3SPHA

Inward rectifier potassium channel kir2.2 i223l mutant in complex with pip2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 89
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3sphA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3sphA01
4I9WA 3LNMB 1J95A 3ATEA 3LUTB 4X89A 5CBHA 2ZD9A 5KUMA 2AHZA 1R3LC 4G27B 4PDMA 2NLJC 2P7TC 2EILC 4QNHB 4MS2A 2BOCC 4JTCB 2WLLA 3LDEA 1OCCC 4QE9A 3K0GA 4PA4A 5BZBA 3RVZA 4XDJA 1G4YB 1ZWIC 4R50A 5EBLC 4JTAB 4MTFA 3SJQC 2EIJC 2EIKC 4RO2A 3AUWB 1V54C 2QKSA 2HJFC 2HG5C 4MTGA 2EIMC 2ZXWC 3FB7C 4MSWC 4PA7A 5EC2C 3RVYA 4PDRA 4WFHA 1KKDA 2X6CA 1R3KC 4PA3A 4WFGA 5E1AC 4ZBMA 3AGWA 3F7YC 3OGCC 4MTOA 2EINC 1S5HC 3ZRSA 3BEHA 2DWDC 3AG4C 3F7VC 4MW8A 5B3SC 3K08A 3SYCA 2R9RB 1U4FA 4PDLA 3E89A 4UUJC 3E8FA 1V55C 3LDCA 4LP8A 3ZJZA 5EK0A 2HVKC 3FB8C 4PDVA 3ATDA 4J9ZB 3SPGA 4P9PA 3F5WC 2DYRC 3LDDA 4GX2A 3UM7A 3ABLC 4GX5A 4XDLA 2YEVA 5IY5C 2HVJC 3K04A 2A0LA 5KUKA 3FB5C 3AT9A 3E8GA 2WLHA 3VSQA 3UKMA 3ATFA 3ASOC 3SPJA 4TWKA 3SPHA 4F4LA 4WFFA 1U4EA 3AG1C 4MVUA 3SPIA 2DWEC 2K1EA 4HZ3A 2OCCC 2WLLB 3EFFK 4LCUC 4MVOA 2X6AA 4PA9A 3K06A 2A9HA 4RAIA 3R65A 1R3JC 5B1BC 2H8PC 3ASNC 4H37A 2AHYA 1JVMA 4EKWA 3RBZA 1OCOC 2WLKA 2WLJA 3JYCA 5EBMC 3AT8A 4OXSA 3STLC 2WLMA 4MW3A 2WLNA 3T2MA 2ITDC 2ITCC 4XDKA 3E8HA 2IH3C 3HPLC 4PA6A 2QTOA 4WFEA 4KFMA 3SPCA 4R8CA 4X8AA 1ORQC 2Q69A 3SYPA 1LNQA 4QE7A 3STZC 2BOBC 4GX0A 1M56C 2Q6AA 2WLIA 4J9YB 3ATBA 4RUEA 4MVSA 4MVMA 1N9PA 3ABMC 3TETA 3GB7C 5CBGA 2GIXA 3K0DA 4JTDB 1R3IC 5J9PC 2KB1A 4MVQA 2X6BA 3SYQA 2HFEC 2E4FA 3ABKC 3TCUA 3E83A 3OR6C 4R7CA 3T1CA 3T4DA 5EBWC 3K03A 3T4ZA 3E86A 5CBFA 5EC1C 2WLIB 1K4CC 2JK5C 4X88A 2Y69C 3IFXA 2ATKC 3X2QC 2A79B 3AG2C 4R6ZA 1P7BA 4HYOA 2IH1C 3SYAA 4MVZA 3OUFA 1M57C 3WG7C 1OCRC 2Q68A 1QLEC 3E8BA 2Q67A 3OUSA 4RUFA 4P2ZA 1BL8A 4P9OA 4BW5A 3PJSK 4DXWA 3ATAA 1XL6A 1XL4A 4LBEC 4MVRA 3FB6C 4P30A 5B1AC 3SYOA 4G28B 4GX1A 3RW0A 3VOUA 1K4DC 2W0FC 3OR7C 3K6NA 2DYSC 1OCZC 3AG3C 4H33A 4CBCA 3KG2A 3IGAC
chains in the Genus database with same CATH superfamily
1ES0B 4LAQH 4ABVA 2LFRA 1QEWA 1FNSL 3U0TA 4V1DD 5IW1B 1VQLV 2GB2A 3TJHC 5L8LB 4NT6B 4U2ZA 4ZMOA 1JZ5A 1UZ6E 1XHZA 3EJQA 5EIIG 3MJ7B 4PLJD 5K1NA 1SXCA 4FOMA 5FM4A 1FFOA 1HQRB 5IVXF 2G3MA 2OKMA 4PJFB 2N4IA 3PJNA 4GINA 3WGVB 1Q43A 2D3JA 1OE2A 3BVNB 4PSRA 3LPPA 5B38A 1FRGH 3FS9A 2XWZA 4JHUA 4PA3A 3BAWA 4I1RA 3UAJD 2ZAHA 3PABA 4L3EE 3US0A 3S96A 3ZRFC 4HBCH 2BH0A 2BW5A 3JWNE 3WAKA 3RVTD 1JYVA 4CN6A 2DWDC 1BAFL 1U9KA 3GBDA 4TUJB 4V2CB 1E28A 3V4PH 2I32A 4CVUA 4P46B 4NI3A 1AFVH 3TEWA 3IMSA 4NZJA 2EC9U 1C7TA 3U7WH 2Z1KA 3DX6A 2QZQA 3IFNH 3RNKB 1I8MB 1YJWV 3DXAE 3F7LA 4Y19D 3DHUA 3CPLB 1UD2A 3NG5A 1PG7L 5FA3A 5FYLL 2ESVA 1CI3M 4Y5XA 5I1IH 2Y69B 1VF6A 3EDFA 3VDAA 3QQXA 4RMWA 3ZDZB 3HKEB 4CH6A 3J7AU 2E8YA 5EPMA 4FVMA 1C16B 5D2LB 4W93A 4BK4A 4RISH 4DPCX 1HNXO 1OP4A 4XI5C 3SKOB 5IJ9B 4Z7VA 5FL7G 3SR2C 3L3IB 5KS9B 5DVMA 1KBHA 4B3RO 4Q6IB 5DR5L 4DV6B 2H6OA 2ZT9B 3ECVA 1OCOC 1F51A 1Y6KR 1A7QL 3QXDA 3A4DA 4UIKH 2OL3B 4WUKH 3QO1B 2IV8A 4OZGE 2E9WA 1YA5A 4XNZC 1OCWH 1WFUA 2Q9OA 2NY4C 2BSKA 3QRGH 3W5MA 1CGVA 4JY4B 4HFUL 2A6JA 3AMLA 5T1LA 1QLEL 2NR6A 2WC7A 3A6OA 4XCNA 4N2CA 4X4ME 1ZWIB 3J2PA 5HGBA 2Z7YA 3DO7B 5FO9B 1JWSA 2KHAA 3VB8A 1JQ0A 1KB9J 4HBQA 3AWGA 1G6RL 1F4XL 3U46B 4B96A 1NBMG 1F4AA 3PWPB 4UINH 1FPTH 3FU5A 2VDLH 3TZVB 1DVSA 1LQSR 1H2SB 4I50B 1AC6A 3AZUA 1H6TA 4DP1X 4F7TA 1AXSA 1ITBB 2GTZA 2IALA 4WWNA 4E41D 1K8DA 1B0GA 1CDYA 3UG4A 1TZIB 2FMLA 1XGTA 1NAMB 3TCTA 4ZFQA 2BNRA 2BZ7A 5CEZH 5ACLA 2QEXV 4YSTA 4J4PC 3VI3E 5TQ0L 1QTSA 2CO3A 1CTOA 5FC9A 2V5RA 3QG6A 1C08B 1MNUL 3O65A 4RWUA 3FAWA 2YKLH 4G28B 1WP7A 1QEXA 4M48H 4OZ4B 3D3VA 4WFGD 4PJAE 1J1PH 1L7IL 1TVKA 4PG9A 4JAMA 4ZFFA 1YSCA 4LFHG 2K78A 4G1EB 3X13B 2FSEA 3CN2A 4OGAC 2W94A 2EYRB 1XD0A 4P9HL 2L4OA 3D2UD 4BRJA 3T4AA 5AVVB 3EDEA 1RJZB 2IIJA 2YA0A 3BSGA 2A6IB 4A67A 1SY6A 4D94A 4PJXF 3KPMB 5J12C 3HCVB 3NUKA 1S0VA 1CWVA 1WAAE 4G8GD 4L8DA 5A40E 5ALCL 5I1EH 2PY5A 4XHJC 1SHWA 4D7BA 3I6KB 1EHXA 1KKDA 1V9PA 1FNGA 3LQZB 5DUML 5IE9A 3U2SA 3Q4HA 4HJ0D 2J57A 1RD6A 1TXKA 2JKWA 1FSKB 3MVSA 3OGOE 5IW3A 3T1FA 5B3SC 1CN4A 5B1OA 5F9OL 2CPUA 5LAPA 4XO3A 3NH7H 4HPOL 1KJ3H 4XXDB 3FB8C 3S2CA 2PW1A 2Y0PA 1J9TA 3MUJA 4XVOA 3OKKA 1KLFA 1L9OA 2XA8H 1MFAL 3SDCB 4CW1A 4JO1H 4UQDA 4NN5C 2Z91A 2X28A 1Z5VA 5SWZA 2A9NH 5KUKA 4QF1B 1P5VB 4KITB 12E8L 1FV1B 2I7OA 2AQSA 2FEDC 5FCUL 4KROB 2N1TE 3ZTCC 3BQUA 4XH2A 1KLUA 1IQDA 3FQTA 5BV7H 3QEHA 3BZFA 2ZXWB 5ID1B 5A2FA 4DR6B 4ZAKA 3BP5A 1A32A 1CD1A 3FTSA 1HHJB 5DXWA 3LZOA 2H8PC 1RPOA 3LZNA 3UTTE 1Y18B 1PD1A 4UT9L 2AHYA 1XMWA 4NX0A 5C0EB 3K91A 3ZE2E 1EMTL 4AM0A 3MBWA 4DV1B 3MRDB 4BQ9A 1MDAA 1VZIA 1SFDA 1LO3L 4TSCH 4YDLB 2WZPA 1MCJA 1HE8A 3PGFH 3IF1A 4UUJB 4ADJA 3CMAV 2AABL 1VQMV 1BZDA 1QA9A 3BH8B 4I18B 5AW6B 1TUBB 3EHBC 4I1PA 4K8RD 1RIUH 5DVLA 2ZJSL 3SYPA 1HR0O 1FH5H 2UXBO 4Y88A 2BSSA 3FYEB 2DWXA 1J5OL 3DX7B 4JKPH 4H8WL 4J3VA 3CDZB 3N9GL 4M93B 1Z9PA 2C8NA 4BW9A 5ESVA 2RQ8A 3WUWG 1UOLA 1NFDA 1RPUA 1MREL 2ILLA 2QWNB 1GO3F 2ADIA 2DV6A 4N21A 5FDWB 3SB3A 1P84F 4OCYL 2BFVL 2XWBB 5JVDB 4K7FB 3OF6A 1A4BA 1QPPA 4XPGH 5BOPA 1RJLB 4UQEA 5KVEL 4YSRA 1D7CA 5DZAA 3FK3A 1B2YA 5D5ME 4GKKB 3QXAA 1T4KA 2O5XH 4WW2A 3D85B 3VWKB 1UM5L 3MLRH 4QAWA 4W9CC 4YDKH 3MV8E 4MD4B 4O4JB 4IJ3C 5IQLA 4U7NA 3BAKA 5C9JA 4OQTL 1H3VA 2EUVA 4ZJ9A 2FH6A 2PW2B 2H2SC 5INCB 1OSPH 3SN6N 3QZWA 3IVKA 3U83A 3LRLA 4M6OL 2PCYA 4IOIA 3SE8H 4G6ML 1L0NH 3KBFA 2MWCA 3OZLA 2HTLC 3C60C 4OH2A 1I7ZA 4BCZA 3P4NA 3UERA 2CZNA 1AJNA 1LP9B 3TA3B 1LQBC 3PHOA 1JGUL 4DO5A 4HV8A 4OLUH 1QHOA 2FJGB 2XQYG 3H6JA 5EB9A 5EBLC 1MHHB 5D8JH 4K5LA 3AJ7A 4Y2DD 3KGUA 1YVLA 3MXWL 4FGMA 2OMWA 1OAKH 2F74B 4V1DA 4CADB 1KCUH 3ET9F 4N5UA 2V0AA 2BRQA 1SN0A 2F4VB 1S9VB 3MUZ1 3RGVB 2G9KA 2UUAO 1DBAL 3IMTA 3M8OH 3EO9H 4XODA 5B1CA 5HYSG 3N43B 4H5SB 2BVQB 1DN0B 1JZ8A 2OMVB 3IMBA 5I1LB 2OX5A 3ETDA 5KBNC 2ATAA 2BY3A 1PZUB 2JJ1G 4H88H 3ZDWA 2UYLA 4Z9KB 1GW6A 4ONGH 2MQCA 3UAJA 1T7ZA 5IKCA 4L8SB 3TYGH 1J5DA 4HFWA 4FFWC 1K6QH 3KYNA 3ZUCA 2L35A 1A1NB 1U95A 2RFXB 5GRJL 4KPHL 4XAKD 4ZXBC 2J7LA 3AS2A 1WBXB 4MA3B 1F97A 4HLZG 1MXDA 4U1NA 1QSED 2VDOL 5GRXG 6FABL 3N1QC 5HD8C 1T03L 4ISVA 5ECJE 5D6DC 3B2PA 4Y19A 4NNYB 5L7XL 4YE4H 2DBLL 2WYHA 4ZUTA 5LGHH 4POUB 5A16A 2HTKD 1AO7E 2XCMC 3FUMA 3IETA 3RWGA 4R4ND 4P23B 5AVRB 4BGLA 3MKKA 4J7KA 4JI4O 1P84K 2WXIA 2EO1A 4FJYA 3AWFA 3CZKA 5D1QC 2WM0A 5MEPA 1Z9SB 3FU6A 4GNKB 1KTKE 4YK4B 3D2TA 4XVUC 3B9KB 5LN4A 1WA2X 5FKPB 4L9LB 1G5AA 2EIMB 1E7UA 2GSGB 2XOTA 5DEGA 5CLZA 1E8ZA 1T22B 4LCUB 1IAIL 5J2TB 2OYPA 3OBAA 3TF7C 2Z93A 3QR2A 5L2KB 3MHHC 5L9DL 3MRBB 3L9YA 1PMYA 4U6YA 1KC5L 4HA1A 4GKSB 2Z8WC 5GPRA 1OTSD 2PI4A 1TYEB 4XNQB 3WXWH 2EXWD 1AGDA 2VUOA 4FQIL 1PG7H 4Q2ZA 5FYLH 5JHLA 2A99A 3MCLH 1VERA 2ICEA 1KG0A 1HT6A 3OHXA 4YBLB 4YWGH 4AYDC 1US6A 1S9WB 3NYKA 5LGJA 1SNRA 1UJ3A 2I7SA 2DYSC 2QKIA 3MZGB 4LSPL 4Z7WF 3ZHDA 3D9AL 1LVEA 4PW3A 3WLWD 1G7LA 3K2KA 3LUTB 3T8MA 3HTLX 3U4EA 5B8CB 4E41A 5JW4R 5A7BA 4NKIH 1NVPD 3ZGIA 1MH5A 3A5VA 4GLRH 3ABKB 1CT8B 5EH1A 1X5HA 4WFBV 3RWJA 5DR5H 3MCG1 3AU1A 2Z4QA 1I9EA 3I75A 5EC2A 4I0KA 5IVXB 2QA4V 1DUYB 2YMXL 3VH8A 4X7SL 5IFAL 3VW3L 3TBVA 2QQKL 5ITFB 4Y16C 4OKVA 1MA1A 4K8XA 4LLYA 1FLTX 2QADD 3SY0A 3VWJB 4HFUH 1BMFG 1NGPL 5GJTL 4WFGA 5GIRA 4IYIA 2CWRA 3TH2T 5J57B 2YN5A 3IKCA 4GEJA 2J2ZB 3VRIA 4ACTA 5CGTA 2XIBA 2CRZA 3AY4C 2ZT9C 1WG3A 3DUSA 4XC1L 4NQTA 3NZ8A 4KJQC 4UM8A 1AGFA 1IEHA 2CA4A 3WV0A 1XGPB 1G6RH 4HS8L 3D2UA 1F4XH 4N4YB 2BTQA 4NO3B 2APVA 2I07A 2KQNA 3NIDF 5BUPA 1HXMA 3UTQB 3QEUA 3SGJC 2AANA 3BVVA 3RIAF 4MYWB 3P9LB 4MSWA 1Q1PA 3O2DA 4G8GA 4M8RA 3LRHA 1EO5A 1G7JA 4ZI8A 2AJXL 1USQA 3RKPA 1E2WA 2HFTA 4FLOA 4M56A 1YNTA 2ATKB 4K9EC 1EZSA 1PLGL 2LABA 1X5GA 4B5EA 2CUAA 3S5ZA 4JI8O 2FEEL 1GC1C 5HHQB 4K0OA 1F11A 2E5LO 5LCVA 3DPBB 1J0HA 3C3SA 1KJVB 2X4QA 4HHAA 2IQAB 4MA7H 4KU1A 5LA6A 4MNGB 4X7EC 3T0BA 4B3SB 2J1WA 1V3KA 1L7IH 1JZ3A 4UOQA 4JFWA 1Z9MA 1S9XB 2LFEA 4TNWK 1NFAA 3JV4B 3TIEB 5L4JA 3ALXA 3E80A 2EIBA 2UUDK 3NZUA 1M6UA 4WNQA 4P9HH 3L7EA 2HJLA 1S7SA 3MUGB 1C8QA 5DYFA 5FYKE 3SKUD 3ZZLA 4LK4A 5DU7A 5GGTL 2CH7B 4JV5B 2B4CL 1FFNB 2A4EA 2Z64C 1IM3D 4XTRC 2HLAB 4DOHB 4MJIB 2JTDA 3L6FB 2YIBD 2PWHA 2VL5B 1WUNT 5ALCH 2F54D 4FTVB 4DPBX 1AS8A 1T1ZA 5DUMH 2V2TA 3NSDA 4K3HA 4S10A 4CMHC 1SQQH 4JI7O 4XVSH 3IXAA 3NPSC 5F9OH 4FLTA 2DQTH 4WRLA 4XWOD 5I0VA 3EYOA 3UZQB 4AM0Q 2Y7QB 4HPOH 2VR9A 2OTUB 1EVUA 4QIRA 3FU9A 3QIUB 1I94B 2HPOA 4MZRA 5EU5A 2NXZD 1SQBH 5HHPB 3BZ5A 2H3NB 5CSZB 5E0FA 3CIAA 5DVOA 1YCIA 5CA3A 4P2ZA 4QHUB 3V0VA 1PG7W 3L74H 3H54A 3MRCA 1HOEA 4GQRA 4Y9FA 12E8H 1EDQA 3WHE1 1RI8A 5AALA 5FCUH 4Y1AD 4Y4FD 3SE9L 3STZB 4Q6YA 3SE3A 4J3OF 2ATPB 3MLSL 5TE7L 5DRNB 1S8DB 2GAZB 2XAQA 4PJ9B 3SDCC 4CN4A 6CGTA 2ROYA 4LOFA 4UT9H 4RZKA 3CMOL 1EMTH 2QTVA 3OWRA 1KB5A 1AS6A 4PJXB 2C7UA 2G0LA 1XCQA 1KYOF 1HHGB 4NQUA 1LO3H 1W2KT 4RAVA 3X2QB 5FA4A 3QUGA 2AABH 3RIAK 2KH2B 4I0XA 3X14A 2ZXWC 3IGKA 5SWQA 4YJ3B 4WFEE 3GSXB 5DC4B 3ULUL 1PG7X 4KQ3L 2ESVE 2FX7L 4KXAA 4DCQA 4AC4A 4R7NB 3QUKA 3IYLW 1MPAL 1U3HB 2ZSWA 3WMPA 3IDJA 4YDLC 4H8WH 3KWTA 3N9GH 1NANH 4UUJC 2QR0B 2H6PB 1OD9A 4EB6A 2FYVA 3KEDA 1MREH 5INDA 5EF1A 4NPYB 3AQYA 5TGBB 4OCYH 5DJ8B 1W0WB 1XB8A 4ZS7H 5I5MA 3C6EA 2D7OA 1FL3A 4Y2DA 5KVFE 5IB2A 4F92B 1GM7A 1R33A 1XV8A 1HSAA 3QFJD 3SZKC 3T3MF 3ETBJ 5JNYB 2JRIA 1W0KG 3W56A 3TNNB 3OB0K 1UM5H 3NJNA 4UI2A 1KPRA 1QLEB 5HI5D 4IHJB 1K7DA 4IDLA 4OQTH 1BQLL 2UUDH 2WO2B 2IWGA 1TTRA 4YHOL 2DJSA 4NBZB 1ETJA 1G6RB 2BE3A 1RJCA 1EV2E 4A04A 1P69B 4G6MH 4EVNB 4ZPTA 3UAFA 4EZMA 4PRAB 3V0FA 2EDLA 3DX9A 2B8OT 2HKAA 1YPZA 3LKOB 1J5EO 4BH7B 1CFBA 3CC5B 1W16A 5E24E 1JPST 2L0DA 2CGZA 4MQSB 3BN9D 1OY3B 5EU3B 3IWUA 1OGAB 5DHDA 3LKPB 1QSEA 2K1MA 1EFXB 3JALA 2F1MA 3KPSD 2Z4TA 3KHOA 3MXWH 2F7PA 4U6HB 1F7YA 4FD0A 4M8UA 1F3JA 3SHSA 5I75B 3GS7A 3LB6C 3TA3C 4B9GA 1ZRUA 3SQRA 1J9CT 1U41A 3LNEA 5C86A 1ACXA 3D3VE 4YBQD 4N8CL 3T0EE 1ROCA 2BOBA 1PDKA 2DQUL 4Q58C 3ULVL 4J3TA 3STLB 3IJEA 2F43G 1F6AB 3BZEB 4OLYL 4UAOB 2XICA 3F01A 4A2MA 4TQPA 3SGDI 2VM3A 1FZKA 5C7ZA 3E9TA 3OUSA 3T0VA 5I23A 1KYUA 1IM9D 4Y4HB 4FYTA 1HFUA 4JFPA 2F08A 1FAFA 2VITA 3W0WD 4X1YB 1XXDC 2CGOA 1Q6IA 1FC2D 4G1MA 3P11L 4U7OA 5JZ7C 3MV11 5GRJH 4KPHH 1NFKA 3HC4L 3D07A 1ZJBA 3GIZL 4MZIA 3Q1SL 6FABH 2VDOH 2R9AA 1R3JB 2QSAA 2R1XA 3N50A 4H8HA 3ZKQD 4F1SA 1T03H 2FHFA 4QE9A 3C5ZD 4ORGB 4AIOA 5L7XH 2DBLH 3BIKA 4L8SC 3HC0B 1YF2A 4B3TO 4BKLB 1TJIL 1DDHA 2H26B 5JDSA 1R24B 1NCNA 5LBSH 3WD5L 2J6EA 4FYQA 4HZLB 1RK1B 2GCYA 3H9SE 4N2LA 3BWAA 4WEMB 4YSDA 1JGVL 1GAXA 4NQXA 4N24A 3BVOA 3R1GL 1H2LA 4Q14A 3LZPA 2DQCL 4AEIH 1I1FB 3U4BH 2KZWA 4NQEB 1RZ7L 5KAFZ 2HFEB 1M2VA 3IMWA 1XAKA 5B22A 5I66B 3M17B 3OB0H 3HG1B 1Y1DA 1IAIH 2Y5QA 4PMFA 3HFFA 4KKBC 5EUOA 2O4EA 3DC5A 4MWFB 4YK4C 1NUNB 4EBQH 3HPJB 1GJWA 3EGDB 1KC5H 3P4OA 2EVJA 2J20A 3ABUA 4NQSA 2CA3A 5BV7C 1DANU 4X99B 4L4VE 3OMAB 3NN8A 4NEHB 4YVNA 4LCUC 4AYSA 5M95B 2VUKA 5LMUB 2A3TA 2E9BA 4GO8A 3FN0L 4JLRB 5C6PB 3KYMA 2BSTB 5T1MB 1GN3A 2CGNA 1R6NA 3D9AH 1M7DB 2IBZH 1NWOA 1KN2L 1MLBB 1WRFA 1OGTA 5CZRA 3DRTA 1B06A 3MGOB 4PY7A 3OD4A 1E4JA 1J0KA 4JDVB 4L5FL 4CVXA 2C1OA 3BO8A 1UHVA 4HUKB 4A7QA 2YMXH 4LSTL 4X7SH 5IFAH 1PNLA 3VW3H 1XXFC 1YEHL 2QQKH 2E46A 2Q6AA 1GR7A 3W81A 1Q3EA 1SQFA 1BOYA 1PNDA 1W8EA 1GYWA 1IC0A 5J6HA 3GYRA 5ISZB 3T71A 5B8CC 2KB1A 3NJKA 3JZ7A 1NGPH 5GJTH 2DPKA 3TN0D 5MENB 3LRKA 4NS0A 3ABKC 1XMQB 3MRLB 4XMKL 4YHNA 3QZOA 5IV2A 1Q9KA 3HBZA 3DHMA 4M6AA 3RX8A 2OXGB 1QHPA 4XC1H 3GC3A 4NKDA 4QO1B 4AENA 3S8FB 3L3KB 4PCSA 4HS8H 2C9UA 3S3BB 2G5BA 3NR7A 1G7IA 2PWEA 3KNBA 5C0JA 4KJWC 3MRGA 1IM3A 3OXRA 3MYJB 1FYTE 1S7VA 4IU3B 4NO0D 2YIBA 4L1TA 4NBYB 2F54A 5FHBL 1U8LB 5HHXL 2G75B 3JTTA 1BL8A 4UTAL 2Z1PA 5E51A 4LBEC 4JFQB 4Z7WB 4AQAA 1I4FA 4ZI7A 1N12A 3PGCB 2DYPB 4K0KO 1EAPA 3L95A 3FSWA 3CJJA 4PELA 2WTRA 2UY7B 3C5JA 2HMIC 2X4PB 4PDMA 2A4ZA 4OGYL 4KRLB 2PPDA 1Z3RA 3RA7L 4AGMA 3M1OA 1S7UB 2X4UA 4DO4A 4JFFE 1PV0A 3KZIZ 2BPBA 4AQ1A 2B7DT 1UATA 4ZT1A 3D25B 4Z7UF 1J12A 3D8CA 4MXWL 5TDPA 3VFWA 2D0FA 4PRID 1CDCA 2ITDB 4GAYB 4Y1AA 4Y4FA 5E9DD 2JXMB 2VSCA 4WI6A 4OZIF 1VQNV 1I3UA 1JFFA 1A4AA 1CP9A 2DQ0A 4FLWA 1WC7B 5E4IA 2UUBO 2B4CH 2HSIA 3S3XA 5GGTH 4MS6A 3O4OC 1BS3A 2QQQA 4NYLB 3NIDB 2R0ZL 4GSDL 3WFEL 2CE4A 2Q7EA 1JXDA 1KACB 4PJFE 4KBPA 5DLMH 2VDOB 4GQ9L 2ISDA 1IKFL 4DR4B 5IR1A 3FU8A 1YXBA 1XWVA 1Y76B 1BW8A 4A1RA 4DGUA 5E4AA 2FBOJ 4GW1A 1RUPH 1FVEB 2Y2TA 3NRFA 1Z1WA 1XTMA 2G2RA 5C8JB 4LSUL 1YYLL 4X62B 3U6XA 1RJYA 2FE0A 3TEUA 3D52A 4JFZL 2VRZA 4X66O 3SE9H 1XGRB 4H37A 1MZYA 4MDJB 4KVNL 4XPHL 3MLSH 3IEAA 2VSMB 1HHIA 4OZFB 4UTCA 5MERB 3TV3L 4D0DB 2YPKB 3C6LD 5TE7H 1GSMA 3QFJA 2WYTA 1N26A 2C3WA 4F7PB 3L54A 4W9IC 1HNWO 1A9EA 3QUML 4P59L 5AEAA 3N27A 4XOBA 4TN9A 5D2LE 2DH3A 3WMSA 4FEIA 3TNMA 1JE6A 1QW9A 4QE7A 3STZC 4J6RH 2YRPA 3EYSL 5JQ6L 5DT1L 4WU7A 4P2RD 2F6AA 4P5MA 4JGMA 2XZQL 4PJ8C 3S9DB 4PV1C 2ITCA 3L4XA 4I1NB 4WEEA 4KQ3H 1TMCB 4YNYB 2FX7H 5C3IA 2PZSA 2X1OA 3OSKA 3EKCA 3PF2A 4Q56A 4R7VA 4RX4D 2X89D 3G5XA 2YSTA 3SODB 2E7LC 1CGYA 1MPAH 4U6XA 3AT0A 2ZTBA 5FGCB 1XDTT 3X2QC 3PAYA 1PQZA 1EBPA 4E41E 2YXMA 2ZXDA 1MI5D 4I0CC 3LTVA 3MO1A 3RPIB 3RWEB 3X17A 4F9LA 3H2QA 3NSYA 1DJWA 5BOJA 5SX4I 5LP6A 3FRPB 1FZOA 3KPSA 3PWPE 1NSNL 4ELMF 3ZYJA 1KB3A 3CXFA 3RUGF 1U3HC 4C4KT 4F37K 3HKBA 1MFEL 1ZAGA 1OP5K 4APQB 1BVOA 4N2MA 3O6FD 3HNVL 4YDMA 4ADIA 5I17B 4OD2A 3SDAB 1E65A 2YGQA 4WFGE 4ELDA 3MRNA 1QR4A 2NLJC 1BQLH 3NK4A 4GRMB 4ODXA 1LDPL 4YHOH 2VDML 3H4FA 5KYNA 4GO6B 1JIBA 2Q2EB 2I26N 3LSSA 3BAEH 3RY6C 3QHZL 1IM9A 4MD5A 3CGTA 3GRGA 2W0FA 3W2DL 4ODTL 4F8QA 1AP6A 3QRBA 2AVFA 2MHAB 4LL9A 4QPKA 3KPOB 5DJCB 5CFAA 5FIEA 2C1PA 2NQ3A 3CCHA 3W0WA 5J3HC 2ZXEB 3ZJAA 2AGJL 5J56B 4AGOA 1SEQL 3IXTA 1X7SA 3WKNA 1VHPA 5IHZA 2R2CA 3ZHUA 2O30A 2XKUA 1NGXA 4ODBD 3UL4A 4JN1L 3C5ZA 2ZXBA 2H1PL 3FHQA 3H1ZA 1YN6A 3FUEA 3UBFA 3V7AG 1VF5B 1NEPA 2E76B 3PWJB 1EO8L 1AI4A 2DQFB 2PO6D 2AJUH 1KBWA 3JVGC 4G9DA 5KAQG 5GRZA 1FDLL 3SGEI 1EZVY 3IJYB 2YC0A 2GBUA 2YAMA 1I9RL 4N8CH 4OT1L 5CJQL 1ZIAA 5GQBA 3T3MB 5BRPA 3ULVH 5IBLD 4LF6O 2Y5TA 4U1IB 3SDDD 2I85A 3AXLA 4J80A 2UX7A 3B37A 3BCCH 2UXDB 2VQEB 1RSOB 3GKZA 4BWAA 2A6DA 3BKML 3OKNA 1OT2A 3LIZL 3S48A 5I75C 3OGCB 4M5SA 3CQQA 5DQJB 1JVMA 3NJIA 1MEXL 4EI5D 3O3AB 3V0AC 3P11H 1BQZA 4CDHA 3H2PA 3STLC 2L7EA 2P4AB 2JEUA 3HC4H 4FQJL 3GIZH 4N22A 3Q1SH 2ED8A 4P9HC 3OG4B 2AAVA 1KECA 2CHWA 2WXPA 1HHKB 1ZK5A 1E9QB 4EQ2A 1KULA 3BUYB 4R8CA 4LFAO 4E9SA 2QWQB 2NYYD 1TJIH 4FFVC 2JQMA 3ASOB 3FCSA 5A2BA 3ARQA 2FKXA 4WAFA 3L2MA 2X4NA 3NJLA 1JGVH 2HKHH 1JK8B 1T7XA 2BVPA 3DROB 1P4LB 1JNHA 2BNUA 3R1GH 1LK2A 4ZFGL 3FTGB 2IJJA 3VYNA 1RPQA 2JEXA 4CSPA 2J4WL 4MMXA 5D7KD 1GPOL 1RZ7H 4YXKL 1RUKL 5CZKA 1OP5H 4OCSH 2OTWB 2HVKB 2PYJA 2WWMC 3OUFA 2ZXCA 1O5PA 3DSFH 1VFMA 1T66D 4QOKD 4TQ8A 5L88H 1R19A 5CIPH 3MA7B 2Q67A 1AP2A 3VG0H 4U05A 3EFOA 3TN0A 3OTOO 3GBLA 4FXLA 1RK0B 3E3QE 2ZYHA 3N42F 4D9QD 3CZSA 4JVUA 5AWNL 4MLSA 4AZ8B 2OS7A 1WEJL 4BELD 4IK6A 1IBMB 3WFHA 4Z95L 3ZE0F 5FEBA 4H1LA 1HILB 3IMRA 4OM0L 1MN4A 4Z8FL 2ID5A 2R23A 5LBVA 3HI5H 4X4XA 2O57A 1RU9L 1BF2A 3UAEA 4FJ6A 1UH3A 4K4KA 4NO0A 1B3IA 4JRFA 4LHQB 4XC3L 1A4CA 3SOTA 1NC4D 1TU2A 4PW9A 4YLBA 4X20A 3K9SA 1KN2H 3QT2A 5G5DA 1JWMA 5EO0B 4R97B 1A9BB 1JAEA 2CR6A 3BMVA 3CRAA 5EDSA 3BVXA 3GXUB 1WBZB 3CFNA 3VFPB 1LDSA 1YEHH 4H26B 4FA6A 1BLNA 1LP9E 1X4ZA 2EDKA 4H8WC 3W39B 4I7ZC 5F7UA 4BQ8A 1TTUA 3QG7L 1HAWA 2GUOB 4E9YA 4GYBA 3QYCA 3K8MA 4XMKH 2W6IG 1N0LA 2BVTA 4PRIA 1BVNP 1A6WL 1D2PA 3CSYA 5E9DA 2OJZL 4X7CC 3SJVB 1KXTA 1DLFH 1CXIA 2ADQB 1ESOA 1F02I 1S6NA 2YAOA 3MJ8A 3RI5K 2YOAA 1DN2A 7FABH 3FO1B 1UWEL 4DVBA 2F95B 1N2RB 2XWJB 4AUJA 4DUZB 2DWEC 1K8IB 3CC1A 3EFFK 3N3EA 3PHQB 4MXVE 5FHBH 1UXSA 1TOXA 2NDGA 1JNNL 3L70H 4GYCB 2JIXD 3IMUA 4JFXB 4RH4A 1JPEA 3UACA 4C56D 2X87A 2JE8A 4TUYB 4YXLH 1T21B 1ZS2A 3DC0A 5DI8B 8PAZA 2UUCB 3K72A 4QLWA 3FZUC 3GSVA 4MW3A 2R2EB 4B9KC 2NY4D 4Z0BL 5M7QA 1NUFA 3RA7H 2V33A 1KGIA 3ROOA 3S3SA 4CMMB 4KHPB 2NNUA 1UB6A 1DBJL 2AXHA 3WELA 1HJCA 2I5YL 2ZOUA 4MXWH 4XBEL 4AWJC 5FUZH 4MVMA 3V0JA 3SO5A 5EO9B 3WKQA 2R9HC 1CDJA 2JJUA 1YY8B 1WYJA 4WHYG 4LVEA 3BCFA 2YQ3A 4JI6O 2VQ1A 3H1JH 3C6LA 4JPVL 1NCCH 3RZCD 2EUXA 4CS3A 1IBFA 4N0FA 4HIJB 3UPAA 2R0ZH 3VVVA 4GSDH 3RB5A 3AABA 3FOLA 3WFEH 4XNAA 4LOVA 2CHZA 4GLXA 4J4PD 1J8SA 1G4MA 1OB1A 3VI4F 4N1EA 4GQ9H 2VWEE 3BAAA 1IKFH 3B7YA 4ODHL 4P2RA 4QXTB 3DX8A 3ARBB 3NGBB 3I3BA 5DD0L 3VUAA 2EECA 3OSVA 1YG9A 4P9OA 1E4XL 4XXWC 1PU0A 4E0RA 4GS7B 2Q8AL 4RX4A 3G6AA 1J0YA 2ICWB 4LB8A 1U93B 2X89A 5L2KE 2G4GA 4WFFE 4HG4K 4DR5O 3TXSA 1YYLH 1HI6B 4M5ZL 1BBDL 4LNUB 5K39B 1MI5A 4OGAD 4NUJB 4JFZH 4AKPA 4E9RA 4Z3TA 5B38G 2PTTB 1G87A 2VJ8A 4Z7UB 3T8XB 5JHDB 3OJDB 4X42A 3MGAA 4PLNC 4KVNH 1N64L 3HA0A 5DQ9B 4OZIB 2RJMA 1HH9A 3LQAL 4NZDA 4Q7DA 3T08A 4KUZL 2WINB 4UILL 2EUWA 3PDOA 3QUMH 3QARA 4P59H 5DD3L 2CK2A 3RYCA 3LSOB 1A7RH 2NY3C 4O2BA 1XB6A 3O6FA 5EUOE 5PCYA 5MHSD 1E1QG 5ESAA 2AJZA 5LOVB 4J1UA 4F20A 1EJ6A 4FM0A 2HHHB 3EYSH 5JQ6H 3GSQB 3BEHA 3Q3GB 1ICTA 2PCFA 1P1ZA 5IVXE 4JYAB 4NDMB 2XZQH 3LPOA 4I0PB 2HWZL 4W9HC 2YA1A 4HWZA 1VACA 5ICYB 5IM7A 2AXGB 5G2NA 3MOBL 4RQEA 2DKUA 4PP2A 4PW4A 5IQMA 2FEDD 4I4WB 2CO6A 4DEPB 5B39A 1K34A 2M6YA 1TENA 2DDQL 3SPJA 4GPVA 2GI0A 2F53B 4DR7O 3KCPA 3APDA 5FOBB 3BP4A 3UYPB 1OJHA 3O2VL 3OQ3B 4JBSA 1GA2A 4PV9A 4ZQKB 1NSNH 4KRMB 5DGRA 4M7ZC 1VJSA 4F8OA 1RZKL 1HL5A 2F7IA 2PO6A 5DJ6B 1MFEH 2LE9A 4UDTB 3P9MB 3HNVH 2HJKB 2FGWL 2IAMB 3QQNA 1AANA 4XCFL 2WLNA 2XV3A 3V5KB 1F42A 1V3JA 2VISB 3EHBD 3L8QA 3SDDA 1THAA 2MNUA 4J8RB 2YLHA 2DAVA 4RDQF 4S1DC 1EO7A 3MFFB 3QHZH 5KX5A 1Q8IA 3W2DH 1DFXA 2ICES 4ODTH 4PGEA 4KTYA 4MNGE 4Z78A 2P8MB 3GB7C 5CB4B 4TQIA 4M1GH 3K5MA 5BMVB 2OQJA 2AGJH 4LGSB 3EIFA 4EI5A 1SEQH 5GGSB 1E5UI 2DQJL 2KG7B 1Q9WB 3LPWA 3P3RA 3PFQA 5F1NA 5JDJA 5L2JB 3PHAA 4POYA 4GUQA 4LVHB 1BFTA 4I4TA 2BCKB 2FQEA 4JN1H 4AXWA 3KPQA 1A1OA 2H1PH 3VYPA 3ZMZA 1IBYA 1KC8W 4L0PB 1ILSA 5GJSH 3B3IB 3CZUB 2VLMD 4J2XA 2B5UA 3D09A 3BKYL 4FNRA 4PJCA 1FDLH 3LRSA 4DR1B 2XXCB 2PKDA 4TL5A 3RUGB 3RWDA 2NNFA 1I9RH 2H2SD 5CJQH 5DURD 4A2DA 1BOGB 4KDTC 3OR7C 1PLAA 2AZAA 2WW8A 4BD4A 2HTLD 3GMOB 3C60D 3K81A 1NOFA 4HXBL 1VF5C 2J1KA 1YSOA 3H53A 3IJSA 4JHVA 3VXTA 3BKMH 3VXUD 1XFPA 2AHIA 1YMHB 5DZ9A 4EE2A 2ORBL 3L9DA 1UJTA 4QOKA 2Y4TA 4NZUL 3DO3A 1FGNL 5G4MA 2YRZA 1MEXH 2OMNA 2VZVA 3LH2L 4NFBA 1HYSD 4RFEA 1UT2A 1QFUL 4AV4A 4IIQA 5KJRH 1B0WA 5IMMB 1TQSA 2OMYA 1UGNA 2TSAA 2B4CC 4JB9L 1HZHL 1VQ7V 3OGCC 2Y7OA 4LP5A 2XN9D 3JATA 3BMWA 1T2QL 3GWOA 3ARGB 4XB7A 2WGNB 3NJHA 3CCSV 4PJXE 4OKDA 4BUGA 2ENSA 3HE7B 4FQXC 1MWOA 1NC4A 4OFDA 2YD2A 4TXVB 5EK0A 5FB8A 5CKAA 5E4EB 3S3WA 4ZFGH 3LH9A 1QRKA 3BT0A 4JJOA 1MCLA 3G5YB 5BUGA 1R0AL 1SS3A 4OD1L 4YXKH 5T1KB 4TTDC 3ASOC 1T2JA 2EVIA 2DWDA 3RL1A 3IE4A 3ILEA 3QUMB 2E27L 1BWWA 3AY2A 4YC2B 4F3FA 3VO0A 4ZXBD 2HYMA 5GTHZ 2AC0A 2AQPA 3MLTA 2R1YA 1A7OL 3QUXD 5CZXD 5JORA 1L9PA 4E5XA 5HD8D 1RFDL 4NIKB 3FB6B 4CNIB 3HZMB 5AWNH 1NCGA 1PM9A 3MAQA 1RZFH 4FLSA 4A7SA 1WEJH 3P4LA 2WLJA 2FIKB 2X4TA 4Z95H 2QGEA 1UCTA 4JI2B 4OM0H 1VGKB 4Z8FH 1BZQK 4LSRL 1LE5A 5D1QD 1RU9H 1WPCA 1BFVL 1RK7A 2VDQL 1GAFL 1V3MA 4GUPB 2XWXA 4JGJA 5AYUH 1Q8MA 3HHMA 4XC3H 4XVUD 3V8CA 5TDNA 1UACL 3S5LA 1WJ3A 2ZKHL 4KK6D 4C4KO 2JIXA 3QYMA 3GSRB 2AJVL 4C56A 4IMLA 3GMQA 4J5VA 1B88A 2DLTA 2OW6A 3WS6C 3HHSA 3NCWA 3I9GL 1WBYA 1BEYL 3CK0H 2JQZA 2GUYA 3MGTB 1DJIA 1SOQA 1QLRB 5ANMA 5BRQA 1V10A 2NN4A 1N59A 3DKHA 1KYFA 1XGQB 4QDGA 5KBKA 3K1KC 3QG7H 3HFML 3BDXA 4OF6A 3D18B 4R97C 2Y7MA 3QZWG 1OGAE 4TVSa 1O6TA 3FAVA 2VDMB 1A6WH 1LO5B 5DJYB 1GCYA 5DRXA 2FAUA 1R1BA 4YY3O 2UU9O 2DL2A 2OJZH 3HLKA 3N42B 4JQXA 1TF4A 2AEQH 2H32B 1VIBA 4Z5RA 1U6AL 3RZCA 1A3RL 1R47A 3ESMA 3OZKA 3LKNA 3QDGD 3IGAC 4DR2B 4I3GA 2HKFL 3W0WE 3ZE0B 5ES4B 3RJDA 1CLOL 2DOCA 4FG4A 1FF5A 1JGIA 1JNNH 3FT4B 3L1GA 1CQKA 3HRZB 4J4PA 4E42A 5I1GH 4PGCA 4Y16D 1D9KB 1USZA 3RL2B 5C08D 4KI1A 2QDVA 3APFA 3EOAA 3FU7B 4XRCB 4Z0BH 4MTFA 3ROLA 1XQ4A 2K4AA 4U7SA 2HJFC 4JRXD 4KVPA 4UQ2B 4X6CA 4BZ2A 1MSDA 1DBJH 1F1GA 2E74C 5GZOD 1GZQB 2I5YH 3ARFB 3TPKA 3DGEA 3VD9A 4UOW1 3F5WA 4KJQD 4WK0B 4XBEH 5CP7A 4P5SA 2ICCA 4NM4L 5CBAB 2JFCA 3TBWA 4FP8H 1IAKB 5GGRY 4BFBD 4YHIB 1B6QA 1IARB 5I9QC 4TQEL 3DGGA 2GJJA 2OA9A 1CFTA 1TTAA 2E5EA 4JPVH 4A6YL 1N4CA 4Z3FA 3MRHA 3C9NB 3BSZH 4EI6A 5FAAA 3BAIA 1KCWA 5B1KA 3ULVC 4JGSA 1RUML 2XNAA 1PTZA 3S4SB 2BIIA 4EN3B 3K8KA 3RWRD 1IBKO 4RIRB 4C7UA 5AZUA 4ODHH 5DD0H 3IJ4A 1KCVL 2E7DA 2XX1A 3BGMB 5JLZA 2K1EA 3FB8A 2Q8AH 3KVDD 1QFWM 1NGWA 3RYIB 1CDUA 1LD9B 3GSNB 2D7MA 3T2MA 1BG9A 3D0VA 4BSWB 2ZWNA 4M5ZH 1LTXA 1BBDH 4KKRA 1T83C 4LGRB 3WN5B 1XR8A 1FXVA 1BE3H 3BUQA 4B3VA 1R1CA 2SEBA 2Q87A 4MCZA 2Q69A 4XTRD 5DZOA 3BLPX 4HD9A 3W3BA 5JJEB 5A7EA 1N64H 2H8PA 3ARDC 2JTYA 3LQAH 3L5HA 3UBGA 1B6UA 1N70A 2IXQA 3IDMA 2XY2A 4KUZH 4KVCL 3DV4A 4UILH 4MVQA 4F5CA 2OK0H 4BCYA 1I1AB 2P44B 4RMBA 1RP3B 4NXMB 1RZIB 4M4PA 2FWUA 2GT9A 4UFZA 2IDUA 3WDHA 4QTHA 1SEBB 4E2LA 3HAEA 4HCRA 4M7JL 2M2DA 4MNQB 5KVEE 1E8YA 5I73B 3P3UA 1JI1A 3VI4B 3CRMA 2LQTA 4MCYB 1SBSH 2XZZA 5F7EL 4KJYB 3E1F1 2BMKA 5DDHB 4P2OB 5A2IH 5ITZB 2VL4A 4N1CA 4S1QH 2XAGA 3MJWA 5LAXB 3MOBH 3X12A 5K9QI 3KGTA 8FABB 5MENE 3VRJB 1U8KB 1UFUA 5BZZA 3I2CL 3MU3A 2DDQH 3ZXAC 4AL8C 4V11A 3AG3C 3VH8G 2ZONA 2X0WA 3KS0J 1XH2A 4YGAB 1AIFA 3O2VH 4PJEF 5KBLA 2ZP8A 1EEYA 5JIIA 4QRRD 3SDCD 1CTNA 4UMSA 1N7ML 2X53A 5BVJA 3RLSA 3WNLA 1RZKH 1DYZA 1F1DA 4IBSA 4BZYA 3GRBA 3G6JF 1CLVA 1AZCA 1DO5A 2PABA 4ZFOL 3SDLA 4ODUB 3ZZQA 2KT6A 1NBYB 1UOKA 2FGWH 2XBZA 4FMKA 4GI9A 4Z7WE 4XCFH 5E8EA 3D0AA 2OI9C 4Z7AA 3F58L 5F7HA 4EMZA 4LWSA 5DJ2B 4IIJB 4HPHA 3RVUC 1XZWA 4D0BA 1VKXA 2QKCA 3AGWA 4H8QA 4TRPL 2Z8VC 1OXYA 3GMPA 4I89A 5DO8A 3APMA 3SQBA 2JVUA 3FU3A 3VXUA 1ZT4A 3GUTA 3A67L 1T20A 2HT2C 3A8TA 2IAMC 1AYOA 4NVPA 2CPCA 5LDSA 3E8VA 5H2FZ 1GOFA 2DQJH 4ZNEA 4XB3A 4PB9L 4C59B 2VLJB 3VNZA 3MRMB 4DKDC 5EBWB 1NAKH 4PRPD 4H8PA 1YJ9V 1PYWA 3ABLC 1CUOA 3KGRA 4M4RB 1DTOA 1K85A 3P3NA 1YDPB 2XN9A 4AILC 4W9JC 1L9MA 1CFSA 3TH3T 5IB3A 1BYNA 2CK0L 2E8ZA 5K9KB 4WWOA 3GSOB 3KE0A 4JO5A 3MRJB 1R5VB 1U58B 4X8GA 1N5AB 1X5MA 3D39B 4FG6C 4UNVA 4LVHC 5LMNB 1RUQL 2VQTA 4JRLA 1FZMB 3JT0A 3PIQA 4DP6X 4PGDA 4K15A 3J81N 1MRDH 2Z0BA 3RTQB 3ZBHA 3PAZA 4QHKI 3C90A 1MOFA 2ORBH 1IQWL 4MX7A 3CDGA 4IYHA 3K46A 2X38A 1EDYA 4NZUH 1FGNH 5F7WC 2DLIA 1PD3A 1P4BL 32C2B 1HNGA 3MQIA 2AP2A 2ZYIA 3LH2H 3K2MC 3QUXA 1CYXA 3NMEA 3VFMA 3MODL 1M3IA 3MBEC 4RAUA 1T0PB 1QFUH 4LLVA 5D6DA 1B3JA 2EP6A 1GGYA 3FL7A 3KW8A 2W8CA 3UJTL 2Z8RA 3CSBA 3LB6D 4JB9H 1F8TL 3TA3D 3VSVA 1HZHH 4LCYA 2WYIA 4CC4C 5KN5B 1A2YA 4PS4H 2YK1H 1T2QH 3QZNA 4PRHB 5E5LA 3SGIA 1ECYA 5D1QA 1MCBA 5DUJA 3L3DB 3ES6B 1D5ZA 4BIZA 2DQDL 1BVKB 5CN1A 3HG3A 4HWBH 1CFQA 2FR4B 1FP5A 5KBMA 3CNKA 4X80L 4U1JB 3UTSB 4X1IB 4NAQA 5T1JA 4QCIA 5HXMA 3MRRB 2EYSB 2JNZA 1KP2A 4OFQA 1R0AH 1AG0A 3FB5B 4OD1H 4N90D 3I3EA 2E27H 4A5UB 5JZ7D 3QQ4B 1ZVHA 3LEYH 3MRPA 1S3JA 4IKIA 2GY5A 1CD9B 2FO4B 4L05A 5E4EC 3RVWC 4LLQA 1RFDH 4Z76B 5KEZA 4GXUN 5DMGC 1W9XA 2Z31D 5B1BB 3EFDL 4JM0A 4R7LA 1K2DA 1HWWA 3C75A 1MG3C 2DKMA 2ZX9A 4M3HA 2GFBA 3K4AA 1B4LA 2V9TA 5LWYL 3M88A 3ALWA 4ONFL 1PGRB 3QDGA 1BFVH 1GAFH 3OKEB 5AUMB 5CNHA 2YXLA 3ZTDC 3U6XS 4LHUB 1UACH 2X4RB 3I6LE 2ZKHH 5F9DC 2BINA 5CZVL 1FQ9C 1MVYA 3ZRSA 1KYAA 4ZOAA 3F7VC 3K08A 3I9GH 5D1XC 1ZMYA 4Y16A 1YAZA 4WW1B 4DKAA 5C08A 4MDRA 3ZMRA 3QNYB 3TFKC 4KUCD 4JPIA 4M61B 4FFKA 3UM7A 1M2OA 1J05A 1R5IA 3EH4B 4JRXA 1TVBB 3MJGX 5JO5A 3HFMH 5KS9A 5GZOA 1BJMA 2J44A 4YSCA 1ZA3B 3VD7A 4PWEA 2FGZA 3AY4A 4F8LA 2DRUA 1ND0A 3F6JA 3ZHNA 3CVDA 1MHCB 3JAWA 1S76D 3R66A 2APFA 2PR4L 3EJTA 3VXOA 3FT2B 4LF3B 3CFMA 5KOMC 3SGJA 4JZJC 3L5XH 1DJYA 3WCYA 4G6AD 5D2NC 2EYTB 2IU0A 4LL4A 3G5VB 5DFVC 2AMGA 1U6AH 1RZGB 1A3RH 1SDAB 4R83A 3GXIA 1U0QA 1NR1A 1MF2L 2HKFH 3T3ME 1LEGB 1THZA 2K0RA 1CLOH 3FUIA 1L6PA 2CXKA 5F93C 3MJ9L 1PZ5A 2PYFA 2P48B 4GI6A 5LGUA 2PP9A 4YDNA 1M90W 3IJHA 1WA1X 1Q9OB 2QM7A 5EU6D 2VDPB 1Z2GA 3FJTA 4D8PA 1QZNA 4B3MB 3REVA 2Z7UA 3NIGF 5EZYB 3SQOH 1H2MA 1FXKB 4Q20A 4H13C 5JOEA 1N8ZB 3F7PC 2EIJB 2GIXA 4C83B 2ENQA 5EYPA 1DQLL 1EBAA 5IEKA 1HDMB 3KMDA 5EEZA 1QR1A 1S5LZ 4ODWA 4HWUA 1A7NH 1QPKA 1WCQA 1I1RA 5FPIA 2OMXB 2FWOA 3FKSG 3T77A 4NM4H 2JJWA 4KJWD 1UKQA 4F33B 5D7KE 1SZTA 4OZ4A 4TQEH 1EA9C 3N40P 3O3EB 2FWLB 1X5IA 4FHKA 1CF8H 3OC8A 4LPWA 5HY9B 4A6YH 2B1OA 1TSRA 4MQXC 25C8L 1O7DC 2LV4A 2IDCA 4LCIL 1ZUQA 1R9FA 1SZXA 1OKEA 3UP1A 1RUMH 4DKFL 3ZY7A 1DJSA 4PV8B 2I25N 4L3CA 3BJ91 2HMID 1JYNA 1S78C 2FL5A 3DK0A 3O9WD 1AR5A 1CDBA 3A0BZ 3QIWB 2P7TC 3I6KA 3OKOA 2MK3A 4JQIL 5TDOA 1KEGL 3NJGA 3TBBA 4QY8B 3WB2A 4JPWL 4HJGB 5IWLC 4LHJB 2CBQA 1JZGA 4HGWB 3PV7A 3FQ1A 1E6OL 43CAB 1E6JL 3QULB 2LW3A 5CEYA 3TH4T 4CILA 4FMVA 1GCFA 4L0ZA 2UZYB 1NTZH 4HS6B 3LNGA 4LKXB 1G9NL 1I08A 4NP9A 4ABUA 4QRRA 3SDCA 1UASA 4I77H 4L8BA 4R96B 1KTDA 3N1GC 1U3JA 4GIOA 3Q06A 4KVCH 1OCZB 1Q82W 1IC7H 4OIBA 4P3DB 4AOFA 3CRCA 2Y0SA 1MSPA 2PWGA 2WBXA 1ZE3H 1NCTA 2HA1A 3FQNB 3HVNA 1P9MC 1TO4A 4NUPA 2O5NA 2GBTA 2QLVB 3RFRA 4MD0A 1ZDQA 2XFXB 2YPLB 4TVPL 1R73A 2Q76A 5E03A 4XP4L 3MLVL 4GP5B 5E5MB 2DM4A 3N40F 5DRWB 1WN7A 5IJVB 1HQ4A 3V4PA 3PAVA 4FTVD 2VIRB 2HKOA 5F7EH 4DGVL 3MRDA 2VDQB 3HKCA 5B66Z 1N33B 1NPNA 1AGEB 4UUJA 4MKMA 2JKLA 5DMIH 3QDJD 1W0VB 2PXYA 2K4WA 3I2CH 3VMNA 2VW6A 3IDYB 1OHHG 2UY6B 2FJFA 2YARA 3AQDA 3ORJA 3QWOB 1FFPB 2ZG1A 1PSKL 4HYTB 3RX9A 3SJVE 5I73C 4PRPA 3QA3A 1NTMH 2BIPA 4PJBF 3SPVA 2EDMA 1NFIA 3CQFA 4CZZA 1N7MH 3DX7A 4WI4A 2OMTB 5ANME 5J11C 2DIJA 5F7YC 2UXTA 3BN3B 1JXGA 5D93C 4BUHA 4BQ6A 4FMTA 4PJGA 1PJWA 4DV6O 1I8IA 3HE6B 1DQQB 3KWWB 2E4TA 1JHTA 1MCHA 3B9VA 4JG9A 4X6DF 4PJ8D 4Q9QL 2GJZB 3F58H 5CINL 5F72S 1J1XL 5IMLA 1A4JA 2FUTA 2VMEA 1NPUA 4KY2A 4TRPH 1KIRB 4XP9L 5HBBA 4JFEB 3E22B 1CVSC 2C9AA 3MDJA 3ZE1F 3QRLA 1JJ2U 3A67H 5JHMA 5CBFA 3MV7D 4OAWA 3HG0A 4Z18A 2CO2A 1BQHA 3LD8B 4PD4F 4MB4A 3GMMB 2WQWA 4N0UE 2IH1C 2E75C 4DRXB 4PB9H 1L0LH 4U6VL 4GG8A 5F1KC 4ENED 2ZUUA 3BE1L 3TA3A 4X7TA 1JPGA 2WY3B 4WSJA 2B9ZA 4X4YA 1UTDA 2YXFA 1WQVT 4PJEB 4U3XA 3JV6A 5I6PA 4NTWA 3K4DA 2FECI 4WSKA 4E9LA 1VESA 4JEGB 4LDLB 2CK0H 2IAAC 4HUVB 4UB8Z 4I13B 1F3DH 2BJML 1KTRL 1SN2A 1U8QA 1UWYA 2IPUK 2EJRA 3G6JB 3S3PA 4WHTA 5GGVH 2XOKG 4JTCB 1RUQH 4Q97A 3LXCA 3IFOB 5I28A 5I6XB 1K4CB 1MY5A 3B56A 4G8IB 2ENYA 3DYOA 5CM1A 5J3HD 4JJ5A 4A6YB 5B1JC 4EEEA 1A7PH 2X3AA 4JE4B 1IQWH 3CDCA 5J2UB 4Q9CA 2BVQA 4IDJL 1HC1A 1QBMH 5C0BB 5C92A 1P4BH 3Q8FA 4UV7L 5MHSE 5DTFA 5EFIA 1ZL8A 5IFJA 5H35B 2WKLA 2G5UA 5IQ9B 4Z7UE 5JHDE 2Z31A 1U8CA 4L8SA 4NR1A 2VDRL 3J7HA 3UJTH 2BP8B 3A0OA 5KVMC 1XIWB 1F8TH 2FQFA 3VXQB 4XX1G 1NCWL 4LLMA 3SKJH 3S36L 3WL9A 3QS2A 3TVMC 1T7VA 2VR5A 3QQ3B 1WBXA 1P53A 3UZVB 4B27A 5KANI 2AJSH 2Q1EA 5T5FA 1AE6L 3SKMB 2CLVB 2DQDH 3C2SA 3TS8A 2BSRA 4NCDA 1B9ZA 4X80H 3RIKA 4HDIA 3BT2L 2WLLB 4E9XA 1EEQA 5E1AB 3JARB 4QHPA 2DQEL 3U25A 2GC4C 1JGEB 3HI1A 1N0XL 3WTUA 4WGKA 1A5FL 1S9YB 4YXHL 3V6FB 4F5CE 2K6WA 3QJOA 2C26A 3GQFA 2WZ0A 1D2DA 1F13A 2ODHA 3FFDA 3T5WA 2YGNA 1Q72L 4DR6O 1XF5A 2F53E 2GSGA 4L5FE 5EIIB 3W9DA 3BXNA 2DMXA 3EFDH 3S7GA 4JRYE 1AD0A 2CDGB 1XH3B 3VXNB 4F2MA 5HHMD 4DV1O 1LNUB 5LWYH 4KI5F 5LHDA 2QJ1A 3PXJA 1OVZA 2GHWB 3GHEL 4MNHA 4U1KA 2A06H 3MHZA 2E4FA 2XXMB 4O4HB 1NDMB 1CD8A 1BWMA 1OK8A 4YVUA 4JFUA 2Q6WB 3V6OC 3FT1A 3VSTA 4HKBA 1KT2B 2Y9RT 5EU6A 2IJ0C 1WAPA 2YEZA 5BZXA 3EOBB 4AYID 2X0VA 1E9OB 1FFRA 2Z3YA 1NUGA 3OKLB 1TPXB 3S6CA 5BRZD 1NLDL 4PTUA 1N3NB 3LNNA 3P40A 4ZFOB 3DYMA 2VN3A 2DZEA 1CGWA 3BP7A 2Y0IA 3CFTA 3ZRVA 3C8KB 2B59A 4NQED 5B3NA 4MJ2A 3VQXA 3RN4A 1F4WL 4GKKO 3B7UX 3KM2A 3QDMD 4FEMA 1G1OA 3OKDB 2PR4H 2F18A 3QUZD 4LIQE 1WUZA 1WS7A 3VQMA 3EUUA 1O9VA 4N2DA 1FO0L 1THCA 2IWFA 1TQCC 2YBRB 3PNWA 4Z1VA 4AQ8A 2H3OA 3MV9D 4ELME 3RUGE 2J2ZA 1MF2H 3B2DC 4LBEA 4OCXL 3NRPA 3H3BC 4HUMB 2BSED 5E7BA 2E86A 1XGPA 2NCMA 2EXSA 2CLRA 1BXXA 2F8IA 4XBFA 3O9WA 2CCWA 1HNFA 3IT8D 3ARED 4UAHA 4WTXA 1YMMB 2ZXQA 5EN2A 1H38A 4L9DA 1AAJA 3A6CL 3ZIAG 1W15A 2VABA 2A9DA 1VADB 3NP3A 1A1MA 2GJ6B 2ZX5A 4GSXA 3I9PA 1H9VA 5DJ0B 4W68A 5LXGL 2NW2B 4UV8A 1DQLH 1EAQA 1TQBB 2AZUA 3TPUA 2A73A 4YOKA 4B9YA 2R70A 3MKGA 3RWFA 4FNPA 4AV5A 5BMFL 3WJMB 4FXGC 4HWNA 2ZYSA 2F4VO 3WNJA 5KYXA 3T4YA 3ARSA 4HJSA 4HAKA 1T6BX 5ISZD 4LSDA 2YQBA 3U6RB 3KYKL 1EX0A 1ORSA 1OO2A 3MFGB 1GXEA 2W91A 5I8CA 5JHBA 25C8H 3DX2A 4KK8C 3TIEA 2RNBA 4LCIH 1AXTL 5EEUA 1MG2C 1AP5A 4LFCB 4PJDA 4Q4EA 2BVYA 2ZR3A 4HUUA 5B1AB 2EE6A 3FZUD 2L04A 2Y22A 4K7PY 4BSVB 1FFNA 5IYZA 2H41A 1WVZA 4NZRL 3IU4H 2H6UA 3U1SL 1DQJA 1VQ4V 4K3DL 4FTVA 1YY9C 4JQIH 4UQCA 3PAUA 1MSWD 2CIKA 4S0HA 3MA9H 1OOAA 1NCIA 2ARHA 4ANUA 3ZT5A 1QLFB 2DYPD 3GINA 3QDJA 4R7DA 4IKNA 1E6OH 2R9HD 1E6JH 2HX7A 1ZVSB 1YUHA 2VDKL 3NVQA 1M7IA 5C8YA 1G9NH 2VC2L 3ML8A 5IHLB 3WIHL 4BSJA 3FQUA 2YAQA 1XBRA 3ZEDA 3UOAB 4O58L 3T1CA 1JRHL 1YO4A 2MQ3A 5FHAL 1L0PA 1DZ0A 3AEIA 1V8HA 1A65A 1MFNA 3HW7A 1GH6A 3STZA 1ZTMA 1TEGA 3RDTB 3KLLA 4G7QB 5GS3A 3RYHA 4PJ8A 3B09A 5DRNA 2C3HA 1XEQA 2DB8A 2V5MA 1KJMB 4H1LG 3HVDA 3MLVH 1JX9A 4F8PA 2JELL 1IEBB 3EXLA 2AJYH 1E30A 1BIHA 1DJZA 1DTUA 2B9BA 3K5LA 2P43B 2Q73A 4PP1C 4DGVH 1OCZC 4A7GF 4O02L 2GPZA 2X44D 1M7UA 3ESOA 1OP3K 5E2VL 1ZY9A 1Y6XA 2YD7A 1G1XB 1CB4A 3LH8A 3MV7A 5DUBB 4KK9C 3SJCC 1NC2D 2X70B 1TYJA 3G3LA 4FDWA 3WNMA 2ADPA 4OM1L 3WAJA 3EG9B 4WK2B 3QWRD 1PSKH 4F93B 3QEGL 4RGMB 3MN8A 1DVFC 3FSOA 2P5PA 5AKTA 3BHPA 1IC4L 4ZO7A 3QJUB 3ZDXE 3MTXA 1D7FA 3KR3L 3ZTNL 2RALA 4JREC 1G5GA 2IJHA 2QR0A 2NY3D 3ZE0E 2VMCA 3VXMD 4NPYA 2ZCKL 4FAAB 2NLJA 2F1BA 3C09B 2NZIA 3AM8C 1UPGA 3EBGA 3IDYC 3TF4A 1O6SB 2VAAB 4JMNA 3IAGC 4PJIB 3TEYA 1JG9A 3RY6A 5IHBA 1J1XH 4LGPB 2XWRA 3WUWB 4B9PA 4JDEB 3FOMB 4GIAA 3LDCA 4XP9H 1IGJB 5CGYC 2R2BA 4DP0X 2OIGA 5I82A 4MB3A 3JTSB 1B0RA 5JR1H 1LUWA 2VXVL 4ZPVA 4K3EL 2CE6A 3OT7A 1DQVA 1QBLH 1MCNA 2JK5B 3HZVA 4GRLB 1D5BA 5E6UB 4H44C 4OTXL 3B7TA 5DMKA 4U6VH 1EHKB 4B0MB 4AI8A 2WXLA 4NQDD 4S2SB 1ITCA 4EVNA 1E3FA 2AK4B 2WXMA 4FQPA 1HW7A 4P2QD 3ZSSA 4C47A 3ARRA 3HLAA 3LKOA 3BE1H 3F00A 4RQQB 4RZCB 4LSVL 5LN8A 2A9ML 3JVGA 2IPTH 4PJBB 3LEXB 1HCFX 4KC3B 1KP3A 1MLCA 3TX4A 2HH0L 4PEEA 4CUCA 3AAZA 2F2HA 2BJMH 1NWPA 3DMMB 1DE4A 3ULSB 5BXFA 2MCG1 4U6HA 2AXJA 4BA8A 1T04B 4KFMA 2D03L 3KPLB 2D2CB 3CLWA 3P0YL 4X5XB 1HWYA 1YYML 4B3SO 4ZHQB 1K8AW 2HVJB 3IAPA 4X6DB 3VGAC 4BH8A 1N6VA 1N6QL 4N2GA 3Q2LA 3KJ6L 5D1ZB 5J9PC 2CDYA 3ZE1B 4WFHE 3P0GB 3FQXB 4UV7H 1RFYA 5KMGB 4PCTA 2GSIB 1MW2A 3P4MA 4OGXL 3UCSC 4BIOA 1I7RB 4G8AC 1Q4NX 4G42A 4X98A 1BHAA 5HYSB 5EC1C 1K4CC 4NKOB 3E2HB 3KZ8A 2VDRH 4X1YA 3UCQA 5KG9A 4AQEA 2YRLA 4OV5A 3QORB 1OP3H 3S36H 3W38A 3VGBA 4GLRI 2Z8SA 1KPUA 4UNUA 5IT2H 1P6FA 4WV1B 1AE6H 3OM3B 2EH7L 3MTRA 4UZSA 3PWLB 3S35L 1IGTB 3GK8L 3F6LA 4MNQE 5IHWA 1U91B 1CXKA 1VQPV 3ABMB 4BYHA 3VI4E 3LNMB 1I94O 3G08A 1LUVA 1KIPB 3IN0A 5C9KA 2MNJB 4YDVB 1IBZA 1RK1A 2CJUL 4DUWA 3W82A 2CNYA 3QC5X 4LKCB 4AV0A 2DQEH 2Z7ZA 4UT7L 5J1AA 1N0XH 1NBQA 5BRZA 1A5FH 4P99A 4JKMA 4YXHH 1FL6B 1X4XA 1QFOA 2N05A 3EGSA 1CLZL 4Z7NF 1TUEB 1VF7A 3SO3B 1IDSA 1Q72H 4EXKA 2C4FU 4JHZA 4NQEA 1E8WA 3KAAA 1P5UB 5TK4A 3FB7C 1KTLB 2X4OA 3QDMA 5E1AC 2NUTB 3QUZA 1BA9A 4UT9A 4G83A 3PGDB 4ZMVA 3TESA 1PIFA 4DV5B 1CL7L 4EZKA 1ZE3C 3MV9A 4FQXD 5B39G 3GIVB 1E9PB 1OB0A 4BXVA 3LDBC 4PJ5D 4O2FB 5TF1L 3L1EA 1TTFA 1Q9LB 2NY1B 4X99A 2BSEA 1MQ8A 1MHEA 3ML0A 5IVZA 2MIZA 3M1BB 1LR1A 2YQ2A 5EZJB 1JF1A 2APTA 1U33A 4TV9B 2Y06L 4NO2A 5T1MA 3GGWA 2CD0A 3AREA 2TSBA 2GI7A 2AV7B 1A0QL 1QVOB 3GD1C 1YLBB 1MLBA 3HZ3A 3L4CA 1NLDH 2A1WL 1OCRB 3K1DA 3TIDA 4G7RB 1LK3L 2BP0A 4M7KH 3GPEA 3LYRA 3OAUL 2JB6B 1YEWA 2E6JA 1INDL 3RHWF 4PVLA 1RSFA 3MMEA 4UZGA 1QBBA 1F4WH 3MYZA 1P84J 1QP1A 5C6TH 4O4IA 1KXVC 1FG2A 1AR1B 2X4SA 4DN3H 1FO0H 4RLDA 5ISZA 1U3NA 4NENB 2R9IA 3F05A 5HDBF 4AMWA 1EXUB 2IH3C 2F68X 5IJKA 5AKVA 4OQTA 2W81C 2DWEA 1EM1A 3BYTA 1A6PA 3CHQA 2CKBL 5DVNA 4AE1A 4QGPA 2XRAL 4TNGA 3NFSL 3O41B 3D39E 1G6UA 1P4IL 5D5PA 1KZQA 1SOSA 2WVVA 2ZPKL 3FBKA 3PL6D 4N0CD 2Q5BA 4IGBD 2YRBA 2NTFA 1NTKH 3G80A 1SOKA 4XZUA 4XO8A 1U8LA 2VN4A 3A6CH 2NY6B 2VUYA 1PW3A 3EH1A 4L3FA 3IDIA 2HFFB 5LXGH 3FT3B 2QWOB 1G94A 5EU4A 3N04A 1VCBC 2DYPA 4FRWA 4NCC1 2X4PA 1K5NB 1F90L 2D3NA 1O9WA 1X5FA 2B2XL 2CTRA 3REWA 3V0DA 4UTBL 5A3IC 3T65B 4JDZA 1YI2V 2ZIMA 1D7DA 4XMVA 3UPRA 3KYKH 3OXSA 1RZ8A 5EZLA 1J0ZA 3WSQL 5SWSB 2Y72A 3FD9A 3FUHA 2QPDB 2WBKA 1TQBC 3D8MA 1AXTH 5CJOL 3N1FC 3EH5B 4IHBA 2AK1L 3Q9PA 1TJGH 2VDRB 3IGFA 4XXWA 3CZNA 1EGJA 1ZHNB 1FVCA 5JXEC 3QFDB 3U1SH 3MOQA 3PJLA 4K3DH 2P06A 1Q86W 4LCCC 3Q1EA 1MELA 1NANI 4JN2B 3O11B 4J3BA 2WA3A 4NYLA 1N36O 1S5JA 4JHAL 3UTZA 3CZLA 4S11A 2GIMA 2JJVA 2P8PA 3S36X 3TT3L 5JMOC 3U36B 1NC2A 2B15A 1MUJA 1OALA 3B8SA 2GG1A 2WAQA 4DV4B 4IBWA 3QWRA 5LBSA 3OGIB 2VDKH 2VC2H 2EICA 3WB0A 4QJ3B 4U3SB 3WIHH 1GK9A 5BZWB 2VYRE 4O58H 1JRHH 2VN5A 4WTQA 2ZG3A 5FHAH 5A2LH 3ULVD 2ZSVB 2ETNA 1X3DA 2D9CA 3RFZB 5EORH 3ZSTA 1UM4H 2ZX8A 3DK2A 4E5XG 2LGQA 3VXMA 1G7QA 4KJPC 4EUPH 3V52H 5J4MA 5C0DA 1TZOA 3H9ZA 4OI7A 1O9GA 1TVHB 4M43H 5MERA 2CHDA 3QXUA 4UCFA 3CZEA 3VOUA 4NC2B 2JELH 4FKKA 3K06A 1R3KB 2F66C 2VH5H 3EYUL 5DD5L 5TE4L 3LEVH 4RSVA 3DARA 3L5WB 4HEPA 3S5LG 4TSAH 3RX5A 1GYCA 5EU7E 5E2VH 5HYQA 2QSTA 3N1MC 4S0TD 3ZMVA 1LHZA 4R9HA 4KRPB 5HGDB 5LMUO 1YC8A 4OM1H 4AMXA 4TLUA 3A47A 1GS7A 2R69L 4G7YL 3QEGH 4NQDA 2DN9A 4JJHA 1NJ9A 3ARDD 3AW5A 3WXVH 5JH7A 4P2QA 1IC4H 3N44B 1R3HB 3ZTNH 3Q5YA 4PMEA 2DWYA 4WQOA 5I74B 4B95C 3SZ6A 3U0ZA 3SBQA 1JPSH 4R2GB 4DP5X 7PAZA 1MAML 1Q94A 4EQ3A 4HNAA 4P4KB 5I6NA 3RWEA 1OPOA 5I16A 2ZCKH 4ETQB 3KD4A 2FNWA 3DXRB 1UOWA 1TNMA 4FX5A 2YSUB 1JOYA 4GKJB 3MROA 4I88A 4WWPA 1SVBA 3VFGL 3NAAL 1FO0B 3GLDA 4YAQB 1P7GA 2A79B 3JD0A 4HMDA 1FGVL 2WQRA 3GB7A 4PJ6A 2J5WA 4QXUL 5ELIA 1XMQO 3CCEV 1AMYA 4HXAL 5H5NA 1H3XA 2VXVH 3MCKA 4K3EH 2PR9A 2WVSA 2VWKA 4KOBA 5KAQF 1H19A 1OV9A 4KKLC 4Y5VC 3K5SA 5JW4Q 2NX5D 5E5UB 2P5WD 1URZA 5K59F 4PRBA 5AW9B 3VFSB 2XAHA 3DOSB 4KX7A 3MLYL 4XMPL 3UO8B 2BOLA 5JW4M 3WFZA 2ZCZA 2MKLC 4DK0A 5K9QG 2A9MH 2CGYA 2X2IA 5F7BA 2RACA 3BH9B 1YTFD 1ADQL 4G6KL 5JW3L 2HH0H 4GCZA 4HLJA 4AKOA 3QXTA 4KDTA 1SLWA 4ELKB 3OR7A 5F8RC 3L3JA 4NXKA 3U7AA 1HKLL 2Q7YB 4OGZA 3RVUD 3QHFL 2JGDB 3ZRXA 5BS0B 5HHOB 2FO8A 3UGUA 1NMCB 1IAII 4FLQA 2D03H 3PWJA 1IL1B 2J8UA 1J0JA 2V8MA 3P0YH 1YYMH 5I1DA 1W72B 2FQGA 1Y74B 3FO9B 4MTOA 2HT2D 3CQPA 3UC0L 4JPSA 1KFGA 2IAMD 2QKAA 2JKTM 2MNWA 3ETSA 5ID0A 5DRZA 2FTAA 2YAEA 3KJ6H 2PCXA 3VU1A 1UXLA 3VFVB 1KIQB 4TQDA 3DI3B 3DMMC 4P3WA 5LQBL 2VRQA 2UVEA 2G38A 1X7TA 4YSOA 2XTJC 1AD9A 4F15C 3DX1A 2FEJA 1DSYA 5GGTA 4G9FB 4UIMB 4J3XA 3KPPA 2YKKA 2HVJC 3KPNA 4P04A 5DSCA 1YEJL 5FYKL 3ZK0A 3HMXH 3AG2B 4R4FH 4ZUWB 5FUCE 3IBOA 2PYED 5EEVA 2DI8A 2E9IA 4FQXA 3O8XA 3RWCB 4DR4O 4QHLA 4NOBA 4Y8DC 5CU5A 4PJ5A 1QSFD 4HLEA 3RYFB 4FG6D 2EH7H 2JJSA 5FK9B 3S35H 2KDGA 2V3FA 2CDEB 3GK8H 1FFXB 3HPLA 5EZOH 2YPLE 5HGHA 5K9OB 1K4DB 3CFJA 4GJTB 1KY6A 2NY2B 2VDKB 3HS0C 2VC2B 4ESKA 4AUUA 1ZIBA 2OM5A 3QGVA 1CE6A 4OXSA 4X8XA 1Z5YD 2CJUH 4X62O 3QORC 1KXQA 3O2WL 2CR3A 3E2EA 4W4OC 2P49B 3RBGA 4ZS6C 2GUZA 4UT7H 3G71V 5HVGB 4WV1C 5E08H 1MIEL 2VE6A 4JY5L 3MBED 4EUPB 2GHYA 1HCVA 4UQIM 4LF4B 3HAEG 3S34L 1CLZH 2QQNL 3RPKA 2KMWA 4F8NA 3LNIA 3V4VB 1N9PA 3ABMC 1G9NC 2IDFA 1P49A 1HN1A 2WANA 5EOCL 5T3ZD 2I60L 4U3HA 5MP6L 2HUEA 1CK0H 1QRND 2OTWA 4O9HL 5E8OB 1XZ0A 1JDAA 2BNQD 4XT1C 4YSAA 4TPRL 4LVOC 5HVWA 2H5UA 2BZCA 3KPRD 5BZDB 5F1OB 4O02B 5DFWH 2CCVA 1CL7H 4PHZA 4IS6B 3VFNA 4CC5A 1WGVA 1JUFB 2ERJB 1ZPLA 2VOTA 3MV7E 5TF1H 1FORH 2IJIA 3WE1A 1AJPA 2FEEI 2IPKB 4GFXA 3BI9X 1KYOJ 4RGND 1RHHB 4P5TA 3WS6A 2OTPA 4MCNA 3GSWB 2Q7HA 2UWEA 3HC3L 4FJZA 4MA8L 2XU9A 3UAAA 3ZL4L 4CL7A 5JQHC 2W65A 2Y06H 4JFEE 3PL6A 2XPZA 4ZYKA 4IGBA 3FFOA 3THML 2YWYA 2YAFA 1T0MB 4YGVA 2Y6SC 1A0QH 2XZCL 4D9RE 3RVWD 3EYVB 1LK3H 2HG0A 2NY1C 2VZ3A 3GHPA 5DMGD 5F7AA 1OF2B 3Q0HA 3TBSB 3OAUH 3UBXA 2AQRA 2IV9A 4N9GA 1INDH 1DZBA 3EUDA 2D31A 5DHYA 3X11A 3I74A 3WO4C 1NUDA 3L3OB 1WT5A 4H26A 5LYJA 5AZEH 2WXHA 3FONA 4BUQA 4Z7NB 1UZGA 3V5DB 4XDJA 1JV2A 2Y7LA 5ENWB 3ZS8C 5KVFL 1CDHA 2WB1A 5GSRB 5KYYA 4PJEE 3DHPA 3IGAA 1VQ9V 1X4YA 2WYZA 3MRKB 3RY4A 5IUSA 1N32B 3MC0A 2OYMA 1W91A 2A9CA 5BW7C 2CKBH 4UCTA 2P24B 2HLFC 3FNKA 5KW9L 4N5ED 3DDGA 2XRAH 4FZEL 5HPMA 3NFSH 4KZCA 1KB9F 3VCLB 4D9LH 1WWBX 3QDHA 4PGJA 5D1XD 1P4IH 1JXJA 1T2XA 1FG9C 2COVD 3TFKD 3LMJH 4OJDH 1NDGA 2HJFA 1U8NA 3CUPB 5DZVA 3ZKXC 1FZJB 3FO2A 4ENZA 4TUYA 2ODIA 3CC4V 3ATFA 2V5TA 3MLPA 1X5JA 2LAGB 1VP7A 3QPQC 5AW8B 3U30C 4F7MB 4YJ2A 1F90H 2X2YA 2B2XH 4M1DL 3VXSB 5IJ0A 1VGEL 4HKJA 4UTBH 1IAOB 3DO4A 1RULH 3VI3B 1YCSA 5DFVD 4ANWA 4DK5A 1FE8L 1BVLB 2NY6C 4LAJH 5TK2A 2WXKA 3ASNC 3QUYB 3WSQH 3KDMB 5TQ2H 1P7KA 4I2XA 2WXFA 4IRSC 1Y7VA 5CJOH 4TLTA 4BA0A 4DTGL 3GZQA 3GMLB 2VQEO 1V55B 4NC1E 3WENA 2AK1H 5F8QC 2VXTL 3WY2A 1JTOA 1XBDA 2BOCB 4GY4A 4K71C 1H3UA 1FN4B 1RLBA 4DV3B 2NMSA 2OW7A 4IHOA 5A43C 3K9AA 4HIJA 4L37A 4WUUB 4QTIH 3WIFB 5LGYA 1DEDA 3HKFA 1NLBL 2YD0A 1K73W 1SY6L 2JCWA 2Q86A 2WCGA 1OSEA 5J1TC 1MMMA 1QCEA 4GG6A 1T83A 1L5GB 3UBXI 4FXTA 4QXTA 2FATH 1QZ1A 1X5XA 4MAUL 2I9TA 3APOA 5H2BB 4BIKA 3SDYH 4HEMA 2OMUA 1HOCB 2FQDA 3ARDA 4U1LA 1AHKA 1RP8A 43C9B 5KVGL 1BFOB 1S7TB 5JOPE 4MQXD 4FHJA 2K7QA 4A7TA 1ZX3A 3A6BL 4ZBJA 1E43A 1JGLL 2FYUH 1M6OB 3DBSA 4Z7VF 1SQVH 2N74A 4RUFA 4DXWA 1I3RB 3H0TA 3QJQB 3S37X 3TBCA 5GONB 4GAAA 3T8XA 1A3ZA 4WKZB 4IEFB 1K3IA 1VQ6V 1S78D 4R4BA 3KG5A 4JL2A 5GSVA 2IOMA 3GI9L 2DQHL 1J95A 3E6HB 4DFHA 3P77B 2Z0AA 4N25A 3CFUA 4YZFF 3CZJA 4JM2C 1T89C 5CIPA 1F00I 4X5PA 4JGNA 3QDAA 3AK1A 2P80D 5C6WH 3EYUH 4JKLA 3LIUA 1CS6A 4U0QB 3U7YL 4FA8A 2OZ4H 2VO5A 1BLIA 3UTTB 1N34B 2UZXB 5IIEB 5DGQA 1IBMO 5T1DL 2NX5A 3POHA 4ZUSA 2P5WA 5C71A 4DAGL 2HG5C 2R69H 4LMQE 1TCRA 1BXUA 4Q6KA 1R3KC 1YECL 2QVKA 5EOQL 2VLKD 4GZRB 2W07A 3JD3A 1BVNT 3MR9A 1ZLWK 1QUPA 1DSFL 1R34A 2EDXA 2J21A 1MAMH 5D7LB 3OLIA 1AI1L 1UKSA 5L6YL 4Z1PA 1B90A 1AI6A 1CXFA 2E47A 5FOBA 1TLMA 1OLLA 4JPQA 2H4EA 1PX4A 3A0HZ 4NWUL 4QXGL 5TH2B 3VFGH 3B8YA 1Z7JA 4HU2A 3NAAH 4NQCB 1XUQA 2WIIB 4BGDA 3VFUA 4JCMA 1XI1A 2VKWA 4YDJA 4L8JA 5IMKA 3TK1A 3FFCB 3VA6A 1SMDA 2HJKA 4QXUH 5D5MB 4HXAH 2P28B 3BLKA 1HCYA 2CKBB 4RA0C 3V5KA 1S72V 4TV8B 4J8RA 1NBZA 1WZKA 5A6MA 4F7CA 3SE4C 3MLWL 3MFFA 2YGPA 5DWUL 5E8PA 1GVIA 2NY0B 4PIRF 1A64A 3MLYH 4XMPH 2X10A 1ID2A 2ICWI 3TBYB 1TVDA 4DUZO 3K74B 2P8LA 3JD2A 5DS2A 1ADQH 2PYEA 2WSKA 4G6KH 5IY5B 1TGOA 5JW3H 2UUCO 1QSFA 1HKLH 1DQKA 1D7BA 3QHFH 1KBGL 4AGLA 2OXHA 4TSFG 1P7HL 3BPLC 4JI1B 3RT3C 3U4AA 2E3CA 3UT5A 4PR5B 5CA0A 5HJ3A 3ZL2A 3ZHRA 4KHPO 2C9XA 2ICWJ 1DF4A 3SKNB 3M1CA 3OR6C 4HUXA 3TT1L 4S1SL 1UQSA 1PKOA 2ZNWA 1AQHA 4H25B 4QI3A 5JIDA 3NIGE 5HI4C 4QR7A 3VXPB 5JW5B 3RILA 3MBEA 1YAIA 5LQBH 4B08A 1INQB 2GITA 3BD5A 4P5RA 1VFBA 4HKZB 1QO3B 5SX5H 4XCYB 4X2UA 1QRNA 2X1WL 3GLEA 4CC4A 5E6YA 4QRPE 3ATAA 3S2AA 2ZWKA 2BNQA 4JKWA 1MNGA 1YEJH 1KZYA 1NGYB 2YBGA 5FYKH 5GGQL 1QAWA 1ZEAL 3KPRA 1GJUA 3BVWA 3SBRA 1GGIH 1UXWA 2Y2YA 3E6FA 2VLJD 4OI9A 5E56A 4WHYH 3DUUB 4O2EB 2X88A 3WNOA 5AG9A 2QSCL 4HALA 1JPTL 3L1FA 3MLZL 1WV7T 4Y9EA 1XSOA 1ZLWH 3BFWA 4ONHB 3GRWH 4JTAB 3K58A 4HUNB 3HB3C 3O2WH 3OVUB 1SYSB 4G8EB 4J3UA 1A8JH 3CH8A 1AB3A 4OSUL 1NFDF 3BX7C 3V0WL 3ZQ9A 1NH6A 3S34H 2QQNH 2O61B 2NY2C 2ZWYA 1WDAA 4MBOA 5EOCH 3EO1B 3L3GB 3R8QA 1QSZA 2I60H 5MP6H 2CDFA 4J41A 4FLVA 4O9HH 1HSBB 3QUMA 4WW2F 2AKRA 4TPRH 4PDVA 4PREB 5GS1B 3B6SB 2HHHO 4HK0B 4JYAO 4XBGB 5JIHA 2CO1A 3AS0A 3F7VA 4IK7A 5E94B 1A4KA 1HH6B 2MCPL 1NKDA 1QACA 4K2UL 5D1XA 5DYOA 5D7JC 4A68A 1XF4A 3HC3H 1VGKA 2IMNA 2QQLH 4HKXA 4MA8H 4PRHD 4L0YA 3EFFA 3QIBB 5ETUB 5KYWB 1V7ML 5I8KH 2PLTA 4FLYA 3G4SV 1XB3A 3BVUA 5JHLL 2HZHA 1PBYA 3HR0A 4JVPA 3QBTB 2XUMA 3CJHB 2V37A 4EKJA 5DK2B 1NH2D 1WTGT 5MEOA 5F3BB 1T3FB 3EYQC 2GK0B 3O3BA 5I76A 4GB9A 5FO8A 1WCBA 2V1DA 4DZ8B 1PZAA 3N2GA 1OEZW 4HIEA 4B9IA 2XG4A 4DN4L 4DV7B 1UZ8B 1U30A 3N5AA 2AK4E 4JZJA 5F7KC 3ZX1A 5D2NA 4B3RB 1A3LL 1J86A 3PDGA 4FNTA 5KVFH 2H3KA 2P26A 5IQ7L 1JFQL 3QJTB 1UGKA 3D18A 2XV0A 2AXFA 1BQHG 1KUQA 4HAMA 1VFAB 3BIAX 3D05A 4KMTL 4HJEA 3SYQA 1YDXA 2CIIB 1B04A 1AGBB 1JZHA 2R29H 4R3SA 3JSNA 5D55A 5DO2C 4F7EB 5FFLA 5LGKA 3ULUD 3E38A 3L3OC 3BEVA 2CTQA 1JERA 4N0YL 3WEMA 2OV0A 1R75A 1IGYA 3BD3A 4X6DE 3TTSA 5K1XA 1FAIL 2DLGA 4MDIB 3NFNA 3ZHKA 5KYUA 4LCWD 3RNQB 3QI9B 2PYLA 3TO4C 3PWVB 1T1XB 4YMPA 5GS0L 4O4YL 4GXFA 2WLZA 1JXKA 3EF4A 3VYOA 1MCSA 3O2DL 3PJSK 4MVRA 3CXCU 3NT0A 1T1YA 2XTLA 3U2JA 3A4AA 3BPZA 2VM4A 4Z0XB 1BCIA 3P02A 5B5EZ 4XB8A 3INOA 2JKSA 5TTRA 4XRCA 4M1DH 4N28A 1HHHA 1WZ1L 1VGEH 3VE0B 3GVMA 4DR1O 4OF0A 1TO5A 2H2PC 5LCVL 1GZQA 4TLKA 5JPNB 4IL6Z 5IB5B 4NERA 1T5XB 3LXBA 2ZCLH 2DQGL 2BS71 2MEJB 2VB5A 1UYWL 2UZPA 1MCOL 2EEAA 2MPVA 3BGFB 4K7PL 2A7WA 5LGNA 2VZTA 4NHCL 1VB9A 1JV5A 4QHNA 4QRTB