4DV7O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv7O00
4LFCO 4YY3O 2F4VO 5A2QN 1I94O 4JI2O 3RT3C 5H5NA 4JI3O 4JI6O 4JI0O 3T1YO 4NXMO 2HHHO 4DV3O 2UUCO 4DV0O 1IBKO 2N74A 1NS1A 4OPAA 2LW7A 5LMUO 4X66O 4DV7O 1A32A 4LF8O 1N36O 4DUZO 4JI1O 1IBLO 4B3MO 4DV4O 1R6TA 4JV5O 1X59A 3OTOO 4JI4O 1HNWO 4DR7O 1F7YA 1XMQO 4B3SO 1HNZO 2DJVA 2UUAO 5IT9N 1D2DA 4DR2O 4AQYO 3J81N 1AILA 2Z0AA 1HR0O 4DR6O 4DV1O 4B3TO 1FKAO 4LFAO 1XNQO 2VQEO 4DR5O 4DR1O 4JI5O 1YZBA 4GKJO 4NXNO 2ZKOA 3F5TA 1N32O 2UXCO 2UUBO 1AB3A 4K0KO 4LF9O 4LF5O 4X62O 5LMNO 4LF4O 3R66A 2E5LO 1IBMO 5BY1A 3O65A 4DUYO 1XMOO 1KUQA 4DV6O 1J5EO 4JYAO 3J7AU 4JI8O 4GKKO 1XNRO 5FLXN 4X65O 4DR3O 4JI7O 2FKXA 2AGAA 4LFBO 3J80N 2ZM6O 1XEQA 4OPHA 1R1BA 3SDLA 3M8AA 4KHPO 4B3RO 4LF6O 3JAMN 5IWAO 5BR8O 2UXDO 1HNXO 4DR4O 5LL6Y 4LF7O 2UU9O 4X64O 1G1XB 4DV5O 1N34O 3T1HO 4DV2O 2DOSA 1FYJA 4A5UB 1DK1A 5BXZA 2JRIA 4OX9O 2VQFO 1FJGO 4YHHO 1N33O 2UXBO
chains in the Genus database with same CATH superfamily
1K34A 1QLNA 1E1RG 4CC5A 4DR4B 1JCHA 1PL0A 1FFTB 2Q6AA 3VBBA 1SZXA 4G2KA 2XAQA 4JZGA 3IC9A 3TGUH 3CP1A 1S5JA 4YIOA 4AHCA 4QGPA 5EK0A 1X59A 4J9YB 2CTWA 3FFQA 4FFBA 1HNZO 1AROP 1S76D 1QR9A 3JATB 1KQSU 4LF6B 5JVDB 1SQFA 4DR6O 1BQ0A 1NT2B 4TQFA 3ASNC 1EZVH 4DV1O 4B3TO 4QJFB 1VF6C 3RYIB 4X66B 3JASA 4LF8B 4WBNA 3W7XA 2YXYA 2DW4A 1WB8A 1AB3A 5EBMC 3OTOB 4LF9O 3AG2C 2Q7HA 2OIGA 1N8RW 5EBLC 4U7OA 2UUAB 2ETNA 1JR9A 1VQ8V 5H6QA 1NTMH 1J5EO 2Y4TA 2VQEB 1J95A 4GX0A 1I5XA 1BZKA 3ZMZA 2ZCEA 1GN2A 2EIMB 1V54B 1M9NA 2BTQA 4O4HB 1QLEC 4B3MB 3ETQA 5KMGA 2ZM6O 1K73W 1M1KW 1PNMA 1IZ3A 1Y74B 1K4CC 5FNVA 2XT9A 2X6BA 4GX2A 1L8DA 2NR5A 1XMOB 2VWKA 3F7YC 4FM2A 1N34O 4PJ0Z 1VQLV 3KG2A 1P7BA 4KFMA 3E8BA 4QE9A 3AG4C 5A2QN 1N0NA 4CBCA 2X0LA 1NVPB 1KC8W 4HZ3A 1G4YB 4JYBA 3L71H 3FYIB 1JJOA 1B06A 4J41A 2UXNA 4CH3A 1N36O 5KHIA 3K04A 4I0XB 4JI1O 3HKBA 1M5IA 3OMIB 3QTCA 1KECA 4UB6Z 1D5AA 3APOA 3CC7V 2HVKC 1YHQV 2IBZH 1MABG 4YY3B 2CUGA 4CH5A 1H2MA 4GUNA 2DJVA 2UUCB 4DV3B 2GBOA 1F4MA 2V1DA 1G6UA 4UFZA 2D2CB 1BE3H 2DYRC 2ZNIA 1ZTEA 1PD3A 2GDSA 3ZMVA 4MVZA 4DV5B 1WA8A 4B7EA 3OUSA 2OT5A 2WLJA 4PELA 1K9MW 1ZLZA 3JALB 1Q8IA 3ZRSA 4LFCB 3CCVV 5LMNO 3ZIAG 4NTXA 4JI0B 3LSUA 5JCOC 3KCYA 4UCUA 2A9HA 3ABKC 1YI2V 2NLJC 3B8NA 4OPHA 1RPRA 1NI8A 4X20B 4F6EA 2ZD9A 4LF5B 3JD3A 1VP7A 2MK3A 2ILMA 3K59A 2QA4V 4I50B 3T4ZA 4X1IA 4WFAV 2RQ6A 3CCLV 3CYOA 1VQKV 3T2MA 1Z2GA 3H1KH 4EFBA 2IU3A 1L0LH 3CJHB 4OX9O 2KG7B 2WA3A 4O2BB 3C90A 4O2AA 2ZE7A 1I94O 2Z3YA 1SA0B 5JJNB 3ZCCA 2QE7G 1NH2D 4TUYB 2FL4A 4E4EA 2Q7GA 1DTOA 5LXTB 3ZEDA 1NR1A 2LW7A 3LDDA 5CN0A 1MMMA 1ENVA 4JV5O 2R72A 3JCZA 2KKWA 1ZL8A 4NB5A 3HKDA 2VS0A 3HPLC 3CE2A 3B2EE 1CP9A 4JI4O 1U97A 4B3SO 1NTKH 4KHPB 4ZI7A 2ADPA 1ZWIC 1H2KA 3UO2A 4DR2O 1HNXB 1MOFA 2A06H 2YEVB 5L3EA 4HAMA 1SQXH 3ZS8C 2QKSA 2LO1A 1Y76A 4O4LB 1W0KG 4PI0A 1JPXA 2WWWA 4DV4B 3OR7C 2L35A 4PA6A 1RM1B 1GMGA 1R6KA 2IU0A 1S5LZ 4NXMB 2P4VA 3CSXA 1R3LC 4TV9B 3L70H 5B3SB 1SRYA 4P2ZA 4MVMA 4UV9A 2LP7A 1WNSA 1SQGA 4JI7O 2FKXA 4HNAA 4EFEA 1WAZA 1W0JG 3ZMSA 3TK1A 5GONB 1BHAA 2GUZA 4JGSA 1KMIZ 4I4TA 5CB4B 2JVDA 4LF4B 4B7KA 5LL6Y 2R9AA 4X1KB 5IY5C 3FB7C 2ZE8A 4U3JA 2FB5A 1S5HC 3N2KB 4X65B 4GKJB 5TISZ 1K92A 3K9AA 4ABMA 4WF9V 1LR1A 1N4CA 4NKGB 1QHTA 1VQ7V 4IT5A 2DN9A 2EILC 4UV8A 4DV0O 2EJ7A 1AI5A 3EHBB 5CA0A 1UFIA 4TV8B 2QM4A 4DW0A 1HWYA 4FLVA 2G38A 2AHYA 1Z5WA 1EBOA 2YIDA 1K33A 2XTAA 2Y48A 4FZ1A 4YHHB 1PP9H 4P30A 5LOVA 2PI5A 2A0LA 5BR8B 2UXDB 3GB7C 3A8TA 4I55A 4J42A 2OYQA 1AILA 4LF7B 1URFA 3HKCB 2BCCH 1CPYA 2YI9A 1ZX3A 1VEWA 1P49A 1SC5B 4RUFA 1FJGB 4CS3A 1LUVA 3KCXA 3BFRA 1M56C 1K3EA 1GN3A 3THOA 3C3TA 1KUQA 2YC0A 3K57A 4GKKO 4PHZA 3ML0A 4NR1A 4LR3A 1B6QA 2P22C 1BCCH 2Q5ZA 1XL6A 2E75B 2CH7B 3UT5B 1FAFA 3LNNA 5LYJA 4LF6O 5IWAO 2JK5C 1R3JC 5BMVB 1VQ4V 5IDJA 1GN6A 4EKWA 3K5OA 2HJDA 4K8XA 2ZXWC 2DOSA 4CZZA 3SJBC 3OGIB 1XBLA 4ICGA 3ABLB 5L3CA 1H2GA 3WB2A 1MSWD 1KD1W 4YJ3B 5J2TB 1FPOA 4PV1B 4JI3O 1M93A 4W4LA 3CCSV 1O9HA 3IFXA 3FB5C 4PDMA 1NS1A 1M57B 1A32A 1H2SB 2XHBA 4J7KA 3RYFB 2PZSA 3CCJV 2QDOA 1VQPV 4B3MO 2JGDB 5KHGA 2IM9A 2QWRB 2HG5C 2WAMA 1HNWO 3WG7C 2DYSB 2QSAA 3TCUA 5BZBA 1QBZA 5JQGB 3ZHQA 1XNQO 2GTSA 1I0HA 3ZMUA 4OXSA 5KUMA 1SKVA 1IBLB 5LGTA 2ZKOA 3ASOB 2YS8A 4K3AA 1N32O 4KP4A 4G27B 4IL6Z 2OCCB 1SQBH 1OCOC 3F7VC 2UXBB 1EN5A 2H3OA 5LA6B 4BIOA 2BOBC 2WLKA 3ZRWA 4LP8A 2X6AA 3UO3A 4AQYB 1VQ5V 5IJ0B 1HR0B 3D3QA 3WB0A 2UXXA 1F51A 5IJ9B 4Z1MG 4UCRA 4NXNB 2F95B 3JSLA 3G4SV 2ZNJA 3X2QC 2OWOA 1MZFA 3QO7A 4LCUC 3G71V 4HYOA 4B3RO 2XASA 1DGSA 1OCRB 2IW5A 4L87A 1GM8A 2EIKC 3E22B 3AK3A 3HB3B 5DEDA 3DXRA 3FAVB 4FIPC 1G8MA 2PUSA 3SPCA 3ZMTA 4GX5A 4DV5O 2ZDIA 3GVMA 3JATA 1XNRB 2Q4PA 1SS3A 3N2GA 5JVDA 1SZTA 1BSMA 3RYIA 1Y66A 5B1AC 2KSDA 2LGWA 3D36A 4LFCO 4WFEA 2YXHA 3W7UA 4LWSB 3RT3C 2UUBB 4JI0O 2B5UA 1IBKO 1YSCA 2DQ3A 4X1YB 4IHJA 4Q20A 2Y69C 1KU9A 4GYCB 1WPXA 2WLLB 3E8GA 4JI8B 3ZHUA 4EB6B 4H33A 2WLHA 1LNQA 1XMQO 1SQPH 3ZJZA 4O4JB 2RMKB 3T1YB 2Q7EA 1QU7A 2UU9B 4LFAO 2F43G 2NNUA 5L3DA 4DR1O 4XDJA 3CWBH 3K0GA 3P3NA 1ROPA 4BAYA 4JAUA 2IJHA 2VQFB 5HFLA 1YTFD 4U3FH 2QTSA 2HVJC 4BIZA 3VOUA 2Q67A 1IXMA 2EZPA 3APQA 2CGOA 1BL8A 1WLEA 1WP7A 3A0BZ 4W4KA 2CTQA 3MHSC 1Q81W 4LFBO 2M7WA 4IYIA 4I0XA 2CGNA 4KHPO 3ZX6A 3JAMN 5IYDO 3HKEA 1HNXO 3P32A 1AR4A 5B66Z 1G1XB 2A79B 4UB8Z 3W7TA 2AW9A 2VRZA 1AP5A 3FB8C 4P9OA 1QCEA 2R9IA 3AG2B 1NTZH 2OCHA 5KUKA 1PNLA 4JI6O 5IYBO 4NXMO 3DTUB 4KXRA 1BQZA 4F4LA 4JYCA 2JS3A 4J7ZA 4DRXB 4NYKA 3AG3C 2AZ2A 3KZIZ 4RQEA 1Q86W 4JASA 4IIJB 3NXSA 4K8ZA 4G28B 4MS2A 2WLIA 4XBFA 4X20A 4MVSA 1LUWA 4FFBB 4GKJO 4YJ2B 3T1HB 4ASUG 4FJCC 4D6TH 4MVRA 4R50A 1R3KC 3STLC 1KKDA 1SERA 4XDLA 1Q3EA 1XUQA 4DR7B 5J9PC 2EJRA 3CJHA 4MTOA 3K03A 2KG7A 3G6BA 3IC7A 4R6ZA 4DV6O 2IJIA 1SA0A 3B8MA 3EFFK 5LP6B 1SESA 5FLXN 1Q90D 1BGYH 4DK0A 1L1FA 1NVPD 5LXTA 3IGAC 1N0JA 2BOCC 4E2LA 4JPRA 4NTWA 4TQDA 1NQTA 1TUBA 5BR8O 2UXDO 3CCMV 4JTAB 2LW1A 4LF7O 2BTQB 2YI8A 2E5LB 1AI7A 4JAAA 3B77A 5CBHA 4X9QA 4JYAB 4GCZA 4TWKA 4XDKA 4DO2A 2Q68A 1QVGU 1EFRG 3JD4A 3OD4A 1FJGO 1N33O 2O57A 3BRCA 4GZRB 3ABMC 4MTFA 5KHJA 1JX9A 4K0KB 1GN4A 3OFNG 2QGNA 1JJ2U 3CRCA 1PV0A 2PYLA 4DUYB 1DF5A 1YEWA 3JD1A 4L8JA 3CPWU 4DR3B 4JYYA 1NBMG 4FLZA 3L74H 1OCZC 3ZHVA 3D8CA 2K1EA 2PI4A 4RUEA 3G6EV 5GONA 1OHHG 2Z0AA 3JARA 4DR5O 5EC2C 1KKCA 5HFMA 3S3WA 5IYZB 4X1KA 1ZUQA 1ZSPA 5A9GA 1AR1B 1JA8A 2CAZC 5EZYB 5K1PA 4JZ2A 1NZ6A 4F6RB 4MW8A 5B1NA 1V55B 3IJ4A 3N2KA 3K58A 1RSOB 5CA3A 3I55V 3SYQA 1YXBA 2W0FC 5B1BC 3TXQA 2P6JA 2V7QG 4DV1B 1Q82W 4I9WA 1EM1A 4RQFA 1RFYA 2IH1C 4TT3G 1TGOA 2A7WA 4UVAA 4UCVA 1KB9F 4UVBA 4TV8A 5EBWC 4LF9B 2RCVA 5LGNA 2F93B 3ZHSA 2EZOA 1YJNV 3L9DA 1J5EB 2EULA 5KHKA 2ZR3A 2ZR2A 2Q8VA 1X4TA 3B4SA 1M4UA 3HKCA 2UXBO 3L72H 2Q73A 1QR8A 3JYCA 2HHHO 1AVMA 2XAJA 3SR2C 1M90W 2L6LA 4C7UA 3TETA 2HR3A 1IBMB 2CTRA 3SGIA 5KLVH 4DUZO 2ZT9B 2JDIG 3UM7A 1XILA 2QWQB 3W7SA 4JTDB 5FPRA 3CCEV 1SF9A 4WFFA 4QNHB 5H6RA 5IY5B 2R70A 3CCRV 4PA7A 3JD2A 2CH7A 3UT5A 2EINC 1TVKA 1TAEA 1D5NA 4O4IB 1N36B 5BMVA 2WLMA 2JJ2G 3STZC 4JI1B 4DYLA 3F5TA 4DK1A 2UXCO 2UUBO 3CMEV 4UCOA 4X62O 1WB7A 1AR5A 2D3OW 3RW0A 2XAGA 1FXVA 5BY1A 3VQXA 3E8HA 4YJ3A 5J2TA 3H01A 1L0NH 4CS2A 4JI8O 5EIBD 2YIBA 3FKSG 2FYUH 2P7TC 4UVCA 4PDLA 3RYFA 1R1BA 3N27A 4KUMA 4CC6A 2IJJA 2JGDA 5LMNB 4DR4O 1TUEB 5J2UB 2UU9O 3AG7A 2YUAA 5KAFZ 4PDVA 4IGGA 1VARA 2QR4A 3U10A 2EIJC 2ARHA 5C8YB 3ZRVA 3BVOA 3OR6C 4H13B 5JQGA 2VQFO 3K79A 4U3JB 3MAQA 2DWEC 1M56B 1HDJA 1H38A 1WPBA 1K5QA 2BE3A 3T1CA 1JMKC 1IX9A 1R6NA 3OW2U 3SYPA 5B1OA 5CBFA 1IXBA 4X66O 2V4DA 5LA6A 4LF8O 5KA5A 4RWUA 1FFXB 3M99B 5E1AC 3QVNA 3OTOO 2Y4UA 3BA8A 5IJ9A 1I94B 4H0LB 4D7SA 3CX5F 2UUAO 2XNDG 3ETDA 3W7WA 3J81N 2ZXWB 3ETEA 4ZOLB 1FKAO 2VQEO 4I7ZB 3RGBA 1YF2A 1WJZA 3MHHC 4KL1A 2GSMB 4DXWA 3E22A 1HW7A 1ZAUA 3FAVA 3SJCC 2ZE5A 1HP8A 3RBZA 1JQ0A 3SYCA 1EN4A 1OJHA 4JI4B 4UUJC 3RYCB 3QG5A 4TOIA 1BT8A 2QTOA 2DYSC 2N05A 3NR7A 1YCIA 2JIZG 3JAKA 1XMOO 4LWSA 5LHIA 1FXKB 4P9PA 4DV7B 3UKMA 1JVMA 1Y4MA 2Q0AA 2AHZA 2W6JG 4X1YA 2QKCA 1V9PA 2QEXV 1U96A 5H9CA 5CA1B 3IAYA 2YIBD 2WLLA 1EN6A 3EVKA 5GTIZ 4MT8A 1UJWB 1Q6UA 4EB6A 1Q5OA 4PD4F 2E76B 2PTMA 1MG1A 5ITZB 4O4JA 3CRQA 3T1HO 5LYJB 2XAFA 3RWRD 2CK3G 4JI7B 4JI5B 3CS5A 3DGEA 1OCOB 3ZHTA 2JRIA 4YY3O 1OV9A 1NU1H 2EBOA 1XHZA 1VIBA 4WCEV 3AG1B 2UUCO 4DV3O 1PNKA 4FZ0A 1UPGA 2F66C 1AJNA 3CRMA 1GM9A 2P06A 2GTAA 2BTOA 5GW7A 1OCCC 1F7YA 2YXLA 1YJWV 1KP3A 1DF4A 2Z5UA 2EX3A 3JSNA 3BHPA 4FPPA 3KKYA 1VF6A 1YZBA 2CTPA 3LDEA 3Q4HB 2LGQA 2FTKA 4DV2B 1O9GA 4MSWC 2FMLA 4YIPA 1XHXA 1GO3F 4PI2A 4NTYA 4K0KO 2W6IG 3BCCH 4LF5O 1R73A 2F4VB 4O4HA 2MW2B 3E89A 4I9QA 4DUYO 1XREA 2ODMA 4FLXA 1Y74A 3OT7A 4GX1A 4DR3O 2P5OA 2AGAA 1B04A 5KAIZ 3LSSA 3OAAG 3ZHRA 3SDLA 1KBHA 4Q6GA 4DRXA 3WU2Z 3U0ZA 3JCUZ 4JAVA 2QJ1A 2ZDIC 2LJ2A 3P3PA 3RVYA 1NJIW 5AG2A 2BSKB 4GKKB 2YDEA 1SETA 4IIJA 4MTGA 5EYPB 4TSFG 4MVUA 3JAWB 1DK1A 2GHYA 4X88A 3D36C 3MDSA 3DXRB 3DSQA 4WFBV 3OEHG 3MD0A 3SPIA 4YJ2A 1JFFB 3N2GB 5IWAB 3E86A 3ASNB 4WFHA 2DQ0A 1H2LA 3WFVA 4BW5A 1Y6XA 3SPGA 5L3BA 2B1IA 3LUTB 2X6CA 1VF5B 3K08A 1Q6IA 1MZEA 4FM0A 5LHHA 4J7JA 3CXHF 3GWKC 2H8PC 4FLUA 3K3WA 2JGUA 4QPJA 4DV4O 4ZHQB 5JH7B 4IHJB 5LP6A 3G67A 2EIMC 1V54C 2Y0IA 2Q69A 2R9RB 1PKXA 5LHGA 3SJQC 1H8HG 5KX5B 4NVPA 4JI3B 2HJFC 1IVSA 3RYHB 5JWPA 1MSDA 5E79Z 3JALA 1RPOA 3ABUA 4LNUB 1IDSA 1Q43A 3SPJA 4X64B 3K5NA 1QLEB 3CB2A 5LBQA 1H2NA 3B09A 2LFSA 4UXNA 1CXZB 3UQ8A 3OM3B 3FX7A 4LH6A 3I56V 1HNWB 5LGUA 4LF4O 4JI2B 1YITV 3R66A 1IBMO 2CDYA 2ZIMA 3K5LA 1XNQB 5LMUB 3AG3B 2XAHA 4X65O 4PA9A 4UCSA 5JCOA 5DN6G 2RN9A 5JJJB 3AG4B 4I50A 5IE9A 1KYOF 1XEQA 3K5MA 1N32B 4J9ZB 3L75H 3CRAA 1NKDA 3A0HZ 1YVWA 3JASB 2QWNB 3ZN0A 4GT1A 4WBNB 1VMGA 4O2BA 1WN7A 1VQ9V 1FYJA 2AZ0A 3E8FA 3HKEB 4TUYA 5LP6C 1KP2A 4YHHO 2JEUA 5IYZA 4B3RB 2XUMA 5D5QA 4AILC 5EZYA 3H1IH 2N74A 2DYRB 1GRJA 4F6RA 5KMGB 1RSOA 1S3JA 3OMAB 2JEXA 2B9ZA 4N23A 2P90A 3OUFA 5FL7G 5FNVB 2YEVA 3E83A 3H1LH 1AI6A 4BW9A 2AXTZ 3A2FA 1US6A 3BEHA 5GTHZ 3E35A 3BPZA 4O4LA 1D2DA 2PF4E 1IBKB 4IYHA 2OTJV 1IURA 3ZN1A 1NH2B 1Q7YW 3PJSK 3ABKB 1YJ9V 3VQYA 4RO2A 3CD6V 3BA9A 4GLXA 3ABMB 1R3IC 1S72V 4AI8A 4TV9A 2WLIB 1S0VA 1E79G 3ICXA 1K97A 4H37A 1XMQB 1SQVH 2Q9LA 2XOKG 3HKBB 1VQOV 3CCQV 4U7NA 3CEIA 4LFAB 2QM8A 3C3SA 2ATKC 2LQTA 4EEQA 4DR1B 3RN4A 5CB4A 4R7CA 1PM9A 4J10A 2CE4A 1OCZB 4K35A 2ZE6A 3J80N 3SJAC 2RDCA 2X7RB 2E3CA 2Q0OC 3DC5A 3HR0A 1HNZB 1V55C 4CH6A 1K4DC 1WA8B 1XDCA 2RJZA 4J11A 1Q6HA 2E74B 2ITDC 1I5YA 4DR6B 1H8EG 4WFGA 4YXWG 4B3TB 2A3QA 1T5EA 1E1QG 2HFEC 1TUBB 5F2VO 3R65A 2VWJA 3SYOA 2Y0PA 4LFBB 4ZBMA 1YIJV 1FD9A 3RFRA 1VQ6V 1QNMA 4O4IA 5B1BB 3LNMB 2LFRA 5H5NA 4HBNA 2PY5A 1RM1C 5FPOA 5K1XA 4DV7O 1SQQH 4FFKA 2DMXA 5B3SC 1IBLO 4I5SA 2YIAA 3ETGA 3P30A 4X1IB 2ZM6B 1VQNV 4ZKIA 1I7FA 4JI6B 5IT9N 2ADQB 4AQYO 2YSUB 1HR0O 1GH6A 3A0RA 2QKAA 4O2AB 4JI5O 4LC1A 4OGQB 1N34B 5J2UA 4NXNO 3QO5A 3OTFA 2IH3C 4FM1A 5C93A 3QF7A 3SYAA 3ZBHA 1YDXA 3JARB 2P4KA 3H1JH 1XL4A 4J80A 3CMAV 5C8YA 5EIBC 1CEZA 2K9PA 4PA4A 1GKFA 3B40A 4N21A 3ABTA 3CC2V 4BWAA 1ZL8B 3HKDB 4X89A 5IYCO 1XNRO 1AJQA 2JS5A 3UCSC 2B1GA 4FVMA 4ZIBA 4ZI7B 3CRRA 1XQ8A 1K8AW 1COWG 2F1MA 1I08A 4PA3A 2EILB 4LH7A 1FFXA 4LBEC 2EINB 4QPKA 4FLWA 1Y76B 3WB1A 2YICA 3OMNB 3EXAA 3OE7G 1P4RA 4DV6B 3GWOA 1MNGA 4DV2O 3K0DA 3PN1A 1P84F 4QIWF 1XOUA 2N04A 4ZOLA 4QE7A 2F4VO 5B5EZ 5KHHA 4FLTA 1K7DA 3F5WC 3T1YO 4HNAB 2OIEA 1GAXA 2QWPB 4OPAA 2F23A 3CC4V 3OGCC 1QVFU 1FXHA 3RYCA 1B3QA 5KA6A 2GUZB 2C2AA 2HLDG 1VQMV 4I4TB 3K9SA 3BY6A 1P7GA 4Z1VA 1FXKA 1N33B 1DLBA 4MVOA 4MVQA 4DW1A 2M6YA 2HKOA 3D3IA 3O9OA 4JTCB 2WLNA 3DC6A 5CA1A 2EIJB 1K5SA 4CH4A 2QWOB 2W0XA 2ITCC 4PDRA 1BS3A 3OEEG 5IJ0A 4OX9B 5CA0B 5ITZA 1TVKB 3TXSA 1Z5VA 2H94A 3ABLC 3H1HH 1Y67A 3VQWA 3M7MX 4FMTA 5DM6V 2KB1A 2DE0X 2GV9A 3J7AU 4DR5B 3BAAA 1GM7A 2ZIOA 5L3GA 1M57C 2JJ1G 1OZ0A 3QNEA 4FK5C 5LOVB 5EC1C 4I55B 4JV5B 3CXCU 1S77D 1BMFG 3VQVA 4B3SB 3SPHA 5L3FA 3AEIA 3CCUV 4H44B 1QQCA 4DR2B 4BR6A 4X64O 2KQXA 1F4NA 3AK2A 2QM7A 5DECA 3CHXA 1BHBA 1FXKC 2ZINA 3WG7B 2WSSG 1FS0G 2P67A 3ASOC 4JI2O 3Q4HA 4D7TA 2ZQMA 3T4DA 2OCCC 3LDCA 3QO8A 4MW3A 5LMUO 3JD0A 4X8AA 3E2EA 1W59A 1EZJA 1R6TA 1AJPA 4DR7O 5H2FZ 3AK1A 4JF3A 1F23A 3FD9A 1PL4A 1XI1A 5JJEB 1GK9A 2WPDG 2HHHB 2PYJA 1JOYA 3U11A 1NR7A 3AG1C 1OCRC 3BABA 4UCTA 4BIUA 2DWDC 1MA1A 3G80A 2HEPA 2IJKA 2WA4A 4DUZB 4FLYA 3X2QB 2PGGA 3LSQA 1W2BU 4RAIA 2BSKA 2EIKB 5EYPA 3JAWA 3S3XA 2E5LO 1GTOA 3I5DA 3O65A 4DV0B 5CBGA 1PPJH 4JYAO 1JFFA 3FB6C 1AI4A 1WP8A 1OCCB 3TJTA 2RNBA 5B1AB 3H9VA 4CS4A 3JAKB 5CMUA 2OTLV 2UXCB 1ORQC 4B08A 4Z2WA 3M8AA 1VF7A 4X62B 2NN4A 1THZA 3L73H 2Y69B 1RP3B 2HP8A 3RVZA 4ZHQA 3K06A 3FYEB 5JH7A 1YTFB 1AP6A 5D5PA 4MTXA 5KX5A 1TA8A 3RYHA 4A5UB 3ZRXA 5BXZA 3ZRWB 4LNUA 4R8CA
chains in the Genus database with same CATH topology
4LFCO 4YY3O 2F4VO 5A2QN 1I94O 4JI2O 3RT3C 5H5NA 4JI3O 4JI6O 4JI0O 3T1YO 4NXMO 2HHHO 4DV3O 2UUCO 4DV0O 1IBKO 2N74A 1NS1A 4OPAA 2LW7A 5LMUO 4X66O 4DV7O 1A32A 4LF8O 1N36O 4DUZO 4JI1O 1IBLO 4B3MO 4DV4O 1R6TA 4JV5O 1X59A 3OTOO 4JI4O 1HNWO 4DR7O 1F7YA 1XMQO 4B3SO 1HNZO 2DJVA 2UUAO 5IT9N 1D2DA 4DR2O 4AQYO 3J81N 1AILA 2Z0AA 1HR0O 4DR6O 4DV1O 4B3TO 1FKAO 4LFAO 1XNQO 2VQEO 4DR5O 4DR1O 4JI5O 1YZBA 4GKJO 4NXNO 2ZKOA 3F5TA 1N32O 2UXCO 2UUBO 1AB3A 4K0KO 4LF9O 4LF5O 4X62O 5LMNO 4LF4O 3R66A 2E5LO 1IBMO 5BY1A 3O65A 4DUYO 1XMOO 1KUQA 4DV6O 1J5EO 4JYAO 3J7AU 4JI8O 4GKKO 1XNRO 5FLXN 4X65O 4DR3O 4JI7O 2FKXA 2AGAA 4LFBO 3J80N 2ZM6O 1XEQA 4OPHA 1R1BA 3SDLA 3M8AA 4KHPO 4B3RO 4LF6O 3JAMN 5IWAO 5BR8O 2UXDO 1HNXO 4DR4O 5LL6Y 4LF7O 2UU9O 4X64O 1G1XB 4DV5O 1N34O 3T1HO 4DV2O 2DOSA 1FYJA 4A5UB 1DK1A 5BXZA 2JRIA 4OX9O 2VQFO 1FJGO 4YHHO 1N33O 2UXBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC O;  4YY3 O;  2F4V O;  5A2Q N;  1I94 O;  4JI2 O;  3RT3 C;  5H5N A;  4JI3 O;  4JI6 O;  4JI0 O;  3T1Y O;  4NXM O;  2HHH O;  4DV3 O;  2UUC O;  4DV0 O;  1IBK O;  2N74 A;  1NS1 A;  4OPA A;  2LW7 A;  5LMU O;  4X66 O;  4DV7 O;  1A32 A;  4LF8 O;  1N36 O;  4DUZ O;  4JI1 O;  1IBL O;  4B3M O;  4DV4 O;  1R6T A;  4JV5 O;  1X59 A;  3OTO O;  4JI4 O;  1HNW O;  4DR7 O;  1F7Y A;  1XMQ O;  4B3S O;  1HNZ O;  2DJV A;  2UUA O;  5IT9 N;  1D2D A;  4DR2 O;  4AQY O;  3J81 N;  1AIL A;  2Z0A A;  1HR0 O;  4DR6 O;  4DV1 O;  4B3T O;  1FKA O;  4LFA O;  1XNQ O;  2VQE O;  4DR5 O;  4DR1 O;  4JI5 O;  1YZB A;  4GKJ O;  4NXN O;  2ZKO A;  3F5T A;  1N32 O;  2UXC O;  2UUB O;  1AB3 A;  4K0K O;  4LF9 O;  4LF5 O;  4X62 O;  5LMN O;  4LF4 O;  3R66 A;  2E5L O;  1IBM O;  5BY1 A;  3O65 A;  4DUY O;  1XMO O;  1KUQ A;  4DV6 O;  1J5E O;  4JYA O;  3J7A U;  4JI8 O;  4GKK O;  1XNR O;  5FLX N;  4X65 O;  4DR3 O;  4JI7 O;  2FKX A;  2AGA A;  4LFB O;  3J80 N;  2ZM6 O;  1XEQ A;  4OPH A;  1R1B A;  3SDL A;  3M8A A;  4KHP O;  4B3R O;  4LF6 O;  3JAM N;  5IWA O;  5BR8 O;  2UXD O;  1HNX O;  4DR4 O;  5LL6 Y;  4LF7 O;  2UU9 O;  4X64 O;  1G1X B;  4DV5 O;  1N34 O;  3T1H O;  4DV2 O;  2DOS A;  1FYJ A;  4A5U B;  1DK1 A;  5BXZ A;  2JRI A;  4OX9 O;  2VQF O;  1FJG O;  4YHH O;  1N33 O;  2UXB O; 
#chains in the Genus database with same CATH topology
 1K34 A;  1QLN A;  1E1R G;  4CC5 A;  4DR4 B;  1JCH A;  1PL0 A;  1FFT B;  2Q6A A;  3VBB A;  1SZX A;  4G2K A;  2XAQ A;  4JZG A;  3IC9 A;  3TGU H;  3CP1 A;  1S5J A;  4YIO A;  4AHC A;  4QGP A;  5EK0 A;  1X59 A;  4J9Y B;  2CTW A;  3FFQ A;  4FFB A;  1HNZ O;  1ARO P;  1S76 D;  1QR9 A;  3JAT B;  1KQS U;  4LF6 B;  5JVD B;  1SQF A;  4DR6 O;  1BQ0 A;  1NT2 B;  4TQF A;  3ASN C;  1EZV H;  4DV1 O;  4B3T O;  4QJF B;  1VF6 C;  3RYI B;  4X66 B;  3JAS A;  4LF8 B;  4WBN A;  3W7X A;  2YXY A;  2DW4 A;  1WB8 A;  1AB3 A;  5EBM C;  3OTO B;  4LF9 O;  3AG2 C;  2Q7H A;  2OIG A;  1N8R W;  5EBL C;  4U7O A;  2UUA B;  2ETN A;  1JR9 A;  1VQ8 V;  5H6Q A;  1NTM H;  1J5E O;  2Y4T A;  2VQE B;  1J95 A;  4GX0 A;  1I5X A;  1BZK A;  3ZMZ A;  2ZCE A;  1GN2 A;  2EIM B;  1V54 B;  1M9N A;  2BTQ A;  4O4H B;  1QLE C;  4B3M B;  3ETQ A;  5KMG A;  2ZM6 O;  1K73 W;  1M1K W;  1PNM A;  1IZ3 A;  1Y74 B;  1K4C C;  5FNV A;  2XT9 A;  2X6B A;  4GX2 A;  1L8D A;  2NR5 A;  1XMO B;  2VWK A;  3F7Y C;  4FM2 A;  1N34 O;  4PJ0 Z;  1VQL V;  3KG2 A;  1P7B A;  4KFM A;  3E8B A;  4QE9 A;  3AG4 C;  5A2Q N;  1N0N A;  4CBC A;  2X0L A;  1NVP B;  1KC8 W;  4HZ3 A;  1G4Y B;  4JYB A;  3L71 H;  3FYI B;  1JJO A;  1B06 A;  4J41 A;  2UXN A;  4CH3 A;  1N36 O;  5KHI A;  3K04 A;  4I0X B;  4JI1 O;  3HKB A;  1M5I A;  3OMI B;  3QTC A;  1KEC A;  4UB6 Z;  1D5A A;  3APO A;  3CC7 V;  2HVK C;  1YHQ V;  2IBZ H;  1MAB G;  4YY3 B;  2CUG A;  4CH5 A;  1H2M A;  4GUN A;  2DJV A;  2UUC B;  4DV3 B;  2GBO A;  1F4M A;  2V1D A;  1G6U A;  4UFZ A;  2D2C B;  1BE3 H;  2DYR C;  2ZNI A;  1ZTE A;  1PD3 A;  2GDS A;  3ZMV A;  4MVZ A;  4DV5 B;  1WA8 A;  4B7E A;  3OUS A;  2OT5 A;  2WLJ A;  4PEL A;  1K9M W;  1ZLZ A;  3JAL B;  1Q8I A;  3ZRS A;  4LFC B;  3CCV V;  5LMN O;  3ZIA G;  4NTX A;  4JI0 B;  3LSU A;  5JCO C;  3KCY A;  4UCU A;  2A9H A;  3ABK C;  1YI2 V;  2NLJ C;  3B8N A;  4OPH A;  1RPR A;  1NI8 A;  4X20 B;  4F6E A;  2ZD9 A;  4LF5 B;  3JD3 A;  1VP7 A;  2MK3 A;  2ILM A;  3K59 A;  2QA4 V;  4I50 B;  3T4Z A;  4X1I A;  4WFA V;  2RQ6 A;  3CCL V;  3CYO A;  1VQK V;  3T2M A;  1Z2G A;  3H1K H;  4EFB A;  2IU3 A;  1L0L H;  3CJH B;  4OX9 O;  2KG7 B;  2WA3 A;  4O2B B;  3C90 A;  4O2A A;  2ZE7 A;  1I94 O;  2Z3Y A;  1SA0 B;  5JJN B;  3ZCC A;  2QE7 G;  1NH2 D;  4TUY B;  2FL4 A;  4E4E A;  2Q7G A;  1DTO A;  5LXT B;  3ZED A;  1NR1 A;  2LW7 A;  3LDD A;  5CN0 A;  1MMM A;  1ENV A;  4JV5 O;  2R72 A;  3JCZ A;  2KKW A;  1ZL8 A;  4NB5 A;  3HKD A;  2VS0 A;  3HPL C;  3CE2 A;  3B2E E;  1CP9 A;  4JI4 O;  1U97 A;  4B3S O;  1NTK H;  4KHP B;  4ZI7 A;  2ADP A;  1ZWI C;  1H2K A;  3UO2 A;  4DR2 O;  1HNX B;  1MOF A;  2A06 H;  2YEV B;  5L3E A;  4HAM A;  1SQX H;  3ZS8 C;  2QKS A;  2LO1 A;  1Y76 A;  4O4L B;  1W0K G;  4PI0 A;  1JPX A;  2WWW A;  4DV4 B;  3OR7 C;  2L35 A;  4PA6 A;  1RM1 B;  1GMG A;  1R6K A;  2IU0 A;  1S5L Z;  4NXM B;  2P4V A;  3CSX A;  1R3L C;  4TV9 B;  3L70 H;  5B3S B;  1SRY A;  4P2Z A;  4MVM A;  4UV9 A;  2LP7 A;  1WNS A;  1SQG A;  4JI7 O;  2FKX A;  4HNA A;  4EFE A;  1WAZ A;  1W0J G;  3ZMS A;  3TK1 A;  5GON B;  1BHA A;  2GUZ A;  4JGS A;  1KMI Z;  4I4T A;  5CB4 B;  2JVD A;  4LF4 B;  4B7K A;  5LL6 Y;  2R9A A;  4X1K B;  5IY5 C;  3FB7 C;  2ZE8 A;  4U3J A;  2FB5 A;  1S5H C;  3N2K B;  4X65 B;  4GKJ B;  5TIS Z;  1K92 A;  3K9A A;  4ABM A;  4WF9 V;  1LR1 A;  1N4C A;  4NKG B;  1QHT A;  1VQ7 V;  4IT5 A;  2DN9 A;  2EIL C;  4UV8 A;  4DV0 O;  2EJ7 A;  1AI5 A;  3EHB B;  5CA0 A;  1UFI A;  4TV8 B;  2QM4 A;  4DW0 A;  1HWY A;  4FLV A;  2G38 A;  2AHY A;  1Z5W A;  1EBO A;  2YID A;  1K33 A;  2XTA A;  2Y48 A;  4FZ1 A;  4YHH B;  1PP9 H;  4P30 A;  5LOV A;  2PI5 A;  2A0L A;  5BR8 B;  2UXD B;  3GB7 C;  3A8T A;  4I55 A;  4J42 A;  2OYQ A;  1AIL A;  4LF7 B;  1URF A;  3HKC B;  2BCC H;  1CPY A;  2YI9 A;  1ZX3 A;  1VEW A;  1P49 A;  1SC5 B;  4RUF A;  1FJG B;  4CS3 A;  1LUV A;  3KCX A;  3BFR A;  1M56 C;  1K3E A;  1GN3 A;  3THO A;  3C3T A;  1KUQ A;  2YC0 A;  3K57 A;  4GKK O;  4PHZ A;  3ML0 A;  4NR1 A;  4LR3 A;  1B6Q A;  2P22 C;  1BCC H;  2Q5Z A;  1XL6 A;  2E75 B;  2CH7 B;  3UT5 B;  1FAF A;  3LNN A;  5LYJ A;  4LF6 O;  5IWA O;  2JK5 C;  1R3J C;  5BMV B;  1VQ4 V;  5IDJ A;  1GN6 A;  4EKW A;  3K5O A;  2HJD A;  4K8X A;  2ZXW C;  2DOS A;  4CZZ A;  3SJB C;  3OGI B;  1XBL A;  4ICG A;  3ABL B;  5L3C A;  1H2G A;  3WB2 A;  1MSW D;  1KD1 W;  4YJ3 B;  5J2T B;  1FPO A;  4PV1 B;  4JI3 O;  1M93 A;  4W4L A;  3CCS V;  1O9H A;  3IFX A;  3FB5 C;  4PDM A;  1NS1 A;  1M57 B;  1A32 A;  1H2S B;  2XHB A;  4J7K A;  3RYF B;  2PZS A;  3CCJ V;  2QDO A;  1VQP V;  4B3M O;  2JGD B;  5KHG A;  2IM9 A;  2QWR B;  2HG5 C;  2WAM A;  1HNW O;  3WG7 C;  2DYS B;  2QSA A;  3TCU A;  5BZB A;  1QBZ A;  5JQG B;  3ZHQ A;  1XNQ O;  2GTS A;  1I0H A;  3ZMU A;  4OXS A;  5KUM A;  1SKV A;  1IBL B;  5LGT A;  2ZKO A;  3ASO B;  2YS8 A;  4K3A A;  1N32 O;  4KP4 A;  4G27 B;  4IL6 Z;  2OCC B;  1SQB H;  1OCO C;  3F7V C;  2UXB B;  1EN5 A;  2H3O A;  5LA6 B;  4BIO A;  2BOB C;  2WLK A;  3ZRW A;  4LP8 A;  2X6A A;  3UO3 A;  4AQY B;  1VQ5 V;  5IJ0 B;  1HR0 B;  3D3Q A;  3WB0 A;  2UXX A;  1F51 A;  5IJ9 B;  4Z1M G;  4UCR A;  4NXN B;  2F95 B;  3JSL A;  3G4S V;  2ZNJ A;  3X2Q C;  2OWO A;  1MZF A;  3QO7 A;  4LCU C;  3G71 V;  4HYO A;  4B3R O;  2XAS A;  1DGS A;  1OCR B;  2IW5 A;  4L87 A;  1GM8 A;  2EIK C;  3E22 B;  3AK3 A;  3HB3 B;  5DED A;  3DXR A;  3FAV B;  4FIP C;  1G8M A;  2PUS A;  3SPC A;  3ZMT A;  4GX5 A;  4DV5 O;  2ZDI A;  3GVM A;  3JAT A;  1XNR B;  2Q4P A;  1SS3 A;  3N2G A;  5JVD A;  1SZT A;  1BSM A;  3RYI A;  1Y66 A;  5B1A C;  2KSD A;  2LGW A;  3D36 A;  4LFC O;  4WFE A;  2YXH A;  3W7U A;  4LWS B;  3RT3 C;  2UUB B;  4JI0 O;  2B5U A;  1IBK O;  1YSC A;  2DQ3 A;  4X1Y B;  4IHJ A;  4Q20 A;  2Y69 C;  1KU9 A;  4GYC B;  1WPX A;  2WLL B;  3E8G A;  4JI8 B;  3ZHU A;  4EB6 B;  4H33 A;  2WLH A;  1LNQ A;  1XMQ O;  1SQP H;  3ZJZ A;  4O4J B;  2RMK B;  3T1Y B;  2Q7E A;  1QU7 A;  2UU9 B;  4LFA O;  2F43 G;  2NNU A;  5L3D A;  4DR1 O;  4XDJ A;  3CWB H;  3K0G A;  3P3N A;  1ROP A;  4BAY A;  4JAU A;  2IJH A;  2VQF B;  5HFL A;  1YTF D;  4U3F H;  2QTS A;  2HVJ C;  4BIZ A;  3VOU A;  2Q67 A;  1IXM A;  2EZP A;  3APQ A;  2CGO A;  1BL8 A;  1WLE A;  1WP7 A;  3A0B Z;  4W4K A;  2CTQ A;  3MHS C;  1Q81 W;  4LFB O;  2M7W A;  4IYI A;  4I0X A;  2CGN A;  4KHP O;  3ZX6 A;  3JAM N;  5IYD O;  3HKE A;  1HNX O;  3P32 A;  1AR4 A;  5B66 Z;  1G1X B;  2A79 B;  4UB8 Z;  3W7T A;  2AW9 A;  2VRZ A;  1AP5 A;  3FB8 C;  4P9O A;  1QCE A;  2R9I A;  3AG2 B;  1NTZ H;  2OCH A;  5KUK A;  1PNL A;  4JI6 O;  5IYB O;  4NXM O;  3DTU B;  4KXR A;  1BQZ A;  4F4L A;  4JYC A;  2JS3 A;  4J7Z A;  4DRX B;  4NYK A;  3AG3 C;  2AZ2 A;  3KZI Z;  4RQE A;  1Q86 W;  4JAS A;  4IIJ B;  3NXS A;  4K8Z A;  4G28 B;  4MS2 A;  2WLI A;  4XBF A;  4X20 A;  4MVS A;  1LUW A;  4FFB B;  4GKJ O;  4YJ2 B;  3T1H B;  4ASU G;  4FJC C;  4D6T H;  4MVR A;  4R50 A;  1R3K C;  3STL C;  1KKD A;  1SER A;  4XDL A;  1Q3E A;  1XUQ A;  4DR7 B;  5J9P C;  2EJR A;  3CJH A;  4MTO A;  3K03 A;  2KG7 A;  3G6B A;  3IC7 A;  4R6Z A;  4DV6 O;  2IJI A;  1SA0 A;  3B8M A;  3EFF K;  5LP6 B;  1SES A;  5FLX N;  1Q90 D;  1BGY H;  4DK0 A;  1L1F A;  1NVP D;  5LXT A;  3IGA C;  1N0J A;  2BOC C;  4E2L A;  4JPR A;  4NTW A;  4TQD A;  1NQT A;  1TUB A;  5BR8 O;  2UXD O;  3CCM V;  4JTA B;  2LW1 A;  4LF7 O;  2BTQ B;  2YI8 A;  2E5L B;  1AI7 A;  4JAA A;  3B77 A;  5CBH A;  4X9Q A;  4JYA B;  4GCZ A;  4TWK A;  4XDK A;  4DO2 A;  2Q68 A;  1QVG U;  1EFR G;  3JD4 A;  3OD4 A;  1FJG O;  1N33 O;  2O57 A;  3BRC A;  4GZR B;  3ABM C;  4MTF A;  5KHJ A;  1JX9 A;  4K0K B;  1GN4 A;  3OFN G;  2QGN A;  1JJ2 U;  3CRC A;  1PV0 A;  2PYL A;  4DUY B;  1DF5 A;  1YEW A;  3JD1 A;  4L8J A;  3CPW U;  4DR3 B;  4JYY A;  1NBM G;  4FLZ A;  3L74 H;  1OCZ C;  3ZHV A;  3D8C A;  2K1E A;  2PI4 A;  4RUE A;  3G6E V;  5GON A;  1OHH G;  2Z0A A;  3JAR A;  4DR5 O;  5EC2 C;  1KKC A;  5HFM A;  3S3W A;  5IYZ B;  4X1K A;  1ZUQ A;  1ZSP A;  5A9G A;  1AR1 B;  1JA8 A;  2CAZ C;  5EZY B;  5K1P A;  4JZ2 A;  1NZ6 A;  4F6R B;  4MW8 A;  5B1N A;  1V55 B;  3IJ4 A;  3N2K A;  3K58 A;  1RSO B;  5CA3 A;  3I55 V;  3SYQ A;  1YXB A;  2W0F C;  5B1B C;  3TXQ A;  2P6J A;  2V7Q G;  4DV1 B;  1Q82 W;  4I9W A;  1EM1 A;  4RQF A;  1RFY A;  2IH1 C;  4TT3 G;  1TGO A;  2A7W A;  4UVA A;  4UCV A;  1KB9 F;  4UVB A;  4TV8 A;  5EBW C;  4LF9 B;  2RCV A;  5LGN A;  2F93 B;  3ZHS A;  2EZO A;  1YJN V;  3L9D A;  1J5E B;  2EUL A;  5KHK A;  2ZR3 A;  2ZR2 A;  2Q8V A;  1X4T A;  3B4S A;  1M4U A;  3HKC A;  2UXB O;  3L72 H;  2Q73 A;  1QR8 A;  3JYC A;  2HHH O;  1AVM A;  2XAJ A;  3SR2 C;  1M90 W;  2L6L A;  4C7U A;  3TET A;  2HR3 A;  1IBM B;  2CTR A;  3SGI A;  5KLV H;  4DUZ O;  2ZT9 B;  2JDI G;  3UM7 A;  1XIL A;  2QWQ B;  3W7S A;  4JTD B;  5FPR A;  3CCE V;  1SF9 A;  4WFF A;  4QNH B;  5H6R A;  5IY5 B;  2R70 A;  3CCR V;  4PA7 A;  3JD2 A;  2CH7 A;  3UT5 A;  2EIN C;  1TVK A;  1TAE A;  1D5N A;  4O4I B;  1N36 B;  5BMV A;  2WLM A;  2JJ2 G;  3STZ C;  4JI1 B;  4DYL A;  3F5T A;  4DK1 A;  2UXC O;  2UUB O;  3CME V;  4UCO A;  4X62 O;  1WB7 A;  1AR5 A;  2D3O W;  3RW0 A;  2XAG A;  1FXV A;  5BY1 A;  3VQX A;  3E8H A;  4YJ3 A;  5J2T A;  3H01 A;  1L0N H;  4CS2 A;  4JI8 O;  5EIB D;  2YIB A;  3FKS G;  2FYU H;  2P7T C;  4UVC A;  4PDL A;  3RYF A;  1R1B A;  3N27 A;  4KUM A;  4CC6 A;  2IJJ A;  2JGD A;  5LMN B;  4DR4 O;  1TUE B;  5J2U B;  2UU9 O;  3AG7 A;  2YUA A;  5KAF Z;  4PDV A;  4IGG A;  1VAR A;  2QR4 A;  3U10 A;  2EIJ C;  2ARH A;  5C8Y B;  3ZRV A;  3BVO A;  3OR6 C;  4H13 B;  5JQG A;  2VQF O;  3K79 A;  4U3J B;  3MAQ A;  2DWE C;  1M56 B;  1HDJ A;  1H38 A;  1WPB A;  1K5Q A;  2BE3 A;  3T1C A;  1JMK C;  1IX9 A;  1R6N A;  3OW2 U;  3SYP A;  5B1O A;  5CBF A;  1IXB A;  4X66 O;  2V4D A;  5LA6 A;  4LF8 O;  5KA5 A;  4RWU A;  1FFX B;  3M99 B;  5E1A C;  3QVN A;  3OTO O;  2Y4U A;  3BA8 A;  5IJ9 A;  1I94 B;  4H0L B;  4D7S A;  3CX5 F;  2UUA O;  2XND G;  3ETD A;  3W7W A;  3J81 N;  2ZXW B;  3ETE A;  4ZOL B;  1FKA O;  2VQE O;  4I7Z B;  3RGB A;  1YF2 A;  1WJZ A;  3MHH C;  4KL1 A;  2GSM B;  4DXW A;  3E22 A;  1HW7 A;  1ZAU A;  3FAV A;  3SJC C;  2ZE5 A;  1HP8 A;  3RBZ A;  1JQ0 A;  3SYC A;  1EN4 A;  1OJH A;  4JI4 B;  4UUJ C;  3RYC B;  3QG5 A;  4TOI A;  1BT8 A;  2QTO A;  2DYS C;  2N05 A;  3NR7 A;  1YCI A;  2JIZ G;  3JAK A;  1XMO O;  4LWS A;  5LHI A;  1FXK B;  4P9P A;  4DV7 B;  3UKM A;  1JVM A;  1Y4M A;  2Q0A A;  2AHZ A;  2W6J G;  4X1Y A;  2QKC A;  1V9P A;  2QEX V;  1U96 A;  5H9C A;  5CA1 B;  3IAY A;  2YIB D;  2WLL A;  1EN6 A;  3EVK A;  5GTI Z;  4MT8 A;  1UJW B;  1Q6U A;  4EB6 A;  1Q5O A;  4PD4 F;  2E76 B;  2PTM A;  1MG1 A;  5ITZ B;  4O4J A;  3CRQ A;  3T1H O;  5LYJ B;  2XAF A;  3RWR D;  2CK3 G;  4JI7 B;  4JI5 B;  3CS5 A;  3DGE A;  1OCO B;  3ZHT A;  2JRI A;  4YY3 O;  1OV9 A;  1NU1 H;  2EBO A;  1XHZ A;  1VIB A;  4WCE V;  3AG1 B;  2UUC O;  4DV3 O;  1PNK A;  4FZ0 A;  1UPG A;  2F66 C;  1AJN A;  3CRM A;  1GM9 A;  2P06 A;  2GTA A;  2BTO A;  5GW7 A;  1OCC C;  1F7Y A;  2YXL A;  1YJW V;  1KP3 A;  1DF4 A;  2Z5U A;  2EX3 A;  3JSN A;  3BHP A;  4FPP A;  3KKY A;  1VF6 A;  1YZB A;  2CTP A;  3LDE A;  3Q4H B;  2LGQ A;  2FTK A;  4DV2 B;  1O9G A;  4MSW C;  2FML A;  4YIP A;  1XHX A;  1GO3 F;  4PI2 A;  4NTY A;  4K0K O;  2W6I G;  3BCC H;  4LF5 O;  1R73 A;  2F4V B;  4O4H A;  2MW2 B;  3E89 A;  4I9Q A;  4DUY O;  1XRE A;  2ODM A;  4FLX A;  1Y74 A;  3OT7 A;  4GX1 A;  4DR3 O;  2P5O A;  2AGA A;  1B04 A;  5KAI Z;  3LSS A;  3OAA G;  3ZHR A;  3SDL A;  1KBH A;  4Q6G A;  4DRX A;  3WU2 Z;  3U0Z A;  3JCU Z;  4JAV A;  2QJ1 A;  2ZDI C;  2LJ2 A;  3P3P A;  3RVY A;  1NJI W;  5AG2 A;  2BSK B;  4GKK B;  2YDE A;  1SET A;  4IIJ A;  4MTG A;  5EYP B;  4TSF G;  4MVU A;  3JAW B;  1DK1 A;  2GHY A;  4X88 A;  3D36 C;  3MDS A;  3DXR B;  3DSQ A;  4WFB V;  3OEH G;  3MD0 A;  3SPI A;  4YJ2 A;  1JFF B;  3N2G B;  5IWA B;  3E86 A;  3ASN B;  4WFH A;  2DQ0 A;  1H2L A;  3WFV A;  4BW5 A;  1Y6X A;  3SPG A;  5L3B A;  2B1I A;  3LUT B;  2X6C A;  1VF5 B;  3K08 A;  1Q6I A;  1MZE A;  4FM0 A;  5LHH A;  4J7J A;  3CXH F;  3GWK C;  2H8P C;  4FLU A;  3K3W A;  2JGU A;  4QPJ A;  4DV4 O;  4ZHQ B;  5JH7 B;  4IHJ B;  5LP6 A;  3G67 A;  2EIM C;  1V54 C;  2Y0I A;  2Q69 A;  2R9R B;  1PKX A;  5LHG A;  3SJQ C;  1H8H G;  5KX5 B;  4NVP A;  4JI3 B;  2HJF C;  1IVS A;  3RYH B;  5JWP A;  1MSD A;  5E79 Z;  3JAL A;  1RPO A;  3ABU A;  4LNU B;  1IDS A;  1Q43 A;  3SPJ A;  4X64 B;  3K5N A;  1QLE B;  3CB2 A;  5LBQ A;  1H2N A;  3B09 A;  2LFS A;  4UXN A;  1CXZ B;  3UQ8 A;  3OM3 B;  3FX7 A;  4LH6 A;  3I56 V;  1HNW B;  5LGU A;  4LF4 O;  4JI2 B;  1YIT V;  3R66 A;  1IBM O;  2CDY A;  2ZIM A;  3K5L A;  1XNQ B;  5LMU B;  3AG3 B;  2XAH A;  4X65 O;  4PA9 A;  4UCS A;  5JCO A;  5DN6 G;  2RN9 A;  5JJJ B;  3AG4 B;  4I50 A;  5IE9 A;  1KYO F;  1XEQ A;  3K5M A;  1N32 B;  4J9Z B;  3L75 H;  3CRA A;  1NKD A;  3A0H Z;  1YVW A;  3JAS B;  2QWN B;  3ZN0 A;  4GT1 A;  4WBN B;  1VMG A;  4O2B A;  1WN7 A;  1VQ9 V;  1FYJ A;  2AZ0 A;  3E8F A;  3HKE B;  4TUY A;  5LP6 C;  1KP2 A;  4YHH O;  2JEU A;  5IYZ A;  4B3R B;  2XUM A;  5D5Q A;  4AIL C;  5EZY A;  3H1I H;  2N74 A;  2DYR B;  1GRJ A;  4F6R A;  5KMG B;  1RSO A;  1S3J A;  3OMA B;  2JEX A;  2B9Z A;  4N23 A;  2P90 A;  3OUF A;  5FL7 G;  5FNV B;  2YEV A;  3E83 A;  3H1L H;  1AI6 A;  4BW9 A;  2AXT Z;  3A2F A;  1US6 A;  3BEH A;  5GTH Z;  3E35 A;  3BPZ A;  4O4L A;  1D2D A;  2PF4 E;  1IBK B;  4IYH A;  2OTJ V;  1IUR A;  3ZN1 A;  1NH2 B;  1Q7Y W;  3PJS K;  3ABK B;  1YJ9 V;  3VQY A;  4RO2 A;  3CD6 V;  3BA9 A;  4GLX A;  3ABM B;  1R3I C;  1S72 V;  4AI8 A;  4TV9 A;  2WLI B;  1S0V A;  1E79 G;  3ICX A;  1K97 A;  4H37 A;  1XMQ B;  1SQV H;  2Q9L A;  2XOK G;  3HKB B;  1VQO V;  3CCQ V;  4U7N A;  3CEI A;  4LFA B;  2QM8 A;  3C3S A;  2ATK C;  2LQT A;  4EEQ A;  4DR1 B;  3RN4 A;  5CB4 A;  4R7C A;  1PM9 A;  4J10 A;  2CE4 A;  1OCZ B;  4K35 A;  2ZE6 A;  3J80 N;  3SJA C;  2RDC A;  2X7R B;  2E3C A;  2Q0O C;  3DC5 A;  3HR0 A;  1HNZ B;  1V55 C;  4CH6 A;  1K4D C;  1WA8 B;  1XDC A;  2RJZ A;  4J11 A;  1Q6H A;  2E74 B;  2ITD C;  1I5Y A;  4DR6 B;  1H8E G;  4WFG A;  4YXW G;  4B3T B;  2A3Q A;  1T5E A;  1E1Q G;  2HFE C;  1TUB B;  5F2V O;  3R65 A;  2VWJ A;  3SYO A;  2Y0P A;  4LFB B;  4ZBM A;  1YIJ V;  1FD9 A;  3RFR A;  1VQ6 V;  1QNM A;  4O4I A;  5B1B B;  3LNM B;  2LFR A;  5H5N A;  4HBN A;  2PY5 A;  1RM1 C;  5FPO A;  5K1X A;  4DV7 O;  1SQQ H;  4FFK A;  2DMX A;  5B3S C;  1IBL O;  4I5S A;  2YIA A;  3ETG A;  3P30 A;  4X1I B;  2ZM6 B;  1VQN V;  4ZKI A;  1I7F A;  4JI6 B;  5IT9 N;  2ADQ B;  4AQY O;  2YSU B;  1HR0 O;  1GH6 A;  3A0R A;  2QKA A;  4O2A B;  4JI5 O;  4LC1 A;  4OGQ B;  1N34 B;  5J2U A;  4NXN O;  3QO5 A;  3OTF A;  2IH3 C;  4FM1 A;  5C93 A;  3QF7 A;  3SYA A;  3ZBH A;  1YDX A;  3JAR B;  2P4K A;  3H1J H;  1XL4 A;  4J80 A;  3CMA V;  5C8Y A;  5EIB C;  1CEZ A;  2K9P A;  4PA4 A;  1GKF A;  3B40 A;  4N21 A;  3ABT A;  3CC2 V;  4BWA A;  1ZL8 B;  3HKD B;  4X89 A;  5IYC O;  1XNR O;  1AJQ A;  2JS5 A;  3UCS C;  2B1G A;  4FVM A;  4ZIB A;  4ZI7 B;  3CRR A;  1XQ8 A;  1K8A W;  1COW G;  2F1M A;  1I08 A;  4PA3 A;  2EIL B;  4LH7 A;  1FFX A;  4LBE C;  2EIN B;  4QPK A;  4FLW A;  1Y76 B;  3WB1 A;  2YIC A;  3OMN B;  3EXA A;  3OE7 G;  1P4R A;  4DV6 B;  3GWO A;  1MNG A;  4DV2 O;  3K0D A;  3PN1 A;  1P84 F;  4QIW F;  1XOU A;  2N04 A;  4ZOL A;  4QE7 A;  2F4V O;  5B5E Z;  5KHH A;  4FLT A;  1K7D A;  3F5W C;  3T1Y O;  4HNA B;  2OIE A;  1GAX A;  2QWP B;  4OPA A;  2F23 A;  3CC4 V;  3OGC C;  1QVF U;  1FXH A;  3RYC A;  1B3Q A;  5KA6 A;  2GUZ B;  2C2A A;  2HLD G;  1VQM V;  4I4T B;  3K9S A;  3BY6 A;  1P7G A;  4Z1V A;  1FXK A;  1N33 B;  1DLB A;  4MVO A;  4MVQ A;  4DW1 A;  2M6Y A;  2HKO A;  3D3I A;  3O9O A;  4JTC B;  2WLN A;  3DC6 A;  5CA1 A;  2EIJ B;  1K5S A;  4CH4 A;  2QWO B;  2W0X A;  2ITC C;  4PDR A;  1BS3 A;  3OEE G;  5IJ0 A;  4OX9 B;  5CA0 B;  5ITZ A;  1TVK B;  3TXS A;  1Z5V A;  2H94 A;  3ABL C;  3H1H H;  1Y67 A;  3VQW A;  3M7M X;  4FMT A;  5DM6 V;  2KB1 A;  2DE0 X;  2GV9 A;  3J7A U;  4DR5 B;  3BAA A;  1GM7 A;  2ZIO A;  5L3G A;  1M57 C;  2JJ1 G;  1OZ0 A;  3QNE A;  4FK5 C;  5LOV B;  5EC1 C;  4I55 B;  4JV5 B;  3CXC U;  1S77 D;  1BMF G;  3VQV A;  4B3S B;  3SPH A;  5L3F A;  3AEI A;  3CCU V;  4H44 B;  1QQC A;  4DR2 B;  4BR6 A;  4X64 O;  2KQX A;  1F4N A;  3AK2 A;  2QM7 A;  5DEC A;  3CHX A;  1BHB A;  1FXK C;  2ZIN A;  3WG7 B;  2WSS G;  1FS0 G;  2P67 A;  3ASO C;  4JI2 O;  3Q4H A;  4D7T A;  2ZQM A;  3T4D A;  2OCC C;  3LDC A;  3QO8 A;  4MW3 A;  5LMU O;  3JD0 A;  4X8A A;  3E2E A;  1W59 A;  1EZJ A;  1R6T A;  1AJP A;  4DR7 O;  5H2F Z;  3AK1 A;  4JF3 A;  1F23 A;  3FD9 A;  1PL4 A;  1XI1 A;  5JJE B;  1GK9 A;  2WPD G;  2HHH B;  2PYJ A;  1JOY A;  3U11 A;  1NR7 A;  3AG1 C;  1OCR C;  3BAB A;  4UCT A;  4BIU A;  2DWD C;  1MA1 A;  3G80 A;  2HEP A;  2IJK A;  2WA4 A;  4DUZ B;  4FLY A;  3X2Q B;  2PGG A;  3LSQ A;  1W2B U;  4RAI A;  2BSK A;  2EIK B;  5EYP A;  3JAW A;  3S3X A;  2E5L O;  1GTO A;  3I5D A;  3O65 A;  4DV0 B;  5CBG A;  1PPJ H;  4JYA O;  1JFF A;  3FB6 C;  1AI4 A;  1WP8 A;  1OCC B;  3TJT A;  2RNB A;  5B1A B;  3H9V A;  4CS4 A;  3JAK B;  5CMU A;  2OTL V;  2UXC B;  1ORQ C;  4B08 A;  4Z2W A;  3M8A A;  1VF7 A;  4X62 B;  2NN4 A;  1THZ A;  3L73 H;  2Y69 B;  1RP3 B;  2HP8 A;  3RVZ A;  4ZHQ A;  3K06 A;  3FYE B;  5JH7 A;  1YTF B;  1AP6 A;  5D5P A;  4MTX A;  5KX5 A;  1TA8 A;  3RYH A;  4A5U B;  3ZRX A;  5BXZ A;  3ZRW B;  4LNU A;  4R8C A; 
#chains in the Genus database with same CATH homology
 4LFC O;  4YY3 O;  2F4V O;  5A2Q N;  1I94 O;  4JI2 O;  3RT3 C;  5H5N A;  4JI3 O;  4JI6 O;  4JI0 O;  3T1Y O;  4NXM O;  2HHH O;  4DV3 O;  2UUC O;  4DV0 O;  1IBK O;  2N74 A;  1NS1 A;  4OPA A;  2LW7 A;  5LMU O;  4X66 O;  4DV7 O;  1A32 A;  4LF8 O;  1N36 O;  4DUZ O;  4JI1 O;  1IBL O;  4B3M O;  4DV4 O;  1R6T A;  4JV5 O;  1X59 A;  3OTO O;  4JI4 O;  1HNW O;  4DR7 O;  1F7Y A;  1XMQ O;  4B3S O;  1HNZ O;  2DJV A;  2UUA O;  5IT9 N;  1D2D A;  4DR2 O;  4AQY O;  3J81 N;  1AIL A;  2Z0A A;  1HR0 O;  4DR6 O;  4DV1 O;  4B3T O;  1FKA O;  4LFA O;  1XNQ O;  2VQE O;  4DR5 O;  4DR1 O;  4JI5 O;  1YZB A;  4GKJ O;  4NXN O;  2ZKO A;  3F5T A;  1N32 O;  2UXC O;  2UUB O;  1AB3 A;  4K0K O;  4LF9 O;  4LF5 O;  4X62 O;  5LMN O;  4LF4 O;  3R66 A;  2E5L O;  1IBM O;  5BY1 A;  3O65 A;  4DUY O;  1XMO O;  1KUQ A;  4DV6 O;  1J5E O;  4JYA O;  3J7A U;  4JI8 O;  4GKK O;  1XNR O;  5FLX N;  4X65 O;  4DR3 O;  4JI7 O;  2FKX A;  2AGA A;  4LFB O;  3J80 N;  2ZM6 O;  1XEQ A;  4OPH A;  1R1B A;  3SDL A;  3M8A A;  4KHP O;  4B3R O;  4LF6 O;  3JAM N;  5IWA O;  5BR8 O;  2UXD O;  1HNX O;  4DR4 O;  5LL6 Y;  4LF7 O;  2UU9 O;  4X64 O;  1G1X B;  4DV5 O;  1N34 O;  3T1H O;  4DV2 O;  2DOS A;  1FYJ A;  4A5U B;  1DK1 A;  5BXZ A;  2JRI A;  4OX9 O;  2VQF O;  1FJG O;  4YHH O;  1N33 O;  2UXB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...