2HHHO

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2hhhO00
4YHHO 5BXZA 5BR8O 2UUBO 1IBLO 4DV2O 5LMNO 1XNQO 1FKAO 4OPHA 2VQEO 4DV6O 4OPAA 4KHPO 1AB3A 4JI3O 3R66A 4LFCO 3J81N 1N36O 4DR3O 4DR2O 3O65A 4JV5O 3RT3C 2Z0AA 3J7AU 1DK1A 4B3SO 4DUZO 2DOSA 3F5TA 4GKKO 2FKXA 5LMUO 5H5NA 1F7YA 4X64O 3T1HO 1FYJA 1R1BA 5IT9N 1D2DA 1IBMO 4DV1O 1X59A 4JI4O 1I94O 3JAMN 2UXCO 4JI5O 1XEQA 1IBKO 4LF6O 4DR4O 4DV4O 4X66O 1HNZO 2UUCO 4DR5O 5LL6Y 1G1XB 1XMQO 2JRIA 2N74A 4JYAO 4AQYO 1N32O 3OTOO 3T1YO 2DJVA 4B3RO 2VQFO 1KUQA 1N34O 4NXMO 4LF5O 4DR6O 4JI8O 4OX9O 4LFAO 5BY1A 2E5LO 4DUYO 5FLXN 2UXDO 4LF8O 4DV5O 5IWAO 1HR0O 1XMOO 2UU9O 4A5UB 4DV0O 2ZM6O 4DV3O 1XNRO 4X65O 4DR1O 1YZBA 4YY3O 2LW7A 4X62O 1J5EO 4JI1O 5A2QN 4B3MO 2ZKOA 4DV7O 4NXNO 3J80N 1N33O 4JI6O 2HHHO 4B3TO 4GKJO 1NS1A 1R6TA 4JI7O 4K0KO 3SDLA 3M8AA 4LF7O 1FJGO 1HNWO 4JI2O 4LFBO 2AGAA 2F4VO 4LF4O 1AILA 4JI0O 1A32A 4LF9O 2UUAO 2UXBO 1HNXO 4DR7O
chains in the Genus database with same CATH superfamily
2XAQA 1BHBA 3K58A 3CRAA 3H01A 2B1GA 2N05A 1NVPD 2QA4V 2BSKA 4FLWA 4JYCA 3ETQA 4I55A 1G4YB 1Y6XA 4X1YA 3HKDB 2XAJA 4DR2O 2C2AA 3O65A 3K9SA 4FPPA 3JD1A 5TISZ 2Q7GA 1QQCA 3ASOB 1Q90D 3JALA 5IJ9B 4WCEV 3GB7C 2IJJA 3ZRVA 1B06A 1IBMB 1PM9A 4I50B 1XHZA 5JVDA 1GN4A 2WPDG 3R65A 4D7TA 2IBZH 4DV3B 4LBEC 1KUQA 4JYAB 1QCEA 1TUBB 3HKBA 2M7WA 4LFAO 1SF9A 2WWWA 4GKJB 2OIEA 3D3QA 5J2UA 3U10A 1WP7A 4DR1O 3SJAC 3G71V 2WLMA 3NR7A 1Y67A 3LNMB 4TV9A 3ZHSA 1Q6UA 1KB9F 2PF4E 2FMLA 5CB4B 3L73H 1NS1A 4O2AB 3RYFA 3ZX6A 2EIKC 3GWKC 4NKGB 3M8AA 4JI6B 4JAUA 4DRXB 1FJGO 2P4VA 1ZUQA 3ZN1A 4HAMA 4FMTA 4F6EA 2R9IA 1THZA 3OFNG 2UXBO 1K3EA 4MTXA 5ITZB 1HNXB 3E89A 3A2FA 2LGQA 3AG1B 4U3FH 4N21A 3KG2A 1IBLB 3AG1C 1OHHG 1FAFA 1XNQB 3IJ4A 5L3BA 2VQEB 4DV6B 3RYCB 4JI5B 1HP8A 4NR1A 1GO3F 4Q20A 4B3SO 2GHYA 1DF4A 4Q6GA 3OR7C 1F7YA 4QE9A 2Y69B 4JV5B 2BTQA 1R1BA 4GKKB 3X2QB 4JYBA 1LUWA 2WLIB 1I94O 2AW9A 4RUEA 3X2QC 4U7NA 4E2LA 1K4CC 2LFRA 1SKVA 5CA1B 3LNNA 4L87A 1TAEA 3C3TA 4J42A 4IGGA 5KAFZ 3JAKB 2P90A 5LGUA 4CH6A 3HKCB 1GN3A 3JAWB 3DTUB 3AK3A 4TQDA 5KAIZ 5IYCO 2ZXWB 4NXMO 1AR4A 5CMUA 1NVPB 3LDCA 2OCHA 1CEZA 2CE4A 2ZXWC 3OMNB 3EVKA 4B3RB 3B8NA 1BZKA 3N27A 4DW0A 4ZHQB 4A5UB 1HWYA 1XL4A 3TXSA 2R9RB 3ABKB 3CRQA 5IYDO 4B3MO 4X89A 1XREA 4NXNO 1N0NA 3H1JH 4WFFA 4HNAA 1MOFA 2UUBB 1R6TA 3APOA 1QHTA 5KUKA 2QGNA 1US6A 4K3AA 3B77A 5EIBD 3D36C 4ICGA 3UKMA 1VQ7V 4UCOA 5HFLA 2VRZA 4QIWF 2DYSB 1R3JC 4JAAA 3EHBB 2Z5UA 2HR3A 5F2VO 3I55V 2ADQB 4UV9A 4OXSA 5FL7G 4OPHA 4B7KA 2Z3YA 1WJZA 1AP6A 4FVMA 1V54B 3ZHTA 1SZXA 1KBHA 3E8FA 4DR3O 1ENVA 1I5XA 1FFTB 3BY6A 3RYIB 3SPGA 3FB6C 3RT3C 3SR2C 1M56B 3RVZA 1BGYH 3A0RA 5H5NA 1M56C 2CTRA 1FD9A 1NH2D 2ZIOA 5LHIA 1RSOB 4QPKA 1D2DA 1KECA 1X59A 1S5LZ 2QM7A 2K9PA 3JD2A 4ZOLA 1SQFA 5H2FZ 5CN0A 2L35A 1L0LH 2UUCO 5KX5A 2ARHA 2PI4A 3L75H 4H0LB 4YIOA 4TT3G 1R6NA 4NTWA 4TOIA 1N8RW 2E3CA 3ABLB 3GVMA 5L3CA 5BZBA 3ZRWA 3CMEV 3QVNA 4CH4A 2DJVA 5LYJB 3P3NA 2VQFO 3K04A 1YXBA 1N34O 1UFIA 4LF5O 4PJ0Z 4OX9O 2P67A 3BVOA 3UT5A 1V55B 1XMOO 1MABG 2R9AA 4K0KB 1G6UA 1V55C 4H44B 4IIJA 3ETGA 1FXKA 3SGIA 3CCJV 1J5EO 2ZKOA 2QJ1A 1MG1A 5B3SC 4WBNB 1XNRB 2HHHO 1VF5B 3P32A 3CCEV 5EZYB 5EYPB 1OCRB 1WN7A 2P4KA 3ZMVA 1E79G 1NBMG 5KHKA 3OMIB 2F4VB 3G80A 3K5OA 3VOUA 3BABA 5LMNO 5GONB 3MD0A 1SC5B 3D3IA 3ABMB 2B1IA 4X1KB 4LFCO 5JJJB 3ABMC 2EZOA 1M1KW 2GTAA 5FPOA 1GH6A 2CTQA 3AG4B 2Z0AA 1I5YA 2P7TC 3AG4C 3A0BZ 4NVPA 4P2ZA 4HBNA 3L9DA 3CEIA 1B3QA 1NI8A 2YEVA 5H9CA 4J10A 4DV1O 3ZHUA 1F4NA 5FNVB 3TCUA 4DYLA 1TVKA 2A9HA 1EZVH 3F5WC 3OEEG 5IJ0A 3CD6V 1JFFA 3K79A 3S3WA 4WFGA 4U3JA 3IAYA 2GDSA 5KMGA 4IYIA 4PHZA 4DR5O 2CH7B 3OGCC 5EIBC 5DECA 4XBFA 4KP4A 4ZBMA 4DR1B 3CS5A 2JGUA 2EULA 1K97A 3TGUH 5LA6B 4LF8O 3W7UA 2JDIG 5IWAO 3CE2A 1SQVH 5IYZB 1Q82W 4PA7A 2IJIA 2LW7A 5KA6A 4JI1O 5A2QN 1RPRA 2UXBB 1YHQV 1N4CA 1H8EG 4JYYA 1Q81W 4X65B 2H3OA 4R6ZA 5LXTB 2W0XA 3OW2U 1NH2B 2EINC 2CAZC 1CXZB 3NXSA 1HNWO 2Q73A 1YCIA 1VARA 4DW1A 2A7WA 2CK3G 5L3GA 5IDJA 3B2EE 2F93B 3FYIB 3FB7C 2Y4TA 4Z1MG 3CRMA 5B1NA 1YJNV 4AILC 3IGAC 4B3SB 1EN4A 5BR8B 4O4HB 4WFAV 2ZCEA 3B40A 1BSMA 4JI3O 2LW1A 3T4DA 2Q5ZA 3T4ZA 4MVMA 2Y48A 5K1PA 4I9WA 1I94B 1WPXA 2KG7B 4KHPB 4UB6Z 4X20B 3E8GA 1W59A 2AHYA 1AR5A 2V7QG 1LNQA 4LCUC 4LH7A 3RYHA 1K73W 3E35A 4L8JA 3BPZA 1KU9A 2A3QA 4PDLA 3HB3B 1Z2GA 2B5UA 4ZI7A 2E75B 2BCCH 1HNZB 5JJNB 1RPOA 2BOCC 2XUMA 1YJ9V 1VP7A 4MT8A 4LNUB 3RWRD 2DYRB 3AG7A 4NXNB 4KUMA 4GX2A 2HG5C 2HJDA 3ETDA 4FFBB 4EEQA 3CJHB 1PD3A 4UVBA 2GBOA 1F4MA 3JD4A 1N33O 1VEWA 1NQTA 1QR8A 4B3TO 3H9VA 1MZEA 4FM0A 5CA0A 4O4JA 2D2CB 2DE0X 3SDLA 2BSKB 1CP9A 1AROP 3K03A 4LF7O 2QWPB 2AGAA 4I55B 4AI8A 4X1YB 3C3SA 3K0GA 4D7SA 3HR0A 5LGTA 3SYAA 1WNSA 4LFBB 4DR3B 2QTOA 1Y76B 4LF9B 3STZC 5LHGA 5BMVB 1U96A 2EIJB 2Q6AA 1O9GA 1AI6A 2DQ0A 1H8HG 5LP6A 1R3KC 3JARA 3ZRSA 5EBMC 5KHJA 4BR6A 1VQKV 4ZKIA 4CS4A 1XL6A 2ZE7A 1NTMH 3CHXA 3CSXA 4W4LA 1YI2V 2ILMA 4X8AA 3AG2C 2KSDA 3L72H 4LF5B 4OX9B 2GSMB 2HEPA 3ASNC 1PL0A 1VQPV 1BE3H 2IU3A 1NR1A 2IM9A 5EBLC 1JCHA 4FFKA 1JMKC 1GN6A 3TETA 1VQ6V 1GKFA 1P4RA 1J5EB 4MTOA 2F23A 1Z5WA 4DR6O 5JWPA 3FAVA 2E5LO 1VQ5V 2RJZA 4RAIA 1S76D 1AJNA 3BCCH 1PNMA 1M93A 1ZWIC 3OD4A 3UO2A 2CTWA 3OUSA 3ETEA 5DM6V 2UU9B 4TUYA 4DV7O 3PJSK 5C8YA 5DEDA 4UCRA 1S0VA 3RVYA 5LMNB 1M90W 1K34A 4PA4A 3CCSV 4O4LB 3OT7A 1SA0A 4JI2O 5KA5A 5IY5B 3I5DA 4JI0O 2ADPA 5IY5C 2HP8A 4DV2O 1NJIW 4JPRA 1IDSA 2EIKB 3F7VC 2EBOA 3HKDA 2Q7EA 3ML0A 2ZE8A 2XASA 4DV1B 2RNBA 1F51A 3R66A 2R72A 1K33A 3CB2A 2YSUB 5EC1C 5JJEB 1TUEB 1ZL8A 3J7AU 4DUZO 2QTSA 3O9OA 2HLDG 3AK2A 3Q4HA 3W7SA 4I0XB 3ZHRA 4X64O 3T1HO 3APQA 1IXBA 4B7EA 3W7XA 3BA8A 1H2KA 4I50A 1X4TA 4FLTA 2ITCC 4GCZA 4DR4O 5H6RA 2YS8A 2YI8A 3F7YC 3U11A 1UJWB 3CPWU 4LF8B 4UB8Z 5IWAB 4X9QA 4X1IB 1L1FA 1G1XB 1B04A 1LUVA 4GX5A 4O4IB 2EILC 2OTJV 4JI1B 4TWKA 1FFXB 2BTOA 4BW5A 5KHHA 1Q86W 2QM4A 2YIDA 3HKEA 4NYKA 4MS2A 4DV0O 3WU2Z 3E8BA 1WA8A 4CH5A 1W2BU 2WLLB 4GZRB 2EZPA 2PI5A 5CB4A 4O2AA 5IYBO 3LDEA 2OT5A 4EFBA 2UXXA 2P5OA 2ZNIA 1J95A 2JS3A 3W7WA 1VQ8V 1EFRG 3U0ZA 2UUAO 5ITZA 3ZIAG 4DR7O 1R6KA 4C7UA 5KHIA 3SJQC 3AEIA 4YJ3A 2MK3A 3QNEA 2JGDA 1D5NA 1JOYA 3OEHG 3UQ8A 1SS3A 1XI1A 3N2KB 4PA6A 1VF6C 4QNHB 3G67A 1JR9A 3T1CA 1N36O 5CBFA 2AHZA 1S72V 2FYUH 2G38A 4K8ZA 4ZOLB 3MHHC 2V4DA 2YC0A 4IL6Z 2DOSA 4B08A 3SPCA 1KP3A 2WSSG 4Z1VA 2NR5A 3DGEA 3RN4A 2EJRA 3ZRWB 5J2TA 5LMUB 4JI4O 3FYEB 4OGQB 2LP7A 3C90A 4MW8A 1IBKO 4LF6O 2JS5A 3DSQA 4MTFA 2FTKA 3HKCA 3JAWA 3EFFK 3K9AA 3LDDA 2DW4A 4IIJB 3KCYA 3E22A 4F6RB 1FXKC 3T1YO 5JH7B 3ABTA 3QG5A 3K59A 4AQYB 1DLBA 1JPXA 4B3TB 5BY1A 4ZHQA 3JD0A 1Y74B 1GTOA 3FB5C 2LQTA 2F66C 2WLKA 1NT2B 1PP9H 4DUYB 1YTFD 4H37A 1T5EA 1PPJH 4MVUA 1PV0A 2OIGA 3WB0A 4PD4F 2O57A 4J11A 4GT1A 4QGPA 4JI7O 2A79B 1MA1A 2P06A 5CBHA 4FLVA 3THOA 1SQGA 2E74B 2A0LA 1Z5VA 2QKSA 2YICA 1SQQH 2YXYA 1OZ0A 2KB1A 3T2MA 2YDEA 5B3SB 5L3EA 3DC5A 3VQWA 3ZBHA 1P7BA 1SQXH 2Q68A 1QR9A 1SESA 2YI9A 4QJFB 1AB3A 3CP1A 2X7RB 1DF5A 3RYIA 2ZNJA 2PY5A 2Q0AA 5IJ0B 1JFFB 4U3JB 4EB6B 3SYQA 4DR2B 3TXQA 1RSOA 3ZMUA 5GTIZ 3CCVV 4FM1A 5B1OA 2NLJC 3GWOA 2QSAA 2QWRB 1IBMO 1VQ9V 1BCCH 2LO1A 1VQLV 3DXRB 1WLEA 2UXCO 1XEQA 5B1AB 4F4LA 4DR6B 5B1AC 2X6AA 2E5LB 3A8TA 4KFMA 2ITDC 4FZ1A 2JRIA 1SZTA 2N74A 5LYJA 4JYAO 3RFRA 2QE7G 4LP8A 2ZR3A 2JIZG 3AK1A 4BIUA 4DV7B 1VQNV 4JI8O 1YF2A 1GM7A 3H1IH 2UXDO 2R70A 1OV9A 4J7ZA 4LFAB 2ATKC 4YIPA 5JCOA 4JI2B 4JI0B 1EM1A 3H1HH 1BHAA 1EN6A 1PKXA 3J80N 2N04A 4JI6O 4UUJC 5EZYA 5EYPA 2PZSA 1S5JA 1YVWA 1SETA 4R8CA 1RFYA 5K1XA 1AI5A 4RO2A 3D8CA 2LJ2A 3IC7A 4IHJB 2Q7HA 2PGGA 2EIMC 5LGNA 4TV8A 4J41A 1K7DA 2AZ2A 1H2MA 3CCQV 1HNXO 2A06H 1FJGB 3N2GA 5GONA 1KYOF 3CC2V 1QLEC 2ZD9A 1IBLO 4DUZB 1XNQO 2GV9A 3OUFA 4I4TA 2PUSA 1FKAO 2VQEO 1TGOA 4X1KA 4DV6O 2QR4A 3RYHB 2EINB 3M7MX 3OM3B 3K3WA 1JJ2U 4PV1B 3UM7A 2Q4PA 4G2KA 4JV5O 3VBBA 1WP8A 4ZI7B 4GKKO 4N23A 2FKXA 2JJ2G 1EN5A 4UCTA 3LSUA 5JQGA 5B1BB 3JATA 1RM1B 4DK1A 4DK0A 1M57C 5B1BC 3JAMN 1RM1C 4MVZA 2FB5A 1WB7A 4DV4O 2CH7A 1TA8A 1W0JG 3E83A 2E76B 1Q5OA 3QF7A 1NZ6A 1U97A 3OGIB 4CS2A 1N32O 2WA4A 1M5IA 3K5NA 2ZDIA 4J80A 5H6QA 4B3RO 3JASA 2Y0IA 1ROPA 1VF7A 4WFEA 5CA3A 4FIPC 2GUZB 5IYZA 5D5QA 4NXMB 1DGSA 1KP2A 3K06A 2ZM6O 4BAYA 2F1MA 1BS3A 4MVRA 5E79Z 3OE7G 2OCCB 4JASA 3K0DA 4B3MB 5FPRA 4UVAA 2OCCC 5HFMA 1V9PA 5IE9A 4FM2A 4MW3A 2QWNB 5EBWC 4H33A 3CCUV 2KKWA 1N36B 4JAVA 5LOVB 5LP6C 1Y4MA 1WPBA 2Q8VA 3H1LH 4XDKA 1D5AA 2PTMA 4O4HA 1QVFU 3IFXA 2QM8A 3FKSG 4G28B 2KG7A 1GN2A 4JI4B 3MAQA 3ZHVA 1KQSU 1EBOA 1IBKB 4MVOA 2WLNA 1R3IC 3CRRA 2DQ3A 4BIZA 1XQ8A 4UCVA 3T1YB 2YIAA 3JALB 4D6TH 1OCZB 3FAVB 3L70H 1M9NA 1OCZC 4X66O 3P3PA 1Q3EA 1XDCA 5B66Z 4UV8A 5A9GA 2UUCB 5JVDB 4LNUA 3SYOA 1XILA 5C8YB 4PDVA 1NKDA 3ABUA 4FFBA 3CJHA 3AG2B 2VQFB 4O2BA 3HKBB 4JI7B 1N34B 2XAHA 3ASNB 4FLZA 2IH3C 1XNRO 2HJFC 5J2UB 3G6EV 3VQVA 4X62O 1XMOB 4LR3A 2Q9LA 2DMXA 2ZR2A 1PL4A 1MSWD 2OTLV 5EC2C 4JF3A 2BOBC 1Q6IA 2ZIMA 4KXRA 3WG7B 4J9ZB 4TV9B 3WG7C 4H13B 3QO8A 3RYFB 2HHHB 4WF9V 1S3JA 1URFA 2F4VO 4LF4O 3ZN0A 1KD1W 1Y76A 1HDJA 3EXAA 2K1EA 1XHXA 4FLXA 2OYQA 5BXZA 2DWEC 1ZL8B 2IJHA 3Q4HB 3M99B 5BMVA 3ASOC 3LSSA 1YDXA 4P9PA 2DN9A 2CTPA 1LR1A 4MVSA 3ZMTA 2RMKB 4TQFA 2CUGA 4LWSA 1NR7A 2HFEC 3J81N 1GK9A 1MMMA 4YJ2A 1GM9A 2X6CA 2UXCB 4JTDB 2CDYA 4LFCB 3B8MA 1ZTEA 4MTGA 1XBLA 3IC9A 1PNLA 2WLHA 1AVMA 2NNUA 3RBZA 3WFVA 3CC4V 3ZHQA 2BTQB 1FPOA 4CH3A 2P6JA 5CBGA 5KHGA 1WB8A 2M6YA 1K5QA 1YEWA 2ZQMA 2VWJA 4DO2A 3L71H 3K5LA 4JI8B 3CX5F 3UO3A 1BMFG 4JTAB 1E1RG 2UXDB 3HKEB 3BFRA 2BE3A 2Q0OC 3JYCA 2XOKG 2JK5C 2JVDA 5LL6Y 1JX9A 1FXHA 4EFEA 1WA8B 4UXNA 1KKCA 1YITV 4J9YB 4FZ0A 5IJ9A 4CZZA 3OTOO 2Q67A 4DR5B 3CWBH 1ZSPA 1KMIZ 4GYCB 4XDJA 4P30A 3QTCA 1S77D 3ZS8C 4RUFA 1PNKA 4ABMA 5GW7A 1HR0O 4CS3A 1H2NA 2XAGA 2W0FC 3ZJZA 5B5EZ 4X65O 1QVGU 4I9QA 1YZBA 4YY3O 4HZ3A 2EILB 4CBCA 1FS0G 3KCXA 1TUBA 1P84F 1QU7A 4O4LA 2ZE5A 5KLVH 4YJ3B 2JGDB 2QEXV 4HNAB 1HW7A 4XDLA 5D5PA 1K9MW 3LUTB 1AI4A 2F95B 3ZMZA 1H2LA 2H8PC 4YHHO 1HNWB 4J7KA 5BR8O 1KKDA 2Y69C 2GTSA 4PI0A 4JGSA 1QLNA 4DRXA 5J2TB 2IJKA 3FX7A 3KZIZ 4KHPO 3SYPA 3BHPA 2YIBA 1NTZH 3MDSA 4JI3B 1DK1A 1SQPH 4I0XA 4TSFG 3F5TA 3TJTA 4DV4B 1G8MA 1B6QA 2CGNA 1JVMA 1K4DC 1NTKH 1Q7YW 1H2SB 2XT9A 3E22B 1N32B 3RYCA 1IVSA 2WAMA 4GUNA 4AHCA 4X1IA 1HNZO 1BQZA 3KKYA 4O4IA 1AP5A 4K8XA 5KX5B 1XMQO 2MW2B 2ZM6B 3ABKC 1FFXA 1FXVA 3I56V 4CC6A 3RW0A 2WLIA 3ICXA 1RP3B 2WA3A 1YJWV 4MSWC 5CA1A 1IXMA 4DV5O 2WLLA 4PA3A 1YIJV 1SRYA 3UT5B 2HVKC 1P7GA 3JAKA 2QDOA 1OJHA 4WFBV 2DYSC 4R7CA 4IYHA 1R73A 1FXKB 2YXLA 2OWOA 4QPJA 1IX9A 3WB1A 1H38A 2H94A 1N33B 1V54C 1MNGA 3SJCC 4LC1A 5KUMA 2JEXA 4LFBO 2ZINA 2L6LA 5J9PC 4LF9O 2HKOA 4CC5A 4RWUA 3OR6C 4LF7B 3G4SV 3ZEDA 4P9OA 2EX3A 3SPIA 3VQXA 1VF6A 4JZGA 3N2KA 4U7OA 1JA8A 2F43G 3CCMV 3D36A 2P22C 4OPAA 4LH6A 4W4KA 3CC7V 3SPJA 1O9HA 4ASUG 4UCSA 3VQYA 1MSDA 1AJQA 4X66B 4ZIBA 2RDCA 3ABLC 1I0HA 4J7JA 2PYJA 2Q69A 3K57A 5LHHA 2YEVB 3B09A 5AG2A 3RGBA 1I7FA 3FD9A 4WFHA 1TVKB 3BAAA 2AXTZ 3L74H 3STLC 1GM8A 2AZ0A 4PDMA 1OCOB 1W0KG 2WLJA 1OCOC 4F6RA 3WB2A 5JH7A 5KMGB 1SQBH 3JD3A 5JCOC 4X62B 1Q43A 2QWOB 1H2GA 1F23A 1Y74A 3K5MA 1Q8IA 4X88A 3SJBC 1K8AW 1OCRC 4EKWA 2UU9O 3AG3B 3FB8C 5L3FA 4DV3O 2IW5A 4TV8B 3TK1A 3AG3C 2D3OW 4LF4B 2W6JG 2VWKA 4YXWG 3N2GB 2YXHA 3H1KH 3E86A 1AJPA 4I5SA 3QO7A 4GKJO 1L0NH 4KL1A 4GX1A 4I4TB 1IURA 2DWDC 4UVCA 3CXCU 3BRCA 5DN6G 4I7ZB 1VQOV 1GMGA 4WBNA 5LBQA 3P30A 2B9ZA 2ETNA 4Z2WA 3CCRV 5E1AC 1N0JA 5JQGB 4DV2B 3JATB 1NU1H 4RQEA 1MZFA 4E4EA 2EIMB 1OCCB 3JCZA 4BIOA 1OCCC 4EB6A 1AI7A 5L3DA 4NTYA 2NN4A 4FJCC 1QLEB 1VIBA 4BWAA 2PYLA 3DXRA 1CPYA 3K08A 2QKAA 1FYJA 5C93A 3CYOA 1VMGA 4K35A 3OTOB 4X64B 3T1HB 2ZDIC 3JASB 4PDRA 2HVJC 4NB5A 4JI5O 1JQ0A 3PN1A 3A0HZ 4MVQA 1I08A 1JJOA 1HR0B 2ZT9B 3G6BA 1E1QG 4DR4B 1YTFB 2V1DA 5FNVA 1QBZA 4YY3B 1M57B 2RCVA 3LSQA 3S3XA 1Q6HA 3OAAG 3SPHA 1K92A 3JCUZ 4RQFA 1AR1B 1WAZA 3BA9A 1QNMA 2XHBA 4JZ2A 4GLXA 3QO5A 3CXHF 2X6BA 3CMAV 4DV0B 3JSNA 4YHHB 2W6IG 3MHSC 4FK5C 2RN9A 1BQ0A 5LA6A 2X0LA 4IHJA 3W7TA 2Y0PA 5CA0B 4O4JB 4R50A 1BT8A 2QKCA 1YSCA 1S5HC 1GRJA 2JJ1G 4G27B 3UCSC 3CCLV 1K5SA 2RQ6A 2UUBO 2QWQB 2UUAB 5LXTA 2CGOA 4DR7B 4BW9A 1ZX3A 1XUQA 3B4SA 1P49A 1VQMV 2XNDG 3BEHA 1R3LC 3E8HA 4PELA 4UCUA 4DXWA 5LP6B 2ODMA 3DC6A 1ORQC 3JARB 1M4UA 5LMUO 3SYCA 3ZRXA 5IT9N 1BL8A 1EZJA 1XMQB 3OTFA 1ZLZA 2IU0A 4QE7A 2DYRC 4HYOA 3HPLC 2XTAA 2YIBD 1XOUA 4JTCB 3FFQA 4O2BB 4X20A 2JEUA 5EK0A 2LGWA 1KC8W 4DV5B 2UXNA 4LF6B 1COWG 2Y4UA 2ZE6A 4FLUA 4AQYO 3ZMSA 1L8DA 1ZAUA 2GUZA 2LFSA 4DUYO 2VS0A 5FLXN 1DTOA 3ZCCA 1UPGA 3CRCA 4FLYA 2KQXA 2YUAA 4GX0A 2FL4A 1IZ3A 4UFZA 2EJ7A 4IT5A 1Y66A 4TUYB 3JSLA 1SERA 5GTHZ 4K0KO 1VQ4V 2EIJC 2XAFA 4LWSB 1AILA 5LOVA 2IH1C 1GAXA 3OMAB 3E2EA 1A32A 1SA0B 4PI2A 4YJ2B 4NTXA 4PA9A
chains in the Genus database with same CATH topology
4YHHO 5BXZA 5BR8O 2UUBO 1IBLO 4DV2O 5LMNO 1XNQO 1FKAO 4OPHA 2VQEO 4DV6O 4OPAA 4KHPO 1AB3A 4JI3O 3R66A 4LFCO 3J81N 1N36O 4DR3O 4DR2O 3O65A 4JV5O 3RT3C 2Z0AA 3J7AU 1DK1A 4B3SO 4DUZO 2DOSA 3F5TA 4GKKO 2FKXA 5LMUO 5H5NA 1F7YA 4X64O 3T1HO 1FYJA 1R1BA 5IT9N 1D2DA 1IBMO 4DV1O 1X59A 4JI4O 1I94O 3JAMN 2UXCO 4JI5O 1XEQA 1IBKO 4LF6O 4DR4O 4DV4O 4X66O 1HNZO 2UUCO 4DR5O 5LL6Y 1G1XB 1XMQO 2JRIA 2N74A 4JYAO 4AQYO 1N32O 3OTOO 3T1YO 2DJVA 4B3RO 2VQFO 1KUQA 1N34O 4NXMO 4LF5O 4DR6O 4JI8O 4OX9O 4LFAO 5BY1A 2E5LO 4DUYO 5FLXN 2UXDO 4LF8O 4DV5O 5IWAO 1HR0O 1XMOO 2UU9O 4A5UB 4DV0O 2ZM6O 4DV3O 1XNRO 4X65O 4DR1O 1YZBA 4YY3O 2LW7A 4X62O 1J5EO 4JI1O 5A2QN 4B3MO 2ZKOA 4DV7O 4NXNO 3J80N 1N33O 4JI6O 2HHHO 4B3TO 4GKJO 1NS1A 1R6TA 4JI7O 4K0KO 3SDLA 3M8AA 4LF7O 1FJGO 1HNWO 4JI2O 4LFBO 2AGAA 2F4VO 4LF4O 1AILA 4JI0O 1A32A 4LF9O 2UUAO 2UXBO 1HNXO 4DR7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH O;  5BXZ A;  5BR8 O;  2UUB O;  1IBL O;  4DV2 O;  5LMN O;  1XNQ O;  1FKA O;  4OPH A;  2VQE O;  4DV6 O;  4OPA A;  4KHP O;  1AB3 A;  4JI3 O;  3R66 A;  4LFC O;  3J81 N;  1N36 O;  4DR3 O;  4DR2 O;  3O65 A;  4JV5 O;  3RT3 C;  2Z0A A;  3J7A U;  1DK1 A;  4B3S O;  4DUZ O;  2DOS A;  3F5T A;  4GKK O;  2FKX A;  5LMU O;  5H5N A;  1F7Y A;  4X64 O;  3T1H O;  1FYJ A;  1R1B A;  5IT9 N;  1D2D A;  1IBM O;  4DV1 O;  1X59 A;  4JI4 O;  1I94 O;  3JAM N;  2UXC O;  4JI5 O;  1XEQ A;  1IBK O;  4LF6 O;  4DR4 O;  4DV4 O;  4X66 O;  1HNZ O;  2UUC O;  4DR5 O;  5LL6 Y;  1G1X B;  1XMQ O;  2JRI A;  2N74 A;  4JYA O;  4AQY O;  1N32 O;  3OTO O;  3T1Y O;  2DJV A;  4B3R O;  2VQF O;  1KUQ A;  1N34 O;  4NXM O;  4LF5 O;  4DR6 O;  4JI8 O;  4OX9 O;  4LFA O;  5BY1 A;  2E5L O;  4DUY O;  5FLX N;  2UXD O;  4LF8 O;  4DV5 O;  5IWA O;  1HR0 O;  1XMO O;  2UU9 O;  4A5U B;  4DV0 O;  2ZM6 O;  4DV3 O;  1XNR O;  4X65 O;  4DR1 O;  1YZB A;  4YY3 O;  2LW7 A;  4X62 O;  1J5E O;  4JI1 O;  5A2Q N;  4B3M O;  2ZKO A;  4DV7 O;  4NXN O;  3J80 N;  1N33 O;  4JI6 O;  2HHH O;  4B3T O;  4GKJ O;  1NS1 A;  1R6T A;  4JI7 O;  4K0K O;  3SDL A;  3M8A A;  4LF7 O;  1FJG O;  1HNW O;  4JI2 O;  4LFB O;  2AGA A;  2F4V O;  4LF4 O;  1AIL A;  4JI0 O;  1A32 A;  4LF9 O;  2UUA O;  2UXB O;  1HNX O;  4DR7 O; 
#chains in the Genus database with same CATH topology
 2XAQ A;  1BHB A;  3K58 A;  3CRA A;  3H01 A;  2B1G A;  2N05 A;  1NVP D;  2QA4 V;  2BSK A;  4FLW A;  4JYC A;  3ETQ A;  4I55 A;  1G4Y B;  1Y6X A;  4X1Y A;  3HKD B;  2XAJ A;  4DR2 O;  2C2A A;  3O65 A;  3K9S A;  4FPP A;  3JD1 A;  5TIS Z;  2Q7G A;  1QQC A;  3ASO B;  1Q90 D;  3JAL A;  5IJ9 B;  4WCE V;  3GB7 C;  2IJJ A;  3ZRV A;  1B06 A;  1IBM B;  1PM9 A;  4I50 B;  1XHZ A;  5JVD A;  1GN4 A;  2WPD G;  3R65 A;  4D7T A;  2IBZ H;  4DV3 B;  4LBE C;  1KUQ A;  4JYA B;  1QCE A;  1TUB B;  3HKB A;  2M7W A;  4LFA O;  1SF9 A;  2WWW A;  4GKJ B;  2OIE A;  3D3Q A;  5J2U A;  3U10 A;  1WP7 A;  4DR1 O;  3SJA C;  3G71 V;  2WLM A;  3NR7 A;  1Y67 A;  3LNM B;  4TV9 A;  3ZHS A;  1Q6U A;  1KB9 F;  2PF4 E;  2FML A;  5CB4 B;  3L73 H;  1NS1 A;  4O2A B;  3RYF A;  3ZX6 A;  2EIK C;  3GWK C;  4NKG B;  3M8A A;  4JI6 B;  4JAU A;  4DRX B;  1FJG O;  2P4V A;  1ZUQ A;  3ZN1 A;  4HAM A;  4FMT A;  4F6E A;  2R9I A;  1THZ A;  3OFN G;  2UXB O;  1K3E A;  4MTX A;  5ITZ B;  1HNX B;  3E89 A;  3A2F A;  2LGQ A;  3AG1 B;  4U3F H;  4N21 A;  3KG2 A;  1IBL B;  3AG1 C;  1OHH G;  1FAF A;  1XNQ B;  3IJ4 A;  5L3B A;  2VQE B;  4DV6 B;  3RYC B;  4JI5 B;  1HP8 A;  4NR1 A;  1GO3 F;  4Q20 A;  4B3S O;  2GHY A;  1DF4 A;  4Q6G A;  3OR7 C;  1F7Y A;  4QE9 A;  2Y69 B;  4JV5 B;  2BTQ A;  1R1B A;  4GKK B;  3X2Q B;  4JYB A;  1LUW A;  2WLI B;  1I94 O;  2AW9 A;  4RUE A;  3X2Q C;  4U7N A;  4E2L A;  1K4C C;  2LFR A;  1SKV A;  5CA1 B;  3LNN A;  4L87 A;  1TAE A;  3C3T A;  4J42 A;  4IGG A;  5KAF Z;  3JAK B;  2P90 A;  5LGU A;  4CH6 A;  3HKC B;  1GN3 A;  3JAW B;  3DTU B;  3AK3 A;  4TQD A;  5KAI Z;  5IYC O;  2ZXW B;  4NXM O;  1AR4 A;  5CMU A;  1NVP B;  3LDC A;  2OCH A;  1CEZ A;  2CE4 A;  2ZXW C;  3OMN B;  3EVK A;  4B3R B;  3B8N A;  1BZK A;  3N27 A;  4DW0 A;  4ZHQ B;  4A5U B;  1HWY A;  1XL4 A;  3TXS A;  2R9R B;  3ABK B;  3CRQ A;  5IYD O;  4B3M O;  4X89 A;  1XRE A;  4NXN O;  1N0N A;  3H1J H;  4WFF A;  4HNA A;  1MOF A;  2UUB B;  1R6T A;  3APO A;  1QHT A;  5KUK A;  2QGN A;  1US6 A;  4K3A A;  3B77 A;  5EIB D;  3D36 C;  4ICG A;  3UKM A;  1VQ7 V;  4UCO A;  5HFL A;  2VRZ A;  4QIW F;  2DYS B;  1R3J C;  4JAA A;  3EHB B;  2Z5U A;  2HR3 A;  5F2V O;  3I55 V;  2ADQ B;  4UV9 A;  4OXS A;  5FL7 G;  4OPH A;  4B7K A;  2Z3Y A;  1WJZ A;  1AP6 A;  4FVM A;  1V54 B;  3ZHT A;  1SZX A;  1KBH A;  3E8F A;  4DR3 O;  1ENV A;  1I5X A;  1FFT B;  3BY6 A;  3RYI B;  3SPG A;  3FB6 C;  3RT3 C;  3SR2 C;  1M56 B;  3RVZ A;  1BGY H;  3A0R A;  5H5N A;  1M56 C;  2CTR A;  1FD9 A;  1NH2 D;  2ZIO A;  5LHI A;  1RSO B;  4QPK A;  1D2D A;  1KEC A;  1X59 A;  1S5L Z;  2QM7 A;  2K9P A;  3JD2 A;  4ZOL A;  1SQF A;  5H2F Z;  5CN0 A;  2L35 A;  1L0L H;  2UUC O;  5KX5 A;  2ARH A;  2PI4 A;  3L75 H;  4H0L B;  4YIO A;  4TT3 G;  1R6N A;  4NTW A;  4TOI A;  1N8R W;  2E3C A;  3ABL B;  3GVM A;  5L3C A;  5BZB A;  3ZRW A;  3CME V;  3QVN A;  4CH4 A;  2DJV A;  5LYJ B;  3P3N A;  2VQF O;  3K04 A;  1YXB A;  1N34 O;  1UFI A;  4LF5 O;  4PJ0 Z;  4OX9 O;  2P67 A;  3BVO A;  3UT5 A;  1V55 B;  1XMO O;  1MAB G;  2R9A A;  4K0K B;  1G6U A;  1V55 C;  4H44 B;  4IIJ A;  3ETG A;  1FXK A;  3SGI A;  3CCJ V;  1J5E O;  2ZKO A;  2QJ1 A;  1MG1 A;  5B3S C;  4WBN B;  1XNR B;  2HHH O;  1VF5 B;  3P32 A;  3CCE V;  5EZY B;  5EYP B;  1OCR B;  1WN7 A;  2P4K A;  3ZMV A;  1E79 G;  1NBM G;  5KHK A;  3OMI B;  2F4V B;  3G80 A;  3K5O A;  3VOU A;  3BAB A;  5LMN O;  5GON B;  3MD0 A;  1SC5 B;  3D3I A;  3ABM B;  2B1I A;  4X1K B;  4LFC O;  5JJJ B;  3ABM C;  2EZO A;  1M1K W;  2GTA A;  5FPO A;  1GH6 A;  2CTQ A;  3AG4 B;  2Z0A A;  1I5Y A;  2P7T C;  3AG4 C;  3A0B Z;  4NVP A;  4P2Z A;  4HBN A;  3L9D A;  3CEI A;  1B3Q A;  1NI8 A;  2YEV A;  5H9C A;  4J10 A;  4DV1 O;  3ZHU A;  1F4N A;  5FNV B;  3TCU A;  4DYL A;  1TVK A;  2A9H A;  1EZV H;  3F5W C;  3OEE G;  5IJ0 A;  3CD6 V;  1JFF A;  3K79 A;  3S3W A;  4WFG A;  4U3J A;  3IAY A;  2GDS A;  5KMG A;  4IYI A;  4PHZ A;  4DR5 O;  2CH7 B;  3OGC C;  5EIB C;  5DEC A;  4XBF A;  4KP4 A;  4ZBM A;  4DR1 B;  3CS5 A;  2JGU A;  2EUL A;  1K97 A;  3TGU H;  5LA6 B;  4LF8 O;  3W7U A;  2JDI G;  5IWA O;  3CE2 A;  1SQV H;  5IYZ B;  1Q82 W;  4PA7 A;  2IJI A;  2LW7 A;  5KA6 A;  4JI1 O;  5A2Q N;  1RPR A;  2UXB B;  1YHQ V;  1N4C A;  1H8E G;  4JYY A;  1Q81 W;  4X65 B;  2H3O A;  4R6Z A;  5LXT B;  2W0X A;  3OW2 U;  1NH2 B;  2EIN C;  2CAZ C;  1CXZ B;  3NXS A;  1HNW O;  2Q73 A;  1YCI A;  1VAR A;  4DW1 A;  2A7W A;  2CK3 G;  5L3G A;  5IDJ A;  3B2E E;  2F93 B;  3FYI B;  3FB7 C;  2Y4T A;  4Z1M G;  3CRM A;  5B1N A;  1YJN V;  4AIL C;  3IGA C;  4B3S B;  1EN4 A;  5BR8 B;  4O4H B;  4WFA V;  2ZCE A;  3B40 A;  1BSM A;  4JI3 O;  2LW1 A;  3T4D A;  2Q5Z A;  3T4Z A;  4MVM A;  2Y48 A;  5K1P A;  4I9W A;  1I94 B;  1WPX A;  2KG7 B;  4KHP B;  4UB6 Z;  4X20 B;  3E8G A;  1W59 A;  2AHY A;  1AR5 A;  2V7Q G;  1LNQ A;  4LCU C;  4LH7 A;  3RYH A;  1K73 W;  3E35 A;  4L8J A;  3BPZ A;  1KU9 A;  2A3Q A;  4PDL A;  3HB3 B;  1Z2G A;  2B5U A;  4ZI7 A;  2E75 B;  2BCC H;  1HNZ B;  5JJN B;  1RPO A;  2BOC C;  2XUM A;  1YJ9 V;  1VP7 A;  4MT8 A;  4LNU B;  3RWR D;  2DYR B;  3AG7 A;  4NXN B;  4KUM A;  4GX2 A;  2HG5 C;  2HJD A;  3ETD A;  4FFB B;  4EEQ A;  3CJH B;  1PD3 A;  4UVB A;  2GBO A;  1F4M A;  3JD4 A;  1N33 O;  1VEW A;  1NQT A;  1QR8 A;  4B3T O;  3H9V A;  1MZE A;  4FM0 A;  5CA0 A;  4O4J A;  2D2C B;  2DE0 X;  3SDL A;  2BSK B;  1CP9 A;  1ARO P;  3K03 A;  4LF7 O;  2QWP B;  2AGA A;  4I55 B;  4AI8 A;  4X1Y B;  3C3S A;  3K0G A;  4D7S A;  3HR0 A;  5LGT A;  3SYA A;  1WNS A;  4LFB B;  4DR3 B;  2QTO A;  1Y76 B;  4LF9 B;  3STZ C;  5LHG A;  5BMV B;  1U96 A;  2EIJ B;  2Q6A A;  1O9G A;  1AI6 A;  2DQ0 A;  1H8H G;  5LP6 A;  1R3K C;  3JAR A;  3ZRS A;  5EBM C;  5KHJ A;  4BR6 A;  1VQK V;  4ZKI A;  4CS4 A;  1XL6 A;  2ZE7 A;  1NTM H;  3CHX A;  3CSX A;  4W4L A;  1YI2 V;  2ILM A;  4X8A A;  3AG2 C;  2KSD A;  3L72 H;  4LF5 B;  4OX9 B;  2GSM B;  2HEP A;  3ASN C;  1PL0 A;  1VQP V;  1BE3 H;  2IU3 A;  1NR1 A;  2IM9 A;  5EBL C;  1JCH A;  4FFK A;  1JMK C;  1GN6 A;  3TET A;  1VQ6 V;  1GKF A;  1P4R A;  1J5E B;  4MTO A;  2F23 A;  1Z5W A;  4DR6 O;  5JWP A;  3FAV A;  2E5L O;  1VQ5 V;  2RJZ A;  4RAI A;  1S76 D;  1AJN A;  3BCC H;  1PNM A;  1M93 A;  1ZWI C;  3OD4 A;  3UO2 A;  2CTW A;  3OUS A;  3ETE A;  5DM6 V;  2UU9 B;  4TUY A;  4DV7 O;  3PJS K;  5C8Y A;  5DED A;  4UCR A;  1S0V A;  3RVY A;  5LMN B;  1M90 W;  1K34 A;  4PA4 A;  3CCS V;  4O4L B;  3OT7 A;  1SA0 A;  4JI2 O;  5KA5 A;  5IY5 B;  3I5D A;  4JI0 O;  2ADP A;  5IY5 C;  2HP8 A;  4DV2 O;  1NJI W;  4JPR A;  1IDS A;  2EIK B;  3F7V C;  2EBO A;  3HKD A;  2Q7E A;  3ML0 A;  2ZE8 A;  2XAS A;  4DV1 B;  2RNB A;  1F51 A;  3R66 A;  2R72 A;  1K33 A;  3CB2 A;  2YSU B;  5EC1 C;  5JJE B;  1TUE B;  1ZL8 A;  3J7A U;  4DUZ O;  2QTS A;  3O9O A;  2HLD G;  3AK2 A;  3Q4H A;  3W7S A;  4I0X B;  3ZHR A;  4X64 O;  3T1H O;  3APQ A;  1IXB A;  4B7E A;  3W7X A;  3BA8 A;  1H2K A;  4I50 A;  1X4T A;  4FLT A;  2ITC C;  4GCZ A;  4DR4 O;  5H6R A;  2YS8 A;  2YI8 A;  3F7Y C;  3U11 A;  1UJW B;  3CPW U;  4LF8 B;  4UB8 Z;  5IWA B;  4X9Q A;  4X1I B;  1L1F A;  1G1X B;  1B04 A;  1LUV A;  4GX5 A;  4O4I B;  2EIL C;  2OTJ V;  4JI1 B;  4TWK A;  1FFX B;  2BTO A;  4BW5 A;  5KHH A;  1Q86 W;  2QM4 A;  2YID A;  3HKE A;  4NYK A;  4MS2 A;  4DV0 O;  3WU2 Z;  3E8B A;  1WA8 A;  4CH5 A;  1W2B U;  2WLL B;  4GZR B;  2EZP A;  2PI5 A;  5CB4 A;  4O2A A;  5IYB O;  3LDE A;  2OT5 A;  4EFB A;  2UXX A;  2P5O A;  2ZNI A;  1J95 A;  2JS3 A;  3W7W A;  1VQ8 V;  1EFR G;  3U0Z A;  2UUA O;  5ITZ A;  3ZIA G;  4DR7 O;  1R6K A;  4C7U A;  5KHI A;  3SJQ C;  3AEI A;  4YJ3 A;  2MK3 A;  3QNE A;  2JGD A;  1D5N A;  1JOY A;  3OEH G;  3UQ8 A;  1SS3 A;  1XI1 A;  3N2K B;  4PA6 A;  1VF6 C;  4QNH B;  3G67 A;  1JR9 A;  3T1C A;  1N36 O;  5CBF A;  2AHZ A;  1S72 V;  2FYU H;  2G38 A;  4K8Z A;  4ZOL B;  3MHH C;  2V4D A;  2YC0 A;  4IL6 Z;  2DOS A;  4B08 A;  3SPC A;  1KP3 A;  2WSS G;  4Z1V A;  2NR5 A;  3DGE A;  3RN4 A;  2EJR A;  3ZRW B;  5J2T A;  5LMU B;  4JI4 O;  3FYE B;  4OGQ B;  2LP7 A;  3C90 A;  4MW8 A;  1IBK O;  4LF6 O;  2JS5 A;  3DSQ A;  4MTF A;  2FTK A;  3HKC A;  3JAW A;  3EFF K;  3K9A A;  3LDD A;  2DW4 A;  4IIJ B;  3KCY A;  3E22 A;  4F6R B;  1FXK C;  3T1Y O;  5JH7 B;  3ABT A;  3QG5 A;  3K59 A;  4AQY B;  1DLB A;  1JPX A;  4B3T B;  5BY1 A;  4ZHQ A;  3JD0 A;  1Y74 B;  1GTO A;  3FB5 C;  2LQT A;  2F66 C;  2WLK A;  1NT2 B;  1PP9 H;  4DUY B;  1YTF D;  4H37 A;  1T5E A;  1PPJ H;  4MVU A;  1PV0 A;  2OIG A;  3WB0 A;  4PD4 F;  2O57 A;  4J11 A;  4GT1 A;  4QGP A;  4JI7 O;  2A79 B;  1MA1 A;  2P06 A;  5CBH A;  4FLV A;  3THO A;  1SQG A;  2E74 B;  2A0L A;  1Z5V A;  2QKS A;  2YIC A;  1SQQ H;  2YXY A;  1OZ0 A;  2KB1 A;  3T2M A;  2YDE A;  5B3S B;  5L3E A;  3DC5 A;  3VQW A;  3ZBH A;  1P7B A;  1SQX H;  2Q68 A;  1QR9 A;  1SES A;  2YI9 A;  4QJF B;  1AB3 A;  3CP1 A;  2X7R B;  1DF5 A;  3RYI A;  2ZNJ A;  2PY5 A;  2Q0A A;  5IJ0 B;  1JFF B;  4U3J B;  4EB6 B;  3SYQ A;  4DR2 B;  3TXQ A;  1RSO A;  3ZMU A;  5GTI Z;  3CCV V;  4FM1 A;  5B1O A;  2NLJ C;  3GWO A;  2QSA A;  2QWR B;  1IBM O;  1VQ9 V;  1BCC H;  2LO1 A;  1VQL V;  3DXR B;  1WLE A;  2UXC O;  1XEQ A;  5B1A B;  4F4L A;  4DR6 B;  5B1A C;  2X6A A;  2E5L B;  3A8T A;  4KFM A;  2ITD C;  4FZ1 A;  2JRI A;  1SZT A;  2N74 A;  5LYJ A;  4JYA O;  3RFR A;  2QE7 G;  4LP8 A;  2ZR3 A;  2JIZ G;  3AK1 A;  4BIU A;  4DV7 B;  1VQN V;  4JI8 O;  1YF2 A;  1GM7 A;  3H1I H;  2UXD O;  2R70 A;  1OV9 A;  4J7Z A;  4LFA B;  2ATK C;  4YIP A;  5JCO A;  4JI2 B;  4JI0 B;  1EM1 A;  3H1H H;  1BHA A;  1EN6 A;  1PKX A;  3J80 N;  2N04 A;  4JI6 O;  4UUJ C;  5EZY A;  5EYP A;  2PZS A;  1S5J A;  1YVW A;  1SET A;  4R8C A;  1RFY A;  5K1X A;  1AI5 A;  4RO2 A;  3D8C A;  2LJ2 A;  3IC7 A;  4IHJ B;  2Q7H A;  2PGG A;  2EIM C;  5LGN A;  4TV8 A;  4J41 A;  1K7D A;  2AZ2 A;  1H2M A;  3CCQ V;  1HNX O;  2A06 H;  1FJG B;  3N2G A;  5GON A;  1KYO F;  3CC2 V;  1QLE C;  2ZD9 A;  1IBL O;  4DUZ B;  1XNQ O;  2GV9 A;  3OUF A;  4I4T A;  2PUS A;  1FKA O;  2VQE O;  1TGO A;  4X1K A;  4DV6 O;  2QR4 A;  3RYH B;  2EIN B;  3M7M X;  3OM3 B;  3K3W A;  1JJ2 U;  4PV1 B;  3UM7 A;  2Q4P A;  4G2K A;  4JV5 O;  3VBB A;  1WP8 A;  4ZI7 B;  4GKK O;  4N23 A;  2FKX A;  2JJ2 G;  1EN5 A;  4UCT A;  3LSU A;  5JQG A;  5B1B B;  3JAT A;  1RM1 B;  4DK1 A;  4DK0 A;  1M57 C;  5B1B C;  3JAM N;  1RM1 C;  4MVZ A;  2FB5 A;  1WB7 A;  4DV4 O;  2CH7 A;  1TA8 A;  1W0J G;  3E83 A;  2E76 B;  1Q5O A;  3QF7 A;  1NZ6 A;  1U97 A;  3OGI B;  4CS2 A;  1N32 O;  2WA4 A;  1M5I A;  3K5N A;  2ZDI A;  4J80 A;  5H6Q A;  4B3R O;  3JAS A;  2Y0I A;  1ROP A;  1VF7 A;  4WFE A;  5CA3 A;  4FIP C;  2GUZ B;  5IYZ A;  5D5Q A;  4NXM B;  1DGS A;  1KP2 A;  3K06 A;  2ZM6 O;  4BAY A;  2F1M A;  1BS3 A;  4MVR A;  5E79 Z;  3OE7 G;  2OCC B;  4JAS A;  3K0D A;  4B3M B;  5FPR A;  4UVA A;  2OCC C;  5HFM A;  1V9P A;  5IE9 A;  4FM2 A;  4MW3 A;  2QWN B;  5EBW C;  4H33 A;  3CCU V;  2KKW A;  1N36 B;  4JAV A;  5LOV B;  5LP6 C;  1Y4M A;  1WPB A;  2Q8V A;  3H1L H;  4XDK A;  1D5A A;  2PTM A;  4O4H A;  1QVF U;  3IFX A;  2QM8 A;  3FKS G;  4G28 B;  2KG7 A;  1GN2 A;  4JI4 B;  3MAQ A;  3ZHV A;  1KQS U;  1EBO A;  1IBK B;  4MVO A;  2WLN A;  1R3I C;  3CRR A;  2DQ3 A;  4BIZ A;  1XQ8 A;  4UCV A;  3T1Y B;  2YIA A;  3JAL B;  4D6T H;  1OCZ B;  3FAV B;  3L70 H;  1M9N A;  1OCZ C;  4X66 O;  3P3P A;  1Q3E A;  1XDC A;  5B66 Z;  4UV8 A;  5A9G A;  2UUC B;  5JVD B;  4LNU A;  3SYO A;  1XIL A;  5C8Y B;  4PDV A;  1NKD A;  3ABU A;  4FFB A;  3CJH A;  3AG2 B;  2VQF B;  4O2B A;  3HKB B;  4JI7 B;  1N34 B;  2XAH A;  3ASN B;  4FLZ A;  2IH3 C;  1XNR O;  2HJF C;  5J2U B;  3G6E V;  3VQV A;  4X62 O;  1XMO B;  4LR3 A;  2Q9L A;  2DMX A;  2ZR2 A;  1PL4 A;  1MSW D;  2OTL V;  5EC2 C;  4JF3 A;  2BOB C;  1Q6I A;  2ZIM A;  4KXR A;  3WG7 B;  4J9Z B;  4TV9 B;  3WG7 C;  4H13 B;  3QO8 A;  3RYF B;  2HHH B;  4WF9 V;  1S3J A;  1URF A;  2F4V O;  4LF4 O;  3ZN0 A;  1KD1 W;  1Y76 A;  1HDJ A;  3EXA A;  2K1E A;  1XHX A;  4FLX A;  2OYQ A;  5BXZ A;  2DWE C;  1ZL8 B;  2IJH A;  3Q4H B;  3M99 B;  5BMV A;  3ASO C;  3LSS A;  1YDX A;  4P9P A;  2DN9 A;  2CTP A;  1LR1 A;  4MVS A;  3ZMT A;  2RMK B;  4TQF A;  2CUG A;  4LWS A;  1NR7 A;  2HFE C;  3J81 N;  1GK9 A;  1MMM A;  4YJ2 A;  1GM9 A;  2X6C A;  2UXC B;  4JTD B;  2CDY A;  4LFC B;  3B8M A;  1ZTE A;  4MTG A;  1XBL A;  3IC9 A;  1PNL A;  2WLH A;  1AVM A;  2NNU A;  3RBZ A;  3WFV A;  3CC4 V;  3ZHQ A;  2BTQ B;  1FPO A;  4CH3 A;  2P6J A;  5CBG A;  5KHG A;  1WB8 A;  2M6Y A;  1K5Q A;  1YEW A;  2ZQM A;  2VWJ A;  4DO2 A;  3L71 H;  3K5L A;  4JI8 B;  3CX5 F;  3UO3 A;  1BMF G;  4JTA B;  1E1R G;  2UXD B;  3HKE B;  3BFR A;  2BE3 A;  2Q0O C;  3JYC A;  2XOK G;  2JK5 C;  2JVD A;  5LL6 Y;  1JX9 A;  1FXH A;  4EFE A;  1WA8 B;  4UXN A;  1KKC A;  1YIT V;  4J9Y B;  4FZ0 A;  5IJ9 A;  4CZZ A;  3OTO O;  2Q67 A;  4DR5 B;  3CWB H;  1ZSP A;  1KMI Z;  4GYC B;  4XDJ A;  4P30 A;  3QTC A;  1S77 D;  3ZS8 C;  4RUF A;  1PNK A;  4ABM A;  5GW7 A;  1HR0 O;  4CS3 A;  1H2N A;  2XAG A;  2W0F C;  3ZJZ A;  5B5E Z;  4X65 O;  1QVG U;  4I9Q A;  1YZB A;  4YY3 O;  4HZ3 A;  2EIL B;  4CBC A;  1FS0 G;  3KCX A;  1TUB A;  1P84 F;  1QU7 A;  4O4L A;  2ZE5 A;  5KLV H;  4YJ3 B;  2JGD B;  2QEX V;  4HNA B;  1HW7 A;  4XDL A;  5D5P A;  1K9M W;  3LUT B;  1AI4 A;  2F95 B;  3ZMZ A;  1H2L A;  2H8P C;  4YHH O;  1HNW B;  4J7K A;  5BR8 O;  1KKD A;  2Y69 C;  2GTS A;  4PI0 A;  4JGS A;  1QLN A;  4DRX A;  5J2T B;  2IJK A;  3FX7 A;  3KZI Z;  4KHP O;  3SYP A;  3BHP A;  2YIB A;  1NTZ H;  3MDS A;  4JI3 B;  1DK1 A;  1SQP H;  4I0X A;  4TSF G;  3F5T A;  3TJT A;  4DV4 B;  1G8M A;  1B6Q A;  2CGN A;  1JVM A;  1K4D C;  1NTK H;  1Q7Y W;  1H2S B;  2XT9 A;  3E22 B;  1N32 B;  3RYC A;  1IVS A;  2WAM A;  4GUN A;  4AHC A;  4X1I A;  1HNZ O;  1BQZ A;  3KKY A;  4O4I A;  1AP5 A;  4K8X A;  5KX5 B;  1XMQ O;  2MW2 B;  2ZM6 B;  3ABK C;  1FFX A;  1FXV A;  3I56 V;  4CC6 A;  3RW0 A;  2WLI A;  3ICX A;  1RP3 B;  2WA3 A;  1YJW V;  4MSW C;  5CA1 A;  1IXM A;  4DV5 O;  2WLL A;  4PA3 A;  1YIJ V;  1SRY A;  3UT5 B;  2HVK C;  1P7G A;  3JAK A;  2QDO A;  1OJH A;  4WFB V;  2DYS C;  4R7C A;  4IYH A;  1R73 A;  1FXK B;  2YXL A;  2OWO A;  4QPJ A;  1IX9 A;  3WB1 A;  1H38 A;  2H94 A;  1N33 B;  1V54 C;  1MNG A;  3SJC C;  4LC1 A;  5KUM A;  2JEX A;  4LFB O;  2ZIN A;  2L6L A;  5J9P C;  4LF9 O;  2HKO A;  4CC5 A;  4RWU A;  3OR6 C;  4LF7 B;  3G4S V;  3ZED A;  4P9O A;  2EX3 A;  3SPI A;  3VQX A;  1VF6 A;  4JZG A;  3N2K A;  4U7O A;  1JA8 A;  2F43 G;  3CCM V;  3D36 A;  2P22 C;  4OPA A;  4LH6 A;  4W4K A;  3CC7 V;  3SPJ A;  1O9H A;  4ASU G;  4UCS A;  3VQY A;  1MSD A;  1AJQ A;  4X66 B;  4ZIB A;  2RDC A;  3ABL C;  1I0H A;  4J7J A;  2PYJ A;  2Q69 A;  3K57 A;  5LHH A;  2YEV B;  3B09 A;  5AG2 A;  3RGB A;  1I7F A;  3FD9 A;  4WFH A;  1TVK B;  3BAA A;  2AXT Z;  3L74 H;  3STL C;  1GM8 A;  2AZ0 A;  4PDM A;  1OCO B;  1W0K G;  2WLJ A;  1OCO C;  4F6R A;  3WB2 A;  5JH7 A;  5KMG B;  1SQB H;  3JD3 A;  5JCO C;  4X62 B;  1Q43 A;  2QWO B;  1H2G A;  1F23 A;  1Y74 A;  3K5M A;  1Q8I A;  4X88 A;  3SJB C;  1K8A W;  1OCR C;  4EKW A;  2UU9 O;  3AG3 B;  3FB8 C;  5L3F A;  4DV3 O;  2IW5 A;  4TV8 B;  3TK1 A;  3AG3 C;  2D3O W;  4LF4 B;  2W6J G;  2VWK A;  4YXW G;  3N2G B;  2YXH A;  3H1K H;  3E86 A;  1AJP A;  4I5S A;  3QO7 A;  4GKJ O;  1L0N H;  4KL1 A;  4GX1 A;  4I4T B;  1IUR A;  2DWD C;  4UVC A;  3CXC U;  3BRC A;  5DN6 G;  4I7Z B;  1VQO V;  1GMG A;  4WBN A;  5LBQ A;  3P30 A;  2B9Z A;  2ETN A;  4Z2W A;  3CCR V;  5E1A C;  1N0J A;  5JQG B;  4DV2 B;  3JAT B;  1NU1 H;  4RQE A;  1MZF A;  4E4E A;  2EIM B;  1OCC B;  3JCZ A;  4BIO A;  1OCC C;  4EB6 A;  1AI7 A;  5L3D A;  4NTY A;  2NN4 A;  4FJC C;  1QLE B;  1VIB A;  4BWA A;  2PYL A;  3DXR A;  1CPY A;  3K08 A;  2QKA A;  1FYJ A;  5C93 A;  3CYO A;  1VMG A;  4K35 A;  3OTO B;  4X64 B;  3T1H B;  2ZDI C;  3JAS B;  4PDR A;  2HVJ C;  4NB5 A;  4JI5 O;  1JQ0 A;  3PN1 A;  3A0H Z;  4MVQ A;  1I08 A;  1JJO A;  1HR0 B;  2ZT9 B;  3G6B A;  1E1Q G;  4DR4 B;  1YTF B;  2V1D A;  5FNV A;  1QBZ A;  4YY3 B;  1M57 B;  2RCV A;  3LSQ A;  3S3X A;  1Q6H A;  3OAA G;  3SPH A;  1K92 A;  3JCU Z;  4RQF A;  1AR1 B;  1WAZ A;  3BA9 A;  1QNM A;  2XHB A;  4JZ2 A;  4GLX A;  3QO5 A;  3CXH F;  2X6B A;  3CMA V;  4DV0 B;  3JSN A;  4YHH B;  2W6I G;  3MHS C;  4FK5 C;  2RN9 A;  1BQ0 A;  5LA6 A;  2X0L A;  4IHJ A;  3W7T A;  2Y0P A;  5CA0 B;  4O4J B;  4R50 A;  1BT8 A;  2QKC A;  1YSC A;  1S5H C;  1GRJ A;  2JJ1 G;  4G27 B;  3UCS C;  3CCL V;  1K5S A;  2RQ6 A;  2UUB O;  2QWQ B;  2UUA B;  5LXT A;  2CGO A;  4DR7 B;  4BW9 A;  1ZX3 A;  1XUQ A;  3B4S A;  1P49 A;  1VQM V;  2XND G;  3BEH A;  1R3L C;  3E8H A;  4PEL A;  4UCU A;  4DXW A;  5LP6 B;  2ODM A;  3DC6 A;  1ORQ C;  3JAR B;  1M4U A;  5LMU O;  3SYC A;  3ZRX A;  5IT9 N;  1BL8 A;  1EZJ A;  1XMQ B;  3OTF A;  1ZLZ A;  2IU0 A;  4QE7 A;  2DYR C;  4HYO A;  3HPL C;  2XTA A;  2YIB D;  1XOU A;  4JTC B;  3FFQ A;  4O2B B;  4X20 A;  2JEU A;  5EK0 A;  2LGW A;  1KC8 W;  4DV5 B;  2UXN A;  4LF6 B;  1COW G;  2Y4U A;  2ZE6 A;  4FLU A;  4AQY O;  3ZMS A;  1L8D A;  1ZAU A;  2GUZ A;  2LFS A;  4DUY O;  2VS0 A;  5FLX N;  1DTO A;  3ZCC A;  1UPG A;  3CRC A;  4FLY A;  2KQX A;  2YUA A;  4GX0 A;  2FL4 A;  1IZ3 A;  4UFZ A;  2EJ7 A;  4IT5 A;  1Y66 A;  4TUY B;  3JSL A;  1SER A;  5GTH Z;  4K0K O;  1VQ4 V;  2EIJ C;  2XAF A;  4LWS B;  1AIL A;  5LOV A;  2IH1 C;  1GAX A;  3OMA B;  3E2E A;  1A32 A;  1SA0 B;  4PI2 A;  4YJ2 B;  4NTX A;  4PA9 A; 
#chains in the Genus database with same CATH homology
 4YHH O;  5BXZ A;  5BR8 O;  2UUB O;  1IBL O;  4DV2 O;  5LMN O;  1XNQ O;  1FKA O;  4OPH A;  2VQE O;  4DV6 O;  4OPA A;  4KHP O;  1AB3 A;  4JI3 O;  3R66 A;  4LFC O;  3J81 N;  1N36 O;  4DR3 O;  4DR2 O;  3O65 A;  4JV5 O;  3RT3 C;  2Z0A A;  3J7A U;  1DK1 A;  4B3S O;  4DUZ O;  2DOS A;  3F5T A;  4GKK O;  2FKX A;  5LMU O;  5H5N A;  1F7Y A;  4X64 O;  3T1H O;  1FYJ A;  1R1B A;  5IT9 N;  1D2D A;  1IBM O;  4DV1 O;  1X59 A;  4JI4 O;  1I94 O;  3JAM N;  2UXC O;  4JI5 O;  1XEQ A;  1IBK O;  4LF6 O;  4DR4 O;  4DV4 O;  4X66 O;  1HNZ O;  2UUC O;  4DR5 O;  5LL6 Y;  1G1X B;  1XMQ O;  2JRI A;  2N74 A;  4JYA O;  4AQY O;  1N32 O;  3OTO O;  3T1Y O;  2DJV A;  4B3R O;  2VQF O;  1KUQ A;  1N34 O;  4NXM O;  4LF5 O;  4DR6 O;  4JI8 O;  4OX9 O;  4LFA O;  5BY1 A;  2E5L O;  4DUY O;  5FLX N;  2UXD O;  4LF8 O;  4DV5 O;  5IWA O;  1HR0 O;  1XMO O;  2UU9 O;  4A5U B;  4DV0 O;  2ZM6 O;  4DV3 O;  1XNR O;  4X65 O;  4DR1 O;  1YZB A;  4YY3 O;  2LW7 A;  4X62 O;  1J5E O;  4JI1 O;  5A2Q N;  4B3M O;  2ZKO A;  4DV7 O;  4NXN O;  3J80 N;  1N33 O;  4JI6 O;  2HHH O;  4B3T O;  4GKJ O;  1NS1 A;  1R6T A;  4JI7 O;  4K0K O;  3SDL A;  3M8A A;  4LF7 O;  1FJG O;  1HNW O;  4JI2 O;  4LFB O;  2AGA A;  2F4V O;  4LF4 O;  1AIL A;  4JI0 O;  1A32 A;  4LF9 O;  2UUA O;  2UXB O;  1HNX O;  4DR7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...