5EC1C

Kcsa with v76ester mutation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 39
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ec1C00
4H33A 4LCUC 1JVMA 1KKDA 3LDEA 1V54C 4QE9A 5B3SC 1OCCC 5E1AC 2OCCC 2DWDC 5EC2C 1K4DC 4PDVA 2A0LA 3ASOC 3STZC 4PA4A 3UM7A 2HVKC 3E86A 1XL6A 1G4YB 1R3LC 2AHZA 4HYOA 2BOCC 2DWEC 3OUFA 4LP8A 2X6BA 2DYRC 3IFXA 2WLHA 3E8BA 3RBZA 2JK5C 2IH1C 4WFGA 4GX2A 3AG3C 3LDDA 3E83A 3FB5C 1V55C 4GX5A 4P2ZA 2BOBC 2K1EA 4QNHB 3EFFK 2Q69A 1R3IC 1J95A 3LUTB 2QKSA 2EIJC 3HPLC 3R65A 3TCUA 3OR7C 4X8AA 4MVZA 3E8GA 4R8CA 4X89A 5EC1C 1QLEC 4H37A 3OUSA 4G27B 2Y69C 3FB7C 3AG1C 2H8PC 3BEHA 2ZXWC 4XDJA 3AG4C 3RVZA 3ZJZA 3AG2C 3WG7C 4R7CA 4DXWA 5IY5C 4RUFA 1OCRC 2HVJC 4MTFA 3SPIA 4MVUA 3ABLC 4MVRA 4HZ3A 4RAIA 2R9RB 3KG2A 3SYPA 3T4DA 1M56C 4MVMA 5CBHA 1OCOC 1BL8A 1XL4A 2EIMC 4BW5A 4JTDB 4RUEA 2WLNA 5EBLC 2DYSC 3OGCC 4X88A 5CBFA 3K06A 4WFEA 4PDMA 1ZWIC 2EINC 3X2QC 4PDLA 3PJSK 2KB1A 2YEVA 1K4CC 4P9OA 4MW3A 4GX1A 4MVQA 4MSWC 4MVSA 4I9WA 3ABMC 3SPHA 3E89A 3K04A 5EK0A 4UUJC 3RVYA 3T2MA 4KFMA 4LBEC 3K03A 5B1AC 2A79B 3SYQA 2WLKA 4JTAB 5EBWC 4XDLA 4GX0A 4ZBMA 1R3JC 2ATKC 3E8FA 4XDKA 3UKMA 4JTCB 2WLLB 5KUMA 4MVOA 1ORQC 2HJFC 4PA9A 3SPGA 3F7YC 2WLLA 3IGAC 3JYCA 3SYOA 3SJQC 1M57C 3SPJA 2HFEC 4EKWA 2HG5C 4MTOA 4PDRA 4CBCA 4TWKA 3GB7C 5B1BC 2X6AA 5KUKA 3FB6C 2ITCC 1R3KC 4PA7A 2ZD9A 3FB8C 3K0DA 5BZBA 4MW8A 3STLC 2EIKC 3ABKC 4MTGA 4MS2A 4P30A 5EBMC 4F4LA 2Q68A 2P7TC 3ASNC 3K0GA 4OXSA 1P7BA 1OCZC 3F7VC 3SYAA 3ZRSA 2AHYA 4RO2A 4P9PA 3F5WC 4WFFA 3RW0A 2Q67A 3OR6C 4G28B 2NLJC 2W0FC 2A9HA 4PA3A 5J9PC 4QE7A 1LNQA 3E8HA 3LNMB 2WLJA 4PA6A 3LDCA 5CBGA 2ITDC 3T1CA 4WFHA 3VOUA 2WLIB 1S5HC 2IH3C 4R50A 3T4ZA 3SYCA 4R6ZA 4J9ZB 4J9YB 3TETA 2EILC 2WLIA 2X6CA 3K08A 2Q6AA 2WLMA 3SPCA 2QTOA
chains in the Genus database with same CATH superfamily
1NI8A 1DTOA 3MHSC 1AI6A 2KSDA 3B2EE 3L74H 5EC2C 3CCQV 1LR1A 1V54B 4FM1A 2CTRA 2FYUH 1Y76B 3CYOA 3KCXA 4ZOLB 4BAYA 2Q0OC 3RBZA 4BR6A 4PHZA 5HFLA 1AILA 1SA0A 4LFCO 3H1JH 4G27B 3FB7C 3ZS8C 4LH7A 1ZAUA 4R7CA 2AXTZ 4K35A 2E75B 4FM0A 4JI8O 3CB2A 4JI1B 5H6QA 1WNSA 1NTMH 4W4KA 1BL8A 3QTCA 1AP6A 3SJAC 2PI5A 4L87A 3BVOA 2PTMA 1B06A 2CE4A 1MMMA 1ROPA 4MSWC 4NTYA 3RYIB 4Q20A 1HNZB 2EX3A 4LWSB 4FFBB 4IHJA 1JJ2U 3ETGA 4Q6GA 1DF4A 1XMOO 1VQ4V 5LGTA 4FLZA 2ZIOA 4O4JA 4JTCB 3N2KA 4LC1A 5B1AB 1N34B 2HJFC 2ETNA 3HKCB 3DC5A 1TUEB 4KHPO 1HNXB 3K5NA 1KB9F 1W0JG 1BQ0A 3OD4A 3ZMTA 1P49A 5JH7A 3K0DA 3STLC 5EZYB 4X62B 1DF5A 1OCZB 1O9HA 3E8HA 3KZIZ 1W2BU 2WLIB 2A06H 1XOUA 2B5UA 1IURA 4J9ZB 2ZDIC 5K1XA 4U7NA 4FK5C 4LF8B 2LQTA 3AK1A 5LGUA 1EN6A 1JFFB 4YHHO 1OCCC 3JD2A 3TGUH 2ADQB 4LNUB 4YJ2A 4ZIBA 1Q5OA 4OX9O 1SZXA 3I56V 4Z2WA 3ZN1A 2CTPA 2DQ0A 3CPWU 1QU7A 3OR7C 1Q6HA 3PN1A 1QLEC 1HNWO 4TUYB 5KAIZ 5KX5A 2EZPA 4XDJA 5LMUB 4O4HB 4I5SA 4JYBA 3SPIA 4JI2O 2F23A 3AG2B 5IE9A 3WB2A 3P30A 3RT3C 3K5LA 4DV6O 3CCLV 1OCOC 2LW1A 4X88A 2QWQB 4WFEA 1Z5WA 2JS5A 4WBNB 5IT9N 2EINB 2UUBO 2P67A 1VQ8V 1J5EO 4LF7B 4B3TB 4UVAA 4O4LB 1PD3A 1BT8A 4GX0A 3ZHRA 4LH6A 2HKOA 2ZNIA 4RQEA 3CCEV 3FYIB 4TWKA 2ITCC 4I7ZB 3AG7A 2A7WA 1JOYA 3G6EV 4GKKB 2PI4A 2CTQA 2EIKB 1TGOA 2NLJC 1GM9A 3QO5A 5KHGA 1NU1H 3OMNB 2UXBO 2Q5ZA 2JEXA 3T4ZA 2X6CA 1DGSA 3VQVA 4D7SA 2OTJV 4DO2A 2HHHO 1BE3H 2K9PA 1K4DC 1AJQA 3A8TA 4X66O 1WN7A 1I0HA 4JI6O 2WLHA 5IWAB 1LUVA 2CUGA 2BTOA 3E83A 4ZHQA 5JQGB 2GUZA 4R8CA 5K1PA 1Y4MA 3DC6A 2M6YA 1W59A 2V7QG 3AG1C 4FJCC 1FYJA 3WB1A 3ZBHA 1PL4A 5LL6Y 2Y69B 3K59A 1K8AW 4DUZB 5CBHA 4Z1VA 2YC0A 4DR1B 4FLUA 1I7FA 4LF4O 2EIMB 4PDMA 3I55V 3NXSA 4PDLA 2PZSA 4DR7B 3BHPA 4F6EA 2JGDB 1FPOA 3L72H 4O4IB 1NVPD 3ABMC 1AR5A 4J41A 1COWG 3EVKA 4J42A 2ZXWB 3ZHTA 2W0XA 1XMQB 2XAHA 3B77A 1BMFG 5KHHA 1A32A 4JI7O 3SJQC 3UT5B 4UB6Z 2UXCO 1Q8IA 4CBCA 2X6AA 4CS3A 4K0KO 2Q7GA 1UPGA 1IBLO 4MS2A 4NKGB 1FXKB 1ZSPA 3L73H 3ETEA 1EN4A 3T1YB 2EJ7A 3CXHF 3LNMB 5KMGB 4PA6A 1QVGU 1K7DA 2ITDC 4PI2A 2HLDG 1S5HC 1S5JA 4DV4O 1NTKH 2AZ0A 4I9QA 1Z2GA 2BTQA 1R1BA 4H33A 4UCSA 4B3RO 4DR5O 5GONA 1RSOA 2LFSA 4B3MO 2RDCA 5B3SB 4BIUA 1VMGA 1M1KW 1YI2V 1OZ0A 3D36A 1BQZA 4LF6B 2DYRC 5BMVB 4QPKA 1I94O 1XHZA 5B1NA 3G67A 1WPXA 1FJGB 4P2ZA 4I0XB 4QNHB 2PYJA 3EFFK 1FKAO 2ILMA 5EC1C 2QM8A 4QIWF 3DSQA 4JZ2A 1ENVA 3I5DA 4O2AA 5IY5C 2GSMB 3QF7A 4DW0A 2W6JG 3QVNA 4K8XA 5BR8O 4AQYB 3ICXA 1BHAA 3K5MA 2YIBA 4N21A 1JR9A 1SZTA 4PD4F 5LHGA 3K58A 3SDLA 1GM8A 1BHBA 3O9OA 1NR7A 2YEVA 4GUNA 3RGBA 3K79A 5CA0B 4B3SB 3CJHA 1MA1A 1NH2D 1AJPA 1K5SA 1ORQC 2VRZA 1RFYA 4QPJA 2O57A 2ZR3A 4MTOA 1THZA 1Q3EA 4DR3B 4LFAB 5FPRA 1IXBA 3ABKB 1NVPB 2YIBD 4PA3A 1WLEA 4EB6A 1M93A 4WFHA 4JI0B 3BAAA 4R6ZA 2RQ6A 1Q82W 4LF5B 5DEDA 1NJIW 3JATB 4RWUA 4ASUG 2DQ3A 3A0HZ 4IT5A 2MW2B 1I5XA 3JARA 3STZC 3QO7A 4PA4A 5LP6A 2VQEO 2IU3A 1XNRB 2MK3A 1Y74B 1AI5A 5B1OA 4WFGA 1M5IA 1N32B 3CRMA 2UXXA 4ZI7B 1SESA 3TCUA 2LFRA 5J2UB 1YZBA 2F95B 3ZMSA 1MSWD 1S77D 1OJHA 2IM9A 2EZOA 3TJTA 1G1XB 1VQ6V 2UU9B 2OCCB 4L8JA 2R9RB 1JCHA 4D6TH 3HKEB 3K9AA 4H13B 4MTXA 2D2CB 1HNZO 3K06A 3OFNG 2EULA 4DR2B 1ZL8A 2E5LB 5H5NA 3T1HB 5EK0A 1WAZA 4JYCA 3FYEB 1GK9A 1HNXO 5JJNB 4YY3O 2YI9A 3B8MA 4FZ1A 2WLLB 2OWOA 3F7YC 5ITZA 4XBFA 2QM7A 3EXAA 2N04A 2V1DA 3DGEA 1PNKA 1VQ9V 4IIJB 4X62O 2RJZA 1PL0A 1XDCA 5LXTB 1PPJH 5CB4B 3OGIB 4NXNB 2RMKB 4OXSA 3ZRSA 1VIBA 1XBLA 1UJWB 3ZRWA 4P9PA 4J7JA 4E2LA 1SKVA 1S3JA 3E35A 4WFAV 2UUCB 3LDCA 4NVPA 1FD9A 4DUYO 4R50A 1M4UA 2EJRA 3LSUA 3MHHC 1GKFA 2JJ1G 2BSKB 3JSNA 4UV9A 1Q6IA 3B8NA 1OCCB 3IAYA 2R70A 3B09A 4E4EA 1MG1A 2X7RB 5L3BA 1H38A 3FB5C 5KA5A 2K1EA 1VEWA 2YEVB 1E1QG 3LUTB 3FX7A 1IBKB 1VF6A 3SR2C 4TOIA 4X89A 3VQWA 3BEHA 1H8EG 4I4TB 1VQLV 1QLEB 3WG7C 2H3OA 1UFIA 1OCRC 2XAFA 2PUSA 5CA3A 4HZ3A 2Q7EA 1F4NA 4OPHA 4DR4O 2Q9LA 4RUEA 4DRXB 1WA8A 3WB0A 4H0LB 2CAZC 4LF7O 1B3QA 4B3TO 1OCOB 1URFA 5E79Z 3GVMA 3X2QC 1GAXA 4X65O 4I50A 4FVMA 1K4CC 1AR1B 4GX1A 1U97A 2V4DA 4UUJC 4UFZA 2FTKA 1NZ6A 3HKBB 3JAMN 2P06A 2CK3G 2HEPA 5KUMA 4CZZA 4MVOA 1VQMV 1F7YA 3OW2U 1QBZA 4TQFA 1M57C 3C3SA 2DN9A 2P5OA 5JWPA 2F4VB 4TV8A 1D2DA 1QNMA 3GB7C 5B1BC 1KD1W 4A5UB 3OTFA 5BZBA 2JS3A 1XUQA 3ASNC 3F5TA 4JZGA 1P7BA 5C8YB 2AHYA 4IYIA 4X1IB 1GMGA 3CXCU 3CRRA 4KUMA 2JEUA 1YTFB 4JAAA 2WLJA 3RYHA 2KQXA 5KHIA 1KU9A 3THOA 2GTSA 2L6LA 3Q4HA 4CC5A 5LA6B 3D36C 4CH6A 1VQ7V 4ZKIA 1VP7A 1D5AA 1NTZH 1XL6A 1SQBH 4DW1A 2JGUA 3N2GA 1QCEA 4LP8A 1VQ5V 5C93A 4CS2A 1VQKV 2Q69A 1J95A 1GH6A 2DW4A 4X8AA 1CP9A 4DUZO 4DV7B 2UUAB 1JJOA 3AG1B 4RUFA 4YJ3A 1PV0A 1R6KA 4DR7O 1E1RG 3JASA 2QE7G 2F66C 2QWOB 1TVKA 5L3CA 4UCTA 3UCSC 4UVCA 4LFBO 1SQQH 4I9WA 3H01A 3JCZA 3T2MA 1KECA 2FMLA 5JCOA 5LOVA 3ZN0A 4EFBA 4DV1B 2A79B 3ABMB 2G38A 3JAKB 3APQA 2QKCA 3RYFB 2YI8A 1YJ9V 2DMXA 5TISZ 1FFXA 2VQFB 2NN4A 3SPJA 3HR0A 4PDRA 1P84F 3D3IA 2JJ2G 3FB8C 2UXDO 1GN4A 2M7WA 5EYPB 4DV0B 5IYBO 5L3EA 1SETA 2DJVA 3APOA 4X1YA 4F6RA 3ZCCA 3GWKC 3ZMZA 2ZM6O 1IXMA 2C2AA 3OTOB 3RYCA 2P6JA 3GWOA 4PJ0Z 1O9GA 2HJDA 3SYCA 5F2VO 3TETA 2IW5A 4GZRB 2YIDA 5IJ0A 2NNUA 4PA9A 3CS5A 4DV3B 2OT5A 5LP6C 1F23A 1KKDA 1IBMO 3OAAG 1WB7A 4LF6O 3P32A 1N36B 4ICGA 1EM1A 3W7WA 3SJBC 3UM7A 2IJHA 3BA9A 1CEZA 3U10A 3JD3A 4TT3G 2WA4A 3JAWA 4GX5A 1K92A 4JI8B 2GDSA 1AROP 1SA0B 2QKSA 5L3DA 4MVZA 2E74B 4AQYO 2CGOA 2WA3A 1QVFU 3IC7A 2PGGA 2N05A 3NR7A 4CH3A 3MD0A 4J80A 4DXWA 2QGNA 3ETDA 4I55A 1YF2A 2FKXA 5IY5B 1MSDA 1EZVH 2QEXV 1PKXA 1QLNA 2YUAA 5CBFA 2YS8A 3CX5F 1HW7A 4GT1A 1Y6XA 4NXMO 4HNAA 2Y0PA 1N33B 5CA1A 4KHPB 3E89A 4IHJB 4DV2O 5FLXN 2GTAA 2F43G 2Q7HA 3CCMV 3CHXA 4O4JB 4X9QA 3N2KB 4FLTA 5BXZA 3CEIA 1IDSA 4DR3O 2OCHA 4DK0A 5IYZA 4UVBA 4LFAO 3CRQA 4U3JA 1XREA 5BY1A 1BCCH 5JH7B 4PA7A 2ZD9A 4JF3A 3C90A 2QDOA 3BRCA 4P30A 1K73W 2KG7A 1AP5A 4JI0O 2F1MA 3K57A 2YIAA 4JI4B 2XNDG 3F5WC 3OE7G 4G28B 3W7UA 3AEIA 1YEWA 1JPXA 4YHHB 5KAFZ 4TV9A 1Q7YW 4YIPA 5GTHZ 3JD1A 3L70H 4OX9B 1AI7A 4LF9O 2Q4PA 1K9MW 1XNRO 3S3XA 4QE9A 2RNBA 5E1AC 1MZFA 4UCOA 1XEQA 2RCVA 4YJ2B 5B5EZ 5B66Z 1HR0B 2A0LA 2HVKC 1N32O 3VQXA 1VF6C 4NB5A 2WAMA 3AG3C 5LMNB 1EBOA 3SJCC 3JALA 3IC9A 5KX5B 1XNQO 2FB5A 3ZIAG 2UU9O 3J7AU 2XAQA 3AG4C 1VF7A 2RN9A 2Y0IA 1EZJA 4MVUA 2UUBB 4FLWA 1J5EB 3L75H 2E3CA 1LUWA 2E5LO 4JTDB 5EBLC 4CH4A 2DYSC 3K5OA 3BPZA 5J2TA 3G6BA 1IZ3A 3FAVA 4DYLA 3P3NA 5KA6A 2Z0AA 4X20A 4LBEC 4FLXA 1WP7A 1S0VA 1RPOA 3QO8A 4AI8A 1TA8A 5IYCO 4IGGA 2UXBB 1VF5B 3JD4A 2ARHA 1R3KC 3R66A 5EBMC 1Q43A 3ZHQA 2JRIA 1S72V 3S3WA 2Q67A 1NS1A 1G8MA 1KUQA 3JAWB 4GKJB 4JI5B 3H9VA 2JVDA 1K97A 4X1KA 4X66B 3BCCH 4N23A 2Q73A 1F4MA 3L9DA 2ZINA 3LDEA 5JVDA 1P4RA 4NTXA 4YXWG 3ZHVA 2QR4A 2UXNA 1P7GA 1R3LC 4HAMA 4HYOA 3QNEA 2YXYA 1MOFA 1Y76A 4ZOLA 4ZHQB 3LDDA 1V55C 4UCVA 2GUZB 3RFRA 2EIJC 3U11A 4CC6A 1FXHA 2QWNB 2ZXWC 4WCEV 1TUBA 3ZJZA 4U7OA 2LGWA 3L71H 4MVRA 3WG7B 3KG2A 1GN6A 3SYPA 4OPAA 3T4DA 1OCRB 1XL4A 3ZHSA 2A3QA 3CD6V 5JCOC 3PJSK 1PM9A 4JI7B 4JI1O 3X2QB 1FFTB 3RYIA 3JCUZ 4CS4A 4TV9B 3N27A 2F4VO 1IBLB 4B08A 3E8FA 4EFEA 3SPGA 1KYOF 3HKCA 2LW7A 1G6UA 1M57B 4Z1MG 4DV4B 4MW8A 5B1BB 2P7TC 3K0GA 1N34O 4KL1A 5EZYA 2CH7A 1VQNV 3ASNB 4B3RB 4FFKA 3VOUA 4B3MB 2EBOA 3JALB 1AR4A 2BTQB 1RP3B 2WLIA 1FAFA 4O2BA 1I94B 4FPPA 5KHJA 3ZMUA 2DOSA 5GONB 1RSOB 2QM4A 2Z3YA 1JFFA 2AW9A 4BIZA 1JMKC 2X0LA 3FKSG 1G4YB 3LSSA 1L0LH 1RM1C 3DXRA 5D5QA 4UXNA 3IFXA 4LF8O 1NH2B 1SS3A 3O65A 2R9AA 3ZMVA 3OUSA 3SGIA 2ZE8A 2ZNJA 4O2AB 5FL7G 4TUYA 1GN2A 3JSLA 1JA8A 1GO3F 2ZQMA 4O4HA 1WPBA 3ETQA 2R72A 3TXQA 1M56C 4FIPC 3E22A 4J11A 4OGQB 4FMTA 3CCSV 5CN0A 1S76D 2XAJA 3FD9A 4DV1O 3UQ8A 2QSAA 5LMUO 4P9OA 4WBNA 4MW3A 3CJHB 5FNVA 3RVYA 3VQYA 2YSUB 1E79G 3K3WA 3CSXA 2VQFO 3HKDA 1WP8A 1YSCA 4O4LA 1N0JA 2ATKC 5KLVH 5EIBD 4BIOA 1QHTA 2HFEC 1D5NA 3RWRD 2LP7A 1EN5A 1HP8A 5JVDB 2XTAA 5A2QN 3OMIB 3A0BZ 1YXBA 3TXSA 4F4LA 2XUMA 3OTOO 3HB3B 3F7VC 3SYAA 1YITV 3RW0A 1YDXA 4MT8A 4EB6B 1BGYH 2ODMA 4QE7A 4K8ZA 3JD0A 4DV3O 1VQOV 1BS3A 4JV5B 2VQEB 2EILC 3ABUA 3BFRA 1DK1A 3K08A 2Q6AA 2ZE5A 1N36O 4GKKO 1JVMA 1TUBB 2IU0A 1W0KG 3JARB 3TK1A 2VWKA 2OCCC 1BSMA 3BABA 5LP6B 2H94A 3ASOC 3E86A 4JYAB 2AHZA 2ZIMA 3KKYA 3G80A 2BOCC 3H1IH 1JX9A 2HP8A 1KQSU 1GRJA 2JK5C 2IH1C 4GLXA 4FLVA 1AB3A 4DV5B 5KHKA 3IJ4A 1WJZA 4IYHA 2WPDG 1YCIA 4IL6Z 1SRYA 5JQGA 3E8GA 2H8PC 3CRAA 1GM7A 4GCZA 5IWAO 2D3OW 1OV9A 1IVSA 1K3EA 3ZRVA 1PNMA 4FLYA 1K5QA 3ABLC 1SQVH 4DR6B 2WLNA 1N33O 4YY3B 5GW7A 1ZL8B 2IJIA 4QGPA 1S5LZ 2CH7B 1H2SB 2JGDA 3K04A 4O4IA 3ZEDA 4JI3B 1ZUQA 4DR1O 4XDLA 1R3JC 4W4LA 5ITZB 1QR9A 4O2BB 3RN4A 3CCVV 3QG5A 5LBQA 3UT5A 4JI4O 4DUYB 1NQTA 3MDSA 1XMQO 3ZRWB 4HBNA 3DXRB 1FXKA 2W0FC 4G2KA 2A9HA 2IJKA 1AI4A 2WSSG 2OTLV 5J9PC 3ABTA 2AZ2A 1SERA 5KMGA 1VQPV 1H2LA 2IBZH 1GTOA 3C3TA 4JGSA 1HR0O 2QTOA 2R9IA 5DN6G 4H44B 4X64B 3T1YO 1V54C 1YJWV 1I08A 3AK3A 3CC7V 2XT9A 5LMNO 2Q0AA 3B4SA 3E22B 2X6BA 1ZX3A 4KP4A 3E8BA 3D8CA 5BMVA 3CC4V 3CCJV 1U96A 3AG3B 4I0XA 5FNVB 3WFVA 4DR4B 2PYLA 3CE2A 1Z5VA 3HKDB 1RPRA 1KC8W 4X65B 3AG4B 5H2FZ 4MTFA 1FJGO 4LFCB 4GYCB 5IJ9A 3H1HH 1WA8B 1B6QA 2GBOA 1L8DA 1KP2A 4YIOA 2B1GA 3E2EA 4QJFB 1ZWIC 2DYRB 2Y48A 4I50B 2DYSB 1L0NH 3CMEV 4UCUA 1EFRG 3SPHA 1F51A 3EHBB 1T5EA 5CA0A 1PNLA 5B1AC 1NBMG 1X59A 3M8AA 3UKMA 3A2FA 3ML0A 4JASA 3IGAC 4TV8B 3BY6A 1XMOB 3W7XA 4B3SO 2YXHA 1XILA 3FB6C 4MTGA 1XHXA 1Y67A 2Q68A 4GKJO 4JI5O 1OCZC 2ZT9B 1CPYA 1M9NA 1H2MA 3DTUB 1SQGA 3RYHB 1LNQA 4UV8A 4RQFA 4WFBV 2N74A 4J9YB 2ZE7A 1H8HG 3OM3B 3Q4HB 5FPOA 1KP3A 5JJJB 4JYYA 2VS0A 5LGNA 2PF4E 3JATA 1OHHG 5GTIZ 2JDIG 3G4SV 2KKWA 4PDVA 3WU2Z 2XHBA 3N2GB 3UO2A 4LF5O 1VARA 2DWEC 4JAVA 1X4TA 3W7SA 1I5YA 5EIBC 1Y74A 4NTWA 2BOBC 3CC2V 1NR1A 3HPLC 4ZI7A 1V55B 4JPRA 4H37A 2EIJB 5LYJA 1H2KA 2HR3A 4BW9A 3AG2C 4YJ3B 5J2UA 1SC5B 5AG2A 4LFBB 1NKDA 2VWJA 2LJ2A 1HNWB 3JASB 5HFMA 1JQ0A 4MVMA 5LHIA 3OMAB 3HKEA 1TVKB 3OGCC 1GN3A 4JI2B 2EINC 4DV6B 2FL4A 2B9ZA 2QTSA 2XOKG 5LOVB 3CCUV 3ZHUA 1HWYA 3CP1A 4KFMA 2UXDB 2WLKA 1Q86W 1NT2B 2CDYA 5L3FA 1FFXB 4LR3A 1MZEA 2WLLA 3JYCA 4DR2O 1FXVA 2ZM6B 4EKWA 3T1HO 1SQXH 1R6NA 4TSFG 4PELA 2XAGA 4IIJA 2JIZG 4K3AA 3OT7A 1Q6UA 2EIKC 1DLBA 1N8RW 3CWBH 4F6RB 4X1YB 5LXTA 4TQDA 5CB4A 3CRCA 3D3QA 4RO2A 4WFFA 2CTWA 3OR6C 1H2NA 3RYCB 1IBMB 3H1KH 2L35A 4D7TA 1M90W 3T1CA 5IJ0B 4NXNO 5CMUA 2ZDIA 2BSKA 2UUCO 2DWDC 3CMAV 4BWAA 4KXRA 5IJ9B 2Z5UA 3OUFA 3KCYA 2HHHB 1RM1B 4GX2A 3BA8A 4PV1B 4JI6B 1R3IC 1L1FA 2P22C 3A0RA 1Q90D 2Y69C 3K9SA 3RVZA 4I4TA 4NXMB 3ZX6A 4I55B 4B7EA 4RAIA 4FM2A 1MABG 4DV2B 2Y4TA 1IBKO 3AK2A 2OIGA 2EIMC 4BW5A 1M56B 5DECA 4DRXA 4J7KA 4HNAB 4NR1A 1HDJA 5IYDO 4J7ZA 5CA1B 2IJJA 2KB1A 5H6RA 4NYKA 4UCRA 4J10A 1Y66A 1BZKA 4LF4B 2BE3A 2DE0X 1CXZB 3SYQA 2YICA 1V9PA 4XDKA 5IDJA 1IX9A 3HKBA 2WWWA 5IYZB 1US6A 3LSQA 4U3JB 4UB8Z 4ABMA 1SQFA 2HG5C 1AVMA 1XQ8A 2ZKOA 2PY5A 3H1LH 1FXKC 1KBHA 2QWPB 2KG7B 3LNNA 1K34A 2UXCB 5DM6V 4LF9B 3J80N 1R73A 3W7TA 4AHCA 4JV5O 3UO3A 4DK1A 5C8YA 3M99B 4LWSA 4FFBA 4K0KB 4X1IA 5L3GA 4U3FH 2P90A 2QKAA 4AILC 2IH3C 5JJEB 5D5PA 5LHHA 3J81N 2WLMA 3SPCA 1N0NA 3OEEG 2B1IA 2EILB 4JYAO 4LCUC 5LYJB 2NR5A 2YDEA 3B40A 1TAEA 5B3SC 2Q8VA 1N4CA 5LA6A 1YVWA 3OEHG 4DV5O 1XNQB 4PI0A 2LO1A 2QJ1A 2F93B 3ASOB 4DR5B 4FZ0A 3P3PA 4CH5A 2BCCH 1KKCA 3CCRV 2LGQA 1XI1A 3R65A 1FS0G 3U0ZA 1K33A 1AJNA 2QWRB 1YTFD 2GV9A 4DR6O 2GHYA 1QR8A 2HVJC 2XASA 4LNUA 4B7KA 2YXLA 3ABLB 1WB8A 1YHQV 2ADPA 3MAQA 4EEQA 1SF9A 2OIEA 4DV7O 5J2TB 5BR8B 2AGAA 4JI3O 2UUAO 1QQCA 3FAVB 3G71V 2OYQA 4MVQA 4MVSA 1KMIZ 4X20B 1PP9H 1R6TA 2ZCEA 1SQPH 3K03A 1Q81W 4C7UA 1YIJV 2ZR2A 4JTAB 5EBWC 4ZBMA 3JAKA 2P4KA 1YJNV 4JAUA 3M7MX 3SYOA 3RYFA 2E76B 5H9CA 2CGNA 5KUKA 1H2GA 2P4VA 3ABKC 3VBBA 4WF9V 5EYPA 2Y4UA 2QA4V 1ZLZA 1ZTEA 2W6IG 3FFQA 5A9GA 3ZRXA 5CBGA 1B04A 4X1KB 4X64O 4DV0O 1MNGA 2ZE6A
chains in the Genus database with same CATH topology
2R9IA 5DN6G 1K9MW 4ASUG 2DQ3A 1DTOA 1V54C 1YJWV 4QE9A 3MHSC 1AI6A 5E1AC 5EC2C 3CCQV 3CC7V 1I5XA 1V54B 2A0LA 3STZC 3QO7A 4PA4A 2HVKC 2IU3A 2MK3A 3CYOA 1AI5A 2X6BA 4BAYA 5B1OA 4KP4A 3E8BA 3RBZA 4WFGA 2WAMA 3AG3C 1EBOA 2UXXA 5HFLA 3CC4V 3CCJV 1SESA 3AG3B 3TCUA 3WFVA 3ZIAG 4G27B 3FB7C 2LFRA 2XAQA 3AG4C 1RPRA 3ZMSA 1KC8W 4R7CA 1MSWD 1S77D 3AG4B 4MTFA 1EZJA 2EZOA 4MVUA 1VQ6V 2OCCB 2R9RB 1JCHA 5H6QA 1BL8A 1B6QA 3K9AA 4MTXA 4JTDB 1KP2A 5EBLC 2DYSC 4L87A 2PI5A 2B1GA 3K06A 3OFNG 3E2EA 4QJFB 1ZWIC 2DYRB 2Y48A 2DYSB 1ROPA 3CMEV 4MSWC 1EFRG 3SPHA 4Q20A 5EK0A 1F51A 3EHBB 5KA6A 4JYCA 4LBEC 3FYEB 1PNLA 1JJ2U 5B1AC 1S0VA 3ETGA 1NBMG 1GK9A 1DF4A 1VQ4V 5LGTA 1RPOA 3B8MA 3UKMA 5B1AB 3QO8A 2WLLB 4JTCB 4LC1A 2HJFC 3ML0A 3F7YC 4JASA 3IGAC 4XBFA 2QM7A 3BY6A 1TUEB 2V1DA 3DGEA 5IYCO 1PNKA 3W7XA 1VQ9V 1W0JG 3JD4A 3FB6C 1R3KC 3ZMTA 1PL0A 3K0DA 3STLC 4MTGA 5EBMC 2Q68A 4OXSA 1OCZC 3ZRSA 1CPYA 1UJWB 1S72V 1M9NA 3ZRWA 4P9PA 4E2LA 2Q67A 1DF5A 3DTUB 1S3JA 1G8MA 3E35A 1OCZB 4WFAV 1LNQA 3E8HA 1W2BU 3LDCA 4UV8A 4RQFA 2WLIB 4R50A 4WFBV 2B5UA 4J9ZB 4J9YB 1H8HG 1K97A 3OM3B 2EJRA 2ZDIC 4N23A 1KP3A 1F4MA 3MHHC 1GKFA 4U7NA 4FK5C 5LGNA 2JJ1G 5LGUA 4UV9A 3LDEA 1OHHG 1P4RA 1OCCC 3JD2A 4YXWG 2JDIG 3G4SV 4PDVA 3B8NA 2UXNA 1OCCB 1R3LC 4HAMA 4HYOA 3QNEA 2DWEC 4JAVA 1MOFA 3W7SA 3I56V 1I5YA 1MG1A 2X7RB 3ZN1A 5L3BA 3LDDA 3FB5C 1H38A 1V55C 5KA5A 2BOBC 2K1EA 3CC2V 2YEVB 1NR1A 2DQ0A 3CPWU 1E1QG 3LUTB 2EIJC 3HPLC 3OR7C 1V55B 4JPRA 4X89A 1QLEC 4H37A 1FXHA 2EZPA 3BEHA 1H8EG 2EIJB 2ZXWC 4WCEV 4XDJA 2HR3A 3ZJZA 3AG2C 1VQLV 1QLEB 3WG7C 4U7OA 4I5SA 4JYBA 1NKDA 1OCRC 3SPIA 2XAFA 5CA3A 3AG2B 4MVRA 4HZ3A 3WG7B 3KG2A 3P30A 1F4NA 3SYPA 3T4DA 1JQ0A 4MVMA 5HFMA 3CCLV 5LHIA 1OCOC 1OCRB 1XL4A 3OMAB 4RUEA 3OGCC 4X88A 1OCOB 4WFEA 3CD6V 2EINC 3X2QC 3PJSK 1K4CC 1AR1B 4GX1A 2EINB 2XOKG 2P67A 3CCUV 1VQ8V 3X2QB 1HWYA 3CP1A 4UUJC 1FFTB 4KFMA 4UVAA 2FTKA 1PD3A 2WLKA 1Q86W 4GX0A 3E8FA 2HKOA 2CK3G 5L3FA 4RQEA 5KUMA 4CZZA 4MVOA 3CCEV 3SPGA 1VQMV 3OW2U 1QBZA 2WLLA 3JYCA 3FYIB 1M57C 1FXVA 4EKWA 1R6NA 4TSFG 3GB7C 4PELA 4TWKA 2XAGA 5B1BC 2ITCC 1KD1W 1M57B 4Z1MG 2JIZG 5BZBA 4MW8A 2EIKC 1DLBA 5B1BB 1N8RW 2P7TC 3ASNC 3K0GA 1JOYA 3G6EV 1P7BA 2PI4A 2AHYA 4RO2A 4WFFA 2EIKB 3OR6C 1VQNV 1GMGA 2NLJC 3ASNB 1GM9A 3QO5A 4KUMA 3CXCU 2JEUA 3OMNB 1YTFB 2WLJA 1M90W 3T1CA 3VOUA 2EBOA 2JEXA 3T4ZA 2WLIA 2X6CA 4FPPA 5CMUA 3ZMUA 2OTJV 2ZDIA 2Z3YA 4DO2A 2DWDC 3CMAV 1VQ7V 1K4DC 4ZKIA 1AJQA 4BIZA 2X0LA 1XL6A 3FKSG 1G4YB 3LSSA 1RM1C 1QCEA 2Z5UA 3OUFA 4LP8A 1VQ5V 4UXNA 3IFXA 1RM1B 2WLHA 5C93A 4GX2A 3E83A 1VQKV 1NH2B 2Q69A 1R3IC 1J95A 1L1FA 2DW4A 4X8AA 4R8CA 3ZMVA 1Y4MA 2V7QG 3OUSA 1CP9A 3A0RA 2Y69C 3AG1C 4FJCC 3RVZA 5FL7G 2Y69B 3AG1B 4RUFA 1GO3F 2ZQMA 1K8AW 4RAIA 1MABG 1M56C 1R6KA 5CBHA 1E1RG 4FIPC 2EIMC 4BW5A 2QE7G 4FMTA 3CCSV 1M56B 5CN0A 2EIMB 4PDMA 3I55V 2XAJA 1S76D 3NXSA 5L3CA 5IYDO 4PDLA 2IJJA 2KB1A 4UVCA 5H6RA 4P9OA 4MW3A 1NVPD 4I9WA 3ABMC 3H01A 3JCZA 1Y66A 3RVYA 3T2MA 1KECA 2YSUB 1E79G 3K3WA 3ZN0A 1COWG 2A79B 3ABMB 3SYQA 1YSCA 2ZXWB 2ATKC 4XDKA 5IDJA 2XAHA 2WWWA 3B77A 3LSQA 1BMFG 1YJ9V 3SJQC 3SPJA 2HFEC 2HG5C 4PDRA 2LP7A 4CBCA 2X6AA 3D3IA 2JJ2G 3FB8C 1FXKC 2M7WA 3OMIB 4MS2A 4F4LA 1K34A 3HB3B 5IYBO 5DM6V 1SETA 5L3EA 3F7VC 1R73A 3W7TA 3SYAA 1FXKB 1YITV 3RW0A 3ETEA 4MT8A 3ZCCA 3ZMZA 3M99B 4QE7A 1IXMA 2C2AA 3JD0A 3LNMB 5L3GA 4PA6A 1QVGU 1K7DA 2ITDC 2P6JA 2P90A 3GWOA 2HLDG 1VQOV 1S5HC 2IH3C 3SYCA 3TETA 2IW5A 2EILC 3ABUA 3K08A 5LHHA 2NNUA 2Q6AA 2WLMA 4PA9A 3SPCA 4H33A 3OEEG 2B1IA 2EILB 2OT5A 4LCUC 1JVMA 1F23A 1W0KG 2IU0A 1KKDA 3OAAG 5B3SC 3TK1A 2OCCC 2LFSA 3P32A 2H94A 3OEHG 3W7WA 3ASOC 3UM7A 2IJHA 4BIUA 3E86A 5B3SB 1M1KW 2AHZA 2BOCC 1CEZA 1YI2V 3ASOB 1OZ0A 1JX9A 3D36A 3JD3A 2DYRC 4TT3G 4QPKA 1KQSU 2JK5C 2IH1C 5B1NA 1WPXA 4GX5A 1K92A 4P2ZA 4QNHB 3EFFK 1AROP 2WPDG 3CCRV 2QKSA 3R65A 1FS0G 1SRYA 5L3DA 4MVZA 3E8GA 5EC1C 1K33A 2QM8A 1AJNA 4QIWF 2H8PC 1YTFD 1GM7A 1QVFU 3IC7A 1ENVA 4GCZA 2GHYA 3MD0A 2D3OW 4DXWA 5IY5C 2GSMB 1K3EA 1QR8A 1PNMA 2HVJC 2W6JG 3ZRVA 3ETDA 1K5QA 2XASA 3ABLC 1BHAA 5IY5B 2QEXV 1PKXA 2WLNA 3ABLB 1QLNA 1YHQV 5CBFA 4GT1A 4N21A 1SZTA 5GW7A 5LHGA 1GM8A 1BHBA 3G71V 1NR7A 2YEVA 2IJIA 4MVQA 4MVSA 3E89A 3K79A 3K04A 3K03A 1Q81W 2F43G 1YIJV 2ZR2A 3CCMV 4JTAB 5EBWC 4XDLA 4ZBMA 1R3JC 1NH2D 1AJPA 1K5SA 1ORQC 1QR9A 1YJNV 4JAUA 4QPJA 3SYOA 4UVBA 3CCVV 5LBQA 2ZR3A 4MTOA 1THZA 5H9CA 5KUKA 1H2GA 1NQTA 4PA7A 2ZD9A 4JF3A 3ABKC 3VBBA 4P30A 1K73W 4WF9V 3ZRWB 2XNDG 3ABKB 3F5WC 3OE7G 2QA4V 4G28B 3W7UA 1FXKA 3AEIA 2W0FC 2W6IG 4G2KA 2A9HA 2IJKA 1AI4A 2WSSG 1NVPB 1JPXA 4PA3A 3ABTA 3ZRXA 1WLEA 5J9PC 1Q7YW 2OTLV 5CBGA 1SERA 4WFHA 1VQPV 3JD1A 4R6ZA 1AI7A 1GTOA 1Q82W 1NJIW 4JGSA 2QTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H33 A;  4LCU C;  1JVM A;  1KKD A;  3LDE A;  1V54 C;  4QE9 A;  5B3S C;  1OCC C;  5E1A C;  2OCC C;  2DWD C;  5EC2 C;  1K4D C;  4PDV A;  2A0L A;  3ASO C;  3STZ C;  4PA4 A;  3UM7 A;  2HVK C;  3E86 A;  1XL6 A;  1G4Y B;  1R3L C;  2AHZ A;  4HYO A;  2BOC C;  2DWE C;  3OUF A;  4LP8 A;  2X6B A;  2DYR C;  3IFX A;  2WLH A;  3E8B A;  3RBZ A;  2JK5 C;  2IH1 C;  4WFG A;  4GX2 A;  3AG3 C;  3LDD A;  3E83 A;  3FB5 C;  1V55 C;  4GX5 A;  4P2Z A;  2BOB C;  2K1E A;  4QNH B;  3EFF K;  2Q69 A;  1R3I C;  1J95 A;  3LUT B;  2QKS A;  2EIJ C;  3HPL C;  3R65 A;  3TCU A;  3OR7 C;  4X8A A;  4MVZ A;  3E8G A;  4R8C A;  4X89 A;  5EC1 C;  1QLE C;  4H37 A;  3OUS A;  4G27 B;  2Y69 C;  3FB7 C;  3AG1 C;  2H8P C;  3BEH A;  2ZXW C;  4XDJ A;  3AG4 C;  3RVZ A;  3ZJZ A;  3AG2 C;  3WG7 C;  4R7C A;  4DXW A;  5IY5 C;  4RUF A;  1OCR C;  2HVJ C;  4MTF A;  3SPI A;  4MVU A;  3ABL C;  4MVR A;  4HZ3 A;  4RAI A;  2R9R B;  3KG2 A;  3SYP A;  3T4D A;  1M56 C;  4MVM A;  5CBH A;  1OCO C;  1BL8 A;  1XL4 A;  2EIM C;  4BW5 A;  4JTD B;  4RUE A;  2WLN A;  5EBL C;  2DYS C;  3OGC C;  4X88 A;  5CBF A;  3K06 A;  4WFE A;  4PDM A;  1ZWI C;  2EIN C;  3X2Q C;  4PDL A;  3PJS K;  2KB1 A;  2YEV A;  1K4C C;  4P9O A;  4MW3 A;  4GX1 A;  4MVQ A;  4MSW C;  4MVS A;  4I9W A;  3ABM C;  3SPH A;  3E89 A;  3K04 A;  5EK0 A;  4UUJ C;  3RVY A;  3T2M A;  4KFM A;  4LBE C;  3K03 A;  5B1A C;  2A79 B;  3SYQ A;  2WLK A;  4JTA B;  5EBW C;  4XDL A;  4GX0 A;  4ZBM A;  1R3J C;  2ATK C;  3E8F A;  4XDK A;  3UKM A;  4JTC B;  2WLL B;  5KUM A;  4MVO A;  1ORQ C;  2HJF C;  4PA9 A;  3SPG A;  3F7Y C;  2WLL A;  3IGA C;  3JYC A;  3SYO A;  3SJQ C;  1M57 C;  3SPJ A;  2HFE C;  4EKW A;  2HG5 C;  4MTO A;  4PDR A;  4CBC A;  4TWK A;  3GB7 C;  5B1B C;  2X6A A;  5KUK A;  3FB6 C;  2ITC C;  1R3K C;  4PA7 A;  2ZD9 A;  3FB8 C;  3K0D A;  5BZB A;  4MW8 A;  3STL C;  2EIK C;  3ABK C;  4MTG A;  4MS2 A;  4P30 A;  5EBM C;  4F4L A;  2Q68 A;  2P7T C;  3ASN C;  3K0G A;  4OXS A;  1P7B A;  1OCZ C;  3F7V C;  3SYA A;  3ZRS A;  2AHY A;  4RO2 A;  4P9P A;  3F5W C;  4WFF A;  3RW0 A;  2Q67 A;  3OR6 C;  4G28 B;  2NLJ C;  2W0F C;  2A9H A;  4PA3 A;  5J9P C;  4QE7 A;  1LNQ A;  3E8H A;  3LNM B;  2WLJ A;  4PA6 A;  3LDC A;  5CBG A;  2ITD C;  3T1C A;  4WFH A;  3VOU A;  2WLI B;  1S5H C;  2IH3 C;  4R50 A;  3T4Z A;  3SYC A;  4R6Z A;  4J9Z B;  4J9Y B;  3TET A;  2EIL C;  2WLI A;  2X6C A;  3K08 A;  2Q6A A;  2WLM A;  3SPC A;  2QTO A; 
#chains in the Genus database with same CATH topology
 1NI8 A;  1DTO A;  3MHS C;  1AI6 A;  2KSD A;  3B2E E;  3L74 H;  5EC2 C;  3CCQ V;  1LR1 A;  1V54 B;  4FM1 A;  2CTR A;  2FYU H;  1Y76 B;  3CYO A;  3KCX A;  4ZOL B;  4BAY A;  2Q0O C;  3RBZ A;  4BR6 A;  4PHZ A;  5HFL A;  1AIL A;  1SA0 A;  4LFC O;  3H1J H;  4G27 B;  3FB7 C;  3ZS8 C;  4LH7 A;  1ZAU A;  4R7C A;  2AXT Z;  4K35 A;  2E75 B;  4FM0 A;  4JI8 O;  3CB2 A;  4JI1 B;  5H6Q A;  1WNS A;  1NTM H;  4W4K A;  1BL8 A;  3QTC A;  1AP6 A;  3SJA C;  2PI5 A;  4L87 A;  3BVO A;  2PTM A;  1B06 A;  2CE4 A;  1MMM A;  1ROP A;  4MSW C;  4NTY A;  3RYI B;  4Q20 A;  1HNZ B;  2EX3 A;  4LWS B;  4FFB B;  4IHJ A;  1JJ2 U;  3ETG A;  4Q6G A;  1DF4 A;  1XMO O;  1VQ4 V;  5LGT A;  4FLZ A;  2ZIO A;  4O4J A;  4JTC B;  3N2K A;  4LC1 A;  5B1A B;  1N34 B;  2HJF C;  2ETN A;  3HKC B;  3DC5 A;  1TUE B;  4KHP O;  1HNX B;  3K5N A;  1KB9 F;  1W0J G;  1BQ0 A;  3OD4 A;  3ZMT A;  1P49 A;  5JH7 A;  3K0D A;  3STL C;  5EZY B;  4X62 B;  1DF5 A;  1OCZ B;  1O9H A;  3E8H A;  3KZI Z;  1W2B U;  2WLI B;  2A06 H;  1XOU A;  2B5U A;  1IUR A;  4J9Z B;  2ZDI C;  5K1X A;  4U7N A;  4FK5 C;  4LF8 B;  2LQT A;  3AK1 A;  5LGU A;  1EN6 A;  1JFF B;  4YHH O;  1OCC C;  3JD2 A;  3TGU H;  2ADQ B;  4LNU B;  4YJ2 A;  4ZIB A;  1Q5O A;  4OX9 O;  1SZX A;  3I56 V;  4Z2W A;  3ZN1 A;  2CTP A;  2DQ0 A;  3CPW U;  1QU7 A;  3OR7 C;  1Q6H A;  3PN1 A;  1QLE C;  1HNW O;  4TUY B;  5KAI Z;  5KX5 A;  2EZP A;  4XDJ A;  5LMU B;  4O4H B;  4I5S A;  4JYB A;  3SPI A;  4JI2 O;  2F23 A;  3AG2 B;  5IE9 A;  3WB2 A;  3P30 A;  3RT3 C;  3K5L A;  4DV6 O;  3CCL V;  1OCO C;  2LW1 A;  4X88 A;  2QWQ B;  4WFE A;  1Z5W A;  2JS5 A;  4WBN B;  5IT9 N;  2EIN B;  2UUB O;  2P67 A;  1VQ8 V;  1J5E O;  4LF7 B;  4B3T B;  4UVA A;  4O4L B;  1PD3 A;  1BT8 A;  4GX0 A;  3ZHR A;  4LH6 A;  2HKO A;  2ZNI A;  4RQE A;  3CCE V;  3FYI B;  4TWK A;  2ITC C;  4I7Z B;  3AG7 A;  2A7W A;  1JOY A;  3G6E V;  4GKK B;  2PI4 A;  2CTQ A;  2EIK B;  1TGO A;  2NLJ C;  1GM9 A;  3QO5 A;  5KHG A;  1NU1 H;  3OMN B;  2UXB O;  2Q5Z A;  2JEX A;  3T4Z A;  2X6C A;  1DGS A;  3VQV A;  4D7S A;  2OTJ V;  4DO2 A;  2HHH O;  1BE3 H;  2K9P A;  1K4D C;  1AJQ A;  3A8T A;  4X66 O;  1WN7 A;  1I0H A;  4JI6 O;  2WLH A;  5IWA B;  1LUV A;  2CUG A;  2BTO A;  3E83 A;  4ZHQ A;  5JQG B;  2GUZ A;  4R8C A;  5K1P A;  1Y4M A;  3DC6 A;  2M6Y A;  1W59 A;  2V7Q G;  3AG1 C;  4FJC C;  1FYJ A;  3WB1 A;  3ZBH A;  1PL4 A;  5LL6 Y;  2Y69 B;  3K59 A;  1K8A W;  4DUZ B;  5CBH A;  4Z1V A;  2YC0 A;  4DR1 B;  4FLU A;  1I7F A;  4LF4 O;  2EIM B;  4PDM A;  3I55 V;  3NXS A;  4PDL A;  2PZS A;  4DR7 B;  3BHP A;  4F6E A;  2JGD B;  1FPO A;  3L72 H;  4O4I B;  1NVP D;  3ABM C;  1AR5 A;  4J41 A;  1COW G;  3EVK A;  4J42 A;  2ZXW B;  3ZHT A;  2W0X A;  1XMQ B;  2XAH A;  3B77 A;  1BMF G;  5KHH A;  1A32 A;  4JI7 O;  3SJQ C;  3UT5 B;  4UB6 Z;  2UXC O;  1Q8I A;  4CBC A;  2X6A A;  4CS3 A;  4K0K O;  2Q7G A;  1UPG A;  1IBL O;  4MS2 A;  4NKG B;  1FXK B;  1ZSP A;  3L73 H;  3ETE A;  1EN4 A;  3T1Y B;  2EJ7 A;  3CXH F;  3LNM B;  5KMG B;  4PA6 A;  1QVG U;  1K7D A;  2ITD C;  4PI2 A;  2HLD G;  1S5H C;  1S5J A;  4DV4 O;  1NTK H;  2AZ0 A;  4I9Q A;  1Z2G A;  2BTQ A;  1R1B A;  4H33 A;  4UCS A;  4B3R O;  4DR5 O;  5GON A;  1RSO A;  2LFS A;  4B3M O;  2RDC A;  5B3S B;  4BIU A;  1VMG A;  1M1K W;  1YI2 V;  1OZ0 A;  3D36 A;  1BQZ A;  4LF6 B;  2DYR C;  5BMV B;  4QPK A;  1I94 O;  1XHZ A;  5B1N A;  3G67 A;  1WPX A;  1FJG B;  4P2Z A;  4I0X B;  4QNH B;  2PYJ A;  3EFF K;  1FKA O;  2ILM A;  5EC1 C;  2QM8 A;  4QIW F;  3DSQ A;  4JZ2 A;  1ENV A;  3I5D A;  4O2A A;  5IY5 C;  2GSM B;  3QF7 A;  4DW0 A;  2W6J G;  3QVN A;  4K8X A;  5BR8 O;  4AQY B;  3ICX A;  1BHA A;  3K5M A;  2YIB A;  4N21 A;  1JR9 A;  1SZT A;  4PD4 F;  5LHG A;  3K58 A;  3SDL A;  1GM8 A;  1BHB A;  3O9O A;  1NR7 A;  2YEV A;  4GUN A;  3RGB A;  3K79 A;  5CA0 B;  4B3S B;  3CJH A;  1MA1 A;  1NH2 D;  1AJP A;  1K5S A;  1ORQ C;  2VRZ A;  1RFY A;  4QPJ A;  2O57 A;  2ZR3 A;  4MTO A;  1THZ A;  1Q3E A;  4DR3 B;  4LFA B;  5FPR A;  1IXB A;  3ABK B;  1NVP B;  2YIB D;  4PA3 A;  1WLE A;  4EB6 A;  1M93 A;  4WFH A;  4JI0 B;  3BAA A;  4R6Z A;  2RQ6 A;  1Q82 W;  4LF5 B;  5DED A;  1NJI W;  3JAT B;  4RWU A;  4ASU G;  2DQ3 A;  3A0H Z;  4IT5 A;  2MW2 B;  1I5X A;  3JAR A;  3STZ C;  3QO7 A;  4PA4 A;  5LP6 A;  2VQE O;  2IU3 A;  1XNR B;  2MK3 A;  1Y74 B;  1AI5 A;  5B1O A;  4WFG A;  1M5I A;  1N32 B;  3CRM A;  2UXX A;  4ZI7 B;  1SES A;  3TCU A;  2LFR A;  5J2U B;  1YZB A;  2F95 B;  3ZMS A;  1MSW D;  1S77 D;  1OJH A;  2IM9 A;  2EZO A;  3TJT A;  1G1X B;  1VQ6 V;  2UU9 B;  2OCC B;  4L8J A;  2R9R B;  1JCH A;  4D6T H;  3HKE B;  3K9A A;  4H13 B;  4MTX A;  2D2C B;  1HNZ O;  3K06 A;  3OFN G;  2EUL A;  4DR2 B;  1ZL8 A;  2E5L B;  5H5N A;  3T1H B;  5EK0 A;  1WAZ A;  4JYC A;  3FYE B;  1GK9 A;  1HNX O;  5JJN B;  4YY3 O;  2YI9 A;  3B8M A;  4FZ1 A;  2WLL B;  2OWO A;  3F7Y C;  5ITZ A;  4XBF A;  2QM7 A;  3EXA A;  2N04 A;  2V1D A;  3DGE A;  1PNK A;  1VQ9 V;  4IIJ B;  4X62 O;  2RJZ A;  1PL0 A;  1XDC A;  5LXT B;  1PPJ H;  5CB4 B;  3OGI B;  4NXN B;  2RMK B;  4OXS A;  3ZRS A;  1VIB A;  1XBL A;  1UJW B;  3ZRW A;  4P9P A;  4J7J A;  4E2L A;  1SKV A;  1S3J A;  3E35 A;  4WFA V;  2UUC B;  3LDC A;  4NVP A;  1FD9 A;  4DUY O;  4R50 A;  1M4U A;  2EJR A;  3LSU A;  3MHH C;  1GKF A;  2JJ1 G;  2BSK B;  3JSN A;  4UV9 A;  1Q6I A;  3B8N A;  1OCC B;  3IAY A;  2R70 A;  3B09 A;  4E4E A;  1MG1 A;  2X7R B;  5L3B A;  1H38 A;  3FB5 C;  5KA5 A;  2K1E A;  1VEW A;  2YEV B;  1E1Q G;  3LUT B;  3FX7 A;  1IBK B;  1VF6 A;  3SR2 C;  4TOI A;  4X89 A;  3VQW A;  3BEH A;  1H8E G;  4I4T B;  1VQL V;  1QLE B;  3WG7 C;  2H3O A;  1UFI A;  1OCR C;  2XAF A;  2PUS A;  5CA3 A;  4HZ3 A;  2Q7E A;  1F4N A;  4OPH A;  4DR4 O;  2Q9L A;  4RUE A;  4DRX B;  1WA8 A;  3WB0 A;  4H0L B;  2CAZ C;  4LF7 O;  1B3Q A;  4B3T O;  1OCO B;  1URF A;  5E79 Z;  3GVM A;  3X2Q C;  1GAX A;  4X65 O;  4I50 A;  4FVM A;  1K4C C;  1AR1 B;  4GX1 A;  1U97 A;  2V4D A;  4UUJ C;  4UFZ A;  2FTK A;  1NZ6 A;  3HKB B;  3JAM N;  2P06 A;  2CK3 G;  2HEP A;  5KUM A;  4CZZ A;  4MVO A;  1VQM V;  1F7Y A;  3OW2 U;  1QBZ A;  4TQF A;  1M57 C;  3C3S A;  2DN9 A;  2P5O A;  5JWP A;  2F4V B;  4TV8 A;  1D2D A;  1QNM A;  3GB7 C;  5B1B C;  1KD1 W;  4A5U B;  3OTF A;  5BZB A;  2JS3 A;  1XUQ A;  3ASN C;  3F5T A;  4JZG A;  1P7B A;  5C8Y B;  2AHY A;  4IYI A;  4X1I B;  1GMG A;  3CXC U;  3CRR A;  4KUM A;  2JEU A;  1YTF B;  4JAA A;  2WLJ A;  3RYH A;  2KQX A;  5KHI A;  1KU9 A;  3THO A;  2GTS A;  2L6L A;  3Q4H A;  4CC5 A;  5LA6 B;  3D36 C;  4CH6 A;  1VQ7 V;  4ZKI A;  1VP7 A;  1D5A A;  1NTZ H;  1XL6 A;  1SQB H;  4DW1 A;  2JGU A;  3N2G A;  1QCE A;  4LP8 A;  1VQ5 V;  5C93 A;  4CS2 A;  1VQK V;  2Q69 A;  1J95 A;  1GH6 A;  2DW4 A;  4X8A A;  1CP9 A;  4DUZ O;  4DV7 B;  2UUA B;  1JJO A;  3AG1 B;  4RUF A;  4YJ3 A;  1PV0 A;  1R6K A;  4DR7 O;  1E1R G;  3JAS A;  2QE7 G;  2F66 C;  2QWO B;  1TVK A;  5L3C A;  4UCT A;  3UCS C;  4UVC A;  4LFB O;  1SQQ H;  4I9W A;  3H01 A;  3JCZ A;  3T2M A;  1KEC A;  2FML A;  5JCO A;  5LOV A;  3ZN0 A;  4EFB A;  4DV1 B;  2A79 B;  3ABM B;  2G38 A;  3JAK B;  3APQ A;  2QKC A;  3RYF B;  2YI8 A;  1YJ9 V;  2DMX A;  5TIS Z;  1FFX A;  2VQF B;  2NN4 A;  3SPJ A;  3HR0 A;  4PDR A;  1P84 F;  3D3I A;  2JJ2 G;  3FB8 C;  2UXD O;  1GN4 A;  2M7W A;  5EYP B;  4DV0 B;  5IYB O;  5L3E A;  1SET A;  2DJV A;  3APO A;  4X1Y A;  4F6R A;  3ZCC A;  3GWK C;  3ZMZ A;  2ZM6 O;  1IXM A;  2C2A A;  3OTO B;  3RYC A;  2P6J A;  3GWO A;  4PJ0 Z;  1O9G A;  2HJD A;  3SYC A;  5F2V O;  3TET A;  2IW5 A;  4GZR B;  2YID A;  5IJ0 A;  2NNU A;  4PA9 A;  3CS5 A;  4DV3 B;  2OT5 A;  5LP6 C;  1F23 A;  1KKD A;  1IBM O;  3OAA G;  1WB7 A;  4LF6 O;  3P32 A;  1N36 B;  4ICG A;  1EM1 A;  3W7W A;  3SJB C;  3UM7 A;  2IJH A;  3BA9 A;  1CEZ A;  3U10 A;  3JD3 A;  4TT3 G;  2WA4 A;  3JAW A;  4GX5 A;  1K92 A;  4JI8 B;  2GDS A;  1ARO P;  1SA0 B;  2QKS A;  5L3D A;  4MVZ A;  2E74 B;  4AQY O;  2CGO A;  2WA3 A;  1QVF U;  3IC7 A;  2PGG A;  2N05 A;  3NR7 A;  4CH3 A;  3MD0 A;  4J80 A;  4DXW A;  2QGN A;  3ETD A;  4I55 A;  1YF2 A;  2FKX A;  5IY5 B;  1MSD A;  1EZV H;  2QEX V;  1PKX A;  1QLN A;  2YUA A;  5CBF A;  2YS8 A;  3CX5 F;  1HW7 A;  4GT1 A;  1Y6X A;  4NXM O;  4HNA A;  2Y0P A;  1N33 B;  5CA1 A;  4KHP B;  3E89 A;  4IHJ B;  4DV2 O;  5FLX N;  2GTA A;  2F43 G;  2Q7H A;  3CCM V;  3CHX A;  4O4J B;  4X9Q A;  3N2K B;  4FLT A;  5BXZ A;  3CEI A;  1IDS A;  4DR3 O;  2OCH A;  4DK0 A;  5IYZ A;  4UVB A;  4LFA O;  3CRQ A;  4U3J A;  1XRE A;  5BY1 A;  1BCC H;  5JH7 B;  4PA7 A;  2ZD9 A;  4JF3 A;  3C90 A;  2QDO A;  3BRC A;  4P30 A;  1K73 W;  2KG7 A;  1AP5 A;  4JI0 O;  2F1M A;  3K57 A;  2YIA A;  4JI4 B;  2XND G;  3F5W C;  3OE7 G;  4G28 B;  3W7U A;  3AEI A;  1YEW A;  1JPX A;  4YHH B;  5KAF Z;  4TV9 A;  1Q7Y W;  4YIP A;  5GTH Z;  3JD1 A;  3L70 H;  4OX9 B;  1AI7 A;  4LF9 O;  2Q4P A;  1K9M W;  1XNR O;  3S3X A;  4QE9 A;  2RNB A;  5E1A C;  1MZF A;  4UCO A;  1XEQ A;  2RCV A;  4YJ2 B;  5B5E Z;  5B66 Z;  1HR0 B;  2A0L A;  2HVK C;  1N32 O;  3VQX A;  1VF6 C;  4NB5 A;  2WAM A;  3AG3 C;  5LMN B;  1EBO A;  3SJC C;  3JAL A;  3IC9 A;  5KX5 B;  1XNQ O;  2FB5 A;  3ZIA G;  2UU9 O;  3J7A U;  2XAQ A;  3AG4 C;  1VF7 A;  2RN9 A;  2Y0I A;  1EZJ A;  4MVU A;  2UUB B;  4FLW A;  1J5E B;  3L75 H;  2E3C A;  1LUW A;  2E5L O;  4JTD B;  5EBL C;  4CH4 A;  2DYS C;  3K5O A;  3BPZ A;  5J2T A;  3G6B A;  1IZ3 A;  3FAV A;  4DYL A;  3P3N A;  5KA6 A;  2Z0A A;  4X20 A;  4LBE C;  4FLX A;  1WP7 A;  1S0V A;  1RPO A;  3QO8 A;  4AI8 A;  1TA8 A;  5IYC O;  4IGG A;  2UXB B;  1VF5 B;  3JD4 A;  2ARH A;  1R3K C;  3R66 A;  5EBM C;  1Q43 A;  3ZHQ A;  2JRI A;  1S72 V;  3S3W A;  2Q67 A;  1NS1 A;  1G8M A;  1KUQ A;  3JAW B;  4GKJ B;  4JI5 B;  3H9V A;  2JVD A;  1K97 A;  4X1K A;  4X66 B;  3BCC H;  4N23 A;  2Q73 A;  1F4M A;  3L9D A;  2ZIN A;  3LDE A;  5JVD A;  1P4R A;  4NTX A;  4YXW G;  3ZHV A;  2QR4 A;  2UXN A;  1P7G A;  1R3L C;  4HAM A;  4HYO A;  3QNE A;  2YXY A;  1MOF A;  1Y76 A;  4ZOL A;  4ZHQ B;  3LDD A;  1V55 C;  4UCV A;  2GUZ B;  3RFR A;  2EIJ C;  3U11 A;  4CC6 A;  1FXH A;  2QWN B;  2ZXW C;  4WCE V;  1TUB A;  3ZJZ A;  4U7O A;  2LGW A;  3L71 H;  4MVR A;  3WG7 B;  3KG2 A;  1GN6 A;  3SYP A;  4OPA A;  3T4D A;  1OCR B;  1XL4 A;  3ZHS A;  2A3Q A;  3CD6 V;  5JCO C;  3PJS K;  1PM9 A;  4JI7 B;  4JI1 O;  3X2Q B;  1FFT B;  3RYI A;  3JCU Z;  4CS4 A;  4TV9 B;  3N27 A;  2F4V O;  1IBL B;  4B08 A;  3E8F A;  4EFE A;  3SPG A;  1KYO F;  3HKC A;  2LW7 A;  1G6U A;  1M57 B;  4Z1M G;  4DV4 B;  4MW8 A;  5B1B B;  2P7T C;  3K0G A;  1N34 O;  4KL1 A;  5EZY A;  2CH7 A;  1VQN V;  3ASN B;  4B3R B;  4FFK A;  3VOU A;  4B3M B;  2EBO A;  3JAL B;  1AR4 A;  2BTQ B;  1RP3 B;  2WLI A;  1FAF A;  4O2B A;  1I94 B;  4FPP A;  5KHJ A;  3ZMU A;  2DOS A;  5GON B;  1RSO B;  2QM4 A;  2Z3Y A;  1JFF A;  2AW9 A;  4BIZ A;  1JMK C;  2X0L A;  3FKS G;  1G4Y B;  3LSS A;  1L0L H;  1RM1 C;  3DXR A;  5D5Q A;  4UXN A;  3IFX A;  4LF8 O;  1NH2 B;  1SS3 A;  3O65 A;  2R9A A;  3ZMV A;  3OUS A;  3SGI A;  2ZE8 A;  2ZNJ A;  4O2A B;  5FL7 G;  4TUY A;  1GN2 A;  3JSL A;  1JA8 A;  1GO3 F;  2ZQM A;  4O4H A;  1WPB A;  3ETQ A;  2R72 A;  3TXQ A;  1M56 C;  4FIP C;  3E22 A;  4J11 A;  4OGQ B;  4FMT A;  3CCS V;  5CN0 A;  1S76 D;  2XAJ A;  3FD9 A;  4DV1 O;  3UQ8 A;  2QSA A;  5LMU O;  4P9O A;  4WBN A;  4MW3 A;  3CJH B;  5FNV A;  3RVY A;  3VQY A;  2YSU B;  1E79 G;  3K3W A;  3CSX A;  2VQF O;  3HKD A;  1WP8 A;  1YSC A;  4O4L A;  1N0J A;  2ATK C;  5KLV H;  5EIB D;  4BIO A;  1QHT A;  2HFE C;  1D5N A;  3RWR D;  2LP7 A;  1EN5 A;  1HP8 A;  5JVD B;  2XTA A;  5A2Q N;  3OMI B;  3A0B Z;  1YXB A;  3TXS A;  4F4L A;  2XUM A;  3OTO O;  3HB3 B;  3F7V C;  3SYA A;  1YIT V;  3RW0 A;  1YDX A;  4MT8 A;  4EB6 B;  1BGY H;  2ODM A;  4QE7 A;  4K8Z A;  3JD0 A;  4DV3 O;  1VQO V;  1BS3 A;  4JV5 B;  2VQE B;  2EIL C;  3ABU A;  3BFR A;  1DK1 A;  3K08 A;  2Q6A A;  2ZE5 A;  1N36 O;  4GKK O;  1JVM A;  1TUB B;  2IU0 A;  1W0K G;  3JAR B;  3TK1 A;  2VWK A;  2OCC C;  1BSM A;  3BAB A;  5LP6 B;  2H94 A;  3ASO C;  3E86 A;  4JYA B;  2AHZ A;  2ZIM A;  3KKY A;  3G80 A;  2BOC C;  3H1I H;  1JX9 A;  2HP8 A;  1KQS U;  1GRJ A;  2JK5 C;  2IH1 C;  4GLX A;  4FLV A;  1AB3 A;  4DV5 B;  5KHK A;  3IJ4 A;  1WJZ A;  4IYH A;  2WPD G;  1YCI A;  4IL6 Z;  1SRY A;  5JQG A;  3E8G A;  2H8P C;  3CRA A;  1GM7 A;  4GCZ A;  5IWA O;  2D3O W;  1OV9 A;  1IVS A;  1K3E A;  3ZRV A;  1PNM A;  4FLY A;  1K5Q A;  3ABL C;  1SQV H;  4DR6 B;  2WLN A;  1N33 O;  4YY3 B;  5GW7 A;  1ZL8 B;  2IJI A;  4QGP A;  1S5L Z;  2CH7 B;  1H2S B;  2JGD A;  3K04 A;  4O4I A;  3ZED A;  4JI3 B;  1ZUQ A;  4DR1 O;  4XDL A;  1R3J C;  4W4L A;  5ITZ B;  1QR9 A;  4O2B B;  3RN4 A;  3CCV V;  3QG5 A;  5LBQ A;  3UT5 A;  4JI4 O;  4DUY B;  1NQT A;  3MDS A;  1XMQ O;  3ZRW B;  4HBN A;  3DXR B;  1FXK A;  2W0F C;  4G2K A;  2A9H A;  2IJK A;  1AI4 A;  2WSS G;  2OTL V;  5J9P C;  3ABT A;  2AZ2 A;  1SER A;  5KMG A;  1VQP V;  1H2L A;  2IBZ H;  1GTO A;  3C3T A;  4JGS A;  1HR0 O;  2QTO A;  2R9I A;  5DN6 G;  4H44 B;  4X64 B;  3T1Y O;  1V54 C;  1YJW V;  1I08 A;  3AK3 A;  3CC7 V;  2XT9 A;  5LMN O;  2Q0A A;  3B4S A;  3E22 B;  2X6B A;  1ZX3 A;  4KP4 A;  3E8B A;  3D8C A;  5BMV A;  3CC4 V;  3CCJ V;  1U96 A;  3AG3 B;  4I0X A;  5FNV B;  3WFV A;  4DR4 B;  2PYL A;  3CE2 A;  1Z5V A;  3HKD B;  1RPR A;  1KC8 W;  4X65 B;  3AG4 B;  5H2F Z;  4MTF A;  1FJG O;  4LFC B;  4GYC B;  5IJ9 A;  3H1H H;  1WA8 B;  1B6Q A;  2GBO A;  1L8D A;  1KP2 A;  4YIO A;  2B1G A;  3E2E A;  4QJF B;  1ZWI C;  2DYR B;  2Y48 A;  4I50 B;  2DYS B;  1L0N H;  3CME V;  4UCU A;  1EFR G;  3SPH A;  1F51 A;  3EHB B;  1T5E A;  5CA0 A;  1PNL A;  5B1A C;  1NBM G;  1X59 A;  3M8A A;  3UKM A;  3A2F A;  3ML0 A;  4JAS A;  3IGA C;  4TV8 B;  3BY6 A;  1XMO B;  3W7X A;  4B3S O;  2YXH A;  1XIL A;  3FB6 C;  4MTG A;  1XHX A;  1Y67 A;  2Q68 A;  4GKJ O;  4JI5 O;  1OCZ C;  2ZT9 B;  1CPY A;  1M9N A;  1H2M A;  3DTU B;  1SQG A;  3RYH B;  1LNQ A;  4UV8 A;  4RQF A;  4WFB V;  2N74 A;  4J9Y B;  2ZE7 A;  1H8H G;  3OM3 B;  3Q4H B;  5FPO A;  1KP3 A;  5JJJ B;  4JYY A;  2VS0 A;  5LGN A;  2PF4 E;  3JAT A;  1OHH G;  5GTI Z;  2JDI G;  3G4S V;  2KKW A;  4PDV A;  3WU2 Z;  2XHB A;  3N2G B;  3UO2 A;  4LF5 O;  1VAR A;  2DWE C;  4JAV A;  1X4T A;  3W7S A;  1I5Y A;  5EIB C;  1Y74 A;  4NTW A;  2BOB C;  3CC2 V;  1NR1 A;  3HPL C;  4ZI7 A;  1V55 B;  4JPR A;  4H37 A;  2EIJ B;  5LYJ A;  1H2K A;  2HR3 A;  4BW9 A;  3AG2 C;  4YJ3 B;  5J2U A;  1SC5 B;  5AG2 A;  4LFB B;  1NKD A;  2VWJ A;  2LJ2 A;  1HNW B;  3JAS B;  5HFM A;  1JQ0 A;  4MVM A;  5LHI A;  3OMA B;  3HKE A;  1TVK B;  3OGC C;  1GN3 A;  4JI2 B;  2EIN C;  4DV6 B;  2FL4 A;  2B9Z A;  2QTS A;  2XOK G;  5LOV B;  3CCU V;  3ZHU A;  1HWY A;  3CP1 A;  4KFM A;  2UXD B;  2WLK A;  1Q86 W;  1NT2 B;  2CDY A;  5L3F A;  1FFX B;  4LR3 A;  1MZE A;  2WLL A;  3JYC A;  4DR2 O;  1FXV A;  2ZM6 B;  4EKW A;  3T1H O;  1SQX H;  1R6N A;  4TSF G;  4PEL A;  2XAG A;  4IIJ A;  2JIZ G;  4K3A A;  3OT7 A;  1Q6U A;  2EIK C;  1DLB A;  1N8R W;  3CWB H;  4F6R B;  4X1Y B;  5LXT A;  4TQD A;  5CB4 A;  3CRC A;  3D3Q A;  4RO2 A;  4WFF A;  2CTW A;  3OR6 C;  1H2N A;  3RYC B;  1IBM B;  3H1K H;  2L35 A;  4D7T A;  1M90 W;  3T1C A;  5IJ0 B;  4NXN O;  5CMU A;  2ZDI A;  2BSK A;  2UUC O;  2DWD C;  3CMA V;  4BWA A;  4KXR A;  5IJ9 B;  2Z5U A;  3OUF A;  3KCY A;  2HHH B;  1RM1 B;  4GX2 A;  3BA8 A;  4PV1 B;  4JI6 B;  1R3I C;  1L1F A;  2P22 C;  3A0R A;  1Q90 D;  2Y69 C;  3K9S A;  3RVZ A;  4I4T A;  4NXM B;  3ZX6 A;  4I55 B;  4B7E A;  4RAI A;  4FM2 A;  1MAB G;  4DV2 B;  2Y4T A;  1IBK O;  3AK2 A;  2OIG A;  2EIM C;  4BW5 A;  1M56 B;  5DEC A;  4DRX A;  4J7K A;  4HNA B;  4NR1 A;  1HDJ A;  5IYD O;  4J7Z A;  5CA1 B;  2IJJ A;  2KB1 A;  5H6R A;  4NYK A;  4UCR A;  4J10 A;  1Y66 A;  1BZK A;  4LF4 B;  2BE3 A;  2DE0 X;  1CXZ B;  3SYQ A;  2YIC A;  1V9P A;  4XDK A;  5IDJ A;  1IX9 A;  3HKB A;  2WWW A;  5IYZ B;  1US6 A;  3LSQ A;  4U3J B;  4UB8 Z;  4ABM A;  1SQF A;  2HG5 C;  1AVM A;  1XQ8 A;  2ZKO A;  2PY5 A;  3H1L H;  1FXK C;  1KBH A;  2QWP B;  2KG7 B;  3LNN A;  1K34 A;  2UXC B;  5DM6 V;  4LF9 B;  3J80 N;  1R73 A;  3W7T A;  4AHC A;  4JV5 O;  3UO3 A;  4DK1 A;  5C8Y A;  3M99 B;  4LWS A;  4FFB A;  4K0K B;  4X1I A;  5L3G A;  4U3F H;  2P90 A;  2QKA A;  4AIL C;  2IH3 C;  5JJE B;  5D5P A;  5LHH A;  3J81 N;  2WLM A;  3SPC A;  1N0N A;  3OEE G;  2B1I A;  2EIL B;  4JYA O;  4LCU C;  5LYJ B;  2NR5 A;  2YDE A;  3B40 A;  1TAE A;  5B3S C;  2Q8V A;  1N4C A;  5LA6 A;  1YVW A;  3OEH G;  4DV5 O;  1XNQ B;  4PI0 A;  2LO1 A;  2QJ1 A;  2F93 B;  3ASO B;  4DR5 B;  4FZ0 A;  3P3P A;  4CH5 A;  2BCC H;  1KKC A;  3CCR V;  2LGQ A;  1XI1 A;  3R65 A;  1FS0 G;  3U0Z A;  1K33 A;  1AJN A;  2QWR B;  1YTF D;  2GV9 A;  4DR6 O;  2GHY A;  1QR8 A;  2HVJ C;  2XAS A;  4LNU A;  4B7K A;  2YXL A;  3ABL B;  1WB8 A;  1YHQ V;  2ADP A;  3MAQ A;  4EEQ A;  1SF9 A;  2OIE A;  4DV7 O;  5J2T B;  5BR8 B;  2AGA A;  4JI3 O;  2UUA O;  1QQC A;  3FAV B;  3G71 V;  2OYQ A;  4MVQ A;  4MVS A;  1KMI Z;  4X20 B;  1PP9 H;  1R6T A;  2ZCE A;  1SQP H;  3K03 A;  1Q81 W;  4C7U A;  1YIJ V;  2ZR2 A;  4JTA B;  5EBW C;  4ZBM A;  3JAK A;  2P4K A;  1YJN V;  4JAU A;  3M7M X;  3SYO A;  3RYF A;  2E76 B;  5H9C A;  2CGN A;  5KUK A;  1H2G A;  2P4V A;  3ABK C;  3VBB A;  4WF9 V;  5EYP A;  2Y4U A;  2QA4 V;  1ZLZ A;  1ZTE A;  2W6I G;  3FFQ A;  5A9G A;  3ZRX A;  5CBG A;  1B04 A;  4X1K B;  4X64 O;  4DV0 O;  1MNG A;  2ZE6 A; 
#chains in the Genus database with same CATH homology
 2R9I A;  5DN6 G;  1K9M W;  4ASU G;  2DQ3 A;  1DTO A;  1V54 C;  1YJW V;  4QE9 A;  3MHS C;  1AI6 A;  5E1A C;  5EC2 C;  3CCQ V;  3CC7 V;  1I5X A;  1V54 B;  2A0L A;  3STZ C;  3QO7 A;  4PA4 A;  2HVK C;  2IU3 A;  2MK3 A;  3CYO A;  1AI5 A;  2X6B A;  4BAY A;  5B1O A;  4KP4 A;  3E8B A;  3RBZ A;  4WFG A;  2WAM A;  3AG3 C;  1EBO A;  2UXX A;  5HFL A;  3CC4 V;  3CCJ V;  1SES A;  3AG3 B;  3TCU A;  3WFV A;  3ZIA G;  4G27 B;  3FB7 C;  2LFR A;  2XAQ A;  3AG4 C;  1RPR A;  3ZMS A;  1KC8 W;  4R7C A;  1MSW D;  1S77 D;  3AG4 B;  4MTF A;  1EZJ A;  2EZO A;  4MVU A;  1VQ6 V;  2OCC B;  2R9R B;  1JCH A;  5H6Q A;  1BL8 A;  1B6Q A;  3K9A A;  4MTX A;  4JTD B;  1KP2 A;  5EBL C;  2DYS C;  4L87 A;  2PI5 A;  2B1G A;  3K06 A;  3OFN G;  3E2E A;  4QJF B;  1ZWI C;  2DYR B;  2Y48 A;  2DYS B;  1ROP A;  3CME V;  4MSW C;  1EFR G;  3SPH A;  4Q20 A;  5EK0 A;  1F51 A;  3EHB B;  5KA6 A;  4JYC A;  4LBE C;  3FYE B;  1PNL A;  1JJ2 U;  5B1A C;  1S0V A;  3ETG A;  1NBM G;  1GK9 A;  1DF4 A;  1VQ4 V;  5LGT A;  1RPO A;  3B8M A;  3UKM A;  5B1A B;  3QO8 A;  2WLL B;  4JTC B;  4LC1 A;  2HJF C;  3ML0 A;  3F7Y C;  4JAS A;  3IGA C;  4XBF A;  2QM7 A;  3BY6 A;  1TUE B;  2V1D A;  3DGE A;  5IYC O;  1PNK A;  3W7X A;  1VQ9 V;  1W0J G;  3JD4 A;  3FB6 C;  1R3K C;  3ZMT A;  1PL0 A;  3K0D A;  3STL C;  4MTG A;  5EBM C;  2Q68 A;  4OXS A;  1OCZ C;  3ZRS A;  1CPY A;  1UJW B;  1S72 V;  1M9N A;  3ZRW A;  4P9P A;  4E2L A;  2Q67 A;  1DF5 A;  3DTU B;  1S3J A;  1G8M A;  3E35 A;  1OCZ B;  4WFA V;  1LNQ A;  3E8H A;  1W2B U;  3LDC A;  4UV8 A;  4RQF A;  2WLI B;  4R50 A;  4WFB V;  2B5U A;  4J9Z B;  4J9Y B;  1H8H G;  1K97 A;  3OM3 B;  2EJR A;  2ZDI C;  4N23 A;  1KP3 A;  1F4M A;  3MHH C;  1GKF A;  4U7N A;  4FK5 C;  5LGN A;  2JJ1 G;  5LGU A;  4UV9 A;  3LDE A;  1OHH G;  1P4R A;  1OCC C;  3JD2 A;  4YXW G;  2JDI G;  3G4S V;  4PDV A;  3B8N A;  2UXN A;  1OCC B;  1R3L C;  4HAM A;  4HYO A;  3QNE A;  2DWE C;  4JAV A;  1MOF A;  3W7S A;  3I56 V;  1I5Y A;  1MG1 A;  2X7R B;  3ZN1 A;  5L3B A;  3LDD A;  3FB5 C;  1H38 A;  1V55 C;  5KA5 A;  2BOB C;  2K1E A;  3CC2 V;  2YEV B;  1NR1 A;  2DQ0 A;  3CPW U;  1E1Q G;  3LUT B;  2EIJ C;  3HPL C;  3OR7 C;  1V55 B;  4JPR A;  4X89 A;  1QLE C;  4H37 A;  1FXH A;  2EZP A;  3BEH A;  1H8E G;  2EIJ B;  2ZXW C;  4WCE V;  4XDJ A;  2HR3 A;  3ZJZ A;  3AG2 C;  1VQL V;  1QLE B;  3WG7 C;  4U7O A;  4I5S A;  4JYB A;  1NKD A;  1OCR C;  3SPI A;  2XAF A;  5CA3 A;  3AG2 B;  4MVR A;  4HZ3 A;  3WG7 B;  3KG2 A;  3P30 A;  1F4N A;  3SYP A;  3T4D A;  1JQ0 A;  4MVM A;  5HFM A;  3CCL V;  5LHI A;  1OCO C;  1OCR B;  1XL4 A;  3OMA B;  4RUE A;  3OGC C;  4X88 A;  1OCO B;  4WFE A;  3CD6 V;  2EIN C;  3X2Q C;  3PJS K;  1K4C C;  1AR1 B;  4GX1 A;  2EIN B;  2XOK G;  2P67 A;  3CCU V;  1VQ8 V;  3X2Q B;  1HWY A;  3CP1 A;  4UUJ C;  1FFT B;  4KFM A;  4UVA A;  2FTK A;  1PD3 A;  2WLK A;  1Q86 W;  4GX0 A;  3E8F A;  2HKO A;  2CK3 G;  5L3F A;  4RQE A;  5KUM A;  4CZZ A;  4MVO A;  3CCE V;  3SPG A;  1VQM V;  3OW2 U;  1QBZ A;  2WLL A;  3JYC A;  3FYI B;  1M57 C;  1FXV A;  4EKW A;  1R6N A;  4TSF G;  3GB7 C;  4PEL A;  4TWK A;  2XAG A;  5B1B C;  2ITC C;  1KD1 W;  1M57 B;  4Z1M G;  2JIZ G;  5BZB A;  4MW8 A;  2EIK C;  1DLB A;  5B1B B;  1N8R W;  2P7T C;  3ASN C;  3K0G A;  1JOY A;  3G6E V;  1P7B A;  2PI4 A;  2AHY A;  4RO2 A;  4WFF A;  2EIK B;  3OR6 C;  1VQN V;  1GMG A;  2NLJ C;  3ASN B;  1GM9 A;  3QO5 A;  4KUM A;  3CXC U;  2JEU A;  3OMN B;  1YTF B;  2WLJ A;  1M90 W;  3T1C A;  3VOU A;  2EBO A;  2JEX A;  3T4Z A;  2WLI A;  2X6C A;  4FPP A;  5CMU A;  3ZMU A;  2OTJ V;  2ZDI A;  2Z3Y A;  4DO2 A;  2DWD C;  3CMA V;  1VQ7 V;  1K4D C;  4ZKI A;  1AJQ A;  4BIZ A;  2X0L A;  1XL6 A;  3FKS G;  1G4Y B;  3LSS A;  1RM1 C;  1QCE A;  2Z5U A;  3OUF A;  4LP8 A;  1VQ5 V;  4UXN A;  3IFX A;  1RM1 B;  2WLH A;  5C93 A;  4GX2 A;  3E83 A;  1VQK V;  1NH2 B;  2Q69 A;  1R3I C;  1J95 A;  1L1F A;  2DW4 A;  4X8A A;  4R8C A;  3ZMV A;  1Y4M A;  2V7Q G;  3OUS A;  1CP9 A;  3A0R A;  2Y69 C;  3AG1 C;  4FJC C;  3RVZ A;  5FL7 G;  2Y69 B;  3AG1 B;  4RUF A;  1GO3 F;  2ZQM A;  1K8A W;  4RAI A;  1MAB G;  1M56 C;  1R6K A;  5CBH A;  1E1R G;  4FIP C;  2EIM C;  4BW5 A;  2QE7 G;  4FMT A;  3CCS V;  1M56 B;  5CN0 A;  2EIM B;  4PDM A;  3I55 V;  2XAJ A;  1S76 D;  3NXS A;  5L3C A;  5IYD O;  4PDL A;  2IJJ A;  2KB1 A;  4UVC A;  5H6R A;  4P9O A;  4MW3 A;  1NVP D;  4I9W A;  3ABM C;  3H01 A;  3JCZ A;  1Y66 A;  3RVY A;  3T2M A;  1KEC A;  2YSU B;  1E79 G;  3K3W A;  3ZN0 A;  1COW G;  2A79 B;  3ABM B;  3SYQ A;  1YSC A;  2ZXW B;  2ATK C;  4XDK A;  5IDJ A;  2XAH A;  2WWW A;  3B77 A;  3LSQ A;  1BMF G;  1YJ9 V;  3SJQ C;  3SPJ A;  2HFE C;  2HG5 C;  4PDR A;  2LP7 A;  4CBC A;  2X6A A;  3D3I A;  2JJ2 G;  3FB8 C;  1FXK C;  2M7W A;  3OMI B;  4MS2 A;  4F4L A;  1K34 A;  3HB3 B;  5IYB O;  5DM6 V;  1SET A;  5L3E A;  3F7V C;  1R73 A;  3W7T A;  3SYA A;  1FXK B;  1YIT V;  3RW0 A;  3ETE A;  4MT8 A;  3ZCC A;  3ZMZ A;  3M99 B;  4QE7 A;  1IXM A;  2C2A A;  3JD0 A;  3LNM B;  5L3G A;  4PA6 A;  1QVG U;  1K7D A;  2ITD C;  2P6J A;  2P90 A;  3GWO A;  2HLD G;  1VQO V;  1S5H C;  2IH3 C;  3SYC A;  3TET A;  2IW5 A;  2EIL C;  3ABU A;  3K08 A;  5LHH A;  2NNU A;  2Q6A A;  2WLM A;  4PA9 A;  3SPC A;  4H33 A;  3OEE G;  2B1I A;  2EIL B;  2OT5 A;  4LCU C;  1JVM A;  1F23 A;  1W0K G;  2IU0 A;  1KKD A;  3OAA G;  5B3S C;  3TK1 A;  2OCC C;  2LFS A;  3P32 A;  2H94 A;  3OEH G;  3W7W A;  3ASO C;  3UM7 A;  2IJH A;  4BIU A;  3E86 A;  5B3S B;  1M1K W;  2AHZ A;  2BOC C;  1CEZ A;  1YI2 V;  3ASO B;  1OZ0 A;  1JX9 A;  3D36 A;  3JD3 A;  2DYR C;  4TT3 G;  4QPK A;  1KQS U;  2JK5 C;  2IH1 C;  5B1N A;  1WPX A;  4GX5 A;  1K92 A;  4P2Z A;  4QNH B;  3EFF K;  1ARO P;  2WPD G;  3CCR V;  2QKS A;  3R65 A;  1FS0 G;  1SRY A;  5L3D A;  4MVZ A;  3E8G A;  5EC1 C;  1K33 A;  2QM8 A;  1AJN A;  4QIW F;  2H8P C;  1YTF D;  1GM7 A;  1QVF U;  3IC7 A;  1ENV A;  4GCZ A;  2GHY A;  3MD0 A;  2D3O W;  4DXW A;  5IY5 C;  2GSM B;  1K3E A;  1QR8 A;  1PNM A;  2HVJ C;  2W6J G;  3ZRV A;  3ETD A;  1K5Q A;  2XAS A;  3ABL C;  1BHA A;  5IY5 B;  2QEX V;  1PKX A;  2WLN A;  3ABL B;  1QLN A;  1YHQ V;  5CBF A;  4GT1 A;  4N21 A;  1SZT A;  5GW7 A;  5LHG A;  1GM8 A;  1BHB A;  3G71 V;  1NR7 A;  2YEV A;  2IJI A;  4MVQ A;  4MVS A;  3E89 A;  3K79 A;  3K04 A;  3K03 A;  1Q81 W;  2F43 G;  1YIJ V;  2ZR2 A;  3CCM V;  4JTA B;  5EBW C;  4XDL A;  4ZBM A;  1R3J C;  1NH2 D;  1AJP A;  1K5S A;  1ORQ C;  1QR9 A;  1YJN V;  4JAU A;  4QPJ A;  3SYO A;  4UVB A;  3CCV V;  5LBQ A;  2ZR3 A;  4MTO A;  1THZ A;  5H9C A;  5KUK A;  1H2G A;  1NQT A;  4PA7 A;  2ZD9 A;  4JF3 A;  3ABK C;  3VBB A;  4P30 A;  1K73 W;  4WF9 V;  3ZRW B;  2XND G;  3ABK B;  3F5W C;  3OE7 G;  2QA4 V;  4G28 B;  3W7U A;  1FXK A;  3AEI A;  2W0F C;  2W6I G;  4G2K A;  2A9H A;  2IJK A;  1AI4 A;  2WSS G;  1NVP B;  1JPX A;  4PA3 A;  3ABT A;  3ZRX A;  1WLE A;  5J9P C;  1Q7Y W;  2OTL V;  5CBG A;  1SER A;  4WFH A;  1VQP V;  3JD1 A;  4R6Z A;  1AI7 A;  1GTO A;  1Q82 W;  1NJI W;  4JGS A;  2QTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...