5EC1C

Kcsa with v76ester mutation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
102
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 39
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ec1C00
2HVKC 3AG2C 4LP8A 4PA6A 4BW5A 2ITCC 3F5WC 3SYOA 3K0DA 3ZRSA 2QKSA 2X6CA 3E8HA 3F7VC 4JTCB 2Y69C 4J9YB 3OR6C 4PA9A 2Q6AA 2X6BA 4PA3A 4R6ZA 4RUFA 3ASNC 2DYRC 4X8AA 3T1CA 4TWKA 4MVRA 4EKWA 4MS2A 4PDVA 3ZJZA 4GX2A 3UM7A 3RVZA 3E8FA 2QTOA 5CBHA 4H37A 3LNMB 1K4CC 2IH3C 4H33A 4XDJA 1S5HC 3KG2A 3LDCA 4KFMA 4MTFA 3SJQC 3AG1C 3RVYA 3TETA 3E8BA 3GB7C 3OR7C 3SPIA 1R3IC 5B1AC 2BOBC 1KKDA 2EIMC 3JYCA 1OCCC 2EILC 2ITDC 1R3KC 4GX5A 1OCZC 4MVQA 1OCRC 1XL4A 1M56C 4R7CA 4R8CA 3VOUA 2Q69A 2WLNA 4MW8A 4RAIA 2AHZA 4JTDB 2ATKC 3E86A 4PA7A 2R9RB 1R3LC 4LBEC 2KB1A 3LDDA 3EFFK 4MVUA 2ZD9A 3SYPA 2W0FC 1V55C 5EBWC 3K04A 2EIKC 4RUEA 1M57C 4UUJC 5EBMC 3SPHA 3T2MA 1OCOC 2WLHA 1XL6A 3SYAA 2X6AA 5BZBA 3IFXA 3E89A 4HYOA 4J9ZB 4MVSA 5B3SC 3AG3C 2HJFC 5EBLC 4X88A 3SYCA 3UKMA 2DWEC 1G4YB 2Q68A 2Q67A 2YEVA 2EINC 2P7TC 3FB5C 1V54C 3BEHA 4RO2A 3K0GA 3RW0A 2WLLB 4P9OA 5CBFA 2WLLA 2DWDC 2DYSC 4GX0A 4PDMA 3FB8C 3E8GA 1BL8A 4MTGA 3WG7C 3PJSK 4WFFA 3OGCC 3T4ZA 4QNHB 3STLC 4XDKA 2IH1C 1R3JC 4R50A 5EC2C 3LUTB 5KUMA 3SYQA 2AHYA 4G28B 3ABLC 4MTOA 4OXSA 4ZBMA 5B1BC 1JVMA 3HPLC 5CBGA 2WLIB 1ORQC 3ABMC 2WLIA 4LCUC 3OUFA 4JTAB 4XDLA 4I9WA 3AG4C 4MSWC 2K1EA 2HFEC 2BOCC 3TCUA 4DXWA 2A9HA 4CBCA 4MW3A 3F7YC 1J95A 4MVZA 1QLEC 4QE9A 3K08A 2WLMA 4PDRA 4WFHA 5EK0A 3K03A 3X2QC 1P7BA 5IY5C 3FB6C 4WFGA 3E83A 4GX1A 4G27B 2HVJC 4X89A 1LNQA 3FB7C 3SPJA 2EIJC 2A79B 3ASOC 5J9PC 4PA4A 2A0LA 3IGAC 2HG5C 4HZ3A 2JK5C 3K06A 2ZXWC 3T4DA 5EC1C 5KUKA 3RBZA 4WFEA 3STZC 5E1AC 4MVMA 4P2ZA 4PDLA 2OCCC 2NLJC 3ABKC 4P9PA 3OUSA 3SPCA 2H8PC 2WLKA 4F4LA 4MVOA 1K4DC 1ZWIC 3SPGA 4P30A 3LDEA 2WLJA 4QE7A 3R65A
chains in the Genus database with same CATH superfamily
2HVKC 2Q7EA 4WF9V 1DK1A 1S3JA 1TVKB 4NXMB 3F7VC 2RQ6A 4TQDA 4FLXA 2M7WA 2X6BA 1XMQO 1S0VA 1XHZA 4JI3O 3ABLB 1BS3A 5BMVA 1GKFA 4I50A 4QPKA 1XUQA 2Q4PA 4PELA 3LNMB 4H33A 3CMEV 3OR7C 3SPIA 1DTOA 1IBMB 1FXKA 2QKAA 3IJ4A 2B1GA 1HR0B 2IJHA 3KKYA 4UCVA 1IVSA 1FJGO 3RWRD 2R9RB 4B3RO 4LBEC 5HFMA 1W0KG 2AGAA 4LF7O 4NVPA 1GM8A 3OTOO 2P4VA 3C90A 2R70A 5H2FZ 5EBMC 1N34B 4DV2B 2V1DA 1OCRB 3TK1A 2ZQMA 5HFLA 1AR4A 1G4YB 4DR5B 1NU1H 2Q67A 2QM7A 3K0GA 3LSQA 1K97A 2P06A 1BCCH 5D5PA 3ZN0A 3OGCC 4DV6O 3K9AA 3LUTB 2HHHO 1NR1A 5CB4B 1KD1W 4ZIBA 4ZBMA 3H1IH 4JYBA 2R72A 4J10A 5B1NA 1V54B 3HKBB 1H2GA 2N74A 4LCUC 1OCCB 5LA6B 2BCCH 2DQ3A 1N8RW 4CBCA 2JGDB 3E2EA 1ZAUA 3OT7A 3JAKB 2QDOA 4Z1MG 1AP6A 4UCRA 5CN0A 4B7EA 1S76D 4HBNA 1WJZA 2GHYA 1RM1B 4JASA 5J2UB 5JJJB 4UFZA 1Q3EA 3RYIB 4KXRA 2IU0A 5IYCO 3MDSA 3MHSC 3OR6C 2YI9A 1BE3H 4X1KB 5LP6A 4PDVA 2UU9B 3UM7A 4ZOLB 3FAVB 4LF6B 2IJJA 3AG1C 4F6EA 3GWOA 4CH4A 3JYCA 2ITDC 2Y69B 1G6UA 1OCZC 1ZSPA 3ML0A 1TGOA 4KUMA 3ASNB 3BCCH 2KB1A 4MVUA 3UO3A 1AR5A 4LF4B 1Q81W 3D36C 4BR6A 3CYOA 2LFSA 4DV0B 1Q8IA 4B3MO 4GKJB 5H6QA 4YJ3A 5CA1B 3UKMA 4DR2O 4K35A 2DWEC 2LW7A 4FLWA 3T1HO 5KMGA 1TUBA 3QO8A 5LBQA 4D7SA 3B8MA 2UUBB 4DUZO 2XAQA 1M93A 2EJ7A 3THOA 4DV4B 1YJNV 3HKCA 3ICXA 2E76B 5L3GA 4JV5B 3CEIA 1F23A 2ADPA 3G4SV 3B40A 1XDCA 1L8DA 3B4SA 2EJRA 3OGIB 3JD2A 5B1OA 1GTOA 4JI5O 3CJHA 5IT9N 4DR1B 4PA4A 5EYPA 1K33A 5IJ9B 4UCOA 4HZ3A 1Y74B 2EZPA 2JK5C 5FNVA 2CK3G 3M7MX 1Q82W 1HNXO 3U10A 3EHBB 3HKDA 4P2ZA 3BFRA 2WLJA 3JARA 3RFRA 2LFRA 3RN4A 2OT5A 1IBKO 1XILA 1Y76B 2VQFO 1SERA 1SQBH 1HNWO 1K3EA 3JD4A 1GN3A 3DGEA 1YTFB 1BGYH 3ZHQA 1NR7A 5TISZ 2BTQB 3WB1A 3LDCA 2ADQB 1DLBA 2ZE8A 3QO7A 3SJQC 3DTUB 1I5XA 4MVQA 1OCRC 4U3JA 4L8JA 5EZYA 3ETGA 3ZHUA 4JAUA 3H9VA 3HKEA 3CC2V 2AXTZ 5IYZB 2CDYA 2IJIA 4I4TA 2YIBD 2CH7B 1O9HA 1YF2A 2ZCEA 4YIPA 2O57A 4N21A 2E5LB 5B3SC 3AG3C 1WA8B 1M90W 1PL4A 2XAFA 4X62O 2Q68A 1SZTA 3BVOA 1V54C 1N32O 4JAVA 4DR7O 1CEZA 2DYRB 3WB0A 2EIKB 3QO5A 1EN6A 1COWG 5EC2C 1MZFA 2VWKA 3CCRV 2UUCB 3SJBC 2K9PA 5LXTB 5C8YB 1FAFA 4N23A 2V4DA 3HR0A 1T5EA 1RM1C 2A9HA 5KHKA 4OX9O 1GO3F 5IDJA 1YCIA 4FLUA 1XI1A 2ZM6B 1YHQV 1QVGU 2GUZA 3IC7A 3ZRWA 5LHIA 2LP7A 2HVJC 1O9GA 2EIJC 3JAWB 4BIOA 1Q43A 2HG5C 3ABUA 1RPOA 1SS3A 3FYIB 5IJ0B 4LF5B 2M6YA 4JYAO 5IWAB 4Z2WA 5GTHZ 3C3TA 4AI8A 4ZI7A 5LMNB 3K5LA 2Y69C 4R6ZA 1AR1B 2F1MA 3ASNC 4X8AA 1GH6A 3JALB 3OW2U 1VMGA 3EVKA 4X1IB 2AZ2A 2P6JA 1NS1A 3OTFA 2QTOA 2QA4V 4GT1A 3NR7A 4OGQB 3B2EE 4FVMA 1YXBA 2W6IG 3SJCC 2ZKOA 2Y48A 2XT9A 2F93B 4MW8A 2JVDA 4UCTA 4DK0A 4HNAA 2QJ1A 2DW4A 4U3FH 1CPYA 5LMUB 3ZHRA 3Q4HB 5KAIZ 3J80N 4RUEA 2VQEO 4ZHQB 3FX7A 1U97A 1XL6A 3IFXA 2F66C 3J81N 3BAAA 3CRMA 2QEXV 1M56B 4FFKA 1PM9A 2F4VB 3BEHA 2QWPB 3KCYA 1N36O 2BSKB 2HLDG 4IHJB 1K8AW 3G6BA 2YIBA 1YJ9V 5JCOA 4KHPO 3T1YB 2QKCA 1ROPA 1PNKA 2HEPA 3EXAA 1EFRG 1MMMA 3OUFA 4I0XB 1DF4A 4B7KA 3TXQA 1LR1A 3N2KA 4EFEA 3F7YC 1R6KA 4WFHA 5CA0B 5H9CA 1Q5OA 4J7KA 3K59A 5KX5A 3UT5B 3VQYA 4UB8Z 1NH2B 1B06A 3T4DA 2AZ0A 3AG4B 4FM1A 2IBZH 2EX3A 5FPRA 3SPCA 3CXHF 4DV1B 3AK3A 2ARHA 4AQYB 2LJ2A 4PA6A 3CRCA 5JJEB 2CTRA 3K0DA 5KHIA 2QKSA 2XUMA 4J41A 4EEQA 4BIZA 2LW1A 4J9YB 4DR3O 4IIJB 4FFBB 1WB8A 1W59A 4LFCO 4K0KB 3E8FA 3BRCA 1FKAO 1IBLO 3AG2B 3KG2A 4LFAB 3E8BA 2ZE5A 1QR8A 4X20A 2WLNA 1IX9A 4QIWF 1NTMH 3E86A 3ZRVA 4Q6GA 4BAYA 4EB6A 4JI6O 4FJCC 2EIKC 4O4HA 2B9ZA 3UQ8A 1Z2GA 2EILB 2QWQB 3E89A 4I7ZB 1W2BU 4X88A 3ETEA 5KHJA 4O2AA 2NNUA 1URFA 4GKKO 1NVPD 3IAYA 3OMIB 4GZRB 3GVMA 1MABG 4F6RB 4GLXA 2KG7A 1SA0A 1R3JC 3MD0A 4O4LB 3RYFB 2B5UA 1G1XB 4JI7B 3L73H 5BR8O 4B3TB 2WA3A 4O2BA 4UVBA 4YY3O 2CAZC 3TCUA 5JVDB 2ZINA 3P3NA 3B09A 4FZ0A 3RYHA 4JF3A 1OV9A 4WFGA 3E83A 3MHHC 2Q0OC 1J5EO 4X89A 1JQ0A 1LNQA 3SPJA 3WU2Z 1S5JA 5BMVB 4OPAA 3H1JH 5J9PC 2W6JG 3CRAA 4LR3A 5KUKA 4WFAV 2QWRB 2Z0AA 4DV7O 5L3DA 4NYKA 4PDLA 4P9PA 3OE7G 4RQEA 3OUSA 4MVOA 1P84F 4GUNA 3SPGA 3LDEA 2X7RB 4JI2B 2B1IA 2KKWA 2GTAA 2CGNA 3ASOB 1IXBA 2UXCB 4PA9A 1W0JG 3T1CA 1XNRB 5JWPA 2ZE6A 4IYIA 1RSOA 2BTOA 4H37A 2IH3C 3TETA 3ABTA 5BXZA 4R7CA 1GAXA 1AROP 1M56C 4TSFG 2QM8A 4B3SO 5DEDA 3ZBHA 4IGGA 4JGSA 5B5EZ 1BQ0A 1XBLA 1YIJV 2A06H 1XMOB 4LFBO 1M4UA 3LSSA 3UCSC 3T2MA 1KECA 2UUAB 3CC4V 1Y67A 4HYOA 2GDSA 1GK9A 2YEVB 1KMIZ 2P7TC 4P9OA 4WBNB 1AJQA 4JI1O 4YJ2A 1M57B 2E74B 1QQCA 3A0BZ 1DGSA 2JEXA 3B77A 5ITZB 4FM2A 1AILA 2UXBO 4JI4B 3F5TA 4U7NA 3CRRA 4TUYA 1VP7A 1YSCA 3AG4C 5JQGA 2RN9A 2YXHA 4JZGA 1MZEA 3OM3B 3X2QC 5IY5C 4D6TH 4XBFA 2P90A 1XMQB 4JI3B 1EM1A 1P49A 3ZX6A 5B3SB 3AG3B 1SRYA 4I55A 1R1BA 1Q7YW 1K4DC 2D2CB 2Q9LA 4QE7A 3AG2C 2EULA 1TVKA 3D3IA 1KC8W 3P3PA 1FJGB 1JX9A 4B3RB 4LF7B 1BT8A 4MS2A 1GM9A 1MG1A 3H1HH 3OTOB 3ZHVA 1OZ0A 4DRXA 1WNSA 3RVYA 4JI0O 2ZR2A 4ASUG 4MTXA 1TUBB 1YITV 2EILC 3APOA 2EBOA 2R9IA 2EIJB 1HW7A 1NTKH 1GM7A 4X64O 3HKCB 3CPWU 1JPXA 3DC6A 4DV6B 5L3FA 1LUVA 4PI2A 1QNMA 2HHHB 1JA8A 1DF5A 1QBZA 2YUAA 2EIMB 3H01A 1B6QA 5EBLC 3RGBA 2DMXA 2PZSA 3UO2A 1SESA 2QTSA 1NKDA 2WLLB 1VF5B 1V55B 1EZJA 4O4IB 1BL8A 4NTYA 3L75H 3CCVV 4ABMA 3DXRB 4FK5C 1XQ8A 4QNHB 4O4JB 1VQ4V 1OCOB 3OMAB 1KBHA 1TUEB 4UV8A 5CB4A 1JFFB 5B1BC 4LC1A 2WLIB 1E79G 3HKBA 5GTIZ 2F23A 1WN7A 1Q86W 1MOFA 3LSUA 4NTWA 2JGDA 2QR4A 1FXKC 4X1YB 4UV9A 5LYJA 3N27A 3ASOC 2ZE7A 2P67A 1Q6HA 1N4CA 1YTFD 1H2SB 1SQQH 1BSMA 4DR6O 2RCVA 2KSDA 2Q0AA 5J2UA 5K1PA 4CC5A 1K34A 4P30A 1VF7A 1Y4MA 3AK1A 5EZYB 4LP8A 3RYIA 2PUSA 4X66O 3F5WC 3LNNA 5D5QA 4LH6A 2BE3A 4DUYO 4EKWA 4JI8O 4X1KA 3ABKB 4NB5A 4ZOLA 1I94O 3S3XA 3FAVA 1FXHA 4B3MB 4DR2B 4IYHA 1R3KC 4L87A 4UXNA 3T1HB 4RAIA 1JJ2U 4IL6Z 4DUZB 3EFFK 4PJ0Z 1UJWB 4DK1A 1M57C 1YDXA 1NI8A 3K57A 3L70H 5CA1A 2HJFC 4NXNO 3DSQA 3CCUV 1YI2V 3RW0A 3FB5C 5EIBC 1N33O 1I7FA 3ZMSA 3ZRWB 4TQFA 3K5MA 1AP5A 4JI5B 3E8GA 5IE9A 3ZMZA 3PJSK 3ZS8C 5AG2A 3STLC 2YS8A 2QWOB 4R50A 1VQMV 2OTLV 2X0LA 2AHYA 5LP6C 4LNUA 5C93A 3ETQA 4OXSA 5JJNB 2IW5A 4TT3G 1ORQC 5KHGA 1KP3A 1HNXB 4PV1B 4I9WA 3CCMV 1J95A 3CCLV 1M9NA 3WG7B 1IBKB 2IU3A 3A8TA 2QSAA 4TOIA 5DN6G 2VQFB 1FPOA 5FL7G 3FB7C 1HNWB 2N04A 2L6LA 3BA8A 1KB9F 2QE7G 1S72V 2NLJC 1EN4A 5KLVH 2H8PC 3CCSV 1AB3A 3A0HZ 1Q6UA 4BW5A 4CS3A 1XNQO 1EBOA 1Y76A 1VQ6V 2FMLA 2PYJA 4FLTA 4FZ1A 3CCEV 4FIPC 4Z1VA 2DQ0A 4HAMA 1GN4A 1R73A 4MTFA 2GSMB 1BMFG 2CTQA 1PP9H 2L35A 2EIMC 4X62B 3BHPA 3BPZA 1S5LZ 1N32B 3RYCA 4DR7B 4CH3A 3E22B 3RT3C 3G6EV 5IYZA 1V55C 4JAAA 3CHXA 2CH7A 1VQPV 4LF8O 4LH7A 1OCOC 5BZBA 1BHAA 3TJTA 1SKVA 3TGUH 2UXNA 1H8HG 4K3AA 3SDLA 2HJDA 2GBOA 1N0NA 4OX9B 2RMKB 2LQTA 4W4KA 1SQPH 3ZHTA 4MTGA 1H2NA 3D8CA 1U96A 2P4KA 2Q7GA 4TV9B 3H1KH 5KUMA 1NH2D 2Q73A 2FL4A 3CS5A 4GCZA 2EINB 5J2TA 2JRIA 2XNDG 5FPOA 3BABA 4XDLA 2QM4A 1HNZO 2MW2B 4DXWA 3QG5A 4JYAB 2AW9A 1F51A 2IJKA 1HWYA 2C2AA 3JASB 3ETDA 5LHHA 4TV8B 1FYJA 1R6TA 3JAWA 4LF9O 3IGAC 1GMGA 3R66A 2WAMA 4YHHO 5E1AC 5LOVB 3CCQV 5IJ0A 4MVMA 3ABKC 2WLKA 4F4LA 3W7SA 4J80A 3O65A 2PF4E 4X65O 4NTXA 1KYOF 4JTCB 4EB6B 1XHXA 1BZKA 3JALA 4NR1A 4TWKA 4FLZA 4O4HB 5JH7A 5LHGA 2CGOA 4X1IA 4MT8A 2JJ2G 2JGUA 5KA5A 2VQEB 1VQ5V 1FFXA 4KFMA 4FLVA 3JATA 1R3IC 2ZNJA 5B1AC 3C3SA 1KKDA 3CRQA 3X2QB 1XL4A 5IY5B 4LWSB 2Q69A 4JTDB 1ZL8B 4CS2A 3K9SA 3JSNA 4DV3O 1N36B 1FS0G 3SYPA 3Q4HA 3W7UA 3ZEDA 4UUJC 4DR4O 4KHPB 4ZHQA 3SPHA 4J42A 2OIEA 1SQGA 2ZR3A 2LGWA 3N2GB 1L1FA 2CUGA 3RYHB 2Q5ZA 1VQ9V 1EZVH 5GONB 1XEQA 4I5SA 3I5DA 1VF6C 4IHJA 3WG7C 4E2LA 2OWOA 1AJPA 4XDKA 2YXLA 1NTZH 4YIOA 1S77D 2Q8VA 5LL6Y 2JIZG 4I0XA 4J11A 2HFEC 2BOCC 4AILC 1ENVA 2OIGA 4DV5O 4QE9A 2UXDO 5CA0A 2ZIMA 2ZIOA 2LO1A 3K03A 4G2KA 3CD6V 3WB2A 2A7WA 5DM6V 4DR3B 2A0LA 1V9PA 4LFCB 5H6RA 5CMUA 2YIDA 3CCJV 2E3CA 1ZLZA 1NJIW 2OCHA 1IBLB 2DOSA 3W7TA 3R65A 3B8NA 2JS3A 3E8HA 1OHHG 4RQFA 2YSUB 1SQVH 4IT5A 1KP2A 4IIJA 4FFBA 4I50B 5B1BB 4JI6B 1D5AA 5E79Z 1VQKV 2A3QA 3CXCU 3FD9A 3OEHG 1FXKB 1SQFA 4PD4F 2F43G 1VARA 4NXMO 4R8CA 3VOUA 4GKKB 1GRJA 4PA7A 3L9DA 4NKGB 1K7DA 2Z5UA 1TAEA 1WP7A 3JD0A 1NT2B 2Q7HA 2Y0PA 3QTCA 3ZRXA 5BR8B 3U0ZA 4C7UA 1IBMO 4JYYA 1AVMA 3JD1A 5JQGB 2YICA 1UFIA 2EINC 4YY3B 5FLXN 1HR0O 4AHCA 2QWNB 4U7OA 3PN1A 3T4ZA 4D7TA 1J5EB 3I55V 4O4LA 3RYFA 1ZTEA 1Y6XA 1VQLV 1N34O 3E35A 4DV2O 3CSXA 3CX5F 4I55B 4B08A 4DV7B 4DR5O 1BHBA 4MSWC 3ZMTA 1MSDA 5JVDA 1HP8A 1PV0A 1Q90D 2N05A 1KU9A 3D36A 5A9GA 2OTJV 3VQWA 1SC5B 4DRXB 2PY5A 3QVNA 2FKXA 1UPGA 1Y66A 2ZDIC 2ITCC 5IYBO 1THZA 5L3CA 4YXWG 3K5OA 3QNEA 2Q6AA 4PA3A 4B3SB 4UCUA 5LP6B 3K5NA 2OCCB 3W7XA 5CBHA 4LFBB 1VQOV 4UB6Z 1K9MW 3JAMN 1CP9A 3FYEB 1FXVA 2BOBC 3L74H 4QJFB 5LGNA 3A0RA 4J7ZA 4FMTA 3FKSG 4JI1B 1IDSA 2W0XA 4H44B 5F2VO 5EBWC 1WP8A 2UU9O 2R9AA 4DW0A 1WAZA 4LF6O 1WLEA 3SYAA 4J9ZB 4YJ3B 4MVSA 1E1QG 2RJZA 2UXBB 1YVWA 2YEVA 5KMGB 3JD3A 1QVFU 4WBNA 5LYJB 1B04A 5K1XA 3GWKC 3CC7V 1L0LH 3MAQA 4LF4O 4A5UB 3SYQA 4E4EA 4DV0O 4JZ2A 2JDIG 4GKJO 1VEWA 2KQXA 5ITZA 1D5NA 3H1LH 4UVAA 2PI5A 1AI7A 2K1EA 4MW3A 4MVZA 2UUBO 3K08A 1PKXA 4PDRA 1SZXA 5EK0A 1F4NA 5BY1A 1P7BA 3CJHB 4GX1A 4G27B 2LGQA 4H0LB 4DV4O 1JMKC 2GTSA 5EYPB 3CP1A 2GV9A 5FNVB 1JR9A 2XAGA 4WFEA 3CWBH 4FLYA 4JV5O 3HKDB 2HR3A 5KA6A 3JARB 1N0JA 4JI0B 5LA6A 1YZBA 4BWAA 1FD9A 4RWUA 1YJWV 3ZMVA 4UCSA 3SYOA 2Y4TA 3JAKA 4DR1O 2H3OA 4X64B 5H5NA 3J7AU 4PHZA 3W7WA 1IZ3A 1VQ7V 1AI5A 1BQZA 2OYQA 4FM0A 2E75B 1S5HC 2XHBA 2P22C 3M99B 2ZT9B 3G80A 1IURA 4U3JB 4CC6A 2AHZA 4ZKIA 3HKEB 3JCUZ 1IXMA 3OFNG 3LDDA 4I4TB 4UVCA 3K04A 4LNUB 1H38A 1KUQA 1F4MA 2YIAA 3VQXA 1JCHA 1AJNA 1MSWD 2WLLA 2DYSC 4GX0A 2MK3A 1GN2A 2FYUH 1CXZB 4O4IA 2XASA 2CTPA 3G71V 3DXRA 4CS4A 4O4JA 1A32A 3CE2A 1X59A 4OPHA 3ABLC 1JFFA 3VBBA 2E5LO 1JVMA 5CBGA 2UXXA 5B1AB 2WLIA 1WPXA 3OAAG 3U11A 4DR6B 1HDJA 2P5OA 5LGUA 5DECA 1I0HA 4K8XA 1YEWA 2GUZB 4X1YA 4X66B 1MA1A 2Z3YA 4BW9A 4DUYB 2UUCO 3ABMB 2YC0A 4JI8B 3P32A 2OCCC 1I94B 4KL1A 1I08A 4FPPA 1H2LA 2FB5A 1KKCA 2ZM6O 1F7YA 3RYCB 4ZI7B 2X6CA 1GN6A 2RDCA 3OMNB 2XTAA 2ETNA 3K58A 2H94A 2PYLA 3ZJZA 5IJ9A 1B3QA 1Y74A 1K4CC 2Y0IA 2NR5A 4LF5O 4CZZA 2JJ1G 5IWAO 4NXNB 2YXYA 3FFQA 3SR2C 1OCCC 3VQVA 5LMNO 2CTWA 1PL0A 1N33B 2ATKC 4HNAB 1R3LC 1G8MA 2WPDG 1K5QA 2ZD9A 3L71H 1RPRA 1VQNV 4DO2A 2D3OW 5J2TB 3P30A 3O9OA 2BTQA 2X6AA 1M5IA 2ILMA 4QGPA 3ZHSA 1D2DA 1JJOA 5LMUO 4WFFA 1PNMA 1QU7A 4JYCA 3NXSA 4G28B 4W4LA 1I5YA 2F4VO 2RNBA 1LUWA 1WA8A 3N2KB 2VRZA 1H8EG 1PD3A 1VF6A 1NZ6A 1XNQB 5KHHA 5KX5B 3M8AA 5IYDO 2V7QG 3JSLA 2EZOA 2A79B 5JH7B 1TA8A 3T1YO 2WSSG 1H2KA 3K06A 3K79A 5EC1C 1QHTA 4BIUA 1FFXB 1SQXH 3ZN1A 3TXSA 2YI8A 2WA4A 3OD4A 5C8YA 5LXTA 1QLEB 3JATB 1ZWIC 4CH5A 1P7GA 3AK2A 5L3EA 4WCEV 4GYCB 3WFVA 4KP4A 1VQ8V 2ZXWB 5L3BA 3JCZA 4H13B 4DYLA 1Z5VA 2VS0A 1QCEA 4MVRA 2HP8A 3RVZA 3CMAV 4XDJA 3APQA 4LF8B 2HKOA 1AI6A 3G67A 4DV1O 3GB7C 4AQYO 2DE0X 1ZX3A 3BY6A 5CA3A 4X20B 4GX5A 3DC5A 4ICGA 1WPBA 2NN4A 3A2FA 3E22A 3BA9A 2JEUA 4K0KO 1QLNA 1US6A 2ODMA 3KZIZ 1OJHA 2WLHA 4LFAO 1ZUQA 3K3WA 3OEEG 4O2AB 1HNZB 5CBFA 2DWDC 2XOKG 1AI4A 1PNLA 3S3WA 2WWWA 2KG7B 1SA0B 4JPRA 4TV9A 4LF9B 3HB3B 3QF7A 4MTOA 4K8ZA 4YHHB 3ABMC 4O2BB 1M1KW 2VWJA 2WLMA 4X65B 3JASA 3FB6C 4I9QA 2BSKA 1P4RA 4TV8A 1NQTA 4JI7O 2Y4UA 2QGNA 4B3TO 2DJVA 1H2MA 5LOVA 1MNGA 1Q6IA 4J7JA 2G38A 3ZRSA 1KQSU 5KAFZ 4RUFA 3UT5A 4DV3B 2DYRC 1L0NH 3KCXA 4PI0A 4GX2A 1RSOB 5B66Z 4DR4B 4CH6A 3SGIA 4JI2O 2ZDIA 2JS5A 1NBMG 4LWSA 2UXCO 1RP3B 5LGTA 1ZL8A 1SETA 4X9QA 1XNRO 5A2QN 4EFBA 2W0FC 3D3QA 3AG7A 2XAJA 4Q20A 1K73W 2XAHA 3AG1B 5JCOC 2PGGA 2YDEA 4DW1A 1OCZB 3SYCA 3ZMUA 1PPJH 2FTKA 3ZIAG 3IC9A 3N2GA 4RO2A 4PDMA 2PTMA 1VIBA 4DV5B 3AEIA 1QR9A 3FB8C 5GONA 4YJ2B 2UXDB 1K5SA 3SJAC 3L72H 1XOUA 1R6NA 4QPJA 3ZCCA 2IH1C 1XMOO 2UUAO 2PI4A 3HPLC 1FFTB 1WB7A 4JTAB 4TUYB 5EIBD 3I56V 2IM9A 1EN5A 1NVPB 1QLEC 1JOYA 5GW7A 3CB2A 1Z5WA 1X4TA 2F95B 4WFBV 1K92A 4F6RA 2ZXWC 3STZC 4JI4O 1XREA 2CE4A 2ZNIA 2DN9A 1SF9A 2DYSB 3RBZA 1E1RG 1RFYA
chains in the Genus database with same CATH topology
2HVKC 1YJWV 3ZMVA 4PA6A 4BW5A 4WF9V 1EBOA 3SYOA 3K0DA 1S3JA 2QKSA 1VQ6V 3F7VC 4BIZA 4J9YB 2M7WA 2X6BA 1S0VA 3ABLB 3CCEV 1GKFA 4FIPC 4QPKA 3W7WA 1VQ7V 1AI5A 3E8FA 4PELA 2DQ0A 3LNMB 4HAMA 4H33A 3AG2B 1S5HC 1R73A 3KG2A 3CMEV 4MTFA 2GSMB 1BMFG 3E8BA 3M99B 3OR7C 3SPIA 1DTOA 1FXKA 1QR8A 2EIMC 2WLNA 2B1GA 2AHZA 2IJHA 4QIWF 3E86A 4ZKIA 2R9RB 4LBEC 3ZRVA 5HFMA 1W0KG 1IXMA 3OFNG 3LDDA 4BAYA 3G6EV 1V55C 4UVCA 1GM8A 3K04A 2EIKC 4FJCC 1VQPV 1H38A 5EBMC 1F4MA 1OCOC 5BZBA 1BHAA 2EILB 3E89A 1JCHA 2V1DA 1W2BU 1OCRB 2UXNA 4X88A 1H8HG 2ZQMA 5HFLA 3TK1A 1G4YB 3ETEA 2Q67A 1AJNA 2NNUA 2QM7A 1MSWD 3K0GA 3LSQA 2WLLA 2DYSC 4GX0A 2MK3A 1NVPD 3OMIB 1K97A 4MTGA 1MABG 3ZN0A 2XASA 3OGCC 3G71V 3MD0A 1R3JC 2B5UA 3K9AA 3LUTB 5KUMA 1NH2D 1NR1A 1KD1W 3ABLC 4GCZA 4ZBMA 3VBBA 1JVMA 4JYBA 2EINB 5CBGA 1V54B 2UXXA 5B1AB 2WLIA 5B1NA 1H2GA 2XNDG 4LCUC 1WPXA 1OCCB 3OAAG 4UVBA 4XDLA 3TCUA 2DQ3A 4DXWA 5LGUA 4CBCA 1N8RW 3E2EA 1F51A 2IJKA 1HWYA 2C2AA 4Z1MG 4JF3A 4WFGA 3E83A 3ETDA 3MHHC 5LHHA 4X89A 1JQ0A 1LNQA 5CN0A 3SPJA 2Z3YA 5J9PC 3IGAC 2W6JG 3ABMB 1S76D 1GMGA 2GHYA 5KUKA 2WAMA 4WFAV 1RM1B 5E1AC 3P32A 3CCQV 4MVMA 4PDLA 5L3DA 2OCCC 3ABKC 3OE7G 4JASA 4P9PA 3OUSA 4RQEA 2WLKA 4FPPA 4F4LA 4MVOA 3W7SA 3SPGA 3LDEA 2X7RB 2B1IA 2IU0A 5IYCO 2X6CA 3ASOB 3MHSC 4JTCB 4PA9A 3OR6C 3OMNB 1W0JG 3T1CA 4TWKA 2H94A 5LHGA 4PDVA 3ZJZA 3UM7A 4MT8A 2JJ2G 5KA5A 4H37A 1K4CC 2IH3C 1VQ5V 4KFMA 2IJJA 3TETA 3AG1C 4CZZA 2JJ1G 1R3IC 3ABTA 3GWOA 5B1AC 1KKDA 3JYCA 1OCCC 2ITDC 2Y69B 4R7CA 1OCZC 3X2QB 3ML0A 1AROP 1M56C 1XL4A 4KUMA 5IY5B 2Q69A 1PL0A 3ASNB 4JTDB 4TSFG 2ATKC 2QM8A 1R3LC 1G8MA 2WPDG 2KB1A 1K5QA 4MVUA 1FS0G 4JGSA 2ZD9A 3SYPA 3W7UA 1YIJV 1RPRA 1VQNV 4DO2A 4UUJC 2D3OW 1Q81W 3CYOA 3LSSA 3T2MA 3SPHA 2LFSA 3P30A 1KECA 2X6AA 3CC4V 5H6QA 4HYOA 1GK9A 2ZR3A 3UKMA 1L1FA 2DWEC 2YEVB 2P7TC 4P9OA 3QO8A 5LBQA 1AJQA 1VQ9V 3B8MA 1M57B 2XAQA 4I5SA 3WG7C 4WFFA 1PNMA 4E2LA 1AJPA 4XDKA 1YJNV 2JEXA 4JYCA 3NXSA 4G28B 1S77D 3B77A 5L3GA 1I5YA 1F23A 4U7NA 2JIZG 3G4SV 1YSCA 3AG4C 2HFEC 2BOCC 1ENVA 2EJRA 1H8EG 3JD2A 4QE9A 5B1OA 1GTOA 1PD3A 3OM3B 3K03A 4G2KA 3X2QC 3CD6V 5IY5C 5IYDO 2V7QG 4XBFA 5DM6V 2P90A 2EZOA 2A79B 4PA4A 1K33A 2A0LA 2WSSG 4HZ3A 2EZPA 2JK5C 3K06A 2CK3G 3K79A 5EC1C 5H6RA 5B3SB 3AG3B 5CMUA 4BIUA 3CCJV 1Q82W 3ZN1A 3EHBB 4P2ZA 1SRYA 1NJIW 1Q7YW 1QLEB 1K4DC 1ZWIC 3W7TA 2WLJA 4QE7A 3R65A 2LFRA 3AG2C 3B8NA 2OT5A 5L3EA 1SERA 4WCEV 3E8HA 3WFVA 3D3IA 4KP4A 1OHHG 1KC8W 1K3EA 1JX9A 2ZXWB 2YSUB 3JD4A 4RQFA 5L3BA 3JCZA 1VQ8V 1KP2A 3DGEA 1QCEA 4MVRA 4MS2A 1GM9A 5B1BB 1MG1A 1YTFB 3RVZA 1NR7A 3CMAV 1OZ0A 4XDJA 1VQKV 3CXCU 3LDCA 2HKOA 1DLBA 3QO7A 3SJQC 1AI6A 3DTUB 3RVYA 2ZR2A 3GB7C 3OEHG 1FXKB 4MTXA 4ASUG 3BY6A 5CA3A 1YITV 2EILC 1I5XA 2F43G 4GX5A 4MVQA 1OCRC 4R8CA 3ETGA 2EBOA 3VOUA 2R9IA 4JAUA 2EIJB 4PA7A 1K7DA 2Z5UA 1GM7A 3CC2V 2JEUA 3CPWU 1JPXA 2IJIA 1QLNA 3JD0A 5L3FA 3ZRXA 1DF5A 2WLHA 1QBZA 2EIMB 3H01A 4N21A 1B6QA 3K3WA 5B3SC 3AG3C 3JD1A 3OEEG 5EBLC 1M90W 2XAFA 2Q68A 1SZTA 1SESA 2EINC 1V54C 1NKDA 2WLLB 5CBFA 4JAVA 2DWDC 2XOKG 1AI4A 1V55B 2DYRB 1PNLA 1CEZA 1EZJA 2EIKB 1BL8A 3QO5A 2WWWA 3CCVV 4U7OA 1COWG 4FK5C 3T4ZA 4QNHB 3I55V 4JPRA 1VQ4V 1OCOB 5EC2C 1VQLV 3OMAB 3E35A 3HB3B 1TUEB 4UV8A 3CCRV 4MTOA 5B1BC 4LC1A 2WLIB 3ABMC 1E79G 1M1KW 4N23A 1BHBA 4MSWC 1RM1C 1Q86W 2A9HA 1MOFA 3ZMTA 1GO3F 5IDJA 1FXKC 2WLMA 1YHQV 1QVGU 4UV9A 3IC7A 3ZRWA 5LHIA 2LP7A 3FB6C 2HVJC 1P4RA 2EIJC 3ASOC 3D36A 1NQTA 2HG5C 2OTJV 3ABUA 2P67A 1RPOA 1YTFD 3FYIB 1K34A 4P30A 1Y4MA 1Y66A 4LP8A 2ZDIC 2ITCC 5IYBO 3F5WC 1THZA 3ZRSA 5L3CA 4YXWG 1KQSU 3QNEA 2Y69C 2Q6AA 4PA3A 4R6ZA 1AR1B 4RUFA 3ASNC 2DYRC 4X8AA 3OW2U 4EKWA 2OCCB 3ABKB 4GX2A 2P6JA 3W7XA 2QTOA 5CBHA 2QA4V 1VQOV 4GT1A 1FXHA 2ZDIA 1K9MW 1CP9A 3FYEB 2W6IG 1FXVA 2BOBC 2Y48A 4QJFB 1NBMG 1R3KC 5LGNA 3A0RA 4L87A 4UXNA 4MW8A 4RAIA 1JJ2U 4FMTA 3FKSG 5LGTA 2DW4A 1SETA 1CPYA 3EFFK 2W0FC 5EBWC 1UJWB 4RUEA 2XAJA 1M57C 4Q20A 1K73W 2XAHA 3AG1B 1WLEA 1XL6A 3SYAA 3IFXA 4J9ZB 4MVSA 2QEXV 1OCZB 3SYCA 2HJFC 1M56B 3ZMUA 2FTKA 3CCUV 1E1QG 3ZIAG 1YI2V 2YEVA 3RW0A 3FB5C 4RO2A 3BEHA 3JD3A 1QVFU 4PDMA 3ZMSA 3ZRWB 3AEIA 1QR9A 3FB8C 1K5SA 3E8GA 3CC7V 2HLDG 3ZMZA 3PJSK 1K8AW 3STLC 1R6NA 4QPJA 3ZCCA 2IH1C 4R50A 1YJ9V 1VQMV 2OTLV 3SYQA 2X0LA 2AHYA 2JDIG 1ROPA 1PNKA 5C93A 2PI4A 4OXSA 2IW5A 3HPLC 1FFTB 1ORQC 4TT3G 1KP3A 1EFRG 4UVAA 3OUFA 2PI5A 4JTAB 1DF4A 4I9WA 3I56V 1AI7A 2K1EA 3CCMV 4MW3A 1NVPB 3F7YC 1J95A 1R6KA 4MVZA 3CCLV 1M9NA 1QLEC 3WG7B 3K08A 1PKXA 4PDRA 4WFHA 2IU3A 5EK0A 5H9CA 1JOYA 1F4NA 5GW7A 5DN6G 1P7BA 5FL7G 4GX1A 4G27B 3FB7C 4WFBV 1K92A 3CP1A 1NH2B 2QE7G 2ZXWC 3T4DA 2XAGA 4WFEA 3AG4B 3STZC 1S72V 2NLJC 3SPCA 2H8PC 2HR3A 3CCSV 2DYSB 5KA6A 3RBZA 1E1RG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVK C;  3AG2 C;  4LP8 A;  4PA6 A;  4BW5 A;  2ITC C;  3F5W C;  3SYO A;  3K0D A;  3ZRS A;  2QKS A;  2X6C A;  3E8H A;  3F7V C;  4JTC B;  2Y69 C;  4J9Y B;  3OR6 C;  4PA9 A;  2Q6A A;  2X6B A;  4PA3 A;  4R6Z A;  4RUF A;  3ASN C;  2DYR C;  4X8A A;  3T1C A;  4TWK A;  4MVR A;  4EKW A;  4MS2 A;  4PDV A;  3ZJZ A;  4GX2 A;  3UM7 A;  3RVZ A;  3E8F A;  2QTO A;  5CBH A;  4H37 A;  3LNM B;  1K4C C;  2IH3 C;  4H33 A;  4XDJ A;  1S5H C;  3KG2 A;  3LDC A;  4KFM A;  4MTF A;  3SJQ C;  3AG1 C;  3RVY A;  3TET A;  3E8B A;  3GB7 C;  3OR7 C;  3SPI A;  1R3I C;  5B1A C;  2BOB C;  1KKD A;  2EIM C;  3JYC A;  1OCC C;  2EIL C;  2ITD C;  1R3K C;  4GX5 A;  1OCZ C;  4MVQ A;  1OCR C;  1XL4 A;  1M56 C;  4R7C A;  4R8C A;  3VOU A;  2Q69 A;  2WLN A;  4MW8 A;  4RAI A;  2AHZ A;  4JTD B;  2ATK C;  3E86 A;  4PA7 A;  2R9R B;  1R3L C;  4LBE C;  2KB1 A;  3LDD A;  3EFF K;  4MVU A;  2ZD9 A;  3SYP A;  2W0F C;  1V55 C;  5EBW C;  3K04 A;  2EIK C;  4RUE A;  1M57 C;  4UUJ C;  5EBM C;  3SPH A;  3T2M A;  1OCO C;  2WLH A;  1XL6 A;  3SYA A;  2X6A A;  5BZB A;  3IFX A;  3E89 A;  4HYO A;  4J9Z B;  4MVS A;  5B3S C;  3AG3 C;  2HJF C;  5EBL C;  4X88 A;  3SYC A;  3UKM A;  2DWE C;  1G4Y B;  2Q68 A;  2Q67 A;  2YEV A;  2EIN C;  2P7T C;  3FB5 C;  1V54 C;  3BEH A;  4RO2 A;  3K0G A;  3RW0 A;  2WLL B;  4P9O A;  5CBF A;  2WLL A;  2DWD C;  2DYS C;  4GX0 A;  4PDM A;  3FB8 C;  3E8G A;  1BL8 A;  4MTG A;  3WG7 C;  3PJS K;  4WFF A;  3OGC C;  3T4Z A;  4QNH B;  3STL C;  4XDK A;  2IH1 C;  1R3J C;  4R50 A;  5EC2 C;  3LUT B;  5KUM A;  3SYQ A;  2AHY A;  4G28 B;  3ABL C;  4MTO A;  4OXS A;  4ZBM A;  5B1B C;  1JVM A;  3HPL C;  5CBG A;  2WLI B;  1ORQ C;  3ABM C;  2WLI A;  4LCU C;  3OUF A;  4JTA B;  4XDL A;  4I9W A;  3AG4 C;  4MSW C;  2K1E A;  2HFE C;  2BOC C;  3TCU A;  4DXW A;  2A9H A;  4CBC A;  4MW3 A;  3F7Y C;  1J95 A;  4MVZ A;  1QLE C;  4QE9 A;  3K08 A;  2WLM A;  4PDR A;  4WFH A;  5EK0 A;  3K03 A;  3X2Q C;  1P7B A;  5IY5 C;  3FB6 C;  4WFG A;  3E83 A;  4GX1 A;  4G27 B;  2HVJ C;  4X89 A;  1LNQ A;  3FB7 C;  3SPJ A;  2EIJ C;  2A79 B;  3ASO C;  5J9P C;  4PA4 A;  2A0L A;  3IGA C;  2HG5 C;  4HZ3 A;  2JK5 C;  3K06 A;  2ZXW C;  3T4D A;  5EC1 C;  5KUK A;  3RBZ A;  4WFE A;  3STZ C;  5E1A C;  4MVM A;  4P2Z A;  4PDL A;  2OCC C;  2NLJ C;  3ABK C;  4P9P A;  3OUS A;  3SPC A;  2H8P C;  2WLK A;  4F4L A;  4MVO A;  1K4D C;  1ZWI C;  3SPG A;  4P30 A;  3LDE A;  2WLJ A;  4QE7 A;  3R65 A; 
#chains in the Genus database with same CATH topology
 2HVK C;  2Q7E A;  4WF9 V;  1DK1 A;  1S3J A;  1TVK B;  4NXM B;  3F7V C;  2RQ6 A;  4TQD A;  4FLX A;  2M7W A;  2X6B A;  1XMQ O;  1S0V A;  1XHZ A;  4JI3 O;  3ABL B;  1BS3 A;  5BMV A;  1GKF A;  4I50 A;  4QPK A;  1XUQ A;  2Q4P A;  4PEL A;  3LNM B;  4H33 A;  3CME V;  3OR7 C;  3SPI A;  1DTO A;  1IBM B;  1FXK A;  2QKA A;  3IJ4 A;  2B1G A;  1HR0 B;  2IJH A;  3KKY A;  4UCV A;  1IVS A;  1FJG O;  3RWR D;  2R9R B;  4B3R O;  4LBE C;  5HFM A;  1W0K G;  2AGA A;  4LF7 O;  4NVP A;  1GM8 A;  3OTO O;  2P4V A;  3C90 A;  2R70 A;  5H2F Z;  5EBM C;  1N34 B;  4DV2 B;  2V1D A;  1OCR B;  3TK1 A;  2ZQM A;  5HFL A;  1AR4 A;  1G4Y B;  4DR5 B;  1NU1 H;  2Q67 A;  2QM7 A;  3K0G A;  3LSQ A;  1K97 A;  2P06 A;  1BCC H;  5D5P A;  3ZN0 A;  3OGC C;  4DV6 O;  3K9A A;  3LUT B;  2HHH O;  1NR1 A;  5CB4 B;  1KD1 W;  4ZIB A;  4ZBM A;  3H1I H;  4JYB A;  2R72 A;  4J10 A;  5B1N A;  1V54 B;  3HKB B;  1H2G A;  2N74 A;  4LCU C;  1OCC B;  5LA6 B;  2BCC H;  2DQ3 A;  1N8R W;  4CBC A;  2JGD B;  3E2E A;  1ZAU A;  3OT7 A;  3JAK B;  2QDO A;  4Z1M G;  1AP6 A;  4UCR A;  5CN0 A;  4B7E A;  1S76 D;  4HBN A;  1WJZ A;  2GHY A;  1RM1 B;  4JAS A;  5J2U B;  5JJJ B;  4UFZ A;  1Q3E A;  3RYI B;  4KXR A;  2IU0 A;  5IYC O;  3MDS A;  3MHS C;  3OR6 C;  2YI9 A;  1BE3 H;  4X1K B;  5LP6 A;  4PDV A;  2UU9 B;  3UM7 A;  4ZOL B;  3FAV B;  4LF6 B;  2IJJ A;  3AG1 C;  4F6E A;  3GWO A;  4CH4 A;  3JYC A;  2ITD C;  2Y69 B;  1G6U A;  1OCZ C;  1ZSP A;  3ML0 A;  1TGO A;  4KUM A;  3ASN B;  3BCC H;  2KB1 A;  4MVU A;  3UO3 A;  1AR5 A;  4LF4 B;  1Q81 W;  3D36 C;  4BR6 A;  3CYO A;  2LFS A;  4DV0 B;  1Q8I A;  4B3M O;  4GKJ B;  5H6Q A;  4YJ3 A;  5CA1 B;  3UKM A;  4DR2 O;  4K35 A;  2DWE C;  2LW7 A;  4FLW A;  3T1H O;  5KMG A;  1TUB A;  3QO8 A;  5LBQ A;  4D7S A;  3B8M A;  2UUB B;  4DUZ O;  2XAQ A;  1M93 A;  2EJ7 A;  3THO A;  4DV4 B;  1YJN V;  3HKC A;  3ICX A;  2E76 B;  5L3G A;  4JV5 B;  3CEI A;  1F23 A;  2ADP A;  3G4S V;  3B40 A;  1XDC A;  1L8D A;  3B4S A;  2EJR A;  3OGI B;  3JD2 A;  5B1O A;  1GTO A;  4JI5 O;  3CJH A;  5IT9 N;  4DR1 B;  4PA4 A;  5EYP A;  1K33 A;  5IJ9 B;  4UCO A;  4HZ3 A;  1Y74 B;  2EZP A;  2JK5 C;  5FNV A;  2CK3 G;  3M7M X;  1Q82 W;  1HNX O;  3U10 A;  3EHB B;  3HKD A;  4P2Z A;  3BFR A;  2WLJ A;  3JAR A;  3RFR A;  2LFR A;  3RN4 A;  2OT5 A;  1IBK O;  1XIL A;  1Y76 B;  2VQF O;  1SER A;  1SQB H;  1HNW O;  1K3E A;  3JD4 A;  1GN3 A;  3DGE A;  1YTF B;  1BGY H;  3ZHQ A;  1NR7 A;  5TIS Z;  2BTQ B;  3WB1 A;  3LDC A;  2ADQ B;  1DLB A;  2ZE8 A;  3QO7 A;  3SJQ C;  3DTU B;  1I5X A;  4MVQ A;  1OCR C;  4U3J A;  4L8J A;  5EZY A;  3ETG A;  3ZHU A;  4JAU A;  3H9V A;  3HKE A;  3CC2 V;  2AXT Z;  5IYZ B;  2CDY A;  2IJI A;  4I4T A;  2YIB D;  2CH7 B;  1O9H A;  1YF2 A;  2ZCE A;  4YIP A;  2O57 A;  4N21 A;  2E5L B;  5B3S C;  3AG3 C;  1WA8 B;  1M90 W;  1PL4 A;  2XAF A;  4X62 O;  2Q68 A;  1SZT A;  3BVO A;  1V54 C;  1N32 O;  4JAV A;  4DR7 O;  1CEZ A;  2DYR B;  3WB0 A;  2EIK B;  3QO5 A;  1EN6 A;  1COW G;  5EC2 C;  1MZF A;  2VWK A;  3CCR V;  2UUC B;  3SJB C;  2K9P A;  5LXT B;  5C8Y B;  1FAF A;  4N23 A;  2V4D A;  3HR0 A;  1T5E A;  1RM1 C;  2A9H A;  5KHK A;  4OX9 O;  1GO3 F;  5IDJ A;  1YCI A;  4FLU A;  1XI1 A;  2ZM6 B;  1YHQ V;  1QVG U;  2GUZ A;  3IC7 A;  3ZRW A;  5LHI A;  2LP7 A;  2HVJ C;  1O9G A;  2EIJ C;  3JAW B;  4BIO A;  1Q43 A;  2HG5 C;  3ABU A;  1RPO A;  1SS3 A;  3FYI B;  5IJ0 B;  4LF5 B;  2M6Y A;  4JYA O;  5IWA B;  4Z2W A;  5GTH Z;  3C3T A;  4AI8 A;  4ZI7 A;  5LMN B;  3K5L A;  2Y69 C;  4R6Z A;  1AR1 B;  2F1M A;  3ASN C;  4X8A A;  1GH6 A;  3JAL B;  3OW2 U;  1VMG A;  3EVK A;  4X1I B;  2AZ2 A;  2P6J A;  1NS1 A;  3OTF A;  2QTO A;  2QA4 V;  4GT1 A;  3NR7 A;  4OGQ B;  3B2E E;  4FVM A;  1YXB A;  2W6I G;  3SJC C;  2ZKO A;  2Y48 A;  2XT9 A;  2F93 B;  4MW8 A;  2JVD A;  4UCT A;  4DK0 A;  4HNA A;  2QJ1 A;  2DW4 A;  4U3F H;  1CPY A;  5LMU B;  3ZHR A;  3Q4H B;  5KAI Z;  3J80 N;  4RUE A;  2VQE O;  4ZHQ B;  3FX7 A;  1U97 A;  1XL6 A;  3IFX A;  2F66 C;  3J81 N;  3BAA A;  3CRM A;  2QEX V;  1M56 B;  4FFK A;  1PM9 A;  2F4V B;  3BEH A;  2QWP B;  3KCY A;  1N36 O;  2BSK B;  2HLD G;  4IHJ B;  1K8A W;  3G6B A;  2YIB A;  1YJ9 V;  5JCO A;  4KHP O;  3T1Y B;  2QKC A;  1ROP A;  1PNK A;  2HEP A;  3EXA A;  1EFR G;  1MMM A;  3OUF A;  4I0X B;  1DF4 A;  4B7K A;  3TXQ A;  1LR1 A;  3N2K A;  4EFE A;  3F7Y C;  1R6K A;  4WFH A;  5CA0 B;  5H9C A;  1Q5O A;  4J7K A;  3K59 A;  5KX5 A;  3UT5 B;  3VQY A;  4UB8 Z;  1NH2 B;  1B06 A;  3T4D A;  2AZ0 A;  3AG4 B;  4FM1 A;  2IBZ H;  2EX3 A;  5FPR A;  3SPC A;  3CXH F;  4DV1 B;  3AK3 A;  2ARH A;  4AQY B;  2LJ2 A;  4PA6 A;  3CRC A;  5JJE B;  2CTR A;  3K0D A;  5KHI A;  2QKS A;  2XUM A;  4J41 A;  4EEQ A;  4BIZ A;  2LW1 A;  4J9Y B;  4DR3 O;  4IIJ B;  4FFB B;  1WB8 A;  1W59 A;  4LFC O;  4K0K B;  3E8F A;  3BRC A;  1FKA O;  1IBL O;  3AG2 B;  3KG2 A;  4LFA B;  3E8B A;  2ZE5 A;  1QR8 A;  4X20 A;  2WLN A;  1IX9 A;  4QIW F;  1NTM H;  3E86 A;  3ZRV A;  4Q6G A;  4BAY A;  4EB6 A;  4JI6 O;  4FJC C;  2EIK C;  4O4H A;  2B9Z A;  3UQ8 A;  1Z2G A;  2EIL B;  2QWQ B;  3E89 A;  4I7Z B;  1W2B U;  4X88 A;  3ETE A;  5KHJ A;  4O2A A;  2NNU A;  1URF A;  4GKK O;  1NVP D;  3IAY A;  3OMI B;  4GZR B;  3GVM A;  1MAB G;  4F6R B;  4GLX A;  2KG7 A;  1SA0 A;  1R3J C;  3MD0 A;  4O4L B;  3RYF B;  2B5U A;  1G1X B;  4JI7 B;  3L73 H;  5BR8 O;  4B3T B;  2WA3 A;  4O2B A;  4UVB A;  4YY3 O;  2CAZ C;  3TCU A;  5JVD B;  2ZIN A;  3P3N A;  3B09 A;  4FZ0 A;  3RYH A;  4JF3 A;  1OV9 A;  4WFG A;  3E83 A;  3MHH C;  2Q0O C;  1J5E O;  4X89 A;  1JQ0 A;  1LNQ A;  3SPJ A;  3WU2 Z;  1S5J A;  5BMV B;  4OPA A;  3H1J H;  5J9P C;  2W6J G;  3CRA A;  4LR3 A;  5KUK A;  4WFA V;  2QWR B;  2Z0A A;  4DV7 O;  5L3D A;  4NYK A;  4PDL A;  4P9P A;  3OE7 G;  4RQE A;  3OUS A;  4MVO A;  1P84 F;  4GUN A;  3SPG A;  3LDE A;  2X7R B;  4JI2 B;  2B1I A;  2KKW A;  2GTA A;  2CGN A;  3ASO B;  1IXB A;  2UXC B;  4PA9 A;  1W0J G;  3T1C A;  1XNR B;  5JWP A;  2ZE6 A;  4IYI A;  1RSO A;  2BTO A;  4H37 A;  2IH3 C;  3TET A;  3ABT A;  5BXZ A;  4R7C A;  1GAX A;  1ARO P;  1M56 C;  4TSF G;  2QM8 A;  4B3S O;  5DED A;  3ZBH A;  4IGG A;  4JGS A;  5B5E Z;  1BQ0 A;  1XBL A;  1YIJ V;  2A06 H;  1XMO B;  4LFB O;  1M4U A;  3LSS A;  3UCS C;  3T2M A;  1KEC A;  2UUA B;  3CC4 V;  1Y67 A;  4HYO A;  2GDS A;  1GK9 A;  2YEV B;  1KMI Z;  2P7T C;  4P9O A;  4WBN B;  1AJQ A;  4JI1 O;  4YJ2 A;  1M57 B;  2E74 B;  1QQC A;  3A0B Z;  1DGS A;  2JEX A;  3B77 A;  5ITZ B;  4FM2 A;  1AIL A;  2UXB O;  4JI4 B;  3F5T A;  4U7N A;  3CRR A;  4TUY A;  1VP7 A;  1YSC A;  3AG4 C;  5JQG A;  2RN9 A;  2YXH A;  4JZG A;  1MZE A;  3OM3 B;  3X2Q C;  5IY5 C;  4D6T H;  4XBF A;  2P90 A;  1XMQ B;  4JI3 B;  1EM1 A;  1P49 A;  3ZX6 A;  5B3S B;  3AG3 B;  1SRY A;  4I55 A;  1R1B A;  1Q7Y W;  1K4D C;  2D2C B;  2Q9L A;  4QE7 A;  3AG2 C;  2EUL A;  1TVK A;  3D3I A;  1KC8 W;  3P3P A;  1FJG B;  1JX9 A;  4B3R B;  4LF7 B;  1BT8 A;  4MS2 A;  1GM9 A;  1MG1 A;  3H1H H;  3OTO B;  3ZHV A;  1OZ0 A;  4DRX A;  1WNS A;  3RVY A;  4JI0 O;  2ZR2 A;  4ASU G;  4MTX A;  1TUB B;  1YIT V;  2EIL C;  3APO A;  2EBO A;  2R9I A;  2EIJ B;  1HW7 A;  1NTK H;  1GM7 A;  4X64 O;  3HKC B;  3CPW U;  1JPX A;  3DC6 A;  4DV6 B;  5L3F A;  1LUV A;  4PI2 A;  1QNM A;  2HHH B;  1JA8 A;  1DF5 A;  1QBZ A;  2YUA A;  2EIM B;  3H01 A;  1B6Q A;  5EBL C;  3RGB A;  2DMX A;  2PZS A;  3UO2 A;  1SES A;  2QTS A;  1NKD A;  2WLL B;  1VF5 B;  1V55 B;  1EZJ A;  4O4I B;  1BL8 A;  4NTY A;  3L75 H;  3CCV V;  4ABM A;  3DXR B;  4FK5 C;  1XQ8 A;  4QNH B;  4O4J B;  1VQ4 V;  1OCO B;  3OMA B;  1KBH A;  1TUE B;  4UV8 A;  5CB4 A;  1JFF B;  5B1B C;  4LC1 A;  2WLI B;  1E79 G;  3HKB A;  5GTI Z;  2F23 A;  1WN7 A;  1Q86 W;  1MOF A;  3LSU A;  4NTW A;  2JGD A;  2QR4 A;  1FXK C;  4X1Y B;  4UV9 A;  5LYJ A;  3N27 A;  3ASO C;  2ZE7 A;  2P67 A;  1Q6H A;  1N4C A;  1YTF D;  1H2S B;  1SQQ H;  1BSM A;  4DR6 O;  2RCV A;  2KSD A;  2Q0A A;  5J2U A;  5K1P A;  4CC5 A;  1K34 A;  4P30 A;  1VF7 A;  1Y4M A;  3AK1 A;  5EZY B;  4LP8 A;  3RYI A;  2PUS A;  4X66 O;  3F5W C;  3LNN A;  5D5Q A;  4LH6 A;  2BE3 A;  4DUY O;  4EKW A;  4JI8 O;  4X1K A;  3ABK B;  4NB5 A;  4ZOL A;  1I94 O;  3S3X A;  3FAV A;  1FXH A;  4B3M B;  4DR2 B;  4IYH A;  1R3K C;  4L87 A;  4UXN A;  3T1H B;  4RAI A;  1JJ2 U;  4IL6 Z;  4DUZ B;  3EFF K;  4PJ0 Z;  1UJW B;  4DK1 A;  1M57 C;  1YDX A;  1NI8 A;  3K57 A;  3L70 H;  5CA1 A;  2HJF C;  4NXN O;  3DSQ A;  3CCU V;  1YI2 V;  3RW0 A;  3FB5 C;  5EIB C;  1N33 O;  1I7F A;  3ZMS A;  3ZRW B;  4TQF A;  3K5M A;  1AP5 A;  4JI5 B;  3E8G A;  5IE9 A;  3ZMZ A;  3PJS K;  3ZS8 C;  5AG2 A;  3STL C;  2YS8 A;  2QWO B;  4R50 A;  1VQM V;  2OTL V;  2X0L A;  2AHY A;  5LP6 C;  4LNU A;  5C93 A;  3ETQ A;  4OXS A;  5JJN B;  2IW5 A;  4TT3 G;  1ORQ C;  5KHG A;  1KP3 A;  1HNX B;  4PV1 B;  4I9W A;  3CCM V;  1J95 A;  3CCL V;  1M9N A;  3WG7 B;  1IBK B;  2IU3 A;  3A8T A;  2QSA A;  4TOI A;  5DN6 G;  2VQF B;  1FPO A;  5FL7 G;  3FB7 C;  1HNW B;  2N04 A;  2L6L A;  3BA8 A;  1KB9 F;  2QE7 G;  1S72 V;  2NLJ C;  1EN4 A;  5KLV H;  2H8P C;  3CCS V;  1AB3 A;  3A0H Z;  1Q6U A;  4BW5 A;  4CS3 A;  1XNQ O;  1EBO A;  1Y76 A;  1VQ6 V;  2FML A;  2PYJ A;  4FLT A;  4FZ1 A;  3CCE V;  4FIP C;  4Z1V A;  2DQ0 A;  4HAM A;  1GN4 A;  1R73 A;  4MTF A;  2GSM B;  1BMF G;  2CTQ A;  1PP9 H;  2L35 A;  2EIM C;  4X62 B;  3BHP A;  3BPZ A;  1S5L Z;  1N32 B;  3RYC A;  4DR7 B;  4CH3 A;  3E22 B;  3RT3 C;  3G6E V;  5IYZ A;  1V55 C;  4JAA A;  3CHX A;  2CH7 A;  1VQP V;  4LF8 O;  4LH7 A;  1OCO C;  5BZB A;  1BHA A;  3TJT A;  1SKV A;  3TGU H;  2UXN A;  1H8H G;  4K3A A;  3SDL A;  2HJD A;  2GBO A;  1N0N A;  4OX9 B;  2RMK B;  2LQT A;  4W4K A;  1SQP H;  3ZHT A;  4MTG A;  1H2N A;  3D8C A;  1U96 A;  2P4K A;  2Q7G A;  4TV9 B;  3H1K H;  5KUM A;  1NH2 D;  2Q73 A;  2FL4 A;  3CS5 A;  4GCZ A;  2EIN B;  5J2T A;  2JRI A;  2XND G;  5FPO A;  3BAB A;  4XDL A;  2QM4 A;  1HNZ O;  2MW2 B;  4DXW A;  3QG5 A;  4JYA B;  2AW9 A;  1F51 A;  2IJK A;  1HWY A;  2C2A A;  3JAS B;  3ETD A;  5LHH A;  4TV8 B;  1FYJ A;  1R6T A;  3JAW A;  4LF9 O;  3IGA C;  1GMG A;  3R66 A;  2WAM A;  4YHH O;  5E1A C;  5LOV B;  3CCQ V;  5IJ0 A;  4MVM A;  3ABK C;  2WLK A;  4F4L A;  3W7S A;  4J80 A;  3O65 A;  2PF4 E;  4X65 O;  4NTX A;  1KYO F;  4JTC B;  4EB6 B;  1XHX A;  1BZK A;  3JAL A;  4NR1 A;  4TWK A;  4FLZ A;  4O4H B;  5JH7 A;  5LHG A;  2CGO A;  4X1I A;  4MT8 A;  2JJ2 G;  2JGU A;  5KA5 A;  2VQE B;  1VQ5 V;  1FFX A;  4KFM A;  4FLV A;  3JAT A;  1R3I C;  2ZNJ A;  5B1A C;  3C3S A;  1KKD A;  3CRQ A;  3X2Q B;  1XL4 A;  5IY5 B;  4LWS B;  2Q69 A;  4JTD B;  1ZL8 B;  4CS2 A;  3K9S A;  3JSN A;  4DV3 O;  1N36 B;  1FS0 G;  3SYP A;  3Q4H A;  3W7U A;  3ZED A;  4UUJ C;  4DR4 O;  4KHP B;  4ZHQ A;  3SPH A;  4J42 A;  2OIE A;  1SQG A;  2ZR3 A;  2LGW A;  3N2G B;  1L1F A;  2CUG A;  3RYH B;  2Q5Z A;  1VQ9 V;  1EZV H;  5GON B;  1XEQ A;  4I5S A;  3I5D A;  1VF6 C;  4IHJ A;  3WG7 C;  4E2L A;  2OWO A;  1AJP A;  4XDK A;  2YXL A;  1NTZ H;  4YIO A;  1S77 D;  2Q8V A;  5LL6 Y;  2JIZ G;  4I0X A;  4J11 A;  2HFE C;  2BOC C;  4AIL C;  1ENV A;  2OIG A;  4DV5 O;  4QE9 A;  2UXD O;  5CA0 A;  2ZIM A;  2ZIO A;  2LO1 A;  3K03 A;  4G2K A;  3CD6 V;  3WB2 A;  2A7W A;  5DM6 V;  4DR3 B;  2A0L A;  1V9P A;  4LFC B;  5H6R A;  5CMU A;  2YID A;  3CCJ V;  2E3C A;  1ZLZ A;  1NJI W;  2OCH A;  1IBL B;  2DOS A;  3W7T A;  3R65 A;  3B8N A;  2JS3 A;  3E8H A;  1OHH G;  4RQF A;  2YSU B;  1SQV H;  4IT5 A;  1KP2 A;  4IIJ A;  4FFB A;  4I50 B;  5B1B B;  4JI6 B;  1D5A A;  5E79 Z;  1VQK V;  2A3Q A;  3CXC U;  3FD9 A;  3OEH G;  1FXK B;  1SQF A;  4PD4 F;  2F43 G;  1VAR A;  4NXM O;  4R8C A;  3VOU A;  4GKK B;  1GRJ A;  4PA7 A;  3L9D A;  4NKG B;  1K7D A;  2Z5U A;  1TAE A;  1WP7 A;  3JD0 A;  1NT2 B;  2Q7H A;  2Y0P A;  3QTC A;  3ZRX A;  5BR8 B;  3U0Z A;  4C7U A;  1IBM O;  4JYY A;  1AVM A;  3JD1 A;  5JQG B;  2YIC A;  1UFI A;  2EIN C;  4YY3 B;  5FLX N;  1HR0 O;  4AHC A;  2QWN B;  4U7O A;  3PN1 A;  3T4Z A;  4D7T A;  1J5E B;  3I55 V;  4O4L A;  3RYF A;  1ZTE A;  1Y6X A;  1VQL V;  1N34 O;  3E35 A;  4DV2 O;  3CSX A;  3CX5 F;  4I55 B;  4B08 A;  4DV7 B;  4DR5 O;  1BHB A;  4MSW C;  3ZMT A;  1MSD A;  5JVD A;  1HP8 A;  1PV0 A;  1Q90 D;  2N05 A;  1KU9 A;  3D36 A;  5A9G A;  2OTJ V;  3VQW A;  1SC5 B;  4DRX B;  2PY5 A;  3QVN A;  2FKX A;  1UPG A;  1Y66 A;  2ZDI C;  2ITC C;  5IYB O;  1THZ A;  5L3C A;  4YXW G;  3K5O A;  3QNE A;  2Q6A A;  4PA3 A;  4B3S B;  4UCU A;  5LP6 B;  3K5N A;  2OCC B;  3W7X A;  5CBH A;  4LFB B;  1VQO V;  4UB6 Z;  1K9M W;  3JAM N;  1CP9 A;  3FYE B;  1FXV A;  2BOB C;  3L74 H;  4QJF B;  5LGN A;  3A0R A;  4J7Z A;  4FMT A;  3FKS G;  4JI1 B;  1IDS A;  2W0X A;  4H44 B;  5F2V O;  5EBW C;  1WP8 A;  2UU9 O;  2R9A A;  4DW0 A;  1WAZ A;  4LF6 O;  1WLE A;  3SYA A;  4J9Z B;  4YJ3 B;  4MVS A;  1E1Q G;  2RJZ A;  2UXB B;  1YVW A;  2YEV A;  5KMG B;  3JD3 A;  1QVF U;  4WBN A;  5LYJ B;  1B04 A;  5K1X A;  3GWK C;  3CC7 V;  1L0L H;  3MAQ A;  4LF4 O;  4A5U B;  3SYQ A;  4E4E A;  4DV0 O;  4JZ2 A;  2JDI G;  4GKJ O;  1VEW A;  2KQX A;  5ITZ A;  1D5N A;  3H1L H;  4UVA A;  2PI5 A;  1AI7 A;  2K1E A;  4MW3 A;  4MVZ A;  2UUB O;  3K08 A;  1PKX A;  4PDR A;  1SZX A;  5EK0 A;  1F4N A;  5BY1 A;  1P7B A;  3CJH B;  4GX1 A;  4G27 B;  2LGQ A;  4H0L B;  4DV4 O;  1JMK C;  2GTS A;  5EYP B;  3CP1 A;  2GV9 A;  5FNV B;  1JR9 A;  2XAG A;  4WFE A;  3CWB H;  4FLY A;  4JV5 O;  3HKD B;  2HR3 A;  5KA6 A;  3JAR B;  1N0J A;  4JI0 B;  5LA6 A;  1YZB A;  4BWA A;  1FD9 A;  4RWU A;  1YJW V;  3ZMV A;  4UCS A;  3SYO A;  2Y4T A;  3JAK A;  4DR1 O;  2H3O A;  4X64 B;  5H5N A;  3J7A U;  4PHZ A;  3W7W A;  1IZ3 A;  1VQ7 V;  1AI5 A;  1BQZ A;  2OYQ A;  4FM0 A;  2E75 B;  1S5H C;  2XHB A;  2P22 C;  3M99 B;  2ZT9 B;  3G80 A;  1IUR A;  4U3J B;  4CC6 A;  2AHZ A;  4ZKI A;  3HKE B;  3JCU Z;  1IXM A;  3OFN G;  3LDD A;  4I4T B;  4UVC A;  3K04 A;  4LNU B;  1H38 A;  1KUQ A;  1F4M A;  2YIA A;  3VQX A;  1JCH A;  1AJN A;  1MSW D;  2WLL A;  2DYS C;  4GX0 A;  2MK3 A;  1GN2 A;  2FYU H;  1CXZ B;  4O4I A;  2XAS A;  2CTP A;  3G71 V;  3DXR A;  4CS4 A;  4O4J A;  1A32 A;  3CE2 A;  1X59 A;  4OPH A;  3ABL C;  1JFF A;  3VBB A;  2E5L O;  1JVM A;  5CBG A;  2UXX A;  5B1A B;  2WLI A;  1WPX A;  3OAA G;  3U11 A;  4DR6 B;  1HDJ A;  2P5O A;  5LGU A;  5DEC A;  1I0H A;  4K8X A;  1YEW A;  2GUZ B;  4X1Y A;  4X66 B;  1MA1 A;  2Z3Y A;  4BW9 A;  4DUY B;  2UUC O;  3ABM B;  2YC0 A;  4JI8 B;  3P32 A;  2OCC C;  1I94 B;  4KL1 A;  1I08 A;  4FPP A;  1H2L A;  2FB5 A;  1KKC A;  2ZM6 O;  1F7Y A;  3RYC B;  4ZI7 B;  2X6C A;  1GN6 A;  2RDC A;  3OMN B;  2XTA A;  2ETN A;  3K58 A;  2H94 A;  2PYL A;  3ZJZ A;  5IJ9 A;  1B3Q A;  1Y74 A;  1K4C C;  2Y0I A;  2NR5 A;  4LF5 O;  4CZZ A;  2JJ1 G;  5IWA O;  4NXN B;  2YXY A;  3FFQ A;  3SR2 C;  1OCC C;  3VQV A;  5LMN O;  2CTW A;  1PL0 A;  1N33 B;  2ATK C;  4HNA B;  1R3L C;  1G8M A;  2WPD G;  1K5Q A;  2ZD9 A;  3L71 H;  1RPR A;  1VQN V;  4DO2 A;  2D3O W;  5J2T B;  3P30 A;  3O9O A;  2BTQ A;  2X6A A;  1M5I A;  2ILM A;  4QGP A;  3ZHS A;  1D2D A;  1JJO A;  5LMU O;  4WFF A;  1PNM A;  1QU7 A;  4JYC A;  3NXS A;  4G28 B;  4W4L A;  1I5Y A;  2F4V O;  2RNB A;  1LUW A;  1WA8 A;  3N2K B;  2VRZ A;  1H8E G;  1PD3 A;  1VF6 A;  1NZ6 A;  1XNQ B;  5KHH A;  5KX5 B;  3M8A A;  5IYD O;  2V7Q G;  3JSL A;  2EZO A;  2A79 B;  5JH7 B;  1TA8 A;  3T1Y O;  2WSS G;  1H2K A;  3K06 A;  3K79 A;  5EC1 C;  1QHT A;  4BIU A;  1FFX B;  1SQX H;  3ZN1 A;  3TXS A;  2YI8 A;  2WA4 A;  3OD4 A;  5C8Y A;  5LXT A;  1QLE B;  3JAT B;  1ZWI C;  4CH5 A;  1P7G A;  3AK2 A;  5L3E A;  4WCE V;  4GYC B;  3WFV A;  4KP4 A;  1VQ8 V;  2ZXW B;  5L3B A;  3JCZ A;  4H13 B;  4DYL A;  1Z5V A;  2VS0 A;  1QCE A;  4MVR A;  2HP8 A;  3RVZ A;  3CMA V;  4XDJ A;  3APQ A;  4LF8 B;  2HKO A;  1AI6 A;  3G67 A;  4DV1 O;  3GB7 C;  4AQY O;  2DE0 X;  1ZX3 A;  3BY6 A;  5CA3 A;  4X20 B;  4GX5 A;  3DC5 A;  4ICG A;  1WPB A;  2NN4 A;  3A2F A;  3E22 A;  3BA9 A;  2JEU A;  4K0K O;  1QLN A;  1US6 A;  2ODM A;  3KZI Z;  1OJH A;  2WLH A;  4LFA O;  1ZUQ A;  3K3W A;  3OEE G;  4O2A B;  1HNZ B;  5CBF A;  2DWD C;  2XOK G;  1AI4 A;  1PNL A;  3S3W A;  2WWW A;  2KG7 B;  1SA0 B;  4JPR A;  4TV9 A;  4LF9 B;  3HB3 B;  3QF7 A;  4MTO A;  4K8Z A;  4YHH B;  3ABM C;  4O2B B;  1M1K W;  2VWJ A;  2WLM A;  4X65 B;  3JAS A;  3FB6 C;  4I9Q A;  2BSK A;  1P4R A;  4TV8 A;  1NQT A;  4JI7 O;  2Y4U A;  2QGN A;  4B3T O;  2DJV A;  1H2M A;  5LOV A;  1MNG A;  1Q6I A;  4J7J A;  2G38 A;  3ZRS A;  1KQS U;  5KAF Z;  4RUF A;  3UT5 A;  4DV3 B;  2DYR C;  1L0N H;  3KCX A;  4PI0 A;  4GX2 A;  1RSO B;  5B66 Z;  4DR4 B;  4CH6 A;  3SGI A;  4JI2 O;  2ZDI A;  2JS5 A;  1NBM G;  4LWS A;  2UXC O;  1RP3 B;  5LGT A;  1ZL8 A;  1SET A;  4X9Q A;  1XNR O;  5A2Q N;  4EFB A;  2W0F C;  3D3Q A;  3AG7 A;  2XAJ A;  4Q20 A;  1K73 W;  2XAH A;  3AG1 B;  5JCO C;  2PGG A;  2YDE A;  4DW1 A;  1OCZ B;  3SYC A;  3ZMU A;  1PPJ H;  2FTK A;  3ZIA G;  3IC9 A;  3N2G A;  4RO2 A;  4PDM A;  2PTM A;  1VIB A;  4DV5 B;  3AEI A;  1QR9 A;  3FB8 C;  5GON A;  4YJ2 B;  2UXD B;  1K5S A;  3SJA C;  3L72 H;  1XOU A;  1R6N A;  4QPJ A;  3ZCC A;  2IH1 C;  1XMO O;  2UUA O;  2PI4 A;  3HPL C;  1FFT B;  1WB7 A;  4JTA B;  4TUY B;  5EIB D;  3I56 V;  2IM9 A;  1EN5 A;  1NVP B;  1QLE C;  1JOY A;  5GW7 A;  3CB2 A;  1Z5W A;  1X4T A;  2F95 B;  4WFB V;  1K92 A;  4F6R A;  2ZXW C;  3STZ C;  4JI4 O;  1XRE A;  2CE4 A;  2ZNI A;  2DN9 A;  1SF9 A;  2DYS B;  3RBZ A;  1E1R G;  1RFY A; 
#chains in the Genus database with same CATH homology
 2HVK C;  1YJW V;  3ZMV A;  4PA6 A;  4BW5 A;  4WF9 V;  1EBO A;  3SYO A;  3K0D A;  1S3J A;  2QKS A;  1VQ6 V;  3F7V C;  4BIZ A;  4J9Y B;  2M7W A;  2X6B A;  1S0V A;  3ABL B;  3CCE V;  1GKF A;  4FIP C;  4QPK A;  3W7W A;  1VQ7 V;  1AI5 A;  3E8F A;  4PEL A;  2DQ0 A;  3LNM B;  4HAM A;  4H33 A;  3AG2 B;  1S5H C;  1R73 A;  3KG2 A;  3CME V;  4MTF A;  2GSM B;  1BMF G;  3E8B A;  3M99 B;  3OR7 C;  3SPI A;  1DTO A;  1FXK A;  1QR8 A;  2EIM C;  2WLN A;  2B1G A;  2AHZ A;  2IJH A;  4QIW F;  3E86 A;  4ZKI A;  2R9R B;  4LBE C;  3ZRV A;  5HFM A;  1W0K G;  1IXM A;  3OFN G;  3LDD A;  4BAY A;  3G6E V;  1V55 C;  4UVC A;  1GM8 A;  3K04 A;  2EIK C;  4FJC C;  1VQP V;  1H38 A;  5EBM C;  1F4M A;  1OCO C;  5BZB A;  1BHA A;  2EIL B;  3E89 A;  1JCH A;  2V1D A;  1W2B U;  1OCR B;  2UXN A;  4X88 A;  1H8H G;  2ZQM A;  5HFL A;  3TK1 A;  1G4Y B;  3ETE A;  2Q67 A;  1AJN A;  2NNU A;  2QM7 A;  1MSW D;  3K0G A;  3LSQ A;  2WLL A;  2DYS C;  4GX0 A;  2MK3 A;  1NVP D;  3OMI B;  1K97 A;  4MTG A;  1MAB G;  3ZN0 A;  2XAS A;  3OGC C;  3G71 V;  3MD0 A;  1R3J C;  2B5U A;  3K9A A;  3LUT B;  5KUM A;  1NH2 D;  1NR1 A;  1KD1 W;  3ABL C;  4GCZ A;  4ZBM A;  3VBB A;  1JVM A;  4JYB A;  2EIN B;  5CBG A;  1V54 B;  2UXX A;  5B1A B;  2WLI A;  5B1N A;  1H2G A;  2XND G;  4LCU C;  1WPX A;  1OCC B;  3OAA G;  4UVB A;  4XDL A;  3TCU A;  2DQ3 A;  4DXW A;  5LGU A;  4CBC A;  1N8R W;  3E2E A;  1F51 A;  2IJK A;  1HWY A;  2C2A A;  4Z1M G;  4JF3 A;  4WFG A;  3E83 A;  3ETD A;  3MHH C;  5LHH A;  4X89 A;  1JQ0 A;  1LNQ A;  5CN0 A;  3SPJ A;  2Z3Y A;  5J9P C;  3IGA C;  2W6J G;  3ABM B;  1S76 D;  1GMG A;  2GHY A;  5KUK A;  2WAM A;  4WFA V;  1RM1 B;  5E1A C;  3P32 A;  3CCQ V;  4MVM A;  4PDL A;  5L3D A;  2OCC C;  3ABK C;  3OE7 G;  4JAS A;  4P9P A;  3OUS A;  4RQE A;  2WLK A;  4FPP A;  4F4L A;  4MVO A;  3W7S A;  3SPG A;  3LDE A;  2X7R B;  2B1I A;  2IU0 A;  5IYC O;  2X6C A;  3ASO B;  3MHS C;  4JTC B;  4PA9 A;  3OR6 C;  3OMN B;  1W0J G;  3T1C A;  4TWK A;  2H94 A;  5LHG A;  4PDV A;  3ZJZ A;  3UM7 A;  4MT8 A;  2JJ2 G;  5KA5 A;  4H37 A;  1K4C C;  2IH3 C;  1VQ5 V;  4KFM A;  2IJJ A;  3TET A;  3AG1 C;  4CZZ A;  2JJ1 G;  1R3I C;  3ABT A;  3GWO A;  5B1A C;  1KKD A;  3JYC A;  1OCC C;  2ITD C;  2Y69 B;  4R7C A;  1OCZ C;  3X2Q B;  3ML0 A;  1ARO P;  1M56 C;  1XL4 A;  4KUM A;  5IY5 B;  2Q69 A;  1PL0 A;  3ASN B;  4JTD B;  4TSF G;  2ATK C;  2QM8 A;  1R3L C;  1G8M A;  2WPD G;  2KB1 A;  1K5Q A;  4MVU A;  1FS0 G;  4JGS A;  2ZD9 A;  3SYP A;  3W7U A;  1YIJ V;  1RPR A;  1VQN V;  4DO2 A;  4UUJ C;  2D3O W;  1Q81 W;  3CYO A;  3LSS A;  3T2M A;  3SPH A;  2LFS A;  3P30 A;  1KEC A;  2X6A A;  3CC4 V;  5H6Q A;  4HYO A;  1GK9 A;  2ZR3 A;  3UKM A;  1L1F A;  2DWE C;  2YEV B;  2P7T C;  4P9O A;  3QO8 A;  5LBQ A;  1AJQ A;  1VQ9 V;  3B8M A;  1M57 B;  2XAQ A;  4I5S A;  3WG7 C;  4WFF A;  1PNM A;  4E2L A;  1AJP A;  4XDK A;  1YJN V;  2JEX A;  4JYC A;  3NXS A;  4G28 B;  1S77 D;  3B77 A;  5L3G A;  1I5Y A;  1F23 A;  4U7N A;  2JIZ G;  3G4S V;  1YSC A;  3AG4 C;  2HFE C;  2BOC C;  1ENV A;  2EJR A;  1H8E G;  3JD2 A;  4QE9 A;  5B1O A;  1GTO A;  1PD3 A;  3OM3 B;  3K03 A;  4G2K A;  3X2Q C;  3CD6 V;  5IY5 C;  5IYD O;  2V7Q G;  4XBF A;  5DM6 V;  2P90 A;  2EZO A;  2A79 B;  4PA4 A;  1K33 A;  2A0L A;  2WSS G;  4HZ3 A;  2EZP A;  2JK5 C;  3K06 A;  2CK3 G;  3K79 A;  5EC1 C;  5H6R A;  5B3S B;  3AG3 B;  5CMU A;  4BIU A;  3CCJ V;  1Q82 W;  3ZN1 A;  3EHB B;  4P2Z A;  1SRY A;  1NJI W;  1Q7Y W;  1QLE B;  1K4D C;  1ZWI C;  3W7T A;  2WLJ A;  4QE7 A;  3R65 A;  2LFR A;  3AG2 C;  3B8N A;  2OT5 A;  5L3E A;  1SER A;  4WCE V;  3E8H A;  3WFV A;  3D3I A;  4KP4 A;  1OHH G;  1KC8 W;  1K3E A;  1JX9 A;  2ZXW B;  2YSU B;  3JD4 A;  4RQF A;  5L3B A;  3JCZ A;  1VQ8 V;  1KP2 A;  3DGE A;  1QCE A;  4MVR A;  4MS2 A;  1GM9 A;  5B1B B;  1MG1 A;  1YTF B;  3RVZ A;  1NR7 A;  3CMA V;  1OZ0 A;  4XDJ A;  1VQK V;  3CXC U;  3LDC A;  2HKO A;  1DLB A;  3QO7 A;  3SJQ C;  1AI6 A;  3DTU B;  3RVY A;  2ZR2 A;  3GB7 C;  3OEH G;  1FXK B;  4MTX A;  4ASU G;  3BY6 A;  5CA3 A;  1YIT V;  2EIL C;  1I5X A;  2F43 G;  4GX5 A;  4MVQ A;  1OCR C;  4R8C A;  3ETG A;  2EBO A;  3VOU A;  2R9I A;  4JAU A;  2EIJ B;  4PA7 A;  1K7D A;  2Z5U A;  1GM7 A;  3CC2 V;  2JEU A;  3CPW U;  1JPX A;  2IJI A;  1QLN A;  3JD0 A;  5L3F A;  3ZRX A;  1DF5 A;  2WLH A;  1QBZ A;  2EIM B;  3H01 A;  4N21 A;  1B6Q A;  3K3W A;  5B3S C;  3AG3 C;  3JD1 A;  3OEE G;  5EBL C;  1M90 W;  2XAF A;  2Q68 A;  1SZT A;  1SES A;  2EIN C;  1V54 C;  1NKD A;  2WLL B;  5CBF A;  4JAV A;  2DWD C;  2XOK G;  1AI4 A;  1V55 B;  2DYR B;  1PNL A;  1CEZ A;  1EZJ A;  2EIK B;  1BL8 A;  3QO5 A;  2WWW A;  3CCV V;  4U7O A;  1COW G;  4FK5 C;  3T4Z A;  4QNH B;  3I55 V;  4JPR A;  1VQ4 V;  1OCO B;  5EC2 C;  1VQL V;  3OMA B;  3E35 A;  3HB3 B;  1TUE B;  4UV8 A;  3CCR V;  4MTO A;  5B1B C;  4LC1 A;  2WLI B;  3ABM C;  1E79 G;  1M1K W;  4N23 A;  1BHB A;  4MSW C;  1RM1 C;  1Q86 W;  2A9H A;  1MOF A;  3ZMT A;  1GO3 F;  5IDJ A;  1FXK C;  2WLM A;  1YHQ V;  1QVG U;  4UV9 A;  3IC7 A;  3ZRW A;  5LHI A;  2LP7 A;  3FB6 C;  2HVJ C;  1P4R A;  2EIJ C;  3ASO C;  3D36 A;  1NQT A;  2HG5 C;  2OTJ V;  3ABU A;  2P67 A;  1RPO A;  1YTF D;  3FYI B;  1K34 A;  4P30 A;  1Y4M A;  1Y66 A;  4LP8 A;  2ZDI C;  2ITC C;  5IYB O;  3F5W C;  1THZ A;  3ZRS A;  5L3C A;  4YXW G;  1KQS U;  3QNE A;  2Y69 C;  2Q6A A;  4PA3 A;  4R6Z A;  1AR1 B;  4RUF A;  3ASN C;  2DYR C;  4X8A A;  3OW2 U;  4EKW A;  2OCC B;  3ABK B;  4GX2 A;  2P6J A;  3W7X A;  2QTO A;  5CBH A;  2QA4 V;  1VQO V;  4GT1 A;  1FXH A;  2ZDI A;  1K9M W;  1CP9 A;  3FYE B;  2W6I G;  1FXV A;  2BOB C;  2Y48 A;  4QJF B;  1NBM G;  1R3K C;  5LGN A;  3A0R A;  4L87 A;  4UXN A;  4MW8 A;  4RAI A;  1JJ2 U;  4FMT A;  3FKS G;  5LGT A;  2DW4 A;  1SET A;  1CPY A;  3EFF K;  2W0F C;  5EBW C;  1UJW B;  4RUE A;  2XAJ A;  1M57 C;  4Q20 A;  1K73 W;  2XAH A;  3AG1 B;  1WLE A;  1XL6 A;  3SYA A;  3IFX A;  4J9Z B;  4MVS A;  2QEX V;  1OCZ B;  3SYC A;  2HJF C;  1M56 B;  3ZMU A;  2FTK A;  3CCU V;  1E1Q G;  3ZIA G;  1YI2 V;  2YEV A;  3RW0 A;  3FB5 C;  4RO2 A;  3BEH A;  3JD3 A;  1QVF U;  4PDM A;  3ZMS A;  3ZRW B;  3AEI A;  1QR9 A;  3FB8 C;  1K5S A;  3E8G A;  3CC7 V;  2HLD G;  3ZMZ A;  3PJS K;  1K8A W;  3STL C;  1R6N A;  4QPJ A;  3ZCC A;  2IH1 C;  4R50 A;  1YJ9 V;  1VQM V;  2OTL V;  3SYQ A;  2X0L A;  2AHY A;  2JDI G;  1ROP A;  1PNK A;  5C93 A;  2PI4 A;  4OXS A;  2IW5 A;  3HPL C;  1FFT B;  1ORQ C;  4TT3 G;  1KP3 A;  1EFR G;  4UVA A;  3OUF A;  2PI5 A;  4JTA B;  1DF4 A;  4I9W A;  3I56 V;  1AI7 A;  2K1E A;  3CCM V;  4MW3 A;  1NVP B;  3F7Y C;  1J95 A;  1R6K A;  4MVZ A;  3CCL V;  1M9N A;  1QLE C;  3WG7 B;  3K08 A;  1PKX A;  4PDR A;  4WFH A;  2IU3 A;  5EK0 A;  5H9C A;  1JOY A;  1F4N A;  5GW7 A;  5DN6 G;  1P7B A;  5FL7 G;  4GX1 A;  4G27 B;  3FB7 C;  4WFB V;  1K92 A;  3CP1 A;  1NH2 B;  2QE7 G;  2ZXW C;  3T4D A;  2XAG A;  4WFE A;  3AG4 B;  3STZ C;  1S72 V;  2NLJ C;  3SPC A;  2H8P C;  2HR3 A;  3CCS V;  2DYS B;  5KA6 A;  3RBZ A;  1E1R G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...