3SPHA

Inward rectifier potassium channel kir2.2 i223l mutant in complex with pip2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
332
structure length
332
Chain Sequence
b'CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 89
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3sphA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3sphA01
3OUFA 3FB6C 3LDCA 4XDJA 2BOBC 4JTAB 3E8FA 4P9PA 4R50A 3X2QC 4MVZA 1S5HC 3ASNC 2WLIA 5B1BC 4J9YB 3AG3C 1V55C 4PA6A 3LDEA 3AGWA 5J9PC 2A9HA 4R7CA 2AHZA 3K06A 2AHYA 2WLHA 4MVOA 3E8BA 2QKSA 3SPCA 3E83A 3VSQA 4R8CA 4HZ3A 3K04A 3K0DA 2HG5C 4MTOA 1JVMA 5CBGA 4HYOA 5KUMA 2EIMC 2Q6AA 4MVSA 1R3JC 3SYPA 3F7YC 1KKDA 2R9RB 5EBWC 1XL4A 1XL6A 3LNMB 3STLC 3ZRSA 3AT8A 3ASOC 4GX1A 4P30A 4PA9A 2EINC 2WLIB 1R3LC 4P2ZA 4WFGA 2DWDC 3ABLC 4TWKA 2NLJC 3E89A 1ORQC 4X8AA 1QLEC 4G28B 4QE9A 3SPHA 3ATFA 3EFFK 3ATDA 4XDKA 2W0FC 3AG2C 3UKMA 3IGAC 4MS2A 3E8HA 2WLLA 3OGCC 2ITDC 3HPLC 5KUKA 2X6CA 5EBLC 3SYAA 3T1CA 3RVYA 4BW5A 4GX0A 1K4DC 2ZD9A 4PDVA 2WLMA 2HVKC 3ABMC 4X88A 5EBMC 5B1AC 2DYRC 4R6ZA 4MW8A 4F4LA 3SPIA 4MVUA 4PA7A 4P9OA 3TETA 3FB7C 4G27B 4QE7A 4GX5A 4MVRA 4MTFA 3VOUA 3AG4C 2X6AA 4PDRA 1BL8A 3SYOA 5EC2C 4J9ZB 4JTCB 2IH1C 2ZXWC 4WFEA 4PA3A 4X89A 3ATAA 3K6NA 1J95A 3AG1C 4LBEC 2YEVA 4RAIA 2Q69A 3SPGA 1ZWIC 3AT9A 3KG2A 2Q68A 3K03A 4UUJC 2WLLB 3SYQA 3RVZA 4RO2A 2EIJC 5EK0A 4RUFA 3T4DA 3OR7C 3ZJZA 2JK5C 4MW3A 2Y69C 2QTOA 5BZBA 2IH3C 3F5WC 4H37A 4WFHA 5CBHA 1U4FA 1OCZC 1R3IC 2WLJA 4OXSA 4JTDB 4MVMA 3K08A 4RUEA 2WLNA 3OR6C 3FB8C 3SPJA 3LUTB 2A0LA 2HVJC 3ATBA 2EILC 1G4YB 2HJFC 4LCUC 3R65A 2HFEC 4GX2A 1M56C 3RBZA 1U4EA 4CBCA 5CBFA 2EIKC 4DXWA 2A79B 3ABKC 4PA4A 2Q67A 4PDMA 1OCCC 1OCRC 3ATEA 5E1AC 1OCOC 3SYCA 3TCUA 1P7BA 1M57C 3GB7C 3OUSA 4EKWA 3AUWB 3PJSK 4LP8A 3SJQC 5IY5C 4MVQA 4XDLA 4WFFA 2X6BA 2WLKA 3BEHA 3T4ZA 2ATKC 3STZC 4MSWC 5EC1C 2DYSC 1V54C 2H8PC 3E8GA 2ITCC 2OCCC 2BOCC 2E4FA 2K1EA 4H33A 4I9WA 1R3KC 4KFMA 5B3SC 3T2MA 4PDLA 3LDDA 3F7VC 3IFXA 4MTGA 3WG7C 1N9PA 2KB1A 4ZBMA 3FB5C 3RW0A 2GIXA 3E86A 4QNHB 2P7TC 3UM7A 3JYCA 1K4CC 2DWEC 1LNQA 3K0GA
chains in the Genus database with same CATH superfamily
3UCSC 3GWKC 5E9DB 5C0BA 3UYPA 5JOEA 3MGTB 1HXMA 1IE4A 4MVZA 1EAQA 3VGAB 4E2LA 4J2XA 1KKCA 2FJGA 4CRPA 5L2JA 3T04D 2Y1VA 3ML9A 3HKCA 4P23D 3ZDYF 2AHZA 2Q86A 2ZQKA 4HPHA 4J8RA 4MYPA 4TQPA 4GG8A 4NQCD 1QEWA 4X80H 3QIBC 3NFPA 3CBRA 1F00I 5KUMA 5DK0A 1KBGL 3VFGH 3QG7H 3AGVA 5IB4A 2DWDA 2N7AA 5DSCA 3TYGL 4F33B 5EU3A 2F4VO 2W07B 3FUHA 1NPUA 4PGCB 3RPIB 3L16A 5J13B 4OV6F 4U3CA 3SKUD 3K5SA 3E2HC 2VQEO 1BE3H 4PV1B 1LP9A 3HKEB 1SJEA 3VYNA 4N23A 1V8HA 3FYIB 3MHHC 3ES6A 5CEYA 2D3OW 3AREB 1YNTF 1KLFB 4LHQB 1MLCA 4NENA 4NKDB 4U2YA 3L3IA 2BTQB 2OCCB 3IKCA 2XG5A 3JSSA 1TUBB 4PWEA 3O0LA 4C55A 4F6RA 4WGVB 4BFGA 3MBED 1AQKH 3GLZA 1HEHC 1QO3A 1W0WA 3EYVB 2Z91A 15C8L 4YC2C 2Y3AA 2KQXA 1S8DA 2XZAH 3AAZA 3UJIH 3KH4A 2QWRB 2X4RB 4S1QL 4LCIL 2IBZY 5GZND 1OM9A 1WICA 1ZV2A 4PRIB 1NAML 4LAQL 4Z7IA 3EJTA 1QU7A 3QJFA 4ORZC 2B20A 4N0RA 3JWOH 5EHFA 3OJ2C 3BLKA 1WV7T 3AY2A 3MGOA 4Q58C 1ROWA 3D1MC 2UUDH 5T1DH 1A32A 3UO2A 2OMNA 1HDMB 4R7LA 4YHLL 3WU2Z 4XO5A 2ZNJA 4PCSA 1K8AW 5HDBF 2GBUA 1Z3RA 2MCG1 2L7UA 2RCVA 1IQWL 4Z7WE 3FO0H 2ZUTA 3LZLA 2K4WA 1HI6B 2L35A 4WF7A 3EYSH 3QHZL 1D3CA 1FFXA 1NM9A 1R19A 4Y1AD 4CVXA 1QLEB 1MFAL 1TKWB 3ZDXE 3L4ZA 3ELQA 4J1UB 1Q86W 3LXBA 1JPTL 3ZHVA 1T21A 4HIXH 4WO4C 4EOWL 4U7SA 4KHPO 2R72A 3BQVA 1JGLL 3CC4V 2ZD0A 3VU2A 3S5LB 1L9MA 2JXMA 2HJKB 4MA7L 1CBVH 4N1CA 3P3UA 4JI2O 5KVEE 3APFA 1SF9A 2FX9L 3FD9A 1KGUA 1NAMH 2FKXA 1P1ZA 1IGML 3FONA 4JE0A 4I13B 3UTSB 4MTXA 4JM2B 3DJTA 3JVGC 1T4WA 2YUAA 3H9HA 5IQLA 4M5YL 4FFZL 1N70A 3EBAA 3MV9D 5E23A 4Q9QH 4ZUUB 1RZ8A 4FK5C 4HWZB 1ZT7A 3LN4A 3GK8L 3QFDA 1CMOA 2V7HB 4IRJA 2VYRE 5BZZA 1D5ZB 3E8FA 2GAZB 5DDHA 4JK0D 4IS6A 2EE9A 2WVSA 2NT0A 3HLAB 4L1TA 3ZQXA 1RZ7H 1IGCL 3AGWA 4MAZA 3T5WA 1AXIB 1Q72L 1PEWA 4WU7B 1OB0A 2EEDA 1CDIA 4JI0B 2H0PA 1OM3L 1SRYA 2XY1A 4WKXA 1MCOH 2ZCLH 3MRCA 4K7PY 5D2NE 4UOZA 4FXLA 2ZIDA 4N6RA 3LHPL 2ADGB 4KROB 3QQ9C 5JXAL 3CZFA 2CKBA 5DJCB 1KBHA 1XF2A 5FOBA 3SEPA 3TBTA 4GO9A 4FYQA 1CT8B 4XCEA 4F7TA 5IJVA 1HE7A 1RV6X 4G6JL 3OL2A 3TURA 2YOAA 5L4FA 2DQ3A 1MAML 4JPKL 2NTFA 3RJQB 4JO4H 3ATDA 4N1HB 3FUMA 3NFSH 3FO9A 1QRND 5LA6A 3ZZSA 4LWSA 4DW0A 4H1LA 2HVKA 2OP4L 4J23A 3G4SV 2FQGA 1OALA 1W72H 3BAXA 4HX1A 2MK3A 3R06B 3IPEA 2YQBA 5CN3A 3NJHA 4X9HA 2GUZB 1Q9KA 2BW4A 3ARTA 3BYTA 2Z92A 1JJ2U 1EDQA 2PWHA 1RU9H 1XO8A 4NP4L 2ZXBA 4U6YB 2FBJH 4LFCO 2FL5B 1A9BA 1H0DA 3IF1B 4NZJA 3MOBL 4NKGB 3DV6A 3H1IH 4XWOC 1PU0A 4YE4H 1WUZA 3BKMH 5L4IA 3OGOE 1LO2H 5PAZA 5SWSA 4W70A 5A7EA 3HMXL 3TIDB 1T7XA 1MH5A 4WNQA 2VS0A 4UIKH 2CKNA 4HOWA 1HJCA 3N9GL 3UZQB 1N4CA 4XBMA 1AGCA 4Z76A 2NT1A 1INDH 5I1AB 3CD6V 2ZWNA 3L9RB 1ND0A 3TCXA 3FQ2A 3VGGA 3DJZA 4WWID 3ZK0A 5BO1H 3LVEA 1UT9A 2B7DT 2BTOA 2YI9A 1RZIA 2FMLA 4LHUG 1DEDA 4ELKA 1TUPA 1B0RB 4NCC2 1BDYA 4QLWA 1E4XI 1IGYB 4KK9D 1DYZA 5FYKE 4OF5A 4NN7B 2YUWA 5D7HA 4N9GB 1I53A 4LOEA 1NBMG 3AFLA 4EB6B 3RZCA 2WNGA 5DZPA 1E79G 2XT1B 4NP4H 1G7HB 4ODVH 4IIJA 3RYIA 4Y8AA 4ZFOA 4MSWC 1NMCC 2PP9A 5CILL 4E9RA 3RWHB 3DTUB 1LO4H 1KMIZ 1G7LA 3LV3B 3RYCA 1JYXA 5D7JA 4L4TA 2MNWA 3V4PL 1B04A 3QHTC 5BZXA 5FHBL 4Y5VB 4FQIL 4HH9A 1N6VA 4M56A 3AG1B 2YAHA 4K0KB 4HIHB 5D1QD 4ZW6A 3KH3A 3FXIC 2HPTA 1T0OA 2CJUL 1SOSA 4K7FB 4RGMC 1X6LA 1QFOA 5EG6C 4LMQI 1UYWL 4TULL 4QKXB 2COVD 5HP5A 2WAMA 1J9CT 3NMEA 4N86A 5AZUA 4RMSA 1EBPA 5HVWA 2M6YA 3O2VL 2Y2TA 3E6FA 1JI1A 5FB8B 1E9PB 1WNSA 1EANA 4U1KA 3VG0H 3HE7A 5IJBC 4WIQA 4JI4B 3D18B 1OO2A 4U6XB 1D6VL 3BZ5A 3LXAA 5B1JA 1E28B 1JV2B 3OKDB 3ZRSA 1HCFX 2RQ8A 2IW5A 3Q0HA 2MEJB 1RPRA 3FQUA 2DMBA 2EINC 4Y7MA 1WPCA 1OCOB 3U10A 1CZ8H 2C5DC 1CR9L 2JJ2G 2XKNB 4UCUA 1RK1A 3K57A 5EWIL 5DMJB 5IV2B 4L0YA 3VQWA 3DX2A 3E8HA 4WJ5B 3GSUA 2ZUWA 1KFAH 3T4YB 1A65A 4AI8A 1KJ3L 3IS0X 2IXQA 3SHSA 3WXVH 3ZKMC 3AEIA 4F6EA 1QWNA 4QXGL 4X4MA 1FE8H 2XTSA 5A16A 5EBMC 2N1KA 2OIGA 3FBQA 3L7EA 1H8HG 1SXSA 2Q4PA 2Z4TA 2Q7YB 1C08A 4DV1B 3QJOA 5I82A 2CJUH 4X4XB 1R3IH 5DRNA 1UYWH 1RPOA 1A6PA 3CIQA 1UACL 4WFEA 2PO6B 4RMRA 3RTQD 3ZE1B 3JARB 4P4KD 4MVBC 1SYSB 4PJGF 2D7NA 3ENEA 2Z35A 2BHFA 4I48B 3O6FC 1US6A 2Z31D 1TSRA 3CHPA 2HKFH 4E5XA 2CBTA 3J07A 1R4XA 5EO1A 4OTXL 3X1BA 4OPAA 4JEGB 1UXMA 5I1IL 4CC5A 2QM8A 3K7UA 5B38G 2WVVA 3B40A 1UEMA 3OKNA 4ZTOL 5F1OB 4XN8A 3MLZH 4AL8L 1K7DA 1MHCB 4LOUD 4WO4A 1RM1B 1KJ3H 2ZXEB 4Y16D 2VN6A 4G8IA 1JPSH 1A7OH 2DTML 2QQKL 2AERT 4TQEH 4UF7C 5K1VA 2WA4A 1L3NA 3ZGHA 2WLZA 2X1OA 4ISVB 3VU1A 4XPTH 4EFBA 4NAMA 1OAYH 1KIQA 1HYSC 5JVDA 4BSVA 3E7JA 2QEJA 1QHTA 1T04B 3DX0A 3PFUA 2UWEF 4WNSA 5T3ZL 2FBOJ 4RMTA 4R5XA 1OLZA 2VXTH 3B2VH 2NNFA 4HNAA 2GABA 1YNTA 4HIJA 5T33H 3T2PA 4YXKL 1OV9A 3DX8B 4MJ2A 1F42A 1GGBH 2WB7A 3HZMA 3ARFC 4MNQD 4AV4A 4DAGL 5ICYB 4CGUB 5JHAA 5DD1L 5B1BC 2HZHA 1NGYA 4OTXH 4LLDB 4V11A 4WUUA 2ZE6A 2WCSA 2GKIA 2FRGP 1CFQB 2NY3B 3FUNA 3CCRV 3QXTA 4HSQA 2NYYC 4F7PB 1M6OB 1NEZG 1EPFA 2HLFC 2QA4V 3CHSA 3UO3A 2XETA 4UV7H 4AL8H 2WJ5A 2ZYHA 4CVZB 1VIWA 1DZ0A 3N43B 4OGZA 2QQKH 3ETSA 2H9GA 4Y19B 2LJ2A 4TSCL 2X7LB 1QFWH 2R9RB 4X5XB 4O4LB 3JD3A 3L71H 1XL6A 5KAQF 4L0ZA 1N8RW 2EEAA 2ZKOA 2HH0H 3S96B 5H37G 1FO0A 1ZHNB 2A6DA 2CGRL 2NY6B 3VM5A 2OX5B 4FQHA 1G9MC 3AVEA 4YDMA 2CUGA 2Q7NA 4XBGA 2Q3AA 4XP1L 1A6UH 1OARL 1TZGL 2NXYB 2WKGA 1H6UA 2WO4A 3AQYA 3OSKA 4I0CC 5GGRY 5D8JH 4NWUH 5L8KB 3LQMA 3OM3B 3WMQA 5I6LA 4Z8FH 3VXRE 3F7YA 3NK3A 3G5WA 2W9DH 3BVDB 2CKBL 3HBGA 3I6SA 1KYOK 1NGWB 3L7FB 1XTLA 4BFIA 1ZUQA 3WTUA 1AHMA 4DR3O 3DO7B 3P3PA 1DBJL 5F96H 2LV4A 2A0LC 4TUJB 4MAYD 4PA3A 3WY3A 1S7WB 4AITA 3EIFA 1HQRB 3V7MA 4AKPA 4MKTA 1WA0X 4XN1A 5HHOA 4O2AA 3TA3B 4UUJC 3K5NA 5AB9A 5I66B 3WTVA 5GGRA 1DVZA 3ML0A 4Y4FD 4HIQA 1IM3B 4K7PL 4DUYO 1SF5A 3HC4L 3V4UL 4DEPC 5BOJA 1IAIH 3VFNB 4X66O 3C2AL 4ZXBA 2P45B 1Q6UA 4HCRA 5DJ6B 3RURA 4DGYL 3BA8A 5C0DB 3FU7A 2AK1H 3MCLH 3OAZH 4JPQA 5HVFB 1N12A 3GNML 3QEUA 4NNPL 1SETA 5DJ2A 1FFNA 2ENQA 1FORL 2OI9B 1OARH 4E4EA 1TZGH 4IIZA 4J3WA 3LSQA 4EN2A 1P7QD 5LDUA 2XT9A 4OM0H 4HK3N 5DTFA 1CDYA 2X9XA 3ALPA 3FW6A 3ZDZE 5FOJA 3C8KA 2O61A 1B0GB 4EI6A 3UCRA 5DK3A 5I0VA 3IXTA 1QKZL 4O58L 4NQDA 2LO1A 1S7UB 3D05A 4LVHB 1J1XH 1JE6A 3V6FB 5JXEC 4NSKA 5DFVD 3H54A 3HC0B 1A2YA 2OXHA 3RX9A 1MWOA 4W4NA 3RKDD 4MMYB 1S7RB 3CG8A 3MNZA 4YZFE 1A7QL 2J12B 5H37H 2P42B 1FH5L 2D2CC 4NYLA 2UX7A 1FBIL 2CRZA 2NR6C 2YOCA 4H1LH 5TE4L 3U1SH 3W11C 2WCGA 4E2OA 2DWEC 3I3DA 3GXPA 3WFHA 2YQ2A 4E0RA 2G5RA 3ZKXB 4Q7DA 4XVTH 4PY7B 2VITA 4NPKA 1LK3H 4OR1A 3F64A 4JFVA 4WEMB 3MYJA 4IRSB 4L18A 1BAFH 4LDLB 2Z3YA 2BP8A 1LWHA 1OGTB 3LKQB 1UD3A 3O3BA 4ZFZA 4DGYH 3FRPG 3GNMH 3HN5A 2QKSA 1RUAH 1HNWO 1MCNA 2DLIA 4ZQKA 4GKKO 5JNYA 4QGPA 3HI5H 5JYMA 3Q2CA 2A6JA 4PP1C 5JIPA 3H2QA 4N24A 1MW1A 3NRPA 5A3IC 1YJDC 2ADYA 5LOVA 1WVZA 2NYZA 4LSSH 5EBWC 4LNUA 5E6IC 1ZSDA 3S4SA 4AM0Q 1E6OL 4IBVA 2OAAA 3RAJL 2LU3A 2EDBA 4L9DA 1OCRB 4B53A 1QSZA 1GKOA 2OMXA 3RNQA 1A9EB 4CBPA 2EX3A 3LIUA 4MRCA 4ZS6D 4X4YB 1MVUB 4PJDE 3WO3B 3VE0B 1F1DA 1A7QH 4M61B 3KWWA 3SYAA 2WXJA 5F1NB 3MRBB 1KB5B 2XI9A 4BH7A 1TVBB 2NQDA 3HS9A 2X4PA 1J8HB 4WTZA 4QF1A 1CD1B 2IBZX 4KTDL 1Q9LA 4WEBH 4CSTA 32C2A 2JWYA 3C5ZD 4PJFB 2GJ6B 4Q20A 4LE8A 5GGSB 2NOYA 1C16B 3X2QB 1WHOA 1CICB 4RWYH 4LKCA 2DQDH 3D48R 1QACA 4DESA 2P4VA 5H94A 4L5FL 4OFPA 4GRWB 3B2UD 2EYSB 1NM4A 3HCVA 3KYAA 5F72S 4RO2A 5H35A 4NO3B 4BCXA 4GO6B 1XSJA 1GYAA 2IMNA 1OTTD 3ARDC 5D93B 2P8PB 5LWYL 4LKXB 4IHJB 2OCJA 4FAAB 1RZGB 2NY5C 4O02H 3BRFA 1N4XL 1EHLH 3UH8A 4S1SH 4BHUI 1SZXA 2J8UB 3ATBA 3K6DA 3TIEB 2HJFC 4ONFL 5ANMB 1AGDB 1DZBA 1M56C 2CLVA 4AENB 3AXLB 3FF8A 4NUJA 2VLJE 3GMMB 3JWNC 2PN5A 1JV5A 4HQQH 3ZSSA 2EJRA 4MKMA 3JBG7 4ZPVA 5I1GL 3BN3B 4IGBB 4OZIA 4BDVA 2WYTA 4RGNC 3TCUA 3FTVA 2DKUA 2AZAA 3PXLA 4KTDH 3U36B 4JFOA 1NSNL 3WJLC 1T5XB 3RIFK 1L6PA 2XX1A 3DSNB 3WY1A 1GK9A 3H0TA 4H0LB 2VW4A 4RAVB 4MJID 5JJJB 4FQ1L 1X9UA 3CMOL 1VAHA 4ONOA 2VSDA 3OD4A 3H4HA 1U8NB 4L5FH 3QDMB 3E86A 1T22A 1N7MH 3GEWB 4JM2F 3FPXA 4JHZA 4RFEB 4UMGA 4NTWA 3ZEDA 1DQQA 35C8H 1I1YB 3KR3L 2ZX9A 2CK0L 4P2RE 5DD6B 4M62H 4QRUA 2PCFA 1E8WA 2F18A 2OL3A 1FVEB 1TXKA 4HG4J 4RRPA 5EZLB 2ZOWA 3MLPA 3OZ9L 2VQUA 3NR7A 4C57C 4TV3A 1BSMA 3L6FA 3PQYA 4X5WB 3P0VL 2APBA 5E1GA 5IDJA 3HZYA 1AOZA 3LEYH 1P0SE 1Q38A 4EXKA 1E2ZA 1I85C 1EFXA 3Q6GL 3NFNA 2DOSA 4YHHB 2AQ3A 4PJGA 3EYOA 4BSWB 3L3JB 5KX5B 4QXTA 4ZFFB 2SEBB 3GWOA 4EI5A 3C6LD 3QI9D 2QWNB 2MNJB 5KHGA 3RGBA 4LFHD 4L9LB 4OLXH 4UQAA 3MV7A 4LF4B 2DYSB 1E27B 4NRZB 2YSUB 3S2AA 3CMOH 4HMEA 3LEXB 4OLEA 3LNGA 4B60A 1DLHB 4I4WB 2AAVA 1G8MA 1SESA 1AI1L 1I9JH 2VDMH 3DRQB 3NIGF 3OTOB 2YD8A 5DJXB 1YEJL 3UJJL 2X1QA 1UXLA 3MCKA 5DEGB 3HI6L 3C08L 5TDPA 3VXPA 4YDIL 3JYBA 3HS8A 5FF6B 1FO0L 4GW4A 4QEGA 1XQ4A 2PW1B 4F7KA 3DBXB 4Z78B 7PAZA 1AXSB 1GJWA 2XTJE 3HFFA 4JKLA 5E4EB 1DCLA 4Q6YA 4XP5L 4ORGB 3W7UA 3ZJZA 1NC2B 4NGHL 2UWEA 3DTXB 5CGYC 1CXHA 3Q6GH 1NLDL 2I07B 1V5JA 3E8VA 3PJLA 1HYRC 3K08A 3F62A 4HD9A 1R3JB 4V1DA 1YMHA 3ROLA 3BVTA 1IZ3A 3T6ZA 3WDJA 1XI1A 4I1NB 4ODXA 4WWKC 4WVRA 3S35X 1R33A 4LARL 3CPLB 4FQXD 2OR9L 4LBEA 4YBLC 1PX8A 2YFNA 3VFWA 3QAZC 3KPOB 3MJ7A 4YDZA 5CA0B 2DQEH 4TUYB 2VRAA 4TLSA 3HPLB 2B39A 4WHYG 2AQ1A 2ARWA 1NBVL 2OTWB 2YWZA 3K46A 3K72B 3MRHA 4KOCA 4ELDA 1N5YL 2UXCB 1I7RB 4TOYH 3BA9A 2CHDA 2RJMA 4I5BA 2BNRE 4PLJD 2AXFA 5DWUH 2VR7A 2BIQA 2EDQA 2NR6A 3GMRA 4XMPH 2X0LA 2I7OA 3BPOB 2XBZA 5DFWH 2F15A 2EZPA 2VUOA 2YK1H 4LL1A 1A6ZA 2Z4QA 3SDCA 1CF8H 2Z0BA 4HJ0C 3CBKB 2ICWJ 1PYWA 1BZ7B 3GI9H 3S97C 1NCGA 1S9XB 2YAMA 1M1XB 5F6IB 3SGEH 5CJXA 4QHPA 4WHDA 5FGSA 3DETC 1QTPA 5C08D 7PCYA 5JORA 4L3EB 1GGIL 3WMPA 3T1HO 5I19L 2EEXA 3OT7A 5ESAA 2JH2A 3KYKH 5AYQA 5E6IA 4JF3A 4IIQA 2AGAA 2PXYB 3D6GA 3HR0A 1G94A 3V52H 5AG8A 2CBQA 2F53E 2PTVA 2X6VA 1J0IA 3NSYA 5F9JB 3P40A 3S5ZA 3CE1A 5ALCH 4AK2A 1DDHB 1S9WA 2ZSWB 4KTEL 3RGVC 1FPOA 3QDJA 1F4NA 5IQ9B 1I9EA 3DX3A 5AEAA 5EYPA 1JVKA 2V17L 5C71A 4HCRH 1HEZA 1VADB 3QH3B 2NCEA 3MJ6A 4NJ9L 2NSXA 1RHFA 5DURB 4NHCL 2OYQA 1U96A 1SLXA 4J27A 2JMRA 4Y88A 4FLOA 4Z7UA 3L75H 2VLRD 2GW5A 4DR2B 5DD0H 2WSPA 1YEEL 4JFFE 5TFSL 2UY7B 1PJ9A 2C7UB 5C0RH 5EEZA 4TUUA 2F5BH 1IXMA 2NDFA 5F7LB 4CH4A 2YBGA 3JCUZ 4WV1C 1MIEH 2P5ED 4QXWA 3VFOB 3MLRL 4XP9L 4MVRA 4OCSH 4WHYH 1CO1A 1FFTB 5CZXD 5KSUA 2KMWA 3TXSA 3H7LA 4G9FE 4KI5E 4QYAA 1ZPUA 4DO5A 2ADIB 2IAMC 4NJAL 1KGJA 3HEIB 2JCCE 3O9WD 3AG3B 1V55B 3ZHRA 4YXHL 3J27A 3DKHA 2CDFB 2GDSA 1KN4H 3IU4H 4NKOB 4OFKA 4AWJC 5IHLB 3N2GB 1BYOA 1ET7A 3ZE1F 2CPCA 3VFTB 2PYEE 4S1RL 3HKBA 1AFVL 2WLJA 5AVWB 3P1VA 3ZJAA 4QHMA 1ZMYA 2QQNH 5H2BA 2CCWA 1FJGB 1TO5A 4GSDL 1JVOA 1FFRA 2V17H 1A4CA 5D71H 5GTIZ 3BWZA 3MRRA 3K58A 3MDSA 1KCVH 3BO8B 4NHCH 5I1KL 3HZKA 1NDGA 2UXTA 3MGTA 1YEEH 2WZPA 1YYLL 1LEIA 1UJ3B 3VCLA 3HB3B 1HFUA 5JO5B 1KY7A 2NX5B 3G04B 3KVQA 1XGRB 2Z8SA 4IOIB 5IESL 3A2FA 4IJTA 4X7DC 1GO3F 8FABA 1V54C 3IWUA 2X6UA 1R3HA 3RDJA 2EILB 3U6RB 4W1TA 2ZINA 3WDIA 4R7DB 4BGDA 3G3LA 3EBGA 1RHHB 3MBXL 3QEQA 4HDIB 2BW5A 3QUXB 4LPCA 1SFHA 2OS7A 4KUMA 2W07A 1LL1A 4Z7VE 4PGCA 3RPIA 1X5JA 1UOLA 5LJYH 4TLUA 3LDCA 4JFDB 4WCYH 2HT3C 4D9LL 3GKWH 4U3HA 2D8KA 3S88H 3MXWL 3T3PB 1NTKH 3L3HB 3KPRB 1KLFA 1QFPA 4GSDH 4JREB 3PWPD 4NKDA 3UZEC 2BTQA 4PJ5E 3WOVA 2AEPH 3DXRA 1WEJL 4J3XA 1JZ8A 5A9GA 4JV5B 2VW6A 3APNA 3IYLW 5I0DA 2JEXA 1I85A 3BAAA 3EYVA 3VQYA 3RU8L 1FZJB 4L4JA 3WE1A 4NXMB 3V4VB 1YYLH 2H6OA 3RY4A 5KVGH 1WO2A 2B5IC 4FEIA 2X4RA 3NEEA 4PRHE 4LF8B 1EZVX 3K91A 3KLLA 1GN2A 2IWEA 5EIIB 3ETBF 3SSGA 1BPLB 1YEDB 5GIRB 4N2EA 3ULUC 5C0AB 2O6PA 3GXMA 4TN9A 2OL3L 5DJ8B 1MRFH 4NXNB 1OGSA 4N2GA 4JG5A 4DK5A 5B5EZ 4X9GA 4A1RA 1OLLA 3HRZB 4RESB 2F8OA 3M17B 1EK3A 1HDMA 3QZWB 5F9WC 1KJ2B 3IJHA 4CUCA 5LQBL 5I9QB 5D4JA 3BKCH 4UV8A 43CAB 3SCMC 4D9LH 1HI6A 2XN1A 4G83A 5KYUB 4ZMTA 2HKHH 3FRUB 4JG9A 2OSYA 3VNZA 1WAEA 1G9ML 5KEZA 3IMBA 2IH1C 1TKWA 2P5OA 5K9JL 1CTOA 4P23B 5J9PB 2BXYA 2EXYC 5D5PA 4BE6A 3GTNA 3M8OL 3RU8H 3S5LA 2HJKA 1IBLB 1CXZB 1MSDA 4MHHI 2X4QB 2N7SA 1UM4H 5KBMA 4MDJA 2EDMA 4QYOA 2CHZA 2F08A 4B95C 3B9KC 4WWKA 4WBNB 2XZQH 4PGZA 5C8JB 3K4ZA 5GRJH 1XMOB 1JI2A 4YL4A 3GBML 2H32H 5IW3A 4DV7O 4ZUUA 3PL6D 5HHME 2OSLA 3WIIL 4E9QA 3ZIYA 5CM1A 1GPOH 2V7HA 2GAZA 2DQFB 4YJ3B 2EYRB 1R73A 2FX7L 5BR8B 3X14B 4GZRB 3HLAA 4PJ8C 4UZGA 3U30C 2APTA 1KENH 4FZEL 3T6QC 4NOFA 4PMEA 5K1PA 4IEFB 4DK1A 1VARA 1TENA 2ID5A 4RFNB 3AM8C 4WFFA 2I5YL 4A6YH 4KFZC 1AHWB 1R24A 3MBEB 4WU7A 1GAFL 5LAXB 4K3JL 5DZ9A 5I1EL 2A83B 3MROB 2Y7NA 1IGJA 2ADGA 3JSNA 5IBLD 3SBPA 5DJCA 1MFEH 3EADA 1CT8A 1IGIH 1VZIA 1F3DH 1TF4A 4UDUB 3ZL1A 2JKLA 4K9EC 1HHIB 4HUMB 4XHJC 4N4YB 3FBKA 2C3XA 3KLSA 1BQRA 1QSED 3Q3GB 3L3DB 3QCTL 3LMJL 4WSGA 4AVIA 4POZD 5IFAL 2WAHA 1ZV5A 1YEFH 4N2HA 2WXRA 4KXDA 1SVCP 3LY6A 1AR2A 2KKWA 2GUZA 5JIMA 4B9ZA 4AYDC 3Q6FB 2E9JA 4U6YA 2FL5A 4MJHA 2XN9D 3FF7A 4Y1AB 2VAJA 5I5RA 1YJ9V 2R2EA 4BD4A 3N2JA 3K5LA 3WEMA 4XC1H 1LO0L 5BPPA 2DQTH 4PSPA 3KLHD 1IKOP 4OZFG 3TO4D 4N8VG 1EDYA 1RCYA 3RVXC 1GAFH 1WWCA 1WBXB 5CFAA 3H7BB 1MQ8A 3MA9L 5I1EH 2VQ1B 4NPYB 3VQ2C 2ATKB 3UZQA 2ATPB 1IC1A 2BNQD 4CBZA 3BUQA 1SNRA 3GZKA 1A6WH 3TA3C 5KVDL 1YJDL 3V6BR 2F9BT 3CDYA 2ETNA 1HCYA 3L9RA 2WOYA 3QUZC 2E27H 4IKKA 1KCUL 2KQMA 1AQDB 3V79C 1CVRA 1TTRA 1IE5A 4P48A 1AP2B 3FUEA 2YGPA 3F7RA 3AWGA 4KC3B 3LMJH 3TJEH 1DQIA 1S5HB 4TRPL 1NFIA 1IGYA 4ZAKD 3ASNB 1ROCA 2FH6A 4AC4A 1Z9OA 1COBA 1IBKB 1YA5A 1AACA 2R4RL 4PJFF 4N9GA 4OY9A 4ZMZA 2F7PA 4EB6A 3SYQA 2BM3A 1G7HA 4NM4H 3UABA 2I60L 1PZBA 1YY9C 1KCBA 2R0LL 4GRWF 4XVUC 3RWHA 2FWSA 3BVNB 1BBDH 2JIZG 2R23A 3W2DL 3GC3A 4ZOAA 4J3UA 2CDGB 4NUQA 5L0QC 3N2KB 4Y5VA 3DX6B 3JZ7A 4YXLL 2HB0A 5F3HB 1O9VA 4HIHA 4A2MA 2W0FB 3EH1A 1QRNB 3H9SA 4F9PC 4YXWG 2J8UF 2ZSVA 2E8YA 2OSWA 1SY6H 3DJ9A 4U31A 3TLRA 5GJTL 5E1AC 4PS4H 4K7FA 3K6SB 1YEGL 2FEEL 4FMFA 4M1GH 2WKOF 3LN9A 3CTTA 1YPZB 3IAPA 1ENVA 1TJIL 2VO5A 4U7KA 2IGLA 2HMID 4DK3A 4H7VA 1NBZA 4M3JA 5FB8A 1ZTXE 1E9PA 1G7PA 3OZLA 3UGXA 4DCQB 2V2WB 3D18A 5KYNA 1AANA 2ARJB 2R4RH 1E28A 1JV2A 3OKDA 3ZS8C 1A3LL 1PP9H 3I02B 1UWXK 1RFDL 3HNSH 2QM7A 2XKNA 5FHAH 5IV2A 4HGWB 2WBKA 2A77H 2QV2A 2PCPB 1DJSA 2EJ1A 4WJ5A 3TF4A 1A9VA 1XH3A 4D9QD 3T4YA 3TM6A 1KPRB 3QEHB 1IARB 5TPWL 4F93B 1E3ZA 4DP0X 2O6DA 1F7YA 4HETA 4YXLH 4FA8A 5HVHC 5KVFL 4FFWC 1J1OH 2XQYK 2OA9A 1F8TL 2OR8A 5KSAD 3P11L 2WTPA 1OGAE 3O3UN 3VX0A 3T6WA 3ZKQD 4PELA 3MRMB 1SYVB 4UINL 4DN4L 3B2MA 2R1YB 3N55A 3L4XA 1PPJH 2PO6A 4LIQE 3JARA 1C5BL 3UKMA 4TKWA 3IDMB 1CICC 1EERB 4HOXA 5LGKA 4KKAC 1RKRA 3ECWA 3STZB 4I48A 4GO8A 4JGSA 4HUUB 1TJHL 5J89A 3EJQA 2Q0AA 1LDPL 4UM9D 3SCMA 5IEHB 5JDJA 3ZHFA 2EO9A 1XBRA 1B9KA 1WBZB 4K3AA 1JRHL 1DANT 1RFDH 4Z3FA 1ZLSL 4FMKA 3G71V 2OZ4H 2WO2B 5DCCA 4P9OA 4NKMA 1O9WA 2FB4L 3HAEG 1A7BA 5AYTA 3KGTA 1CFMA 1MHCA 3AWFA 2FK9A 1JTTA 3B7UX 1HNZO 1DBKH 2VUKA 3FOLA 5GGUA 1AROP 3DGGB 2FX8L 1S2EA 1G6RB 3P2BA 2YSTA 5KVFH 2P22C 2W65B 3NEXA 5E8PA 3S34H 4ZFGH 4CC6A 4QAMB 2ICEB 1UWGL 5CWSA 3S37L 3GD1C 3MJ9A 5EB9A 4WI9A 4YHOL 2MQ0A 3CFDA 4PCKA 1UD4A 4K94C 1C8PA 4MBOA 4CZZA 4BFRA 1T04A 4FFYA 4PJBE 2UZXB 3BFQG 3GO1H 4JVUA 4JAMB 4EF3A 1QLEL 3AW5A 3BZ4B 2QADD 3K2UH 3SB3A 2ZM6O 2AEQL 3KCPB 1WCBA 4PJ8A 2QSCH 4GSRA 4QT5B 5DA0B 3DX8A 1IC0A 2HLDG 2BVOA 4YGAB 3OGCB 3RX5A 4DR7O 3T1FB 4N2FA 1Q1JL 4JI7O 5DRXB 5IHHA 4KXBA 2H45A 4DERA 3DXAE 4MFHA 3KWTA 1Q3EA 2N74A 3DROB 3ZYIA 4F7PA 4TLKA 4J4PC 1M6OA 4DF9A 4JCLA 1RSOB 4CVZA 4ANXA 3CFJB 1A6TB 2E7CA 4JI6B 4Y4KD 4Y19A 3FQNB 2X7LA 1FSKC 4W9IC 4X5XA 4O4LA 4XB8A 5KOVC 4R4FH 4DZ8A 2XWXA 5D1ZC 2P26A 2HKAA 3RTQB 4U6HB 5DK2B 1CP9A 2R4SL 3GS0A 1KPUB 5AQ0A 3ZTJG 1IMHC 3S96A 3WTXA 4P4KB 1ZHNA 3TH2T 2NNXA 5D96C 3MRIB 3BKJL 2OX5A 5BMVB 5ICXB 5F0JB 2ZF8A 1IUZA 2ZONA 3DWTA 2FYUH 1U8KB 2Z31B 1IJNA 3LKSB 3FTGB 2FEDC 4HHAB 5I8KL 3W82A 4N3TA 1AYOA 1FGVL 3CX5F 1DJHA 3N40P 1QLEH 3HHSB 4PFEA 3T08A 2AEOA 2WSSG 4OCYL 1URZA 1YSOA 2AEQH 3G7TA 2HHHB 5IW6B 1JD9A 1NGWA 3L7FA 2DBLL 4JO3H 1H15B 2VLLB 4W93A 4JL2A 4LCCC 3VFVA 4N21A 3DO7A 2P4AB 4FI8A 2VC2B 3F12B 1J1PH 1Q1JH 2YUVA 2ZCKL 4HT1L 4TUJA 4Y16B 1U3HD 2W9EL 4IOSA 2VJXA 5KTEL 4QHLB 4B08A 1S7WA 2ADJB 3IN0A 1HQRA 1KYDA 1VIBA 1H2SB 4OGAD 4LLQB 4CVUA 3UX9B 3TA3A 2X10A 1LE5A 1MREH 3O4LA 5I66A 2JGUA 1DE4A 5EU4B 5AAMA 3L5XL 3BKYH 5EO9B 4HYTB 3T8MA 3QUZA 1BXXA 2YBRB 3RVYA 2HWZL 4HCIA 2R29A 1DBAH 4YSRA 3PREA 1H3XA 3VFNA 2RBLA 2CUMA 2WNWA 2PPDA 4JFZH 1WWBX 3L2NA 4G2AA 4NT6B 1YTFD 5IBUB 1N64L 3ZTNL 2AJZA 3ZQWA 3HC3H 4B0MB 4Q6IB 2OM5A 4LVOB 2NXZC 4MNQB 4MZIA 4P5TD 4P2QD 3IMRA 1LJMA 3DPBB 5TJWK 4G8GE 3FCSB 4KX7A 4LCYB 5B8CB 1Y6NR 1DFBH 2EIJC 1GMEA 4H8WL 1S7UA 1D9KD 2V3DA 3V6FA 2CIKA 3HC0A 1KGYE 4KH9A 4JKNA 2ZCKH 3SE8L 1CGTA 1S7RA 2AJSL 2FDBP 1CQYA 1CIUA 4FKEA 1UHVA 1BLIA 4MMYA 1OT4A 3ZRCC 4ECNA 2X0UA 3VXSD 3KYNB 4CMHB 4NKQB 2VO8A 2WUCL 2BIIA 4XMXA 4WJKB 3CFIC 1GGCL 3IJYB 4KXZI 4XMTA 3FN3A 1T2QL 1G84A 2X42A 2FJFB 4QRFA 4X9QA 3GRWA 4PY7A 3SPVA 4AW4A 4GJTB 1JNJA 1R5IB 5DUJA 2NSMA 4GXUM 1BZEA 3FJTA 3ZBHA 3LKQA 1XCTB 3RIKA 4Y2DC 4P9HL 4O5LL 2YA1A 4JFTA 2NY4D 2J21A 4BKLA 1TVHB 5D6DC 4K3EH 4BK8A 4DV0B 3D85D 3NIFE 4W4OA 3T6XA 1RL1A 4MAYB 1F11B 5AVXB 2R9IA 5DZAA 2AS5M 1I1RA 2J6EL 1SA0B 2X2YA 3KPNB 1A9EA 1AR4A 4AVHA 4DWHA 4X4YA 1D5IH 1MVUA 1ASOA 3VE0A 3GJFB 2X2IA 4M02A 4U1LA 2XOKG 1ID5I 4Y4FB 4PA6A 1TCMA 3BMVA 3EFFA 4GAFB 4ICXA 5EU5B 1KQSU 1C5CH 1ML0A 1KB5A 3MNVA 4FGMA 2LQRA 5GONA 4LZKA 3T3PF 1TVBA 1IX2A 3PIQA 1T2QH 3MHSC 3RA7L 1CD1A 5TK2A 5DQ9A 3OF6D 5LP6B 2NDGA 4Z7NE 2UXDB 1J12A 2HFEB 2IDQA 3OPUA 3VXNA 5SWQB 3GSNA 5HPOA 3I75B 2R8SL 2QJDA 2Y36H 4ONGH 1P7QB 4E41E 3QFJE 3FUDA 1A8JH 4G8FA 1CICA 4TWKA 3ARBC 4GKSA 5F7EH 4DTGL 4GMSL 5GGQH 4JZ2A 5FPRA 2LTQB 4NO3A 2VLKE 3R66A 4AJWA 3Q1EA 1IL1B 4IHJA 1WLHA 3VD7A 3MYZA 2R7EB 5L7XL 3D4YA 1V27A 3JV0A 4X9BA 5JZ7D 2J1ZA 2AGJH 2VLJD 1RZJC 2J8UA 4TNVK 5AVZB 3TIEA 1JZ5A 5JIDA 3CDGB 2Q8AL 5ANMA 1AGDA 2ZZUT 3RUGE 4AENA 3AXLA 4XOCA 3FAXA 4PHXA 2B3RA 2EP6A 3GMMA 1GAXA 3ELAT 4HKJA 5AOMA 2QT6A 1S78D 1UUNA 1ZHBB 4ZUTB 4IGBA 4JFPB 1CLZL 2BSTA 3TJPA 4AEEA 3B7SA 5DXWA 2ODMA 3ALWA 2CBOA 4P9ML 3U36A 1EWHA 1T5XA 3DSNA 3EBHA 1AO7E 2FO1A 5C07E 4RAVA 4HUCA 4BELD 2CGZA 2GT9B 5DJAB 1EO8L 4EQ3A 2EILC 1OPGL 4W6YB 1U8NA 4P2RD 3QDMA 2UVEA 4WKZB 5F7DB 4GX2A 3Q8CA 3Q5YA 4CH5A 3NCJL 4RFEA 5T1JA 2XQBL 4DETA 1I1YA 3P30H 3BXNB 4NUGL 4BZ2A 4X6CB 4URKA 4L4VE 5DD6A 2DJSA 4PB0L 4G43B 3UGUA 5J2TB 5E5LA 4AEIL 3RDTD 1TVKB 3B2DC 1R75A 2IDTA 1FVEA 1N34O 4TNVF 1IBGH 1SXZA 3CYOA 1KGCE 3MJ9L 1INQB 5EZLA 2XNAB 5KHKA 2QDOA 3BDYL 4DGUA 1YG9A 3O0RH 4X5WA 2L6LA 4QPJA 2NY0C 4FFYL 1XR9B 3O41B 1E5ZA 5D1ZA 2Y4TA 3MLYL 3O3AB 5FA3B 3RKPA 1RP8A 3C5ZB 1GS6X 3OLEA 4DIXA 4LPYA 2DQ6A 4J7JA 2OZNA 1S7TA 1MJJB 1SMOA 1S7QA 1VFUA 1QFUL 4CADA 4ODHL 3ULVE 1LLAA 1ZVNA 4IBTA 1I82A 4ATTA 3L3JA 1QR8A 5KX5A 1Q7YW 1XX9C 2JI3A 2SEBA 3K59A 4W9HC 5DRZB 4NB7A 3UXFA 5LNDA 4JE4B 5IROD 1WA1X 2OWOA 2DY2A 4HKBB 5KJRH 4L9LA 1EO8H 4HPYH 4NLAA 3WSQL 1OCZB 1E27A 4NRZA 3UJTH 3JTSB 3LEXA 4FG6C 4XC3H 1DLHA 4I4WA 5JH7B 3OJDB 3ZHDA 5K9QG 2C26A 2GY7B 3LHAA 5GS0H 2QM4A 5AW1B 3UYRH 3NCFB 3ZO0A 2EVFA 2Y48A 3IJ9A 5DJXA 3INUL 4QLRA 4AQZA 5BS0D 3EF4A 5MERB 1XD0A 5CUSH 3UTQA 4FG4A 1JX9A 4TNWK 5FF6A 1TUEB 5FYJE 3MJ9H 4PJEE 1U93A 1BVKB 4URTB 3VJ6B 2Y7MA 2PW1A 4LHUD 3DBXA 4Z78A 2KZWA 4FLTA 1AXSA 3A47A 3BDYH 1XGUA 4X20B 3Q06A 1EGJH 4W9FC 1OAQH 4ORGA 4ZG1A 2HLEB 3K80A 1NC2A 1CXLA 2XWBB 4BUQA 3KMDA 3DTXA 2ZD9A 4XNYL 2I07A 1QFUH 3O6KL 4MJIB 4U1MB 3SQOL 1GZPB 2FR4A 1DLBA 1VQNV 2W9LA 4U1SB 1BIIB 3QXDA 4KXRA 1L7TH 5I6PA 1SOQA 2ZX7A 3CPLA 5HVGB 1L8DA 2BP0A 4IGGA 1QI3A 5IWLC 1H3WM 2VDQL 3F58L 3KPOA 1QWHA 3JAWB 5CA0A 4TUYA 2VZTA 3HPLA 2XIBA 2BIMA 3U4BH 1OAZH 3RVZA 1NDMA 1IFRA 2KZBA 2GPZA 2R29L 1I7RA 3EO1A 2XBDA 1AR1C 1BJ1H 4KY1H 1QEXA 3QCVL 1W0YT 4TNWF 4HWEL 2PP8A 1JD7A 1MFVA 1FVCA 3IFNL 4M5ZL 4XCFH 5E5RB 1T0MB 3E38A 5LBSH 1SKVA 4X7SL 3C5SB 4LCWE 5JHDB 2VXUH 1K5QA 1WP7A 4LBAA 2QGDA 1URIA 5LBVA 3QHFL 3GIZH 1BZ7A 3C6LB 3CCLV 2X4TB 5EZYB 1HKLL 1S9XA 3QI9B 4ZRGA 4A7VA 4YHKL 2Q7GA 1XZ0A 1V3LA 1BVNT 1P5UC 4Y2DA 2WM0A 1LDSA 4GINA 4XE0A 2AZUA 4PV9B 2XXGA 4IRZA 3K6OA 3MQIA 3UCQA 4L3EA 4FKKA 4N8CH 3U79A 5IHZB 2X3AA 3PWJB 3ZMEA 1R0AH 1MIMH 4JR9H 3QDGD 2NY2C 1YPZF 2PXYA 2RD0A 2I9TA 4OUOA 1TZ8A 4MTGA 2AJYL 1J8SA 4G6AD 4I1RA 4XNQB 5F9JA 3JYCA 1BYNA 1DDHA 2ICES 2ZSWA 1KIUB 3GRWL 4ODUB 4YPGB 3CWBH 3FB6C 1F4HA 3QCVH 4KHXH 5IQ9A 4M9OA 1Y76B 2N56A 3IFNH 4BWAA 2J88L 2ERJB 4JFFD 1VADA 3QH3A 3KS0J 1WIOA 2Y1YA 4H0GA 4FRWA 4MS8D 4FHBD 3VH8B 3A0HZ 1UA6L 4L1DA 2AHYA 3HRPA 4QJ4B 1PKQB 5I8EB 1BQLL 1MFDL 5T3XL 4DOHB 2C7UA 1XIWC 2O5XH 4OD1H 1RUKL 3B1TA 4LSQH 4OUUB 1AYRA 4P5MB 5CBGA 1HKLH 1U30A 4HF5L 3SGJC 4KI5D 4FQXB 4HS6B 1VQ7V 1XL4A 5KYYB 2IPUK 4UNUA 4L8SC 3EH4B 4JI0O 3EUDA 5A2IH 1S9KC 1K8IB 2ADIA 5GRVL 5EUOB 3ZT7A 1A02N 2CDFA 1YQVL 2DQCH 2D31B 2MCPH 3N2GA 1VA9A 4OLZL 1KB5L 1W59A 5FYLL 3VFTA 4HXBL 4Q9CA 4K2UH 1N6QH 3CFNA 3BT2L 4BK5A 1GY1A 5F1IB 4OSUL 3DOSB 3T8XB 3GSNL 2IADB 3QPQC 4ACPA 5AW5B 1YLBB 1GY2A 1SJHB 3DK0A 3MRQB 4PIRF 3W39B 4PQXA 3DX7B 4AG4L 1HESA 1N0JA 1MI5E 3BO8A 3HTLX 5D1XE 1SDYA 4BZYA 1P4BH 2FGWL 4IU2B 2Q73A 4BIUA 3MO1B 4CAGA 3U25A 1T89C 5C08B 3TV3L 2WLLB 3LS4H 3C90A 1CD9B 2NX5A 3G04A 4RFOH 4B27A 4IOIA 1LGVA 4OM1L 4F27A 4LRIC 5BMFL 2YPVL 5BV7B 3H8NA 3D0VB 3KE0A 2JNZA 4EXPX 1U9KA 3U9UA 5ITBH 1XWVA 3SBWC 2HLAB 2WANA 5CB4A 4IBSA 1I9RH 2OK0H 1N6UA 4R7DA 3NCXA 5BRZA 7FABH 4APQC 2JB5L 1Q0XH 1RHHA 4UZUA 4HDIA 3ABLB 3RX7A 3FTSA 1GYUA 3VQLA 2YRPA 2QBWA 3CSBA 5HI4C 2K9UA 1WAAF 1A3ZA 4HJGB 1GVIA 4Y9FA 2NUTA 5A43C 2IU3A 2LAAA 4JFXB 5K39B 4EN3C 4X6DE 5HTSA 1YHPA 1NGXB 1GZHC 2F58L 1BBJB 1HH6A 2QTVA 4Z9KB 4K94L 3N1GC 5EULV 4UQBA 2VLRB 2X2JA 3AUWB 4JRYA 3R1GH 4OZ4A 4R9HA 5J56B 4HJEA 4AVJA 3PGFH 4AG4H 2P5EB 1B6DA 2VZOA 4FD0A 4PRHD 2L0DA 3WG7C 2J3SA 3HKFA 4J7KA 4YFLF 25C8L 2F7OA 1JR9A 5HHVH 4GEIA 1KB9J 2XTJC 4PIBA 5B22A 1ZJBA 4NHUB 4BZ2L 1NUNB 4APXA 3WAJA 3ZN6A 5EIIA 4DKEH 2XAQA 1YEDA 5GIRA 2WGNB 1P7KB 1VCAA 5DJ8A 5ALBL 1U95B 4Y9EA 1UZGA 2P43B 2VGLM 5HGDB 3HRZA 5DRWB 4BUHA 3WUZA 5CAYB 1AZRA 4FL4B 5CJ5A 1NFAA 4NNXB 4K0KO 1KJ2A 5FA4B 1AXTL 2XXMB 3CZLA 5F1SA 1WH0A 4YNYB 3RYFA 4IKLA 4YSPA 4PY8J 4LESA 2X3BA 3WKML 5KYUA 2XQYG 3FRUA 4OB5H 4O4IB 1BLNB 4TSFG 3ZE0E 3TT3H 3GSXB 4U1IB 2E76C 4X1KB 3L1EA 4DH2A 5I15L 5K9KA 1RVFL 1WS7A 5DFTA 5FEBA 2H0JA 4HUNB 5D1QC 1TEGA 5EA0L 4OCXH 4GS7C 4YQXH 5FUCC 4JI4O 3L3OC 4XAKE 4XAWL 1E90A 1T7ZA 5CEZL 4NQCA 5IUCA 1IBHA 4B9JA 2HG5B 2X38A 2XWJA 2YPLE 4ODTH 3VGFA 3K0WA 4GAJL 4LGSB 4BZ2H 3OX8B 5HYSA 1HHGB 4KKLC 5L3EA 1WD8A 5HHMD 4WBNA 2P24B 5C8JA 4LF9B 4GLXA 1UEYA 3FB7C 1XUQA 1B2WL 1UB5B 2WV3A 4P4RA 4DUVA 3KW8A 4WF9V 1KDIA 4LT7A 4XBEL 4HZ1A 5B21A 4RRPM 1QABA 1BVNP 2DQFA 1R1BA 3RBSA 5GS2H 1FLTX 3EOTH 3TNNB 3CZJA 5ETUB 2B1AH 4E9LA 3MODH 1CG9B 1XQ8A 3PWPB 3P4LA 3QJTB 2VN4A 4DV1O 3WKMH 4N0FB 3H2PA 2MPAL 4IEFA 4OAWB 3FQTB 3MACH 2UXBB 3MBEA 4C83B 4RETB 2EDHA 3S8FB 2R69H 5JPMB 1JFQH 5CMAB 3Q43A 4AIOA 1H3GA 1HL9A 1I3RA 5E7FA 2A83A 2GTWB 3AK2A 3EDJA 3MROA 4H0IA 5GZNA 2XA8H 3ASOB 1NMAH 1DVFD 3ROOB 3QNYA 1PIFA 3AC0A 4XAWH 4I18B 2IOIA 3V0VB 5EORH 4UDUA 5MEND 3DC5A 1HHIA 1PX3A 5E8DH 1NTMH 1PLCA 3JWDH 4OZHE 1YY8B 5E2WL 3IDXL 5IVOA 1JGVL 3L3DA 2O30A 4I2XE 4BWUA 4LP8A 3N91A 1YEKH 2GY5A 5I1HL 4JYCA 1G1CA 5DHVB 3D36C 2E4FA 4JDZB 1T66D 1SN2A 4RCAA 5FFLA 4Y1AA 2YD4A 1CFSB 4Q6KA 4ZBMA 3FB6A 1N0NA 4G5ZL 1AB3A 1NLBH 4MQ7B 3U48A 2R9HD 2W59A 4W68A 1KPVA 2BOLA 2Q76B 4LOUC 4LVEA 2BS8A 3DOHA 2FT6A 1P6WA 1OIOA 2YA2A 1WBXA 3FT9A 3H7BA 3K6FA 3OHXC 4IRZL 5ESQA 3VDCA 2VCOA 4HV8B 2ATKA 1NGZB 4FMTA 3CFKB 3Q1SL 2LLLA 1IC4L 2D7OA 1ASQA 3B34A 5FO8B 3O6ML 4ZUWB 3HR5B 1C7TA 4YHPB 1XR8B 1YAIA 4Q0XL 2FUQA 3S35H 1WJ3A 3MV9A 1AQDA 4LFAB 3M88A 1BFTA 3WDHA 1VKXB 3PL6B 4W81A 3CP1A 1AP2A 4C47A 4BWWA 2B1HH 3QXWA 2OMZB 5C0EB 2H1PH 4X8JB 2V7NB 3T4AC 4Z3GA 5AVVB 1S5HA 1CI3M 3CVHH 1A4KA 4ZOBA 1ORQC 2E9BA 3L4UA 5ICZB 4JDTL 4LVOC 2QGCA 2WZAA 5D2NB 5ADOL 3NCCB 4FI6A 4EUPA 3EXAA 4HMDA 2W95A 1YCIA 1CXEA 3F04A 1Q6IA 2GK0A 3IRPX 1HEJC 1J0HA 5L2KA 2E75B 5H2FZ 4LPXA 2YIBD 4X99B 5ADPL 4LCVA 5D70H 3AROA 1VF5B 4JI1B 4I4TB 3HJ0A 5J4MA 4A7GF 3BVNA 2HSIA 3T8VA 1GOFA 4JPVL 2BVTA 2CDGA 2MFNA 2OJZH 4MLIA 2OW6A 4UM8B 5AKTA 4IRZH 4G11A 4KITB 4PDRA 3UAEA 4ODSH 1UT1A 2W0FA 2L7QA 2WHVA 4JFUA 1TYJA 1NCDL 1JPGB 1QSEB 2K7QA 3QEGL 2IH8A 3PJNA 1MCFA 5F7BA 1YMMA 1D6EA 3LQAL 4LRIA 3TH3T 3K6SA 4Q0XH 4OX9B 3MOAH 1XH1A 1NAKL 3HLKA 2WO3B 3NG5A 1Z0MA 4I0KA 1YPZA 3RVTD 4GQPH 2IH3C 1RZJL 3SO3B 3Q8EA 3WE6B 3BAJA 4UI2A 4HS8H 2XN9B 1MABG 4J7RA 3LPOA 5HI3C 1B4JH 3VB9A 2ZCZA 4DCQA 2V2WA 4DGWC 3ME0B 2XYBA 3D3IA 4U7NA 1UD5A 2ARJA 2KH2B 4KGJA 4CW1A 4KJYB 1CD0A 5CBFA 3TO4B 1ODAA 5IT9N 5HD8C 2M7WA 4C4BA 3VWJD 4WY7H 4HGWA 4L1BA 2F7RA 1T6VN 2CG9X 4LLAA 2CDYA 4JFHE 3B56A 2BNQB 2Z0AA 1ZS8B 4XNUL 3X12B 1NZ6A 4Q9RH 2R51A 3ARGC 4FF9A 4X6CF 5D55A 1J5OL 1VF6C 2NSQA 2IH9A 4YAQB 1KPRA 2UU9B 3QEHA 4YSCA 1OGAD 1R34A 2BIPA 3VXOB 4N0UB 1RK0B 3ZDWA 1NCDH 1OCWH 4TVPH 4ZMNA 3CCVV 3Q05A 1OWWA 1QNMA 2I25N 2L04A 3CDFA 1I8LA 3MRMA 4N85A 4ZAKB 4F58H 4F8QA 5CZVL 2QJ1A 1OF2B 3PDDA 5BY1A 2D7MA 1OZTG 3IDMA 3MUJA 1MELA 2JEUA 4H44C 4I77H 2Y69B 4NVPA 2FT7A 1VFAA 1XEDA 3STZA 3BWAB 1XNQB 4HUUA 4DGIL 1MFCL 3C09C 3NDYE 3PCYA 1YIJV 3PG2A 1WBZA 3AZUA 3EW3B 4PJCB 5CCKL 1TETH 3QIUD 5HYIA 3IMVA 4NO5B 2V5TA 1EJ6A 3CC5B 3V0GA 3TBBA 2DMGA 5BO0D 1XGYH 2WMPA 5D1QA 3PHOB 1KB9F 1CDCA 1J5OH 2KDGA 2CH8A 3RWCB 5EWIH 2HAZA 1KCSH 3G6JE 1EAOA 3DGGA 3AXIA 5J0BA 1G6RA 5SX5K 5ABDE 2YXVA 6FABH 1PMYA 1ZY9A 1K72A 2MHAB 2ICEA 1L4IA 1QBZA 2XXFA 1YEHL 4WSKA 1KJ2L 2QL1A 5G4OA 4B5EA 4LF3B 2ZCHH 4QHKI 1JJOA 2WLMA 1QW8A 5C0BE 2Z7UA 2E9GA 1BV8A 3CSFA 3M1BB 4JQXC 3GRGA 4XVJL 1XHHA 2UZXA 4YDKL 3QA3B 1WAAA 4JAMA 2GUYA 4WWOA 1A47A 3BZ4A 3APOA 5JMRA 4M7LL 3DIDA 3KCPA 4LEEA 1LQBC 2X9YA 2ODIA 3NBNA 4R0LB 3DXAD 1BQZA 3OGCA 3LNHA 1PD1A 1ACCA 5E70A 3T1FA 2GI7A 4MMZB 2XAFA 3V4VH 4F8NA 5JQGB 2YXWA 5FV2A 4X0KA 3ZHUA 2G4GA 5BQDA 4B9CA 3HS0B 5AD0B 3ZHKA 1G7MB 3ZMVA 4JZJB 2D3VA 3DRTB 5F97E 4OJYA 1RSOA 1R9FA 1LP9E 5KSAB 3CFJA 1KC8W 1F97A 1OSYA 4MB3A 4G7YH 1EZVH 3ETQA 3FQNA 1DTUA 3M8AA 3V0FA 1FL3B 4M6OL 3S4SG 3IJEB 4U6HA 5DK2A 5EH1A 3ZMZA 2IPTH 1KPUA 4JRXD 4ANWA 5AKSA 5KG9A 1TJMA 5CLWA 1S5IH 3ZRWA 3CQFA 3FQXB 3ABKC 2K1MA 3MRIA 2ZUQB 2KYIA 2ITDB 4KKCC 5BMVA 4Y1SA 3PDOB 5AOLA 1BXUA 5F9OH 1V7NH 1M57C 1ZANH 4XVJH 3VB8A 1U8KA 2VDKB 4J2QA 4UM9B 4XNDA 5HHXH 1SMDA 3FTGA 5E79Z 3V0JA 4N0YH 2EKSA 1LK2A 2GJPA 3HHSA 3MRGA 4JB9L 4UQ3A 5DZNA 3HE6C 5MEOB 4PI2A 1RLBA 3RX8A 1TZHA 5DJ0B 5GPRA 5IW6A 5BW7C 4JRFA 1H15A 2VLLA 3MLXL 4JANA 4QTIH 3FCTB 4M1CC 5HGAB 1PZCA 4DP4X 1QSFA 3ILPB 1UFUA 2VN7A 4PJHF 3CHOA 1HCVA 3QK0A 3PUUA 4QHLA 2ADJA 4JTAB 3QUYD 4Q9BA 4HPOL 4YDJB 4UQCA 3KWXA 2A73B 4LLQA 2V1DA 1UCBH 3BFWA 3NZHL 4FLVA 5EU4A 3COOA 1JFHA 3A8TA 3MZGB 2YBRA 1WK0A 1E6JH 4M6OH 1HSBA 1KD1W 4PJ6A 5FM4A 1CU4L 2UY6A 1EEQA 4PHZA 1NKRA 2ROXA 4KK8D 4TSBL 4NT6A 2QADB 3DYOA 3QDHA 1HNXB 5DLMH 5AB2A 2P49B 5HDWA 4G8GD 1DVQA 1FRGL 2G60H 1NANH 1OT2A 2FWLB 4X65B 3VMNA 4MNQA 2DWYA 4XO9A 1V05A 3KYOB 5D7IB 1SFDA 4AGPA 3VQ1C 3HFMH 3MZTA 4LCYA 4DO4A 2MQCA 5B8CA 4G82A 2ZR2A 1HOEA 4UB0L 3TZVC 1FA4A 2B9ZA 2AXJA 5EUOF 2EH7H 4L3AA 4YHHO 3MR9B 1SM3H 1NPNA 3B2PA 1R3KB 1RURH 2E59A 4Y4KB 4JGNA 5B1AC 1MWAL 2NZ9C 3S3WA 5CJQL 1V3KA 1X4XA 1Y1UA 4MVUA 3KYNA 2P8LB 3V9FA 4HJTA 1XB8A 4W9ZA 1BA9A 4LF4O 2AEIT 3KHQA 2G5BB 3IJYA 2V4DA 4YEEA 1AS7A 3V0WL 1KBWA 2ZOKB 4PVNA 3VWKC 3WKYA 3PNRB 2VXVL 2J71A 1DR9A 4YR6B 3OTOO 1A4JB 4U1GC 4Z1VA 1R5IA 3VXRB 5JPNC 4JJHA 1PGRB 2VXQA 1XCTA 1HILB 2Z0UA 4RRPG 2GHZA 1CGYA 1MNUH 5BZBA 4NZRL 4DQAA 5AVQB 3TVMC 5FUZL 3WD5L 2EQDA 1TVHA 4KMLB 4XPFH 4B9GA 3KJ6L 5JQIB 1GTFA 2BVPB 5D6CB 4LQ1A 1K92A 3BAEL 4JBSA 1X4YA 4LDCA 1U3HB 4MAYA 3GBNH 5I6NA 4X2UA 1F11A 3UPRB 3WL9B 1I3GL 3CFBB 2QVMA 3R4DA 4EBQL 4KZEL 1SA0A 2V5YA 3ARGA 3G80A 1MEXH 4NQUA 2WD0A 1ZTMA 1DSFH 3GJFA 4JDEB 2Z34A 5BXZA 4Y4FA 4Y8DC 4LPWA 5HGBB 5J6GB 3VSTA 2A6IB 2EDXA 1BQHB 4QTHB 1PG7W 3PJSB 4XMUA 4FKHA 3FTZA 2EULA 3T0ED 4DT2A 1QLFA 2XFXB 3GLDA 3VD3A 4Y5YC 4GKOA 3PHSA 3QFJD 4JRLA 5LP6A 3GDCA 4E41D 2HFEA 4Z7AA 3BGFB 5AW3B 2BX5A 2D03L 2UXCO 4J3SA 5FLUA 3I75A 4P5TB 3QNZB 4YX2L 2Y23A 3CSGA 3WNNA 1P7QA 1GW6A 1OQXA 3IN2A 1D2DA 1NFDA 3DGCR 3OG4B 4M03A 3T2NH 4NZRH 2VLKD 1NH6A 1MHEB 2PR9A 3P9MA 4FXKC 5FUZH 4NKIH 4OLUH 4DV2O 1VACB 3KJ6H 1D9KB 2XG4A 4MS6A 1TO4A 2NW3B 3P9LB 3V0IA 2N05A 1IL1A 4NQTA 4PJIB 1AI7A 3WNPA 3QUMH 1OP9A 2VXSL 3RILA 2IALB 4H13C 4XR8C 1GL4B 1KKDA 4MMXC 3UACA 3CDGA 4P2OD 3JD2A 1BHBA 4PRPE 3LSOB 3KBEA 2X1PA 3LNFA 4R96A 3D2UD 2FEEI 4Q4IA 2IPUG 5A2AA 4XNZB 5IK3B 1ZHBA 4ZUTA 3V5DB 3T0AA 1JK8B 1RIUL 4XOAA 2Z7WA 4N2CA 3W37A 4BA8A 1K73W 1SXCA 5ILTL 5C07D 1SEQL 3MNWB 3WJJA 5KS9B 3CS5A 2OXGA 1QA9A 2YZ8A 3QPKA 5HPMB 5ACZB 2NY4B 5AW6B 1BEYH 3THML 5I6XC 3ILQD 3PNWB 1WFTA 4YX2H 4FJ6A 2O1AA 1U8OB 3H1HH 3D85B 4XI5D 2GT9A 3DHPA 3MRNB 4GSUA 5DJAA 1U3ZA 3B6SA 1X5LA 1HZHL 4G27B 2KUTA 3D69B 5LYJB 2I26N 4R2GD 5F7DA 4NBZB 4WW2B 3TN0C 1B9ZA 2BOBB 2E7MA 1BL8A 4JHWL 3VW3H 2Q8BL 4DR2O 1Z3GH 4TTDC 3BXNA 4H2CA 4X6CA 3KCYA 5GRZA 1G6RL 4F7MA 5J2TA 4M7LT 3AG7A 1JGUL 1KV7A 1TVKA 1MZYA 4QPEA 2VXSH 3CXHJ 3LNNA 1INQA 1XTMA 4G72B 1ZTEA 2K9PA 3BFRA 4FABH 1XR9A 2V3EA 3A6CH 3O41A 1SQBH 5C3LD 2YD7A 4GKNB 5FA3A 1S7VB 3ULVD 3C5ZA 1AQMA 1AY1H 2XHNA 4L5FE 2Y22A 2R0KH 1W72B 3ZMUA 3B8SA 2NLJB 4QRSA 4MAUH 5BVPL 5ILTH 2AQTA 1N5AB 1WSST 2GJJA 1RUQL 1YZZA 2MKLC 4X4ME 4BQCA 5DRZA 4UAOB 3MKGA 2G5UA 3O9WC 1FJGO 4OFQA 3ZRFC 3Q2NA 1TLKA 2YD2A 3LIZA 1LXMA 5GZOC 3CLEH 4ICWA 2DI7A 2FVNA 3EFOA 5DQJB 2Y7SA 2Y6SD 3LB6D 3SE3A 4BYHA 1UASA 4WFEE 3O8XD 4I3SL 5JH7A 5BW7A 7TAAA 2LE9A 4OZGA 2VLJB 4WUKH 5E94B 1L0YA 4FA7B 4OQTH 4P46C 1JGUH 1S7XB 2C3WA 2YD1A 4YHZH 1ADQH 2ZKHL 5K69A 3CX2A 3WN5B 1UM6H 4QNHB 4ZMLA 2KSDA 1FPTL 4W9JC 1OHHG 1MW3A 2ZNIA 4HJUA 2JJ1G 4X1IA 4BQBA 5FC9A 4XCYB 2P6JA 4H8PA 1IVLA 2G3NA 3EBIA 1YSCA 4GFXA 1AD9B 1DQMH 1ESOA 2XWBA 1FZKB 4C4KO 4UTAH 1Z2KA 3OQ3B 4LSRH 4XT1C 1GXEA 4LVNC 1I7UB 2QV4A 2GBTA 4MJIA 4U1MA 3L1FA 4G8EB 3CSPA 1GZPA 3IJ4A 4F3FB 1TQCB 2HVJB 1CGXA 1VPOL 2WA3A 3B9DA 2HG5C 3TBSB 4P2RB 2B1GA 2LFSA 1CFNB 1NL0L 2VC2L 1RZQA 2FATL 4U1SA 2QE7G 1BIIA 3JWNG 3GHEL 4Y7OC 2MSPA 4ONHA 1DVSA 2F68X 2WYHA 2FWUA 3SGKC 5LKNA 3JAWA 4JV5O 3RDTB 3C3TA 5CSZB 4F2EA 3GB7B 5CJ8A 4BZ1A 1MRDH 2VDOL 1GR7A 2JQZA 4JPWL 4NXMO 1BM7A 1TYRA 4M5TA 1U6AL 2RHEA 2FHCA 1JYVA 3UDWC 5DS1A 4LF8O 4HC1H 3KDMA 1M90W 1HH9B 1IBMB 2R1WB 4Y2OB 3UO1L 4K8RC 5JJNB 1T0MA 4NXNO 3C5SA 1E2WA 1CF1A 3VWKA 2L7JA 2EYTB 1VEOA 2KLRA 3JUYA 4G3YL 3V9EA 3W9EB 2QSQA 5IMOB 4M6ML 2YRZA 2CU9A 3C6LA 5TH2B 3QI9A 2X4TA 3TCLB 4F20A 5JPNA 4RAIA 2N7BA 1BQ0A 5CHNB 1T03L 1VPOH 4P3CH 1BSIA 3OW2U 3FFCA 2VC2H 4ZW8A 2FATH 3BSZA 1VQPV 1EAJA 1TNNA 3KEDA 3F5WC 3F6IA 5HJBA 2YRLA 5IHZA 4J3OC 3PWJA 2W60B 5JW4R 1AR5A 3DUSB 1NICA 1M5IA 1O9GA 5BS0B 3JCZA 3B77A 3A3YB 4PJHA 5HDBE 2DEXX 3F6JA 5T5FA 4Y1TA 1IBLO 1XCQB 4XNQA 1VJSA 5C6WH 4AM0A 1IGFL 4BH8B 2UVFA 4LHUB 1JGDB 4ODUA 1KIUA 4YPGA 5ICUA 1XGTB 2NY5H 5FECB 3OXRA 4MT8A 2Q3XA 4IYHA 1Y76A 2LW7A 1MXGA 4AUYA 1O7VA 1SHXA 3NH7H 2VXQL 3PPSA 4F8PA 2EE0A 1XMOO 3M45A 1CGUA 1SBBA 1L9QA 1CQKA 4TNEA 5DF0A 3VH8A 1ZHKB 2HFTA 4FMVA 1PKQA 4A7UA 1WDAA 3CPUA 1NC4A 1PZ2A 1QOKA 2EXSA 3O9OA 4F9LC 4P5MA 4OUUA 2J1KA 4CNIB 1S3KL 2C3VB 1C8QA 4DYLA 5BR8O 5IB5A 1JZGA 1NI8A 4FTVA 2KHAA 1N9PA 5B3JF 4FQXA 2Q9LA 3H56A 5KYYA 1VF7A 1UB6B 3V8OA 3UAAA 3E80A 3QT2A 1K8IA 2DQIL 4R83A 4A2DA 3EOAB 5EUOA 5I74C 5E4AA 3W7SA 4UQEA 3QZNA 4YSOA 1NIDA 2VABB 2X05A 1NCCL 2D31A 5KW9L 2A3QA 4AGNA 2FWOB 2YEQA 4W9KC 2APSA 1WLEA 2DD8L 2WBJC 2AV1B 1OF0A 5F1IA 2UXFA 4R8WL 1I8MB 1SXBA 4MMXA 3CRMA 5DVKA 4MTOA 1IIKA 1L9SA 1MI5D 1P4LA 1PL3A 2BVEA 3DOSA 4IJ3C 2HN7A 3U7YL 9PCYA 4MB5A 1E7VA 1SJHA 1ACXA 2N0KA 1LD9B 1FGNL 2VXQH 3MRQA 4MXQC 3O11A 3Q2LA 4NQDE 3DX7A 1KBPA 4PJCF 3V4LA 3EO9H 3QYNA 3H4FA 2F95B 5FFGA 1QFHA 3MO1A 2ENPA 3I85A 4LSUL 4AIEA 1TIUA 5C08A 4PG2C 2WLLA 4LOVA 2WZ6A 4P59H 1BJMA 4M48H 4X83A 3EZJB 4YFDB 5FW6A 1A66A 2K7PA 3QDGB 4IK6A 2ZUYA 3D0VA 2NZ1A 2XV6B 2CTWA 3D07A 2HLAA 3N5AA 4ZD3H 3CFEB 1IDSA 4L8JA 2DQIH 3FOMB 3GJFH 3QG5A 1UVQB 1DBML 1OXYA 1VEMA 2QVKA 2VL5B 1IM9D 2IFFL 1NWPA 5EZOH 4UBDC 2F7QA 3FUJA 3BP6A 5KW9H 4M6NL 4CS2A 3ATAA 2WP3T 4N2IA 4TQHA 2K45A 3WLWC 1OSZB 4HJGA 3IGLA 1SRDA 4JFFB 4JFXA 5K39A 1RUPH 3QULB 1Y74B 1BBJA 3OKKA 3UC0H 4I3RL 1D5BB 1CXIA 4BCZA 5I5MA 2VLRA 4JPRA 3WTWA 3KKYA 2XWZA 4FQPA 4TUOA 1SEBB 2QHRH 5DMKA 4O2BB 4QXUL 1GJIA 2HFFB 2APFA 1XSOA 1U3JA 1ZVYA 2P5EA 4OLVH 1LILA 3ARPA 1IBKO 4Y9BA 4FLWA 3E8UH 3STLB 2EC9T 3GSRB 4KVCL 1RP3B 3BDXA 4YK4B 4Y2LA 3BPLB 1IFGA 5B38B 1I1AC 5D7EA 1QBMH 3KEHA 3GTTA 1PPIA 5CLZA 3O9WA 4NC2B 2UZYB 4UILL 2OFQA 1GN6A 4KKQA 1X9LA 3CN1A 1BG1A 2HRHA 1NKOA 2ZICA 3VD5A 4H8VA 5CZKA 4EZMA 5HGDA 1AJPA 5DRWA 5GHWL 5HDQH 1L0XA 4NNXA 1XB3A 3C60D 5CF3A 5FA4A 2DYRB 1JNHA 1VERA 2DM4A 4M6NH 3PUCA 5EN2B 2CZNA 5GJSL 4MYWB 2QKIC 5KVGE 5TF1L 3WY2A 1XF3B 4NCDA 3IWVA 3ZX1A 5I71B 2D0FA 3IB4A 4JHUA 5EUKB 4O4IA 1BLNA 3CLWA 2F19L 3FQ4A 4JAUA 3GSXA 2H5UA 4U1IA 3EUUA 4XAKD 4X1KA 1GGTA 4UFZA 1EMTL 3SDAC 4G2KA 2B9AA 5A2BA 5BOPA 4B9KC 3UAJD 3LIZL 1EH9A 3VTMA 2VDLL 2IG2L 2YPLD 4AT6B 2ZKWA 2XYCA 4Z3IA 2A9AA 1OB1B 2R9AA 2HG5A 3QQ4A 4Z7VB 2UXVA 3FB8B 3NZ8B 1NEZB 1FAFA 2FYYA 2WTRB 3LRGA 4OZIE 4UILH 4FM0A 2P24A 3KJ4B 3U2SB 2GEEA 2WUBL 2CO2A 3E6HA 1AGEB 3SGKA 2PPCA 1KXTB 3OGIB 5J2UB 1UB5A 2YKLL 2C9XA 3Q2VA 3CMGA 3WFBL 5GHWH 3L1OL 1Y0LA 4WNJA 4ZMPA 2CPUA 3QJHB 3RWIB 3L4WA 5JLZB 3UDWA 5ETUA 1OV8A 2BFGA 4M1DL 5IY5B 3DUUB 3PWPA 4JYBA 4R0LC 4AYID 5HSFA 2LU5A 4LF5B 4N0FA 3K8LA 4LSTH 5D7IF 3FQTA 2ZT9B 1CYXA 2VE6B 4PRHB 4FJCC 1RJLB 4JMNA 4C83A 1DLFL 2F19H 5CMAA 2GITB 1LEKB 3VRLF 2VWKA 5DECA 4UVBA 3UMNA 4PUBL 2H3NB 3ROOA 4F15B 3LIZH 4NZTL 4BGLA 4I18A 5TDNB 2F54A 3V0VA 2WAQA 4XPBL 4PWKA 4NNYB 2DOCA 3PQYE 4BZ1L 5IF0B 1T1YB 5LVEA 3FL7A 2MCAA 2Q69A 3GT6A 3BIKA 2TRYA 1YY8A 3EJYC 4FXGB 5I8OL 3K03A 3F5WA 3P2TA 5LNGA 1KCLA 1KXQA 2HA1A 3U4EA 1UXWB 4FP8H 4PJGE 4JYYA 4GRMB 3NA9L 1F90L 4IMKC 4G42A 4HEPA 4JDZA 4YDLC 1MHPL 3RB5A 2IJJA 3CDZB 3QTCA 2ENSA 1BVLB 2RFXB 2J8HA 3B5HA 1A7NL 3MV7E 4HMCA 1ROPA 1RIVH 1MG2C 5FUOH 5IJ9B 3WYRA 2DI9A 2HTKD 3FZUD 3MRJA 1WFJA 4PGDA 4QD2E 5DHEA 2A6KA 1KEGH 1Q82W 1DLFH 3ESMA 4FNLL 4YSDA 2WPDG 4ETYA 1RPUA 4EPSA 3V8CA 1RIHL 3JTTB 3BVXA 1DO6A 1L9NA 3NCYS 5GGTL 1ZPLA 1JNLL 5KBPA 3BSZL 1JZ6A 1K4DB 1NGZA 3P69A 3AWEA 3CFKA 4RGOL 4F9LA 4RQQA 4C56D 5FO8A 4FNTA 4KRPD 4ZUWA 3HR5A 5AVSB 5HHMB 5FAAA 4BJLA 4XPBH 2D3NA 2QQLH 4YHPA 1XR8A 3TCTA 2Y0SA 4BZ1H 3TK1A 5B3SC 5ITZB 4DV6B 1M2OA 3N1QC 4PJ9C 1VKXA 1JWUB 1KCRL 2V6HA 1FL5A 3PL6A 4AMKL 4ELME 3FB5C 3M7FB 5C0EA 2OMZA 2UWEE 4KJQC 2A9DA 5FW8A 1IIIA 3RWGB 5SX5H 1HOCB 2E46A 4AHCA 1CN4A 2DEWX 3A4FA 4XDJA 3N44B 4RAHA 3PWUB 4JFEA 4PREB 4V1DE 1PNMA 2CJTA 4JI6O 3QO7A 3JVFC 1IQDA 3DO4A 2V2XA 2XHBA 2HR3A 1NVPD 2UXGA 1E5AA 2HT2D 3RY6C 2W0XA 5AKVA 2K78A 5AZ2H 5I2IB 4X99A 3FRPB 5IVXB 5DEZA 2YPKA 5JHLL 1P84K 4I4TA 1SQVH 4OGXL 4ALAL 1DVFB 4DW2H 3DMMC 3ABGA 4S1DC 3TC9A 4E9VA 5I73C 3QISA 2OMUB 1HIML 4PJIF 4U6VH 3NABH 3A6BL 4UM8A 5MENB 2A9BA 4OFDA 3WFCH 3MJWA 4L8BB 4OGQB 4YLBA 3DGEA 4QDGA 1JPGA 1QSEA 4GXVL 2JLPA 2HHHO 2IANE 3MKKA 5T5FH 4O4HB 4GW5A 4PAZA 4WCEV 1HVXA 3WE6A 3F7QA 2MJWA 4QO1B 5F7KC 3CFCH 4GKZB 4X6EB 5D5MA 2EZ0D 2XN9A 4WZ9A 4FA6A 5J57B 5KS9F 4PB9L 1JHLH 2AK4D 3WNJA 3TFKC 3ME0A 1Z2GA 3GMQB 4OLYH 3I2CL 2FCBA 3JD1A 3WB0A 1FIEA 1KFGA 3ALXA 5T1KD 2DN9A 5FO9A 4POYA 3SKNB 4LNVA 2JJSA 3KPLB 5KVDE 1M7IB 5CFHA 1P84F 3NRFA 3PP4L 3VBBA 1JTPA 1NUDA 4WW2F 2E6JA 4B9PA 2GSMB 3FTUA 1IJ9A 2BNQA 3AB0C 1JXGA 1ZS8A 1VQLV 3X12A 5ES4B 4W6WB 5CMUA 1I8KB 2ICWI 1CDBA 4AJVA 1IURA 1HIMH 1X4ZA 4GUPA 3QDJE 2YJQA 1QVOB 3S98A 1N8OE 4RUEA 1BQUA 5FW7A 4QHNA 1I1AA 4N0UA 1RK0A 3VXOA 5CD3B 3ZYJA 2GBAA 4GXVH 4JO2H 5ERWB 3W56A 1T1ZB 5TDOB 1BGXL 4Z7UE 4RNRB 4ZAKA 4FQ2H 4OI7A 5C0GB 4TSAH 3L17A 4OF6A 1DN2A 3U6XS 3FPYA 1UH3A 3NJLA 5HJDA 4G6MH 3GM8A 1HINH 4AYBA 3PXJA 1YN7B 2IDUA 3QUHA 4L0PB 4UT6A 1M4UA 3ABMB 1PSKL 3VXTB 4DKFH 4Q6GA 5A2FA 2QKIA 1D9KC 2R27A 5ANHA 1IM3D 4PJCA 5C0CD 3LSSA 1EEUA 4R4BB 5DQDL 2X4NB 3F7VC 4J12A 4OCMC 3CC5A 1YQ2A 3RPBA 4CN1A 4NFCA 2E47A 3SDAA 2Y06L 4LSVH 2P7TC 3PHOA 2QGNA 1ERNA 1PDKA 5BV7H 3RWCA 1Q8IA 1L7IH 2F6AA 3OEEG 3G08B 5T1MA 4NXKA 5FIEA 4DV0O 2JGDA 2Y5QA 2MHAA 3S2CA 5ISZE 3JWNE 1IT9L 4OLWL 4R3SA 3WHXB 1VZHA 1EX0A 1T1WB 4GI9A 1AVMA 3IDNB 1KJVA 3G5YB 3PAVA 4LF3A 3S36L 4HKZB 5E2TL 4W9DC 5TE7H 1PNDA 3QIWD 2J5LB 3M1BA 2DE0X 1DJWA 3LPFA 4JLRB 3RWRD 1CTNA 5CR8A 1CL7L 1ORSA 3QA3A 4DV4B 5SV3A 5FCUL 4X5PA 8PAZA 4QKTA 4WI2A 3VWJB 1OCCB 2WSKA 2CXKA 4R0LA 2QZQA 2YARA 3B43A 5CBEA 5K1NA 5KVFE 1DEEB 3CMAV 5C2UB 2YGQA 1D5AA 3AG2C 3F8UB 2BH0A 2UXDO 1DQDL 4MMZA 3QEQE 4IRSD 1BMGA 5D72L 5DQDH 4ZMOA 3HS0A 1OGAB 1U8LB 1MPAL 3FSOA 4NQED 1T6WA 2P80D 5K1XA 3MHZA 1G7MA 1KG0B 3EHBD 2ZNXA 4JZJA 3DRTA 4XMLL 1TEFA 1OW0C 5KSAA 2DLEA 2XN0A 2GSIB 2I85A 2FIRT 4G7VH 3ZO9A 3DBSA 4X4ZA 3BD4A 3SKJL 1AJNA 1FL3A 1TITA 4YWGL 3OKYA 1K9MW 3AU1A 2Z6FA 4EEQA 2IDCA 2D2OA 3LDBC 1BFOB 5ESVA 2YXFA 3FQXA 4LPUA 3QFGA 3S36H 1TCRA 5E2TH 2ITDA 4DSYA 1Q5OA 1W0VA 1U0QA 3Q8BA 1Z5WA 4BW9A 4UM9A 5D1ZI 1SDAB 3GMNA 1CTMA 1TQBB 2ED6A 2J6WA 1MCJA 1QR4A 2OJEB 4IMKA 3A22A 2J4WL 2X5PA 1FYTD 3QIUB 4KDWA 5DJ0A 1EEZB 2ZAHA 3OR6C 4YS4A 2E9IA 2AP2A 1ILUA 2FTAA 2YXYA 4U2ZA 4U49A 3FCTA 4KQ3L 4GBXD 5HGAA 2KLSA 4KKNA 3ILPA 4LPVA 1JF6A 3V0DA 1UD6A 2RACA 3WIAA 5T3ZD 2VH5H 3Q8AA 1DL7L 3TT1L 4YDJA 3CLFH 2A73A 3FT4A 4IDJH 3QORD 4LU5H 4QY8B 5F7HA 5LCVH 3MN8A 4PJBB 4R97C 1VESA 2BVQB 5IB2B 1JOIA 4WWNA 2FO8A 1HS6A 2E7DA 2E7HA 5F6HJ 4DZBB 3RWJB 4FFTA 4TT3G 4YSTA 4AGQA 1EUTA 4BFKA 1KBBA 4GQRA 3FFQA 1Q0YL 4GLRH 4YHNB 2EEBA 4U1HA 1B2YA 3BN9D 3DXAB 4XXDB 3BAWA 3UBGA 1NA8A 3KYOA 5I1DB 4HD5A 5D7IA 2J4WH 2VDNL 3TASA 1CDJA 3R0MA 4Z6AT 2AABH 4P8QA 5CSGA 1AZUA 2YMXL 1OAKL 2E74B 1CCZA 1RPKA 5ENWB 4JI3B 1UXSB 3HKZA 1GHFL 4PRBB 1AVAA 3QCUL 3MR9A 3G9VA 1ZE3C 5E1HB 5AW2B 2BE3A 1IBBA 4FFVC 4HAFA 1R3KA 4YDVB 1D5XA 3RL1A 2H94A 2Q0OC 1BZ8A 1WGOA 2WLYA 4LCUB 3D8CA 4HIIB 1RZFL 2P8LA 1B06A 1A14H 1P69B 5MI0B 3OHMB 1IKNC 2DV6A 4JRXB 5E08H 2R56L 4GX1A 5KAIZ 2ZOKA 1ITCA 5DHVH 2E7LC 4MXVF 4YR6A 1NBYB 4NAQA 3EKCA 1A4JA 5D4IA 1WZAA 2B15A 3B5TA 2EADA 5IROC 3ZYOA 4IT5A 4PYHA 5L3BA 2Z8WC 2QELA 5LHHA 4IHOA 1Q0YH 2BOCB 4QRPE 2V9TA 4ZS7H 4C59B 1BWMA 4U1NB 4YPJA 3VFMB 5KVEH 2ADFL 2B4CH 1KT2B 5GS2D 4JI7B 5D6CA 3NIGE 3E1F1 1U3HA 5CLXA 3UPRA 3WL9A 4LQFH 4QXVA 3QUYB 2GBVA 4N25A 1RUMH 1PL4A 4K4KA 1EVTC 4MQSB 1MZEA 4XBPB 4JAAA 1ZK9A 3MVSA 4JDEA 1T0NA 3HVNA 3X3GL 5J6GA 3KGSA 3APCA 2A6IA 4H88H 1KYUA 3O6LL 2ADPA 1BQHA 5AUMB 1O7DC 4QTHA 3O2DL 1HC1A 4Q89A 1R3IC 3PJSA 4X7TB 4GRLC 1JFFA 4K3DL 2ZG1A 4UTBH 2XFXA 3RFZB 4NRXA 5KYWB 2Q0ZX 3D34A 4DP1X 3SPJA 4G8GB 4K71B 3ULAB 5DI8A 5F7MC 1N32B 1I5XA 4P5TA 4P2QA