1YXBA

Crystal structure of phosphoribosyl-atp pyrophosphatase from streptomyces coelicolor. nesg target rr8.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
84
Chain Sequence
KTFEELFTELQHKAANTSRTAELVDKGVHAIGKKVVEEAAEVWMAAEYEGKDAAAEEISQLLYHVQVMMVARGISLDDVYAHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphoribosyl-ATP pyrophosphatase
publication title Crystal structure of Phosphoribosyl-ATP pyrophosphatase from Streptomyces coelicolor. NESG target RR8.
rcsb
source organism Streptomyces coelicolor
total genus 21
structure length 84
sequence length 88
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.1.31: Phosphoribosyl-ATP diphosphatase.
pdb deposition date 2005-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 1yxbA00
2Q4PA 2Q5ZA 2Q73A 1YVWA 3C90A 2GTAA 2P06A 1Y6XA 5IE9A 2OIEA 4QGPA 2OIGA 1YXBA 2A7WA 3CRCA 3CRAA 2YXHA 2Q9LA 1VMGA 2A3QA
chains in the Genus database with same CATH superfamily
4WBNA 3LDDA 2ZE8A 5LXTB 1G6UA 4AQYO 4LFAO 2XUMA 2UXCO 1SA0A 2BSKB 4TOIA 2DYRC 4TV8A 5IWAO 5EBMC 1XOUA 1SF9A 3E86A 1XMOB 3T1YB 5GTHZ 4ZOLB 2RCVA 3OMAB 1I94O 3ABMC 4JI7B 3GWOA 2JGUA 4DR3O 1P7BA 4DR1B 1LNQA 4JAVA 3JASB 4MVRA 2CDYA 1Y76B 1N0NA 3JARB 4X64O 2ARHA 2CTPA 4UV8A 1AJQA 2MW2B 2P7TC 1S5JA 3DC5A 3MDSA 3F5WC 4UFZA 1V54C 1S5HC 4G27B 2KQXA 5DN6G 4DV5O 1HNZO 4FLWA 3RVYA 2UXBB 4TWKA 3K9AA 2RJZA 1F4MA 1P84F 4X1YB 5F2VO 3ZHVA 5EIBC 4DV5B 4GKJB 3CP1A 3H9VA 1G4YB 3J81N 4JGSA 4BAYA 4KHPO 2XOKG 2DWDC 4CBCA 2R72A 4W4LA 2XAJA 1GN2A 2W0FC 4J11A 4PDVA 1VQLV 2DYSC 3ZN0A 2Y0PA 4ZIBA 4X62O 1MZEA 3E8FA 3S3XA 4DV1O 2X6AA 3OE7G 3KZIZ 1KQSU 3CSXA 1W59A 3RYCA 1Q5OA 2P67A 1EN4A 4X62B 2XAFA 1OCOC 2V4DA 4AILC 4TUYB 1FD9A 2LFRA 1J5EB 1US6A 5KUMA 2EZPA 1Z2GA 3H01A 5EIBD 2NNUA 1BL8A 1ZWIC 4X1IB 4JI3B 4JTCB 1N32B 4K8ZA 3CCJV 2GUZA 4EB6B 2F95B 4PHZA 5LGNA 1PV0A 2YICA 1YVWA 1K9MW 3BFRA 3UT5A 2OYQA 1SS3A 3I56V 3E8GA 2DWEC 2R9IA 4PA9A 4Q6GA 2WA4A 1S0VA 1K3EA 2X7RB 3AG3C 2VWJA 3QO7A 3AG4C 4Z2WA 4I9WA 2JS3A 1XHZA 4HAMA 3L73H 2PF4E 2EJRA 3OR6C 3VQXA 2L35A 3SPHA 4FK5C 1THZA 3CXCU 1S77D 3JCZA 1ZL8B 4P9PA 3BA8A 4QE7A 4FZ1A 1MOFA 1R3KC 5JVDB 1EN6A 3ZN1A 5BY1A 1XNQO 3JAMN 2BSKA 2GDSA 2CGNA 4J42A 2YIBA 3B77A 1EM1A 3UM7A 1GM8A 5FL7G 1ROPA 5H2FZ 1XNQB 1BCCH 4BR6A 1UFIA 1K7DA 2JDIG 3ZIAG 4ZOLA 1YITV 4PA4A 4LC1A 3FFQA 1QVFU 1FFTB 1EFRG 1FFXB 1Q6HA 4UCUA 2AGAA 2F93B 3FB5C 1ORQC 3JASA 1I0HA 1WB8A 1K92A 3JARA 3PJSK 2ZKOA 2PYJA 2XAHA 5LYJB 2EIKB 3SYOA 1AJNA 3TETA 5CBGA 2BTQA 3APQA 1PNLA 2YUAA 3N27A 4NVPA 4G2KA 2EILB 5IT9N 1S5LZ 2DQ0A 4DV0B 1D5NA 4TQFA 4FLTA 5JH7B 4J10A 1K73W 2IU3A 4NR1A 4JF3A 5K1PA 4X1YA 1JX9A 5ITZB 3G4SV 4YJ2B 3CC4V 4DV4O 1QHTA 2JJ2G 3H1HH 1SKVA 2Q68A 4UCSA 4GX2A 3WG7C 1NTMH 1KP2A 4LFCO 3BA9A 2X0LA 4CH3A 1K5SA 4K0KO 2YS8A 3D8CA 1FXKA 1H2KA 5H6QA 2LO1A 1KECA 2CE4A 5IY5B 1R3JC 2IW5A 4K0KB 3T4ZA 2IU0A 5KAIZ 3UO3A 2KKWA 1R6TA 4J7KA 4X89A 4DR2O 3SPJA 2XAQA 4TUYA 4JYBA 3QO5A 3KKYA 5E1AC 2KG7B 4L87A 4FFKA 2EIJC 4X1IA 1VMGA 4DV7O 2Q7EA 1U96A 2RMKB 3A0RA 5KAFZ 4JASA 4QPJA 5BR8B 4EB6A 5D5QA 1SQVH 4LF6B 2JRIA 1AROP 1L0LH 1WAZA 3VQVA 4PDMA 3ZMVA 4K35A 1Q8IA 4XDJA 2QWOB 4QE9A 4NTYA 1X59A 3E8BA 4TV9B 3RYIB 5FPOA 1VQ6V 4JI6B 4B7EA 3ZHUA 2IJHA 3O65A 5HFMA 2BCCH 1H2MA 2FYUH 4GKKB 3U0ZA 1HNXO 1WB7A 2E3CA 4KL1A 2A06H 4G28B 2IM9A 5CB4A 2W0XA 3VOUA 4RO2A 3OTFA 3UQ8A 4MTGA 2W6IG 1ZL8A 2N04A 1N8RW 3GVMA 3CMEV 5EC2C 3I5DA 4OX9O 5JVDA 3ML0A 1V9PA 4F4LA 5KMGB 3K9SA 1I5XA 4DR7O 1BZKA 3HPLC 3KCYA 3WFVA 1MSWD 2HKOA 1HDJA 1VQ9V 3CS5A 4JI5O 3BABA 4H37A 3OEHG 2PI4A 4OPHA 5CN0A 2CGOA 1VQPV 4IHJB 2Q6AA 4MTFA 3STLC 5KHHA 1FAFA 1T5EA 2A3QA 1TUBA 2JK5C 4CZZA 3OFNG 3K5OA 3O9OA 1XHXA 1RPOA 1LUVA 3A8TA 4UXNA 3JD4A 1B04A 1FFXA 2EIKC 3HKDB 3K06A 5CA1B 2LJ2A 3DSQA 3RGBA 1GN4A 5L3CA 3CC7V 3CPWU 3SGIA 3ZMUA 4Z1MG 4LFBB 4PI0A 4UVAA 5LP6B 2EILC 3ABUA 5LYJA 4X65O 3CCLV 1GN6A 1SETA 3GWKC 4D6TH 2CTRA 1QU7A 5BZBA 3CCRV 1OCZB 2BE3A 2JJ1G 1IBKB 1OZ0A 2LFSA 4DUZO 4NXNB 4LBEC 1YJNV 4LF8B 1ZLZA 2EINB 2KB1A 1Q86W 2QM7A 3CRCA 4E2LA 2HVJC 3L72H 1GTOA 3N2KB 5LMNB 4YJ2A 2OCCB 2OTLV 2ZM6B 1PP9H 4RQFA 4H13B 1KKCA 3RVZA 1FKAO 1WP8A 5IY5C 3EFFK 2F4VO 1BHBA 1Y6XA 1RM1B 2GTSA 3HKEB 1R73A 2VQEO 5B1BB 3OT7A 3T1HB 2DN9A 3G67A 2F23A 4GZRB 3IJ4A 1BS3A 4LF5O 2UUCB 2V7QG 1NJIW 3ZBHA 3QO8A 3OM3B 2ZE5A 2UU9O 1SZTA 1XREA 4TQDA 3OTOB 3RYCB 4JI8B 2ILMA 2BOCC 1HR0B 2OIEA 1K8AW 4DXWA 2LW1A 5B1NA 1KBHA 2ZR3A 5LL6Y 4QPKA 4JYAB 2KG7A 2P5OA 1FPOA 4MTXA 1S3JA 3JD1A 4P30A 3BAAA 2F66C 4B3MO 1QLNA 3OW2U 2Q67A 4YHHB 2ITCC 5FPRA 1SQFA 1AR4A 2HHHO 1Q82W 4PV1B 3BCCH 2W6JG 3WB2A 1IBLO 1NR1A 5BXZA 3H1JH 3SDLA 4RQEA 3Q4HA 1QR8A 4TV9A 4GCZA 3G71V 2Y48A 1WNSA 3RYIA 3UCSC 1RPRA 3CHXA 3DXRB 2LGWA 1HNWO 1K5QA 1HWYA 5CBFA 2H8PC 4LWSB 4TT3G 2VQFB 4FPPA 1OJHA 4DUYB 1SQQH 1BSMA 1X4TA 3F7YC 3B4SA 2Q8VA 1JJOA 1G8MA 1H38A 4I9QA 3CCUV 3OR7C 5KMGA 4JZGA 5LHHA 1FJGB 2RN9A 3LSUA 3N2GB 4X66B 2ODMA 1VQ8V 1XMOO 2FKXA 5D5PA 3SPIA 3T1YO 1BGYH 4B3RB 4FVMA 4DV3B 3U11A 1R3LC 2DE0X 2H3OA 3KG2A 2OTJV 4JI7O 1B06A 3K58A 4HBNA 4X1KA 3CWBH 4IHJA 3LSQA 4CH5A 4EKWA 1Q7YW 1KU9A 5LP6C 4DR1O 3M99B 1VF5B 2P4KA 4IYIA 3ZHQA 3HKDA 4R6ZA 5CA1A 1O9HA 1MNGA 4LR3A 2HLDG 1JFFB 1OCZC 1P7GA 5K1XA 4HYOA 3BRCA 4DR6B 5LP6A 1KMIZ 4O4IB 3QG5A 4LF9B 4P2ZA 1DK1A 2EINC 4U7NA 5KHGA 1F23A 3KCXA 1K4CC 4PA6A 1N33B 2OCCC 1SRYA 1YDXA 2BTQB 1N36B 3ZRXA 3L71H 2UXBO 4FM0A 4YIPA 1VQNV 4OXSA 1KB9F 1M57B 1IX9A 3N2KA 1RM1C 4GKJO 4DK0A 2H94A 1KP3A 1JR9A 2Q7HA 5B1BC 3RFRA 3FX7A 2QA4V 1XL4A 3ETDA 3ETEA 4WFGA 2LGQA 4UCTA 3L9DA 1B6QA 5LMUB 3HKEA 1UPGA 1FYJA 5EC1C 2A79B 2P6JA 1HP8A 1IZ3A 1FXKB 2A9HA 5LA6B 4HZ3A 1W2BU 3K5MA 1VQ4V 1K33A 1NTZH 2HVKC 4B3SB 4PI2A 4A5UB 5B5EZ 4CS3A 4LNUB 3WG7B 1IDSA 1QQCA 1Z5VA 1JA8A 3F5TA 3WU2Z 1J5EO 4O4HA 4KP4A 2CUGA 2JIZG 1DF5A 2QKAA 4J80A 1VP7A 2IH3C 4JI3O 1N32O 4JZ2A 1MG1A 2UXDB 4DYLA 5IJ9B 4K3AA 2Q9LA 4YJ3B 4X8AA 4IIJB 2LQTA 4U3FH 1UJWB 2ZXWB 1O9GA 4J7ZA 5JQGA 1NT2B 3ZHSA 1K97A 1IXMA 3NR7A 4NKGB 2EIJB 3TXQA 1VQKV 2VS0A 1KKDA 4JI1B 4DRXA 4WCEV 2X6CA 1R6NA 3K08A 2QM4A 3DXRA 3CD6V 2QKCA 4JV5B 2WLIB 1LUWA 2E75B 5E79Z 4LWSA 1NKDA 3CYOA 4UV9A 2ZE6A 1F7YA 2FMLA 2QWNB 1XQ8A 1EBOA 1Y74B 5CB4B 1COWG 3EHBB 1TA8A 3D3IA 2Y69B 3SYQA 3NXSA 2ATKC 2N74A 3RYHB 4I50B 5IDJA 1DGSA 5A9GA 3N2GA 2WLKA 2ZIOA 4FLVA 3SYCA 3L74H 3MHHC 3S3WA 1AR5A 1JJ2U 3QVNA 3RW0A 3THOA 4ZHQB 3K57A 5KX5A 1M90W 4X9QA 3B8MA 1FS0G 1ZSPA 2RDCA 2CTWA 2QEXV 1TUBB 3LUTB 3JAWB 1SZXA 2JVDA 3K03A 5JJNB 3AG2B 4H44B 3SJAC 4JTDB 3JD2A 1AVMA 1YJ9V 1JFFA 4PDRA 2YIBD 5DECA 2ZDIC 2OT5A 4QIWF 3K0GA 4O4IA 3CX5F 1SQGA 2PTMA 5B1AB 2F1MA 4R7CA 5LHGA 1M57C 3K04A 1OCCB 1CP9A 2EBOA 4KXRA 4DV0O 2ZDIA 1RSOB 4XBFA 2IJJA 2GBOA 3D36C 1XMQB 2P4VA 1QVGU 3ZX6A 1W0JG 3E22B 1M5IA 3E89A 1CEZA 5JJEB 2Q0AA 5KLVH 4JI0B 1VQOV 1AI4A 3CRQA 1WA8A 3ZMSA 1JCHA 3D36A 1FXKC 1U97A 4D7SA 3LNNA 3ZJZA 2HFEC 1YSCA 4PA3A 1N0JA 4FM2A 5H5NA 4ZKIA 5LA6A 1V55B 1R1BA 2ZQMA 4LNUA 3ZRSA 1S76D 3B09A 2DJVA 1NTKH 4BWAA 4IYHA 3RYFA 2QTOA 2ZXWC 3C3SA 1BMFG 4UCRA 4I7ZB 4JI4B 3FYIB 4WFAV 4YY3B 5BR8O 4NTXA 3W7UA 5IJ9A 4LF6O 4YJ3A 4BIZA 4IIJA 2B1IA 4O4LB 3PN1A 4H0LB 2AXTZ 1Y67A 3TXSA 4AI8A 4DR5B 3W7WA 1YTFB 2DMXA 1L0NH 1AILA 4NYKA 5IYDO 4BW9A 4O2BB 5GONA 4JI6O 3Q4HB 3LSSA 3E2EA 2YXHA 1YF2A 3OMNB 3K0DA 1M9NA 1YEWA 1H2SB 4GKKO 2CH7B 3ABKB 4Q20A 1B3QA 2WLIA 2Y69C 3T1CA 1M4UA 4JYYA 4MVSA 1PL4A 3WB0A 2PGGA 3T2MA 4GYCB 1TGOA 1Y74A 2E76B 4UUJC 5DEDA 4NTWA 4GT1A 4CC5A 4R8CA 3A0BZ 2XNDG 1GM9A 5C8YB 2QM8A 5KHIA 3CCSV 3EVKA 2Q4PA 3CCEV 2PYLA 1R6KA 3RYHA 4I50A 4WFFA 2B1GA 2EX3A 1JQ0A 3FYEB 1Y66A 1H2LA 3AG2C 3ZHTA 4PJ0Z 4ZHQA 2YIDA 1CXZB 1AB3A 1DF4A 2YI8A 4X1KB 4MW8A 1E1QG 4H33A 4MT8A 1SQXH 2Q5ZA 3JAWA 1PL0A 5B1AC 4DV6B 2GHYA 4LFBO 1BHAA 1EZVH 1OCCC 4P9OA 1L1FA 2AW9A 4JI2B 3QTCA 2MK3A 1YZBA 2UXXA 3AEIA 1PD3A 3E35A 5KA5A 3LNMB 1NH2B 3B40A 1IBKO 4JYCA 3ETGA 1I7FA 1Q6IA 2YXYA 3AK2A 3CXHF 1RSOA 4NXNO 4LF8O 1PKXA 4NXMB 1GKFA 1WPBA 3JALB 4BIUA 5LMNO 3E22A 1VF6C 1KUQA 5KHJA 2ZM6O 5IYCO 2WWWA 1WLEA 5IYBO 3E83A 3G6EV 3CCQV 1V55C 2HP8A 4FZ0A 2Z0AA 1VF6A 1K34A 3VQWA 3FB6C 3G80A 3C90A 5L3EA 1AR1B 3T1HO 2YXLA 1KD1W 2RQ6A 2UUCO 4LF7B 1H2NA 2O57A 4EFBA 2QWRB 2YIAA 3QNEA 1NQTA 3VQYA 3HB3B 3UKMA 5B3SB 3OTOO 4JI8O 2IBZH 3W7XA 1HR0O 3SPCA 2FTKA 5CA0B 4JYAO 2EULA 2L6LA 4O4HB 3MHSC 1YHQV 1CPYA 4YHHO 3IGAC 5FNVB 4MVOA 1XNRB 4O4LA 3CRAA 4DV2B 3RN4A 4UCOA 3W7SA 2YDEA 4CS4A 2HJDA 1ZAUA 2NLJC 4J9ZB 2Y4TA 2DOSA 5JQGB 3ZS8C 2ZCEA 3ABKC 3APOA 3HKCB 1PPJH 1VQ5V 4O2BA 1H2GA 3CJHB 4HNAB 3SYAA 4CH4A 4NB5A 4R50A 4D7TA 2YSUB 4DRXB 3OUSA 3STZC 4UCVA 2E5LB 2VQFO 1GH6A 4MVQA 2CH7A 3FD9A 4EFEA 4WF9V 4DUYO 3CRMA 1H8EG 4ICGA 3OGCC 1QLEC 4W4KA 1M56B 2X6BA 1JOYA 5AG2A 2P06A 3TK1A 5LOVB 1D5AA 1H8HG 2QWPB 1J95A 2NR5A 4O4JA 1YXBA 4TSFG 2Q7GA 3P30A 5C8YA 1FJGO 3K59A 4X66O 2QGNA 4ZI7A 4U3JA 4B3RO 4QJFB 4DV3O 1I08A 1XUQA 3ZMZA 4PDLA 4LF4B 2OCHA 1MA1A 1RP3B 1A32A 1N34B 4IT5A 2YEVA 3P32A 2UUAB 2JGDB 3TJTA 5H6RA 1YIJV 2UUBB 5C93A 5KX5B 4WFEA 1DTOA 3L70H 1M1KW 3SYPA 4DR6O 2GV9A 1XL6A 3H1LH 2QR4A 4AQYB 2CK3G 4LFAB 4LF9O 5H9CA 2R9AA 2UXCB 5IJ0B 3OD4A 4N23A 2DQ3A 2R70A 3OAAG 4JPRA 1N33O 1AJPA 3CE2A 5IWAB 1IXBA 2ETNA 4RUEA 1TAEA 3JD3A 1N36O 5EK0A 4J9YB 1QNMA 1JMKC 2FL4A 2PUSA 1I94B 3JALA 3B2EE 2ZE7A 1OCRB 3P3NA 4DR3B 1GAXA 3CMAV 3CEIA 5LGTA 1XBLA 3A2FA 1NH2D 1SQBH 1WA8B 2IH1C 2ADQB 5LMUO 2WAMA 4X64B 4PD4F 3ZRVA 3J7AU 2OWOA 5B3SC 3DC6A 4CH6A 3SJQC 3IC9A 4GX0A 5LGUA 3M8AA 2Y0IA 3BY6A 5EZYB 5KUKA 4QGPA 1NBMG 4B3SO 3T4DA 5CA3A 1WPXA 5EBWC 2WLMA 2BTOA 3BPZA 3CRRA 1HNZB 4MVMA 1MSDA 3K79A 3DGEA 5EBLC 5CA0A 5DM6V 4FFBA 1LR1A 1VIBA 3JATB 1L8DA 1IBMO 3RYFB 2UXDO 2G38A 2EIMB 2JEXA 1JPXA 2XTAA 4FLXA 5FNVA 2EJ7A 2D3OW 4MSWC 4KHPB 1IBMB 4UVBA 2RNBA 1P4RA 3OGIB 3AG1B 3MAQA 3X2QB 3R66A 3JSLA 2LW7A 1BQZA 3HKBA 5B1OA 4YXWG 1Q3EA 4MW3A 4GUNA 3HKCA 1N4CA 4JI1O 2GTAA 4DV1B 5CBHA 1VQMV 2C2AA 2QKSA 1E79G 1M56C 2QSAA 4OPAA 3CJHA 4HNAA 4JV5O 2VRZA 1Y4MA 5GONB 4F6RA 3K5NA 1S72V 4X20A 1AI5A 1GO3F 4FJCC 3LDCA 5LOVA 1GM7A 3CCVV 1Q43A 4I4TB 2XAGA 4XDLA 2Z3YA 4KFMA 4I5SA 1WN7A 2WSSG 5IYZB 5L3GA 2E74B 4UVCA 4JAAA 2AHYA 4DK1A 4BIOA 1VARA 1BE3H 3OEEG 4IL6Z 1XEQA 4MTOA 1QBZA 4GX1A 4Z1VA 5J2TB 1DLBA 1QR9A 3TGUH 3K3WA 2JGDA 3E8HA 3M7MX 1I5YA 2IJIA 5L3FA 5B66Z 5LXTA 1MMMA 2WLLB 5TISZ 1YJWV 4PELA 1TVKB 3JCUZ 4AHCA 5JJJB 3AK1A 1K4DC 3SJBC 4JAUA 3A0HZ 4L8JA 2ZNJA 5IJ0A 1VQ7V 1OV9A 3R65A 1AI6A 2QWQB 3K5LA 1OCRC 1VF7A 3ASNB 2IJKA 1NU1H 1XMQO 1AI7A 1TUEB 2V1DA 1HW7A 3JYCA 4U7OA 1D2DA 2EZOA 4JI0O 3F7VC 5LHIA 3IFXA 1Y76A 2B5UA 3RBZA 1RFYA 4CS2A 1Q6UA 1XI1A 2WLHA 5JWPA 3AK3A 3FKSG 2Y4UA 4BW5A 3FAVB 2ZR2A 1EN5A 2D2CB 4B7KA 3BHPA 3JD0A 5IE9A 5EZYA 3ASOB 4WFBV 2UXNA 4X88A 2WPDG 3ABLB 3W7TA 2EIMC 5BMVB 4MVUA 2ZNIA 2HJFC 4KUMA 2HR3A 1URFA 4RAIA 5EYPB 5J2UB 4LH6A 3AG1C 4JI4O 3JATA 1SERA 3X2QC 4YY3O 1AP5A 3IC7A 1ZUQA 4DV4B 4DR4O 3SPGA 2DW4A 1W0KG 4ABMA 4C7UA 2AZ0A 3ETQA 3BVOA 3OMIB 3QF7A 4LFCB 4DR4B 3AG7A 2XHBA 4DR5O 1ZX3A 3L75H 3EXAA 4DW0A 3H1KH 1JVMA 3JAKB 1PNKA 3VBBA 3ZRWB 4DR2B 1NVPB 4O2AB 2P90A 3DTUB 3SR2C 3GB7C 2Q73A 5L3DA 4DV7B 1SC5B 4I4TA 1NR7A 2WLJA 4O4JB 5IYZA 3UO2A 1MABG 1SQPH 3HR0A 4I0XB 4I55B 2ADPA 1EZJA 1QLEB 4PA7A 3I55V 2M7WA 4F6EA 1YI2V 4ZI7B 1NS1A 2PZSA 4U3JB 1NZ6A 2AHZA 2ZD9A 1IURA 2PI5A 1PNMA 5J2TA 1F4NA 2AZ2A 5KHKA 1QCEA 1M93A 3J80N 1AP6A 2P22C 2FB5A 2YEVB 1HNXB 4DV6O 1Q81W 3D3QA 2WLLA 4WBNB 1KYOF 3CCMV 2QE7G 3RWRD 3ASNC 4JI2O 3SJCC 2ZIMA 2JEUA 3C3TA 1TVKA 3RT3C 1SA0B 3H1IH 1FXVA 4OX9B 3OUFA 4TV8B 4FLZA 1SESA 2OIGA 4FLYA 2PY5A 2HG5C 4UB8Z 4GLXA 4DR7B 1GMGA 4JI5B 4NXMO 2DYRB 1MZFA 4FLUA 3FB8C 5KA6A 1XDCA 2XASA 1GK9A 2Q69A 4LCUC 3ABMB 4RWUA 5CMUA 3CB2A 4UB6Z 3ASOC 3TCUA 4B08A 3ABLC 3FAVA 3ZHRA 2JS5A 3JSNA 2YI9A 3FB7C 4MVZA 1KC8W 3ICXA 4LF7O 1YCIA 4X65B 1ENVA 4OGQB 5HFLA 2LP7A 5JH7A 2NN4A 4FMTA 2YC0A 1VEWA 2A7WA 1NI8A 3ZEDA 5BMVA 5L3BA 5ITZA 4DUZB 1G1XB 5LBQA 2KSDA 2HEPA 1V54B 5EYPA 5J2UA 4DW1A 4N21A 4JTAB 4LP8A 1BT8A 4FFBB 1XNRO 1GRJA 2A0LA 3P3PA 1Z5WA 1OHHG 4DV2O 4B3TO 5FLXN 2Q0OC 2K9PA 2F4VB 3MD0A 4J7JA 5J9PC 4IGGA 3LDEA 2ZINA 4B3TB 2VQEB 1ZTEA 2QTSA 1WJZA 3WB1A 2WA3A 4LF5B 3HKBB 3B8NA 1BQ0A 3JAKA 3U10A 4LH7A 3IAYA 2E5LO 3CC2V 2DYSB 3ZRWA 5A2QN 2UU9B 4EEQA 1GN3A 4O2AA 3ZMTA 2CTQA 2M6YA 3G6BA 2QJ1A 4F6RB 2ITDC 4RUFA 2XT9A 4E4EA 1IVSA 4XDKA 2VWKA 2GUZB 1OCOB 5GTIZ 1F51A 4X20B 4B3MB 4MS2A 4FIPC 5JCOC 2N05A 1YTFD 4CC6A 3UT5B 5GW7A 2QDOA 3ZCCA 2HHHB 1R3IC 4DO2A 2ZT9B 1NVPD 4QNHB 1IBLB 2B9ZA 2F43G 4I0XA 4I55A 2R9RB 4ASUG 4LF4O 5JCOA 2Z5UA 2CAZC 1XILA 1FXHA 4GX5A 1N34O 1E1RG 2K1EA 1HNWB 2UUAO 4K8XA 2UUBO 2BOBC 2WLNA 4WFHA 1P49A 3AG3B 1WP7A 4YIOA 1PM9A 2GSMB 1Q90D 3BEHA 3ABTA 4FM1A 3AG4B 4ZBMA 4J41A
chains in the Genus database with same CATH topology
2Q4PA 2Q5ZA 2Q73A 1YVWA 3C90A 2GTAA 2P06A 1Y6XA 5IE9A 2OIEA 4QGPA 2OIGA 1YXBA 2A7WA 3CRCA 3CRAA 2YXHA 2Q9LA 1VMGA 2A3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4P A;  2Q5Z A;  2Q73 A;  1YVW A;  3C90 A;  2GTA A;  2P06 A;  1Y6X A;  5IE9 A;  2OIE A;  4QGP A;  2OIG A;  1YXB A;  2A7W A;  3CRC A;  3CRA A;  2YXH A;  2Q9L A;  1VMG A;  2A3Q A; 
#chains in the Genus database with same CATH topology
 4WBN A;  3LDD A;  2ZE8 A;  5LXT B;  1G6U A;  4AQY O;  4LFA O;  2XUM A;  2UXC O;  1SA0 A;  2BSK B;  4TOI A;  2DYR C;  4TV8 A;  5IWA O;  5EBM C;  1XOU A;  1SF9 A;  3E86 A;  1XMO B;  3T1Y B;  5GTH Z;  4ZOL B;  2RCV A;  3OMA B;  1I94 O;  3ABM C;  4JI7 B;  3GWO A;  2JGU A;  4DR3 O;  1P7B A;  4DR1 B;  1LNQ A;  4JAV A;  3JAS B;  4MVR A;  2CDY A;  1Y76 B;  1N0N A;  3JAR B;  4X64 O;  2ARH A;  2CTP A;  4UV8 A;  1AJQ A;  2MW2 B;  2P7T C;  1S5J A;  3DC5 A;  3MDS A;  3F5W C;  4UFZ A;  1V54 C;  1S5H C;  4G27 B;  2KQX A;  5DN6 G;  4DV5 O;  1HNZ O;  4FLW A;  3RVY A;  2UXB B;  4TWK A;  3K9A A;  2RJZ A;  1F4M A;  1P84 F;  4X1Y B;  5F2V O;  3ZHV A;  5EIB C;  4DV5 B;  4GKJ B;  3CP1 A;  3H9V A;  1G4Y B;  3J81 N;  4JGS A;  4BAY A;  4KHP O;  2XOK G;  2DWD C;  4CBC A;  2R72 A;  4W4L A;  2XAJ A;  1GN2 A;  2W0F C;  4J11 A;  4PDV A;  1VQL V;  2DYS C;  3ZN0 A;  2Y0P A;  4ZIB A;  4X62 O;  1MZE A;  3E8F A;  3S3X A;  4DV1 O;  2X6A A;  3OE7 G;  3KZI Z;  1KQS U;  3CSX A;  1W59 A;  3RYC A;  1Q5O A;  2P67 A;  1EN4 A;  4X62 B;  2XAF A;  1OCO C;  2V4D A;  4AIL C;  4TUY B;  1FD9 A;  2LFR A;  1J5E B;  1US6 A;  5KUM A;  2EZP A;  1Z2G A;  3H01 A;  5EIB D;  2NNU A;  1BL8 A;  1ZWI C;  4X1I B;  4JI3 B;  4JTC B;  1N32 B;  4K8Z A;  3CCJ V;  2GUZ A;  4EB6 B;  2F95 B;  4PHZ A;  5LGN A;  1PV0 A;  2YIC A;  1YVW A;  1K9M W;  3BFR A;  3UT5 A;  2OYQ A;  1SS3 A;  3I56 V;  3E8G A;  2DWE C;  2R9I A;  4PA9 A;  4Q6G A;  2WA4 A;  1S0V A;  1K3E A;  2X7R B;  3AG3 C;  2VWJ A;  3QO7 A;  3AG4 C;  4Z2W A;  4I9W A;  2JS3 A;  1XHZ A;  4HAM A;  3L73 H;  2PF4 E;  2EJR A;  3OR6 C;  3VQX A;  2L35 A;  3SPH A;  4FK5 C;  1THZ A;  3CXC U;  1S77 D;  3JCZ A;  1ZL8 B;  4P9P A;  3BA8 A;  4QE7 A;  4FZ1 A;  1MOF A;  1R3K C;  5JVD B;  1EN6 A;  3ZN1 A;  5BY1 A;  1XNQ O;  3JAM N;  2BSK A;  2GDS A;  2CGN A;  4J42 A;  2YIB A;  3B77 A;  1EM1 A;  3UM7 A;  1GM8 A;  5FL7 G;  1ROP A;  5H2F Z;  1XNQ B;  1BCC H;  4BR6 A;  1UFI A;  1K7D A;  2JDI G;  3ZIA G;  4ZOL A;  1YIT V;  4PA4 A;  4LC1 A;  3FFQ A;  1QVF U;  1FFT B;  1EFR G;  1FFX B;  1Q6H A;  4UCU A;  2AGA A;  2F93 B;  3FB5 C;  1ORQ C;  3JAS A;  1I0H A;  1WB8 A;  1K92 A;  3JAR A;  3PJS K;  2ZKO A;  2PYJ A;  2XAH A;  5LYJ B;  2EIK B;  3SYO A;  1AJN A;  3TET A;  5CBG A;  2BTQ A;  3APQ A;  1PNL A;  2YUA A;  3N27 A;  4NVP A;  4G2K A;  2EIL B;  5IT9 N;  1S5L Z;  2DQ0 A;  4DV0 B;  1D5N A;  4TQF A;  4FLT A;  5JH7 B;  4J10 A;  1K73 W;  2IU3 A;  4NR1 A;  4JF3 A;  5K1P A;  4X1Y A;  1JX9 A;  5ITZ B;  3G4S V;  4YJ2 B;  3CC4 V;  4DV4 O;  1QHT A;  2JJ2 G;  3H1H H;  1SKV A;  2Q68 A;  4UCS A;  4GX2 A;  3WG7 C;  1NTM H;  1KP2 A;  4LFC O;  3BA9 A;  2X0L A;  4CH3 A;  1K5S A;  4K0K O;  2YS8 A;  3D8C A;  1FXK A;  1H2K A;  5H6Q A;  2LO1 A;  1KEC A;  2CE4 A;  5IY5 B;  1R3J C;  2IW5 A;  4K0K B;  3T4Z A;  2IU0 A;  5KAI Z;  3UO3 A;  2KKW A;  1R6T A;  4J7K A;  4X89 A;  4DR2 O;  3SPJ A;  2XAQ A;  4TUY A;  4JYB A;  3QO5 A;  3KKY A;  5E1A C;  2KG7 B;  4L87 A;  4FFK A;  2EIJ C;  4X1I A;  1VMG A;  4DV7 O;  2Q7E A;  1U96 A;  2RMK B;  3A0R A;  5KAF Z;  4JAS A;  4QPJ A;  5BR8 B;  4EB6 A;  5D5Q A;  1SQV H;  4LF6 B;  2JRI A;  1ARO P;  1L0L H;  1WAZ A;  3VQV A;  4PDM A;  3ZMV A;  4K35 A;  1Q8I A;  4XDJ A;  2QWO B;  4QE9 A;  4NTY A;  1X59 A;  3E8B A;  4TV9 B;  3RYI B;  5FPO A;  1VQ6 V;  4JI6 B;  4B7E A;  3ZHU A;  2IJH A;  3O65 A;  5HFM A;  2BCC H;  1H2M A;  2FYU H;  4GKK B;  3U0Z A;  1HNX O;  1WB7 A;  2E3C A;  4KL1 A;  2A06 H;  4G28 B;  2IM9 A;  5CB4 A;  2W0X A;  3VOU A;  4RO2 A;  3OTF A;  3UQ8 A;  4MTG A;  2W6I G;  1ZL8 A;  2N04 A;  1N8R W;  3GVM A;  3CME V;  5EC2 C;  3I5D A;  4OX9 O;  5JVD A;  3ML0 A;  1V9P A;  4F4L A;  5KMG B;  3K9S A;  1I5X A;  4DR7 O;  1BZK A;  3HPL C;  3KCY A;  3WFV A;  1MSW D;  2HKO A;  1HDJ A;  1VQ9 V;  3CS5 A;  4JI5 O;  3BAB A;  4H37 A;  3OEH G;  2PI4 A;  4OPH A;  5CN0 A;  2CGO A;  1VQP V;  4IHJ B;  2Q6A A;  4MTF A;  3STL C;  5KHH A;  1FAF A;  1T5E A;  2A3Q A;  1TUB A;  2JK5 C;  4CZZ A;  3OFN G;  3K5O A;  3O9O A;  1XHX A;  1RPO A;  1LUV A;  3A8T A;  4UXN A;  3JD4 A;  1B04 A;  1FFX A;  2EIK C;  3HKD B;  3K06 A;  5CA1 B;  2LJ2 A;  3DSQ A;  3RGB A;  1GN4 A;  5L3C A;  3CC7 V;  3CPW U;  3SGI A;  3ZMU A;  4Z1M G;  4LFB B;  4PI0 A;  4UVA A;  5LP6 B;  2EIL C;  3ABU A;  5LYJ A;  4X65 O;  3CCL V;  1GN6 A;  1SET A;  3GWK C;  4D6T H;  2CTR A;  1QU7 A;  5BZB A;  3CCR V;  1OCZ B;  2BE3 A;  2JJ1 G;  1IBK B;  1OZ0 A;  2LFS A;  4DUZ O;  4NXN B;  4LBE C;  1YJN V;  4LF8 B;  1ZLZ A;  2EIN B;  2KB1 A;  1Q86 W;  2QM7 A;  3CRC A;  4E2L A;  2HVJ C;  3L72 H;  1GTO A;  3N2K B;  5LMN B;  4YJ2 A;  2OCC B;  2OTL V;  2ZM6 B;  1PP9 H;  4RQF A;  4H13 B;  1KKC A;  3RVZ A;  1FKA O;  1WP8 A;  5IY5 C;  3EFF K;  2F4V O;  1BHB A;  1Y6X A;  1RM1 B;  2GTS A;  3HKE B;  1R73 A;  2VQE O;  5B1B B;  3OT7 A;  3T1H B;  2DN9 A;  3G67 A;  2F23 A;  4GZR B;  3IJ4 A;  1BS3 A;  4LF5 O;  2UUC B;  2V7Q G;  1NJI W;  3ZBH A;  3QO8 A;  3OM3 B;  2ZE5 A;  2UU9 O;  1SZT A;  1XRE A;  4TQD A;  3OTO B;  3RYC B;  4JI8 B;  2ILM A;  2BOC C;  1HR0 B;  2OIE A;  1K8A W;  4DXW A;  2LW1 A;  5B1N A;  1KBH A;  2ZR3 A;  5LL6 Y;  4QPK A;  4JYA B;  2KG7 A;  2P5O A;  1FPO A;  4MTX A;  1S3J A;  3JD1 A;  4P30 A;  3BAA A;  2F66 C;  4B3M O;  1QLN A;  3OW2 U;  2Q67 A;  4YHH B;  2ITC C;  5FPR A;  1SQF A;  1AR4 A;  2HHH O;  1Q82 W;  4PV1 B;  3BCC H;  2W6J G;  3WB2 A;  1IBL O;  1NR1 A;  5BXZ A;  3H1J H;  3SDL A;  4RQE A;  3Q4H A;  1QR8 A;  4TV9 A;  4GCZ A;  3G71 V;  2Y48 A;  1WNS A;  3RYI A;  3UCS C;  1RPR A;  3CHX A;  3DXR B;  2LGW A;  1HNW O;  1K5Q A;  1HWY A;  5CBF A;  2H8P C;  4LWS B;  4TT3 G;  2VQF B;  4FPP A;  1OJH A;  4DUY B;  1SQQ H;  1BSM A;  1X4T A;  3F7Y C;  3B4S A;  2Q8V A;  1JJO A;  1G8M A;  1H38 A;  4I9Q A;  3CCU V;  3OR7 C;  5KMG A;  4JZG A;  5LHH A;  1FJG B;  2RN9 A;  3LSU A;  3N2G B;  4X66 B;  2ODM A;  1VQ8 V;  1XMO O;  2FKX A;  5D5P A;  3SPI A;  3T1Y O;  1BGY H;  4B3R B;  4FVM A;  4DV3 B;  3U11 A;  1R3L C;  2DE0 X;  2H3O A;  3KG2 A;  2OTJ V;  4JI7 O;  1B06 A;  3K58 A;  4HBN A;  4X1K A;  3CWB H;  4IHJ A;  3LSQ A;  4CH5 A;  4EKW A;  1Q7Y W;  1KU9 A;  5LP6 C;  4DR1 O;  3M99 B;  1VF5 B;  2P4K A;  4IYI A;  3ZHQ A;  3HKD A;  4R6Z A;  5CA1 A;  1O9H A;  1MNG A;  4LR3 A;  2HLD G;  1JFF B;  1OCZ C;  1P7G A;  5K1X A;  4HYO A;  3BRC A;  4DR6 B;  5LP6 A;  1KMI Z;  4O4I B;  3QG5 A;  4LF9 B;  4P2Z A;  1DK1 A;  2EIN C;  4U7N A;  5KHG A;  1F23 A;  3KCX A;  1K4C C;  4PA6 A;  1N33 B;  2OCC C;  1SRY A;  1YDX A;  2BTQ B;  1N36 B;  3ZRX A;  3L71 H;  2UXB O;  4FM0 A;  4YIP A;  1VQN V;  4OXS A;  1KB9 F;  1M57 B;  1IX9 A;  3N2K A;  1RM1 C;  4GKJ O;  4DK0 A;  2H94 A;  1KP3 A;  1JR9 A;  2Q7H A;  5B1B C;  3RFR A;  3FX7 A;  2QA4 V;  1XL4 A;  3ETD A;  3ETE A;  4WFG A;  2LGQ A;  4UCT A;  3L9D A;  1B6Q A;  5LMU B;  3HKE A;  1UPG A;  1FYJ A;  5EC1 C;  2A79 B;  2P6J A;  1HP8 A;  1IZ3 A;  1FXK B;  2A9H A;  5LA6 B;  4HZ3 A;  1W2B U;  3K5M A;  1VQ4 V;  1K33 A;  1NTZ H;  2HVK C;  4B3S B;  4PI2 A;  4A5U B;  5B5E Z;  4CS3 A;  4LNU B;  3WG7 B;  1IDS A;  1QQC A;  1Z5V A;  1JA8 A;  3F5T A;  3WU2 Z;  1J5E O;  4O4H A;  4KP4 A;  2CUG A;  2JIZ G;  1DF5 A;  2QKA A;  4J80 A;  1VP7 A;  2IH3 C;  4JI3 O;  1N32 O;  4JZ2 A;  1MG1 A;  2UXD B;  4DYL A;  5IJ9 B;  4K3A A;  2Q9L A;  4YJ3 B;  4X8A A;  4IIJ B;  2LQT A;  4U3F H;  1UJW B;  2ZXW B;  1O9G A;  4J7Z A;  5JQG A;  1NT2 B;  3ZHS A;  1K97 A;  1IXM A;  3NR7 A;  4NKG B;  2EIJ B;  3TXQ A;  1VQK V;  2VS0 A;  1KKD A;  4JI1 B;  4DRX A;  4WCE V;  2X6C A;  1R6N A;  3K08 A;  2QM4 A;  3DXR A;  3CD6 V;  2QKC A;  4JV5 B;  2WLI B;  1LUW A;  2E75 B;  5E79 Z;  4LWS A;  1NKD A;  3CYO A;  4UV9 A;  2ZE6 A;  1F7Y A;  2FML A;  2QWN B;  1XQ8 A;  1EBO A;  1Y74 B;  5CB4 B;  1COW G;  3EHB B;  1TA8 A;  3D3I A;  2Y69 B;  3SYQ A;  3NXS A;  2ATK C;  2N74 A;  3RYH B;  4I50 B;  5IDJ A;  1DGS A;  5A9G A;  3N2G A;  2WLK A;  2ZIO A;  4FLV A;  3SYC A;  3L74 H;  3MHH C;  3S3W A;  1AR5 A;  1JJ2 U;  3QVN A;  3RW0 A;  3THO A;  4ZHQ B;  3K57 A;  5KX5 A;  1M90 W;  4X9Q A;  3B8M A;  1FS0 G;  1ZSP A;  2RDC A;  2CTW A;  2QEX V;  1TUB B;  3LUT B;  3JAW B;  1SZX A;  2JVD A;  3K03 A;  5JJN B;  3AG2 B;  4H44 B;  3SJA C;  4JTD B;  3JD2 A;  1AVM A;  1YJ9 V;  1JFF A;  4PDR A;  2YIB D;  5DEC A;  2ZDI C;  2OT5 A;  4QIW F;  3K0G A;  4O4I A;  3CX5 F;  1SQG A;  2PTM A;  5B1A B;  2F1M A;  4R7C A;  5LHG A;  1M57 C;  3K04 A;  1OCC B;  1CP9 A;  2EBO A;  4KXR A;  4DV0 O;  2ZDI A;  1RSO B;  4XBF A;  2IJJ A;  2GBO A;  3D36 C;  1XMQ B;  2P4V A;  1QVG U;  3ZX6 A;  1W0J G;  3E22 B;  1M5I A;  3E89 A;  1CEZ A;  5JJE B;  2Q0A A;  5KLV H;  4JI0 B;  1VQO V;  1AI4 A;  3CRQ A;  1WA8 A;  3ZMS A;  1JCH A;  3D36 A;  1FXK C;  1U97 A;  4D7S A;  3LNN A;  3ZJZ A;  2HFE C;  1YSC A;  4PA3 A;  1N0J A;  4FM2 A;  5H5N A;  4ZKI A;  5LA6 A;  1V55 B;  1R1B A;  2ZQM A;  4LNU A;  3ZRS A;  1S76 D;  3B09 A;  2DJV A;  1NTK H;  4BWA A;  4IYH A;  3RYF A;  2QTO A;  2ZXW C;  3C3S A;  1BMF G;  4UCR A;  4I7Z B;  4JI4 B;  3FYI B;  4WFA V;  4YY3 B;  5BR8 O;  4NTX A;  3W7U A;  5IJ9 A;  4LF6 O;  4YJ3 A;  4BIZ A;  4IIJ A;  2B1I A;  4O4L B;  3PN1 A;  4H0L B;  2AXT Z;  1Y67 A;  3TXS A;  4AI8 A;  4DR5 B;  3W7W A;  1YTF B;  2DMX A;  1L0N H;  1AIL A;  4NYK A;  5IYD O;  4BW9 A;  4O2B B;  5GON A;  4JI6 O;  3Q4H B;  3LSS A;  3E2E A;  2YXH A;  1YF2 A;  3OMN B;  3K0D A;  1M9N A;  1YEW A;  1H2S B;  4GKK O;  2CH7 B;  3ABK B;  4Q20 A;  1B3Q A;  2WLI A;  2Y69 C;  3T1C A;  1M4U A;  4JYY A;  4MVS A;  1PL4 A;  3WB0 A;  2PGG A;  3T2M A;  4GYC B;  1TGO A;  1Y74 A;  2E76 B;  4UUJ C;  5DED A;  4NTW A;  4GT1 A;  4CC5 A;  4R8C A;  3A0B Z;  2XND G;  1GM9 A;  5C8Y B;  2QM8 A;  5KHI A;  3CCS V;  3EVK A;  2Q4P A;  3CCE V;  2PYL A;  1R6K A;  3RYH A;  4I50 A;  4WFF A;  2B1G A;  2EX3 A;  1JQ0 A;  3FYE B;  1Y66 A;  1H2L A;  3AG2 C;  3ZHT A;  4PJ0 Z;  4ZHQ A;  2YID A;  1CXZ B;  1AB3 A;  1DF4 A;  2YI8 A;  4X1K B;  4MW8 A;  1E1Q G;  4H33 A;  4MT8 A;  1SQX H;  2Q5Z A;  3JAW A;  1PL0 A;  5B1A C;  4DV6 B;  2GHY A;  4LFB O;  1BHA A;  1EZV H;  1OCC C;  4P9O A;  1L1F A;  2AW9 A;  4JI2 B;  3QTC A;  2MK3 A;  1YZB A;  2UXX A;  3AEI A;  1PD3 A;  3E35 A;  5KA5 A;  3LNM B;  1NH2 B;  3B40 A;  1IBK O;  4JYC A;  3ETG A;  1I7F A;  1Q6I A;  2YXY A;  3AK2 A;  3CXH F;  1RSO A;  4NXN O;  4LF8 O;  1PKX A;  4NXM B;  1GKF A;  1WPB A;  3JAL B;  4BIU A;  5LMN O;  3E22 A;  1VF6 C;  1KUQ A;  5KHJ A;  2ZM6 O;  5IYC O;  2WWW A;  1WLE A;  5IYB O;  3E83 A;  3G6E V;  3CCQ V;  1V55 C;  2HP8 A;  4FZ0 A;  2Z0A A;  1VF6 A;  1K34 A;  3VQW A;  3FB6 C;  3G80 A;  3C90 A;  5L3E A;  1AR1 B;  3T1H O;  2YXL A;  1KD1 W;  2RQ6 A;  2UUC O;  4LF7 B;  1H2N A;  2O57 A;  4EFB A;  2QWR B;  2YIA A;  3QNE A;  1NQT A;  3VQY A;  3HB3 B;  3UKM A;  5B3S B;  3OTO O;  4JI8 O;  2IBZ H;  3W7X A;  1HR0 O;  3SPC A;  2FTK A;  5CA0 B;  4JYA O;  2EUL A;  2L6L A;  4O4H B;  3MHS C;  1YHQ V;  1CPY A;  4YHH O;  3IGA C;  5FNV B;  4MVO A;  1XNR B;  4O4L A;  3CRA A;  4DV2 B;  3RN4 A;  4UCO A;  3W7S A;  2YDE A;  4CS4 A;  2HJD A;  1ZAU A;  2NLJ C;  4J9Z B;  2Y4T A;  2DOS A;  5JQG B;  3ZS8 C;  2ZCE A;  3ABK C;  3APO A;  3HKC B;  1PPJ H;  1VQ5 V;  4O2B A;  1H2G A;  3CJH B;  4HNA B;  3SYA A;  4CH4 A;  4NB5 A;  4R50 A;  4D7T A;  2YSU B;  4DRX B;  3OUS A;  3STZ C;  4UCV A;  2E5L B;  2VQF O;  1GH6 A;  4MVQ A;  2CH7 A;  3FD9 A;  4EFE A;  4WF9 V;  4DUY O;  3CRM A;  1H8E G;  4ICG A;  3OGC C;  1QLE C;  4W4K A;  1M56 B;  2X6B A;  1JOY A;  5AG2 A;  2P06 A;  3TK1 A;  5LOV B;  1D5A A;  1H8H G;  2QWP B;  1J95 A;  2NR5 A;  4O4J A;  1YXB A;  4TSF G;  2Q7G A;  3P30 A;  5C8Y A;  1FJG O;  3K59 A;  4X66 O;  2QGN A;  4ZI7 A;  4U3J A;  4B3R O;  4QJF B;  4DV3 O;  1I08 A;  1XUQ A;  3ZMZ A;  4PDL A;  4LF4 B;  2OCH A;  1MA1 A;  1RP3 B;  1A32 A;  1N34 B;  4IT5 A;  2YEV A;  3P32 A;  2UUA B;  2JGD B;  3TJT A;  5H6R A;  1YIJ V;  2UUB B;  5C93 A;  5KX5 B;  4WFE A;  1DTO A;  3L70 H;  1M1K W;  3SYP A;  4DR6 O;  2GV9 A;  1XL6 A;  3H1L H;  2QR4 A;  4AQY B;  2CK3 G;  4LFA B;  4LF9 O;  5H9C A;  2R9A A;  2UXC B;  5IJ0 B;  3OD4 A;  4N23 A;  2DQ3 A;  2R70 A;  3OAA G;  4JPR A;  1N33 O;  1AJP A;  3CE2 A;  5IWA B;  1IXB A;  2ETN A;  4RUE A;  1TAE A;  3JD3 A;  1N36 O;  5EK0 A;  4J9Y B;  1QNM A;  1JMK C;  2FL4 A;  2PUS A;  1I94 B;  3JAL A;  3B2E E;  2ZE7 A;  1OCR B;  3P3N A;  4DR3 B;  1GAX A;  3CMA V;  3CEI A;  5LGT A;  1XBL A;  3A2F A;  1NH2 D;  1SQB H;  1WA8 B;  2IH1 C;  2ADQ B;  5LMU O;  2WAM A;  4X64 B;  4PD4 F;  3ZRV A;  3J7A U;  2OWO A;  5B3S C;  3DC6 A;  4CH6 A;  3SJQ C;  3IC9 A;  4GX0 A;  5LGU A;  3M8A A;  2Y0I A;  3BY6 A;  5EZY B;  5KUK A;  4QGP A;  1NBM G;  4B3S O;  3T4D A;  5CA3 A;  1WPX A;  5EBW C;  2WLM A;  2BTO A;  3BPZ A;  3CRR A;  1HNZ B;  4MVM A;  1MSD A;  3K79 A;  3DGE A;  5EBL C;  5CA0 A;  5DM6 V;  4FFB A;  1LR1 A;  1VIB A;  3JAT B;  1L8D A;  1IBM O;  3RYF B;  2UXD O;  2G38 A;  2EIM B;  2JEX A;  1JPX A;  2XTA A;  4FLX A;  5FNV A;  2EJ7 A;  2D3O W;  4MSW C;  4KHP B;  1IBM B;  4UVB A;  2RNB A;  1P4R A;  3OGI B;  3AG1 B;  3MAQ A;  3X2Q B;  3R66 A;  3JSL A;  2LW7 A;  1BQZ A;  3HKB A;  5B1O A;  4YXW G;  1Q3E A;  4MW3 A;  4GUN A;  3HKC A;  1N4C A;  4JI1 O;  2GTA A;  4DV1 B;  5CBH A;  1VQM V;  2C2A A;  2QKS A;  1E79 G;  1M56 C;  2QSA A;  4OPA A;  3CJH A;  4HNA A;  4JV5 O;  2VRZ A;  1Y4M A;  5GON B;  4F6R A;  3K5N A;  1S72 V;  4X20 A;  1AI5 A;  1GO3 F;  4FJC C;  3LDC A;  5LOV A;  1GM7 A;  3CCV V;  1Q43 A;  4I4T B;  2XAG A;  4XDL A;  2Z3Y A;  4KFM A;  4I5S A;  1WN7 A;  2WSS G;  5IYZ B;  5L3G A;  2E74 B;  4UVC A;  4JAA A;  2AHY A;  4DK1 A;  4BIO A;  1VAR A;  1BE3 H;  3OEE G;  4IL6 Z;  1XEQ A;  4MTO A;  1QBZ A;  4GX1 A;  4Z1V A;  5J2T B;  1DLB A;  1QR9 A;  3TGU H;  3K3W A;  2JGD A;  3E8H A;  3M7M X;  1I5Y A;  2IJI A;  5L3F A;  5B66 Z;  5LXT A;  1MMM A;  2WLL B;  5TIS Z;  1YJW V;  4PEL A;  1TVK B;  3JCU Z;  4AHC A;  5JJJ B;  3AK1 A;  1K4D C;  3SJB C;  4JAU A;  3A0H Z;  4L8J A;  2ZNJ A;  5IJ0 A;  1VQ7 V;  1OV9 A;  3R65 A;  1AI6 A;  2QWQ B;  3K5L A;  1OCR C;  1VF7 A;  3ASN B;  2IJK A;  1NU1 H;  1XMQ O;  1AI7 A;  1TUE B;  2V1D A;  1HW7 A;  3JYC A;  4U7O A;  1D2D A;  2EZO A;  4JI0 O;  3F7V C;  5LHI A;  3IFX A;  1Y76 A;  2B5U A;  3RBZ A;  1RFY A;  4CS2 A;  1Q6U A;  1XI1 A;  2WLH A;  5JWP A;  3AK3 A;  3FKS G;  2Y4U A;  4BW5 A;  3FAV B;  2ZR2 A;  1EN5 A;  2D2C B;  4B7K A;  3BHP A;  3JD0 A;  5IE9 A;  5EZY A;  3ASO B;  4WFB V;  2UXN A;  4X88 A;  2WPD G;  3ABL B;  3W7T A;  2EIM C;  5BMV B;  4MVU A;  2ZNI A;  2HJF C;  4KUM A;  2HR3 A;  1URF A;  4RAI A;  5EYP B;  5J2U B;  4LH6 A;  3AG1 C;  4JI4 O;  3JAT A;  1SER A;  3X2Q C;  4YY3 O;  1AP5 A;  3IC7 A;  1ZUQ A;  4DV4 B;  4DR4 O;  3SPG A;  2DW4 A;  1W0K G;  4ABM A;  4C7U A;  2AZ0 A;  3ETQ A;  3BVO A;  3OMI B;  3QF7 A;  4LFC B;  4DR4 B;  3AG7 A;  2XHB A;  4DR5 O;  1ZX3 A;  3L75 H;  3EXA A;  4DW0 A;  3H1K H;  1JVM A;  3JAK B;  1PNK A;  3VBB A;  3ZRW B;  4DR2 B;  1NVP B;  4O2A B;  2P90 A;  3DTU B;  3SR2 C;  3GB7 C;  2Q73 A;  5L3D A;  4DV7 B;  1SC5 B;  4I4T A;  1NR7 A;  2WLJ A;  4O4J B;  5IYZ A;  3UO2 A;  1MAB G;  1SQP H;  3HR0 A;  4I0X B;  4I55 B;  2ADP A;  1EZJ A;  1QLE B;  4PA7 A;  3I55 V;  2M7W A;  4F6E A;  1YI2 V;  4ZI7 B;  1NS1 A;  2PZS A;  4U3J B;  1NZ6 A;  2AHZ A;  2ZD9 A;  1IUR A;  2PI5 A;  1PNM A;  5J2T A;  1F4N A;  2AZ2 A;  5KHK A;  1QCE A;  1M93 A;  3J80 N;  1AP6 A;  2P22 C;  2FB5 A;  2YEV B;  1HNX B;  4DV6 O;  1Q81 W;  3D3Q A;  2WLL A;  4WBN B;  1KYO F;  3CCM V;  2QE7 G;  3RWR D;  3ASN C;  4JI2 O;  3SJC C;  2ZIM A;  2JEU A;  3C3T A;  1TVK A;  3RT3 C;  1SA0 B;  3H1I H;  1FXV A;  4OX9 B;  3OUF A;  4TV8 B;  4FLZ A;  1SES A;  2OIG A;  4FLY A;  2PY5 A;  2HG5 C;  4UB8 Z;  4GLX A;  4DR7 B;  1GMG A;  4JI5 B;  4NXM O;  2DYR B;  1MZF A;  4FLU A;  3FB8 C;  5KA6 A;  1XDC A;  2XAS A;  1GK9 A;  2Q69 A;  4LCU C;  3ABM B;  4RWU A;  5CMU A;  3CB2 A;  4UB6 Z;  3ASO C;  3TCU A;  4B08 A;  3ABL C;  3FAV A;  3ZHR A;  2JS5 A;  3JSN A;  2YI9 A;  3FB7 C;  4MVZ A;  1KC8 W;  3ICX A;  4LF7 O;  1YCI A;  4X65 B;  1ENV A;  4OGQ B;  5HFL A;  2LP7 A;  5JH7 A;  2NN4 A;  4FMT A;  2YC0 A;  1VEW A;  2A7W A;  1NI8 A;  3ZED A;  5BMV A;  5L3B A;  5ITZ A;  4DUZ B;  1G1X B;  5LBQ A;  2KSD A;  2HEP A;  1V54 B;  5EYP A;  5J2U A;  4DW1 A;  4N21 A;  4JTA B;  4LP8 A;  1BT8 A;  4FFB B;  1XNR O;  1GRJ A;  2A0L A;  3P3P A;  1Z5W A;  1OHH G;  4DV2 O;  4B3T O;  5FLX N;  2Q0O C;  2K9P A;  2F4V B;  3MD0 A;  4J7J A;  5J9P C;  4IGG A;  3LDE A;  2ZIN A;  4B3T B;  2VQE B;  1ZTE A;  2QTS A;  1WJZ A;  3WB1 A;  2WA3 A;  4LF5 B;  3HKB B;  3B8N A;  1BQ0 A;  3JAK A;  3U10 A;  4LH7 A;  3IAY A;  2E5L O;  3CC2 V;  2DYS B;  3ZRW A;  5A2Q N;  2UU9 B;  4EEQ A;  1GN3 A;  4O2A A;  3ZMT A;  2CTQ A;  2M6Y A;  3G6B A;  2QJ1 A;  4F6R B;  2ITD C;  4RUF A;  2XT9 A;  4E4E A;  1IVS A;  4XDK A;  2VWK A;  2GUZ B;  1OCO B;  5GTI Z;  1F51 A;  4X20 B;  4B3M B;  4MS2 A;  4FIP C;  5JCO C;  2N05 A;  1YTF D;  4CC6 A;  3UT5 B;  5GW7 A;  2QDO A;  3ZCC A;  2HHH B;  1R3I C;  4DO2 A;  2ZT9 B;  1NVP D;  4QNH B;  1IBL B;  2B9Z A;  2F43 G;  4I0X A;  4I55 A;  2R9R B;  4ASU G;  4LF4 O;  5JCO A;  2Z5U A;  2CAZ C;  1XIL A;  1FXH A;  4GX5 A;  1N34 O;  1E1R G;  2K1E A;  1HNW B;  2UUA O;  4K8X A;  2UUB O;  2BOB C;  2WLN A;  4WFH A;  1P49 A;  3AG3 B;  1WP7 A;  4YIO A;  1PM9 A;  2GSM B;  1Q90 D;  3BEH A;  3ABT A;  4FM1 A;  3AG4 B;  4ZBM A;  4J41 A; 
#chains in the Genus database with same CATH homology
 2Q4P A;  2Q5Z A;  2Q73 A;  1YVW A;  3C90 A;  2GTA A;  2P06 A;  1Y6X A;  5IE9 A;  2OIE A;  4QGP A;  2OIG A;  1YXB A;  2A7W A;  3CRC A;  3CRA A;  2YXH A;  2Q9L A;  1VMG A;  2A3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...