3SPHA

Inward rectifier potassium channel kir2.2 i223l mutant in complex with pip2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
total genus 89
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3sphA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3sphA01
1XL4A 4PA9A 4QNHB 5BZBA 2DWEC 2WLNA 4LBEC 3SPIA 4JTDB 3AG3C 4CBCA 1V55C 3SJQC 3AUWB 5KUMA 4WFGA 2Q69A 3ASNC 3FB6C 4P2ZA 3SYOA 1G4YB 4GX5A 2BOBC 3SPGA 1R3KC 2Y69C 1KKDA 3AT9A 1P7BA 3ASOC 4XDLA 4XDJA 3ATFA 2EIMC 4BW5A 1JVMA 1U4FA 2X6BA 4PA6A 2GIXA 2EILC 1QLEC 4G28B 4P9PA 4HYOA 5EBMC 3KG2A 1U4EA 4WFFA 5J9PC 3OUFA 2X6CA 4MTFA 3SYQA 2P7TC 2YEVA 4EKWA 1K4DC 3UKMA 3SPJA 3AG2C 2QTOA 4MVZA 3T4ZA 4MVUA 3ZRSA 2Q6AA 2A0LA 2HJFC 4MW8A 5EBWC 2WLJA 3HPLC 3F5WC 2QKSA 2Q67A 3LUTB 2ATKC 2DWDC 5EC2C 3RVYA 4QE9A 2X6AA 3AT8A 3T4DA 3F7YC 3OR7C 4HZ3A 4R7CA 1M57C 2ZD9A 4XDKA 4MVOA 5EC1C 2WLHA 5EBLC 3SPCA 3X2QC 3VSQA 2Q68A 3IFXA 3RW0A 3ATEA 3PJSK 4WFHA 4J9ZB 4H37A 3R65A 4JTCB 4PA7A 3ATAA 2AHYA 3FB7C 4P9OA 2WLLA 2BOCC 4LCUC 3F7VC 3K6NA 5E1AC 4MVRA 3BEHA 3ABMC 3UM7A 3FB8C 1BL8A 1J95A 1OCCC 2HVKC 4PDVA 3TETA 4R6ZA 1M56C 3E8GA 3IGAC 4QE7A 3LDEA 2ZXWC 4X8AA 3AGWA 3ABKC 2W0FC 3AG1C 4MSWC 4MVMA 3K06A 3T1CA 3OUSA 1R3LC 5KUKA 4MTGA 5CBGA 2EINC 2HVJC 4JTAB 3RBZA 4PDMA 3SPHA 4MW3A 4PA4A 4RUEA 3K08A 4LP8A 5B1BC 3TCUA 2IH3C 4UUJC 3ATDA 2EIJC 4RUFA 3GB7C 3STZC 2JK5C 3K03A 4MTOA 4R8CA 5CBFA 2DYSC 1S5HC 3VOUA 2NLJC 4X88A 4P30A 3WG7C 5B3SC 2ITDC 3FB5C 4R50A 2IH1C 5EK0A 4GX0A 3E8BA 3ABLC 3SYAA 2WLIA 3EFFK 2R9RB 4J9YB 3E83A 1XL6A 4WFEA 4KFMA 3LNMB 3JYCA 1ZWIC 4X89A 3RVZA 3E89A 4RAIA 3E86A 3STLC 1V54C 1OCOC 2EIKC 2A79B 2DYRC 4H33A 4PDLA 1R3IC 4MVSA 3K0DA 3LDCA 4OXSA 2OCCC 4TWKA 1LNQA 5IY5C 2WLLB 1OCRC 2HFEC 3ATBA 3E8FA 4DXWA 1N9PA 2KB1A 3E8HA 3SYPA 1OCZC 4RO2A 3ZJZA 4GX2A 1ORQC 4G27B 4I9WA 2H8PC 4MVQA 1R3JC 2ITCC 2WLIB 4PA3A 4PDRA 4ZBMA 5B1AC 5CBHA 2HG5C 4MS2A 4F4LA 3AG4C 4GX1A 3LDDA 3K0GA 1K4CC 2K1EA 2A9HA 2AHZA 2WLKA 2WLMA 3OGCC 3K04A 3OR6C 3SYCA 2E4FA 3T2MA
chains in the Genus database with same CATH superfamily
4UQ2B 5IJCC 1URIA 2ROXA 4OZIB 5GTIZ 4Z76B 4QJ5B 4WFGA 4LRIC 3SE6A 3ASNC 3HKBA 1MQ8A 4ZSOA 3D9AL 2OXHB 1IVSA 3LPPA 3LRSA 5EEZA 4X0KB 3M6DA 1M1XB 5CJQL 4KZDL 3LNFA 4LCUA 3ZZSA 4AQ1B 1KXQA 5GJTL 1UJ3C 4QD2E 3HB3D 3N9GH 1GJIA 2HFFA 1PPIA 3NRQA 1M9SA 4JR9L 2EJRA 3BIAX 1EO8L 1CF8L 3AG3B 5EZIL 3MGTB 1NFDF 4UM8B 4IMLA 4GIPD 2F7OA 5ISZA 1CFTB 5E8DL 2WB7A 3TA3B 3MNWA 3T1WA 1C12B 3HFML 5FM8A 1I5XA 3QJHB 3TV3L 1TJGL 1UM5H 2FSEA 4Z7WF 5GSVB 2IPUG 2DH3A 1RJLA 4OBSA 4NFCA 1DTOA 4UM9A 2A1WL 2CLVB 4N2BA 5C09D 1L0XA 5DUPH 3FT1A 4FE9A 4ZUUA 1CYXA 2YA1A 3BP4A 1FFNA 4PRDB 1Q94B 4F8LA 1A21A 4L1HA 1Q9OB 4N2KA 4CADB 1BX2B 4DR4O 5CN1A 5BVJA 3C12A 1FNLA 5CCKL 1JPTL 3BE1H 1JDCA 4X8JB 5F44A 3KZ8A 5HHOA 5KJ4A 5KN5A 4N24A 4QJ4B 4XMTA 4QE7A 3F6JA 3DJRA 3HS9A 3LQAL 1NGZB 2P5WB 3K59A 4KOCA 4YHOL 5DDHB 3KGUA 3QWOB 1NU1H 3BD5A 3LKSA 4AYSA 1D5MB 4O2CB 3HHSB 5JIIA 4M4RA 2O6EA 1WH0A 3CFQA 3MKGA 3QPXH 3OWRA 1QR8A 1JYNA 1WCQA 2ZX8A 1LR1A 3PL6B 2XSKA 1O9HA 4HUWB 4TPRL 4K3AA 2P67A 2CM6A 4JHUA 3W0WB 2JCCA 4PVNA 5IV2A 3W7XA 3VDAA 2Z7ZA 4AZ8A 4F7PA 4L2LA 4P23C 1FLRH 3PWLB 5F3HA 3EW3B 2OL3B 3CHRA 1CEZA 5HXMA 3EFFK 4LBEA 1N70A 5T1KD 3OG6B 2EDNA 3ML9A 4U1JB 2G75B 3VNYA 3KLHC 1SN5A 5ANMA 5IB3B 1D7DA 1OB1A 2IAMB 2R1YB 1R3KA 3QQNA 4WFFD 4P3DA 1OSEA 2KS0A 2YA2A 1FVDA 1WGOA 1F4WH 5EZPA 2DM4A 4X80L 1A8JH 3SJVA 4XGZA 4PJAF 4IBUA 1O6SA 2XXCB 5HPMB 1COWG 1D5ZB 1N0LA 3K6IA 3MUY1 3UZVA 5I2IA 1H5BA 4FADA 4NUPA 1GA2A 4TQIA 3LN4B 4I55A 4L3FA 4NNXB 4PW9A 1N33B 2BCKA 1F4HA 3BCFA 4LOEA 5D2NB 3U7YL 2H26A 4MNGA 2IBZH 1BVOA 2B1HL 1GZPA 4LIQL 4QGPA 4RA3A 4QRPB 5KVEL 4O02L 2JE8A 4AT6A 3T3PE 4LT7A 2LLGA 1K6QL 5K9OB 3P77B 4WWID 2BVUA 2PCXA 2ZIOA 2PCYA 2QADB 3Q9PA 4UIMB 1I82A 3BAYA 2ETNA 4PB0H 2WXNA 2E56A 1A6VH 3U9PL 2DIJA 4YDVB 5B1JA 1I9IH 3NH7H 1I53A 1QSFD 4KKLD 3DROB 1S3JA 2NW3A 1XFPA 1CK0L 4JZGA 3D25A 4WW2B 1XCQA 1WS7A 2WQUA 4DV4B 5D4IA 1FFOB 5DJ0A 2A2QT 4Y7MA 1SF3A 4MNHA 5AD0B 3QIBA 2ARWA 1G1KA 3KPMB 4ZZFA 3AABA 3M86A 3OEEG 2CHZA 3NZ8A 6PAZA 4JN2B 1TTBA 1ZY9A 4QE9A 5KOVC 3CB2A 2ESVD 1YJDC 3FDWA 4JAUA 1MFUA 4X9BA 4TL5A 5GRVK 2WZPA 5J9PB 1HINL 2CMRL 2F61A 4QMEA 5CN0A 2FJFB 4I5BB 2Z5UA 3FT3A 4AYGA 4KTDL 3VFRB 3BIBX 1RZIB 3QDJD 3KPRD 1ZS8B 2WWOA 1L0LH 3CLEL 1JIBA 2ZUWA 3EOAA 3IS0X 4KI1A 4Q9RH 1BZEA 1S7VA 1JPST 2IBGA 5I1DA 1IGML 2HAZA 2DWSA 1KV7A 4KKRA 1IZJA 1NFIB 3ZTNL 1RUQL 2H6PA 1NR7A 2A38A 3GZKA 2VQFO 3EDFA 4IBLT 3TBWB 1XF1A 3RGHA 2X4SA 2CM5A 4FQLL 5JIQA 4URTB 3P3SA 3ZR6A 5K1NA 3QO8A 1J8SA 1TJMA 4G8GB 5H94A 1P4BH 5AW6B 3DPBB 2P4AB 1N64H 4CZZA 1JPFA 1YECL 3QIUB 3BH8A 5I75B 2ATPA 2H9GB 3QULB 3GSNB 3ZL1A 1U8OB 4LC1A 4XTRC 5DZVA 4F57H 1XGPA 4N20A 4W4OC 3AY4A 1OK8A 4IKKA 1D5XA 3RYFA 1XCTB 2VDRB 3W2DL 3DX4A 3CRCA 2XJKA 3IJ8A 1TQCC 2X05A 3F85A 1X5KA 43C9A 1MCHA 4HX1B 1T1WA 3UDWA 3FYEB 5D7LE 1N36O 1MCWW 3JWDL 5IK3B 4M3HA 5FKPA 4GKKO 1KPUB 2CRMA 2FBJL 2YUXA 3VDBA 5F9JB 4KGJA 4LPYA 2EH8L 5B5EZ 5D1QB 3VRJA 3BZ4B 3HMWH 4MNQA 2C9SA 4K8RC 5CIPH 3IETA 3OW2U 4CVZB 3O3EB 3AAZA 1ILSA 4S2SB 2AK4A 5AAWA 1HHHA 1TZHA 2EJ7A 2XTJE 2DQUH 4FFZH 3GEFA 3VFUA 3VD5A 4DCQB 1IBYA 2FEDC 2OSLA 5FCUH 5L9DH 4AM0B 3E6HB 1MWAL 4P8QA 5FECA 4B9YA 4X6BA 1TGOA 2P4VA 2BOBB 4IBYA 3F5WA 2UXCO 3TBTA 4RQFA 4WUKH 2CDGB 3K2IA 4NWTL 2BWIA 4HS8H 4OKVA 4AYMC 1HZHL 5IEHA 1IBMB 2X6VA 1KECA 4YDMA 4NXMB 2Q8BL 4EB6B 1LQSR 1EFQA 3O2DA 3CSFA 4MMXB 3QDMA 4HQQH 1NANH 4C4UA 2BZCA 5CEYA 4JO8A 5TK2A 3QYMA 4PVBA 4A66A 1Z6JT 4X62O 2ADGB 3LYRA 3W39A 3KE0A 1ZHLB 1P84J 5IVXF 1FRGL 2W0LA 3B2VH 3VI3B 4U6VL 4X9YA 2DQHH 1HYSC 3NMEA 2F54D 2XHNA 5I71C 1DBKL 4GRLA 1N6UA 2B15A 1P5UA 2NXZB 2RQEA 4A55A 5CEXA 3FCTB 5JHDA 1ZHNA 4Q9QH 2J6EH 2C1PB 4OVVA 3BGFB 5DC9B 4NZUL 5E6ZA 4BQBA 4F9LA 2ZINA 1SXNA 3FPXA 1AY1L 3NCFB 5EOTB 1J5CA 1X6NA 2VDOH 4L5FH 4ZMZA 3ZE0F 3GGWA 4O00A 2NY1B 4G6MH 4OVUA 2VSMB 3CUPB 3GMMA 3X14B 4ORGB 3Q2WA 4BIZA 5IESL 4TVPL 1KJ2A 5AZUA 4S1RH 3A4FA 1W91A 4AMWA 5FLXN 4RMVA 4DN3L 1MIML 3IJHB 3B9EA 4I3RL 3PQYE 4PJCB 3T2LA 4M6AA 4B95C 4YSQA 5I1EH 3OKDB 1U3ZA 1FBIL 4H0LC 1CDBA 2WD0A 4XR8C 3BUIA 1BAWA 4BSWA 2WTRB 1TO5A 2EXYC 4MSWC 1QFUH 3E9TA 3PJSB 5DJ2B 4AYEC 5K59E 4ZUWA 1OHQA 1YC7A 2BMKA 4P9HL 4MTGA 4LNRB 5FUZL 1WS8A 1YVLA 2IXQB 3UT5A 3KEDA 5KBNC 4M6OL 4FMVA 1FC1A 4OZIF 3N2KA 1NCWL 3MCKA 3N6YA 2YPKB 2LAAA 4KRPB 2V9UA 3TWCL 1JGVL 1IUZA 2OULB 3CFEA 2XQYG 4CN4A 2WAQA 3M8OL 2W1NA 4DP4X 2EUZA 1Q0XL 2VLJE 3S97C 2AABH 4YFEA 4X6FB 1Y76A 1YTFB 1KN4H 1XIWD 3DJSA 1H6UA 5I6XC 4G9FD 3TZVA 4UQDA 3VBBA 1RUPH 3CXFA 3ECQA 3ZPDA 2Z31B 3LKQB 1EHLL 4LVOB 4Z8FL 4FLQA 2CAZC 3RWJB 4JGJA 2OTWA 1N67A 1KACB 2TAAA 3BLKA 4PREA 4F1ZA 3N2JA 4UOW0 5EU6E 2X70A 3CCRV 3MODL 4MAUL 2OQJB 1XR8B 4FLYA 3K6DA 4I3SL 4J3XA 1BZ7B 4JX0A 1HTYA 2ARJQ 4BQ9A 4NFBA 1Q90A 5CGYC 4OPHA 3N1QC 3RVWD 2KERA 3MRMA 4UTAL 1T21B 4N85A 3HKZA 3J7HA 4JRYE 1I3UA 1W72A 1VGKB 4LAQL 1ZANL 5DD6A 4RMBA 4ALAC 1MW3A 3HRZB 1B0GB 1UQSB 5GGSA 1JHTB 3O4LE 4BFKA 5LXVA 5CA3A 4UIKL 1T4KB 3DIDA 4A7GF 1SOSA 2WHVA 3KYOB 2D0FA 1JYVA 4KY2A 4J4PD 4RWUA 1NIDA 5DVNA 3FFCE 4HHGA 4B3RO 5IOPB 1A2YB 5EG6C 2L3BA 2B59B 3BX7C 2HKHL 2Y5EA 3ZMRA 3JQOB 3PAYA 2HJDA 1RFDL 3UPCA 3ZL4L 3CN3A 4Y2DA 3FFDA 3LH2L 1CLYL 4R6UA 4O4HA 4PJBB 2VC2B 4X5WA 1AILA 2E74B 1DN2A 2FHBA 4X98A 5CJQH 4NC0B 4HSCX 3FTGB 5F9DC 5FDWB 5F9WC 5K9JL 1AH1A 3G3LA 4JR9H 4JHBA 1YO4A 1CF8H 5JVDB 4ANUA 4NO5B 4U1NA 4H25A 4WO4A 3HPJA 2PPEA 1WVZA 4ZDHA 5ELIA 3TN0D 2LQRA 2YEZA 4P5SA 2FTAA 3ZMUA 2OMXA 3POHA 3EJZD 1ZK5A 3RGVB 5BMFH 32C2A 2NY2B 1B4TA 1TJGH 5KWYC 4G7VL 3X17A 4WW1A 2J44A 1R9FA 4N9GA 2EVGA 1WC7A 5F0MB 3FCSA 2B1OA 2A1WH 4D3CH 2CBMA 1A65A 5FHAL 2J5LB 4NBYB 4HAFA 2BWQA 3VMNA 3NCYP 4LCCC 4MA8H 4JM2D 5JIMA 3B2DC 4V1DB 1JPTH 2X88A 3LQAC 3NXSA 3KYAA 4MDIB 5IWAO 4ZFGL 4TLUA 2IG2L 4X9HA 4EN3D 4XWOD 5LGJB 1SYVA 1RSFA 2VDPL 4LLYA 2DQEL 1IM3A 4MWFA 5TDNB 3WE6A 2WIIA 2K6ZA 4G42A 1OEZW 3NSFA 1ZAUA 2J4WL 3ECBB 1NKDA 5DQ9B 1NJIW 3RVTD 3EXJA 1VF5C 5PAZA 4FFKA 2F1EA 3O3AB 3OTOB 3ESVF 3SIKA 3QEHA 1AP2B 3JV0A 4ONHA 3SYAA 2FT7A 3DNKA 4WW2F 4WFEA 1R3HA 2NNAB 1G4RA 3OD4A 4IGBD 5IBUB 1IT9L 3CCVV 3BUDA 3B6SB 2FJHB 1WFTA 3HI1B 3MV9B 2CLRA 1SC5B 4ATTA 1JFHA 3LDCA 1Z3RA 2I7SA 3KBFA 4FXTA 3MRIA 1UJTA 3R18A 4KZEH 2GEQA 2HFEC 3I9GL 5BV7C 4IIJA 4XPHH 5JHLA 1JJUA 3GT6A 4UB8Z 4QLRA 5EPMA 3LNGA 2MTPA 4AYFA 5SX5H 1RZKH 4JGNA 4HUNB 3SKMA 4V33A 1UWEL 4P5KB 4X80H 2A6IB 4OI8A 1OAYH 1E50A 1UURA 4JG1L 1T5XB 4MXVE 3E2HB 1MNUL 2R23B 2C3VB 3MQIA 3QUYA 3T0DA 3UGUA 1RHFA 5FGBC 4GQRA 3SKUD 1LQBC 3IDXL 2ZKHL 4P4KC 5D1XD 4JM0A 3L7FB 3CFJB 2EVHA 5FO9B 1GVIA 4AG4H 3IMSA 1JPXA 5L4IA 3KNBB 1AGFB 3BUPA 4HH8A 2R0KL 2VRZA 3FQ1A 4Q4EA 2B1HH 4LIQH 4UQEA 25C8H 4O02H 2YPLD 3TEYA 3AM8A 3EYFB 1R5IA 2V8LA 3RY4A 5C0NC 2NZ9C 5E0FA 2AXTZ 4EKWA 4JHVA 3CBRA 3B56A 3GO1H 3OZLA 3IPEA 3MZGB 4FXLA 5CINH 3U9PH 2ZQKA 4ZUTA 5B8CC 5MP6L 4P46C 3AWGA 2D7OA 3BDXA 3VXPA 5CEZL 5HPOA 1JTPA 4TQDA 1KCLA 2H1LM 5E94B 1EWHA 3C2AL 2V37A 3DV6A 4E42B 1R24B 4OZ4A 4PJEB 3UGXA 1J87A 4GQQA 4K2UH 4KMTH 1OSZA 1HDMA 3PJSK 5F7EL 4KMQA 2OMYB 2VZSA 5EU4A 3PDOA 2A77L 4PG2A 5FKAA 1WHOA 4PRPB 1TUBA 4PRHB 3MNVA 4ZNCD 4GRMA 4XI5C 1D6EB 4BFRA 1HINH 2CMRH 1EMTL 1Q38A 1MFDL 3SDXE 5I1HL 3ARPA 5DF0A 4KKZA 3E8GA 1Y7VA 3TESA 4OLWH 3CLEH 2HWZL 5KHIA 2X4UA 2EDBA 4DT2A 2HRPL 5E9DB 1ZRUA 3RL1A 2PCPB 4DO4A 4JPRA 3T6QC 1RUQH 5BXFB 4YBLB 2VL5A 4U6XA 5I1CL 3CXDL 3GRWH 5DD1H 3C87A 1U8QB 2VO8A 2YXHA 4FQLH 3D3QA 1IC1A 4KO6A 4AJYV 1BZ9A 4BWWA 2R9IA 2H1XA 3IF1A 5ACZB 3ZEDA 2HFGL 1EJFA 2XAGA 2ZWSA 4LOVA 4XO9A 1BFVL 2DQIH 2D9CA 5KSAB 5H8DA 1RZQA 2EDFA 2NNFA 3QJSB 4OZGF 2DQGH 1KBPA 3VI3F 3U2JA 4U3SA 1GSMA 3MV8E 1P84F 2NN4A 4MVBC 5D7LA 5TK4A 4JY6A 3C8HA 4OV6F 4FG6C 2EE2A 1FN4A 5FYKH 4KP4A 3IRCA 3CE2A 3JWDC 2EKSA 3T0WA 2JNZA 5LAXB 2ZWYA 4J39A 5B3SB 4TNVK 3BXNB 2RHEA 2N4IA 2BO0A 3JWDH 4HCIA 1H9DA 4KQ4L 3CPWU 3F83A 1CDYA 5B1NA 3U1SL 2IAMC 5CKAA 3O3DA 2C9UA 4DRXB 1JF5A 2CCVA 2EH8H 3DDFA 4LK4A 2V7HA 3U6XS 3N50A 1JBJA 4MDJA 4Y4KA 5GS1A 2R59A 3OGCC 1O75A 4JCMA 3UO8B 2DQTH 2Q0OC 1WCBB 5CFHA 4K8XA 4TV8B 2YS8A 1EHNA 2GJ6B 4M1GH 5ETUB 4G82A 4PAZA 5J6GA 4MD4B 2ZM6B 1ZLWK 2G60H 1JF1B 1GM9A 2VDQL 1I1RA 4QXUH 3W9EA 1MWAH 1JZ7A 2SEBA 4TOYL 1RUMH 5A16A 3WKML 1K8DB 1HZHH 4Z95L 2F8OA 4L4VB 4AJ0A 3VI4E 4DESA 1K3ZA 3L4UA 1B6UA 4EUPG 3WN5B 5GISH 2Q3ZA 3PHQB 1E4HA 4LLWA 2VDML 1TQVA 5C0CB 2GJZB 5EUKA 4DR6B 3MLXL 4YE4H 3MCLH 3U0TA 5FUOH 2E3CA 4QRQB 2BINA 1H8SA 4KAQL 3Q48A 3LHAA 3FT4B 1FRGH 2MW2B 1ZJAA 4U6VH 2A0LA 1FIGH 3JD0A 4AIOA 1YUHB 1EDQA 5AB9A 4WW2C 1Y0LA 3V4UH 1SQVH 2ED7A 4KH2A 4P23D 3VGDA 3X11A 1QSED 4PRAB 5JQHC 1IVTA 1VACB 4PR5B 2X6UA 4NZUH 2DQDH 1OKEA 4CW1B 3KLHD 2VXVL 4OLUH 3JARA 3WB1A 4ZQKB 1AY1H 3GSRB 4WNQB 4DP9X 2FYUH 2JJTC 2IH1A 4N2AA 1ZSDA 4UOJA 2E5EA 3Q9QA 1OAQL 3QCVL 3PQYA 3QEQA 4MJIB 2HVKC 2AXHA 3IAPA 4IBSA 4ABVA 5IESH 5DJ8A 2XN9B 1Q1JH 1MLCB 4OFYA 1P7KB 1WA8B 4RAVA 3WNLA 2I9LA 5T3XD 5CSZA 4YK4B 2VN4A 2P5EE 3QJOA 4J3UA 1NTZH 1PS3A 4NGHH 2GDSA 3BGAA 2R8SL 4P9HC 2QM8A 3E35A 5E5MB 4G6JL 3F12A 5BRPA 4B3MO 1OPGL 4CAGA 2FNBA 5M94B 1KTLA 2OMTA 1HNGA 3STZC 4DHLA 4URKA 1FORH 3V4VB 4G5AA 2FB5A 2VLJA 3E9UA 3QIUC 5I75C 4NB5A 1UCBL 2IJ0C 4EN2A 1KYDA 3BSZH 3O0RL 3TWCH 5EA0L 3SKOA 3W5MA 4Z7QB 3WUWA 3M8OH 3HKDB 5GJSH 2MWCA 5HTSA 3MZTA 3K1KC 3S4SA 2DYPB 1Q1PA 1BWMA 5EU6A 2XV0A 4TWKA 1T7VA 3IXTB 4GSQA 3ZHVA 4OD3L 4NKMA 1AQDB 3WFDL 3MUGA 2KB1A 4IRSA 2ZCKL 2VR9A 1JK8A 1U3NA 2ZTBA 4IYKA 1WUNT 4YNYA 4JDEA 4F15B 3MODH 1DQJB 4MAUH 3K5NA 1CE6A 4JRYA 4JPVL 2DQMA 4OGAC 4QJFB 3EFOB 4I3SH 4EZMA 3K58A 4P3CL 5C92A 2BTQA 1J8HD 2D0HA 2V4DA 3LEXA 3O4LA 3PIQB 5JYMA 1KGCE 1YY8B 1MY5A 2A9ML 3C8KB 2UZIL 4KV5E 2VZOA 3U48A 3GNMH 3AS2A 4OIIH 3VG0H 1V55C 12E8L 3IN2A 1LO5A 4GPVA 2Q69A 2BOBC 3FFCA 3GMQA 2Q8AH 5KYWA 4UIKH 4LGRB 4JQXC 2K8MA 1WFUA 4J2QA 3MJ9A 3DUHA 2Q7HA 3LXBA 1PAZA 4N87A 3L9RA 4N90D 4GKNA 5DVLA 2EE3A 2YLHA 2DLEA 4ZI7A 1HCZA 4MMXC 43CAA 5J2UB 5EV7A 4OFQA 4F6RB 1ASPA 1BOYA 1IJ9A 3FL7A 5DSCB 4XTRD 2OMVB 3F7YB 3FUFA 1E4KC 3D36A 3VMPA 4X8GA 3APQA 3FQWA 1CLYH 3PDGA 2N05A 1EAPB 2H3NA 4W4NA 1FNFA 2OM5A 2IVFC 2EH7H 2P43B 1KKCA 4Y4HC 2BP5M 3OKNA 3QYNA 1SY6A 3O6FA 3BGFC 5IOKA 4A2GA 4LDEB 1E7VA 3ETEA 4G1EA 2B9ZA 1Y1UA 5CA0B 3B09A 2DL2A 5JORA 4HS6B 2RQ8A 2NY0B 1H8HG 5FXCH 1XB8A 2CBQA 3ETDA 4JRXE 4K8RD 1YMHA 3II1A 4FQHB 2PTMA 1XSIA 2XT1B 3VRLE 3K8LA 3CHPA 1AI4A 4BA0A 2DJSA 1H2MA 2FEDD 4MCZB 4L1DA 1NDTA 3ALPA 3P73A 3ZN1A 4MW3A 4HUXA 5ABDE 2QA4V 2YXFA 5TE7L 3VWJA 1RHHB 3QE5A 4NSKB 4I13B 1CFNA 2X28A 4K7PX 1PLGH 2H6OA 1QBMH 4I0XA 1S77D 4P30A 1QTPA 1CWVA 3VE0A 5F8QC 3B37A 5LXGL 2VDPH 4IJTA 3WO4B 4D7BA 4HH9B 4P2QE 4Y16B 1CL7L 4AE0A 4KRPC 2VDNB 4QXVA 4NJ9L 4ELME 5JXAL 1YN6A 1SJHA 2DWEA 2J4WH 1QLRB 1C5CL 4RVBA 1HYSD 2EZPA 2XVLA 5H35A 3KWWB 3QNXA 5I8OL 2P5PA 3X1EA 4BCXA 2Y4TA 3S36X 3RWEA 4DP6X 1Q3EA 3VXOA 4O2AB 1KT2A 2JH2A 3TEZA 3CVIH 2MSPA 2ZCLH 5DQJA 5AB1A 3L73H 1KIRB 4WFBV 5CN3A 4LRNL 3WELA 1IT9H 1YEEH 4PJEF 1HHJA 1U2CA 2DEYX 3K81A 5E8NB 3QQ9C 4L9LC 3HFFA 4UAOB 1MDTA 4OSUH 3INUH 1UXLA 4XB7A 2H32H 1XCWA 2XWCA 3D8CA 2GIYA 3H9VA 1FO0B 3I9GH 4GX1A 4NM8L 2ADYA 1A6UL 5ERWB 3QZLA 3FOMA 3L2LA 1IEBA 4ZX5A 5DUBB 1LTXA 1K5NB 2SODB 3QW9A 5D7SL 1QHTA 1L9OA 3TVMC 2AV7A 3HLAA 1GGIL 4JJ5A 3ULUE 4LHQB 4GW4B 2Y3NA 2ED8A 3LVTA 5IJVA 1OCZB 3HRZC 3N1MC 1MNUH 4GX5A 5FLUA 2ENYA 4PRNA 3RNKA 3EYVA 1B90A 1ZHKA 2MK3A 4YDIL 2EXYD 3OQ3B 2JJUA 4QRUB 4NN6C 5LGTA 3N40F 5HHXH 3TXSA 3A21A 4JO3L 4J3OF 4PGCB 4PJ5B 4F27A 1KQSU 2CG9X 2KLRA 5FO8A 2R0KH 1V3MA 3LN5A 5DK2A 3T08A 3VD1A 3EGDA 2C7FA 3C60B 4FFYH 3HKCA 4CUCA 4EQ3A 1Q0YL 1QSFE 3WB0A 5ITBL 4P2CG 2E74C 3TC9A 4MLIA 2WA4A 3HE6C 4LKXA 4X4XB 2O6CA 4CH3A 5C07E 3VW3L 5CA1B 3WBDA 1UWGH 5JDJA 5KMGA 1GYWA 3WHXB 4O4IB 1VQMV 2BOCA 1N26A 4IK7A 3F7VA 3MCYA 4LPTA 1BGYH 1RZ8B 5T1MA 3EXLA 4ABQA 1S6NA 4HIXL 2R4SL 4OGXL 4JRWA 5F7EH 3RGVC 3SDXA 2W60B 5L3DA 1CGSH 3CFBA 1ZVYA 3KLAA 3F6LA 4YHKH 3D3VB 1AC6A 5CGYD 1A1MA 2HP4A 4E9SA 4PTTA 1NAML 5KUKA 5E4EC 3VWKB 2HJKA 3Q5TA 4OM0L 5AWNL 4O58L 5DO8A 2DLFH 2VH5H 3D2UB 3OG4B 3DA0A 3QPQC 2ZKXA 1YUKB 5T33H 3GBMH 4LGSB 4Q0XL 2HRPH 2IH3C 2AK1H 2QKIB 2LOEA 5DEJA 1XXDC 4UINH 3WE1A 3QO5A 4ICXA 3ARBC 4R8CA 2HX8A 5DWUL 1G7QB 5I1CH 2WN2A 1RLBA 4YSEA 1A9EA 2VWEE 3MREB 2IANB 2VLRB 2RA1A 3EDJA 4U6YA 5LN4A 1UPGA 1XGUB 1OSPL 3MV8A 4JZOB 2HFGH 1L7IL 1OGTA 4IOIA 5KBPA 3VSTA 3CXHJ 4UDUA 3OC5A 4BW9A 4MS6A 1U3HC 2DN7A 5IHLB 3JV4A 3MJGX 2A06H 2ORBH 2X0UA 3C5SA 5GRZA 4YHPB 5DD0L 5TDPA 1GAXA 1PSKL 3CVHL 3EJYC 3RY6A 2VITA 2FNWA 4APQA 2ZXGA 1AJ7L 1I94O 1JGEA 3O6LL 1ADQA 4AVKA 1SLXA 1EN6A 3WL9A 1Q8IA 2K6WA 3B1TA 3EH2A 3SO3B 5I8CA 3HC4L 3MLWL 1MI5E 8FABB 4TUOB 3U1SH 4UWQB 2XOKG 2AZ2A 5TE4H 2Y0PA 4ZXBA 3G9AB 5FYJU 4BZ2H 5C9JA 2HB0A 4F20A 1A4KB 1NC2A 3QA3B 4LARL 4PTUB 3UTSE 5HDLA 1YYLL 4PG9B 4KX8A 4GMTL 3FN3A 1R5WA 3E2HC 2DN9A 4Q52A 1S8DB 4KKPA 3UO2A 2IWGA 1S7SA 3Q44A 2Y48A 2FB4H 2PO6C 3FSZA 3SDDB 4FLOA 3VI4A 2VDQH 2CKBA 4NXSA 4TL4A 3UCRA 2E6PA 1FH5H 1MUJA 4DGUA 3JWNC 4TOYH 3KVPA 4QF1A 5J12B 4PY7A 1U36A 1S7XA 3SJCC 3WEBA 4U1IB 2YICA 1CUOA 5ESAB 2VDMH 3DX8B 4YVUA 4G11A 1RU9L 1AFVL 1QVFU 1A1NB 2F54E 3DHJA 4PUBH 4FLVA 3HEIB 4LF3A 2BK8A 1A4AA 4Z7QF 2LU7A 4YL4A 2XG5B 1DUZA 4GKSB 1YAZA 5JQIB 2O5ZH 1UH2A 5CD5C 4N4YB 2EDOA 3B77A 5D93B 1KCUL 4NRZA 3MDSA 4C56D 5MERA 3H42H 1NM4A 2VYRE 5KYNA 1M53A 3WJJA 1JWUB 3R19A 1SOXA 2KG7B 1G6VK 3QXAB 1OB0A 3WDIA 4KHPB 2YA0A 5F0LB 3RDTC 2VXVH 2V2TB 1WEJH 1QR1B 3LDEA 4KUMA 3QG6A 1QVOA 2UXVA 3IC7A 3ARFC 4LSPH 1OAQH 2P5EA 4GW1B 1AG0A 4Q20A 2AJ3A 3DSNB 4I9WD 4OF5A 4WI9A 4YIQA 3HTLX 4KK9C 1LO4H 3SGEH 5FOBA 3H3PL 3DV4B 4FA6A 1N4CA 1KWGA 2MPAL 4H44B 1NIFA 2VR7A 4FQ1L 4L8SA 4P4KD 3VGGA 5GZOC 4DPBX 1K97A 1A14L 1BSIA 4K3JL 1A7NH 3IAGC 1ASQA 2EDEA 2VDOB 1OPGH 3L3DB 4ZMWA 4UOW1 5IHBA 2KPNA 3DHUA 5JOFA 4LNUA 4LLUB 4Z3HA 4PLJC 5L7XL 2JFCA 2PPFA 1XX9C 2NZ9D 5E8EA 5C0ND 5F88A 2Q6WB 4DP1X 3VQLA 1UCBH 4XAKE 4LLVA 4IBVA 1U0QA 5EA0H 5BZWB 2XDHA 4Z7OB 4DW0A 1JZDC 1YEHH 4P46D 3RTQB 2DW5A 3LZNA 2WPDG 5C6TL 2CXGA 2RCVA 3DBXB 5KSVA 4GAGL 4A04A 5KS9B 4KK5C 4L8BB 5IFJB 3J2PA 3AG7A 3VQWA 1H8EG 4DR5O 1CLZH 3P4NA 1NMCB 4OD3H 1AD9A 2Z93B 1KCSH 4DV3O 2X2JA 4ODVH 3T2MA 2Z92A 1QG3A 1DQMH 2I60H 3BZ5A 4HJIA 4X4YB 4NYLA 4XI5D 1F4MA 1N6VA 2W80C 1AGCA 1N7MH 4LSSL 4P3CH 3FU9A 4N22A 3FB6C 1AJPA 5KZCD 3MUJA 3GC3A 5L3CA 1OARL 2QHRH 4X1YB 3E22B 4WRLA 2H41A 3WEMA 2UZIH 2FIKA 3VXSB 4LVHB 3A4EA 1BGXH 2VDKH 4M02A 2H4EA 4R26H 3R66A 2WO2B 3TH3T 1G9HA 1YMMD 5KSBB 3SE3A 1JD7A 1XH1A 1FXKC 3RAJL 2EUXA 3ZR5A 4X9IA 2XNAB 3WJMB 2QSTA 2F8XC 1KB3A 4JI7O 2WSPA 4LOUC 2UZXB 1RM1C 1BQLH 5KYXA 1AS6A 4N2LA 4J6RH 3CRRA 1I3GL 1NGWB 3L3OC 4DEWA 1I4FB 4XP6H 3WN5C 3GIZL 4XC1L 4AXWB 4LFBB 4PI2A 3DX2A 2Y07L 3DX1A 1PY9A 2BC4B 4YDJA 3WUZA 2BSKB 3GBNH 3OF6A 1ZVSA 2AEOA 2YAHA 1S7RA 1KG0A 1R75A 3F7RA 4RGMC 5LGUA 1NGYB 2B1AL 2Q68A 4MVBD 5DEDA 4R4FL 2DZEA 5C8YA 5DJYA 1Y66A 4FG6D 4JZNA 4JFYA 4RMQA 2GBVA 4GAJL 1MW1A 4IOSD 4NUGH 5L6YH 2NNXA 2GSMB 2YPVA 2FIRT 2WYZA 3NYKA 2BVOA 4L48A 5C09A 4RQEA 1HHIB 4JRXA 5A6LA 4U0RC 1SJEB 3LEVL 4XCNA 1UB6A 3MBEC 3GMOA 2IAMD 3HBZA 3N5AA 1M71B 5D7JB 5IM7B 5JPNB 4GFTB 2RR3A 1FJ1A 3TH2T 1WQVT 3FRPG 4PCSA 1F1DA 1U93A 1NLDH 4UQCA 3MLZL 2AMGA 1T89A 3VU2A 3QO0A 1GC1L 3WS3B 1FL3A 4PJ7F 2XXMB 3MA7A 1GM8A 2ZPKH 5DJ6B 4HKXB 4YK4C 4JKKA 5AOLA 1XDCA 2VN3A 3DX9B 2RFXA 4X7SL 3CXHK 5AG9A 4P2QA 2UY7B 3CN0A 1HNWO 1J0JA 2X0WA 1SETA 5FV2A 4C83B 4ELMA 3ULVL 1CFVL 5DVPA 3GXUB 1BD2E 3QXUA 4DUYO 3KBPA 5BQ7B 2CIKB 3FO9A 4M93B 3JSLA 4NJ9H 5FFGA 2WSKA 4D0DB 5T1KA 4BK5A 3UG3A 3GD1C 4JI3B 4LSVH 5F96H 4DOHE 3PWPE 3APNA 3BMWA 4ETQB 2WLIB 5IMLB 1H8OA 4BAYA 4UT9A 3ZKSD 3KL0A 4YSDA 3QNFA 4HETA 5HYEA 4LRNH 5GZNC 1EHKB 2JQZA 1UATA 1E2VA 5DC0A 2VUOA 4CBPA 5C0BD 4TSBL 4XE0A 3IXAB 2WJ7A 5F7DA 4CMMA 2X42A 2EDTA 1HL8A 4TUKL 2YIAA 1CR9L 4TVPD 4XPTL 1FSKB 1QWUA 3QDGB 2JKIS 1KJ3H 3WS6C 2DV6A 4PVLA 4PBDA 1J5EB 1JRHL 5D7SH 1C9SA 3GXIA 5MHSD 1KTCA 1GGIH 4G6FD 4P9MH 4NO0A 3TBCA 4YGAB 1AXTL 4H1LA 4KY1L 2W94A 3T1HO 3FPYA 3FCGA 4PSRA 4AV5A 3QQDB 3IGLA 3ZQ9A 3EJSA 3TJEL 1L7TH 1LHZA 3U2SA 4WUUB 1OWRM 2FVNA 2J8HA 2QV2A 4OLZL 1DN0A 3IWUA 2E75B 5EIIA 4AW4A 3T4ZA 1E9PB 1L6XA 5E6IB 3UTTB 4HUVB 1BLNA 1T0NA 1H8LA 4ZOAA 1QSFA 2YPLE 5J1TC 3B2UC 2Z91B 2FR4A 4G8GD 4NPYB 3US1A 4BM7A 2Q7GA 3UBGA 1KIUA 3HUJE 4QXTA 5C1MB 4N2NA 1TCRA 2GUOB 3X1BA 3F7YC 2C4XA 4GLRI 4HOWA 5IW6B 1UGNA 1Q0YH 1IFGA 1QBZA 1S7WB 3VYNA 4NM4L 5ITBH 4AEEA 2B0SH 3ETBJ 2WXJA 3DWTA 1QBAA 1UASA 1UD3A 3C6SB 5LBGA 3HE7C 3NN8A 3CXHF 1WAPA 3AITA 1E2WA 3VW3H 1BQ0A 4MQ7B 4N2OA 3KZIZ 1KTDA 1HOCA 4W9JC 1TR7A 5JO5B 4JI5B 2DWDB 4HF5L 5LG1A 4W70A 3CFMA 4WEUD 2OMUB 2P45B 3X2QB 3QDJA 3RWCA 5DJZA 4O4LA 3H1LH 5SWZB 2NY0C 2RQ6A 3V5KA 5F6HI 4YHIA 4OGAD 1GN3A 3CRAA 1E8ZA 2O30A 1NIBA 3T4YB 1FD9A 1T2QL 3MA9L 5FUCC 3G04B 1TVDA 4QTHA 3BRFA 4P2RB 3GI8H 3NIFB 5EWIH 3BH9A 4ZPVB 4O58H 3UMTA 4UCVA 4YBHA 1R47A 3BP5B 3N3EA 1GO3F 2C7UA 4Q0XH 4GSRA 1UEYA 4D0BA 4MQXC 1T22A 4BDVA 4N23A 4WHTB 5DWUH 3WKPA 4UNUA 1OTSC 5IGXH 1ZWIC 1S7QA 2X4QB 5D2LB 3WO4C 1MCOH 3QUZA 1L9PA 2W0XA 4Y16C 1MCWM 2CO7B 5EZLB 1P4IL 1WTLA 2AEQH 3WYRA 2A6JA 3EO0A 4FJ6A 4X65O 4EEQA 2CA4A 3FSOA 3NA4A 4HK0B 1KENL 4PA3A 2PN5A 3G6AA 4Y4HD 3ILPB 1B0RA 3X12B 3NR7A 2AV1B 5KSUB 2F18A 3O6LH 4WNSA 3HG4A 1WZKA 3U2IA 2PWEA 1OLZA 3FUJA 2N59A 3UTSA 3I3BA 1XZ0A 1FGVL 3G5WA 3ZTJH 1GGBH 3HC4H 3MLWH 4JFFE 4P2OB 1KXTB 1U95B 2CQVA 3D4YA 2CE4A 2AXGB 4LARH 2YXWA 2E6QA 3X13A 5MI0B 5LNGA 4R97C 1I7TB 3BD3A 4LZKA 3OKOA 1K3IA 1B3IA 3LH8A 4UV4H 3H7BA 1CXZB 5EIBC 5GTHZ 3EH5B 1N8OE 3ZYIA 3JALA 4CH5A 5LHHA 2CSPA 2R7EA 4RIRA 3KPPB 4X9FA 1SZTA 1RSOA 4K7PL 4K7FB 4DK5A 2P24B 2JEUA 1UYWL 2F54A 3NRPA 3FONA 1AO7B 3VQMA 4XCEB 1FS0G 4UYQA 1PD0A 3F58H 3ABTA 4X2UA 3GMLA 5JW3H 3C60C 4R0LC 1KOAA 1RIUL 5GRXG 4HCFA 4GSXA 3GI9H 1GCFA 1IC0A 1JNNL 2KQXA 4JO2H 4FCAA 3G6DH 3ARRA 5E8PA 4LSQL 3S36L 4EI6A 1QSEE 1ZHBB 3G4SV 2KC0A 2OX5B 4HIHB 2R27A 4MGXA 4NFDA 4NJAH 4F3FB 4AUJA 1OVZA 2EIZB 4KRLB 1A6AA 5KS9F 1ODUA 5I1IL 3STLA 1O5DT 2VABB 1P9MA 1XF3A 3QQ9D 3AS3A 2HVJA 2JK5B 4DV7O 2X4TB 3CFIC 3CSYA 2QKCA 1DANT 1YVWA 1TU2B 2OZ4H 4I85A 4WWOA 3L4WA 3FB5B 3VXME 4AQAA 1J5HA 7FABL 1QFOA 4XB8A 4YY3O 5T3XE 3CEIA 3TVMD 1AI5A 4PV8A 2FSDA 4NQEB 3WSQL 1NJ9A 1J9TA 3OXSB 1CT8A 1WBXA 3QVNA 3MGOB 1BM3H 4ELKA 1CXEA 3MV7E 4DVBB 3PGFL 4LSDA 3MROB 4FZ0A 5KSBF 4HZAA 1FL6B 3X3FL 4K3EL 3EH3B 4N2DA 4D9QD 4K3JH 4E0RB 3SDLA 3KPSD 5BUGA 3FULA 3SKNB 3Q05A 1XIWA 2EE6A 2UUCB 5K39B 4DP2X 3U25A 4RRPM 5J1AA 1AGEB 5JQ6H 4XNZB 4Y2OB 1G7JB 4ERSH 2FO1A 1KEGH 2YI9A 3HE6D 4PY8J 2GCYB 4XP4L 5CEZD 2MPVA 2QQKL 4RDBA 3VM7A 3OMIB 4I9QA 3T8XA 1KNOB 4W9GC 2BSRA 2GK0A 5AZ2L 1HEJC 2CDEB 4G1MB 1HL9A 3K80A 3U1PA 4GAGH 4FD0A 5HHPA 2ZXQA 4Z3EA 1JL8A 5I6MA 4ZMNA 2ATAA 4HZLA 2C3HA 5C2UB 3D85B 4PBWD 4M5YL 3RGVD 4P2ZA 1JV2B 4K94C 2FUTA 3CJJA 3IU3B 4UTBH 3VFPB 1FF5A 2I27N 4IDJL 1F1GA 5FR3A 2P7TB 5HHMD 1N33O 2EIMC 2CALA 2IQAB 2W65A 1T0MA 3WDJA 3SD5A 4KKCC 4Z3IA 3TURA 3P4OA 1MFCH 2CDFB 1NH2D 1BT8A 2FX9L 3QZWA 4J4PA 5CLWA 4BKLB 3U36B 1I1YA 4Y1AB 1KEMH 3QPQD 4LEOB 1R0AL 3UX9B 3SDDC 5F7MC 4M1DL 1DQVA 2YD6A 3WKNA 3T6XA 3U11A 4DZBA 3ARBD 4H8HA 2BFVL 5D7IB 4YR6A 4EE2A 1INQB 4TQEH 2CO6A 3SBWA 2XA3A 5JR1H 3IGUA 4R7CA 2HR3A 2DTMH 3HNSL 4F7TA 3QIWC 2Y07H 3C9NA 4TKWA 4WI6A 4HJJH 3ROOB 1KJ2L 4G9DA 4WI8A 4U4BA 4W93A 4NQSA 2WKOA 2I69A 1U3HD 1FA4A 4R4FH 1EZJA 2DD8L 4C54A 1ES0A 3EJYD 3NJJA 2MJWA 3FOLA 5HYSA 3DVFA 1SYSB 1IJNA 2ZUYA 1KJMB 1YHQV 4NIKB 4Z7WE 5F3BA 1ZSPA 1UGKA 4JZJA 3FB7B 3BFOA 3ZE1B 2Q73A 5BMVB 1RPKA 2A9BA 2Z1KA 1AOHA 3ZE2B 5F7BA 3N42F 2UXXA 1GC1C 4JM2A 3VFVA 3K08A 4PHZA 1MEXL 5L88H 5H2BB 4BZYA 2ZOKA 4RUFA 3UAEA 2NLJA 3MLZH 4GMSL 1ZX3A 3ELQA 3VYOA 1CLOH 3HZMA 3THML 4XMWA 1T6VN 4EN3A 2QSCH 3VFTA 2D3VA 5GSRB 1XVSA 1HKLH 2PO6D 4FYQA 1QSVA 3CZFB 3IEAA 4IRZA 1T83A 1DR9A 1FWXA 1OANA 1BD2A 4B9IA 4LFCO 2CD0A 3NCJL 4MYWB 5BO1L 3QORC 2XWZA 4MA3A 1JS4A 3WLWC 4S1SH 1X5AA 3ULVH 2GSGA 1CFVH 3MLRL 3HG1B 2ITDB 2W38A 5KTEL 3ESUF 2K9PA 3I84A 3QHFL 4RNRB 3DTUB 1QZNA 1X5HA 2OMWB 4RMRA 3CHSA 4DWHA 2YDEA 3MMEA 1GW6A 1A3RH 2FD6L 2DIAA 3HC0A 3PWPA 5IW1B 4IJ3B 5LA6A 2ZOTA 1UTDA 1W72L 5CD5D 3DOIA 1YIJV 3P30L 4HWBA 4LSUH 3RTQC 3FUNA 2VJ0A 4H13B 1JNHB 3ETBF 1FNEB 3HI6L 3NJXA 3OR6C 1DDTA 1WFIA 3FQXA 2EAEA 1M6UA 4JPIB 4NRYA 4QRRB 3I55V 4G8AC 3ULSB 4OU3A 4ZD3L 1OCRB 5ITFB 1B2WH 4J7KA 4JTDB 1JDDA 4GG8A 4UANA 3SQOL 3BVVA 4WENB 3L1FA 1NMCC 3IE9A 3RDTD 1OF2A 5DJXA 5JQGA 3FQ4A 3ZMNA 3ASOC 1R3JB 2IH8A 3ATFA 3CSGA 3IMRA 3OAUL 4J3VA 2APBA 2HG5B 3ARFD 4PJAE 4PRHD 5AVVB 2NXYB 2BVQB 3O9WB 4QYOB 1CR9H 4XPTH 3L75H 5SX4I 5IWLA 3IM1A 4YAQB 5AOKA 4Q58C 3KG2A 4KK9D 3HN3A 2DBLL 3BDYL 3NIFF 3Q6FB 4LVHC 4P06A 5GZOD 4LHJB 4OV5B 2OTUA 1Z0NA 2FWOA 2Q5ZA 2YPLA 2H6UA 3IDYB 1FKAO 4IHJB 5BPPA 3TJEH 1UD6A 3HUJA 2NNRA 2AHIA 3GIVB 4OLZH 1CU4L 2IMMA 2BSSA 2X6MA 3EAKA 3KJ4B 2GFBB 5EBLC 4JB9H 4OQ1A 3E8UL 1IGFH 5D2LF 3TJHC 4OX9B 2CUGA 1QRNB 4PLJD 3F7QA 4ZUVA 1RIVH 1WV7T 2R1XA 4FS0A 4YHHO 1LXMA 1W0KG 1QEWA 4CSSA 2PY5A 4JFDB 4CL7A 3TNMA 3B7TA 2BERA 2UWEB 4QHKI 4C4BA 4WZ9A 1K5WA 1WTGT 4P5RA 2CGNA 4HPYL 3GSVA 5B1BB 2DBJA 3GJFA 4KK5D 3RWGA 2YUVA 3SE9H 3H9SD 3G08B 3NCWA 4B0MM 3BHBA 1RJYB 3D0VB 1S7TA 4ONFL 5I0DA 3MVSA 5D7JC 2FLBT 3MGAA 4YX2L 3UBXG 3ZU8A 3S5ZA 1LE5B 2IFGA 3BD4A 4ZODA 4BFNA 3QUXB 3P3NA 1MA1A 3SCMD 1MJUH 1XMQB 2EDKA 2W0FB 2C34A 3MA9H 4FK5C 1G6RA 4RGNC 1S9XA 4KZCA 2GJ6D 3N55A 5INCB 5DCCA 4H26A 1WAEA 2E47A 4MAYB 5CNHA 4HV8B 1T03H 1XL6A 5L3GA 2OTLV 4FDWA 3SOBL 3UZEA 4N6RA 4I8DA 2ZE6A 1OHZA 3QCUH 4EZJA 1I85C 2E5LB 2VNCA 3MJ6A 5IG7A 4ODXB 3HVNA 2BP8B 5JHLL 3R7QA 5E6YA 4KKNA 3WFEL 4M93C 3T65A 1D5BB 4HBCL 1PZ3A 3KGRA 2IFFL 4MS2A 2QEXV 5DR5L 4FNRA 3W7SA 1ZTXL 3WNKA 2BNUB 1R6KA 4CC1A 1SEBA 4ZFOB 2ZQMA 2GV9A 1KENH 2QWRB 4CS4A 1JUFB 2XN0A 4R7DA 1KJVA 4MD5A 4I48A 4JFFA 4N1HB 2ICEB 2QPFA 2IDCA 3KCWA 3DPDA 1QBLL 3MBED 1V10A 5IYZB 4JI0O 1G7MB 1XH3B 3U7WH 4GXVL 5EUOE 1MVUA 3FYIB 1NBYA 4OTXL 4PGJA 1JMXA 1T3FB 2E9GA 2Q8VA 2XQYK 4HA1A 1JN6A 1JFQH 1SOQA 2PP8A 1YSOA 2GPZA 1X7QA 4CVXA 3QIBC 1AGBA 1DZBA 2QKSA 1JSYA 2GT9B 2PR4L 4F80A 2EC8A 3WFVA 3GXTA 3MPCA 1JFFA 1FG9C 3P32A 1PKOA 4G8IA 4XBGB 5LO7A 5DJAA 3TH4T 2NW2A 4K7PH 3L9YA 5IVXE 1A7QL 3IGAB 1YEDA 1UYWH 1HW7A 3IDNA 1Q9WA 3BVWA 1JV5A 1N59B 1C16B 1QSEA 1MW0A 4XX1E 1YPZB 4DAGL 1KV3A 2PYJA 4PDVA 3REWA 2IADB 1M56C 4G3YL 1F97A 5ABZA 3NPZB 3C3TA 5IVNA 1MHCB 4LSQH 4DYLA 4CJ0A 3RI5F 3RKPA 5TDOA 1C8PA 4Z7UB 1BIIB 2Y7NA 3VUAA 3WTUA 5CN2A 3T77B 3VXMA 1IZ3A 3CMEV 3DO7A 4IU2A 1Q81W 3WJLC 3GVMA 3TBSA 2J3SA 2DYSC 5LMNB 1EQWA 1FZMA 1XGYH 1ETZB 3MRFB 3MV7A 1USQA 4CGUB 4JYYA 3BZDA 4MRCA 4R90H 3WSQH 5T3ZE 1HESA 2YMOA 4QRBA 4ZUSB 1OP3H 3UDWC 1KGIA 3RVZA 3EGSB 3BPCB 3E86A 4FHBD 3BKJL 4A67A 3OTOO 4EUPB 3JTTB 4K3EH 1D7CA 2V3FA 2X4OB 4MTXA 1GGUA 3LOWA 1T6BX 3B2UD 4QIRA 1SQBH 2MQCA 5JNYA 3GKWL 1OK0A 2E27H 4FI8A 2DJMA 4N26A 2Y0IA 1U8JB 1MFMA 1LYQA 2J1YA 3VDCA 3S2AA 2VKXA 1ASOA 2EXSA 3DK2A 5D6CB 5IJ9A 2OA9A 4A5UB 4GUCA 2VUYA 3LDDA 3LSSA 1X59A 2AHZA 2UXBO 1DDHB 3HE7D 3TPUA 4HGKC 1CD1B 2GTWA 1VJSA 4XXDA 2WKGA 1FFPA 5AZ2H 3ZDXB 3FU7A 5CFAA 1S0VA 3BWUC 1WFMA 2XWBA 2XOTA 1BFOB 1REIA 1LDSA 4JPWH 1AXIB 1PEWA 2NY0D 5DFAA 4GKOA 1RJZB 3O2DH 3ZE1F 5D9SB 2FZ3A 3ZE2F 4HYOA 1QD0A 2EECA 1QYGL 5LKNA 4CC4A 3LPGA 2EVIA 4YSSA 1DEEB 2BIPA 2E7CA 1MJJA 5EZYB 1G7LA 1QFWL 2W91A 3CVBA 4G8EA 4L3ED 1E28A 1NC4B 4CU7A 5MI0C 2WUBL 4H40A 3CCUV 1WB8A 4XOCA 2P22C 4MXQC 3CSXA 3D06A 3L1EA 1R0AH 2O5YL 1GL4B 5I66A 3ISRA 1N2RA 2M6YA 3GSWB 2JB6B 4MQXD 3K74B 4W4OA 4FXKB 2BFVH 2P8PB 4QXGH 1E8YA 1ZLSH 4F7MB 1OTSD 3BWSA 4FGMA 4E41B 3I3DA 4AGOA 1Z9SB 4X64B 2DS4A 5FYKU 4EZKA 4MDRA 5L2KB 3KJ6L 4X1IA 2QR0B 2ZYIA 4OIFA 2O6PA 4Y16D 1NGQL 3HNSH 4NWUH 4YLBA 1J0HA 3Q2LA 5D5MB 4JI4B 4ZTPH 4N8VG 1QQCA 3W0WE 4TSFG 1NMBL 1BQHG 4QHMB 4YDKH 1JOYA 1SESA 4D7SA 1Y07A 1GZQB 1KJ2H 4JFSA 2HLDG 2R2EB 1SXAA 3M88A 3B1UA 2VDKB 4GUOA 1IC5L 1U8NA 4NKOA 4GI6A 3HBGA 2LE9A 3SQBA 2Z7YA 2TRHA 4Z7WA 2LU4A 2DD8H 1WICA 1N32B 2ZNIA 4NNPH 5DHXB 2BXYA 5KAFZ 4PJ8B 3PGCA 3KLQA 5I8KL 5E8OB 2HLEB 3SZKC 1U92B 1UA3A 2WQSA 3V52L 3C6EA 4B9GA 2JK5C 2UV3A 4BSJA 3C08L 2EVFA 4EXKA 3IU4H 5BS0D 5I8EA 5IVZA 3FB5C 1M7DB 3ARWA 4JFED 5GPRA 2BNQD 1WF5A 4GYBA 3Q8CA 5D1ZB 1AHMA 2XNDG 3US9A 4FLRA 4O5LH 1B04A 2ZOUA 4X89A 3R8QA 4DIXA 4XPAH 1NUNB 3FT2A 5K9QG 3GB7B 5IQ9A 3A0OA 2RMKB 3BSGA 4WQOA 4XMLL 4YGVA 5FA4A 3ZUCA 3BKYH 5EIBD 4QRPE 4TV3A 2EUWA 2OJEB 3ATBA 5BO1H 3NCJH 1V7MH 2CIIA 3A24A 4QRSB 3S98A 2Z34A 4FEMA 4UF7C 4NENB 3G71V 3WOVA 2F7PA 5CD3A 2Q9LA 3V5DA 1KGYE 3C60D 4DKDC 5KTEH 1A8ZA 1FVEA 5F89A 1BZ8A 2CWRA 4GP8B 4XNZC 4XVJH 3O11B 4HFWA 3K04A 5DQDL 4XP9L 4RMWA 5B38G 4DR4B 2OXGB 3MJ7B 1W72H 2UWEF 1EZVX 4NCDA 3N91A 3RWHA 1W0WB 2E9WA 3MJ9L 1VF7A 2CTRA 4PJAA 3HG5A 2J2ZA 2FWSA 3PHAA 3Q01A 3OKLB 4Y1SA 4IEFA 5D8JH 3RTLA 1VFAA 4M5TA 3LH9A 1Z5WA 1S9YB 2R2HB 1PDKB 2P7TC 4GKZA 4P4RA 1LEKA 4A68A 1ESOA 4HIIB 1W0JG 2LU5A 1K72A 5MHSE 4Q56A 1JGLH 3UJJH 2HN7B 3MX0B 1AR1B 2UU9B 1R73A 1QNMA 2DBLH 3BDYH 3V0WH 3WAKA 3QUKA 2W9DH 4Y88A 5AVTB 1G94A 4ZFFB 2FJUB 1CI3M 3HKEA 4NP4L 1SY6L 1C1EL 5GHWL 3SY0B 1OCCB 3KDPB 4G8GE 5G5DA 1F3JA 4JPKL 3BWAB 3MRDB 2YC0A 2IAND 3V9CA 1BOGA 3CCLV 4L8CB 2CTWA 5C0IB 3LXAA 1VFUA 4UB0L 4Z78B 1NCAL 4HJ0C 5IMOA 3OLGA 1PZDA 4HMDA 3EZ8A 3MRJB 4OD2A 2BJML 4K71B 4P07A 4BSVB 1VKXB 1HEZA 4OZHE 3V5HB 1SQ2N 1C08A 3FTXA 3ETGA 4PGEB 1S9WB 2WC7A 1IB5A 4GUNA 2B5IB 1GCYA 1JCVA 1RZFH 2B4CL 4JANB 1X5JA 5T5FH 2G2RB 4EMZA 1AKPA 4HPYH 2AJZB 2EICA 2IAAC 4FZEL 5D1QE 4K0KB 1CS6A 1B3QA 5F1IA 3T5WA 2GC7C 3QEUA 4ONFH 1P5VA 4EDXB 2OP4L 3BP7B 1OGAD 4YX2H 4PS4H 3OKMB 5DI8A 3EFFA 3NCBB 5CCJA 2Z3YA 5C0JA 4KKCD 4QAMB 1GTFA 4XP1L 3CJHB 1OD7A 3A67H 4WJKB 5IY5B 4APXB 3VACA 4RA0C 3MN8A 3OHMB 3S35X 2ETWA 1CGYA 2JJ2G 4BGLA 3QJQB 3P0YL 3SDDD 1T5EA 4H8WL 3S3CB 2A6KA 4CVUA 3V0DA 5TQ0L 4XO5A 5ESVB 1ONQA 1W8EA 2VW7A 2WMPA 1QW9A 4HKBB 1YY9C 4OFVA 4PJ9C 3DHMA 4FQQA 3AU1B 1NA8A 2ENQA 3QXWA 3QIWD 3VI3E 2EXWC 3CC5A 5C0AB 1GGCH 3FMGL 3A6BL 4G5ZL 4HC1L 1KYUA 1G43A 3WFEH 1TYRA 3BVDB 4NERA 4HBCH 5BY1A 1YPZF 4N86A 2QPEB 4M6ML 3NJLA 4QHUB 5HGGS 5C0FA 3FK3A 3FO1A 2MCPL 2VKWA 3MNZB 2NX5D 4H13C 5F7LB 5JYLA 3QISA 5CZRA 3RURA 5L2JB 3D4CA 2P4KA 1DLFH 4U7OA 4XMKL 3VJ6B 2DKMA 5EUOA 5GRJL 1AQMA 1EDYA 4L4JA 2VQ1A 3L95B 4F7CA 3AM8C 2B08A 2LABA 3T0EB 3CHOA 4MTFA 4LCCA 3O9WC 4A6YA 2YIBD 5TFSH 4PJCE 3ILDA 5DMGC 4J3SA 3WHE0 4ABMA 4BXVA 5HHQA 4GQPH 2DOSA 5F1NA 2MKWA 1OTTC 5B66Z 4JUTA 2WNWA 4LLDA 4XBEL 3T4DA 4NO3A 2OZNA 1A7OL 4WGWB 3O6MH 4X99A 3BP6A 3DXAB 3IDYC 4OGQC 2ZP9A 5AVQB 3QORD 4GKKB 5E79Z 3ZHSA 3RUGB 3VX0A 3WLWD 1SA0B 3WEOA 4HHAA 1DE4B 5FM5M 1W6WA 5FL7G 3REVA 3UADA 3L3JA 5BQDA 1P2CA 2PYFA 1M4UA 1QQDB 4R6ZA 1KCWA 1RPRA 5EH1A 4IYHA 1MREH 3NP3A 4XZUA 1IKOP 1QUPA 2R72A 1C5DB 5GGVL 2YUWA 3MLVL 3PWNA 4MRBA 2OFQA 5CCHE 4DAGH 1XMWA 1F58L 1WWAX 2EYRA 3DARA 4U1HA 3RTQD 3RVVC 1DQQB 2HFEA 4A2HA 5DUML 4KGLA 3BOVA 2O6FA 3EJCA 5B1BC 3TCUA 5TQ2L 3SN6N 3ZDXF 5FGRA 1UC6A 4FN0A 2NY5C 1Q9KB 2GAZA 3HCVA 1X3DA 3GRBA 3MRBB 2ZWLT 1KLFA 3EO9H 4WFGD 4O2EB 4QPJA 3KLLA 4HUCA 1JWMB 5FGBA 1UXWA 2PF6A 4P4KA 3PFUA 4HWZB 3MRKA 3PE9A 2VZ1A 4BFFA 3QI9C 2AAAA 3V4PL 2C5DC 3G5VB 4J28A 2I07A 1F11A 2JI2A 4UQ2A 2NTSP 2O61B 2HP8A 1MWOA 3RX9A 3TBYB 3QZBA 2EZ0C 4MAYC 4YQXH 1LNQA 3U4AA 1E43A 2JQMA 4WEBH 3AMKA 3KPSE 3MLTB 1F6LL 2OXHA 3KS0H 5K1JA 4A7UA 5DECA 1ADQL 3NZUA 4X0KA 1M1XA 3GRGA 2CCWA 1ROPA 4BIUA 1FNGB 4FQPA 3QP3A 5FGSA 4PJIE 4AQ1A 4BFBD 1GTNA 4I7ZB 2XY1A 1H3PL 1AMYA 4YO0B 4UM9D 3TJHD 4PJBE 2ZE5A 1LNUB 4Y4KC 1KYFA 5GS1C 4CU6A 1XL4A 3OT7A 4QNHB 1XGQA 3MGTA 4UM8A 4AK2A 1SNRA 2CO2A 2G3NA 3U30B 1CFTA 3TA3A 4JW3A 1R17A 1C12A 3CX2A 5HHOD 2H8PB 3QJHA 3JYBA 3JAKA 4E68A 5GSVA 1LWHA 2M83A 3PWVB 3CV5A 1MQKH 3QEGL 2EILC 2JKJA 1ACYL 2A3TA 1UZ6E 2OR7A 2Q5BA 2ZUUA 3HPLB 2ZD0A 4PRDA 1Q94A 1M1SA 4CADA 5D7JD 1TJHL 4YDLC 1BX2A 5HHME 3UKMA 2V17H 3UG5A 3TWYA 3X3GH 2X53A 2XN2A 5EOQL 3RYIB 2LFEA 1WIPA 1KBHA 4ZT1A 3CMAV 4X8JA 5FA3B 1QYGH 5DS8B 4DQOL 3DSFH 1OZTG 2CAKA 3RU8L 1QTSA 4RGND 4ZTOH 2X6AA 1NGZA 3COOA 2Y6TE 4V1DE 5DDHA 4ZQTA 2ZD9A 4DFIA 2WUBH 4LPCA 4F2EA 1HX0A 1D5MA 3QQXA 3HHSA 3O2WL 4IRJB 4IS6B 3P9WB 4O2CA 4HKJA 4OJAA 4DEPC 1KXHA 3PPSA 3UC2A 4KXAA 3GHPA 5D7KD 2XXFA 2YAQA 5EORL 3TIEB 1EK3A 2D3OW 2XA8L 5EBWB 4H88H 3W0WA 3H54A 3BZEB 1PY0A 3ARTA 3P3TA 2ZWKA 3IGAC 1N8RW 1GIGH 4QWWC 3SJVD 1EBOA 1M57B 3PWLA 4J8QA 4JKNA 2OL3A 4IOSA 3IJYB 2C9VA 4LOFA 4CBZA 1YHPA 3U4BH 4DGVL 4OZFG 1QACA 3ZXAC 5FYJE 4L8DB 4U1JA 2AJVH 3ZRWB 1Z1WA 2R1YA 5IB3A 2IAMA 3JVFC 3JCUZ 3MV9E 1Y18B 2EYTB 2LGQA 1YSCA 4Z1VA 5JH7B 3KPNB 2IDTA 1ZEAH 5I8KH 3ABUA 4NNYB 1HSAB 2G5RA 1V54B 3O8XB 5AFAA 5HPMA 3U46B 5AOMA 1D5ZA 1TMQA 1W80A 1P7GA 3CCQV 5A2IH 4PP2B 2F93B 3C08H 1GOHA 1NINA 2R0WH 3FU6A 3PS6A 4R3SB 1NTMH 1BW8A 1OQOA 1M7IB 1QPKA 4UUJB 4PS7A 1I3RA 4NNXA 2EIJB 3MRHB 4ZNEE 5A1AA 2AZUA 4PMEA 3ZHRA 3D4GA 4W6XB 5GXBB 2WYIA 2F8IA 4D7PA 1AG6A 2QT6A 4X1KB 3QIBD 1XEQA 4GIAA 1KLUB 5HI3C 3ZZQA 4F93B 1QR4A 1GTOA 3B7RL 3P77A 4IIQB 4X7DC 3KWUA 5K9OA 3LB6C 4UIMA 2F0CA 4PWKA 3ECUA 5ITZB 5I18L 2V2XA 5DRWB 3HAEA 3PV7A 1UCTA 3LDBC 4JFXB 2WZPD 4WF9V 1IBKB 4B60A 3MC0A 3M7FB 3UL4A 4WW2A 5I1KL 1D7FA 3SOTA 5AVYB 3V0IA 4D6TH 2BS71 3KPMA 4LPWA 3ILEA 1AI1L 4OCXL 1UOWA 3CWBH 5CMUA 1KKDA 1GOFA 5E9NA 4XP9H 1P6AB 5BUAA 2JJTA 5FYLH 4PJEE 4KKAC 3QG7H 5J9PA 4YEFA 2HHHB 2HVKA 4I5BA 2FJFA 3UJTH 4D0CB 1MCNA 4OCNC 4X5LA 3MJ9H 3VFRA 1CI5A 1RZIA 1ZS8A 1NS1A 4PRHE 4PRPE 3GTVA 4LF9O 5EOCH 3D36C 3WIHA 1NFIA 4FMFA 1RUKH 1A47A 1LK3L 2GW5A 5JUEH 2QGEA 3IKCB 5EC1C 1IKFL 2YMTA 1NIEA 3IFPB 3STZA 1QNZL 3RWFB 5HVFB 1XH0A 4LDCA 4G8GA 2AQ3A 3KR3H 3AG2B 1E27B 5IFHL 2X9XA 1YCSA 3QIUA 2E76B 4U33A 2H9GA 2O4EA 1U8OA 4JYAB 1BEXA 3K6NA 1SY6H 1C1EH 3CU7A 1BSMA 3L3GB 2VISB 4OLVL 3K6OA 5F0JB 4JY4B 3RIKA 2R2BA 1Z5YD 2P90A 1TEYA 2AK4D 3HKBB 1ZXKA 2PYED 4OZHA 3AREB 4HX1A 1QABA 3LRSB 3CRQA 3OUSA 4WI2A 1TPXB 2P47B 4TQFA 2L04A 2XKSA 3SPHA 4KHPO 5IK3A 1MLBA 4PA4A 2B4CC 5CMAA 3UPRB 2ZXBA 5F9JA 4MMYB 2JQAA 3VWJC 4DR2O 3OB8A 2XV3A 3H9SE 3KDMA 5D1QA 1B0WA 3BZ4A 4UBDC 4XN5A 2YK1H 5F7KC 3O3EA 4CVZA 4JS7A 4MA7L 3PP3H 1NCCL 4RGOH 4S2SA 3PXLA 4AVIA 1XSJA 5ISZB 4FZEH 4DV5O 3MNWB 3KCPB 3L16A 4OR1A 1SLUA 3FQNA 3LKNB 5TF1L 2OV0A 3QUGA 4DCQA 1IXBA 2GB2A 3TS8A 2IH9A 1EGJL 2JTYA 4AM0A 2VS0A 3E6HA 1ERNA 1M42A 3LRMA 4DJMA 1TNNA 2BOBA 4XO3A 4OI7A 2A79B 2CDGA 4JQXA 6FABH 2GJ6E 5D1ZC 3L9BA 1FIEA 3BP4B 5JTWA 5JHDD 4EB6A 5IMKB 4KI5C 4MMXA 1NH6A 4MXQD 2EDMA 4ISVB 3NTCL 1TTCA 1YDPB 1TO4A 3EO1B 2Z8VC 4O4JA 4PEEA 4H1LG 4UT9L 5BJTA 1RUAH 4FL4C 4H8WH 4L4VE 2ADGA 1ZHLA 5KX5B 1NCNA 1UZ8A 2YUAA 3TIDB 3O81A 5IF0B 3LN9A 1Z2GA 5C0CE 4I2XE 3RUGF 2K1EA 3VSVA 1JXDA 5AQ0A 1X9RA 1AO7D 5FC9A 2BPBA 2HZHA 2UXTA 2N74A 2AQNA 3ULUL 4BH8B 3ZHTA 3CH1B 3FCTA 4Y4HA 1OE3A 5DZJA 3ZQWA 2LVEA 4MFHA 5E0QA 2C1PA 1AI7A 4C7UA 3A6BH 1KU9A 3QHTC 1VADB 5E2WH 4TV9B 2E8ZA 2W0PA 2WYTA 4H5SA 3OHXB 5I26A 4JFZL 4NQDB 2VLKB 5F3HB 1YEIL 3W37A 3TV8A 2J8UB 4GT0A 5EF1A 2YIDA 2VAAB 3CUPA 3X14A 4CNIB 4ORGA 4E9LA 3SYQA 4IHOA 5CR8A 1DBBL 4XMKH 1D9KB 2QTOA 3LS4H 5DZOA 4AWJC 1MG3C 5GRJH 3F8UB 1IAKB 4PJCA 2FQFA 3NABH 4J80A 1CD8A 3OKDA 3TT1L 1I7FA 4EAEA 4UCTA 2ATKC 1I7UB 1FPOA 1NPUA 2WVVB 2NYZA 2OW7A 3JD4A 1KCVL 3B7SA 4NO2B 2WTRA 3DGCR 4FFVC 4XGZB 5EIQA 1SEQH 5DJ2A 3V9FA 4KXCA 1AR1C 4NRXB 4NQED 1LK2B 4HCRA 3G5ZB 4LNRA 2IXQA 1HNXB 2WZ6A 4NX0A 3WXVL 4X7EC 2BOCC 2EIEA 1UWYA 1A7OH 3R0NA 3F7VC 2YPKA 5AW9B 4MS8C 4NZDA 4BQ6A 4I0PB 2WWMC 1OCCC 1WPBA 2LJ2A 1BZQK 5CJOH 1H2LA 3ZTCC 2IU3A 2FT6A 1ZOXA 4X6FA 1G7HB 3O4OC 5L4MA 3B9KC 1SVCP 4UV7H 1URFA 3DURA 1Q90D 1KY7A 2G2PA 1CD9B 4Z7QE 2CRYA 1IQDB 4AIZA 3LKQA 1RXLA 5ICXB 5E08L 1WIOA 5AVWB 2WXLA 2WB1A 3RWJA 5GGVH 3VXQB 1IARB 2DQFA 3MLVH 3F64A 3ZK0A 1F58H 4JI6B 2VXUL 4WI7A 1MAKA 4YEEA 2OQJA 1XR8A 3FXIC 2ZYSA 3BEWB 2Z8RA 1BZ7A 2AJUL 2YD3A 1MCPL 3JWOH 4K5NA 4OF3A 5EZOL 4Y1TA 5TQ2H 4GQZA 4K9EC 3UQ8A 2EADA 1T21A 1CQYA 4D9RD 3QYCA 5EDXA 1SDDA 3BAKA 4EVNB 3D05A 1VGKA 2LR4A 1J10A 3HRZA 4HFUH 5D4HA 1B0GA 1UQSA 1Z66A 1JHTA 2QQNH 1K5SA 4G43B 4OJYA 1T4KA 1YF2A 3QJFB 3H2WA 4E9WA 3FN0L 5EB9A 3H9HA 4JVPA 3FTWA 5IB1B 5IY5C 1S46A 4Y5XB 2LW1A 1F4AA 5LCVA 4Q6KA 3NJFA 5F0PB 2Q10A 3RY6C 3TM6A 2FEEI 3KPSA 1FGNL 2WW8A 3UTZA 5IOPA 5HYIA 1D5NA 1A2YA 3WNNA 2B59A 4KUZL 4KJPC 2G38A 4PJIA 1LEGB 1U42A 1OCOB 3CYOA 3UYPB 4PJBA 3K0GA 1ET7A 5LVEA 2A9HA 2FJSA 2P8MB 4JI3O 3DSQA 3FTGA 3BA8A 1CZ8L 1T66C 4GSDL 3K57A 5ILTL 1H3PH 3LD8B 3AUWB 1A0QL 4O4YL 1PZSA 4F37F 4HJ0D 3B2XA 3C5ZB 4HJTA 2VDLL 1N18A 4N3UA 1AYOA 1HWWA 4N0CC 5JVDA 1XNRB 5CAYB 4GS7B 4NO5A 2HEPA 3UEQA 1Z5VA 1P69B 3RGVA 43C9B 3AB0B 1HQ4B 1TZGH 3KCYA 2XWXA 3QARA 4ORZC 1T1WB 4MMZB 1S4IA 5AYUL 3EYUL 2CKBH 5IVOA 2GG1A 1G0YR 1W15A 4B3MB 3QEGH 1U6AL 4MYPA 3T71A 1ACYH 3OVUB 3T0EC 4O51A 3ZHNA 3UTQB 2ZIMA 1MH5B 1RVFL 4FG0A 4U1MB 5FUCE 5DXWA 4B3TO 5KBMA 1DFXA 5DD3L 3EJJX 4QHLB 4V1DA 2IH3A 2NZ1A 3SPCA 2X1WL 3AAZB 1KGJA 3GXNA 4HXAL 1TZHB 1F2XK 4MDIA 4TQPA 1FNHA 1WBYB 4DQOH 4PB9L 4HKZB 2W92A 3RU8H 1TXKA 2OSLB 1VESA 5F1OB 5LGJA 1YN7B 3S35L 1DL7H 3D4ZA 5TDNA 3TBTB 3OJMB 3LQMA 3WJJC 3GUFA 2DMBA 1RK1B 4TSCH 1EAOA 2JXMB 4OKVB 5G55A 4QLWA 3ECBA 5IEHB 5DTFB 2MQ3A 2ZUQB 5DQ9A 1F3RB 3QUHA 4QNPF 3ABKC 4X4ZA 2YMXL 4QGTA 5EORH 1YY9D 4PJ9D 3QDMB 3U0ZA 1U3HA 1NIAA 1AP2A 2BSEA 1U2YA 3HG1D 2EXWD 1MZZA 3BLBA 2NNAA 1XNQO 2YBGA 1KC5L 1BZOA 4JLRB 4DUWA 2FJHA 3HI1A 3MV9A 3EXAA 1XXFC 4RAUA 4J3OG 3RB5A 3OL2A 4CH4A 2WSSG 3PAUA 4G7SB 4GRLB 4L8SC 3SD2A 5KVMC 1ETA1 4LF5B 1P5UB 1P4UA 1B3JA 1ZHNB 1HZKA 4QRRD 1QW8A 4EI0A 4KJQC 3DYOA 3F7LA 5E03A 4P5KA 1N5YL 2A6IA 1N34O 2CHXA 1PF3A 3MV11 3ECWA 4KITB 3ULVF 3D39B 3KHQA 2R23A 5CCGE 2XAQA 4ZNEA 2C3VA 2EE0A 5F21B 3O9WD 2PO6A 3VFMB 1WYJA 2DMGA 1QFWM 3L7FA 3CFJA 5DMGD 2UUBO 5FO9A 3GLZA 4OZFH 3CRMA 4U1SB 4PJXF 4GG6B 4G70B 4HSAC 3KNBA 1OTTD 1AGFA 4G7YL 4AJWA 4GP5B 3U4KA 1S3KH 3OMZA 4AENB 2X4RA 4DNLA 2R56L 4PJ5E 3EYFA 2ZX6A 1QA9B 2ADJA 4WGKA 2JELL 1NGXA 1FLTX 4EF3A 1B4RA 4DPRA 5KW9L 3LIZL 3CFCH 2O72A 5I18H 2XUMA 3ENEA 1GN2A 4I7ZC 3WENA 2BNRB 5DS1A 4KROB 1QRND 1GMIA 5DMIL 3VGAC 3BA9A 5ALBH 4DKTA 1EEZB 1XSKA 2FGWL 4DVRL 3BRGC 5E94A 1QLEL 1CDGA 3EFDH 4E42A 2QBWA 5CP7B 3RIFK 4FABH 5GGQH 4JFDD 1IAII 4ZPTA 3RVVD 2DQCH 2OMYA 3RDTA 3S5LG 2XZQL 3T6VA 4HNAB 2OYPA 3F3HA 3LZPA 2ZKWA 2XYCA 1PIGA 4FOMA 5E2UH 1IAOB 1K4DC 2F5AL 2LP7A 2O57A 3ARFA 4PRHA 4PRPA 3RBGA 1P4RA 2NTFB 3KYNB 4GXFA 3PUUA 1ND0A 1D6EA 4XBPA 3WO3B 3HPLC 5MEPB 1F90H 2CHDA 3D3VE 3KEHA 2PZSA 1JVKA 5ADPH 1E3ZA 1DQIA 4XDKA 5C0EB 1WA2X 3ETTA 5GZOA 5FS5A 4YN3A 3O2VH 2PCPA 3G67A 1U91A 3QI9D 1PCSA 5D7LD 1T0PB 1VCAA 1LK3H 2YWZA 3JSNA 2NY3B 1U8QA 5D55A 1HH6B 3TEWA 2J1KA 1QI3A 3CK0H 3ZT6A 2EZ0D 3LS5L 4MAYD 4YSCA 5ACZA 4OCLC 5IFHH 4K5MA 2WWWA 1KZYA 1K2DB 3MRPB 4UILH 5J8OA 2YPVH 5KSAA 1VA9A 2IANE 2VLRE 3LMJL 5CILL 3E6FB 1XDTT 3FO0H 3QQ4B 1PNCA 2XTJD 2OK0H 3IS1X 4GYCB 3O3BB 1T89C 1S9VB 2FHCA 4G7QB 4Y4KD 1MFAL 4OJDH 5MEOA 1XBRA 5ESQB 4A7TA 4O4HB 5LBQA 5LAXA 2DE0X 3RX8A 1QHOA 1OPOA 4OJFL 1I0HA 4X6CB 1GS7A 3H9SA 4X98B 2X10A 3BXNA 1K3EA 2YZ8A 5GGTA 2F5BH 3VA2C 3QGVA 2IBZY 4FQ2H 1GHFH 2VM3A 2BDNL 3CN1A 3Q43A 4PP1C 3E8BA 4DRXA 3QQ3A 2EINB 4YZFF 2EUVA 2CH8A 1I7ZB 2YFOA 4BIKA 2BP3A 3CX5J 2A9NH 4K3DH 1I1FA 4H25B 2E7LC 3FB6A 4ZDHB 4PN6A 4O9HL 4WV1B 1V54C 3O8XC 2OMXB 1WCBA 3EYOB 1F23A 1KELL 3GHBL 32C2B 3CPUA 2GJ6A 3QDAA 5ETUA 1UACL 4MD4A 2ERJC 4WW1B 4N9GB 1JF1A 3IMVA 3FH5A 3RIFF 3VGBA 1AVMA 4GZRB 4BK5C 1VEOA 1K8DA 5JHMA 3DUSB 3L3OA 4L4VA 4HWBL 4M7KL 5JJEB 3WN5A 4OJEH 2GHWB 2YD0A 4DUZO 2RJMA 1OP3K 5INDB 2DYRB 5C0CA 4I2XA 2QSAA 4RFEB 5DVKA 3RNQB 2Y7OA 2BHYA 1K33A 1H0DB 3EOYG 1PX3A 3QUMB 2ED6A 5LB1A 3WE6B 3ULUC 5KVFH 2XU9A 3NFPB 3PXJA 4QWWD 4UB6Z 3HMXH 4FG4A 2D2CC 2OCFD 4ZMTA 4PRAA 1BYPA 1AZRA 4JYBA 1VACA 4YXLL 4PR5A 4NKDB 2IU0A 1U4EA 1LM8V 3QEHB 4CW1A 3LKOB 2XC8A 5CBAA 1GMEA 4ZQKA 5EC2B 3GSRA 3OR7B 1KBGL 2YAPA 3DVNB 4H1LH 4XOAA 1CQKA 3OMNB 2IDUA 3ABGA 4QEGA 2ZF9A 4WFHD 4XCFL 2CLRB 1QBBA 2YD5A 3LXCA 2F66C 3UOAB 3UBXB 1DBBH 2FYYB 3MRIB 1MLCA 1M4KA 1WA8A 4HW6A 2D3JA 3GSQB 1UB5B 4L3AA 1YAIA 4HSQA 3D12B 3TT1H 4AYFB 4UDTB 5HYJB 4FLTA 1I8AA 2D0GA 5TPWH 3L5XH 2WLLA 1KYOJ 1WDAA 2H3XC 4KUCF 2BX5A 3RWDB 3S3DB 4OM1H 1FPTH 5LGHH 1AE6L 3V4VA 2J43A 3TETA 1ZIAA 1HNZB 2XQBH 3V7AG 5HI3D 1O9VA 3Q5OA 1GAFL 1RIHH 4MD0B 2IOMA 3LB6D 5IBLC 4LB8A 3WNIA 4PD4J 1M2VB 1EDHA 4XCYA 2QJ1A 4GXUN 3FAWA 1OY3B 1IO4C 2YWYA 3HKDA 3PFQA 5SWQA 3M17A 4WHCA 2DYPA 1P6WA 2V7NB 2PTUA 3O4LD 1Q6IA 1X9LA 4Z7OE 1TPXC 2DLTA 3L4CA 4DGIH 5GZNA 4E36A 1G6RL 1AQDA 2G4GA 3WTYA 1N5AB 3FFCD 4EBQH 5KS9E 3X1GA 3VXPB 2FRGP 4KKAD 1DQJA 1VGEL 3E83A 1TNMA 4ZS7L 3UEZA 1EZVH 1XHZA 3FU8A 2WVSA 3EFOA 3WS6A 5HI5C 1MCPH 3K5RA 3Q13A 1TQWA 3S96B 3NJIA 1YY8A 3O45B 2BS9A 3C8KA 4Q2ZB 3QUZC 3NK4A 4P5MB 2DB8A 5E7FA 5KG9B 5AW3B 1M90W 1YEJH 1ZL8B 1KGWA 2WV3A 3VXSE 2MNJB 1KBBA 1TYEB 4ZAKB 4HAGA 1CLCA 5KSBE 4FQIH 1RV6X 1YEWA 4BFJA 1GH7A 2YAFA 2V3EA 3QFJB 1M6OA 2YGNA 5J2UA 4XWGL 4F6RA 1XT5A 5KHHA 1GYAA 1GRWA 4QCIB 4B7KA 1FNSL 1YEKL 3BPNC 5BZBA 2L4OA 3F7YA 4PJGB 5DSCA 4J2XA 3U6RA 1NCDL 1AQKH 1EAPA 1B4JH 4JF3A 2UX6A 3NPSB 2I26N 5BCAA 1P49A 1BZ9B 5AKRA 4YJ3A 1CZ8H 5L2KD 3HRPA 3ZS8C 4W6YB 1TZIA 2CK0L 4IT5A 4Z23A 1A0QH 4FKHA 1PFCA 3FQTB 2XPZA 3CN2A 3DMMB 1PNDA 1E8WA 1SBSL 4EI5B 2HUEA 3CHQA 3OHXC 3VGFA 1G87A 3ETSA 4HS6A 3VWJD 1FN4B 2I7OA 4A2MA 1DF4A 4WBNA 1SKVA 1IBLB 1GJUA 4BK8A 1IGJB 4EO5A 4FQHA 1AP6A 2G3ZA 1NEZG 2YXLA 2P48B 4NI3A 1TFPA 3EYUH 3NCEB 1ZDQA 4P5TB 1U6AH 5JW4M 2EDWA 2Q76B 4FQJH 4FULA 3BKCL 4MCZA 3V0AC 1NFDB 4HIJB 1RVFH 1DQDH 3FF7A 2QGNA 5GGUB 5DD3H 1RHHA 3H0TB 4HXAH 5D1ZD 2O5XL 4NSKA 3ZGIA 3BEHA 3EKCA 4GG6F 1PFOA 1Y4MA 4S10A 4Y19B 5HVHB 4KI5D 1ZWIA 5D7KE 4YVNA 3S35H 3E2EA 3NA9L 2FO8A 2D73A 4HH9A 3T04D 4Y16A 3AXLB 4G6AC 1E5YA 4HP5A 5MENB 4F6EA 2FKXA 4PMFA 1QLRA 1MJ8L 2HVJC 3KWWA 4XMUA 2MNWA 5HDOA 5LHGA 4DR5B 3TT3L 3VB8A 3AXIA 4LO9A 5D96B 1Z2KA 5T3XL 1AMXA 4K23L 4O2AA 4HJ1A 5HJ3B 2ICCA 4CMHC 4M29A 1S76D 1P0SE 2R4RL 1ZAGA 1KIRA 3V0HA 2V5SA 3QNYB 5ACMA 4LU5L 3G6EV 5L8LB 5GRUL 4DP0X 3MRQB 3BMVA 1BMGA 5E8NA 1S7UB 4FZ8H 5IW3A 3SE4C 3FUMA 3PRZA 3X11B 1FO0A 3RQ3A 3JD2A 1FCCA 3BAEH 3OLIA 4YHZL 4JI7B 4OFKA 4B9CA 5DUBA 1K5NA 4BD4A 3T1YO 2VSKB 4WTZG 5J1SC 3F5TA 2Z9TA 5F7NC 5LP6C 2WZ0A 2ZCZA 3FSVA 3IFNL 3QDGE 4GW4A 3MD0A 3PQYB 3QEQB 1GN6A 1F3DH 4G27B 4FFVD 3BN3B 4QRUA 2Q87A 4RAVB 4ETYA 1Q6HA 2H94A 4PGCA 4Y5XC 4UNTA 5B1OA 3KPTA 4KXDA 4PJ5A 2E4TA 3ZMZA 2WAMA 2C3XA 3CQPA 4AC2A 4D94A 4G7YH 1BVLB 2PYLA 2BSDA 4WUUE 1DFBL 3UGEA 1SZNA 3AQXA 5DC2A 3UTTE 4OGYH 3C60A 1CD0A 4MS8D 4R0LA 2WWMD 5K1PA 2X38A 2B39A 1CJYA 1G1OA 5KW9H 1MCEA 4X4XA 4Y89A 3B9KD 5DA0B 3T2QA 4LLAA 4N8VB 4PU2A