2HHHO

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2hhhO00
2DJVA 4JI1O 3SDLA 4LF6O 4LF5O 5BR8O 2UUCO 4B3MO 4DV3O 1F7YA 3F5TA 1X59A 3JAMN 1HNXO 3T1HO 1FKAO 1AB3A 2UU9O 3J80N 1I94O 4OPAA 3J7AU 1FYJA 5IWAO 3O65A 5LMNO 4JYAO 5LL6Y 1DK1A 5A2QN 2AGAA 4LFAO 2F4VO 5BXZA 4DUZO 4LFBO 2JRIA 4JI0O 3R66A 4X65O 4A5UB 5IT9N 4GKJO 1G1XB 1AILA 4DR3O 4JI8O 2VQFO 2DOSA 3RT3C 3T1YO 5BY1A 2UXCO 2Z0AA 4DV6O 4LF7O 2UXBO 4LF9O 2E5LO 1N36O 4JI2O 4LF8O 4LFCO 4DV1O 1NS1A 1IBLO 1IBKO 4X66O 4KHPO 4DR1O 4DV4O 4DR4O 2VQEO 4NXMO 4X62O 4GKKO 2ZM6O 1N33O 4X64O 4DUYO 2ZKOA 5FLXN 4DV2O 2N74A 1XMOO 4DR6O 3M8AA 4DR5O 4DV7O 1IBMO 1KUQA 4JI3O 1FJGO 4LF4O 4K0KO 1N32O 4AQYO 1XMQO 2UXDO 1N34O 4JI7O 4B3RO 2UUAO 5H5NA 1A32A 1HNZO 1D2DA 4JV5O 2LW7A 4B3SO 1XNQO 4OX9O 1XEQA 4YHHO 4DR2O 1HNWO 3OTOO 4DR7O 1R1BA 4JI4O 2UUBO 4OPHA 4B3TO 1YZBA 4YY3O 4JI6O 2HHHO 4JI5O 4DV5O 1R6TA 2FKXA 4NXNO 5LMUO 1HR0O 4DV0O 3J81N 1XNRO 1J5EO
chains in the Genus database with same CATH superfamily
2BSKA 1XBLA 3ZCCA 1WPBA 1JFFA 3RYIA 1VQOV 4OX9B 1CXZB 1Y76A 5L3CA 1E1QG 1K97A 5KAIZ 1SQPH 1SA0A 4UFZA 1IXBA 1Y74A 2GUZB 3TJTA 2EILB 3DSQA 1HWYA 1M56B 3MHHC 3DXRB 4HNAA 2QM7A 3D8CA 2Y4UA 2ZINA 1RPOA 3U0ZA 2AGAA 2XAJA 2H94A 2EJ7A 2JRIA 4CZZA 4O4HB 4AHCA 1KYOF 1NQTA 2UXBO 4GX2A 1R6NA 2L35A 3N2KB 1H8EG 3A0HZ 3FD9A 1IBKO 4TOIA 4E4EA 1UJWB 4DV4O 1SQXH 5IY5C 3HKDA 4UB8Z 2IU3A 1XL4A 4X62O 3WU2Z 2MK3A 4YJ3A 1N33O 1I7FA 4FMTA 2Q7EA 2RDCA 2OTJV 3N2GB 1FD9A 2JK5C 4KHPB 3SPGA 3LSSA 1HDJA 1VQKV 2WA3A 2AHZA 3CCSV 3X2QB 4K0KO 1IZ3A 1OCOC 4MVQA 4JI7O 3Q4HB 3A0RA 3CE2A 1IBMB 4LP8A 1R1BA 4AILC 2WLNA 1H2LA 3CC2V 2LGWA 4MW3A 4WFFA 3AG4B 3H1IH 5J2UB 1LUVA 4WBNB 4EB6B 1S5JA 5EZYB 1F23A 4JI1O 4YHHB 2R70A 4O2AA 1IDSA 1H8HG 1R3IC 3B40A 5B3SC 2HFEC 2CGNA 3WB0A 1N0JA 3JD1A 4IYHA 4PHZA 2EIJC 5B1AB 1GAXA 1FXKA 2NLJC 4YJ2B 3W7WA 5A2QN 4B3MB 1VQPV 4DUZO 5KUMA 2F1MA 2X7RB 4GX1A 4RQEA 4JI8O 4R6ZA 4O4IA 4CS2A 2PYJA 4HBNA 5EYPA 5IWAB 2CTRA 1JA8A 1NS1A 4IIJB 4TV9A 3E8BA 4DR1O 4IT5A 1U96A 3S3XA 1K3EA 5A9GA 1JCHA 2GTSA 5IYZB 4X64O 1K7DA 1PM9A 4WF9V 5FLXN 3ZRSA 3GWKC 4PDMA 4NTXA 5EBMC 4DR5O 4DXWA 2EILC 1R6KA 2W0FC 1B06A 3T4ZA 2B9ZA 3CP1A 3DTUB 2Q8VA 4AI8A 4O2BA 1GN2A 3FB8C 2OT5A 3OTOB 4K3AA 2UUAO 3K3WA 1HNZO 1Q43A 5CB4A 3VQWA 3ZRXA 4JI3B 1S5LZ 3SPJA 4JI4O 1JPXA 2UUBO 3OEHG 4GCZA 3SGIA 3SYOA 4MVMA 2CTQA 3LNMB 4JYCA 1N32B 1XMQB 1Q82W 5KAFZ 1N34B 1SQVH 1QQCA 3ABLB 2ZCEA 2ARHA 1F7YA 3KKYA 1MNGA 4JI5B 3CMEV 4ZHQB 3K06A 2QWPB 2YICA 2KKWA 4NKGB 4OXSA 1B3QA 2UU9O 1S72V 1FXHA 3FAVA 4BIOA 1NTZH 2G38A 3CXCU 3G4SV 5B1NA 3X2QC 3RYCA 3RVYA 2XT9A 1GKFA 2WLMA 4CC5A 1VQMV 2XUMA 4TWKA 2AHYA 3B77A 2DYSB 1L0LH 5CBGA 3G6EV 3P3PA 3EVKA 2M6YA 1QR9A 2YIAA 1VARA 3JCZA 3AG4C 2UXBB 3UKMA 2DMXA 4TSFG 4DRXA 5CA0A 2OIGA 4DV2O 3M7MX 5B1OA 5JCOC 1XMOO 1IBKB 3FKSG 5EIBD 4DV4B 5L3BA 1WB7A 4HAMA 5CA1B 1KUQA 4PA3A 4LR3A 4FLYA 4X62B 1M1KW 1N33B 2KG7B 5B1AC 5C8YA 2VRZA 2LGQA 2YXLA 2P22C 4I0XA 2A7WA 2LW7A 1XEQA 5JJEB 1AI6A 1SQGA 1I08A 3FYEB 1XL6A 2YIBA 1IVSA 4LC1A 4MSWC 4K0KB 1HR0O 1NKDA 3K9SA 3W7UA 4K8ZA 4YIPA 4JI7B 4IHJA 1ZTEA 1MG1A 3BA8A 5LOVB 4PDLA 4LF5O 4X20A 2HKOA 3JD2A 5IJ9A 5J2TB 2JGDB 1RSOB 4J9YB 1ZX3A 1NJIW 4TQDA 4FZ0A 3THOA 1VF6C 1K8AW 2QSAA 2F23A 1F4MA 3EFFK 2XNDG 4ZOLB 2Q0OC 4JI1B 3O65A 5LMNO 4JYAO 1YXBA 1BCCH 1TVKA 5DECA 4X1IB 2PI4A 5E79Z 3ETEA 3JSLA 4LWSA 2ZIOA 2Q5ZA 1VQ4V 4JI2B 3SPHA 3CS5A 2RNBA 2WLLB 4FFBB 2CAZC 2QKSA 1IBLO 1TA8A 4DUZB 1BL8A 1KMIZ 4DUYB 1P49A 4JI8B 1FAFA 1W0KG 1AR4A 3LSQA 3OMIB 4UCVA 3ZRWA 2H8PC 5JH7B 2EIKB 2ZXWB 3ABLC 4F4LA 1N8RW 3PN1A 1MZEA 5E1AC 3DGEA 2ZIMA 3F7VC 4LCUC 3E22B 2F93B 5LGUA 5CA3A 1XDCA 1HW7A 1BHBA 1YHQV 1EZVH 2PGGA 4X64B 1O9HA 4WFBV 2BSKB 2GV9A 1JFFB 3RYIB 4QIWF 1Y76B 4DR5B 4DR2O 5JJJB 1SA0B 4DV0B 1QLNA 3ETGA 1US6A 3RGBA 3ZN1A 4EEQA 1Y74B 5KHIA 4DV5O 1BGYH 1Z5VA 1KD1W 2DYSC 4HNAB 2UUAB 1VEWA 1HNZB 2DJVA 1K73W 3N27A 3JD3A 5LHGA 1OHHG 3ABMB 4JI4B 4DV3O 1LUWA 4X89A 4B7EA 3QG5A 1ZLZA 2QWNB 3OTFA 2O57A 2JIZG 3ASNB 2K1EA 1EBOA 3R66A 2XAGA 3MDSA 4MTGA 4W4LA 3F5WC 4DR3O 3AG7A 4CC6A 5BY1A 4YJ3B 5D5PA 2ZDIC 3CRRA 2UU9B 3CCJV 2CK3G 3STZC 4HZ3A 2A79B 1U97A 5IDJA 2QM4A 3JALB 4LBEC 3RW0A 2V7QG 5B1BC 4B08A 5LHHA 1D5NA 1MMMA 2P4VA 3EXAA 4DYLA 5JQGA 1SC5B 2JS5A 4TUYA 2DQ0A 2XASA 5EK0A 4PJ0Z 1PNLA 2AZ2A 1QVFU 5KX5A 3CCMV 3M8AA 1NI8A 4TT3G 1Y6XA 3CRQA 1NU1H 3OR7C 5EIBC 3F7YC 4NR1A 1PNMA 1NZ6A 2EX3A 2EZOA 4DV2B 2GSMB 4B3RO 2P06A 1XMOB 4XBFA 2RMKB 3E83A 4O2AB 2K9PA 3OTOO 3SR2C 1NTMH 2XHBA 4FPPA 4MVUA 2FKXA 3PJSK 1CP9A 2QTOA 1URFA 1FXKB 2AW9A 1YI2V 4LF6O 1AJNA 1MOFA 2CH7A 2QM8A 2F95B 2EIKC 2ZXWC 4I55A 3LDDA 2P6JA 1HR0B 2X6CA 2N05A 4O4IB 4J7ZA 3R65A 5EYPB 1MABG 4LNUA 4MT8A 4LF5B 5KMGA 4TV9B 1DK1A 3UCSC 1XILA 3KG2A 2IJKA 2HG5C 1Q7YW 3L74H 2UXCO 4U3FH 2IBZH 2EJRA 3G67A 3L9DA 2VQEB 5LMNB 3L72H 4JYAB 4UCOA 3CWBH 1N4CA 2CUGA 3ZMTA 1ZUQA 3JAWA 1Y67A 2QDOA 3ZS8C 4JTDB 5H6RA 1TAEA 1GK9A 2E75B 4PA6A 2YI9A 1FFXA 2OWOA 4O2BB 3CX5F 3ABMC 3AG2B 3BCCH 3OMAB 3BHPA 1NT2B 2N74A 1IBLB 4H13B 5CB4B 4B7KA 1FXVA 2LQTA 3ZX6A 3W7SA 1JJOA 4JPRA 2OCHA 3WB1A 2Q0AA 1BMFG 2ZT9B 5L3GA 3L75H 3ASNC 4R7CA 3FFQA 2IH1C 3AG3B 4X1YA 4FM2A 2FTKA 1WN7A 1S0VA 4JV5O 4B3SO 2YEVA 4MTFA 3UO3A 4QGPA 1B04A 1Q90D 4NTWA 2HHHO 4UCSA 1OCRB 3H01A 4CS4A 1WPXA 2VS0A 3CRMA 3SJQC 1JQ0A 3FAVB 4DR2B 5H9CA 2WA4A 3STLC 2QE7G 4PI0A 3I55V 1YDXA 3FB7C 3RYCB 1WLEA 4DV5B 4I4TA 3RYFA 2ADPA 4YXWG 1IXMA 1L8DA 1R3LC 3A8TA 1FKAO 3RWRD 5KHGA 2YIBD 1GN3A 4N23A 1PV0A 2ILMA 1W59A 4DV3B 2B5UA 4JI0O 2Y0PA 2QKCA 5IT9N 5GTHZ 1OV9A 1AR1B 3SJCC 1VQ6V 1PP9H 3RYHA 3D36A 4LF7O 3OGIB 1JJ2U 4DRXB 5CA0B 1KKDA 1GH6A 2YXHA 4JI2O 5DN6G 2GHYA 5GONA 2LJ2A 1EN5A 4EFEA 3OR6C 3KCXA 4DR3B 2PZSA 1QCEA 4NXMO 3RVZA 3OUSA 3IFXA 1FXKC 5C8YB 4DUYO 5JJNB 2QWRB 3G71V 4I0XB 3K04A 5LXTA 3DC5A 4GZRB 3JATA 2DE0X 2JJ2G 3ZBHA 3H1KH 1FJGO 5JVDA 3HPLC 4X1KA 2XAFA 3UM7A 4LF4O 4LH7A 3UO2A 2B1GA 2W6JG 4IHJB 4OGQB 1AR5A 3H1JH 1M9NA 1EZJA 2OCCB 3CRAA 5IJ9B 3C3TA 4J41A 4JI6O 2ZNIA 4MVSA 4FM0A 4RUFA 3OMNB 1M56C 2WAMA 5IYDO 5IYBO 4DV0O 4B3RB 5KHHA 3OFNG 1VQNV 2A06H 1TVKB 1NBMG 5DEDA 4BAYA 1Q81W 3AK2A 4H37A 4LWSB 2QWOB 4JTCB 5KLVH 1VQ8V 1BT8A 2P4KA 1SESA 4J7KA 1FYJA 3J7AU 3CD6V 4LF6B 3VQXA 4FVMA 5LP6A 1YIJV 1AP6A 1SS3A 1WP8A 2JEXA 1QVGU 3ZRWB 3AG3C 5LBQA 5LA6A 1M4UA 4LF8O 2RN9A 1YF2A 3VQVA 2ITCC 1Y66A 5LGNA 2ZM6B 4Q6GA 1OCRC 3L70H 3WG7B 3H9VA 3TETA 2BOCC 1GM9A 2UXCB 1BQZA 3JASA 1GN4A 1OJHA 3JAKA 1CEZA 1RPRA 3HKBA 5FNVA 2BE3A 1ENVA 1Q3EA 4BWAA 3LDCA 1M57B 5LHIA 1KKCA 3D3QA 4MVOA 2JDIG 5KA6A 1NR7A 1E79G 4EKWA 4Q20A 4DO2A 1V55B 4D6TH 2BCCH 1P4RA 2M7WA 4J10A 1AI7A 5H5NA 1BQ0A 3C90A 3NXSA 1H2MA 4EFBA 4GT1A 3CC4V 4I50A 4MVZA 1L1FA 1YZBA 4J9ZB 3IGAC 4ASUG 4FLWA 2R9AA 1ZL8A 1XNRO 1XQ8A 4JV5B 4B3SB 2ZNJA 2E74B 1SQBH 5C93A 4KXRA 2HHHB 3RBZA 3ETQA 2ITDC 1K34A 2FL4A 1GM7A 2FYUH 1QU7A 4CH4A 3ETDA 1SZTA 1LNQA 1OCCB 1JVMA 2VWKA 3SYAA 2HP8A 1PPJH 1Q8IA 5JQGB 4TUYB 2DOSA 1NH2D 5FL7G 4DV6O 2ZE6A 4LF9O 4MTOA 1N36O 4W4KA 2OCCC 5KX5B 4F6EA 5HFLA 1MSWD 1XI1A 3S3WA 2XAHA 4JI0B 3ASOB 4PD4F 2VQEO 2MW2B 3CJHA 1X4TA 3CXHF 2CDYA 5IYZA 1TGOA 1WNSA 3TXSA 1G8MA 5HFMA 4R8CA 4LF7B 1O9GA 3ZMZA 2IW5A 1K4DC 3T1CA 3K59A 3HKEA 3BA9A 3CCRV 3DC6A 4NXMB 1SF9A 2YSUB 1W2BU 1M5IA 4QE7A 1A32A 3TCUA 3U10A 1XNQO 2DQ3A 4WFEA 1NH2B 2HJDA 1HNWO 2CH7B 1FS0G 1FJGB 2BTQA 1QHTA 1TUBA 1J5EB 2E3CA 4H44B 1YJ9V 3ZMVA 4I55B 4LF4B 4FLXA 2DN9A 4BIUA 3MHSC 3L73H 2P7TC 1AVMA 3WG7C 4LNUB 1SKVA 2L6LA 3WB2A 3NR7A 3QTCA 3ZMSA 5BZBA 3JARA 4JI6B 3AEIA 3A2FA 1OZ0A 5KHJA 3U11A 3QF7A 3JAMN 4O4LA 1GN6A 3AG1B 4ABMA 1SQQH 4N21A 2DW4A 1M57C 3E8HA 2EBOA 3K0GA 2F43G 2GDSA 4OPAA 4X88A 2WLKA 4H0LB 1Z2GA 1UFIA 3G6BA 1SQFA 2NN4A 3JAWB 1V55C 3CCLV 3HR0A 1G1XB 1B6QA 1BSMA 4FM1A 3T1YO 2XAQA 1FFXB 1Q6HA 3K79A 3HB3B 3OD4A 2BTOA 2GTAA 1JR9A 4LH6A 1KC8W 3K58A 3SPCA 4QNHB 3OE7G 2W0XA 1Q86W 4PA7A 3CRCA 3HKDB 1QBZA 4LF8B 3KCYA 4ZI7A 4X1YB 1G4YB 2PUSA 4I5SA 2UXXA 2QEXV 2YEVB 4FJCC 5EC2C 5L3FA 1FPOA 4DW1A 1YTFB 1XHXA 4X9QA 4PV1B 4AQYO 1N0NA 2CTPA 1OCCC 4B3TB 4BR6A 3CCVV 1YVWA 4DR7O 3CCUV 5IYCO 3B2EE 2ADQB 2Q73A 3UQ8A 1H2SB 2XTAA 3OEEG 4I4TB 3RYFB 4NXNO 5LMUO 4FZ1A 4RQFA 1CPYA 3LDEA 3IJ4A 3ASOC 2Q7GA 3QVNA 3SDLA 1SRYA 3WFVA 4NYKA 3G80A 1D5AA 3CMAV 3SPIA 1FFTB 4JGSA 2HLDG 2C2AA 3RYHB 5L3DA 3T1HO 1XNRB 2Z3YA 2WWWA 1WB8A 2ODMA 4LFBB 1H2KA 5BMVA 1SERA 4PDRA 1AB3A 4JYBA 4WFHA 4CH5A 2DWEC 5GONB 2JGUA 2IJJA 1AP5A 2F4VO 1WA8A 4U7OA 4GUNA 2E5LB 3ZHSA 2N04A 5H2FZ 2QGNA 2WSSG 1JMKC 3QO8A 2LFSA 4LFCO 2HVJC 4X66O 5LXTB 2FB5A 1WAZA 3JATB 5IE9A 2HVKC 3K03A 2P90A 1QLEB 1YCIA 4UCUA 5JVDB 4JTAB 4X1KB 4J7JA 2ZM6O 4DV6B 4LF9B 1M90W 3CB2A 4BW9A 1N36B 1VIBA 2Y4TA 2HEPA 4FIPC 3VQYA 1GM8A 1XOUA 1OCZB 5EBLC 1KU9A 2ZR2A 2X6AA 4G27B 4BIZA 3AG1C 3BRCA 2E76B 4ZKIA 4I9WA 4F6RA 1XHZA 4KFMA 2YUAA 1KP3A 3BPZA 3E8GA 3ABKB 3CYOA 3TK1A 4QPKA 4ICGA 3QO7A 4OPHA 1DF4A 1MA1A 4XDJA 1V9PA 1F4NA 3BY6A 5IJ0A 4DK0A 3P32A 2YI8A 3E86A 2R9IA 2Y0IA 1XNQB 4KP4A 3B8NA 4O4JA 1HNWB 5BR8O 5LP6B 2UUCO 4P2ZA 4UV8A 3W7XA 1VQ7V 2EINB 1PD3A 5ITZA 1WP7A 2KB1A 1Z5WA 3ZIAG 4FLZA 4YIOA 2D3OW 4TV8A 5LA6B 2V4DA 2WLHA 5LL6Y 3GB7C 4JAVA 1BE3H 2IJIA 3JD4A 5BXZA 4UV9A 3FB5C 4X65O 4A5UB 1KB9F 4GKJO 4RAIA 2QR4A 3I5DA 3JASB 1V54B 3JALA 3JAKB 3HKBB 5FNVB 1P7BA 2DYRB 3ZHVA 4IGGA 4DV1O 1YITV 3LSUA 4G2KA 1Q6UA 1DLBA 2WLJA 3K0DA 3KZIZ 5L3EA 1ORQC 3SYPA 2Y69B 3T1YB 1AI5A 4CH6A 2RCVA 3ZRVA 4J11A 1YJWV 1Q5OA 5LYJA 3FB6C 4PA9A 3OAAG 5EBWC 4DV7O 4I50B 3D36C 1GRJA 1I0HA 2ZE5A 1SETA 5F2VO 1VQ5V 1NR1A 2WLIA 1ZL8B 4TQFA 4P9PA 2Y48A 4JAUA 3HKCA 1AJPA 2EZPA 4UVCA 2BOBC 4AQYB 3UT5A 3J81N 1J5EO 2IM9A 3BVOA 1VF5B 4FLUA 4U3JA 3SJBC 4QE9A 5GTIZ 3K08A 1K5SA 1PL4A 1ZSPA 4J42A 1QLEC 4DR7B 1KP2A 4GLXA 2AZ0A 5H6QA 4MTXA 5DM6V 1T5EA 3F5TA 3B8MA 3K5MA 4Z1VA 3CC7V 4X20B 2Q69A 3JCUZ 3BABA 5LMUB 4NXNB 1E1RG 1OCZC 3JD0A 2X0LA 5GW7A 1S77D 2LO1A 3CCQV 1PL0A 4CBCA 1I94O 1KBHA 1W0JG 4JASA 1YJNV 1IURA 4LFAO 3ABTA 2KSDA 2P67A 5CBFA 3RFRA 3CJHB 4FK5C 2Q4PA 1RFYA 1AILA 2GUZA 3CSXA 3ICXA 1K5QA 3T1HB 5KHKA 3RT3C 3DXRA 1XREA 3ABKC 1ZWIC 3AG2C 2F4VB 3HKEB 4DR4O 1KECA 4O4HA 3MD0A 1BS3A 2YS8A 2H3OA 2NR5A 4GKKO 4DR6B 3CEIA 2LFRA 2ZKOA 3N2KA 2CTWA 4LFCB 3T4DA 5LP6C 1EN6A 4Z2WA 2IU0A 2Q7HA 4X66B 1BHAA 3B09A 2EINC 4QJFB 3SYCA 2BTQB 4BW5A 1TUBB 1RM1B 3ZEDA 2PF4E 3OM3B 3IAYA 4JZ2A 4CH3A 3IC7A 4NTYA 2UXDO 3ABUA 4ZBMA 3IC9A 4GX0A 4UXNA 4WFAV 3N2GA 3QO5A 3K5OA 2F66C 1NVPD 1H38A 4R50A 4UVBA 3K5NA 3JARB 4B3TO 4YY3O 3H1LH 4PELA 1V54C 4FLVA 1R6TA 2Z5UA 3ZJZA 3LUTB 1QNMA 1L0NH 4O4LB 2DYRC 1AJQA 3CPWU 4FFKA 3Q4HA 2RJZA 2IJHA 1VQLV 3ZN0A 2X6BA 4GYCB 5LGTA 4XDLA 2QKAA 1HP8A 2Y69C 1H2GA 2P5OA 1M93A 3JSNA 4WFGA 2XOKG 1I5YA 1HNXO 3I56V 4WBNA 5J2UA 4EB6A 4PI2A 3J80N 4NVPA 4UVAA 5EZYA 5BR8B 1BZKA 2UUCB 1THZA 3GWOA 5JCOA 3BAAA 4LFBO 2OYQA 4KUMA 5K1PA 2A0LA 2ZE7A 2VQFO 1NTKH 4JYYA 1NVPB 3D3IA 2E5LO 1VMGA 3AK1A 4ZI7B 2NNUA 1R3JC 4YJ2A 5B5EZ 3OW2U 1S5HC 4X65B 2YIDA 4GKJB 5CN0A 3EHBB 3E2EA 5JWPA 4IYIA 1COWG 2JS3A 2ZQMA 1Q6IA 2ZR3A 3VOUA 4DV1B 3QNEA 2PY5A 4IIJA 5FPOA 5B1BB 2IH3C 3T2MA 1KQSU 3P30A 4DW0A 5EC1C 1YSCA 1F51A 2A3QA 2JEUA 4ZIBA 4L87A 3FYIB 2LP7A 1P7GA 3OUFA 4CS3A 5CBHA 4J80A 1D2DA 1VF6A 4OX9O 4DV7B 2GBOA 4IL6Z 2ETNA 3BEHA 2VWJA 2CE4A 3A0BZ 1AROP 4PA4A 1GO3F 4KL1A 4MVRA 5BMVB 1Y4MA 2PI5A 1SZXA 3FX7A 5B66Z 4K35A 1WA8B 2CGOA 3RN4A 1X59A 4K8XA 3SYQA 3E8FA 4JF3A 4MS2A 3GVMA 5KUKA 1ROPA 4RUEA 1P84F 3ZMUA 1RM1C 1LR1A 2QJ1A 5D5QA 2EIMB 3H1HH 1K9MW 2HR3A 5KMGB 1DGSA 3ZHTA 4ZHQA 3OGCC 1DTOA 4P9OA 3O9OA 1GTOA 4UCRA 5KA5A 1K4CC 4DR1B 3P3NA 1H2NA 1I94B 5CMUA 1G6UA 1RP3B 4P30A 4NB5A 4LFAB 2PTMA 4E2LA 1YTFD 4KHPO 1EFRG 1AI4A 1XUQA 2RQ6A 4XDKA 2YXYA 2B1IA 2LW1A 3LNNA 4F6RB 2PYLA 3ZHRA 4D7SA 2ZE8A 2KQXA 3JYCA 4DR4B 1PNKA 1IBMO 4X8AA 1MZFA 1K33A 4GKKB 2JJ1G 5IJ0B 2D2CB 2QWQB 2EULA 4H33A 2QA4V 2UUBB 1TUEB 3ZHQA 2QTSA 2Q67A 1VQ9V 4U7NA 1ZAUA 4YHHO 4O4JB 3K5LA 1VF7A 3AK3A 5CA1A 3VBBA 5J9PC 3BFRA 4WCEV 1R3KC 2KG7A 5ITZB 5IY5B 2UXDB 3ZHUA 4Z1MG 4UUJC 5AG2A 4UCTA 1IX9A 4D7TA 4TV8B 1J95A 5TISZ 2ZDIA 2ZD9A 4JZGA 1I5XA 4QPJA 4B3MO 4YY3B 3M99B 4I9QA 4RO2A 1DF5A 3E89A 2AXTZ 2YDEA 1PKXA 5LOVA 5IWAO 3K9AA 3W7TA 1OCOB 1JOYA 1S3JA 3TXQA 5J2TA 2JGDA 4JAAA 1RSOA 1UPGA 2UXNA 1HNXB 1VP7A 4RWUA 3TGUH 2Z0AA 2HJFC 4ZOLA 1R73A 5LYJB 1JX9A 3APQA 4X1IA 2V1DA 1QR8A 2Q6AA 2OIEA 3CHXA 3OT7A 3L71H 2VQFB 4DK1A 2R72A 3E35A 3K57A 2W6IG 4GX5A 2WLLA 4FFBA 2WLIB 3CCEV 1YEWA 2ATKC 4HYOA 3ML0A 5B3SB 1S76D 2JVDA 4DR6O 3B4SA 2Q9LA 2EIJB 1EN4A 2A9HA 3HKCB 4MW8A 2FMLA 4JI3O 2WPDG 4C7UA 4UB6Z 5JH7A 3UT5B 1N32O 4I7ZB 1XMQO 4G28B 5K1XA 1GMGA 2R9RB 1K92A 1N34O 2EIMC 4U3JB 3MAQA 4L8JA 5FPRA 1EM1A 3SJAC 2DWDC 1WJZA 3E22A 2YC0A 3C3SA 4FLTA 4PDVA 3APOA 2OTLV 4JI5O 2Q68A 1MSDA
chains in the Genus database with same CATH topology
2DJVA 4JI1O 3SDLA 4LF6O 4LF5O 5BR8O 2UUCO 4B3MO 4DV3O 1F7YA 3F5TA 1X59A 3JAMN 1HNXO 3T1HO 1FKAO 1AB3A 2UU9O 3J80N 1I94O 4OPAA 3J7AU 1FYJA 5IWAO 3O65A 5LMNO 4JYAO 5LL6Y 1DK1A 5A2QN 2AGAA 4LFAO 2F4VO 5BXZA 4DUZO 4LFBO 2JRIA 4JI0O 3R66A 4X65O 4A5UB 5IT9N 4GKJO 1G1XB 1AILA 4DR3O 4JI8O 2VQFO 2DOSA 3RT3C 3T1YO 5BY1A 2UXCO 2Z0AA 4DV6O 4LF7O 2UXBO 4LF9O 2E5LO 1N36O 4JI2O 4LF8O 4LFCO 4DV1O 1NS1A 1IBLO 1IBKO 4X66O 4KHPO 4DR1O 4DV4O 4DR4O 2VQEO 4NXMO 4X62O 4GKKO 2ZM6O 1N33O 4X64O 4DUYO 2ZKOA 5FLXN 4DV2O 2N74A 1XMOO 4DR6O 3M8AA 4DR5O 4DV7O 1IBMO 1KUQA 4JI3O 1FJGO 4LF4O 4K0KO 1N32O 4AQYO 1XMQO 2UXDO 1N34O 4JI7O 4B3RO 2UUAO 5H5NA 1A32A 1HNZO 1D2DA 4JV5O 2LW7A 4B3SO 1XNQO 4OX9O 1XEQA 4YHHO 4DR2O 1HNWO 3OTOO 4DR7O 1R1BA 4JI4O 2UUBO 4OPHA 4B3TO 1YZBA 4YY3O 4JI6O 2HHHO 4JI5O 4DV5O 1R6TA 2FKXA 4NXNO 5LMUO 1HR0O 4DV0O 3J81N 1XNRO 1J5EO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJV A;  4JI1 O;  3SDL A;  4LF6 O;  4LF5 O;  5BR8 O;  2UUC O;  4B3M O;  4DV3 O;  1F7Y A;  3F5T A;  1X59 A;  3JAM N;  1HNX O;  3T1H O;  1FKA O;  1AB3 A;  2UU9 O;  3J80 N;  1I94 O;  4OPA A;  3J7A U;  1FYJ A;  5IWA O;  3O65 A;  5LMN O;  4JYA O;  5LL6 Y;  1DK1 A;  5A2Q N;  2AGA A;  4LFA O;  2F4V O;  5BXZ A;  4DUZ O;  4LFB O;  2JRI A;  4JI0 O;  3R66 A;  4X65 O;  4A5U B;  5IT9 N;  4GKJ O;  1G1X B;  1AIL A;  4DR3 O;  4JI8 O;  2VQF O;  2DOS A;  3RT3 C;  3T1Y O;  5BY1 A;  2UXC O;  2Z0A A;  4DV6 O;  4LF7 O;  2UXB O;  4LF9 O;  2E5L O;  1N36 O;  4JI2 O;  4LF8 O;  4LFC O;  4DV1 O;  1NS1 A;  1IBL O;  1IBK O;  4X66 O;  4KHP O;  4DR1 O;  4DV4 O;  4DR4 O;  2VQE O;  4NXM O;  4X62 O;  4GKK O;  2ZM6 O;  1N33 O;  4X64 O;  4DUY O;  2ZKO A;  5FLX N;  4DV2 O;  2N74 A;  1XMO O;  4DR6 O;  3M8A A;  4DR5 O;  4DV7 O;  1IBM O;  1KUQ A;  4JI3 O;  1FJG O;  4LF4 O;  4K0K O;  1N32 O;  4AQY O;  1XMQ O;  2UXD O;  1N34 O;  4JI7 O;  4B3R O;  2UUA O;  5H5N A;  1A32 A;  1HNZ O;  1D2D A;  4JV5 O;  2LW7 A;  4B3S O;  1XNQ O;  4OX9 O;  1XEQ A;  4YHH O;  4DR2 O;  1HNW O;  3OTO O;  4DR7 O;  1R1B A;  4JI4 O;  2UUB O;  4OPH A;  4B3T O;  1YZB A;  4YY3 O;  4JI6 O;  2HHH O;  4JI5 O;  4DV5 O;  1R6T A;  2FKX A;  4NXN O;  5LMU O;  1HR0 O;  4DV0 O;  3J81 N;  1XNR O;  1J5E O; 
#chains in the Genus database with same CATH topology
 2BSK A;  1XBL A;  3ZCC A;  1WPB A;  1JFF A;  3RYI A;  1VQO V;  4OX9 B;  1CXZ B;  1Y76 A;  5L3C A;  1E1Q G;  1K97 A;  5KAI Z;  1SQP H;  1SA0 A;  4UFZ A;  1IXB A;  1Y74 A;  2GUZ B;  3TJT A;  2EIL B;  3DSQ A;  1HWY A;  1M56 B;  3MHH C;  3DXR B;  4HNA A;  2QM7 A;  3D8C A;  2Y4U A;  2ZIN A;  1RPO A;  3U0Z A;  2AGA A;  2XAJ A;  2H94 A;  2EJ7 A;  2JRI A;  4CZZ A;  4O4H B;  4AHC A;  1KYO F;  1NQT A;  2UXB O;  4GX2 A;  1R6N A;  2L35 A;  3N2K B;  1H8E G;  3A0H Z;  3FD9 A;  1IBK O;  4TOI A;  4E4E A;  1UJW B;  4DV4 O;  1SQX H;  5IY5 C;  3HKD A;  4UB8 Z;  2IU3 A;  1XL4 A;  4X62 O;  3WU2 Z;  2MK3 A;  4YJ3 A;  1N33 O;  1I7F A;  4FMT A;  2Q7E A;  2RDC A;  2OTJ V;  3N2G B;  1FD9 A;  2JK5 C;  4KHP B;  3SPG A;  3LSS A;  1HDJ A;  1VQK V;  2WA3 A;  2AHZ A;  3CCS V;  3X2Q B;  4K0K O;  1IZ3 A;  1OCO C;  4MVQ A;  4JI7 O;  3Q4H B;  3A0R A;  3CE2 A;  1IBM B;  4LP8 A;  1R1B A;  4AIL C;  2WLN A;  1H2L A;  3CC2 V;  2LGW A;  4MW3 A;  4WFF A;  3AG4 B;  3H1I H;  5J2U B;  1LUV A;  4WBN B;  4EB6 B;  1S5J A;  5EZY B;  1F23 A;  4JI1 O;  4YHH B;  2R70 A;  4O2A A;  1IDS A;  1H8H G;  1R3I C;  3B40 A;  5B3S C;  2HFE C;  2CGN A;  3WB0 A;  1N0J A;  3JD1 A;  4IYH A;  4PHZ A;  2EIJ C;  5B1A B;  1GAX A;  1FXK A;  2NLJ C;  4YJ2 B;  3W7W A;  5A2Q N;  4B3M B;  1VQP V;  4DUZ O;  5KUM A;  2F1M A;  2X7R B;  4GX1 A;  4RQE A;  4JI8 O;  4R6Z A;  4O4I A;  4CS2 A;  2PYJ A;  4HBN A;  5EYP A;  5IWA B;  2CTR A;  1JA8 A;  1NS1 A;  4IIJ B;  4TV9 A;  3E8B A;  4DR1 O;  4IT5 A;  1U96 A;  3S3X A;  1K3E A;  5A9G A;  1JCH A;  2GTS A;  5IYZ B;  4X64 O;  1K7D A;  1PM9 A;  4WF9 V;  5FLX N;  3ZRS A;  3GWK C;  4PDM A;  4NTX A;  5EBM C;  4DR5 O;  4DXW A;  2EIL C;  1R6K A;  2W0F C;  1B06 A;  3T4Z A;  2B9Z A;  3CP1 A;  3DTU B;  2Q8V A;  4AI8 A;  4O2B A;  1GN2 A;  3FB8 C;  2OT5 A;  3OTO B;  4K3A A;  2UUA O;  3K3W A;  1HNZ O;  1Q43 A;  5CB4 A;  3VQW A;  3ZRX A;  4JI3 B;  1S5L Z;  3SPJ A;  4JI4 O;  1JPX A;  2UUB O;  3OEH G;  4GCZ A;  3SGI A;  3SYO A;  4MVM A;  2CTQ A;  3LNM B;  4JYC A;  1N32 B;  1XMQ B;  1Q82 W;  5KAF Z;  1N34 B;  1SQV H;  1QQC A;  3ABL B;  2ZCE A;  2ARH A;  1F7Y A;  3KKY A;  1MNG A;  4JI5 B;  3CME V;  4ZHQ B;  3K06 A;  2QWP B;  2YIC A;  2KKW A;  4NKG B;  4OXS A;  1B3Q A;  2UU9 O;  1S72 V;  1FXH A;  3FAV A;  4BIO A;  1NTZ H;  2G38 A;  3CXC U;  3G4S V;  5B1N A;  3X2Q C;  3RYC A;  3RVY A;  2XT9 A;  1GKF A;  2WLM A;  4CC5 A;  1VQM V;  2XUM A;  4TWK A;  2AHY A;  3B77 A;  2DYS B;  1L0L H;  5CBG A;  3G6E V;  3P3P A;  3EVK A;  2M6Y A;  1QR9 A;  2YIA A;  1VAR A;  3JCZ A;  3AG4 C;  2UXB B;  3UKM A;  2DMX A;  4TSF G;  4DRX A;  5CA0 A;  2OIG A;  4DV2 O;  3M7M X;  5B1O A;  5JCO C;  1XMO O;  1IBK B;  3FKS G;  5EIB D;  4DV4 B;  5L3B A;  1WB7 A;  4HAM A;  5CA1 B;  1KUQ A;  4PA3 A;  4LR3 A;  4FLY A;  4X62 B;  1M1K W;  1N33 B;  2KG7 B;  5B1A C;  5C8Y A;  2VRZ A;  2LGQ A;  2YXL A;  2P22 C;  4I0X A;  2A7W A;  2LW7 A;  1XEQ A;  5JJE B;  1AI6 A;  1SQG A;  1I08 A;  3FYE B;  1XL6 A;  2YIB A;  1IVS A;  4LC1 A;  4MSW C;  4K0K B;  1HR0 O;  1NKD A;  3K9S A;  3W7U A;  4K8Z A;  4YIP A;  4JI7 B;  4IHJ A;  1ZTE A;  1MG1 A;  3BA8 A;  5LOV B;  4PDL A;  4LF5 O;  4X20 A;  2HKO A;  3JD2 A;  5IJ9 A;  5J2T B;  2JGD B;  1RSO B;  4J9Y B;  1ZX3 A;  1NJI W;  4TQD A;  4FZ0 A;  3THO A;  1VF6 C;  1K8A W;  2QSA A;  2F23 A;  1F4M A;  3EFF K;  2XND G;  4ZOL B;  2Q0O C;  4JI1 B;  3O65 A;  5LMN O;  4JYA O;  1YXB A;  1BCC H;  1TVK A;  5DEC A;  4X1I B;  2PI4 A;  5E79 Z;  3ETE A;  3JSL A;  4LWS A;  2ZIO A;  2Q5Z A;  1VQ4 V;  4JI2 B;  3SPH A;  3CS5 A;  2RNB A;  2WLL B;  4FFB B;  2CAZ C;  2QKS A;  1IBL O;  1TA8 A;  4DUZ B;  1BL8 A;  1KMI Z;  4DUY B;  1P49 A;  4JI8 B;  1FAF A;  1W0K G;  1AR4 A;  3LSQ A;  3OMI B;  4UCV A;  3ZRW A;  2H8P C;  5JH7 B;  2EIK B;  2ZXW B;  3ABL C;  4F4L A;  1N8R W;  3PN1 A;  1MZE A;  5E1A C;  3DGE A;  2ZIM A;  3F7V C;  4LCU C;  3E22 B;  2F93 B;  5LGU A;  5CA3 A;  1XDC A;  1HW7 A;  1BHB A;  1YHQ V;  1EZV H;  2PGG A;  4X64 B;  1O9H A;  4WFB V;  2BSK B;  2GV9 A;  1JFF B;  3RYI B;  4QIW F;  1Y76 B;  4DR5 B;  4DR2 O;  5JJJ B;  1SA0 B;  4DV0 B;  1QLN A;  3ETG A;  1US6 A;  3RGB A;  3ZN1 A;  4EEQ A;  1Y74 B;  5KHI A;  4DV5 O;  1BGY H;  1Z5V A;  1KD1 W;  2DYS C;  4HNA B;  2UUA B;  1VEW A;  1HNZ B;  2DJV A;  1K73 W;  3N27 A;  3JD3 A;  5LHG A;  1OHH G;  3ABM B;  4JI4 B;  4DV3 O;  1LUW A;  4X89 A;  4B7E A;  3QG5 A;  1ZLZ A;  2QWN B;  3OTF A;  2O57 A;  2JIZ G;  3ASN B;  2K1E A;  1EBO A;  3R66 A;  2XAG A;  3MDS A;  4MTG A;  4W4L A;  3F5W C;  4DR3 O;  3AG7 A;  4CC6 A;  5BY1 A;  4YJ3 B;  5D5P A;  2ZDI C;  3CRR A;  2UU9 B;  3CCJ V;  2CK3 G;  3STZ C;  4HZ3 A;  2A79 B;  1U97 A;  5IDJ A;  2QM4 A;  3JAL B;  4LBE C;  3RW0 A;  2V7Q G;  5B1B C;  4B08 A;  5LHH A;  1D5N A;  1MMM A;  2P4V A;  3EXA A;  4DYL A;  5JQG A;  1SC5 B;  2JS5 A;  4TUY A;  2DQ0 A;  2XAS A;  5EK0 A;  4PJ0 Z;  1PNL A;  2AZ2 A;  1QVF U;  5KX5 A;  3CCM V;  3M8A A;  1NI8 A;  4TT3 G;  1Y6X A;  3CRQ A;  1NU1 H;  3OR7 C;  5EIB C;  3F7Y C;  4NR1 A;  1PNM A;  1NZ6 A;  2EX3 A;  2EZO A;  4DV2 B;  2GSM B;  4B3R O;  2P06 A;  1XMO B;  4XBF A;  2RMK B;  3E83 A;  4O2A B;  2K9P A;  3OTO O;  3SR2 C;  1NTM H;  2XHB A;  4FPP A;  4MVU A;  2FKX A;  3PJS K;  1CP9 A;  2QTO A;  1URF A;  1FXK B;  2AW9 A;  1YI2 V;  4LF6 O;  1AJN A;  1MOF A;  2CH7 A;  2QM8 A;  2F95 B;  2EIK C;  2ZXW C;  4I55 A;  3LDD A;  2P6J A;  1HR0 B;  2X6C A;  2N05 A;  4O4I B;  4J7Z A;  3R65 A;  5EYP B;  1MAB G;  4LNU A;  4MT8 A;  4LF5 B;  5KMG A;  4TV9 B;  1DK1 A;  3UCS C;  1XIL A;  3KG2 A;  2IJK A;  2HG5 C;  1Q7Y W;  3L74 H;  2UXC O;  4U3F H;  2IBZ H;  2EJR A;  3G67 A;  3L9D A;  2VQE B;  5LMN B;  3L72 H;  4JYA B;  4UCO A;  3CWB H;  1N4C A;  2CUG A;  3ZMT A;  1ZUQ A;  3JAW A;  1Y67 A;  2QDO A;  3ZS8 C;  4JTD B;  5H6R A;  1TAE A;  1GK9 A;  2E75 B;  4PA6 A;  2YI9 A;  1FFX A;  2OWO A;  4O2B B;  3CX5 F;  3ABM C;  3AG2 B;  3BCC H;  3OMA B;  3BHP A;  1NT2 B;  2N74 A;  1IBL B;  4H13 B;  5CB4 B;  4B7K A;  1FXV A;  2LQT A;  3ZX6 A;  3W7S A;  1JJO A;  4JPR A;  2OCH A;  3WB1 A;  2Q0A A;  1BMF G;  2ZT9 B;  5L3G A;  3L75 H;  3ASN C;  4R7C A;  3FFQ A;  2IH1 C;  3AG3 B;  4X1Y A;  4FM2 A;  2FTK A;  1WN7 A;  1S0V A;  4JV5 O;  4B3S O;  2YEV A;  4MTF A;  3UO3 A;  4QGP A;  1B04 A;  1Q90 D;  4NTW A;  2HHH O;  4UCS A;  1OCR B;  3H01 A;  4CS4 A;  1WPX A;  2VS0 A;  3CRM A;  3SJQ C;  1JQ0 A;  3FAV B;  4DR2 B;  5H9C A;  2WA4 A;  3STL C;  2QE7 G;  4PI0 A;  3I55 V;  1YDX A;  3FB7 C;  3RYC B;  1WLE A;  4DV5 B;  4I4T A;  3RYF A;  2ADP A;  4YXW G;  1IXM A;  1L8D A;  1R3L C;  3A8T A;  1FKA O;  3RWR D;  5KHG A;  2YIB D;  1GN3 A;  4N23 A;  1PV0 A;  2ILM A;  1W59 A;  4DV3 B;  2B5U A;  4JI0 O;  2Y0P A;  2QKC A;  5IT9 N;  5GTH Z;  1OV9 A;  1AR1 B;  3SJC C;  1VQ6 V;  1PP9 H;  3RYH A;  3D36 A;  4LF7 O;  3OGI B;  1JJ2 U;  4DRX B;  5CA0 B;  1KKD A;  1GH6 A;  2YXH A;  4JI2 O;  5DN6 G;  2GHY A;  5GON A;  2LJ2 A;  1EN5 A;  4EFE A;  3OR6 C;  3KCX A;  4DR3 B;  2PZS A;  1QCE A;  4NXM O;  3RVZ A;  3OUS A;  3IFX A;  1FXK C;  5C8Y B;  4DUY O;  5JJN B;  2QWR B;  3G71 V;  4I0X B;  3K04 A;  5LXT A;  3DC5 A;  4GZR B;  3JAT A;  2DE0 X;  2JJ2 G;  3ZBH A;  3H1K H;  1FJG O;  5JVD A;  3HPL C;  4X1K A;  2XAF A;  3UM7 A;  4LF4 O;  4LH7 A;  3UO2 A;  2B1G A;  2W6J G;  4IHJ B;  4OGQ B;  1AR5 A;  3H1J H;  1M9N A;  1EZJ A;  2OCC B;  3CRA A;  5IJ9 B;  3C3T A;  4J41 A;  4JI6 O;  2ZNI A;  4MVS A;  4FM0 A;  4RUF A;  3OMN B;  1M56 C;  2WAM A;  5IYD O;  5IYB O;  4DV0 O;  4B3R B;  5KHH A;  3OFN G;  1VQN V;  2A06 H;  1TVK B;  1NBM G;  5DED A;  4BAY A;  1Q81 W;  3AK2 A;  4H37 A;  4LWS B;  2QWO B;  4JTC B;  5KLV H;  1VQ8 V;  1BT8 A;  2P4K A;  1SES A;  4J7K A;  1FYJ A;  3J7A U;  3CD6 V;  4LF6 B;  3VQX A;  4FVM A;  5LP6 A;  1YIJ V;  1AP6 A;  1SS3 A;  1WP8 A;  2JEX A;  1QVG U;  3ZRW B;  3AG3 C;  5LBQ A;  5LA6 A;  1M4U A;  4LF8 O;  2RN9 A;  1YF2 A;  3VQV A;  2ITC C;  1Y66 A;  5LGN A;  2ZM6 B;  4Q6G A;  1OCR C;  3L70 H;  3WG7 B;  3H9V A;  3TET A;  2BOC C;  1GM9 A;  2UXC B;  1BQZ A;  3JAS A;  1GN4 A;  1OJH A;  3JAK A;  1CEZ A;  1RPR A;  3HKB A;  5FNV A;  2BE3 A;  1ENV A;  1Q3E A;  4BWA A;  3LDC A;  1M57 B;  5LHI A;  1KKC A;  3D3Q A;  4MVO A;  2JDI G;  5KA6 A;  1NR7 A;  1E79 G;  4EKW A;  4Q20 A;  4DO2 A;  1V55 B;  4D6T H;  2BCC H;  1P4R A;  2M7W A;  4J10 A;  1AI7 A;  5H5N A;  1BQ0 A;  3C90 A;  3NXS A;  1H2M A;  4EFB A;  4GT1 A;  3CC4 V;  4I50 A;  4MVZ A;  1L1F A;  1YZB A;  4J9Z B;  3IGA C;  4ASU G;  4FLW A;  2R9A A;  1ZL8 A;  1XNR O;  1XQ8 A;  4JV5 B;  4B3S B;  2ZNJ A;  2E74 B;  1SQB H;  5C93 A;  4KXR A;  2HHH B;  3RBZ A;  3ETQ A;  2ITD C;  1K34 A;  2FL4 A;  1GM7 A;  2FYU H;  1QU7 A;  4CH4 A;  3ETD A;  1SZT A;  1LNQ A;  1OCC B;  1JVM A;  2VWK A;  3SYA A;  2HP8 A;  1PPJ H;  1Q8I A;  5JQG B;  4TUY B;  2DOS A;  1NH2 D;  5FL7 G;  4DV6 O;  2ZE6 A;  4LF9 O;  4MTO A;  1N36 O;  4W4K A;  2OCC C;  5KX5 B;  4F6E A;  5HFL A;  1MSW D;  1XI1 A;  3S3W A;  2XAH A;  4JI0 B;  3ASO B;  4PD4 F;  2VQE O;  2MW2 B;  3CJH A;  1X4T A;  3CXH F;  2CDY A;  5IYZ A;  1TGO A;  1WNS A;  3TXS A;  1G8M A;  5HFM A;  4R8C A;  4LF7 B;  1O9G A;  3ZMZ A;  2IW5 A;  1K4D C;  3T1C A;  3K59 A;  3HKE A;  3BA9 A;  3CCR V;  3DC6 A;  4NXM B;  1SF9 A;  2YSU B;  1W2B U;  1M5I A;  4QE7 A;  1A32 A;  3TCU A;  3U10 A;  1XNQ O;  2DQ3 A;  4WFE A;  1NH2 B;  2HJD A;  1HNW O;  2CH7 B;  1FS0 G;  1FJG B;  2BTQ A;  1QHT A;  1TUB A;  1J5E B;  2E3C A;  4H44 B;  1YJ9 V;  3ZMV A;  4I55 B;  4LF4 B;  4FLX A;  2DN9 A;  4BIU A;  3MHS C;  3L73 H;  2P7T C;  1AVM A;  3WG7 C;  4LNU B;  1SKV A;  2L6L A;  3WB2 A;  3NR7 A;  3QTC A;  3ZMS A;  5BZB A;  3JAR A;  4JI6 B;  3AEI A;  3A2F A;  1OZ0 A;  5KHJ A;  3U11 A;  3QF7 A;  3JAM N;  4O4L A;  1GN6 A;  3AG1 B;  4ABM A;  1SQQ H;  4N21 A;  2DW4 A;  1M57 C;  3E8H A;  2EBO A;  3K0G A;  2F43 G;  2GDS A;  4OPA A;  4X88 A;  2WLK A;  4H0L B;  1Z2G A;  1UFI A;  3G6B A;  1SQF A;  2NN4 A;  3JAW B;  1V55 C;  3CCL V;  3HR0 A;  1G1X B;  1B6Q A;  1BSM A;  4FM1 A;  3T1Y O;  2XAQ A;  1FFX B;  1Q6H A;  3K79 A;  3HB3 B;  3OD4 A;  2BTO A;  2GTA A;  1JR9 A;  4LH6 A;  1KC8 W;  3K58 A;  3SPC A;  4QNH B;  3OE7 G;  2W0X A;  1Q86 W;  4PA7 A;  3CRC A;  3HKD B;  1QBZ A;  4LF8 B;  3KCY A;  4ZI7 A;  4X1Y B;  1G4Y B;  2PUS A;  4I5S A;  2UXX A;  2QEX V;  2YEV B;  4FJC C;  5EC2 C;  5L3F A;  1FPO A;  4DW1 A;  1YTF B;  1XHX A;  4X9Q A;  4PV1 B;  4AQY O;  1N0N A;  2CTP A;  1OCC C;  4B3T B;  4BR6 A;  3CCV V;  1YVW A;  4DR7 O;  3CCU V;  5IYC O;  3B2E E;  2ADQ B;  2Q73 A;  3UQ8 A;  1H2S B;  2XTA A;  3OEE G;  4I4T B;  3RYF B;  4NXN O;  5LMU O;  4FZ1 A;  4RQF A;  1CPY A;  3LDE A;  3IJ4 A;  3ASO C;  2Q7G A;  3QVN A;  3SDL A;  1SRY A;  3WFV A;  4NYK A;  3G80 A;  1D5A A;  3CMA V;  3SPI A;  1FFT B;  4JGS A;  2HLD G;  2C2A A;  3RYH B;  5L3D A;  3T1H O;  1XNR B;  2Z3Y A;  2WWW A;  1WB8 A;  2ODM A;  4LFB B;  1H2K A;  5BMV A;  1SER A;  4PDR A;  1AB3 A;  4JYB A;  4WFH A;  4CH5 A;  2DWE C;  5GON B;  2JGU A;  2IJJ A;  1AP5 A;  2F4V O;  1WA8 A;  4U7O A;  4GUN A;  2E5L B;  3ZHS A;  2N04 A;  5H2F Z;  2QGN A;  2WSS G;  1JMK C;  3QO8 A;  2LFS A;  4LFC O;  2HVJ C;  4X66 O;  5LXT B;  2FB5 A;  1WAZ A;  3JAT B;  5IE9 A;  2HVK C;  3K03 A;  2P90 A;  1QLE B;  1YCI A;  4UCU A;  5JVD B;  4JTA B;  4X1K B;  4J7J A;  2ZM6 O;  4DV6 B;  4LF9 B;  1M90 W;  3CB2 A;  4BW9 A;  1N36 B;  1VIB A;  2Y4T A;  2HEP A;  4FIP C;  3VQY A;  1GM8 A;  1XOU A;  1OCZ B;  5EBL C;  1KU9 A;  2ZR2 A;  2X6A A;  4G27 B;  4BIZ A;  3AG1 C;  3BRC A;  2E76 B;  4ZKI A;  4I9W A;  4F6R A;  1XHZ A;  4KFM A;  2YUA A;  1KP3 A;  3BPZ A;  3E8G A;  3ABK B;  3CYO A;  3TK1 A;  4QPK A;  4ICG A;  3QO7 A;  4OPH A;  1DF4 A;  1MA1 A;  4XDJ A;  1V9P A;  1F4N A;  3BY6 A;  5IJ0 A;  4DK0 A;  3P32 A;  2YI8 A;  3E86 A;  2R9I A;  2Y0I A;  1XNQ B;  4KP4 A;  3B8N A;  4O4J A;  1HNW B;  5BR8 O;  5LP6 B;  2UUC O;  4P2Z A;  4UV8 A;  3W7X A;  1VQ7 V;  2EIN B;  1PD3 A;  5ITZ A;  1WP7 A;  2KB1 A;  1Z5W A;  3ZIA G;  4FLZ A;  4YIO A;  2D3O W;  4TV8 A;  5LA6 B;  2V4D A;  2WLH A;  5LL6 Y;  3GB7 C;  4JAV A;  1BE3 H;  2IJI A;  3JD4 A;  5BXZ A;  4UV9 A;  3FB5 C;  4X65 O;  4A5U B;  1KB9 F;  4GKJ O;  4RAI A;  2QR4 A;  3I5D A;  3JAS B;  1V54 B;  3JAL A;  3JAK B;  3HKB B;  5FNV B;  1P7B A;  2DYR B;  3ZHV A;  4IGG A;  4DV1 O;  1YIT V;  3LSU A;  4G2K A;  1Q6U A;  1DLB A;  2WLJ A;  3K0D A;  3KZI Z;  5L3E A;  1ORQ C;  3SYP A;  2Y69 B;  3T1Y B;  1AI5 A;  4CH6 A;  2RCV A;  3ZRV A;  4J11 A;  1YJW V;  1Q5O A;  5LYJ A;  3FB6 C;  4PA9 A;  3OAA G;  5EBW C;  4DV7 O;  4I50 B;  3D36 C;  1GRJ A;  1I0H A;  2ZE5 A;  1SET A;  5F2V O;  1VQ5 V;  1NR1 A;  2WLI A;  1ZL8 B;  4TQF A;  4P9P A;  2Y48 A;  4JAU A;  3HKC A;  1AJP A;  2EZP A;  4UVC A;  2BOB C;  4AQY B;  3UT5 A;  3J81 N;  1J5E O;  2IM9 A;  3BVO A;  1VF5 B;  4FLU A;  4U3J A;  3SJB C;  4QE9 A;  5GTI Z;  3K08 A;  1K5S A;  1PL4 A;  1ZSP A;  4J42 A;  1QLE C;  4DR7 B;  1KP2 A;  4GLX A;  2AZ0 A;  5H6Q A;  4MTX A;  5DM6 V;  1T5E A;  3F5T A;  3B8M A;  3K5M A;  4Z1V A;  3CC7 V;  4X20 B;  2Q69 A;  3JCU Z;  3BAB A;  5LMU B;  4NXN B;  1E1R G;  1OCZ C;  3JD0 A;  2X0L A;  5GW7 A;  1S77 D;  2LO1 A;  3CCQ V;  1PL0 A;  4CBC A;  1I94 O;  1KBH A;  1W0J G;  4JAS A;  1YJN V;  1IUR A;  4LFA O;  3ABT A;  2KSD A;  2P67 A;  5CBF A;  3RFR A;  3CJH B;  4FK5 C;  2Q4P A;  1RFY A;  1AIL A;  2GUZ A;  3CSX A;  3ICX A;  1K5Q A;  3T1H B;  5KHK A;  3RT3 C;  3DXR A;  1XRE A;  3ABK C;  1ZWI C;  3AG2 C;  2F4V B;  3HKE B;  4DR4 O;  1KEC A;  4O4H A;  3MD0 A;  1BS3 A;  2YS8 A;  2H3O A;  2NR5 A;  4GKK O;  4DR6 B;  3CEI A;  2LFR A;  2ZKO A;  3N2K A;  2CTW A;  4LFC B;  3T4D A;  5LP6 C;  1EN6 A;  4Z2W A;  2IU0 A;  2Q7H A;  4X66 B;  1BHA A;  3B09 A;  2EIN C;  4QJF B;  3SYC A;  2BTQ B;  4BW5 A;  1TUB B;  1RM1 B;  3ZED A;  2PF4 E;  3OM3 B;  3IAY A;  4JZ2 A;  4CH3 A;  3IC7 A;  4NTY A;  2UXD O;  3ABU A;  4ZBM A;  3IC9 A;  4GX0 A;  4UXN A;  4WFA V;  3N2G A;  3QO5 A;  3K5O A;  2F66 C;  1NVP D;  1H38 A;  4R50 A;  4UVB A;  3K5N A;  3JAR B;  4B3T O;  4YY3 O;  3H1L H;  4PEL A;  1V54 C;  4FLV A;  1R6T A;  2Z5U A;  3ZJZ A;  3LUT B;  1QNM A;  1L0N H;  4O4L B;  2DYR C;  1AJQ A;  3CPW U;  4FFK A;  3Q4H A;  2RJZ A;  2IJH A;  1VQL V;  3ZN0 A;  2X6B A;  4GYC B;  5LGT A;  4XDL A;  2QKA A;  1HP8 A;  2Y69 C;  1H2G A;  2P5O A;  1M93 A;  3JSN A;  4WFG A;  2XOK G;  1I5Y A;  1HNX O;  3I56 V;  4WBN A;  5J2U A;  4EB6 A;  4PI2 A;  3J80 N;  4NVP A;  4UVA A;  5EZY A;  5BR8 B;  1BZK A;  2UUC B;  1THZ A;  3GWO A;  5JCO A;  3BAA A;  4LFB O;  2OYQ A;  4KUM A;  5K1P A;  2A0L A;  2ZE7 A;  2VQF O;  1NTK H;  4JYY A;  1NVP B;  3D3I A;  2E5L O;  1VMG A;  3AK1 A;  4ZI7 B;  2NNU A;  1R3J C;  4YJ2 A;  5B5E Z;  3OW2 U;  1S5H C;  4X65 B;  2YID A;  4GKJ B;  5CN0 A;  3EHB B;  3E2E A;  5JWP A;  4IYI A;  1COW G;  2JS3 A;  2ZQM A;  1Q6I A;  2ZR3 A;  3VOU A;  4DV1 B;  3QNE A;  2PY5 A;  4IIJ A;  5FPO A;  5B1B B;  2IH3 C;  3T2M A;  1KQS U;  3P30 A;  4DW0 A;  5EC1 C;  1YSC A;  1F51 A;  2A3Q A;  2JEU A;  4ZIB A;  4L87 A;  3FYI B;  2LP7 A;  1P7G A;  3OUF A;  4CS3 A;  5CBH A;  4J80 A;  1D2D A;  1VF6 A;  4OX9 O;  4DV7 B;  2GBO A;  4IL6 Z;  2ETN A;  3BEH A;  2VWJ A;  2CE4 A;  3A0B Z;  1ARO P;  4PA4 A;  1GO3 F;  4KL1 A;  4MVR A;  5BMV B;  1Y4M A;  2PI5 A;  1SZX A;  3FX7 A;  5B66 Z;  4K35 A;  1WA8 B;  2CGO A;  3RN4 A;  1X59 A;  4K8X A;  3SYQ A;  3E8F A;  4JF3 A;  4MS2 A;  3GVM A;  5KUK A;  1ROP A;  4RUE A;  1P84 F;  3ZMU A;  1RM1 C;  1LR1 A;  2QJ1 A;  5D5Q A;  2EIM B;  3H1H H;  1K9M W;  2HR3 A;  5KMG B;  1DGS A;  3ZHT A;  4ZHQ A;  3OGC C;  1DTO A;  4P9O A;  3O9O A;  1GTO A;  4UCR A;  5KA5 A;  1K4C C;  4DR1 B;  3P3N A;  1H2N A;  1I94 B;  5CMU A;  1G6U A;  1RP3 B;  4P30 A;  4NB5 A;  4LFA B;  2PTM A;  4E2L A;  1YTF D;  4KHP O;  1EFR G;  1AI4 A;  1XUQ A;  2RQ6 A;  4XDK A;  2YXY A;  2B1I A;  2LW1 A;  3LNN A;  4F6R B;  2PYL A;  3ZHR A;  4D7S A;  2ZE8 A;  2KQX A;  3JYC A;  4DR4 B;  1PNK A;  1IBM O;  4X8A A;  1MZF A;  1K33 A;  4GKK B;  2JJ1 G;  5IJ0 B;  2D2C B;  2QWQ B;  2EUL A;  4H33 A;  2QA4 V;  2UUB B;  1TUE B;  3ZHQ A;  2QTS A;  2Q67 A;  1VQ9 V;  4U7N A;  1ZAU A;  4YHH O;  4O4J B;  3K5L A;  1VF7 A;  3AK3 A;  5CA1 A;  3VBB A;  5J9P C;  3BFR A;  4WCE V;  1R3K C;  2KG7 A;  5ITZ B;  5IY5 B;  2UXD B;  3ZHU A;  4Z1M G;  4UUJ C;  5AG2 A;  4UCT A;  1IX9 A;  4D7T A;  4TV8 B;  1J95 A;  5TIS Z;  2ZDI A;  2ZD9 A;  4JZG A;  1I5X A;  4QPJ A;  4B3M O;  4YY3 B;  3M99 B;  4I9Q A;  4RO2 A;  1DF5 A;  3E89 A;  2AXT Z;  2YDE A;  1PKX A;  5LOV A;  5IWA O;  3K9A A;  3W7T A;  1OCO B;  1JOY A;  1S3J A;  3TXQ A;  5J2T A;  2JGD A;  4JAA A;  1RSO A;  1UPG A;  2UXN A;  1HNX B;  1VP7 A;  4RWU A;  3TGU H;  2Z0A A;  2HJF C;  4ZOL A;  1R73 A;  5LYJ B;  1JX9 A;  3APQ A;  4X1I A;  2V1D A;  1QR8 A;  2Q6A A;  2OIE A;  3CHX A;  3OT7 A;  3L71 H;  2VQF B;  4DK1 A;  2R72 A;  3E35 A;  3K57 A;  2W6I G;  4GX5 A;  2WLL A;  4FFB A;  2WLI B;  3CCE V;  1YEW A;  2ATK C;  4HYO A;  3ML0 A;  5B3S B;  1S76 D;  2JVD A;  4DR6 O;  3B4S A;  2Q9L A;  2EIJ B;  1EN4 A;  2A9H A;  3HKC B;  4MW8 A;  2FML A;  4JI3 O;  2WPD G;  4C7U A;  4UB6 Z;  5JH7 A;  3UT5 B;  1N32 O;  4I7Z B;  1XMQ O;  4G28 B;  5K1X A;  1GMG A;  2R9R B;  1K92 A;  1N34 O;  2EIM C;  4U3J B;  3MAQ A;  4L8J A;  5FPR A;  1EM1 A;  3SJA C;  2DWD C;  1WJZ A;  3E22 A;  2YC0 A;  3C3S A;  4FLT A;  4PDV A;  3APO A;  2OTL V;  4JI5 O;  2Q68 A;  1MSD A; 
#chains in the Genus database with same CATH homology
 2DJV A;  4JI1 O;  3SDL A;  4LF6 O;  4LF5 O;  5BR8 O;  2UUC O;  4B3M O;  4DV3 O;  1F7Y A;  3F5T A;  1X59 A;  3JAM N;  1HNX O;  3T1H O;  1FKA O;  1AB3 A;  2UU9 O;  3J80 N;  1I94 O;  4OPA A;  3J7A U;  1FYJ A;  5IWA O;  3O65 A;  5LMN O;  4JYA O;  5LL6 Y;  1DK1 A;  5A2Q N;  2AGA A;  4LFA O;  2F4V O;  5BXZ A;  4DUZ O;  4LFB O;  2JRI A;  4JI0 O;  3R66 A;  4X65 O;  4A5U B;  5IT9 N;  4GKJ O;  1G1X B;  1AIL A;  4DR3 O;  4JI8 O;  2VQF O;  2DOS A;  3RT3 C;  3T1Y O;  5BY1 A;  2UXC O;  2Z0A A;  4DV6 O;  4LF7 O;  2UXB O;  4LF9 O;  2E5L O;  1N36 O;  4JI2 O;  4LF8 O;  4LFC O;  4DV1 O;  1NS1 A;  1IBL O;  1IBK O;  4X66 O;  4KHP O;  4DR1 O;  4DV4 O;  4DR4 O;  2VQE O;  4NXM O;  4X62 O;  4GKK O;  2ZM6 O;  1N33 O;  4X64 O;  4DUY O;  2ZKO A;  5FLX N;  4DV2 O;  2N74 A;  1XMO O;  4DR6 O;  3M8A A;  4DR5 O;  4DV7 O;  1IBM O;  1KUQ A;  4JI3 O;  1FJG O;  4LF4 O;  4K0K O;  1N32 O;  4AQY O;  1XMQ O;  2UXD O;  1N34 O;  4JI7 O;  4B3R O;  2UUA O;  5H5N A;  1A32 A;  1HNZ O;  1D2D A;  4JV5 O;  2LW7 A;  4B3S O;  1XNQ O;  4OX9 O;  1XEQ A;  4YHH O;  4DR2 O;  1HNW O;  3OTO O;  4DR7 O;  1R1B A;  4JI4 O;  2UUB O;  4OPH A;  4B3T O;  1YZB A;  4YY3 O;  4JI6 O;  2HHH O;  4JI5 O;  4DV5 O;  1R6T A;  2FKX A;  4NXN O;  5LMU O;  1HR0 O;  4DV0 O;  3J81 N;  1XNR O;  1J5E O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...