5EC1C

Kcsa with v76ester mutation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 39
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ec1C00
2BOCC 2ITCC 1ZWIC 2ATKC 3AG2C 4GX1A 4EKWA 2BOBC 2WLMA 4WFGA 3E8HA 3SYQA 4P30A 3K08A 4P9OA 4QNHB 3T4ZA 1XL4A 3F5WC 4KFMA 2AHZA 4GX5A 4P9PA 3ABLC 2EIJC 2QTOA 5IY5C 3HPLC 5KUKA 2Q68A 3SPHA 3SPIA 3AG4C 3KG2A 1R3LC 4RAIA 4JTDB 1R3KC 3K06A 3VOUA 3BEHA 1OCRC 1G4YB 4J9ZB 3SYAA 4XDKA 4JTCB 5CBGA 4LBEC 3AG1C 4MVQA 4MTGA 4MW3A 4J9YB 1QLEC 2HVJC 3IGAC 3OR6C 4R8CA 3SYOA 2HVKC 2DWDC 2X6BA 2DYSC 3E8GA 1M57C 3R65A 5B1AC 1M56C 4X8AA 2WLIB 3F7YC 4RO2A 3OUSA 4PDRA 3F7VC 1OCOC 4MVOA 3ZJZA 4GX2A 2ZXWC 4PA9A 4WFFA 2EIMC 4CBCA 4PA7A 4MVZA 4X89A 4R50A 4XDJA 5B1BC 1ORQC 1XL6A 4H33A 5EBMC 2DWEC 3E89A 3JYCA 4QE7A 1V54C 2JK5C 3AG3C 2Q69A 4WFEA 5KUMA 4MS2A 3ZRSA 3ABKC 3RVZA 2WLLB 5CBHA 5EC1C 3LDDA 1J95A 3LNMB 4F4LA 4LCUC 5EK0A 2A0LA 1K4DC 2ITDC 3RVYA 2A79B 5BZBA 1V55C 1R3JC 3E86A 4MVSA 4PA4A 5E1AC 4JTAB 3ASOC 2HJFC 3LDEA 3OGCC 2DYRC 1R3IC 4XDLA 2AHYA 4MVRA 3SJQC 3K04A 2WLIA 2Q67A 2H8PC 2EILC 3STLC 3K03A 2IH3C 3SYCA 4MTFA 3OR7C 1S5HC 3EFFK 4HZ3A 3RW0A 3WG7C 4G27B 4MVUA 4DXWA 2P7TC 3ASNC 2WLHA 3SPCA 4PDVA 5B3SC 3LUTB 1OCZC 3GB7C 3E8BA 3FB5C 3UKMA 3STZC 3SPGA 2R9RB 1OCCC 1BL8A 2IH1C 2Q6AA 4PA6A 4G28B 2A9HA 5EC2C 4P2ZA 1K4CC 4MSWC 2K1EA 3FB8C 3K0DA 3TETA 3T1CA 4WFHA 2OCCC 3UM7A 3PJSK 2EIKC 4QE9A 3T4DA 5EBWC 1KKDA 4X88A 4LP8A 2HFEC 4MW8A 2X6AA 3IFXA 4MVMA 2KB1A 2EINC 4MTOA 3FB6C 5EBLC 3SYPA 5J9PC 2WLJA 2QKSA 3E83A 3TCUA 1P7BA 2WLNA 4I9WA 4UUJC 4HYOA 4ZBMA 2HG5C 3OUFA 3K0GA 2NLJC 4TWKA 2W0FC 2Y69C 4PDLA 3X2QC 5CBFA 4R6ZA 4PDMA 1LNQA 2WLLA 1JVMA 3ABMC 4GX0A 4PA3A 3RBZA 4BW5A 4RUEA 4H37A 2WLKA 4R7CA 2ZD9A 3LDCA 3SPJA 3T2MA 4OXSA 2X6CA 4RUFA 3FB7C 2YEVA 3E8FA
chains in the Genus database with same CATH superfamily
1MABG 1OCOB 2IJJA 2ZXWB 4O4LA 2EIMB 3SYQA 1S72V 2W6JG 4WFBV 4H0LB 1L0NH 3WFVA 2AHZA 4X65O 1FD9A 2HP8A 1E1QG 2F1MA 2UUBB 1VF5B 5AG2A 4YY3B 4NTWA 3U11A 3AG1C 1D2DA 1D5AA 3OTOB 2WLIB 2OYQA 1HWYA 3VBBA 4X1YB 1W0JG 4NR1A 5EIBD 1Q3EA 1SETA 1XL6A 3JAKA 1QBZA 5L3DA 5LP6B 4QE7A 3EXAA 5KHIA 1DTOA 3KKYA 3RVZA 1SZXA 1L8DA 1VF7A 1XDCA 1KB9F 3HB3B 4BR6A 4F4LA 4O4HB 2Q0OC 1UJWB 3BVOA 1AJNA 2HHHB 1JJOA 1TGOA 2IJIA 1KYOF 1V55C 2HKOA 2VQEO 3C3SA 5GONA 5E1AC 1Q5OA 3LDEA 3JAWA 2VWKA 5FNVA 4LNUA 3ZMTA 3J81N 3OAAG 3STZC 3H9VA 3ZX6A 2Z3YA 1H2LA 2H94A 1R1BA 1HNXB 4FLVA 4Q6GA 3JSNA 4WFHA 5KMGA 1BSMA 2Z0AA 4PI0A 4N21A 4CS4A 2HFEC 3TXSA 4A5UB 1H8HG 5EBLC 4IL6Z 2LFRA 1P7BA 2UXCB 2AZ0A 4DK1A 2CTRA 3AG4B 2ZE5A 1H38A 2F95B 1AR1B 3G80A 1XNRO 5JJEB 3KCXA 5K1PA 5LOVA 1Q6HA 4ZHQA 1HNWB 1DLBA 3ZS8C 4B3MO 4GX1A 1AILA 3S3XA 2IU0A 1XMOO 3FAVB 1FKAO 4PHZA 3B2EE 2ZE7A 4DV7B 1BCCH 3GWKC 1GK9A 4UCVA 1TUBB 3C90A 3VOUA 1IVSA 3CPWU 1OCRC 1IBMO 2DQ0A 1HNXO 2YDEA 1M57C 5JVDA 5JJJB 2IJHA 5CB4A 4MVOA 2XNDG 2CH7A 3P32A 3G67A 3J80N 3RYCB 4QPJA 1XHXA 4JYBA 2UXCO 1B04A 2JK5C 1OCZB 4MS2A 2JDIG 3K5LA 1JFFB 4JAVA 5IJ0B 3IC7A 5A9GA 1WA8A 2UUAB 2JEXA 2ZE8A 3ETQA 4PA4A 4JTAB 4WBNA 1HNWO 2Q67A 2H8PC 4X1KA 3HKCA 1J5EB 2RNBA 3OR7C 3TGUH 3WG7C 1MNGA 4PELA 3BA9A 4DXWA 1HR0O 2L6LA 4JI5B 1FJGO 1XBLA 1N32O 2Y0PA 5LMUO 3ZHQA 3JCZA 3HKDB 3UM7A 1JMKC 3CD6V 2QM8A 4NB5A 1Y74B 1P7GA 3AK1A 4FLYA 2EIJB 1NS1A 4IYHA 3OMIB 1S0VA 1QLNA 5KHGA 4H37A 1I94B 2UUAO 5D5QA 2EJ7A 4AI8A 2DQ3A 2QKAA 4YHHB 1HW7A 4MT8A 2YEVA 3B4SA 2AGAA 2FYUH 1J5EO 3G6BA 1W2BU 1KC8W 3VQVA 1PP9H 1NZ6A 2QWRB 3E2EA 3BABA 4FM2A 1PPJH 5LHHA 5HFMA 1K92A 4JTCB 5CBGA 1ENVA 3N2KA 2Q7HA 2RN9A 4ZI7B 1D5NA 4X9QA 5B1AC 3F7YC 1NBMG 5BMVB 2W6IG 4FM0A 5LGUA 3RWRD 5KUMA 3N27A 1S76D 2UXNA 4QPKA 2IBZH 1EM1A 1GM7A 1GRJA 3TK1A 1I94O 4JI8B 2H3OA 2LGQA 3E86A 4YHHO 3FFQA 1QU7A 2OCCB 3JD0A 5KX5A 3K04A 2BTOA 2ODMA 2UU9B 5IYDO 3PN1A 2VWJA 2Q73A 3CP1A 4I4TB 5B3SC 4B08A 4DW1A 1AVMA 3P3NA 1GN3A 2EULA 2ADQB 3DXRB 3HR0A 2EIKC 4K8XA 4NVPA 4LP8A 1IDSA 1SQBH 1K9MW 4J7KA 3E22A 5B5EZ 5K1XA 5EIBC 2YI9A 3RYFA 3CC2V 2XOKG 4HNAA 2Y69C 4R6ZA 3CCRV 1RP3B 1LNQA 3OD4A 4JZGA 4GUNA 2CTQA 1G8MA 2E74B 4RWUA 3SPJA 1N33B 1H2SB 4O4JB 4DR3B 2BTQB 2Q7GA 1N36B 2YS8A 2BOBC 3E8HA 4X20B 1R6TA 4JZ2A 3OM3B 4AILC 1KD1W 4UCOA 4DV2B 4FLZA 4K8ZA 4H13B 1KECA 1NU1H 2HVKC 2DWDC 5D5PA 3RT3C 4B3TB 4X8AA 3ICXA 1U96A 2AXTZ 3BCCH 3BY6A 3CCMV 4AHCA 4XDJA 3K5OA 3THOA 3JYCA 4LF5B 2JEUA 1K34A 3CJHA 5EC1C 1XREA 4CC6A 4DR2B 1L1FA 4G2KA 3A8TA 4LCUC 1T5EA 1YJWV 2CTPA 1N33O 3ASOC 1BE3H 2NNUA 3ETEA 2Q9LA 1VQ8V 3LSSA 4DV0B 2EILC 3ZMSA 2LW7A 1WJZA 1L0LH 5JQGA 4AQYB 3K79A 4UCUA 5L3GA 3I55V 1SS3A 4DV2O 4FFBA 3UT5A 1AI4A 3ZIAG 2ZR3A 3CCVV 3SJCC 3G6EV 4FJCC 1E1RG 3SYPA 4ZBMA 5J2TB 4JI0B 2W0FC 4PDLA 5JH7B 4DR5B 4RQEA 2WLLA 4IIJA 4DR2O 5J2UB 3A0RA 3DSQA 5KA5A 3AG1B 3P3PA 4DK0A 1VQNV 2GTSA 4I0XA 1QCEA 4JV5B 2ATKC 2JIZG 2OCHA 2YSUB 4YXWG 1NVPD 2XUMA 2CGNA 3T4ZA 4WCEV 2BSKB 1UPGA 4DR1O 3JALA 3K06A 4DR4B 1WP8A 5KAFZ 2GDSA 1ZL8B 1YJNV 4MW3A 1V55B 1Q8IA 2OWOA 4QGPA 2DJVA 3BRCA 2XAGA 4DUZB 2ZNIA 2UXBB 3ABTA 2ZIMA 3CYOA 2XT9A 4JASA 1MZEA 3OE7G 3ETGA 4L8JA 5JJNB 1F7YA 1YVWA 3SJAC 5L3BA 3ZN0A 4J41A 4O2BB 3HKEB 4HAMA 3ZRSA 4DR5O 4ASUG 5B1NA 3O9OA 1GAXA 2K9PA 1RM1C 1K5QA 2A79B 1Q43A 2JGUA 1R3JC 1CP9A 2DYRC 3SJQC 4JV5O 4O4LB 2ZDIA 2IH3C 3G4SV 2AZ2A 3EFFK 3JASA 1GM9A 4DV3O 2WLHA 1YTFB 3W7WA 3VQWA 2R9RB 1OCCC 4DR4O 2MW2B 4JI1B 3U0ZA 1V9PA 3CX5F 5EC2C 1VQKV 2ZM6O 1N34B 2ZNJA 1BMFG 4DUZO 3PJSK 5KLVH 4NTYA 5IYCO 2WA4A 4PJ0Z 5LGNA 3CSXA 5C8YB 2QKSA 4TUYA 5E79Z 1KUQA 1VQOV 5H2FZ 5LGTA 4GKJB 3SDLA 2JJ2G 1TAEA 1OCRB 5LXTB 3RBZA 1PKXA 2XAQA 1NH2B 5L3FA 1UFIA 1P49A 1FFTB 1M90W 4X64B 3JAWB 1M57B 1K3EA 2JJ1G 3QO5A 2YXLA 1GN2A 1WB7A 4DR6O 4U3JB 3T1YO 1IXBA 1XI1A 5EYPB 3CMAV 4GCZA 1WB8A 1NTZH 3CE2A 3HPLC 4X1IB 3SPIA 4TQDA 3A0BZ 1FXKA 1IBLO 4FZ0A 2A3QA 1N34O 4GZRB 3HKBB 4LF7O 5CMUA 1AR5A 3JCUZ 5A2QN 5B1BC 4I50A 2QWOB 3WG7B 4B3SO 1XQ8A 1QQCA 1EFRG 3H01A 4E2LA 4F6RA 1KBHA 4TV9A 3OTFA 1K4DC 2ITDC 3D3IA 4HBNA 4X64O 2HJFC 4IHJA 1I08A 4XDLA 1AROP 1NTKH 3STLC 1IBKB 3K03A 4EB6B 1Y76B 3W7SA 1VF6C 3UKMA 2E75B 1EN4A 1AB3A 4LH6A 1BL8A 5LHIA 2UXDO 1SF9A 2K1EA 1EBOA 5CB4B 1EZVH 4I5SA 2CH7B 1QVGU 1JQ0A 4LF4B 1BQZA 1GM8A 2EINC 1URFA 4PI2A 2E76B 5IJ9A 1N4CA 1YF2A 4TWKA 1FYJA 2UUBO 4I9QA 3AEIA 4YY3O 2ZD9A 1BHAA 4OXSA 4LWSA 1SQQH 1NI8A 5B1AB 3OTOO 1N8RW 3BFRA 4U3FH 3MD0A 4WFGA 3ZHVA 4WFAV 4B7KA 1PM9A 3UCSC 5CA0A 1WNSA 4LFAB 2Q68A 1K97A 2QE7G 4LBEC 4MTGA 2UUCB 2B1IA 4J9YB 2HHHO 3E8GA 1YITV 2F43G 4C7UA 4XBFA 4J80A 5FL7G 1MA1A 4GX2A 1Y66A 3ML0A 4X89A 3OEEG 2DWEC 1S5JA 3AG3C 4WFEA 5B3SB 5CBHA 5DM6V 4UV8A 4KUMA 4UB6Z 4DRXA 2R9AA 1Z2GA 1B06A 1SA0B 5JCOA 1BHBA 4UCTA 2EZOA 2BE3A 1R3IC 3TJTA 2EIKB 4DV1B 3AK2A 2WLIA 2YUAA 5DECA 4X1YA 4TV8B 4KL1A 4HZ3A 1FXHA 4UFZA 4IT5A 4YIPA 1SKVA 5LP6A 2OT5A 2Y69B 2Q7EA 3CCQV 3ZRWA 2VS0A 1FFXB 2XASA 2OIEA 1VQ9V 3N2KB 4DR7B 1K4CC 2UUCO 1AJQA 1YZBA 2Y0IA 2QWQB 3CHXA 3C3TA 1PD3A 3IAYA 2X6AA 3FB6C 3TCUA 2WLNA 1QR8A 3B77A 2IU3A 3OUFA 2KQXA 4DV7O 1SQFA 3JARA 3M99B 2NN4A 2AW9A 4W4LA 4JI2B 4W4KA 1RSOB 3CWBH 3LDCA 2PTMA 2QKCA 1US6A 1YXBA 4LR3A 3G71V 2HLDG 4DV1O 3AG7A 4P30A 3K08A 4LF8B 4QNHB 3CC7V 4JI6B 2JGDB 5IYZB 1LUVA 1SQGA 2IW5A 4GX5A 1M4UA 4I55B 4BAYA 3L72H 2ZE6A 5B66Z 4DR7O 4Z1VA 4R8CA 2P06A 2P5OA 3ASOB 1P4RA 1M56C 1VQPV 4RO2A 4PDRA 4DW0A 3F7VC 4GLXA 2EILB 3ETDA 3FAVA 1IXMA 2PUSA 4YJ2A 1JX9A 3ABKC 3CCSV 1TUBA 1YJ9V 4UVAA 3LDDA 4JI5O 3LNMB 3M7MX 4DYLA 1AJPA 4JI2O 3B40A 2P4VA 1TA8A 1K5SA 1H2KA 2GUZB 3H1LH 3CCJV 1WPXA 3W7XA 5H6QA 4TSFG 3RYCA 5LA6A 4FLTA 4U7OA 3JD4A 1MOFA 2ZINA 2ILMA 1ROPA 2QWPB 2VRZA 1JFFA 5IJ0A 1Q6IA 4O4IB 2QR4A 2FB5A 4ZOLB 3T1CA 3WU2Z 3ZRXA 3RYIB 2CAZC 4JPRA 5J9PC 3NXSA 2LJ2A 3BHPA 5EZYB 4CC5A 4UVBA 4UUJC 2NLJC 2ZQMA 2Q0AA 1XUQA 3CRCA 1U97A 2B1GA 5LYJA 3CS5A 4ICGA 3HKDA 3JATB 4EKWA 1XOUA 2E5LB 1FS0G 3QVNA 1Y74A 1ZSPA 4Z1MG 5IY5C 4FLXA 3T1HB 4JTDB 3BEHA 2QA4V 1RM1B 4J9ZB 3SYAA 5BR8B 1M5IA 1ZUQA 2GSMB 3H1JH 3SYOA 4JI8O 1COWG 1LR1A 1I5YA 3IC9A 4DUYB 3UO3A 2DYRB 5KHHA 1M1KW 4KP4A 4CZZA 3CMEV 3JD1A 1RPRA 1S5LZ 2UU9O 2HJDA 2DE0X 1VQ5V 1GMGA 2WLLB 4EFBA 4LF6B 1S77D 5CA1B 1OCCB 2YICA 2R72A 2A0LA 3BA8A 3N2GB 5BZBA 4I0XB 4OPAA 1QNMA 4ZI7A 1FAFA 4QJFB 2ZR2A 5BMVA 1ZAUA 5HFLA 1CEZA 3Q4HA 2E5LO 2P7TC 2YIBA 4FLWA 2V7QG 2XAFA 3MAQA 4JI7B 3CCEV 1K8AW 4CH4A 1GH6A 1K7DA 2MK3A 3DTUB 3RYHB 3J7AU 5EBWC 2OTJV 3K59A 2M7WA 1VARA 4X88A 4DR3O 1N36O 2F23A 1AR4A 4Z2WA 3K57A 2N05A 3CEIA 3K3WA 3L9DA 4D7TA 4YJ3B 3MHSC 1JVMA 1O9GA 1ZX3A 2P22C 3ZEDA 5BXZA 2PY5A 1KU9A 2ETNA 4B3TO 4NKGB 1HDJA 2GHYA 5B1BB 2CUGA 3F5WC 5KHJA 4LF5O 3CCLV 1KP2A 1R3KC 3QF7A 4NXNB 4N23A 2E3CA 3FKSG 2WSSG 3OUSA 2A06H 2BTQA 4NXMB 2X7RB 4X66B 4DV0O 4PA7A 2V4DA 4X20A 4K0KB 5BY1A 4PV1B 2Y4TA 1KQSU 3H1KH 4AQYO 2HEPA 3D8CA 3K58A 5EK0A 5ITZB 3ZN1A 1R73A 3OGCC 2BCCH 3I56V 1SQVH 2EINB 2YIDA 1KKCA 1YIJV 4CS3A 4ABMA 2V1DA 4JI0O 2YXHA 3L73H 4OX9B 1PNKA 1YI2V 3DGEA 2IH1C 3LSQA 1F4MA 4LFBB 2Q8VA 3T4DA 5DN6G 2KB1A 3CXCU 2WLJA 3E83A 5FPOA 3FYIB 4I9WA 2L35A 2CGOA 4F6RB 2Q5ZA 1JOYA 1OZ0A 3QNEA 3L74H 4UVCA 2YC0A 1Q7YW 1HP8A 4UV9A 5LMNB 1DK1A 4LF9B 1XMQB 1GO3F 3AG2C 2UXBO 4O2AA 3ZMUA 2ZKOA 3JAKB 1BZKA 5J2TA 3AG3B 4P9PA 4QIWF 2IM9A 4OX9O 2A7WA 5JH7A 1WLEA 4WF9V 1JCHA 3KG2A 1R3LC 4RAIA 2OTLV 5KAIZ 5KHKA 1DF4A 4XDKA 1OV9A 3QO7A 5GONB 1JA8A 1QLEC 2ZCEA 1GTOA 2X6BA 1M9NA 1OJHA 2PZSA 3ZRVA 1QVFU 3ZJZA 4PA9A 4WFFA 3FYEB 4MVZA 1MG1A 1NVPB 3D36A 5FNVB 3E89A 4LNUB 4X65B 1V54C 2EBOA 3W7UA 2BSKA 2R9IA 1VQMV 4KXRA 3JSLA 4RQFA 1N0NA 1JJ2U 4NYKA 4JI1O 1H2NA 4DV4B 2YXYA 5LL6Y 2PYLA 5KMGB 4LF9O 2YIAA 2AHYA 4DO2A 2WA3A 2ZDIC 3ZBHA 4EEQA 3AK3A 3RW0A 3OEHG 4G27B 4D7SA 1SRYA 3L75H 4O2BA 2FMLA 4KHPB 3MHHC 4GKJO 1XNQB 4JYAB 1HNZB 2Q6AA 1NR1A 2WWWA 2CK3G 2VQEB 5LOVB 4ZHQB 4FLUA 2EJRA 4JYCA 3OMNB 1M93A 3CRMA 4JI3B 2KG7A 5LBQA 3K0GA 3SGIA 2X0LA 1LUWA 3X2QC 1PNMA 1CXZB 4DRXB 3ABMC 5IT9N 1YDXA 4R7CA 5F2VO 4DV4O 3K9AA 3ZHRA 5JVDB 1M56B 3E8FA 1ZWIC 2FTKA 3D36C 2CDYA 5C8YA 3O65A 4ZKIA 5FLXN 1MMMA 3ZRWB 3ABLC 1K73W 3ABKB 3A0HZ 2QTOA 1I5XA 5KUKA 4KHPO 2GV9A 1XNQO 1XNRB 4JYAO 1FXKC 1HNZO 1WA8B 5LXTA 3S3WA 1Q82W 2HVJC 3ZCCA 2DYSC 2F4VB 3R65A 4WBNB 1TVKA 4B3MB 4E4EA 4X1KB 1XMOB 3HKCB 1IBKO 4U3JA 1ORQC 4JI3O 4H33A 3NR7A 4K35A 5EYPA 1GKFA 3JARB 1TUEB 4X1IA 4IGGA 2Y48A 1Q6UA 1IBMB 2JS5A 1DF5A 4LFCB 3R66A 2KKWA 1W0KG 2QWNB 3L70H 4DV6B 3HKBA 4L87A 1GN4A 4UXNA 4LF4O 3RFRA 4MVUA 2QSAA 1EN5A 2LO1A 1NKDA 2DMXA 3ZMZA 4P2ZA 2ZIOA 3FD9A 3M8AA 4X62B 3TETA 4I7ZB 2LW1A 2F4VO 1I7FA 2YEVB 4LH7A 1NR7A 2Z5UA 2G38A 4MVMA 4YJ2B 1XHZA 4TT3G 4EB6A 3LNNA 1HR0B 1Y76A 1ZTEA 2HG5C 3D3QA 2DW4A 5IY5B 5CBFA 4UCRA 1FJGB 2C2AA 4PDMA 4LFAO 2QDOA 1N32B 1AI5A 5LMUB 1O9HA 1VQ4V 4LFCO 4BW5A 4RUEA 4O4HA 1DGSA 1MZFA 2JRIA 3QG5A 4OGQB 5JWPA 2LQTA 4UCSA 3ZHTA 4K3AA 2W0XA 4DV6O 2UXXA 4MTXA 1YSCA 2PF4E 3CRAA 5LA6B 2YIBD 2Q4PA 1THZA 2PI4A 1Y67A 5H5NA 5B1OA 2RMKB 3OR6C 2VQFB 4X62O 5KX5B 2B5UA 3IJ4A 1OCOC 1RPOA 2DOSA 2ZXWC 2EIMC 4R50A 5EBMC 4TOIA 3EVKA 4JAUA 4BIUA 3B8MA 3WB2A 4BIOA 3JD2A 5LYJB 5CN0A 2WAMA 5JCOC 1BQ0A 2B9ZA 4MVSA 3FX7A 1F51A 4CH5A 3MDSA 4GT1A 3A2FA 3E22B 1ZLZA 3SYCA 4MTFA 3RYFB 5GTHZ 5LP6C 2N74A 4HNAB 3SPCA 4PDVA 3E8BA 4H44B 2EX3A 1IZ3A 1X4TA 3QO8A 3B09A 1WN7A 1SERA 1SA0A 3K0DA 2VQFO 1VQLV 2NR5A 1SZTA 1KKDA 1N0JA 4TV8A 2ARHA 4LF8O 4JI6O 1FPOA 3KZIZ 3EHBB 2QM4A 1FFXA 4FM1A 1JPXA 2LP7A 2WLKA 3CC4V 4BWAA 1F23A 2QJ1A 4J10A 2LFSA 1RFYA 3OGIB 5CA3A 1K33A 2WLMA 3CXHF 3Q4HB 2FL4A 4OPHA 3CJHB 3OMAB 3AG4C 1Q86W 1B6QA 4FIPC 3OT7A 2M6YA 1Y6XA 1WP7A 1Z5WA 1Y4MA 1WPBA 2PGGA 1RSOA 3IGAC 4F6EA 5L3CA 2RJZA 1AI7A 5GW7A 4Q20A 3E35A 1VMGA 4NTXA 4JF3A 2JGDA 5JQGB 5IYZA 2Q69A 1XILA 4I55A 3H1HH 2XAHA 5C93A 1J95A 4FFBB 1SQXH 3UT5B 3U10A 3WB1A 2QGNA 1NJIW 2FKXA 2PYJA 5FPRA 4FFKA 2F66C 4EFEA 1WAZA 2IJKA 4DV5B 3H1IH 4B7EA 1OCZC 3SPGA 2OIGA 2EZPA 4IIJB 1S3JA 2CTWA 4D6TH 4G28B 1Q81W 5L3EA 3K5NA 3FB8C 3ZMVA 1YHQV 2D2CB 2GUZA 4UB8Z 3AG2B 3ABUA 4ZIBA 3TXQA 4MW8A 3IFXA 4BIZA 3APOA 4HYOA 1BT8A 2XHBA 1JR9A 3JALB 3APQA 3T1HO 1H8EG 4JGSA 3UO2A 4GX0A 4PD4F 4PA3A 2R70A 4O4IA 3RN4A 5BR8O 2XTAA 5IDJA 1QLEB 4YIOA 1B3QA 3RGBA 3ZHSA 1FXVA 1R6KA 3K9SA 4ZOLA 4DUYO 1A32A 2BOCC 2ITCC 3RYIA 1QHTA 4P9OA 1VIBA 5IYBO 1SESA 4FK5C 3ASNB 5EZYA 1V54B 2RDCA 4I4TA 4DV5O 1E79G 2EIJC 1R6NA 4LF6O 3KCYA 1IURA 5GTIZ 1YCIA 5TISZ 3P30A 2P6JA 1Z5VA 3GWOA 1H2GA 3JD3A 5DEDA 3JATA 3DXRA 3JASB 4JYYA 1KP3A 2RQ6A 3I5DA 5KA6A 2HR3A 2KSDA 4JAAA 2P90A 1YTFD 4DR1B 1VQ6V 1BGYH 1VEWA 3DC5A 1NT2B 3RVYA 4JI7O 3CRRA 4CS2A 1IX9A 4O4JA 3GVMA 4J42A 4O2AB 1NQTA 2D3OW 1S5HC 4TUYB 1KMIZ 3X2QB 3FB5C 3CB2A 4TQFA 2F93B 3DC6A 3BPZA 2XAJA 4J7JA 5CA1A 3ABMB 4PA6A 3ZHUA 1NH2D 4MSWC 3N2GA 1AP5A 2OCCC 2QEXV 5H9CA 4QE9A 4CH6A 1OHHG 4JI4B 4DV3B 1G6UA 3ABLB 3K5MA 3JAMN 1MSWD 1AP6A 1CPYA 2N04A 4FPPA 4CH3A 1FXKB 1P84F 2ZT9B 2ZM6B 2O57A 4NXNO 1EN6A 3CRQA 2DYSB 2X6CA 4RUFA 2JS3A 4B3RB 3RYHA 3CCUV 4NXMO 4I50B 4X66O 1BS3A 4LC1A 1XL4A 1W59A 5LHGA 1PNLA 4KFMA 3W7TA 1X59A 4BW9A 4K0KO 4YJ3A 3SPHA 2QTSA 4TV9B 1PL0A 1YEWA 4FMTA 1G4YB 2WPDG 2Y4UA 4MVQA 3T2MA 3UQ8A 3OFNG 2DN9A 3WB0A 1VQ7V 4IHJB 1SC5B 3OW2U 4GKKB 1VP7A 4DR6B 2P67A 3T1YB 4CBCA 2KG7B 4JI4O 5IWAB 1Q90D 3VQYA 3SJBC 2P4KA 1MSDA 4J11A 5H6RA 4IYIA 1QR9A 4FZ1A 1IBLB 1F4NA 1SQPH 3QTCA 5J2UA 1PL4A 1XEQA 3VQXA 4LFBO 4B3RO 4MVRA 4LF7B 3BAAA 1G1XB 1EZJA 1I0HA 4GYCB 1PV0A 4B3SB 4J7ZA 2GTAA 5IJ9B 2QM7A 3ASNC 3LUTB 2RCVA 3GB7C 1VF6A 1NTMH 5IE9A 2A9HA 2LGWA 2GBOA 5ITZA 1ZL8A 4LWSB 1TVKB 2YI8A 2JVDA 5LMNO 4GKKO 1XMQO 2PI5A 1H2MA 4MTOA 1AI6A 5IWAO 5CA0B 4U7NA 3L71H 3F5TA 3HKEA 3LSUA 3SR2C 2UXDB 2ADPA 3B8NA 2CE4A 1GN6A 3FB7C 4FVMA
chains in the Genus database with same CATH topology
2ATKC 1MABG 1OCOB 2JIZG 2YSUB 2IJJA 4YXWG 2ZXWB 4EKWA 2EIMB 3SYQA 1NVPD 3T4ZA 1S72V 1FS0G 2W6JG 4WFBV 3WFVA 2AHZA 4WCEV 1THZA 4Z1MG 5IY5C 1E1QG 2PI4A 4JTDB 3K06A 3BEHA 2QA4V 1RM1B 4J9ZB 3SYAA 1YJNV 3AG1C 5B1OA 4MW3A 2GSMB 1V55B 3OR6C 3SYOA 1COWG 1I5YA 2XAGA 2DYRB 1M1KW 4KP4A 2B5UA 3ABTA 2WLIB 3CYOA 4CZZA 1HWYA 3CMEV 1OCOC 1RPOA 3OE7G 3JD1A 3ETGA 1RPRA 4JASA 2ZXWC 3VBBA 1W0JG 2EIMC 4R50A 1SETA 1XL6A 5EBMC 5L3BA 5L3DA 1QBZA 1VQ5V 3ZN0A 4QE7A 4MTXA 1DTOA 1GMGA 4JAUA 4BIUA 3ZRSA 4HAMA 3RVZA 2WLLB 1S77D 4ASUG 5B1NA 3B8MA 3HB3B 1OCCB 3JD2A 4F4LA 1UJWB 1RM1C 5CN0A 1K5QA 2WAMA 1AJNA 2A0LA 2A79B 2IJIA 5BZBA 1V55C 2HKOA 1R3JC 4MVSA 5E1AC 1CP9A 3LDEA 1F51A 2DYRC 4GT1A 3SJQC 4QJFB 2ZDIA 2ZR2A 2IH3C 3SYCA 4MTFA 5HFLA 3G4SV 1CEZA 3EFFK 1GM9A 3ZMTA 2P7TC 3OAAG 2WLHA 3SPCA 4PDVA 1YTFB 3E8BA 3W7WA 3STZC 2R9RB 1OCCC 2Z3YA 3QO8A 2V7QG 2H94A 2XAFA 5EC2C 1SERA 1VQKV 3CCEV 1K8AW 3K0DA 1VQLV 4WFHA 1BMFG 3PJSK 1K7DA 2MK3A 3DTUB 5IYCO 1SZTA 5EBWC 2OTJV 4N21A 2M7WA 1KKDA 4X88A 2HFEC 5LGNA 1H8HG 5EBLC 2QKSA 2LFRA 1P7BA 3K3WA 1VQOV 3EHBB 5LGTA 3AG4B 1H38A 2JJ2G 3MHSC 1AR1B 1OCRB 1JVMA 1JPXA 2LP7A 3RBZA 1PKXA 2WLKA 2XAQA 1NH2B 5L3FA 1FFTB 3CC4V 1M90W 3FB7C 1F23A 1M57B 2LFSA 1K3EA 2JJ1G 3QO5A 1DLBA 4GX1A 5CA3A 1K33A 2WLMA 2IU0A 2GHYA 5B1BB 3F5WC 3CMAV 4GCZA 1GK9A 3HPLC 3OMAB 3SPIA 3AG4C 3CCLV 1B6QA 1KP2A 1Q86W 4FIPC 1R3KC 3VOUA 3CPWU 1OCRC 1FXKA 2DQ0A 1Y4MA 3IGAC 4N23A 3FKSG 1M57C 2WSSG 5L3CA 2IJHA 3OUSA 4MVOA 1AI7A 2X7RB 2XNDG 3P32A 5CMUA 4Q20A 5GW7A 4PA7A 4QPJA 3E35A 5B1BC 3WG7B 4JF3A 4JYBA 2JK5C 1EFRG 2Q69A 3H01A 1OCZB 4MS2A 1KQSU 4E2LA 2JDIG 2XAHA 4JAVA 5C93A 1J95A 3IC7A 5EK0A 1K4DC 2ITDC 2JEXA 3ZN1A 3D3IA 1R73A 4PA4A 4JTAB 2HJFC 3OGCC 3I56V 1NJIW 4XDLA 1AROP 2Q67A 2H8PC 3STLC 3K03A 2EINB 3OR7C 1YIJV 3WG7C 2IJKA 4PELA 4DXWA 3W7SA 2V1DA 1OCZC 1PNKA 3UKMA 3SPGA 1YI2V 3DGEA 2EZPA 1S3JA 1BL8A 2IH1C 3LSQA 4G28B 5LHIA 1F4MA 1Q81W 5L3EA 2K1EA 1EBOA 3FB8C 3JCZA 3UM7A 3ZMVA 1YHQV 4I5SA 3T4DA 5DN6G 3AG2B 1QVGU 3ABUA 3CD6V 1JQ0A 1GM8A 4MW8A 2QM8A 3IFXA 4BIZA 2KB1A 2EINC 3CXCU 2WLJA 3E83A 3FYIB 4I9WA 4HYOA 4TWKA 2EIJB 1H8EG 1JOYA 1OZ0A 3OMIB 4JGSA 3QNEA 1S0VA 4GX0A 4UVCA 1QLNA 4PA3A 1Q7YW 3AEIA 4H37A 2ZD9A 5IDJA 1QLEB 1BHAA 4UV9A 2DQ3A 4OXSA 1FXVA 1R6KA 4MT8A 5B1AB 1N8RW 2YEVA 2BOCC 2ITCC 1GO3F 3AG2C 3MD0A 4WFGA 4P9OA 4WFAV 3ZMUA 5IYBO 1SESA 4FK5C 1W2BU 3ASNB 1V54B 3AG3B 4P9PA 1KC8W 4QIWF 1E79G 2EIJC 1R6NA 1WLEA 2Q68A 4WF9V 1JCHA 3E2EA 3KG2A 1R3LC 4RAIA 2OTLV 1K97A 5LHHA 5HFMA 1DF4A 2QE7G 1K92A 4XDKA 4JTCB 5CBGA 1ENVA 4LBEC 4MTGA 3QO7A 2B1IA 4J9YB 1QLEC 3P30A 2P6JA 1GTOA 2X6BA 1M9NA 1H2GA 3GWOA 3E8GA 3JD3A 1YITV 2F43G 5B1AC 3ZRVA 3F7YC 4XBFA 1QVFU 5FL7G 4GX2A 4PA9A 1NBMG 4WFFA 3ZJZA 1Y66A 3FYEB 3ML0A 4MVZA 4X89A 2W6IG 1MG1A 1KP3A 3OEEG 1NVPB 3D36A 5KA6A 2DWEC 3E89A 5LGUA 2HR3A 1V54C 2EBOA 3W7UA 3AG3C 2P90A 4WFEA 5KUMA 5B3SB 1YTFD 1VQ6V 2R9IA 1VQMV 2UXNA 4QPKA 1S76D 5CBHA 5DM6V 4RQFA 4UV8A 4KUMA 1JJ2U 1GM7A 3TK1A 3RVYA 1BHBA 2EZOA 3E86A 2OCCB 3JD0A 1R3IC 2EIKB 2AHYA 4DO2A 3K04A 2WLIA 5IYDO 2ZDIC 1NQTA 2D3OW 3CP1A 1S5HC 4HZ3A 1FXHA 3RW0A 3OEHG 4G27B 1SRYA 2OT5A 5B3SC 2Y69B 3X2QB 3CCQV 3FB5C 3ZRWA 3MHHC 2XASA 2XAJA 1VQ9V 3ABMB 2Q6AA 1NR1A 4PA6A 1NH2D 2WWWA 1K4CC 2CK3G 4MSWC 1AJQA 2OCCC 2QEXV 5H9CA 2EIKC 4QE9A 1PD3A 4LP8A 2EJRA 4JYCA 3OMNB 2X6AA 1K9MW 1OHHG 3FB6C 3TCUA 3CC2V 2WLNA 1QR8A 2XOKG 2IU3A 3B77A 3OUFA 5LBQA 3K0GA 3ABLB 2X0LA 2Y69C 1PNMA 3X2QC 4R6ZA 3CCRV 1LNQA 1MSWD 1CPYA 4FPPA 3M99B 1FXKB 1G8MA 3ABMC 4R7CA 3K9AA 3LDCA 3SPJA 2DYSB 2X6CA 4RUFA 1M56B 3G71V 2HLDG 3E8FA 1ZWIC 2FTKA 3CCUV 2BOBC 3E8HA 4P30A 3K08A 4QNHB 4LC1A 3CC7V 1XL4A 5LHGA 1PNLA 3OM3B 4KFMA 4ZKIA 3W7TA 4GX5A 2IW5A 3ZRWB 3ABLC 1K73W 3ABKB 5KUKA 2QTOA 1I5XA 3SPHA 1PL0A 4BAYA 4FMTA 1KD1W 1FXKC 1G4YB 2WPDG 1Q82W 4MVQA 1KECA 2HVJC 3OFNG 4R8CA 3T2MA 2HVKC 2DWDC 3ZCCA 1VQ7V 2DYSC 3ASOB 3R65A 1P4RA 1M56C 4X8AA 3OW2U 1VQPV 4RO2A 4PDRA 3F7VC 2EILB 3BY6A 2P67A 4CBCA 3CCMV 3ETDA 4XDJA 1IXMA 1ORQC 4H33A 3JYCA 1JX9A 1GKFA 2JEUA 3ABKC 1K34A 3CCSV 1TUEB 5EC1C 1YJ9V 4UVAA 2Y48A 3LDDA 5H6RA 1QR9A 3LNMB 1L1FA 1F4NA 4G2KA 1DF5A 4LCUC 1AJPA 1W0KG 1YJWV 1K5SA 3ASOC 3CCJV 2NNUA 4L87A 1WPXA 4MVRA 3ETEA 4UXNA 3W7XA 1VQ8V 3LSSA 5H6QA 1EZJA 2EILC 3ZMSA 4TSFG 4MVUA 3JD4A 2QM7A 1MOFA 4U7OA 3ASNC 3K79A 3LUTB 3GB7C 1ROPA 5L3GA 3I55V 1NKDA 3ZMZA 2A9HA 4P2ZA 1AI4A 3ZIAG 2ZR3A 3TETA 3T1CA 2YEVB 3ZRXA 3CCVV 1NR7A 2Z5UA 3G6EV 4FJCC 1E1RG 2PI5A 4JPRA 4MVMA 5J9PC 4MTOA 3NXSA 3SYPA 4TT3G 1AI6A 4UVBA 4U7NA 4UUJC 4ZBMA 2HG5C 2NLJC 2W0FC 2DW4A 4PDLA 5CBFA 5IY5B 2C2AA 4PDMA 4RQEA 2ZQMA 2WLLA 1AI5A 1VQ4V 4BW5A 4RUEA 3A0RA 2B1GA 3AG1B 5KA5A 3B8NA 1VQNV 2UXXA 1QCEA 1YSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOC C;  2ITC C;  1ZWI C;  2ATK C;  3AG2 C;  4GX1 A;  4EKW A;  2BOB C;  2WLM A;  4WFG A;  3E8H A;  3SYQ A;  4P30 A;  3K08 A;  4P9O A;  4QNH B;  3T4Z A;  1XL4 A;  3F5W C;  4KFM A;  2AHZ A;  4GX5 A;  4P9P A;  3ABL C;  2EIJ C;  2QTO A;  5IY5 C;  3HPL C;  5KUK A;  2Q68 A;  3SPH A;  3SPI A;  3AG4 C;  3KG2 A;  1R3L C;  4RAI A;  4JTD B;  1R3K C;  3K06 A;  3VOU A;  3BEH A;  1OCR C;  1G4Y B;  4J9Z B;  3SYA A;  4XDK A;  4JTC B;  5CBG A;  4LBE C;  3AG1 C;  4MVQ A;  4MTG A;  4MW3 A;  4J9Y B;  1QLE C;  2HVJ C;  3IGA C;  3OR6 C;  4R8C A;  3SYO A;  2HVK C;  2DWD C;  2X6B A;  2DYS C;  3E8G A;  1M57 C;  3R65 A;  5B1A C;  1M56 C;  4X8A A;  2WLI B;  3F7Y C;  4RO2 A;  3OUS A;  4PDR A;  3F7V C;  1OCO C;  4MVO A;  3ZJZ A;  4GX2 A;  2ZXW C;  4PA9 A;  4WFF A;  2EIM C;  4CBC A;  4PA7 A;  4MVZ A;  4X89 A;  4R50 A;  4XDJ A;  5B1B C;  1ORQ C;  1XL6 A;  4H33 A;  5EBM C;  2DWE C;  3E89 A;  3JYC A;  4QE7 A;  1V54 C;  2JK5 C;  3AG3 C;  2Q69 A;  4WFE A;  5KUM A;  4MS2 A;  3ZRS A;  3ABK C;  3RVZ A;  2WLL B;  5CBH A;  5EC1 C;  3LDD A;  1J95 A;  3LNM B;  4F4L A;  4LCU C;  5EK0 A;  2A0L A;  1K4D C;  2ITD C;  3RVY A;  2A79 B;  5BZB A;  1V55 C;  1R3J C;  3E86 A;  4MVS A;  4PA4 A;  5E1A C;  4JTA B;  3ASO C;  2HJF C;  3LDE A;  3OGC C;  2DYR C;  1R3I C;  4XDL A;  2AHY A;  4MVR A;  3SJQ C;  3K04 A;  2WLI A;  2Q67 A;  2H8P C;  2EIL C;  3STL C;  3K03 A;  2IH3 C;  3SYC A;  4MTF A;  3OR7 C;  1S5H C;  3EFF K;  4HZ3 A;  3RW0 A;  3WG7 C;  4G27 B;  4MVU A;  4DXW A;  2P7T C;  3ASN C;  2WLH A;  3SPC A;  4PDV A;  5B3S C;  3LUT B;  1OCZ C;  3GB7 C;  3E8B A;  3FB5 C;  3UKM A;  3STZ C;  3SPG A;  2R9R B;  1OCC C;  1BL8 A;  2IH1 C;  2Q6A A;  4PA6 A;  4G28 B;  2A9H A;  5EC2 C;  4P2Z A;  1K4C C;  4MSW C;  2K1E A;  3FB8 C;  3K0D A;  3TET A;  3T1C A;  4WFH A;  2OCC C;  3UM7 A;  3PJS K;  2EIK C;  4QE9 A;  3T4D A;  5EBW C;  1KKD A;  4X88 A;  4LP8 A;  2HFE C;  4MW8 A;  2X6A A;  3IFX A;  4MVM A;  2KB1 A;  2EIN C;  4MTO A;  3FB6 C;  5EBL C;  3SYP A;  5J9P C;  2WLJ A;  2QKS A;  3E83 A;  3TCU A;  1P7B A;  2WLN A;  4I9W A;  4UUJ C;  4HYO A;  4ZBM A;  2HG5 C;  3OUF A;  3K0G A;  2NLJ C;  4TWK A;  2W0F C;  2Y69 C;  4PDL A;  3X2Q C;  5CBF A;  4R6Z A;  4PDM A;  1LNQ A;  2WLL A;  1JVM A;  3ABM C;  4GX0 A;  4PA3 A;  3RBZ A;  4BW5 A;  4RUE A;  4H37 A;  2WLK A;  4R7C A;  2ZD9 A;  3LDC A;  3SPJ A;  3T2M A;  4OXS A;  2X6C A;  4RUF A;  3FB7 C;  2YEV A;  3E8F A; 
#chains in the Genus database with same CATH topology
 1MAB G;  1OCO B;  2IJJ A;  2ZXW B;  4O4L A;  2EIM B;  3SYQ A;  1S72 V;  2W6J G;  4WFB V;  4H0L B;  1L0N H;  3WFV A;  2AHZ A;  4X65 O;  1FD9 A;  2HP8 A;  1E1Q G;  2F1M A;  2UUB B;  1VF5 B;  5AG2 A;  4YY3 B;  4NTW A;  3U11 A;  3AG1 C;  1D2D A;  1D5A A;  3OTO B;  2WLI B;  2OYQ A;  1HWY A;  3VBB A;  4X1Y B;  1W0J G;  4NR1 A;  5EIB D;  1Q3E A;  1SET A;  1XL6 A;  3JAK A;  1QBZ A;  5L3D A;  5LP6 B;  4QE7 A;  3EXA A;  5KHI A;  1DTO A;  3KKY A;  3RVZ A;  1SZX A;  1L8D A;  1VF7 A;  1XDC A;  1KB9 F;  3HB3 B;  4BR6 A;  4F4L A;  4O4H B;  2Q0O C;  1UJW B;  3BVO A;  1AJN A;  2HHH B;  1JJO A;  1TGO A;  2IJI A;  1KYO F;  1V55 C;  2HKO A;  2VQE O;  3C3S A;  5GON A;  5E1A C;  1Q5O A;  3LDE A;  3JAW A;  2VWK A;  5FNV A;  4LNU A;  3ZMT A;  3J81 N;  3OAA G;  3STZ C;  3H9V A;  3ZX6 A;  2Z3Y A;  1H2L A;  2H94 A;  1R1B A;  1HNX B;  4FLV A;  4Q6G A;  3JSN A;  4WFH A;  5KMG A;  1BSM A;  2Z0A A;  4PI0 A;  4N21 A;  4CS4 A;  2HFE C;  3TXS A;  4A5U B;  1H8H G;  5EBL C;  4IL6 Z;  2LFR A;  1P7B A;  2UXC B;  2AZ0 A;  4DK1 A;  2CTR A;  3AG4 B;  2ZE5 A;  1H38 A;  2F95 B;  1AR1 B;  3G80 A;  1XNR O;  5JJE B;  3KCX A;  5K1P A;  5LOV A;  1Q6H A;  4ZHQ A;  1HNW B;  1DLB A;  3ZS8 C;  4B3M O;  4GX1 A;  1AIL A;  3S3X A;  2IU0 A;  1XMO O;  3FAV B;  1FKA O;  4PHZ A;  3B2E E;  2ZE7 A;  4DV7 B;  1BCC H;  3GWK C;  1GK9 A;  4UCV A;  1TUB B;  3C90 A;  3VOU A;  1IVS A;  3CPW U;  1OCR C;  1IBM O;  2DQ0 A;  1HNX O;  2YDE A;  1M57 C;  5JVD A;  5JJJ B;  2IJH A;  5CB4 A;  4MVO A;  2XND G;  2CH7 A;  3P32 A;  3G67 A;  3J80 N;  3RYC B;  4QPJ A;  1XHX A;  4JYB A;  2UXC O;  1B04 A;  2JK5 C;  1OCZ B;  4MS2 A;  2JDI G;  3K5L A;  1JFF B;  4JAV A;  5IJ0 B;  3IC7 A;  5A9G A;  1WA8 A;  2UUA B;  2JEX A;  2ZE8 A;  3ETQ A;  4PA4 A;  4JTA B;  4WBN A;  1HNW O;  2Q67 A;  2H8P C;  4X1K A;  3HKC A;  1J5E B;  2RNB A;  3OR7 C;  3TGU H;  3WG7 C;  1MNG A;  4PEL A;  3BA9 A;  4DXW A;  1HR0 O;  2L6L A;  4JI5 B;  1FJG O;  1XBL A;  1N32 O;  2Y0P A;  5LMU O;  3ZHQ A;  3JCZ A;  3HKD B;  3UM7 A;  1JMK C;  3CD6 V;  2QM8 A;  4NB5 A;  1Y74 B;  1P7G A;  3AK1 A;  4FLY A;  2EIJ B;  1NS1 A;  4IYH A;  3OMI B;  1S0V A;  1QLN A;  5KHG A;  4H37 A;  1I94 B;  2UUA O;  5D5Q A;  2EJ7 A;  4AI8 A;  2DQ3 A;  2QKA A;  4YHH B;  1HW7 A;  4MT8 A;  2YEV A;  3B4S A;  2AGA A;  2FYU H;  1J5E O;  3G6B A;  1W2B U;  1KC8 W;  3VQV A;  1PP9 H;  1NZ6 A;  2QWR B;  3E2E A;  3BAB A;  4FM2 A;  1PPJ H;  5LHH A;  5HFM A;  1K92 A;  4JTC B;  5CBG A;  1ENV A;  3N2K A;  2Q7H A;  2RN9 A;  4ZI7 B;  1D5N A;  4X9Q A;  5B1A C;  3F7Y C;  1NBM G;  5BMV B;  2W6I G;  4FM0 A;  5LGU A;  3RWR D;  5KUM A;  3N27 A;  1S76 D;  2UXN A;  4QPK A;  2IBZ H;  1EM1 A;  1GM7 A;  1GRJ A;  3TK1 A;  1I94 O;  4JI8 B;  2H3O A;  2LGQ A;  3E86 A;  4YHH O;  3FFQ A;  1QU7 A;  2OCC B;  3JD0 A;  5KX5 A;  3K04 A;  2BTO A;  2ODM A;  2UU9 B;  5IYD O;  3PN1 A;  2VWJ A;  2Q73 A;  3CP1 A;  4I4T B;  5B3S C;  4B08 A;  4DW1 A;  1AVM A;  3P3N A;  1GN3 A;  2EUL A;  2ADQ B;  3DXR B;  3HR0 A;  2EIK C;  4K8X A;  4NVP A;  4LP8 A;  1IDS A;  1SQB H;  1K9M W;  4J7K A;  3E22 A;  5B5E Z;  5K1X A;  5EIB C;  2YI9 A;  3RYF A;  3CC2 V;  2XOK G;  4HNA A;  2Y69 C;  4R6Z A;  3CCR V;  1RP3 B;  1LNQ A;  3OD4 A;  4JZG A;  4GUN A;  2CTQ A;  1G8M A;  2E74 B;  4RWU A;  3SPJ A;  1N33 B;  1H2S B;  4O4J B;  4DR3 B;  2BTQ B;  2Q7G A;  1N36 B;  2YS8 A;  2BOB C;  3E8H A;  4X20 B;  1R6T A;  4JZ2 A;  3OM3 B;  4AIL C;  1KD1 W;  4UCO A;  4DV2 B;  4FLZ A;  4K8Z A;  4H13 B;  1KEC A;  1NU1 H;  2HVK C;  2DWD C;  5D5P A;  3RT3 C;  4B3T B;  4X8A A;  3ICX A;  1U96 A;  2AXT Z;  3BCC H;  3BY6 A;  3CCM V;  4AHC A;  4XDJ A;  3K5O A;  3THO A;  3JYC A;  4LF5 B;  2JEU A;  1K34 A;  3CJH A;  5EC1 C;  1XRE A;  4CC6 A;  4DR2 B;  1L1F A;  4G2K A;  3A8T A;  4LCU C;  1T5E A;  1YJW V;  2CTP A;  1N33 O;  3ASO C;  1BE3 H;  2NNU A;  3ETE A;  2Q9L A;  1VQ8 V;  3LSS A;  4DV0 B;  2EIL C;  3ZMS A;  2LW7 A;  1WJZ A;  1L0L H;  5JQG A;  4AQY B;  3K79 A;  4UCU A;  5L3G A;  3I55 V;  1SS3 A;  4DV2 O;  4FFB A;  3UT5 A;  1AI4 A;  3ZIA G;  2ZR3 A;  3CCV V;  3SJC C;  3G6E V;  4FJC C;  1E1R G;  3SYP A;  4ZBM A;  5J2T B;  4JI0 B;  2W0F C;  4PDL A;  5JH7 B;  4DR5 B;  4RQE A;  2WLL A;  4IIJ A;  4DR2 O;  5J2U B;  3A0R A;  3DSQ A;  5KA5 A;  3AG1 B;  3P3P A;  4DK0 A;  1VQN V;  2GTS A;  4I0X A;  1QCE A;  4JV5 B;  2ATK C;  2JIZ G;  2OCH A;  2YSU B;  4YXW G;  1NVP D;  2XUM A;  2CGN A;  3T4Z A;  4WCE V;  2BSK B;  1UPG A;  4DR1 O;  3JAL A;  3K06 A;  4DR4 B;  1WP8 A;  5KAF Z;  2GDS A;  1ZL8 B;  1YJN V;  4MW3 A;  1V55 B;  1Q8I A;  2OWO A;  4QGP A;  2DJV A;  3BRC A;  2XAG A;  4DUZ B;  2ZNI A;  2UXB B;  3ABT A;  2ZIM A;  3CYO A;  2XT9 A;  4JAS A;  1MZE A;  3OE7 G;  3ETG A;  4L8J A;  5JJN B;  1F7Y A;  1YVW A;  3SJA C;  5L3B A;  3ZN0 A;  4J41 A;  4O2B B;  3HKE B;  4HAM A;  3ZRS A;  4DR5 O;  4ASU G;  5B1N A;  3O9O A;  1GAX A;  2K9P A;  1RM1 C;  1K5Q A;  2A79 B;  1Q43 A;  2JGU A;  1R3J C;  1CP9 A;  2DYR C;  3SJQ C;  4JV5 O;  4O4L B;  2ZDI A;  2IH3 C;  3G4S V;  2AZ2 A;  3EFF K;  3JAS A;  1GM9 A;  4DV3 O;  2WLH A;  1YTF B;  3W7W A;  3VQW A;  2R9R B;  1OCC C;  4DR4 O;  2MW2 B;  4JI1 B;  3U0Z A;  1V9P A;  3CX5 F;  5EC2 C;  1VQK V;  2ZM6 O;  1N34 B;  2ZNJ A;  1BMF G;  4DUZ O;  3PJS K;  5KLV H;  4NTY A;  5IYC O;  2WA4 A;  4PJ0 Z;  5LGN A;  3CSX A;  5C8Y B;  2QKS A;  4TUY A;  5E79 Z;  1KUQ A;  1VQO V;  5H2F Z;  5LGT A;  4GKJ B;  3SDL A;  2JJ2 G;  1TAE A;  1OCR B;  5LXT B;  3RBZ A;  1PKX A;  2XAQ A;  1NH2 B;  5L3F A;  1UFI A;  1P49 A;  1FFT B;  1M90 W;  4X64 B;  3JAW B;  1M57 B;  1K3E A;  2JJ1 G;  3QO5 A;  2YXL A;  1GN2 A;  1WB7 A;  4DR6 O;  4U3J B;  3T1Y O;  1IXB A;  1XI1 A;  5EYP B;  3CMA V;  4GCZ A;  1WB8 A;  1NTZ H;  3CE2 A;  3HPL C;  4X1I B;  3SPI A;  4TQD A;  3A0B Z;  1FXK A;  1IBL O;  4FZ0 A;  2A3Q A;  1N34 O;  4GZR B;  3HKB B;  4LF7 O;  5CMU A;  1AR5 A;  3JCU Z;  5A2Q N;  5B1B C;  4I50 A;  2QWO B;  3WG7 B;  4B3S O;  1XQ8 A;  1QQC A;  1EFR G;  3H01 A;  4E2L A;  4F6R A;  1KBH A;  4TV9 A;  3OTF A;  1K4D C;  2ITD C;  3D3I A;  4HBN A;  4X64 O;  2HJF C;  4IHJ A;  1I08 A;  4XDL A;  1ARO P;  1NTK H;  3STL C;  1IBK B;  3K03 A;  4EB6 B;  1Y76 B;  3W7S A;  1VF6 C;  3UKM A;  2E75 B;  1EN4 A;  1AB3 A;  4LH6 A;  1BL8 A;  5LHI A;  2UXD O;  1SF9 A;  2K1E A;  1EBO A;  5CB4 B;  1EZV H;  4I5S A;  2CH7 B;  1QVG U;  1JQ0 A;  4LF4 B;  1BQZ A;  1GM8 A;  2EIN C;  1URF A;  4PI2 A;  2E76 B;  5IJ9 A;  1N4C A;  1YF2 A;  4TWK A;  1FYJ A;  2UUB O;  4I9Q A;  3AEI A;  4YY3 O;  2ZD9 A;  1BHA A;  4OXS A;  4LWS A;  1SQQ H;  1NI8 A;  5B1A B;  3OTO O;  1N8R W;  3BFR A;  4U3F H;  3MD0 A;  4WFG A;  3ZHV A;  4WFA V;  4B7K A;  1PM9 A;  3UCS C;  5CA0 A;  1WNS A;  4LFA B;  2Q68 A;  1K97 A;  2QE7 G;  4LBE C;  4MTG A;  2UUC B;  2B1I A;  4J9Y B;  2HHH O;  3E8G A;  1YIT V;  2F43 G;  4C7U A;  4XBF A;  4J80 A;  5FL7 G;  1MA1 A;  4GX2 A;  1Y66 A;  3ML0 A;  4X89 A;  3OEE G;  2DWE C;  1S5J A;  3AG3 C;  4WFE A;  5B3S B;  5CBH A;  5DM6 V;  4UV8 A;  4KUM A;  4UB6 Z;  4DRX A;  2R9A A;  1Z2G A;  1B06 A;  1SA0 B;  5JCO A;  1BHB A;  4UCT A;  2EZO A;  2BE3 A;  1R3I C;  3TJT A;  2EIK B;  4DV1 B;  3AK2 A;  2WLI A;  2YUA A;  5DEC A;  4X1Y A;  4TV8 B;  4KL1 A;  4HZ3 A;  1FXH A;  4UFZ A;  4IT5 A;  4YIP A;  1SKV A;  5LP6 A;  2OT5 A;  2Y69 B;  2Q7E A;  3CCQ V;  3ZRW A;  2VS0 A;  1FFX B;  2XAS A;  2OIE A;  1VQ9 V;  3N2K B;  4DR7 B;  1K4C C;  2UUC O;  1AJQ A;  1YZB A;  2Y0I A;  2QWQ B;  3CHX A;  3C3T A;  1PD3 A;  3IAY A;  2X6A A;  3FB6 C;  3TCU A;  2WLN A;  1QR8 A;  3B77 A;  2IU3 A;  3OUF A;  2KQX A;  4DV7 O;  1SQF A;  3JAR A;  3M99 B;  2NN4 A;  2AW9 A;  4W4L A;  4JI2 B;  4W4K A;  1RSO B;  3CWB H;  3LDC A;  2PTM A;  2QKC A;  1US6 A;  1YXB A;  4LR3 A;  3G71 V;  2HLD G;  4DV1 O;  3AG7 A;  4P30 A;  3K08 A;  4LF8 B;  4QNH B;  3CC7 V;  4JI6 B;  2JGD B;  5IYZ B;  1LUV A;  1SQG A;  2IW5 A;  4GX5 A;  1M4U A;  4I55 B;  4BAY A;  3L72 H;  2ZE6 A;  5B66 Z;  4DR7 O;  4Z1V A;  4R8C A;  2P06 A;  2P5O A;  3ASO B;  1P4R A;  1M56 C;  1VQP V;  4RO2 A;  4PDR A;  4DW0 A;  3F7V C;  4GLX A;  2EIL B;  3ETD A;  3FAV A;  1IXM A;  2PUS A;  4YJ2 A;  1JX9 A;  3ABK C;  3CCS V;  1TUB A;  1YJ9 V;  4UVA A;  3LDD A;  4JI5 O;  3LNM B;  3M7M X;  4DYL A;  1AJP A;  4JI2 O;  3B40 A;  2P4V A;  1TA8 A;  1K5S A;  1H2K A;  2GUZ B;  3H1L H;  3CCJ V;  1WPX A;  3W7X A;  5H6Q A;  4TSF G;  3RYC A;  5LA6 A;  4FLT A;  4U7O A;  3JD4 A;  1MOF A;  2ZIN A;  2ILM A;  1ROP A;  2QWP B;  2VRZ A;  1JFF A;  5IJ0 A;  1Q6I A;  4O4I B;  2QR4 A;  2FB5 A;  4ZOL B;  3T1C A;  3WU2 Z;  3ZRX A;  3RYI B;  2CAZ C;  4JPR A;  5J9P C;  3NXS A;  2LJ2 A;  3BHP A;  5EZY B;  4CC5 A;  4UVB A;  4UUJ C;  2NLJ C;  2ZQM A;  2Q0A A;  1XUQ A;  3CRC A;  1U97 A;  2B1G A;  5LYJ A;  3CS5 A;  4ICG A;  3HKD A;  3JAT B;  4EKW A;  1XOU A;  2E5L B;  1FS0 G;  3QVN A;  1Y74 A;  1ZSP A;  4Z1M G;  5IY5 C;  4FLX A;  3T1H B;  4JTD B;  3BEH A;  2QA4 V;  1RM1 B;  4J9Z B;  3SYA A;  5BR8 B;  1M5I A;  1ZUQ A;  2GSM B;  3H1J H;  3SYO A;  4JI8 O;  1COW G;  1LR1 A;  1I5Y A;  3IC9 A;  4DUY B;  3UO3 A;  2DYR B;  5KHH A;  1M1K W;  4KP4 A;  4CZZ A;  3CME V;  3JD1 A;  1RPR A;  1S5L Z;  2UU9 O;  2HJD A;  2DE0 X;  1VQ5 V;  1GMG A;  2WLL B;  4EFB A;  4LF6 B;  1S77 D;  5CA1 B;  1OCC B;  2YIC A;  2R72 A;  2A0L A;  3BA8 A;  3N2G B;  5BZB A;  4I0X B;  4OPA A;  1QNM A;  4ZI7 A;  1FAF A;  4QJF B;  2ZR2 A;  5BMV A;  1ZAU A;  5HFL A;  1CEZ A;  3Q4H A;  2E5L O;  2P7T C;  2YIB A;  4FLW A;  2V7Q G;  2XAF A;  3MAQ A;  4JI7 B;  3CCE V;  1K8A W;  4CH4 A;  1GH6 A;  1K7D A;  2MK3 A;  3DTU B;  3RYH B;  3J7A U;  5EBW C;  2OTJ V;  3K59 A;  2M7W A;  1VAR A;  4X88 A;  4DR3 O;  1N36 O;  2F23 A;  1AR4 A;  4Z2W A;  3K57 A;  2N05 A;  3CEI A;  3K3W A;  3L9D A;  4D7T A;  4YJ3 B;  3MHS C;  1JVM A;  1O9G A;  1ZX3 A;  2P22 C;  3ZED A;  5BXZ A;  2PY5 A;  1KU9 A;  2ETN A;  4B3T O;  4NKG B;  1HDJ A;  2GHY A;  5B1B B;  2CUG A;  3F5W C;  5KHJ A;  4LF5 O;  3CCL V;  1KP2 A;  1R3K C;  3QF7 A;  4NXN B;  4N23 A;  2E3C A;  3FKS G;  2WSS G;  3OUS A;  2A06 H;  2BTQ A;  4NXM B;  2X7R B;  4X66 B;  4DV0 O;  4PA7 A;  2V4D A;  4X20 A;  4K0K B;  5BY1 A;  4PV1 B;  2Y4T A;  1KQS U;  3H1K H;  4AQY O;  2HEP A;  3D8C A;  3K58 A;  5EK0 A;  5ITZ B;  3ZN1 A;  1R73 A;  3OGC C;  2BCC H;  3I56 V;  1SQV H;  2EIN B;  2YID A;  1KKC A;  1YIJ V;  4CS3 A;  4ABM A;  2V1D A;  4JI0 O;  2YXH A;  3L73 H;  4OX9 B;  1PNK A;  1YI2 V;  3DGE A;  2IH1 C;  3LSQ A;  1F4M A;  4LFB B;  2Q8V A;  3T4D A;  5DN6 G;  2KB1 A;  3CXC U;  2WLJ A;  3E83 A;  5FPO A;  3FYI B;  4I9W A;  2L35 A;  2CGO A;  4F6R B;  2Q5Z A;  1JOY A;  1OZ0 A;  3QNE A;  3L74 H;  4UVC A;  2YC0 A;  1Q7Y W;  1HP8 A;  4UV9 A;  5LMN B;  1DK1 A;  4LF9 B;  1XMQ B;  1GO3 F;  3AG2 C;  2UXB O;  4O2A A;  3ZMU A;  2ZKO A;  3JAK B;  1BZK A;  5J2T A;  3AG3 B;  4P9P A;  4QIW F;  2IM9 A;  4OX9 O;  2A7W A;  5JH7 A;  1WLE A;  4WF9 V;  1JCH A;  3KG2 A;  1R3L C;  4RAI A;  2OTL V;  5KAI Z;  5KHK A;  1DF4 A;  4XDK A;  1OV9 A;  3QO7 A;  5GON B;  1JA8 A;  1QLE C;  2ZCE A;  1GTO A;  2X6B A;  1M9N A;  1OJH A;  2PZS A;  3ZRV A;  1QVF U;  3ZJZ A;  4PA9 A;  4WFF A;  3FYE B;  4MVZ A;  1MG1 A;  1NVP B;  3D36 A;  5FNV B;  3E89 A;  4LNU B;  4X65 B;  1V54 C;  2EBO A;  3W7U A;  2BSK A;  2R9I A;  1VQM V;  4KXR A;  3JSL A;  4RQF A;  1N0N A;  1JJ2 U;  4NYK A;  4JI1 O;  1H2N A;  4DV4 B;  2YXY A;  5LL6 Y;  2PYL A;  5KMG B;  4LF9 O;  2YIA A;  2AHY A;  4DO2 A;  2WA3 A;  2ZDI C;  3ZBH A;  4EEQ A;  3AK3 A;  3RW0 A;  3OEH G;  4G27 B;  4D7S A;  1SRY A;  3L75 H;  4O2B A;  2FML A;  4KHP B;  3MHH C;  4GKJ O;  1XNQ B;  4JYA B;  1HNZ B;  2Q6A A;  1NR1 A;  2WWW A;  2CK3 G;  2VQE B;  5LOV B;  4ZHQ B;  4FLU A;  2EJR A;  4JYC A;  3OMN B;  1M93 A;  3CRM A;  4JI3 B;  2KG7 A;  5LBQ A;  3K0G A;  3SGI A;  2X0L A;  1LUW A;  3X2Q C;  1PNM A;  1CXZ B;  4DRX B;  3ABM C;  5IT9 N;  1YDX A;  4R7C A;  5F2V O;  4DV4 O;  3K9A A;  3ZHR A;  5JVD B;  1M56 B;  3E8F A;  1ZWI C;  2FTK A;  3D36 C;  2CDY A;  5C8Y A;  3O65 A;  4ZKI A;  5FLX N;  1MMM A;  3ZRW B;  3ABL C;  1K73 W;  3ABK B;  3A0H Z;  2QTO A;  1I5X A;  5KUK A;  4KHP O;  2GV9 A;  1XNQ O;  1XNR B;  4JYA O;  1FXK C;  1HNZ O;  1WA8 B;  5LXT A;  3S3W A;  1Q82 W;  2HVJ C;  3ZCC A;  2DYS C;  2F4V B;  3R65 A;  4WBN B;  1TVK A;  4B3M B;  4E4E A;  4X1K B;  1XMO B;  3HKC B;  1IBK O;  4U3J A;  1ORQ C;  4JI3 O;  4H33 A;  3NR7 A;  4K35 A;  5EYP A;  1GKF A;  3JAR B;  1TUE B;  4X1I A;  4IGG A;  2Y48 A;  1Q6U A;  1IBM B;  2JS5 A;  1DF5 A;  4LFC B;  3R66 A;  2KKW A;  1W0K G;  2QWN B;  3L70 H;  4DV6 B;  3HKB A;  4L87 A;  1GN4 A;  4UXN A;  4LF4 O;  3RFR A;  4MVU A;  2QSA A;  1EN5 A;  2LO1 A;  1NKD A;  2DMX A;  3ZMZ A;  4P2Z A;  2ZIO A;  3FD9 A;  3M8A A;  4X62 B;  3TET A;  4I7Z B;  2LW1 A;  2F4V O;  1I7F A;  2YEV B;  4LH7 A;  1NR7 A;  2Z5U A;  2G38 A;  4MVM A;  4YJ2 B;  1XHZ A;  4TT3 G;  4EB6 A;  3LNN A;  1HR0 B;  1Y76 A;  1ZTE A;  2HG5 C;  3D3Q A;  2DW4 A;  5IY5 B;  5CBF A;  4UCR A;  1FJG B;  2C2A A;  4PDM A;  4LFA O;  2QDO A;  1N32 B;  1AI5 A;  5LMU B;  1O9H A;  1VQ4 V;  4LFC O;  4BW5 A;  4RUE A;  4O4H A;  1DGS A;  1MZF A;  2JRI A;  3QG5 A;  4OGQ B;  5JWP A;  2LQT A;  4UCS A;  3ZHT A;  4K3A A;  2W0X A;  4DV6 O;  2UXX A;  4MTX A;  1YSC A;  2PF4 E;  3CRA A;  5LA6 B;  2YIB D;  2Q4P A;  1THZ A;  2PI4 A;  1Y67 A;  5H5N A;  5B1O A;  2RMK B;  3OR6 C;  2VQF B;  4X62 O;  5KX5 B;  2B5U A;  3IJ4 A;  1OCO C;  1RPO A;  2DOS A;  2ZXW C;  2EIM C;  4R50 A;  5EBM C;  4TOI A;  3EVK A;  4JAU A;  4BIU A;  3B8M A;  3WB2 A;  4BIO A;  3JD2 A;  5LYJ B;  5CN0 A;  2WAM A;  5JCO C;  1BQ0 A;  2B9Z A;  4MVS A;  3FX7 A;  1F51 A;  4CH5 A;  3MDS A;  4GT1 A;  3A2F A;  3E22 B;  1ZLZ A;  3SYC A;  4MTF A;  3RYF B;  5GTH Z;  5LP6 C;  2N74 A;  4HNA B;  3SPC A;  4PDV A;  3E8B A;  4H44 B;  2EX3 A;  1IZ3 A;  1X4T A;  3QO8 A;  3B09 A;  1WN7 A;  1SER A;  1SA0 A;  3K0D A;  2VQF O;  1VQL V;  2NR5 A;  1SZT A;  1KKD A;  1N0J A;  4TV8 A;  2ARH A;  4LF8 O;  4JI6 O;  1FPO A;  3KZI Z;  3EHB B;  2QM4 A;  1FFX A;  4FM1 A;  1JPX A;  2LP7 A;  2WLK A;  3CC4 V;  4BWA A;  1F23 A;  2QJ1 A;  4J10 A;  2LFS A;  1RFY A;  3OGI B;  5CA3 A;  1K33 A;  2WLM A;  3CXH F;  3Q4H B;  2FL4 A;  4OPH A;  3CJH B;  3OMA B;  3AG4 C;  1Q86 W;  1B6Q A;  4FIP C;  3OT7 A;  2M6Y A;  1Y6X A;  1WP7 A;  1Z5W A;  1Y4M A;  1WPB A;  2PGG A;  1RSO A;  3IGA C;  4F6E A;  5L3C A;  2RJZ A;  1AI7 A;  5GW7 A;  4Q20 A;  3E35 A;  1VMG A;  4NTX A;  4JF3 A;  2JGD A;  5JQG B;  5IYZ A;  2Q69 A;  1XIL A;  4I55 A;  3H1H H;  2XAH A;  5C93 A;  1J95 A;  4FFB B;  1SQX H;  3UT5 B;  3U10 A;  3WB1 A;  2QGN A;  1NJI W;  2FKX A;  2PYJ A;  5FPR A;  4FFK A;  2F66 C;  4EFE A;  1WAZ A;  2IJK A;  4DV5 B;  3H1I H;  4B7E A;  1OCZ C;  3SPG A;  2OIG A;  2EZP A;  4IIJ B;  1S3J A;  2CTW A;  4D6T H;  4G28 B;  1Q81 W;  5L3E A;  3K5N A;  3FB8 C;  3ZMV A;  1YHQ V;  2D2C B;  2GUZ A;  4UB8 Z;  3AG2 B;  3ABU A;  4ZIB A;  3TXQ A;  4MW8 A;  3IFX A;  4BIZ A;  3APO A;  4HYO A;  1BT8 A;  2XHB A;  1JR9 A;  3JAL B;  3APQ A;  3T1H O;  1H8E G;  4JGS A;  3UO2 A;  4GX0 A;  4PD4 F;  4PA3 A;  2R70 A;  4O4I A;  3RN4 A;  5BR8 O;  2XTA A;  5IDJ A;  1QLE B;  4YIO A;  1B3Q A;  3RGB A;  3ZHS A;  1FXV A;  1R6K A;  3K9S A;  4ZOL A;  4DUY O;  1A32 A;  2BOC C;  2ITC C;  3RYI A;  1QHT A;  4P9O A;  1VIB A;  5IYB O;  1SES A;  4FK5 C;  3ASN B;  5EZY A;  1V54 B;  2RDC A;  4I4T A;  4DV5 O;  1E79 G;  2EIJ C;  1R6N A;  4LF6 O;  3KCY A;  1IUR A;  5GTI Z;  1YCI A;  5TIS Z;  3P30 A;  2P6J A;  1Z5V A;  3GWO A;  1H2G A;  3JD3 A;  5DED A;  3JAT A;  3DXR A;  3JAS B;  4JYY A;  1KP3 A;  2RQ6 A;  3I5D A;  5KA6 A;  2HR3 A;  2KSD A;  4JAA A;  2P90 A;  1YTF D;  4DR1 B;  1VQ6 V;  1BGY H;  1VEW A;  3DC5 A;  1NT2 B;  3RVY A;  4JI7 O;  3CRR A;  4CS2 A;  1IX9 A;  4O4J A;  3GVM A;  4J42 A;  4O2A B;  1NQT A;  2D3O W;  1S5H C;  4TUY B;  1KMI Z;  3X2Q B;  3FB5 C;  3CB2 A;  4TQF A;  2F93 B;  3DC6 A;  3BPZ A;  2XAJ A;  4J7J A;  5CA1 A;  3ABM B;  4PA6 A;  3ZHU A;  1NH2 D;  4MSW C;  3N2G A;  1AP5 A;  2OCC C;  2QEX V;  5H9C A;  4QE9 A;  4CH6 A;  1OHH G;  4JI4 B;  4DV3 B;  1G6U A;  3ABL B;  3K5M A;  3JAM N;  1MSW D;  1AP6 A;  1CPY A;  2N04 A;  4FPP A;  4CH3 A;  1FXK B;  1P84 F;  2ZT9 B;  2ZM6 B;  2O57 A;  4NXN O;  1EN6 A;  3CRQ A;  2DYS B;  2X6C A;  4RUF A;  2JS3 A;  4B3R B;  3RYH A;  3CCU V;  4NXM O;  4I50 B;  4X66 O;  1BS3 A;  4LC1 A;  1XL4 A;  1W59 A;  5LHG A;  1PNL A;  4KFM A;  3W7T A;  1X59 A;  4BW9 A;  4K0K O;  4YJ3 A;  3SPH A;  2QTS A;  4TV9 B;  1PL0 A;  1YEW A;  4FMT A;  1G4Y B;  2WPD G;  2Y4U A;  4MVQ A;  3T2M A;  3UQ8 A;  3OFN G;  2DN9 A;  3WB0 A;  1VQ7 V;  4IHJ B;  1SC5 B;  3OW2 U;  4GKK B;  1VP7 A;  4DR6 B;  2P67 A;  3T1Y B;  4CBC A;  2KG7 B;  4JI4 O;  5IWA B;  1Q90 D;  3VQY A;  3SJB C;  2P4K A;  1MSD A;  4J11 A;  5H6R A;  4IYI A;  1QR9 A;  4FZ1 A;  1IBL B;  1F4N A;  1SQP H;  3QTC A;  5J2U A;  1PL4 A;  1XEQ A;  3VQX A;  4LFB O;  4B3R O;  4MVR A;  4LF7 B;  3BAA A;  1G1X B;  1EZJ A;  1I0H A;  4GYC B;  1PV0 A;  4B3S B;  4J7Z A;  2GTA A;  5IJ9 B;  2QM7 A;  3ASN C;  3LUT B;  2RCV A;  3GB7 C;  1VF6 A;  1NTM H;  5IE9 A;  2A9H A;  2LGW A;  2GBO A;  5ITZ A;  1ZL8 A;  4LWS B;  1TVK B;  2YI8 A;  2JVD A;  5LMN O;  4GKK O;  1XMQ O;  2PI5 A;  1H2M A;  4MTO A;  1AI6 A;  5IWA O;  5CA0 B;  4U7N A;  3L71 H;  3F5T A;  3HKE A;  3LSU A;  3SR2 C;  2UXD B;  2ADP A;  3B8N A;  2CE4 A;  1GN6 A;  3FB7 C;  4FVM A; 
#chains in the Genus database with same CATH homology
 2ATK C;  1MAB G;  1OCO B;  2JIZ G;  2YSU B;  2IJJ A;  4YXW G;  2ZXW B;  4EKW A;  2EIM B;  3SYQ A;  1NVP D;  3T4Z A;  1S72 V;  1FS0 G;  2W6J G;  4WFB V;  3WFV A;  2AHZ A;  4WCE V;  1THZ A;  4Z1M G;  5IY5 C;  1E1Q G;  2PI4 A;  4JTD B;  3K06 A;  3BEH A;  2QA4 V;  1RM1 B;  4J9Z B;  3SYA A;  1YJN V;  3AG1 C;  5B1O A;  4MW3 A;  2GSM B;  1V55 B;  3OR6 C;  3SYO A;  1COW G;  1I5Y A;  2XAG A;  2DYR B;  1M1K W;  4KP4 A;  2B5U A;  3ABT A;  2WLI B;  3CYO A;  4CZZ A;  1HWY A;  3CME V;  1OCO C;  1RPO A;  3OE7 G;  3JD1 A;  3ETG A;  1RPR A;  4JAS A;  2ZXW C;  3VBB A;  1W0J G;  2EIM C;  4R50 A;  1SET A;  1XL6 A;  5EBM C;  5L3B A;  5L3D A;  1QBZ A;  1VQ5 V;  3ZN0 A;  4QE7 A;  4MTX A;  1DTO A;  1GMG A;  4JAU A;  4BIU A;  3ZRS A;  4HAM A;  3RVZ A;  2WLL B;  1S77 D;  4ASU G;  5B1N A;  3B8M A;  3HB3 B;  1OCC B;  3JD2 A;  4F4L A;  1UJW B;  1RM1 C;  5CN0 A;  1K5Q A;  2WAM A;  1AJN A;  2A0L A;  2A79 B;  2IJI A;  5BZB A;  1V55 C;  2HKO A;  1R3J C;  4MVS A;  5E1A C;  1CP9 A;  3LDE A;  1F51 A;  2DYR C;  4GT1 A;  3SJQ C;  4QJF B;  2ZDI A;  2ZR2 A;  2IH3 C;  3SYC A;  4MTF A;  5HFL A;  3G4S V;  1CEZ A;  3EFF K;  1GM9 A;  3ZMT A;  2P7T C;  3OAA G;  2WLH A;  3SPC A;  4PDV A;  1YTF B;  3E8B A;  3W7W A;  3STZ C;  2R9R B;  1OCC C;  2Z3Y A;  3QO8 A;  2V7Q G;  2H94 A;  2XAF A;  5EC2 C;  1SER A;  1VQK V;  3CCE V;  1K8A W;  3K0D A;  1VQL V;  4WFH A;  1BMF G;  3PJS K;  1K7D A;  2MK3 A;  3DTU B;  5IYC O;  1SZT A;  5EBW C;  2OTJ V;  4N21 A;  2M7W A;  1KKD A;  4X88 A;  2HFE C;  5LGN A;  1H8H G;  5EBL C;  2QKS A;  2LFR A;  1P7B A;  3K3W A;  1VQO V;  3EHB B;  5LGT A;  3AG4 B;  1H38 A;  2JJ2 G;  3MHS C;  1AR1 B;  1OCR B;  1JVM A;  1JPX A;  2LP7 A;  3RBZ A;  1PKX A;  2WLK A;  2XAQ A;  1NH2 B;  5L3F A;  1FFT B;  3CC4 V;  1M90 W;  3FB7 C;  1F23 A;  1M57 B;  2LFS A;  1K3E A;  2JJ1 G;  3QO5 A;  1DLB A;  4GX1 A;  5CA3 A;  1K33 A;  2WLM A;  2IU0 A;  2GHY A;  5B1B B;  3F5W C;  3CMA V;  4GCZ A;  1GK9 A;  3HPL C;  3OMA B;  3SPI A;  3AG4 C;  3CCL V;  1B6Q A;  1KP2 A;  1Q86 W;  4FIP C;  1R3K C;  3VOU A;  3CPW U;  1OCR C;  1FXK A;  2DQ0 A;  1Y4M A;  3IGA C;  4N23 A;  3FKS G;  1M57 C;  2WSS G;  5L3C A;  2IJH A;  3OUS A;  4MVO A;  1AI7 A;  2X7R B;  2XND G;  3P32 A;  5CMU A;  4Q20 A;  5GW7 A;  4PA7 A;  4QPJ A;  3E35 A;  5B1B C;  3WG7 B;  4JF3 A;  4JYB A;  2JK5 C;  1EFR G;  2Q69 A;  3H01 A;  1OCZ B;  4MS2 A;  1KQS U;  4E2L A;  2JDI G;  2XAH A;  4JAV A;  5C93 A;  1J95 A;  3IC7 A;  5EK0 A;  1K4D C;  2ITD C;  2JEX A;  3ZN1 A;  3D3I A;  1R73 A;  4PA4 A;  4JTA B;  2HJF C;  3OGC C;  3I56 V;  1NJI W;  4XDL A;  1ARO P;  2Q67 A;  2H8P C;  3STL C;  3K03 A;  2EIN B;  3OR7 C;  1YIJ V;  3WG7 C;  2IJK A;  4PEL A;  4DXW A;  3W7S A;  2V1D A;  1OCZ C;  1PNK A;  3UKM A;  3SPG A;  1YI2 V;  3DGE A;  2EZP A;  1S3J A;  1BL8 A;  2IH1 C;  3LSQ A;  4G28 B;  5LHI A;  1F4M A;  1Q81 W;  5L3E A;  2K1E A;  1EBO A;  3FB8 C;  3JCZ A;  3UM7 A;  3ZMV A;  1YHQ V;  4I5S A;  3T4D A;  5DN6 G;  3AG2 B;  1QVG U;  3ABU A;  3CD6 V;  1JQ0 A;  1GM8 A;  4MW8 A;  2QM8 A;  3IFX A;  4BIZ A;  2KB1 A;  2EIN C;  3CXC U;  2WLJ A;  3E83 A;  3FYI B;  4I9W A;  4HYO A;  4TWK A;  2EIJ B;  1H8E G;  1JOY A;  1OZ0 A;  3OMI B;  4JGS A;  3QNE A;  1S0V A;  4GX0 A;  4UVC A;  1QLN A;  4PA3 A;  1Q7Y W;  3AEI A;  4H37 A;  2ZD9 A;  5IDJ A;  1QLE B;  1BHA A;  4UV9 A;  2DQ3 A;  4OXS A;  1FXV A;  1R6K A;  4MT8 A;  5B1A B;  1N8R W;  2YEV A;  2BOC C;  2ITC C;  1GO3 F;  3AG2 C;  3MD0 A;  4WFG A;  4P9O A;  4WFA V;  3ZMU A;  5IYB O;  1SES A;  4FK5 C;  1W2B U;  3ASN B;  1V54 B;  3AG3 B;  4P9P A;  1KC8 W;  4QIW F;  1E79 G;  2EIJ C;  1R6N A;  1WLE A;  2Q68 A;  4WF9 V;  1JCH A;  3E2E A;  3KG2 A;  1R3L C;  4RAI A;  2OTL V;  1K97 A;  5LHH A;  5HFM A;  1DF4 A;  2QE7 G;  1K92 A;  4XDK A;  4JTC B;  5CBG A;  1ENV A;  4LBE C;  4MTG A;  3QO7 A;  2B1I A;  4J9Y B;  1QLE C;  3P30 A;  2P6J A;  1GTO A;  2X6B A;  1M9N A;  1H2G A;  3GWO A;  3E8G A;  3JD3 A;  1YIT V;  2F43 G;  5B1A C;  3ZRV A;  3F7Y C;  4XBF A;  1QVF U;  5FL7 G;  4GX2 A;  4PA9 A;  1NBM G;  4WFF A;  3ZJZ A;  1Y66 A;  3FYE B;  3ML0 A;  4MVZ A;  4X89 A;  2W6I G;  1MG1 A;  1KP3 A;  3OEE G;  1NVP B;  3D36 A;  5KA6 A;  2DWE C;  3E89 A;  5LGU A;  2HR3 A;  1V54 C;  2EBO A;  3W7U A;  3AG3 C;  2P90 A;  4WFE A;  5KUM A;  5B3S B;  1YTF D;  1VQ6 V;  2R9I A;  1VQM V;  2UXN A;  4QPK A;  1S76 D;  5CBH A;  5DM6 V;  4RQF A;  4UV8 A;  4KUM A;  1JJ2 U;  1GM7 A;  3TK1 A;  3RVY A;  1BHB A;  2EZO A;  3E86 A;  2OCC B;  3JD0 A;  1R3I C;  2EIK B;  2AHY A;  4DO2 A;  3K04 A;  2WLI A;  5IYD O;  2ZDI C;  1NQT A;  2D3O W;  3CP1 A;  1S5H C;  4HZ3 A;  1FXH A;  3RW0 A;  3OEH G;  4G27 B;  1SRY A;  2OT5 A;  5B3S C;  2Y69 B;  3X2Q B;  3CCQ V;  3FB5 C;  3ZRW A;  3MHH C;  2XAS A;  2XAJ A;  1VQ9 V;  3ABM B;  2Q6A A;  1NR1 A;  4PA6 A;  1NH2 D;  2WWW A;  1K4C C;  2CK3 G;  4MSW C;  1AJQ A;  2OCC C;  2QEX V;  5H9C A;  2EIK C;  4QE9 A;  1PD3 A;  4LP8 A;  2EJR A;  4JYC A;  3OMN B;  2X6A A;  1K9M W;  1OHH G;  3FB6 C;  3TCU A;  3CC2 V;  2WLN A;  1QR8 A;  2XOK G;  2IU3 A;  3B77 A;  3OUF A;  5LBQ A;  3K0G A;  3ABL B;  2X0L A;  2Y69 C;  1PNM A;  3X2Q C;  4R6Z A;  3CCR V;  1LNQ A;  1MSW D;  1CPY A;  4FPP A;  3M99 B;  1FXK B;  1G8M A;  3ABM C;  4R7C A;  3K9A A;  3LDC A;  3SPJ A;  2DYS B;  2X6C A;  4RUF A;  1M56 B;  3G71 V;  2HLD G;  3E8F A;  1ZWI C;  2FTK A;  3CCU V;  2BOB C;  3E8H A;  4P30 A;  3K08 A;  4QNH B;  4LC1 A;  3CC7 V;  1XL4 A;  5LHG A;  1PNL A;  3OM3 B;  4KFM A;  4ZKI A;  3W7T A;  4GX5 A;  2IW5 A;  3ZRW B;  3ABL C;  1K73 W;  3ABK B;  5KUK A;  2QTO A;  1I5X A;  3SPH A;  1PL0 A;  4BAY A;  4FMT A;  1KD1 W;  1FXK C;  1G4Y B;  2WPD G;  1Q82 W;  4MVQ A;  1KEC A;  2HVJ C;  3OFN G;  4R8C A;  3T2M A;  2HVK C;  2DWD C;  3ZCC A;  1VQ7 V;  2DYS C;  3ASO B;  3R65 A;  1P4R A;  1M56 C;  4X8A A;  3OW2 U;  1VQP V;  4RO2 A;  4PDR A;  3F7V C;  2EIL B;  3BY6 A;  2P67 A;  4CBC A;  3CCM V;  3ETD A;  4XDJ A;  1IXM A;  1ORQ C;  4H33 A;  3JYC A;  1JX9 A;  1GKF A;  2JEU A;  3ABK C;  1K34 A;  3CCS V;  1TUE B;  5EC1 C;  1YJ9 V;  4UVA A;  2Y48 A;  3LDD A;  5H6R A;  1QR9 A;  3LNM B;  1L1F A;  1F4N A;  4G2K A;  1DF5 A;  4LCU C;  1AJP A;  1W0K G;  1YJW V;  1K5S A;  3ASO C;  3CCJ V;  2NNU A;  4L87 A;  1WPX A;  4MVR A;  3ETE A;  4UXN A;  3W7X A;  1VQ8 V;  3LSS A;  5H6Q A;  1EZJ A;  2EIL C;  3ZMS A;  4TSF G;  4MVU A;  3JD4 A;  2QM7 A;  1MOF A;  4U7O A;  3ASN C;  3K79 A;  3LUT B;  3GB7 C;  1ROP A;  5L3G A;  3I55 V;  1NKD A;  3ZMZ A;  2A9H A;  4P2Z A;  1AI4 A;  3ZIA G;  2ZR3 A;  3TET A;  3T1C A;  2YEV B;  3ZRX A;  3CCV V;  1NR7 A;  2Z5U A;  3G6E V;  4FJC C;  1E1R G;  2PI5 A;  4JPR A;  4MVM A;  5J9P C;  4MTO A;  3NXS A;  3SYP A;  4TT3 G;  1AI6 A;  4UVB A;  4U7N A;  4UUJ C;  4ZBM A;  2HG5 C;  2NLJ C;  2W0F C;  2DW4 A;  4PDL A;  5CBF A;  5IY5 B;  2C2A A;  4PDM A;  4RQE A;  2ZQM A;  2WLL A;  1AI5 A;  1VQ4 V;  4BW5 A;  4RUE A;  3A0R A;  2B1G A;  3AG1 B;  5KA5 A;  3B8N A;  1VQN V;  2UXX A;  1QCE A;  1YSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...