5EC1C

Kcsa with v76ester mutation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ec1C00
4MVZA 2HJFC 4PA7A 4H33A 1S5HC 3E89A 2WLKA 5EK0A 5CBFA 4I9WA 4PA3A 3E8HA 4XDLA 3OUSA 3SPGA 2DYSC 4P9OA 5EC2C 2R9RB 3T4ZA 3RVYA 5BZBA 5KUMA 1KKDA 3UM7A 2AHZA 2W0FC 3PJSK 1QLEC 3ASOC 3F5WC 3OUFA 4PA9A 2QTOA 3LNMB 4X88A 3IGAC 2WLIA 4WFFA 4XDJA 4MW8A 3SYAA 4MVMA 3ABMC 3GB7C 3OR7C 2KB1A 4MVRA 4KFMA 1R3LC 4MS2A 4OXSA 4JTAB 4GX0A 3TCUA 2HVJC 4J9ZB 4QE9A 2HVKC 4RUEA 3ABLC 2WLMA 2K1EA 3JYCA 3T4DA 4EKWA 2IH1C 2WLNA 4PDRA 4JTCB 5CBHA 1M57C 2Q6AA 2Q68A 3ZJZA 1OCCC 3AG4C 1XL4A 3F7VC 3K06A 2EIKC 3LDCA 4MVQA 4X8AA 3SPCA 2X6CA 3SYPA 2A9HA 2JK5C 3HPLC 3SYQA 4MVOA 1R3IC 3FB6C 3K03A 3OGCC 3UKMA 3IFXA 2ZXWC 3E8GA 1BL8A 2ITCC 3SPJA 2P7TC 5EBWC 2A79B 5EBMC 1V54C 4MTGA 5CBGA 4PDLA 2WLIB 3AG2C 2DYRC 4HYOA 5J9PC 4JTDB 2EILC 3BEHA 4HZ3A 4J9YB 2H8PC 4GX5A 4MW3A 3T1CA 2HFEC 2Q69A 3SYCA 3ABKC 4MTOA 3WG7C 1OCZC 3TETA 2OCCC 3T2MA 1R3JC 3RBZA 3E83A 4G27B 3FB8C 2X6AA 2WLLA 2BOCC 3K0DA 4P30A 4RO2A 3K04A 3SJQC 4WFEA 2QKSA 3LDEA 2Q67A 4PDVA 4MTFA 1OCOC 1ORQC 1K4DC 4WFGA 4MVSA 3FB5C 4RAIA 2ITDC 1J95A 4XDKA 3STZC 3X2QC 1XL6A 1G4YB 1R3KC 2YEVA 3K08A 2Y69C 1M56C 5B1AC 2X6BA 4G28B 3AG1C 5EC1C 2NLJC 2ZD9A 4RUFA 4CBCA 1K4CC 4WFHA 2ATKC 3ASNC 4R7CA 5E1AC 1P7BA 4LP8A 3VOUA 3EFFK 3E8BA 3OR6C 5KUKA 2HG5C 3E8FA 3RVZA 3SPHA 3F7YC 4LBEC 3SPIA 4QNHB 4PA6A 2DWDC 4R50A 1OCRC 4X89A 2WLLB 4BW5A 4P9PA 4TWKA 3LUTB 2AHYA 3SYOA 3E86A 3R65A 4MVUA 2DWEC 4F4LA 4PA4A 2EIMC 1LNQA 4QE7A 4ZBMA 2EINC 3K0GA 3AG3C 5EBLC 4LCUC 2BOBC 2EIJC 5B3SC 5IY5C 3LDDA 4R8CA 2WLHA 4PDMA 4DXWA 4GX2A 4MSWC 5B1BC 3STLC 1ZWIC 4GX1A 3ZRSA 3FB7C 2A0LA 4R6ZA 1JVMA 4H37A 3RW0A 2IH3C 4P2ZA 3KG2A 1V55C 4UUJC 2WLJA
chains in the Genus database with same CATH superfamily
3L70H 1SZXA 1NH2D 2WLKA 1NTZH 3DSQA 2ZE6A 5JJNB 1GKFA 4O4JA 3KCYA 3T4ZA 3RVYA 3OMNB 1QLEC 3JARA 3BY6A 2RCVA 1NH2B 3UT5B 1EN4A 1MNGA 2KB1A 4NB5A 4O2AB 4X65O 1JJ2U 4MS2A 1R3LC 1TVKA 2ZE7A 3ZHVA 4CH6A 4L8JA 3CXHF 2UXDB 3JYCA 4O4IA 4UV8A 3SGIA 4UXNA 1HR0O 1Q7YW 1COWG 2A9HA 2Q0AA 4MVOA 1IVSA 3VQXA 5L3CA 3P3PA 1V54C 2P6JA 4PDLA 1QCEA 4O4LB 4LF7B 3BEHA 5LXTB 3W7SA 4UB8Z 1EFRG 5IJ0A 5LP6B 3A8TA 1NR7A 3RBZA 4H0LB 4U3JA 4L87A 2WLLA 4I55B 2CGOA 2AZ2A 2E74B 1D5NA 5CA0A 1Q82W 4LFAB 1AI4A 5J2UB 4I0XB 1URFA 1MSDA 2QWQB 5KHIA 2GV9A 4LF5O 3JSLA 5BMVA 5KHHA 2IBZH 4JAVA 2WPDG 1HW7A 5LOVB 4R50A 2VS0A 2UXCO 4LF8O 2YI9A 3SYOA 3QG5A 5IJ9A 1VF6A 4UB6Z 2Q8VA 5LA6B 4DK0A 4DR1O 2PZSA 3AG3C 2VRZA 1KBHA 1TGOA 2KG7B 2PGGA 1S5LZ 1MABG 1V55C 4UFZA 2N74A 4GUNA 1NBMG 4PHZA 3RWRD 2Q4PA 3JALA 3MD0A 4KHPO 2UUCB 2F95B 4HNAB 3ZRXA 2FKXA 1K92A 4O2AA 1VEWA 3JATB 1IBKO 3B2EE 3CS5A 1SQPH 5CBHA 1RSOB 3K5NA 1PNLA 4X9QA 4LF4B 4TQFA 4DR6B 4ZI7A 5JH7A 2XAFA 2P7TC 1MA1A 4UCOA 2QGNA 4FJCC 5LXTA 4GKKO 1HNZO 2F4VB 3N2GA 5KMGA 3FYEB 1ZL8B 1JFFB 1R3JC 1H2KA 5F2VO 4A5UB 2LO1A 3LDEA 4JI3O 1VP7A 1OCOC 1ORQC 2OCCB 1N34B 5J2UA 3L9DA 2ADPA 4XDKA 2ZKOA 1G6UA 2CDYA 3L73H 1H8EG 3RN4A 1SQXH 4GLXA 4OGQB 1Z5WA 2G38A 4YXWG 3OW2U 2EINB 4B3TO 4NXMO 1XDCA 4JI7O 4PA6A 1H2NA 2R9AA 2FMLA 4NTXA 5LA6A 1H2LA 1QVFU 2ZDIC 1O9HA 3CWBH 5EBLC 2BTOA 1YIJV 4B3RB 4DYLA 1I94O 3ZRSA 3FKSG 4R6ZA 5H9CA 3U11A 2XASA 2OIGA 4YHHB 2FB5A 5B1BB 2Q73A 5DECA 1G1XB 5LHHA 1SQQH 4PA9A 5KX5A 4KXRA 2BSKB 3IAYA 1K9MW 1F51A 4FFBA 1HDJA 2UXDO 2IH1C 2R9IA 3ABMB 1J5EB 1FFXA 4DR3B 1WB7A 1S76D 2E5LB 3G80A 5JCOC 5AG2A 3ZMTA 4LF6B 1R73A 3BCCH 3OAAG 3KZIZ 4TT3G 2JJ2G 3CHXA 4GX5A 4C7UA 2Q69A 2Q5ZA 4UCUA 4UVAA 3ABKC 2UUBB 3T2MA 1PM9A 2CH7B 5B1OA 2JDIG 4ZKIA 1H2SB 1NS1A 1BQZA 2D3OW 4DRXB 4JI1B 4LFAO 4TV8B 1PL0A 2OT5A 3STZC 1SS3A 1EZVH 1YTFD 3K08A 2OTLV 4DV7B 2X6BA 3FX7A 1RFYA 3HKCB 4YJ2B 3RT3C 4JYAO 1K34A 3K58A 2IJHA 2YXYA 3B77A 1PPJH 3OR6C 1FPOA 4J7JA 2ARHA 1GM7A 1JOYA 4DUYB 3ETGA 2CTWA 3ASNB 1Y4MA 1HNXB 4J11A 3E2EA 3RYHA 3ZMVA 1VARA 4O4HB 3FB7C 2GUZB 3A0BZ 4P2ZA 1BQ0A 2QTSA 3BA9A 2WLJA 2UU9O 2KSDA 2IM9A 5GW7A 4JASA 4K0KB 1KKDA 2W0FC 3OUFA 5JJEB 2M7WA 2UUCO 2ODMA 3UO3A 3QNEA 1UJWB 2LFSA 5L3BA 2ZNIA 3ASOB 3ABLC 1ENVA 1TAEA 2V7QG 3QF7A 4NTWA 3GWOA 5BXZA 2AZ0A 1QHTA 2W6JG 3H1HH 4NTYA 4F6RB 3CD6V 4DW0A 3K03A 3UKMA 1QQCA 1TA8A 1BL8A 2A79B 3FFQA 1R6TA 4NXNO 1BZKA 2NR5A 4N23A 4JTDB 2OTJV 2F4VO 1OCOB 5LHGA 2W0XA 2HFEC 3HKEA 4EFBA 1Y76B 3WB1A 4I4TA 1GN2A 5L3EA 1DGSA 5CB4B 5LMNB 2JEXA 3FAVA 3WG7B 4TV8A 1N34O 5KHJA 3X2QC 1K7DA 5L3GA 4DUZB 3ZMZA 2GTSA 4H44B 4TV9B 2ZIOA 1TUBB 2ATKC 4GYCB 1NVPD 4JZ2A 2E76B 4I50B 1QR9A 1Y6XA 1QLNA 5H2FZ 1U96A 5B1AB 4QPJA 3L72H 4JI6B 4UVCA 4X89A 4P9PA 1KC8W 4WFBV 4MVUA 2VWJA 2H94A 1IBMB 1NVPB 3H01A 3CCVV 4PDMA 1XEQA 1T5EA 5HFLA 3STLC 4PI2A 1ZWIC 2ETNA 3G4SV 2EIMB 4FMTA 4OPAA 4LFCB 4H33A 3E89A 2Q7EA 4QJFB 4JI8O 2QSAA 2JS3A 1NU1H 4I9QA 1LUWA 2QDOA 2X7RB 3W7UA 4FLXA 2UXCB 1XNQO 1WJZA 1MMMA 4X88A 1IBLB 3A0HZ 4MVMA 1I0HA 3O9OA 2DYSB 4DV5B 4FLVA 4MVRA 1NKDA 1E1RG 3H1IH 1SA0A 1I7FA 1THZA 2K1EA 2VQEO 1XNRB 2Q68A 1J5EO 2B5UA 3SYPA 3SYQA 1K33A 4TQDA 4O4JB 2E5LO 1L1FA 3GVMA 3JARB 4LF6O 2DQ3A 1VQPV 5CBGA 3K5LA 4OPHA 2EX3A 3UO2A 5GTIZ 1MZFA 2KKWA 2F23A 2H8PC 1TVKB 1RM1C 1KQSU 2RMKB 2P5OA 1Y76A 4QIWF 1CPYA 2UUBO 2QWRB 2PI5A 3AG2B 4G2KA 1LR1A 5JQGB 1FKAO 3BABA 2EJRA 5TISZ 5CA1A 1L0LH 4J7ZA 1K4DC 5LGNA 1VQ7V 1G4YB 1WLEA 4DV7O 1IDSA 3ZHUA 1TUBA 1M9NA 1WP8A 2ZDIA 3B4SA 5IJ0B 1K73W 1WB8A 5E1AC 4U3JB 4BIOA 1Q86W 3G67A 2WLLB 3MHSC 3JCUZ 3MHHC 4DUYO 1WA8A 5CA0B 1KP3A 3ZHRA 3JAMN 1AI5A 4U7NA 1AVMA 3P30A 4X1YA 2WAMA 4CC5A 1LUVA 1VQMV 4CS3A 1AJPA 3ICXA 5BMVB 2KQXA 2Z0AA 4EEQA 2IH3C 3QO8A 4FLWA 4B3SB 4B3TB 4GCZA 1G8MA 4PA3A 4K0KO 3RFRA 3D8CA 2XT9A 2R9RB 1M90W 1HWYA 1VQLV 3ZS8C 1XQ8A 5IJ9B 1AR5A 3KCXA 4KFMA 2RN9A 5JCOA 5H6QA 4CH3A 1YI2V 1OCCC 3AG4C 3K06A 3F7VC 3MAQA 4EFEA 1IZ3A 1YZBA 3OEHG 4UCSA 3NXSA 2MW2B 1H2GA 1OHHG 3D3IA 2FYUH 2ITCC 3JALB 3LSQA 4X64B 2Q0OC 1Q5OA 1GO3F 4AI8A 5J2TA 2F43G 3T1CA 1M93A 1OCZC 2P4VA 2HP8A 3SR2C 4G27B 3FB8C 5JQGA 3BVOA 2QE7G 4TUYA 4X66O 4FLTA 4ZI7B 1GRJA 5LMNO 3L75H 4FIPC 1QNMA 3QO7A 5JH7B 5IYZB 2V4DA 4DUZO 1CP9A 1L0NH 2YXHA 4JF3A 4CBCA 3CCMV 4DV2B 3N2GB 5KMGB 3SDLA 4PELA 1SESA 2Y69B 4JI6O 4PI0A 4BW5A 2PYLA 1QBZA 3LSUA 3MDSA 5L3FA 2H3OA 3H1JH 3APQA 1IBMO 4I7ZB 2XAGA 4FLZA 2EIJC 1PKXA 1AJQA 3QO5A 1FAFA 3BPZA 4MTXA 4LFCO 3BFRA 1V9PA 4JYAB 5FPRA 5D5QA 2BE3A 3DXRB 3CRMA 3JSNA 2LW1A 5KUMA 4JAAA 2ZQMA 3SJAC 1IBLO 1ZTEA 2A3QA 4DV5O 2IJJA 2ZINA 3ABUA 2HKOA 1XNRO 3C90A 2Q6AA 2BTQA 2Y0PA 3ZJZA 2UU9B 1HP8A 3OEEG 1BHAA 2RQ6A 4HAMA 3SPCA 3WU2Z 3CC4V 1WP7A 1VQ9V 5IYDO 4GKJB 4DV6O 4MTGA 3CE2A 5KX5B 4AILC 1YITV 3H9VA 4HYOA 4O2BB 3M7MX 5B5EZ 2DE0X 2CK3G 3AK1A 4FFBB 5A9GA 3D3QA 3JASA 3CPWU 3ZBHA 1K3EA 2JS5A 1FFXB 4FZ1A 1Q6UA 3UQ8A 1GN6A 3Q4HB 2HJDA 2IU0A 4IYHA 5IYZA 2C2AA 1XL6A 4NXNB 1P49A 1M56C 3AG1C 4LH6A 3T1HB 1R1BA 2HR3A 4LP8A 1XBLA 4NKGB 4FLYA 3E8BA 5EIBC 3T1YB 2R72A 1OCRC 3CCLV 1US6A 5EZYA 3K0GA 2QKCA 3S3WA 2B9ZA 1S0VA 5IY5C 3LDDA 1FS0G 5LGUA 2QR4A 4LF9B 4GX1A 1ZX3A 2HLDG 3RW0A 3CCRV 1MOFA 4UUJC 4B3SO 2V1DA 5CBFA 3CCUV 3DXRA 2ZT9B 1U97A 3DC6A 1A32A 1JQ0A 3OGIB 2E75B 4LFBB 4JGSA 3ZMSA 2FTKA 3TCUA 3RYHB 1DK1A 2QEXV 1QLEB 1EZJA 2EBOA 1SQGA 4JTCB 5DN6G 1M57C 1Y66A 3S3XA 2CTPA 5KA6A 1H38A 1ZLZA 4JI8B 4DV1B 1K5QA 3BRCA 1AP6A 1OCZB 2JIZG 1XNQB 4FM1A 3CCSV 4X1KA 3OMIB 4X64O 2CAZC 1H8HG 4CS4A 4O2BA 2EILC 4J9YB 2YDEA 3K9SA 2Q7HA 3U10A 3OM3B 1YHQV 1V54B 2VQEB 1GMGA 1N0JA 4E2LA 1JJOA 3TK1A 4DR2B 1XHXA 1OV9A 1JPXA 4JYBA 3CP1A 1R6KA 4GZRB 1MSWD 3Q4HA 1J95A 3AG7A 3C3TA 2A7WA 1AB3A 1K5SA 1D2DA 2YC0A 2JGDA 4DV2O 3HKEB 2EIJB 1VQOV 1XMOB 1WPBA 2RNBA 4QNHB 4I4TB 3VBBA 1AR4A 4YJ3B 4Z2WA 2P4KA 4F4LA 3FAVB 1RPRA 4QE7A 5BY1A 3ZRWA 5IDJA 5B3SC 4MSWC 4RQFA 4JI2B 1DLBA 2AXTZ 1FD9A 3W7WA 1YDXA 3L74H 3AG3B 2WA3A 1SZTA 2PYJA 2JVDA 2IJIA 3I5DA 3UM7A 4FLUA 1V55B 5IYBO 3G6BA 1EN6A 1YF2A 1N33B 1VQ6V 3I56V 3CC2V 1GN3A 4LNUB 1HNWB 2WLMA 4J7KA 4UV9A 3IC9A 4PDRA 2EIKC 2XNDG 2ZE8A 1R3IC 3ML0A 4HBNA 3DGEA 3JD4A 4GKJO 3WB2A 1Q43A 2VWKA 1GM8A 2DYRC 3KKYA 5B1NA 5J9PC 3SYCA 1SA0B 4WBNA 2ZR3A 3E83A 3TGUH 2E3CA 3ZEDA 4P30A 1N8RW 1S5JA 1NTKH 3ZN0A 1WPXA 1X4TA 2QKSA 3TXSA 2QM8A 3UCSC 3ETDA 3A0RA 1VQNV 3BA8A 1AI7A 1AROP 3BHPA 2YEVA 4PV1B 1DF4A 3AEIA 1F4MA 3T1HO 2NLJC 3TXQA 2LFRA 4R7CA 3CCEV 1P7BA 1FXHA 5LL6Y 5IWAB 3E8FA 3RVZA 2XTAA 3T1YO 5E79Z 2WSSG 4YJ3A 4X66B 1XUQA 4ZOLA 3SJBC 5CA1B 1LNQA 1XILA 1M4UA 5FL7G 5A2QN 2DOSA 4GX2A 1SKVA 3CCJV 5BR8B 4LF9O 1KECA 2IU3A 2QJ1A 3K57A 1YJWV 4B3MO 3JD2A 2YXLA 3K79A 3F5WC 4IL6Z 1WA8B 4Z1VA 1F7YA 5EYPA 4XDJA 4LFBO 3OR7C 3HKDB 3ETQA 2PUSA 1S3JA 1RPOA 4LNUA 4NYKA 4OXSA 4X1YB 1NJIW 3CCQV 2UUAB 4ZHQA 4OX9B 1YVWA 3CMEV 2DMXA 2UXNA 1PNKA 1M1KW 2IW5A 2EILB 1XL4A 4MVQA 2BCCH 3HB3B 3J81N 3BAAA 4DV1O 3CRQA 1Q8IA 3ZN1A 5LP6C 3JAKA 1ZAUA 4K3AA 1W0JG 4EB6B 1GAXA 3K3WA 1EM1A 3H1KH 2O57A 1XREA 1S72V 3GWKC 1TUEB 4CS2A 4DR2O 5LGTA 5KAFZ 3ABKB 2CGNA 5IT9N 4RAIA 3E35A 1VQ5V 4DV6B 4JI4B 1SC5B 4G28B 2Q7GA 2ZD9A 5J2TB 4PD4F 4D6TH 1AILA 1XMOO 1SQVH 5KUKA 1OZ0A 3F7YC 3K5OA 4TUYB 4TWKA 5CA3A 3P32A 1Y74A 2X0LA 2QWNB 4ZBMA 1ROPA 2CTRA 1PP9H 1EBOA 4X20A 2RDCA 4JI2O 2RJZA 4JI5B 4U3FH 1KD1W 3KG2A 1IXMA 5FPOA 1EN5A 5EK0A 3HKBB 1BMFG 5EC2C 5ITZA 3PJSK 4LR3A 5JWPA 5GONA 1N33O 2WLIA 4U7OA 3SYAA 5LYJA 4QGPA 3HKDA 4IT5A 2UXBB 1KUQA 3AK2A 3B40A 4QE9A 1HNWO 4RUEA 4EKWA 2PY5A 3PN1A 3CEIA 3W7XA 3CB2A 4J42A 3R66A 1NZ6A 5FNVA 1UPGA 1ZSPA 3ABLB 3FB6C 4W4KA 5K1PA 5EBWC 2GDSA 3OT7A 2YIBA 3OD4A 5C8YA 4EB6A 2XHBA 2Z5UA 2OCCC 2GHYA 3ZRVA 1AJNA 4UCRA 2BTQB 1N36B 5KHKA 2EZOA 2JGUA 4XBFA 4RO2A 3K04A 1KP2A 3H1LH 4B7EA 1UFIA 5JVDB 1BE3H 1SQBH 3ZIAG 3CRRA 1QR8A 3B8NA 3JAWA 4RUFA 4IIJA 2D2CB 3CMAV 4RWUA 3X2QB 3JASB 5IWAO 3G6EV 1JX9A 2DWDC 4BIUA 1PNMA 3D36C 3LUTB 1FYJA 3R65A 2CUGA 4K8ZA 2ZE5A 1XMQB 5JJJB 4PA4A 3ZMUA 3TJTA 1BS3A 4LCUC 2BOBC 3JCZA 2YS8A 4KL1A 2DJVA 4FFKA 4DK1A 4DV3B 5B1BC 1I5YA 5BR8O 3N2KA 1W2BU 1GTOA 2Y48A 1IX9A 2CE4A 3J7AU 1W59A 2UXXA 3RYCA 3HKBA 3CJHA 3E8HA 4P9OA 4FVMA 3FD9A 4LH7A 5EZYB 1RP3B 4DV0B 4MW8A 3ABMC 3GB7C 2UUAO 1KB9F 2L6LA 4DO2A 1NQTA 2HVKC 4OX9O 1GK9A 2VQFB 3T4DA 3OTOB 1W0KG 4DR4B 4IHJA 3CRAA 1BHBA 4UCVA 4X8AA 3JD0A 2ZCEA 4J41A 3HPLC 3P3NA 3RYFA 3OGCC 3M99B 4PJ0Z 1JMKC 3JD1A 4UCTA 2GBOA 4FM2A 4HZ3A 2F93B 1I08A 1JCHA 2P67A 3TETA 5DM6V 4BAYA 1FJGB 2QKAA 1I5XA 1RM1B 4WFEA 5K1XA 1H2MA 1CEZA 4FPPA 5JVDA 3WB0A 4MVSA 3K59A 2ZM6B 1FFTB 4X1KB 2EZPA 5KLVH 4JI4O 2DN9A 4DR5B 3HR0A 1DF5A 2F66C 2EJ7A 3ASNC 5H5NA 4ICGA 1XOUA 3APOA 3SPIA 1FXKC 3IC7A 1YJ9V 1NR1A 4JYCA 3UT5A 1VQ4V 1IURA 1YSCA 4DXWA 2R70A 4CH4A 1E79G 4JI5O 2JGDB 4MVZA 4BWAA 4J10A 5IYCO 4I9WA 3OUSA 3QTCA 3JD3A 2AHZA 3ASOC 1YEWA 2QTOA 3LNMB 4WFFA 4K8XA 4O4LA 3ZRWB 1MG1A 2UXBO 5LP6A 4CC6A 1NI8A 2OIEA 1GN4A 2WLNA 2XOKG 3FYIB 1B6QA 4JI0O 4I55A 2X6CA 2JK5C 2OWOA 2FL4A 4B3MB 4I0XA 4X62B 1KYOF 1PL4A 1OCCB 5EBMC 3AG4B 3CXCU 4K35A 2N05A 3VQWA 4MW3A 1SRYA 1PD3A 3WG7C 1S77D 5LOVA 1WAZA 2X6AA 1N36O 3WFVA 4YY3O 2LP7A 5C93A 3EXAA 1N0NA 1VF7A 2Q67A 4PDVA 1VMGA 1N32B 4WFGA 2HEPA 2NNUA 3LSSA 3ZHTA 2KG7A 1R3KC 5B1AC 2XAQA 1R6NA 1JR9A 2QM4A 5EC1C 4D7SA 4WFAV 3ZCCA 1FXVA 1D5AA 3EFFK 2QWPB 4WBNB 2YICA 2M6YA 1XI1A 1K97A 4X1IB 2L35A 1XMQO 2EIMC 4HNAA 2LGWA 1B06A 4KP4A 2QM7A 4GT1A 4ABMA 3JATA 1SF9A 2WLHA 4DV3O 2WA4A 2YEVB 3DTUB 4LWSB 3IJ4A 1JA8A 1RSOA 5HFMA 4PA7A 2YSUB 4AQYB 1BGYH 1F23A 2DYSC 5LHIA 4FM0A 1AR1B 4NVPA 4ZOLB 2DW4A 1Q90D 4DV0O 4Z1MG 2Z3YA 3VQVA 4DR7B 4ZIBA 2Q9LA 4LF7O 2P90A 1AI6A 2ADQB 2YUAA 4BIZA 1ZL8A 4Q6GA 1JFFA 2VQFO 4TSFG 3OTOO 2K9PA 4DR4O 4NR1A 3LDCA 1DTOA 1VQ8V 3F5TA 4J80A 5LBQA 5DEDA 2ZXWC 3E8GA 4CH5A 4FK5C 3SPJA 5EYPB 3AG2C 4Q20A 3O65A 1CXZB 1KMIZ 4ZHQB 2OCHA 3ETEA 1YTFB 3K9AA 4D7TA 1FJGO 2B1GA 5LMUB 3CX5F 3ZX6A 1M5IA 2LW7A 3RYIB 4RQEA 2HHHB 2ZM6O 2ILMA 1VF5B 4N21A 3JAKB 3OFNG 1YJNV 1SQFA 2B1IA 2LJ2A 1FXKB 3D36A 1VQKV 4DR5O 1P84F 2Y4UA 3LNNA 3THOA 4WCEV 1MZEA 1O9GA 3RGBA 5L3DA 1IXBA 2YIDA 5CMUA 3OE7G 2QWOB 5EIBD 1M56B 1YXBA 3I55V 2JJ1G 3AG1B 4X1IA 2DWEC 3VQYA 2BSKA 1K8AW 1P7GA 5B66Z 4JPRA 1OCRB 4LWSA 4JV5B 4UVBA 2Y0IA 3G71V 4DV4B 4CZZA 1VF6C 2HJFC 5IY5B 1S5HC 4LF4O 3U0ZA 1L8DA 2AW9A 4XDLA 2OYQA 4DR6O 5BZBA 2W6IG 1Y74B 5KA5A 1KKCA 3A2FA 4E4EA 1OJHA 3E22B 3EHBB 1E1QG 3NR7A 4X65B 4H13B 4X20B 4JTAB 4GX0A 2HVJC 4J9ZB 2CH7A 3C3SA 3ZHQA 1NT2B 4JAUA 1HR0B 5H6RA 3B8MA 4DRXA 2AGAA 5ITZB 3IFXA 4X62O 1M57B 1QVGU 4DW1A 5GONB 2WLIB 3ZHSA 2ZR2A 5LYJB 4WF9V 5IE9A 3HKCA 4B7KA 4JYYA 4YJ2A 2ZIMA 2GSMB 4W4LA 5KHGA 2CTQA 2BOCC 3CRCA 2JRIA 3K0DA 2Y4TA 2YIBD 5FNVB 2LQTA 3RYIA 1N32O 1AP5A 4ASUG 2ITDC 3N27A 1FXKA 3B09A 4LF5B 3OTFA 2Y69C 4B3RO 4O4HA 3L71H 3SJCC 2GUZA 1NTMH 4KUMA 1P4RA 5C8YB 4IGGA 3K5MA 1K4CC 1XHZA 3CC7V 2YI8A 4YHHO 2HG5C 2XAHA 2P06A 4LBEC 4LF8B 2AHYA 3E86A 5CN0A 2XUMA 1WNSA 4DR1B 4B08A 4R8CA 4YIOA 2PF4E 1Z2GA 4I5SA 4MT8A 4FZ0A 3JAWB 2A06H 2A0LA 2MK3A 3EVKA 1B04A 3ABTA 2IJKA 1PV0A 4IIJB 1GH6A 2JEUA 3QVNA 5B3SB 4BW9A 4AQYO 4F6RA 4DR3O 3SPGA 1YCIA 4AHCA 1N4CA 2N04A 2PI4A 4KHPB 3IGAC 4DR7O 3E22A 1B3QA 3J80N 1IBKB 1SETA 1BSMA 2ZXWB 3AK3A 3N2KB 4LC1A 4O4IB 3RYCB 5CB4A 1Q6HA 3CJHB 5KAIZ 1BCCH 4F6EA 4JI1O 5GTHZ 1Y67A 2YIAA 3CYOA 3CSXA 2WWWA 2EIKB 2ZNJA 4TV9A 1Q3EA 4GKKB 1HNZB 1ZUQA 2PTMA 1GM9A 4BR6A 4I50A 4MTOA 2LGQA 2F1MA 4IYIA 1Z5VA 4IHJB 2DYRB 5LMUO 4JI0B 1WN7A 1F4NA 2NN4A 2QA4V 3SJQC 3M8AA 4JI3B 4MTFA 1HNXO 3RYFB 3W7TA 3FB5C 2HHHO 3OMAB 4TOIA 3DC5A 2P22C 1KU9A 1QU7A 4JZGA 4WFHA 4YIPA 1VIBA 3VOUA 4NXMB 4QPKA 5FLXN 4JI7B 3SPHA 4YY3B 2EULA 1Q6IA 2EINC 1BT8A 2XAJA 1X59A 5D5PA 1SERA 4JV5O 1I94B 1Q81W 1JVMA 2GTAA 4H37A 2DQ0A 4DV4O
chains in the Genus database with same CATH topology
4MVZA 4H33A 3E89A 1NH2D 1SZTA 2WLKA 4QJFB 5IYCO 4I9WA 3OUSA 1GKFA 2X7RB 2IJIA 3T4ZA 3RVYA 3JD3A 3W7UA 3OMNB 3UM7A 2AHZA 1QLEC 3ASOC 1V55B 3BY6A 5IYBO 2QTOA 3LNMB 4X88A 4WFFA 1NH2B 3ZRWB 4MVMA 1VQ6V 2DYSB 3I56V 2KB1A 4MVRA 1JJ2U 1MG1A 4MS2A 1R3LC 1NKDA 3CC2V 1E1RG 1THZA 2WLMA 2K1EA 3JYCA 4UV9A 2WLNA 4PDRA 4UV8A 2Q68A 2XOKG 4UXNA 2B5UA 1B6QA 3FYIB 1Q7YW 2EIKC 2XNDG 2X6CA 3SYPA 1COWG 2A9HA 2JK5C 3SYQA 1K33A 4MVOA 1R3IC 3ML0A 1L1FA 3DGEA 3JD4A 5L3CA 1OCCB 2DQ3A 5EBMC 1V54C 3AG4B 2P6JA 4PDLA 5CBGA 1VQPV 3CXCU 1QCEA 1GM8A 2DYRC 5B1NA 5J9PC 3BEHA 3W7SA 2H8PC 1EFRG 4MW3A 1RM1C 3SYCA 1KQSU 1SRYA 1PD3A 3WG7C 4QIWF 1CPYA 2ZR3A 1NR7A 3RBZA 3AG2B 3E83A 2PI5A 4G2KA 1S77D 4L87A 2X6AA 2WLLA 3WFVA 4P30A 2LP7A 5C93A 1N8RW 2EJRA 3ZN0A 1WPXA 2QKSA 1Q82W 2Q67A 4PDVA 2QM8A 1K4DC 1AI4A 3ETDA 4WFGA 2NNUA 3A0RA 5LGNA 1AI7A 1AROP 3LSSA 1VQ7V 1VQNV 1G4YB 1R3KC 2YEVA 1WLEA 1DF4A 2XAQA 5B1AC 1R6NA 3AEIA 1M9NA 1F4MA 5EC1C 2NLJC 2ZDIA 2LFRA 4WFAV 4R7CA 3CCEV 4JAVA 5E1AC 3ZCCA 1FXVA 1FXHA 1P7BA 2WPDG 3EFFK 1K73W 3E8FA 3RVZA 1Q86W 4R50A 2WLLB 2WSSG 3MHSC 3MHHC 3SYOA 1K97A 1KP3A 2EIMC 1LNQA 1AI5A 4KP4A 4U7NA 3AG3C 2QM7A 4GT1A 5FL7G 2WLHA 3P30A 4GX2A 2WAMA 2YEVB 3CCJV 3DTUB 1VQMV 1AJPA 1KECA 2IU3A 1MABG 2IH3C 3QO8A 5HFMA 1V55C 4PA7A 4GCZA 1G8MA 2YSUB 4PA3A 1NBMG 1F23A 2DYSC 1YJWV 5LHIA 2R9RB 1M90W 1HWYA 3JD2A 1VQLV 1AR1B 3K79A 3F5WC 2DW4A 3MD0A 4Z1MG 2Z3YA 4XDJA 3ZRXA 3OR7C 1K92A 2P90A 1AI6A 4KFMA 1S3JA 1RPOA 1NJIW 4OXSA 3CCQV 4BIZA 5H6QA 4TSFG 3CMEV 5CBHA 2UXNA 1PNLA 1YI2V 1PNKA 1OCCC 1M1KW 2IW5A 2EILB 3AG4C 1XL4A 3F7VC 3K06A 3HB3B 3LDCA 4MVQA 1DTOA 1VQ8V 3OEHG 3NXSA 1H2GA 3ZN1A 1OHHG 5LBQA 3D3IA 2ZXWC 2XAFA 3E8GA 2ITCC 4FK5C 3SPJA 2P7TC 3LSQA 3AG2C 1GO3F 1W0JG 4Q20A 4FJCC 2F43G 3T1CA 3K3WA 3FYEB 1OCZC 3ETEA 1YTFB 1R3JC 4G27B 3K9AA 1S72V 3FB8C 2QE7G 1TUEB 2B1GA 5LGTA 3LDEA 3ABKB 1OCOC 1ORQC 2OCCB 4RAIA 4FIPC 4RQEA 3QO7A 4XDKA 3OFNG 3E35A 4N21A 1YJNV 1VQ5V 2B1IA 1FXKB 1H8EG 1CP9A 3D36A 1VQKV 4G28B 4JF3A 4YXWG 2ZD9A 4WCEV 4CBCA 3CCMV 5L3DA 3OW2U 2EINB 5CMUA 3OE7G 4PELA 5KUKA 1SESA 2Y69B 1M56B 1OZ0A 3F7YC 4PA6A 4BW5A 3I55V 2JJ1G 1QBZA 3AG1B 4TWKA 5CA3A 3P32A 5L3FA 2DWEC 2X0LA 1QVFU 4ZBMA 2ZDIC 1ROPA 1K8AW 5EBLC 2XAGA 2EIJC 4JPRA 1EBOA 1PKXA 1OCRB 1YIJV 1AJQA 3QO5A 4UVBA 3ZRSA 3FKSG 4R6ZA 1KD1W 3G71V 4MTXA 5H9CA 3KG2A 1IXMA 4CZZA 2HJFC 2XASA 5IY5B 1S5HC 5EK0A 4XDLA 5B1BB 1BMFG 5EC2C 5BZBA 5KUMA 5LHHA 3PJSK 2ZQMA 2W6IG 4PA9A 5KA5A 2WLIA 4U7OA 3EHBB 3SYAA 1E1QG 1K9MW 2IJJA 1F51A 3ABUA 4JTAB 4GX0A 2HVJC 4J9ZB 4QE9A 2HKOA 4RUEA 4EKWA 2IH1C 2R9IA 2Q6AA 3ZJZA 3ABMB 4JAUA 3OEEG 1BHAA 3W7XA 5H6RA 4HAMA 3SPCA 3B8MA 3CC4V 1S76D 3ABLB 3FB6C 1VQ9V 5IYDO 3IFXA 1M57B 1QVGU 3ZMTA 5EBWC 1R73A 4MTGA 3OAAG 2WLIB 2ZR2A 1YITV 4TT3G 4HYOA 2JJ2G 4WF9V 4GX5A 2Q69A 2CK3G 4UVAA 2GSMB 3ABKC 2Z5UA 3CPWU 2OCCC 3T2MA 2GHYA 5B1OA 1K3EA 3ZRVA 1AJNA 2JDIG 2EZOA 4XBFA 2BOCC 3K0DA 4RO2A 3K04A 4ZKIA 1KP2A 2D3OW 1PL0A 2OT5A 4ASUG 2IU0A 2ITDC 3STZC 1YTFD 1FXKA 2C2AA 1XL6A 3ZIAG 3K08A 2OTLV 1QR8A 1M56C 2Y69C 3B8NA 2X6BA 4KUMA 3AG1C 1P4RA 4RUFA 1K4CC 1K34A 2HR3A 2IJHA 4LP8A 3B77A 3X2QB 3CMAV 3CC7V 3E8BA 3G6EV 3OR6C 2HG5C 2XAHA 1JX9A 4LBEC 2DWDC 1OCRC 4BIUA 1PNMA 3LUTB 2AHYA 1GM7A 3CCLV 1JOYA 3E86A 3R65A 5CN0A 3ETGA 3ASNB 4PA4A 3ZMUA 1Y4MA 3K0GA 4LCUC 2BOBC 3JCZA 1S0VA 5IY5C 3LDDA 4R8CA 1FS0G 5LGUA 3E2EA 5B1BC 1I5YA 3ZMVA 4I5SA 4GX1A 4MT8A 3FB7C 2A0LA 2HLDG 2MK3A 1W2BU 1GTOA 2Y48A 2IJKA 3ABTA 3RW0A 3CCRV 1MOFA 4P2ZA 4UUJC 2WLJA 2JEUA 2UXXA 5B3SB 2V1DA 5CBFA 3CCUV 5GW7A 3E8HA 4JASA 3SPGA 4P9OA 2PI4A 1KKDA 2W0FC 3OUFA 1JQ0A 2M7WA 3IGAC 4MW8A 3ABMC 3GB7C 4JGSA 3QNEA 1UJWB 2LFSA 3ZMSA 1SETA 2FTKA 3TCUA 2QEXV 5L3BA 1QLEB 2ZXWB 3ASOB 4LC1A 1NQTA 2HVKC 1EZJA 4DO2A 3ABLC 1GK9A 1ENVA 2EBOA 1W0KG 3T4DA 2V7QG 4JTCB 5DN6G 1M57C 1Y66A 1BHBA 3GWOA 5KA6A 1H38A 4X8AA 3JD0A 2W6JG 3HPLC 1K5QA 3CD6V 1OCZB 2JIZG 3K03A 3OGCC 3UKMA 3M99B 3CYOA 1BL8A 3CCSV 3JD1A 3OMIB 2A79B 2WWWA 2EIKB 1H8HG 4N23A 4JTDB 2EILC 4HZ3A 2OTJV 4J9YB 1OCOB 1JCHA 5LHGA 2P67A 2HFEC 1GM9A 4MTOA 3OM3B 3TETA 5DM6V 1YHQV 1V54B 4BAYA 1GMGA 5L3EA 2DYRB 4E2LA 1I5XA 3TK1A 1F4NA 1RM1B 1JPXA 4JYBA 2QA4V 3SJQC 4WFEA 3CP1A 1R6KA 2JEXA 1CEZA 1MSWD 3WG7B 4FPPA 4MTFA 4MVSA 3FB5C 3W7TA 1J95A 3OMAB 1FFTB 3X2QC 1K7DA 5L3GA 2EZPA 3ZMZA 1K5SA 1DF5A 4WFHA 2ATKC 3ASNC 1NVPD 3VOUA 1QR9A 2EIJB 1VQOV 4QPKA 1QLNA 5B1AB 4QPJA 3SPHA 3SPIA 4QNHB 4UVCA 3VBBA 1FXKC 4X89A 4P9PA 1KC8W 4WFBV 4MVUA 3IC7A 1YJ9V 1NR1A 2H94A 4JYCA 4F4LA 1NVPB 1RPRA 4QE7A 1VQ4V 2EINC 3ZRWA 5IDJA 2XAJA 5B3SC 3H01A 3CCVV 1SERA 4PDMA 1YSCA 4DXWA 4MSWC 4RQFA 5HFLA 3STLC 1DLBA 1ZWIC 1Q81W 3G4SV 1JVMA 4H37A 3W7WA 2EIMB 1E79G 4FMTA 2DQ0A 3AG3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVZ A;  2HJF C;  4PA7 A;  4H33 A;  1S5H C;  3E89 A;  2WLK A;  5EK0 A;  5CBF A;  4I9W A;  4PA3 A;  3E8H A;  4XDL A;  3OUS A;  3SPG A;  2DYS C;  4P9O A;  5EC2 C;  2R9R B;  3T4Z A;  3RVY A;  5BZB A;  5KUM A;  1KKD A;  3UM7 A;  2AHZ A;  2W0F C;  3PJS K;  1QLE C;  3ASO C;  3F5W C;  3OUF A;  4PA9 A;  2QTO A;  3LNM B;  4X88 A;  3IGA C;  2WLI A;  4WFF A;  4XDJ A;  4MW8 A;  3SYA A;  4MVM A;  3ABM C;  3GB7 C;  3OR7 C;  2KB1 A;  4MVR A;  4KFM A;  1R3L C;  4MS2 A;  4OXS A;  4JTA B;  4GX0 A;  3TCU A;  2HVJ C;  4J9Z B;  4QE9 A;  2HVK C;  4RUE A;  3ABL C;  2WLM A;  2K1E A;  3JYC A;  3T4D A;  4EKW A;  2IH1 C;  2WLN A;  4PDR A;  4JTC B;  5CBH A;  1M57 C;  2Q6A A;  2Q68 A;  3ZJZ A;  1OCC C;  3AG4 C;  1XL4 A;  3F7V C;  3K06 A;  2EIK C;  3LDC A;  4MVQ A;  4X8A A;  3SPC A;  2X6C A;  3SYP A;  2A9H A;  2JK5 C;  3HPL C;  3SYQ A;  4MVO A;  1R3I C;  3FB6 C;  3K03 A;  3OGC C;  3UKM A;  3IFX A;  2ZXW C;  3E8G A;  1BL8 A;  2ITC C;  3SPJ A;  2P7T C;  5EBW C;  2A79 B;  5EBM C;  1V54 C;  4MTG A;  5CBG A;  4PDL A;  2WLI B;  3AG2 C;  2DYR C;  4HYO A;  5J9P C;  4JTD B;  2EIL C;  3BEH A;  4HZ3 A;  4J9Y B;  2H8P C;  4GX5 A;  4MW3 A;  3T1C A;  2HFE C;  2Q69 A;  3SYC A;  3ABK C;  4MTO A;  3WG7 C;  1OCZ C;  3TET A;  2OCC C;  3T2M A;  1R3J C;  3RBZ A;  3E83 A;  4G27 B;  3FB8 C;  2X6A A;  2WLL A;  2BOC C;  3K0D A;  4P30 A;  4RO2 A;  3K04 A;  3SJQ C;  4WFE A;  2QKS A;  3LDE A;  2Q67 A;  4PDV A;  4MTF A;  1OCO C;  1ORQ C;  1K4D C;  4WFG A;  4MVS A;  3FB5 C;  4RAI A;  2ITD C;  1J95 A;  4XDK A;  3STZ C;  3X2Q C;  1XL6 A;  1G4Y B;  1R3K C;  2YEV A;  3K08 A;  2Y69 C;  1M56 C;  5B1A C;  2X6B A;  4G28 B;  3AG1 C;  5EC1 C;  2NLJ C;  2ZD9 A;  4RUF A;  4CBC A;  1K4C C;  4WFH A;  2ATK C;  3ASN C;  4R7C A;  5E1A C;  1P7B A;  4LP8 A;  3VOU A;  3EFF K;  3E8B A;  3OR6 C;  5KUK A;  2HG5 C;  3E8F A;  3RVZ A;  3SPH A;  3F7Y C;  4LBE C;  3SPI A;  4QNH B;  4PA6 A;  2DWD C;  4R50 A;  1OCR C;  4X89 A;  2WLL B;  4BW5 A;  4P9P A;  4TWK A;  3LUT B;  2AHY A;  3SYO A;  3E86 A;  3R65 A;  4MVU A;  2DWE C;  4F4L A;  4PA4 A;  2EIM C;  1LNQ A;  4QE7 A;  4ZBM A;  2EIN C;  3K0G A;  3AG3 C;  5EBL C;  4LCU C;  2BOB C;  2EIJ C;  5B3S C;  5IY5 C;  3LDD A;  4R8C A;  2WLH A;  4PDM A;  4DXW A;  4GX2 A;  4MSW C;  5B1B C;  3STL C;  1ZWI C;  4GX1 A;  3ZRS A;  3FB7 C;  2A0L A;  4R6Z A;  1JVM A;  4H37 A;  3RW0 A;  2IH3 C;  4P2Z A;  3KG2 A;  1V55 C;  4UUJ C;  2WLJ A; 
#chains in the Genus database with same CATH topology
 3L70 H;  1SZX A;  1NH2 D;  2WLK A;  1NTZ H;  3DSQ A;  2ZE6 A;  5JJN B;  1GKF A;  4O4J A;  3KCY A;  3T4Z A;  3RVY A;  3OMN B;  1QLE C;  3JAR A;  3BY6 A;  2RCV A;  1NH2 B;  3UT5 B;  1EN4 A;  1MNG A;  2KB1 A;  4NB5 A;  4O2A B;  4X65 O;  1JJ2 U;  4MS2 A;  1R3L C;  1TVK A;  2ZE7 A;  3ZHV A;  4CH6 A;  4L8J A;  3CXH F;  2UXD B;  3JYC A;  4O4I A;  4UV8 A;  3SGI A;  4UXN A;  1HR0 O;  1Q7Y W;  1COW G;  2A9H A;  2Q0A A;  4MVO A;  1IVS A;  3VQX A;  5L3C A;  3P3P A;  1V54 C;  2P6J A;  4PDL A;  1QCE A;  4O4L B;  4LF7 B;  3BEH A;  5LXT B;  3W7S A;  4UB8 Z;  1EFR G;  5IJ0 A;  5LP6 B;  3A8T A;  1NR7 A;  3RBZ A;  4H0L B;  4U3J A;  4L87 A;  2WLL A;  4I55 B;  2CGO A;  2AZ2 A;  2E74 B;  1D5N A;  5CA0 A;  1Q82 W;  4LFA B;  1AI4 A;  5J2U B;  4I0X B;  1URF A;  1MSD A;  2QWQ B;  5KHI A;  2GV9 A;  4LF5 O;  3JSL A;  5BMV A;  5KHH A;  2IBZ H;  4JAV A;  2WPD G;  1HW7 A;  5LOV B;  4R50 A;  2VS0 A;  2UXC O;  4LF8 O;  2YI9 A;  3SYO A;  3QG5 A;  5IJ9 A;  1VF6 A;  4UB6 Z;  2Q8V A;  5LA6 B;  4DK0 A;  4DR1 O;  2PZS A;  3AG3 C;  2VRZ A;  1KBH A;  1TGO A;  2KG7 B;  2PGG A;  1S5L Z;  1MAB G;  1V55 C;  4UFZ A;  2N74 A;  4GUN A;  1NBM G;  4PHZ A;  3RWR D;  2Q4P A;  3JAL A;  3MD0 A;  4KHP O;  2UUC B;  2F95 B;  4HNA B;  3ZRX A;  2FKX A;  1K92 A;  4O2A A;  1VEW A;  3JAT B;  1IBK O;  3B2E E;  3CS5 A;  1SQP H;  5CBH A;  1RSO B;  3K5N A;  1PNL A;  4X9Q A;  4LF4 B;  4TQF A;  4DR6 B;  4ZI7 A;  5JH7 A;  2XAF A;  2P7T C;  1MA1 A;  4UCO A;  2QGN A;  4FJC C;  5LXT A;  4GKK O;  1HNZ O;  2F4V B;  3N2G A;  5KMG A;  3FYE B;  1ZL8 B;  1JFF B;  1R3J C;  1H2K A;  5F2V O;  4A5U B;  2LO1 A;  3LDE A;  4JI3 O;  1VP7 A;  1OCO C;  1ORQ C;  2OCC B;  1N34 B;  5J2U A;  3L9D A;  2ADP A;  4XDK A;  2ZKO A;  1G6U A;  2CDY A;  3L73 H;  1H8E G;  3RN4 A;  1SQX H;  4GLX A;  4OGQ B;  1Z5W A;  2G38 A;  4YXW G;  3OW2 U;  2EIN B;  4B3T O;  4NXM O;  1XDC A;  4JI7 O;  4PA6 A;  1H2N A;  2R9A A;  2FML A;  4NTX A;  5LA6 A;  1H2L A;  1QVF U;  2ZDI C;  1O9H A;  3CWB H;  5EBL C;  2BTO A;  1YIJ V;  4B3R B;  4DYL A;  1I94 O;  3ZRS A;  3FKS G;  4R6Z A;  5H9C A;  3U11 A;  2XAS A;  2OIG A;  4YHH B;  2FB5 A;  5B1B B;  2Q73 A;  5DEC A;  1G1X B;  5LHH A;  1SQQ H;  4PA9 A;  5KX5 A;  4KXR A;  2BSK B;  3IAY A;  1K9M W;  1F51 A;  4FFB A;  1HDJ A;  2UXD O;  2IH1 C;  2R9I A;  3ABM B;  1J5E B;  1FFX A;  4DR3 B;  1WB7 A;  1S76 D;  2E5L B;  3G80 A;  5JCO C;  5AG2 A;  3ZMT A;  4LF6 B;  1R73 A;  3BCC H;  3OAA G;  3KZI Z;  4TT3 G;  2JJ2 G;  3CHX A;  4GX5 A;  4C7U A;  2Q69 A;  2Q5Z A;  4UCU A;  4UVA A;  3ABK C;  2UUB B;  3T2M A;  1PM9 A;  2CH7 B;  5B1O A;  2JDI G;  4ZKI A;  1H2S B;  1NS1 A;  1BQZ A;  2D3O W;  4DRX B;  4JI1 B;  4LFA O;  4TV8 B;  1PL0 A;  2OT5 A;  3STZ C;  1SS3 A;  1EZV H;  1YTF D;  3K08 A;  2OTL V;  4DV7 B;  2X6B A;  3FX7 A;  1RFY A;  3HKC B;  4YJ2 B;  3RT3 C;  4JYA O;  1K34 A;  3K58 A;  2IJH A;  2YXY A;  3B77 A;  1PPJ H;  3OR6 C;  1FPO A;  4J7J A;  2ARH A;  1GM7 A;  1JOY A;  4DUY B;  3ETG A;  2CTW A;  3ASN B;  1Y4M A;  1HNX B;  4J11 A;  3E2E A;  3RYH A;  3ZMV A;  1VAR A;  4O4H B;  3FB7 C;  2GUZ B;  3A0B Z;  4P2Z A;  1BQ0 A;  2QTS A;  3BA9 A;  2WLJ A;  2UU9 O;  2KSD A;  2IM9 A;  5GW7 A;  4JAS A;  4K0K B;  1KKD A;  2W0F C;  3OUF A;  5JJE B;  2M7W A;  2UUC O;  2ODM A;  3UO3 A;  3QNE A;  1UJW B;  2LFS A;  5L3B A;  2ZNI A;  3ASO B;  3ABL C;  1ENV A;  1TAE A;  2V7Q G;  3QF7 A;  4NTW A;  3GWO A;  5BXZ A;  2AZ0 A;  1QHT A;  2W6J G;  3H1H H;  4NTY A;  4F6R B;  3CD6 V;  4DW0 A;  3K03 A;  3UKM A;  1QQC A;  1TA8 A;  1BL8 A;  2A79 B;  3FFQ A;  1R6T A;  4NXN O;  1BZK A;  2NR5 A;  4N23 A;  4JTD B;  2OTJ V;  2F4V O;  1OCO B;  5LHG A;  2W0X A;  2HFE C;  3HKE A;  4EFB A;  1Y76 B;  3WB1 A;  4I4T A;  1GN2 A;  5L3E A;  1DGS A;  5CB4 B;  5LMN B;  2JEX A;  3FAV A;  3WG7 B;  4TV8 A;  1N34 O;  5KHJ A;  3X2Q C;  1K7D A;  5L3G A;  4DUZ B;  3ZMZ A;  2GTS A;  4H44 B;  4TV9 B;  2ZIO A;  1TUB B;  2ATK C;  4GYC B;  1NVP D;  4JZ2 A;  2E76 B;  4I50 B;  1QR9 A;  1Y6X A;  1QLN A;  5H2F Z;  1U96 A;  5B1A B;  4QPJ A;  3L72 H;  4JI6 B;  4UVC A;  4X89 A;  4P9P A;  1KC8 W;  4WFB V;  4MVU A;  2VWJ A;  2H94 A;  1IBM B;  1NVP B;  3H01 A;  3CCV V;  4PDM A;  1XEQ A;  1T5E A;  5HFL A;  3STL C;  4PI2 A;  1ZWI C;  2ETN A;  3G4S V;  2EIM B;  4FMT A;  4OPA A;  4LFC B;  4H33 A;  3E89 A;  2Q7E A;  4QJF B;  4JI8 O;  2QSA A;  2JS3 A;  1NU1 H;  4I9Q A;  1LUW A;  2QDO A;  2X7R B;  3W7U A;  4FLX A;  2UXC B;  1XNQ O;  1WJZ A;  1MMM A;  4X88 A;  1IBL B;  3A0H Z;  4MVM A;  1I0H A;  3O9O A;  2DYS B;  4DV5 B;  4FLV A;  4MVR A;  1NKD A;  1E1R G;  3H1I H;  1SA0 A;  1I7F A;  1THZ A;  2K1E A;  2VQE O;  1XNR B;  2Q68 A;  1J5E O;  2B5U A;  3SYP A;  3SYQ A;  1K33 A;  4TQD A;  4O4J B;  2E5L O;  1L1F A;  3GVM A;  3JAR B;  4LF6 O;  2DQ3 A;  1VQP V;  5CBG A;  3K5L A;  4OPH A;  2EX3 A;  3UO2 A;  5GTI Z;  1MZF A;  2KKW A;  2F23 A;  2H8P C;  1TVK B;  1RM1 C;  1KQS U;  2RMK B;  2P5O A;  1Y76 A;  4QIW F;  1CPY A;  2UUB O;  2QWR B;  2PI5 A;  3AG2 B;  4G2K A;  1LR1 A;  5JQG B;  1FKA O;  3BAB A;  2EJR A;  5TIS Z;  5CA1 A;  1L0L H;  4J7Z A;  1K4D C;  5LGN A;  1VQ7 V;  1G4Y B;  1WLE A;  4DV7 O;  1IDS A;  3ZHU A;  1TUB A;  1M9N A;  1WP8 A;  2ZDI A;  3B4S A;  5IJ0 B;  1K73 W;  1WB8 A;  5E1A C;  4U3J B;  4BIO A;  1Q86 W;  3G67 A;  2WLL B;  3MHS C;  3JCU Z;  3MHH C;  4DUY O;  1WA8 A;  5CA0 B;  1KP3 A;  3ZHR A;  3JAM N;  1AI5 A;  4U7N A;  1AVM A;  3P30 A;  4X1Y A;  2WAM A;  4CC5 A;  1LUV A;  1VQM V;  4CS3 A;  1AJP A;  3ICX A;  5BMV B;  2KQX A;  2Z0A A;  4EEQ A;  2IH3 C;  3QO8 A;  4FLW A;  4B3S B;  4B3T B;  4GCZ A;  1G8M A;  4PA3 A;  4K0K O;  3RFR A;  3D8C A;  2XT9 A;  2R9R B;  1M90 W;  1HWY A;  1VQL V;  3ZS8 C;  1XQ8 A;  5IJ9 B;  1AR5 A;  3KCX A;  4KFM A;  2RN9 A;  5JCO A;  5H6Q A;  4CH3 A;  1YI2 V;  1OCC C;  3AG4 C;  3K06 A;  3F7V C;  3MAQ A;  4EFE A;  1IZ3 A;  1YZB A;  3OEH G;  4UCS A;  3NXS A;  2MW2 B;  1H2G A;  1OHH G;  3D3I A;  2FYU H;  2ITC C;  3JAL B;  3LSQ A;  4X64 B;  2Q0O C;  1Q5O A;  1GO3 F;  4AI8 A;  5J2T A;  2F43 G;  3T1C A;  1M93 A;  1OCZ C;  2P4V A;  2HP8 A;  3SR2 C;  4G27 B;  3FB8 C;  5JQG A;  3BVO A;  2QE7 G;  4TUY A;  4X66 O;  4FLT A;  4ZI7 B;  1GRJ A;  5LMN O;  3L75 H;  4FIP C;  1QNM A;  3QO7 A;  5JH7 B;  5IYZ B;  2V4D A;  4DUZ O;  1CP9 A;  1L0N H;  2YXH A;  4JF3 A;  4CBC A;  3CCM V;  4DV2 B;  3N2G B;  5KMG B;  3SDL A;  4PEL A;  1SES A;  2Y69 B;  4JI6 O;  4PI0 A;  4BW5 A;  2PYL A;  1QBZ A;  3LSU A;  3MDS A;  5L3F A;  2H3O A;  3H1J H;  3APQ A;  1IBM O;  4I7Z B;  2XAG A;  4FLZ A;  2EIJ C;  1PKX A;  1AJQ A;  3QO5 A;  1FAF A;  3BPZ A;  4MTX A;  4LFC O;  3BFR A;  1V9P A;  4JYA B;  5FPR A;  5D5Q A;  2BE3 A;  3DXR B;  3CRM A;  3JSN A;  2LW1 A;  5KUM A;  4JAA A;  2ZQM A;  3SJA C;  1IBL O;  1ZTE A;  2A3Q A;  4DV5 O;  2IJJ A;  2ZIN A;  3ABU A;  2HKO A;  1XNR O;  3C90 A;  2Q6A A;  2BTQ A;  2Y0P A;  3ZJZ A;  2UU9 B;  1HP8 A;  3OEE G;  1BHA A;  2RQ6 A;  4HAM A;  3SPC A;  3WU2 Z;  3CC4 V;  1WP7 A;  1VQ9 V;  5IYD O;  4GKJ B;  4DV6 O;  4MTG A;  3CE2 A;  5KX5 B;  4AIL C;  1YIT V;  3H9V A;  4HYO A;  4O2B B;  3M7M X;  5B5E Z;  2DE0 X;  2CK3 G;  3AK1 A;  4FFB B;  5A9G A;  3D3Q A;  3JAS A;  3CPW U;  3ZBH A;  1K3E A;  2JS5 A;  1FFX B;  4FZ1 A;  1Q6U A;  3UQ8 A;  1GN6 A;  3Q4H B;  2HJD A;  2IU0 A;  4IYH A;  5IYZ A;  2C2A A;  1XL6 A;  4NXN B;  1P49 A;  1M56 C;  3AG1 C;  4LH6 A;  3T1H B;  1R1B A;  2HR3 A;  4LP8 A;  1XBL A;  4NKG B;  4FLY A;  3E8B A;  5EIB C;  3T1Y B;  2R72 A;  1OCR C;  3CCL V;  1US6 A;  5EZY A;  3K0G A;  2QKC A;  3S3W A;  2B9Z A;  1S0V A;  5IY5 C;  3LDD A;  1FS0 G;  5LGU A;  2QR4 A;  4LF9 B;  4GX1 A;  1ZX3 A;  2HLD G;  3RW0 A;  3CCR V;  1MOF A;  4UUJ C;  4B3S O;  2V1D A;  5CBF A;  3CCU V;  3DXR A;  2ZT9 B;  1U97 A;  3DC6 A;  1A32 A;  1JQ0 A;  3OGI B;  2E75 B;  4LFB B;  4JGS A;  3ZMS A;  2FTK A;  3TCU A;  3RYH B;  1DK1 A;  2QEX V;  1QLE B;  1EZJ A;  2EBO A;  1SQG A;  4JTC B;  5DN6 G;  1M57 C;  1Y66 A;  3S3X A;  2CTP A;  5KA6 A;  1H38 A;  1ZLZ A;  4JI8 B;  4DV1 B;  1K5Q A;  3BRC A;  1AP6 A;  1OCZ B;  2JIZ G;  1XNQ B;  4FM1 A;  3CCS V;  4X1K A;  3OMI B;  4X64 O;  2CAZ C;  1H8H G;  4CS4 A;  4O2B A;  2EIL C;  4J9Y B;  2YDE A;  3K9S A;  2Q7H A;  3U10 A;  3OM3 B;  1YHQ V;  1V54 B;  2VQE B;  1GMG A;  1N0J A;  4E2L A;  1JJO A;  3TK1 A;  4DR2 B;  1XHX A;  1OV9 A;  1JPX A;  4JYB A;  3CP1 A;  1R6K A;  4GZR B;  1MSW D;  3Q4H A;  1J95 A;  3AG7 A;  3C3T A;  2A7W A;  1AB3 A;  1K5S A;  1D2D A;  2YC0 A;  2JGD A;  4DV2 O;  3HKE B;  2EIJ B;  1VQO V;  1XMO B;  1WPB A;  2RNB A;  4QNH B;  4I4T B;  3VBB A;  1AR4 A;  4YJ3 B;  4Z2W A;  2P4K A;  4F4L A;  3FAV B;  1RPR A;  4QE7 A;  5BY1 A;  3ZRW A;  5IDJ A;  5B3S C;  4MSW C;  4RQF A;  4JI2 B;  1DLB A;  2AXT Z;  1FD9 A;  3W7W A;  1YDX A;  3L74 H;  3AG3 B;  2WA3 A;  1SZT A;  2PYJ A;  2JVD A;  2IJI A;  3I5D A;  3UM7 A;  4FLU A;  1V55 B;  5IYB O;  3G6B A;  1EN6 A;  1YF2 A;  1N33 B;  1VQ6 V;  3I56 V;  3CC2 V;  1GN3 A;  4LNU B;  1HNW B;  2WLM A;  4J7K A;  4UV9 A;  3IC9 A;  4PDR A;  2EIK C;  2XND G;  2ZE8 A;  1R3I C;  3ML0 A;  4HBN A;  3DGE A;  3JD4 A;  4GKJ O;  3WB2 A;  1Q43 A;  2VWK A;  1GM8 A;  2DYR C;  3KKY A;  5B1N A;  5J9P C;  3SYC A;  1SA0 B;  4WBN A;  2ZR3 A;  3E83 A;  3TGU H;  2E3C A;  3ZED A;  4P30 A;  1N8R W;  1S5J A;  1NTK H;  3ZN0 A;  1WPX A;  1X4T A;  2QKS A;  3TXS A;  2QM8 A;  3UCS C;  3ETD A;  3A0R A;  1VQN V;  3BA8 A;  1AI7 A;  1ARO P;  3BHP A;  2YEV A;  4PV1 B;  1DF4 A;  3AEI A;  1F4M A;  3T1H O;  2NLJ C;  3TXQ A;  2LFR A;  4R7C A;  3CCE V;  1P7B A;  1FXH A;  5LL6 Y;  5IWA B;  3E8F A;  3RVZ A;  2XTA A;  3T1Y O;  5E79 Z;  2WSS G;  4YJ3 A;  4X66 B;  1XUQ A;  4ZOL A;  3SJB C;  5CA1 B;  1LNQ A;  1XIL A;  1M4U A;  5FL7 G;  5A2Q N;  2DOS A;  4GX2 A;  1SKV A;  3CCJ V;  5BR8 B;  4LF9 O;  1KEC A;  2IU3 A;  2QJ1 A;  3K57 A;  1YJW V;  4B3M O;  3JD2 A;  2YXL A;  3K79 A;  3F5W C;  4IL6 Z;  1WA8 B;  4Z1V A;  1F7Y A;  5EYP A;  4XDJ A;  4LFB O;  3OR7 C;  3HKD B;  3ETQ A;  2PUS A;  1S3J A;  1RPO A;  4LNU A;  4NYK A;  4OXS A;  4X1Y B;  1NJI W;  3CCQ V;  2UUA B;  4ZHQ A;  4OX9 B;  1YVW A;  3CME V;  2DMX A;  2UXN A;  1PNK A;  1M1K W;  2IW5 A;  2EIL B;  1XL4 A;  4MVQ A;  2BCC H;  3HB3 B;  3J81 N;  3BAA A;  4DV1 O;  3CRQ A;  1Q8I A;  3ZN1 A;  5LP6 C;  3JAK A;  1ZAU A;  4K3A A;  1W0J G;  4EB6 B;  1GAX A;  3K3W A;  1EM1 A;  3H1K H;  2O57 A;  1XRE A;  1S72 V;  3GWK C;  1TUE B;  4CS2 A;  4DR2 O;  5LGT A;  5KAF Z;  3ABK B;  2CGN A;  5IT9 N;  4RAI A;  3E35 A;  1VQ5 V;  4DV6 B;  4JI4 B;  1SC5 B;  4G28 B;  2Q7G A;  2ZD9 A;  5J2T B;  4PD4 F;  4D6T H;  1AIL A;  1XMO O;  1SQV H;  5KUK A;  1OZ0 A;  3F7Y C;  3K5O A;  4TUY B;  4TWK A;  5CA3 A;  3P32 A;  1Y74 A;  2X0L A;  2QWN B;  4ZBM A;  1ROP A;  2CTR A;  1PP9 H;  1EBO A;  4X20 A;  2RDC A;  4JI2 O;  2RJZ A;  4JI5 B;  4U3F H;  1KD1 W;  3KG2 A;  1IXM A;  5FPO A;  1EN5 A;  5EK0 A;  3HKB B;  1BMF G;  5EC2 C;  5ITZ A;  3PJS K;  4LR3 A;  5JWP A;  5GON A;  1N33 O;  2WLI A;  4U7O A;  3SYA A;  5LYJ A;  4QGP A;  3HKD A;  4IT5 A;  2UXB B;  1KUQ A;  3AK2 A;  3B40 A;  4QE9 A;  1HNW O;  4RUE A;  4EKW A;  2PY5 A;  3PN1 A;  3CEI A;  3W7X A;  3CB2 A;  4J42 A;  3R66 A;  1NZ6 A;  5FNV A;  1UPG A;  1ZSP A;  3ABL B;  3FB6 C;  4W4K A;  5K1P A;  5EBW C;  2GDS A;  3OT7 A;  2YIB A;  3OD4 A;  5C8Y A;  4EB6 A;  2XHB A;  2Z5U A;  2OCC C;  2GHY A;  3ZRV A;  1AJN A;  4UCR A;  2BTQ B;  1N36 B;  5KHK A;  2EZO A;  2JGU A;  4XBF A;  4RO2 A;  3K04 A;  1KP2 A;  3H1L H;  4B7E A;  1UFI A;  5JVD B;  1BE3 H;  1SQB H;  3ZIA G;  3CRR A;  1QR8 A;  3B8N A;  3JAW A;  4RUF A;  4IIJ A;  2D2C B;  3CMA V;  4RWU A;  3X2Q B;  3JAS B;  5IWA O;  3G6E V;  1JX9 A;  2DWD C;  4BIU A;  1PNM A;  3D36 C;  3LUT B;  1FYJ A;  3R65 A;  2CUG A;  4K8Z A;  2ZE5 A;  1XMQ B;  5JJJ B;  4PA4 A;  3ZMU A;  3TJT A;  1BS3 A;  4LCU C;  2BOB C;  3JCZ A;  2YS8 A;  4KL1 A;  2DJV A;  4FFK A;  4DK1 A;  4DV3 B;  5B1B C;  1I5Y A;  5BR8 O;  3N2K A;  1W2B U;  1GTO A;  2Y48 A;  1IX9 A;  2CE4 A;  3J7A U;  1W59 A;  2UXX A;  3RYC A;  3HKB A;  3CJH A;  3E8H A;  4P9O A;  4FVM A;  3FD9 A;  4LH7 A;  5EZY B;  1RP3 B;  4DV0 B;  4MW8 A;  3ABM C;  3GB7 C;  2UUA O;  1KB9 F;  2L6L A;  4DO2 A;  1NQT A;  2HVK C;  4OX9 O;  1GK9 A;  2VQF B;  3T4D A;  3OTO B;  1W0K G;  4DR4 B;  4IHJ A;  3CRA A;  1BHB A;  4UCV A;  4X8A A;  3JD0 A;  2ZCE A;  4J41 A;  3HPL C;  3P3N A;  3RYF A;  3OGC C;  3M99 B;  4PJ0 Z;  1JMK C;  3JD1 A;  4UCT A;  2GBO A;  4FM2 A;  4HZ3 A;  2F93 B;  1I08 A;  1JCH A;  2P67 A;  3TET A;  5DM6 V;  4BAY A;  1FJG B;  2QKA A;  1I5X A;  1RM1 B;  4WFE A;  5K1X A;  1H2M A;  1CEZ A;  4FPP A;  5JVD A;  3WB0 A;  4MVS A;  3K59 A;  2ZM6 B;  1FFT B;  4X1K B;  2EZP A;  5KLV H;  4JI4 O;  2DN9 A;  4DR5 B;  3HR0 A;  1DF5 A;  2F66 C;  2EJ7 A;  3ASN C;  5H5N A;  4ICG A;  1XOU A;  3APO A;  3SPI A;  1FXK C;  3IC7 A;  1YJ9 V;  1NR1 A;  4JYC A;  3UT5 A;  1VQ4 V;  1IUR A;  1YSC A;  4DXW A;  2R70 A;  4CH4 A;  1E79 G;  4JI5 O;  2JGD B;  4MVZ A;  4BWA A;  4J10 A;  5IYC O;  4I9W A;  3OUS A;  3QTC A;  3JD3 A;  2AHZ A;  3ASO C;  1YEW A;  2QTO A;  3LNM B;  4WFF A;  4K8X A;  4O4L A;  3ZRW B;  1MG1 A;  2UXB O;  5LP6 A;  4CC6 A;  1NI8 A;  2OIE A;  1GN4 A;  2WLN A;  2XOK G;  3FYI B;  1B6Q A;  4JI0 O;  4I55 A;  2X6C A;  2JK5 C;  2OWO A;  2FL4 A;  4B3M B;  4I0X A;  4X62 B;  1KYO F;  1PL4 A;  1OCC B;  5EBM C;  3AG4 B;  3CXC U;  4K35 A;  2N05 A;  3VQW A;  4MW3 A;  1SRY A;  1PD3 A;  3WG7 C;  1S77 D;  5LOV A;  1WAZ A;  2X6A A;  1N36 O;  3WFV A;  4YY3 O;  2LP7 A;  5C93 A;  3EXA A;  1N0N A;  1VF7 A;  2Q67 A;  4PDV A;  1VMG A;  1N32 B;  4WFG A;  2HEP A;  2NNU A;  3LSS A;  3ZHT A;  2KG7 A;  1R3K C;  5B1A C;  2XAQ A;  1R6N A;  1JR9 A;  2QM4 A;  5EC1 C;  4D7S A;  4WFA V;  3ZCC A;  1FXV A;  1D5A A;  3EFF K;  2QWP B;  4WBN B;  2YIC A;  2M6Y A;  1XI1 A;  1K97 A;  4X1I B;  2L35 A;  1XMQ O;  2EIM C;  4HNA A;  2LGW A;  1B06 A;  4KP4 A;  2QM7 A;  4GT1 A;  4ABM A;  3JAT A;  1SF9 A;  2WLH A;  4DV3 O;  2WA4 A;  2YEV B;  3DTU B;  4LWS B;  3IJ4 A;  1JA8 A;  1RSO A;  5HFM A;  4PA7 A;  2YSU B;  4AQY B;  1BGY H;  1F23 A;  2DYS C;  5LHI A;  4FM0 A;  1AR1 B;  4NVP A;  4ZOL B;  2DW4 A;  1Q90 D;  4DV0 O;  4Z1M G;  2Z3Y A;  3VQV A;  4DR7 B;  4ZIB A;  2Q9L A;  4LF7 O;  2P90 A;  1AI6 A;  2ADQ B;  2YUA A;  4BIZ A;  1ZL8 A;  4Q6G A;  1JFF A;  2VQF O;  4TSF G;  3OTO O;  2K9P A;  4DR4 O;  4NR1 A;  3LDC A;  1DTO A;  1VQ8 V;  3F5T A;  4J80 A;  5LBQ A;  5DED A;  2ZXW C;  3E8G A;  4CH5 A;  4FK5 C;  3SPJ A;  5EYP B;  3AG2 C;  4Q20 A;  3O65 A;  1CXZ B;  1KMI Z;  4ZHQ B;  2OCH A;  3ETE A;  1YTF B;  3K9A A;  4D7T A;  1FJG O;  2B1G A;  5LMU B;  3CX5 F;  3ZX6 A;  1M5I A;  2LW7 A;  3RYI B;  4RQE A;  2HHH B;  2ZM6 O;  2ILM A;  1VF5 B;  4N21 A;  3JAK B;  3OFN G;  1YJN V;  1SQF A;  2B1I A;  2LJ2 A;  1FXK B;  3D36 A;  1VQK V;  4DR5 O;  1P84 F;  2Y4U A;  3LNN A;  3THO A;  4WCE V;  1MZE A;  1O9G A;  3RGB A;  5L3D A;  1IXB A;  2YID A;  5CMU A;  3OE7 G;  2QWO B;  5EIB D;  1M56 B;  1YXB A;  3I55 V;  2JJ1 G;  3AG1 B;  4X1I A;  2DWE C;  3VQY A;  2BSK A;  1K8A W;  1P7G A;  5B66 Z;  4JPR A;  1OCR B;  4LWS A;  4JV5 B;  4UVB A;  2Y0I A;  3G71 V;  4DV4 B;  4CZZ A;  1VF6 C;  2HJF C;  5IY5 B;  1S5H C;  4LF4 O;  3U0Z A;  1L8D A;  2AW9 A;  4XDL A;  2OYQ A;  4DR6 O;  5BZB A;  2W6I G;  1Y74 B;  5KA5 A;  1KKC A;  3A2F A;  4E4E A;  1OJH A;  3E22 B;  3EHB B;  1E1Q G;  3NR7 A;  4X65 B;  4H13 B;  4X20 B;  4JTA B;  4GX0 A;  2HVJ C;  4J9Z B;  2CH7 A;  3C3S A;  3ZHQ A;  1NT2 B;  4JAU A;  1HR0 B;  5H6R A;  3B8M A;  4DRX A;  2AGA A;  5ITZ B;  3IFX A;  4X62 O;  1M57 B;  1QVG U;  4DW1 A;  5GON B;  2WLI B;  3ZHS A;  2ZR2 A;  5LYJ B;  4WF9 V;  5IE9 A;  3HKC A;  4B7K A;  4JYY A;  4YJ2 A;  2ZIM A;  2GSM B;  4W4L A;  5KHG A;  2CTQ A;  2BOC C;  3CRC A;  2JRI A;  3K0D A;  2Y4T A;  2YIB D;  5FNV B;  2LQT A;  3RYI A;  1N32 O;  1AP5 A;  4ASU G;  2ITD C;  3N27 A;  1FXK A;  3B09 A;  4LF5 B;  3OTF A;  2Y69 C;  4B3R O;  4O4H A;  3L71 H;  3SJC C;  2GUZ A;  1NTM H;  4KUM A;  1P4R A;  5C8Y B;  4IGG A;  3K5M A;  1K4C C;  1XHZ A;  3CC7 V;  2YI8 A;  4YHH O;  2HG5 C;  2XAH A;  2P06 A;  4LBE C;  4LF8 B;  2AHY A;  3E86 A;  5CN0 A;  2XUM A;  1WNS A;  4DR1 B;  4B08 A;  4R8C A;  4YIO A;  2PF4 E;  1Z2G A;  4I5S A;  4MT8 A;  4FZ0 A;  3JAW B;  2A06 H;  2A0L A;  2MK3 A;  3EVK A;  1B04 A;  3ABT A;  2IJK A;  1PV0 A;  4IIJ B;  1GH6 A;  2JEU A;  3QVN A;  5B3S B;  4BW9 A;  4AQY O;  4F6R A;  4DR3 O;  3SPG A;  1YCI A;  4AHC A;  1N4C A;  2N04 A;  2PI4 A;  4KHP B;  3IGA C;  4DR7 O;  3E22 A;  1B3Q A;  3J80 N;  1IBK B;  1SET A;  1BSM A;  2ZXW B;  3AK3 A;  3N2K B;  4LC1 A;  4O4I B;  3RYC B;  5CB4 A;  1Q6H A;  3CJH B;  5KAI Z;  1BCC H;  4F6E A;  4JI1 O;  5GTH Z;  1Y67 A;  2YIA A;  3CYO A;  3CSX A;  2WWW A;  2EIK B;  2ZNJ A;  4TV9 A;  1Q3E A;  4GKK B;  1HNZ B;  1ZUQ A;  2PTM A;  1GM9 A;  4BR6 A;  4I50 A;  4MTO A;  2LGQ A;  2F1M A;  4IYI A;  1Z5V A;  4IHJ B;  2DYR B;  5LMU O;  4JI0 B;  1WN7 A;  1F4N A;  2NN4 A;  2QA4 V;  3SJQ C;  3M8A A;  4JI3 B;  4MTF A;  1HNX O;  3RYF B;  3W7T A;  3FB5 C;  2HHH O;  3OMA B;  4TOI A;  3DC5 A;  2P22 C;  1KU9 A;  1QU7 A;  4JZG A;  4WFH A;  4YIP A;  1VIB A;  3VOU A;  4NXM B;  4QPK A;  5FLX N;  4JI7 B;  3SPH A;  4YY3 B;  2EUL A;  1Q6I A;  2EIN C;  1BT8 A;  2XAJ A;  1X59 A;  5D5P A;  1SER A;  4JV5 O;  1I94 B;  1Q81 W;  1JVM A;  2GTA A;  4H37 A;  2DQ0 A;  4DV4 O; 
#chains in the Genus database with same CATH homology
 4MVZ A;  4H33 A;  3E89 A;  1NH2 D;  1SZT A;  2WLK A;  4QJF B;  5IYC O;  4I9W A;  3OUS A;  1GKF A;  2X7R B;  2IJI A;  3T4Z A;  3RVY A;  3JD3 A;  3W7U A;  3OMN B;  3UM7 A;  2AHZ A;  1QLE C;  3ASO C;  1V55 B;  3BY6 A;  5IYB O;  2QTO A;  3LNM B;  4X88 A;  4WFF A;  1NH2 B;  3ZRW B;  4MVM A;  1VQ6 V;  2DYS B;  3I56 V;  2KB1 A;  4MVR A;  1JJ2 U;  1MG1 A;  4MS2 A;  1R3L C;  1NKD A;  3CC2 V;  1E1R G;  1THZ A;  2WLM A;  2K1E A;  3JYC A;  4UV9 A;  2WLN A;  4PDR A;  4UV8 A;  2Q68 A;  2XOK G;  4UXN A;  2B5U A;  1B6Q A;  3FYI B;  1Q7Y W;  2EIK C;  2XND G;  2X6C A;  3SYP A;  1COW G;  2A9H A;  2JK5 C;  3SYQ A;  1K33 A;  4MVO A;  1R3I C;  3ML0 A;  1L1F A;  3DGE A;  3JD4 A;  5L3C A;  1OCC B;  2DQ3 A;  5EBM C;  1V54 C;  3AG4 B;  2P6J A;  4PDL A;  5CBG A;  1VQP V;  3CXC U;  1QCE A;  1GM8 A;  2DYR C;  5B1N A;  5J9P C;  3BEH A;  3W7S A;  2H8P C;  1EFR G;  4MW3 A;  1RM1 C;  3SYC A;  1KQS U;  1SRY A;  1PD3 A;  3WG7 C;  4QIW F;  1CPY A;  2ZR3 A;  1NR7 A;  3RBZ A;  3AG2 B;  3E83 A;  2PI5 A;  4G2K A;  1S77 D;  4L87 A;  2X6A A;  2WLL A;  3WFV A;  4P30 A;  2LP7 A;  5C93 A;  1N8R W;  2EJR A;  3ZN0 A;  1WPX A;  2QKS A;  1Q82 W;  2Q67 A;  4PDV A;  2QM8 A;  1K4D C;  1AI4 A;  3ETD A;  4WFG A;  2NNU A;  3A0R A;  5LGN A;  1AI7 A;  1ARO P;  3LSS A;  1VQ7 V;  1VQN V;  1G4Y B;  1R3K C;  2YEV A;  1WLE A;  1DF4 A;  2XAQ A;  5B1A C;  1R6N A;  3AEI A;  1M9N A;  1F4M A;  5EC1 C;  2NLJ C;  2ZDI A;  2LFR A;  4WFA V;  4R7C A;  3CCE V;  4JAV A;  5E1A C;  3ZCC A;  1FXV A;  1FXH A;  1P7B A;  2WPD G;  3EFF K;  1K73 W;  3E8F A;  3RVZ A;  1Q86 W;  4R50 A;  2WLL B;  2WSS G;  3MHS C;  3MHH C;  3SYO A;  1K97 A;  1KP3 A;  2EIM C;  1LNQ A;  1AI5 A;  4KP4 A;  4U7N A;  3AG3 C;  2QM7 A;  4GT1 A;  5FL7 G;  2WLH A;  3P30 A;  4GX2 A;  2WAM A;  2YEV B;  3CCJ V;  3DTU B;  1VQM V;  1AJP A;  1KEC A;  2IU3 A;  1MAB G;  2IH3 C;  3QO8 A;  5HFM A;  1V55 C;  4PA7 A;  4GCZ A;  1G8M A;  2YSU B;  4PA3 A;  1NBM G;  1F23 A;  2DYS C;  1YJW V;  5LHI A;  2R9R B;  1M90 W;  1HWY A;  3JD2 A;  1VQL V;  1AR1 B;  3K79 A;  3F5W C;  2DW4 A;  3MD0 A;  4Z1M G;  2Z3Y A;  4XDJ A;  3ZRX A;  3OR7 C;  1K92 A;  2P90 A;  1AI6 A;  4KFM A;  1S3J A;  1RPO A;  1NJI W;  4OXS A;  3CCQ V;  4BIZ A;  5H6Q A;  4TSF G;  3CME V;  5CBH A;  2UXN A;  1PNL A;  1YI2 V;  1PNK A;  1OCC C;  1M1K W;  2IW5 A;  2EIL B;  3AG4 C;  1XL4 A;  3F7V C;  3K06 A;  3HB3 B;  3LDC A;  4MVQ A;  1DTO A;  1VQ8 V;  3OEH G;  3NXS A;  1H2G A;  3ZN1 A;  1OHH G;  5LBQ A;  3D3I A;  2ZXW C;  2XAF A;  3E8G A;  2ITC C;  4FK5 C;  3SPJ A;  2P7T C;  3LSQ A;  3AG2 C;  1GO3 F;  1W0J G;  4Q20 A;  4FJC C;  2F43 G;  3T1C A;  3K3W A;  3FYE B;  1OCZ C;  3ETE A;  1YTF B;  1R3J C;  4G27 B;  3K9A A;  1S72 V;  3FB8 C;  2QE7 G;  1TUE B;  2B1G A;  5LGT A;  3LDE A;  3ABK B;  1OCO C;  1ORQ C;  2OCC B;  4RAI A;  4FIP C;  4RQE A;  3QO7 A;  4XDK A;  3OFN G;  3E35 A;  4N21 A;  1YJN V;  1VQ5 V;  2B1I A;  1FXK B;  1H8E G;  1CP9 A;  3D36 A;  1VQK V;  4G28 B;  4JF3 A;  4YXW G;  2ZD9 A;  4WCE V;  4CBC A;  3CCM V;  5L3D A;  3OW2 U;  2EIN B;  5CMU A;  3OE7 G;  4PEL A;  5KUK A;  1SES A;  2Y69 B;  1M56 B;  1OZ0 A;  3F7Y C;  4PA6 A;  4BW5 A;  3I55 V;  2JJ1 G;  1QBZ A;  3AG1 B;  4TWK A;  5CA3 A;  3P32 A;  5L3F A;  2DWE C;  2X0L A;  1QVF U;  4ZBM A;  2ZDI C;  1ROP A;  1K8A W;  5EBL C;  2XAG A;  2EIJ C;  4JPR A;  1EBO A;  1PKX A;  1OCR B;  1YIJ V;  1AJQ A;  3QO5 A;  4UVB A;  3ZRS A;  3FKS G;  4R6Z A;  1KD1 W;  3G71 V;  4MTX A;  5H9C A;  3KG2 A;  1IXM A;  4CZZ A;  2HJF C;  2XAS A;  5IY5 B;  1S5H C;  5EK0 A;  4XDL A;  5B1B B;  1BMF G;  5EC2 C;  5BZB A;  5KUM A;  5LHH A;  3PJS K;  2ZQM A;  2W6I G;  4PA9 A;  5KA5 A;  2WLI A;  4U7O A;  3EHB B;  3SYA A;  1E1Q G;  1K9M W;  2IJJ A;  1F51 A;  3ABU A;  4JTA B;  4GX0 A;  2HVJ C;  4J9Z B;  4QE9 A;  2HKO A;  4RUE A;  4EKW A;  2IH1 C;  2R9I A;  2Q6A A;  3ZJZ A;  3ABM B;  4JAU A;  3OEE G;  1BHA A;  3W7X A;  5H6R A;  4HAM A;  3SPC A;  3B8M A;  3CC4 V;  1S76 D;  3ABL B;  3FB6 C;  1VQ9 V;  5IYD O;  3IFX A;  1M57 B;  1QVG U;  3ZMT A;  5EBW C;  1R73 A;  4MTG A;  3OAA G;  2WLI B;  2ZR2 A;  1YIT V;  4TT3 G;  4HYO A;  2JJ2 G;  4WF9 V;  4GX5 A;  2Q69 A;  2CK3 G;  4UVA A;  2GSM B;  3ABK C;  2Z5U A;  3CPW U;  2OCC C;  3T2M A;  2GHY A;  5B1O A;  1K3E A;  3ZRV A;  1AJN A;  2JDI G;  2EZO A;  4XBF A;  2BOC C;  3K0D A;  4RO2 A;  3K04 A;  4ZKI A;  1KP2 A;  2D3O W;  1PL0 A;  2OT5 A;  4ASU G;  2IU0 A;  2ITD C;  3STZ C;  1YTF D;  1FXK A;  2C2A A;  1XL6 A;  3ZIA G;  3K08 A;  2OTL V;  1QR8 A;  1M56 C;  2Y69 C;  3B8N A;  2X6B A;  4KUM A;  3AG1 C;  1P4R A;  4RUF A;  1K4C C;  1K34 A;  2HR3 A;  2IJH A;  4LP8 A;  3B77 A;  3X2Q B;  3CMA V;  3CC7 V;  3E8B A;  3G6E V;  3OR6 C;  2HG5 C;  2XAH A;  1JX9 A;  4LBE C;  2DWD C;  1OCR C;  4BIU A;  1PNM A;  3LUT B;  2AHY A;  1GM7 A;  3CCL V;  1JOY A;  3E86 A;  3R65 A;  5CN0 A;  3ETG A;  3ASN B;  4PA4 A;  3ZMU A;  1Y4M A;  3K0G A;  4LCU C;  2BOB C;  3JCZ A;  1S0V A;  5IY5 C;  3LDD A;  4R8C A;  1FS0 G;  5LGU A;  3E2E A;  5B1B C;  1I5Y A;  3ZMV A;  4I5S A;  4GX1 A;  4MT8 A;  3FB7 C;  2A0L A;  2HLD G;  2MK3 A;  1W2B U;  1GTO A;  2Y48 A;  2IJK A;  3ABT A;  3RW0 A;  3CCR V;  1MOF A;  4P2Z A;  4UUJ C;  2WLJ A;  2JEU A;  2UXX A;  5B3S B;  2V1D A;  5CBF A;  3CCU V;  5GW7 A;  3E8H A;  4JAS A;  3SPG A;  4P9O A;  2PI4 A;  1KKD A;  2W0F C;  3OUF A;  1JQ0 A;  2M7W A;  3IGA C;  4MW8 A;  3ABM C;  3GB7 C;  4JGS A;  3QNE A;  1UJW B;  2LFS A;  3ZMS A;  1SET A;  2FTK A;  3TCU A;  2QEX V;  5L3B A;  1QLE B;  2ZXW B;  3ASO B;  4LC1 A;  1NQT A;  2HVK C;  1EZJ A;  4DO2 A;  3ABL C;  1GK9 A;  1ENV A;  2EBO A;  1W0K G;  3T4D A;  2V7Q G;  4JTC B;  5DN6 G;  1M57 C;  1Y66 A;  1BHB A;  3GWO A;  5KA6 A;  1H38 A;  4X8A A;  3JD0 A;  2W6J G;  3HPL C;  1K5Q A;  3CD6 V;  1OCZ B;  2JIZ G;  3K03 A;  3OGC C;  3UKM A;  3M99 B;  3CYO A;  1BL8 A;  3CCS V;  3JD1 A;  3OMI B;  2A79 B;  2WWW A;  2EIK B;  1H8H G;  4N23 A;  4JTD B;  2EIL C;  4HZ3 A;  2OTJ V;  4J9Y B;  1OCO B;  1JCH A;  5LHG A;  2P67 A;  2HFE C;  1GM9 A;  4MTO A;  3OM3 B;  3TET A;  5DM6 V;  1YHQ V;  1V54 B;  4BAY A;  1GMG A;  5L3E A;  2DYR B;  4E2L A;  1I5X A;  3TK1 A;  1F4N A;  1RM1 B;  1JPX A;  4JYB A;  2QA4 V;  3SJQ C;  4WFE A;  3CP1 A;  1R6K A;  2JEX A;  1CEZ A;  1MSW D;  3WG7 B;  4FPP A;  4MTF A;  4MVS A;  3FB5 C;  3W7T A;  1J95 A;  3OMA B;  1FFT B;  3X2Q C;  1K7D A;  5L3G A;  2EZP A;  3ZMZ A;  1K5S A;  1DF5 A;  4WFH A;  2ATK C;  3ASN C;  1NVP D;  3VOU A;  1QR9 A;  2EIJ B;  1VQO V;  4QPK A;  1QLN A;  5B1A B;  4QPJ A;  3SPH A;  3SPI A;  4QNH B;  4UVC A;  3VBB A;  1FXK C;  4X89 A;  4P9P A;  1KC8 W;  4WFB V;  4MVU A;  3IC7 A;  1YJ9 V;  1NR1 A;  2H94 A;  4JYC A;  4F4L A;  1NVP B;  1RPR A;  4QE7 A;  1VQ4 V;  2EIN C;  3ZRW A;  5IDJ A;  2XAJ A;  5B3S C;  3H01 A;  3CCV V;  1SER A;  4PDM A;  1YSC A;  4DXW A;  4MSW C;  4RQF A;  5HFL A;  3STL C;  1DLB A;  1ZWI C;  1Q81 W;  3G4S V;  1JVM A;  4H37 A;  3W7W A;  2EIM B;  1E79 G;  4FMT A;  2DQ0 A;  3AG3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...