4DR1O

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr1O00
1HNXO 1IBMO 3R66A 5H5NA 1XMQO 1IBLO 4JI6O 2Z0AA 3M8AA 1XEQA 4DV0O 4X64O 4DV6O 4DV2O 4DR7O 1G1XB 4JYAO 4DR6O 5IWAO 3J7AU 1D2DA 1AILA 4NXMO 1N34O 5BXZA 4DR4O 4YHHO 4JI2O 3T1YO 4GKKO 2JRIA 1NS1A 4B3MO 1F7YA 1YZBA 3OTOO 1KUQA 4DR3O 3O65A 5LL6Y 2VQEO 1N36O 1A32A 1N33O 4X66O 1X59A 2ZM6O 2VQFO 4K0KO 1DK1A 1HNZO 3J80N 4JI1O 2ZKOA 1XMOO 5LMUO 5FLXN 4DV4O 2UU9O 4LF9O 2E5LO 1R1BA 1J5EO 2UUCO 4KHPO 4LFBO 3SDLA 5IT9N 4LF8O 5A2QN 4LFCO 4X65O 1XNQO 2UXBO 4B3SO 4OPHA 2HHHO 4JI8O 3F5TA 1XNRO 2DJVA 4JI0O 4OPAA 1FKAO 4OX9O 2N74A 4DR1O 2UUBO 2F4VO 1FJGO 1N32O 1I94O 2FKXA 5LMNO 4DV1O 4LF6O 4DR2O 2LW7A 4YY3O 2UXCO 4DV5O 1FYJA 4GKJO 2UUAO 4LFAO 4DV3O 4AQYO 2UXDO 4JV5O 4JI4O 4NXNO 4LF7O 4X62O 1HNWO 1HR0O 3RT3C 5BR8O 4DV7O 4B3RO 1AB3A 4DR5O 5BY1A 4DUZO 4A5UB 4LF4O 1IBKO 4DUYO 4B3TO 4JI5O 4JI3O 3J81N 3T1HO 4LF5O 1R6TA 3JAMN 2DOSA 4JI7O 2AGAA
chains in the Genus database with same CATH superfamily
2YXHA 2QTOA 2P4KA 1IBLO 1BGYH 1ZWIC 1HR0B 1K73W 1NI8A 2WLLB 4DUYB 3WFVA 3K06A 3UQ8A 3CRRA 3MDSA 3E8BA 4LH7A 1F7YA 2Y4TA 5EYPB 1VQMV 4WCEV 3CCVV 4BW5A 2Q5ZA 1THZA 4P9PA 1Q7YW 4LP8A 4QPKA 3P30A 4DV6B 2DYSC 2JVDA 4X64B 2IU0A 4GT1A 1QLEC 1V55B 3C3TA 4J7KA 4YJ2A 1K4CC 1FPOA 2CDYA 4DW0A 2YIBD 1E79G 5CMUA 4NVPA 1U96A 4UUJC 3AG2C 4O4IB 4BR6A 3E8HA 1I7FA 5EC2C 1AI6A 2B9ZA 5H2FZ 4LNUA 4JI8O 1RM1C 5IE9A 2FYUH 1SQXH 2PI5A 2PYLA 3A0HZ 3C3SA 4L8JA 1MNGA 4BIZA 4IYHA 3IGAC 2CTWA 1YDXA 3ZMSA 3K03A 3HKDB 2LW7A 5CN0A 5JJEB 1FXKB 1GN3A 1T5EA 4AILC 2QJ1A 5H9CA 3CEIA 2HVJC 4PI0A 3W7WA 4K8XA 4NXNO 3CXHF 1SRYA 1VF6C 2Q0OC 1K34A 1YEWA 4WFBV 2YXYA 2BOBC 2XNDG 5BZBA 5LMNB 3H9VA 3CP1A 4LF6B 2QWRB 2RMKB 1PPJH 3T1HO 4FLVA 3I56V 2A06H 2BTQA 3FKSG 4UVCA 1MZEA 2QWPB 4K35A 2CGNA 3ZIAG 2YSUB 5JQGA 1SA0A 2RJZA 1XEQA 2QTSA 1G6UA 3TGUH 3RW0A 4WF9V 4LF4B 1SESA 4I55A 2D3OW 2JRIA 3SYPA 1K7DA 4EFEA 4JI7B 3ZMZA 5KA5A 3PN1A 1AI5A 1Q5OA 4D7SA 1KQSU 4X88A 3RVZA 1RFYA 1GN2A 2DMXA 4UCUA 2DW4A 3ABMC 2Q4PA 3T4DA 1D5NA 1KD1W 1N34B 2R70A 4DR4B 1ORQC 4FJCC 1YTFD 4J10A 3H1JH 3BHPA 2VQEB 2JEXA 4CH5A 4WFHA 4ZI7A 4B3SO 2VQFB 1NTKH 2HHHO 1H2GA 3L71H 4JZ2A 5GTHZ 1EM1A 4HAMA 3AK2A 5CA1B 5CA3A 1FJGO 4GX5A 4RAIA 1GRJA 5A9GA 3D36C 2WWWA 2XOKG 3ASNB 5LP6A 3A8TA 1GMGA 4BWAA 4DV5O 2QKCA 2UXBB 4ZHQA 1P7BA 3BY6A 4B7EA 4JI4O 4CC5A 4LF7O 3RYHA 2EINB 1OCCB 3ZRXA 4HZ3A 1VQ4V 4HNAB 1WB7A 1QR9A 3ABLB 4FFBB 1IXBA 4DV1B 2OCCB 5KMGB 1NVPD 1XQ8A 2N05A 1JFFB 3CCLV 3NR7A 1KMIZ 2KB1A 1KYOF 2BSKA 3K08A 1H8EG 5B66Z 1IBKB 1G8MA 1N0JA 3K04A 2YEVB 1KU9A 5B3SB 1Y76A 3KKYA 3FFQA 3FAVB 3CD6V 3U10A 3OE7G 5LXTA 4X1YA 4O4JA 2Y0PA 1PL4A 1X59A 2UXNA 4K0KO 4N23A 1DK1A 5LHIA 2IH1C 5GW7A 3HKBA 1M57B 1S76D 3G80A 1VEWA 1PP9H 5IYCO 2ODMA 4JTAB 5EIBC 2PF4E 1I08A 3O9OA 2DWDC 2QGNA 4FLUA 5IT9N 1US6A 4MTFA 3RYCB 4JASA 2Z3YA 1P4RA 4U7NA 4H33A 3TCUA 2JJ2G 2IJHA 5JVDA 4I0XB 4JI0O 3CCSV 3FB8C 2K1EA 3ZRVA 1NR1A 5EZYA 4FFKA 1PM9A 3VQYA 1N8RW 1K8AW 2CK3G 5EBMC 4K8ZA 4MVMA 2WAMA 2HG5C 4J7ZA 1WNSA 1W0JG 3GVMA 2X6AA 1WA8A 4J41A 5KHGA 1M1KW 4X89A 1VQ9V 3ASOC 5H6QA 1GTOA 4TWKA 4MSWC 1JCHA 2P6JA 1B6QA 2LFSA 2K9PA 4ZOLA 2XHBA 2ADQB 3M99B 3BFRA 4JV5B 5IYBO 4JTCB 5KHHA 3THOA 4DR7O 1ZUQA 4BAYA 3VOUA 2H8PC 1L8DA 3JAWB 4O2AA 1F4MA 4RQEA 4DRXA 2EULA 1NS1A 1BQ0A 1NH2D 3JASB 1WPXA 2IJJA 2UUAB 5J2UA 4X66O 3UM7A 2GUZA 4NTYA 1YJWV 4DR6B 4G27B 2G38A 2Q67A 5IJ0B 1BT8A 3HKEA 3SJCC 3VQVA 2HFEC 5LYJA 4B3MB 3SDLA 4U7OA 3WB2A 3LDEA 1K3EA 4P2ZA 5FPOA 3B09A 4UCRA 5B5EZ 2F95B 4EKWA 2IU3A 1GM7A 5LMUB 2Q68A 3B2EE 2UU9B 2XASA 3DC6A 4YJ2B 2A0LA 1OCZC 3APOA 4DR2O 1FYJA 4YY3O 1E1QG 3CJHB 3AG4B 2DN9A 1ROPA 1SC5B 1YTFB 2ZE5A 2QM8A 3JALA 3S3XA 4B3RO 1HWYA 4R50A 4LNUB 1I94B 3EXAA 2IJKA 1AP5A 1H2LA 1E1RG 3SYOA 3RYIB 3JAKB 3R66A 2ZNIA 4PI2A 2V7QG 1F23A 4PHZA 3G6EV 1DTOA 3G67A 4GX0A 1S0VA 1URFA 1W0KG 5KHJA 1QLNA 4NXMO 2JGDA 2XT9A 1B04A 4LF5B 2QKSA 4RUFA 1TUBA 3WG7B 4CS4A 3U0ZA 3J80N 2BTQB 3F7VC 4DV2B 4Z2WA 5L3EA 1NVPB 4FM1A 4DV4O 1YJ9V 4LF9O 1SA0B 1S3JA 2UUCO 4LBEC 5DECA 3B8NA 4I55B 1JMKC 5HFLA 1O9GA 4AI8A 4DK1A 4JYBA 5JWPA 3K59A 2H3OA 1EN5A 1HNZB 4PA7A 4F4LA 2Q8VA 4JYCA 1OCOC 3K79A 1WLEA 2A3QA 3K57A 1FKAO 4PDMA 2CUGA 3AG3C 2RN9A 3BA8A 4PA3A 3CHXA 4X1IA 1I0HA 2JJ1G 4KUMA 1Q6IA 2ZXWC 1I5YA 3EVKA 4ABMA 5LGNA 4FLZA 1SQVH 4HBNA 1SZXA 1FAFA 5J9PC 3CS5A 4ZI7B 5BR8O 4OX9B 3GWKC 4R7CA 3ETGA 4I5SA 2D2CB 3UO3A 3D3IA 1L0LH 1XBLA 4LWSB 2DOSA 2R9RB 1HNXO 3OR6C 4DV3B 1IBMO 2XUMA 1FFXA 1SKVA 2JS3A 4AQYB 5LP6B 1FD9A 5CA0A 2GV9A 4X62B 2EZPA 3JCZA 1ZSPA 3ICXA 2LJ2A 4ZHQB 5B1BC 2YDEA 3G4SV 1JJ2U 3RYHB 3CCQV 1RPRA 1YZBA 3OTOO 1IURA 3A0BZ 4TV9A 3M7MX 4O2BA 3I55V 4MW8A 1N36O 4RWUA 1H2KA 3ZRWA 2Y69B 4NTXA 3SYQA 4JYAB 4I9QA 4FLXA 2Y0IA 2ZNJA 4MVQA 1Q43A 2BSKB 4GKKB 3T1YB 2YXLA 4JAVA 1J5EO 2XAJA 4B08A 5CB4A 2CTPA 4DYLA 1RP3B 1Y76B 5E1AC 4WFGA 5GONA 4DW1A 1N33B 1O9HA 1OHHG 5LXTB 4X1YB 1V54B 4O4JB 4FIPC 3F5TA 2ZDIC 1NH2B 2VS0A 3HKBB 3ZMVA 4LF8B 1VF6A 1J95A 3WB1A 2EIKB 2UUAO 3X2QB 5DM6V 3IC9A 1XNRB 4MW3A 4UCSA 4GX2A 1FXVA 5JVDB 2AXTZ 2P4VA 2IBZH 4JI3O 1RSOB 3BAAA 1R6TA 3JAMN 1PL0A 2ZR2A 5KAFZ 3OGCC 1XMQO 4KP4A 1HNWB 1Q8IA 3M8AA 4DV7B 4UCTA 4EEQA 1S5JA 4XDKA 2OIGA 3SYCA 4JI5B 3J7AU 2EIJB 1WA8B 1DGSA 1XUQA 3P3PA 2QSAA 2X6CA 3L73H 3OR7C 5IYZA 4I9WA 3E83A 2EJ7A 2KKWA 2ZM6O 4MVOA 3AG4C 4DV0B 4ZOLB 3K3WA 3STLC 4DR5B 5KAIZ 1MA1A 4DUZB 2BCCH 4CS3A 5JJJB 2NNUA 3L9DA 3E8GA 4O2AB 3OGIB 1BL8A 4DRXB 1BMFG 1VF5B 3HKCB 1XNQO 3KCXA 4WFEA 1JA8A 1YCIA 3D36A 3DXRA 4LH6A 4JI1B 3SPCA 2IH3C 4CH4A 2EZOA 3OM3B 4OPAA 3DTUB 1YI2V 3LDCA 3JYCA 5KX5B 5B1AB 4MS2A 2P7TC 3ZN0A 2PGGA 2QWNB 5GTIZ 3GB7C 1OCRC 2LGWA 3HKEB 2UXCO 2EJRA 4GKJO 4LR3A 5LYJB 4B7KA 4E4EA 1XOUA 4WBNA 3P3NA 3W7UA 2YUAA 4N21A 5KA6A 1CEZA 5L3BA 3SR2C 5LGUA 3H1IH 3MD0A 3MAQA 2ZE7A 4ZBMA 1ZL8A 3RYFA 3WU2Z 4LCUC 4J42A 2YI8A 4TV8A 2HJDA 1B06A 4LFAB 3S3WA 2P22C 4FLWA 3QO5A 1Y74A 3B4SA 5IY5B 4JI6O 3CC2V 2UXDB 4TQDA 2LO1A 3CE2A 1UJWB 1G1XB 1JVMA 2LP7A 4FZ0A 3JALB 3H1LH 1IDSA 3ZHVA 4YHHO 3ZHQA 4LFBB 2KG7A 4EB6A 3PJSK 1ZTEA 3JSNA 4PELA 4FK5C 1PV0A 3T1CA 3JD1A 1GN4A 4UB6Z 3E89A 3EHBB 1H38A 4QGPA 3VQWA 3ETQA 4Z1VA 5C8YA 4PA6A 5IWAB 5FLXN 4JTDB 3HR0A 4KHPO 2YI9A 3K0GA 3G6BA 3H1HH 2QKAA 4DR3B 2EILB 4LFCO 2JGDB 1M56B 1IZ3A 2WLLA 3OD4A 1Y66A 1PNKA 4OPHA 3LUTB 4IIJA 1TUBB 2JDIG 4BIUA 5BMVA 3ABKC 1XMOB 4GUNA 2UUBO 2E75B 1EN6A 1JOYA 3CPWU 2E5LB 2FKXA 3SJQC 1NQTA 1TVKB 2YS8A 2IM9A 5K1PA 1BQZA 2ZT9B 4FVMA 1P49A 2W0XA 2ZD9A 1W2BU 4G2KA 2RDCA 4U3JA 1VQ7V 1HR0O 3QVNA 2FB5A 1AB3A 1QNMA 4NKGB 1TAEA 5BY1A 2F4VB 2BOCC 1N32B 2FMLA 5HFMA 4DUYO 5KLVH 4O4IA 1YF2A 3JARA 1DLBA 3D8CA 4UV9A 4UB8Z 3OUSA 2LFRA 1EN4A 4IGGA 3CRQA 4X1IB 1R6NA 5JH7A 1KB9F 3ETDA 2DWEC 1EBOA 3B8MA 4O4HA 4DV6O 4X64O 1LNQA 1WP8A 1IVSA 3AG1B 1DF4A 2QM4A 4B3TB 3HKDA 4IHJA 1KP3A 3LDDA 5BXZA 1EFRG 1V55C 2R9AA 5ITZA 1XHZA 5EIBD 2WLJA 3QO8A 3IAYA 3E22A 2YICA 1Q6UA 3CRCA 3UT5A 3FB6C 5B1NA 3ETEA 1IBLB 4NYKA 2DQ0A 2ZE8A 1V9PA 1JPXA 4ICGA 1FFXB 3STZC 5CA0B 1XDCA 1NT2B 3CCUV 3LSSA 3FYIB 2DYSB 4TSFG 1YIJV 1VQLV 4O4LB 1SQFA 1CXZB 4TV9B 4AHCA 1FXKC 2QM7A 4G28B 2ITDC 4JAUA 4O2BB 1NKDA 1SF9A 2YIDA 5EK0A 4DXWA 3AG2B 1YXBA 5LMNO 2EIJC 4LF6O 2B1GA 3IJ4A 3RBZA 4QE7A 1RM1B 5KHIA 2W6IG 4D6TH 2P5OA 4JI8B 5GONB 2Q6AA 1PNMA 3BCCH 1GO3F 4BW9A 4DR5O 1AI7A 2WLNA 4DUZO 1LR1A 4A5UB 4LF4O 4GX1A 4DK0A 1AJPA 5LGTA 3BPZA 4RO2A 4JI7O 3OMNB 4KXRA 1PKXA 5H5NA 1VP7A 1QU7A 4NXNB 3DGEA 1GAXA 3FB7C 1LUWA 1N0NA 2JGUA 2X6BA 4DR1B 1AILA 1N34O 4DR4O 1TGOA 3CB2A 3T1HB 1AI4A 1ZX3A 2VQEO 3N2KA 1ZAUA 2GTAA 1M4UA 3JCUZ 2VQFO 1KECA 4KFMA 3FX7A 4X8AA 3KCYA 5LHHA 1YSCA 3ZHSA 3TK1A 1HW7A 2CTRA 4MVSA 1Q82W 5L3GA 3VBBA 1OJHA 3QF7A 1LUVA 3OFNG 4PD4F 2ZCEA 3ABMB 2UXBO 3AK1A 3ASNC 3H01A 5IYZB 2WLIA 3L75H 2QR4A 5IY5C 4JZGA 5K1XA 4I7ZB 3K5NA 3FAVA 5JQGB 1Y6XA 2EINC 1OCCC 4JI2B 5E79Z 4DV1O 3CX5F 4Q20A 4W4LA 2QA4V 3ABLC 4X1KA 4B3SB 1NU1H 2OCCC 4DO2A 3H1KH 1R3LC 2HHHB 2VWKA 4ZKIA 2Y48A 2PY5A 2EX3A 1FJGB 3RYCA 4R6ZA 1IBKO 1ZLZA 3AK3A 1PNLA 3ZCCA 3P32A 1K33A 5JCOC 4DV5B 3IC7A 5B3SC 4UFZA 1QVFU 4MTGA 4ASUG 3OW2U 4X65B 2B1IA 2B5UA 3W7SA 4LF7B 4D7TA 3B77A 4QJFB 5FPRA 2A9HA 1K92A 1R73A 4L87A 4WBNB 4OXSA 1VQNV 4FLYA 4UV8A 1M57C 4UVAA 1YHQV 1KBHA 3O65A 5LL6Y 1G4YB 1Z5VA 2DE0X 2CTQA 3L72H 4TV8B 4CS2A 1CP9A 1Y74B 1K9MW 3BA9A 2EIMB 3SJBC 4IL6Z 4H13B 1Z2GA 1M90W 2CH7A 2ZDIA 2GSMB 3RGBA 2ZIOA 4R8CA 5D5QA 3VQXA 5A2QN 3TETA 1MABG 1VMGA 3CC4V 4K0KB 3R65A 1SS3A 4EB6B 3JAWA 3RFRA 2RCVA 1D5AA 2F1MA 5H6RA 1NTMH 3K5MA 2DJVA 2LGQA 2N74A 1H2MA 1NZ6A 3BABA 4PV1B 2GBOA 1Q90D 3AEIA 5C8YB 4YXWG 1VQKV 1XL6A 4PA9A 3BEHA 2ETNA 2JEUA 4OGQB 2WLKA 4JV5O 1AVMA 5IJ0A 5LOVA 2CE4A 4JI0B 4Z1MG 2P90A 3JATA 1BSMA 4IIJB 2LW1A 1VQPV 5BMVB 1B3QA 3AG7A 1WP7A 3FB5C 2HP8A 1WJZA 3KZIZ 3TXSA 3BRCA 5TISZ 5IJ9A 3W7XA 2LQTA 2F93B 3UKMA 3E8FA 2PZSA 1XHXA 4E2LA 2PYJA 1SERA 1Y67A 2AHZA 3ASOB 3IFXA 4DR6O 2KQXA 4U3JB 3CJHA 1VQOV 1COWG 1H2NA 2A79B 4B3MO 3JSLA 1H8HG 5EZYB 4F6RA 3T2MA 3JARB 2OCHA 1VQ8V 1A32A 1JR9A 1VIBA 1Q3EA 4QIWF 5JH7B 2V1DA 2AZ0A 3UO2A 3UCSC 4DR7B 2ZINA 4WFFA 5DN6G 2ZR3A 5LMUO 5J2TA 2UU9O 2A7WA 1BS3A 5CBFA 2PUSA 4O4HB 4X20A 5F2VO 1GH6A 4QPJA 3RYIA 3JAKA 3SJAC 5B1OA 5LBQA 3K0DA 4I50A 1M9NA 4IHJB 5L3CA 1OZ0A 5ITZB 4CBCA 3WB0A 4X66B 4W4KA 3E22B 4RUEA 2FL4A 3E86A 3UT5B 4CC6A 2WA3A 2OIEA 1QBZA 1BCCH 4DR1O 4YJ3A 1NR7A 3CSXA 2OTLV 3F5WC 2X7RB 1I94O 2VRZA 2HKOA 3K58A 1K5QA 3SPGA 5AG2A 1QVGU 4J11A 3ZX6A 4JPRA 3B40A 5J2UB 4UVBA 2HR3A 3Q4HA 4PJ0Z 1OCZB 2GUZB 2JK5C 3JD0A 3APQA 2HJFC 1NBMG 3OUFA 1Y4MA 3N2GA 4MVZA 4WFAV 4Q6GA 4DR2B 1WAZA 4YY3B 1YITV 1VQ5V 4FZ1A 4LF5O 5FNVA 1NTZH 5L3DA 3ML0A 5EBLC 2M7WA 3DSQA 3OEEG 4XBFA 2P06A 4B3RB 3SYAA 2Q7HA 3WG7C 4DV2O 4JGSA 3ZHRA 3JD2A 3SPHA 2Q0AA 2OT5A 2RQ6A 5JJNB 4HYOA 2WLHA 4JI2O 4GLXA 3K9SA 4H0LB 3ZMTA 1Z5WA 1FXHA 2QE7G 1SQBH 2ZQMA 1X4TA 2W6JG 4J9YB 1Q6HA 1HNZO 4U3FH 2UXXA 1YVWA 2ZKOA 4BIOA 4LWSA 5D5PA 5KUKA 4I4TA 4NXMB 2PTMA 2L35A 4J9ZB 2QWOB 1SETA 3GWOA 1Q81W 2AW9A 4X65O 4TUYA 1BE3H 4C7UA 5LA6A 4F6EA 2EBOA 1VQ6V 4QE9A 1RPOA 3BVOA 4FMTA 4CH6A 3N2KB 2ILMA 4H44B 3ZEDA 1AP6A 4DV4B 4OX9O 4LF9B 4FM0A 4FM2A 4MT8A 4QNHB 1KC8W 2L6LA 2UUCB 3ZS8C 1JQ0A 3D3QA 1OCOB 3ZHUA 3K5OA 4DV3O 1P7GA 2N04A 4AQYO 3AG3B 4P9OA 4X62O 2XAFA 3RT3C 1OV9A 1YJNV 5LP6C 3L70H 2ZXWB 3ZJZA 5EYPA 2WLIB 4FLTA 1QQCA 1QHTA 2AZ2A 4H37A 2WSSG 3CRAA 1BHAA 2EIMC 2XAQA 4TT3G 3ZMUA 3OEHG 2H94A 2AHYA 1GKFA 2AGAA 1XREA 2W0FC 2E76B 1K4DC 3KG2A 1AJQA 5KUMA 2MW2B 4X1KB 2F43G 2F23A 1MG1A 5BR8B 2OYQA 4JYAO 2DYRB 3U11A 4CZZA 2Y69C 4P30A 1SZTA 2VWJA 3CCJV 4GKKO 3T1YO 3MHHC 3CRMA 1KKDA 1HNXB 1IBMB 1SQQH 3ABTA 3CCEV 5B1BB 1AR1B 4MTXA 1N33O 3RN4A 2Q69A 3SPIA 2WLMA 1NJIW 4GYCB 3L74H 4IT5A 3HB3B 3CYOA 2MK3A 1RSOA 3FYEB 1S77D 1V54C 1FXKA 2JIZG 3RVYA 3OTOB 4NTWA 4LF8O 5IDJA 1GM9A 2IJIA 1N36B 2NN4A 3OMAB 1F51A 2EIKC 3I5DA 3E35A 1M93A 1WB8A 1VARA 1XNRO 1EZJA 2Q7EA 3TJTA 3X2QC 1J5EB 2RNBA 4NR1A 4CH3A 4NB5A 1UPGA 2ZIMA 2E3CA 3JD4A 3QNEA 4LC1A 2HEPA 2CH7B 2V4DA 2QDOA 4PDLA 4JF3A 1QLEB 1K97A 1HNWO 1F4NA 4PDVA 2NLJC 4DV7O 4YIPA 4IYIA 1MOFA 3ZRWB 3RWRD 3G71V 3DC5A 4JI5O 3HKCA 2C2AA 1MZFA 1KKCA 2HVKC 1XILA 2ADPA 1TUEB 3SGIA 2Q73A 2R72A 4UCOA 1R6KA 5KX5A 5CB4B 2Z0AA 1S5LZ 4KL1A 4DV0O 2OWOA 4MTOA 4XDJA 4MVRA 1GK9A 4K3AA 2GHYA 4UCVA 1PD3A 5LOVB 1D2DA 3CC7V 4JI3B 3JATB 1HP8A 5LHGA 1KUQA 2PI4A 3OAAG 5DEDA 1SQPH 1XMQB 1M5IA 1WN7A 2GTSA 5CA1A 1S72V 3K5LA 5IJ9B 3E2EA 3A2FA 2HLDG 4JI1O 3LSUA 2BTOA 1R3IC 3ABUA 2CAZC 1GN6A 3ZHTA 3W7TA 1VF7A 5B1AC 5L3FA 1MMMA 3QTCA 1P84F 1HDJA 2ZM6B 4ZIBA 4HNAA 1AR4A 3LNMB 4EFBA 4JYYA 1TA8A 4F6RB 4FFBA 3CMAV 4X9QA 1AR5A 2XAHA 4GZRB 4PDRA 2CGOA 3C90A 5KMGA 1MSWD 5J2TB 1JFFA 4X20B 3ZRSA 5CBGA 4FPPA 1S5HC 3N27A 1H2SB 1XNQB 1QCEA 4LFAO 5EBWC 4I50B 2JS5A 5JCOA 2UXDO 2Z5UA 3OMIB 2YEVA 1W59A 3F7YC 5CBHA 1OCRB 4TQFA 2F66C 1WPBA 2QWQB 3A0RA 1L0NH 4YIOA 2P67A 2QEXV 2UXCB 4YJ3B 4GKJB 1L1FA 4LFBO 2GDSA 2YC0A 3CWBH 1I5XA 3TXQA 2OTJV 2IW5A 1MSDA 2XAGA 3K9AA 4TOIA 2Q7GA 1JX9A 1TVKA 3CCRV 3MHSC 3DXRB 3JD3A 3FD9A 5IWAO 2BE3A 3SPJA 5IYDO 1XI1A 3Q4HB 4J7JA 2E74B 1XL4A 2XTAA 4DR3O 1DF5A 2ITCC 4GCZA 1U97A 2WPDG 4MVUA 1BHBA 3LNNA 4JI6B 4I0XA 3N2GB 3OT7A 3OTFA 1IXMA 1AROP 5FNVB 2EILC 4JI4B 1M56C 3QG5A 2Y4UA 3QO7A 5EC1C 1XMOO 2FTKA 1R3JC 4YHHB 2E5LO 1R1BA 2X0LA 1KP2A 1BZKA 3CMEV 2ARHA 2YIBA 1ZL8B 3RYFB 3ZBHA 3HPLC 1AJNA 1N4CA 1SQGA 1R3KC 1EZVH 5FL7G 3CCMV 2O57A 2YIAA 2Q9LA 2F4VO 2R9IA 4KHPB 1N32O 1FFTB 2ATKC 2DYRC 2DQ3A 2WA4A 5C93A 3ZN1A 4I4TB 1IX9A 4LFCB 4UXNA 1Q86W 1UFIA 3T4ZA 3ABKB 4PA4A 3CXCU 1QR8A 1GM8A 2KG7B 1JJOA 3EFFK 4TUYB 1K5SA 5LA6B 2ZE6A 4JAAA 2UUBB 5KHKA 3NXSA 2M6YA 3LSQA 1ENVA 4B3TO 3JASA 3AG1C 4J80A 2NR5A 1FS0G 2KSDA 4O4LA 3J81N 4XDLA 1CPYA 4RQFA
chains in the Genus database with same CATH topology
1HNXO 1IBMO 3R66A 5H5NA 1XMQO 1IBLO 4JI6O 2Z0AA 3M8AA 1XEQA 4DV0O 4X64O 4DV6O 4DV2O 4DR7O 1G1XB 4JYAO 4DR6O 5IWAO 3J7AU 1D2DA 1AILA 4NXMO 1N34O 5BXZA 4DR4O 4YHHO 4JI2O 3T1YO 4GKKO 2JRIA 1NS1A 4B3MO 1F7YA 1YZBA 3OTOO 1KUQA 4DR3O 3O65A 5LL6Y 2VQEO 1N36O 1A32A 1N33O 4X66O 1X59A 2ZM6O 2VQFO 4K0KO 1DK1A 1HNZO 3J80N 4JI1O 2ZKOA 1XMOO 5LMUO 5FLXN 4DV4O 2UU9O 4LF9O 2E5LO 1R1BA 1J5EO 2UUCO 4KHPO 4LFBO 3SDLA 5IT9N 4LF8O 5A2QN 4LFCO 4X65O 1XNQO 2UXBO 4B3SO 4OPHA 2HHHO 4JI8O 3F5TA 1XNRO 2DJVA 4JI0O 4OPAA 1FKAO 4OX9O 2N74A 4DR1O 2UUBO 2F4VO 1FJGO 1N32O 1I94O 2FKXA 5LMNO 4DV1O 4LF6O 4DR2O 2LW7A 4YY3O 2UXCO 4DV5O 1FYJA 4GKJO 2UUAO 4LFAO 4DV3O 4AQYO 2UXDO 4JV5O 4JI4O 4NXNO 4LF7O 4X62O 1HNWO 1HR0O 3RT3C 5BR8O 4DV7O 4B3RO 1AB3A 4DR5O 5BY1A 4DUZO 4A5UB 4LF4O 1IBKO 4DUYO 4B3TO 4JI5O 4JI3O 3J81N 3T1HO 4LF5O 1R6TA 3JAMN 2DOSA 4JI7O 2AGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX O;  1IBM O;  3R66 A;  5H5N A;  1XMQ O;  1IBL O;  4JI6 O;  2Z0A A;  3M8A A;  1XEQ A;  4DV0 O;  4X64 O;  4DV6 O;  4DV2 O;  4DR7 O;  1G1X B;  4JYA O;  4DR6 O;  5IWA O;  3J7A U;  1D2D A;  1AIL A;  4NXM O;  1N34 O;  5BXZ A;  4DR4 O;  4YHH O;  4JI2 O;  3T1Y O;  4GKK O;  2JRI A;  1NS1 A;  4B3M O;  1F7Y A;  1YZB A;  3OTO O;  1KUQ A;  4DR3 O;  3O65 A;  5LL6 Y;  2VQE O;  1N36 O;  1A32 A;  1N33 O;  4X66 O;  1X59 A;  2ZM6 O;  2VQF O;  4K0K O;  1DK1 A;  1HNZ O;  3J80 N;  4JI1 O;  2ZKO A;  1XMO O;  5LMU O;  5FLX N;  4DV4 O;  2UU9 O;  4LF9 O;  2E5L O;  1R1B A;  1J5E O;  2UUC O;  4KHP O;  4LFB O;  3SDL A;  5IT9 N;  4LF8 O;  5A2Q N;  4LFC O;  4X65 O;  1XNQ O;  2UXB O;  4B3S O;  4OPH A;  2HHH O;  4JI8 O;  3F5T A;  1XNR O;  2DJV A;  4JI0 O;  4OPA A;  1FKA O;  4OX9 O;  2N74 A;  4DR1 O;  2UUB O;  2F4V O;  1FJG O;  1N32 O;  1I94 O;  2FKX A;  5LMN O;  4DV1 O;  4LF6 O;  4DR2 O;  2LW7 A;  4YY3 O;  2UXC O;  4DV5 O;  1FYJ A;  4GKJ O;  2UUA O;  4LFA O;  4DV3 O;  4AQY O;  2UXD O;  4JV5 O;  4JI4 O;  4NXN O;  4LF7 O;  4X62 O;  1HNW O;  1HR0 O;  3RT3 C;  5BR8 O;  4DV7 O;  4B3R O;  1AB3 A;  4DR5 O;  5BY1 A;  4DUZ O;  4A5U B;  4LF4 O;  1IBK O;  4DUY O;  4B3T O;  4JI5 O;  4JI3 O;  3J81 N;  3T1H O;  4LF5 O;  1R6T A;  3JAM N;  2DOS A;  4JI7 O;  2AGA A; 
#chains in the Genus database with same CATH topology
 2YXH A;  2QTO A;  2P4K A;  1IBL O;  1BGY H;  1ZWI C;  1HR0 B;  1K73 W;  1NI8 A;  2WLL B;  4DUY B;  3WFV A;  3K06 A;  3UQ8 A;  3CRR A;  3MDS A;  3E8B A;  4LH7 A;  1F7Y A;  2Y4T A;  5EYP B;  1VQM V;  4WCE V;  3CCV V;  4BW5 A;  2Q5Z A;  1THZ A;  4P9P A;  1Q7Y W;  4LP8 A;  4QPK A;  3P30 A;  4DV6 B;  2DYS C;  2JVD A;  4X64 B;  2IU0 A;  4GT1 A;  1QLE C;  1V55 B;  3C3T A;  4J7K A;  4YJ2 A;  1K4C C;  1FPO A;  2CDY A;  4DW0 A;  2YIB D;  1E79 G;  5CMU A;  4NVP A;  1U96 A;  4UUJ C;  3AG2 C;  4O4I B;  4BR6 A;  3E8H A;  1I7F A;  5EC2 C;  1AI6 A;  2B9Z A;  5H2F Z;  4LNU A;  4JI8 O;  1RM1 C;  5IE9 A;  2FYU H;  1SQX H;  2PI5 A;  2PYL A;  3A0H Z;  3C3S A;  4L8J A;  1MNG A;  4BIZ A;  4IYH A;  3IGA C;  2CTW A;  1YDX A;  3ZMS A;  3K03 A;  3HKD B;  2LW7 A;  5CN0 A;  5JJE B;  1FXK B;  1GN3 A;  1T5E A;  4AIL C;  2QJ1 A;  5H9C A;  3CEI A;  2HVJ C;  4PI0 A;  3W7W A;  4K8X A;  4NXN O;  3CXH F;  1SRY A;  1VF6 C;  2Q0O C;  1K34 A;  1YEW A;  4WFB V;  2YXY A;  2BOB C;  2XND G;  5BZB A;  5LMN B;  3H9V A;  3CP1 A;  4LF6 B;  2QWR B;  2RMK B;  1PPJ H;  3T1H O;  4FLV A;  3I56 V;  2A06 H;  2BTQ A;  3FKS G;  4UVC A;  1MZE A;  2QWP B;  4K35 A;  2CGN A;  3ZIA G;  2YSU B;  5JQG A;  1SA0 A;  2RJZ A;  1XEQ A;  2QTS A;  1G6U A;  3TGU H;  3RW0 A;  4WF9 V;  4LF4 B;  1SES A;  4I55 A;  2D3O W;  2JRI A;  3SYP A;  1K7D A;  4EFE A;  4JI7 B;  3ZMZ A;  5KA5 A;  3PN1 A;  1AI5 A;  1Q5O A;  4D7S A;  1KQS U;  4X88 A;  3RVZ A;  1RFY A;  1GN2 A;  2DMX A;  4UCU A;  2DW4 A;  3ABM C;  2Q4P A;  3T4D A;  1D5N A;  1KD1 W;  1N34 B;  2R70 A;  4DR4 B;  1ORQ C;  4FJC C;  1YTF D;  4J10 A;  3H1J H;  3BHP A;  2VQE B;  2JEX A;  4CH5 A;  4WFH A;  4ZI7 A;  4B3S O;  2VQF B;  1NTK H;  2HHH O;  1H2G A;  3L71 H;  4JZ2 A;  5GTH Z;  1EM1 A;  4HAM A;  3AK2 A;  5CA1 B;  5CA3 A;  1FJG O;  4GX5 A;  4RAI A;  1GRJ A;  5A9G A;  3D36 C;  2WWW A;  2XOK G;  3ASN B;  5LP6 A;  3A8T A;  1GMG A;  4BWA A;  4DV5 O;  2QKC A;  2UXB B;  4ZHQ A;  1P7B A;  3BY6 A;  4B7E A;  4JI4 O;  4CC5 A;  4LF7 O;  3RYH A;  2EIN B;  1OCC B;  3ZRX A;  4HZ3 A;  1VQ4 V;  4HNA B;  1WB7 A;  1QR9 A;  3ABL B;  4FFB B;  1IXB A;  4DV1 B;  2OCC B;  5KMG B;  1NVP D;  1XQ8 A;  2N05 A;  1JFF B;  3CCL V;  3NR7 A;  1KMI Z;  2KB1 A;  1KYO F;  2BSK A;  3K08 A;  1H8E G;  5B66 Z;  1IBK B;  1G8M A;  1N0J A;  3K04 A;  2YEV B;  1KU9 A;  5B3S B;  1Y76 A;  3KKY A;  3FFQ A;  3FAV B;  3CD6 V;  3U10 A;  3OE7 G;  5LXT A;  4X1Y A;  4O4J A;  2Y0P A;  1PL4 A;  1X59 A;  2UXN A;  4K0K O;  4N23 A;  1DK1 A;  5LHI A;  2IH1 C;  5GW7 A;  3HKB A;  1M57 B;  1S76 D;  3G80 A;  1VEW A;  1PP9 H;  5IYC O;  2ODM A;  4JTA B;  5EIB C;  2PF4 E;  1I08 A;  3O9O A;  2DWD C;  2QGN A;  4FLU A;  5IT9 N;  1US6 A;  4MTF A;  3RYC B;  4JAS A;  2Z3Y A;  1P4R A;  4U7N A;  4H33 A;  3TCU A;  2JJ2 G;  2IJH A;  5JVD A;  4I0X B;  4JI0 O;  3CCS V;  3FB8 C;  2K1E A;  3ZRV A;  1NR1 A;  5EZY A;  4FFK A;  1PM9 A;  3VQY A;  1N8R W;  1K8A W;  2CK3 G;  5EBM C;  4K8Z A;  4MVM A;  2WAM A;  2HG5 C;  4J7Z A;  1WNS A;  1W0J G;  3GVM A;  2X6A A;  1WA8 A;  4J41 A;  5KHG A;  1M1K W;  4X89 A;  1VQ9 V;  3ASO C;  5H6Q A;  1GTO A;  4TWK A;  4MSW C;  1JCH A;  2P6J A;  1B6Q A;  2LFS A;  2K9P A;  4ZOL A;  2XHB A;  2ADQ B;  3M99 B;  3BFR A;  4JV5 B;  5IYB O;  4JTC B;  5KHH A;  3THO A;  4DR7 O;  1ZUQ A;  4BAY A;  3VOU A;  2H8P C;  1L8D A;  3JAW B;  4O2A A;  1F4M A;  4RQE A;  4DRX A;  2EUL A;  1NS1 A;  1BQ0 A;  1NH2 D;  3JAS B;  1WPX A;  2IJJ A;  2UUA B;  5J2U A;  4X66 O;  3UM7 A;  2GUZ A;  4NTY A;  1YJW V;  4DR6 B;  4G27 B;  2G38 A;  2Q67 A;  5IJ0 B;  1BT8 A;  3HKE A;  3SJC C;  3VQV A;  2HFE C;  5LYJ A;  4B3M B;  3SDL A;  4U7O A;  3WB2 A;  3LDE A;  1K3E A;  4P2Z A;  5FPO A;  3B09 A;  4UCR A;  5B5E Z;  2F95 B;  4EKW A;  2IU3 A;  1GM7 A;  5LMU B;  2Q68 A;  3B2E E;  2UU9 B;  2XAS A;  3DC6 A;  4YJ2 B;  2A0L A;  1OCZ C;  3APO A;  4DR2 O;  1FYJ A;  4YY3 O;  1E1Q G;  3CJH B;  3AG4 B;  2DN9 A;  1ROP A;  1SC5 B;  1YTF B;  2ZE5 A;  2QM8 A;  3JAL A;  3S3X A;  4B3R O;  1HWY A;  4R50 A;  4LNU B;  1I94 B;  3EXA A;  2IJK A;  1AP5 A;  1H2L A;  1E1R G;  3SYO A;  3RYI B;  3JAK B;  3R66 A;  2ZNI A;  4PI2 A;  2V7Q G;  1F23 A;  4PHZ A;  3G6E V;  1DTO A;  3G67 A;  4GX0 A;  1S0V A;  1URF A;  1W0K G;  5KHJ A;  1QLN A;  4NXM O;  2JGD A;  2XT9 A;  1B04 A;  4LF5 B;  2QKS A;  4RUF A;  1TUB A;  3WG7 B;  4CS4 A;  3U0Z A;  3J80 N;  2BTQ B;  3F7V C;  4DV2 B;  4Z2W A;  5L3E A;  1NVP B;  4FM1 A;  4DV4 O;  1YJ9 V;  4LF9 O;  1SA0 B;  1S3J A;  2UUC O;  4LBE C;  5DEC A;  3B8N A;  4I55 B;  1JMK C;  5HFL A;  1O9G A;  4AI8 A;  4DK1 A;  4JYB A;  5JWP A;  3K59 A;  2H3O A;  1EN5 A;  1HNZ B;  4PA7 A;  4F4L A;  2Q8V A;  4JYC A;  1OCO C;  3K79 A;  1WLE A;  2A3Q A;  3K57 A;  1FKA O;  4PDM A;  2CUG A;  3AG3 C;  2RN9 A;  3BA8 A;  4PA3 A;  3CHX A;  4X1I A;  1I0H A;  2JJ1 G;  4KUM A;  1Q6I A;  2ZXW C;  1I5Y A;  3EVK A;  4ABM A;  5LGN A;  4FLZ A;  1SQV H;  4HBN A;  1SZX A;  1FAF A;  5J9P C;  3CS5 A;  4ZI7 B;  5BR8 O;  4OX9 B;  3GWK C;  4R7C A;  3ETG A;  4I5S A;  2D2C B;  3UO3 A;  3D3I A;  1L0L H;  1XBL A;  4LWS B;  2DOS A;  2R9R B;  1HNX O;  3OR6 C;  4DV3 B;  1IBM O;  2XUM A;  1FFX A;  1SKV A;  2JS3 A;  4AQY B;  5LP6 B;  1FD9 A;  5CA0 A;  2GV9 A;  4X62 B;  2EZP A;  3JCZ A;  1ZSP A;  3ICX A;  2LJ2 A;  4ZHQ B;  5B1B C;  2YDE A;  3G4S V;  1JJ2 U;  3RYH B;  3CCQ V;  1RPR A;  1YZB A;  3OTO O;  1IUR A;  3A0B Z;  4TV9 A;  3M7M X;  4O2B A;  3I55 V;  4MW8 A;  1N36 O;  4RWU A;  1H2K A;  3ZRW A;  2Y69 B;  4NTX A;  3SYQ A;  4JYA B;  4I9Q A;  4FLX A;  2Y0I A;  2ZNJ A;  4MVQ A;  1Q43 A;  2BSK B;  4GKK B;  3T1Y B;  2YXL A;  4JAV A;  1J5E O;  2XAJ A;  4B08 A;  5CB4 A;  2CTP A;  4DYL A;  1RP3 B;  1Y76 B;  5E1A C;  4WFG A;  5GON A;  4DW1 A;  1N33 B;  1O9H A;  1OHH G;  5LXT B;  4X1Y B;  1V54 B;  4O4J B;  4FIP C;  3F5T A;  2ZDI C;  1NH2 B;  2VS0 A;  3HKB B;  3ZMV A;  4LF8 B;  1VF6 A;  1J95 A;  3WB1 A;  2EIK B;  2UUA O;  3X2Q B;  5DM6 V;  3IC9 A;  1XNR B;  4MW3 A;  4UCS A;  4GX2 A;  1FXV A;  5JVD B;  2AXT Z;  2P4V A;  2IBZ H;  4JI3 O;  1RSO B;  3BAA A;  1R6T A;  3JAM N;  1PL0 A;  2ZR2 A;  5KAF Z;  3OGC C;  1XMQ O;  4KP4 A;  1HNW B;  1Q8I A;  3M8A A;  4DV7 B;  4UCT A;  4EEQ A;  1S5J A;  4XDK A;  2OIG A;  3SYC A;  4JI5 B;  3J7A U;  2EIJ B;  1WA8 B;  1DGS A;  1XUQ A;  3P3P A;  2QSA A;  2X6C A;  3L73 H;  3OR7 C;  5IYZ A;  4I9W A;  3E83 A;  2EJ7 A;  2KKW A;  2ZM6 O;  4MVO A;  3AG4 C;  4DV0 B;  4ZOL B;  3K3W A;  3STL C;  4DR5 B;  5KAI Z;  1MA1 A;  4DUZ B;  2BCC H;  4CS3 A;  5JJJ B;  2NNU A;  3L9D A;  3E8G A;  4O2A B;  3OGI B;  1BL8 A;  4DRX B;  1BMF G;  1VF5 B;  3HKC B;  1XNQ O;  3KCX A;  4WFE A;  1JA8 A;  1YCI A;  3D36 A;  3DXR A;  4LH6 A;  4JI1 B;  3SPC A;  2IH3 C;  4CH4 A;  2EZO A;  3OM3 B;  4OPA A;  3DTU B;  1YI2 V;  3LDC A;  3JYC A;  5KX5 B;  5B1A B;  4MS2 A;  2P7T C;  3ZN0 A;  2PGG A;  2QWN B;  5GTI Z;  3GB7 C;  1OCR C;  2LGW A;  3HKE B;  2UXC O;  2EJR A;  4GKJ O;  4LR3 A;  5LYJ B;  4B7K A;  4E4E A;  1XOU A;  4WBN A;  3P3N A;  3W7U A;  2YUA A;  4N21 A;  5KA6 A;  1CEZ A;  5L3B A;  3SR2 C;  5LGU A;  3H1I H;  3MD0 A;  3MAQ A;  2ZE7 A;  4ZBM A;  1ZL8 A;  3RYF A;  3WU2 Z;  4LCU C;  4J42 A;  2YI8 A;  4TV8 A;  2HJD A;  1B06 A;  4LFA B;  3S3W A;  2P22 C;  4FLW A;  3QO5 A;  1Y74 A;  3B4S A;  5IY5 B;  4JI6 O;  3CC2 V;  2UXD B;  4TQD A;  2LO1 A;  3CE2 A;  1UJW B;  1G1X B;  1JVM A;  2LP7 A;  4FZ0 A;  3JAL B;  3H1L H;  1IDS A;  3ZHV A;  4YHH O;  3ZHQ A;  4LFB B;  2KG7 A;  4EB6 A;  3PJS K;  1ZTE A;  3JSN A;  4PEL A;  4FK5 C;  1PV0 A;  3T1C A;  3JD1 A;  1GN4 A;  4UB6 Z;  3E89 A;  3EHB B;  1H38 A;  4QGP A;  3VQW A;  3ETQ A;  4Z1V A;  5C8Y A;  4PA6 A;  5IWA B;  5FLX N;  4JTD B;  3HR0 A;  4KHP O;  2YI9 A;  3K0G A;  3G6B A;  3H1H H;  2QKA A;  4DR3 B;  2EIL B;  4LFC O;  2JGD B;  1M56 B;  1IZ3 A;  2WLL A;  3OD4 A;  1Y66 A;  1PNK A;  4OPH A;  3LUT B;  4IIJ A;  1TUB B;  2JDI G;  4BIU A;  5BMV A;  3ABK C;  1XMO B;  4GUN A;  2UUB O;  2E75 B;  1EN6 A;  1JOY A;  3CPW U;  2E5L B;  2FKX A;  3SJQ C;  1NQT A;  1TVK B;  2YS8 A;  2IM9 A;  5K1P A;  1BQZ A;  2ZT9 B;  4FVM A;  1P49 A;  2W0X A;  2ZD9 A;  1W2B U;  4G2K A;  2RDC A;  4U3J A;  1VQ7 V;  1HR0 O;  3QVN A;  2FB5 A;  1AB3 A;  1QNM A;  4NKG B;  1TAE A;  5BY1 A;  2F4V B;  2BOC C;  1N32 B;  2FML A;  5HFM A;  4DUY O;  5KLV H;  4O4I A;  1YF2 A;  3JAR A;  1DLB A;  3D8C A;  4UV9 A;  4UB8 Z;  3OUS A;  2LFR A;  1EN4 A;  4IGG A;  3CRQ A;  4X1I B;  1R6N A;  5JH7 A;  1KB9 F;  3ETD A;  2DWE C;  1EBO A;  3B8M A;  4O4H A;  4DV6 O;  4X64 O;  1LNQ A;  1WP8 A;  1IVS A;  3AG1 B;  1DF4 A;  2QM4 A;  4B3T B;  3HKD A;  4IHJ A;  1KP3 A;  3LDD A;  5BXZ A;  1EFR G;  1V55 C;  2R9A A;  5ITZ A;  1XHZ A;  5EIB D;  2WLJ A;  3QO8 A;  3IAY A;  3E22 A;  2YIC A;  1Q6U A;  3CRC A;  3UT5 A;  3FB6 C;  5B1N A;  3ETE A;  1IBL B;  4NYK A;  2DQ0 A;  2ZE8 A;  1V9P A;  1JPX A;  4ICG A;  1FFX B;  3STZ C;  5CA0 B;  1XDC A;  1NT2 B;  3CCU V;  3LSS A;  3FYI B;  2DYS B;  4TSF G;  1YIJ V;  1VQL V;  4O4L B;  1SQF A;  1CXZ B;  4TV9 B;  4AHC A;  1FXK C;  2QM7 A;  4G28 B;  2ITD C;  4JAU A;  4O2B B;  1NKD A;  1SF9 A;  2YID A;  5EK0 A;  4DXW A;  3AG2 B;  1YXB A;  5LMN O;  2EIJ C;  4LF6 O;  2B1G A;  3IJ4 A;  3RBZ A;  4QE7 A;  1RM1 B;  5KHI A;  2W6I G;  4D6T H;  2P5O A;  4JI8 B;  5GON B;  2Q6A A;  1PNM A;  3BCC H;  1GO3 F;  4BW9 A;  4DR5 O;  1AI7 A;  2WLN A;  4DUZ O;  1LR1 A;  4A5U B;  4LF4 O;  4GX1 A;  4DK0 A;  1AJP A;  5LGT A;  3BPZ A;  4RO2 A;  4JI7 O;  3OMN B;  4KXR A;  1PKX A;  5H5N A;  1VP7 A;  1QU7 A;  4NXN B;  3DGE A;  1GAX A;  3FB7 C;  1LUW A;  1N0N A;  2JGU A;  2X6B A;  4DR1 B;  1AIL A;  1N34 O;  4DR4 O;  1TGO A;  3CB2 A;  3T1H B;  1AI4 A;  1ZX3 A;  2VQE O;  3N2K A;  1ZAU A;  2GTA A;  1M4U A;  3JCU Z;  2VQF O;  1KEC A;  4KFM A;  3FX7 A;  4X8A A;  3KCY A;  5LHH A;  1YSC A;  3ZHS A;  3TK1 A;  1HW7 A;  2CTR A;  4MVS A;  1Q82 W;  5L3G A;  3VBB A;  1OJH A;  3QF7 A;  1LUV A;  3OFN G;  4PD4 F;  2ZCE A;  3ABM B;  2UXB O;  3AK1 A;  3ASN C;  3H01 A;  5IYZ B;  2WLI A;  3L75 H;  2QR4 A;  5IY5 C;  4JZG A;  5K1X A;  4I7Z B;  3K5N A;  3FAV A;  5JQG B;  1Y6X A;  2EIN C;  1OCC C;  4JI2 B;  5E79 Z;  4DV1 O;  3CX5 F;  4Q20 A;  4W4L A;  2QA4 V;  3ABL C;  4X1K A;  4B3S B;  1NU1 H;  2OCC C;  4DO2 A;  3H1K H;  1R3L C;  2HHH B;  2VWK A;  4ZKI A;  2Y48 A;  2PY5 A;  2EX3 A;  1FJG B;  3RYC A;  4R6Z A;  1IBK O;  1ZLZ A;  3AK3 A;  1PNL A;  3ZCC A;  3P32 A;  1K33 A;  5JCO C;  4DV5 B;  3IC7 A;  5B3S C;  4UFZ A;  1QVF U;  4MTG A;  4ASU G;  3OW2 U;  4X65 B;  2B1I A;  2B5U A;  3W7S A;  4LF7 B;  4D7T A;  3B77 A;  4QJF B;  5FPR A;  2A9H A;  1K92 A;  1R73 A;  4L87 A;  4WBN B;  4OXS A;  1VQN V;  4FLY A;  4UV8 A;  1M57 C;  4UVA A;  1YHQ V;  1KBH A;  3O65 A;  5LL6 Y;  1G4Y B;  1Z5V A;  2DE0 X;  2CTQ A;  3L72 H;  4TV8 B;  4CS2 A;  1CP9 A;  1Y74 B;  1K9M W;  3BA9 A;  2EIM B;  3SJB C;  4IL6 Z;  4H13 B;  1Z2G A;  1M90 W;  2CH7 A;  2ZDI A;  2GSM B;  3RGB A;  2ZIO A;  4R8C A;  5D5Q A;  3VQX A;  5A2Q N;  3TET A;  1MAB G;  1VMG A;  3CC4 V;  4K0K B;  3R65 A;  1SS3 A;  4EB6 B;  3JAW A;  3RFR A;  2RCV A;  1D5A A;  2F1M A;  5H6R A;  1NTM H;  3K5M A;  2DJV A;  2LGQ A;  2N74 A;  1H2M A;  1NZ6 A;  3BAB A;  4PV1 B;  2GBO A;  1Q90 D;  3AEI A;  5C8Y B;  4YXW G;  1VQK V;  1XL6 A;  4PA9 A;  3BEH A;  2ETN A;  2JEU A;  4OGQ B;  2WLK A;  4JV5 O;  1AVM A;  5IJ0 A;  5LOV A;  2CE4 A;  4JI0 B;  4Z1M G;  2P90 A;  3JAT A;  1BSM A;  4IIJ B;  2LW1 A;  1VQP V;  5BMV B;  1B3Q A;  3AG7 A;  1WP7 A;  3FB5 C;  2HP8 A;  1WJZ A;  3KZI Z;  3TXS A;  3BRC A;  5TIS Z;  5IJ9 A;  3W7X A;  2LQT A;  2F93 B;  3UKM A;  3E8F A;  2PZS A;  1XHX A;  4E2L A;  2PYJ A;  1SER A;  1Y67 A;  2AHZ A;  3ASO B;  3IFX A;  4DR6 O;  2KQX A;  4U3J B;  3CJH A;  1VQO V;  1COW G;  1H2N A;  2A79 B;  4B3M O;  3JSL A;  1H8H G;  5EZY B;  4F6R A;  3T2M A;  3JAR B;  2OCH A;  1VQ8 V;  1A32 A;  1JR9 A;  1VIB A;  1Q3E A;  4QIW F;  5JH7 B;  2V1D A;  2AZ0 A;  3UO2 A;  3UCS C;  4DR7 B;  2ZIN A;  4WFF A;  5DN6 G;  2ZR3 A;  5LMU O;  5J2T A;  2UU9 O;  2A7W A;  1BS3 A;  5CBF A;  2PUS A;  4O4H B;  4X20 A;  5F2V O;  1GH6 A;  4QPJ A;  3RYI A;  3JAK A;  3SJA C;  5B1O A;  5LBQ A;  3K0D A;  4I50 A;  1M9N A;  4IHJ B;  5L3C A;  1OZ0 A;  5ITZ B;  4CBC A;  3WB0 A;  4X66 B;  4W4K A;  3E22 B;  4RUE A;  2FL4 A;  3E86 A;  3UT5 B;  4CC6 A;  2WA3 A;  2OIE A;  1QBZ A;  1BCC H;  4DR1 O;  4YJ3 A;  1NR7 A;  3CSX A;  2OTL V;  3F5W C;  2X7R B;  1I94 O;  2VRZ A;  2HKO A;  3K58 A;  1K5Q A;  3SPG A;  5AG2 A;  1QVG U;  4J11 A;  3ZX6 A;  4JPR A;  3B40 A;  5J2U B;  4UVB A;  2HR3 A;  3Q4H A;  4PJ0 Z;  1OCZ B;  2GUZ B;  2JK5 C;  3JD0 A;  3APQ A;  2HJF C;  1NBM G;  3OUF A;  1Y4M A;  3N2G A;  4MVZ A;  4WFA V;  4Q6G A;  4DR2 B;  1WAZ A;  4YY3 B;  1YIT V;  1VQ5 V;  4FZ1 A;  4LF5 O;  5FNV A;  1NTZ H;  5L3D A;  3ML0 A;  5EBL C;  2M7W A;  3DSQ A;  3OEE G;  4XBF A;  2P06 A;  4B3R B;  3SYA A;  2Q7H A;  3WG7 C;  4DV2 O;  4JGS A;  3ZHR A;  3JD2 A;  3SPH A;  2Q0A A;  2OT5 A;  2RQ6 A;  5JJN B;  4HYO A;  2WLH A;  4JI2 O;  4GLX A;  3K9S A;  4H0L B;  3ZMT A;  1Z5W A;  1FXH A;  2QE7 G;  1SQB H;  2ZQM A;  1X4T A;  2W6J G;  4J9Y B;  1Q6H A;  1HNZ O;  4U3F H;  2UXX A;  1YVW A;  2ZKO A;  4BIO A;  4LWS A;  5D5P A;  5KUK A;  4I4T A;  4NXM B;  2PTM A;  2L35 A;  4J9Z B;  2QWO B;  1SET A;  3GWO A;  1Q81 W;  2AW9 A;  4X65 O;  4TUY A;  1BE3 H;  4C7U A;  5LA6 A;  4F6E A;  2EBO A;  1VQ6 V;  4QE9 A;  1RPO A;  3BVO A;  4FMT A;  4CH6 A;  3N2K B;  2ILM A;  4H44 B;  3ZED A;  1AP6 A;  4DV4 B;  4OX9 O;  4LF9 B;  4FM0 A;  4FM2 A;  4MT8 A;  4QNH B;  1KC8 W;  2L6L A;  2UUC B;  3ZS8 C;  1JQ0 A;  3D3Q A;  1OCO B;  3ZHU A;  3K5O A;  4DV3 O;  1P7G A;  2N04 A;  4AQY O;  3AG3 B;  4P9O A;  4X62 O;  2XAF A;  3RT3 C;  1OV9 A;  1YJN V;  5LP6 C;  3L70 H;  2ZXW B;  3ZJZ A;  5EYP A;  2WLI B;  4FLT A;  1QQC A;  1QHT A;  2AZ2 A;  4H37 A;  2WSS G;  3CRA A;  1BHA A;  2EIM C;  2XAQ A;  4TT3 G;  3ZMU A;  3OEH G;  2H94 A;  2AHY A;  1GKF A;  2AGA A;  1XRE A;  2W0F C;  2E76 B;  1K4D C;  3KG2 A;  1AJQ A;  5KUM A;  2MW2 B;  4X1K B;  2F43 G;  2F23 A;  1MG1 A;  5BR8 B;  2OYQ A;  4JYA O;  2DYR B;  3U11 A;  4CZZ A;  2Y69 C;  4P30 A;  1SZT A;  2VWJ A;  3CCJ V;  4GKK O;  3T1Y O;  3MHH C;  3CRM A;  1KKD A;  1HNX B;  1IBM B;  1SQQ H;  3ABT A;  3CCE V;  5B1B B;  1AR1 B;  4MTX A;  1N33 O;  3RN4 A;  2Q69 A;  3SPI A;  2WLM A;  1NJI W;  4GYC B;  3L74 H;  4IT5 A;  3HB3 B;  3CYO A;  2MK3 A;  1RSO A;  3FYE B;  1S77 D;  1V54 C;  1FXK A;  2JIZ G;  3RVY A;  3OTO B;  4NTW A;  4LF8 O;  5IDJ A;  1GM9 A;  2IJI A;  1N36 B;  2NN4 A;  3OMA B;  1F51 A;  2EIK C;  3I5D A;  3E35 A;  1M93 A;  1WB8 A;  1VAR A;  1XNR O;  1EZJ A;  2Q7E A;  3TJT A;  3X2Q C;  1J5E B;  2RNB A;  4NR1 A;  4CH3 A;  4NB5 A;  1UPG A;  2ZIM A;  2E3C A;  3JD4 A;  3QNE A;  4LC1 A;  2HEP A;  2CH7 B;  2V4D A;  2QDO A;  4PDL A;  4JF3 A;  1QLE B;  1K97 A;  1HNW O;  1F4N A;  4PDV A;  2NLJ C;  4DV7 O;  4YIP A;  4IYI A;  1MOF A;  3ZRW B;  3RWR D;  3G71 V;  3DC5 A;  4JI5 O;  3HKC A;  2C2A A;  1MZF A;  1KKC A;  2HVK C;  1XIL A;  2ADP A;  1TUE B;  3SGI A;  2Q73 A;  2R72 A;  4UCO A;  1R6K A;  5KX5 A;  5CB4 B;  2Z0A A;  1S5L Z;  4KL1 A;  4DV0 O;  2OWO A;  4MTO A;  4XDJ A;  4MVR A;  1GK9 A;  4K3A A;  2GHY A;  4UCV A;  1PD3 A;  5LOV B;  1D2D A;  3CC7 V;  4JI3 B;  3JAT B;  1HP8 A;  5LHG A;  1KUQ A;  2PI4 A;  3OAA G;  5DED A;  1SQP H;  1XMQ B;  1M5I A;  1WN7 A;  2GTS A;  5CA1 A;  1S72 V;  3K5L A;  5IJ9 B;  3E2E A;  3A2F A;  2HLD G;  4JI1 O;  3LSU A;  2BTO A;  1R3I C;  3ABU A;  2CAZ C;  1GN6 A;  3ZHT A;  3W7T A;  1VF7 A;  5B1A C;  5L3F A;  1MMM A;  3QTC A;  1P84 F;  1HDJ A;  2ZM6 B;  4ZIB A;  4HNA A;  1AR4 A;  3LNM B;  4EFB A;  4JYY A;  1TA8 A;  4F6R B;  4FFB A;  3CMA V;  4X9Q A;  1AR5 A;  2XAH A;  4GZR B;  4PDR A;  2CGO A;  3C90 A;  5KMG A;  1MSW D;  5J2T B;  1JFF A;  4X20 B;  3ZRS A;  5CBG A;  4FPP A;  1S5H C;  3N27 A;  1H2S B;  1XNQ B;  1QCE A;  4LFA O;  5EBW C;  4I50 B;  2JS5 A;  5JCO A;  2UXD O;  2Z5U A;  3OMI B;  2YEV A;  1W59 A;  3F7Y C;  5CBH A;  1OCR B;  4TQF A;  2F66 C;  1WPB A;  2QWQ B;  3A0R A;  1L0N H;  4YIO A;  2P67 A;  2QEX V;  2UXC B;  4YJ3 B;  4GKJ B;  1L1F A;  4LFB O;  2GDS A;  2YC0 A;  3CWB H;  1I5X A;  3TXQ A;  2OTJ V;  2IW5 A;  1MSD A;  2XAG A;  3K9A A;  4TOI A;  2Q7G A;  1JX9 A;  1TVK A;  3CCR V;  3MHS C;  3DXR B;  3JD3 A;  3FD9 A;  5IWA O;  2BE3 A;  3SPJ A;  5IYD O;  1XI1 A;  3Q4H B;  4J7J A;  2E74 B;  1XL4 A;  2XTA A;  4DR3 O;  1DF5 A;  2ITC C;  4GCZ A;  1U97 A;  2WPD G;  4MVU A;  1BHB A;  3LNN A;  4JI6 B;  4I0X A;  3N2G B;  3OT7 A;  3OTF A;  1IXM A;  1ARO P;  5FNV B;  2EIL C;  4JI4 B;  1M56 C;  3QG5 A;  2Y4U A;  3QO7 A;  5EC1 C;  1XMO O;  2FTK A;  1R3J C;  4YHH B;  2E5L O;  1R1B A;  2X0L A;  1KP2 A;  1BZK A;  3CME V;  2ARH A;  2YIB A;  1ZL8 B;  3RYF B;  3ZBH A;  3HPL C;  1AJN A;  1N4C A;  1SQG A;  1R3K C;  1EZV H;  5FL7 G;  3CCM V;  2O57 A;  2YIA A;  2Q9L A;  2F4V O;  2R9I A;  4KHP B;  1N32 O;  1FFT B;  2ATK C;  2DYR C;  2DQ3 A;  2WA4 A;  5C93 A;  3ZN1 A;  4I4T B;  1IX9 A;  4LFC B;  4UXN A;  1Q86 W;  1UFI A;  3T4Z A;  3ABK B;  4PA4 A;  3CXC U;  1QR8 A;  1GM8 A;  2KG7 B;  1JJO A;  3EFF K;  4TUY B;  1K5S A;  5LA6 B;  2ZE6 A;  4JAA A;  2UUB B;  5KHK A;  3NXS A;  2M6Y A;  3LSQ A;  1ENV A;  4B3T O;  3JAS A;  3AG1 C;  4J80 A;  2NR5 A;  1FS0 G;  2KSD A;  4O4L A;  3J81 N;  4XDL A;  1CPY A;  4RQF A; 
#chains in the Genus database with same CATH homology
 1HNX O;  1IBM O;  3R66 A;  5H5N A;  1XMQ O;  1IBL O;  4JI6 O;  2Z0A A;  3M8A A;  1XEQ A;  4DV0 O;  4X64 O;  4DV6 O;  4DV2 O;  4DR7 O;  1G1X B;  4JYA O;  4DR6 O;  5IWA O;  3J7A U;  1D2D A;  1AIL A;  4NXM O;  1N34 O;  5BXZ A;  4DR4 O;  4YHH O;  4JI2 O;  3T1Y O;  4GKK O;  2JRI A;  1NS1 A;  4B3M O;  1F7Y A;  1YZB A;  3OTO O;  1KUQ A;  4DR3 O;  3O65 A;  5LL6 Y;  2VQE O;  1N36 O;  1A32 A;  1N33 O;  4X66 O;  1X59 A;  2ZM6 O;  2VQF O;  4K0K O;  1DK1 A;  1HNZ O;  3J80 N;  4JI1 O;  2ZKO A;  1XMO O;  5LMU O;  5FLX N;  4DV4 O;  2UU9 O;  4LF9 O;  2E5L O;  1R1B A;  1J5E O;  2UUC O;  4KHP O;  4LFB O;  3SDL A;  5IT9 N;  4LF8 O;  5A2Q N;  4LFC O;  4X65 O;  1XNQ O;  2UXB O;  4B3S O;  4OPH A;  2HHH O;  4JI8 O;  3F5T A;  1XNR O;  2DJV A;  4JI0 O;  4OPA A;  1FKA O;  4OX9 O;  2N74 A;  4DR1 O;  2UUB O;  2F4V O;  1FJG O;  1N32 O;  1I94 O;  2FKX A;  5LMN O;  4DV1 O;  4LF6 O;  4DR2 O;  2LW7 A;  4YY3 O;  2UXC O;  4DV5 O;  1FYJ A;  4GKJ O;  2UUA O;  4LFA O;  4DV3 O;  4AQY O;  2UXD O;  4JV5 O;  4JI4 O;  4NXN O;  4LF7 O;  4X62 O;  1HNW O;  1HR0 O;  3RT3 C;  5BR8 O;  4DV7 O;  4B3R O;  1AB3 A;  4DR5 O;  5BY1 A;  4DUZ O;  4A5U B;  4LF4 O;  1IBK O;  4DUY O;  4B3T O;  4JI5 O;  4JI3 O;  3J81 N;  3T1H O;  4LF5 O;  1R6T A;  3JAM N;  2DOS A;  4JI7 O;  2AGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...