMMA 2CE4A 2GBOA 2QWRB 1LNQA 2JEUA 3SYPA 1FPOA 3DSQA 3KZIZ 4R6ZA 1S5HC 4KFMA 2Q67A 3JAKA 1AROP 5KLVH 4O2BA 3RYHA 2QDOA 3ZRWA 1WJZA 3IAYA 3WB1A 1XMQB 4LF5B 1L0NH 4B08A 2WPDG 2WSSG 1N34O 1KQSU 5KMGB 4WBNA 5A9GA 1CXZB 3RN4A 4JPRA 3ZRXA 1RFYA 4MW8A 4X20B 2QJ1A 4CS3A 1OCOC 1IBMO 5GW7A 1D5AA 2HG5C 2IM9A 2GV9A 5CB4B 2GUZB 1B06A 2D2CB 2IH3C 4PHZA 3AG1B 1XL6A 4QIWF 1VQ7V 3UT5A 1NR7A 1S72V 3S3XA 3FB5C 1D2DA 3JAKB 1QBZA 4UXNA 4O2BB 3B8NA 3RYHB 3FKSG 4DV6O 3ZRWB 1KBHA 4NXMB 1URFA 5KHJA 2QTOA 5EBMC 4R50A 4LF6O 3K0DA 4LFCO 3AK3A 3HKBA 3CEIA 2O57A 4WBNB 3DTUB 1Z5WA 5B3SC 3JD3A 2CUGA 1AP5A 1YITV 2Q69A 5L3EA 2E74B 4O4LA 2E3CA 1OCZC 1AP6A 1JR9A 1ZSPA 4O2AA 1AJPA 5IDJA 4GKKO 5LGUA 2ITDC 1Q5OA 3WG7B 4W4KA 4NVPA 1VF6A 2M7WA 1XDCA 1FKAO 3E2EA 2Y0IA 1I94O 4XBFA 3CRMA 2P5OA 2YEVA 4F4LA 4DW0A 2OTJV 5IJ9A 2NN4A 1W2BU 5CA3A 2KSDA 3ABUA 4UCOA 4FZ1A 4D7SA 3A0HZ 2R9AA 3H01A 3RYFA 1N0JA 2ZDIC 1N34B 2CAZC 2KG7A 1TAEA 4DRXB 3K5OA 4HAMA 3TXQA 3CC7V 4O2AB 3SYOA 3B2EE 4BWAA 1KYOF 3H9VA 1VQ8V 1MG1A 1NH2D 2VQEO 1XI1A 1M1KW 4BIZA 1IBMB 3IJ4A 3N2GA 3DC5A 1AI6A 3M8AA 4ZIBA 4LF9O 3F7YC 4X1YA 4IYIA 1S3JA 1JCHA 5BXZA 3BY6A 3LSSA 2YEVB 2UXDO 5LL6Y 2ZNIA 2Z3YA 5LHHA 2ZKOA 4FM2A 5IJ9B 1OCRC 4FLVA 1THZA 2JDIG 3RVZA 4UVCA 4JAVA 1VQ4V 2N74A 3RGBA 4FFBB 4DV6B 2A3QA 3RYFB 1K4DC 4DR1B 1K33A 1SKVA 3EVKA 4LFCB 2HEPA 3UO3A 1EN6A 2KG7B 4OX9O 2XTAA 4L87A 4R7CA 4LF8O 3CRAA 4FLTA 2DOSA 1NVPD 2PYLA 1RM1B 3W7WA 2B9ZA 3D36C 1K8AW 4WFGA 3OUFA 3CCJV 4PD4F 1FXKC 2HFEC 3W7TA 5A2QN 4MVSA 4X1YB 2YS8A 1RP3B 1Y67A 4MTGA 2JS3A 4GKKB 2IJIA 1TUBA 4FM1A 1FFXB 1H2GA 1QNMA 3APOA 4B3TB 3ZMTA 2OCCB 3ETEA 1K73W 1XUQA 1I94B 3JD1A 3J7AU 3X2QB 2DW4A 2ZD9A 3P30A 1KKDA 5IE9A 4AILC 1SQVH 1Y4MA 2VRZA 1ROPA 2AW9A 4JTAB 3NR7A 1QLNA 3BPZA 1P4RA 5K1PA 2X6CA 1L1FA 2HR3A 4N21A 3RW0A 2A06H 2F66C 2ZQMA 5E79Z 1QVFU 4G27B 1R3LC 1JX9A 4HZ3A 4MTFA 2VQEB 1TUBB 3N2KA 4LF9B 2EILC 1BQZA 3SJCC 1GN4A 4PDRA 1V55B 3OMNB 3T1YO 2Q4PA 1JFFA 2HKOA 1KP2A 2UXDB 5H2FZ 2ARHA 5B5EZ 3E35A 4OPAA 3E8GA 3NXSA 3HKDA 3DXRB 1FD9A 5LMNO 1D5NA 3L75H 2CDYA 3ABKB 3ZMZA 4TOIA 3JSLA 4CC6A 2MK3A 1OCCB 1M57B 1Q90D 3N2KB 5IWAO 3FYIB 3FB6C 5CBHA 1OCZB 1YTFD 5KA5A 2XHBA 1Y74A 2CTPA 2RN9A 2P4VA 4HBNA 4LH7A 4H44B 1Q82W 1JFFB 4JI2O 2B5UA 4IT5A 1UFIA 2FL4A 4JI8O 3ABMC 3K59A 1SQBH 3LDDA 1VP7A 1J5EB 4JZGA 3HKDB 2JK5C 3ZBHA 3SPCA 3OGIB 3D3IA 5GONA 1LR1A 1LUWA 4IIJA 2BTQA 3QVNA 1M5IA 5FPOA 2Y0PA 3K0GA 2QKCA 3GVMA 4PV1B 1HDJA 4I4TA 4JTDB 4Z2WA 2K9PA 2F23A 3ASOC 1P7BA 2YI8A 1MZEA 2UU9O 5LBQA 1PNMA 1YEWA 1JA8A 3K04A 1Y74B 1XNQB 4XDLA 3D36A 3TXSA 5CBGA 2XAGA 5LMUO 1S76D 4BIUA 2AZ0A 4J7KA 3SYAA 1Q6HA 1Z5VA 4X1IA 3VQXA 3MAQA 3G6BA 2XAHA 3OMIB 2RDCA 4GCZA 5JJNB 1QVGU 2OWOA 1B3QA 3K06A 4IIJB 2XUMA 2BTQB 2OIEA 5DN6G 5AG2A 3HKCA 1KECA 3RYIA 1PD3A 1HW7A 2EJRA 4I4TB 5LMNB 2N05A 4YY3B 1KB9F 2FYUH 2KKWA 1YSCA 3E86A 4MW3A 1FXVA 2DN9A 3CCLV 3ZJZA 3B8MA 4DUZO 1EM1A 2PF4E 4FLZA 5IYZA 3FD9A 4FK5C 3I56V 2DQ0A 4QPJA 5IWAB 4GT1A 3IC7A 2Q0OC 2P90A 2A7WA 4I55A 4X1IB 1OV9A 1S0VA 3OE7G 3ZCCA 4JI3B 4JI0O 3JASA 3OM3B 3ASNB 4I9WA 5KUKA 4JI2B 3L73H 4JI1O 2HLDG 3ZS8C 2Q7GA 3HKCB 3CYOA 3RYIB 2X6BA 1I5XA 4KUMA 3SJBC 4FLYA 4AQYB 4LNUA 4U7OA 1XOUA 3SPIA 4LF5O 3AK1A 3OR6C 4MVMA 2HJDA 4B7EA 2QSAA 1YJWV 3L70H 5B1AC 5EIBC 3THOA 3O9OA 3BEHA 5IYZB 1Q6IA 5H5NA 3RFRA 4FJCC 4GKJB 3ABLC 2ZT9B 3K08A 2UU9B 2ZNJA 3FB7C 5EC1C 4I55B 2BSKA 1KU9A 1M56B 3SYQA 3LNMB 4H33A 3ZEDA 4NKGB 1TVKA 3JASB 2VQFO 1W0JG 3K03A 1PNKA 1FJGO 4W4LA 3OD4A 4TV9A 1EBOA 4GLXA 5B1BC 3PJSK 4LNUB 3AG7A 5KHKA 3P3NA 1JPXA 1MA1A 2RQ6A 3SPJA 2Q7EA 3BCCH 4WFEA 2ZM6B 3BAAA 3KCXA 3CCEV 4LC1A 3JSNA 4LFBO 3H1KH 1PL0A 3QNEA 1W0KG 1M4UA 1YDXA 1DGSA 1QCEA 2EINB 1ZAUA 2P6JA 3JAMN 2FMLA 2XOKG 2NNUA 5L3BA 4RWUA 1R73A 1Y76A 1GAXA 5IT9N 4FLWA 4DUZB 4R8CA 3EXAA 2CTQA 3ETGA 4I0XA 4RO2A 3TGUH 4JYAB 1TVKB 1P7GA 2QM7A 4MVRA 1JJ2U 2YIBA 1ZL8A 4TV9B 1V54C 4PJ0Z 2IW5A 4JI0B 2EX3A 5EIBD 4JI1B 4PA9A 4YXWG 2IU3A 4MVUA 1SA0A 4ZI7A 3CMAV 4H37A 4PA3A 1U97A 4UCTA 2LW1A 4P30A 2QR4A 4TV8A 1PL4A 3CMEV 3AK2A 5IY5B 3JARA 4P2ZA 1H8HG 1BS3A 4AHCA 1EZJA 1YJ9V 4I0XB 2QWQB 3U0ZA 1RPOA 1Q43A 3AG4C 1VIBA 4O4HA 2EIMC 3HKEA 4LWSB 1L0LH 4UVBA 1ZL8B 3B4SA 3A0BZ 1ZUQA 1KMIZ 2DMXA 2CGOA 4P9PA 3W7XA 3CWBH 1SZTA 2VQFB 3JALA 3RVYA 1VF5B 1FJGB 1NZ6A 4CH5A 2ZE8A 4ZI7B 2D3OW 5B1OA 1Q7YW 1N33B 3ABTA 2XASA 4DR1O 4G2KA 4PDMA 4K8ZA 1NBMG 1HNWO 1SZXA 1VQ9V 1JOYA 2Y69C 1FXHA 3T4DA 1N8RW 1AI4A 1Z2GA 4WFHA 4LFBB 3AG3B 2V1DA 4JTCB 5CA1A 4L8JA 1R6KA 2EIKB 3W7UA 3VQWA 4O4HB 3HKEB 2F1MA 2OTLV 1XQ8A 2LP7A 3ZMSA 5EC2C 4LH6A 3T1HO 3UT5B 4MTXA 3JALB 1FS0G 1R3KC 4NTYA 3CS5A 4B3TO 5KAIZ 1Y6XA 3T1CA 1MSDA 1NTMH 2WAMA 1Q3EA 2C2AA 3HKBB 4RAIA 1VQ5V 2AHZA 3G67A 1PNLA 5H6RA 3GB7C 4O4LB 1GO3F 1AI7A 3JAWA 4PDLA 3CD6V 4OGQB 3B09A 1T5EA 1H8EG 2QE7G 4U7NA 1BZKA 4TWKA 1GTOA 4EFBA 3PN1A 3B77A 5B1AB 4MTOA 1I5YA 3DGEA 5IJ0A 3Q4HA 1Q86W 4U3JA 4BR6A 3ABLB 3H1JH 1GMGA 3K5MA 3QO8A 1QQCA 3BHPA 5LP6C 3CP1A 4GX5A 4JI6O 4DV7B 2DYSB 4XDKA 2EZPA 3ZRVA 4GZRB 4X65O 3ZN1A 2QEXV 4GX2A 3I55V 5B1BB 1H2LA 3WU2Z 3JAWB 4IGGA 1K7DA 2R9RB 1HNWB 4DV2O 3JD2A 3STLC 2ZE7A 2DJVA 2YUAA 4RQFA 4QE9A 1R1BA 4J42A 5JH7A 4DV3O 4EEQA 5IJ0B 3N2GB 3Q4HB 1J95A 4KXRA 4N23A 1UJWB 4BW5A 1YIJV 4DV1B 1WB7A 5C93A 1EN4A 3JCZA 3T1HB 1K3EA 2EIJB 3AG2C 1RPRA 1CEZA 2F43G 2ZXWB 5TISZ 1VQ6V 1B6QA 2WLMA 3K5LA 4LP8A 1K92A 1J5EO 4DV4O 5KA6A 1F23A 3CHXA 1ENVA 4J41A 1QR8A 2DE0X 5E1AC 5GTIZ 4NR1A 3JATA 2ATKC 1XHXA 1F4NA 2Y4UA 4FIPC 5L3DA 2KB1A 1F7YA 4F6EA 5JH7B 4QE7A 4D7TA 2Q9LA 1F4MA 4CH4A 5J9PC 4K35A 1PPJH 4MVOA 4MT8A 1R6TA 5JCOC 2ILMA 3KKYA 4Z1MG 3OR7C 2ZCEA 4K3AA 1XNQO 5C8YA 1R3JC 1U96A 2JJ2G 3ZX6A 3AG4B 2QKAA 1OCOB 3RBZA 1IXBA 3GWOA 1M90W 1AI5A 2LFRA 1VARA 3STZC 2AZ2A 2Q5ZA 2BTOA 3ZHRA 4FPPA 3L9DA 1NJIW 5HFMA 1SQXH 4YJ3A 5LYJA 3L72H 4JI6B 3JATB 4DV0O 3IFXA 4FM0A 3OGCC 5BMVA 4X65B 1K5QA 4I5SA 1NH2B 4YY3O 3H1LH 5CMUA 3P3PA 1BHAA 1HP8A 3CRCA 2OYQA 4ICGA 4JYBA
chains in the Genus database with same CATH topology
5FLXN 1R1BA 2AGAA 4JI2O 4DV3O 4JI8O 5BY1A 2Z0AA 4DR2O 2UUBO 4JI0O 4DR3O 3T1HO 4LFAO 1N34O 3J7AU 4DR7O 4KHPO 4X64O 4JI1O 3O65A 1FYJA 3F5TA 1XMOO 4B3TO 4JYAO 1G1XB 4LF5O 1AB3A 4JI3O 1IBMO 1A32A 1YZBA 2JRIA 1J5EO 2HHHO 4DV4O 4YHHO 4DV1O 2VQEO 4JI4O 4DR5O 1N32O 1XNRO 2E5LO 4DUYO 2UUCO 3M8AA 4LF9O 2UXBO 4AQYO 1DK1A 2UU9O 1HNXO 5H5NA 1IBKO 4LF4O 4NXMO 5BXZA 1D2DA 2UXCO 1IBLO 3OTOO 2F4VO 1F7YA 2UXDO 5LL6Y 5LMUO 4DV6O 2ZKOA 4B3RO 3T1YO 1XEQA 2VQFO 1R6TA 2N74A 4LF6O 4LFCO 4B3MO 2FKXA 1FJGO 1AILA 4OPAA 4LF7O 1XNQO 4GKJO 4JI5O 4OX9O 5LMNO 1NS1A 4LF8O 3J80N 2DOSA 4B3SO 4A5UB 1HNZO 4JI6O 3J81N 4NXNO 2LW7A 4X62O 4DR4O 1X59A 2UUAO 4DR1O 4LFBO 4X65O 1N36O 1HNWO 5A2QN 4GKKO 1HR0O 4DV5O 5BR8O 4JV5O 3R66A 4DV0O 4DR6O 4DUZO 4OPHA 5IWAO 3JAMN 2ZM6O 4K0KO 4DV7O 4YY3O 4X66O 4DV2O 1FKAO 1N33O 5IT9N 1XMQO 2DJVA 4JI7O 1I94O 1KUQA 3RT3C 3SDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX N;  1R1B A;  2AGA A;  4JI2 O;  4DV3 O;  4JI8 O;  5BY1 A;  2Z0A A;  4DR2 O;  2UUB O;  4JI0 O;  4DR3 O;  3T1H O;  4LFA O;  1N34 O;  3J7A U;  4DR7 O;  4KHP O;  4X64 O;  4JI1 O;  3O65 A;  1FYJ A;  3F5T A;  1XMO O;  4B3T O;  4JYA O;  1G1X B;  4LF5 O;  1AB3 A;  4JI3 O;  1IBM O;  1A32 A;  1YZB A;  2JRI A;  1J5E O;  2HHH O;  4DV4 O;  4YHH O;  4DV1 O;  2VQE O;  4JI4 O;  4DR5 O;  1N32 O;  1XNR O;  2E5L O;  4DUY O;  2UUC O;  3M8A A;  4LF9 O;  2UXB O;  4AQY O;  1DK1 A;  2UU9 O;  1HNX O;  5H5N A;  1IBK O;  4LF4 O;  4NXM O;  5BXZ A;  1D2D A;  2UXC O;  1IBL O;  3OTO O;  2F4V O;  1F7Y A;  2UXD O;  5LL6 Y;  5LMU O;  4DV6 O;  2ZKO A;  4B3R O;  3T1Y O;  1XEQ A;  2VQF O;  1R6T A;  2N74 A;  4LF6 O;  4LFC O;  4B3M O;  2FKX A;  1FJG O;  1AIL A;  4OPA A;  4LF7 O;  1XNQ O;  4GKJ O;  4JI5 O;  4OX9 O;  5LMN O;  1NS1 A;  4LF8 O;  3J80 N;  2DOS A;  4B3S O;  4A5U B;  1HNZ O;  4JI6 O;  3J81 N;  4NXN O;  2LW7 A;  4X62 O;  4DR4 O;  1X59 A;  2UUA O;  4DR1 O;  4LFB O;  4X65 O;  1N36 O;  1HNW O;  5A2Q N;  4GKK O;  1HR0 O;  4DV5 O;  5BR8 O;  4JV5 O;  3R66 A;  4DV0 O;  4DR6 O;  4DUZ O;  4OPH A;  5IWA O;  3JAM N;  2ZM6 O;  4K0K O;  4DV7 O;  4YY3 O;  4X66 O;  4DV2 O;  1FKA O;  1N33 O;  5IT9 N;  1XMQ O;  2DJV A;  4JI7 O;  1I94 O;  1KUQ A;  3RT3 C;  3SDL A; 
#chains in the Genus database with same CATH topology
 5LHI A;  4PI2 A;  4DV2 B;  4X1K A;  2EJ7 A;  3ETQ A;  5B3S B;  2B1G A;  4DR3 O;  3QTC A;  4KHP O;  5CN0 A;  4Q6G A;  3S3W A;  5C8Y B;  2BCC H;  2HJF C;  5EZY A;  4DV3 B;  4JZ2 A;  2ZDI A;  3EHB B;  2YXL A;  3R65 A;  4DXW A;  3APQ A;  1G1X B;  4UCV A;  3SJA C;  4JI3 O;  2K1E A;  2HP8 A;  4YJ3 B;  1BE3 H;  2RCV A;  4DR5 O;  1N32 O;  4JAU A;  3CX5 F;  4BIO A;  5BMV B;  4DV4 B;  4AQY O;  1ZWI C;  1YF2 A;  2Y48 A;  2WWW A;  2CH7 A;  2YDE A;  5LP6 A;  4FLX A;  1WA8 A;  2ADQ B;  4HYO A;  1TA8 A;  1NR1 A;  3T4Z A;  2A9H A;  1P49 A;  2ZR3 A;  3E8F A;  4DO2 A;  3ZMU A;  2ZIN A;  4F6R A;  4FVM A;  1GM9 A;  2JVD A;  2H8P C;  5FNV A;  5EZY B;  3QF7 A;  4UV9 A;  4EFE A;  1AIL A;  2UUA B;  3G80 A;  4PI0 A;  4GKJ O;  2W6I G;  2Q73 A;  1VQL V;  2GTA A;  3H1I H;  2IU0 A;  1NS1 A;  1S77 D;  1XL4 A;  3J80 N;  3OEE G;  3MDS A;  1H2N A;  3N27 A;  2BE3 A;  4KP4 A;  3B40 A;  4QGP A;  1X59 A;  1FXK A;  1WAZ A;  4J9Z B;  5F2V O;  1US6 A;  2PI5 A;  1JQ0 A;  3OW2 U;  3AG1 C;  2ZR2 A;  2Q8V A;  2CH7 B;  3CCU V;  4HNA A;  1WA8 B;  5GON B;  2ZM6 O;  4GYC B;  4DV0 B;  2IH1 C;  4CS2 A;  1OCR B;  3OUS A;  5FLX N;  1VQK V;  5BY1 A;  2QWN B;  5FNV B;  3C90 A;  4TQD A;  2IJK A;  4CBC A;  2AXT Z;  2QTS A;  3UKM A;  2OT5 A;  4E4E A;  4DR3 B;  1XRE A;  4UCU A;  4DUY B;  1YXB A;  2UXN A;  2WLI A;  4WF9 V;  3RYC A;  1H2K A;  5IYD O;  4KHP B;  1WPB A;  1COW G;  4JYA O;  2WLJ A;  3OT7 A;  1M9N A;  3ZRS A;  1IBK B;  2XAJ A;  1A32 A;  1FXK B;  3TK1 A;  2EBO A;  1ZX3 A;  1WPX A;  3CCQ V;  2F4V B;  2XAQ A;  5JCO A;  2CK3 G;  1CP9 A;  2JEX A;  3ML0 A;  5L3C A;  2ZIM A;  4UCR A;  4HNA B;  1DK1 A;  2YID A;  3WG7 C;  1QR9 A;  2YXH A;  4DR5 B;  1N32 B;  3LUT B;  1WP8 A;  5GTH Z;  2PGG A;  2X7R B;  4YIO A;  1YVW A;  3IGA C;  1NKD A;  5LA6 A;  3ZHQ A;  3UCS C;  2R72 A;  4NTW A;  3K9S A;  4IL6 Z;  1NTK H;  1RSO A;  1IVS A;  5J2U A;  2WLI B;  1AR4 A;  2VWJ A;  1TUE B;  1Q8I A;  3K58 A;  1IUR A;  1KKC A;  4B3S O;  4RUE A;  3L71 H;  4EB6 A;  1P84 F;  4IYH A;  1QHT A;  2F93 B;  3MHS C;  4U3F H;  2QM4 A;  1OJH A;  3ETD A;  4ABM A;  4D6T H;  1S5J A;  3E22 A;  3LSQ A;  5JVD A;  2GHY A;  4PDV A;  5KX5 A;  1VEW A;  2Y4T A;  5FL7 G;  1IXM A;  2EIL B;  1VF6 C;  1EZV H;  3FX7 A;  3WB0 A;  1N33 O;  3HR0 A;  4ZHQ A;  3C3T A;  5LA6 B;  4JI7 O;  1KUQ A;  1GM8 A;  2GDS A;  5KHG A;  4WFF A;  1RSO B;  2KQX A;  2QA4 V;  4DR7 O;  2E75 B;  2QGN A;  1SET A;  2Q7H A;  3O65 A;  1VMG A;  5J2T A;  1F51 A;  5HFL A;  3VQY A;  2H3O A;  3CCV V;  4YIP A;  4GX1 A;  4EB6 B;  3ZHS A;  4I7Z B;  2BSK B;  5B66 Z;  3CCS V;  1RM1 C;  2HHH O;  3UM7 A;  3BA8 A;  3E22 B;  2LQT A;  5JVD B;  4PA6 A;  5KX5 B;  4KL1 A;  1EN5 A;  5DED A;  1AJQ A;  1FFT B;  2WA3 A;  2PI4 A;  2UXC O;  4ASU G;  3VQV A;  4YJ2 A;  1KD1 W;  3ABM B;  1R6N A;  3M99 B;  1V9P A;  1K4C C;  3X2Q C;  5J2T B;  3F5W C;  5EYP A;  1G6U A;  4CC5 A;  2HVK C;  1MSW D;  1R3I C;  1Y66 A;  1Y76 B;  3ZN0 A;  3KCY A;  2VWK A;  2W6J G;  4K0K B;  2LO1 A;  2YXY A;  2HVJ C;  4BW9 A;  4DR4 O;  3ASO B;  3ZIA G;  4B3S B;  4CZZ A;  1WN7 A;  1MNG A;  4G28 B;  4JV5 O;  5BR8 O;  1PP9 H;  3A0R A;  1VQO V;  4GX0 A;  4DR6 O;  3IC9 A;  5D5P A;  1BHB A;  3JYC A;  4DV7 O;  2A0L A;  4YJ2 B;  3BA9 A;  2PZS A;  4UFZ A;  1SA0 B;  2BOB C;  3SDL A;  4ZKI A;  2MW2 B;  1H38 A;  2JIZ G;  2YI9 A;  4PA4 A;  2PUS A;  2UUB O;  1V55 C;  4JI7 B;  4TV8 B;  4LR3 A;  2PYJ A;  1VF7 A;  5EYP B;  3EFF K;  2QWP B;  4Q20 A;  1BL8 A;  1M93 A;  3LDE A;  5BZB A;  2E5L B;  3JAR B;  4DR7 B;  3G71 V;  1E1R G;  1MAB G;  2UXB B;  1E1Q G;  2XAF A;  1AR5 A;  4LF4 B;  1AB3 A;  3ABK C;  4YHH O;  2AHY A;  4DV1 O;  3TJT A;  3VOU A;  1XNR O;  2DYR C;  4MVQ A;  5EK0 A;  1OCC C;  2HHH B;  1M57 C;  4QPK A;  1I7F A;  2IBZ H;  2QKS A;  1HNX O;  4CH6 A;  3CE2 A;  4J11 A;  1BGY H;  4QNH B;  1SER A;  5KUM A;  4DRX A;  3GWK C;  3BAB A;  2UXC B;  2ADP A;  1QLE C;  3K5N A;  5KHH A;  3ZHU A;  1WNS A;  2RMK B;  1WLE A;  3FYE B;  1MZF A;  5CA1 B;  1Q81 W;  3LDC A;  1VQP V;  3CCM V;  2WLN A;  3E8H A;  3TCU A;  3UO2 A;  3SPG A;  2L6L A;  1EFR G;  2EUL A;  4FFB A;  4LCU C;  2LFS A;  5LHG A;  3KG2 A;  2V4D A;  1Q6U A;  4DR4 B;  4OPH A;  5B1N A;  1OHH G;  1ZTE A;  3K57 A;  4DW1 A;  3QG5 A;  4XDJ A;  3JCU Z;  2R9I A;  2DWD C;  5BR8 B;  4JV5 B;  4UCS A;  3C3S A;  2LGQ A;  2FB5 A;  4DR6 B;  4JAS A;  2WLH A;  1AJN A;  5JQG A;  1XHZ A;  4JYC A;  4X9Q A;  1YJN V;  2AGA A;  4RUF A;  2PTM A;  4PEL A;  1TGO A;  1BMF G;  4J7Z A;  4O4I A;  4X64 O;  3ZMV A;  5H6Q A;  2ZE6 A;  4NYK A;  5D5Q A;  4WFB V;  1K5S A;  2UUB B;  2E76 B;  1JVM A;  3W7S A;  1DF5 A;  4JGS A;  1XMO O;  2QWO B;  1IZ3 A;  1FFX A;  2P67 A;  5IYB O;  2ODM A;  4BAY A;  4TUY A;  3FFQ A;  1I0H A;  4WFA V;  3QO7 A;  3CC4 V;  2UUC O;  4NTX A;  4YHH B;  4U3J B;  4LF6 B;  2Q6A A;  1SQP H;  3K3W A;  3L74 H;  3WB2 A;  1XNR B;  3BFR A;  1G4Y B;  5JQG B;  4JF3 A;  1JMK C;  1HNX B;  2RNB A;  3ICX A;  4MVZ A;  1S5L Z;  1SES A;  3K9A A;  1V54 B;  3JD4 A;  4O4I B;  2VS0 A;  4LF7 O;  4RQE A;  4Z1V A;  3ASN C;  3UQ8 A;  1I08 A;  4JI5 O;  1SF9 A;  3CRR A;  2JJ1 G;  4CH3 A;  5KHI A;  5LGN A;  4TUY B;  4NXN O;  3SYC A;  2UUA O;  1LUV A;  1HR0 O;  4DV5 O;  3SPH A;  2QM8 A;  1VQN V;  4TT3 G;  4DYL A;  2N04 A;  3DXR A;  1K97 A;  3SJQ C;  2V7Q G;  3TET A;  5LGT A;  3MD0 A;  1N4C A;  2EIM B;  1AR1 B;  3SR2 C;  4I9Q A;  4TSF G;  1M56 C;  2Z0A A;  4DR2 O;  4FFK A;  4LFA O;  4H0L B;  4FMT A;  4JAA A;  4UV8 A;  2P4K A;  3LNN A;  3WFV A;  2NLJ C;  3LSU A;  3T2M A;  3OAA G;  2BOC C;  2UXX A;  4X64 B;  3F5T A;  2JGU A;  4JYY A;  2P06 A;  3I5D A;  1IDS A;  2OCH A;  2Q68 A;  4J7J A;  1YZB A;  3A2F A;  1SC5 B;  2JGD A;  3CJH A;  1XMO B;  1E79 G;  3CB2 A;  1SRY A;  1G8M A;  5LOV A;  2Y69 B;  2WA4 A;  4JI4 O;  4X88 A;  4AI8 A;  4DUY O;  1XBL A;  5JJJ B;  2JS5 A;  1GH6 A;  1X4T A;  2EIN C;  1IBK O;  3E83 A;  2UUC B;  3OTO O;  3AEI A;  3CCR V;  2F4V O;  4UB6 Z;  5FPR A;  1IX9 A;  4OX9 B;  1GKF A;  2NR5 A;  2CTR A;  4LF8 B;  1L8D A;  3FAV A;  3HB3 B;  5CBF A;  3OFN G;  2DYR B;  2YIC A;  1BSM A;  2G38 A;  5LYJ B;  2OIG A;  1K34 A;  1XIL A;  2FKX A;  1YI2 V;  4J80 A;  3U11 A;  1NVP B;  3SGI A;  3E89 A;  1UPG A;  1WB8 A;  4LF7 B;  4MS2 A;  5JJE B;  1YHQ V;  4JI5 B;  2JGD B;  3CJH B;  5K1X A;  1QLE B;  5KAF Z;  4X1K B;  5LOV B;  2P7T C;  4X62 O;  3F7V C;  1K9M W;  4C7U A;  3BVO A;  2XND G;  1N36 O;  1GRJ A;  1FAF A;  5IYC O;  3R66 A;  4NXN B;  4I50 A;  3FB8 C;  1AVM A;  4MSW C;  2A79 B;  1HR0 B;  5ITZ A;  4DV5 B;  4K8X A;  5IY5 C;  1W59 A;  4X66 O;  2P22 C;  2PY5 A;  3VBB A;  1DF4 A;  3RT3 C;  3FAV B;  4J9Y B;  3CPW U;  3BRC A;  2CGN A;  4WCE V;  3CXH F;  4UB8 Z;  2LGW A;  3CC2 V;  4DR2 B;  2YIA A;  5LP6 B;  4LFA B;  1FYJ A;  1DTO A;  4GUN A;  1GM7 A;  2M6Y A;  1B04 A;  2XT9 A;  4F6R B;  1GK9 A;  1H2M A;  4ZBM A;  3D8C A;  5H9C A;  4I50 B;  4LBE C;  3OMA B;  3T1Y B;  2WLK A;  2IJH A;  3DC6 A;  5ITZ B;  5L3G A;  4JI4 B;  3OEH G;  3AG3 C;  3G4S V;  4IHJ A;  1IBL O;  1OZ0 A;  1JJO A;  2EIK C;  4B3R O;  3JD0 A;  4B7K A;  3OTO B;  4DK0 A;  4B3M O;  5DEC A;  4O4J A;  3D3Q A;  5LXT A;  2ZE5 A;  1KC8 W;  3CSX A;  2YC0 A;  3AG2 B;  4P9O A;  1SQQ H;  4UVA A;  2R70 A;  1QU7 A;  4X8A A;  4OXS A;  4A5U B;  4J10 A;  4ZOL A;  1HNZ O;  3ZHV A;  2B1I A;  3OTF A;  2LW7 A;  4QJF B;  4FZ0 A;  1YTF B;  2F95 B;  4DK1 A;  4JI8 B;  4X62 B;  2H94 A;  1PKX A;  2ZIO A;  2ETN A;  1N36 B;  4IHJ B;  2YIB D;  3RYC B;  1SQF A;  4K0K O;  1O9G A;  2RJZ A;  1XMQ O;  1BT8 A;  2LJ2 A;  2Q0A A;  4UUJ C;  3HPL C;  1PV0 A;  2GTS A;  4X66 B;  3CRQ A;  3QO5 A;  4O4J B;  1N0N A;  5LXT B;  1NU1 H;  2FTK A;  1MOF A;  1VQM V;  1HWY A;  2DQ3 A;  3P32 A;  2ITC C;  1YCI A;  5CA0 A;  1DLB A;  4ZOL B;  1NQT A;  3K79 A;  2CTW A;  5L3F A;  1NT2 B;  2JRI A;  1KP3 A;  3H1H H;  1NTZ H;  2DYS C;  2Z5U A;  5LMU B;  2IJJ A;  1BCC H;  1GN3 A;  2E5L O;  1GN6 A;  2WLL A;  2YSU B;  1ZLZ A;  2X6A A;  5J2U B;  2UXB O;  2GSM B;  4X89 A;  4NXM O;  4LF4 O;  1WP7 A;  4H13 B;  3E8B A;  4E2L A;  5DM6 V;  2DWE C;  5EBL C;  1IBL B;  4EKW A;  1XEQ A;  1PM9 A;  4CS4 A;  2X0L A;  4FLU A;  4B3R B;  2W0X A;  1SQG A;  1GN2 A;  5KMG A;  1SS3 A;  1CPY A;  4TQF A;  5CA0 B;  2L35 A;  3G6E V;  4B3M B;  2W0F C;  1NI8 A;  3ZHT A;  5JWP A;  2EZO A;  3CXC U;  3RWR D;  3M7M X;  2EIJ C;  4NB5 A;  4ZHQ B;  4PA7 A;  1O9H A;  1ORQ C;  1H2S B;  2ZXW C;  4X20 A;  3J81 N;  4LWS A;  5EBW C;  5CB4 A;  2GUZ A;  3U10 A;  2WLL B;  3A8T A;  1HNZ B;  2OCC C;  3MHH C;  1BQ0 A;  1MMM A;  2CE4 A;  2GBO A;  2QWR B;  1LNQ A;  2JEU A;  3SYP A;  1FPO A;  3DSQ A;  3KZI Z;  4R6Z A;  1S5H C;  4KFM A;  2Q67 A;  3JAK A;  1ARO P;  5KLV H;  4O2B A;  3RYH A;  2QDO A;  3ZRW A;  1WJZ A;  3IAY A;  3WB1 A;  1XMQ B;  4LF5 B;  1L0N H;  4B08 A;  2WPD G;  2WSS G;  1N34 O;  1KQS U;  5KMG B;  4WBN A;  5A9G A;  1CXZ B;  3RN4 A;  4JPR A;  3ZRX A;  1RFY A;  4MW8 A;  4X20 B;  2QJ1 A;  4CS3 A;  1OCO C;  1IBM O;  5GW7 A;  1D5A A;  2HG5 C;  2IM9 A;  2GV9 A;  5CB4 B;  2GUZ B;  1B06 A;  2D2C B;  2IH3 C;  4PHZ A;  3AG1 B;  1XL6 A;  4QIW F;  1VQ7 V;  3UT5 A;  1NR7 A;  1S72 V;  3S3X A;  3FB5 C;  1D2D A;  3JAK B;  1QBZ A;  4UXN A;  4O2B B;  3B8N A;  3RYH B;  3FKS G;  4DV6 O;  3ZRW B;  1KBH A;  4NXM B;  1URF A;  5KHJ A;  2QTO A;  5EBM C;  4R50 A;  4LF6 O;  3K0D A;  4LFC O;  3AK3 A;  3HKB A;  3CEI A;  2O57 A;  4WBN B;  3DTU B;  1Z5W A;  5B3S C;  3JD3 A;  2CUG A;  1AP5 A;  1YIT V;  2Q69 A;  5L3E A;  2E74 B;  4O4L A;  2E3C A;  1OCZ C;  1AP6 A;  1JR9 A;  1ZSP A;  4O2A A;  1AJP A;  5IDJ A;  4GKK O;  5LGU A;  2ITD C;  1Q5O A;  3WG7 B;  4W4K A;  4NVP A;  1VF6 A;  2M7W A;  1XDC A;  1FKA O;  3E2E A;  2Y0I A;  1I94 O;  4XBF A;  3CRM A;  2P5O A;  2YEV A;  4F4L A;  4DW0 A;  2OTJ V;  5IJ9 A;  2NN4 A;  1W2B U;  5CA3 A;  2KSD A;  3ABU A;  4UCO A;  4FZ1 A;  4D7S A;  3A0H Z;  2R9A A;  3H01 A;  3RYF A;  1N0J A;  2ZDI C;  1N34 B;  2CAZ C;  2KG7 A;  1TAE A;  4DRX B;  3K5O A;  4HAM A;  3TXQ A;  3CC7 V;  4O2A B;  3SYO A;  3B2E E;  4BWA A;  1KYO F;  3H9V A;  1VQ8 V;  1MG1 A;  1NH2 D;  2VQE O;  1XI1 A;  1M1K W;  4BIZ A;  1IBM B;  3IJ4 A;  3N2G A;  3DC5 A;  1AI6 A;  3M8A A;  4ZIB A;  4LF9 O;  3F7Y C;  4X1Y A;  4IYI A;  1S3J A;  1JCH A;  5BXZ A;  3BY6 A;  3LSS A;  2YEV B;  2UXD O;  5LL6 Y;  2ZNI A;  2Z3Y A;  5LHH A;  2ZKO A;  4FM2 A;  5IJ9 B;  1OCR C;  4FLV A;  1THZ A;  2JDI G;  3RVZ A;  4UVC A;  4JAV A;  1VQ4 V;  2N74 A;  3RGB A;  4FFB B;  4DV6 B;  2A3Q A;  3RYF B;  1K4D C;  4DR1 B;  1K33 A;  1SKV A;  3EVK A;  4LFC B;  2HEP A;  3UO3 A;  1EN6 A;  2KG7 B;  4OX9 O;  2XTA A;  4L87 A;  4R7C A;  4LF8 O;  3CRA A;  4FLT A;  2DOS A;  1NVP D;  2PYL A;  1RM1 B;  3W7W A;  2B9Z A;  3D36 C;  1K8A W;  4WFG A;  3OUF A;  3CCJ V;  4PD4 F;  1FXK C;  2HFE C;  3W7T A;  5A2Q N;  4MVS A;  4X1Y B;  2YS8 A;  1RP3 B;  1Y67 A;  4MTG A;  2JS3 A;  4GKK B;  2IJI A;  1TUB A;  4FM1 A;  1FFX B;  1H2G A;  1QNM A;  3APO A;  4B3T B;  3ZMT A;  2OCC B;  3ETE A;  1K73 W;  1XUQ A;  1I94 B;  3JD1 A;  3J7A U;  3X2Q B;  2DW4 A;  2ZD9 A;  3P30 A;  1KKD A;  5IE9 A;  4AIL C;  1SQV H;  1Y4M A;  2VRZ A;  1ROP A;  2AW9 A;  4JTA B;  3NR7 A;  1QLN A;  3BPZ A;  1P4R A;  5K1P A;  2X6C A;  1L1F A;  2HR3 A;  4N21 A;  3RW0 A;  2A06 H;  2F66 C;  2ZQM A;  5E79 Z;  1QVF U;  4G27 B;  1R3L C;  1JX9 A;  4HZ3 A;  4MTF A;  2VQE B;  1TUB B;  3N2K A;  4LF9 B;  2EIL C;  1BQZ A;  3SJC C;  1GN4 A;  4PDR A;  1V55 B;  3OMN B;  3T1Y O;  2Q4P A;  1JFF A;  2HKO A;  1KP2 A;  2UXD B;  5H2F Z;  2ARH A;  5B5E Z;  3E35 A;  4OPA A;  3E8G A;  3NXS A;  3HKD A;  3DXR B;  1FD9 A;  5LMN O;  1D5N A;  3L75 H;  2CDY A;  3ABK B;  3ZMZ A;  4TOI A;  3JSL A;  4CC6 A;  2MK3 A;  1OCC B;  1M57 B;  1Q90 D;  3N2K B;  5IWA O;  3FYI B;  3FB6 C;  5CBH A;  1OCZ B;  1YTF D;  5KA5 A;  2XHB A;  1Y74 A;  2CTP A;  2RN9 A;  2P4V A;  4HBN A;  4LH7 A;  4H44 B;  1Q82 W;  1JFF B;  4JI2 O;  2B5U A;  4IT5 A;  1UFI A;  2FL4 A;  4JI8 O;  3ABM C;  3K59 A;  1SQB H;  3LDD A;  1VP7 A;  1J5E B;  4JZG A;  3HKD B;  2JK5 C;  3ZBH A;  3SPC A;  3OGI B;  3D3I A;  5GON A;  1LR1 A;  1LUW A;  4IIJ A;  2BTQ A;  3QVN A;  1M5I A;  5FPO A;  2Y0P A;  3K0G A;  2QKC A;  3GVM A;  4PV1 B;  1HDJ A;  4I4T A;  4JTD B;  4Z2W A;  2K9P A;  2F23 A;  3ASO C;  1P7B A;  2YI8 A;  1MZE A;  2UU9 O;  5LBQ A;  1PNM A;  1YEW A;  1JA8 A;  3K04 A;  1Y74 B;  1XNQ B;  4XDL A;  3D36 A;  3TXS A;  5CBG A;  2XAG A;  5LMU O;  1S76 D;  4BIU A;  2AZ0 A;  4J7K A;  3SYA A;  1Q6H A;  1Z5V A;  4X1I A;  3VQX A;  3MAQ A;  3G6B A;  2XAH A;  3OMI B;  2RDC A;  4GCZ A;  5JJN B;  1QVG U;  2OWO A;  1B3Q A;  3K06 A;  4IIJ B;  2XUM A;  2BTQ B;  2OIE A;  5DN6 G;  5AG2 A;  3HKC A;  1KEC A;  3RYI A;  1PD3 A;  1HW7 A;  2EJR A;  4I4T B;  5LMN B;  2N05 A;  4YY3 B;  1KB9 F;  2FYU H;  2KKW A;  1YSC A;  3E86 A;  4MW3 A;  1FXV A;  2DN9 A;  3CCL V;  3ZJZ A;  3B8M A;  4DUZ O;  1EM1 A;  2PF4 E;  4FLZ A;  5IYZ A;  3FD9 A;  4FK5 C;  3I56 V;  2DQ0 A;  4QPJ A;  5IWA B;  4GT1 A;  3IC7 A;  2Q0O C;  2P90 A;  2A7W A;  4I55 A;  4X1I B;  1OV9 A;  1S0V A;  3OE7 G;  3ZCC A;  4JI3 B;  4JI0 O;  3JAS A;  3OM3 B;  3ASN B;  4I9W A;  5KUK A;  4JI2 B;  3L73 H;  4JI1 O;  2HLD G;  3ZS8 C;  2Q7G A;  3HKC B;  3CYO A;  3RYI B;  2X6B A;  1I5X A;  4KUM A;  3SJB C;  4FLY A;  4AQY B;  4LNU A;  4U7O A;  1XOU A;  3SPI A;  4LF5 O;  3AK1 A;  3OR6 C;  4MVM A;  2HJD A;  4B7E A;  2QSA A;  1YJW V;  3L70 H;  5B1A C;  5EIB C;  3THO A;  3O9O A;  3BEH A;  5IYZ B;  1Q6I A;  5H5N A;  3RFR A;  4FJC C;  4GKJ B;  3ABL C;  2ZT9 B;  3K08 A;  2UU9 B;  2ZNJ A;  3FB7 C;  5EC1 C;  4I55 B;  2BSK A;  1KU9 A;  1M56 B;  3SYQ A;  3LNM B;  4H33 A;  3ZED A;  4NKG B;  1TVK A;  3JAS B;  2VQF O;  1W0J G;  3K03 A;  1PNK A;  1FJG O;  4W4L A;  3OD4 A;  4TV9 A;  1EBO A;  4GLX A;  5B1B C;  3PJS K;  4LNU B;  3AG7 A;  5KHK A;  3P3N A;  1JPX A;  1MA1 A;  2RQ6 A;  3SPJ A;  2Q7E A;  3BCC H;  4WFE A;  2ZM6 B;  3BAA A;  3KCX A;  3CCE V;  4LC1 A;  3JSN A;  4LFB O;  3H1K H;  1PL0 A;  3QNE A;  1W0K G;  1M4U A;  1YDX A;  1DGS A;  1QCE A;  2EIN B;  1ZAU A;  2P6J A;  3JAM N;  2FML A;  2XOK G;  2NNU A;  5L3B A;  4RWU A;  1R73 A;  1Y76 A;  1GAX A;  5IT9 N;  4FLW A;  4DUZ B;  4R8C A;  3EXA A;  2CTQ A;  3ETG A;  4I0X A;  4RO2 A;  3TGU H;  4JYA B;  1TVK B;  1P7G A;  2QM7 A;  4MVR A;  1JJ2 U;  2YIB A;  1ZL8 A;  4TV9 B;  1V54 C;  4PJ0 Z;  2IW5 A;  4JI0 B;  2EX3 A;  5EIB D;  4JI1 B;  4PA9 A;  4YXW G;  2IU3 A;  4MVU A;  1SA0 A;  4ZI7 A;  3CMA V;  4H37 A;  4PA3 A;  1U97 A;  4UCT A;  2LW1 A;  4P30 A;  2QR4 A;  4TV8 A;  1PL4 A;  3CME V;  3AK2 A;  5IY5 B;  3JAR A;  4P2Z A;  1H8H G;  1BS3 A;  4AHC A;  1EZJ A;  1YJ9 V;  4I0X B;  2QWQ B;  3U0Z A;  1RPO A;  1Q43 A;  3AG4 C;  1VIB A;  4O4H A;  2EIM C;  3HKE A;  4LWS B;  1L0L H;  4UVB A;  1ZL8 B;  3B4S A;  3A0B Z;  1ZUQ A;  1KMI Z;  2DMX A;  2CGO A;  4P9P A;  3W7X A;  3CWB H;  1SZT A;  2VQF B;  3JAL A;  3RVY A;  1VF5 B;  1FJG B;  1NZ6 A;  4CH5 A;  2ZE8 A;  4ZI7 B;  2D3O W;  5B1O A;  1Q7Y W;  1N33 B;  3ABT A;  2XAS A;  4DR1 O;  4G2K A;  4PDM A;  4K8Z A;  1NBM G;  1HNW O;  1SZX A;  1VQ9 V;  1JOY A;  2Y69 C;  1FXH A;  3T4D A;  1N8R W;  1AI4 A;  1Z2G A;  4WFH A;  4LFB B;  3AG3 B;  2V1D A;  4JTC B;  5CA1 A;  4L8J A;  1R6K A;  2EIK B;  3W7U A;  3VQW A;  4O4H B;  3HKE B;  2F1M A;  2OTL V;  1XQ8 A;  2LP7 A;  3ZMS A;  5EC2 C;  4LH6 A;  3T1H O;  3UT5 B;  4MTX A;  3JAL B;  1FS0 G;  1R3K C;  4NTY A;  3CS5 A;  4B3T O;  5KAI Z;  1Y6X A;  3T1C A;  1MSD A;  1NTM H;  2WAM A;  1Q3E A;  2C2A A;  3HKB B;  4RAI A;  1VQ5 V;  2AHZ A;  3G67 A;  1PNL A;  5H6R A;  3GB7 C;  4O4L B;  1GO3 F;  1AI7 A;  3JAW A;  4PDL A;  3CD6 V;  4OGQ B;  3B09 A;  1T5E A;  1H8E G;  2QE7 G;  4U7N A;  1BZK A;  4TWK A;  1GTO A;  4EFB A;  3PN1 A;  3B77 A;  5B1A B;  4MTO A;  1I5Y A;  3DGE A;  5IJ0 A;  3Q4H A;  1Q86 W;  4U3J A;  4BR6 A;  3ABL B;  3H1J H;  1GMG A;  3K5M A;  3QO8 A;  1QQC A;  3BHP A;  5LP6 C;  3CP1 A;  4GX5 A;  4JI6 O;  4DV7 B;  2DYS B;  4XDK A;  2EZP A;  3ZRV A;  4GZR B;  4X65 O;  3ZN1 A;  2QEX V;  4GX2 A;  3I55 V;  5B1B B;  1H2L A;  3WU2 Z;  3JAW B;  4IGG A;  1K7D A;  2R9R B;  1HNW B;  4DV2 O;  3JD2 A;  3STL C;  2ZE7 A;  2DJV A;  2YUA A;  4RQF A;  4QE9 A;  1R1B A;  4J42 A;  5JH7 A;  4DV3 O;  4EEQ A;  5IJ0 B;  3N2G B;  3Q4H B;  1J95 A;  4KXR A;  4N23 A;  1UJW B;  4BW5 A;  1YIJ V;  4DV1 B;  1WB7 A;  5C93 A;  1EN4 A;  3JCZ A;  3T1H B;  1K3E A;  2EIJ B;  3AG2 C;  1RPR A;  1CEZ A;  2F43 G;  2ZXW B;  5TIS Z;  1VQ6 V;  1B6Q A;  2WLM A;  3K5L A;  4LP8 A;  1K92 A;  1J5E O;  4DV4 O;  5KA6 A;  1F23 A;  3CHX A;  1ENV A;  4J41 A;  1QR8 A;  2DE0 X;  5E1A C;  5GTI Z;  4NR1 A;  3JAT A;  2ATK C;  1XHX A;  1F4N A;  2Y4U A;  4FIP C;  5L3D A;  2KB1 A;  1F7Y A;  4F6E A;  5JH7 B;  4QE7 A;  4D7T A;  2Q9L A;  1F4M A;  4CH4 A;  5J9P C;  4K35 A;  1PPJ H;  4MVO A;  4MT8 A;  1R6T A;  5JCO C;  2ILM A;  3KKY A;  4Z1M G;  3OR7 C;  2ZCE A;  4K3A A;  1XNQ O;  5C8Y A;  1R3J C;  1U96 A;  2JJ2 G;  3ZX6 A;  3AG4 B;  2QKA A;  1OCO B;  3RBZ A;  1IXB A;  3GWO A;  1M90 W;  1AI5 A;  2LFR A;  1VAR A;  3STZ C;  2AZ2 A;  2Q5Z A;  2BTO A;  3ZHR A;  4FPP A;  3L9D A;  1NJI W;  5HFM A;  1SQX H;  4YJ3 A;  5LYJ A;  3L72 H;  4JI6 B;  3JAT B;  4DV0 O;  3IFX A;  4FM0 A;  3OGC C;  5BMV A;  4X65 B;  1K5Q A;  4I5S A;  1NH2 B;  4YY3 O;  3H1L H;  5CMU A;  3P3P A;  1BHA A;  1HP8 A;  3CRC A;  2OYQ A;  4ICG A;  4JYB A; 
#chains in the Genus database with same CATH homology
 5FLX N;  1R1B A;  2AGA A;  4JI2 O;  4DV3 O;  4JI8 O;  5BY1 A;  2Z0A A;  4DR2 O;  2UUB O;  4JI0 O;  4DR3 O;  3T1H O;  4LFA O;  1N34 O;  3J7A U;  4DR7 O;  4KHP O;  4X64 O;  4JI1 O;  3O65 A;  1FYJ A;  3F5T A;  1XMO O;  4B3T O;  4JYA O;  1G1X B;  4LF5 O;  1AB3 A;  4JI3 O;  1IBM O;  1A32 A;  1YZB A;  2JRI A;  1J5E O;  2HHH O;  4DV4 O;  4YHH O;  4DV1 O;  2VQE O;  4JI4 O;  4DR5 O;  1N32 O;  1XNR O;  2E5L O;  4DUY O;  2UUC O;  3M8A A;  4LF9 O;  2UXB O;  4AQY O;  1DK1 A;  2UU9 O;  1HNX O;  5H5N A;  1IBK O;  4LF4 O;  4NXM O;  5BXZ A;  1D2D A;  2UXC O;  1IBL O;  3OTO O;  2F4V O;  1F7Y A;  2UXD O;  5LL6 Y;  5LMU O;  4DV6 O;  2ZKO A;  4B3R O;  3T1Y O;  1XEQ A;  2VQF O;  1R6T A;  2N74 A;  4LF6 O;  4LFC O;  4B3M O;  2FKX A;  1FJG O;  1AIL A;  4OPA A;  4LF7 O;  1XNQ O;  4GKJ O;  4JI5 O;  4OX9 O;  5LMN O;  1NS1 A;  4LF8 O;  3J80 N;  2DOS A;  4B3S O;  4A5U B;  1HNZ O;  4JI6 O;  3J81 N;  4NXN O;  2LW7 A;  4X62 O;  4DR4 O;  1X59 A;  2UUA O;  4DR1 O;  4LFB O;  4X65 O;  1N36 O;  1HNW O;  5A2Q N;  4GKK O;  1HR0 O;  4DV5 O;  5BR8 O;  4JV5 O;  3R66 A;  4DV0 O;  4DR6 O;  4DUZ O;  4OPH A;  5IWA O;  3JAM N;  2ZM6 O;  4K0K O;  4DV7 O;  4YY3 O;  4X66 O;  4DV2 O;  1FKA O;  1N33 O;  5IT9 N;  1XMQ O;  2DJV A;  4JI7 O;  1I94 O;  1KUQ A;  3RT3 C;  3SDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...