1YXBA

Crystal structure of phosphoribosyl-atp pyrophosphatase from streptomyces coelicolor. nesg target rr8.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
84
Chain Sequence
b'KTFEELFTELQHKAANTSRTAELVDKGVHAIGKKVVEEAAEVWMAAEYEGKDAAAEEISQLLYHVQVMMVARGISLDDVYAHLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosyl-ATP pyrophosphatase
publication title Crystal structure of Phosphoribosyl-ATP pyrophosphatase from Streptomyces coelicolor. NESG target RR8.
rcsb
source organism Streptomyces coelicolor
molecule tags Hydrolase
total genus 21
structure length 84
sequence length 88
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.1.31: Phosphoribosyl-ATP diphosphatase.
pdb deposition date 2005-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 1yxbA00
2OIEA 2Q5ZA 5IE9A 1YVWA 2Q4PA 1VMGA 1Y6XA 2P06A 3C90A 3CRCA 2GTAA 2A7WA 3CRAA 1YXBA 2A3QA 2Q73A 2OIGA 2YXHA 4QGPA 2Q9LA
chains in the Genus database with same CATH superfamily
4DV2O 5LA6B 3K57A 4DV0B 1IX9A 4UB8Z 2HLDG 4DV6B 4O4LA 1Q81W 1BQZA 3MDSA 3RBZA 4WF9V 2F95B 4MSWC 3U11A 2ETNA 3CCRV 1V54C 1XHZA 1AI4A 2UUCB 4O2BA 2BCCH 4UCOA 4LFBB 2DYSC 2ZD9A 3ABLB 2YIDA 2HG5C 1ZAUA 3H01A 4JYBA 1Q86W 5IJ0A 1CEZA 2WLIA 2QKSA 4D6TH 4GKKO 2L6LA 4X8AA 5B5EZ 4U3JB 1EZVH 2KB1A 2UXCB 3CEIA 2EX3A 1NVPD 4YHHO 3JAWB 4NXMB 1WN7A 1S5JA 1VF6C 3E22B 2EJRA 2BTOA 4GYCB 2XAGA 4RUFA 5L3FA 4WFAV 2WLLA 2XHBA 4I4TA 4I50A 3QO7A 3T4ZA 2KSDA 3CC2V 4X89A 3K06A 1RM1B 4TV8B 3R66A 1DLBA 1R3IC 1NBMG 5KHKA 2QTOA 3U0ZA 5IE9A 1P4RA 1EN4A 4JI3O 1Y66A 3N2KA 5JVDA 3JASB 3K5MA 4H44B 4MVZA 1TUEB 2YI9A 1QR9A 4FLUA 1Q6IA 1YF2A 1BMFG 4B3TO 1BHBA 1Y76A 3THOA 2P7TC 1JA8A 3Q4HB 4X1IA 3S3WA 2PYLA 4DR6O 2QTSA 4LH7A 1VMGA 2V7QG 1Q3EA 1XNQO 2E75B 3IAYA 1FFTB 4J41A 2A7WA 4DV7B 1AI6A 3O65A 4MT8A 2F66C 1JPXA 3RVYA 2ZR3A 2N05A 2Q73A 5LP6A 4JGSA 3UCSC 3OTFA 1EN6A 2F4VO 2M6YA 4DV5O 4OGQB 4X66B 1IBKO 3LUTB 1VARA 1S72V 4O2AA 5EC2C 5LHGA 5CA3A 4JYCA 1XL6A 2CH7A 4H37A 1S5LZ 1HW7A 4ZOLA 4HYOA 1PD3A 4FLWA 2DQ3A 1D2DA 4OPHA 2Q8VA 5CB4A 2OCHA 5D5QA 3TJTA 3FB6C 4LF4B 4BW9A 1PV0A 1KD1W 1YCIA 2G38A 2FYUH 4NTWA 2YXHA 3ZX6A 4X9QA 2JDIG 5JH7B 1TVKB 3B8NA 3T1CA 4BIOA 4DR7O 1KUQA 5E1AC 4PDRA 2BTQA 4FFBA 4LF7O 2F23A 3I5DA 4JI1O 2IBZH 5IJ9A 4B3RB 4UUJC 3AG1B 4LF8O 2HJDA 4XDKA 2FB5A 1VQ5V 5EZYA 1T5EA 3QG5A 3J80N 2XAFA 1PNKA 1EZJA 1QU7A 2ZE5A 1Z2GA 1TGOA 1QLNA 4GCZA 2ZXWC 5LMUB 3H1JH 2LQTA 4QPKA 2N04A 2QGNA 2HKOA 1PNMA 5EIBD 4PA9A 2EIJC 1G8MA 1V9PA 4CH3A 2AW9A 4QNHB 4F6RB 5H6QA 5LGUA 1OCOC 1V55B 5HFLA 3MD0A 4DV1O 2VQEB 2CDYA 4UVAA 4JV5B 4ASUG 1NH2D 5H6RA 2QJ1A 2JVDA 4DR3O 2CGOA 4X65B 1F7YA 3AEIA 2LGWA 1N0NA 1YTFB 4OXSA 1D5NA 4WFFA 3ZCCA 1JVMA 4JAVA 2B5UA 3AG3C 4DUYB 1HDJA 1WA8A 5EBWC 4MTOA 1P7GA 3EHBB 5LOVB 4HNAB 4ZI7A 2QE7G 5GONB 4RQEA 1GN4A 5LMNO 4CH4A 3CCJV 3F5WC 3ABUA 3K5OA 3ZHTA 2IH3C 1G4YB 3CCQV 1YXBA 4CS4A 2P4VA 4MVUA 1EFRG 1M56B 3F5TA 1S77D 1ZWIC 1PM9A 3P30A 1XEQA 1DF4A 1RSOA 3E86A 2YIBA 3T1HO 1YDXA 3L72H 3TCUA 4J80A 2E5LB 4I0XB 2YI8A 1N34B 1QCEA 2ZE6A 4TQDA 4MVOA 4CC6A 3JSNA 5J2UA 2YS8A 2GDSA 1U96A 1R6KA 2Y0IA 1N32O 5BR8O 1L0LH 3GWOA 2YEVB 1ZL8B 1GN3A 5LHIA 1Z5VA 2DYSB 3WB2A 1OCCC 3BCCH 4PV1B 4QJFB 3OGCC 3VQVA 4AI8A 2ZDIC 4BIZA 1K92A 4BW5A 4JASA 2DWEC 3W7UA 3JATA 2PI5A 2IJKA 3W7XA 1ZUQA 1KU9A 4X62B 2ZM6O 1HNWB 2BSKA 4KFMA 2ZNIA 3JCZA 4PA3A 3CYOA 4WFBV 2UXBO 1N33O 1F51A 4LNUA 3A0HZ 1ENVA 1KP2A 4DXWA 3TXQA 2PZSA 3ZJZA 3T1YB 3EXAA 4TUYA 1DTOA 1EBOA 3ZRVA 4JYAB 4E4EA 4LF6O 1D5AA 4IIJB 1HR0O 1JCHA 2CE4A 4ZHQB 4JI2O 2BE3A 4JI5O 3H9VA 4IHJB 2R9RB 3UT5A 2K1EA 3J7AU 4JAAA 4QE7A 4UCSA 2RMKB 2QSAA 4HZ3A 1KYOF 2B1GA 1MSDA 2Z5UA 4K0KB 3HKCB 3CSXA 3OR6C 4XDJA 4IYIA 1K73W 4PHZA 3VQYA 3ZHRA 4DR2O 5E79Z 4NTYA 4MW3A 5C8YA 4MVRA 4UB6Z 1WJZA 2ITCC 2UU9O 2UXDO 3QNEA 4DW0A 1XMOO 2JGDB 3N27A 4EB6A 4ZIBA 2XAJA 3CCVV 3W7WA 2WPDG 2L35A 3NR7A 5K1XA 4LWSB 3L73H 1K8AW 1WLEA 2KG7B 1IBMB 2IH1C 1IXBA 4J7ZA 1XNRO 4JPRA 4DK1A 1YITV 2AXTZ 4X20A 3OGIB 4K35A 1US6A 3DC6A 2XASA 3K0DA 5JQGA 1SQPH 3ZRXA 2BOBC 3SPHA 3AK2A 2GUZA 4NXNB 3KG2A 1JR9A 1OJHA 2ARHA 4JI4O 4AQYB 3SR2C 5J2TA 1P84F 5EBMC 5IYCO 1GO3F 5KX5B 4JI0B 4DV3O 2UUBO 1XQ8A 4GUNA 1SETA 4CZZA 2P22C 2UUAB 2PI4A 3CJHB 4O4IA 3UM7A 2ZQMA 1AJQA 5DEDA 3CXCU 5EIBC 1J5EO 3VBBA 4BIUA 1URFA 2GV9A 3LSSA 1BS3A 2EJ7A 3SJBC 4YJ2B 3ZEDA 2PY5A 1PPJH 2HR3A 1PNLA 4YJ3B 2DOSA 4Q6GA 4RUEA 5LA6A 3OUSA 5KHIA 3RYIB 3JAMN 5AG2A 4GKJO 3H1LH 1GM7A 1Q6UA 4JI6B 2W0FC 1AB3A 3K59A 2IJHA 4LBEC 1BHAA 1MG1A 3I56V 5KHJA 3K03A 2DJVA 1Q6HA 4UCTA 5J9PC 1HNXB 2A0LA 3OMAB 5DECA 4Z1VA 4LFAO 5JJNB 1BCCH 4HAMA 4X1YB 4PA6A 2QDOA 4LR3A 2WWWA 3ASNC 4YY3B 1XL4A 4K8XA 4OPAA 4DW1A 2Q67A 2ZXWB 2YXYA 4U3JA 1AR4A 1PL0A 2HVJC 3JD0A 2CUGA 2ZE7A 3JAWA 2AHZA 5EC1C 4PD4F 3E22A 4LC1A 5FL7G 4LF9B 2EIJB 2CTQA 4CBCA 4XDLA 1WAZA 4B7KA 4DR5O 2PUSA 2DE0X 3OE7G 1OCOB 2OTLV 5JCOA 2F93B 4EKWA 2LP7A 1Y67A 3L74H 4MVMA 4TV8A 3E89A 1RFYA 2D2CB 3DXRB 4KL1A 3JD1A 1AP5A 3CE2A 3LSQA 1WPBA 3WFVA 1O9HA 3JASA 1L1FA 4J7JA 3T4DA 1LR1A 4B3SO 1R73A 1GM8A 3WG7C 1MZEA 5KHHA 1NZ6A 5KAIZ 1R3LC 1PL4A 4DV2B 2A3QA 3Q4HA 1NVPB 1FXKB 5CA1B 1BQ0A 1MABG 4FIPC 2Y69B 4IL6Z 2RQ6A 4RAIA 3P3PA 3SJAC 1GH6A 1Q8IA 3CHXA 4N21A 1CP9A 1I7FA 1OV9A 1X59A 4A5UB 3HPLC 1JQ0A 2XOKG 4PI0A 2P5OA 1QQCA 4FM0A 1PP9H 2ZR2A 2X0LA 2CGNA 2QWPB 4PA7A 4BWAA 3A0RA 4GKKB 1TA8A 4N23A 3X2QC 3AK1A 4UV8A 4I9WA 1P49A 3SDLA 4TQFA 4YHHB 2ZIOA 3ZN1A 3KCXA 1SS3A 1BT8A 3FB5C 1OCCB 3A8TA 3G6BA 3ZMVA 4JYYA 2P6JA 4FLZA 1KP3A 1WNSA 1W0KG 2HEPA 3E35A 5JWPA 5CBGA 1VQ7V 3CRMA 3NXSA 1KKCA 1ZTEA 1MOFA 5EYPB 3G4SV 1VF5B 4ZKIA 4WBNB 3HR0A 4JI3B 4AILC 5JH7A 1TVKA 5CN0A 1AI7A 4ICGA 4FZ0A 4G27B 1I94O 1I5XA 3ZMUA 5GW7A 4H33A 1NTKH 2Q5ZA 4KXRA 4R8CA 3AG4C 4XBFA 3CCUV 1OCRC 1Q90D 2CTWA 4B3TB 2NR5A 3H1HH 2YIAA 1H2LA 4FLXA 1COWG 1J95A 1VQNV 5IYDO 4DR6B 4B08A 1QLEC 1XNQB 4GX2A 4CS3A 4TV9B 3LSUA 3ABMC 4UFZA 3ZIAG 5LYJB 1W2BU 3ETGA 2PYJA 2XAQA 1AILA 4TT3G 2HHHO 1G1XB 2EULA 1SQFA 1O9GA 3BAAA 2DYRC 2F4VB 4DV5B 2GSMB 3MAQA 1MZFA 1YHQV 1IBKB 4H13B 3SJCC 4F6RA 2DW4A 1B06A 3B2EE 3RYFB 1GAXA 1H2SB 4FLVA 3RW0A 4EFEA 3CWBH 1WPXA 1Z5WA 1F23A 2OCCC 1N36O 2JGUA 2XT9A 4AHCA 2QA4V 4I55B 2EINC 1SF9A 1Q5OA 5B1AB 2CAZC 1M57B 5LOVA 4HNAA 1M90W 5LXTB 1QVGU 5GONA 3K79A 3KKYA 3JYCA 3L75H 2UXXA 1IVSA 4GT1A 4P30A 4PELA 4RWUA 2YC0A 1BL8A 3K08A 2LFRA 2RN9A 1OCZC 1WB8A 4PDLA 4DR7B 2YDEA 3CMEV 1B3QA 2PTMA 2QKCA 3OTOO 3RT3C 4DV4O 3K9SA 4LF7B 2XAHA 4FM2A 3ZRSA 3IC7A 1DGSA 1NH2B 1K97A 1GTOA 4LF8B 4I0XA 2HFEC 3M8AA 3OMIB 2CTRA 1G6UA 2QM7A 4GLXA 3P3NA 2Z3YA 2EILB 2JRIA 4MTFA 4UCVA 5KMGB 3H1IH 2WLHA 2YEVA 4ABMA 1ZL8A 3LDCA 4MW8A 3CD6V 1YIJV 3E8GA 2ZKOA 4JTDB 4GX1A 2VQFO 4MTGA 2EZPA 4LF5O 3ASNB 4DV1B 5B1BC 2K9PA 3CRQA 2B9ZA 1NU1H 1X4TA 4YIPA 3RWRD 2OIGA 3ZBHA 2O57A 3ZRWB 5JJEB 4DR3B 3STZC 3E8FA 1VQMV 1VF6A 3C3TA 3E8HA 1UPGA 3ABKC 2WLJA 2C2AA 2MK3A 2YICA 3CCLV 2VS0A 2LJ2A 4IIJA 2EIKB 3ZHUA 4ZHQA 3P32A 4QIWF 4IHJA 2BOCC 5LMNB 1K5SA 2X6CA 4CH5A 1ZSPA 4D7TA 3HKCA 1NI8A 1FJGO 3K5LA 2JEXA 2X6AA 3FX7A 1SQGA 4X64O 1AP6A 1HNZO 3GVMA 3WG7B 2JGDA 2FKXA 3T1HB 2OT5A 3W7TA 1XOUA 3SGIA 5B3SC 2H8PC 4QGPA 1VQOV 4LWSA 2KG7A 2Y0PA 3SYCA 4UXNA 1V54B 4MS2A 3OT7A 2A9HA 2Q7GA 1M5IA 1K33A 2IJIA 4J9ZB 2E74B 2RDCA 4J11A 1NTMH 4JTCB 1JOYA 1RPRA 1N32B 5BR8B 3B40A 4PDVA 2QWOB 3D36C 4NTXA 1R6TA 3FKSG 1E1QG 5BMVB 5KX5A 3RYCB 1HWYA 4G2KA 2LW7A 5H9CA 1CPYA 3G67A 5CBFA 4QE9A 1FXHA 4FPPA 3X2QB 5KAFZ 3CJHA 3RGBA 3N2GB 2QWQB 5IYZB 2ZM6B 2MW2B 2E76B 2UXBB 1N33B 3FD9A 5LGNA 1GRJA 4MTXA 3OAAG 1OHHG 1YVWA 3T2MA 2OTJV 5DM6V 2ADQB 3TGUH 5L3BA 3KCYA 2NLJC 4LF6B 1AI5A 1N4CA 4YJ2A 1HR0B 2N74A 4JI5B 4JI2B 4JI7O 2EZOA 2E3CA 5ITZB 4YJ3A 3A2FA 3RYIA 4NYKA 4IT5A 4F6EA 2ADPA 1S0VA 3HB3B 2YUAA 4O4JB 4K3AA 4HBNA 1WP7A 3JALB 2Q0AA 4DR2B 2ZINA 1K4DC 2JIZG 3B4SA 4NVPA 2UU9B 3CCEV 2UXDB 3AG4B 3PN1A 1VQPV 1XMOB 1VQ8V 3KZIZ 4DR4O 4O4HB 1DK1A 4H0LB 5FNVB 3CXHF 1QR8A 3BVOA 4F4LA 1FAFA 2LO1A 1XNRB 3UO2A 4YIOA 1S5HC 1JJ2U 4X1YA 3R65A 1AVMA 3ABMB 1RPOA 2ZNJA 4LP8A 4LH6A 3E83A 1SA0B 1I5YA 3ZS8C 1F4NA 5EBLC 4FLTA 2Q68A 4JI4B 4DR1O 2YIBD 1VQLV 2DYRB 4OX9O 1B6QA 3JARB 4DV3B 3F7YC 3ZN0A 2UUBB 1KC8W 2ODMA 2Z0AA 5KLVH 2WA3A 1FFXB 5LHHA 4FMTA 4W4LA 5FPOA 3CRRA 2BSKB 3IJ4A 3VQWA 1Q82W 3OMNB 2EBOA 3L71H 4DRXB 3DXRA 2NNUA 1XMQO 1J5EB 4P9PA 5TISZ 4R7CA 5CA0B 1TAEA 4I5SA 2JEUA 2EINB 4U7NA 5IWAO 3CS5A 2OIEA 1Y74B 1PKXA 1IBLO 4NKGB 2DMXA 4JI8O 5BZBA 1JX9A 4GZRB 3CRAA 3B09A 4Q20A 4B3MO 4GKJB 1FXKA 3BRCA 2UXNA 5CA1A 3HKBB 2AZ0A 3JSLA 4DUZO 5LP6C 1XBLA 1OCZB 3E2EA 3RN4A 4KHPO 2R70A 3TXSA 3SYPA 5BY1A 3A0BZ 1A32A 2VRZA 4X1KB 4FFKA 4LFAB 1FS0G 5H5NA 3DGEA 1EN5A 4LFCO 1WB7A 3OM3B 2YSUB 4K8ZA 3BY6A 1AJNA 1GK9A 3EVKA 2W6JG 2GTAA 4B7EA 4FM1A 5CBHA 1VQKV 3JAKB 2ZDIA 4U7OA 2GBOA 3HKDB 3B77A 4DR5B 1R6NA 3DSQA 2WAMA 3FFQA 1S76D 1FPOA 4J42A 2GHYA 1P7BA 3WB0A 3AG3B 1ROPA 5EYPA 1SZXA 1LUVA 2AZ2A 2RJZA 2WA4A 5LGTA 1SQVH 4WBNA 1UJWB 3RVZA 2X7RB 4DV0O 1ZLZA 2GTSA 3ZHVA 1HP8A 3RFRA 2Q0OC 4DV6O 3UQ8A 3OW2U 4B3SB 1MA1A 5IY5C 4FK5C 5L3EA 2CK3G 1IURA 2FMLA 2QWRB 2UUCO 5EK0A 2VWKA 2FTKA 4I9QA 1R3KC 4U3FH 3HKEB 4TV9A 4LFBO 3U10A 4EEQA 2X6BA 1K34A 5LYJA 1M9NA 2QWNB 3S3XA 1MNGA 2W0XA 3FYEB 3BABA 4DK0A 2XTAA 5B3SB 2Y4TA 3RYHB 3SPIA 2PF4E 3SPJA 3FAVB 2UXCO 1M4UA 1SQBH 4NXMO 3G71V 4Z1MG 5LBQA 1TUBB 2QKAA 3RYFA 2WLMA 1S3JA 1W0JG 1W59A 5A2QN 1E1RG 3CX5F 3ASOC 2F43G 3MHHC 1JFFB 4I55A 3FB7C 4RO2A 3ZHSA 3G80A 2P67A 5GTIZ 4CC5A 5LXTA 4UV9A 1UFIA 2P90A 2W6IG 3D3QA 1AR5A 4P2ZA 1H2KA 3QF7A 3CRCA 1L0NH 3CC7V 1I94B 1NR1A 1ORQC 2LFSA 4O4LB 4TSFG 3BEHA 3STLC 4DV7O 3LNNA 2Q6AA 1NR7A 3JD4A 2FL4A 4O2BB 1B04A 4DYLA 1NT2B 3C90A 2V1DA 2Y48A 1YZBA 1FYJA 3K3WA 4QPJA 5KMGA 2ATKC 4X66O 1XI1A 5IJ0B 5IDJA 2IU3A 2HHHB 2WLIB 4NB5A 5A9GA 3APOA 2CTPA 2JS5A 1R3JC 2LGQA 1IZ3A 1K9MW 3JCUZ 2DWDC 1JMKC 1H2MA 1XREA 2JS3A 4PJ0Z 2LW1A 1EM1A 1KB9F 3SPCA 3CMAV 3SYQA 1RP3B 4CH6A 2ZE8A 5DN6G 1F4MA 1VP7A 2WLLB 3ZRWA 4JZ2A 4I4TB 1H8EG 4I50B 4YXWG 4LF4O 2A79B 1N36B 1KBHA 1KKDA 1GN6A 2KQXA 4ZBMA 3UO3A 1JJOA 2KKWA 3C3SA 3BA8A 4WCEV 1YJ9V 2Q69A 1IXMA 3QVNA 3N2KB 1U97A 5JVDB 1LNQA 4G28B 3K0GA 2P4KA 4IGGA 1BGYH 3CPWU 3J81N 5FPRA 4B3RO 1Y76B 1GN2A 3LDEA 4JI1B 1SZTA 4X1IB 4FZ1A 1KQSU 5B1OA 1QHTA 5BXZA 2HVKC 4FJCC 3OTOB 4DO2A 4DV4B 3L9DA 4C7UA 1SESA 1M93A 2Y4UA 1XDCA 3F7VC 5LMUO 3K04A 3AG7A 3CB2A 3GWKC 3L70H 4R6ZA 1K3EA 5LP6B 1H2NA 1GKFA 4J9YB 4GX5A 2ZCEA 2F1MA 3IFXA 5L3DA 1BE3H 4KP4A 4MVQA 4NR1A 4O2AB 1MMMA 5C93A 2VQEO 2DQ0A 1YEWA 3M7MX 5BMVA 4JV5O 2OWOA 2CH7B 1SRYA 3ETDA 3AG2C 3RYCA 4UVCA 4X65O 2VQFB 2HJFC 3ZMSA 4ZOLB 3APQA 4JTAB 4LF5B 2WSSG 3DC5A 1IDSA 3K9AA 4L87A 3CCMV 4DUYO 2RNBA 3FYIB 2AGAA 3G6EV 3N2GA 3VOUA 5CB4B 2EIMC 3ZMZA 5IYZA 1FXVA 4CS2A 1THZA 1NQTA 2IU0A 2WLNA 2ITDC 3FB8C 5KUMA 2IW5A 2DN9A 2Q4PA 2QR4A 2JK5C 3SJQC 1N0JA 1K4CC 2P06A 1WP8A 5KUKA 5ITZA 3LNMB 1FXKC 3VQXA 3QO5A 2BTQB 1CXZB 3ZHQA 2H94A 4FFBB 2Y69C 4O4JA 5IJ9B 1FJGB 4PI2A 1GM9A 2JJ1G 3JALA 1YTFD 4LCUC 2E5LO 3ABLC 1N34O 5EZYB 4UCRA 4X64B 1HNZB 5IY5B 4J7KA 1QBZA 2XUMA 4O4HA 4WFGA 4W4KA 2M7WA 5FNVA 5HFMA 2RCVA 4X88A 5L3GA 3M99B 3E8BA 1KMIZ 1OZ0A 2Q9LA 1LUWA 3H1KH 2WLKA 3JD3A 1Y4MA 1SA0A 1NS1A 1N8RW 3QTCA 4D7SA 5JCOC 3JD2A 3CCSV 4X62O 1RM1C 1HNWO 2V4DA 3JARA 1VQ6V 3ICXA 1K5QA 3OR7C 1FFXA 3T1YO 3ETQA 3SYOA 4I7ZB 4JYAO 1WA8B 1H38A 1VQ9V 5GTHZ 1VIBA 4ZI7B 3TETA 2XNDG 4DRXA 3ASOB 1AROP 3DTUB 5CA0A 4K0KO 3UKMA 1Y74A 3OUFA 3W7SA 3BA9A 1BSMA 2NN4A 1XILA 4BR6A 4TWKA 4JI7B 1QVFU 1AR1B 1RSOB 2QM8A 3O9OA 4UVBA 4R50A 4TOIA 1NKDA 3HKBA 2ZT9B 1Q43A 4FLYA 2ZIMA 1OCRB 4WFEA 5KA5A 4FVMA 5KA6A 4GX0A 5KHGA 1IBMO 1SQQH 3PJSK 3ML0A 5J2UB 1QLEB 3OEHG 1FKAO 4RQFA 1SKVA 4JZGA 4X1KA 4DR4B 2JJ2G 1KECA 4PA4A 4J10A 4NXNO 5H2FZ 2Q7HA 2QM4A 4AQYO 3OFNG 2IM9A 1H2GA 1SQXH 1QNMA 4JI0O 1E79G 4BAYA 2YXLA 4PDMA 2R9AA 2R72A 3IC9A 5CMUA 1BZKA 3JATB 2R9IA 2UUAO 5B1NA 3I55V 4DR1B 3BPZA 1M1KW 4OX9B 1XUQA 3JAKA 5B1AC 4IYHA 2H3OA 1M57C 3HKDA 3IGAC 4LNUB 3ZMTA 1AJPA 3CP1A 3SYAA 1DF5A 2OCCB 4TUYB 4L8JA 1XHXA 1I0HA 1R1BA 4EFBA 1L8DA 5JJJB 1NTZH 1FD9A 1YI2V 3UT5B 5LL6Y 1XMQB 3AG1C 5B66Z 4JF3A 3TK1A 1K7DA 3ETEA 4MVSA 5IWAB 4KUMA 4JI6O 1IBLB 4P9OA 1GMGA 2D3OW 1MSWD 4JI8B 1SERA 2IJJA 5C8YB 3WU2Z 4B3MB 4EB6B 3WB1A 1SC5B 3BHPA 1H8HG 4Z2WA 1HNXO 4DUZB 3K5NA 4E2LA 3HKEA 2EILC 3ABTA 4UCUA 1ZX3A 3OEEG 3OD4A 4KHPB 3EFFK 2OYQA 1I08A 3BFRA 4X20B 1V55C 3MHSC 4YY3O 2ILMA 3RYHA 3K58A 5JQGB 2GUZB 3LDDA 3FAVA 4LFCB 3CC4V 1Y6XA 2A06H 5J2TB 3GB7C 3SPGA 5D5PA 1TUBA 4LF9O 2B1IA 2AHYA 3D3IA 2QEXV 3D8CA 2HP8A 2Q7EA 3D36A 5F2VO 5K1PA 4O4IB 1VEWA 2PGGA 5B1BB 4JAUA 1JFFA 1NJIW 3AG2B 5FLXN 4WFHA 2EIKC 5IT9N 5L3CA 1YSCA 3B8MA 1M56C 1YJWV 3AK3A 1YJNV 2EIMB 3ABKB 1VQ4V 2VWJA 5IYBO 3QO8A 1VF7A 1Q7YW
chains in the Genus database with same CATH topology
2OIEA 2Q5ZA 5IE9A 1YVWA 2Q4PA 1VMGA 1Y6XA 2P06A 3C90A 3CRCA 2GTAA 2A7WA 3CRAA 1YXBA 2A3QA 2Q73A 2OIGA 2YXHA 4QGPA 2Q9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OIE A;  2Q5Z A;  5IE9 A;  1YVW A;  2Q4P A;  1VMG A;  1Y6X A;  2P06 A;  3C90 A;  3CRC A;  2GTA A;  2A7W A;  3CRA A;  1YXB A;  2A3Q A;  2Q73 A;  2OIG A;  2YXH A;  4QGP A;  2Q9L A; 
#chains in the Genus database with same CATH topology
 4DV2 O;  5LA6 B;  3K57 A;  4DV0 B;  1IX9 A;  4UB8 Z;  2HLD G;  4DV6 B;  4O4L A;  1Q81 W;  1BQZ A;  3MDS A;  3RBZ A;  4WF9 V;  2F95 B;  4MSW C;  3U11 A;  2ETN A;  3CCR V;  1V54 C;  1XHZ A;  1AI4 A;  2UUC B;  4O2B A;  2BCC H;  4UCO A;  4LFB B;  2DYS C;  2ZD9 A;  3ABL B;  2YID A;  2HG5 C;  1ZAU A;  3H01 A;  4JYB A;  1Q86 W;  5IJ0 A;  1CEZ A;  2WLI A;  2QKS A;  4D6T H;  4GKK O;  2L6L A;  4X8A A;  5B5E Z;  4U3J B;  1EZV H;  2KB1 A;  2UXC B;  3CEI A;  2EX3 A;  1NVP D;  4YHH O;  3JAW B;  4NXM B;  1WN7 A;  1S5J A;  1VF6 C;  3E22 B;  2EJR A;  2BTO A;  4GYC B;  2XAG A;  4RUF A;  5L3F A;  4WFA V;  2WLL A;  2XHB A;  4I4T A;  4I50 A;  3QO7 A;  3T4Z A;  2KSD A;  3CC2 V;  4X89 A;  3K06 A;  1RM1 B;  4TV8 B;  3R66 A;  1DLB A;  1R3I C;  1NBM G;  5KHK A;  2QTO A;  3U0Z A;  5IE9 A;  1P4R A;  1EN4 A;  4JI3 O;  1Y66 A;  3N2K A;  5JVD A;  3JAS B;  3K5M A;  4H44 B;  4MVZ A;  1TUE B;  2YI9 A;  1QR9 A;  4FLU A;  1Q6I A;  1YF2 A;  1BMF G;  4B3T O;  1BHB A;  1Y76 A;  3THO A;  2P7T C;  1JA8 A;  3Q4H B;  4X1I A;  3S3W A;  2PYL A;  4DR6 O;  2QTS A;  4LH7 A;  1VMG A;  2V7Q G;  1Q3E A;  1XNQ O;  2E75 B;  3IAY A;  1FFT B;  4J41 A;  2A7W A;  4DV7 B;  1AI6 A;  3O65 A;  4MT8 A;  2F66 C;  1JPX A;  3RVY A;  2ZR3 A;  2N05 A;  2Q73 A;  5LP6 A;  4JGS A;  3UCS C;  3OTF A;  1EN6 A;  2F4V O;  2M6Y A;  4DV5 O;  4OGQ B;  4X66 B;  1IBK O;  3LUT B;  1VAR A;  1S72 V;  4O2A A;  5EC2 C;  5LHG A;  5CA3 A;  4JYC A;  1XL6 A;  2CH7 A;  4H37 A;  1S5L Z;  1HW7 A;  4ZOL A;  4HYO A;  1PD3 A;  4FLW A;  2DQ3 A;  1D2D A;  4OPH A;  2Q8V A;  5CB4 A;  2OCH A;  5D5Q A;  3TJT A;  3FB6 C;  4LF4 B;  4BW9 A;  1PV0 A;  1KD1 W;  1YCI A;  2G38 A;  2FYU H;  4NTW A;  2YXH A;  3ZX6 A;  4X9Q A;  2JDI G;  5JH7 B;  1TVK B;  3B8N A;  3T1C A;  4BIO A;  4DR7 O;  1KUQ A;  5E1A C;  4PDR A;  2BTQ A;  4FFB A;  4LF7 O;  2F23 A;  3I5D A;  4JI1 O;  2IBZ H;  5IJ9 A;  4B3R B;  4UUJ C;  3AG1 B;  4LF8 O;  2HJD A;  4XDK A;  2FB5 A;  1VQ5 V;  5EZY A;  1T5E A;  3QG5 A;  3J80 N;  2XAF A;  1PNK A;  1EZJ A;  1QU7 A;  2ZE5 A;  1Z2G A;  1TGO A;  1QLN A;  4GCZ A;  2ZXW C;  5LMU B;  3H1J H;  2LQT A;  4QPK A;  2N04 A;  2QGN A;  2HKO A;  1PNM A;  5EIB D;  4PA9 A;  2EIJ C;  1G8M A;  1V9P A;  4CH3 A;  2AW9 A;  4QNH B;  4F6R B;  5H6Q A;  5LGU A;  1OCO C;  1V55 B;  5HFL A;  3MD0 A;  4DV1 O;  2VQE B;  2CDY A;  4UVA A;  4JV5 B;  4ASU G;  1NH2 D;  5H6R A;  2QJ1 A;  2JVD A;  4DR3 O;  2CGO A;  4X65 B;  1F7Y A;  3AEI A;  2LGW A;  1N0N A;  1YTF B;  4OXS A;  1D5N A;  4WFF A;  3ZCC A;  1JVM A;  4JAV A;  2B5U A;  3AG3 C;  4DUY B;  1HDJ A;  1WA8 A;  5EBW C;  4MTO A;  1P7G A;  3EHB B;  5LOV B;  4HNA B;  4ZI7 A;  2QE7 G;  5GON B;  4RQE A;  1GN4 A;  5LMN O;  4CH4 A;  3CCJ V;  3F5W C;  3ABU A;  3K5O A;  3ZHT A;  2IH3 C;  1G4Y B;  3CCQ V;  1YXB A;  4CS4 A;  2P4V A;  4MVU A;  1EFR G;  1M56 B;  3F5T A;  1S77 D;  1ZWI C;  1PM9 A;  3P30 A;  1XEQ A;  1DF4 A;  1RSO A;  3E86 A;  2YIB A;  3T1H O;  1YDX A;  3L72 H;  3TCU A;  4J80 A;  2E5L B;  4I0X B;  2YI8 A;  1N34 B;  1QCE A;  2ZE6 A;  4TQD A;  4MVO A;  4CC6 A;  3JSN A;  5J2U A;  2YS8 A;  2GDS A;  1U96 A;  1R6K A;  2Y0I A;  1N32 O;  5BR8 O;  1L0L H;  3GWO A;  2YEV B;  1ZL8 B;  1GN3 A;  5LHI A;  1Z5V A;  2DYS B;  3WB2 A;  1OCC C;  3BCC H;  4PV1 B;  4QJF B;  3OGC C;  3VQV A;  4AI8 A;  2ZDI C;  4BIZ A;  1K92 A;  4BW5 A;  4JAS A;  2DWE C;  3W7U A;  3JAT A;  2PI5 A;  2IJK A;  3W7X A;  1ZUQ A;  1KU9 A;  4X62 B;  2ZM6 O;  1HNW B;  2BSK A;  4KFM A;  2ZNI A;  3JCZ A;  4PA3 A;  3CYO A;  4WFB V;  2UXB O;  1N33 O;  1F51 A;  4LNU A;  3A0H Z;  1ENV A;  1KP2 A;  4DXW A;  3TXQ A;  2PZS A;  3ZJZ A;  3T1Y B;  3EXA A;  4TUY A;  1DTO A;  1EBO A;  3ZRV A;  4JYA B;  4E4E A;  4LF6 O;  1D5A A;  4IIJ B;  1HR0 O;  1JCH A;  2CE4 A;  4ZHQ B;  4JI2 O;  2BE3 A;  4JI5 O;  3H9V A;  4IHJ B;  2R9R B;  3UT5 A;  2K1E A;  3J7A U;  4JAA A;  4QE7 A;  4UCS A;  2RMK B;  2QSA A;  4HZ3 A;  1KYO F;  2B1G A;  1MSD A;  2Z5U A;  4K0K B;  3HKC B;  3CSX A;  3OR6 C;  4XDJ A;  4IYI A;  1K73 W;  4PHZ A;  3VQY A;  3ZHR A;  4DR2 O;  5E79 Z;  4NTY A;  4MW3 A;  5C8Y A;  4MVR A;  4UB6 Z;  1WJZ A;  2ITC C;  2UU9 O;  2UXD O;  3QNE A;  4DW0 A;  1XMO O;  2JGD B;  3N27 A;  4EB6 A;  4ZIB A;  2XAJ A;  3CCV V;  3W7W A;  2WPD G;  2L35 A;  3NR7 A;  5K1X A;  4LWS B;  3L73 H;  1K8A W;  1WLE A;  2KG7 B;  1IBM B;  2IH1 C;  1IXB A;  4J7Z A;  1XNR O;  4JPR A;  4DK1 A;  1YIT V;  2AXT Z;  4X20 A;  3OGI B;  4K35 A;  1US6 A;  3DC6 A;  2XAS A;  3K0D A;  5JQG A;  1SQP H;  3ZRX A;  2BOB C;  3SPH A;  3AK2 A;  2GUZ A;  4NXN B;  3KG2 A;  1JR9 A;  1OJH A;  2ARH A;  4JI4 O;  4AQY B;  3SR2 C;  5J2T A;  1P84 F;  5EBM C;  5IYC O;  1GO3 F;  5KX5 B;  4JI0 B;  4DV3 O;  2UUB O;  1XQ8 A;  4GUN A;  1SET A;  4CZZ A;  2P22 C;  2UUA B;  2PI4 A;  3CJH B;  4O4I A;  3UM7 A;  2ZQM A;  1AJQ A;  5DED A;  3CXC U;  5EIB C;  1J5E O;  3VBB A;  4BIU A;  1URF A;  2GV9 A;  3LSS A;  1BS3 A;  2EJ7 A;  3SJB C;  4YJ2 B;  3ZED A;  2PY5 A;  1PPJ H;  2HR3 A;  1PNL A;  4YJ3 B;  2DOS A;  4Q6G A;  4RUE A;  5LA6 A;  3OUS A;  5KHI A;  3RYI B;  3JAM N;  5AG2 A;  4GKJ O;  3H1L H;  1GM7 A;  1Q6U A;  4JI6 B;  2W0F C;  1AB3 A;  3K59 A;  2IJH A;  4LBE C;  1BHA A;  1MG1 A;  3I56 V;  5KHJ A;  3K03 A;  2DJV A;  1Q6H A;  4UCT A;  5J9P C;  1HNX B;  2A0L A;  3OMA B;  5DEC A;  4Z1V A;  4LFA O;  5JJN B;  1BCC H;  4HAM A;  4X1Y B;  4PA6 A;  2QDO A;  4LR3 A;  2WWW A;  3ASN C;  4YY3 B;  1XL4 A;  4K8X A;  4OPA A;  4DW1 A;  2Q67 A;  2ZXW B;  2YXY A;  4U3J A;  1AR4 A;  1PL0 A;  2HVJ C;  3JD0 A;  2CUG A;  2ZE7 A;  3JAW A;  2AHZ A;  5EC1 C;  4PD4 F;  3E22 A;  4LC1 A;  5FL7 G;  4LF9 B;  2EIJ B;  2CTQ A;  4CBC A;  4XDL A;  1WAZ A;  4B7K A;  4DR5 O;  2PUS A;  2DE0 X;  3OE7 G;  1OCO B;  2OTL V;  5JCO A;  2F93 B;  4EKW A;  2LP7 A;  1Y67 A;  3L74 H;  4MVM A;  4TV8 A;  3E89 A;  1RFY A;  2D2C B;  3DXR B;  4KL1 A;  3JD1 A;  1AP5 A;  3CE2 A;  3LSQ A;  1WPB A;  3WFV A;  1O9H A;  3JAS A;  1L1F A;  4J7J A;  3T4D A;  1LR1 A;  4B3S O;  1R73 A;  1GM8 A;  3WG7 C;  1MZE A;  5KHH A;  1NZ6 A;  5KAI Z;  1R3L C;  1PL4 A;  4DV2 B;  2A3Q A;  3Q4H A;  1NVP B;  1FXK B;  5CA1 B;  1BQ0 A;  1MAB G;  4FIP C;  2Y69 B;  4IL6 Z;  2RQ6 A;  4RAI A;  3P3P A;  3SJA C;  1GH6 A;  1Q8I A;  3CHX A;  4N21 A;  1CP9 A;  1I7F A;  1OV9 A;  1X59 A;  4A5U B;  3HPL C;  1JQ0 A;  2XOK G;  4PI0 A;  2P5O A;  1QQC A;  4FM0 A;  1PP9 H;  2ZR2 A;  2X0L A;  2CGN A;  2QWP B;  4PA7 A;  4BWA A;  3A0R A;  4GKK B;  1TA8 A;  4N23 A;  3X2Q C;  3AK1 A;  4UV8 A;  4I9W A;  1P49 A;  3SDL A;  4TQF A;  4YHH B;  2ZIO A;  3ZN1 A;  3KCX A;  1SS3 A;  1BT8 A;  3FB5 C;  1OCC B;  3A8T A;  3G6B A;  3ZMV A;  4JYY A;  2P6J A;  4FLZ A;  1KP3 A;  1WNS A;  1W0K G;  2HEP A;  3E35 A;  5JWP A;  5CBG A;  1VQ7 V;  3CRM A;  3NXS A;  1KKC A;  1ZTE A;  1MOF A;  5EYP B;  3G4S V;  1VF5 B;  4ZKI A;  4WBN B;  3HR0 A;  4JI3 B;  4AIL C;  5JH7 A;  1TVK A;  5CN0 A;  1AI7 A;  4ICG A;  4FZ0 A;  4G27 B;  1I94 O;  1I5X A;  3ZMU A;  5GW7 A;  4H33 A;  1NTK H;  2Q5Z A;  4KXR A;  4R8C A;  3AG4 C;  4XBF A;  3CCU V;  1OCR C;  1Q90 D;  2CTW A;  4B3T B;  2NR5 A;  3H1H H;  2YIA A;  1H2L A;  4FLX A;  1COW G;  1J95 A;  1VQN V;  5IYD O;  4DR6 B;  4B08 A;  1QLE C;  1XNQ B;  4GX2 A;  4CS3 A;  4TV9 B;  3LSU A;  3ABM C;  4UFZ A;  3ZIA G;  5LYJ B;  1W2B U;  3ETG A;  2PYJ A;  2XAQ A;  1AIL A;  4TT3 G;  2HHH O;  1G1X B;  2EUL A;  1SQF A;  1O9G A;  3BAA A;  2DYR C;  2F4V B;  4DV5 B;  2GSM B;  3MAQ A;  1MZF A;  1YHQ V;  1IBK B;  4H13 B;  3SJC C;  4F6R A;  2DW4 A;  1B06 A;  3B2E E;  3RYF B;  1GAX A;  1H2S B;  4FLV A;  3RW0 A;  4EFE A;  3CWB H;  1WPX A;  1Z5W A;  1F23 A;  2OCC C;  1N36 O;  2JGU A;  2XT9 A;  4AHC A;  2QA4 V;  4I55 B;  2EIN C;  1SF9 A;  1Q5O A;  5B1A B;  2CAZ C;  1M57 B;  5LOV A;  4HNA A;  1M90 W;  5LXT B;  1QVG U;  5GON A;  3K79 A;  3KKY A;  3JYC A;  3L75 H;  2UXX A;  1IVS A;  4GT1 A;  4P30 A;  4PEL A;  4RWU A;  2YC0 A;  1BL8 A;  3K08 A;  2LFR A;  2RN9 A;  1OCZ C;  1WB8 A;  4PDL A;  4DR7 B;  2YDE A;  3CME V;  1B3Q A;  2PTM A;  2QKC A;  3OTO O;  3RT3 C;  4DV4 O;  3K9S A;  4LF7 B;  2XAH A;  4FM2 A;  3ZRS A;  3IC7 A;  1DGS A;  1NH2 B;  1K97 A;  1GTO A;  4LF8 B;  4I0X A;  2HFE C;  3M8A A;  3OMI B;  2CTR A;  1G6U A;  2QM7 A;  4GLX A;  3P3N A;  2Z3Y A;  2EIL B;  2JRI A;  4MTF A;  4UCV A;  5KMG B;  3H1I H;  2WLH A;  2YEV A;  4ABM A;  1ZL8 A;  3LDC A;  4MW8 A;  3CD6 V;  1YIJ V;  3E8G A;  2ZKO A;  4JTD B;  4GX1 A;  2VQF O;  4MTG A;  2EZP A;  4LF5 O;  3ASN B;  4DV1 B;  5B1B C;  2K9P A;  3CRQ A;  2B9Z A;  1NU1 H;  1X4T A;  4YIP A;  3RWR D;  2OIG A;  3ZBH A;  2O57 A;  3ZRW B;  5JJE B;  4DR3 B;  3STZ C;  3E8F A;  1VQM V;  1VF6 A;  3C3T A;  3E8H A;  1UPG A;  3ABK C;  2WLJ A;  2C2A A;  2MK3 A;  2YIC A;  3CCL V;  2VS0 A;  2LJ2 A;  4IIJ A;  2EIK B;  3ZHU A;  4ZHQ A;  3P32 A;  4QIW F;  4IHJ A;  2BOC C;  5LMN B;  1K5S A;  2X6C A;  4CH5 A;  1ZSP A;  4D7T A;  3HKC A;  1NI8 A;  1FJG O;  3K5L A;  2JEX A;  2X6A A;  3FX7 A;  1SQG A;  4X64 O;  1AP6 A;  1HNZ O;  3GVM A;  3WG7 B;  2JGD A;  2FKX A;  3T1H B;  2OT5 A;  3W7T A;  1XOU A;  3SGI A;  5B3S C;  2H8P C;  4QGP A;  1VQO V;  4LWS A;  2KG7 A;  2Y0P A;  3SYC A;  4UXN A;  1V54 B;  4MS2 A;  3OT7 A;  2A9H A;  2Q7G A;  1M5I A;  1K33 A;  2IJI A;  4J9Z B;  2E74 B;  2RDC A;  4J11 A;  1NTM H;  4JTC B;  1JOY A;  1RPR A;  1N32 B;  5BR8 B;  3B40 A;  4PDV A;  2QWO B;  3D36 C;  4NTX A;  1R6T A;  3FKS G;  1E1Q G;  5BMV B;  5KX5 A;  3RYC B;  1HWY A;  4G2K A;  2LW7 A;  5H9C A;  1CPY A;  3G67 A;  5CBF A;  4QE9 A;  1FXH A;  4FPP A;  3X2Q B;  5KAF Z;  3CJH A;  3RGB A;  3N2G B;  2QWQ B;  5IYZ B;  2ZM6 B;  2MW2 B;  2E76 B;  2UXB B;  1N33 B;  3FD9 A;  5LGN A;  1GRJ A;  4MTX A;  3OAA G;  1OHH G;  1YVW A;  3T2M A;  2OTJ V;  5DM6 V;  2ADQ B;  3TGU H;  5L3B A;  3KCY A;  2NLJ C;  4LF6 B;  1AI5 A;  1N4C A;  4YJ2 A;  1HR0 B;  2N74 A;  4JI5 B;  4JI2 B;  4JI7 O;  2EZO A;  2E3C A;  5ITZ B;  4YJ3 A;  3A2F A;  3RYI A;  4NYK A;  4IT5 A;  4F6E A;  2ADP A;  1S0V A;  3HB3 B;  2YUA A;  4O4J B;  4K3A A;  4HBN A;  1WP7 A;  3JAL B;  2Q0A A;  4DR2 B;  2ZIN A;  1K4D C;  2JIZ G;  3B4S A;  4NVP A;  2UU9 B;  3CCE V;  2UXD B;  3AG4 B;  3PN1 A;  1VQP V;  1XMO B;  1VQ8 V;  3KZI Z;  4DR4 O;  4O4H B;  1DK1 A;  4H0L B;  5FNV B;  3CXH F;  1QR8 A;  3BVO A;  4F4L A;  1FAF A;  2LO1 A;  1XNR B;  3UO2 A;  4YIO A;  1S5H C;  1JJ2 U;  4X1Y A;  3R65 A;  1AVM A;  3ABM B;  1RPO A;  2ZNJ A;  4LP8 A;  4LH6 A;  3E83 A;  1SA0 B;  1I5Y A;  3ZS8 C;  1F4N A;  5EBL C;  4FLT A;  2Q68 A;  4JI4 B;  4DR1 O;  2YIB D;  1VQL V;  2DYR B;  4OX9 O;  1B6Q A;  3JAR B;  4DV3 B;  3F7Y C;  3ZN0 A;  2UUB B;  1KC8 W;  2ODM A;  2Z0A A;  5KLV H;  2WA3 A;  1FFX B;  5LHH A;  4FMT A;  4W4L A;  5FPO A;  3CRR A;  2BSK B;  3IJ4 A;  3VQW A;  1Q82 W;  3OMN B;  2EBO A;  3L71 H;  4DRX B;  3DXR A;  2NNU A;  1XMQ O;  1J5E B;  4P9P A;  5TIS Z;  4R7C A;  5CA0 B;  1TAE A;  4I5S A;  2JEU A;  2EIN B;  4U7N A;  5IWA O;  3CS5 A;  2OIE A;  1Y74 B;  1PKX A;  1IBL O;  4NKG B;  2DMX A;  4JI8 O;  5BZB A;  1JX9 A;  4GZR B;  3CRA A;  3B09 A;  4Q20 A;  4B3M O;  4GKJ B;  1FXK A;  3BRC A;  2UXN A;  5CA1 A;  3HKB B;  2AZ0 A;  3JSL A;  4DUZ O;  5LP6 C;  1XBL A;  1OCZ B;  3E2E A;  3RN4 A;  4KHP O;  2R70 A;  3TXS A;  3SYP A;  5BY1 A;  3A0B Z;  1A32 A;  2VRZ A;  4X1K B;  4FFK A;  4LFA B;  1FS0 G;  5H5N A;  3DGE A;  1EN5 A;  4LFC O;  1WB7 A;  3OM3 B;  2YSU B;  4K8Z A;  3BY6 A;  1AJN A;  1GK9 A;  3EVK A;  2W6J G;  2GTA A;  4B7E A;  4FM1 A;  5CBH A;  1VQK V;  3JAK B;  2ZDI A;  4U7O A;  2GBO A;  3HKD B;  3B77 A;  4DR5 B;  1R6N A;  3DSQ A;  2WAM A;  3FFQ A;  1S76 D;  1FPO A;  4J42 A;  2GHY A;  1P7B A;  3WB0 A;  3AG3 B;  1ROP A;  5EYP A;  1SZX A;  1LUV A;  2AZ2 A;  2RJZ A;  2WA4 A;  5LGT A;  1SQV H;  4WBN A;  1UJW B;  3RVZ A;  2X7R B;  4DV0 O;  1ZLZ A;  2GTS A;  3ZHV A;  1HP8 A;  3RFR A;  2Q0O C;  4DV6 O;  3UQ8 A;  3OW2 U;  4B3S B;  1MA1 A;  5IY5 C;  4FK5 C;  5L3E A;  2CK3 G;  1IUR A;  2FML A;  2QWR B;  2UUC O;  5EK0 A;  2VWK A;  2FTK A;  4I9Q A;  1R3K C;  4U3F H;  3HKE B;  4TV9 A;  4LFB O;  3U10 A;  4EEQ A;  2X6B A;  1K34 A;  5LYJ A;  1M9N A;  2QWN B;  3S3X A;  1MNG A;  2W0X A;  3FYE B;  3BAB A;  4DK0 A;  2XTA A;  5B3S B;  2Y4T A;  3RYH B;  3SPI A;  2PF4 E;  3SPJ A;  3FAV B;  2UXC O;  1M4U A;  1SQB H;  4NXM O;  3G71 V;  4Z1M G;  5LBQ A;  1TUB B;  2QKA A;  3RYF A;  2WLM A;  1S3J A;  1W0J G;  1W59 A;  5A2Q N;  1E1R G;  3CX5 F;  3ASO C;  2F43 G;  3MHH C;  1JFF B;  4I55 A;  3FB7 C;  4RO2 A;  3ZHS A;  3G80 A;  2P67 A;  5GTI Z;  4CC5 A;  5LXT A;  4UV9 A;  1UFI A;  2P90 A;  2W6I G;  3D3Q A;  1AR5 A;  4P2Z A;  1H2K A;  3QF7 A;  3CRC A;  1L0N H;  3CC7 V;  1I94 B;  1NR1 A;  1ORQ C;  2LFS A;  4O4L B;  4TSF G;  3BEH A;  3STL C;  4DV7 O;  3LNN A;  2Q6A A;  1NR7 A;  3JD4 A;  2FL4 A;  4O2B B;  1B04 A;  4DYL A;  1NT2 B;  3C90 A;  2V1D A;  2Y48 A;  1YZB A;  1FYJ A;  3K3W A;  4QPJ A;  5KMG A;  2ATK C;  4X66 O;  1XI1 A;  5IJ0 B;  5IDJ A;  2IU3 A;  2HHH B;  2WLI B;  4NB5 A;  5A9G A;  3APO A;  2CTP A;  2JS5 A;  1R3J C;  2LGQ A;  1IZ3 A;  1K9M W;  3JCU Z;  2DWD C;  1JMK C;  1H2M A;  1XRE A;  2JS3 A;  4PJ0 Z;  2LW1 A;  1EM1 A;  1KB9 F;  3SPC A;  3CMA V;  3SYQ A;  1RP3 B;  4CH6 A;  2ZE8 A;  5DN6 G;  1F4M A;  1VP7 A;  2WLL B;  3ZRW A;  4JZ2 A;  4I4T B;  1H8E G;  4I50 B;  4YXW G;  4LF4 O;  2A79 B;  1N36 B;  1KBH A;  1KKD A;  1GN6 A;  2KQX A;  4ZBM A;  3UO3 A;  1JJO A;  2KKW A;  3C3S A;  3BA8 A;  4WCE V;  1YJ9 V;  2Q69 A;  1IXM A;  3QVN A;  3N2K B;  1U97 A;  5JVD B;  1LNQ A;  4G28 B;  3K0G A;  2P4K A;  4IGG A;  1BGY H;  3CPW U;  3J81 N;  5FPR A;  4B3R O;  1Y76 B;  1GN2 A;  3LDE A;  4JI1 B;  1SZT A;  4X1I B;  4FZ1 A;  1KQS U;  5B1O A;  1QHT A;  5BXZ A;  2HVK C;  4FJC C;  3OTO B;  4DO2 A;  4DV4 B;  3L9D A;  4C7U A;  1SES A;  1M93 A;  2Y4U A;  1XDC A;  3F7V C;  5LMU O;  3K04 A;  3AG7 A;  3CB2 A;  3GWK C;  3L70 H;  4R6Z A;  1K3E A;  5LP6 B;  1H2N A;  1GKF A;  4J9Y B;  4GX5 A;  2ZCE A;  2F1M A;  3IFX A;  5L3D A;  1BE3 H;  4KP4 A;  4MVQ A;  4NR1 A;  4O2A B;  1MMM A;  5C93 A;  2VQE O;  2DQ0 A;  1YEW A;  3M7M X;  5BMV A;  4JV5 O;  2OWO A;  2CH7 B;  1SRY A;  3ETD A;  3AG2 C;  3RYC A;  4UVC A;  4X65 O;  2VQF B;  2HJF C;  3ZMS A;  4ZOL B;  3APQ A;  4JTA B;  4LF5 B;  2WSS G;  3DC5 A;  1IDS A;  3K9A A;  4L87 A;  3CCM V;  4DUY O;  2RNB A;  3FYI B;  2AGA A;  3G6E V;  3N2G A;  3VOU A;  5CB4 B;  2EIM C;  3ZMZ A;  5IYZ A;  1FXV A;  4CS2 A;  1THZ A;  1NQT A;  2IU0 A;  2WLN A;  2ITD C;  3FB8 C;  5KUM A;  2IW5 A;  2DN9 A;  2Q4P A;  2QR4 A;  2JK5 C;  3SJQ C;  1N0J A;  1K4C C;  2P06 A;  1WP8 A;  5KUK A;  5ITZ A;  3LNM B;  1FXK C;  3VQX A;  3QO5 A;  2BTQ B;  1CXZ B;  3ZHQ A;  2H94 A;  4FFB B;  2Y69 C;  4O4J A;  5IJ9 B;  1FJG B;  4PI2 A;  1GM9 A;  2JJ1 G;  3JAL A;  1YTF D;  4LCU C;  2E5L O;  3ABL C;  1N34 O;  5EZY B;  4UCR A;  4X64 B;  1HNZ B;  5IY5 B;  4J7K A;  1QBZ A;  2XUM A;  4O4H A;  4WFG A;  4W4K A;  2M7W A;  5FNV A;  5HFM A;  2RCV A;  4X88 A;  5L3G A;  3M99 B;  3E8B A;  1KMI Z;  1OZ0 A;  2Q9L A;  1LUW A;  3H1K H;  2WLK A;  3JD3 A;  1Y4M A;  1SA0 A;  1NS1 A;  1N8R W;  3QTC A;  4D7S A;  5JCO C;  3JD2 A;  3CCS V;  4X62 O;  1RM1 C;  1HNW O;  2V4D A;  3JAR A;  1VQ6 V;  3ICX A;  1K5Q A;  3OR7 C;  1FFX A;  3T1Y O;  3ETQ A;  3SYO A;  4I7Z B;  4JYA O;  1WA8 B;  1H38 A;  1VQ9 V;  5GTH Z;  1VIB A;  4ZI7 B;  3TET A;  2XND G;  4DRX A;  3ASO B;  1ARO P;  3DTU B;  5CA0 A;  4K0K O;  3UKM A;  1Y74 A;  3OUF A;  3W7S A;  3BA9 A;  1BSM A;  2NN4 A;  1XIL A;  4BR6 A;  4TWK A;  4JI7 B;  1QVF U;  1AR1 B;  1RSO B;  2QM8 A;  3O9O A;  4UVB A;  4R50 A;  4TOI A;  1NKD A;  3HKB A;  2ZT9 B;  1Q43 A;  4FLY A;  2ZIM A;  1OCR B;  4WFE A;  5KA5 A;  4FVM A;  5KA6 A;  4GX0 A;  5KHG A;  1IBM O;  1SQQ H;  3PJS K;  3ML0 A;  5J2U B;  1QLE B;  3OEH G;  1FKA O;  4RQF A;  1SKV A;  4JZG A;  4X1K A;  4DR4 B;  2JJ2 G;  1KEC A;  4PA4 A;  4J10 A;  4NXN O;  5H2F Z;  2Q7H A;  2QM4 A;  4AQY O;  3OFN G;  2IM9 A;  1H2G A;  1SQX H;  1QNM A;  4JI0 O;  1E79 G;  4BAY A;  2YXL A;  4PDM A;  2R9A A;  2R72 A;  3IC9 A;  5CMU A;  1BZK A;  3JAT B;  2R9I A;  2UUA O;  5B1N A;  3I55 V;  4DR1 B;  3BPZ A;  1M1K W;  4OX9 B;  1XUQ A;  3JAK A;  5B1A C;  4IYH A;  2H3O A;  1M57 C;  3HKD A;  3IGA C;  4LNU B;  3ZMT A;  1AJP A;  3CP1 A;  3SYA A;  1DF5 A;  2OCC B;  4TUY B;  4L8J A;  1XHX A;  1I0H A;  1R1B A;  4EFB A;  1L8D A;  5JJJ B;  1NTZ H;  1FD9 A;  1YI2 V;  3UT5 B;  5LL6 Y;  1XMQ B;  3AG1 C;  5B66 Z;  4JF3 A;  3TK1 A;  1K7D A;  3ETE A;  4MVS A;  5IWA B;  4KUM A;  4JI6 O;  1IBL B;  4P9O A;  1GMG A;  2D3O W;  1MSW D;  4JI8 B;  1SER A;  2IJJ A;  5C8Y B;  3WU2 Z;  4B3M B;  4EB6 B;  3WB1 A;  1SC5 B;  3BHP A;  1H8H G;  4Z2W A;  1HNX O;  4DUZ B;  3K5N A;  4E2L A;  3HKE A;  2EIL C;  3ABT A;  4UCU A;  1ZX3 A;  3OEE G;  3OD4 A;  4KHP B;  3EFF K;  2OYQ A;  1I08 A;  3BFR A;  4X20 B;  1V55 C;  3MHS C;  4YY3 O;  2ILM A;  3RYH A;  3K58 A;  5JQG B;  2GUZ B;  3LDD A;  3FAV A;  4LFC B;  3CC4 V;  1Y6X A;  2A06 H;  5J2T B;  3GB7 C;  3SPG A;  5D5P A;  1TUB A;  4LF9 O;  2B1I A;  2AHY A;  3D3I A;  2QEX V;  3D8C A;  2HP8 A;  2Q7E A;  3D36 A;  5F2V O;  5K1P A;  4O4I B;  1VEW A;  2PGG A;  5B1B B;  4JAU A;  1JFF A;  1NJI W;  3AG2 B;  5FLX N;  4WFH A;  2EIK C;  5IT9 N;  5L3C A;  1YSC A;  3B8M A;  1M56 C;  1YJW V;  3AK3 A;  1YJN V;  2EIM B;  3ABK B;  1VQ4 V;  2VWJ A;  5IYB O;  3QO8 A;  1VF7 A;  1Q7Y W; 
#chains in the Genus database with same CATH homology
 2OIE A;  2Q5Z A;  5IE9 A;  1YVW A;  2Q4P A;  1VMG A;  1Y6X A;  2P06 A;  3C90 A;  3CRC A;  2GTA A;  2A7W A;  3CRA A;  1YXB A;  2A3Q A;  2Q73 A;  2OIG A;  2YXH A;  4QGP A;  2Q9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...