5BR8O

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5br8O00
4GKKO 4LF6O 4LF4O 3F5TA 2UUCO 4JI2O 3J80N 5IWAO 4JI5O 5BY1A 3J7AU 2AGAA 2UXBO 4DUYO 4LF5O 1AB3A 5LMNO 4DR1O 2UUAO 3JAMN 4JI1O 4A5UB 1X59A 4X66O 1F7YA 5LL6Y 1N34O 1HNZO 5FLXN 4JI4O 4B3RO 1KUQA 4B3TO 1G1XB 1N33O 4DV0O 2VQFO 3T1YO 1D2DA 4DR4O 1XEQA 4LFCO 4DV5O 2UUBO 1R1BA 2UU9O 1HR0O 5BR8O 4YHHO 1A32A 1FJGO 2Z0AA 4DR3O 4DR2O 4LFBO 4LF7O 4DUZO 4JYAO 1I94O 2N74A 1XMQO 1IBMO 4DR6O 4GKJO 4DR7O 1IBKO 2E5LO 5IT9N 4JI3O 4OPHA 4LF8O 3SDLA 4NXNO 1XMOO 4DV6O 4B3SO 4DV7O 1FYJA 2LW7A 4DV3O 3J81N 5H5NA 3R66A 1IBLO 2JRIA 1N36O 1HNWO 3M8AA 1J5EO 4JI7O 3OTOO 1DK1A 2DOSA 5A2QN 4NXMO 4AQYO 3T1HO 2VQEO 1XNRO 4DV2O 3RT3C 4OPAA 4DR5O 2DJVA 1XNQO 4JI8O 4JV5O 5LMUO 1HNXO 4K0KO 4X64O 4DV4O 4YY3O 4JI6O 4X65O 1AILA 4LF9O 2ZKOA 1YZBA 2ZM6O 4B3MO 4OX9O 4LFAO 2UXCO 4X62O 2F4VO 1FKAO 2FKXA 4DV1O 1NS1A 4KHPO 1N32O 2UXDO 4JI0O 3O65A 1R6TA 2HHHO 5BXZA
chains in the Genus database with same CATH superfamily
3CJHB 2IJJA 3CYOA 1PNMA 2F23A 1COWG 4J80A 5H9CA 4TUYB 4UCUA 4DYLA 4GX1A 4TQDA 3OM3B 4JYAB 3K9AA 2CDYA 1Y4MA 4X66B 1P84F 1RFYA 3L73H 5B3SC 5C8YB 4DV0O 2CE4A 1NVPB 4LP8A 3APQA 2NNUA 1WP8A 1GKFA 5EC1C 2Q0AA 1B04A 2D2CB 4YHHB 4DR3B 5CMUA 1E1RG 4UCVA 5A9GA 1EZJA 2A79B 1O9HA 4LCUC 4JI3O 3SPHA 4LF8B 1AROP 2KB1A 5F2VO 4DV6B 2GTSA 2YI9A 1FXKA 5JH7A 3JATA 4GCZA 2X6BA 1MSDA 1Z2GA 2JJ2G 4XDLA 3G71V 4NXMO 2RNBA 2O57A 2VQEO 4R6ZA 1MA1A 3ABUA 1VP7A 2H3OA 4MT8A 4KHPB 4WFAV 3ML0A 1FFXB 2A3QA 3FYIB 1RSOB 5LMUB 1HNXB 1NR1A 4XDJA 1BQ0A 4TV9A 4N23A 2UXBB 1YZBA 1O9GA 2BSKA 5LMNB 1GN2A 2DE0X 3SYAA 1H2KA 4PA7A 1Y76B 3W7SA 4GX5A 3TXQA 2VRZA 1ZL8B 3ABKB 5L3EA 4ASUG 1VF6A 1FFTB 4NXNO 4I50A 3Q4HA 5ITZB 3ASOB 1VQPV 4CH4A 4JI2O 1R6NA 3RYCA 3AK3A 4H13B 4FM0A 1NT2B 5IYZB 4JI1B 1NKDA 3ZRWA 1HNZO 3HKDB 1GTOA 3K79A 4G28B 3L74H 1IBKB 4UUJC 1K7DA 4J9YB 3K59A 3KKYA 1BZKA 4LR3A 4FFKA 2AW9A 1PNLA 2YICA 2XAQA 4DUZB 2N74A 4GUNA 1P4RA 1XDCA 1SETA 2ZIMA 3UCSC 2X7RB 1XNRB 2Q73A 3L72H 5EZYB 4GKJB 2HLDG 2K9PA 4B08A 3CRAA 4DV7O 3K0GA 5DECA 3BPZA 3G6BA 3QO5A 2DYSC 2IU3A 5B1AC 1XQ8A 1IBLO 1U97A 3OUSA 2PZSA 2IJHA 3BVOA 4X62B 1QLEB 2EIMC 2YEVA 2YIBA 5IJ0A 3P30A 2HKOA 1M56C 1R3KC 3FB7C 3CRMA 3B40A 4TWKA 2P4VA 2RMKB 4X64B 1NH2B 3BAAA 4LF9O 1TUEB 1L0NH 1Q81W 2JJ1G 4EEQA 1RP3B 1JX9A 3JSLA 1TUBB 4O4HB 1IDSA 1FKAO 1BL8A 2DN9A 2EULA 2EIJB 2HHHB 4LF6O 4LF4O 2A9HA 3RYHA 5LA6A 3E86A 1G8MA 3JASA 2KSDA 2FL4A 5H6RA 5LGUA 5BR8B 3N2KB 5EYPB 3ZHSA 1WPBA 3B09A 5JCOA 1LUWA 3JARA 5IYCO 1Q7YW 4MTXA 3CCQV 3VQWA 4F6RB 4YJ2A 1SKVA 2WWWA 1JOYA 2W0FC 4DR7B 5CBHA 5B1BB 4B3TO 5LHIA 3GWKC 4BW9A 1SESA 1TVKA 3T1YO 4DXWA 1D2DA 4DV0B 1R3LC 2IW5A 2N04A 3LDDA 1SS3A 5AG2A 1S0VA 3CRRA 4EFEA 5KHGA 1VF5B 2ZIOA 2DYRB 2MK3A 1IX9A 3OEEG 5IT9N 1JJ2U 4MTGA 4GZRB 5GONA 4JI3B 4JI8B 4JV5B 2EIKB 1ZSPA 4NKGB 4PDMA 1WJZA 2EILB 3SR2C 5C93A 3P32A 4KL1A 3M99B 4AHCA 1NVPD 2PI5A 4K3AA 1VQ6V 5IYBO 1KB9F 3E8HA 4NXMB 3EFFK 3IJ4A 4UCOA 2VQEB 3QO8A 2GBOA 1R3JC 2WLJA 1Y6XA 2QM8A 3ICXA 4K0KO 5L3GA 3EXAA 4I55B 4YJ3B 3RYFA 4YY3O 4JI6O 1OJHA 2WLKA 2JGDB 1AI4A 3THOA 1URFA 1P7BA 3BABA 1Q6HA 2HVJC 2ZDIC 3JSNA 4YXWG 4NXNB 1EZVH 3L9DA 5LGNA 2R9RB 3I5DA 3GVMA 3GB7C 4QJFB 4JI2B 2AZ0A 4CS3A 3ABKC 3AEIA 3CRCA 3EVKA 1TAEA 4QPJA 5J2UA 3EHBB 4L87A 1YTFB 1HNZB 3DTUB 3L71H 3APOA 3PN1A 2R9AA 3FKSG 1DTOA 1EFRG 3B8NA 4KXRA 4JF3A 1Q86W 3BEHA 4KP4A 3QO7A 1DF4A 4JYAO 1I0HA 1R73A 2P7TC 3LSSA 4AQYB 1GN6A 4JYBA 1SQPH 1KYOF 2P4KA 4OPHA 3BRCA 1Y67A 1L8DA 3ZJZA 1JFFA 1GM8A 1L0LH 4DV7B 3R66A 4O4JA 1AR4A 1SQGA 3DXRA 1IBLB 3E2EA 2XAGA 5J9PC 2DOSA 2UXCB 3QF7A 3DSQA 1S5LZ 4PA3A 4TUYA 4JI0B 2A06H 2Q69A 3JD3A 1K73W 3IGAC 3MHSC 1WA8A 4WFFA 3CP1A 3D3IA 1OCOB 1Q8IA 1FS0G 1EM1A 4JTDB 5C8YA 1QLEC 1QQCA 3OE7G 2ZE6A 1IZ3A 2JK5C 2V7QG 4LF9B 2OCHA 1AI6A 4B7EA 1NS1A 4KHPO 4UVAA 2QWQB 3UO2A 2LP7A 3P3PA 3F5TA 2IJIA 4RQFA 1CEZA 1K5SA 4LF4B 5E79Z 4LF6B 3KZIZ 3S3XA 5CA1B 1L1FA 1E79G 1V9PA 2UXBO 4FM1A 4LF5O 4G2KA 5LMNO 4NTXA 4JAVA 2EIJC 1GK9A 3H1HH 2FB5A 4IIJB 3AG2B 4DR6B 1NH2D 2ODMA 2WA3A 1KUQA 4NVPA 4AI8A 5KMGB 3SJBC 4B3TB 5CBFA 2D3OW 1WB8A 1K34A 1MMMA 3T1YB 1E1QG 2Z3YA 1MOFA 3H01A 3L70H 2UXNA 3ZRVA 4DR2O 2H8PC 1B6QA 2JEXA 4IYIA 5CN0A 2LGQA 1MZFA 3SPGA 3STLC 5IDJA 2QKSA 1QLNA 5B1BC 5BMVB 2IH1C 4ABMA 2LFSA 3SPJA 3JAWB 4O4LB 1XI1A 1IBKO 5IJ9B 1ZLZA 1NJIW 1XMOO 3T1CA 1Y76A 4BIUA 1FAFA 4J10A 1ZL8A 3CSXA 4TOIA 1SZXA 4I4TB 2W6IG 3ETDA 5B5EZ 2DYRC 2CH7A 3B8MA 1I5XA 1XNRO 3AK1A 2RDCA 1OCZB 3LDEA 3O9OA 4KUMA 5LOVB 5CA3A 1SQQH 1N0NA 2KG7B 4G27B 2P5OA 4PDLA 1K5QA 3ZRXA 3FB5C 5JVDA 1M9NA 5IYZA 4LNUA 1OCRB 3X2QC 2EILC 3HKDA 3ZCCA 2QWOB 1G6UA 1Q5OA 3W7XA 5IWAB 4K0KB 4ZBMA 2P67A 3ZMTA 5EK0A 4JI6B 2IM9A 2Y0IA 3WG7B 4Q6GA 4X62O 5KHIA 4I0XB 3O65A 1R3IC 5KHKA 2M7WA 1MZEA 1LNQA 3VBBA 4TSFG 3SYQA 2OCCC 4LFCB 3RYIA 2WLHA 2ZXWB 5EZYA 2Q9LA 2DQ3A 2YIAA 4GYCB 1YIJV 2CTQA 1I94B 4X1IB 2P90A 3BA9A 2ZCEA 4ZHQB 5J2TB 3M7MX 2PTMA 3OW2U 2UUBO 4QPKA 5LXTA 1VQ8V 3K0DA 5BR8O 4UV9A 2FYUH 1PPJH 4I7ZB 1AJNA 1GH6A 4EKWA 2GDSA 2XOKG 2G38A 2E76B 2Q67A 1QBZA 1IVSA 3UM7A 2WLMA 4DR7O 1HWYA 3CEIA 3CCRV 4ZI7B 2WPDG 4DV3O 1H2LA 3HKCB 1YTFD 2A7WA 5H5NA 4BWAA 1IURA 5K1XA 4WBNA 3RFRA 4LWSB 1W0JG 3K9SA 3ABLC 4OX9B 3JALB 4B7KA 4CC5A 3T2MA 5KHJA 4D7SA 4FVMA 2DJVA 3E22A 2GSMB 4ZOLB 2ETNA 1SQBH 3UT5A 4JI8O 4JV5O 5CA0A 3LUTB 2Q4PA 4F6RA 2V1DA 3MD0A 1H8HG 3F7VC 3F5WC 4X65O 2LO1A 3HKEB 4DUYB 4MVMA 4TV8A 1AR5A 5FL7G 5EBMC 4Z2WA 1YVWA 5JJJB 3PJSK 4O2AB 3ZHRA 1VF7A 1OCOC 5JQGA 4PI2A 4C7UA 2WLIB 4UCTA 4YIPA 3K5MA 4JYYA 1FD9A 2JEUA 4IHJB 4DR1O 2CGNA 2XAFA 3AK2A 4LF5B 1XHXA 3K06A 1Q3EA 1BS3A 1F7YA 1U96A 4J7JA 5KHHA 2P06A 3D3QA 3UQ8A 3H1KH 3OGIB 4HZ3A 3BCCH 1GMGA 2Q7HA 3DC5A 3KG2A 2QTSA 4DR2B 2E3CA 1HNWB 1K33A 4I55A 1P49A 1ZX3A 2ZE7A 3IC9A 3OTFA 2HJDA 3CXCU 2W0XA 1XMOB 1BQZA 5HFLA 4U7NA 3N2GB 1WPXA 2Q6AA 2ADPA 3ZMSA 4EB6B 4AQYO 4UCSA 4GX2A 1EN6A 2KQXA 1PD3A 4P9OA 5LHGA 1P7GA 1GN3A 2UXXA 1WN7A 2QM7A 2HFEC 4BAYA 4H37A 1KU9A 2R72A 3FAVB 3CRQA 4MS2A 3ASNB 2GUZA 1OCZC 2HJFC 2UXCO 2YSUB 1WLEA 1N32O 2BCCH 2N05A 4JI0O 5LGTA 2WLLA 2QWNB 2JS3A 3K04A 2ZE5A 2XAJA 3WB1A 4X20A 1YF2A 2QM4A 4K8XA 5LL6Y 2ITCC 3KCYA 5B1NA 3ZEDA 1XMQB 3BY6A 1BMFG 3JCZA 4JZ2A 1JPXA 2ZXWC 3JAKB 3ZX6A 4LH6A 4X9QA 2VQFO 1N0JA 4PD4F 2BTQB 2UU9O 2UUBB 2YXLA 3FYEB 2QGNA 4DW1A 3BA8A 3SGIA 2WSSG 1BHBA 5KLVH 2JS5A 4RQEA 3ZBHA 5IYDO 1IBMO 4DR6O 3E35A 4CH5A 1UJWB 4PHZA 2B1IA 3ZMUA 1RM1B 1PP9H 2EBOA 2XHBA 1MNGA 4DV3B 1K92A 5KX5B 3E8BA 1WNSA 3OTOO 1W0KG 1F4MA 5TISZ 4J42A 2QR4A 1FXKB 1M1KW 1PL0A 3JATB 5E1AC 4KFMA 5L3FA 4IIJA 4CH6A 1XOUA 1F23A 1NZ6A 1SQVH 2NN4A 3K57A 1NTZH 1SA0A 1KC8W 4HNAA 5KMGA 4NYKA 4X65B 4O4IA 4B3MO 3E83A 2EX3A 4JGSA 4RUEA 3CMAV 1NR7A 2LJ2A 4FLTA 4TV9B 2BOCC 2R9IA 3JD2A 2PY5A 2NR5A 2QWPB 3D36C 5BMVA 1YCIA 1F4NA 2YDEA 3HR0A 5IWAO 1EN4A 4O4LA 3LNMB 5IJ9A 3SJAC 4FZ0A 3CX5F 3FB8C 2Y69B 4DR1B 3Q4HB 3BFRA 1Y74A 1AP6A 4I4TA 3CC7V 5GTIZ 3ABMB 5H2FZ 1VQNV 4JPRA 4H33A 4MVQA 1RPRA 1V54B 4BW5A 1I7FA 3FX7A 4LFCO 4FK5C 4DV5O 5B1OA 3CD6V 1KP3A 5LOVA 1SZTA 2KG7A 2M6YA 5BZBA 2P22C 4J7ZA 3H1IH 1RPOA 1I94O 5JJNB 3OEHG 3ASOC 5KUKA 2WA4A 5LYJB 2P6JA 1YJNV 4X1YB 5B66Z 1VIBA 2X0LA 3H1JH 4I0XA 2LQTA 1GRJA 2CUGA 1S5HC 2PUSA 2B5UA 2RCVA 2RQ6A 3ZHVA 5DM6V 3M8AA 2EZPA 3B77A 1VEWA 3RWRD 3NR7A 1YSCA 2OTLV 4TT3G 1VQKV 1S77D 3VQVA 3K08A 4X1IA 1Q6IA 3AG1B 1Q6UA 5KUMA 3IAYA 3E8GA 3U0ZA 1ZUQA 2YEVB 3WB0A 4ZHQA 4FLXA 4JASA 3CJHA 2XTAA 4OX9O 3CS5A 4MVZA 2OIEA 5FNVB 4UV8A 4BIOA 2YXHA 3DGEA 1N32B 1R6TA 4FLZA 2GTAA 1AJPA 1JVMA 3CCMV 3OMNB 2Q5ZA 2UUCO 3T4DA 4DW0A 4J7KA 3CMEV 3QTCA 3ASNC 3J80N 4JI5O 3J7AU 4DUYO 1YHQV 4FFBB 3D8CA 4ZI7A 4DK1A 2VWJA 3P3NA 3HKCA 1Q43A 4MVRA 3SYPA 5GW7A 3FFQA 4LWSA 3JD0A 4RO2A 3NXSA 2CTPA 3VOUA 1BCCH 1Y66A 1G1XB 1BHAA 3JARB 1GM9A 1QCEA 1Z5VA 2ZNIA 2VQFB 2RJZA 2AHYA 2UU9B 3RBZA 3L75H 4ZOLA 2QKAA 1CP9A 1N8RW 3G4SV 2CTWA 1KKDA 1AI7A 3ZHUA 4HAMA 3HKEA 5FPRA 3D36A 4FJCC 1IBMB 2E5LO 2Q7EA 1AR1B 4O2AA 1M57B 4MSWC 4GLXA 4JAAA 1FFXA 2GV9A 1HNWO 4JI7O 1RSOA 2QSAA 2ZDIA 4W4KA 3OTOB 4I9QA 2WLNA 2E74B 1KP2A 4MTFA 1IXMA 3H1LH 1YJ9V 4GKKB 4F6EA 4X88A 3LNNA 1QR8A 2Y0PA 4EFBA 1YEWA 1AILA 2ZKOA 2UUAB 5ITZA 3A0RA 4B3MB 2XT9A 5IE9A 1N34B 4GT1A 2FKXA 3BHPA 4JI4B 2DWDC 2EIKC 3A0BZ 1HDJA 1PKXA 3ZS8C 4WFBV 1M90W 1NQTA 4HBNA 4WFEA 3OR7C 2YI8A 3K5NA 4H44B 1OV9A 4R50A 5B1AB 1KMIZ 1FXVA 3N2GA 4J11A 2CK3G 2EIMB 4D6TH 3S3WA 2ZQMA 2FTKA 1XEQA 4B3SB 1VQ9V 5J2UB 1VQ5V 2Y69C 2IBZH 1HR0O 4DV5B 2AZ2A 1XL4A 2X6CA 3G6EV 3N27A 4UFZA 4LF7O 1N36B 1CPYA 3E8FA 4FIPC 1XMQO 1V54C 3FAVA 4E4EA 2F1MA 4U3JB 1W59A 3WU2Z 2OYQA 1F51A 3AG4B 3SDLA 2ARHA 4FM2A 3MDSA 2LW7A 3A0HZ 3OT7A 1PNKA 5CBGA 1D5AA 2PF4E 1VQMV 2CAZC 1HP8A 4O4JB 2A0LA 4DR5O 5JWPA 4NB5A 1XNQO 3CCUV 3DXRB 2NLJC 2QDOA 4R7CA 1EBOA 4PI0A 1TUBA 3U11A 4OXSA 4O4HA 1UFIA 2QEXV 4WF9V 1M4UA 4PDRA 3JAKA 1XL6A 1YI2V 1BT8A 1NTMH 3AG3B 2IJKA 1WA8B 2BTQA 3ZHTA 5LP6B 1VQOV 4QE9A 4UB6Z 3B2EE 3N2KA 5EYPA 3AG1C 2B9ZA 3OMAB 1W2BU 1YJWV 3AG7A 4Z1MG 3ABTA 2B1GA 2UUCB 3ZN1A 4PELA 2Q0OC 3SPIA 3CCSV 4GX0A 4LH7A 4JI5B 3SPCA 4X1KB 1FJGB 2ILMA 4LFBB 1JA8A 1YXBA 4J9ZB 4MVSA 1S5JA 4LC1A 2YIBD 5KX5A 3SYOA 3LSUA 3ZMVA 3FB6C 2HG5C 2ZD9A 5EC2C 3CPWU 5CB4B 1VQ7V 1Q82W 3SYCA 1A32A 1ZTEA 2PYLA 3C3SA 3HKBB 1ENVA 1KD1W 2OWOA 4NTYA 3ZMZA 1B3QA 5JCOC 4O2BB 4UVBA 2E5LB 3JCUZ 4ICGA 1FYJA 2IH3C 1WB7A 2DMXA 4WFHA 4DV4B 4IT5A 2EJ7A 3AG2C 4QNHB 1QR9A 2KKWA 4JI7B 4IL6Z 4YJ3A 3RT3C 1AI5A 1T5EA 2L6LA 2LGWA 1R6KA 2JGDA 1FPOA 1IXBA 1NI8A 1M57C 3QNEA 2CH7B 3CC2V 1K4DC 1H2MA 3W7WA 1XHZA 4OGQB 1JQ0A 1YITV 5EBWC 4JTAB 5JVDB 4UB8Z 4LNUB 4JZGA 3CB2A 5DEDA 2ZT9B 2Y4UA 1K97A 2PI4A 5KAIZ 4P30A 1SQXH 2EINB 4L8JA 2DW4A 3G67A 2PYJA 5BY1A 3WB2A 1PL4A 3LSQA 2Q7GA 4BIZA 5LYJA 2LFRA 4X1YA 4DRXB 4A5UB 3CHXA 3K5OA 3RYIB 3TGUH 4FPPA 1OCRC 2QA4V 4F4LA 2CTRA 4DK0A 2QTOA 1N33O 4DO2A 2W6JG 3MAQA 2EJRA 1N4CA 4JAUA 1HR0B 3C90A 2QWRB 2Z0AA 3WG7C 3UO3A 5IY5B 4LF7B 1FXHA 2FMLA 1SQFA 4I5SA 4MVUA 5LXTB 3T1HB 1S76D 2ZR3A 3CCJV 3VQYA 1KBHA 5FNVA 1THZA 1GN4A 1WP7A 4I9WA 2F95B 1Q90D 2JRIA 3OFNG 4MTOA 3OD4A 1DK1A 1OZ0A 3AG4C 1QVFU 4U7OA 4DV2O 4FFBA 1DGSA 2HEPA 4LBEC 4WBNB 4DR5B 1XILA 5KA6A 4MW3A 1VQLV 1G4YB 1J95A 5GTHZ 2JDIG 4CBCA 1XNQB 2BE3A 3RN4A 5LBQA 1V55B 3I56V 1US6A 2ZNJA 2BOBC 3E22B 1H2SB 5H6QA 3UT5B 3W7TA 5CA0B 2Q8VA 2ITDC 2F4VO 3MHHC 2JGUA 2OTJV 2ZE8A 5CA1A 3ETQA 3G80A 4DV1O 2HR3A 5JH7B 4QGPA 1MG1A 5FPOA 5BXZA 4TV8B 4GKKO 1M93A 1D5NA 4CS2A 3AG3C 1H38A 3ETGA 5HFMA 3FD9A 5LP6C 5JQGB 1AB3A 2UUAO 1OCCB 3CXHF 1SERA 1N34O 4K35A 2DQ0A 4JI4O 4B3RO 3SJCC 4YIOA 3OMIB 1QVGU 3A8TA 3UKMA 1KKCA 2ZINA 1S72V 2BSKB 3IFXA 2GHYA 4DR4O 1S3JA 2DWEC 1I08A 3TCUA 2QJ1A 1QNMA 1SRYA 3JAWA 3X2QB 4NR1A 4ZKIA 2L35A 5JJEB 4I50B 1K4CC 4X8AA 1MSWD 3RYCB 3R65A 1JMKC 3CWBH 1VARA 2X6AA 2AHZA 1PV0A 4B3SO 1MABG 3J81N 2YUAA 1DLBA 3ZRWB 3RVYA 2YC0A 3OAAG 4X89A 2OCCB 3TXSA 1KQSU 1EN5A 1K3EA 3ZHQA 1N36O 1J5EO 3W7UA 4JYCA 5A2QN 1QHTA 4IGGA 3E89A 3STZC 1JCHA 1LUVA 2XUMA 1KECA 1BSMA 4UVCA 5L3DA 1NU1H 2YS8A 2IU0A 3GWOA 4FLVA 3QVNA 5L3CA 3A2FA 1GO3F 1X4TA 4MVOA 1Z5WA 4N21A 2ZM6O 4LFAO 3HB3B 1ORQC 3CCLV 3T4ZA 1H8EG 1GAXA 4RWUA 3ZRSA 2UXDO 1H2NA 4HYOA 1TGOA 4R8CA 5D5QA 2LW1A 3RGBA 4FMTA 2GUZB 2H94A 2YXYA 5B3SB 1GM7A 4U3JA 4AILC 1SC5B 2JVDA 2WLLB 3JD4A 4RUFA 4QIWF 1XREA 5IJ0B 5J2TA 3JAMN 1I5YA 4X66O 4PA6A 3CC4V 4FLUA 1AJQA 2OT5A 4X20B 3ABLB 5K1PA 2EINC 1QU7A 2BTOA 3TK1A 4P2ZA 4CS4A 3RW0A 3LDCA 4FLWA 1N33B 2ATKC 2E75B 3OUFA 1AP5A 2RN9A 3ZIAG 4YHHO 1FJGO 4DR3O 4LFBO 3OR6C 1NTKH 2AXTZ 4K8ZA 3RYHB 5LA6B 3JASB 4IYHA 5DN6G 1ZAUA 2CGOA 1SF9A 4LF8O 3I55V 4DV6O 3JALA 5LP6A 4JTCB 1ZWIC 5IY5C 3F7YC 2F43G 2K1EA 4YJ2B 1K9MW 1H2GA 2C2AA 3ETEA 2VS0A 4PA4A 3ZN0A 3CCVV 4CC6A 1TVKB 3RVZA 3WFVA 4X1KA 4TQFA 4PA9A 3H9VA 1HW7A 4DV2B 5LMUO 1HNXO 2R70A 3QG5A 4NTWA 4DV4O 3U10A 2Q68A 2WLIA 4QE7A 4XBFA 5LHHA 5GONB 2F93B 4PV1B 5CB4A 2WAMA 2PGGA 2F4VB 4IHJA 4DV1B 1RM1C 1SA0B 3HKBA 1V55C 4CH3A 4HNAB 1ROPA 3K03A 4O4IB 4CZZA 1XBLA 5EBLC 3B4SA 1VQ4V 4PDVA 5KA5A 1TA8A 3DC6A 1M5IA 3KCXA 4E2LA 2AGAA 4O2BA 2QE7G 3JYCA 3HPLC 2HVKC 4JI1O 1FXKC 2YIDA 1X59A 2JIZG 4MW8A 5FLXN 4XDKA 4B3RB 3RYFB 3VQXA 4WCEV 4RAIA 1YDXA 3OGCC 1R1BA 1Y74B 3CE2A 1OCCC 4DR4B 2F66C 1LR1A 4P9PA 1VMGA 1NBMG 3IC7A 4D7TA 1DF5A 4DUZO 3TJTA 2DYSB 2V4DA 2VWKA 1BE3H 3CCEV 2Y4TA 4GKJO 2ZR2A 5EIBC 4Z1VA 5L3BA 2EZOA 5KAFZ 2HP8A 1OHHG 1JJOA 1VF6C 1XUQA 4EB6A 2Y48A 2MW2B 4U3FH 1M56B 1PM9A 3K58A 2Z5UA 4YY3B 3TETA 5D5PA 3C3TA 3K5LA 2OIGA 1JR9A 3ABMC 4W4LA 4H0LB 5EIBD 2XNDG 1J5EB 4UXNA 3T1HO 1WAZA 1BGYH 4OPAA 2ADQB 4WFGA 3K3WA 4DRXA 3SJQC 4UCRA 4X64O 1UPGA 4FZ1A 1CXZB 4BR6A 2ZM6B 4J41A 2XASA 4LFAB 4FLYA 1AVMA 1JFFB 2QKCA 4Q20A 1B06A 2HHHO 4ZIBA 2UXDB 2XAHA 3JD1A 1K8AW 4PJ0Z
chains in the Genus database with same CATH topology
4GKKO 4LF6O 4LF4O 3F5TA 2UUCO 4JI2O 3J80N 5IWAO 4JI5O 5BY1A 3J7AU 2AGAA 2UXBO 4DUYO 4LF5O 1AB3A 5LMNO 4DR1O 2UUAO 3JAMN 4JI1O 4A5UB 1X59A 4X66O 1F7YA 5LL6Y 1N34O 1HNZO 5FLXN 4JI4O 4B3RO 1KUQA 4B3TO 1G1XB 1N33O 4DV0O 2VQFO 3T1YO 1D2DA 4DR4O 1XEQA 4LFCO 4DV5O 2UUBO 1R1BA 2UU9O 1HR0O 5BR8O 4YHHO 1A32A 1FJGO 2Z0AA 4DR3O 4DR2O 4LFBO 4LF7O 4DUZO 4JYAO 1I94O 2N74A 1XMQO 1IBMO 4DR6O 4GKJO 4DR7O 1IBKO 2E5LO 5IT9N 4JI3O 4OPHA 4LF8O 3SDLA 4NXNO 1XMOO 4DV6O 4B3SO 4DV7O 1FYJA 2LW7A 4DV3O 3J81N 5H5NA 3R66A 1IBLO 2JRIA 1N36O 1HNWO 3M8AA 1J5EO 4JI7O 3OTOO 1DK1A 2DOSA 5A2QN 4NXMO 4AQYO 3T1HO 2VQEO 1XNRO 4DV2O 3RT3C 4OPAA 4DR5O 2DJVA 1XNQO 4JI8O 4JV5O 5LMUO 1HNXO 4K0KO 4X64O 4DV4O 4YY3O 4JI6O 4X65O 1AILA 4LF9O 2ZKOA 1YZBA 2ZM6O 4B3MO 4OX9O 4LFAO 2UXCO 4X62O 2F4VO 1FKAO 2FKXA 4DV1O 1NS1A 4KHPO 1N32O 2UXDO 4JI0O 3O65A 1R6TA 2HHHO 5BXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK O;  4LF6 O;  4LF4 O;  3F5T A;  2UUC O;  4JI2 O;  3J80 N;  5IWA O;  4JI5 O;  5BY1 A;  3J7A U;  2AGA A;  2UXB O;  4DUY O;  4LF5 O;  1AB3 A;  5LMN O;  4DR1 O;  2UUA O;  3JAM N;  4JI1 O;  4A5U B;  1X59 A;  4X66 O;  1F7Y A;  5LL6 Y;  1N34 O;  1HNZ O;  5FLX N;  4JI4 O;  4B3R O;  1KUQ A;  4B3T O;  1G1X B;  1N33 O;  4DV0 O;  2VQF O;  3T1Y O;  1D2D A;  4DR4 O;  1XEQ A;  4LFC O;  4DV5 O;  2UUB O;  1R1B A;  2UU9 O;  1HR0 O;  5BR8 O;  4YHH O;  1A32 A;  1FJG O;  2Z0A A;  4DR3 O;  4DR2 O;  4LFB O;  4LF7 O;  4DUZ O;  4JYA O;  1I94 O;  2N74 A;  1XMQ O;  1IBM O;  4DR6 O;  4GKJ O;  4DR7 O;  1IBK O;  2E5L O;  5IT9 N;  4JI3 O;  4OPH A;  4LF8 O;  3SDL A;  4NXN O;  1XMO O;  4DV6 O;  4B3S O;  4DV7 O;  1FYJ A;  2LW7 A;  4DV3 O;  3J81 N;  5H5N A;  3R66 A;  1IBL O;  2JRI A;  1N36 O;  1HNW O;  3M8A A;  1J5E O;  4JI7 O;  3OTO O;  1DK1 A;  2DOS A;  5A2Q N;  4NXM O;  4AQY O;  3T1H O;  2VQE O;  1XNR O;  4DV2 O;  3RT3 C;  4OPA A;  4DR5 O;  2DJV A;  1XNQ O;  4JI8 O;  4JV5 O;  5LMU O;  1HNX O;  4K0K O;  4X64 O;  4DV4 O;  4YY3 O;  4JI6 O;  4X65 O;  1AIL A;  4LF9 O;  2ZKO A;  1YZB A;  2ZM6 O;  4B3M O;  4OX9 O;  4LFA O;  2UXC O;  4X62 O;  2F4V O;  1FKA O;  2FKX A;  4DV1 O;  1NS1 A;  4KHP O;  1N32 O;  2UXD O;  4JI0 O;  3O65 A;  1R6T A;  2HHH O;  5BXZ A; 
#chains in the Genus database with same CATH topology
 3CJH B;  2IJJ A;  3CYO A;  1PNM A;  2F23 A;  1COW G;  4J80 A;  5H9C A;  4TUY B;  4UCU A;  4DYL A;  4GX1 A;  4TQD A;  3OM3 B;  4JYA B;  3K9A A;  2CDY A;  1Y4M A;  4X66 B;  1P84 F;  1RFY A;  3L73 H;  5B3S C;  5C8Y B;  4DV0 O;  2CE4 A;  1NVP B;  4LP8 A;  3APQ A;  2NNU A;  1WP8 A;  1GKF A;  5EC1 C;  2Q0A A;  1B04 A;  2D2C B;  4YHH B;  4DR3 B;  5CMU A;  1E1R G;  4UCV A;  5A9G A;  1EZJ A;  2A79 B;  1O9H A;  4LCU C;  4JI3 O;  3SPH A;  4LF8 B;  1ARO P;  2KB1 A;  5F2V O;  4DV6 B;  2GTS A;  2YI9 A;  1FXK A;  5JH7 A;  3JAT A;  4GCZ A;  2X6B A;  1MSD A;  1Z2G A;  2JJ2 G;  4XDL A;  3G71 V;  4NXM O;  2RNB A;  2O57 A;  2VQE O;  4R6Z A;  1MA1 A;  3ABU A;  1VP7 A;  2H3O A;  4MT8 A;  4KHP B;  4WFA V;  3ML0 A;  1FFX B;  2A3Q A;  3FYI B;  1RSO B;  5LMU B;  1HNX B;  1NR1 A;  4XDJ A;  1BQ0 A;  4TV9 A;  4N23 A;  2UXB B;  1YZB A;  1O9G A;  2BSK A;  5LMN B;  1GN2 A;  2DE0 X;  3SYA A;  1H2K A;  4PA7 A;  1Y76 B;  3W7S A;  4GX5 A;  3TXQ A;  2VRZ A;  1ZL8 B;  3ABK B;  5L3E A;  4ASU G;  1VF6 A;  1FFT B;  4NXN O;  4I50 A;  3Q4H A;  5ITZ B;  3ASO B;  1VQP V;  4CH4 A;  4JI2 O;  1R6N A;  3RYC A;  3AK3 A;  4H13 B;  4FM0 A;  1NT2 B;  5IYZ B;  4JI1 B;  1NKD A;  3ZRW A;  1HNZ O;  3HKD B;  1GTO A;  3K79 A;  4G28 B;  3L74 H;  1IBK B;  4UUJ C;  1K7D A;  4J9Y B;  3K59 A;  3KKY A;  1BZK A;  4LR3 A;  4FFK A;  2AW9 A;  1PNL A;  2YIC A;  2XAQ A;  4DUZ B;  2N74 A;  4GUN A;  1P4R A;  1XDC A;  1SET A;  2ZIM A;  3UCS C;  2X7R B;  1XNR B;  2Q73 A;  3L72 H;  5EZY B;  4GKJ B;  2HLD G;  2K9P A;  4B08 A;  3CRA A;  4DV7 O;  3K0G A;  5DEC A;  3BPZ A;  3G6B A;  3QO5 A;  2DYS C;  2IU3 A;  5B1A C;  1XQ8 A;  1IBL O;  1U97 A;  3OUS A;  2PZS A;  2IJH A;  3BVO A;  4X62 B;  1QLE B;  2EIM C;  2YEV A;  2YIB A;  5IJ0 A;  3P30 A;  2HKO A;  1M56 C;  1R3K C;  3FB7 C;  3CRM A;  3B40 A;  4TWK A;  2P4V A;  2RMK B;  4X64 B;  1NH2 B;  3BAA A;  4LF9 O;  1TUE B;  1L0N H;  1Q81 W;  2JJ1 G;  4EEQ A;  1RP3 B;  1JX9 A;  3JSL A;  1TUB B;  4O4H B;  1IDS A;  1FKA O;  1BL8 A;  2DN9 A;  2EUL A;  2EIJ B;  2HHH B;  4LF6 O;  4LF4 O;  2A9H A;  3RYH A;  5LA6 A;  3E86 A;  1G8M A;  3JAS A;  2KSD A;  2FL4 A;  5H6R A;  5LGU A;  5BR8 B;  3N2K B;  5EYP B;  3ZHS A;  1WPB A;  3B09 A;  5JCO A;  1LUW A;  3JAR A;  5IYC O;  1Q7Y W;  4MTX A;  3CCQ V;  3VQW A;  4F6R B;  4YJ2 A;  1SKV A;  2WWW A;  1JOY A;  2W0F C;  4DR7 B;  5CBH A;  5B1B B;  4B3T O;  5LHI A;  3GWK C;  4BW9 A;  1SES A;  1TVK A;  3T1Y O;  4DXW A;  1D2D A;  4DV0 B;  1R3L C;  2IW5 A;  2N04 A;  3LDD A;  1SS3 A;  5AG2 A;  1S0V A;  3CRR A;  4EFE A;  5KHG A;  1VF5 B;  2ZIO A;  2DYR B;  2MK3 A;  1IX9 A;  3OEE G;  5IT9 N;  1JJ2 U;  4MTG A;  4GZR B;  5GON A;  4JI3 B;  4JI8 B;  4JV5 B;  2EIK B;  1ZSP A;  4NKG B;  4PDM A;  1WJZ A;  2EIL B;  3SR2 C;  5C93 A;  3P32 A;  4KL1 A;  3M99 B;  4AHC A;  1NVP D;  2PI5 A;  4K3A A;  1VQ6 V;  5IYB O;  1KB9 F;  3E8H A;  4NXM B;  3EFF K;  3IJ4 A;  4UCO A;  2VQE B;  3QO8 A;  2GBO A;  1R3J C;  2WLJ A;  1Y6X A;  2QM8 A;  3ICX A;  4K0K O;  5L3G A;  3EXA A;  4I55 B;  4YJ3 B;  3RYF A;  4YY3 O;  4JI6 O;  1OJH A;  2WLK A;  2JGD B;  1AI4 A;  3THO A;  1URF A;  1P7B A;  3BAB A;  1Q6H A;  2HVJ C;  2ZDI C;  3JSN A;  4YXW G;  4NXN B;  1EZV H;  3L9D A;  5LGN A;  2R9R B;  3I5D A;  3GVM A;  3GB7 C;  4QJF B;  4JI2 B;  2AZ0 A;  4CS3 A;  3ABK C;  3AEI A;  3CRC A;  3EVK A;  1TAE A;  4QPJ A;  5J2U A;  3EHB B;  4L87 A;  1YTF B;  1HNZ B;  3DTU B;  3L71 H;  3APO A;  3PN1 A;  2R9A A;  3FKS G;  1DTO A;  1EFR G;  3B8N A;  4KXR A;  4JF3 A;  1Q86 W;  3BEH A;  4KP4 A;  3QO7 A;  1DF4 A;  4JYA O;  1I0H A;  1R73 A;  2P7T C;  3LSS A;  4AQY B;  1GN6 A;  4JYB A;  1SQP H;  1KYO F;  2P4K A;  4OPH A;  3BRC A;  1Y67 A;  1L8D A;  3ZJZ A;  1JFF A;  1GM8 A;  1L0L H;  4DV7 B;  3R66 A;  4O4J A;  1AR4 A;  1SQG A;  3DXR A;  1IBL B;  3E2E A;  2XAG A;  5J9P C;  2DOS A;  2UXC B;  3QF7 A;  3DSQ A;  1S5L Z;  4PA3 A;  4TUY A;  4JI0 B;  2A06 H;  2Q69 A;  3JD3 A;  1K73 W;  3IGA C;  3MHS C;  1WA8 A;  4WFF A;  3CP1 A;  3D3I A;  1OCO B;  1Q8I A;  1FS0 G;  1EM1 A;  4JTD B;  5C8Y A;  1QLE C;  1QQC A;  3OE7 G;  2ZE6 A;  1IZ3 A;  2JK5 C;  2V7Q G;  4LF9 B;  2OCH A;  1AI6 A;  4B7E A;  1NS1 A;  4KHP O;  4UVA A;  2QWQ B;  3UO2 A;  2LP7 A;  3P3P A;  3F5T A;  2IJI A;  4RQF A;  1CEZ A;  1K5S A;  4LF4 B;  5E79 Z;  4LF6 B;  3KZI Z;  3S3X A;  5CA1 B;  1L1F A;  1E79 G;  1V9P A;  2UXB O;  4FM1 A;  4LF5 O;  4G2K A;  5LMN O;  4NTX A;  4JAV A;  2EIJ C;  1GK9 A;  3H1H H;  2FB5 A;  4IIJ B;  3AG2 B;  4DR6 B;  1NH2 D;  2ODM A;  2WA3 A;  1KUQ A;  4NVP A;  4AI8 A;  5KMG B;  3SJB C;  4B3T B;  5CBF A;  2D3O W;  1WB8 A;  1K34 A;  1MMM A;  3T1Y B;  1E1Q G;  2Z3Y A;  1MOF A;  3H01 A;  3L70 H;  2UXN A;  3ZRV A;  4DR2 O;  2H8P C;  1B6Q A;  2JEX A;  4IYI A;  5CN0 A;  2LGQ A;  1MZF A;  3SPG A;  3STL C;  5IDJ A;  2QKS A;  1QLN A;  5B1B C;  5BMV B;  2IH1 C;  4ABM A;  2LFS A;  3SPJ A;  3JAW B;  4O4L B;  1XI1 A;  1IBK O;  5IJ9 B;  1ZLZ A;  1NJI W;  1XMO O;  3T1C A;  1Y76 A;  4BIU A;  1FAF A;  4J10 A;  1ZL8 A;  3CSX A;  4TOI A;  1SZX A;  4I4T B;  2W6I G;  3ETD A;  5B5E Z;  2DYR C;  2CH7 A;  3B8M A;  1I5X A;  1XNR O;  3AK1 A;  2RDC A;  1OCZ B;  3LDE A;  3O9O A;  4KUM A;  5LOV B;  5CA3 A;  1SQQ H;  1N0N A;  2KG7 B;  4G27 B;  2P5O A;  4PDL A;  1K5Q A;  3ZRX A;  3FB5 C;  5JVD A;  1M9N A;  5IYZ A;  4LNU A;  1OCR B;  3X2Q C;  2EIL C;  3HKD A;  3ZCC A;  2QWO B;  1G6U A;  1Q5O A;  3W7X A;  5IWA B;  4K0K B;  4ZBM A;  2P67 A;  3ZMT A;  5EK0 A;  4JI6 B;  2IM9 A;  2Y0I A;  3WG7 B;  4Q6G A;  4X62 O;  5KHI A;  4I0X B;  3O65 A;  1R3I C;  5KHK A;  2M7W A;  1MZE A;  1LNQ A;  3VBB A;  4TSF G;  3SYQ A;  2OCC C;  4LFC B;  3RYI A;  2WLH A;  2ZXW B;  5EZY A;  2Q9L A;  2DQ3 A;  2YIA A;  4GYC B;  1YIJ V;  2CTQ A;  1I94 B;  4X1I B;  2P90 A;  3BA9 A;  2ZCE A;  4ZHQ B;  5J2T B;  3M7M X;  2PTM A;  3OW2 U;  2UUB O;  4QPK A;  5LXT A;  1VQ8 V;  3K0D A;  5BR8 O;  4UV9 A;  2FYU H;  1PPJ H;  4I7Z B;  1AJN A;  1GH6 A;  4EKW A;  2GDS A;  2XOK G;  2G38 A;  2E76 B;  2Q67 A;  1QBZ A;  1IVS A;  3UM7 A;  2WLM A;  4DR7 O;  1HWY A;  3CEI A;  3CCR V;  4ZI7 B;  2WPD G;  4DV3 O;  1H2L A;  3HKC B;  1YTF D;  2A7W A;  5H5N A;  4BWA A;  1IUR A;  5K1X A;  4WBN A;  3RFR A;  4LWS B;  1W0J G;  3K9S A;  3ABL C;  4OX9 B;  3JAL B;  4B7K A;  4CC5 A;  3T2M A;  5KHJ A;  4D7S A;  4FVM A;  2DJV A;  3E22 A;  2GSM B;  4ZOL B;  2ETN A;  1SQB H;  3UT5 A;  4JI8 O;  4JV5 O;  5CA0 A;  3LUT B;  2Q4P A;  4F6R A;  2V1D A;  3MD0 A;  1H8H G;  3F7V C;  3F5W C;  4X65 O;  2LO1 A;  3HKE B;  4DUY B;  4MVM A;  4TV8 A;  1AR5 A;  5FL7 G;  5EBM C;  4Z2W A;  1YVW A;  5JJJ B;  3PJS K;  4O2A B;  3ZHR A;  1VF7 A;  1OCO C;  5JQG A;  4PI2 A;  4C7U A;  2WLI B;  4UCT A;  4YIP A;  3K5M A;  4JYY A;  1FD9 A;  2JEU A;  4IHJ B;  4DR1 O;  2CGN A;  2XAF A;  3AK2 A;  4LF5 B;  1XHX A;  3K06 A;  1Q3E A;  1BS3 A;  1F7Y A;  1U96 A;  4J7J A;  5KHH A;  2P06 A;  3D3Q A;  3UQ8 A;  3H1K H;  3OGI B;  4HZ3 A;  3BCC H;  1GMG A;  2Q7H A;  3DC5 A;  3KG2 A;  2QTS A;  4DR2 B;  2E3C A;  1HNW B;  1K33 A;  4I55 A;  1P49 A;  1ZX3 A;  2ZE7 A;  3IC9 A;  3OTF A;  2HJD A;  3CXC U;  2W0X A;  1XMO B;  1BQZ A;  5HFL A;  4U7N A;  3N2G B;  1WPX A;  2Q6A A;  2ADP A;  3ZMS A;  4EB6 B;  4AQY O;  4UCS A;  4GX2 A;  1EN6 A;  2KQX A;  1PD3 A;  4P9O A;  5LHG A;  1P7G A;  1GN3 A;  2UXX A;  1WN7 A;  2QM7 A;  2HFE C;  4BAY A;  4H37 A;  1KU9 A;  2R72 A;  3FAV B;  3CRQ A;  4MS2 A;  3ASN B;  2GUZ A;  1OCZ C;  2HJF C;  2UXC O;  2YSU B;  1WLE A;  1N32 O;  2BCC H;  2N05 A;  4JI0 O;  5LGT A;  2WLL A;  2QWN B;  2JS3 A;  3K04 A;  2ZE5 A;  2XAJ A;  3WB1 A;  4X20 A;  1YF2 A;  2QM4 A;  4K8X A;  5LL6 Y;  2ITC C;  3KCY A;  5B1N A;  3ZED A;  1XMQ B;  3BY6 A;  1BMF G;  3JCZ A;  4JZ2 A;  1JPX A;  2ZXW C;  3JAK B;  3ZX6 A;  4LH6 A;  4X9Q A;  2VQF O;  1N0J A;  4PD4 F;  2BTQ B;  2UU9 O;  2UUB B;  2YXL A;  3FYE B;  2QGN A;  4DW1 A;  3BA8 A;  3SGI A;  2WSS G;  1BHB A;  5KLV H;  2JS5 A;  4RQE A;  3ZBH A;  5IYD O;  1IBM O;  4DR6 O;  3E35 A;  4CH5 A;  1UJW B;  4PHZ A;  2B1I A;  3ZMU A;  1RM1 B;  1PP9 H;  2EBO A;  2XHB A;  1MNG A;  4DV3 B;  1K92 A;  5KX5 B;  3E8B A;  1WNS A;  3OTO O;  1W0K G;  1F4M A;  5TIS Z;  4J42 A;  2QR4 A;  1FXK B;  1M1K W;  1PL0 A;  3JAT B;  5E1A C;  4KFM A;  5L3F A;  4IIJ A;  4CH6 A;  1XOU A;  1F23 A;  1NZ6 A;  1SQV H;  2NN4 A;  3K57 A;  1NTZ H;  1SA0 A;  1KC8 W;  4HNA A;  5KMG A;  4NYK A;  4X65 B;  4O4I A;  4B3M O;  3E83 A;  2EX3 A;  4JGS A;  4RUE A;  3CMA V;  1NR7 A;  2LJ2 A;  4FLT A;  4TV9 B;  2BOC C;  2R9I A;  3JD2 A;  2PY5 A;  2NR5 A;  2QWP B;  3D36 C;  5BMV A;  1YCI A;  1F4N A;  2YDE A;  3HR0 A;  5IWA O;  1EN4 A;  4O4L A;  3LNM B;  5IJ9 A;  3SJA C;  4FZ0 A;  3CX5 F;  3FB8 C;  2Y69 B;  4DR1 B;  3Q4H B;  3BFR A;  1Y74 A;  1AP6 A;  4I4T A;  3CC7 V;  5GTI Z;  3ABM B;  5H2F Z;  1VQN V;  4JPR A;  4H33 A;  4MVQ A;  1RPR A;  1V54 B;  4BW5 A;  1I7F A;  3FX7 A;  4LFC O;  4FK5 C;  4DV5 O;  5B1O A;  3CD6 V;  1KP3 A;  5LOV A;  1SZT A;  2KG7 A;  2M6Y A;  5BZB A;  2P22 C;  4J7Z A;  3H1I H;  1RPO A;  1I94 O;  5JJN B;  3OEH G;  3ASO C;  5KUK A;  2WA4 A;  5LYJ B;  2P6J A;  1YJN V;  4X1Y B;  5B66 Z;  1VIB A;  2X0L A;  3H1J H;  4I0X A;  2LQT A;  1GRJ A;  2CUG A;  1S5H C;  2PUS A;  2B5U A;  2RCV A;  2RQ6 A;  3ZHV A;  5DM6 V;  3M8A A;  2EZP A;  3B77 A;  1VEW A;  3RWR D;  3NR7 A;  1YSC A;  2OTL V;  4TT3 G;  1VQK V;  1S77 D;  3VQV A;  3K08 A;  4X1I A;  1Q6I A;  3AG1 B;  1Q6U A;  5KUM A;  3IAY A;  3E8G A;  3U0Z A;  1ZUQ A;  2YEV B;  3WB0 A;  4ZHQ A;  4FLX A;  4JAS A;  3CJH A;  2XTA A;  4OX9 O;  3CS5 A;  4MVZ A;  2OIE A;  5FNV B;  4UV8 A;  4BIO A;  2YXH A;  3DGE A;  1N32 B;  1R6T A;  4FLZ A;  2GTA A;  1AJP A;  1JVM A;  3CCM V;  3OMN B;  2Q5Z A;  2UUC O;  3T4D A;  4DW0 A;  4J7K A;  3CME V;  3QTC A;  3ASN C;  3J80 N;  4JI5 O;  3J7A U;  4DUY O;  1YHQ V;  4FFB B;  3D8C A;  4ZI7 A;  4DK1 A;  2VWJ A;  3P3N A;  3HKC A;  1Q43 A;  4MVR A;  3SYP A;  5GW7 A;  3FFQ A;  4LWS A;  3JD0 A;  4RO2 A;  3NXS A;  2CTP A;  3VOU A;  1BCC H;  1Y66 A;  1G1X B;  1BHA A;  3JAR B;  1GM9 A;  1QCE A;  1Z5V A;  2ZNI A;  2VQF B;  2RJZ A;  2AHY A;  2UU9 B;  3RBZ A;  3L75 H;  4ZOL A;  2QKA A;  1CP9 A;  1N8R W;  3G4S V;  2CTW A;  1KKD A;  1AI7 A;  3ZHU A;  4HAM A;  3HKE A;  5FPR A;  3D36 A;  4FJC C;  1IBM B;  2E5L O;  2Q7E A;  1AR1 B;  4O2A A;  1M57 B;  4MSW C;  4GLX A;  4JAA A;  1FFX A;  2GV9 A;  1HNW O;  4JI7 O;  1RSO A;  2QSA A;  2ZDI A;  4W4K A;  3OTO B;  4I9Q A;  2WLN A;  2E74 B;  1KP2 A;  4MTF A;  1IXM A;  3H1L H;  1YJ9 V;  4GKK B;  4F6E A;  4X88 A;  3LNN A;  1QR8 A;  2Y0P A;  4EFB A;  1YEW A;  1AIL A;  2ZKO A;  2UUA B;  5ITZ A;  3A0R A;  4B3M B;  2XT9 A;  5IE9 A;  1N34 B;  4GT1 A;  2FKX A;  3BHP A;  4JI4 B;  2DWD C;  2EIK C;  3A0B Z;  1HDJ A;  1PKX A;  3ZS8 C;  4WFB V;  1M90 W;  1NQT A;  4HBN A;  4WFE A;  3OR7 C;  2YI8 A;  3K5N A;  4H44 B;  1OV9 A;  4R50 A;  5B1A B;  1KMI Z;  1FXV A;  3N2G A;  4J11 A;  2CK3 G;  2EIM B;  4D6T H;  3S3W A;  2ZQM A;  2FTK A;  1XEQ A;  4B3S B;  1VQ9 V;  5J2U B;  1VQ5 V;  2Y69 C;  2IBZ H;  1HR0 O;  4DV5 B;  2AZ2 A;  1XL4 A;  2X6C A;  3G6E V;  3N27 A;  4UFZ A;  4LF7 O;  1N36 B;  1CPY A;  3E8F A;  4FIP C;  1XMQ O;  1V54 C;  3FAV A;  4E4E A;  2F1M A;  4U3J B;  1W59 A;  3WU2 Z;  2OYQ A;  1F51 A;  3AG4 B;  3SDL A;  2ARH A;  4FM2 A;  3MDS A;  2LW7 A;  3A0H Z;  3OT7 A;  1PNK A;  5CBG A;  1D5A A;  2PF4 E;  1VQM V;  2CAZ C;  1HP8 A;  4O4J B;  2A0L A;  4DR5 O;  5JWP A;  4NB5 A;  1XNQ O;  3CCU V;  3DXR B;  2NLJ C;  2QDO A;  4R7C A;  1EBO A;  4PI0 A;  1TUB A;  3U11 A;  4OXS A;  4O4H A;  1UFI A;  2QEX V;  4WF9 V;  1M4U A;  4PDR A;  3JAK A;  1XL6 A;  1YI2 V;  1BT8 A;  1NTM H;  3AG3 B;  2IJK A;  1WA8 B;  2BTQ A;  3ZHT A;  5LP6 B;  1VQO V;  4QE9 A;  4UB6 Z;  3B2E E;  3N2K A;  5EYP A;  3AG1 C;  2B9Z A;  3OMA B;  1W2B U;  1YJW V;  3AG7 A;  4Z1M G;  3ABT A;  2B1G A;  2UUC B;  3ZN1 A;  4PEL A;  2Q0O C;  3SPI A;  3CCS V;  4GX0 A;  4LH7 A;  4JI5 B;  3SPC A;  4X1K B;  1FJG B;  2ILM A;  4LFB B;  1JA8 A;  1YXB A;  4J9Z B;  4MVS A;  1S5J A;  4LC1 A;  2YIB D;  5KX5 A;  3SYO A;  3LSU A;  3ZMV A;  3FB6 C;  2HG5 C;  2ZD9 A;  5EC2 C;  3CPW U;  5CB4 B;  1VQ7 V;  1Q82 W;  3SYC A;  1A32 A;  1ZTE A;  2PYL A;  3C3S A;  3HKB B;  1ENV A;  1KD1 W;  2OWO A;  4NTY A;  3ZMZ A;  1B3Q A;  5JCO C;  4O2B B;  4UVB A;  2E5L B;  3JCU Z;  4ICG A;  1FYJ A;  2IH3 C;  1WB7 A;  2DMX A;  4WFH A;  4DV4 B;  4IT5 A;  2EJ7 A;  3AG2 C;  4QNH B;  1QR9 A;  2KKW A;  4JI7 B;  4IL6 Z;  4YJ3 A;  3RT3 C;  1AI5 A;  1T5E A;  2L6L A;  2LGW A;  1R6K A;  2JGD A;  1FPO A;  1IXB A;  1NI8 A;  1M57 C;  3QNE A;  2CH7 B;  3CC2 V;  1K4D C;  1H2M A;  3W7W A;  1XHZ A;  4OGQ B;  1JQ0 A;  1YIT V;  5EBW C;  4JTA B;  5JVD B;  4UB8 Z;  4LNU B;  4JZG A;  3CB2 A;  5DED A;  2ZT9 B;  2Y4U A;  1K97 A;  2PI4 A;  5KAI Z;  4P30 A;  1SQX H;  2EIN B;  4L8J A;  2DW4 A;  3G67 A;  2PYJ A;  5BY1 A;  3WB2 A;  1PL4 A;  3LSQ A;  2Q7G A;  4BIZ A;  5LYJ A;  2LFR A;  4X1Y A;  4DRX B;  4A5U B;  3CHX A;  3K5O A;  3RYI B;  3TGU H;  4FPP A;  1OCR C;  2QA4 V;  4F4L A;  2CTR A;  4DK0 A;  2QTO A;  1N33 O;  4DO2 A;  2W6J G;  3MAQ A;  2EJR A;  1N4C A;  4JAU A;  1HR0 B;  3C90 A;  2QWR B;  2Z0A A;  3WG7 C;  3UO3 A;  5IY5 B;  4LF7 B;  1FXH A;  2FML A;  1SQF A;  4I5S A;  4MVU A;  5LXT B;  3T1H B;  1S76 D;  2ZR3 A;  3CCJ V;  3VQY A;  1KBH A;  5FNV A;  1THZ A;  1GN4 A;  1WP7 A;  4I9W A;  2F95 B;  1Q90 D;  2JRI A;  3OFN G;  4MTO A;  3OD4 A;  1DK1 A;  1OZ0 A;  3AG4 C;  1QVF U;  4U7O A;  4DV2 O;  4FFB A;  1DGS A;  2HEP A;  4LBE C;  4WBN B;  4DR5 B;  1XIL A;  5KA6 A;  4MW3 A;  1VQL V;  1G4Y B;  1J95 A;  5GTH Z;  2JDI G;  4CBC A;  1XNQ B;  2BE3 A;  3RN4 A;  5LBQ A;  1V55 B;  3I56 V;  1US6 A;  2ZNJ A;  2BOB C;  3E22 B;  1H2S B;  5H6Q A;  3UT5 B;  3W7T A;  5CA0 B;  2Q8V A;  2ITD C;  2F4V O;  3MHH C;  2JGU A;  2OTJ V;  2ZE8 A;  5CA1 A;  3ETQ A;  3G80 A;  4DV1 O;  2HR3 A;  5JH7 B;  4QGP A;  1MG1 A;  5FPO A;  5BXZ A;  4TV8 B;  4GKK O;  1M93 A;  1D5N A;  4CS2 A;  3AG3 C;  1H38 A;  3ETG A;  5HFM A;  3FD9 A;  5LP6 C;  5JQG B;  1AB3 A;  2UUA O;  1OCC B;  3CXH F;  1SER A;  1N34 O;  4K35 A;  2DQ0 A;  4JI4 O;  4B3R O;  3SJC C;  4YIO A;  3OMI B;  1QVG U;  3A8T A;  3UKM A;  1KKC A;  2ZIN A;  1S72 V;  2BSK B;  3IFX A;  2GHY A;  4DR4 O;  1S3J A;  2DWE C;  1I08 A;  3TCU A;  2QJ1 A;  1QNM A;  1SRY A;  3JAW A;  3X2Q B;  4NR1 A;  4ZKI A;  2L35 A;  5JJE B;  4I50 B;  1K4C C;  4X8A A;  1MSW D;  3RYC B;  3R65 A;  1JMK C;  3CWB H;  1VAR A;  2X6A A;  2AHZ A;  1PV0 A;  4B3S O;  1MAB G;  3J81 N;  2YUA A;  1DLB A;  3ZRW B;  3RVY A;  2YC0 A;  3OAA G;  4X89 A;  2OCC B;  3TXS A;  1KQS U;  1EN5 A;  1K3E A;  3ZHQ A;  1N36 O;  1J5E O;  3W7U A;  4JYC A;  5A2Q N;  1QHT A;  4IGG A;  3E89 A;  3STZ C;  1JCH A;  1LUV A;  2XUM A;  1KEC A;  1BSM A;  4UVC A;  5L3D A;  1NU1 H;  2YS8 A;  2IU0 A;  3GWO A;  4FLV A;  3QVN A;  5L3C A;  3A2F A;  1GO3 F;  1X4T A;  4MVO A;  1Z5W A;  4N21 A;  2ZM6 O;  4LFA O;  3HB3 B;  1ORQ C;  3CCL V;  3T4Z A;  1H8E G;  1GAX A;  4RWU A;  3ZRS A;  2UXD O;  1H2N A;  4HYO A;  1TGO A;  4R8C A;  5D5Q A;  2LW1 A;  3RGB A;  4FMT A;  2GUZ B;  2H94 A;  2YXY A;  5B3S B;  1GM7 A;  4U3J A;  4AIL C;  1SC5 B;  2JVD A;  2WLL B;  3JD4 A;  4RUF A;  4QIW F;  1XRE A;  5IJ0 B;  5J2T A;  3JAM N;  1I5Y A;  4X66 O;  4PA6 A;  3CC4 V;  4FLU A;  1AJQ A;  2OT5 A;  4X20 B;  3ABL B;  5K1P A;  2EIN C;  1QU7 A;  2BTO A;  3TK1 A;  4P2Z A;  4CS4 A;  3RW0 A;  3LDC A;  4FLW A;  1N33 B;  2ATK C;  2E75 B;  3OUF A;  1AP5 A;  2RN9 A;  3ZIA G;  4YHH O;  1FJG O;  4DR3 O;  4LFB O;  3OR6 C;  1NTK H;  2AXT Z;  4K8Z A;  3RYH B;  5LA6 B;  3JAS B;  4IYH A;  5DN6 G;  1ZAU A;  2CGO A;  1SF9 A;  4LF8 O;  3I55 V;  4DV6 O;  3JAL A;  5LP6 A;  4JTC B;  1ZWI C;  5IY5 C;  3F7Y C;  2F43 G;  2K1E A;  4YJ2 B;  1K9M W;  1H2G A;  2C2A A;  3ETE A;  2VS0 A;  4PA4 A;  3ZN0 A;  3CCV V;  4CC6 A;  1TVK B;  3RVZ A;  3WFV A;  4X1K A;  4TQF A;  4PA9 A;  3H9V A;  1HW7 A;  4DV2 B;  5LMU O;  1HNX O;  2R70 A;  3QG5 A;  4NTW A;  4DV4 O;  3U10 A;  2Q68 A;  2WLI A;  4QE7 A;  4XBF A;  5LHH A;  5GON B;  2F93 B;  4PV1 B;  5CB4 A;  2WAM A;  2PGG A;  2F4V B;  4IHJ A;  4DV1 B;  1RM1 C;  1SA0 B;  3HKB A;  1V55 C;  4CH3 A;  4HNA B;  1ROP A;  3K03 A;  4O4I B;  4CZZ A;  1XBL A;  5EBL C;  3B4S A;  1VQ4 V;  4PDV A;  5KA5 A;  1TA8 A;  3DC6 A;  1M5I A;  3KCX A;  4E2L A;  2AGA A;  4O2B A;  2QE7 G;  3JYC A;  3HPL C;  2HVK C;  4JI1 O;  1FXK C;  2YID A;  1X59 A;  2JIZ G;  4MW8 A;  5FLX N;  4XDK A;  4B3R B;  3RYF B;  3VQX A;  4WCE V;  4RAI A;  1YDX A;  3OGC C;  1R1B A;  1Y74 B;  3CE2 A;  1OCC C;  4DR4 B;  2F66 C;  1LR1 A;  4P9P A;  1VMG A;  1NBM G;  3IC7 A;  4D7T A;  1DF5 A;  4DUZ O;  3TJT A;  2DYS B;  2V4D A;  2VWK A;  1BE3 H;  3CCE V;  2Y4T A;  4GKJ O;  2ZR2 A;  5EIB C;  4Z1V A;  5L3B A;  2EZO A;  5KAF Z;  2HP8 A;  1OHH G;  1JJO A;  1VF6 C;  1XUQ A;  4EB6 A;  2Y48 A;  2MW2 B;  4U3F H;  1M56 B;  1PM9 A;  3K58 A;  2Z5U A;  4YY3 B;  3TET A;  5D5P A;  3C3T A;  3K5L A;  2OIG A;  1JR9 A;  3ABM C;  4W4L A;  4H0L B;  5EIB D;  2XND G;  1J5E B;  4UXN A;  3T1H O;  1WAZ A;  1BGY H;  4OPA A;  2ADQ B;  4WFG A;  3K3W A;  4DRX A;  3SJQ C;  4UCR A;  4X64 O;  1UPG A;  4FZ1 A;  1CXZ B;  4BR6 A;  2ZM6 B;  4J41 A;  2XAS A;  4LFA B;  4FLY A;  1AVM A;  1JFF B;  2QKC A;  4Q20 A;  1B06 A;  2HHH O;  4ZIB A;  2UXD B;  2XAH A;  3JD1 A;  1K8A W;  4PJ0 Z; 
#chains in the Genus database with same CATH homology
 4GKK O;  4LF6 O;  4LF4 O;  3F5T A;  2UUC O;  4JI2 O;  3J80 N;  5IWA O;  4JI5 O;  5BY1 A;  3J7A U;  2AGA A;  2UXB O;  4DUY O;  4LF5 O;  1AB3 A;  5LMN O;  4DR1 O;  2UUA O;  3JAM N;  4JI1 O;  4A5U B;  1X59 A;  4X66 O;  1F7Y A;  5LL6 Y;  1N34 O;  1HNZ O;  5FLX N;  4JI4 O;  4B3R O;  1KUQ A;  4B3T O;  1G1X B;  1N33 O;  4DV0 O;  2VQF O;  3T1Y O;  1D2D A;  4DR4 O;  1XEQ A;  4LFC O;  4DV5 O;  2UUB O;  1R1B A;  2UU9 O;  1HR0 O;  5BR8 O;  4YHH O;  1A32 A;  1FJG O;  2Z0A A;  4DR3 O;  4DR2 O;  4LFB O;  4LF7 O;  4DUZ O;  4JYA O;  1I94 O;  2N74 A;  1XMQ O;  1IBM O;  4DR6 O;  4GKJ O;  4DR7 O;  1IBK O;  2E5L O;  5IT9 N;  4JI3 O;  4OPH A;  4LF8 O;  3SDL A;  4NXN O;  1XMO O;  4DV6 O;  4B3S O;  4DV7 O;  1FYJ A;  2LW7 A;  4DV3 O;  3J81 N;  5H5N A;  3R66 A;  1IBL O;  2JRI A;  1N36 O;  1HNW O;  3M8A A;  1J5E O;  4JI7 O;  3OTO O;  1DK1 A;  2DOS A;  5A2Q N;  4NXM O;  4AQY O;  3T1H O;  2VQE O;  1XNR O;  4DV2 O;  3RT3 C;  4OPA A;  4DR5 O;  2DJV A;  1XNQ O;  4JI8 O;  4JV5 O;  5LMU O;  1HNX O;  4K0K O;  4X64 O;  4DV4 O;  4YY3 O;  4JI6 O;  4X65 O;  1AIL A;  4LF9 O;  2ZKO A;  1YZB A;  2ZM6 O;  4B3M O;  4OX9 O;  4LFA O;  2UXC O;  4X62 O;  2F4V O;  1FKA O;  2FKX A;  4DV1 O;  1NS1 A;  4KHP O;  1N32 O;  2UXD O;  4JI0 O;  3O65 A;  1R6T A;  2HHH O;  5BXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...