3SPHA

Inward rectifier potassium channel kir2.2 i223l mutant in complex with pip2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 89
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3sphA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3sphA01
3JYCA 5B3SC 3ATFA 1K4DC 3RW0A 3K03A 2IH3C 4P2ZA 2DYSC 1OCRC 5B1BC 3FB7C 3SPHA 1J95A 3STZC 3SYPA 3ASOC 1U4EA 1R3JC 4PA6A 3AT8A 4PDLA 2DWDC 5CBGA 3E8FA 5BZBA 2A79B 2ITDC 3OR6C 2Q6AA 2EIJC 1V55C 5E1AC 1BL8A 4F4LA 1KKDA 1P7BA 3E8BA 2AHZA 3K08A 4WFHA 5EK0A 4MS2A 4RUEA 3VOUA 3HPLC 4X88A 2BOBC 1R3LC 1S5HC 4GX2A 1G4YB 2Y69C 1K4CC 2ZD9A 2WLLB 3IFXA 1ZWIC 4P9PA 4LCUC 4QNHB 2Q69A 5EBMC 3LDCA 2HVJC 2WLIB 1XL4A 3AG1C 4G28B 4PDRA 5EC2C 3T2MA 3ABKC 4JTDB 2K1EA 3OUFA 1OCCC 5EBWC 2QTOA 3FB6C 1JVMA 4J9YB 2WLKA 4WFEA 3SYCA 3AG2C 4EKWA 2EIKC 2WLHA 4MVMA 1M56C 1R3IC 3T4ZA 2JK5C 3EFFK 3RVYA 4R7CA 4LP8A 4PA3A 3FB8C 4J9ZB 3UM7A 2DYRC 3SYQA 4CBCA 4DXWA 4HZ3A 4R8CA 4RAIA 4XDJA 3E83A 4PA7A 1OCOC 2EILC 3TETA 3WG7C 2KB1A 4PA4A 1N9PA 2X6AA 4MVRA 3E86A 4R6ZA 4H37A 4OXSA 2WLJA 3ASNC 3K0DA 5CBHA 3RBZA 4JTCB 3LNMB 3TCUA 4MSWC 3LDDA 3AUWB 4P30A 2HG5C 2R9RB 3SYAA 4P9OA 2IH1C 2A0LA 4MTFA 4H33A 2H8PC 4PDVA 2P7TC 1ORQC 2A9HA 3SJQC 4G27B 3T1CA 5CBFA 1OCZC 2W0FC 2ITCC 2HJFC 3E8GA 3IGAC 2EINC 4WFFA 4R50A 4TWKA 4PDMA 3OGCC 4MVZA 2X6CA 3AGWA 3E89A 4KFMA 5J9PC 3T4DA 4MW3A 2HFEC 4XDKA 4RUFA 4I9WA 2YEVA 3BEHA 3R65A 4RO2A 2QKSA 3SPCA 2GIXA 3PJSK 1XL6A 3GB7C 4MTOA 3LUTB 4MVSA 2ATKC 5EBLC 3AT9A 3ABLC 5EC1C 3OUSA 1R3KC 4GX0A 4QE9A 2HVKC 4QE7A 3SPIA 2BOCC 2AHYA 3K06A 2Q68A 3E8HA 3LDEA 4MTGA 4UUJC 2WLMA 3ABMC 3SPGA 3OR7C 2NLJC 2EIMC 4PA9A 2E4FA 4LBEC 4ZBMA 5KUMA 3KG2A 3ATDA 4X89A 4MVQA 3AG3C 4HYOA 4GX1A 3VSQA 4MVUA 2X6BA 4JTAB 1M57C 1U4FA 3K0GA 2ZXWC 3F7YC 3ZRSA 3K04A 3K6NA 3X2QC 3ZJZA 4BW5A 3AG4C 4MW8A 3ATAA 4X8AA 5IY5C 5KUKA 5B1AC 4MVOA 2OCCC 4WFGA 1LNQA 4GX5A 4XDLA 3SPJA 3STLC 1V54C 3UKMA 3F7VC 3RVZA 3SYOA 3ATBA 2WLLA 3FB5C 2DWEC 3ATEA 1QLEC 2WLIA 3F5WC 2WLNA 2Q67A
chains in the Genus database with same CATH superfamily
3BAXA 4AX3A 3QFJD 5FOBA 2GTAA 3T0EB 3GHBL 4EJ1C 3KJ6H 4R0LA 4ZUTB 2IGTA 3U0TA 1HNGA 4XOBA 1JZ2A 1LUVA 3I6GA 3T2OA 4RWUA 4Z78A 1KCSL 3X3FL 2ZR2A 4I7ZB 2HJKB 5IQLA 3MRHB 4IRJB 4LLUA 3WFHB 1U92B 4HSCX 1V9PA 1X5FA 4AL8L 5DRNB 3S37X 5C6TH 3FU7B 5ADOL 2ZPKL 5KZCD 4AC2A 3KPOA 2H7WA 3UC0L 3FHQA 1K92A 4PJBB 1QD0A 4JO3H 5F1KC 2BWDA 3MR9A 2QA4V 3GUFA 5B1CA 4PS8A 4N8VA 1A4KB 4JZNB 3P30L 4L0ZA 1EWHA 4MASA 5EZJB 4P5TC 3FB6C 1QSZA 2JKWA 1DVYA 1G4RA 4JI3O 1ETZA 3ZKMC 3IE4A 2VITA 5DLMH 5CJ5A 2VZOA 1DJWA 1XH3A 2H3XC 3UACA 1NGWB 2P3YA 2Q8AH 3BH9A 4PJ5D 3Q0HA 1BBJB 1M05A 4GSDL 4NWUL 5IQMA 2EULA 1YIJV 4N1HB 4KNTA 4DKFL 2D0GA 3B40A 4IOSD 4UQBA 3PGCA 4DUZB 2QLVB 4B0MB 2PZSA 4PBDA 3MXVH 1P49A 3OKNB 3QVAA 3EH4B 3ABKB 5IMLA 1ORQA 1PL3A 1NMAH 5TF0A 3D12B 4PUBL 3KPSA 2Y07H 3TL5A 2E0PA 4YHYB 4P9OA 3KPRE 3ABUA 5DR5H 1H3GA 2X6UA 3Q9PA 1WTLA 3VGAB 2J8UB 4TL5A 5H6QA 4XOAA 3CLEL 2ITCC 1BF2A 2WWMC 3PXHA 2E7LC 1S9VA 3O0RH 4X6DB 1TTAA 4GAAA 2OL3B 4Z77A 2WCPA 4P2AA 1OL0A 1BV8A 3JVGA 4U6XA 1JVKA 2JELH 3S36X 1WT5C 5F96H 5T3XL 1OJHA 2PW2A 5F1NA 1Q7YW 2ZSVB 5EORL 5EO0B 2B5IB 3N40F 4I3GA 3DVIA 1WC7B 5JQIB 3EZ8A 1F4HA 1PYWA 1XREA 2ADJB 2ITCA 4AYDC 2E7LA 2G2NA 3TVMB 1BFVH 3DX8B 5DECA 2IDUA 1XR8A 4WEBL 1OP3K 3VFGL 1GTNA 3FTZA 4QXUH 4B9JA 4MVQA 1OSZB 2FMLA 3QHZH 5AB9A 1UG9A 1UM6L 1URIA 3S3DB 1J8SA 3KH3A 3MXWH 1YEWA 4AEEA 1PKQB 3FRPB 5LXVA 3I5DA 1FHGA 5JPMB 2ZTBA 4DO2A 1F23A 2Q7AA 5KSBB 2V2XA 4E9XA 5DD5L 4LCCB 12E8H 4ZXBC 1BFOA 1XGUB 1GW6A 4BV1A 5FUOH 5ABAA 3TGXA 4X9QA 1KACB 3D5OF 3NIDE 3W37A 2BVQB 2LE9A 3D09A 1RK1B 1O5DT 4ZZKA 3SBPA 1EMTL 4M00A 1SDDA 4JDZB 2YFOA 3D85A 1D5MB 3E9TA 4FG0A 4KDVA 2BNRA 4S1QL 3PG2A 4U0RC 4ENEC 4E41D 4KX8A 4HEPA 5ID1A 3V4PB 2YD9A 2F08A 2AK4B 2LGWA 3BAEL 1OZ0A 3ZMEA 1FNGB 1INQA 2CRYA 4NQCE 1S5HA 1DN2A 1A9BA 1N34O 4CL7A 2WBJD 2FHFA 2CE4A 3DIVA 4F7CB 2HVJA 1LO4H 3MUGB 3ESPA 1QTPA 5JW3L 5EZIH 3JD3A 1AOZA 5B3SB 3HZYB 5D55A 1ZSDA 4JE0A 5GJSL 1YPZA 4F1ZA 1R6TA 2Y2TA 3QUHA 4UV4L 3KYKH 3MJWA 4JNXA 3CS5A 1MFAH 4E9QA 5AAMA 5ANME 5K9KA 2B9ZA 2A6DB 4NQVB 4PHZA 2WGNB 3ARGC 1LEKB 1Y6KR 4NQDD 1ZY9A 1KFGA 4Z76B 2AXWA 2L7JA 3CDGA 2G3MA 1U8PB 2YUWA 4RDQG 4OI7A 3HNSH 1XEQA 2Q7YA 5GS2H 2SEBA 2Z0UA 3HUJE 4XNQB 1Z1WA 1KTKE 2XWJA 4CDHA 4A38A 5EZPA 1UOKA 1E79G 3I3BA 4MCYB 4J5VA 2P90A 1ZE3H 3O2DH 3BN3B 5AWNL 3HKCB 1R6VA 2OYMA 2B4CC 3SJAC 1I9JH 4I18C 4L4TB 3DSQA 3NIDF 4V1DA 1OTSD 1M1KW 3L9YA 1VFUA 2DYPD 2E7CA 3C5JA 3MA9H 2EE6A 2JEXA 4N6RA 4KTGA 4LF6O 2OSYA 3DWTA 4YXLL 1YITV 4XVUD 1A6TA 3QYNA 4KXZI 1UJ3B 3MDSA 4CVZA 3M8OH 2XHBA 1XH0A 5DURB 4TVPL 3UZVA 6FABH 4IL6Z 1IXMA 1CYGA 1J8HE 1ERNA 4P3DB 4RGOL 2D4DA 3FO2A 3WLBA 3K9SA 1BMFG 4XPAL 3OF6A 1SZNA 4A7SA 3MLTA 5EN2B 3WTTA 2EUVA 5HYJB 1UFUA 3GBNL 1UH3A 5A2BA 1K7DA 3KVQA 5ANHA 5C0FB 3KDPB 2P24B 3FU5A 4UTBL 4QHMA 3BAKA 2R8SH 3LRKA 2OMUA 4HHAA 4PJEB 3JTSB 3TO4C 1P4BL 1QR4A 2BSED 3B5TA 3R1GH 5I1IL 1IGFH 4LVNC 2ZXWC 2CJUL 3K8KA 4Q14A 3X2QC 3PHQB 4JKKA 5LGHH 5EOTB 3HUJF 4KKNA 4X6CB 1ZA6A 1SN5A 5GGTL 1DUZA 3PGFH 4YHIA 3TA4D 5BRQA 4X5WB 3ZTNL 3SGKC 4HG4J 1VEPA 4U49A 1ZLVH 2HCZX 2QV2A 4OZ4A 1HNXB 4BKTC 4LEOA 2DICA 4C4KO 4C56B 5D7HA 4DVRL 1HU8A 2FJHB 3L7EB 2WXQA 3UZQB 4WNJA 3RBSA 2AI0H 4JO2H 3TO4A 4A1RA 5FC9A 2RJZA 3KXFB 4KKPA 3DGEA 1MHEB 1AP2A 1KB9K 5E79Z 1RZKC 3N06B 4GW1B 3Q05A 2ICWB 2D7TH 4KAQL 1TR7A 3X1EA 3C60D 3C2SA 3G5YB 1NUDA 3PDOB 3FKUS 1JYWA 1GH6A 1UXLA 1RPOA 1Y66A 2WA3A 5JVDA 4NO5A 3QCTL 4HJIA 2VKXA 2L35A 1U2HA 2VDNL 3EO0A 2PWHA 3KS0H 1N64H 3KPSE 4WW1B 5FYJE 3SODB 3FCTB 3VXPB 4XC3L 2H41A 2IANA 4CS2A 3TPUA 5GRVL 4WWID 3GVMA 5KVDL 2OX5A 3DVNB 3LEVL 4I48B 4N0CD 4U3XA 4WWKA 4ZUVB 3STZB 4APQA 4BRVA 4P0DA 1GO3F 5IIEA 2XXCB 3L17A 2AZAA 4UCFA 2FHCA 1IAOB 3ZTJH 3RI5F 5BUPA 4D94A 1J0JA 3CC5A 1LGVA 1JK9A 1FGNH 1X44A 1FCCA 3MODL 3RVTD 3LNIA 3UIZA 4B5ZA 5E6IC 4I50B 3RB7A 5DJ2B 3OAUL 2K7QA 4MJ6A 3CHRA 3EYOB 3N0PB 4R4BB 4UM8A 2FUTA 4DPBX 4XNUL 4ODSH 1YYLL 1PIGA 3DMMA 5D96C 4Z0BH 4N22A 3FZUD 1DUYA 3F01A 3HE6D 3NCWA 4FFKA 2DBLL 4GQZA 3WN5B 1QR1A 5E6IA 2JV6A 4WO0A 3WMPA 4IJTA 1DJSA 4ZYKB 1YSOA 1XZ0B 4AVJA 3C6SA 4EI5C 4JYBA 4F57H 3O41B 4PW3A 1PDKB 2MOGA 3RWEA 3MJ9A 4OGXL 3V6BR 3GUTB 2GUZB 3ML8A 1FC2D 4PI0A 5SWZA 1AQ8A 2ZWZA 5JLZB 2BNRE 3FT4A 1HHHB 2KHAA 1FC1A 2BOLA 3KZ8A 2JIXB 3O2WH 4MDJA 5GZND 1XXFC 3LEYH 1CPUA 1F3DH 4K9EL 4L1BA 1WD8A 4KV5F 4E5XB 5AENA 2EBOA 1GZHA 3B9KA 1UJWB 1MH5A 5EU7C 4GIOA 5L4JA 2PI5A 4JREC 5D6CA 5FYKD 1WK0A 2H1XA 4D6TH 5KHJA 1ACXA 1NDMB 1YPZE 3RZCA 2WXOA 1JOYA 1JGUH 4NZRH 3SOTA 3VXSA 5IHHA 1GMIA 2LFRA 1KJ2A 1T7VA 1H8OA 4LSRH 3UTSB 4XZUA 5T1MA 2KZBA 3Q43A 2FT7A 5IOKA 1JV2A 2EKJA 2D7PA 2WO3B 5BRZA 2GBUA 4H8WC 4J3XA 5LOVB 2NY6D 4M4RA 3U10A 4HULB 4OD1H 5DHEA 1T22A 1OARL 1CD1A 5IFAH 2LW3A 5BZZA 2WA4A 1DVFD 1PD1A 4XN9A 5ICZA 2CBPA 5ALBL 2A77L 3CZKA 4NNPH 3R7RA 4FL4B 1N32B 5FKAB 3TF4A 3CE2A 3MNZA 1CR9L 1IX2A 3RDTB 3VWJC 1GOHA 4HXBH 1IKNA 2JE8A 4Q9RL 4XCCL 4DR5O 4P05A 2A0LD 2CGZA 1YQ2A 3K0WA 4MBRA 1RXLA 4V1DE 4XBGA 5KTEL 1A6VH 1NGQH 1BP3B 4NWTL 5J9PB 4GKLA 4DYLA 2Y69C 1NDGA 2E56A 3GI9H 3GKWL 3V52L 2FIKB 5IBTH 1AACA 3HR5A 4LKCB 3QA3B 2NLJB 4YUEL 4HV8B 3BFQG 4LRIC 2FRGP 5BV7C 4M5YH 1OD7A 5IYBO 3DV4B 4LKXA 4NM8H 2ADIB 2J4WH 3GMNA 5EMYA 4NQCD 4OM1H 4HUVA 1M7DA 2UUDK 2QHRH 4HWBH 3FQ1A 4HWNA 2EC9U 3OKDA 4ZT1A 3GMPB 3M1CA 3W82A 4CMMB 2PCXA 1I7UB 4NJAH 3VRIA 3PWPB 1T83C 4KUZH 1YPZF 2HG5A 2EDQA 1F56A 4PLKC 5C8YB 1B6DA 2PPAA 2WVTA 3MA7B 1WVZA 2ZWSA 8PAZA 4UT7H 2VDOH 2C4FU 1U8HA 1JZGA 1E4WL 4K5PA 1OE3A 3FU3A 4LOVA 4K7FA 1TJHH 4N8PA 1U3JA 2DQCL 3W9EA 4GAGH 2XVGA 2RMNA 4UM9A 4DV1B 3M1OA 5ENWA 5DD3L 3P4MB 3GB7A 4DERA 1GC1H 1FPTL 3A4EA 5DWPA 1OCOB 3RZWA 4DPCX 3FF7A 5IJKC 1SQXH 5LXTA 4NN5B 4R2GD 5KWYC 5K9OB 3QPQC 3MI6A 3DO7A 4K55A 4KP4A 3KEDA 4OFPA 5F7LB 5SWSD 1QFWI 4HBQA 4WHYH 5KVGE 3B2VH 3K5NA 1AQDB 4NXMO 1S9XB 3ZO0A 5HI5C 1BWWA 3OV6A 1CT8B 2R1WA 1P2CB 3DPBA 2XKUA 2CAKA 3DC0A 4PJ9C 4YBQC 5L2JA 4MAYD 4YOKA 5AVWB 3SOBH 1KYOF 2E74C 5DJDB 2G9HB 2EZ0D 2FZ3A 4MMZA 4KHPO 4YLBA 1E2VA 1O7VA 2YAHA 3AG3C 1Q94A 1N8ZA 1GN4A 5JQGA 1N4XH 4TNGA 1OM9A 5KSVA 5B21A 3NK3A 4H7VA 4ATWA 4BFFA 2X0VA 5KVFE 5LBVA 4AYFA 4HIJB 3V4UL 4HKBB 2IANE 2CUIA 4UTAH 3NSJA 4C4BA 1X5ZA 5CSGA 2UWEA 1AIFB 1Y0LB 3LIZA 2ZXDA 1DBMH 4WAFA 2DMHA 3KDMB 3PGDA 4LAQL 4PVLA 2MQCA 4I4TB 1AJNA 1RIHL 5J6HA 1GGCH 3GFUA 1R33A 5CA1B 1F8TL 5DD1L 3CQPA 1YN7B 2LP7A 2I9TB 1S3RA 3QIWA 5D5MB 1OGTA 5FGBC 1KPVA 5KS9A 3TYFB 4ZNEA 1SYVA 3MGAA 3UBHA 5JXEA 3FFDA 2JJUA 2FK9A 4U7NA 4ICGA 4I13B 3JWDL 4G43A 4WJ5B 3RYCA 3PU7A 3QUZC 5D7JD 1QP1A 1RH8A 2JLLA 1MKFA 1NAML 4AQZA 2AV1B 4LCUA 5EBMA 2OR9L 3PWNB 4AGQA 1A3RH 1IM3D 4K5NA 4AUUA 3RFRA 4AUYA 4FX5A 4OUOA 3TN0C 4FZ0A 1M90W 4ZPVB 4AI7A 2XQYK 1WIOA 5KANI 3DHUA 4JG1L 5HJ3A 5FGBA 4AH2B 1KU9A 2V9RA 1PFOA 5HFLA 1NT2B 1RM1C 3L48A 3B2UD 5AW6B 1BAWA 4GKJO 1YNKH 4MQXD 5T1LB 1NVPD 1ZLDA 4LF4O 4UNVA 3PWLB 1DBAL 4HZ1A 4J1UB 1NEPA 3JV4A 5SWZE 1JPSH 1MF2H 1R24A 3WXWL 2IBBA 4DRXA 1ZSHA 5H94A 1PX8A 4MS8C 5AZ2H 1QI5A 3DURA 5L3EA 1A4AA 7CGTA 4N8VG 2VQ4A 4K3AA 1KGCE 3LHPL 5FW8A 2MPAH 3D36A 3D25B 2AKRB 3V4VL 2A6IB 2FKXA 4AEHH 5CINH 1X6NA 1XR9A 2HT4D 4JFPA 1CL7L 1MCFA 1TMQA 4H25A 3VXTA 5A16A 4OZIB 4FNPA 3IGKA 5E4IA 5CKAA 3GMQB 1U8KB 3HLAA 1AVMA 5BXFA 3ZMZA 2FEEI 5IMOB 1C12B 1JD7A 2JK5B 4PY8J 1NQTA 2N4IA 2P8LB 4Z8FL 1KB3A 3KKYA 3EJQA 4CW1B 3VXSE 3TX4A 1MEXL 1IEHA 4U1MB 3IDXL 1EAPA 1NCAL 5C86A 1HNYA 3UYPB 3X1GA 5A2AA 1T7YA 4U1JA 3CCUV 1U8OA 4MRBA 1U93A 5BRZE 2W0PA 3R65A 5KX5A 1OGAE 1FJ1B 4MA1B 3VFRA 5LCVL 2KLTA 5A43C 1FZMA 3OD4A 2FBJH 3WHXA 5F0MB 2AABL 3B1UA 4ODWB 1BXAA 4ICXA 3TJEL 5EEXA 2OSWA 5GQBA 5KYXB 2YSSA 5L9DL 2PYED 4ZX6A 5I8KH 3WO3B 2WQ8A 1X5KA 2IDCA 4OCWL 1CUOA 4A7UA 4GBXC 3NH7L 2C3GA 4W68A 1SBSH 2W0XA 4HPOH 4C4KT 4DK1A 2VDPL 3QEQA 2WWWA 3RYMA 4NAJA 2QBWA 3WKQA 3C9NB 3WTSA 5E5UB 4JRYB 4UV7L 4X7SH 2FSEB 1VFAB 3MLPA 4K9JA 2EXWC 2GUYA 4N8CH 1RUML 3W2DH 5A3IC 5J3HC 1T0OA 2GAZB 4HUUA 1U8LB 3OR7B 2XY2A 4FJYA 4MYWB 3G6AB 5D7EA 2VSDA 2FTKA 5F3FA 3RW0A 1RQ5A 2CHNA 4JFOA 4UIMB 3L9RA 2LTQB 4DP5X 4ODUA 2W6JG 5BVPL 2UY7A 4PM1A 1N6QL 3Q5TA 3FB7C 3T1HB 1A22B 3EW3B 2DKSA 2KQXA 2PO6B 5DRZA 2RCVA 5ESQB 3HPLA 3QDAA 1R3LA 2ZJSL 1UT2A 4GO8A 1JZHA 3UTQB 3ARDB 1GJIA 3IDIB 3VBBA 4QOKB 5F7NC 4GS7C 4ZI8A 1BZ9A 1VFOA 2LABA 2WWKO 4M93C 4BM7A 2F53B 5B3JF 2A83A 2Y6SC 3HB3B 2E75B 4YHHB 1HHIA 3BAWA 4PJFB 3F58L 3MRRA 4F3FB 5JPNC 4QHUA 3CNKA 4D8PB 4F24A 3C6EA 2R39A 4JG0H 3EFOB 4M6OL 3MFGB 3VWKA 3PAVA 4MJID 4R97C 1N2RB 4XMWA 2D3VA 3MRKA 3G04A 2DQDL 2IVFC 3OSKA 5IB5A 3VI3F 3CMOH 3ZMUA 4PJXF 4JFFB 1YEJL 2Z92A 2VLKB 3VI3B 2IG2H 4U6VH 4AMKH 2H5UA 1YJNV 4YEEA 1H8NA 2A9NL 4R7DA 3VVVA 2AEWA 3FUKA 2VQEB 1I0HA 5EFIB 5TQ2H 2YICA 4QXGL 3V6ZA 3LQAL 4KVNL 3SO3C 5JQ6L 1WA8B 1QRNA 1NFDA 4G1MA 4Y16A 4ABWA 3T3PF 3UJTL 3ZQXA 4BCZA 5JYMA 4OCSH 1BAFL 1QBBA 2VYRE 1XVSA 3KGUA 2LT9A 1F6AB 1KMIZ 3MRBB 2W60A 5I30L 1GJUA 1XGTA 1PFCA 5DJYB 2UWEE 3VB8A 5IVZA 4KQ0A 5C07A 3GJFK 4FFVD 3GHEL 3RL1B 1YLBB 2XNAA 4NZFA 4W4OC 3EOAB 2WWNA 4KXBA 5L7XH 2VR8A 4UBDD 5DHMC 1ML0A 5G4MA 3DGGB 3DDFA 1XSKA 2WJ5A 5D4IA 5ITZA 3GSNA 2IFFH 1A6AB 3NCYS 4IGBA 1EK3A 4W6WB 3V0IA 4ZMNA 4WW2C 2G30A 4FQIL 5KS9E 1TJGL 3FO1B 2VZUA 2CNYA 3G5WA 3GXFA 3P9WB 2ENYA 2H8PB 4P5RA 3TZVA 3W56A 1HJCA 4Y5XA 5ACZA 1AZBA 3WB1A 4E2OA 1RZQA 5D1XD 1ZL8A 1P5UA 4HCRH 1PCSA 4QF1A 4XPTH 3IJEA 5GSVA 2EVGA 3D3VA 2OPCA 3IU4H 2XQBL 4BSWB 2HFEB 3I56V 4LEXL 1W0JG 1HR0O 5GZOD 4CUCA 3D18B 3X1FA 3FPXA 1KOAA 1WICA 4L8SB 3UZEC 4Z3EA 1IGYA 1GYCA 1YEIL 2AXFA 3V0VA 1IBDA 3STLC 2BRRH 3OKMA 4Z3JA 4POYA 2YEVB 5DJZB 3EXJA 5LAPA 4TOIA 2WVVA 3CFCH 3X14B 1MG3C 1MOFA 4RH4A 1CPYA 1BEXA 3C12A 1C08B 3V6FA 4IHBA 2ILMA 5F7KC 3MRCB 4OU3A 4QJFB 1SXBA 1IJNA 1WF5A 2A6KB 3BP4A 3GRGA 1ZPLA 2IMMA 3QULB 4JN1L 3QORB 4KRLB 4MCZA 4ZOBA 2PCPB 3QHFH 3M17B 3AQZA 3ICXA 4AQEA 1KCBA 1NCCH 2MQGA 2ZOKB 3STLA 1WS7A 2HT3C 4X4ZA 4HH9A 4J6RH 1P7BA 1ONQB 3QJOA 4U1IA 1ECYA 4R5VA 4APQD 5EPMB 4OJFH 1F4WL 4Z7VB 3ARSA 4PJ8A 4RGMC 3P3TA 3P9MB 5T3ZL 2G60H 2WWOA 3CFUA 3PQYA 1S7XA 4XWOC 1W6WA 4Y4HB 1R5IA 4Z7WB 2VLRA 1CDUA 4FLQA 4UT6A 1FDLH 4FMFA 4X8JB 5J1SC 3RVXD 5D1QB 5KS9F 3G08B 1HEJC 4K35A 4NI6A 3EADA 4RISH 1CTNA 4RAVA 3MRPA 1C1EH 2LV4A 3MGTB 1AMXA 4IDJH 4NQUA 5CILH 1SJHA 1WZ1L 4UTCA 4QRFA 3AG4B 1IILE 1DLHA 3CIAA 1B3QA 1ZK9A 4KK6C 3VGEA 3ARFD 2KC0A 4G70B 2CCVA 3DUSB 2J71A 2YQBA 3GSOB 4PJCA 2A9AA 2X89D 4U6YB 4FYSA 1WP8A 1T89A 3GPSA 4QO1A 5K59E 1Q9WA 5I5JA 3QXTA 1S7WA 1MIML 2IM9A 1BEYH 2B9AA 5AVRB 1QEWA 2X4TA 3RQ3A 5GHWL 4TRPL 2YBRB 1CLYL 5BNXD 4AT6B 4XTRD 3A0OA 3G7TA 3QEQE 4ANKA 4UZSA 1X5LA 4PS4L 2P4AB 1IEBB 1TO4A 4NS0A 4JY5L 4S2SB 5FO2A 1LNUA 3NJGA 2VDQL 3HAEH 1KYOJ 2Z35A 5CZVH 3W81A 2XACC 1IAMA 3PV6B 4WHDA 4X0KB 4QRRA 2VXTL 3VI4B 4P3WA 2DM3A 1BQLL 2GTWB 4O51A 1SJMA 4H8VA 5LB1A 2JB5H 2G5UA 2YAPA 4MQ7A 4MNQB 2XN9A 2EYRB 2CTQA 3CVDA 4LFBB 4S1DC 2EIDA 1TGOA 1QVGU 4H0LC 1D9KB 4LPYA 4YDZA 1WG3A 1VESA 5D2NC 1XH1A 5C0CA 5F7FA 1SQGA 5CHNA 2IAMD 2I85A 2XZAH 1T5KA 3MV9A 4K3HA 2DMBA 3VXSD 4EBQL 1SJVA 3TU6A 3TYGL 5EU4B 4PMEA 4QMEA 4BZ1H 1KN2H 5KVGL 4R84A 1EANA 4MQSB 2G9KA 3V0JA 4KZDH 3MRMA 5I1DA 1UXSB 4HF5L 4ZMLA 1OGAD 3QVNA 3QI9B 2ATKB 2UUBB 2XN2A 3FFQA 3UCRA 3KPNA 5KSUA 3VO0A 2XBZA 1QFPA 4YO0B 5C08B 2G75B 1OSPL 2H3NA 3GMMA 3KD4A 1CS6A 3V0GA 2IPUG 5K59F 4AENB 5KVFL 2XDHA 4KRPB 1QZNA 2NY2C 3NABL 3ZTDC 1IFHL 3REVB 2XXFA 2HZHA 4OLZH 4ZAKC 5LGJA 3HCVA 4KHXL 3UX9B 1LEIB 4NN7B 3LN4A 1TYEB 4OGAD 2K45A 3OR6C 1I4FA 1TTCA 5CJXA 2VDML 1OB0A 3NFPA 2E7BA 1K6QH 4F8NA 3QO1B 4O58L 4WI7A 1YY9D 2Z3FA 1JF5A 2Y2WA 4FNSA 1H5BA 1I53A 1NFDE 1QRNE 3UL4A 3CFQA 3JWNE 1I8IA 2YC1A 3JASB 4GI6A 3ECQA 1GGIL 5CCJA 3IBEA 5E8OB 2K8QA 2FO1A 4JZJC 2N3JA 4HKJA 3O45B 5C07E 4NNXA 1J0YA 1GMGA 4K3JH 1JMXA 3ZDXE 1MNUH 3RN4A 5J6GA 4LT7A 4G5ZH 3RAJL 1LEGB 4D3CL 2CIKB 4D7PA 3RVYA 3WSQH 2GSMB 2GHZA 4RIRB 1T03L 4KO5A 4J11A 3BLBA 2RB8A 2CGRL 2VR3A 1ETB1 4JHAH 2AXGA 1JF6A 5CN1A 1QKZH 3RX8A 3L4TA 3D50A 4TV8A 3AY2A 2NY5H 2CUAA 3PDDA 1NCGA 3D2UA 3LXUX 3GLEA 2WQXA 3CN0A 3SR2C 3QO0A 5I6PA 5EZOH 3AM8A 3U9PL 5B8CB 3D3VE 5F9AC 1TUBA 4PR5B 3CHQA 5DLLA 3OGOE 4IIJA 5IJ0A 3SYAA 4BYHA 3CU7A 4PU2A 3L3HA 3OGCA 1E9QA 2ED6A 3EH5B 4JI8O 5I1JH 2RN9A 1I7TA 2ZUWA 3E8GA 3AB0C 1T6WA 1IGCH 4TQHA 4M4PA 2ZOLA 1CFSA 1EEZB 2WXPA 4NQED 3FCBA 5IB2B 3TEYA 3TV3H 4OGYL 5E8EB 5GS1B 1M2VA 1UVQB 4EUPA 1ND0B 3RA7L 1ZRUA 2WBKA 3BYTA 4XAWH 3ASNB 3P73A 1JBJA 5SWQB 3BZEB 4G8GD 5CEXB 1NFDF 2VERA 2FWUA 4XGZB 1VCAA 3S88L 5DZAA 2H2PD 5KYUA 1SRDA 4DN3L 4BHUI 1JPTL 5E5RB 1AZNA 3CD4A 2WZAA 3WFEL 4ZOLA 1XBDA 1UWFA 1CDGA 3NCMA 4ZBMA 3GM8A 3WKYA 3LKQB 3L13A 3WNMA 4ELDA 3CLFL 1FRGL 3ZDXF 1MCJA 4D0DA 1M1XB 2D03H 5D9SB 3GMRB 1WZMA 4OZHA 4YE4H 2CR0A 2VZVA 3T2LA 3PQYE 3RWJB 2WYTA 3FSAA 1FSKC 2ENSA 3UKMA 1JV5B 1EXGA 3EUUA 5J6SA 1DSYA 1OTSC 4XOEA 3LD8C 3NJLA 2NY4B 4YHML 3L73H 1HP8A 2KKWA 4ALAL 3LNNA 3HVNA 5HDLA 3C2AH 1QBLL 2GCYB 3ZSTA 2HYMA 1Z9MA 4XVUC 3SDDB 5KG9A 3N2KA 5CMUA 1G7MA 1M6UA 1C5DB 3NSDA 1SF5A 4U1NA 4YHLH 1ECZA 1OK8A 1QW8A 4PJCE 4OBSA 1TMCB 2GEEA 2WWKT 5H2FZ 5K69A 3B2XA 2XLLA 1PNMA 4GMSH 4CNIB 3R66A 1MWAL 1EHLL 2GITB 4TSFG 2IALA 1MFMA 1QU7A 1DQTA 3BPLC 3TCXA 2WXLA 3IETB 1R34A 4Z5RB 1MCOH 2QPDB 4EDWL 4AQ8A 3CFJA 3K58A 1M9SA 1HYSD 5BV7L 4CADA 1G6UA 4XP9H 1MCBA 1RP9A 5JR1H 5L2KB 3MRDA 4QRRE 3KVDD 3MJGX 4P2RB 1SYSA 4LSVL 1R3IC 4O2FA 4UVBA 4DGIL 2ESVB 2OMNA 5EZLB 4QRSA 5I1GL 3BQVA 3JAMN 1W0KG 4OF3A 3UYOD 3PE9A 2O6FA 2XN9E 3RYIA 4O2EA 4JVWA 1Q6IA 3RJOA 4J3VA 3NPSB 4ONOA 1IKFL 2MJWA 3ARYA 3EBGA 4GKSB 4NUJB 3P3SA 3UBXG 1NAKH 1A7PH 1WCBB 5C0CE 3X11B 2E27H 1N0LA 4OPAA 3ILPB 4JFEB 1OPGL 4P30A 1P4LB 2ZNIA 2RDCA 3BX7C 4YIQB 4K0KB 4MD0A 5D7IB 4EB6A 4JPKL 3C60C 5BVJA 4FCAA 3L3OB 4IOIA 1PJWA 4YPJA 3BRGC 1I3VA 1MFNA 3LZOA 1KTDB 4O5LH 3VD2A 5INDA 4PJCF 5I6KA 1S0VA 4DW2L 2CU9A 4EIBA 2A6JB 1M1SA 1OB1B 1S5IH 4PGBA 3VCLB 2V5SA 4MRCA 4MTOA 1SVZA 4I89A 4FADA 2OLDA 1G1CA 1QLEL 3Q8EA 4IDLA 2YUZA 4IW4C 4N0CC 2UX6A 4R5TA 5DSCB 2BRQA 1NCTA 3LIZL 3M1BB 1OE2A 1TJIH 2ED7A 4DQOL 2QWOB 2CIIA 4HJJH 1YNTA 3BLPX 4NPYA 4M5ZL 1FFQA 2I07B 3T9WA 4RMWA 1RFDH 4KKBD 5ILTL 4LWSA 3ZHFA 2EH7H 2W8CA 4EEQA 5F72S 1WCQA 2QL1A 5E8NA 4QNPE 3D48R 1GGBL 1S3KH 4NO3B 3SJVA 1XIWC 3K46A 2YGOA 2ZCLH 5LP6C 4NO2A 1A32A 4FQCL 4AZ8A 1N34B 1ET8A 3VGFA 1VB9A 1Y6MR 5E6SB 3NJFA 5I66A 4LB8A 1BFSA 3IEAA 2OMZA 1U8IB 4LRNL 1PAMA 2IGFH 4OJEH 5BZDA 3QS2A 1X6LA 4NO0A 1FV1A 3FZUC 3HE6C 2VQ1B 3FKSG 3GHPA 4RGND 3HG2A 1IBMB 3GINA 1XIWA 3V9FA 3Q4HA 1XB3A 4X4MA 3WEAA 3WU2Z 1DSWA 1MLCA 2G5BB 1ZLEA 5GRZA 1V55C 3EGDB 2V3FA 3LSQA 3IJSA 1IEAA 4XNXH 2HN7B 5DHVA 1ZA3B 1FN4B 2HJLA 4OCXH 5C8JB 1ET7A 1MJUL 1MJ8L 3OAWA 3T3ME 3VWKD 1Q9OA 3D2TA 5GZNC 3OX8A 4KBPA 1BG1A 2H0EA 4G3YL 5LA6A 1RZ8B 1A4CA 4JPIB 3UMNA 2OTWB 4MHHI 4YDLB 2A73A 5I82A 4J9YB 1MI5A 3NRQA 1VZGA 3FN9A 1H3WM 2BP5M 1DGSA 1CDIA 1HC1A 4G8FA 4Y4FD 3O4OC 2JXMA 1JNNL 1D2PA 2ZWKA 3W57A 2VDNB 1QRND 1UA7A 1TVHB 1TKWB 2EIZA 4QTIL 5FS5A 2XNDG 1K5NA 1I1AA 1ES0B 3CVHH 4ZDHA 4H8HA 4XPBH 1CFTB 4JGJA 4MVRA 2KQMA 4NLHA 2NY6C 3OHXB 4PWHA 5DJ6B 1I31A 4BZ2H 1WUZA 5FKPB 3TEWA 3U4EA 3ES6B 1ZVSA 2LW7A 4XMPH 4PTUB 3N42F 1RAMA 1EBAA 2AJUH 4OZHE 1IL1B 15C8L 1B2WL 4GPVA 2B2XH 4BIOA 2NY3B 4XBEL 3ME0A 4JO5A 1MW1A 5D1ZA 2ZDIA 3E6FA 1BVLA 1VPOH 4DCQB 3HAEB 2DLIA 4P57A 1G9NH 4X5XA 5FO8B 1N8OE 5E9DB 1A6ZB 1AI7A 3WIHH 3DRQB 3Q8FA 5FM5M 3BVUA 3JWNG 2AJXL 2GFBB 2X4PA 4DV7O 3T3MF 2CGYA 3RI5K 2OI9B 2XWCA 3APFA 4QRTA 5DZJA 1LP9B 1WQVT 1XCTA 3NA9H 2Z4QB 1UT9A 3KR3H 3QNZA 1ZUQA 2W5PA 4QD2E 3KG2A 3L5XH 4ZTPH 2J6EA 3QWOB 5HY9B 2MKWA 3BQUB 5KHGA 1HT6A 1JVLA 1LE5B 5JHDB 3ZE1F 3E8UL 5CEZE 3WNJA 7TAAA 5HYSA 2OK0H 1TZIA 4MW8A 4I3SH 4A7GA 4Z6AT 1IRAY 3QRBA 2Y3AA 5C0BD 5E7FA 3RRQA 4QRPD 3MC0A 5CKGA 3MLUL 3EXAA 4CGTA 3QNYA 3NK4A 2WLYA 2BHZA 2GI0A 2RHEA 1K9MW 3TFKC 5C0EB 4Y9GA 3B7RL 5I1LA 5ELIA 2JEUA 4G9FE 1RJYB 4HXAH 4P46C 3L2LA 1O6SB 4JY4B 2HLEB 1W9XA 5MI0B 3CCJV 3I6SA 2ZXEB 4E9SA 4MMXB 5DHXB 4ZI7A 3CMGA 4OZHF 4I85A 4FLYA 1A6PA 2F95B 2BP0B 2FD6L 3E22B 4TS6A 2H32B 3P40A 3QDGD 4R2GC 1FYTD 3EKCA 1KP3A 3HC2A 1BXUA 1KIRB 1YTFB 1WIPA 3M7FB 4QRBA 4YR6B 5FEBA 3HBPA 2VDRH 3AREA 3INUL 4IKIA 3ZRFC 1ZDQA 2CH7A 2F5AH 1DR9A 2FX9H 1OE1A 5LMNO 4IU3A 4MAYC 5T1KA 1YMHA 3LDCA 2DPKA 2FE0A 2Z7WA 2EZ0C 1HQRB 5K93A 3KE0A 3VDCA 1R3JB 5KYWA 2F74A 5DJ8B 3OAZH 5IQ9B 3RX5A 3EZJB 5INCB 5E1AB 3TC9A 4IJ3C 1YN6B 1Q81W 4HX1B 5C0IA 4JI0O 4ZFZA 4ELKA 1XF5B 3MRNB 2HKHH 4PJDA 43C9A 2WTRA 3HI1B 3PP3K 3K71A 1OF2B 1W0VB 4BFNA 1VF5B 1AGDB 1G7IB 1RV6X 2JNZA 1UOVA 1REIA 3FB5B 4XE5B 1I7FA 5ADPL 3DV6A 4BKLB 3D07A 3G5VA 3GSNL 1YZZA 1EUTA 1G6RA 1LWRA 5H6RA 5DVKA 2RMKB 3BIKB 1B04A 3HKEA 3IK2A 4P2QA 1JHKH 3I02A 5C3TA 3SJVE 1F4MA 5D7JC 4I5BA 4GY4A 1G7HA 3JYBA 3UABA 1D5ZB 2A4ZA 4TNVF 3THOA 1QVFU 2YMOA 4BFIB 1FNLA 3DJRA 2NW3A 4Q9CA 1T5WA 2CA3A 4LLWA 2IJIA 2RQEA 3MJ8B 3TIDA 2B4CH 4G8IA 1I8KA 3M07A 5JZ7D 3CCLV 3ERXA 4FFYA 3BKML 1OP3H 4E9YA 3VXUB 3WJMB 3NESA 3BRDA 2WPGA 1TUEB 1DVZA 1I82A 1Z9PA 5DHYB 1F51A 2H3KA 2KDGA 3EH3B 4MQXC 2GBAA 4FQLL 3V5DA 4R26L 3NMEA 1IM9D 2NSQA 4S0SD 3GNMH 5HVHC 4B3MO 2NTFB 3C5ZA 3JD2A 4NRXB 4ADGA 3QQ4B 3UPRB 4WV1B 1RULL 3HG0A 3J80N 5E2VL 4B27A 3F5WA 1RUKL 2YAOA 2HT4C 2OJEB 1K8DB 4YPGB 1J8RA 4F7MB 4BRJA 1VFBA 4JFQA 2B77A 1MI5E 4DR5B 1J11A 1YNTF 4LESA 3VG9C 1AGCB 5ITBH 1EJ8A 1K4DC 4JN2A 3Q2WA 2VAAA 2MCPH 2ID5A 5DUBB 1GPOH 4EZLA 5H4YA 4ODBD 3MBXL 4UCUA 4IOFD 3OWEA 2VJ0A 4XP6H 3U0PA 3UFIA 3DX6A 1QFUL 3FT3A 2X70B 3TOPA 2NQDA 1H3PH 2DWEB 1J5EO 4JCMA 4ZFFB 4MMYA 4RSVA 2QDOA 3CZLA 4ZNCD 1LE9B 3HZKB 1MHCB 4LVOB 5CBEA 1S7TA 4P9PA 1ZVNA 2GK0B 4UDTA 4L2LA 2E6JA 4ZMTA 4Y2LA 4F7PA 2IU3A 4G59C 1RZKH 1E9PA 4NRYB 2MNWA 3WEBA 4PW9A 1HIML 3VFNA 4F93B 3C6LD 4LCIH 2DQTH 4WFGE 1WJZA 1T5XA 1BOYA 4ETYA 1MJ7H 3B9DA 1UB6B 3T09A 3V2AR 1JJUA 1FKAO 1NAMB 3W11D 1XBRA 1L6XA 4YGAB 3DXRA 3ZHSA 4TV9B 1BVZA 1CBVH 2PWDA 4YAQB 2O61A 1YRKA 4J3OH 35C8H 4ZW7A 5JUEL 2Q7HA 3QIUD 4I0PA 1MW2A 3T0BA 3AG1B 1U21A 1B88A 5AW9B 3BN9D 1A6WH 2WM0A 1IBLO 1HXYB 5BS0A 3TLRA 3HG1B 3MCKA 5B1BB 1JRHI 3MV7B 4UB0H 3B09A 2LHAA 3KHQA 5E9NA 1KQSU 2XC8A 1F1GA 1GOGA 3FAWA 3I6KB 3N91A 5FUCE 5GRJL 2Z8WC 4PRHA 4YSSA 1MW3A 3H42H 4HK3N 1T1YB 4N5UA 4R50A 1KENH 1V7MH 4JFZL 4Y89A 3KNBA 3ZDYE 4Z7QE 4E9VA 1JCVA 3NFNA 4FP8L 4OW6A 5FGCB 4KHPB 1F90H 1N5AB 4MAUH 3V4VB 5FA3B 2WXFA 3N5AA 1B4RA 5C0AB 1E6JH 3SKOB 1Q6HA 3T2QA 3OTFA 2XXGA 3MUJA 5GPRA 2YEZB 1TETH 4Y5YC 2HVKC 2BZ7A 1Q9KB 4M48L 3FN0H 3BSGA 2V37A 5KJRL 4MX7A 2XAJA 3MHHC 1BM3L 2JJVA 1BD2B 1PBYA 1CURA 4EUPG 2E9WA 3T4AB 4GX1A 4WKZB 1T1ZB 1VQ6V 3F7YC 1RP8A 3OWRA 2QZ5A 2OBGA 1PD3A 3DIDA 1JXJA 2TRYA 3LZFL 5CAYB 5B1AC 4M9OA 4IHOB 3CB2A 1I7RA 2OMYA 2R4RH 2R0ZH 5F2FA 1M4UA 1AHWC 1LYQA 4JZOB 5FFOA 2Q0ZX 3AACA 4PGCA 1FCGA 2FB4L 5LL6Y 2QDVA 2COQA 2L7QA 4K3DH 3MV8A 4PJ7B 2R2CA 1GTFA 4DW1A 2BINA 2NQ3A 3CGTA 1ZHNA 2CUMA 4JFDB 2A99A 3K6IA 4Q4EA 2A9DA 1KXHA 4J8QA 3RNKB 3IPFA 1YI2V 4ENZA 3VQXA 4G1EB 2GC4C 3BUQA 1KEGL 1IZJA 4X1YB 3FOLB 3DK0A 3H9SA 4PJDE 4FFVC 5CBGA 1VLXA 1WSST 2CO2A 2UYLB 5EU6E 1F1DA 5AVUB 3CZNA 3K5RA 2JJSC 3CC4V 2WXKA 4YDIL 5FHAL 2AEIT 5SX4H 1U3YA 4UBDC 4GKJB 4M8UA 1E8ZA 4YHPB 3R0NA 4Z7QF 3WJLC 3ZDYF 3FN3A 3O3BA 3HG3A 3O6FB 5D8JL 1ORSA 2AQNA 1UWGL 2DW4A 5GGRB 3H9HB 4G9FD 1FL6A 5J13C 5GRYA 3HNTL 5E95B 2MWCA 1GZQB 3OHMB 4OQTA 3LZLA 5D1XC 4HS8H 4J42A 4F6EA 3TCTA 4GMTH 2X2YA 5I1AB 4UQEA 1OOAA 1G43A 4I5SA 4PRIB 4OX9O 2WLHA 5GZOC 2P46B 3S3BB 4FXLA 5C09B 1NGXA 4KQ4H 3QJSB 3FB8C 2DYRC 3RU8H 2GJ6D 4CBCA 1AD9A 2JCCB 4K2UL 5DS2A 1H2GA 2F93B 1LK3L 1EAOA 3RTQA 2UY6A 1A3ZA 3KLKA 2Q6WB 4TSAH 3HRPA 1FAKT 2R2BB 4ABVA 1HX0A 1Y18B 1IXBA 3VFWA 3OXSA 5EUOA 1YJDC 2O5YL 1HTYA 4U3CA 5C7XL 3H4HA 5C0RL 3RIFF 4P5TB 3FB6B 4XN1A 1EXUB 4RCAA 4D0CB 3T1WA 4Z1VA 1UH4A 1QWHA 5ICXB 4HZLA 5EOCL 1UXMA 2MQ0A 2OMXA 2UZPA 2A74B 1QO3A 3KYOB 1OM3L 4F37F 4KY1H 2H9GB 4MD5B 4GW5B 4PJDF 1ZJBA 5E03A 1G9HA 5DI8A 1EFXA 5I2IA 1Z6JT 4JQIA 5JLZA 4TQEL 4ERSH 1HS6A 2ALAA 4OF0A 2Q7EA 4TUJB 5TFSL 2YPVA 1YMMB 3EJJX 1H6FA 4PVBA 5KW9H 5CWSA 3ZRXA 2GSIA 3QJQB 4RNRA 1HSAA 1ASOA 1P4IL 1Z5HA 4JG5A 5DJAB 3A6BL 3RVXC 3O11B 4PREB 3X17A 2ZKYA 3FFCB 3MZGB 5JXAL 3LXCA 3TBYB 3JWOC 4ZO7A 2PPFA 3WD5L 5PCYA 1AZZC 1F4YL 2QMJA 2FATH 3BPCA 4Q9BA 1T0PB 3UBGA 5L3GA 2R2HB 1OAUH 1F4XH 2UZXA 1TVDA 1KFAH 1JDCA 4NZTL 3ZJZA 2YXFA 1XDCA 4NO0D 1P6FA 3F64A 3TA3C 4MVOA 4O4JA 2Y7LA 4PLNC 1FXKA 3ZQ9A 4O4LA 2QADB 4D8OA 4A6YH 4GO9A 1JK8A 5DWUL 4XTRC 1FXHA 1ADQA 1GKEA 3SB3A 5IEKA 5FW7A 2XWDA 3I9IA 3SBWC 1WWBX 4O02A 2WANA 3ARVA 4JDTL 3R19A 4FE9A 4FXKA 1OF0A 5B1JA 4X4YB 4TMPA 4NKIL 1MUJB 3M99B 3AABA 4I9WE 4BA0A 1N18A 2IADA 5CCGE 2BJMH 3O6LL 2X4SA 4OKVB 5HHPB 2F18A 3TA3A 5DC4B 4DTGH 2OTPA 2ADFH 3IDMB 3DK2A 2YIBA 3FUFA 4QEGA 1EAQA 3IT8D 1YEFL 4LPXA 2Y23A 1IAIL 4ZXBB 3E38A 4G71B 5A2CA 4FXGC 2C1OB 5BS0E 1NSNL 3NRPA 4H8UA 1J1XL 5IK3B 1FZJA 1FNAA 4DW0A 3AEIA 4Z2WA 5DMGC 5TJWK 1WEJH 4U0RB 1CE6A 2QGBA 3MLYL 4PRHE 1G84A 5E4AA 3D0VB 2FH8A 3CCRV 2IAMC 4S1RL 4XNMA 4PCSA 5TE7L 2UUDH 1UD6A 1AGFB 5CGBA 4HBCL 5FB8B 5E99L 1ZK5A 4LMQI 2VM4A 1S7SB 4FI7A 4Z18A 5E2JA 3P32A 1R3IL 1GY2A 3ZUNC 4IBTA 3Q5YA 2ATPA 1DSFH 4P4KA 2GEQA 3KYMA 4HUKB 4K7PH 4ZTOL 4GG6B 5E1GA 1H9VA 1GY1A 4GO6B 4DGWC 2YJQA 4PWEA 2VW4A 1QLNA 1RURL 3NBNA 3QYCA 4X50A 1EEYA 2Z3YA 2GUOB 3OXRA 3FH8A 3TXSA 5D1ZD 5GXBB 1U8QB 5EDSA 4S0HA 2EX3A 4YJ2A 3CCEV 3BISA 3ARGB 4OZ4B 3QO7A 3MMEA 3DC6A 2WXJA 1HESA 4WUUE 4WFGD 3EXLA 2CR3A 1RK0A 1NGZB 1ZAUA 1RHHA 1AGBB 4X4XA 2X12A 4G6FD 4OGAC 3BZFA 2NYYD 3EO1A 3OD3A 1FH5L 3ML9A 3KCYA 5HD8D 3CUPB 2Y72A 1T2QH 3VFOA 1OLLA 2BNQA 4X4KA 3LQZA 4GSQA 3MV8E 4MJHA 4RO2A 3OLIA 4FLOA 2L04A 4UUJA 5DTFB 4BQBA 4MDIB 5BUGA 4MVSA 3T77A 3WAJA 1TLMA 4I18B 4XPHL 3OJDA 2H1PH 2L7EA 1ZVHA 3D9AH 3HZVB 2P8PB 3BH8B 3QUMA 4JJ5A 1JP5A 1I9IH 1YY8A 5FM4A 1UACL 2OTLV 3AMLA 3H9SE 5CUSL 5HHQA 4N2OA 3KL5A 4G9DB 3CXHK 3T08A 1RZGA 4JDEB 4M1DH 4FYQA 4OJCA 1IC5L 4Q89A 2HH0H 5AVZB 5DHDA 2VDQB 2YMTA 5CSZB 3OG6B 1F58H 4X1KA 2J7LA 5J4MA 1P7QA 1F6FB 2CGNA 4R8WH 4QGYA 7PAZA 1KJVB 1RP3B 3QUGA 4WU5B 1QR9A 5T1JA 1I8MA 4TKWA 4WEEA 3FCSA 5TDPB 1SQBH 4M8RA 4UQAA 1P7KA 1JHTB 1FO0H 4X64O 2X40A 3V0HA 1A9VA 4LP8A 1IARB 1HHJA 4M1CD 3RVUC 5KSAA 2VSMB 4G7YH 3RWGA 5IOPB 4BKSC 3L75H 1NPUA 1HWHB 2I9LA 3NIGE 1KY7A 4LVNB 2ZXWB 3RNQA 5IWAO 3S3JA 1M7XA 4QRQB 1X9QA 2Q6AA 3FQ4A 1VGEH 5EUOE 1P9MC 3S2CA 2HRHA 1NANH 2WOBA 4I1PA 2H2PC 4NZJA 1RIUH 3RWHB 1AO7D 3Q2NA 4EQ3A 3KWWB 3PWUB 4FOMA 2WY3B 4LLVB 3QG7H 4X99A 4WO4D 3O4LE 5DGRA 5EU6D 1NIFA 4OCYL 3VE0A 1S7QB 2IBZH 2CWRA 4ZFOA 5D5QA 1HDJA 2NXYB 4WSKA 3SGJC 2VDMB 3P3RA 3U46A 3IFOA 2JB6B 3GIZL 4FKKA 2AJZA 4XP5H 3P4NB 4NQXB 4POUB 1DVTA 3PWVA 2ZIOA 1MFDL 1X7SA 2F19H 3TK1A 4DUYB 3L6FA 3MRLB 3QXVA 1TIUA 4HIHA 5DRWB 5EG6C 2CLVA 3ARXA 2B1AH 1UT1A 3O8XB 5I5IA 2Z0BA 2ZE5A 2DM4A 4RZCB 5HFMA 5A2FA 3ETTA 4ZODA 4U7MA 4ZW8A 4YDVB 4MVBD 1MNNA 1NC4D 5CP7B 1KLFA 3TCUA 2W0FA 3DA0A 2MCAA 1FD9A 3PABA 3FSVA 4G7SB 1E6OL 4LCWD 3WUWA 3ZVVA 1CZ8L 1JNLH 3LH2L 2Q7NA 3NIGF 1ZT4B 3CWBH 4D9RD 4X80L 1K8IA 2PWEA 4KJWD 1NR7A 3ZZLA 2Z93B 3RWIB 4XDKA 3N50A 5TH2A 5C7ZA 2BOCA 3MV11 4HSAC 1FGVL 1O9ZA 4FPPA 3ZDZB 2HTKD 2Q86B 3D3QA 1ZT7A 4XNBA 1HYSC 3ABZA 2GJRA 2RD0A 2K3TA 2AHYA 1G1XB 3T0EA 2ROYA 4XWGL 4ZUTA 5D96B 1X5HA 3P9LB 4X9BA 2BS71 3FHAA 1DQML 4LF8B 4FM1A 3K5LA 1EJOH 3HZ3A 2BSDA 3JSSA 4AOFA 4EVNB 4YFEA 3GEWB 4UCRA 4J2QA 2HJKA 1AY1L 2CQVA 4EI5B 2ZUTA 3LKRB 4IRJA 5DUPL 3WFHA 4GKNB 1U92A 3NACL 3GI8L 1E1RG 2F1MA 3OPZH 1YC8A 5DRNA 4WF9V 1OP9A 1T80A 3FU7A 3KPQB 4KKRA 1JXDA 3HNVL 4XB3A 3UAFA 3W7UA 1S8DB 4M8QB 2YMXL 3CAFA 4PJBA 4OLUL 1MFEH 3FU8A 4DP9X 4LLQA 3GIVA 3WNNA 3OKYA 5GRXG 3OKEB 3P0VL 1PZAA 2Q2EB 1A4KA 1I8LA 1UFGA 3N40P 1JGLH 4JZNA 2XPGB 1XOUA 3WTXA 1NQBA 4UAOC 3VYOA 3MLSL 3N1PC 2ZONA 1W8EA 5BMFL 1YG9A 4JREB 1QNIA 1D6VH 1T0MB 2YKLL 4JO1H 5DD0L 1NGWA 4KI5F 3S5ZA 3WMSA 3JD0A 2ITDC 3JV5A 3ZT5A 2B1GA 1BBJA 4NWUH 1KBGL 3QEGL 4FLRA 5LQBH 1WAAA 3C75A 2MOQA 3DC5A 2IQ9H 4HVBA 3AFLA 1N0XL 5EC1B 3OKNA 5FYLD 43CAB 2DJVA 2AZ0A 1YQVL 2DQIL 2O6PA 4EI6B 4FFZA 4HAGA 3X1NA 3FSZA 3NEEA 3H56A 4I9WD 2OULB 1G5AA 4GI9A 4KKBC 2P52A 3DHMA 2J8UA 3SYCA 3QDME 3F6LA 3VWJB 4X6DA 1FORL 1JHLL 2BNQE 2OL3A 4N2GA 2DIBA 1MWAB 4W9HC 4XVTL 2OIGA 2R56H 3S98A 4JI8B 5I1HL 2CKNA 2ED9A 4GUOA 4NUGH 2Y69B 1CGSL 1WPXA 2XQ0A 1SM3L 1OT1A 2ZX5A 4YFLF 5EO0A 2ZSVA 2V2TB 1MELA 1BVOA 2R0KL 1WC7A 4KMLB 2ADJA 3CXFA 4Y19D 1XEDA 3TVMA 4HA1A 3DX8A 4NZUL 3OTTA 3N41F 3H7LA 1EH9A 2C9SA 4HQQL 3JCZA 4RGNC 5GW7A 1OSZA 5DA0B 4X7CC 5L0QB 3Q6GH 4AYSA 2VL5B 5AZEL 2JI2A 1BMWA 1CE1L 4TWKA 2W94A 4M3HA 3TH4T 3WELA 1JE6A 1PKQA 3EYSL 3FRPA 5JPMA 5HGAB 5KSBA 1I94B 2B3RA 1NBQA 5DC0A 4DR4O 5DN6G 3CZFB 4LCCA 1XGUA 4HJSA 5L4IA 4W9EC 5T8IA 4GKZB 5F0LB 1KZYA 4N28A 2BVQA 4TLSA 2LU7A 2IH9A 1PLAA 1RK1A 1SXNA 3C5SB 4WUUD 3PL6C 5CCKH 4JDZA 2KZ1B 4E42B 1D5MA 3KBHE 3QRFM 4TULL 3JT2A 1IUZA 1KIPB 5IT2H 3CRMA 1OCWL 3V4PA 3APCA 2QGNA 4LBEC 2AK4A 3QCUH 1F3JB 3TF7C 1FNGA 2F58H 3AQXA 2DMKA 3QJFB 1KB5B 2XRAH 3A23A 1HKFA 5JO5B 1ZXQA 2WZ6A 4FQ1H 3SY0B 3BKCL 4EZMA 1L0LH 2EIBA 4B9GA 4Z7AA 4FA6A 4F7CA 4UZGA 3ULVE 2J2ZB 3MUGA 5I1EH 4PV1C 1U8JB 8FABB 4IYHA 3HZYA 4H26B 3CH1B 1KXVA 4LVEA 4PJ9B 4A6YB 2J73A 5K9QI 1ZHBB 3QARA 2E74B 2Z9TA 4QTFA 4NQVA 2ZCHL 5GGVH 5IM7B 5ACLA 2Q0OC 4KNUA 4L1TA 1LEKA 2WUBL 5KA5A 3AG3B 4Z76A 2FEDD 1QUNB 1U8PA 3UAEA 3ARRA 3KEHA 3ETGA 4QGPA 1D5RA 4LLDB 3G6JB 4XNQA 2UU9B 5CJQH 3K57A 1PG7L 1AH1A 2A1WH 1UJ3C 1JPFB 4MCYA 4F9LA 2GDSA 2YPLB 1B4LA 4O4YH 2XYBA 3HKCA 1JD9A 4NC0B 2X4NB 4HJ1A 1MAML 4J8RB 4L4TA 3P3PA 4ZS7L 1S5LZ 2WLLB 1ZWIC 3FXIC 1GGYA 2WJ7A 4GEIA 3UEQA 3ZDXB 4AM0Q 2UZIH 4N2CA 1MCQA 2P49B 5D70L 3CFKB 2N7SA 4R7NA 5CD3B 1ZVYA 1RLBA 2OMTB 3UBXB 3HMWH 4X8GA 1HQ4B 4AVIA 4J7KA 1PU0A 1UJ3A 4XPGH 1A1OB 3QUZB 5HGBB 1Q0YL 3WDHA 5B1KA 3HC4L 4PCKA 4FQ2L 4JPSA 1NEZB 1QNZL 4P3DA 1IDSA 3UTPD 4LF7B 4XNDA 3F7VB 4HHGA 3T0EE 4X20B 3E83A 3TN0B 2DMXA 3U2SA 1W59A 3ULVF 4ES9A 1QQDB 2M83A 2CUGA 5HYJA 1U97A 1R73A 2P67A 2FWOB 2NN4A 3O4LD 1RM1B 3V6OC 2R15A 5CBHA 5C0FA 4GAYB 2P24A 4H20L 4IK7A 2ZCEA 1W72B 5AYUH 5IJ9B 3UYRL 2P06A 1EFQA 2Y5QA 2Y7MA 1CXKA 2UXTA 3JTSA 3BD4A 4PJEA 1NTMH 2VH5L 3IGAC 3PHQA 2P48B 2OJZL 4PJBE 3DHPA 4X6CA 5EOTA 1O9VA 3FTUA 2V1DA 2YDEA 1XMOO 3CRAA 4X5WA 3ZTNH 4Q0XL 1HZHL 2NXZD 2GBOA 1AJQA 1IJ9A 1O7DC 4C56A 4ZFGH 1Y67A 3SJCC 4AQOA 3FU6A 2FJHA 3L7EA 4H2AA 1XILA 3VFTB 3CRRA 3UZQA 3V5KB 1TO5A 4YC2B 3KXFA 1AD0B 4NC1E 2QQQA 2UUAO 3L45A 3S5LB 4KI5D 1MHEA 4OTXL 4GW1A 2HLAB 4HP5A 2ICWA 4OVUA 4JVUA 1WAAE 2YUVA 3LZPA 3G5YA 5F7HA 3PDOA 1MQKL 1KNOB 1M57C 5EYPB 3P3NA 1QWNA 1KCRH 4YSDA 1KYDA 1V10A 5AW7B 4WW1A 3S36L 1DO6A 2ZXGA 3FCTA 1FYHB 1NCWL 3VXPA 4BE5A 3H9ZA 3PUCA 3PFQA 3CZEA 1XB8A 2D31B 2J8UE 3CIQA 1MVUA 4L5FL 1FO0B 3D39D 4JKWA 4X6DE 3DVNA 4I48A 4ZUVA 3KLQA 4OFYD 3STZA 1AI4A 4GUPB 4RA3A 3QZWB 1AFVL 3VG0H 3KMDA 2EDOA 2XIBA 3UCQA 1DDHB 1IAOA 3GZQA 4OQTL 4M6ML 2PYFB 4RRPA 1RPRA 3TBCA 3VW3H 4OD3H 4ZFQA 3SDYH 3L5JA 1Z9SB 1JZJA 2DIEA 5BZBA 2F54B 5D4HA 4DR3O 2Z7UA 2VC2H 3WLWD 2WD0A 5J2TB 3HE7D 4I50A 5IGXL 3V8CA 5DJ2A 4PJBF 1NFIB 5JZ7C 2ZD0A 3CFNA 5JH7B 1ZGLA 4M29A 4TUOB 5DMIH 1D5XB 4K8RL 3ROOB 3TT3H 3EYOA 4D0BB 4R4BA 4LSQH 2W81C 2XBDA 3UDWA 5MHSD 2P80D 2CKBB 4AYID 1RFYA 1AXIB 2X09A 2Z31D 1AVAA 3AWGA 3FB7B 4DHLA 3RWRD 3VUAA 5JJNB 1IBGH 3WN5A 2BP3A 5ERWB 3B3IB 4F58H 2DQUL 5KSBE 2EIKC 3BCCH 2WKGA 3MLVH 1JSYA 1JXGA 1XZ0A 1XSIA 4MNHB 2YXWA 4ZYKA 3O41A 1WAAF 1PDKA 1M3IA 1OW0A 3GUTA 4IBWA 1AJPA 2GUZA 2AVGA 4RFEB 4ZJ9A 4C55A 5A2KH 3K4AA 3QUYA 1RZFL 1X4ZA 4DWHA 2E47A 2XWTB 4WLCA 3TT1L 3WY1A 4JQIL 1HHHA 4M93B 4YFDB 1Z3RA 2P5PA 3CZUB 2JIXA 2YPVL 3MJ7B 4NC2B 1E30A 5GS3A 2OZ4A 4OIIH 3BSZL 3I2CH 2WLJA 3QCVL 4N2FA 4WCYL 5JPNB 4CGUB 2J8UF 4RVBA 4MSWC 3QDMD 2OYPA 4E5XA 5LGNA 2WNXA 2BNQD 2GK2A 4R97B 4WI4A 1CK0H 1M7IB 4IOFC 1EEUA 5DM6V 4X9YA 1KMGA 2HFGL 4YVUA 2UZYB 3BSHA 3DARA 3G9AB 4JO8A 3QWNA 4FL4C 2EH8H 4UIKL 2K4AA 1NDMA 2P5EB 4HOXA 1K33A 4Y1AB 3FUDA 2PPEA 2YQ2A 3BGMB 4EEEA 2Q20A 1N0JA 3NJVA 3SBRA 3UTSA 1GCFA 2QKSA 4BFRA 4JI7O 1A1NB 3CHXA 3SGEH 4U3SB 3WNOA 1PZ5B 1EERB 1EZVY 3SO3B 1P7QD 5LOVA 1A8ZA 3LDEA 3BJ91 1CICB 3JWOL 3C6LC 4JR9H 2CK0H 4OZFG 2NLJC 1ADQL 1HZLA 1U96A 5FKAA 5ICYB 1X3DA 3QDJD 5D6DA 2EDEA 5SV4A 3ZR6A 1PNKA 5BO1L 3W11C 3RDTA 1CR9H 4AVKA 2VE6B 4OF5A 1Q43A 2F8OA 3QH3B 4P59L 4FQJL 4WRLA 4XCNB 3BD5A 4K5LA 4OD2B 2ODHA 5KANG 4XPFL 4L4TE 4XO3A 3QIUC 5J9PA 1HEZB 4M7KH 3HBZA 2F4VO 2OMVB 3BN9C 4WW2B 3GKWH 2P6JA 4XVJL 4XMLH 3UGUA 2FIKA 2P5WB 3MTRA 3QA3A 3S3PA 2NLJA 3EOTL 1GM9A 4HFWB 5CFAA 5I0DA 4HV8A 1J5CA 3GKZA 4JRFA 3DV4A 2FGWH 3LPWA 3H2PA 2ADIA 4TNVK 1CDJA 3RUGF 2DN7A 1E5BA 1ILSA 4C7UA 3ULVD 3GMPA 4AV0A 3X12B 2EIJC 3G3LA 4CMMA 1FHNA 1I7UA 5HYJE 1T04B 1A3QA 3PWPA 3WFZA 5EK0A 3MUUA 5FM8A 3UO1H 1LO0L 1P1VA 4JF3A 2BOBC 5C8YA 3U25A 3MA7A 4KUCF 4OM0H 4PJEE 4QNHB 5DEFB 1FUNA 4U05A 1A7QL 3T2MA 5GGQL 3N2GB 4Z3HA 5E5MB 1TNMA 2DEXX 4KFZC 4PG2C 4X6CE 5HHVL 5EBWC 4WFEA 1T0NB 3JUZA 3NCEB 3P4MA 1EDQA 1ESOA 2WBWB 3L7FA 3K2MC 4MTMA 2OR7A 3ZEDA 4NYLB 2HLFD 2X42A 4C56E 1LM8V 5K9OA 3D4GA 3L95B 2QQKL 2K4WA 4M56A 4RGMB 1AQDA 1S9XA 1MHPL 3KXFE 4YSRA 2HRPH 3DECA 1CT8A 4ZG1A 2J3SA 1P2CA 4KKQA 4NIKB 4R90L 4EN3C 3BPNC 4M02A 1TCRB 4FULA 2VDLL 5DJDA 5FYKH 2R9RB 2AJ3B 2G9HA 4KTEL 3O65A 2RH0A 3GJFB 5E2UH 5AQ0A 2ZQKA 3UG4A 1QACA 1BYOA 1MVFA 4HIJA 4HKBA 3I9PA 5EHFA 4JO4H 3WNLA 1KCVH 2CZNA 3K2UH 3IB4A 1JZ7A 1U3HD 1AIFA 1Y0LA 4B3MB 3KZIZ 5TGBB 3QFJB 3KDMA 2GT9B 4PCYA 4I4TA 1VQ9V 3WUWG 4DO5A 1P7GA 2X4OB 1GS6X 3K79A 1OQXA 4XRCB 3GTTA 4MA8H 1YN7A 2I9TA 4JFSA 1MFUA 4AMWA 5CGYD 1DTUA 5D5MA 4OLEA 1ZLVK 3NAAH 3TYFA 4PB0H 4X89A 4NP4L 4X6CF 4DT2A 2EJ1A 2ETWA 4KK9D 4X5RA 4PLJD 4WJ5A 5KZCB 4ONFL 5GRUL 5F89B 1TJMA 2AV1A 1ZLSL 3PWNA 4AK2A 3VGBA 3RL2A 3FUJA 4N8UA 4MD4B 4RX4A 3MRIB 1DJZA 5BPPA 4ZPVA 5L8JB 3POHA 2F43G 1YHPA 3KW7A 3NP4A 5SX5K 3W9DB 4AH2A 1ZE3C 2A9MH 5D2NB 1UB5B 1E3ZA 3BKYH 1TEYA 1X5IA 5FUZH 4OZGB 1BX2B 3LS4H 5T1LA 4BFOA 4PJ5B 3PWLA 5TISZ 2ADPA 4J1UA 2QFRA 3DVGB 4FQXD 3VDBA 2EAEA 5JHLH 2GKIA 4ZFOL 2FSDA 3U0WH 3CN2A 1KBHA 1MCEA 1N7MH 3E8BA 1Z5YD 2MPVA 2N1KA 2AVFA 2AKRA 3D25A 3BVTA 2A6IA 3O2DA 4NLAA 4QWWD 5KVEE 2BVTA 5CIPH 4DR7O 2JKRM 1G4YB 5I76B 3CFMA 3I3EA 1BDYA 4OZIA 3L54A 1L6PA 1GYAA 3GMQA 2V2WB 1U8KA 2CR6A 5G4NA 5IMOA 1C12A 2C1PB 2JK5A 4ONGH 1JFHA 1G7QB 4FK5C 3QAZB 2P8LA 3BVWA 4ZAKB 4XO4A 3V4LA 5HDQL 1UASA 4CW1A 2NDGA 1DF4A 4JANB 3TS8A 1IBLB 3OR6B 4HC1A 1L9PA 4JY6B 4FYTA 3UTSE 2XIIA 2RQ6A 4U1MA 4XOCA 3D08A 3UP1A 4JPWH 1NCAH 2CO7B 1LO3L 3UYPA 4HCGA 1Q1JL 3LS5H 4OLWH 5AAWA 4D7TA 3BAIA 4DGVH 1FJ1A 3NCBB 3S35H 2IMNA 4PD4K 4W4NA 3SHSA 3W5NA 4ODWA 4NZDA 3QRGL 3S8WA 1DQLH 4BH8B 4JZJB 2ARJQ 5KYXA 1PZUB 4JQXA 5FLXN 4A04A 4JCLA 3VJ6B 1NDTA 4WI5A 2X9YA 3NH7H 3OE7G 5IYZB 4HLZH 5FCUL 2LTQC 1P4UA 3B43A 4Y0GA 2P42B 5FLUA 2Y7SA 1ET5A 4RWYL 3TURA 1KC5H 2PUQT 4AC4A 2JS5A 4HIEB 3C9NA 4PDMA 3NUKA 4N2DA 4JRYA 4LQFH 4MNGA 2FSEA 1FWXA 1VFAA 4UV7H 3ISYA 4M62L 1Y1UA 4B9PA 1EVUA 4A2DA 3LB6D 2GAZA 3CSXA 2VSKB 5EBLC 4JKNA 5D71H 1GKOA 1U8LA 3OR7A 4D7SA 3GXNA 4K7PX 3BUBA 4IKJA 4E41B 1KCWA 3QEUB 3O6MH 2IFGA 4BXSV 2PW1B 3H3PL 4UIMA 4FAAB 4JK0D 5D4JA 2DRUA 3C08H 3UBFA 2BFGA 2DQEL 3FRPG 3V0WL 1J8KA 3S48A 2FQGA 4R5XA 2C9PA 3AB0B 3OL2A 3HB3C 2WBJB 3BRCA 3CD6V 2PO6A 4GG8B 3PWPE 4M7LL 5ESQA 2YBGA 2Y36H 1DLFL 4LP4A 1IGTB 4UNUA 1Y07A 5L8KB 5AB0A 3KGRA 1Y4MA 2Z65C 3UTQA 1OV8A 3KL0A 3ARDA 4KH2A 3IDIA 4NQQA 1RJLB 4QOKA 5I19H 4JRXD 4PSPA 5K1NA 1J1PL 4LXFA 3MOAL 2Z64C 2F53A 3DJ9A 4DUXA 1HOCB 4WFEE 5DJ0B 4NQDB 2YWZA 2D9CA 4F3FA 3UP6A 2FB5A 4PJFA 1GYVA 1I8UA 5C2UB 4D8PA 5C9JB 1KGWA 5LXGL 5IG7B 2NYYC 3HI5H 3EFOA 4U1SB 5FYJH 5AUMB 1AR1D 1N2RA 3L5WB 5HD8C 3P3YA 5LNEA 1VA9A 3NG5A 4KXZH 2NNXA 4JFFA 2VC2B 1FSKB 2VLKA 2OL3L 4RMVA 4OX9B 5I15L 4IRZH 1GGUA 2BS9A 4AGLA 4P9ML 2DYPB 3LD8B 1YEKL 5JNYB 3OLDA 5EFIA 2APSA 3WDJA 2XZCH 3BEWB 1WA8A 1H8EG 3IFXA 1LO5B 3DO3A 4K15A 3RX9A 2V3EA 2E7HA 3FCGA 3GZOA 3CVIH 4EO5A 4DV0O 3FONB 3DRTB 5EC2C 5LGYA 4Q9QH 3K3WA 2F0CA 1F6AA 3MRBA 1TYRA 4GKOA 5DJYA 5C0DB 5HYJD 3O9WC 5L3BA 3RL1A 3CQFA 1IT9L 3BUPA 3EOAA 2Y0SA 3MLRL 4LASL 4R6UA 4WWNA 2BCMA 3DGGA 3UTOA 3T0WA 1EAJA 1A6AA 5C2BL 5D5ME 2LVEA 4X66B 1VQ5V 2WN3A 1AC6A 1S7UB 2Y06L 3OMNB 3FO1A 5F7EH 1DBJL 2H8PA 4HAKA 3GYRA 2W9EH 4FKHA 3M7OA 4IM8A 1J05B 1P53A 2X1QA 5EA0L 3T2NH 1BYNA 4YDNA 3MLXL 5I8OL 3AQDA 2FJSA 4BSWA 1JERA 2HFEA 2P47B 3GJEB 1Q5OA 3E3QE 3LH9A 2V7HB 3QQ9D 3V4PL 5GS1A 1PD0A 2O26U 3D18A 4PPTA 4GYBA 4RWHA 1CXIA 5JJEB 4L8SA 3QEHB 4YJZL 4LSUH 4PIRF 5AB2A 1KIQB 4ZSOB 3NDYE 3T71A 1OZTG 1J12A 1NINA 4L8DB 4LGSB 5CM1A 2YEVA 5DJZA 3KWTA 5BOJA 2C3HA 4XT1C 3GXUB 2R9AA 3X14A 1MCWM 2JSFA 1AZRA 4WO4C 2R23B 2AK1H 2YXHA 3SPIA 1XGYH 4FNQA 1C08A 1WA1X 4O2BB 1KBWA 4JM2D 3MRCA 3C60B 2Q3ZA 4WBNB 2A6KA 2QQNH 3HFMH 2HTLC 3IXTB 4LSTH 3QULA 4ONHB 3FK3A 3QORA 3SCMD 2YFNA 2PCPA 3MHZA 3ZL4L 3M17A 2AW9A 2DQHL 4CN4A 1X5GA 2BNUB 1EO8L 1GJWA 2F5BL 5CFHA 2ZOKA 5IJDC 4JHUA 3ZR5A 1ONQA 5F0PB 4FTVD 3AG4C 4HSQA 1I9RL 1RKRA 4Z7NB 2HRLA 5EPMA 3U1QA 4OZIE 3EBHA 4Z7VA 2GQHA 4XDLA 2IDFA 1J5HA 3LN9A 2HT2D 3BUTA 1ZDSA 3GS4A 3IAQA 4MVBC 4YHZL 3CCQV 5J57B 4Z7WA 4Y4HA 3L4VA 5IQ7H 5D5MF 3IFLH 2WN2A 2IPTL 5F1SA 3SE9H 5D1QA 3G08A 1LL1A 3Q2VA 2HKFL 3MGTA 5GSRB 3LYRA 4TSCL 1TQCB 2AS5M 3W0WE 2C9AA 3T2PA 3VM5A 4URTB 3MX0B 1CC3A 3MNMA 3E8FA 4KJWC 3TASA 2YRBA 2DQGH 3DUSA 2QEXV 2HR3A 2CMRL 3EF4A 3Q01A 5LP6B 3GSOA 2HTKC 2FEJA 2X7LB 2R4SH 4HETA 5DS1A 3NJKA 4U6YA 3F7KA 3TJHD 1NGPL 2G4GA 4NGHL 5DT1H 2YHGA 2UXGA 2DJMA 3F7PC 2WQAA 4Y4KD 3SKUD 4KTDL 3HKDB 1CGVA 2YBRA 3HE6B 4AT6A 5TF1H 4L4VD 2YQGA 1KTLB 1DVXA 1IEBA 1XV8A 3QUYD 4MNGE 1TPXC 2VO5A 5JOPD 5FGSA 3NSYA 2FX7H 3CXDH 1V55B 3PV6A 4X0KA 1MHHB 3PAYA 3VI4A 2VXVL 1MRFL 2GTWA 4A2GA 3Q6FB 4HFUH 4GI8A 5B3NA 4Q8BA 1HH6B 2EDFA 4LNUB 4DPAX 2ZXQA 3DTXB 3QI9C 4MNQA 2EYRA 5K39B 1UKTA 4GJTB 1B4JH 4M6AA 5DA4A 4ANXA 4JL1A 1D9KA 2WINB 3KLHD 4YSAA 3RBZA 4HPYH 3VD3A 2JI3A 3TBTB 1TVKB 3FOMB 5I6LA 1WGOA 2GV9A 4U6HB 1RVFL 5B38B 5HVFB 1IC0A 1RD6A 5EU4A 2UXVA 3O4OB 1DJHA 1FNSH 2CBOA 4QOKE 1W80A 1UXSA 4KXAA 3SN6N 2VIRB 2YUAA 4FMVA 2ZUUA 3QI9A 2ATKA 5DK2B 5TDNB 4CKVX 4GUQA 2F53E 4UTAA 4E5XG 2OIEA 1YJDH 2J8OA 2NY6B 3D51A 4PJFE 4PRNA 4YO0A 5C08A 5IMMB 1A7RL 2G75A 1SY6A 4QCIB 3P3UA 3A67H 1OAZL 2IWEA 4AENA 2VKWA 4WGKA 4KPHH 3K06A 3OTOO 2ZWYA 3IFNH 1Z3GH 4Y1TA 1ACCA 4UOW1 1D3CA 3FH5A 3REVA 4LPTA 2Y2YA 4JGUA 1J87A 4JAMB 2K1MA 4JFFE 3DX1A 4LIQE 4GRMB 3TO2B 4EF3A 2VLKE 1N0NA 1SETA 4U6TA 3OQRA 1LEIA 3APOA 2HB0A 3PS6A 3NIDB 3P11L 5F8RC 3JALB 5B1OA 1ZS8B 1SOQA 4PRPD 1C5CH 1RI8A 1NBYB 1AZVA 4M6NL 5IY5C 4HOZA 2X0UA 2ZP9A 4G8EA 1Q3EA 2YI8A 5DUMH 5E51A 4JS7A 2JGDB 3JASA 3QIBD 4KXCA 5HP5A 3AQYA 2W92A 4MZ2A 1UADC 4ZOAA 3FD9A 5IESL 3MCYA 2E4TA 3AW5A 2WLNA 3O45A 1UEYA 5B8CC 1TOXA 1SFDA 3PWPD 2AEPH 4P2ZA 3GZKA 3AXHA 1WAZA 1BQKA 1W2KT 3N44B 2CIKA 1Z5WA 4PDLA 4M7LT 2DWDC 4NB7A 4RIRA 1I5XA 1ZTXH 1A47A 1IGIL 2R0WH 3LY6A 3N9GH 4NKDB 1FAIH 1MPAH 2ZXCA 1U30A 5ANMB 1EX0A 1LQSR 3IJ4A 3MJ9H 1QFWH 2E9BA 4WFED 1OVZA 4EN2A 3GSRB 4NB5A 4GRWE 1SKVA 5CIPB 3P30A 5B8CA 4HIXH 4P46B 3HUJB 4KJYB 5AYQA 2GI7A 1JFQH 1A14L 1AKJD 2YK1H 3DJTA 4XMUA 2HHHB 3T0XA 5CR8A 4YY3O 3VQYA 4J23A 4P3CL 4R2GB 5KVEL 1K73W 1JZ5A 4X9IA 1G0XA 3QYMA 1EEZA 2AQ3A 4LGPB 5SWSB 5IE9A 4PWJA 1PZBA 1D7FA 3RWCB 5IB2A 1MCCA 3K4ZA 1UUNA 3L4ZA 5E8EA 1MREL 4U1LB 1UVQA 1X4TA 5AG2A 1JGVL 1I1YB 1ND0A 3GSWB 5HPOA 5K5YA 2Z6FA 1BQ5A 2R2EB 4AEIH 4YN3A 4JI6O 1QSED 4KVPA 5SWQA 1K3ZA 5CEXA 1IU1A 4EOWH 4DAGL 4MAYB 3BZEA 4XGZA 3FUMA 4ANVA 3KPTA 1KJ2H 4F1SA 2MCMA 3BUDA 4PGJA 3ZGIA 2VT0A 3HC3L 2FO8A 2FEDC 4XCEB 1CLOL 2AP2A 2ZAIA 1NMBH 1M2OA 3EDKA 3LKQA 2BFVL 3DSNB 1DL7H 4RA0C 4QLRA 5C0GB 3U48A 4PDVA 4IJ3B 2VMCA 1D7CA 3KJ6L 4Q20A 1JAEA 1M1XA 3GO1H 5D9SA 4Z7VE 3WKPA 4G6KH 5E2WL 1DZBA 1W8NA 2QV4A 4ODXB 3P54A 3RWJA 2A5UA 4Z7WE 4K4KA 1DTOA 1JV5A 4FKEA 5KBMA 5D1QE 2VRQA 3B7TA 1DVUA 4RMRA 2IU0A 4CH3A 3UT5B 4WNSA 5IBUG 5C6TL 2CJSA 3N55A 4PJ0Z 4GRWF 2HSIA 1EXHA 5D7LB 2GCYA 2C3WA 4JO3L 3SDDA 1H3VA 1ZTEA 1GYUA 4ZZFA 5K1JA 1C5DA 4HD9A 5D7JB 4KK8C 4KNSA 2Y7OA 3GK8H 4J4PA 3IMUA 5M95B 3ULUF 3MLZH 1IM3B 4CNIA 2NNUA 2GITA 3RJDA 1L0YA 2FO4B 5TE6H 3ZZ1A 2WW8A 3W7TA 5DLML 4DV6O 5J1AB 4M3KB 5BMVB 1NOLA 2Q8AL 4MHHG 3BH9B 3IETA 2NSXA 5CJOL 4WI2A 5KOMC 4Z5RA 1PX3A 2I7SA 2ZG2A 4EDWH 4L8JA 3L2NA 1ZOXA 4RMTA 1NVPB 2WV3A 3KHOA 1NGYB 3MXVL 5L2KA 4KOCA 1HCYA 2CM6A 2LFGA 3VI4E 4PSRA 1NMAL 4P2RA 4C58B 2Y07L 1LXMA 2ESVA 5EZLA 5I1GH 1OWWA 3Q2CA 4MNQE 5DR5L 4MLSA 4DK5A 5KBNC 2QPFA 1M6OB 4Z7VF 2NXZC 5FFLA 3O0RL 1S9VB 4GKSA 4NUJA 1UWXH 4EXPX 3UEZA 1WCBA 3X11A 2X87A 2A7BA 2COVD 2OV0A 2VRKA 3VG9B 3JD1A 5FHBH 4L8BB 2G2RB 3Q9QA 4U6XB 1K4DB 2JELL 2QSVA 1ASPA 3ILPA 1P4LA 4JFEA 1OPGH 2O5ZH 2XA8H 4KI5C 4YIQA 5DCCA 1AANA 5B4MD 2WLIB 1XEUA 2IWKA 5D7IA 3W0WD 4JPKH 2XPZA 1DJYA 2EDDA 5AVSB 1VAHA 3L3OA 2QTOA 1XF4B 4S0TD 3I74A 1BFVL 1KTDA 4PJAF 3RY6A 4QXUL 2FBOJ 4B95C 4ATTA 4RFOH 4X98B 1G0YR 1NH2B 1OB1A 3FQUB 3QHZL 4XNAA 3VCLA 2XAHA 3WDIA 5L6YL 1Q0XH 3ZRWB 1FE8H 2Z7ZA 3MXWL 2PYEB 2ZUYA 1QLEH 2AANA 4YZWA 5F0JB 1QYGH 2A3TA 5DSCA 2XCMC 3BE1H 1DLBA 3IRPX 4JB9H 3M1BA 4ZX5A 12E8L 2AEQH 3LSOB 3SDCD 4L3CB 5FUOL 1OAKH 3L1GA 5B7FA 1CMOA 3MVSA 5KAQG 3IMSA 2I07A 3Q8BA 5AVTB 4HCRA 5ILTH 1AP5A 3ASWA 3VI4F 3WLWC 3HE7C 4HWZB 4PYGA 3TBBA 3LDBC 2BWQA 2BSSB 1JZDC 1GGBH 3DI3B 4FZEL 4NO3A 5IEHB 1KJMB 3U4AA 2IXQB 4DZ8B 1QW9A 2DMGA 2ISDA 4JMNA 3ETQA 2X44D 3VU1A 1VQ8V 1KV3A 1MZZA 1NOAA 3GBLA 1H2LA 1DZ0A 2PR4H 3FQXB 3L3JB 4GNKB 5F88B 3OLGA 1U8IA 1XUQA 2YRLA 3OKKB 5EF3A 2Z31C 1LO4L 5AG8A 1CYXA 2QEJA 2VLME 3NGBC 5JHAA 1F11B 5IUCA 2VQ1A 2AFNA 2VNCA 2QR4A 1DQJB 7FABH 1MFAL 4IHJB 2WZ0A 1IE4A 1G9MH 5T33H 3B8MA 4X2UA 3I9GH 5GGTA 2G5BA 2WZPA 3RVVC 1OHHG 3EGDA 5HHME 1AAJA 2HN7A 2AZUA 1FN4A 4BW5A 1ZA3A 2Y24A 5K1PA 1T66D 5C8JA 4OF8A 4Z3FA 5E8DH 1H0DB 5EUKB 3VQVA 4Y5YB 4LGRB 4JYAB 2HVKB 4J3WA 2K9UA 1RZ8A 1KTRL 2W0LA 2HX8A 3O2DL 4JPIA 4MJIB 3HVDA 2OTWA 3U7YH 4PH8A 4P23C 5LN4A 1I9JL 5LDSA 4QGTA 3UJJH 1GRJA 4LHUD 4KZ0A 4BBWA 2EINB 3TTSA 3F7YB 4PA6A 2E9GA 4E9LA 2H4EA 4CC6A 4CS3A 2OCFD 3A0RA 1TVHA 5B1AB 1TKWA 1FG9C 1FVDB 3F6IA 1I85A 3IKKA 4PYHA 5T1DH 3FQWB 4YWGH 1MCLA 2P26A 1ES0A 5TTRA 1AHWB 2D8KA 2YAEA 3M8OL 1CFTA 1JUFB 2DN9A 3KPLB 3OHXA 2EZPA 1QSVA 2EEBA 5DJ6A 3P77B 3ZTJG 4PGZA 3HHRB 2BC4B 5FKPA 4NBXB 2DWXA 3ES6A 3LX9A 1WPCA 2NYKA 4PTUA 5M94B 1SF9A 2E86A 1IL1A 2OI9C 2AJSL 15C8H 1B2WH 4F7KA 1YEEH 1VF6A 4BWAA 4TPRH 2X1PA 3ZL2A 5CGTA 2R8SL 4DCQA 3HAEA 5E08H 3MAQA 5FO8A 4BIUA 5E9DA 1A6ZA 3NTCH 3R1GL 1AI5A 1IGFL 3HBGA 2QSCH 5TE4H 2GFBA 3FO0H 3HI6H 5LGHL 3LSSA 2NCMA 5KOVC 1SQPH 1IAKB 4ZD3H 1ROWA 3JV6B 4I1RA 5LBGA 5J13B 1BCCH