4DV7O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv7O00
1XNRO 4DR6O 3F5TA 4DR1O 4DR2O 2ZM6O 4JV5O 4JI5O 3JAMN 4LF7O 2Z0AA 1XNQO 2UXCO 4LF4O 2UXDO 1X59A 4YHHO 4DV6O 5FLXN 5BR8O 2N74A 5LL6Y 4X65O 4LF8O 1A32A 1J5EO 3SDLA 1XEQA 5BXZA 1NS1A 4A5UB 4DUYO 1IBMO 1HR0O 2UUAO 4DV1O 4B3SO 1G1XB 4OPAA 3M8AA 1FYJA 4AQYO 4LFBO 4JI1O 4JYAO 4LFAO 4X62O 4DV4O 4OPHA 1N36O 4JI4O 4X64O 1F7YA 1KUQA 2E5LO 1HNZO 4DV0O 2VQFO 2UUCO 4JI7O 4NXNO 2UXBO 3R66A 1N32O 2DOSA 5LMNO 1FKAO 2UUBO 2JRIA 1N33O 4DR4O 4DR7O 4YY3O 4DV2O 3T1HO 1IBLO 1FJGO 1AILA 5H5NA 4DUZO 4K0KO 4JI2O 1XMOO 3RT3C 4B3TO 4B3RO 2DJVA 4DR3O 4GKKO 4OX9O 4LF5O 4B3MO 2VQEO 1YZBA 4JI0O 2AGAA 4X66O 3T1YO 5A2QN 1N34O 4NXMO 1D2DA 2LW7A 4KHPO 2ZKOA 2F4VO 1AB3A 3J81N 4JI3O 3OTOO 1XMQO 4JI8O 2HHHO 1I94O 1R1BA 5LMUO 4JI6O 3O65A 2FKXA 1R6TA 4DV5O 1HNWO 4GKJO 5IT9N 1IBKO 1DK1A 4LF9O 4DV3O 2UU9O 3J80N 4DV7O 4LFCO 5BY1A 5IWAO 3J7AU 4LF6O 4DR5O 1HNXO
chains in the Genus database with same CATH superfamily
4FPPA 4X88A 1YJNV 4DR7B 3HKCB 1Z5VA 3CX5F 1SQXH 2DW4A 2YEVA 3RN4A 2MK3A 3C3SA 4JGSA 1KP2A 3OMAB 4W4LA 3QO8A 5J2UA 1A32A 1VQ5V 4JI0B 3IAYA 3GWOA 5LHIA 1G1XB 1KU9A 1URFA 1OCCC 1S3JA 4PDLA 5D5QA 2XAJA 1THZA 2LFRA 5JCOC 3G6EV 3ABUA 3RVYA 1VF5B 1E79G 2YDEA 4BW5A 4LWSA 2Q67A 2VQFO 3OUSA 1LUVA 5LYJB 3ZBHA 4WBNB 1XNRB 1R6NA 1Y66A 3Q4HA 4P2ZA 4DR6B 1BE3H 1OZ0A 5H9CA 2IBZH 5B1BC 1JX9A 4JV5B 4I0XA 2LGQA 3CCQV 4IIJA 3RYCA 2YICA 1NH2D 4TSFG 3T4DA 4X20B 3UO2A 5JVDA 4G28B 2AGAA 4NXMO 2R70A 2JIZG 2PI4A 1W0JG 3EHBB 4IYIA 4OXSA 2F4VO 4LNUA 5LHGA 4LFBB 3THOA 4LFAB 5FPOA 1KC8W 1EFRG 1LNQA 3ABKC 2YIAA 5L3EA 2ARHA 4QJFB 4MTOA 4JZ2A 1N32B 4D7TA 1XHZA 1G6UA 3CPWU 1EBOA 1IBLB 3GVMA 5IYCO 4YXWG 4UV8A 2B1GA 1K4CC 4UV9A 3QVNA 4O2BB 5BXZA 2OYQA 2Q7EA 2Q0OC 3LSUA 1OCCB 1VQ4V 4DR4B 1AI6A 1IURA 1WN7A 2CGNA 3E89A 4MW3A 4RUEA 3TETA 4YJ2B 4J7JA 3S3XA 3KZIZ 4PA3A 1MSDA 2UUCO 2QKAA 5FL7G 1Z2GA 5LOVB 2UXBO 3JATA 3E8HA 5B1BB 4U7OA 4U3JA 2ITDC 3L75H 3IGAC 1SESA 3B2EE 4YHHB 3FB7C 2UXNA 3H1KH 4JI2O 3LNNA 1EM1A 4K8XA 4LFCB 1M4UA 3RGBA 3D3QA 3SPGA 2OIGA 3APOA 3JD0A 3L73H 4O2AB 2GHYA 3X2QC 1I94O 3E22B 5IY5C 1VQ8V 2E74B 2BSKA 2FKXA 2UXCB 4GKJO 5DN6G 1EN6A 4FLZA 1YTFD 3ABKB 2E5LB 3CCUV 4IT5A 1J5EB 1QR8A 1WP8A 5L3FA 4JI7B 2D2CB 3J7AU 4B7EA 4LF6O 5FNVB 3D36C 1RPOA 5IJ0A 4PDRA 3JASA 1S5HC 4ICGA 2QE7G 3LDCA 3OAAG 4JYBA 2Z0AA 1WNSA 1VQKV 2WLIA 3C3TA 1WPXA 1B06A 1KYOF 4LH6A 1XEQA 2Q4PA 3HKEB 3CCRV 3B40A 4X1IB 4PA9A 4GYCB 4JI8B 1S76D 4MVQA 4JI6B 4CH5A 1ZWIC 1PNLA 3OE7G 4JI1O 4AI8A 5KHHA 3LDDA 3OGCC 3KG2A 4PD4F 2IW5A 1KUQA 2HP8A 4DV0O 3K08A 1Q43A 3P32A 1FD9A 3SYAA 3H9VA 2CH7A 4J41A 4CS4A 1N33O 1EZVH 1K73W 1TA8A 3RBZA 4LF7B 2YEVB 3FB6C 4P30A 3W7WA 4X89A 3ZS8C 5EYPA 1N4CA 2QEXV 2QTOA 5L3DA 4X65B 4GKKO 1NJIW 1PD3A 3HB3B 4XDLA 2AZ2A 2ZQMA 5BMVA 3F5WC 1TAEA 2CTWA 3ZRWA 1XL4A 3OTOO 2EJ7A 4PA7A 3B4SA 3X2QB 4AQYB 1VIBA 5IY5B 4J9YB 1K7DA 3HKCA 4KFMA 1YVWA 3JAWB 4W4KA 1K5QA 3U0ZA 3J80N 1L0LH 5JJNB 3K04A 3WB0A 4TV8B 3U11A 2UUBB 1VEWA 2X6CA 3MD0A 2IJHA 4JI5O 3JAMN 3EVKA 1AR4A 5B66Z 1Y6XA 3QTCA 4B3TB 2Y48A 1H38A 5C8YA 3PJSK 5CBHA 1N34B 3JSNA 1IBMO 5LYJA 1DF5A 5KAFZ 1YHQV 4IHJB 2YUAA 3HPLC 2Y0PA 2ZXWC 2ADPA 3CCJV 2WLKA 3DGEA 1GO3F 3TXSA 1N36O 2OCHA 1QQCA 4I7ZB 2MW2B 4K8ZA 1HNZO 2EJRA 3RFRA 4JYYA 4YIPA 1VQ7V 4HYOA 2RDCA 2ODMA 5K1PA 5KA5A 3ZX6A 3R66A 1PL0A 1S77D 2W0FC 2ZM6B 3WG7C 2X6BA 5CMUA 5IYZB 4DUZO 1JR9A 3OW2U 1KQSU 4E2LA 1B6QA 2QM8A 5J9PC 4B3MO 1ZSPA 4LCUC 1JQ0A 5K1XA 1Y74A 4L87A 1AJPA 4DW0A 2HHHO 4I5SA 4CZZA 3GB7C 4JYAB 2PYLA 4C7UA 4BWAA 1SQFA 2ZE7A 1ZAUA 2M7WA 4CS3A 1PM9A 4TQFA 3H01A 2JJ1G 1IBKO 2ZR3A 3K9AA 3OEEG 4LF9O 2P4KA 2XAHA 2YXYA 4DR5O 4DO2A 1Q81W 3JSLA 4ASUG 1Q82W 4O2BA 4XDJA 1JFFB 4MW8A 1OJHA 4UCUA 4DV2B 2LO1A 1R6KA 5B1OA 4D7SA 1QBZA 3NR7A 1IX9A 1HWYA 4DR3B 5JCOA 3ZN0A 1Y76B 4YJ2A 5LGUA 5TISZ 3VQVA 4BIZA 5LOVA 4B3SO 2OT5A 3K3WA 4OPAA 3ZJZA 4DK1A 2ZXWB 2BSKB 3VQYA 3L9DA 3ZIAG 4PDMA 3H1HH 2XASA 2KB1A 3UQ8A 1GH6A 4DV7B 2FL4A 1BMFG 3ZMTA 3VQXA 2YS8A 2ZIMA 1O9GA 4DR2B 3CD6V 4NR1A 1B04A 3SYOA 3WG7B 1FJGO 3FYIB 3E22A 1XNQB 5D5PA 1SC5B 2XAFA 1Q6IA 2WLIB 2HJFC 4DV6B 1GM7A 5DM6V 4UCRA 4LF8B 4JPRA 3ZHRA 4OX9O 3E86A 1BHBA 4QGPA 4DV1B 1VQ9V 1XILA 4ZI7A 2DWDC 4PI2A 1VQPV 1SKVA 4PA4A 3HKBB 4HAMA 2C2AA 1QHTA 4X62B 5GTIZ 2DQ3A 1R6TA 4DV5O 3VQWA 4LF4B 4JAVA 1FS0G 3CXHF 4B08A 2HKOA 2P06A 3IC9A 1K34A 4NXNB 3FD9A 1HNXO 1MA1A 3CYOA 3HKEA 3PN1A 1I7FA 1ZL8B 4O4LB 4X1IA 4WF9V 4GLXA 1U96A 5KHIA 3CCVV 1BSMA 3ZEDA 5KHKA 4I55A 3E83A 4L8JA 4UB8Z 4X66B 3DSQA 4A5UB 4RUFA 3SPJA 3ZRWB 2UUAO 3BA8A 4WFAV 1AP6A 1H2MA 1H2LA 2CUGA 2XNDG 3N2KB 3RYIB 4MVRA 2WA3A 2OTJV 3B8NA 1EZJA 3T4ZA 1VMGA 1BT8A 3OM3B 4UVCA 3QNEA 2B9ZA 4X8AA 1F4NA 3ETGA 2A3QA 5GONB 3P30A 4NTXA 4J10A 4JI3B 4EKWA 4BR6A 4YY3O 1H8HG 1VQMV 4GCZA 3ETDA 2ATKC 1RSOB 1VQNV 5B3SC 1QVFU 3JAWA 5C8YB 1R3LC 1FXHA 1BS3A 1PNKA 1KBHA 4I9WA 2YXHA 3D36A 5ITZA 4KHPO 2ZKOA 4FJCC 4TV8A 5H6QA 2EIMC 3J81N 1FAFA 3A0HZ 4FIPC 3JD1A 4HNAB 2QR4A 5KX5B 4QPJA 2JEXA 2UU9O 2WLHA 1YI2V 3ZRSA 2RNBA 2VQFB 5BY1A 3FB5C 1R73A 3U10A 2GUZA 1DGSA 2P90A 2Q68A 2F43G 4DR1O 3LNMB 2EINC 4FLXA 4NYKA 5H2FZ 4IHJA 4CH3A 3N2GB 1IXBA 1FPOA 2Y0IA 3STLC 2Q73A 3AG2C 2R72A 2EIKC 4XBFA 1AI5A 2B1IA 3CCLV 3CP1A 1KKCA 1NS1A 1Y74B 1HR0O 4XDKA 2F4VB 2ZCEA 1JOYA 1Q7YW 3FYEB 4R50A 3B77A 3JD3A 3AG3C 5L3CA 1SQBH 2YSUB 3BABA 3T1HB 1SZTA 2LJ2A 2Q5ZA 4JI4O 3MAQA 2R9AA 3CEIA 5GW7A 5IYZA 4X1YB 4QE7A 2RQ6A 2ZNIA 3W7XA 1WP7A 2KG7A 5E79Z 1VF6A 4DR4O 5EIBD 1OCRC 4QE9A 3ZHUA 5EC1C 5CA0A 4JAAA 2VRZA 4N21A 4TV9B 2VS0A 4K0KO 1MSWD 5B3SB 3BAAA 5L3BA 4DV3B 5CBGA 2BE3A 1NTMH 4JTDB 2L35A 4LF5O 1F51A 2QSAA 2ZIOA 1YZBA 1JJ2U 5H6RA 4D6TH 1F23A 1V54C 2EIMB 3JARA 4TQDA 4BW9A 1JFFA 1NBMG 4F6RB 3O65A 3IFXA 1X4TA 1QLEC 1W2BU 1XOUA 4LFCO 3T1CA 4O4JB 2UUCB 1Y76A 3AEIA 2EX3A 2UXBB 3K57A 4CBCA 1NQTA 2EINB 1NZ6A 2IH3C 4O4IA 3T2MA 2VWJA 3OFNG 2ITCC 3AG2B 2F23A 3H1LH 1IXMA 2UXCO 2UXDO 3B8MA 5CB4B 2EIKB 1OCOC 5HFLA 5LA6B 5FLXN 4TT3G 1M90W 1K5SA 4UVBA 5LL6Y 1J5EO 1ORQC 2YXLA 4ZI7B 1B3QA 1I5YA 3DTUB 1M5IA 3AG3B 1I94B 5JJJB 4UFZA 2RN9A 2O57A 4PHZA 1WA8A 4GKJB 4H44B 4CS2A 4X64O 1M9NA 1M93A 2WA4A 1EN5A 1Q90D 1W0KG 4KL1A 4FLUA 3ASOC 3MDSA 1S72V 4LF6B 1E1RG 2E3CA 3T1YB 2JS5A 3CRQA 2JJ2G 1NVPD 1OV9A 4IL6Z 5LMNO 2HG5C 4I4TA 2DN9A 1OCRB 1W59A 2OTLV 3HKBA 1AI4A 2HR3A 4I55B 5EIBC 3CMAV 3K5LA 2AHZA 1PL4A 1XMOO 2N04A 1GN3A 4X1KB 3ML0A 2VQEO 1H2KA 2Q8VA 4FLVA 2WLJA 2QM4A 1V54B 2X0LA 3CRAA 4FMTA 1SQGA 2YIDA 1ZL8A 4O4LA 4JI1B 5LGTA 2R9IA 1H2GA 5CN0A 2HLDG 1GTOA 1HNWO 3TCUA 1QLEB 2CE4A 3JCZA 1SF9A 3SR2C 4DV0B 4HBNA 2DMXA 2PGGA 1XDCA 1RPRA 3AK1A 2PZSA 2H8PC 3KCXA 1VF6C 5E1AC 4RQFA 4LBEC 4UUJC 4YIOA 1BQ0A 2DYRC 1SS3A 2PUSA 2CAZC 3LDEA 3P3PA 3N2KA 3RYIA 2BTOA 1OCOB 3OMNB 1KP3A 4GKKB 4PDVA 5AG2A 1OHHG 1BHAA 1LUWA 1TVKB 2JVDA 4FK5C 3CHXA 5ITZB 4LP8A 3P3NA 2DQ0A 4WFHA 4FM1A 3OTOB 3BFRA 4RWUA 5GONA 4WFBV 3M8AA 4JYCA 1RP3B 4K35A 2YC0A 4DV4O 2EIJC 3BVOA 1YJ9V 1AJQA 1WJZA 2CTQA 1K9MW 3LSQA 4DXWA 1F7YA 3ASOB 1RSOA 2GUZB 2V7QG 3BHPA 1P4RA 1K33A 1YEWA 3KKYA 4AILC 2DOSA 3DC5A 4J42A 2ZD9A 3L70H 4JI5B 2QJ1A 3C90A 4R7CA 1TGOA 5EZYB 3QF7A 2GTAA 5GTHZ 2CDYA 2ZE5A 4U7NA 4GX1A 4FM0A 4HNAA 2X6AA 1AR5A 1WAZA 5KMGA 5KX5A 4MSWC 5IE9A 2EILC 2IJIA 1GKFA 1H2NA 1O9HA 3VOUA 2HJDA 4KXRA 1IBMB 1XHXA 3TXQA 1AJNA 2RCVA 5J2TA 1AB3A 2JDIG 1QR9A 2GDSA 2GTSA 1TUBB 1L0NH 3N2GA 3KCYA 4ZHQA 3WB1A 5IJ9B 1P49A 5JH7B 1DK1A 3OD4A 4ZKIA 5JQGA 1HNZB 5IWAO 3K0DA 2KG7B 2NN4A 5EBLC 2HFEC 1I0HA 1GAXA 2DE0X 4FLTA 1T5EA 4JF3A 1YITV 5CA0B 2DYRB 4Z2WA 2YI9A 3CWBH 4DUZB 2D3OW 1D5NA 2N05A 1X59A 2EBOA 1VQOV 3E8FA 3ZHVA 5BR8O 2N74A 4B3MB 5IYDO 1AP5A 4X1YA 4DUYO 3SPCA 3E2EA 3JARB 5EC2C 3TK1A 3ZHQA 1MMMA 3G6BA 4E4EA 2HHHB 2L6LA 1S0VA 3QG5A 3CRCA 2EIJB 3OEHG 1NKDA 4OPHA 1IBKB 4LF9B 4TV9A 4B3RB 1PNMA 1KMIZ 3AG4C 4DR5B 1CP9A 4FFBA 1IDSA 4O4IB 4GT1A 3UT5B 2DYSC 2QKCA 5BZBA 5KLVH 1NVPB 4F6RA 3QO5A 3L72H 2GBOA 3D3IA 3N27A 3F7YC 3RT3C 2P6JA 2EILB 2XTAA 3IC7A 1MNGA 3AK2A 4QNHB 2XHBA 1WPBA 4O4JA 4EFEA 4UCTA 4B3SB 1K8AW 2JGUA 3JYCA 3K03A 2QWOB 1Q6UA 4JTAB 1XMQO 1QLNA 5LGNA 4YJ3B 3ZRVA 5LMUO 4WFFA 1KD1W 1WA8B 1MABG 1YCIA 5B1NA 3L71H 3AG7A 5CB4A 4LH7A 5LA6A 4CC5A 2OCCC 2WSSG 4O4HB 4J80A 3TJTA 4I4TB 1BL8A 2F1MA 3DXRB 3OTFA 4DRXB 4I9QA 3CRRA 2A0LA 3CXCU 2GSMB 4MVOA 4BIUA 2CTPA 1FJGB 1PKXA 3JAKA 4QPKA 1WLEA 4LF4O 3ZCCA 4ZOLB 2JGDB 3UCSC 4OX9B 1E1QG 1G8MA 4LR3A 1K92A 2A7WA 1MOFA 5KUMA 2RJZA 1Q86W 4H37A 1PPJH 4U3FH 1I08A 3M99B 2QWQB 2AZ0A 3WFVA 5LHHA 2NNUA 2XOKG 4DV5B 3K5NA 3ZMSA 3UKMA 4IGGA 2FMLA 1LR1A 2QKSA 3AG4B 3QO7A 4MVMA 3W7UA 4RO2A 1HNXB 3CMEV 1CXZB 4X1KA 1QNMA 2Q7HA 4EB6B 1VF7A 3SYPA 2WLLB 2DYSB 4DR7O 1ROPA 1HW7A 1M56C 2AHYA 2LQTA 2AW9A 5H5NA 4UB6Z 4NTWA 1XL6A 4ZBMA 3K58A 4P9PA 1NTKH 2B5UA 3RWRD 1FFTB 3SYQA 2Z3YA 3CC2V 4JI0O 1S5JA 5A2QN 1UJWB 2UUAB 4PV1B 2A9HA 2EULA 3CJHB 4LC1A 1ZX3A 4JI3O 4NB5A 3JALB 1Y67A 4TOIA 4MS2A 4UXNA 1GN4A 2HEPA 3BA9A 3TGUH 1XI1A 2OCCB 1VQ6V 3IJ4A 5LP6C 1TVKA 1IZ3A 1XNRO 4DR6O 4J7KA 1KECA 1YJWV 3APQA 3BPZA 4YY3B 4JV5O 4UVAA 4P9OA 2CK3G 1JPXA 1H8EG 1DF4A 5IDJA 5KMGB 1Q3EA 3CSXA 2RMKB 5J2TB 2KSDA 4KHPB 1YF2A 4N23A 2XAGA 4FFKA 4G27B 5C93A 4EEQA 4LFBO 5CA1B 1HDJA 1N0JA 4ZHQB 3B09A 4LFAO 3EFFK 4WCEV 2VWKA 5EZYA 2WAMA 1P84F 4GUNA 5JQGB 2UU9B 2PTMA 2ZNJA 4NXMB 1H2SB 2K9PA 2ZDIA 4J7ZA 3OT7A 2HVJC 3FAVA 3L74H 1N32O 1F4MA 4DR1B 4B7KA 5KHGA 2BTQB 1SRYA 2QM7A 1FXVA 2LP7A 1M56B 3T1HO 3AG1C 4TWKA 3RYFB 2W0XA 3A0BZ 1QVGU 1IBLO 1TUBA 2CGOA 3EXAA 4KUMA 2ILMA 4MVSA 4FLYA 5IJ9A 3SGIA 2WWWA 4ABMA 5JH7A 3CC7V 1XREA 1SA0B 2E76B 5B5EZ 1HR0B 1S5LZ 2AXTZ 2PF4E 4DK0A 2LW7A 1QU7A 2H94A 1P7GA 2ADQB 1FFXB 4H13B 4JI4B 2W6IG 4JZGA 2XT9A 4JAUA 4DV3O 2F93B 4PELA 4KP4A 2PYJA 3CE2A 4FFBB 3E8GA 5EK0A 5LP6B 2P67A 1MZFA 1R3KC 2Q6AA 3K79A 4MVUA 1SQPH 3RYHB 2Y4TA 1HP8A 2P4VA 1JCHA 3SJBC 4K0KB 3H1JH 1R3JC 2GV9A 2QTSA 3ZMVA 4YHHO 1G4YB 4LF5B 3ABTA 4X9QA 3FX7A 3RW0A 1I5XA 3OGIB 4J11A 4F4LA 4GZRB 4UCVA 1GMGA 1YDXA 2FTKA 4Z1VA 2QGNA 1GM8A 1FXKA 2H3OA 4GX2A 2WLNA 3UT5A 3LSSA 4UCSA 3HKDB 2ZT9B 4JI2B 1Z5WA 2E5LO 4UCOA 3ZN1A 4JI7O 1NR1A 4G2KA 3G71V 1NI8A 3BEHA 4CH6A 2QWNB 2JRIA 4WFGA 3A0RA 2ZE6A 3AG1B 3JAKB 4MT8A 1VP7A 1V55C 4YJ3A 3I55V 1NTZH 2R9RB 2UXDB 3MHHC 3STZC 3K59A 4Q6GA 2P7TC 4RAIA 4TUYB 3CS5A 3T1YO 1JA8A 4O4HA 1AROP 1KKDA 2ZR2A 1ENVA 4JI8O 5IYBO 3DXRA 3JCUZ 1GN2A 4JI6O 2DWEC 2K1EA 4DRXA 3ABLC 4X64B 1PP9H 3R65A 2YIBA 4I50A 3BCCH 1UFIA 4ZOLA 3G80A 3ICXA 4FZ1A 3AK3A 2JGDA 2OWOA 2ZDIC 3E8BA 1DLBA 2Q69A 5LMNB 1Q8IA 1M57C 1BQZA 4CH4A 3G67A 4LF7O 1NU1H 3SPIA 1XUQA 2IJKA 3RVZA 2V1DA 3UM7A 5CBFA 1DTOA 3DC6A 1XMOB 1NT2B 2P22C 3F7VC 4NTYA 5KAIZ 3H1IH 1US6A 5LXTB 4X65O 2VQEB 4MTXA 2Q7GA 3UO3A 3CRMA 5DECA 4WFEA 4FZ0A 1P7BA 1N33B 2YIBD 5B1AC 4EB6A 3MHSC 2WLLA 4AQYO 1XBLA 3E35A 4RQEA 1HNWB 1K4DC 4BIOA 5J2UB 1YIJV 1BZKA 5L3GA 3W7TA 2BOBC 1NH2B 2X7RB 5EBWC 5JWPA 2NLJC 2Q0AA 3ASNC 5F2VO 1RM1C 1IVSA 5CA3A 1FKAO 1YXBA 2QDOA 2UUBO 3CJHA 4PI0A 1COWG 1V55B 3JALA 3W7SA 3ETEA 4MVZA 4LWSB 4B3TO 3D8CA 3SJAC 3G4SV 3ETQA 1AR1B 4NVPA 4QIWF 1ZLZA 4F6EA 5KA6A 3JD4A 3Q4HB 2JEUA 1SQVH 1N34O 4NKGB 3SYCA 3CCSV 5KUKA 1MZEA 1FXKC 4CC6A 2BOCC 2A79B 4I0XB 3OUFA 2QA4V 2E75B 4IIJB 1R1BA 3RYCB 4DV4B 3ABLB 5JJEB 2PY5A 4DW1A 1Y4MA 2OIEA 1U97A 5JVDB 3ABMC 2F95B 1AVMA 2KKWA 3FAVB 1JJOA 4WBNA 4LNUB 1XQ8A 5LBQA 3F5TA 1M57B 3K5OA 1SZXA 1GN6A 2ZM6O 5CA1A 4BAYA 1N36B 4X20A 1D5AA 2W6JG 3SDLA 1V9PA 3I56V 4AHCA 2LGWA 1ZTEA 2WPDG 1BCCH 1NR7A 4Q20A 4Z1MG 1YSCA 5B1AB 1N0NA 5A9GA 2BTQA 1FYJA 2FYUH 4JYAO 3S3WA 2CTRA 1TUEB 1CEZA 1ZUQA 2Y4UA 3ZRXA 2M6YA 3RYFA 1WB7A 1JMKC 1CPYA 2ZINA 4ZIBA 5IWAB 2V4DA 4MTGA 3SPHA 3O9OA 3K06A 2EZPA 1K3EA 3ASNB 1SA0A 1RM1B 3WU2Z 1BGYH 3ZHTA 3CCEV 4R8CA 3SJQC 2Y69C 3FB8C 2PI5A 4DV2O 3ZMZA 1OCZC 1AILA 1FFXA 4R6ZA 1KB9F 5FPRA 2IU3A 5BR8B 3OR6C 2DJVA 4DR3O 4B3RO 3LUTB 1SERA 4IYHA 3JATB 4DUYB 1YTFB 1UPGA 3K9SA 2XAQA 1FXKB 4U3JB 5LP6A 3BY6A 4DYLA 3CB2A 3OMIB 3RYHA 1Q6HA 2Q9LA 2JS3A 2KQXA 1M1KW 3BRCA 3ABMB 4PA6A 4DV7O 5DEDA 2ZE8A 2YI8A 4PJ0Z 1Q5OA 2LFSA 1EN4A 2JK5C 4FVMA 1GRJA 3K5MA 4J9ZB 4MTFA 3WB2A 4DR2O 4OGQB 2A06H 4FM2A 1SQQH 3VBBA 2IJJA 2QWRB 1R3IC 2XUMA 2ETNA 1XNQO 1L1FA 4DV6O 3CC4V 3A8TA 3HKDA 1MG1A 4LF8O 4FLWA 2QWPB 1PV0A 3K0GA 2IH1C 2EZOA 5IJ0B 4H0LB 4DV1O 4EFBA 1VQLV 1XMQB 2IU0A 3JASB 1GM9A 2IM9A 5LMUB 4O2AA 1J95A 4X62O 3A2FA 1JVMA 4I50B 2NR5A 5EBMC 5KHJA 2G38A 1GK9A 3HR0A 4NXNO 3FFQA 1AI7A 5FNVA 1VARA 4TUYA 2Y69B 2FB5A 2LW1A 2UXXA 5HFMA 1OCZB 1RFYA 2F66C 3SJCC 3CCMV 3I5DA 4JTCB 4GX5A 3NXSA 4GX0A 2BCCH 4X66O 1SETA 1K97A 2Z5UA 4H33A 2CH7B 3ZMUA 1L8DA 1D2DA 4JASA 2P5OA 3JD2A 1WB8A 5EYPB 3FKSG 3M7MX 4K3AA 2HVKC 2WLMA 4HZ3A 5IT9N 1N8RW 3OR7C 3ZHSA 5BMVB 5LXTA 3GWKC 1QCEA
chains in the Genus database with same CATH topology
1XNRO 4DR6O 3F5TA 4DR1O 4DR2O 2ZM6O 4JV5O 4JI5O 3JAMN 4LF7O 2Z0AA 1XNQO 2UXCO 4LF4O 2UXDO 1X59A 4YHHO 4DV6O 5FLXN 5BR8O 2N74A 5LL6Y 4X65O 4LF8O 1A32A 1J5EO 3SDLA 1XEQA 5BXZA 1NS1A 4A5UB 4DUYO 1IBMO 1HR0O 2UUAO 4DV1O 4B3SO 1G1XB 4OPAA 3M8AA 1FYJA 4AQYO 4LFBO 4JI1O 4JYAO 4LFAO 4X62O 4DV4O 4OPHA 1N36O 4JI4O 4X64O 1F7YA 1KUQA 2E5LO 1HNZO 4DV0O 2VQFO 2UUCO 4JI7O 4NXNO 2UXBO 3R66A 1N32O 2DOSA 5LMNO 1FKAO 2UUBO 2JRIA 1N33O 4DR4O 4DR7O 4YY3O 4DV2O 3T1HO 1IBLO 1FJGO 1AILA 5H5NA 4DUZO 4K0KO 4JI2O 1XMOO 3RT3C 4B3TO 4B3RO 2DJVA 4DR3O 4GKKO 4OX9O 4LF5O 4B3MO 2VQEO 1YZBA 4JI0O 2AGAA 4X66O 3T1YO 5A2QN 1N34O 4NXMO 1D2DA 2LW7A 4KHPO 2ZKOA 2F4VO 1AB3A 3J81N 4JI3O 3OTOO 1XMQO 4JI8O 2HHHO 1I94O 1R1BA 5LMUO 4JI6O 3O65A 2FKXA 1R6TA 4DV5O 1HNWO 4GKJO 5IT9N 1IBKO 1DK1A 4LF9O 4DV3O 2UU9O 3J80N 4DV7O 4LFCO 5BY1A 5IWAO 3J7AU 4LF6O 4DR5O 1HNXO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR O;  4DR6 O;  3F5T A;  4DR1 O;  4DR2 O;  2ZM6 O;  4JV5 O;  4JI5 O;  3JAM N;  4LF7 O;  2Z0A A;  1XNQ O;  2UXC O;  4LF4 O;  2UXD O;  1X59 A;  4YHH O;  4DV6 O;  5FLX N;  5BR8 O;  2N74 A;  5LL6 Y;  4X65 O;  4LF8 O;  1A32 A;  1J5E O;  3SDL A;  1XEQ A;  5BXZ A;  1NS1 A;  4A5U B;  4DUY O;  1IBM O;  1HR0 O;  2UUA O;  4DV1 O;  4B3S O;  1G1X B;  4OPA A;  3M8A A;  1FYJ A;  4AQY O;  4LFB O;  4JI1 O;  4JYA O;  4LFA O;  4X62 O;  4DV4 O;  4OPH A;  1N36 O;  4JI4 O;  4X64 O;  1F7Y A;  1KUQ A;  2E5L O;  1HNZ O;  4DV0 O;  2VQF O;  2UUC O;  4JI7 O;  4NXN O;  2UXB O;  3R66 A;  1N32 O;  2DOS A;  5LMN O;  1FKA O;  2UUB O;  2JRI A;  1N33 O;  4DR4 O;  4DR7 O;  4YY3 O;  4DV2 O;  3T1H O;  1IBL O;  1FJG O;  1AIL A;  5H5N A;  4DUZ O;  4K0K O;  4JI2 O;  1XMO O;  3RT3 C;  4B3T O;  4B3R O;  2DJV A;  4DR3 O;  4GKK O;  4OX9 O;  4LF5 O;  4B3M O;  2VQE O;  1YZB A;  4JI0 O;  2AGA A;  4X66 O;  3T1Y O;  5A2Q N;  1N34 O;  4NXM O;  1D2D A;  2LW7 A;  4KHP O;  2ZKO A;  2F4V O;  1AB3 A;  3J81 N;  4JI3 O;  3OTO O;  1XMQ O;  4JI8 O;  2HHH O;  1I94 O;  1R1B A;  5LMU O;  4JI6 O;  3O65 A;  2FKX A;  1R6T A;  4DV5 O;  1HNW O;  4GKJ O;  5IT9 N;  1IBK O;  1DK1 A;  4LF9 O;  4DV3 O;  2UU9 O;  3J80 N;  4DV7 O;  4LFC O;  5BY1 A;  5IWA O;  3J7A U;  4LF6 O;  4DR5 O;  1HNX O; 
#chains in the Genus database with same CATH topology
 4FPP A;  4X88 A;  1YJN V;  4DR7 B;  3HKC B;  1Z5V A;  3CX5 F;  1SQX H;  2DW4 A;  2YEV A;  3RN4 A;  2MK3 A;  3C3S A;  4JGS A;  1KP2 A;  3OMA B;  4W4L A;  3QO8 A;  5J2U A;  1A32 A;  1VQ5 V;  4JI0 B;  3IAY A;  3GWO A;  5LHI A;  1G1X B;  1KU9 A;  1URF A;  1OCC C;  1S3J A;  4PDL A;  5D5Q A;  2XAJ A;  1THZ A;  2LFR A;  5JCO C;  3G6E V;  3ABU A;  3RVY A;  1VF5 B;  1E79 G;  2YDE A;  4BW5 A;  4LWS A;  2Q67 A;  2VQF O;  3OUS A;  1LUV A;  5LYJ B;  3ZBH A;  4WBN B;  1XNR B;  1R6N A;  1Y66 A;  3Q4H A;  4P2Z A;  4DR6 B;  1BE3 H;  1OZ0 A;  5H9C A;  2IBZ H;  5B1B C;  1JX9 A;  4JV5 B;  4I0X A;  2LGQ A;  3CCQ V;  4IIJ A;  3RYC A;  2YIC A;  1NH2 D;  4TSF G;  3T4D A;  4X20 B;  3UO2 A;  5JVD A;  4G28 B;  2AGA A;  4NXM O;  2R70 A;  2JIZ G;  2PI4 A;  1W0J G;  3EHB B;  4IYI A;  4OXS A;  2F4V O;  4LNU A;  5LHG A;  4LFB B;  3THO A;  4LFA B;  5FPO A;  1KC8 W;  1EFR G;  1LNQ A;  3ABK C;  2YIA A;  5L3E A;  2ARH A;  4QJF B;  4MTO A;  4JZ2 A;  1N32 B;  4D7T A;  1XHZ A;  1G6U A;  3CPW U;  1EBO A;  1IBL B;  3GVM A;  5IYC O;  4YXW G;  4UV8 A;  2B1G A;  1K4C C;  4UV9 A;  3QVN A;  4O2B B;  5BXZ A;  2OYQ A;  2Q7E A;  2Q0O C;  3LSU A;  1OCC B;  1VQ4 V;  4DR4 B;  1AI6 A;  1IUR A;  1WN7 A;  2CGN A;  3E89 A;  4MW3 A;  4RUE A;  3TET A;  4YJ2 B;  4J7J A;  3S3X A;  3KZI Z;  4PA3 A;  1MSD A;  2UUC O;  2QKA A;  5FL7 G;  1Z2G A;  5LOV B;  2UXB O;  3JAT A;  3E8H A;  5B1B B;  4U7O A;  4U3J A;  2ITD C;  3L75 H;  3IGA C;  1SES A;  3B2E E;  4YHH B;  3FB7 C;  2UXN A;  3H1K H;  4JI2 O;  3LNN A;  1EM1 A;  4K8X A;  4LFC B;  1M4U A;  3RGB A;  3D3Q A;  3SPG A;  2OIG A;  3APO A;  3JD0 A;  3L73 H;  4O2A B;  2GHY A;  3X2Q C;  1I94 O;  3E22 B;  5IY5 C;  1VQ8 V;  2E74 B;  2BSK A;  2FKX A;  2UXC B;  4GKJ O;  5DN6 G;  1EN6 A;  4FLZ A;  1YTF D;  3ABK B;  2E5L B;  3CCU V;  4IT5 A;  1J5E B;  1QR8 A;  1WP8 A;  5L3F A;  4JI7 B;  2D2C B;  3J7A U;  4B7E A;  4LF6 O;  5FNV B;  3D36 C;  1RPO A;  5IJ0 A;  4PDR A;  3JAS A;  1S5H C;  4ICG A;  2QE7 G;  3LDC A;  3OAA G;  4JYB A;  2Z0A A;  1WNS A;  1VQK V;  2WLI A;  3C3T A;  1WPX A;  1B06 A;  1KYO F;  4LH6 A;  1XEQ A;  2Q4P A;  3HKE B;  3CCR V;  3B40 A;  4X1I B;  4PA9 A;  4GYC B;  4JI8 B;  1S76 D;  4MVQ A;  4JI6 B;  4CH5 A;  1ZWI C;  1PNL A;  3OE7 G;  4JI1 O;  4AI8 A;  5KHH A;  3LDD A;  3OGC C;  3KG2 A;  4PD4 F;  2IW5 A;  1KUQ A;  2HP8 A;  4DV0 O;  3K08 A;  1Q43 A;  3P32 A;  1FD9 A;  3SYA A;  3H9V A;  2CH7 A;  4J41 A;  4CS4 A;  1N33 O;  1EZV H;  1K73 W;  1TA8 A;  3RBZ A;  4LF7 B;  2YEV B;  3FB6 C;  4P30 A;  3W7W A;  4X89 A;  3ZS8 C;  5EYP A;  1N4C A;  2QEX V;  2QTO A;  5L3D A;  4X65 B;  4GKK O;  1NJI W;  1PD3 A;  3HB3 B;  4XDL A;  2AZ2 A;  2ZQM A;  5BMV A;  3F5W C;  1TAE A;  2CTW A;  3ZRW A;  1XL4 A;  3OTO O;  2EJ7 A;  4PA7 A;  3B4S A;  3X2Q B;  4AQY B;  1VIB A;  5IY5 B;  4J9Y B;  1K7D A;  3HKC A;  4KFM A;  1YVW A;  3JAW B;  4W4K A;  1K5Q A;  3U0Z A;  3J80 N;  1L0L H;  5JJN B;  3K04 A;  3WB0 A;  4TV8 B;  3U11 A;  2UUB B;  1VEW A;  2X6C A;  3MD0 A;  2IJH A;  4JI5 O;  3JAM N;  3EVK A;  1AR4 A;  5B66 Z;  1Y6X A;  3QTC A;  4B3T B;  2Y48 A;  1H38 A;  5C8Y A;  3PJS K;  5CBH A;  1N34 B;  3JSN A;  1IBM O;  5LYJ A;  1DF5 A;  5KAF Z;  1YHQ V;  4IHJ B;  2YUA A;  3HPL C;  2Y0P A;  2ZXW C;  2ADP A;  3CCJ V;  2WLK A;  3DGE A;  1GO3 F;  3TXS A;  1N36 O;  2OCH A;  1QQC A;  4I7Z B;  2MW2 B;  4K8Z A;  1HNZ O;  2EJR A;  3RFR A;  4JYY A;  4YIP A;  1VQ7 V;  4HYO A;  2RDC A;  2ODM A;  5K1P A;  5KA5 A;  3ZX6 A;  3R66 A;  1PL0 A;  1S77 D;  2W0F C;  2ZM6 B;  3WG7 C;  2X6B A;  5CMU A;  5IYZ B;  4DUZ O;  1JR9 A;  3OW2 U;  1KQS U;  4E2L A;  1B6Q A;  2QM8 A;  5J9P C;  4B3M O;  1ZSP A;  4LCU C;  1JQ0 A;  5K1X A;  1Y74 A;  4L87 A;  1AJP A;  4DW0 A;  2HHH O;  4I5S A;  4CZZ A;  3GB7 C;  4JYA B;  2PYL A;  4C7U A;  4BWA A;  1SQF A;  2ZE7 A;  1ZAU A;  2M7W A;  4CS3 A;  1PM9 A;  4TQF A;  3H01 A;  2JJ1 G;  1IBK O;  2ZR3 A;  3K9A A;  3OEE G;  4LF9 O;  2P4K A;  2XAH A;  2YXY A;  4DR5 O;  4DO2 A;  1Q81 W;  3JSL A;  4ASU G;  1Q82 W;  4O2B A;  4XDJ A;  1JFF B;  4MW8 A;  1OJH A;  4UCU A;  4DV2 B;  2LO1 A;  1R6K A;  5B1O A;  4D7S A;  1QBZ A;  3NR7 A;  1IX9 A;  1HWY A;  4DR3 B;  5JCO A;  3ZN0 A;  1Y76 B;  4YJ2 A;  5LGU A;  5TIS Z;  3VQV A;  4BIZ A;  5LOV A;  4B3S O;  2OT5 A;  3K3W A;  4OPA A;  3ZJZ A;  4DK1 A;  2ZXW B;  2BSK B;  3VQY A;  3L9D A;  3ZIA G;  4PDM A;  3H1H H;  2XAS A;  2KB1 A;  3UQ8 A;  1GH6 A;  4DV7 B;  2FL4 A;  1BMF G;  3ZMT A;  3VQX A;  2YS8 A;  2ZIM A;  1O9G A;  4DR2 B;  3CD6 V;  4NR1 A;  1B04 A;  3SYO A;  3WG7 B;  1FJG O;  3FYI B;  3E22 A;  1XNQ B;  5D5P A;  1SC5 B;  2XAF A;  1Q6I A;  2WLI B;  2HJF C;  4DV6 B;  1GM7 A;  5DM6 V;  4UCR A;  4LF8 B;  4JPR A;  3ZHR A;  4OX9 O;  3E86 A;  1BHB A;  4QGP A;  4DV1 B;  1VQ9 V;  1XIL A;  4ZI7 A;  2DWD C;  4PI2 A;  1VQP V;  1SKV A;  4PA4 A;  3HKB B;  4HAM A;  2C2A A;  1QHT A;  4X62 B;  5GTI Z;  2DQ3 A;  1R6T A;  4DV5 O;  3VQW A;  4LF4 B;  4JAV A;  1FS0 G;  3CXH F;  4B08 A;  2HKO A;  2P06 A;  3IC9 A;  1K34 A;  4NXN B;  3FD9 A;  1HNX O;  1MA1 A;  3CYO A;  3HKE A;  3PN1 A;  1I7F A;  1ZL8 B;  4O4L B;  4X1I A;  4WF9 V;  4GLX A;  1U96 A;  5KHI A;  3CCV V;  1BSM A;  3ZED A;  5KHK A;  4I55 A;  3E83 A;  4L8J A;  4UB8 Z;  4X66 B;  3DSQ A;  4A5U B;  4RUF A;  3SPJ A;  3ZRW B;  2UUA O;  3BA8 A;  4WFA V;  1AP6 A;  1H2M A;  1H2L A;  2CUG A;  2XND G;  3N2K B;  3RYI B;  4MVR A;  2WA3 A;  2OTJ V;  3B8N A;  1EZJ A;  3T4Z A;  1VMG A;  1BT8 A;  3OM3 B;  4UVC A;  3QNE A;  2B9Z A;  4X8A A;  1F4N A;  3ETG A;  2A3Q A;  5GON B;  3P30 A;  4NTX A;  4J10 A;  4JI3 B;  4EKW A;  4BR6 A;  4YY3 O;  1H8H G;  1VQM V;  4GCZ A;  3ETD A;  2ATK C;  1RSO B;  1VQN V;  5B3S C;  1QVF U;  3JAW A;  5C8Y B;  1R3L C;  1FXH A;  1BS3 A;  1PNK A;  1KBH A;  4I9W A;  2YXH A;  3D36 A;  5ITZ A;  4KHP O;  2ZKO A;  4FJC C;  4TV8 A;  5H6Q A;  2EIM C;  3J81 N;  1FAF A;  3A0H Z;  4FIP C;  3JD1 A;  4HNA B;  2QR4 A;  5KX5 B;  4QPJ A;  2JEX A;  2UU9 O;  2WLH A;  1YI2 V;  3ZRS A;  2RNB A;  2VQF B;  5BY1 A;  3FB5 C;  1R73 A;  3U10 A;  2GUZ A;  1DGS A;  2P90 A;  2Q68 A;  2F43 G;  4DR1 O;  3LNM B;  2EIN C;  4FLX A;  4NYK A;  5H2F Z;  4IHJ A;  4CH3 A;  3N2G B;  1IXB A;  1FPO A;  2Y0I A;  3STL C;  2Q73 A;  3AG2 C;  2R72 A;  2EIK C;  4XBF A;  1AI5 A;  2B1I A;  3CCL V;  3CP1 A;  1KKC A;  1NS1 A;  1Y74 B;  1HR0 O;  4XDK A;  2F4V B;  2ZCE A;  1JOY A;  1Q7Y W;  3FYE B;  4R50 A;  3B77 A;  3JD3 A;  3AG3 C;  5L3C A;  1SQB H;  2YSU B;  3BAB A;  3T1H B;  1SZT A;  2LJ2 A;  2Q5Z A;  4JI4 O;  3MAQ A;  2R9A A;  3CEI A;  5GW7 A;  5IYZ A;  4X1Y B;  4QE7 A;  2RQ6 A;  2ZNI A;  3W7X A;  1WP7 A;  2KG7 A;  5E79 Z;  1VF6 A;  4DR4 O;  5EIB D;  1OCR C;  4QE9 A;  3ZHU A;  5EC1 C;  5CA0 A;  4JAA A;  2VRZ A;  4N21 A;  4TV9 B;  2VS0 A;  4K0K O;  1MSW D;  5B3S B;  3BAA A;  5L3B A;  4DV3 B;  5CBG A;  2BE3 A;  1NTM H;  4JTD B;  2L35 A;  4LF5 O;  1F51 A;  2QSA A;  2ZIO A;  1YZB A;  1JJ2 U;  5H6R A;  4D6T H;  1F23 A;  1V54 C;  2EIM B;  3JAR A;  4TQD A;  4BW9 A;  1JFF A;  1NBM G;  4F6R B;  3O65 A;  3IFX A;  1X4T A;  1QLE C;  1W2B U;  1XOU A;  4LFC O;  3T1C A;  4O4J B;  2UUC B;  1Y76 A;  3AEI A;  2EX3 A;  2UXB B;  3K57 A;  4CBC A;  1NQT A;  2EIN B;  1NZ6 A;  2IH3 C;  4O4I A;  3T2M A;  2VWJ A;  3OFN G;  2ITC C;  3AG2 B;  2F23 A;  3H1L H;  1IXM A;  2UXC O;  2UXD O;  3B8M A;  5CB4 B;  2EIK B;  1OCO C;  5HFL A;  5LA6 B;  5FLX N;  4TT3 G;  1M90 W;  1K5S A;  4UVB A;  5LL6 Y;  1J5E O;  1ORQ C;  2YXL A;  4ZI7 B;  1B3Q A;  1I5Y A;  3DTU B;  1M5I A;  3AG3 B;  1I94 B;  5JJJ B;  4UFZ A;  2RN9 A;  2O57 A;  4PHZ A;  1WA8 A;  4GKJ B;  4H44 B;  4CS2 A;  4X64 O;  1M9N A;  1M93 A;  2WA4 A;  1EN5 A;  1Q90 D;  1W0K G;  4KL1 A;  4FLU A;  3ASO C;  3MDS A;  1S72 V;  4LF6 B;  1E1R G;  2E3C A;  3T1Y B;  2JS5 A;  3CRQ A;  2JJ2 G;  1NVP D;  1OV9 A;  4IL6 Z;  5LMN O;  2HG5 C;  4I4T A;  2DN9 A;  1OCR B;  1W59 A;  2OTL V;  3HKB A;  1AI4 A;  2HR3 A;  4I55 B;  5EIB C;  3CMA V;  3K5L A;  2AHZ A;  1PL4 A;  1XMO O;  2N04 A;  1GN3 A;  4X1K B;  3ML0 A;  2VQE O;  1H2K A;  2Q8V A;  4FLV A;  2WLJ A;  2QM4 A;  1V54 B;  2X0L A;  3CRA A;  4FMT A;  1SQG A;  2YID A;  1ZL8 A;  4O4L A;  4JI1 B;  5LGT A;  2R9I A;  1H2G A;  5CN0 A;  2HLD G;  1GTO A;  1HNW O;  3TCU A;  1QLE B;  2CE4 A;  3JCZ A;  1SF9 A;  3SR2 C;  4DV0 B;  4HBN A;  2DMX A;  2PGG A;  1XDC A;  1RPR A;  3AK1 A;  2PZS A;  2H8P C;  3KCX A;  1VF6 C;  5E1A C;  4RQF A;  4LBE C;  4UUJ C;  4YIO A;  1BQ0 A;  2DYR C;  1SS3 A;  2PUS A;  2CAZ C;  3LDE A;  3P3P A;  3N2K A;  3RYI A;  2BTO A;  1OCO B;  3OMN B;  1KP3 A;  4GKK B;  4PDV A;  5AG2 A;  1OHH G;  1BHA A;  1LUW A;  1TVK B;  2JVD A;  4FK5 C;  3CHX A;  5ITZ B;  4LP8 A;  3P3N A;  2DQ0 A;  4WFH A;  4FM1 A;  3OTO B;  3BFR A;  4RWU A;  5GON A;  4WFB V;  3M8A A;  4JYC A;  1RP3 B;  4K35 A;  2YC0 A;  4DV4 O;  2EIJ C;  3BVO A;  1YJ9 V;  1AJQ A;  1WJZ A;  2CTQ A;  1K9M W;  3LSQ A;  4DXW A;  1F7Y A;  3ASO B;  1RSO A;  2GUZ B;  2V7Q G;  3BHP A;  1P4R A;  1K33 A;  1YEW A;  3KKY A;  4AIL C;  2DOS A;  3DC5 A;  4J42 A;  2ZD9 A;  3L70 H;  4JI5 B;  2QJ1 A;  3C90 A;  4R7C A;  1TGO A;  5EZY B;  3QF7 A;  2GTA A;  5GTH Z;  2CDY A;  2ZE5 A;  4U7N A;  4GX1 A;  4FM0 A;  4HNA A;  2X6A A;  1AR5 A;  1WAZ A;  5KMG A;  5KX5 A;  4MSW C;  5IE9 A;  2EIL C;  2IJI A;  1GKF A;  1H2N A;  1O9H A;  3VOU A;  2HJD A;  4KXR A;  1IBM B;  1XHX A;  3TXQ A;  1AJN A;  2RCV A;  5J2T A;  1AB3 A;  2JDI G;  1QR9 A;  2GDS A;  2GTS A;  1TUB B;  1L0N H;  3N2G A;  3KCY A;  4ZHQ A;  3WB1 A;  5IJ9 B;  1P49 A;  5JH7 B;  1DK1 A;  3OD4 A;  4ZKI A;  5JQG A;  1HNZ B;  5IWA O;  3K0D A;  2KG7 B;  2NN4 A;  5EBL C;  2HFE C;  1I0H A;  1GAX A;  2DE0 X;  4FLT A;  1T5E A;  4JF3 A;  1YIT V;  5CA0 B;  2DYR B;  4Z2W A;  2YI9 A;  3CWB H;  4DUZ B;  2D3O W;  1D5N A;  2N05 A;  1X59 A;  2EBO A;  1VQO V;  3E8F A;  3ZHV A;  5BR8 O;  2N74 A;  4B3M B;  5IYD O;  1AP5 A;  4X1Y A;  4DUY O;  3SPC A;  3E2E A;  3JAR B;  5EC2 C;  3TK1 A;  3ZHQ A;  1MMM A;  3G6B A;  4E4E A;  2HHH B;  2L6L A;  1S0V A;  3QG5 A;  3CRC A;  2EIJ B;  3OEH G;  1NKD A;  4OPH A;  1IBK B;  4LF9 B;  4TV9 A;  4B3R B;  1PNM A;  1KMI Z;  3AG4 C;  4DR5 B;  1CP9 A;  4FFB A;  1IDS A;  4O4I B;  4GT1 A;  3UT5 B;  2DYS C;  2QKC A;  5BZB A;  5KLV H;  1NVP B;  4F6R A;  3QO5 A;  3L72 H;  2GBO A;  3D3I A;  3N27 A;  3F7Y C;  3RT3 C;  2P6J A;  2EIL B;  2XTA A;  3IC7 A;  1MNG A;  3AK2 A;  4QNH B;  2XHB A;  1WPB A;  4O4J A;  4EFE A;  4UCT A;  4B3S B;  1K8A W;  2JGU A;  3JYC A;  3K03 A;  2QWO B;  1Q6U A;  4JTA B;  1XMQ O;  1QLN A;  5LGN A;  4YJ3 B;  3ZRV A;  5LMU O;  4WFF A;  1KD1 W;  1WA8 B;  1MAB G;  1YCI A;  5B1N A;  3L71 H;  3AG7 A;  5CB4 A;  4LH7 A;  5LA6 A;  4CC5 A;  2OCC C;  2WSS G;  4O4H B;  4J80 A;  3TJT A;  4I4T B;  1BL8 A;  2F1M A;  3DXR B;  3OTF A;  4DRX B;  4I9Q A;  3CRR A;  2A0L A;  3CXC U;  2GSM B;  4MVO A;  4BIU A;  2CTP A;  1FJG B;  1PKX A;  3JAK A;  4QPK A;  1WLE A;  4LF4 O;  3ZCC A;  4ZOL B;  2JGD B;  3UCS C;  4OX9 B;  1E1Q G;  1G8M A;  4LR3 A;  1K92 A;  2A7W A;  1MOF A;  5KUM A;  2RJZ A;  1Q86 W;  4H37 A;  1PPJ H;  4U3F H;  1I08 A;  3M99 B;  2QWQ B;  2AZ0 A;  3WFV A;  5LHH A;  2NNU A;  2XOK G;  4DV5 B;  3K5N A;  3ZMS A;  3UKM A;  4IGG A;  2FML A;  1LR1 A;  2QKS A;  3AG4 B;  3QO7 A;  4MVM A;  3W7U A;  4RO2 A;  1HNX B;  3CME V;  1CXZ B;  4X1K A;  1QNM A;  2Q7H A;  4EB6 B;  1VF7 A;  3SYP A;  2WLL B;  2DYS B;  4DR7 O;  1ROP A;  1HW7 A;  1M56 C;  2AHY A;  2LQT A;  2AW9 A;  5H5N A;  4UB6 Z;  4NTW A;  1XL6 A;  4ZBM A;  3K58 A;  4P9P A;  1NTK H;  2B5U A;  3RWR D;  1FFT B;  3SYQ A;  2Z3Y A;  3CC2 V;  4JI0 O;  1S5J A;  5A2Q N;  1UJW B;  2UUA B;  4PV1 B;  2A9H A;  2EUL A;  3CJH B;  4LC1 A;  1ZX3 A;  4JI3 O;  4NB5 A;  3JAL B;  1Y67 A;  4TOI A;  4MS2 A;  4UXN A;  1GN4 A;  2HEP A;  3BA9 A;  3TGU H;  1XI1 A;  2OCC B;  1VQ6 V;  3IJ4 A;  5LP6 C;  1TVK A;  1IZ3 A;  1XNR O;  4DR6 O;  4J7K A;  1KEC A;  1YJW V;  3APQ A;  3BPZ A;  4YY3 B;  4JV5 O;  4UVA A;  4P9O A;  2CK3 G;  1JPX A;  1H8E G;  1DF4 A;  5IDJ A;  5KMG B;  1Q3E A;  3CSX A;  2RMK B;  5J2T B;  2KSD A;  4KHP B;  1YF2 A;  4N23 A;  2XAG A;  4FFK A;  4G27 B;  5C93 A;  4EEQ A;  4LFB O;  5CA1 B;  1HDJ A;  1N0J A;  4ZHQ B;  3B09 A;  4LFA O;  3EFF K;  4WCE V;  2VWK A;  5EZY A;  2WAM A;  1P84 F;  4GUN A;  5JQG B;  2UU9 B;  2PTM A;  2ZNJ A;  4NXM B;  1H2S B;  2K9P A;  2ZDI A;  4J7Z A;  3OT7 A;  2HVJ C;  3FAV A;  3L74 H;  1N32 O;  1F4M A;  4DR1 B;  4B7K A;  5KHG A;  2BTQ B;  1SRY A;  2QM7 A;  1FXV A;  2LP7 A;  1M56 B;  3T1H O;  3AG1 C;  4TWK A;  3RYF B;  2W0X A;  3A0B Z;  1QVG U;  1IBL O;  1TUB A;  2CGO A;  3EXA A;  4KUM A;  2ILM A;  4MVS A;  4FLY A;  5IJ9 A;  3SGI A;  2WWW A;  4ABM A;  5JH7 A;  3CC7 V;  1XRE A;  1SA0 B;  2E76 B;  5B5E Z;  1HR0 B;  1S5L Z;  2AXT Z;  2PF4 E;  4DK0 A;  2LW7 A;  1QU7 A;  2H94 A;  1P7G A;  2ADQ B;  1FFX B;  4H13 B;  4JI4 B;  2W6I G;  4JZG A;  2XT9 A;  4JAU A;  4DV3 O;  2F93 B;  4PEL A;  4KP4 A;  2PYJ A;  3CE2 A;  4FFB B;  3E8G A;  5EK0 A;  5LP6 B;  2P67 A;  1MZF A;  1R3K C;  2Q6A A;  3K79 A;  4MVU A;  1SQP H;  3RYH B;  2Y4T A;  1HP8 A;  2P4V A;  1JCH A;  3SJB C;  4K0K B;  3H1J H;  1R3J C;  2GV9 A;  2QTS A;  3ZMV A;  4YHH O;  1G4Y B;  4LF5 B;  3ABT A;  4X9Q A;  3FX7 A;  3RW0 A;  1I5X A;  3OGI B;  4J11 A;  4F4L A;  4GZR B;  4UCV A;  1GMG A;  1YDX A;  2FTK A;  4Z1V A;  2QGN A;  1GM8 A;  1FXK A;  2H3O A;  4GX2 A;  2WLN A;  3UT5 A;  3LSS A;  4UCS A;  3HKD B;  2ZT9 B;  4JI2 B;  1Z5W A;  2E5L O;  4UCO A;  3ZN1 A;  4JI7 O;  1NR1 A;  4G2K A;  3G71 V;  1NI8 A;  3BEH A;  4CH6 A;  2QWN B;  2JRI A;  4WFG A;  3A0R A;  2ZE6 A;  3AG1 B;  3JAK B;  4MT8 A;  1VP7 A;  1V55 C;  4YJ3 A;  3I55 V;  1NTZ H;  2R9R B;  2UXD B;  3MHH C;  3STZ C;  3K59 A;  4Q6G A;  2P7T C;  4RAI A;  4TUY B;  3CS5 A;  3T1Y O;  1JA8 A;  4O4H A;  1ARO P;  1KKD A;  2ZR2 A;  1ENV A;  4JI8 O;  5IYB O;  3DXR A;  3JCU Z;  1GN2 A;  4JI6 O;  2DWE C;  2K1E A;  4DRX A;  3ABL C;  4X64 B;  1PP9 H;  3R65 A;  2YIB A;  4I50 A;  3BCC H;  1UFI A;  4ZOL A;  3G80 A;  3ICX A;  4FZ1 A;  3AK3 A;  2JGD A;  2OWO A;  2ZDI C;  3E8B A;  1DLB A;  2Q69 A;  5LMN B;  1Q8I A;  1M57 C;  1BQZ A;  4CH4 A;  3G67 A;  4LF7 O;  1NU1 H;  3SPI A;  1XUQ A;  2IJK A;  3RVZ A;  2V1D A;  3UM7 A;  5CBF A;  1DTO A;  3DC6 A;  1XMO B;  1NT2 B;  2P22 C;  3F7V C;  4NTY A;  5KAI Z;  3H1I H;  1US6 A;  5LXT B;  4X65 O;  2VQE B;  4MTX A;  2Q7G A;  3UO3 A;  3CRM A;  5DEC A;  4WFE A;  4FZ0 A;  1P7B A;  1N33 B;  2YIB D;  5B1A C;  4EB6 A;  3MHS C;  2WLL A;  4AQY O;  1XBL A;  3E35 A;  4RQE A;  1HNW B;  1K4D C;  4BIO A;  5J2U B;  1YIJ V;  1BZK A;  5L3G A;  3W7T A;  2BOB C;  1NH2 B;  2X7R B;  5EBW C;  5JWP A;  2NLJ C;  2Q0A A;  3ASN C;  5F2V O;  1RM1 C;  1IVS A;  5CA3 A;  1FKA O;  1YXB A;  2QDO A;  2UUB O;  3CJH A;  4PI0 A;  1COW G;  1V55 B;  3JAL A;  3W7S A;  3ETE A;  4MVZ A;  4LWS B;  4B3T O;  3D8C A;  3SJA C;  3G4S V;  3ETQ A;  1AR1 B;  4NVP A;  4QIW F;  1ZLZ A;  4F6E A;  5KA6 A;  3JD4 A;  3Q4H B;  2JEU A;  1SQV H;  1N34 O;  4NKG B;  3SYC A;  3CCS V;  5KUK A;  1MZE A;  1FXK C;  4CC6 A;  2BOC C;  2A79 B;  4I0X B;  3OUF A;  2QA4 V;  2E75 B;  4IIJ B;  1R1B A;  3RYC B;  4DV4 B;  3ABL B;  5JJE B;  2PY5 A;  4DW1 A;  1Y4M A;  2OIE A;  1U97 A;  5JVD B;  3ABM C;  2F95 B;  1AVM A;  2KKW A;  3FAV B;  1JJO A;  4WBN A;  4LNU B;  1XQ8 A;  5LBQ A;  3F5T A;  1M57 B;  3K5O A;  1SZX A;  1GN6 A;  2ZM6 O;  5CA1 A;  4BAY A;  1N36 B;  4X20 A;  1D5A A;  2W6J G;  3SDL A;  1V9P A;  3I56 V;  4AHC A;  2LGW A;  1ZTE A;  2WPD G;  1BCC H;  1NR7 A;  4Q20 A;  4Z1M G;  1YSC A;  5B1A B;  1N0N A;  5A9G A;  2BTQ A;  1FYJ A;  2FYU H;  4JYA O;  3S3W A;  2CTR A;  1TUE B;  1CEZ A;  1ZUQ A;  2Y4U A;  3ZRX A;  2M6Y A;  3RYF A;  1WB7 A;  1JMK C;  1CPY A;  2ZIN A;  4ZIB A;  5IWA B;  2V4D A;  4MTG A;  3SPH A;  3O9O A;  3K06 A;  2EZP A;  1K3E A;  3ASN B;  1SA0 A;  1RM1 B;  3WU2 Z;  1BGY H;  3ZHT A;  3CCE V;  4R8C A;  3SJQ C;  2Y69 C;  3FB8 C;  2PI5 A;  4DV2 O;  3ZMZ A;  1OCZ C;  1AIL A;  1FFX A;  4R6Z A;  1KB9 F;  5FPR A;  2IU3 A;  5BR8 B;  3OR6 C;  2DJV A;  4DR3 O;  4B3R O;  3LUT B;  1SER A;  4IYH A;  3JAT B;  4DUY B;  1YTF B;  1UPG A;  3K9S A;  2XAQ A;  1FXK B;  4U3J B;  5LP6 A;  3BY6 A;  4DYL A;  3CB2 A;  3OMI B;  3RYH A;  1Q6H A;  2Q9L A;  2JS3 A;  2KQX A;  1M1K W;  3BRC A;  3ABM B;  4PA6 A;  4DV7 O;  5DED A;  2ZE8 A;  2YI8 A;  4PJ0 Z;  1Q5O A;  2LFS A;  1EN4 A;  2JK5 C;  4FVM A;  1GRJ A;  3K5M A;  4J9Z B;  4MTF A;  3WB2 A;  4DR2 O;  4OGQ B;  2A06 H;  4FM2 A;  1SQQ H;  3VBB A;  2IJJ A;  2QWR B;  1R3I C;  2XUM A;  2ETN A;  1XNQ O;  1L1F A;  4DV6 O;  3CC4 V;  3A8T A;  3HKD A;  1MG1 A;  4LF8 O;  4FLW A;  2QWP B;  1PV0 A;  3K0G A;  2IH1 C;  2EZO A;  5IJ0 B;  4H0L B;  4DV1 O;  4EFB A;  1VQL V;  1XMQ B;  2IU0 A;  3JAS B;  1GM9 A;  2IM9 A;  5LMU B;  4O2A A;  1J95 A;  4X62 O;  3A2F A;  1JVM A;  4I50 B;  2NR5 A;  5EBM C;  5KHJ A;  2G38 A;  1GK9 A;  3HR0 A;  4NXN O;  3FFQ A;  1AI7 A;  5FNV A;  1VAR A;  4TUY A;  2Y69 B;  2FB5 A;  2LW1 A;  2UXX A;  5HFM A;  1OCZ B;  1RFY A;  2F66 C;  3SJC C;  3CCM V;  3I5D A;  4JTC B;  4GX5 A;  3NXS A;  4GX0 A;  2BCC H;  4X66 O;  1SET A;  1K97 A;  2Z5U A;  4H33 A;  2CH7 B;  3ZMU A;  1L8D A;  1D2D A;  4JAS A;  2P5O A;  3JD2 A;  1WB8 A;  5EYP B;  3FKS G;  3M7M X;  4K3A A;  2HVK C;  2WLM A;  4HZ3 A;  5IT9 N;  1N8R W;  3OR7 C;  3ZHS A;  5BMV B;  5LXT A;  3GWK C;  1QCE A; 
#chains in the Genus database with same CATH homology
 1XNR O;  4DR6 O;  3F5T A;  4DR1 O;  4DR2 O;  2ZM6 O;  4JV5 O;  4JI5 O;  3JAM N;  4LF7 O;  2Z0A A;  1XNQ O;  2UXC O;  4LF4 O;  2UXD O;  1X59 A;  4YHH O;  4DV6 O;  5FLX N;  5BR8 O;  2N74 A;  5LL6 Y;  4X65 O;  4LF8 O;  1A32 A;  1J5E O;  3SDL A;  1XEQ A;  5BXZ A;  1NS1 A;  4A5U B;  4DUY O;  1IBM O;  1HR0 O;  2UUA O;  4DV1 O;  4B3S O;  1G1X B;  4OPA A;  3M8A A;  1FYJ A;  4AQY O;  4LFB O;  4JI1 O;  4JYA O;  4LFA O;  4X62 O;  4DV4 O;  4OPH A;  1N36 O;  4JI4 O;  4X64 O;  1F7Y A;  1KUQ A;  2E5L O;  1HNZ O;  4DV0 O;  2VQF O;  2UUC O;  4JI7 O;  4NXN O;  2UXB O;  3R66 A;  1N32 O;  2DOS A;  5LMN O;  1FKA O;  2UUB O;  2JRI A;  1N33 O;  4DR4 O;  4DR7 O;  4YY3 O;  4DV2 O;  3T1H O;  1IBL O;  1FJG O;  1AIL A;  5H5N A;  4DUZ O;  4K0K O;  4JI2 O;  1XMO O;  3RT3 C;  4B3T O;  4B3R O;  2DJV A;  4DR3 O;  4GKK O;  4OX9 O;  4LF5 O;  4B3M O;  2VQE O;  1YZB A;  4JI0 O;  2AGA A;  4X66 O;  3T1Y O;  5A2Q N;  1N34 O;  4NXM O;  1D2D A;  2LW7 A;  4KHP O;  2ZKO A;  2F4V O;  1AB3 A;  3J81 N;  4JI3 O;  3OTO O;  1XMQ O;  4JI8 O;  2HHH O;  1I94 O;  1R1B A;  5LMU O;  4JI6 O;  3O65 A;  2FKX A;  1R6T A;  4DV5 O;  1HNW O;  4GKJ O;  5IT9 N;  1IBK O;  1DK1 A;  4LF9 O;  4DV3 O;  2UU9 O;  3J80 N;  4DV7 O;  4LFC O;  5BY1 A;  5IWA O;  3J7A U;  4LF6 O;  4DR5 O;  1HNX O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...