5BR8O

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5br8O00
4DV7O 1HNXO 1YZBA 4JI3O 1KUQA 4DR4O 2VQFO 1X59A 4AQYO 3J7AU 4X64O 5H5NA 3OTOO 1XMQO 4DV3O 2UXDO 5LL6Y 1AB3A 4X65O 5BR8O 4LF6O 1N32O 3JAMN 1N33O 4JI0O 1XNRO 1FKAO 4LFBO 5BY1A 1IBKO 3M8AA 4JI4O 2UUCO 2Z0AA 2UUAO 2ZM6O 4OPHA 1DK1A 3O65A 4KHPO 4B3MO 2DJVA 1XNQO 1FJGO 1N36O 4DV5O 4B3TO 4DR1O 4GKKO 4JYAO 4JV5O 4YHHO 1D2DA 4JI7O 1XEQA 3RT3C 4X66O 4K0KO 5IT9N 4DR5O 4B3SO 4OPAA 4LF9O 2UXBO 1FYJA 5LMNO 4DV6O 4JI2O 5BXZA 3T1HO 4GKJO 1R1BA 2ZKOA 5A2QN 4DUZO 3J80N 2E5LO 4LFAO 4A5UB 2FKXA 4LF5O 4JI1O 5FLXN 4DV2O 2DOSA 4JI5O 2LW7A 3T1YO 2N74A 4B3RO 4JI8O 2UU9O 5LMUO 4DR7O 4DR6O 4LFCO 2F4VO 1IBMO 4JI6O 1N34O 4X62O 2HHHO 1I94O 2AGAA 1XMOO 1G1XB 1F7YA 2JRIA 4OX9O 1IBLO 3F5TA 5IWAO 3R66A 4DV0O 4DR3O 1J5EO 4NXNO 1NS1A 4DV1O 1HNZO 2UUBO 4LF4O 4YY3O 3J81N 1HR0O 3SDLA 2VQEO 1R6TA 4DV4O 1A32A 2UXCO 1AILA 4LF7O 1HNWO 4LF8O 4DUYO 4DR2O 4NXMO
chains in the Genus database with same CATH superfamily
2JS5A 1I7FA 2KB1A 2ZXWC 4LF9B 3CC7V 1X59A 3T1HB 3ASNB 3K3WA 3LDDA 2UXDO 4U3JB 1VF7A 1QLEC 1KC8W 1WLEA 1K9MW 4JI0O 3OD4A 4DO2A 1VQNV 1JFFB 1Q90D 1IBKO 3BA9A 4MTFA 2DMXA 2Y69C 3G6BA 1WPXA 4JAAA 5EBLC 2BTQA 5C8YA 3RWRD 2CDYA 3HKBB 2UUBB 4R8CA 3D3QA 2LW1A 4X66O 4CC5A 1HR0B 5IT9N 2H3OA 5L3CA 1D5NA 3TETA 4UVAA 2PY5A 1OCRC 3ZMTA 3N2KA 5GTHZ 4QIWF 1S3JA 3BRCA 4J7JA 1MABG 1GM8A 1MZFA 1KMIZ 2CGNA 5KX5B 5LHIA 4IYHA 5JVDA 3B4SA 5B1AB 1RP3B 3QVNA 2EBOA 4ZOLA 3W7SA 1GN2A 5J2TA 2P4VA 2ZE7A 1FJGB 5KHHA 2QKCA 3LSUA 4B3TB 3OE7G 2OCCB 2DYSB 3E35A 3ABMB 1YEWA 1PKXA 2ZE6A 1AILA 4C7UA 5JJEB 4DR5B 3SJAC 1KQSU 1WJZA 4LNUB 4GX1A 1HNXO 2A9HA 1BQ0A 3VQWA 1I08A 2R9RB 5H2FZ 2Q0AA 1WP7A 4DV6B 2DQ3A 1BHAA 4PHZA 3RGBA 4DV3O 1H2NA 4TV9B 3DTUB 2PUSA 4IT5A 2KG7A 2WSSG 5CA1A 2XAHA 4LCUC 1LR1A 1V9PA 3UO2A 1K4CC 1SQXH 2B9ZA 3SPGA 4UVCA 2ADPA 3BABA 1VIBA 3ML0A 1NZ6A 3BCCH 3AK2A 3O65A 3P30A 2RN9A 5IWAB 4B3MO 3AG1C 4QPKA 2EJ7A 2ZXWB 4XBFA 3CCJV 4EKWA 2D2CB 3BVOA 4JI7O 2AW9A 1FXVA 1QLEB 3H1KH 4QGPA 3K5LA 1HNWB 1S0VA 3PN1A 4X8AA 1VQOV 4FLVA 3STLC 3KCYA 1FPOA 1N0JA 5CMUA 3J80N 2Y69B 4PA7A 4BWAA 2AZ2A 1ZL8A 1SS3A 2Q67A 4X65B 1GN6A 4O2AB 2JGUA 1NVPD 1IBMO 4JI6O 4CS2A 1W59A 2JRIA 2X0LA 2F23A 1Q7YW 1L0LH 5FPOA 3JYCA 3DXRA 3E2EA 1YVWA 4BW9A 3VBBA 2YDEA 2R70A 1YF2A 1TA8A 2ZR3A 1OCRB 5KHIA 4O4HA 3VOUA 5DEDA 2F43G 2WLIB 2HG5C 2VQEO 5H9CA 3CRMA 5KUMA 2EIMC 2R9AA 3FB6C 5JQGB 5JH7A 4DUYO 2BSKB 3LSSA 4W4KA 3UT5B 3OUSA 1R73A 2QSAA 2YSUB 2CUGA 2GTSA 2LJ2A 1K5SA 4JAUA 4DUZB 1F51A 3RYFA 4LFAB 1KP2A 5CA3A 1QNMA 2F4VB 4IIJB 4FPPA 1XMOB 5EIBD 3HKDB 1Y4MA 4OPHA 1AJNA 2R9IA 2AXTZ 3AG7A 4PD4F 1EBOA 2WA3A 3K5MA 4LH6A 4NR1A 3LNNA 3JD1A 3ZS8C 3FYEB 3E83A 1MZEA 4N21A 3QNEA 4U3JA 5TISZ 1AP5A 2F1MA 2UXCB 2JGDB 3HKCB 1Q6HA 2QA4V 3JCUZ 1JFFA 2QM4A 3GVMA 2ZKOA 5IY5C 3G6EV 4GX0A 4A5UB 4DR4B 2VQFB 4NB5A 4B7KA 3DGEA 4GX5A 4B3RO 2Q4PA 2ETNA 3AG3B 2E74B 3H1LH 3CS5A 5CN0A 3ZJZA 3HKBA 4CS4A 1XNRB 4UCOA 3APOA 2K1EA 1H2GA 1PD3A 3S3WA 3ZHSA 1OJHA 2ZE5A 3EXAA 4DR3O 2KSDA 2EZOA 3QO5A 2P4KA 2CE4A 3BFRA 1SC5B 3I5DA 3L9DA 4Z2WA 1BSMA 5E1AC 2JEXA 2QKSA 4K0KB 2HVKC 5JJNB 5EIBC 1H2SB 2PGGA 1H2KA 2H94A 4DV7O 1NJIW 3MHSC 4JYCA 4WFAV 1PV0A 3J7AU 3WG7C 2B1IA 2Q0OC 1M90W 4JYYA 2OCHA 3EVKA 1YJ9V 4FM2A 3E8FA 2VQEB 1W0KG 4JZGA 1AROP 1Q43A 1FKAO 4IL6Z 4LFCB 1GTOA 4I9QA 4MS2A 2EIMB 5JJJB 1IBLB 1JJOA 5LBQA 1J5EB 1BHBA 1QR9A 4BIZA 3SPCA 3L74H 3G80A 5JCOC 4JV5O 2IH1C 4TV9A 3UM7A 3WU2Z 3OR7C 1ZAUA 4FMTA 3SPIA 4JI2O 2ZNJA 4JI3B 3IJ4A 3ZHVA 1Q82W 2DYRC 3E22B 3I55V 4JI8O 3RVYA 1AI4A 4NKGB 4EFEA 1N33B 2JVDA 4B08A 1NVPB 4HNAB 3SPHA 5GW7A 4FLUA 2GV9A 3AG2C 3U11A 3CCVV 2V4DA 3EHBB 2Q9LA 2PI5A 4O2BB 4WCEV 4BIUA 4HAMA 1N36B 2XTAA 1OCOC 1Y67A 4JYBA 5IY5B 1SQVH 1Y74B 3DC6A 4DV4O 5AG2A 4FZ1A 2V7QG 1I0HA 2B1GA 5LGTA 1KP3A 4O2AA 1P7BA 4TUYB 2OYQA 4UV9A 4AILC 4DR3B 3IGAC 5IYBO 4AQYO 3UQ8A 3BY6A 3T1CA 3OTOO 1MG1A 2JEUA 1NH2D 5BR8O 4J7KA 4LF6O 3M7MX 2ATKC 3N2GB 1TVKB 2HJFC 3AK3A 1M5IA 2Z0AA 4X62B 1FD9A 4I9WA 1NU1H 1I94B 2AHYA 3RN4A 1K4DC 4YIPA 1KBHA 1QCEA 5JQGA 4J10A 4BAYA 4P9PA 2BSKA 3UT5A 3N27A 4PDVA 4YIOA 3E8GA 1NI8A 2Y0PA 1K73W 4O4JB 4OXSA 3WG7B 1Y76A 4MW3A 1VP7A 2A7WA 2YI9A 2ZR2A 1S5JA 5BZBA 1KD1W 4IIJA 3CD6V 4GKJO 2CAZC 2OIGA 1SKVA 3HKDA 1EZJA 4AHCA 3FB5C 1XMQB 2LW7A 1M9NA 5LMUO 2XUMA 1N32B 4DR7O 1PNMA 5D5PA 1N34O 2Q7EA 4OGQB 3SYOA 2HKOA 2RMKB 3DXRB 4JI4B 3CPWU 1OCZC 1Y6XA 4OX9O 1CPYA 1OCCC 2PYLA 2UUAB 3HKEA 2JGDA 1GM7A 3HKCA 1Z5WA 3K0GA 1TAEA 3O9OA 2JK5C 4PA4A 3QTCA 2MW2B 4YY3O 4Z1MG 4TWKA 3OAAG 1A32A 3E89A 2WPDG 4LF7O 1PP9H 4ASUG 4B3SB 4TV8A 1M1KW 2YIBD 3GWKC 4HZ3A 2WLLB 4FLZA 1VARA 3CRRA 4RUEA 3RYFB 1JOYA 4NTXA 5LMNB 4UVBA 3AG2B 4W4LA 3D3IA 2ITDC 3JAKA 1RSOB 1S72V 3PJSK 3T1YB 1K97A 1MMMA 1OCOB 2CTQA 4J80A 3A2FA 5KAIZ 4DR6B 2HVJC 4MTXA 4D7TA 1FAFA 3M8AA 3ETEA 5JWPA 2V1DA 3JD2A 2UXXA 2EIJC 4JAVA 1IDSA 4JPRA 1JPXA 2ILMA 4GLXA 3FFQA 4NXNB 4DV5O 2PI4A 1XREA 4JTDB 4DV1B 3AG4C 4I50B 4O4IB 4LBEC 3B8MA 2WA4A 1SQBH 1X4TA 4HBNA 2AZ0A 2BOCC 4L8JA 2AHZA 1DGSA 4DW1A 1WB8A 4LF5O 1B6QA 1SQPH 3JAWA 2VRZA 4PI0A 4NTYA 4ZKIA 4J9YB 1H2LA 3SGIA 4J7ZA 1Z2GA 2HHHO 4MSWC 3JATA 1G1XB 1R3JC 5KLVH 1IX9A 1LNQA 4K3AA 2QM7A 5ITZB 2L35A 4P9OA 5EBWC 3OMIB 2KQXA 4CC6A 1IURA 2EINC 4CH3A 2W6JG 5B1BC 1SRYA 1XILA 4AI8A 4XDLA 3E22A 1F4MA 3CRQA 3ABKC 5H6QA 3TK1A 4DR2O 4NXMO 1GN3A 1YDXA 1IVSA 2BTOA 2Y0IA 1P84F 4K35A 4HNAA 1OCZB 4ZBMA 1OCCB 4X64O 2YUAA 4O2BA 4JI1B 2R72A 5C93A 2QJ1A 4PA3A 2P22C 4LP8A 4JTAB 1MA1A 1NH2B 5CB4B 2UU9B 1WP8A 1COWG 1BCCH 2GSMB 1Y74A 2WLNA 2OIEA 2WAMA 3M99B 1JR9A 3ETGA 1DK1A 2Q68A 1QHTA 1XNQO 1NR1A 4TUYA 2QE7G 1PPJH 4DRXB 4LF4B 4LWSB 1SF9A 3T4ZA 5LA6B 1JA8A 2CK3G 1SQGA 4X9QA 3ZX6A 5B66Z 3RVZA 4GX2A 4LF8B 4LH7A 4MVMA 2F95B 3N2GA 1TVKA 2UXBO 3B77A 2DQ0A 4E4EA 3SYPA 3WFVA 2EIJB 2QR4A 1YIJV 1SETA 3H1HH 4EEQA 2ADQB 3K5NA 1Q3EA 2HEPA 4JI5O 2WLHA 2UXDB 4X88A 3AG4B 3LSQA 4WFHA 2KKWA 4R7CA 3HB3B 4I4TB 4JI0B 4O4JA 1IBKB 1NQTA 1KECA 3IC9A 1URFA 2RDCA 1Q81W 1JX9A 2FMLA 2F93B 5L3BA 3CWBH 4G28B 1XI1A 1XUQA 1V54C 3U10A 1SZTA 2RNBA 4X66B 3CMAV 4DW0A 3OW2U 2A06H 2LQTA 2ARHA 2XAQA 2JS3A 2N05A 1W2BU 1XBLA 2IU0A 1WB7A 1KU9A 3B2EE 4X1YB 3ASOC 2ZD9A 2HP8A 1XDCA 2EINB 3TCUA 5BY1A 1K5QA 2Q6AA 2PZSA 4IGGA 3ABLC 2QM8A 2MK3A 1UFIA 2OTJV 5IYDO 2P5OA 2LFRA 2O57A 2WLLA 1Y76B 4DR1O 4MVOA 4ABMA 4JYAO 2X6BA 1RPRA 1XEQA 3RT3C 2UXNA 2XT9A 1EN5A 1RSOA 1WA8B 3KKYA 3CJHB 4UXNA 4FZ0A 4QE9A 5BMVB 2ODMA 4X1IB 1HNXB 1R1BA 3CCLV 1AR1B 2FKXA 1NT2B 1M57C 2W0FC 1JMKC 4DV3B 3TJTA 1WNSA 1BGYH 3A0HZ 4J9ZB 4I50A 4FLXA 1ZWIC 2PF4E 3HKEB 4PELA 1GM9A 4UB6Z 4O4IA 2G38A 3R66A 4DV0O 3MDSA 2C2AA 3ZRSA 4B3MB 3JSNA 4D6TH 3ZMSA 3CMEV 3G71V 2VS0A 1EN4A 3AG1B 3ZHTA 1WPBA 4NTWA 1K8AW 4TV8B 4JI7B 1K33A 3L73H 4MVQA 1QBZA 1VQ6V 4H33A 3JAKB 2GTAA 5DN6G 3CSXA 2ZNIA 4IHJB 2XAFA 1VQ7V 1DTOA 3KG2A 5ITZA 4MVSA 4YJ3B 2M7WA 1VF6C 3RW0A 1AP6A 2X6CA 3KCXA 4LC1A 4TOIA 1V54B 1IBMB 4JI6B 2BE3A 4O4LB 2Q69A 1DF4A 5FNVB 1RFYA 4X20B 1CP9A 1RPOA 4UV8A 3IAYA 3LNMB 2CH7B 4UCTA 5EYPB 4GKKO 4F6RB 4MTGA 3SJCC 2OWOA 4YHHO 1MOFA 3E8BA 5CBGA 3ASOB 3ZEDA 5CB4A 3C3SA 3ZHRA 3JALB 4DUYB 1HDJA 3TGUH 5IJ0B 2A3QA 3R65A 4ICGA 5LOVB 3THOA 2E5LO 1THZA 3JAWB 1M4UA 3CHXA 2IJHA 4DV2O 1KB9F 4QJFB 2VWKA 3JATB 4DRXA 4LWSA 1RM1C 4I55B 4ZHQB 3K79A 5LA6A 4MT8A 1Q8IA 5LYJA 2QTSA 3D8CA 3ZN0A 3DC5A 1R3KC 2HFEC 2GHYA 3NXSA 2WLJA 2ZQMA 1YHQV 2YIDA 4KXRA 3TXQA 3X2QC 1M57B 1VQ5V 1HP8A 1KKDA 2IH3C 5CBHA 4JTCB 1ENVA 4PDRA 3CCRV 3OGIB 4I4TA 1KYOF 2ZIMA 5IYZB 5LP6C 1XL4A 4YJ2B 3FB7C 3CXHF 4UB8Z 2EULA 2WLMA 3B8NA 2D3OW 4X89A 3CRAA 2Y4TA 4B3RB 4F6EA 4FFBB 3BEHA 4RWUA 1P7GA 3OTFA 1K92A 3C3TA 4LFBO 3F7YC 4I7ZB 3OMNB 5EC1C 4UCUA 2UUCO 1AI5A 3K06A 2ZM6O 1M93A 4IYIA 1R6KA 2IJIA 4H13B 3ZIAG 4KHPO 3UCSC 3OGCC 3W7WA 3ETDA 3E8HA 1YI2V 2RJZA 1L0NH 3CC2V 3ZMZA 2YIBA 3K04A 5DM6V 1VQ9V 4RAIA 1GAXA 4FFKA 3LUTB 2W0XA 5FL7G 4WFEA 1D2DA 4XDJA 3CEIA 4X1YA 4RQEA 4JF3A 2E75B 4LF9O 3G4SV 1WN7A 3ZCCA 5B3SC 2BOBC 4RUFA 4DV7B 4MVZA 5L3FA 3L70H 3T1HO 1NTZH 3FAVA 2IJJA 2DWDC 4U3FH 4CH6A 1TUBA 3GB7C 3ZMUA 1SQQH 4WBNB 3P3PA 2Z5UA 4F4LA 2AGAA 2XNDG 1B06A 5KHKA 3QO8A 1WA8A 1LUVA 4R6ZA 2N04A 3CJHA 1PNLA 1NTMH 5BMVA 2UUBO 4X1IA 1GO3F 1Y66A 4PV1B 1R6NA 3KZIZ 2ZIOA 4ZIBA 3JD3A 5EC2C 2XHBA 3JD0A 1HR0O 1R6TA 3FD9A 4JV5B 5HFMA 3AK1A 2JJ2G 5J9PC 2DN9A 2YXYA 4JGSA 1CXZB 4MVUA 1Z5VA 1ZSPA 3ABTA 3CC4V 1VMGA 4JI2B 4TQFA 4H0LB 5L3DA 2P6JA 4TQDA 3JASA 3OM3B 1VQKV 1YJNV 4JI8B 1Q6UA 4KFMA 2DYRB 4PI2A 3P3NA 3X2QB 1XQ8A 4DYLA 3OUFA 4DK0A 3OEEG 4DK1A 1FJGO 1PNKA 1LUWA 5L3EA 3H01A 4QE7A 4JZ2A 4B3TO 5LP6B 2VWJA 1EFRG 3WB0A 1IZ3A 1NBMG 3DSQA 4PDLA 1GH6A 4IHJA 4DR5O 4DV4B 2P7TC 2EILC 4XDKA 5EBMC 1AI6A 3HR0A 3ETQA 4YJ3A 4X1KB 4CH5A 2L6LA 2NLJC 3F7VC 1JQ0A 4DV6O 4HYOA 1F4NA 4EB6B 5L3GA 4O4LA 2XAGA 4EFBA 1R3LC 3L75H 5CA0B 3BAAA 4AQYB 1VQ8V 2CTWA 5FNVA 4X20A 3OTOB 2N74A 5HFLA 2CH7A 5BR8B 5EYPA 4LF6B 1UJWB 4F6RA 2DE0X 3UKMA 1U96A 2HJDA 1N8RW 3OMAB 3Q4HB 3A8TA 1KKCA 5IWAO 5B1OA 3UO3A 4U7OA 1U97A 3JCZA 5B3SB 3IC7A 3JALA 2QWPB 3ZMVA 4FJCC 1HNZO 1SZXA 1J95A 3SJQC 5IJ0A 5LOVA 1I5XA 2YXLA 1SA0B 2NN4A 2EJRA 3FKSG 1H8EG 1HNWO 1GRJA 5LXTB 2X7RB 4N23A 2XAJA 4I55A 4J11A 4ZHQA 1DF5A 3MHHC 1VQLV 5LHGA 4GKJB 1FFXA 3C90A 1Q5OA 2IM9A 1TGOA 1AB3A 4X65O 4MW8A 1YTFD 3JAMN 5LMUB 2QWRB 4G27B 4DR7B 4UFZA 1N34B 1BS3A 1MSDA 5IYCO 3ZRWB 4OX9B 1PM9A 3ABUA 5J2UA 4P30A 2ITCC 3OEHG 4QPJA 5IYZA 4GZRB 4YJ2A 1Q6IA 4MTOA 4YY3B 1UPGA 1ZUQA 2QKAA 1VEWA 2LP7A 4LF7B 5KHJA 4R50A 4FFBA 2P06A 2NR5A 3L72H 3ICXA 1W0JG 3QG5A 4DUZO 4LFAO 2JJ1G 1EN6A 5FLXN 1AJPA 1JVMA 2ZDIC 1HWYA 1QQCA 5FPRA 5K1XA 1AJQA 3B40A 3IFXA 5LYJB 3K03A 2F4VO 1R3IC 2RCVA 4D7SA 4FIPC 5K1PA 5EZYB 1XHZA 1XMOO 1F7YA 3K59A 3A0RA 2EILB 2P90A 1NKDA 1VF6A 2JIZG 1NS1A 3P32A 4DV5B 1BL8A 1QLNA 3CP1A 3W7UA 3SJBC 4QNHB 3D36C 1ZX3A 2UXCO 2ZT9B 3K58A 5LGUA 1GKFA 2A79B 1D5AA 3BHPA 2F66C 4FLWA 4WBNA 1GN4A 1GK9A 2Q5ZA 4J41A 1G8MA 1FXKC 4DR4O 2VQFO 1PL4A 1YCIA 4JASA 4BIOA 3AG3C 2Q73A 3CE2A 1HNZB 1FS0G 4LF5B 1M56C 2YEVB 3ZBHA 3BA8A 1ROPA 3CCUV 1XNRO 1L8DA 5GONB 3ZRXA 2OTLV 1BT8A 1PL0A 4PA9A 2HHHB 5JCOA 2P67A 3H1IH 3APQA 1JJ2U 1CEZA 2LO1A 5KHGA 4ZI7A 1QR8A 1L1FA 4K0KO 1B04A 2K9PA 2Y48A 5IE9A 4U7NA 2Z3YA 1XOUA 5B1BB 5KMGA 4DR2B 3FAVB 4NXMB 5BXZA 3ABKB 3CYOA 3S3XA 1JCHA 1TUBB 1XL6A 3L71H 2DW4A 4X64B 3GWOA 1OV9A 4LR3A 1FFTB 3MAQA 1V55C 3RYIB 1BQZA 4LFCO 5LP6A 2ZCEA 3A0BZ 4TSFG 1QVGU 3QF7A 1ZTEA 1IBLO 1DLBA 3JD4A 4NVPA 1J5EO 4X1KA 1XNQB 5DECA 4CBCA 3CX5F 4EB6A 4I5SA 1K3EA 5CA0A 2HR3A 1QU7A 2OT5A 3ZHQA 4FM1A 3E86A 5IJ9B 1BZKA 5KA6A 1H2MA 4FVMA 4JI3O 3OR6C 2UXBB 4P2ZA 2EIKC 3Q4HA 3JASB 3MD0A 2H8PC 2X6AA 5H5NA 2EZPA 4FK5C 3RYHB 4JI5B 1N33O 1EM1A 1NTKH 3JARB 1YTFB 3ZHUA 1AR5A 3JSLA 3CRCA 4CZZA 1SA0A 3K9SA 4FLTA 5LXTA 2XOKG 2YXHA 1N36O 2FTKA 1FXKB 4I0XB 2GUZB 4GT1A 5CBFA 1M56B 1IXBA 4PJ0Z 4WFGA 3T2MA 2ZE8A 1AR4A 5GTIZ 5B5EZ 2FL4A 2ZINA 3U0ZA 2GDSA 2Q7GA 3VQVA 5A2QN 4WF9V 1B3QA 3K9AA 2LGWA 1FXHA 3ZRWA 4E2LA 1SESA 2DOSA 3RYCB 1E1RG 2FYUH 2YS8A 1HW7A 3LDEA 3SR2C 1Q86W 2GBOA 4X62O 1I94O 1E1QG 3K08A 3NR7A 4Q6GA 3CCMV 2B5UA 5KX5A 4YXWG 1VQMV 2EX3A 5B1NA 2QTOA 2WWWA 2BCCH 3EFFK 3ABLB 2LGQA 4UCRA 4DR1B 5KAFZ 2YICA 2PTMA 2XASA 3J81N 4JYAB 3CXCU 4H37A 2LFSA 4K8ZA 1V55B 3FB8C 3FYIB 1YITV 1T5EA 3I56V 2IU3A 2M6YA 2BTQB 5C8YB 1G4YB 1FFXB 1YZBA 1QVFU 3K57A 4G2KA 3SPJA 4LNUA 5EZYA 1XMQO 2E3CA 2JDIG 4L87A 3W7TA 1G6UA 4GCZA 1N32O 1MSWD 3SYAA 2FB5A 2A0LA 3HPLC 4JI4O 3K0DA 3N2KB 5J2UB 3CCSV 1E79G 2UUAO 1VF5B 1O9HA 5H6RA 1S76D 4Z1VA 4DV0B 1NR7A 1S77D 4UCVA 1SQFA 4TT3G 3SYQA 3CCEV 3CCQV 1VQPV 1N0NA 2EIKB 3ZRVA 1VQ4V 5JVDB 1ORQC 4ZOLB 2QWOB 4GYCB 2YEVA 4B3SO 5KUKA 3FX7A 5J2TB 3VQYA 1WAZA 3OFNG 1FYJA 1GMGA 2QGNA 5GONA 5LMNO 4CS3A 2NNUA 1BMFG 1S5LZ 1OZ0A 1P49A 5E79Z 3T1YO 1MNGA 3BPZA 1I5YA 3H9VA 4DR6O 3AEIA 4Q20A 1AVMA 2YI8A 1P4RA 1EZVH 1N4CA 2Y4UA 4BR6A 3ASNC 1O9GA 4NXNO 2Q7HA 2KG7B 4DV1O 5CA1B 2CTRA 3CB2A 2IBZH 4UUJC 5EK0A 3VQXA 4MVRA 4GUNA 1TUEB 4GKKB 3H1JH 3F5WC 3SDLA 4YHHB 2WLKA 3WB2A 2Q8VA 2WLIA 1H8HG 2IW5A 3RYIA 4PA6A 4B7EA 4UCSA 3G67A 4WFFA 4DXWA 1YXBA 2HLDG 4PDMA 2QDOA 1KUQA 3STZC 2DWEC 2E5LB 5LL6Y 4CH4A 4DV2B 3T4DA 1SERA 1US6A 5LHHA 1S5HC 4BW5A 3W7XA 2CGOA 2ZDIA 1IXMA 1RM1B 2QEXV 2W6IG 3OT7A 2DJVA 1ZL8B 5IJ9A 4ZI7B 2YC0A 2CTPA 4FLYA 5B1AC 3K5OA 1YSCA 5KMGB 3RYHA 2RQ6A 3TXSA 2IJKA 1H38A 1F23A 5F2VO 1K7DA 3JARA 4OPAA 4WFBV 4RO2A 3WB1A 5LGNA 3D36A 4O4HB 4J42A 2OCCC 2DYSC 3ABMC 4JI1O 1K34A 3SYCA 4K8XA 2UU9O 3QO7A 5JH7B 4KL1A 2YIAA 1FXKA 4I0XA 2GUZA 5IDJA 4LFBB 2UUCB 4KUMA 4H44B 3F5TA 4KP4A 5A9GA 2ZM6B 2PYJA 1OHHG 1ZLZA 4KHPB 4NYKA 3RBZA 5KA5A 1YJWV 4LF4O 3B09A 1AI7A 1BE3H 2E76B 1XHXA 4FM0A 2QWNB 4LF8O 3RYCA 3RFRA 2QWQB 4RQFA 3LDCA 3ZN1A 5D5QA
chains in the Genus database with same CATH topology
4DV7O 1HNXO 1YZBA 4JI3O 1KUQA 4DR4O 2VQFO 1X59A 4AQYO 3J7AU 4X64O 5H5NA 3OTOO 1XMQO 4DV3O 2UXDO 5LL6Y 1AB3A 4X65O 5BR8O 4LF6O 1N32O 3JAMN 1N33O 4JI0O 1XNRO 1FKAO 4LFBO 5BY1A 1IBKO 3M8AA 4JI4O 2UUCO 2Z0AA 2UUAO 2ZM6O 4OPHA 1DK1A 3O65A 4KHPO 4B3MO 2DJVA 1XNQO 1FJGO 1N36O 4DV5O 4B3TO 4DR1O 4GKKO 4JYAO 4JV5O 4YHHO 1D2DA 4JI7O 1XEQA 3RT3C 4X66O 4K0KO 5IT9N 4DR5O 4B3SO 4OPAA 4LF9O 2UXBO 1FYJA 5LMNO 4DV6O 4JI2O 5BXZA 3T1HO 4GKJO 1R1BA 2ZKOA 5A2QN 4DUZO 3J80N 2E5LO 4LFAO 4A5UB 2FKXA 4LF5O 4JI1O 5FLXN 4DV2O 2DOSA 4JI5O 2LW7A 3T1YO 2N74A 4B3RO 4JI8O 2UU9O 5LMUO 4DR7O 4DR6O 4LFCO 2F4VO 1IBMO 4JI6O 1N34O 4X62O 2HHHO 1I94O 2AGAA 1XMOO 1G1XB 1F7YA 2JRIA 4OX9O 1IBLO 3F5TA 5IWAO 3R66A 4DV0O 4DR3O 1J5EO 4NXNO 1NS1A 4DV1O 1HNZO 2UUBO 4LF4O 4YY3O 3J81N 1HR0O 3SDLA 2VQEO 1R6TA 4DV4O 1A32A 2UXCO 1AILA 4LF7O 1HNWO 4LF8O 4DUYO 4DR2O 4NXMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 O;  1HNX O;  1YZB A;  4JI3 O;  1KUQ A;  4DR4 O;  2VQF O;  1X59 A;  4AQY O;  3J7A U;  4X64 O;  5H5N A;  3OTO O;  1XMQ O;  4DV3 O;  2UXD O;  5LL6 Y;  1AB3 A;  4X65 O;  5BR8 O;  4LF6 O;  1N32 O;  3JAM N;  1N33 O;  4JI0 O;  1XNR O;  1FKA O;  4LFB O;  5BY1 A;  1IBK O;  3M8A A;  4JI4 O;  2UUC O;  2Z0A A;  2UUA O;  2ZM6 O;  4OPH A;  1DK1 A;  3O65 A;  4KHP O;  4B3M O;  2DJV A;  1XNQ O;  1FJG O;  1N36 O;  4DV5 O;  4B3T O;  4DR1 O;  4GKK O;  4JYA O;  4JV5 O;  4YHH O;  1D2D A;  4JI7 O;  1XEQ A;  3RT3 C;  4X66 O;  4K0K O;  5IT9 N;  4DR5 O;  4B3S O;  4OPA A;  4LF9 O;  2UXB O;  1FYJ A;  5LMN O;  4DV6 O;  4JI2 O;  5BXZ A;  3T1H O;  4GKJ O;  1R1B A;  2ZKO A;  5A2Q N;  4DUZ O;  3J80 N;  2E5L O;  4LFA O;  4A5U B;  2FKX A;  4LF5 O;  4JI1 O;  5FLX N;  4DV2 O;  2DOS A;  4JI5 O;  2LW7 A;  3T1Y O;  2N74 A;  4B3R O;  4JI8 O;  2UU9 O;  5LMU O;  4DR7 O;  4DR6 O;  4LFC O;  2F4V O;  1IBM O;  4JI6 O;  1N34 O;  4X62 O;  2HHH O;  1I94 O;  2AGA A;  1XMO O;  1G1X B;  1F7Y A;  2JRI A;  4OX9 O;  1IBL O;  3F5T A;  5IWA O;  3R66 A;  4DV0 O;  4DR3 O;  1J5E O;  4NXN O;  1NS1 A;  4DV1 O;  1HNZ O;  2UUB O;  4LF4 O;  4YY3 O;  3J81 N;  1HR0 O;  3SDL A;  2VQE O;  1R6T A;  4DV4 O;  1A32 A;  2UXC O;  1AIL A;  4LF7 O;  1HNW O;  4LF8 O;  4DUY O;  4DR2 O;  4NXM O; 
#chains in the Genus database with same CATH topology
 2JS5 A;  1I7F A;  2KB1 A;  2ZXW C;  4LF9 B;  3CC7 V;  1X59 A;  3T1H B;  3ASN B;  3K3W A;  3LDD A;  2UXD O;  4U3J B;  1VF7 A;  1QLE C;  1KC8 W;  1WLE A;  1K9M W;  4JI0 O;  3OD4 A;  4DO2 A;  1VQN V;  1JFF B;  1Q90 D;  1IBK O;  3BA9 A;  4MTF A;  2DMX A;  2Y69 C;  3G6B A;  1WPX A;  4JAA A;  5EBL C;  2BTQ A;  5C8Y A;  3RWR D;  2CDY A;  3HKB B;  2UUB B;  4R8C A;  3D3Q A;  2LW1 A;  4X66 O;  4CC5 A;  1HR0 B;  5IT9 N;  2H3O A;  5L3C A;  1D5N A;  3TET A;  4UVA A;  2PY5 A;  1OCR C;  3ZMT A;  3N2K A;  5GTH Z;  4QIW F;  1S3J A;  3BRC A;  4J7J A;  1MAB G;  1GM8 A;  1MZF A;  1KMI Z;  2CGN A;  5KX5 B;  5LHI A;  4IYH A;  5JVD A;  3B4S A;  5B1A B;  1RP3 B;  3QVN A;  2EBO A;  4ZOL A;  3W7S A;  1GN2 A;  5J2T A;  2P4V A;  2ZE7 A;  1FJG B;  5KHH A;  2QKC A;  3LSU A;  4B3T B;  3OE7 G;  2OCC B;  2DYS B;  3E35 A;  3ABM B;  1YEW A;  1PKX A;  2ZE6 A;  1AIL A;  4C7U A;  5JJE B;  4DR5 B;  3SJA C;  1KQS U;  1WJZ A;  4LNU B;  4GX1 A;  1HNX O;  2A9H A;  1BQ0 A;  3VQW A;  1I08 A;  2R9R B;  5H2F Z;  2Q0A A;  1WP7 A;  4DV6 B;  2DQ3 A;  1BHA A;  4PHZ A;  3RGB A;  4DV3 O;  1H2N A;  4TV9 B;  3DTU B;  2PUS A;  4IT5 A;  2KG7 A;  2WSS G;  5CA1 A;  2XAH A;  4LCU C;  1LR1 A;  1V9P A;  3UO2 A;  1K4C C;  1SQX H;  2B9Z A;  3SPG A;  4UVC A;  2ADP A;  3BAB A;  1VIB A;  3ML0 A;  1NZ6 A;  3BCC H;  3AK2 A;  3O65 A;  3P30 A;  2RN9 A;  5IWA B;  4B3M O;  3AG1 C;  4QPK A;  2EJ7 A;  2ZXW B;  4XBF A;  3CCJ V;  4EKW A;  2D2C B;  3BVO A;  4JI7 O;  2AW9 A;  1FXV A;  1QLE B;  3H1K H;  4QGP A;  3K5L A;  1HNW B;  1S0V A;  3PN1 A;  4X8A A;  1VQO V;  4FLV A;  3STL C;  3KCY A;  1FPO A;  1N0J A;  5CMU A;  3J80 N;  2Y69 B;  4PA7 A;  4BWA A;  2AZ2 A;  1ZL8 A;  1SS3 A;  2Q67 A;  4X65 B;  1GN6 A;  4O2A B;  2JGU A;  1NVP D;  1IBM O;  4JI6 O;  4CS2 A;  1W59 A;  2JRI A;  2X0L A;  2F23 A;  1Q7Y W;  1L0L H;  5FPO A;  3JYC A;  3DXR A;  3E2E A;  1YVW A;  4BW9 A;  3VBB A;  2YDE A;  2R70 A;  1YF2 A;  1TA8 A;  2ZR3 A;  1OCR B;  5KHI A;  4O4H A;  3VOU A;  5DED A;  2F43 G;  2WLI B;  2HG5 C;  2VQE O;  5H9C A;  3CRM A;  5KUM A;  2EIM C;  2R9A A;  3FB6 C;  5JQG B;  5JH7 A;  4DUY O;  2BSK B;  3LSS A;  4W4K A;  3UT5 B;  3OUS A;  1R73 A;  2QSA A;  2YSU B;  2CUG A;  2GTS A;  2LJ2 A;  1K5S A;  4JAU A;  4DUZ B;  1F51 A;  3RYF A;  4LFA B;  1KP2 A;  5CA3 A;  1QNM A;  2F4V B;  4IIJ B;  4FPP A;  1XMO B;  5EIB D;  3HKD B;  1Y4M A;  4OPH A;  1AJN A;  2R9I A;  2AXT Z;  3AG7 A;  4PD4 F;  1EBO A;  2WA3 A;  3K5M A;  4LH6 A;  4NR1 A;  3LNN A;  3JD1 A;  3ZS8 C;  3FYE B;  3E83 A;  1MZE A;  4N21 A;  3QNE A;  4U3J A;  5TIS Z;  1AP5 A;  2F1M A;  2UXC B;  2JGD B;  3HKC B;  1Q6H A;  2QA4 V;  3JCU Z;  1JFF A;  2QM4 A;  3GVM A;  2ZKO A;  5IY5 C;  3G6E V;  4GX0 A;  4A5U B;  4DR4 B;  2VQF B;  4NB5 A;  4B7K A;  3DGE A;  4GX5 A;  4B3R O;  2Q4P A;  2ETN A;  3AG3 B;  2E74 B;  3H1L H;  3CS5 A;  5CN0 A;  3ZJZ A;  3HKB A;  4CS4 A;  1XNR B;  4UCO A;  3APO A;  2K1E A;  1H2G A;  1PD3 A;  3S3W A;  3ZHS A;  1OJH A;  2ZE5 A;  3EXA A;  4DR3 O;  2KSD A;  2EZO A;  3QO5 A;  2P4K A;  2CE4 A;  3BFR A;  1SC5 B;  3I5D A;  3L9D A;  4Z2W A;  1BSM A;  5E1A C;  2JEX A;  2QKS A;  4K0K B;  2HVK C;  5JJN B;  5EIB C;  1H2S B;  2PGG A;  1H2K A;  2H94 A;  4DV7 O;  1NJI W;  3MHS C;  4JYC A;  4WFA V;  1PV0 A;  3J7A U;  3WG7 C;  2B1I A;  2Q0O C;  1M90 W;  4JYY A;  2OCH A;  3EVK A;  1YJ9 V;  4FM2 A;  3E8F A;  2VQE B;  1W0K G;  4JZG A;  1ARO P;  1Q43 A;  1FKA O;  4IL6 Z;  4LFC B;  1GTO A;  4I9Q A;  4MS2 A;  2EIM B;  5JJJ B;  1IBL B;  1JJO A;  5LBQ A;  1J5E B;  1BHB A;  1QR9 A;  4BIZ A;  3SPC A;  3L74 H;  3G80 A;  5JCO C;  4JV5 O;  2IH1 C;  4TV9 A;  3UM7 A;  3WU2 Z;  3OR7 C;  1ZAU A;  4FMT A;  3SPI A;  4JI2 O;  2ZNJ A;  4JI3 B;  3IJ4 A;  3ZHV A;  1Q82 W;  2DYR C;  3E22 B;  3I55 V;  4JI8 O;  3RVY A;  1AI4 A;  4NKG B;  4EFE A;  1N33 B;  2JVD A;  4B08 A;  1NVP B;  4HNA B;  3SPH A;  5GW7 A;  4FLU A;  2GV9 A;  3AG2 C;  3U11 A;  3CCV V;  2V4D A;  3EHB B;  2Q9L A;  2PI5 A;  4O2B B;  4WCE V;  4BIU A;  4HAM A;  1N36 B;  2XTA A;  1OCO C;  1Y67 A;  4JYB A;  5IY5 B;  1SQV H;  1Y74 B;  3DC6 A;  4DV4 O;  5AG2 A;  4FZ1 A;  2V7Q G;  1I0H A;  2B1G A;  5LGT A;  1KP3 A;  4O2A A;  1P7B A;  4TUY B;  2OYQ A;  4UV9 A;  4AIL C;  4DR3 B;  3IGA C;  5IYB O;  4AQY O;  3UQ8 A;  3BY6 A;  3T1C A;  3OTO O;  1MG1 A;  2JEU A;  1NH2 D;  5BR8 O;  4J7K A;  4LF6 O;  3M7M X;  2ATK C;  3N2G B;  1TVK B;  2HJF C;  3AK3 A;  1M5I A;  2Z0A A;  4X62 B;  1FD9 A;  4I9W A;  1NU1 H;  1I94 B;  2AHY A;  3RN4 A;  1K4D C;  4YIP A;  1KBH A;  1QCE A;  5JQG A;  4J10 A;  4BAY A;  4P9P A;  2BSK A;  3UT5 A;  3N27 A;  4PDV A;  4YIO A;  3E8G A;  1NI8 A;  2Y0P A;  1K73 W;  4O4J B;  4OXS A;  3WG7 B;  1Y76 A;  4MW3 A;  1VP7 A;  2A7W A;  2YI9 A;  2ZR2 A;  1S5J A;  5BZB A;  1KD1 W;  4IIJ A;  3CD6 V;  4GKJ O;  2CAZ C;  2OIG A;  1SKV A;  3HKD A;  1EZJ A;  4AHC A;  3FB5 C;  1XMQ B;  2LW7 A;  1M9N A;  5LMU O;  2XUM A;  1N32 B;  4DR7 O;  1PNM A;  5D5P A;  1N34 O;  2Q7E A;  4OGQ B;  3SYO A;  2HKO A;  2RMK B;  3DXR B;  4JI4 B;  3CPW U;  1OCZ C;  1Y6X A;  4OX9 O;  1CPY A;  1OCC C;  2PYL A;  2UUA B;  3HKE A;  2JGD A;  1GM7 A;  3HKC A;  1Z5W A;  3K0G A;  1TAE A;  3O9O A;  2JK5 C;  4PA4 A;  3QTC A;  2MW2 B;  4YY3 O;  4Z1M G;  4TWK A;  3OAA G;  1A32 A;  3E89 A;  2WPD G;  4LF7 O;  1PP9 H;  4ASU G;  4B3S B;  4TV8 A;  1M1K W;  2YIB D;  3GWK C;  4HZ3 A;  2WLL B;  4FLZ A;  1VAR A;  3CRR A;  4RUE A;  3RYF B;  1JOY A;  4NTX A;  5LMN B;  4UVB A;  3AG2 B;  4W4L A;  3D3I A;  2ITD C;  3JAK A;  1RSO B;  1S72 V;  3PJS K;  3T1Y B;  1K97 A;  1MMM A;  1OCO B;  2CTQ A;  4J80 A;  3A2F A;  5KAI Z;  4DR6 B;  2HVJ C;  4MTX A;  4D7T A;  1FAF A;  3M8A A;  3ETE A;  5JWP A;  2V1D A;  3JD2 A;  2UXX A;  2EIJ C;  4JAV A;  1IDS A;  4JPR A;  1JPX A;  2ILM A;  4GLX A;  3FFQ A;  4NXN B;  4DV5 O;  2PI4 A;  1XRE A;  4JTD B;  4DV1 B;  3AG4 C;  4I50 B;  4O4I B;  4LBE C;  3B8M A;  2WA4 A;  1SQB H;  1X4T A;  4HBN A;  2AZ0 A;  2BOC C;  4L8J A;  2AHZ A;  1DGS A;  4DW1 A;  1WB8 A;  4LF5 O;  1B6Q A;  1SQP H;  3JAW A;  2VRZ A;  4PI0 A;  4NTY A;  4ZKI A;  4J9Y B;  1H2L A;  3SGI A;  4J7Z A;  1Z2G A;  2HHH O;  4MSW C;  3JAT A;  1G1X B;  1R3J C;  5KLV H;  1IX9 A;  1LNQ A;  4K3A A;  2QM7 A;  5ITZ B;  2L35 A;  4P9O A;  5EBW C;  3OMI B;  2KQX A;  4CC6 A;  1IUR A;  2EIN C;  4CH3 A;  2W6J G;  5B1B C;  1SRY A;  1XIL A;  4AI8 A;  4XDL A;  3E22 A;  1F4M A;  3CRQ A;  3ABK C;  5H6Q A;  3TK1 A;  4DR2 O;  4NXM O;  1GN3 A;  1YDX A;  1IVS A;  2BTO A;  2Y0I A;  1P84 F;  4K35 A;  4HNA A;  1OCZ B;  4ZBM A;  1OCC B;  4X64 O;  2YUA A;  4O2B A;  4JI1 B;  2R72 A;  5C93 A;  2QJ1 A;  4PA3 A;  2P22 C;  4LP8 A;  4JTA B;  1MA1 A;  1NH2 B;  5CB4 B;  2UU9 B;  1WP8 A;  1COW G;  1BCC H;  2GSM B;  1Y74 A;  2WLN A;  2OIE A;  2WAM A;  3M99 B;  1JR9 A;  3ETG A;  1DK1 A;  2Q68 A;  1QHT A;  1XNQ O;  1NR1 A;  4TUY A;  2QE7 G;  1PPJ H;  4DRX B;  4LF4 B;  4LWS B;  1SF9 A;  3T4Z A;  5LA6 B;  1JA8 A;  2CK3 G;  1SQG A;  4X9Q A;  3ZX6 A;  5B66 Z;  3RVZ A;  4GX2 A;  4LF8 B;  4LH7 A;  4MVM A;  2F95 B;  3N2G A;  1TVK A;  2UXB O;  3B77 A;  2DQ0 A;  4E4E A;  3SYP A;  3WFV A;  2EIJ B;  2QR4 A;  1YIJ V;  1SET A;  3H1H H;  4EEQ A;  2ADQ B;  3K5N A;  1Q3E A;  2HEP A;  4JI5 O;  2WLH A;  2UXD B;  4X88 A;  3AG4 B;  3LSQ A;  4WFH A;  2KKW A;  4R7C A;  3HB3 B;  4I4T B;  4JI0 B;  4O4J A;  1IBK B;  1NQT A;  1KEC A;  3IC9 A;  1URF A;  2RDC A;  1Q81 W;  1JX9 A;  2FML A;  2F93 B;  5L3B A;  3CWB H;  4G28 B;  1XI1 A;  1XUQ A;  1V54 C;  3U10 A;  1SZT A;  2RNB A;  4X66 B;  3CMA V;  4DW0 A;  3OW2 U;  2A06 H;  2LQT A;  2ARH A;  2XAQ A;  2JS3 A;  2N05 A;  1W2B U;  1XBL A;  2IU0 A;  1WB7 A;  1KU9 A;  3B2E E;  4X1Y B;  3ASO C;  2ZD9 A;  2HP8 A;  1XDC A;  2EIN B;  3TCU A;  5BY1 A;  1K5Q A;  2Q6A A;  2PZS A;  4IGG A;  3ABL C;  2QM8 A;  2MK3 A;  1UFI A;  2OTJ V;  5IYD O;  2P5O A;  2LFR A;  2O57 A;  2WLL A;  1Y76 B;  4DR1 O;  4MVO A;  4ABM A;  4JYA O;  2X6B A;  1RPR A;  1XEQ A;  3RT3 C;  2UXN A;  2XT9 A;  1EN5 A;  1RSO A;  1WA8 B;  3KKY A;  3CJH B;  4UXN A;  4FZ0 A;  4QE9 A;  5BMV B;  2ODM A;  4X1I B;  1HNX B;  1R1B A;  3CCL V;  1AR1 B;  2FKX A;  1NT2 B;  1M57 C;  2W0F C;  1JMK C;  4DV3 B;  3TJT A;  1WNS A;  1BGY H;  3A0H Z;  4J9Z B;  4I50 A;  4FLX A;  1ZWI C;  2PF4 E;  3HKE B;  4PEL A;  1GM9 A;  4UB6 Z;  4O4I A;  2G38 A;  3R66 A;  4DV0 O;  3MDS A;  2C2A A;  3ZRS A;  4B3M B;  3JSN A;  4D6T H;  3ZMS A;  3CME V;  3G71 V;  2VS0 A;  1EN4 A;  3AG1 B;  3ZHT A;  1WPB A;  4NTW A;  1K8A W;  4TV8 B;  4JI7 B;  1K33 A;  3L73 H;  4MVQ A;  1QBZ A;  1VQ6 V;  4H33 A;  3JAK B;  2GTA A;  5DN6 G;  3CSX A;  2ZNI A;  4IHJ B;  2XAF A;  1VQ7 V;  1DTO A;  3KG2 A;  5ITZ A;  4MVS A;  4YJ3 B;  2M7W A;  1VF6 C;  3RW0 A;  1AP6 A;  2X6C A;  3KCX A;  4LC1 A;  4TOI A;  1V54 B;  1IBM B;  4JI6 B;  2BE3 A;  4O4L B;  2Q69 A;  1DF4 A;  5FNV B;  1RFY A;  4X20 B;  1CP9 A;  1RPO A;  4UV8 A;  3IAY A;  3LNM B;  2CH7 B;  4UCT A;  5EYP B;  4GKK O;  4F6R B;  4MTG A;  3SJC C;  2OWO A;  4YHH O;  1MOF A;  3E8B A;  5CBG A;  3ASO B;  3ZED A;  5CB4 A;  3C3S A;  3ZHR A;  3JAL B;  4DUY B;  1HDJ A;  3TGU H;  5IJ0 B;  2A3Q A;  3R65 A;  4ICG A;  5LOV B;  3THO A;  2E5L O;  1THZ A;  3JAW B;  1M4U A;  3CHX A;  2IJH A;  4DV2 O;  1KB9 F;  4QJF B;  2VWK A;  3JAT B;  4DRX A;  4LWS A;  1RM1 C;  4I55 B;  4ZHQ B;  3K79 A;  5LA6 A;  4MT8 A;  1Q8I A;  5LYJ A;  2QTS A;  3D8C A;  3ZN0 A;  3DC5 A;  1R3K C;  2HFE C;  2GHY A;  3NXS A;  2WLJ A;  2ZQM A;  1YHQ V;  2YID A;  4KXR A;  3TXQ A;  3X2Q C;  1M57 B;  1VQ5 V;  1HP8 A;  1KKD A;  2IH3 C;  5CBH A;  4JTC B;  1ENV A;  4PDR A;  3CCR V;  3OGI B;  4I4T A;  1KYO F;  2ZIM A;  5IYZ B;  5LP6 C;  1XL4 A;  4YJ2 B;  3FB7 C;  3CXH F;  4UB8 Z;  2EUL A;  2WLM A;  3B8N A;  2D3O W;  4X89 A;  3CRA A;  2Y4T A;  4B3R B;  4F6E A;  4FFB B;  3BEH A;  4RWU A;  1P7G A;  3OTF A;  1K92 A;  3C3T A;  4LFB O;  3F7Y C;  4I7Z B;  3OMN B;  5EC1 C;  4UCU A;  2UUC O;  1AI5 A;  3K06 A;  2ZM6 O;  1M93 A;  4IYI A;  1R6K A;  2IJI A;  4H13 B;  3ZIA G;  4KHP O;  3UCS C;  3OGC C;  3W7W A;  3ETD A;  3E8H A;  1YI2 V;  2RJZ A;  1L0N H;  3CC2 V;  3ZMZ A;  2YIB A;  3K04 A;  5DM6 V;  1VQ9 V;  4RAI A;  1GAX A;  4FFK A;  3LUT B;  2W0X A;  5FL7 G;  4WFE A;  1D2D A;  4XDJ A;  3CEI A;  4X1Y A;  4RQE A;  4JF3 A;  2E75 B;  4LF9 O;  3G4S V;  1WN7 A;  3ZCC A;  5B3S C;  2BOB C;  4RUF A;  4DV7 B;  4MVZ A;  5L3F A;  3L70 H;  3T1H O;  1NTZ H;  3FAV A;  2IJJ A;  2DWD C;  4U3F H;  4CH6 A;  1TUB A;  3GB7 C;  3ZMU A;  1SQQ H;  4WBN B;  3P3P A;  2Z5U A;  4F4L A;  2AGA A;  2XND G;  1B06 A;  5KHK A;  3QO8 A;  1WA8 A;  1LUV A;  4R6Z A;  2N04 A;  3CJH A;  1PNL A;  1NTM H;  5BMV A;  2UUB O;  4X1I A;  1GO3 F;  1Y66 A;  4PV1 B;  1R6N A;  3KZI Z;  2ZIO A;  4ZIB A;  3JD3 A;  5EC2 C;  2XHB A;  3JD0 A;  1HR0 O;  1R6T A;  3FD9 A;  4JV5 B;  5HFM A;  3AK1 A;  2JJ2 G;  5J9P C;  2DN9 A;  2YXY A;  4JGS A;  1CXZ B;  4MVU A;  1Z5V A;  1ZSP A;  3ABT A;  3CC4 V;  1VMG A;  4JI2 B;  4TQF A;  4H0L B;  5L3D A;  2P6J A;  4TQD A;  3JAS A;  3OM3 B;  1VQK V;  1YJN V;  4JI8 B;  1Q6U A;  4KFM A;  2DYR B;  4PI2 A;  3P3N A;  3X2Q B;  1XQ8 A;  4DYL A;  3OUF A;  4DK0 A;  3OEE G;  4DK1 A;  1FJG O;  1PNK A;  1LUW A;  5L3E A;  3H01 A;  4QE7 A;  4JZ2 A;  4B3T O;  5LP6 B;  2VWJ A;  1EFR G;  3WB0 A;  1IZ3 A;  1NBM G;  3DSQ A;  4PDL A;  1GH6 A;  4IHJ A;  4DR5 O;  4DV4 B;  2P7T C;  2EIL C;  4XDK A;  5EBM C;  1AI6 A;  3HR0 A;  3ETQ A;  4YJ3 A;  4X1K B;  4CH5 A;  2L6L A;  2NLJ C;  3F7V C;  1JQ0 A;  4DV6 O;  4HYO A;  1F4N A;  4EB6 B;  5L3G A;  4O4L A;  2XAG A;  4EFB A;  1R3L C;  3L75 H;  5CA0 B;  3BAA A;  4AQY B;  1VQ8 V;  2CTW A;  5FNV A;  4X20 A;  3OTO B;  2N74 A;  5HFL A;  2CH7 A;  5BR8 B;  5EYP A;  4LF6 B;  1UJW B;  4F6R A;  2DE0 X;  3UKM A;  1U96 A;  2HJD A;  1N8R W;  3OMA B;  3Q4H B;  3A8T A;  1KKC A;  5IWA O;  5B1O A;  3UO3 A;  4U7O A;  1U97 A;  3JCZ A;  5B3S B;  3IC7 A;  3JAL A;  2QWP B;  3ZMV A;  4FJC C;  1HNZ O;  1SZX A;  1J95 A;  3SJQ C;  5IJ0 A;  5LOV A;  1I5X A;  2YXL A;  1SA0 B;  2NN4 A;  2EJR A;  3FKS G;  1H8E G;  1HNW O;  1GRJ A;  5LXT B;  2X7R B;  4N23 A;  2XAJ A;  4I55 A;  4J11 A;  4ZHQ A;  1DF5 A;  3MHH C;  1VQL V;  5LHG A;  4GKJ B;  1FFX A;  3C90 A;  1Q5O A;  2IM9 A;  1TGO A;  1AB3 A;  4X65 O;  4MW8 A;  1YTF D;  3JAM N;  5LMU B;  2QWR B;  4G27 B;  4DR7 B;  4UFZ A;  1N34 B;  1BS3 A;  1MSD A;  5IYC O;  3ZRW B;  4OX9 B;  1PM9 A;  3ABU A;  5J2U A;  4P30 A;  2ITC C;  3OEH G;  4QPJ A;  5IYZ A;  4GZR B;  4YJ2 A;  1Q6I A;  4MTO A;  4YY3 B;  1UPG A;  1ZUQ A;  2QKA A;  1VEW A;  2LP7 A;  4LF7 B;  5KHJ A;  4R50 A;  4FFB A;  2P06 A;  2NR5 A;  3L72 H;  3ICX A;  1W0J G;  3QG5 A;  4DUZ O;  4LFA O;  2JJ1 G;  1EN6 A;  5FLX N;  1AJP A;  1JVM A;  2ZDI C;  1HWY A;  1QQC A;  5FPR A;  5K1X A;  1AJQ A;  3B40 A;  3IFX A;  5LYJ B;  3K03 A;  2F4V O;  1R3I C;  2RCV A;  4D7S A;  4FIP C;  5K1P A;  5EZY B;  1XHZ A;  1XMO O;  1F7Y A;  3K59 A;  3A0R A;  2EIL B;  2P90 A;  1NKD A;  1VF6 A;  2JIZ G;  1NS1 A;  3P32 A;  4DV5 B;  1BL8 A;  1QLN A;  3CP1 A;  3W7U A;  3SJB C;  4QNH B;  3D36 C;  1ZX3 A;  2UXC O;  2ZT9 B;  3K58 A;  5LGU A;  1GKF A;  2A79 B;  1D5A A;  3BHP A;  2F66 C;  4FLW A;  4WBN A;  1GN4 A;  1GK9 A;  2Q5Z A;  4J41 A;  1G8M A;  1FXK C;  4DR4 O;  2VQF O;  1PL4 A;  1YCI A;  4JAS A;  4BIO A;  3AG3 C;  2Q73 A;  3CE2 A;  1HNZ B;  1FS0 G;  4LF5 B;  1M56 C;  2YEV B;  3ZBH A;  3BA8 A;  1ROP A;  3CCU V;  1XNR O;  1L8D A;  5GON B;  3ZRX A;  2OTL V;  1BT8 A;  1PL0 A;  4PA9 A;  2HHH B;  5JCO A;  2P67 A;  3H1I H;  3APQ A;  1JJ2 U;  1CEZ A;  2LO1 A;  5KHG A;  4ZI7 A;  1QR8 A;  1L1F A;  4K0K O;  1B04 A;  2K9P A;  2Y48 A;  5IE9 A;  4U7N A;  2Z3Y A;  1XOU A;  5B1B B;  5KMG A;  4DR2 B;  3FAV B;  4NXM B;  5BXZ A;  3ABK B;  3CYO A;  3S3X A;  1JCH A;  1TUB B;  1XL6 A;  3L71 H;  2DW4 A;  4X64 B;  3GWO A;  1OV9 A;  4LR3 A;  1FFT B;  3MAQ A;  1V55 C;  3RYI B;  1BQZ A;  4LFC O;  5LP6 A;  2ZCE A;  3A0B Z;  4TSF G;  1QVG U;  3QF7 A;  1ZTE A;  1IBL O;  1DLB A;  3JD4 A;  4NVP A;  1J5E O;  4X1K A;  1XNQ B;  5DEC A;  4CBC A;  3CX5 F;  4EB6 A;  4I5S A;  1K3E A;  5CA0 A;  2HR3 A;  1QU7 A;  2OT5 A;  3ZHQ A;  4FM1 A;  3E86 A;  5IJ9 B;  1BZK A;  5KA6 A;  1H2M A;  4FVM A;  4JI3 O;  3OR6 C;  2UXB B;  4P2Z A;  2EIK C;  3Q4H A;  3JAS B;  3MD0 A;  2H8P C;  2X6A A;  5H5N A;  2EZP A;  4FK5 C;  3RYH B;  4JI5 B;  1N33 O;  1EM1 A;  1NTK H;  3JAR B;  1YTF B;  3ZHU A;  1AR5 A;  3JSL A;  3CRC A;  4CZZ A;  1SA0 A;  3K9S A;  4FLT A;  5LXT A;  2XOK G;  2YXH A;  1N36 O;  2FTK A;  1FXK B;  4I0X B;  2GUZ B;  4GT1 A;  5CBF A;  1M56 B;  1IXB A;  4PJ0 Z;  4WFG A;  3T2M A;  2ZE8 A;  1AR4 A;  5GTI Z;  5B5E Z;  2FL4 A;  2ZIN A;  3U0Z A;  2GDS A;  2Q7G A;  3VQV A;  5A2Q N;  4WF9 V;  1B3Q A;  3K9A A;  2LGW A;  1FXH A;  3ZRW A;  4E2L A;  1SES A;  2DOS A;  3RYC B;  1E1R G;  2FYU H;  2YS8 A;  1HW7 A;  3LDE A;  3SR2 C;  1Q86 W;  2GBO A;  4X62 O;  1I94 O;  1E1Q G;  3K08 A;  3NR7 A;  4Q6G A;  3CCM V;  2B5U A;  5KX5 A;  4YXW G;  1VQM V;  2EX3 A;  5B1N A;  2QTO A;  2WWW A;  2BCC H;  3EFF K;  3ABL B;  2LGQ A;  4UCR A;  4DR1 B;  5KAF Z;  2YIC A;  2PTM A;  2XAS A;  3J81 N;  4JYA B;  3CXC U;  4H37 A;  2LFS A;  4K8Z A;  1V55 B;  3FB8 C;  3FYI B;  1YIT V;  1T5E A;  3I56 V;  2IU3 A;  2M6Y A;  2BTQ B;  5C8Y B;  1G4Y B;  1FFX B;  1YZB A;  1QVF U;  3K57 A;  4G2K A;  3SPJ A;  4LNU A;  5EZY A;  1XMQ O;  2E3C A;  2JDI G;  4L87 A;  3W7T A;  1G6U A;  4GCZ A;  1N32 O;  1MSW D;  3SYA A;  2FB5 A;  2A0L A;  3HPL C;  4JI4 O;  3K0D A;  3N2K B;  5J2U B;  3CCS V;  1E79 G;  2UUA O;  1VF5 B;  1O9H A;  5H6R A;  1S76 D;  4Z1V A;  4DV0 B;  1NR7 A;  1S77 D;  4UCV A;  1SQF A;  4TT3 G;  3SYQ A;  3CCE V;  3CCQ V;  1VQP V;  1N0N A;  2EIK B;  3ZRV A;  1VQ4 V;  5JVD B;  1ORQ C;  4ZOL B;  2QWO B;  4GYC B;  2YEV A;  4B3S O;  5KUK A;  3FX7 A;  5J2T B;  3VQY A;  1WAZ A;  3OFN G;  1FYJ A;  1GMG A;  2QGN A;  5GON A;  5LMN O;  4CS3 A;  2NNU A;  1BMF G;  1S5L Z;  1OZ0 A;  1P49 A;  5E79 Z;  3T1Y O;  1MNG A;  3BPZ A;  1I5Y A;  3H9V A;  4DR6 O;  3AEI A;  4Q20 A;  1AVM A;  2YI8 A;  1P4R A;  1EZV H;  1N4C A;  2Y4U A;  4BR6 A;  3ASN C;  1O9G A;  4NXN O;  2Q7H A;  2KG7 B;  4DV1 O;  5CA1 B;  2CTR A;  3CB2 A;  2IBZ H;  4UUJ C;  5EK0 A;  3VQX A;  4MVR A;  4GUN A;  1TUE B;  4GKK B;  3H1J H;  3F5W C;  3SDL A;  4YHH B;  2WLK A;  3WB2 A;  2Q8V A;  2WLI A;  1H8H G;  2IW5 A;  3RYI A;  4PA6 A;  4B7E A;  4UCS A;  3G67 A;  4WFF A;  4DXW A;  1YXB A;  2HLD G;  4PDM A;  2QDO A;  1KUQ A;  3STZ C;  2DWE C;  2E5L B;  5LL6 Y;  4CH4 A;  4DV2 B;  3T4D A;  1SER A;  1US6 A;  5LHH A;  1S5H C;  4BW5 A;  3W7X A;  2CGO A;  2ZDI A;  1IXM A;  1RM1 B;  2QEX V;  2W6I G;  3OT7 A;  2DJV A;  1ZL8 B;  5IJ9 A;  4ZI7 B;  2YC0 A;  2CTP A;  4FLY A;  5B1A C;  3K5O A;  1YSC A;  5KMG B;  3RYH A;  2RQ6 A;  3TXS A;  2IJK A;  1H38 A;  1F23 A;  5F2V O;  1K7D A;  3JAR A;  4OPA A;  4WFB V;  4RO2 A;  3WB1 A;  5LGN A;  3D36 A;  4O4H B;  4J42 A;  2OCC C;  2DYS C;  3ABM C;  4JI1 O;  1K34 A;  3SYC A;  4K8X A;  2UU9 O;  3QO7 A;  5JH7 B;  4KL1 A;  2YIA A;  1FXK A;  4I0X A;  2GUZ A;  5IDJ A;  4LFB B;  2UUC B;  4KUM A;  4H44 B;  3F5T A;  4KP4 A;  5A9G A;  2ZM6 B;  2PYJ A;  1OHH G;  1ZLZ A;  4KHP B;  4NYK A;  3RBZ A;  5KA5 A;  1YJW V;  4LF4 O;  3B09 A;  1AI7 A;  1BE3 H;  2E76 B;  1XHX A;  4FM0 A;  2QWN B;  4LF8 O;  3RYC A;  3RFR A;  2QWQ B;  4RQF A;  3LDC A;  3ZN1 A;  5D5Q A; 
#chains in the Genus database with same CATH homology
 4DV7 O;  1HNX O;  1YZB A;  4JI3 O;  1KUQ A;  4DR4 O;  2VQF O;  1X59 A;  4AQY O;  3J7A U;  4X64 O;  5H5N A;  3OTO O;  1XMQ O;  4DV3 O;  2UXD O;  5LL6 Y;  1AB3 A;  4X65 O;  5BR8 O;  4LF6 O;  1N32 O;  3JAM N;  1N33 O;  4JI0 O;  1XNR O;  1FKA O;  4LFB O;  5BY1 A;  1IBK O;  3M8A A;  4JI4 O;  2UUC O;  2Z0A A;  2UUA O;  2ZM6 O;  4OPH A;  1DK1 A;  3O65 A;  4KHP O;  4B3M O;  2DJV A;  1XNQ O;  1FJG O;  1N36 O;  4DV5 O;  4B3T O;  4DR1 O;  4GKK O;  4JYA O;  4JV5 O;  4YHH O;  1D2D A;  4JI7 O;  1XEQ A;  3RT3 C;  4X66 O;  4K0K O;  5IT9 N;  4DR5 O;  4B3S O;  4OPA A;  4LF9 O;  2UXB O;  1FYJ A;  5LMN O;  4DV6 O;  4JI2 O;  5BXZ A;  3T1H O;  4GKJ O;  1R1B A;  2ZKO A;  5A2Q N;  4DUZ O;  3J80 N;  2E5L O;  4LFA O;  4A5U B;  2FKX A;  4LF5 O;  4JI1 O;  5FLX N;  4DV2 O;  2DOS A;  4JI5 O;  2LW7 A;  3T1Y O;  2N74 A;  4B3R O;  4JI8 O;  2UU9 O;  5LMU O;  4DR7 O;  4DR6 O;  4LFC O;  2F4V O;  1IBM O;  4JI6 O;  1N34 O;  4X62 O;  2HHH O;  1I94 O;  2AGA A;  1XMO O;  1G1X B;  1F7Y A;  2JRI A;  4OX9 O;  1IBL O;  3F5T A;  5IWA O;  3R66 A;  4DV0 O;  4DR3 O;  1J5E O;  4NXN O;  1NS1 A;  4DV1 O;  1HNZ O;  2UUB O;  4LF4 O;  4YY3 O;  3J81 N;  1HR0 O;  3SDL A;  2VQE O;  1R6T A;  4DV4 O;  1A32 A;  2UXC O;  1AIL A;  4LF7 O;  1HNW O;  4LF8 O;  4DUY O;  4DR2 O;  4NXM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...