5EC1C

Kcsa with v76ester mutation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
total genus 39
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ec1C00
2WLKA 4HZ3A 4MTOA 1G4YB 4H37A 2Q67A 5EBWC 4DXWA 4JTDB 4GX0A 4X8AA 5EBLC 4UUJC 2JK5C 4LP8A 3VOUA 3ZRSA 3SJQC 2EIJC 5EC1C 3FB6C 5BZBA 2ZD9A 4CBCA 3T1CA 4MS2A 5B1AC 4MVUA 2ITCC 3SYOA 1QLEC 1S5HC 4LCUC 4H33A 4MVOA 2KB1A 4R50A 3RBZA 4MW8A 4BW5A 2WLNA 1LNQA 2H8PC 3SPHA 3E89A 3F7YC 3E8GA 4XDLA 4MTGA 2WLJA 2IH1C 3EFFK 4J9YB 3AG2C 3OGCC 4R8CA 2HFEC 3SPIA 4GX5A 4RO2A 4QNHB 3LDEA 4JTCB 4OXSA 4G28B 4ZBMA 4RUEA 5CBFA 3FB8C 4WFHA 5KUMA 3AG1C 3BEHA 3F7VC 2A9HA 3SYPA 4PA7A 2HJFC 3JYCA 2Q6AA 3ABKC 3K06A 3ZJZA 2EINC 2Y69C 2DWEC 2WLIA 4P2ZA 4PDVA 4MVMA 4X88A 2QTOA 3KG2A 3F5WC 4QE9A 3AG3C 4MVSA 4F4LA 2EIKC 3TCUA 4LBEC 2WLHA 4P30A 3UKMA 4PA3A 1P7BA 3SPCA 2HVKC 4HYOA 1OCCC 2DYRC 4MW3A 4R7CA 4WFFA 2W0FC 2HVJC 2Q68A 4XDKA 2A79B 4TWKA 3K04A 4MVRA 5EBMC 1K4CC 3K0DA 2BOBC 5CBGA 3E83A 2EILC 4GX2A 5E1AC 4RAIA 1M57C 3OUFA 4WFEA 1R3KC 5IY5C 5KUKA 4I9WA 4G27B 4PDLA 3IGAC 4MVZA 3SYAA 1ZWIC 2DYSC 3OUSA 3RVZA 2HG5C 4GX1A 3X2QC 3E8BA 4XDJA 4PA4A 3T2MA 3E86A 4R6ZA 2WLLA 1BL8A 4J9ZB 3R65A 1M56C 3T4DA 3SPGA 4WFGA 4PDMA 2X6BA 3TETA 2QKSA 1OCZC 1K4DC 2AHYA 2DWDC 3OR6C 4PA6A 4P9OA 2WLIB 3SYQA 3LUTB 5EK0A 5EC2C 2NLJC 4RUFA 2K1EA 3E8FA 2Q69A 3T4ZA 2ITDC 3HPLC 3K03A 1XL4A 3STLC 2WLMA 1R3JC 5B1BC 2BOCC 4QE7A 3ASNC 3UM7A 3ASOC 3PJSK 4KFMA 4PDRA 2IH3C 3K0GA 1KKDA 1R3IC 1V55C 4MSWC 1R3LC 3ABMC 1J95A 3AG4C 4MTFA 5B3SC 1V54C 4PA9A 1ORQC 2EIMC 2P7TC 2ZXWC 5CBHA 1XL6A 4JTAB 1JVMA 3SYCA 2AHZA 3IFXA 3K08A 3LNMB 4P9PA 4EKWA 3FB7C 2ATKC 3RW0A 3SPJA 3ABLC 3RVYA 2YEVA 3OR7C 3FB5C 2R9RB 2X6CA 3LDCA 1OCOC 2X6AA 3STZC 2OCCC 3E8HA 1OCRC 4X89A 3LDDA 3WG7C 4MVQA 5J9PC 2A0LA 3GB7C 2WLLB
chains in the Genus database with same CATH superfamily
4O4LB 3CX5F 2RNBA 4WBNB 1G4YB 4O4IA 1IX9A 4DXWA 1HDJA 2R70A 3N2GB 4ABMA 4UUJC 1FJGB 1JA8A 1K5QA 4F6RA 5CB4A 1XNRO 2ODMA 1SZXA 3RBZA 1CEZA 4O4HA 1GN2A 2G38A 2A7WA 1SERA 3E89A 2YXHA 1AI4A 1SQFA 2HEPA 4X1KB 2PYLA 1R6NA 2ADPA 4NXNO 1YCIA 3GVMA 5L3FA 4QE9A 3W7TA 3OTFA 2Q0AA 1AR1B 1N0JA 4MTXA 1P7BA 2XAQA 3ZN0A 4BW9A 4GKKO 2ARHA 3OT7A 4JI3O 4FLXA 3OUSA 3ZRWB 4U3FH 4PA4A 2VQFO 2PGGA 3J81N 3GWKC 3K3WA 4DUYO 1SQVH 1QR9A 3P32A 4DRXB 2DWDC 1KB9F 2Q9LA 1DLBA 5LP6A 1QCEA 2Q7EA 3ASOB 5C93A 3BCCH 2VQEO 1YSCA 1FKAO 2ITDC 4IYHA 2WLMA 5LGUA 2A3QA 3ASNC 1JR9A 4JI0B 1V55C 1R3LC 4CC6A 4O4IB 3CMAV 4CH3A 3OAAG 4PA9A 1Y4MA 2JDIG 4JI1B 3DC6A 5IYZA 4DV1O 2UXBO 1PPJH 1GK9A 3SDLA 3C90A 1YZBA 3JD1A 4EKWA 5EIBC 4LFAB 3WG7B 3FB5C 3JD2A 2DOSA 1R1BA 2F95B 1NVPD 5IE9A 1LUVA 4L87A 1NU1H 4Z1MG 4X64B 5KLVH 2A0LA 3JAKA 3ABTA 2XAGA 2XTAA 1GMGA 5B1AB 2F66C 1JX9A 3SJQC 4LF6B 2ZR3A 4HNAA 1R6TA 4CBCA 5LP6C 2CGOA 5B1OA 1XOUA 4JI8B 4QIWF 1L1FA 3B77A 1VF6C 1KECA 2Q7GA 2QTSA 1JOYA 5KHKA 3CB2A 4TSFG 3FB8C 4UXNA 2CH7B 2A9HA 1HP8A 4PA7A 2HJFC 4LH6A 3J80N 4LF4O 3ABKC 2EINC 4P2ZA 4F4LA 4UCTA 3JAMN 2NR5A 1EN6A 1HWYA 4JZ2A 3IC7A 4TWKA 4MVRA 5LOVB 1SQQH 4JZGA 3WFVA 4KL1A 2GTAA 1M90W 5IY5C 4OGQB 5BR8B 3KKYA 2QWQB 2XAFA 1AILA 3O65A 3T2MA 4PELA 3ZMUA 1IXBA 2F23A 1A32A 4TQFA 1M56C 4B3RO 4QPJA 1S5JA 3L75H 5FNVA 1R6KA 4JAAA 4NXMB 4J80A 3C3SA 4GCZA 1BQ0A 2K1EA 4DV0O 4FLWA 1SF9A 1GKFA 1THZA 2CTWA 4KXRA 1IXMA 1VMGA 4YY3O 3PJSK 4UCUA 1S0VA 5ITZA 1XL6A 2B5UA 1LR1A 4I0XB 4I50A 3FB7C 3UO2A 3ABLC 3QO8A 3ZHUA 2JGDA 1V55B 2EBOA 2N05A 1Y66A 5E79Z 1MSDA 3OE7G 4OX9O 3BY6A 3AG2B 1FXKC 1ZL8B 1DF5A 1HR0O 4IHJB 3BA8A 1HNWO 1TVKA 5HFLA 2UU9O 1PL0A 3NXSA 4OXSA 2ZKOA 3AG1C 4KUMA 5KHGA 4DV2B 1WB7A 3VQXA 3OTOO 2PY5A 3WU2Z 4C7UA 3EHBB 1QU7A 4MVSA 5IJ9B 4DR7O 1TGOA 2KG7A 2ETNA 2GDSA 2QSAA 4GYCB 2RDCA 1YVWA 3ZEDA 4DK1A 2QM7A 1M9NA 2QKCA 1MMMA 3RVZA 4W4KA 1PKXA 4X66B 2ZM6B 2OIGA 3SPGA 2PI4A 4EEQA 5L3EA 1JFFB 1OCZC 2XAHA 5ITZB 4NTYA 3S3WA 4WF9V 4RUFA 1S72V 2Q69A 5GTHZ 1JPXA 4A5UB 2JGDB 1R3IC 1BE3H 2VWKA 2ZXWC 4LWSA 4LF5B 3KCXA 2F43G 3VQWA 2IM9A 3A0RA 2ATKC 2Q73A 1NJIW 1VP7A 2UUCO 2QE7G 3ZHVA 3HR0A 4DR2B 1B6QA 4TV8B 3AG1B 3ICXA 4GX0A 4X8AA 1Q86W 2F1MA 3B40A 3E35A 3QVNA 1N32B 5BY1A 5LOVA 4O4HB 1Q81W 4Q6GA 2WLNA 3UT5A 3DXRB 1I08A 5LGNA 1XHZA 2YI9A 4X62B 2WA3A 2ZNJA 3AG2C 2HFEC 3SPIA 4ZI7A 4QNHB 2RJZA 5TISZ 1COWG 1W59A 4RUEA 3H1HH 5KUMA 2ZE7A 3L73H 4DV6B 3IAYA 2E75B 3WB2A 1HR0B 2QGNA 3FAVB 1KBHA 3ZHQA 4X88A 2HKOA 3D8CA 4UB6Z 3A0HZ 1RSOA 2EULA 3BVOA 2WLHA 4I55A 2DE0X 1DK1A 5LYJB 1VF6A 5BMVB 2QWRB 1XMQB 3K0DA 4GX2A 3TGUH 1U97A 4DR6B 4MT8A 3C3TA 4DK0A 3T1YO 5GTIZ 2QEXV 3CEIA 1O9HA 4DR7B 3CMEV 1AI6A 1AI7A 3LUTB 5LA6B 4JI5O 3T4ZA 4LF7B 4DV2O 2ZE6A 1VQLV 2N74A 1I5YA 2Y4UA 3VQVA 1TVKB 2X7RB 1P7GA 1GN4A 2ZM6O 4B3TB 1NS1A 5HFMA 2IW5A 2YIDA 1ZUQA 1GM7A 1DTOA 4LFBO 1G1XB 1OZ0A 3CD6V 1GH6A 1OCCB 4LF8B 4LF9B 5LMUO 4K35A 3GB7C 3HKEB 1TUBA 2LJ2A 4H37A 1MZEA 3OTOB 4YJ2A 3I5DA 1D5AA 5BZBA 3T1CA 1XBLA 3SYOA 2DW4A 4B3MO 1XMOO 1ENVA 1OCOB 3K59A 4RO2A 2UXNA 4IIJB 2QWNB 4DR5B 5CBFA 1WA8A 2HR3A 4B08A 1GM8A 2WWWA 4X65O 3RT3C 4TUYB 4FLZA 2AZ2A 3UKMA 3DGEA 1VQ6V 4HYOA 5H9CA 2BCCH 1N36O 1Y74B 1Z2GA 2JS5A 2ZNIA 2YS8A 5L3GA 4O4JA 1F4NA 5IYCO 3A2FA 1GM9A 2NNUA 1T5EA 1H2SB 1M57B 1JQ0A 4HBNA 4CH5A 1RPRA 4YY3B 4PHZA 4N21A 2M6YA 3U11A 4OPHA 4J11A 3CRRA 3CE2A 3OR6C 2WAMA 3OMNB 4DV7B 4FZ1A 3VQYA 3CRAA 4IYIA 5LYJA 2OTJV 1OJHA 3L71H 3UT5B 2CAZC 2IJHA 3JAKB 4O2BB 4BIUA 2E3CA 2ADQB 2P06A 1TUBB 4EFEA 4PD4F 5IDJA 1XMOB 1JCHA 3J7AU 3P3NA 3AEIA 3RVYA 1SKVA 5B1NA 1N34B 1P4RA 2DYSB 5KMGA 4E2LA 1W0KG 3H9VA 3JALB 1UFIA 1PD3A 1ZL8A 4CS2A 3G67A 2CK3G 4QJFB 1G8MA 2ZR2A 1OCZB 4LF4B 2LFSA 1SQBH 1VARA 4MS2A 1S5HC 2FKXA 1VEWA 1S5LZ 3IC9A 1TA8A 1PP9H 3JASA 5C8YA 4MTGA 5H5NA 2YI8A 4GX5A 4X62O 4PV1B 1AR5A 1QLEB 3BEHA 5IJ0B 4GKJB 4FLUA 1Q43A 2OT5A 3HKDA 1N32O 4O4JB 3KG2A 4WCEV 2UXCO 1ZTEA 2KG7B 4L8JA 2KSDA 4DUYB 4Z1VA 4FMTA 1EZJA 4DV5B 1KYOF 4WFFA 1F4MA 5JVDB 2QDOA 1EZVH 2AW9A 4O4LA 5EYPB 4CC5A 5CBGA 5JQGA 4LFAO 2FYUH 3N2KA 1M57C 2QR4A 4I9WA 4EFBA 4LF5O 1K73W 4JYYA 1XMQO 3H01A 4GKKB 3N27A 4NTXA 4JV5B 2HP8A 1IBKB 4P9OA 4X65B 3CC7V 4I50B 2UUBB 1IBKO 1BHAA 2IH3C 3ETDA 1KKDA 2KQXA 4MTFA 1VQ9V 5KA5A 5CN0A 1RFYA 3K08A 2CTPA 4P9PA 1WA8B 4DV4B 2X6CA 1FJGO 3ZRWA 2OIEA 4UVAA 4TV8A 3RYCA 3D36A 3CJHB 4JAUA 2JEUA 1K9MW 1XDCA 2UXCB 5EBLC 1ZAUA 1H38A 3JARA 2ZD9A 4JI6B 4LFBB 4JI2O 4DR1B 1QLEC 2IJKA 3CCUV 1FD9A 2N04A 4FJCC 2XAJA 4J42A 3MHSC 2UU9B 2PYJA 2AZ0A 5KAFZ 3CRQA 1XREA 2BE3A 3LDEA 4ZBMA 4WFHA 4J7JA 3G6EV 1VIBA 3AK3A 5B5EZ 2BTQA 2Y4TA 2P6JA 3APQA 5BMVA 1XNQB 2IJIA 1KC8W 5LGTA 2HVKC 2YXYA 5IYBO 2EIKB 3ETQA 1CXZB 3E83A 1FFXB 3CHXA 1ZWIC 3CWBH 1KU9A 3E8BA 4BAYA 1BGYH 3BA9A 4LNUB 1K5SA 4GLXA 3ABUA 4WFGA 3W7XA 2MW2B 2WA4A 3JALA 2UXXA 4JI7B 1QLNA 1WAZA 1BCCH 3JAWA 3QO5A 5LHIA 1NTZH 1JJ2U 1B06A 4GKJO 3ZN1A 2CTQA 2JIZG 4JV5O 1H2MA 1PM9A 4BIOA 4FPPA 3N2KB 1HNZB 3TXQA 4FM2A 1SZTA 1EN4A 1WLEA 3ZHTA 1YITV 1HNWB 1NR1A 2C2AA 2ZDIA 2AHZA 3FYEB 4EB6B 1SA0B 3LNMB 1H2GA 1J5EO 2W6IG 1Q8IA 3RYFB 2XUMA 1Q82W 2B9ZA 3K9AA 1K8AW 4DW0A 1MABG 1YTFB 1US6A 4NTWA 2W6JG 1KP3A 4UVBA 1N34O 4LP8A 5JVDA 4RWUA 4H44B 3T1HB 3AG7A 2KB1A 4MW8A 4D7TA 2XHBA 4TV9A 3RYIB 3SPHA 3CRCA 3AG4B 4UV9A 2WLJA 3B4SA 3DTUB 4J9YB 2CDYA 2GTSA 1DF4A 4LH7A 4ZHQB 4DUZO 3K79A 3R66A 2UUBO 1FFXA 1VQ7V 2Q6AA 1MZFA 4TUYA 4LF6O 2WLIA 3RWRD 1HNXO 2BSKB 1H2NA 2XT9A 3JATA 1OCCC 2W0FC 4LF8O 2OTLV 3K5MA 5FL7G 1K4CC 1YDXA 1AR4A 2NN4A 4MVZA 2DYSC 3LSUA 3JSNA 2HG5C 2YICA 2JEXA 4YHHO 1MSWD 5FNVB 2PF4E 4DV5O 1KMIZ 1K7DA 1PNLA 2JS3A 2QKSA 2ZIMA 1XEQA 2LO1A 2AHYA 4ZIBA 1M5IA 3MDSA 2P67A 2LGWA 1L0NH 5JH7A 3H1JH 4AQYB 1NZ6A 2CTRA 3LSQA 4UFZA 3HPLC 1K97A 1YI2V 2M7WA 4UVCA 3EXAA 5DECA 5KHIA 4B7KA 1KUQA 4UCVA 4KFMA 2P5OA 2ZE5A 1WB8A 4YJ3B 2JGUA 1H2KA 1J95A 3ABMC 3AG4C 4FFBB 4I0XA 2EZPA 2R72A 4B3MB 2WSSG 4JI8O 5BR8O 3SYCA 4DR6O 2V7QG 2GHYA 3JSLA 1QHTA 5EZYA 3OR7C 4LNUA 1SC5B 2R9RB 3TK1A 3OW2U 1OCOC 2YSUB 1OCRC 5IT9N 3WG7C 4MVQA 2QWPB 2WLLB 3CRMA 3GWOA 1HNXB 2P22C 4JTDB 3E2EA 3JCZA 2Y0PA 2D2CB 1XILA 4DR5O 1IVSA 3THOA 3OD4A 4R8CA 4JTCB 4DRXA 1U96A 1PL4A 1Z5VA 4CS3A 1EBOA 3SYPA 4U7OA 5H2FZ 3T1HO 4UCSA 1AB3A 2HHHO 4RQEA 3DSQA 3UCSC 2LW7A 1W2BU 4X64O 2O57A 2UXDB 1O9GA 4YHHB 2Q4PA 4PI2A 4J7ZA 4FLYA 3BHPA 4RAIA 4WFEA 4ASUG 1E1RG 1AP5A 1SETA 4FM1A 3X2QC 5IY5B 4DR3B 3I56V 3H1KH 2YEVB 4CH4A 3H1IH 4J9ZB 4JAVA 2ZIOA 1XNQO 4O2BA 1NVPB 4F6EA 2FMLA 5FPOA 4NYKA 2WLIB 1FFTB 5EC2C 3FAVA 1WNSA 1P49A 3CCLV 3E8FA 1MNGA 3VBBA 3DC5A 2LGQA 2LFRA 3UM7A 4GUNA 4MSWC 2VQFB 5B3SC 3T1YB 4JTAB 5J2TA 3OGIB 3QO7A 3W7WA 2JJ2G 3B8NA 2LQTA 3CC4V 3STZC 4DR2O 3AK1A 5C8YB 3M7MX 1WPBA 5J9PC 4XBFA 3A0BZ 4GT1A 5EBWC 3QTCA 4K0KO 2WPDG 3VOUA 2EIJC 4DV4O 2Y69B 4JYAB 4ZOLA 3P3PA 1FXKA 1S3JA 3E8GA 3QG5A 3EFFK 1JJOA 1OV9A 1MOFA 1TUEB 1N33B 1FS0G 4JYAO 5AG2A 4DR1O 1XNRB 4K8ZA 2VRZA 2ILMA 2RN9A 2BTQB 2FB5A 1Q6HA 2JVDA 3OMAB 5JH7B 1YTFD 3JD0A 3HKCB 3AG3C 4JI7O 5LBQA 1G6UA 4PA3A 3LSSA 2JRIA 5FLXN 1HW7A 3U10A 4NR1A 1GN6A 5LHHA 2PI5A 5KUKA 4PDLA 1VQKV 2JJ1G 1BS3A 3CXCU 1PNKA 2B1GA 1YHQV 1VQ4V 2EILB 2RCVA 3ZX6A 2GUZA 4DO2A 5J2TB 2ZXWB 4IHJA 4JI4B 4B3SB 4NXMO 4NXNB 4YXWG 3L70H 2DQ3A 3ML0A 3K0GA 1BT8A 4X66O 5GONA 2P7TC 2AXTZ 1Y74A 4JASA 4I4TA 3HKBB 4JI6O 2YEVA 5CMUA 2MK3A 4FZ0A 5B3SB 3F5TA 1YEWA 5B66Z 1NH2B 1S76D 3HKEA 1XQ8A 4PDRA 4KP4A 4HZ3A 2Q67A 3B2EE 4DV3O 1GN3A 2IJJA 4TV9B 4R50A 1LNQA 4OPAA 4H0LB 1V54B 3OGCC 1JFFA 3MD0A 4DV0B 3Q4HB 4AILC 3ZCCA 4IGGA 4WFAV 3K06A 4CZZA 1EN5A 2Y48A 3K57A 3L72H 3TCUA 4LBEC 3AG3B 3SPCA 1Q6IA 3W7SA 4MW3A 5JWPA 1NTMH 2HVJC 1K92A 5EBMC 3QF7A 2EILC 1I7FA 1N8RW 2YUAA 3IGAC 2H94A 2FTKA 3NR7A 3FKSG 4Q20A 4R6ZA 3R65A 1GAXA 2CGNA 3TETA 5GONB 3W7UA 4BR6A 1BHBA 1IBMO 1M1KW 5IJ0A 3CP1A 4DR4B 4EB6A 5D5PA 3HKDB 5B1BC 4QE7A 3CCEV 1ZSPA 1QBZA 1FXKB 2FL4A 1B3QA 5FPRA 3KCYA 3MAQA 5EYPA 1S77D 3OMIB 1IDSA 3A8TA 2VWJA 1NI8A 3IFXA 1Q5OA 4TOIA 5LXTA 3RW0A 3P30A 1RSOB 5KMGB 4I55B 3RYIA 1P84F 2IBZH 3LDDA 1YJ9V 5JJEB 2GUZB 1QQCA 4MTOA 3ZRSA 5EC1C 3SR2C 1VQPV 3SJBC 1ROPA 5B1AC 1VQ5V 4MVOA 2CE4A 1D5NA 4CS4A 2H8PC 3JASB 1W0JG 1EM1A 2EINB 4XDLA 4JI0O 1VQNV 2ZT9B 4QGPA 2HJDA 5DEDA 3F7VC 5DN6G 2QJ1A 4LWSB 4D6TH 3SGIA 2VQEB 2CH7A 3D3IA 2E5LB 3BABA 4NB5A 4AI8A 2GSMB 2QTOA 3CSXA 2PTMA 1VQ8V 4JYBA 5LMUB 1I5XA 4XDKA 2LW1A 3CJHA 3G6BA 5JQGB 4K3AA 4UV8A 1Q7YW 3CC2V 5IYZB 1J5EB 2YIBA 3SYAA 3OFNG 3HKBA 3ZRVA 3ABKB 3DXRA 1N36B 3G4SV 2Z5UA 5IYDO 5GW7A 3ZMZA 4ZKIA 3PN1A 4PDMA 4ZI7B 1RM1C 4YIOA 3HB3B 1Q3EA 1F23A 1F51A 4LF7O 1IURA 4JI5B 1QVGU 3SYQA 3ZRXA 1M93A 2EX3A 5EZYB 1XL4A 3BPZA 1H8EG 5D5QA 3ZHRA 2YXLA 5JCOC 5KA6A 3G80A 2EIJB 1WN7A 5KHHA 1E1QG 2QA4V 4PI0A 2P4VA 3FYIB 2E76B 2HLDG 4X9QA 1YJNV 3SPJA 3Q4HA 4W4LA 1FPOA 5IWAO 3ETEA 3LDCA 2W0XA 1AROP 3RYCB 4X89A 5DM6V 1BSMA 2QWOB 4LF9O 2OCHA 5BXZA 3FB6C 4CH6A 1D2DA 4ZOLB 2ITCC 3CCVV 4DV6O 4BW5A 1FXHA 2GBOA 1KKCA 2ZDIC 4O2AB 3B8MA 4J10A 1OHHG 4G28B 4J7KA 3N2GA 5F2VO 4NKGB 1UPGA 3JYCA 3E22A 4B3SO 3M99B 2DN9A 4JYCA 1SA0A 4PDVA 4MVMA 3RYFA 3WB1A 2EIKC 2AGAA 3X2QB 4BIZA 4P30A 4LC1A 3CXHF 3LNNA 1IBLB 4UCOA 5IWAB 3FD9A 3OUFA 4YJ2B 1L8DA 1QNMA 5A9GA 1NH2D 4JI3B 4H13B 1AJQA 3E86A 1VQMV 1QR8A 4FFKA 1Q90D 1BL8A 5J2UA 3K58A 4PJ0Z 1NR7A 2DYRB 1K4DC 1K34A 2RMKB 4PA6A 1Y67A 1YF2A 2PUSA 1SS3A 2OWOA 2ZCEA 1XUQA 3CCJV 1WPXA 2YIBD 2Q7HA 3L74H 1SRYA 3OEHG 4N23A 4UCRA 4DR3O 3JCUZ 5CBHA 2QM8A 1FAFA 1X59A 2OYQA 1X4TA 1VF7A 1OCRB 5L3CA 1MG1A 2DMXA 3ZS8C 4K0KB 1QVFU 3ZMSA 3SJAC 2UXDO 5B1BB 1ZX3A 2B1IA 4OX9B 4O2AA 4TT3G 2OCCB 2WLKA 2UUCB 1YJWV 1NKDA 4LR3A 1AP6A 3FFQA 4WFBV 1URFA 2H3OA 2QKAA 2L6LA 2IH1C 2F4VB 1GTOA 3H1LH 3G71V 2BTOA 4ZHQA 3OM3B 3TJTA 1I94B 3D3QA 4I7ZB 2Y69C 2BSKA 3EVKA 4YIPA 3F5WC 1YXBA 4DW1A 2ZINA 1XI1A 4X20A 3JD4A 1M56B 5KAIZ 2DYRC 5LHGA 4B3RB 3TXSA 1PNMA 2A79B 5JJNB 4FIPC 2XOKG 2RQ6A 5CA1B 3K5LA 1R3KC 3SJCC 4G27B 2R9IA 2ZQMA 1NT2B 4QPKA 2V1DA 4JF3A 3D36C 3O9OA 2ZE8A 1RM1B 3T4DA 1BQZA 3RGBA 3E22B 4G2KA 3ZHSA 3CPWU 1E79G 3JARB 5KHJA 2HHHB 4AQYO 1WJZA 3B09A 4I4TB 1JMKC 5EK0A 1Y6XA 3BRCA 2E5LO 2Z0AA 4JGSA 1SQGA 1NBMG 3K03A 3STLC 1L0LH 2BOCC 2YDEA 4YJ3A 5CA0A 5LMNO 4FFBA 2Q8VA 3CCRV 1NQTA 2QM4A 5KX5B 4LFCO 3IJ4A 2EIMC 2X0LA 3RFRA 4U3JA 1SESA 1JVMA 1RPOA 2YC0A 2E74B 4HAMA 2VS0A 5EIBD 2OCCC 3E8HA 3RYHB 1CPYA 3CCQV 3I55V 2PZSA 4KHPB 2Q0OC 4LCUC 4HNAB 4JI1O 2F4VO 1MA1A 2L35A 1GRJA 1AJPA 4I9QA 3ASNB 3ZBHA 1Y76A 1B04A 2CUGA 2Z3YA 4U7NA 2EJ7A 4IIJA 1KP2A 3UQ8A 1GO3F 3AK2A 4FLVA 3ZJZA 1FXVA 4DV7O 2DWEC 4DR4O 2XNDG 2EZOA 4FK5C 1IZ3A 1H8HG 2IU0A 2P4KA 4R7CA 2Q68A 1SQXH 5JCOA 3K04A 1KQSU 3UO3A 1VF5B 2BOBC 1F7YA 4E4EA 1V9PA 2D3OW 2Q5ZA 4GX1A 4GZRB 4LFCB 5IJ9A 3BFRA 4IT5A 4X1YA 5L3BA 4X1IB 5CA0B 3ABMB 5LMNB 4UB8Z 2DJVA 3KZIZ 4B7EA 3JD3A 4ICGA 2NLJC 1PV0A 5LXTB 1KD1W 3MHHC 1N0NA 4DUZB 1I94O 1DGSA 1R3JC 3HKCA 2IU3A 1UJWB 5CA1A 1AJNA 1ORQC 1H2LA 3CYOA 3M8AA 3ETGA 1FYJA 5H6QA 3U0ZA 4KHPO 1WP8A 4DV3B 3JATB 3BAAA 1Q6UA 4X20B 2EIMB 1BZKA 4K8XA 1Y76B 3K5OA 1WP7A 5LP6B 2A06H 4FVMA 2JK5C 3S3XA 3JAWB 1YIJV 4MVUA 1R73A 4H33A 4DV1B 2UXBB 2EJRA 4B3TO 3F7YC 1HNZO 2DQ0A 5KX5A 2YIAA 2GV9A 4WBNA 4U3JB 1K33A 4NVPA 2KKWA 2Y0IA 1VQOV 3RN4A 4JI2B 4FM0A 1EFRG 4F6RB 5CB4B 4FLTA 4JI4O 4BWAA 1I0HA 3ZMTA 1IBMB 3ABLB 4X1YB 2UUAB 4X1KA 5H6RA 3K9SA 2P90A 2R9AA 5E1AC 5LL6Y 3ZIAG 1N4CA 5JJJB 1LUWA 4JPRA 4XDJA 5J2UB 5L3DA 5CA3A 5K1PA 1IBLO 5A2QN 2WLLA 4TQDA 4RQFA 3RYHA 3WB0A 2X6BA 1SQPH 2UUAO 4DYLA 1M4UA 4I5SA 1TAEA 3K5NA 1RP3B 2XASA 3FX7A 1NTKH 3CCMV 4IL6Z 3CCSV 4Z2WA 3QNEA 3OEEG 5K1XA 2V4DA 1N33O 3ASOC 2F93B 1XHXA 3APOA 1V54C 1ZLZA 1CP9A 1AVMA 1AI5A 3L9DA 5LA6A 1BMFG 3ZMVA 1Z5WA 4X1IA 4D7SA 4J41A 2X6AA 3CS5A 4AHCA 2K9PA 2LP7A 1K3EA
chains in the Genus database with same CATH topology
3GWOA 1G4YB 4H37A 4DXWA 4JTDB 3E2EA 3JCZA 4UUJC 5BZBA 3FB6C 1K5QA 3T1CA 3SYOA 2ITCC 2DW4A 3CCVV 3RBZA 4BW5A 1CEZA 1FXHA 1SERA 3E89A 1ENVA 2ZDIC 1AI4A 4R8CA 1OCOB 3B8MA 4RO2A 1OHHG 2UXNA 4JTCB 4G28B 5CBFA 1R6NA 1EBOA 3SYPA 2HR3A 4U7OA 3JYCA 3M99B 4JYCA 1GM8A 4PDVA 2WWWA 4MVMA 5L3FA 4QE9A 3W7TA 4RQEA 2EIKC 3X2QB 1AR1B 1W2BU 4BIZA 4P30A 3DGEA 3UKMA 1VQ6V 4LC1A 4MTXA 1P7BA 4HYOA 5H9CA 2XAQA 3ZN0A 4RAIA 4WFEA 3OUFA 4ASUG 5L3GA 1E1RG 1F4NA 1SETA 5IYCO 3OUSA 1GM9A 3X2QC 2NNUA 3ZRWB 1M57B 5IY5B 1NH2D 3I56V 4PA4A 1AJQA 2YEVB 1JQ0A 3E86A 1QR8A 1VQMV 1BL8A 4J9ZB 4JAVA 3K3WA 1RPRA 1NR7A 2DYRB 1NVPB 4N21A 1K4DC 1K34A 1QR9A 3P32A 2DWDC 3OR6C 4PA6A 2WLIB 2WAMA 1FFTB 1DLBA 3OMNB 1QCEA 5EC2C 3ASOB 3E8FA 5C93A 3CCJV 3CCLV 1YSCA 3VBBA 1WPXA 2ITDC 1SRYA 2WLMA 5LGUA 2LFRA 3ASNC 3UM7A 2OTJV 3OEHG 4N23A 2IJHA 1V55C 4MSWC 1R3LC 4BIUA 5B3SC 3CMAV 3OAAG 4PA9A 1Y4MA 2JDIG 5CBHA 5IDJA 2QM8A 4JTAB 1JCHA 1GK9A 3AEIA 3JD1A 4EKWA 3QO7A 3RVYA 3WG7B 3FB5C 3W7WA 3JD2A 2JJ2G 5B1NA 1OCRB 3B8NA 5L3CA 1MG1A 3CC4V 1NVPD 1P4RA 3STZC 2DYSB 3ZMSA 1QVFU 5B1BB 4L87A 4Z1MG 4E2LA 2B1IA 1W0KG 5J9PC 2A0LA 3ABTA 1PD3A 4XBFA 2XAGA 4TT3G 2OCCB 2WLKA 4GT1A 5EBWC 1GMGA 5B1AB 2CK3G 1YJWV 2WPDG 1JX9A 3VOUA 3SJQC 1NKDA 2EIJC 2ZR3A 1G8MA 2ZR2A 1OCZB 2Y69B 4QJFB 4CBCA 2LFSA 4MS2A 1S5HC 5B1OA 4WFBV 4QIWF 1L1FA 3B77A 1FXKA 1S3JA 1KECA 3E8GA 4MTGA 2IH1C 3EFFK 1GTOA 4GX5A 1MOFA 1JOYA 1TUEB 3G71V 4TSFG 1QLEB 1FS0G 3FB8C 3BEHA 3OM3B 4UXNA 2A9HA 4PA7A 2HJFC 2OT5A 3ABKC 2EINC 2Y69C 4P2ZA 3OMAB 3KG2A 3F5WC 4WCEV 1YTFD 3JD0A 3AG3C 4F4LA 3JD4A 1HWYA 1M56B 5LBQA 4PA3A 4FMTA 3LSSA 1EZJA 2DYRC 5LHGA 4WFFA 1PNMA 1F4MA 2A79B 3IC7A 4TWKA 4FIPC 4MVRA 2XOKG 5CBGA 3WFVA 5LHHA 1M90W 1M57C 5IY5C 1R3KC 2PI5A 5KUKA 4I9WA 4G27B 4PDLA 2R9IA 2ZQMA 4QPKA 2V1DA 2XAFA 1K73W 1VQKV 4JF3A 3T2MA 4PELA 3H01A 3ZMUA 2JJ1G 3CXCU 1M56C 3T4DA 1RM1B 4QPJA 1PNKA 2B1GA 1YHQV 1VQ4V 2EILB 1R6KA 4G2KA 3CPWU 1E79G 4DO2A 4P9OA 2ZXWB 3CC7V 5EK0A 4GCZA 2K1EA 4JGSA 1NBMG 3K03A 4YXWG 1BHAA 3STLC 1GKFA 1THZA 2DQ3A 1IXMA 2BOCC 3ML0A 3PJSK 2IH3C 3ETDA 3K0GA 1KKDA 4MTFA 3CCRV 1VQ9V 5KA5A 1NQTA 5CN0A 1S0VA 2P7TC 2EIMC 2X0LA 4JASA 1XL6A 2B5UA 1JVMA 1SESA 3K08A 4P9PA 1RPOA 3FB7C 3ABLC 2YEVA 3QO8A 2X6CA 4HAMA 5CMUA 2MK3A 5B3SB 3ZRWA 2OCCC 3E8HA 1NH2B 1S76D 1V55B 2EBOA 1Y66A 1CPYA 4UVAA 3D36A 3OE7G 4PDRA 4KP4A 4JAUA 2JEUA 3BY6A 4HZ3A 1K9MW 3AG2B 2Q67A 1FXKC 3CCQV 5EBLC 3I55V 1H38A 1DF5A 2ZD9A 2IJJA 1QLEC 2IJKA 4LCUC 3CCUV 4R50A 1LNQA 4FJCC 2XAJA 3MHSC 1V54B 5HFLA 3OGCC 1AJPA 1PL0A 3ASNB 3NXSA 3LDEA 4OXSA 4ZBMA 4WFHA 2Z3YA 4U7NA 3AG1C 3MD0A 4KUMA 1KP2A 3G6EV 1GO3F 3ZCCA 4WFAV 3K06A 3ZJZA 1FXVA 2DWEC 4CZZA 3EHBB 2P6JA 2Y48A 4MVSA 2XNDG 2EZOA 3TCUA 4LBEC 4FK5C 1H8HG 3AG3B 2IU0A 2IJIA 3SPCA 5LGTA 2HVKC 5IYBO 4MW3A 3W7SA 1KC8W 4R7CA 2HVJC 2Q68A 2EIKB 1K92A 2QM7A 3K04A 5EBMC 1M9NA 1KQSU 2BOBC 3E83A 2EILC 1N8RW 3IGAC 2D3OW 2H94A 1ZWIC 2FTKA 3RVZA 4GX1A 3E8BA 1PKXA 3FKSG 4BAYA 4Q20A 5L3BA 4R6ZA 1K5SA 3ABMB 3R65A 3ABUA 3SPGA 2PI4A 4WFGA 5L3EA 3W7XA 3TETA 1OCZC 2XAHA 2UXXA 3W7UA 1QLNA 1BHBA 1M1KW 3CP1A 3QO5A 3JD3A 5LHIA 2NLJC 1JJ2U 4WF9V 4RUFA 1S72V 2Q69A 1KD1W 3MHHC 1JPXA 1R3JC 5B1BC 3ZN1A 4QE7A 3CCEV 2JIZG 1QBZA 2IU3A 1R3IC 1FXKB 4FPPA 1UJWB 1AJNA 1ORQC 2ZXWC 1SZTA 1WLEA 1YITV 1S77D 3OMIB 3CYOA 1NR1A 2C2AA 2F43G 2ZDIA 3ETGA 2AHZA 3FYEB 3IFXA 5H6QA 3A0RA 3LNMB 1H2GA 2ATKC 3RW0A 2W6IG 1NJIW 3P30A 1Q82W 3K9AA 3LDDA 2QE7G 1K8AW 1YJ9V 1MABG 2EIMB 1YTFB 1B6QA 4MTOA 3AG1B 2W6JG 1KP3A 4UVBA 4GX0A 4X8AA 1Q86W 2JK5C 4LP8A 3ZRSA 3E35A 5EC1C 1VQPV 1YIJV 1Q81W 1ROPA 5B1AC 4MVUA 1R73A 1VQ5V 4H33A 4MVOA 2KB1A 4MW8A 2WLNA 2EJRA 2H8PC 3SPHA 5LGNA 1W0JG 3AG4B 3F7YC 4UV9A 2EINB 2DQ0A 4XDLA 2WLJA 3DTUB 4J9YB 3AG2C 2HFEC 3SPIA 1VQNV 4QNHB 1K33A 1COWG 4RUEA 5KUMA 1DF4A 3F7VC 1VQOV 5DN6G 3K79A 1EFRG 1VQ7V 2Q6AA 3D3IA 2GSMB 2WLIA 4X88A 2HKOA 2QTOA 3ZMTA 3ABLB 2WLHA 1VQ8V 4JYBA 1I5XA 1OCCC 2W0FC 4XDKA 2OTLV 5H6RA 2P90A 4UV8A 1Q7YW 3CC2V 5FL7G 1K4CC 3K0DA 4GX2A 5E1AC 4MT8A 3ZIAG 4MVZA 3SYAA 2DYSC 2HG5C 3OFNG 4JPRA 3ZRVA 4XDJA 2JEXA 3ABKB 5L3DA 5CA3A 1MSWD 2QEXV 3G4SV 2WLLA 2Z5UA 5IYDO 5GW7A 3ZMZA 4ZKIA 4RQFA 1K7DA 4PDMA 1PNLA 2X6BA 1RM1C 3HB3B 2QKSA 1F23A 2AHYA 1F51A 4I5SA 3CMEV 2P67A 1QVGU 1AI6A 1AI7A 3SYQA 3LUTB 3ZRXA 2XASA 3CCMV 3LSQA 3T4ZA 3HPLC 3CCSV 1K97A 1XL4A 1YI2V 2M7WA 3QNEA 1H8EG 4UVCA 1VQLV 3OEEG 3ASOC 4KFMA 1I5YA 5KA6A 2X7RB 3ABMC 1J95A 3AG4C 2EIJB 1V54C 1E1QG 2QA4V 1CP9A 5HFMA 2EZPA 2IW5A 3FYIB 2HLDG 2WSSG 1GM7A 3SYCA 1AI5A 1DTOA 1BMFG 2V7QG 3ZMVA 2GHYA 1YJNV 3SPJA 1OZ0A 3OR7C 3ETEA 3CD6V 2R9RB 3TK1A 3OW2U 3LDCA 1OCOC 1OCCB 2X6AA 2YSUB 1AROP 1OCRC 4X89A 5DM6V 2LP7A 3WG7C 1K3EA 4MVQA 3GB7C 2WLLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLK A;  4HZ3 A;  4MTO A;  1G4Y B;  4H37 A;  2Q67 A;  5EBW C;  4DXW A;  4JTD B;  4GX0 A;  4X8A A;  5EBL C;  4UUJ C;  2JK5 C;  4LP8 A;  3VOU A;  3ZRS A;  3SJQ C;  2EIJ C;  5EC1 C;  3FB6 C;  5BZB A;  2ZD9 A;  4CBC A;  3T1C A;  4MS2 A;  5B1A C;  4MVU A;  2ITC C;  3SYO A;  1QLE C;  1S5H C;  4LCU C;  4H33 A;  4MVO A;  2KB1 A;  4R50 A;  3RBZ A;  4MW8 A;  4BW5 A;  2WLN A;  1LNQ A;  2H8P C;  3SPH A;  3E89 A;  3F7Y C;  3E8G A;  4XDL A;  4MTG A;  2WLJ A;  2IH1 C;  3EFF K;  4J9Y B;  3AG2 C;  3OGC C;  4R8C A;  2HFE C;  3SPI A;  4GX5 A;  4RO2 A;  4QNH B;  3LDE A;  4JTC B;  4OXS A;  4G28 B;  4ZBM A;  4RUE A;  5CBF A;  3FB8 C;  4WFH A;  5KUM A;  3AG1 C;  3BEH A;  3F7V C;  2A9H A;  3SYP A;  4PA7 A;  2HJF C;  3JYC A;  2Q6A A;  3ABK C;  3K06 A;  3ZJZ A;  2EIN C;  2Y69 C;  2DWE C;  2WLI A;  4P2Z A;  4PDV A;  4MVM A;  4X88 A;  2QTO A;  3KG2 A;  3F5W C;  4QE9 A;  3AG3 C;  4MVS A;  4F4L A;  2EIK C;  3TCU A;  4LBE C;  2WLH A;  4P30 A;  3UKM A;  4PA3 A;  1P7B A;  3SPC A;  2HVK C;  4HYO A;  1OCC C;  2DYR C;  4MW3 A;  4R7C A;  4WFF A;  2W0F C;  2HVJ C;  2Q68 A;  4XDK A;  2A79 B;  4TWK A;  3K04 A;  4MVR A;  5EBM C;  1K4C C;  3K0D A;  2BOB C;  5CBG A;  3E83 A;  2EIL C;  4GX2 A;  5E1A C;  4RAI A;  1M57 C;  3OUF A;  4WFE A;  1R3K C;  5IY5 C;  5KUK A;  4I9W A;  4G27 B;  4PDL A;  3IGA C;  4MVZ A;  3SYA A;  1ZWI C;  2DYS C;  3OUS A;  3RVZ A;  2HG5 C;  4GX1 A;  3X2Q C;  3E8B A;  4XDJ A;  4PA4 A;  3T2M A;  3E86 A;  4R6Z A;  2WLL A;  1BL8 A;  4J9Z B;  3R65 A;  1M56 C;  3T4D A;  3SPG A;  4WFG A;  4PDM A;  2X6B A;  3TET A;  2QKS A;  1OCZ C;  1K4D C;  2AHY A;  2DWD C;  3OR6 C;  4PA6 A;  4P9O A;  2WLI B;  3SYQ A;  3LUT B;  5EK0 A;  5EC2 C;  2NLJ C;  4RUF A;  2K1E A;  3E8F A;  2Q69 A;  3T4Z A;  2ITD C;  3HPL C;  3K03 A;  1XL4 A;  3STL C;  2WLM A;  1R3J C;  5B1B C;  2BOC C;  4QE7 A;  3ASN C;  3UM7 A;  3ASO C;  3PJS K;  4KFM A;  4PDR A;  2IH3 C;  3K0G A;  1KKD A;  1R3I C;  1V55 C;  4MSW C;  1R3L C;  3ABM C;  1J95 A;  3AG4 C;  4MTF A;  5B3S C;  1V54 C;  4PA9 A;  1ORQ C;  2EIM C;  2P7T C;  2ZXW C;  5CBH A;  1XL6 A;  4JTA B;  1JVM A;  3SYC A;  2AHZ A;  3IFX A;  3K08 A;  3LNM B;  4P9P A;  4EKW A;  3FB7 C;  2ATK C;  3RW0 A;  3SPJ A;  3ABL C;  3RVY A;  2YEV A;  3OR7 C;  3FB5 C;  2R9R B;  2X6C A;  3LDC A;  1OCO C;  2X6A A;  3STZ C;  2OCC C;  3E8H A;  1OCR C;  4X89 A;  3LDD A;  3WG7 C;  4MVQ A;  5J9P C;  2A0L A;  3GB7 C;  2WLL B; 
#chains in the Genus database with same CATH topology
 4O4L B;  3CX5 F;  2RNB A;  4WBN B;  1G4Y B;  4O4I A;  1IX9 A;  4DXW A;  1HDJ A;  2R70 A;  3N2G B;  4ABM A;  4UUJ C;  1FJG B;  1JA8 A;  1K5Q A;  4F6R A;  5CB4 A;  1XNR O;  2ODM A;  1SZX A;  3RBZ A;  1CEZ A;  4O4H A;  1GN2 A;  2G38 A;  2A7W A;  1SER A;  3E89 A;  2YXH A;  1AI4 A;  1SQF A;  2HEP A;  4X1K B;  2PYL A;  1R6N A;  2ADP A;  4NXN O;  1YCI A;  3GVM A;  5L3F A;  4QE9 A;  3W7T A;  3OTF A;  2Q0A A;  1AR1 B;  1N0J A;  4MTX A;  1P7B A;  2XAQ A;  3ZN0 A;  4BW9 A;  4GKK O;  2ARH A;  3OT7 A;  4JI3 O;  4FLX A;  3OUS A;  3ZRW B;  4U3F H;  4PA4 A;  2VQF O;  2PGG A;  3J81 N;  3GWK C;  3K3W A;  4DUY O;  1SQV H;  1QR9 A;  3P32 A;  4DRX B;  2DWD C;  1KB9 F;  2Q9L A;  1DLB A;  5LP6 A;  1QCE A;  2Q7E A;  3ASO B;  5C93 A;  3BCC H;  2VQE O;  1YSC A;  1FKA O;  2ITD C;  4IYH A;  2WLM A;  5LGU A;  2A3Q A;  3ASN C;  1JR9 A;  4JI0 B;  1V55 C;  1R3L C;  4CC6 A;  4O4I B;  3CMA V;  4CH3 A;  3OAA G;  4PA9 A;  1Y4M A;  2JDI G;  4JI1 B;  3DC6 A;  5IYZ A;  4DV1 O;  2UXB O;  1PPJ H;  1GK9 A;  3SDL A;  3C90 A;  1YZB A;  3JD1 A;  4EKW A;  5EIB C;  4LFA B;  3WG7 B;  3FB5 C;  3JD2 A;  2DOS A;  1R1B A;  2F95 B;  1NVP D;  5IE9 A;  1LUV A;  4L87 A;  1NU1 H;  4Z1M G;  4X64 B;  5KLV H;  2A0L A;  3JAK A;  3ABT A;  2XAG A;  2XTA A;  1GMG A;  5B1A B;  2F66 C;  1JX9 A;  3SJQ C;  4LF6 B;  2ZR3 A;  4HNA A;  1R6T A;  4CBC A;  5LP6 C;  2CGO A;  5B1O A;  1XOU A;  4JI8 B;  4QIW F;  1L1F A;  3B77 A;  1VF6 C;  1KEC A;  2Q7G A;  2QTS A;  1JOY A;  5KHK A;  3CB2 A;  4TSF G;  3FB8 C;  4UXN A;  2CH7 B;  2A9H A;  1HP8 A;  4PA7 A;  2HJF C;  4LH6 A;  3J80 N;  4LF4 O;  3ABK C;  2EIN C;  4P2Z A;  4F4L A;  4UCT A;  3JAM N;  2NR5 A;  1EN6 A;  1HWY A;  4JZ2 A;  3IC7 A;  4TWK A;  4MVR A;  5LOV B;  1SQQ H;  4JZG A;  3WFV A;  4KL1 A;  2GTA A;  1M90 W;  5IY5 C;  4OGQ B;  5BR8 B;  3KKY A;  2QWQ B;  2XAF A;  1AIL A;  3O65 A;  3T2M A;  4PEL A;  3ZMU A;  1IXB A;  2F23 A;  1A32 A;  4TQF A;  1M56 C;  4B3R O;  4QPJ A;  1S5J A;  3L75 H;  5FNV A;  1R6K A;  4JAA A;  4NXM B;  4J80 A;  3C3S A;  4GCZ A;  1BQ0 A;  2K1E A;  4DV0 O;  4FLW A;  1SF9 A;  1GKF A;  1THZ A;  2CTW A;  4KXR A;  1IXM A;  1VMG A;  4YY3 O;  3PJS K;  4UCU A;  1S0V A;  5ITZ A;  1XL6 A;  2B5U A;  1LR1 A;  4I0X B;  4I50 A;  3FB7 C;  3UO2 A;  3ABL C;  3QO8 A;  3ZHU A;  2JGD A;  1V55 B;  2EBO A;  2N05 A;  1Y66 A;  5E79 Z;  1MSD A;  3OE7 G;  4OX9 O;  3BY6 A;  3AG2 B;  1FXK C;  1ZL8 B;  1DF5 A;  1HR0 O;  4IHJ B;  3BA8 A;  1HNW O;  1TVK A;  5HFL A;  2UU9 O;  1PL0 A;  3NXS A;  4OXS A;  2ZKO A;  3AG1 C;  4KUM A;  5KHG A;  4DV2 B;  1WB7 A;  3VQX A;  3OTO O;  2PY5 A;  3WU2 Z;  4C7U A;  3EHB B;  1QU7 A;  4MVS A;  5IJ9 B;  4DR7 O;  1TGO A;  2KG7 A;  2ETN A;  2GDS A;  2QSA A;  4GYC B;  2RDC A;  1YVW A;  3ZED A;  4DK1 A;  2QM7 A;  1M9N A;  2QKC A;  1MMM A;  3RVZ A;  4W4K A;  1PKX A;  4X66 B;  2ZM6 B;  2OIG A;  3SPG A;  2PI4 A;  4EEQ A;  5L3E A;  1JFF B;  1OCZ C;  2XAH A;  5ITZ B;  4NTY A;  3S3W A;  4WF9 V;  4RUF A;  1S72 V;  2Q69 A;  5GTH Z;  1JPX A;  4A5U B;  2JGD B;  1R3I C;  1BE3 H;  2VWK A;  2ZXW C;  4LWS A;  4LF5 B;  3KCX A;  2F43 G;  3VQW A;  2IM9 A;  3A0R A;  2ATK C;  2Q73 A;  1NJI W;  1VP7 A;  2UUC O;  2QE7 G;  3ZHV A;  3HR0 A;  4DR2 B;  1B6Q A;  4TV8 B;  3AG1 B;  3ICX A;  4GX0 A;  4X8A A;  1Q86 W;  2F1M A;  3B40 A;  3E35 A;  3QVN A;  1N32 B;  5BY1 A;  5LOV A;  4O4H B;  1Q81 W;  4Q6G A;  2WLN A;  3UT5 A;  3DXR B;  1I08 A;  5LGN A;  1XHZ A;  2YI9 A;  4X62 B;  2WA3 A;  2ZNJ A;  3AG2 C;  2HFE C;  3SPI A;  4ZI7 A;  4QNH B;  2RJZ A;  5TIS Z;  1COW G;  1W59 A;  4RUE A;  3H1H H;  5KUM A;  2ZE7 A;  3L73 H;  4DV6 B;  3IAY A;  2E75 B;  3WB2 A;  1HR0 B;  2QGN A;  3FAV B;  1KBH A;  3ZHQ A;  4X88 A;  2HKO A;  3D8C A;  4UB6 Z;  3A0H Z;  1RSO A;  2EUL A;  3BVO A;  2WLH A;  4I55 A;  2DE0 X;  1DK1 A;  5LYJ B;  1VF6 A;  5BMV B;  2QWR B;  1XMQ B;  3K0D A;  4GX2 A;  3TGU H;  1U97 A;  4DR6 B;  4MT8 A;  3C3T A;  4DK0 A;  3T1Y O;  5GTI Z;  2QEX V;  3CEI A;  1O9H A;  4DR7 B;  3CME V;  1AI6 A;  1AI7 A;  3LUT B;  5LA6 B;  4JI5 O;  3T4Z A;  4LF7 B;  4DV2 O;  2ZE6 A;  1VQL V;  2N74 A;  1I5Y A;  2Y4U A;  3VQV A;  1TVK B;  2X7R B;  1P7G A;  1GN4 A;  2ZM6 O;  4B3T B;  1NS1 A;  5HFM A;  2IW5 A;  2YID A;  1ZUQ A;  1GM7 A;  1DTO A;  4LFB O;  1G1X B;  1OZ0 A;  3CD6 V;  1GH6 A;  1OCC B;  4LF8 B;  4LF9 B;  5LMU O;  4K35 A;  3GB7 C;  3HKE B;  1TUB A;  2LJ2 A;  4H37 A;  1MZE A;  3OTO B;  4YJ2 A;  3I5D A;  1D5A A;  5BZB A;  3T1C A;  1XBL A;  3SYO A;  2DW4 A;  4B3M O;  1XMO O;  1ENV A;  1OCO B;  3K59 A;  4RO2 A;  2UXN A;  4IIJ B;  2QWN B;  4DR5 B;  5CBF A;  1WA8 A;  2HR3 A;  4B08 A;  1GM8 A;  2WWW A;  4X65 O;  3RT3 C;  4TUY B;  4FLZ A;  2AZ2 A;  3UKM A;  3DGE A;  1VQ6 V;  4HYO A;  5H9C A;  2BCC H;  1N36 O;  1Y74 B;  1Z2G A;  2JS5 A;  2ZNI A;  2YS8 A;  5L3G A;  4O4J A;  1F4N A;  5IYC O;  3A2F A;  1GM9 A;  2NNU A;  1T5E A;  1H2S B;  1M57 B;  1JQ0 A;  4HBN A;  4CH5 A;  1RPR A;  4YY3 B;  4PHZ A;  4N21 A;  2M6Y A;  3U11 A;  4OPH A;  4J11 A;  3CRR A;  3CE2 A;  3OR6 C;  2WAM A;  3OMN B;  4DV7 B;  4FZ1 A;  3VQY A;  3CRA A;  4IYI A;  5LYJ A;  2OTJ V;  1OJH A;  3L71 H;  3UT5 B;  2CAZ C;  2IJH A;  3JAK B;  4O2B B;  4BIU A;  2E3C A;  2ADQ B;  2P06 A;  1TUB B;  4EFE A;  4PD4 F;  5IDJ A;  1XMO B;  1JCH A;  3J7A U;  3P3N A;  3AEI A;  3RVY A;  1SKV A;  5B1N A;  1N34 B;  1P4R A;  2DYS B;  5KMG A;  4E2L A;  1W0K G;  3H9V A;  3JAL B;  1UFI A;  1PD3 A;  1ZL8 A;  4CS2 A;  3G67 A;  2CK3 G;  4QJF B;  1G8M A;  2ZR2 A;  1OCZ B;  4LF4 B;  2LFS A;  1SQB H;  1VAR A;  4MS2 A;  1S5H C;  2FKX A;  1VEW A;  1S5L Z;  3IC9 A;  1TA8 A;  1PP9 H;  3JAS A;  5C8Y A;  4MTG A;  5H5N A;  2YI8 A;  4GX5 A;  4X62 O;  4PV1 B;  1AR5 A;  1QLE B;  3BEH A;  5IJ0 B;  4GKJ B;  4FLU A;  1Q43 A;  2OT5 A;  3HKD A;  1N32 O;  4O4J B;  3KG2 A;  4WCE V;  2UXC O;  1ZTE A;  2KG7 B;  4L8J A;  2KSD A;  4DUY B;  4Z1V A;  4FMT A;  1EZJ A;  4DV5 B;  1KYO F;  4WFF A;  1F4M A;  5JVD B;  2QDO A;  1EZV H;  2AW9 A;  4O4L A;  5EYP B;  4CC5 A;  5CBG A;  5JQG A;  4LFA O;  2FYU H;  3N2K A;  1M57 C;  2QR4 A;  4I9W A;  4EFB A;  4LF5 O;  1K73 W;  4JYY A;  1XMQ O;  3H01 A;  4GKK B;  3N27 A;  4NTX A;  4JV5 B;  2HP8 A;  1IBK B;  4P9O A;  4X65 B;  3CC7 V;  4I50 B;  2UUB B;  1IBK O;  1BHA A;  2IH3 C;  3ETD A;  1KKD A;  2KQX A;  4MTF A;  1VQ9 V;  5KA5 A;  5CN0 A;  1RFY A;  3K08 A;  2CTP A;  4P9P A;  1WA8 B;  4DV4 B;  2X6C A;  1FJG O;  3ZRW A;  2OIE A;  4UVA A;  4TV8 A;  3RYC A;  3D36 A;  3CJH B;  4JAU A;  2JEU A;  1K9M W;  1XDC A;  2UXC B;  5EBL C;  1ZAU A;  1H38 A;  3JAR A;  2ZD9 A;  4JI6 B;  4LFB B;  4JI2 O;  4DR1 B;  1QLE C;  2IJK A;  3CCU V;  1FD9 A;  2N04 A;  4FJC C;  2XAJ A;  4J42 A;  3MHS C;  2UU9 B;  2PYJ A;  2AZ0 A;  5KAF Z;  3CRQ A;  1XRE A;  2BE3 A;  3LDE A;  4ZBM A;  4WFH A;  4J7J A;  3G6E V;  1VIB A;  3AK3 A;  5B5E Z;  2BTQ A;  2Y4T A;  2P6J A;  3APQ A;  5BMV A;  1XNQ B;  2IJI A;  1KC8 W;  5LGT A;  2HVK C;  2YXY A;  5IYB O;  2EIK B;  3ETQ A;  1CXZ B;  3E83 A;  1FFX B;  3CHX A;  1ZWI C;  3CWB H;  1KU9 A;  3E8B A;  4BAY A;  1BGY H;  3BA9 A;  4LNU B;  1K5S A;  4GLX A;  3ABU A;  4WFG A;  3W7X A;  2MW2 B;  2WA4 A;  3JAL A;  2UXX A;  4JI7 B;  1QLN A;  1WAZ A;  1BCC H;  3JAW A;  3QO5 A;  5LHI A;  1NTZ H;  1JJ2 U;  1B06 A;  4GKJ O;  3ZN1 A;  2CTQ A;  2JIZ G;  4JV5 O;  1H2M A;  1PM9 A;  4BIO A;  4FPP A;  3N2K B;  1HNZ B;  3TXQ A;  4FM2 A;  1SZT A;  1EN4 A;  1WLE A;  3ZHT A;  1YIT V;  1HNW B;  1NR1 A;  2C2A A;  2ZDI A;  2AHZ A;  3FYE B;  4EB6 B;  1SA0 B;  3LNM B;  1H2G A;  1J5E O;  2W6I G;  1Q8I A;  3RYF B;  2XUM A;  1Q82 W;  2B9Z A;  3K9A A;  1K8A W;  4DW0 A;  1MAB G;  1YTF B;  1US6 A;  4NTW A;  2W6J G;  1KP3 A;  4UVB A;  1N34 O;  4LP8 A;  5JVD A;  4RWU A;  4H44 B;  3T1H B;  3AG7 A;  2KB1 A;  4MW8 A;  4D7T A;  2XHB A;  4TV9 A;  3RYI B;  3SPH A;  3CRC A;  3AG4 B;  4UV9 A;  2WLJ A;  3B4S A;  3DTU B;  4J9Y B;  2CDY A;  2GTS A;  1DF4 A;  4LH7 A;  4ZHQ B;  4DUZ O;  3K79 A;  3R66 A;  2UUB O;  1FFX A;  1VQ7 V;  2Q6A A;  1MZF A;  4TUY A;  4LF6 O;  2WLI A;  3RWR D;  1HNX O;  2BSK B;  1H2N A;  2XT9 A;  3JAT A;  1OCC C;  2W0F C;  4LF8 O;  2OTL V;  3K5M A;  5FL7 G;  1K4C C;  1YDX A;  1AR4 A;  2NN4 A;  4MVZ A;  2DYS C;  3LSU A;  3JSN A;  2HG5 C;  2YIC A;  2JEX A;  4YHH O;  1MSW D;  5FNV B;  2PF4 E;  4DV5 O;  1KMI Z;  1K7D A;  1PNL A;  2JS3 A;  2QKS A;  2ZIM A;  1XEQ A;  2LO1 A;  2AHY A;  4ZIB A;  1M5I A;  3MDS A;  2P67 A;  2LGW A;  1L0N H;  5JH7 A;  3H1J H;  4AQY B;  1NZ6 A;  2CTR A;  3LSQ A;  4UFZ A;  3HPL C;  1K97 A;  1YI2 V;  2M7W A;  4UVC A;  3EXA A;  5DEC A;  5KHI A;  4B7K A;  1KUQ A;  4UCV A;  4KFM A;  2P5O A;  2ZE5 A;  1WB8 A;  4YJ3 B;  2JGU A;  1H2K A;  1J95 A;  3ABM C;  3AG4 C;  4FFB B;  4I0X A;  2EZP A;  2R72 A;  4B3M B;  2WSS G;  4JI8 O;  5BR8 O;  3SYC A;  4DR6 O;  2V7Q G;  2GHY A;  3JSL A;  1QHT A;  5EZY A;  3OR7 C;  4LNU A;  1SC5 B;  2R9R B;  3TK1 A;  3OW2 U;  1OCO C;  2YSU B;  1OCR C;  5IT9 N;  3WG7 C;  4MVQ A;  2QWP B;  2WLL B;  3CRM A;  3GWO A;  1HNX B;  2P22 C;  4JTD B;  3E2E A;  3JCZ A;  2Y0P A;  2D2C B;  1XIL A;  4DR5 O;  1IVS A;  3THO A;  3OD4 A;  4R8C A;  4JTC B;  4DRX A;  1U96 A;  1PL4 A;  1Z5V A;  4CS3 A;  1EBO A;  3SYP A;  4U7O A;  5H2F Z;  3T1H O;  4UCS A;  1AB3 A;  2HHH O;  4RQE A;  3DSQ A;  3UCS C;  2LW7 A;  1W2B U;  4X64 O;  2O57 A;  2UXD B;  1O9G A;  4YHH B;  2Q4P A;  4PI2 A;  4J7Z A;  4FLY A;  3BHP A;  4RAI A;  4WFE A;  4ASU G;  1E1R G;  1AP5 A;  1SET A;  4FM1 A;  3X2Q C;  5IY5 B;  4DR3 B;  3I56 V;  3H1K H;  2YEV B;  4CH4 A;  3H1I H;  4J9Z B;  4JAV A;  2ZIO A;  1XNQ O;  4O2B A;  1NVP B;  4F6E A;  2FML A;  5FPO A;  4NYK A;  2WLI B;  1FFT B;  5EC2 C;  3FAV A;  1WNS A;  1P49 A;  3CCL V;  3E8F A;  1MNG A;  3VBB A;  3DC5 A;  2LGQ A;  2LFR A;  3UM7 A;  4GUN A;  4MSW C;  2VQF B;  5B3S C;  3T1Y B;  4JTA B;  5J2T A;  3OGI B;  3QO7 A;  3W7W A;  2JJ2 G;  3B8N A;  2LQT A;  3CC4 V;  3STZ C;  4DR2 O;  3AK1 A;  5C8Y B;  3M7M X;  1WPB A;  5J9P C;  4XBF A;  3A0B Z;  4GT1 A;  5EBW C;  3QTC A;  4K0K O;  2WPD G;  3VOU A;  2EIJ C;  4DV4 O;  2Y69 B;  4JYA B;  4ZOL A;  3P3P A;  1FXK A;  1S3J A;  3E8G A;  3QG5 A;  3EFF K;  1JJO A;  1OV9 A;  1MOF A;  1TUE B;  1N33 B;  1FS0 G;  4JYA O;  5AG2 A;  4DR1 O;  1XNR B;  4K8Z A;  2VRZ A;  2ILM A;  2RN9 A;  2BTQ B;  2FB5 A;  1Q6H A;  2JVD A;  3OMA B;  5JH7 B;  1YTF D;  3JD0 A;  3HKC B;  3AG3 C;  4JI7 O;  5LBQ A;  1G6U A;  4PA3 A;  3LSS A;  2JRI A;  5FLX N;  1HW7 A;  3U10 A;  4NR1 A;  1GN6 A;  5LHH A;  2PI5 A;  5KUK A;  4PDL A;  1VQK V;  2JJ1 G;  1BS3 A;  3CXC U;  1PNK A;  2B1G A;  1YHQ V;  1VQ4 V;  2EIL B;  2RCV A;  3ZX6 A;  2GUZ A;  4DO2 A;  5J2T B;  2ZXW B;  4IHJ A;  4JI4 B;  4B3S B;  4NXM O;  4NXN B;  4YXW G;  3L70 H;  2DQ3 A;  3ML0 A;  3K0G A;  1BT8 A;  4X66 O;  5GON A;  2P7T C;  2AXT Z;  1Y74 A;  4JAS A;  4I4T A;  3HKB B;  4JI6 O;  2YEV A;  5CMU A;  2MK3 A;  4FZ0 A;  5B3S B;  3F5T A;  1YEW A;  5B66 Z;  1NH2 B;  1S76 D;  3HKE A;  1XQ8 A;  4PDR A;  4KP4 A;  4HZ3 A;  2Q67 A;  3B2E E;  4DV3 O;  1GN3 A;  2IJJ A;  4TV9 B;  4R50 A;  1LNQ A;  4OPA A;  4H0L B;  1V54 B;  3OGC C;  1JFF A;  3MD0 A;  4DV0 B;  3Q4H B;  4AIL C;  3ZCC A;  4IGG A;  4WFA V;  3K06 A;  4CZZ A;  1EN5 A;  2Y48 A;  3K57 A;  3L72 H;  3TCU A;  4LBE C;  3AG3 B;  3SPC A;  1Q6I A;  3W7S A;  4MW3 A;  5JWP A;  1NTM H;  2HVJ C;  1K92 A;  5EBM C;  3QF7 A;  2EIL C;  1I7F A;  1N8R W;  2YUA A;  3IGA C;  2H94 A;  2FTK A;  3NR7 A;  3FKS G;  4Q20 A;  4R6Z A;  3R65 A;  1GAX A;  2CGN A;  3TET A;  5GON B;  3W7U A;  4BR6 A;  1BHB A;  1IBM O;  1M1K W;  5IJ0 A;  3CP1 A;  4DR4 B;  4EB6 A;  5D5P A;  3HKD B;  5B1B C;  4QE7 A;  3CCE V;  1ZSP A;  1QBZ A;  1FXK B;  2FL4 A;  1B3Q A;  5FPR A;  3KCY A;  3MAQ A;  5EYP A;  1S77 D;  3OMI B;  1IDS A;  3A8T A;  2VWJ A;  1NI8 A;  3IFX A;  1Q5O A;  4TOI A;  5LXT A;  3RW0 A;  3P30 A;  1RSO B;  5KMG B;  4I55 B;  3RYI A;  1P84 F;  2IBZ H;  3LDD A;  1YJ9 V;  5JJE B;  2GUZ B;  1QQC A;  4MTO A;  3ZRS A;  5EC1 C;  3SR2 C;  1VQP V;  3SJB C;  1ROP A;  5B1A C;  1VQ5 V;  4MVO A;  2CE4 A;  1D5N A;  4CS4 A;  2H8P C;  3JAS B;  1W0J G;  1EM1 A;  2EIN B;  4XDL A;  4JI0 O;  1VQN V;  2ZT9 B;  4QGP A;  2HJD A;  5DED A;  3F7V C;  5DN6 G;  2QJ1 A;  4LWS B;  4D6T H;  3SGI A;  2VQE B;  2CH7 A;  3D3I A;  2E5L B;  3BAB A;  4NB5 A;  4AI8 A;  2GSM B;  2QTO A;  3CSX A;  2PTM A;  1VQ8 V;  4JYB A;  5LMU B;  1I5X A;  4XDK A;  2LW1 A;  3CJH A;  3G6B A;  5JQG B;  4K3A A;  4UV8 A;  1Q7Y W;  3CC2 V;  5IYZ B;  1J5E B;  2YIB A;  3SYA A;  3OFN G;  3HKB A;  3ZRV A;  3ABK B;  3DXR A;  1N36 B;  3G4S V;  2Z5U A;  5IYD O;  5GW7 A;  3ZMZ A;  4ZKI A;  3PN1 A;  4PDM A;  4ZI7 B;  1RM1 C;  4YIO A;  3HB3 B;  1Q3E A;  1F23 A;  1F51 A;  4LF7 O;  1IUR A;  4JI5 B;  1QVG U;  3SYQ A;  3ZRX A;  1M93 A;  2EX3 A;  5EZY B;  1XL4 A;  3BPZ A;  1H8E G;  5D5Q A;  3ZHR A;  2YXL A;  5JCO C;  5KA6 A;  3G80 A;  2EIJ B;  1WN7 A;  5KHH A;  1E1Q G;  2QA4 V;  4PI0 A;  2P4V A;  3FYI B;  2E76 B;  2HLD G;  4X9Q A;  1YJN V;  3SPJ A;  3Q4H A;  4W4L A;  1FPO A;  5IWA O;  3ETE A;  3LDC A;  2W0X A;  1ARO P;  3RYC B;  4X89 A;  5DM6 V;  1BSM A;  2QWO B;  4LF9 O;  2OCH A;  5BXZ A;  3FB6 C;  4CH6 A;  1D2D A;  4ZOL B;  2ITC C;  3CCV V;  4DV6 O;  4BW5 A;  1FXH A;  2GBO A;  1KKC A;  2ZDI C;  4O2A B;  3B8M A;  4J10 A;  1OHH G;  4G28 B;  4J7K A;  3N2G A;  5F2V O;  4NKG B;  1UPG A;  3JYC A;  3E22 A;  4B3S O;  3M99 B;  2DN9 A;  4JYC A;  1SA0 A;  4PDV A;  4MVM A;  3RYF A;  3WB1 A;  2EIK C;  2AGA A;  3X2Q B;  4BIZ A;  4P30 A;  4LC1 A;  3CXH F;  3LNN A;  1IBL B;  4UCO A;  5IWA B;  3FD9 A;  3OUF A;  4YJ2 B;  1L8D A;  1QNM A;  5A9G A;  1NH2 D;  4JI3 B;  4H13 B;  1AJQ A;  3E86 A;  1VQM V;  1QR8 A;  4FFK A;  1Q90 D;  1BL8 A;  5J2U A;  3K58 A;  4PJ0 Z;  1NR7 A;  2DYR B;  1K4D C;  1K34 A;  2RMK B;  4PA6 A;  1Y67 A;  1YF2 A;  2PUS A;  1SS3 A;  2OWO A;  2ZCE A;  1XUQ A;  3CCJ V;  1WPX A;  2YIB D;  2Q7H A;  3L74 H;  1SRY A;  3OEH G;  4N23 A;  4UCR A;  4DR3 O;  3JCU Z;  5CBH A;  2QM8 A;  1FAF A;  1X59 A;  2OYQ A;  1X4T A;  1VF7 A;  1OCR B;  5L3C A;  1MG1 A;  2DMX A;  3ZS8 C;  4K0K B;  1QVF U;  3ZMS A;  3SJA C;  2UXD O;  5B1B B;  1ZX3 A;  2B1I A;  4OX9 B;  4O2A A;  4TT3 G;  2OCC B;  2WLK A;  2UUC B;  1YJW V;  1NKD A;  4LR3 A;  1AP6 A;  3FFQ A;  4WFB V;  1URF A;  2H3O A;  2QKA A;  2L6L A;  2IH1 C;  2F4V B;  1GTO A;  3H1L H;  3G71 V;  2BTO A;  4ZHQ A;  3OM3 B;  3TJT A;  1I94 B;  3D3Q A;  4I7Z B;  2Y69 C;  2BSK A;  3EVK A;  4YIP A;  3F5W C;  1YXB A;  4DW1 A;  2ZIN A;  1XI1 A;  4X20 A;  3JD4 A;  1M56 B;  5KAI Z;  2DYR C;  5LHG A;  4B3R B;  3TXS A;  1PNM A;  2A79 B;  5JJN B;  4FIP C;  2XOK G;  2RQ6 A;  5CA1 B;  3K5L A;  1R3K C;  3SJC C;  4G27 B;  2R9I A;  2ZQM A;  1NT2 B;  4QPK A;  2V1D A;  4JF3 A;  3D36 C;  3O9O A;  2ZE8 A;  1RM1 B;  3T4D A;  1BQZ A;  3RGB A;  3E22 B;  4G2K A;  3ZHS A;  3CPW U;  1E79 G;  3JAR B;  5KHJ A;  2HHH B;  4AQY O;  1WJZ A;  3B09 A;  4I4T B;  1JMK C;  5EK0 A;  1Y6X A;  3BRC A;  2E5L O;  2Z0A A;  4JGS A;  1SQG A;  1NBM G;  3K03 A;  3STL C;  1L0L H;  2BOC C;  2YDE A;  4YJ3 A;  5CA0 A;  5LMN O;  4FFB A;  2Q8V A;  3CCR V;  1NQT A;  2QM4 A;  5KX5 B;  4LFC O;  3IJ4 A;  2EIM C;  2X0L A;  3RFR A;  4U3J A;  1SES A;  1JVM A;  1RPO A;  2YC0 A;  2E74 B;  4HAM A;  2VS0 A;  5EIB D;  2OCC C;  3E8H A;  3RYH B;  1CPY A;  3CCQ V;  3I55 V;  2PZS A;  4KHP B;  2Q0O C;  4LCU C;  4HNA B;  4JI1 O;  2F4V O;  1MA1 A;  2L35 A;  1GRJ A;  1AJP A;  4I9Q A;  3ASN B;  3ZBH A;  1Y76 A;  1B04 A;  2CUG A;  2Z3Y A;  4U7N A;  2EJ7 A;  4IIJ A;  1KP2 A;  3UQ8 A;  1GO3 F;  3AK2 A;  4FLV A;  3ZJZ A;  1FXV A;  4DV7 O;  2DWE C;  4DR4 O;  2XND G;  2EZO A;  4FK5 C;  1IZ3 A;  1H8H G;  2IU0 A;  2P4K A;  4R7C A;  2Q68 A;  1SQX H;  5JCO A;  3K04 A;  1KQS U;  3UO3 A;  1VF5 B;  2BOB C;  1F7Y A;  4E4E A;  1V9P A;  2D3O W;  2Q5Z A;  4GX1 A;  4GZR B;  4LFC B;  5IJ9 A;  3BFR A;  4IT5 A;  4X1Y A;  5L3B A;  4X1I B;  5CA0 B;  3ABM B;  5LMN B;  4UB8 Z;  2DJV A;  3KZI Z;  4B7E A;  3JD3 A;  4ICG A;  2NLJ C;  1PV0 A;  5LXT B;  1KD1 W;  3MHH C;  1N0N A;  4DUZ B;  1I94 O;  1DGS A;  1R3J C;  3HKC A;  2IU3 A;  1UJW B;  5CA1 A;  1AJN A;  1ORQ C;  1H2L A;  3CYO A;  3M8A A;  3ETG A;  1FYJ A;  5H6Q A;  3U0Z A;  4KHP O;  1WP8 A;  4DV3 B;  3JAT B;  3BAA A;  1Q6U A;  4X20 B;  2EIM B;  1BZK A;  4K8X A;  1Y76 B;  3K5O A;  1WP7 A;  5LP6 B;  2A06 H;  4FVM A;  2JK5 C;  3S3X A;  3JAW B;  1YIJ V;  4MVU A;  1R73 A;  4H33 A;  4DV1 B;  2UXB B;  2EJR A;  4B3T O;  3F7Y C;  1HNZ O;  2DQ0 A;  5KX5 A;  2YIA A;  2GV9 A;  4WBN A;  4U3J B;  1K33 A;  4NVP A;  2KKW A;  2Y0I A;  1VQO V;  3RN4 A;  4JI2 B;  4FM0 A;  1EFR G;  4F6R B;  5CB4 B;  4FLT A;  4JI4 O;  4BWA A;  1I0H A;  3ZMT A;  1IBM B;  3ABL B;  4X1Y B;  2UUA B;  4X1K A;  5H6R A;  3K9S A;  2P90 A;  2R9A A;  5E1A C;  5LL6 Y;  3ZIA G;  1N4C A;  5JJJ B;  1LUW A;  4JPR A;  4XDJ A;  5J2U B;  5L3D A;  5CA3 A;  5K1P A;  1IBL O;  5A2Q N;  2WLL A;  4TQD A;  4RQF A;  3RYH A;  3WB0 A;  2X6B A;  1SQP H;  2UUA O;  4DYL A;  1M4U A;  4I5S A;  1TAE A;  3K5N A;  1RP3 B;  2XAS A;  3FX7 A;  1NTK H;  3CCM V;  4IL6 Z;  3CCS V;  4Z2W A;  3QNE A;  3OEE G;  5K1X A;  2V4D A;  1N33 O;  3ASO C;  2F93 B;  1XHX A;  3APO A;  1V54 C;  1ZLZ A;  1CP9 A;  1AVM A;  1AI5 A;  3L9D A;  5LA6 A;  1BMF G;  3ZMV A;  1Z5W A;  4X1I A;  4D7S A;  4J41 A;  2X6A A;  3CS5 A;  4AHC A;  2K9P A;  2LP7 A;  1K3E A; 
#chains in the Genus database with same CATH homology
 3GWO A;  1G4Y B;  4H37 A;  4DXW A;  4JTD B;  3E2E A;  3JCZ A;  4UUJ C;  5BZB A;  3FB6 C;  1K5Q A;  3T1C A;  3SYO A;  2ITC C;  2DW4 A;  3CCV V;  3RBZ A;  4BW5 A;  1CEZ A;  1FXH A;  1SER A;  3E89 A;  1ENV A;  2ZDI C;  1AI4 A;  4R8C A;  1OCO B;  3B8M A;  4RO2 A;  1OHH G;  2UXN A;  4JTC B;  4G28 B;  5CBF A;  1R6N A;  1EBO A;  3SYP A;  2HR3 A;  4U7O A;  3JYC A;  3M99 B;  4JYC A;  1GM8 A;  4PDV A;  2WWW A;  4MVM A;  5L3F A;  4QE9 A;  3W7T A;  4RQE A;  2EIK C;  3X2Q B;  1AR1 B;  1W2B U;  4BIZ A;  4P30 A;  3DGE A;  3UKM A;  1VQ6 V;  4LC1 A;  4MTX A;  1P7B A;  4HYO A;  5H9C A;  2XAQ A;  3ZN0 A;  4RAI A;  4WFE A;  3OUF A;  4ASU G;  5L3G A;  1E1R G;  1F4N A;  1SET A;  5IYC O;  3OUS A;  1GM9 A;  3X2Q C;  2NNU A;  3ZRW B;  1M57 B;  5IY5 B;  1NH2 D;  3I56 V;  4PA4 A;  1AJQ A;  2YEV B;  1JQ0 A;  3E86 A;  1QR8 A;  1VQM V;  1BL8 A;  4J9Z B;  4JAV A;  3K3W A;  1RPR A;  1NR7 A;  2DYR B;  1NVP B;  4N21 A;  1K4D C;  1K34 A;  1QR9 A;  3P32 A;  2DWD C;  3OR6 C;  4PA6 A;  2WLI B;  2WAM A;  1FFT B;  1DLB A;  3OMN B;  1QCE A;  5EC2 C;  3ASO B;  3E8F A;  5C93 A;  3CCJ V;  3CCL V;  1YSC A;  3VBB A;  1WPX A;  2ITD C;  1SRY A;  2WLM A;  5LGU A;  2LFR A;  3ASN C;  3UM7 A;  2OTJ V;  3OEH G;  4N23 A;  2IJH A;  1V55 C;  4MSW C;  1R3L C;  4BIU A;  5B3S C;  3CMA V;  3OAA G;  4PA9 A;  1Y4M A;  2JDI G;  5CBH A;  5IDJ A;  2QM8 A;  4JTA B;  1JCH A;  1GK9 A;  3AEI A;  3JD1 A;  4EKW A;  3QO7 A;  3RVY A;  3WG7 B;  3FB5 C;  3W7W A;  3JD2 A;  2JJ2 G;  5B1N A;  1OCR B;  3B8N A;  5L3C A;  1MG1 A;  3CC4 V;  1NVP D;  1P4R A;  3STZ C;  2DYS B;  3ZMS A;  1QVF U;  5B1B B;  4L87 A;  4Z1M G;  4E2L A;  2B1I A;  1W0K G;  5J9P C;  2A0L A;  3ABT A;  1PD3 A;  4XBF A;  2XAG A;  4TT3 G;  2OCC B;  2WLK A;  4GT1 A;  5EBW C;  1GMG A;  5B1A B;  2CK3 G;  1YJW V;  2WPD G;  1JX9 A;  3VOU A;  3SJQ C;  1NKD A;  2EIJ C;  2ZR3 A;  1G8M A;  2ZR2 A;  1OCZ B;  2Y69 B;  4QJF B;  4CBC A;  2LFS A;  4MS2 A;  1S5H C;  5B1O A;  4WFB V;  4QIW F;  1L1F A;  3B77 A;  1FXK A;  1S3J A;  1KEC A;  3E8G A;  4MTG A;  2IH1 C;  3EFF K;  1GTO A;  4GX5 A;  1MOF A;  1JOY A;  1TUE B;  3G71 V;  4TSF G;  1QLE B;  1FS0 G;  3FB8 C;  3BEH A;  3OM3 B;  4UXN A;  2A9H A;  4PA7 A;  2HJF C;  2OT5 A;  3ABK C;  2EIN C;  2Y69 C;  4P2Z A;  3OMA B;  3KG2 A;  3F5W C;  4WCE V;  1YTF D;  3JD0 A;  3AG3 C;  4F4L A;  3JD4 A;  1HWY A;  1M56 B;  5LBQ A;  4PA3 A;  4FMT A;  3LSS A;  1EZJ A;  2DYR C;  5LHG A;  4WFF A;  1PNM A;  1F4M A;  2A79 B;  3IC7 A;  4TWK A;  4FIP C;  4MVR A;  2XOK G;  5CBG A;  3WFV A;  5LHH A;  1M90 W;  1M57 C;  5IY5 C;  1R3K C;  2PI5 A;  5KUK A;  4I9W A;  4G27 B;  4PDL A;  2R9I A;  2ZQM A;  4QPK A;  2V1D A;  2XAF A;  1K73 W;  1VQK V;  4JF3 A;  3T2M A;  4PEL A;  3H01 A;  3ZMU A;  2JJ1 G;  3CXC U;  1M56 C;  3T4D A;  1RM1 B;  4QPJ A;  1PNK A;  2B1G A;  1YHQ V;  1VQ4 V;  2EIL B;  1R6K A;  4G2K A;  3CPW U;  1E79 G;  4DO2 A;  4P9O A;  2ZXW B;  3CC7 V;  5EK0 A;  4GCZ A;  2K1E A;  4JGS A;  1NBM G;  3K03 A;  4YXW G;  1BHA A;  3STL C;  1GKF A;  1THZ A;  2DQ3 A;  1IXM A;  2BOC C;  3ML0 A;  3PJS K;  2IH3 C;  3ETD A;  3K0G A;  1KKD A;  4MTF A;  3CCR V;  1VQ9 V;  5KA5 A;  1NQT A;  5CN0 A;  1S0V A;  2P7T C;  2EIM C;  2X0L A;  4JAS A;  1XL6 A;  2B5U A;  1JVM A;  1SES A;  3K08 A;  4P9P A;  1RPO A;  3FB7 C;  3ABL C;  2YEV A;  3QO8 A;  2X6C A;  4HAM A;  5CMU A;  2MK3 A;  5B3S B;  3ZRW A;  2OCC C;  3E8H A;  1NH2 B;  1S76 D;  1V55 B;  2EBO A;  1Y66 A;  1CPY A;  4UVA A;  3D36 A;  3OE7 G;  4PDR A;  4KP4 A;  4JAU A;  2JEU A;  3BY6 A;  4HZ3 A;  1K9M W;  3AG2 B;  2Q67 A;  1FXK C;  3CCQ V;  5EBL C;  3I55 V;  1H38 A;  1DF5 A;  2ZD9 A;  2IJJ A;  1QLE C;  2IJK A;  4LCU C;  3CCU V;  4R50 A;  1LNQ A;  4FJC C;  2XAJ A;  3MHS C;  1V54 B;  5HFL A;  3OGC C;  1AJP A;  1PL0 A;  3ASN B;  3NXS A;  3LDE A;  4OXS A;  4ZBM A;  4WFH A;  2Z3Y A;  4U7N A;  3AG1 C;  3MD0 A;  4KUM A;  1KP2 A;  3G6E V;  1GO3 F;  3ZCC A;  4WFA V;  3K06 A;  3ZJZ A;  1FXV A;  2DWE C;  4CZZ A;  3EHB B;  2P6J A;  2Y48 A;  4MVS A;  2XND G;  2EZO A;  3TCU A;  4LBE C;  4FK5 C;  1H8H G;  3AG3 B;  2IU0 A;  2IJI A;  3SPC A;  5LGT A;  2HVK C;  5IYB O;  4MW3 A;  3W7S A;  1KC8 W;  4R7C A;  2HVJ C;  2Q68 A;  2EIK B;  1K92 A;  2QM7 A;  3K04 A;  5EBM C;  1M9N A;  1KQS U;  2BOB C;  3E83 A;  2EIL C;  1N8R W;  3IGA C;  2D3O W;  2H94 A;  1ZWI C;  2FTK A;  3RVZ A;  4GX1 A;  3E8B A;  1PKX A;  3FKS G;  4BAY A;  4Q20 A;  5L3B A;  4R6Z A;  1K5S A;  3ABM B;  3R65 A;  3ABU A;  3SPG A;  2PI4 A;  4WFG A;  5L3E A;  3W7X A;  3TET A;  1OCZ C;  2XAH A;  2UXX A;  3W7U A;  1QLN A;  1BHB A;  1M1K W;  3CP1 A;  3QO5 A;  3JD3 A;  5LHI A;  2NLJ C;  1JJ2 U;  4WF9 V;  4RUF A;  1S72 V;  2Q69 A;  1KD1 W;  3MHH C;  1JPX A;  1R3J C;  5B1B C;  3ZN1 A;  4QE7 A;  3CCE V;  2JIZ G;  1QBZ A;  2IU3 A;  1R3I C;  1FXK B;  4FPP A;  1UJW B;  1AJN A;  1ORQ C;  2ZXW C;  1SZT A;  1WLE A;  1YIT V;  1S77 D;  3OMI B;  3CYO A;  1NR1 A;  2C2A A;  2F43 G;  2ZDI A;  3ETG A;  2AHZ A;  3FYE B;  3IFX A;  5H6Q A;  3A0R A;  3LNM B;  1H2G A;  2ATK C;  3RW0 A;  2W6I G;  1NJI W;  3P30 A;  1Q82 W;  3K9A A;  3LDD A;  2QE7 G;  1K8A W;  1YJ9 V;  1MAB G;  2EIM B;  1YTF B;  1B6Q A;  4MTO A;  3AG1 B;  2W6J G;  1KP3 A;  4UVB A;  4GX0 A;  4X8A A;  1Q86 W;  2JK5 C;  4LP8 A;  3ZRS A;  3E35 A;  5EC1 C;  1VQP V;  1YIJ V;  1Q81 W;  1ROP A;  5B1A C;  4MVU A;  1R73 A;  1VQ5 V;  4H33 A;  4MVO A;  2KB1 A;  4MW8 A;  2WLN A;  2EJR A;  2H8P C;  3SPH A;  5LGN A;  1W0J G;  3AG4 B;  3F7Y C;  4UV9 A;  2EIN B;  2DQ0 A;  4XDL A;  2WLJ A;  3DTU B;  4J9Y B;  3AG2 C;  2HFE C;  3SPI A;  1VQN V;  4QNH B;  1K33 A;  1COW G;  4RUE A;  5KUM A;  1DF4 A;  3F7V C;  1VQO V;  5DN6 G;  3K79 A;  1EFR G;  1VQ7 V;  2Q6A A;  3D3I A;  2GSM B;  2WLI A;  4X88 A;  2HKO A;  2QTO A;  3ZMT A;  3ABL B;  2WLH A;  1VQ8 V;  4JYB A;  1I5X A;  1OCC C;  2W0F C;  4XDK A;  2OTL V;  5H6R A;  2P90 A;  4UV8 A;  1Q7Y W;  3CC2 V;  5FL7 G;  1K4C C;  3K0D A;  4GX2 A;  5E1A C;  4MT8 A;  3ZIA G;  4MVZ A;  3SYA A;  2DYS C;  2HG5 C;  3OFN G;  4JPR A;  3ZRV A;  4XDJ A;  2JEX A;  3ABK B;  5L3D A;  5CA3 A;  1MSW D;  2QEX V;  3G4S V;  2WLL A;  2Z5U A;  5IYD O;  5GW7 A;  3ZMZ A;  4ZKI A;  4RQF A;  1K7D A;  4PDM A;  1PNL A;  2X6B A;  1RM1 C;  3HB3 B;  2QKS A;  1F23 A;  2AHY A;  1F51 A;  4I5S A;  3CME V;  2P67 A;  1QVG U;  1AI6 A;  1AI7 A;  3SYQ A;  3LUT B;  3ZRX A;  2XAS A;  3CCM V;  3LSQ A;  3T4Z A;  3HPL C;  3CCS V;  1K97 A;  1XL4 A;  1YI2 V;  2M7W A;  3QNE A;  1H8E G;  4UVC A;  1VQL V;  3OEE G;  3ASO C;  4KFM A;  1I5Y A;  5KA6 A;  2X7R B;  3ABM C;  1J95 A;  3AG4 C;  2EIJ B;  1V54 C;  1E1Q G;  2QA4 V;  1CP9 A;  5HFM A;  2EZP A;  2IW5 A;  3FYI B;  2HLD G;  2WSS G;  1GM7 A;  3SYC A;  1AI5 A;  1DTO A;  1BMF G;  2V7Q G;  3ZMV A;  2GHY A;  1YJN V;  3SPJ A;  1OZ0 A;  3OR7 C;  3ETE A;  3CD6 V;  2R9R B;  3TK1 A;  3OW2 U;  3LDC A;  1OCO C;  1OCC B;  2X6A A;  2YSU B;  1ARO P;  1OCR C;  4X89 A;  5DM6 V;  2LP7 A;  3WG7 C;  1K3E A;  4MVQ A;  3GB7 C;  2WLL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...