4DR1O

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr1O00
4DR1O 4LF6O 1XMQO 4X64O 1AILA 3T1HO 2UXDO 1KUQA 4DV0O 4LF8O 4NXNO 1NS1A 2HHHO 4JI8O 2E5LO 2UU9O 4DV6O 4LFCO 2N74A 2Z0AA 5BY1A 2DJVA 3M8AA 4AQYO 1FJGO 1IBMO 4JI2O 1DK1A 5IT9N 4X65O 3SDLA 4DR3O 1AB3A 1FKAO 1HNZO 4DR2O 4DR7O 3RT3C 1IBLO 4JI4O 1N34O 1YZBA 3O65A 4OPHA 4YY3O 5A2QN 3J81N 5LMUO 4K0KO 4JYAO 2JRIA 4DR4O 5BR8O 1A32A 2UUAO 1N32O 4NXMO 4YHHO 4LF5O 4JV5O 1R1BA 2UXBO 4B3SO 4OPAA 5H5NA 4DR5O 1X59A 1XNRO 1F7YA 2ZM6O 3R66A 1XEQA 2VQFO 2F4VO 2VQEO 1I94O 2FKXA 3J7AU 4JI3O 4JI1O 4DV3O 4LF9O 2LW7A 4LFBO 3F5TA 4GKKO 2UXCO 4OX9O 1XNQO 4DV2O 1R6TA 4A5UB 4B3TO 1J5EO 1HNXO 4X62O 3JAMN 2DOSA 5FLXN 4LF7O 4LFAO 1HNWO 4LF4O 3OTOO 4JI7O 5LMNO 1N33O 2AGAA 1D2DA 4DV4O 4KHPO 4B3RO 1N36O 2UUCO 4DUZO 1FYJA 4JI6O 4DV1O 1G1XB 1IBKO 4DV7O 4X66O 5IWAO 4DR6O 2UUBO 5LL6Y 3J80N 5BXZA 4GKJO 4JI0O 1XMOO 4B3MO 4JI5O 3T1YO 4DV5O 4DUYO 2ZKOA 1HR0O
chains in the Genus database with same CATH superfamily
4O4LA 3OMNB 1PV0A 4X64O 5CA1B 1ENVA 1E1QG 1P7GA 2ZXWC 4FLWA 3KCXA 4O2AA 5ITZB 3B40A 3AK2A 2KKWA 2D2CB 4DV6O 3L74H 2XHBA 4NKGB 1SKVA 2WLNA 1Q6UA 3CE2A 4ZKIA 2ILMA 5JQGB 3WU2Z 1HNZO 2QKCA 4TUYA 2Y0PA 1HP8A 5HFMA 1Q43A 1IBLO 3EFFK 5EIBD 4MTXA 4QJFB 4I0XA 1Z2GA 2XTAA 3JARB 4DR3B 5E79Z 3E8GA 5CB4A 2LGWA 1WLEA 4KFMA 1WPBA 4CS2A 1HNWB 1RPOA 1NQTA 3DXRB 3CCQV 3K79A 3LDEA 2P7TC 3ABLC 4U3JB 4LR3A 3SYAA 2ZR2A 5GW7A 1H2MA 3HKEB 1VQLV 4RQEA 1SESA 4NXMB 4NB5A 5B1OA 1T5EA 1MSDA 1OCRB 2QEXV 3OM3B 3WFVA 3BY6A 1N8RW 1IURA 3JD0A 2A0LA 1QU7A 4EEQA 2BSKB 4WCEV 4LF4B 3ZS8C 4X66O 1PNMA 4IHJA 4ASUG 3STZC 4I50B 3K3WA 1AI4A 4LF6O 1H2SB 2A7WA 2K1EA 5FL7G 5FNVB 3A0BZ 1DLBA 2Q4PA 1UPGA 1M4UA 2IJIA 5KA5A 4JTDB 1US6A 2CGOA 1RM1C 3A2FA 3SDLA 1YTFD 3JD4A 4DRXB 2DE0X 2DN9A 3JCZA 1N34O 3IC7A 4OPHA 3SPJA 2JIZG 3HKBA 3FAVB 1V9PA 2JEUA 2LFRA 4TV9A 3ZMSA 1ZWIC 4K8ZA 4G27B 2VWKA 4RAIA 3HKDA 2OTLV 1QR9A 2UXBO 2OCCC 4B3SO 2PI5A 1ZAUA 5BZBA 4DR5O 2BCCH 2F1MA 3SJCC 2XAHA 4YJ2B 1XEQA 3ETGA 4LBEC 1I94O 3SGIA 3BABA 1YHQV 4JAAA 4DW0A 3JD3A 4PV1B 2IBZH 3RW0A 1XNQO 4MT8A 3RVZA 3JAMN 5DM6V 2CTQA 1QVFU 3EHBB 3QF7A 2UXNA 2JK5C 2X7RB 3G71V 4JI7O 5B1NA 4DV1B 4QIWF 1VQ7V 4DUZB 3QO5A 3AG7A 3K04A 3W7SA 1BSMA 3GWKC 1VQOV 1K92A 1XL6A 2IU0A 3FAVA 1SQGA 4ZIBA 5IYZA 4AQYB 3ASNB 3ETEA 4GKJO 2EILC 2EJRA 4LH6A 5L3GA 2KSDA 1WA8B 4GX1A 5CBHA 5J2UA 3JASA 4R8CA 1B04A 4O4LB 3T1HO 2UXDB 3SYOA 3OTFA 2YXYA 4XDKA 1XMQB 4F6EA 1NS1A 2P06A 1EN6A 3OFNG 3RYCB 3T1CA 1I0HA 2Z0AA 3M8AA 4UXNA 4JAUA 3DC6A 3KZIZ 1M57C 3HB3B 4EB6A 3OEEG 2JJ2G 5IY5B 2WSSG 4OXSA 4UV9A 1GM8A 4JI4O 4L8JA 2VWJA 1NTZH 4I50A 5A2QN 5H6QA 1TVKB 1MSWD 1SQVH 1VF7A 1MABG 3ABKC 4ZOLA 4MW8A 4PA4A 4B3TB 4DR4O 1BHAA 1D5AA 3N2KA 5BR8O 3ABMB 1XI1A 1FXHA 1R1BA 3ZMTA 4GLXA 2KG7B 4QNHB 1GAXA 2YXLA 4MTGA 3E2EA 2E5LB 4XDJA 1OCRC 2WLKA 1TUBA 4N23A 5BMVA 2ATKC 1GK9A 2ZE8A 1MG1A 4LH7A 4LWSA 3I56V 4E4EA 4LF9O 3AK3A 1DF4A 3O9OA 1LUWA 2VQFB 4D6TH 2B9ZA 2DOSA 4X66B 2L35A 1EN4A 4LF4O 3AG2B 3OT7A 2C2AA 2DYSB 1JQ0A 1K7DA 1TA8A 4IGGA 1FYJA 2UXXA 4UVBA 5KHJA 2A06H 2LFSA 4PDLA 1Y76A 1U97A 1BCCH 1IX9A 3LSSA 4G28B 2YIBD 2B1GA 4DR1O 1PNKA 1M1KW 1Q8IA 1VF6A 3HKDB 1K97A 2K9PA 3CC2V 5EZYA 1MNGA 5JJEB 1NVPB 4TOIA 2DJVA 4R6ZA 4I4TB 2DWDC 4X65O 4C7UA 5LP6C 5A9GA 5H6RA 4UCOA 1Z5VA 3RVYA 5CA1A 4AHCA 3ZRWB 4YY3B 4I7ZB 4P9OA 2ZT9B 1V54C 1WPXA 5GTIZ 2BE3A 5LHHA 2W6IG 4X20B 1KYOF 1VIBA 3HR0A 2QA4V 3ETQA 4GUNA 4Z1MG 4TWKA 4O2BA 4DV4B 2HVKC 5HFLA 1NKDA 1DTOA 1X59A 3JSNA 5LBQA 3THOA 1E79G 4RUEA 2W0XA 2HEPA 1K4CC 4DV2B 2LGQA 1GKFA 3CSXA 3D3IA 1GMGA 3N2GA 2XAJA 2PYLA 4FJCC 1WNSA 3K58A 2JEXA 4DV5B 4DV2O 1OCCC 2EIKB 4H37A 1AP5A 3E8FA 3ZN0A 1HR0B 3JALB 4LFAO 3OMAB 3T1YB 1KKDA 1BQ0A 4I55A 2WAMA 3JYCA 3UT5A 4XBFA 1JMKC 4WF9V 5L3DA 2L6LA 3AG4C 2UUBO 3ZRSA 4P2ZA 4UVAA 4IL6Z 4WFHA 1HW7A 1Q90D 5LMNB 3K0GA 5KA6A 1FD9A 4GCZA 2DQ0A 4NXNB 5IYCO 2P6JA 3T1HB 2UXDO 1KUQA 2WLIA 1B6QA 4X1YB 1YVWA 2RDCA 3LSQA 5B1BC 1URFA 3IFXA 3RYHB 1TUBB 1VQPV 2P90A 2OWOA 1WJZA 5KMGB 1S72V 4AQYO 3H9VA 3WB0A 4TV8B 1NH2D 2RJZA 2CTRA 2IH3C 1FFXB 5JCOA 4FLXA 4TUYB 1SS3A 3G67A 4DUYB 2DQ3A 4MVZA 4NTXA 2LO1A 4F6RA 2Q73A 3FX7A 2CK3G 1W59A 1NR1A 1BQZA 4I55B 1VARA 2AZ2A 4GZRB 1SQQH 4NTYA 4CZZA 2E76B 5H5NA 1WB7A 1I94B 2X6CA 5K1XA 2QE7G 1F7YA 3G6BA 5LHIA 5EYPB 2XOKG 4J80A 2VQEO 3CC4V 4JI3O 4B3SB 2ZIMA 3H1JH 2OIEA 1NTKH 1XHXA 2UXCO 3OUSA 4OX9O 2AZ0A 3CXHF 4JZ2A 4FZ1A 2KB1A 2BTQA 2PTMA 5JCOC 2V7QG 2EINB 4JTAB 4ZHQB 1N36O 1R73A 3QO7A 5H2FZ 1K8AW 4JI6O 5BR8B 1AR1B 1N33B 3E86A 4X20A 1R3LC 1JPXA 4CC6A 4JGSA 3FFQA 4X62B 2JGDA 3ETDA 1FXKB 3AG3B 3Q4HB 4JI5O 4QPJA 1BMFG 1OCOB 1NVPD 1NH2B 3SJQC 3KCYA 3C90A 5J2TA 1FXVA 2WA3A 4I4TA 4L87A 1V55B 3AEIA 1R3KC 3B09A 4ZBMA 2NNUA 5GONA 1SA0B 3ABMC 1VMGA 1ZUQA 5EIBC 2ZCEA 3CCMV 1NI8A 3G4SV 4IT5A 2GSMB 1M56B 1R3JC 3VBBA 4FPPA 2F23A 3AG1C 2KQXA 4JZGA 3T4DA 2QM4A 5IYBO 4I9QA 2QGNA 4JASA 3O65A 1MMMA 2ODMA 4H44B 3RBZA 3J81N 1SZXA 2JRIA 1YTFB 3JALA 3RYFB 3CCEV 1V54B 4NXMO 1I08A 4QE9A 4B3RB 2YIAA 2CUGA 2E3CA 2CTPA 4UCSA 4JI7B 1IVSA 3WG7C 2O57A 2XASA 1M56C 1KP2A 2QKSA 3TK1A 3PJSK 4X1IB 5EBWC 4UUJC 1XNQB 5KHHA 2Q67A 3K5LA 2DMXA 4LF8B 1FXKC 3AG3C 3JARA 1P84F 4J41A 3CHXA 5J2TB 2CH7A 4O2BB 1BE3H 2ZQMA 3HPLC 1B06A 4UCTA 3TJTA 4AI8A 5KUMA 2R70A 4DR5B 2PGGA 1XREA 5LMNO 2A3QA 1AI5A 4O4IA 3B8NA 3H1IH 3K03A 1HNZB 4DR6O 4PA3A 1M90W 4HZ3A 3FD9A 3DC5A 1KQSU 1S5HC 5ITZA 5B3SB 4B3MO 3OE7G 3T1YO 2EINC 4FM1A 3UO2A 5KX5B 3IGAC 2WLLB 1HNXB 2YS8A 1Q86W 4AILC 3JCUZ 3BFRA 3OD4A 1YJNV 5JJJB 2Z3YA 1IXMA 2UU9O 4ICGA 3CCRV 1SQXH 3JAKB 5BY1A 3OW2U 4JI2O 1QBZA 1K4DC 1SC5B 3DTUB 4K3AA 3U0ZA 4FVMA 2XT9A 3CMEV 1AB3A 3CMAV 1FKAO 4JYBA 2QWNB 4YXWG 3RT3C 4LF6B 2HKOA 4O4JA 4KHPB 3VQYA 2DYRC 3ZHQA 5IYZB 3L73H 3LSUA 3ASOB 4IIJB 4K0KO 1CXZB 2YI9A 3CD6V 1N4CA 4H0LB 5C93A 1GTOA 1FFXA 2UUCB 4CH6A 4TV8A 4OPAA 5J2UB 4IIJA 2IH1C 5LA6B 1IBMB 2YI8A 1ZSPA 2OYQA 4O2AB 2CH7B 3EXAA 3NXSA 5AG2A 3CCLV 2FKXA 4W4LA 1F51A 2W6JG 2YIBA 2F43G 1WAZA 1GN2A 1VQ9V 4DR1B 4X62O 3K06A 4P30A 1ZL8B 3OTOO 3H1HH 1KMIZ 4FLVA 2XAQA 1SRYA 2OT5A 2WLLA 2Y48A 4P9PA 1Z5WA 4JAVA 4DK1A 1YIJV 1H2NA 4JI8B 4WBNA 2ZKOA 1KD1W 5IYDO 1S0VA 4KP4A 2Q68A 3BPZA 1P7BA 3ZCCA 1J95A 5IDJA 3TXSA 4FLUA 2ZNIA 4LF9B 3B2EE 1MA1A 1B3QA 4DYLA 2NN4A 2QJ1A 1S76D 1AI7A 4J7ZA 1JR9A 3SPHA 1DK1A 3OGIB 4WFFA 1X4TA 1YDXA 2HVJC 3ZMUA 2IM9A 1IDSA 1AI6A 2N05A 2ZIOA 3AG2C 3DGEA 3OUFA 4J7JA 2WLJA 3K59A 4CH5A 2UUAO 4JV5O 1FPOA 1RP3B 2XAFA 1GN3A 1Y66A 3CRQA 3LNMB 2QKAA 1FFTB 1TGOA 2IJHA 1N0NA 2EJ7A 2CE4A 1AJNA 2PZSA 5CBGA 4X1IA 4DV0B 4IYIA 2QTSA 2F4VO 4U7OA 3I5DA 3SPCA 1L1FA 3ZRVA 4GKKO 2F4VB 5CA3A 2M6YA 4DO2A 1XMOB 4JI0B 1J5EO 4K8XA 3RN4A 2BOCC 4K0KB 1XOUA 1XQ8A 3K9SA 3APOA 3W7TA 2EIMB 3D8CA 2HFEC 3B8MA 1MZFA 1M57B 5CA0A 1JVMA 4BWAA 1VF5B 3D36C 3T4ZA 3ICXA 3DSQA 3ZHTA 1SQBH 3DXRA 2Q7GA 1OCZC 3L9DA 2HHHB 1R6NA 5GONB 2F66C 3FKSG 3CRRA 3LUTB 5FNVA 3UO3A 1AJQA 4FMTA 2BTQB 2JJ1G 1XILA 4BIZA 3S3XA 4B3MB 2LW1A 3JATB 2JS3A 2MK3A 4LP8A 2JGDB 5IT9N 2NR5A 1QLEB 1U96A 2ZE7A 3CRMA 4XDLA 4LCUC 2HR3A 4DR7O 5DECA 2R72A 1W0JG 2GDSA 4I9WA 4YHHB 2EIKC 3NR7A 4DXWA 2F93B 1WP7A 4ZHQA 4WBNB 3ZBHA 4YY3O 1TVKA 2HLDG 1NT2B 3MAQA 4MVMA 1O9GA 3OMIB 5B1AC 1AVMA 2DW4A 4RWUA 4WFBV 5LGTA 2OTJV 2B1IA 1I5YA 5EYPA 1FS0G 4FLZA 4FIPC 3OR7C 3JD2A 4GX2A 3F5TA 3BAAA 1WA8A 1S3JA 2ITDC 2X6BA 3JASB 1EZJA 1YEWA 5CB4B 1GH6A 4GYCB 3F5WC 4PDMA 2G38A 2ZXWB 1SF9A 3RYHA 4WFAV 4I0XB 3QG5A 1CEZA 5LGUA 1XHZA 2Q9LA 1RM1B 1OCOC 4FM2A 3OR6C 2EIJB 2UUCO 4JPRA 3QNEA 4PD4F 1OHHG 1KBHA 1S5JA 3B4SA 4O4IB 3BA8A 2YDEA 4JYAB 3CJHA 1Q82W 5DN6G 3E22B 4LNUA 4F4LA 1VQ5V 3IJ4A 1S5LZ 2NLJC 2EIMC 4X89A 3C3TA 2WLMA 5LOVB 2LP7A 4DV3B 3CCSV 2E75B 5JJNB 3UT5B 4O4JB 3P30A 4NTWA 4G2KA 3ZMZA 2WLIB 2QWPB 3MD0A 1G4YB 5DEDA 1KC8W 1M5IA 2WA4A 3ZHRA 2B5UA 4BW9A 3CP1A 2E5LO 1UJWB 4J9YB 3BVOA 4X88A 5D5QA 1BGYH 2XAGA 3JAWA 4PA6A 2YSUB 2H8PC 2P4KA 3UCSC 4JI6B 4DR4B 4TV9B 5JVDB 3VQWA 4JTCB 2OCCB 1N36B 1K73W 1Y76B 1I5XA 1YSCA 2P5OA 1YZBA 4GX5A 4UVCA 4DRXA 1IBLB 3I55V 1N32O 4YHHO 4J10A 1AJPA 4DW1A 4JI3B 5GTHZ 2Y69B 2YICA 1P4RA 3GB7C 3ZRWA 3BRCA 2QSAA 1EZVH 3GWOA 4DV6B 2MW2B 3K5OA 3R65A 2Q0OC 4H13B 1QVGU 1R6TA 5BMVB 1Q3EA 2FB5A 1F4MA 2XNDG 4J9ZB 2KG7A 2PUSA 2IJKA 3L70H 3SYCA 2BSKA 3X2QC 4B3RO 4RQFA 4DUZO 2QWQB 2OCHA 1SETA 1N0JA 1IBKB 2Y69C 4DV1O 4MTFA 3K9AA 1JCHA 2AXTZ 3RYFA 1FJGB 4OGQB 1PL4A 4CH4A 4GT1A 1DGSA 3D3QA 3ABTA 4ZI7B 4J42A 2RQ6A 2WWWA 1CP9A 3HKEA 2EILB 4B7KA 2ZE6A 3FB6C 4U3JA 4NXNO 3U10A 5KAIZ 4UFZA 1QNMA 3KG2A 4KUMA 4PJ0Z 1M9NA 3ABLB 1SERA 5KUKA 3L71H 1H2LA 2CGNA 4TQDA 1GM7A 1TUEB 1SZTA 2R9AA 3UKMA 5KLVH 4PDRA 3CX5F 1K33A 4JV5B 2UUAB 2GHYA 1W2BU 4J11A 4BIOA 2IU3A 4F6RB 2Q8VA 2ARHA 5CN0A 3CS5A 1D5NA 1NJIW 3ABUA 2ZINA 3TETA 1EM1A 3H01A 4QGPA 1KECA 3N2KB 2Q5ZA 3SJAC 4UV8A 1VQ4V 4ZOLB 4PELA 1R3IC 2X0LA 3ZMVA 2PYJA 5KMGA 2V1DA 2EX3A 1PM9A 4UCRA 5LHGA 4EB6B 4DV3O 2LW7A 5EBMC 1Y6XA 4NYKA 2JDIG 1P49A 2V4DA 3ABKB 3SJBC 4ABMA 2PI4A 2XUMA 3K57A 2YEVB 1OCZB 3CCVV 1VEWA 3CEIA 1ZLZA 2ZD9A 3L75H 1G1XB 4X65B 3P3PA 4DV7O 4MTOA 3C3SA 1JX9A 3UQ8A 4PI2A 4DUYO 4FK5C 4CS3A 1AR5A 4KL1A 2W0FC 2DWEC 4PA9A 1UFIA 2FMLA 4X1KA 4LFBB 5B5EZ 3T2MA 1KP3A 3JATA 4B7EA 1EBOA 1K34A 1XBLA 4YJ3A 1IBMO 3QVNA 1Q6IA 1PL0A 5FPOA 2JVDA 1Y4MA 4DR3O 3IAYA 3JSLA 3A0RA 3TCUA 1YXBA 3OAAG 4BIUA 1VQ8V 4GX0A 5KAFZ 4YIOA 3CWBH 3AK1A 1GN4A 4N21A 2P67A 4DR7B 5CA0B 2A9HA 2M7WA 4HNAB 1NU1H 4LF5O 3ZIAG 1ZTEA 5EC1C 1YF2A 3E89A 3HKCA 3SR2C 1Y74A 4LFAB 1VQ6V 2RN9A 4JI2B 5IY5C 4LNUB 3R66A 4LFCB 4CC5A 4O4HA 4X64B 3STLC 4DK0A 3F7YC 2PY5A 1RFYA 4R7CA 4CBCA 2ZNJA 3WB2A 4A5UB 4QPKA 1H8HG 1JJ2U 4B3TO 2Z5UA 1HNXO 1SA0A 1VF6C 2Y4TA 5FLXN 4LF7O 3P32A 1K3EA 4UB8Z 4JI4B 5EBLC 1QLEC 3B77A 4MVQA 5CBFA 4DV4O 5IJ0A 3A8TA 1WB8A 3FYEB 4D7TA 3QO8A 3P3NA 1QQCA 2CAZC 2YEVA 2HP8A 3JAKA 5BXZA 1YCIA 4JI0O 3LNNA 1XMOO 1RSOA 5IJ9B 3SPGA 3CCUV 1NBMG 5LXTA 4CH3A 1AR4A 4GKKB 1JOYA 1WN7A 2N04A 1XMQO 1G8MA 4BAYA 1GRJA 4MVUA 2PF4E 4DV0O 1KB9F 4LF8O 5E1AC 4LWSB 2ZM6B 4BW5A 3E8HA 1H38A 2QM8A 1VQMV 3UM7A 2P22C 5B1AB 4GKJB 1BL8A 1FJGO 4IHJB 4FFKA 5KHKA 1W0KG 4JF3A 3VQXA 3MHSC 4DR2O 2LQTA 3ZJZA 2QWOB 2GUZA 3CCJV 1MOFA 2AHZA 2RNBA 5B66Z 4X9QA 5LP6B 4J7KA 1PKXA 5JWPA 2R9IA 4I5SA 3LDDA 5LMUO 4DV7B 5LYJA 3RYIB 1LUVA 4KXRA 3F7VC 5J9PC 3IC9A 4U3FH 2YC0A 1A32A 1K9MW 1TAEA 2GTAA 1VQKV 4RUFA 4TSFG 1JFFB 4FFBB 3BA9A 2ZDIC 1XNRO 3K0DA 2JS5A 1VQNV 2FTKA 3W7XA 4MVSA 2VQFO 2QR4A 2QTOA 4TQFA 2Y4UA 4EFBA 5JQGA 1CPYA 1JFFA 4FFBA 2RMKB 3W7UA 4PHZA 4Z1VA 2HJDA 3ZHVA 2E74B 3U11A 1Y67A 5LYJB 3CB2A 1BT8A 2WLHA 5JVDA 5LA6A 4X1YA 3E83A 1THZA 1H2GA 2JGUA 2IW5A 2WPDG 1FAFA 2EZPA 2VRZA 3K5MA 1XL4A 3JAWB 2GUZB 3OTOB 4W4KA 1L8DA 5C8YB 3RWRD 3MDSA 1BHBA 1AP6A 2AHYA 4FM0A 1Q6HA 2EIJC 3HKCB 2DYRB 1AILA 4YJ3B 1E1RG 3SYPA 3E8BA 2ZE5A 1BZKA 2H3OA 1OCCB 1FXKA 4BR6A 1PP9H 5L3CA 4X8AA 3WB1A 4YJ2A 2N74A 3CJHB 1I7FA 1ROPA 4RO2A 1OV9A 3SPIA 1XNRB 2CDYA 4EKWA 3N2GB 4PDVA 1XUQA 4QE7A 3LDCA 4FZ0A 3RFRA 2OIGA 2F95B 5IJ0B 5K1PA 2RCVA 5KX5A 3OEHG 1R6KA 2R9RB 4CS4A 1PPJH 1IZ3A 3E35A 5IE9A 1F23A 1K5QA 1L0NH 2DYSC 4UCUA 2QM7A 3SYQA 2Q6AA 3FB8C 4LC1A 2D3OW 1QR8A 4FLYA 1JJOA 4D7SA 3J7AU 4JI1O 1Y74B 3ASNC 2VS0A 4YIPA 3ASOC 3ZX6A 1LR1A 2EULA 1XDCA 5LGNA 1OZ0A 3H1LH 3BEHA 5EZYB 5IWAB 4DR6B 3CRCA 4NVPA 3M7MX 5F2VO 3ZHSA 2AGAA 1D2DA 2UXBB 1COWG 2ZDIA 2UUBB 5KHGA 3WG7B 3CYOA 1N32B 1S77D 3EVKA 5B3SC 3QTCA 1QLNA 5IWAO 5LL6Y 3HKBB 1Q5OA 1N34B 4HAMA 1HR0O 5CMUA 3TGUH 1AROP 4UCVA 3KKYA 4JI1B 4IYHA 4U7NA 2HJFC 3AG1B 3N27A 5L3FA 5TISZ 2ADPA 2QDOA 4R50A 5FPRA 3AG4B 2HHHO 5JH7A 1MZEA 5L3EA 4LFCO 1QCEA 5L3BA 1DF5A 1YITV 1LNQA 4ZI7A 2Q7HA 1V55C 4LF5B 1EN5A 3VOUA 1YJ9V 4Q6GA 3Q4HA 4TT3G 3ZN1A 4JYAO 1G6UA 4H33A 4MS2A 3W7WA 1HDJA 3S3WA 1L0LH 3ZHUA 2P4VA 2HG5C 4NR1A 1JA8A 2ETNA 3G80A 2ADQB 2H94A 4K35A 4LFBO 1HWYA 2Q0AA 4MW3A 1GM9A 2Y0IA 2FYUH 3BHPA 4JI5B 1K5SA 1Q81W 5LXTB 5IJ9A 5JH7B 1RSOB 1HNWO 1H8EG 1H2KA 3M99B 1N33O 2GTSA 3ZEDA 1VP7A 2Q7EA 1NZ6A 1EFRG 2ITCC 3CPWU 3K08A 3VQVA 3CXCU 1O9HA 3ML0A 1GO3F 2YUAA 2BOBC 4MSWC 2A79B 2EZOA 3APQA 4OX9B 3X2QB 1IXBA 2UXCB 1BS3A 4JYYA 5D5PA 2Q69A 2EBOA 1OJHA 1YI2V 4MVOA 2VQEB 1GN6A 4O4HB 1SQFA 1NR7A 4JI8O 3RGBA 3PN1A 3K5NA 2GV9A 3H1KH 1RPRA 3ZRXA 1Q7YW 3L72H 3FB7C 3G6EV 5LMUB 2QWRB 4UB6Z 1PNLA 2X6AA 4HNAA 4Z2WA 2GBOA 3MHHC 3E22A 2YXHA 4Q20A 3D36A 2YIDA 4PA7A 4DR2B 4JYCA 3GVMA 1KKCA 4FLTA 5KHIA 5LOVA 1WP8A 3FB5C 3FYIB 3OGCC 3BCCH 1YJWV 1SQPH 1ZX3A 2ZM6O 2AW9A 1J5EB 3TXQA 4X1KB 4PI0A 1QHTA 1PD3A 2BTOA 2FL4A 5H9CA 4MVRA 2LJ2A 2ZR3A 1F4NA 2CTWA 4WFGA 1NTMH 1ORQC 4EFEA 4HYOA 3CC7V 4KHPO 5EC2C 4HBNA 3CRAA 3RYIA 4B08A 5EK0A 3A0HZ 5B1BB 1IBKO 1ZL8A 4LF7B 1M93A 4E2LA 3J80N 3RYCA 1KU9A 5LP6A 5C8YA 4WFEA 2IJJA 2UU9B 4DV5O 3JD1A
chains in the Genus database with same CATH topology
4DR1O 4LF6O 1XMQO 4X64O 1AILA 3T1HO 2UXDO 1KUQA 4DV0O 4LF8O 4NXNO 1NS1A 2HHHO 4JI8O 2E5LO 2UU9O 4DV6O 4LFCO 2N74A 2Z0AA 5BY1A 2DJVA 3M8AA 4AQYO 1FJGO 1IBMO 4JI2O 1DK1A 5IT9N 4X65O 3SDLA 4DR3O 1AB3A 1FKAO 1HNZO 4DR2O 4DR7O 3RT3C 1IBLO 4JI4O 1N34O 1YZBA 3O65A 4OPHA 4YY3O 5A2QN 3J81N 5LMUO 4K0KO 4JYAO 2JRIA 4DR4O 5BR8O 1A32A 2UUAO 1N32O 4NXMO 4YHHO 4LF5O 4JV5O 1R1BA 2UXBO 4B3SO 4OPAA 5H5NA 4DR5O 1X59A 1XNRO 1F7YA 2ZM6O 3R66A 1XEQA 2VQFO 2F4VO 2VQEO 1I94O 2FKXA 3J7AU 4JI3O 4JI1O 4DV3O 4LF9O 2LW7A 4LFBO 3F5TA 4GKKO 2UXCO 4OX9O 1XNQO 4DV2O 1R6TA 4A5UB 4B3TO 1J5EO 1HNXO 4X62O 3JAMN 2DOSA 5FLXN 4LF7O 4LFAO 1HNWO 4LF4O 3OTOO 4JI7O 5LMNO 1N33O 2AGAA 1D2DA 4DV4O 4KHPO 4B3RO 1N36O 2UUCO 4DUZO 1FYJA 4JI6O 4DV1O 1G1XB 1IBKO 4DV7O 4X66O 5IWAO 4DR6O 2UUBO 5LL6Y 3J80N 5BXZA 4GKJO 4JI0O 1XMOO 4B3MO 4JI5O 3T1YO 4DV5O 4DUYO 2ZKOA 1HR0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 O;  4LF6 O;  1XMQ O;  4X64 O;  1AIL A;  3T1H O;  2UXD O;  1KUQ A;  4DV0 O;  4LF8 O;  4NXN O;  1NS1 A;  2HHH O;  4JI8 O;  2E5L O;  2UU9 O;  4DV6 O;  4LFC O;  2N74 A;  2Z0A A;  5BY1 A;  2DJV A;  3M8A A;  4AQY O;  1FJG O;  1IBM O;  4JI2 O;  1DK1 A;  5IT9 N;  4X65 O;  3SDL A;  4DR3 O;  1AB3 A;  1FKA O;  1HNZ O;  4DR2 O;  4DR7 O;  3RT3 C;  1IBL O;  4JI4 O;  1N34 O;  1YZB A;  3O65 A;  4OPH A;  4YY3 O;  5A2Q N;  3J81 N;  5LMU O;  4K0K O;  4JYA O;  2JRI A;  4DR4 O;  5BR8 O;  1A32 A;  2UUA O;  1N32 O;  4NXM O;  4YHH O;  4LF5 O;  4JV5 O;  1R1B A;  2UXB O;  4B3S O;  4OPA A;  5H5N A;  4DR5 O;  1X59 A;  1XNR O;  1F7Y A;  2ZM6 O;  3R66 A;  1XEQ A;  2VQF O;  2F4V O;  2VQE O;  1I94 O;  2FKX A;  3J7A U;  4JI3 O;  4JI1 O;  4DV3 O;  4LF9 O;  2LW7 A;  4LFB O;  3F5T A;  4GKK O;  2UXC O;  4OX9 O;  1XNQ O;  4DV2 O;  1R6T A;  4A5U B;  4B3T O;  1J5E O;  1HNX O;  4X62 O;  3JAM N;  2DOS A;  5FLX N;  4LF7 O;  4LFA O;  1HNW O;  4LF4 O;  3OTO O;  4JI7 O;  5LMN O;  1N33 O;  2AGA A;  1D2D A;  4DV4 O;  4KHP O;  4B3R O;  1N36 O;  2UUC O;  4DUZ O;  1FYJ A;  4JI6 O;  4DV1 O;  1G1X B;  1IBK O;  4DV7 O;  4X66 O;  5IWA O;  4DR6 O;  2UUB O;  5LL6 Y;  3J80 N;  5BXZ A;  4GKJ O;  4JI0 O;  1XMO O;  4B3M O;  4JI5 O;  3T1Y O;  4DV5 O;  4DUY O;  2ZKO A;  1HR0 O; 
#chains in the Genus database with same CATH topology
 4O4L A;  3OMN B;  1PV0 A;  4X64 O;  5CA1 B;  1ENV A;  1E1Q G;  1P7G A;  2ZXW C;  4FLW A;  3KCX A;  4O2A A;  5ITZ B;  3B40 A;  3AK2 A;  2KKW A;  2D2C B;  4DV6 O;  3L74 H;  2XHB A;  4NKG B;  1SKV A;  2WLN A;  1Q6U A;  3CE2 A;  4ZKI A;  2ILM A;  5JQG B;  3WU2 Z;  1HNZ O;  2QKC A;  4TUY A;  2Y0P A;  1HP8 A;  5HFM A;  1Q43 A;  1IBL O;  3EFF K;  5EIB D;  4MTX A;  4QJF B;  4I0X A;  1Z2G A;  2XTA A;  3JAR B;  4DR3 B;  5E79 Z;  3E8G A;  5CB4 A;  2LGW A;  1WLE A;  4KFM A;  1WPB A;  4CS2 A;  1HNW B;  1RPO A;  1NQT A;  3DXR B;  3CCQ V;  3K79 A;  3LDE A;  2P7T C;  3ABL C;  4U3J B;  4LR3 A;  3SYA A;  2ZR2 A;  5GW7 A;  1H2M A;  3HKE B;  1VQL V;  4RQE A;  1SES A;  4NXM B;  4NB5 A;  5B1O A;  1T5E A;  1MSD A;  1OCR B;  2QEX V;  3OM3 B;  3WFV A;  3BY6 A;  1N8R W;  1IUR A;  3JD0 A;  2A0L A;  1QU7 A;  4EEQ A;  2BSK B;  4WCE V;  4LF4 B;  3ZS8 C;  4X66 O;  1PNM A;  4IHJ A;  4ASU G;  3STZ C;  4I50 B;  3K3W A;  1AI4 A;  4LF6 O;  1H2S B;  2A7W A;  2K1E A;  5FL7 G;  5FNV B;  3A0B Z;  1DLB A;  2Q4P A;  1UPG A;  1M4U A;  2IJI A;  5KA5 A;  4JTD B;  1US6 A;  2CGO A;  1RM1 C;  3A2F A;  3SDL A;  1YTF D;  3JD4 A;  4DRX B;  2DE0 X;  2DN9 A;  3JCZ A;  1N34 O;  3IC7 A;  4OPH A;  3SPJ A;  2JIZ G;  3HKB A;  3FAV B;  1V9P A;  2JEU A;  2LFR A;  4TV9 A;  3ZMS A;  1ZWI C;  4K8Z A;  4G27 B;  2VWK A;  4RAI A;  3HKD A;  2OTL V;  1QR9 A;  2UXB O;  2OCC C;  4B3S O;  2PI5 A;  1ZAU A;  5BZB A;  4DR5 O;  2BCC H;  2F1M A;  3SJC C;  2XAH A;  4YJ2 B;  1XEQ A;  3ETG A;  4LBE C;  1I94 O;  3SGI A;  3BAB A;  1YHQ V;  4JAA A;  4DW0 A;  3JD3 A;  4PV1 B;  2IBZ H;  3RW0 A;  1XNQ O;  4MT8 A;  3RVZ A;  3JAM N;  5DM6 V;  2CTQ A;  1QVF U;  3EHB B;  3QF7 A;  2UXN A;  2JK5 C;  2X7R B;  3G71 V;  4JI7 O;  5B1N A;  4DV1 B;  4QIW F;  1VQ7 V;  4DUZ B;  3QO5 A;  3AG7 A;  3K04 A;  3W7S A;  1BSM A;  3GWK C;  1VQO V;  1K92 A;  1XL6 A;  2IU0 A;  3FAV A;  1SQG A;  4ZIB A;  5IYZ A;  4AQY B;  3ASN B;  3ETE A;  4GKJ O;  2EIL C;  2EJR A;  4LH6 A;  5L3G A;  2KSD A;  1WA8 B;  4GX1 A;  5CBH A;  5J2U A;  3JAS A;  4R8C A;  1B04 A;  4O4L B;  3T1H O;  2UXD B;  3SYO A;  3OTF A;  2YXY A;  4XDK A;  1XMQ B;  4F6E A;  1NS1 A;  2P06 A;  1EN6 A;  3OFN G;  3RYC B;  3T1C A;  1I0H A;  2Z0A A;  3M8A A;  4UXN A;  4JAU A;  3DC6 A;  3KZI Z;  1M57 C;  3HB3 B;  4EB6 A;  3OEE G;  2JJ2 G;  5IY5 B;  2WSS G;  4OXS A;  4UV9 A;  1GM8 A;  4JI4 O;  4L8J A;  2VWJ A;  1NTZ H;  4I50 A;  5A2Q N;  5H6Q A;  1TVK B;  1MSW D;  1SQV H;  1VF7 A;  1MAB G;  3ABK C;  4ZOL A;  4MW8 A;  4PA4 A;  4B3T B;  4DR4 O;  1BHA A;  1D5A A;  3N2K A;  5BR8 O;  3ABM B;  1XI1 A;  1FXH A;  1R1B A;  3ZMT A;  4GLX A;  2KG7 B;  4QNH B;  1GAX A;  2YXL A;  4MTG A;  3E2E A;  2E5L B;  4XDJ A;  1OCR C;  2WLK A;  1TUB A;  4N23 A;  5BMV A;  2ATK C;  1GK9 A;  2ZE8 A;  1MG1 A;  4LH7 A;  4LWS A;  3I56 V;  4E4E A;  4LF9 O;  3AK3 A;  1DF4 A;  3O9O A;  1LUW A;  2VQF B;  4D6T H;  2B9Z A;  2DOS A;  4X66 B;  2L35 A;  1EN4 A;  4LF4 O;  3AG2 B;  3OT7 A;  2C2A A;  2DYS B;  1JQ0 A;  1K7D A;  1TA8 A;  4IGG A;  1FYJ A;  2UXX A;  4UVB A;  5KHJ A;  2A06 H;  2LFS A;  4PDL A;  1Y76 A;  1U97 A;  1BCC H;  1IX9 A;  3LSS A;  4G28 B;  2YIB D;  2B1G A;  4DR1 O;  1PNK A;  1M1K W;  1Q8I A;  1VF6 A;  3HKD B;  1K97 A;  2K9P A;  3CC2 V;  5EZY A;  1MNG A;  5JJE B;  1NVP B;  4TOI A;  2DJV A;  4R6Z A;  4I4T B;  2DWD C;  4X65 O;  4C7U A;  5LP6 C;  5A9G A;  5H6R A;  4UCO A;  1Z5V A;  3RVY A;  5CA1 A;  4AHC A;  3ZRW B;  4YY3 B;  4I7Z B;  4P9O A;  2ZT9 B;  1V54 C;  1WPX A;  5GTI Z;  2BE3 A;  5LHH A;  2W6I G;  4X20 B;  1KYO F;  1VIB A;  3HR0 A;  2QA4 V;  3ETQ A;  4GUN A;  4Z1M G;  4TWK A;  4O2B A;  4DV4 B;  2HVK C;  5HFL A;  1NKD A;  1DTO A;  1X59 A;  3JSN A;  5LBQ A;  3THO A;  1E79 G;  4RUE A;  2W0X A;  2HEP A;  1K4C C;  4DV2 B;  2LGQ A;  1GKF A;  3CSX A;  3D3I A;  1GMG A;  3N2G A;  2XAJ A;  2PYL A;  4FJC C;  1WNS A;  3K58 A;  2JEX A;  4DV5 B;  4DV2 O;  1OCC C;  2EIK B;  4H37 A;  1AP5 A;  3E8F A;  3ZN0 A;  1HR0 B;  3JAL B;  4LFA O;  3OMA B;  3T1Y B;  1KKD A;  1BQ0 A;  4I55 A;  2WAM A;  3JYC A;  3UT5 A;  4XBF A;  1JMK C;  4WF9 V;  5L3D A;  2L6L A;  3AG4 C;  2UUB O;  3ZRS A;  4P2Z A;  4UVA A;  4IL6 Z;  4WFH A;  1HW7 A;  1Q90 D;  5LMN B;  3K0G A;  5KA6 A;  1FD9 A;  4GCZ A;  2DQ0 A;  4NXN B;  5IYC O;  2P6J A;  3T1H B;  2UXD O;  1KUQ A;  2WLI A;  1B6Q A;  4X1Y B;  1YVW A;  2RDC A;  3LSQ A;  5B1B C;  1URF A;  3IFX A;  3RYH B;  1TUB B;  1VQP V;  2P90 A;  2OWO A;  1WJZ A;  5KMG B;  1S72 V;  4AQY O;  3H9V A;  3WB0 A;  4TV8 B;  1NH2 D;  2RJZ A;  2CTR A;  2IH3 C;  1FFX B;  5JCO A;  4FLX A;  4TUY B;  1SS3 A;  3G67 A;  4DUY B;  2DQ3 A;  4MVZ A;  4NTX A;  2LO1 A;  4F6R A;  2Q73 A;  3FX7 A;  2CK3 G;  1W59 A;  1NR1 A;  1BQZ A;  4I55 B;  1VAR A;  2AZ2 A;  4GZR B;  1SQQ H;  4NTY A;  4CZZ A;  2E76 B;  5H5N A;  1WB7 A;  1I94 B;  2X6C A;  5K1X A;  2QE7 G;  1F7Y A;  3G6B A;  5LHI A;  5EYP B;  2XOK G;  4J80 A;  2VQE O;  3CC4 V;  4JI3 O;  4B3S B;  2ZIM A;  3H1J H;  2OIE A;  1NTK H;  1XHX A;  2UXC O;  3OUS A;  4OX9 O;  2AZ0 A;  3CXH F;  4JZ2 A;  4FZ1 A;  2KB1 A;  2BTQ A;  2PTM A;  5JCO C;  2V7Q G;  2EIN B;  4JTA B;  4ZHQ B;  1N36 O;  1R73 A;  3QO7 A;  5H2F Z;  1K8A W;  4JI6 O;  5BR8 B;  1AR1 B;  1N33 B;  3E86 A;  4X20 A;  1R3L C;  1JPX A;  4CC6 A;  4JGS A;  3FFQ A;  4X62 B;  2JGD A;  3ETD A;  1FXK B;  3AG3 B;  3Q4H B;  4JI5 O;  4QPJ A;  1BMF G;  1OCO B;  1NVP D;  1NH2 B;  3SJQ C;  3KCY A;  3C90 A;  5J2T A;  1FXV A;  2WA3 A;  4I4T A;  4L87 A;  1V55 B;  3AEI A;  1R3K C;  3B09 A;  4ZBM A;  2NNU A;  5GON A;  1SA0 B;  3ABM C;  1VMG A;  1ZUQ A;  5EIB C;  2ZCE A;  3CCM V;  1NI8 A;  3G4S V;  4IT5 A;  2GSM B;  1M56 B;  1R3J C;  3VBB A;  4FPP A;  2F23 A;  3AG1 C;  2KQX A;  4JZG A;  3T4D A;  2QM4 A;  5IYB O;  4I9Q A;  2QGN A;  4JAS A;  3O65 A;  1MMM A;  2ODM A;  4H44 B;  3RBZ A;  3J81 N;  1SZX A;  2JRI A;  1YTF B;  3JAL A;  3RYF B;  3CCE V;  1V54 B;  4NXM O;  1I08 A;  4QE9 A;  4B3R B;  2YIA A;  2CUG A;  2E3C A;  2CTP A;  4UCS A;  4JI7 B;  1IVS A;  3WG7 C;  2O57 A;  2XAS A;  1M56 C;  1KP2 A;  2QKS A;  3TK1 A;  3PJS K;  4X1I B;  5EBW C;  4UUJ C;  1XNQ B;  5KHH A;  2Q67 A;  3K5L A;  2DMX A;  4LF8 B;  1FXK C;  3AG3 C;  3JAR A;  1P84 F;  4J41 A;  3CHX A;  5J2T B;  2CH7 A;  4O2B B;  1BE3 H;  2ZQM A;  3HPL C;  1B06 A;  4UCT A;  3TJT A;  4AI8 A;  5KUM A;  2R70 A;  4DR5 B;  2PGG A;  1XRE A;  5LMN O;  2A3Q A;  1AI5 A;  4O4I A;  3B8N A;  3H1I H;  3K03 A;  1HNZ B;  4DR6 O;  4PA3 A;  1M90 W;  4HZ3 A;  3FD9 A;  3DC5 A;  1KQS U;  1S5H C;  5ITZ A;  5B3S B;  4B3M O;  3OE7 G;  3T1Y O;  2EIN C;  4FM1 A;  3UO2 A;  5KX5 B;  3IGA C;  2WLL B;  1HNX B;  2YS8 A;  1Q86 W;  4AIL C;  3JCU Z;  3BFR A;  3OD4 A;  1YJN V;  5JJJ B;  2Z3Y A;  1IXM A;  2UU9 O;  4ICG A;  3CCR V;  1SQX H;  3JAK B;  5BY1 A;  3OW2 U;  4JI2 O;  1QBZ A;  1K4D C;  1SC5 B;  3DTU B;  4K3A A;  3U0Z A;  4FVM A;  2XT9 A;  3CME V;  1AB3 A;  3CMA V;  1FKA O;  4JYB A;  2QWN B;  4YXW G;  3RT3 C;  4LF6 B;  2HKO A;  4O4J A;  4KHP B;  3VQY A;  2DYR C;  3ZHQ A;  5IYZ B;  3L73 H;  3LSU A;  3ASO B;  4IIJ B;  4K0K O;  1CXZ B;  2YI9 A;  3CD6 V;  1N4C A;  4H0L B;  5C93 A;  1GTO A;  1FFX A;  2UUC B;  4CH6 A;  4TV8 A;  4OPA A;  5J2U B;  4IIJ A;  2IH1 C;  5LA6 B;  1IBM B;  2YI8 A;  1ZSP A;  2OYQ A;  4O2A B;  2CH7 B;  3EXA A;  3NXS A;  5AG2 A;  3CCL V;  2FKX A;  4W4L A;  1F51 A;  2W6J G;  2YIB A;  2F43 G;  1WAZ A;  1GN2 A;  1VQ9 V;  4DR1 B;  4X62 O;  3K06 A;  4P30 A;  1ZL8 B;  3OTO O;  3H1H H;  1KMI Z;  4FLV A;  2XAQ A;  1SRY A;  2OT5 A;  2WLL A;  2Y48 A;  4P9P A;  1Z5W A;  4JAV A;  4DK1 A;  1YIJ V;  1H2N A;  4JI8 B;  4WBN A;  2ZKO A;  1KD1 W;  5IYD O;  1S0V A;  4KP4 A;  2Q68 A;  3BPZ A;  1P7B A;  3ZCC A;  1J95 A;  5IDJ A;  3TXS A;  4FLU A;  2ZNI A;  4LF9 B;  3B2E E;  1MA1 A;  1B3Q A;  4DYL A;  2NN4 A;  2QJ1 A;  1S76 D;  1AI7 A;  4J7Z A;  1JR9 A;  3SPH A;  1DK1 A;  3OGI B;  4WFF A;  1X4T A;  1YDX A;  2HVJ C;  3ZMU A;  2IM9 A;  1IDS A;  1AI6 A;  2N05 A;  2ZIO A;  3AG2 C;  3DGE A;  3OUF A;  4J7J A;  2WLJ A;  3K59 A;  4CH5 A;  2UUA O;  4JV5 O;  1FPO A;  1RP3 B;  2XAF A;  1GN3 A;  1Y66 A;  3CRQ A;  3LNM B;  2QKA A;  1FFT B;  1TGO A;  2IJH A;  1N0N A;  2EJ7 A;  2CE4 A;  1AJN A;  2PZS A;  5CBG A;  4X1I A;  4DV0 B;  4IYI A;  2QTS A;  2F4V O;  4U7O A;  3I5D A;  3SPC A;  1L1F A;  3ZRV A;  4GKK O;  2F4V B;  5CA3 A;  2M6Y A;  4DO2 A;  1XMO B;  4JI0 B;  1J5E O;  4K8X A;  3RN4 A;  2BOC C;  4K0K B;  1XOU A;  1XQ8 A;  3K9S A;  3APO A;  3W7T A;  2EIM B;  3D8C A;  2HFE C;  3B8M A;  1MZF A;  1M57 B;  5CA0 A;  1JVM A;  4BWA A;  1VF5 B;  3D36 C;  3T4Z A;  3ICX A;  3DSQ A;  3ZHT A;  1SQB H;  3DXR A;  2Q7G A;  1OCZ C;  3L9D A;  2HHH B;  1R6N A;  5GON B;  2F66 C;  3FKS G;  3CRR A;  3LUT B;  5FNV A;  3UO3 A;  1AJQ A;  4FMT A;  2BTQ B;  2JJ1 G;  1XIL A;  4BIZ A;  3S3X A;  4B3M B;  2LW1 A;  3JAT B;  2JS3 A;  2MK3 A;  4LP8 A;  2JGD B;  5IT9 N;  2NR5 A;  1QLE B;  1U96 A;  2ZE7 A;  3CRM A;  4XDL A;  4LCU C;  2HR3 A;  4DR7 O;  5DEC A;  2R72 A;  1W0J G;  2GDS A;  4I9W A;  4YHH B;  2EIK C;  3NR7 A;  4DXW A;  2F93 B;  1WP7 A;  4ZHQ A;  4WBN B;  3ZBH A;  4YY3 O;  1TVK A;  2HLD G;  1NT2 B;  3MAQ A;  4MVM A;  1O9G A;  3OMI B;  5B1A C;  1AVM A;  2DW4 A;  4RWU A;  4WFB V;  5LGT A;  2OTJ V;  2B1I A;  1I5Y A;  5EYP A;  1FS0 G;  4FLZ A;  4FIP C;  3OR7 C;  3JD2 A;  4GX2 A;  3F5T A;  3BAA A;  1WA8 A;  1S3J A;  2ITD C;  2X6B A;  3JAS B;  1EZJ A;  1YEW A;  5CB4 B;  1GH6 A;  4GYC B;  3F5W C;  4PDM A;  2G38 A;  2ZXW B;  1SF9 A;  3RYH A;  4WFA V;  4I0X B;  3QG5 A;  1CEZ A;  5LGU A;  1XHZ A;  2Q9L A;  1RM1 B;  1OCO C;  4FM2 A;  3OR6 C;  2EIJ B;  2UUC O;  4JPR A;  3QNE A;  4PD4 F;  1OHH G;  1KBH A;  1S5J A;  3B4S A;  4O4I B;  3BA8 A;  2YDE A;  4JYA B;  3CJH A;  1Q82 W;  5DN6 G;  3E22 B;  4LNU A;  4F4L A;  1VQ5 V;  3IJ4 A;  1S5L Z;  2NLJ C;  2EIM C;  4X89 A;  3C3T A;  2WLM A;  5LOV B;  2LP7 A;  4DV3 B;  3CCS V;  2E75 B;  5JJN B;  3UT5 B;  4O4J B;  3P30 A;  4NTW A;  4G2K A;  3ZMZ A;  2WLI B;  2QWP B;  3MD0 A;  1G4Y B;  5DED A;  1KC8 W;  1M5I A;  2WA4 A;  3ZHR A;  2B5U A;  4BW9 A;  3CP1 A;  2E5L O;  1UJW B;  4J9Y B;  3BVO A;  4X88 A;  5D5Q A;  1BGY H;  2XAG A;  3JAW A;  4PA6 A;  2YSU B;  2H8P C;  2P4K A;  3UCS C;  4JI6 B;  4DR4 B;  4TV9 B;  5JVD B;  3VQW A;  4JTC B;  2OCC B;  1N36 B;  1K73 W;  1Y76 B;  1I5X A;  1YSC A;  2P5O A;  1YZB A;  4GX5 A;  4UVC A;  4DRX A;  1IBL B;  3I55 V;  1N32 O;  4YHH O;  4J10 A;  1AJP A;  4DW1 A;  4JI3 B;  5GTH Z;  2Y69 B;  2YIC A;  1P4R A;  3GB7 C;  3ZRW A;  3BRC A;  2QSA A;  1EZV H;  3GWO A;  4DV6 B;  2MW2 B;  3K5O A;  3R65 A;  2Q0O C;  4H13 B;  1QVG U;  1R6T A;  5BMV B;  1Q3E A;  2FB5 A;  1F4M A;  2XND G;  4J9Z B;  2KG7 A;  2PUS A;  2IJK A;  3L70 H;  3SYC A;  2BSK A;  3X2Q C;  4B3R O;  4RQF A;  4DUZ O;  2QWQ B;  2OCH A;  1SET A;  1N0J A;  1IBK B;  2Y69 C;  4DV1 O;  4MTF A;  3K9A A;  1JCH A;  2AXT Z;  3RYF A;  1FJG B;  4OGQ B;  1PL4 A;  4CH4 A;  4GT1 A;  1DGS A;  3D3Q A;  3ABT A;  4ZI7 B;  4J42 A;  2RQ6 A;  2WWW A;  1CP9 A;  3HKE A;  2EIL B;  4B7K A;  2ZE6 A;  3FB6 C;  4U3J A;  4NXN O;  3U10 A;  5KAI Z;  4UFZ A;  1QNM A;  3KG2 A;  4KUM A;  4PJ0 Z;  1M9N A;  3ABL B;  1SER A;  5KUK A;  3L71 H;  1H2L A;  2CGN A;  4TQD A;  1GM7 A;  1TUE B;  1SZT A;  2R9A A;  3UKM A;  5KLV H;  4PDR A;  3CX5 F;  1K33 A;  4JV5 B;  2UUA B;  2GHY A;  1W2B U;  4J11 A;  4BIO A;  2IU3 A;  4F6R B;  2Q8V A;  2ARH A;  5CN0 A;  3CS5 A;  1D5N A;  1NJI W;  3ABU A;  2ZIN A;  3TET A;  1EM1 A;  3H01 A;  4QGP A;  1KEC A;  3N2K B;  2Q5Z A;  3SJA C;  4UV8 A;  1VQ4 V;  4ZOL B;  4PEL A;  1R3I C;  2X0L A;  3ZMV A;  2PYJ A;  5KMG A;  2V1D A;  2EX3 A;  1PM9 A;  4UCR A;  5LHG A;  4EB6 B;  4DV3 O;  2LW7 A;  5EBM C;  1Y6X A;  4NYK A;  2JDI G;  1P49 A;  2V4D A;  3ABK B;  3SJB C;  4ABM A;  2PI4 A;  2XUM A;  3K57 A;  2YEV B;  1OCZ B;  3CCV V;  1VEW A;  3CEI A;  1ZLZ A;  2ZD9 A;  3L75 H;  1G1X B;  4X65 B;  3P3P A;  4DV7 O;  4MTO A;  3C3S A;  1JX9 A;  3UQ8 A;  4PI2 A;  4DUY O;  4FK5 C;  4CS3 A;  1AR5 A;  4KL1 A;  2W0F C;  2DWE C;  4PA9 A;  1UFI A;  2FML A;  4X1K A;  4LFB B;  5B5E Z;  3T2M A;  1KP3 A;  3JAT A;  4B7E A;  1EBO A;  1K34 A;  1XBL A;  4YJ3 A;  1IBM O;  3QVN A;  1Q6I A;  1PL0 A;  5FPO A;  2JVD A;  1Y4M A;  4DR3 O;  3IAY A;  3JSL A;  3A0R A;  3TCU A;  1YXB A;  3OAA G;  4BIU A;  1VQ8 V;  4GX0 A;  5KAF Z;  4YIO A;  3CWB H;  3AK1 A;  1GN4 A;  4N21 A;  2P67 A;  4DR7 B;  5CA0 B;  2A9H A;  2M7W A;  4HNA B;  1NU1 H;  4LF5 O;  3ZIA G;  1ZTE A;  5EC1 C;  1YF2 A;  3E89 A;  3HKC A;  3SR2 C;  1Y74 A;  4LFA B;  1VQ6 V;  2RN9 A;  4JI2 B;  5IY5 C;  4LNU B;  3R66 A;  4LFC B;  4CC5 A;  4O4H A;  4X64 B;  3STL C;  4DK0 A;  3F7Y C;  2PY5 A;  1RFY A;  4R7C A;  4CBC A;  2ZNJ A;  3WB2 A;  4A5U B;  4QPK A;  1H8H G;  1JJ2 U;  4B3T O;  2Z5U A;  1HNX O;  1SA0 A;  1VF6 C;  2Y4T A;  5FLX N;  4LF7 O;  3P32 A;  1K3E A;  4UB8 Z;  4JI4 B;  5EBL C;  1QLE C;  3B77 A;  4MVQ A;  5CBF A;  4DV4 O;  5IJ0 A;  3A8T A;  1WB8 A;  3FYE B;  4D7T A;  3QO8 A;  3P3N A;  1QQC A;  2CAZ C;  2YEV A;  2HP8 A;  3JAK A;  5BXZ A;  1YCI A;  4JI0 O;  3LNN A;  1XMO O;  1RSO A;  5IJ9 B;  3SPG A;  3CCU V;  1NBM G;  5LXT A;  4CH3 A;  1AR4 A;  4GKK B;  1JOY A;  1WN7 A;  2N04 A;  1XMQ O;  1G8M A;  4BAY A;  1GRJ A;  4MVU A;  2PF4 E;  4DV0 O;  1KB9 F;  4LF8 O;  5E1A C;  4LWS B;  2ZM6 B;  4BW5 A;  3E8H A;  1H38 A;  2QM8 A;  1VQM V;  3UM7 A;  2P22 C;  5B1A B;  4GKJ B;  1BL8 A;  1FJG O;  4IHJ B;  4FFK A;  5KHK A;  1W0K G;  4JF3 A;  3VQX A;  3MHS C;  4DR2 O;  2LQT A;  3ZJZ A;  2QWO B;  2GUZ A;  3CCJ V;  1MOF A;  2AHZ A;  2RNB A;  5B66 Z;  4X9Q A;  5LP6 B;  4J7K A;  1PKX A;  5JWP A;  2R9I A;  4I5S A;  3LDD A;  5LMU O;  4DV7 B;  5LYJ A;  3RYI B;  1LUV A;  4KXR A;  3F7V C;  5J9P C;  3IC9 A;  4U3F H;  2YC0 A;  1A32 A;  1K9M W;  1TAE A;  2GTA A;  1VQK V;  4RUF A;  4TSF G;  1JFF B;  4FFB B;  3BA9 A;  2ZDI C;  1XNR O;  3K0D A;  2JS5 A;  1VQN V;  2FTK A;  3W7X A;  4MVS A;  2VQF O;  2QR4 A;  2QTO A;  4TQF A;  2Y4U A;  4EFB A;  5JQG A;  1CPY A;  1JFF A;  4FFB A;  2RMK B;  3W7U A;  4PHZ A;  4Z1V A;  2HJD A;  3ZHV A;  2E74 B;  3U11 A;  1Y67 A;  5LYJ B;  3CB2 A;  1BT8 A;  2WLH A;  5JVD A;  5LA6 A;  4X1Y A;  3E83 A;  1THZ A;  1H2G A;  2JGU A;  2IW5 A;  2WPD G;  1FAF A;  2EZP A;  2VRZ A;  3K5M A;  1XL4 A;  3JAW B;  2GUZ B;  3OTO B;  4W4K A;  1L8D A;  5C8Y B;  3RWR D;  3MDS A;  1BHB A;  1AP6 A;  2AHY A;  4FM0 A;  1Q6H A;  2EIJ C;  3HKC B;  2DYR B;  1AIL A;  4YJ3 B;  1E1R G;  3SYP A;  3E8B A;  2ZE5 A;  1BZK A;  2H3O A;  1OCC B;  1FXK A;  4BR6 A;  1PP9 H;  5L3C A;  4X8A A;  3WB1 A;  4YJ2 A;  2N74 A;  3CJH B;  1I7F A;  1ROP A;  4RO2 A;  1OV9 A;  3SPI A;  1XNR B;  2CDY A;  4EKW A;  3N2G B;  4PDV A;  1XUQ A;  4QE7 A;  3LDC A;  4FZ0 A;  3RFR A;  2OIG A;  2F95 B;  5IJ0 B;  5K1P A;  2RCV A;  5KX5 A;  3OEH G;  1R6K A;  2R9R B;  4CS4 A;  1PPJ H;  1IZ3 A;  3E35 A;  5IE9 A;  1F23 A;  1K5Q A;  1L0N H;  2DYS C;  4UCU A;  2QM7 A;  3SYQ A;  2Q6A A;  3FB8 C;  4LC1 A;  2D3O W;  1QR8 A;  4FLY A;  1JJO A;  4D7S A;  3J7A U;  4JI1 O;  1Y74 B;  3ASN C;  2VS0 A;  4YIP A;  3ASO C;  3ZX6 A;  1LR1 A;  2EUL A;  1XDC A;  5LGN A;  1OZ0 A;  3H1L H;  3BEH A;  5EZY B;  5IWA B;  4DR6 B;  3CRC A;  4NVP A;  3M7M X;  5F2V O;  3ZHS A;  2AGA A;  1D2D A;  2UXB B;  1COW G;  2ZDI A;  2UUB B;  5KHG A;  3WG7 B;  3CYO A;  1N32 B;  1S77 D;  3EVK A;  5B3S C;  3QTC A;  1QLN A;  5IWA O;  5LL6 Y;  3HKB B;  1Q5O A;  1N34 B;  4HAM A;  1HR0 O;  5CMU A;  3TGU H;  1ARO P;  4UCV A;  3KKY A;  4JI1 B;  4IYH A;  4U7N A;  2HJF C;  3AG1 B;  3N27 A;  5L3F A;  5TIS Z;  2ADP A;  2QDO A;  4R50 A;  5FPR A;  3AG4 B;  2HHH O;  5JH7 A;  1MZE A;  5L3E A;  4LFC O;  1QCE A;  5L3B A;  1DF5 A;  1YIT V;  1LNQ A;  4ZI7 A;  2Q7H A;  1V55 C;  4LF5 B;  1EN5 A;  3VOU A;  1YJ9 V;  4Q6G A;  3Q4H A;  4TT3 G;  3ZN1 A;  4JYA O;  1G6U A;  4H33 A;  4MS2 A;  3W7W A;  1HDJ A;  3S3W A;  1L0L H;  3ZHU A;  2P4V A;  2HG5 C;  4NR1 A;  1JA8 A;  2ETN A;  3G80 A;  2ADQ B;  2H94 A;  4K35 A;  4LFB O;  1HWY A;  2Q0A A;  4MW3 A;  1GM9 A;  2Y0I A;  2FYU H;  3BHP A;  4JI5 B;  1K5S A;  1Q81 W;  5LXT B;  5IJ9 A;  5JH7 B;  1RSO B;  1HNW O;  1H8E G;  1H2K A;  3M99 B;  1N33 O;  2GTS A;  3ZED A;  1VP7 A;  2Q7E A;  1NZ6 A;  1EFR G;  2ITC C;  3CPW U;  3K08 A;  3VQV A;  3CXC U;  1O9H A;  3ML0 A;  1GO3 F;  2YUA A;  2BOB C;  4MSW C;  2A79 B;  2EZO A;  3APQ A;  4OX9 B;  3X2Q B;  1IXB A;  2UXC B;  1BS3 A;  4JYY A;  5D5P A;  2Q69 A;  2EBO A;  1OJH A;  1YI2 V;  4MVO A;  2VQE B;  1GN6 A;  4O4H B;  1SQF A;  1NR7 A;  4JI8 O;  3RGB A;  3PN1 A;  3K5N A;  2GV9 A;  3H1K H;  1RPR A;  3ZRX A;  1Q7Y W;  3L72 H;  3FB7 C;  3G6E V;  5LMU B;  2QWR B;  4UB6 Z;  1PNL A;  2X6A A;  4HNA A;  4Z2W A;  2GBO A;  3MHH C;  3E22 A;  2YXH A;  4Q20 A;  3D36 A;  2YID A;  4PA7 A;  4DR2 B;  4JYC A;  3GVM A;  1KKC A;  4FLT A;  5KHI A;  5LOV A;  1WP8 A;  3FB5 C;  3FYI B;  3OGC C;  3BCC H;  1YJW V;  1SQP H;  1ZX3 A;  2ZM6 O;  2AW9 A;  1J5E B;  3TXQ A;  4X1K B;  4PI0 A;  1QHT A;  1PD3 A;  2BTO A;  2FL4 A;  5H9C A;  4MVR A;  2LJ2 A;  2ZR3 A;  1F4N A;  2CTW A;  4WFG A;  1NTM H;  1ORQ C;  4EFE A;  4HYO A;  3CC7 V;  4KHP O;  5EC2 C;  4HBN A;  3CRA A;  3RYI A;  4B08 A;  5EK0 A;  3A0H Z;  5B1B B;  1IBK O;  1ZL8 A;  4LF7 B;  1M93 A;  4E2L A;  3J80 N;  3RYC A;  1KU9 A;  5LP6 A;  5C8Y A;  4WFE A;  2IJJ A;  2UU9 B;  4DV5 O;  3JD1 A; 
#chains in the Genus database with same CATH homology
 4DR1 O;  4LF6 O;  1XMQ O;  4X64 O;  1AIL A;  3T1H O;  2UXD O;  1KUQ A;  4DV0 O;  4LF8 O;  4NXN O;  1NS1 A;  2HHH O;  4JI8 O;  2E5L O;  2UU9 O;  4DV6 O;  4LFC O;  2N74 A;  2Z0A A;  5BY1 A;  2DJV A;  3M8A A;  4AQY O;  1FJG O;  1IBM O;  4JI2 O;  1DK1 A;  5IT9 N;  4X65 O;  3SDL A;  4DR3 O;  1AB3 A;  1FKA O;  1HNZ O;  4DR2 O;  4DR7 O;  3RT3 C;  1IBL O;  4JI4 O;  1N34 O;  1YZB A;  3O65 A;  4OPH A;  4YY3 O;  5A2Q N;  3J81 N;  5LMU O;  4K0K O;  4JYA O;  2JRI A;  4DR4 O;  5BR8 O;  1A32 A;  2UUA O;  1N32 O;  4NXM O;  4YHH O;  4LF5 O;  4JV5 O;  1R1B A;  2UXB O;  4B3S O;  4OPA A;  5H5N A;  4DR5 O;  1X59 A;  1XNR O;  1F7Y A;  2ZM6 O;  3R66 A;  1XEQ A;  2VQF O;  2F4V O;  2VQE O;  1I94 O;  2FKX A;  3J7A U;  4JI3 O;  4JI1 O;  4DV3 O;  4LF9 O;  2LW7 A;  4LFB O;  3F5T A;  4GKK O;  2UXC O;  4OX9 O;  1XNQ O;  4DV2 O;  1R6T A;  4A5U B;  4B3T O;  1J5E O;  1HNX O;  4X62 O;  3JAM N;  2DOS A;  5FLX N;  4LF7 O;  4LFA O;  1HNW O;  4LF4 O;  3OTO O;  4JI7 O;  5LMN O;  1N33 O;  2AGA A;  1D2D A;  4DV4 O;  4KHP O;  4B3R O;  1N36 O;  2UUC O;  4DUZ O;  1FYJ A;  4JI6 O;  4DV1 O;  1G1X B;  1IBK O;  4DV7 O;  4X66 O;  5IWA O;  4DR6 O;  2UUB O;  5LL6 Y;  3J80 N;  5BXZ A;  4GKJ O;  4JI0 O;  1XMO O;  4B3M O;  4JI5 O;  3T1Y O;  4DV5 O;  4DUY O;  2ZKO A;  1HR0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...