5BR8O

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5br8O00
1FYJA 1R1BA 1N36O 4B3RO 1IBLO 4JI5O 5A2QN 2LW7A 2UU9O 3M8AA 5FLXN 2UXCO 1HNXO 4JV5O 1HNWO 1DK1A 3F5TA 1I94O 1A32A 4JI7O 5LMNO 1XNQO 2FKXA 4JI4O 3T1YO 3J80N 4OPHA 2VQEO 1KUQA 2DOSA 1XMQO 2F4VO 4DR3O 4JYAO 4DR1O 4LF6O 1X59A 1XMOO 1IBKO 2ZKOA 4DV0O 1G1XB 4AQYO 4JI2O 4X64O 4LF5O 4OX9O 2ZM6O 3O65A 4B3SO 4NXMO 4DR7O 4DV7O 5BXZA 4GKKO 1F7YA 3OTOO 2UUAO 2UXBO 2VQFO 1J5EO 5LMUO 5BR8O 2AGAA 1AILA 3J7AU 4DV3O 4DR2O 4X65O 2HHHO 4DV1O 5H5NA 4X62O 1YZBA 4DV4O 4LF7O 1HNZO 4DUYO 4JI1O 1AB3A 4YY3O 4LF9O 4OPAA 5IWAO 4NXNO 3R66A 1IBMO 5IT9N 1NS1A 4DV6O 3T1HO 3SDLA 1FKAO 2UXDO 4LF8O 4YHHO 4DV5O 1HR0O 4JI8O 1N33O 1N34O 4DR4O 4K0KO 4DR5O 3JAMN 1XEQA 5BY1A 2UUBO 2E5LO 4LFCO 4DR6O 4LFBO 4B3MO 4KHPO 2N74A 4LF4O 4B3TO 2JRIA 3J81N 2DJVA 4JI0O 4JI3O 4JI6O 1N32O 4LFAO 1FJGO 1XNRO 4A5UB 1D2DA 3RT3C 4GKJO 4X66O 5LL6Y 2UUCO 4DUZO 2Z0AA 4DV2O 1R6TA
chains in the Genus database with same CATH superfamily
2OWOA 3D36A 3SPHA 1LNQA 1Q81W 1OCRC 5IE9A 3JAKB 1I94O 2EIKB 4AI8A 2FKXA 4K8XA 2XTAA 3AG3C 1NTZH 2XOKG 4LF6O 1VARA 2YICA 4DV0O 1SQBH 3QNEA 1WPBA 4GLXA 1V9PA 2AHZA 1Q43A 3CEIA 1XHXA 2LW1A 4OX9O 4B3SO 3ETGA 2LQTA 4UV8A 2X7RB 4FZ1A 4O4HA 1SZTA 2Q7HA 3MHSC 4UCVA 3BAAA 2JEUA 1J5EO 2UXBO 1ZUQA 5IJ0A 5HFMA 4UVCA 1NI8A 4ZOLB 1XBLA 2ITDC 5B1OA 4J41A 4EKWA 4Z2WA 1Y66A 1RSOA 4FLVA 4DYLA 2VWJA 3B4SA 1NS1A 4R8CA 3ZRVA 4LR3A 2DYSB 3T1HO 3ABTA 3OGCC 2PI5A 3SJCC 2P06A 1AJQA 1HR0B 1XUQA 3G6BA 1N33B 5GONA 1F4NA 3D36C 1S5JA 4OXSA 3ZN1A 3W7UA 4LFCB 1XQ8A 4LH7A 4LF4B 1M93A 2RNBA 1N32B 1Q6UA 2WLIB 5EBWC 3CXCU 1M57C 4GUNA 4GKJB 4X66B 1T5EA 5FNVA 3A8TA 1ZX3A 1NBMG 5FPRA 3WB0A 1CP9A 2QWNB 1FD9A 1WLEA 2ZE7A 3VBBA 4IT5A 2KB1A 5LHIA 3ZRXA 4FK5C 2EIMB 4FM0A 2AXTZ 1KBHA 1TVKB 4O4IA 4LCUC 2IJHA 3JAWA 3I55V 4G2KA 3AG2C 5KAIZ 3K5LA 1HNWO 5GTHZ 2BE3A 3RYIA 1I94B 2BOBC 1ORQC 3RFRA 2C2AA 2M7WA 4CZZA 4FVMA 2DN9A 1X59A 4NTXA 4P9PA 2FB5A 4LF6B 1SERA 4UCTA 3CRMA 3SR2C 1V55C 4DV0B 1GN2A 3UO2A 2GHYA 2ZM6O 5J2TB 4DR7O 4OX9B 4B3SB 5CN0A 3T4ZA 5EIBC 1B3QA 3HKDA 1J5EB 2UXBB 3QO7A 4LNUB 2RDCA 2ILMA 3OD4A 1WP7A 1VMGA 2IJJA 1FXKB 1NR7A 3OFNG 3SPJA 1G6UA 3JARB 1CPYA 4IYIA 4R6ZA 5LA6B 1SETA 4YY3O 2FTKA 2CGOA 1OCCC 3HR0A 5IWAO 2A7WA 1RP3B 5J9PC 1I7FA 1DF5A 2E74B 4FM2A 1FKAO 3T1HB 2EILC 3AG4B 4UB8Z 2XAGA 4MVMA 1S76D 4DR5O 3JAMN 4W4KA 2WLLA 2OCHA 3SYQA 3SPIA 2UUBO 1ZL8A 5H6QA 4KHPO 2Y4UA 3L72H 1KD1W 5CB4B 3CCJV 4QPKA 2XAHA 1B6QA 1R6TA 2EJRA 4FLZA 3MAQA 1FYJA 2HJDA 1BS3A 2XAQA 3SYOA 1I5YA 4O2BB 4HNAB 1PL4A 1TUEB 4JV5O 1K97A 2EULA 4NTWA 5DN6G 1HNWB 4MVOA 4X20B 2P5OA 1H2MA 5LMNO 4B7KA 2M6YA 3JALA 2VQEO 4X1KA 2ZNJA 2Z3YA 1IBKO 3BPZA 2LGQA 4CS4A 1N8RW 4LWSB 2L35A 3KCXA 3B8NA 1NKDA 2ZM6B 4DR7B 4J7KA 3K03A 2FYUH 2Q68A 2Q4PA 4NYKA 4DK0A 2K9PA 4RQEA 1R6KA 3RYFA 3CP1A 2HHHO 4D6TH 5IYBO 2K1EA 2VRZA 3R65A 3JCUZ 3K57A 3CCVV 2XAFA 2V4DA 4X1IA 3AG1B 4YY3B 2WLNA 5IWAB 4WBNA 1BHAA 2Q9LA 2P90A 4J10A 1WJZA 3VQXA 1UJWB 1N0NA 1QLNA 3JD2A 1BL8A 4I0XA 4CH4A 4LH6A 3A0RA 3GWOA 4UVBA 4PDLA 4DR5B 5KAFZ 1M57B 2UUBB 4PA4A 1F23A 3JAKA 2X6CA 2A0LA 4ZIBA 4KHPB 4UV9A 4PELA 5KA5A 3CJHB 3DTUB 1GN4A 3AK1A 1GMGA 1E1QG 2YIBA 4O4HB 3ZS8C 3AG2B 1N0JA 2ADPA 3WG7B 5BZBA 1M4UA 4JAUA 4J11A 1H8HG 2UU9O 4CH3A 1FAFA 4I7ZB 1GM9A 2R72A 4JV5B 3E22B 1Q3EA 1V55B 3HKEB 3ZEDA 3SJQC 2ZQMA 5LMNB 4ZOLA 4WFBV 1OCOC 4ASUG 3ZRSA 1KKDA 2VQEB 5CA3A 2Q7EA 1BE3H 1YF2A 1IBKB 1D5NA 2QM8A 2YI8A 2WA3A 2ZCEA 2Q0AA 3MD0A 2DQ3A 4LF5O 4CS2A 4JTCB 3ZHQA 3OR7C 1L0NH 3OTOO 3C3SA 3H01A 3CXHF 5LGTA 5JCOA 1OCCB 1PL0A 3AK3A 3FB5C 3FB7C 5KHJA 3DXRB 2HHHB 2EIKC 1HNZO 2IU3A 2WA4A 3CCLV 2WLIA 2EILB 3ASNC 4JGSA 3NR7A 1SESA 1VQ4V 3WB2A 1YJNV 2BSKB 5IDJA 1JA8A 3RYCB 3E83A 4O4IB 4IHJB 1EFRG 3JAWB 4IGGA 2QSAA 4I9WA 4JI8O 3OEEG 5CBFA 1TVKA 3QO5A 5B3SC 5KUKA 4PA3A 4JAVA 4TOIA 3ZX6A 3GVMA 5HFLA 4H13B 3EXAA 4JZGA 3L74H 4BIOA 2MK3A 2YEVB 3DSQA 1B04A 4DUZO 4TSFG 2ARHA 4DV2O 1S3JA 1Q5OA 3K0GA 3EVKA 3EFFK 2YXLA 5CBGA 4JI5O 3RVZA 4PA9A 2DYSC 2UU9B 4WFEA 1ZAUA 1K3EA 4LNUA 1K4CC 2QR4A 2IU0A 1A32A 2YXHA 1G4YB 2NR5A 1L8DA 1Q82W 1JPXA 1FXKA 5JCOC 1Q7YW 1BQZA 3IGAC 1BSMA 3BA9A 5LA6A 2ZKOA 1KC8W 3W7SA 4FLTA 4MVSA 1SC5B 4FFBB 1S77D 4AQYO 2FL4A 4F6EA 4TV9B 4LF5B 4DV7O 4BWAA 2YIDA 4RAIA 3TK1A 1OCZB 3CD6V 3P3NA 5KHGA 3OTOB 2KG7A 2QM7A 2A06H 3JCZA 4JYCA 1WN7A 4MVRA 1HW7A 2JGUA 1W0KG 1US6A 5A9GA 5CB4A 2AZ2A 1HNZB 4JI1O 4JTAB 1K92A 4NB5A 1O9HA 1Z5WA 3R66A 2BTOA 4BW9A 4MTGA 1AR4A 5EBMC 2JS3A 3SDLA 5L3GA 1GN6A 3B40A 2Y48A 5FL7G 4JI8B 1XEQA 4GCZA 5L3BA 3JATA 4FJCC 3ASOC 1N4CA 4X20A 5KHKA 1WB8A 2JRIA 4JI0O 1EN6A 2DWEC 4J7ZA 2ZD9A 1KP3A 5H6RA 1FXKC 5J2UA 4TQFA 5CMUA 3N2KB 3RYHA 2CTQA 2IJIA 2N05A 4DUZB 3LNMB 2Q7GA 4LWSA 4DV2B 4NKGB 1GTOA 1N36O 2HR3A 1OCOB 4JI5B 4RQFA 3UQ8A 1QNMA 3CSXA 2E76B 2YIAA 2WLMA 2OTJV 4JYYA 1DK1A 1JOYA 4XBFA 1SS3A 1V54C 2QWOB 2YSUB 5EIBD 1ZLZA 4CH6A 4JYAO 3UKMA 3K79A 4WBNB 1LR1A 4DW0A 3P32A 1BT8A 4UCRA 3QTCA 3P3PA 2WSSG 4I0XB 1VQMV 4AQYB 2HJFC 1OJHA 5L3CA 1GAXA 3CWBH 4DV7B 3ZHSA 4GKKO 1TA8A 2VQFO 1W0JG 3ASNB 5BR8O 1KMIZ 3W7XA 4DV3O 3OMIB 1GM7A 4X65O 1MZEA 2DYRB 4H33A 2Q67A 3DGEA 4DXWA 4QJFB 4MT8A 1BZKA 1I0HA 3CJHA 3BHPA 2P22C 4JI1B 5B3SB 5LP6B 4OPAA 3B2EE 3ZN0A 1J95A 5LHGA 1AI4A 3ZBHA 3CE2A 3OR6C 3CYOA 3CCQV 4TWKA 5TISZ 1M1KW 3VQVA 3E22A 3HKEA 1R3JC 2Z5UA 4JI0B 5KHHA 3BABA 2Q69A 1Q86W 3RT3C 1KP2A 1NJIW 1VQ9V 1QVFU 2R9IA 3B77A 4JTDB 4L8JA 3G71V 3AG1C 4BAYA 5IYZB 1N36B 1WB7A 1M5IA 4CS3A 1K8AW 1BMFG 3ETDA 1DGSA 3K5MA 3DXRA 1MOFA 3KG2A 4OGQB 1EZVH 2MW2B 4ICGA 4JYAB 2BCCH 3SJBC 3FX7A 5KMGB 2RJZA 2BSKA 3RYCA 3HB3B 4IHJA 3OUFA 1SKVA 2IJKA 4GKKB 1IZ3A 2EINC 1WNSA 2VQFB 5C8YA 5BR8B 3TCUA 4DV3B 4I55B 3VQWA 4X65B 4B7EA 2F95B 5KHIA 2HEPA 3VQYA 4X62O 5IYCO 2RCVA 4HAMA 4Z1VA 5B1BC 2QWPB 5EYPB 3K59A 1NU1H 2ZIOA 4WCEV 1VQLV 2QTOA 1SQXH 4AHCA 3CC4V 2YEVA 2OIGA 1NT2B 3C3TA 1HP8A 4J7JA 2F43G 3ASOB 3STZC 4J42A 4DV5O 3U0ZA 1QU7A 2WLKA 4NVPA 5JJNB 3QG5A 1K73W 4DR6O 2DW4A 1SQPH 2O57A 3E8GA 3LSSA 3J81N 4JI6O 1PV0A 4UFZA 2QTSA 2ZE5A 4YJ3B 4FFBA 2DE0X 1VF7A 1PKXA 3CRCA 1V54B 1GN3A 2KG7B 3JSLA 4TV9A 5CA0B 4BIZA 3ABUA 3AEIA 2Y0PA 5JH7A 3ZRWB 2Y69C 1VP7A 5K1XA 1JCHA 1SRYA 2ZDIA 3SPGA 3LNNA 2VS0A 1DLBA 2P4KA 4DW1A 1PNKA 3BFRA 2WLJA 2F66C 2QWRB 4BR6A 4FLWA 1VQKV 3ZMSA 3JATB 1RM1B 1F7YA 2RMKB 3FAVB 2JK5C 3ZMVA 2IH3C 4KFMA 4FLUA 2YIBD 3K0DA 1S72V 5J2UB 5DM6V 3JD0A 3PJSK 3RYHB 2Q8VA 3HKCB 4X62B 1TAEA 1R3IC 2RN9A 3AG7A 5IJ9A 4K3AA 2B5UA 4YIOA 1Z5VA 3N2KA 4LF9O 4N23A 2HKOA 4QE7A 4DV5B 3FD9A 4KL1A 4PJ0Z 4P9OA 1FFTB 4QE9A 5L3DA 4F4LA 1OCZC 1P84F 2N04A 3ABMC 3FYEB 4DR6B 3BVOA 2BOCC 1TGOA 1VQ5V 4JI3O 1H8EG 3M99B 4JI6B 4EFBA 3CRAA 2DMXA 2WWWA 2ZDIC 2V7QG 1P7BA 3RW0A 3OTFA 5E1AC 2LFRA 5GTIZ 3LDCA 1NH2B 1URFA 1P4RA 4U3JB 1KKCA 5A2QN 2QKAA 1QQCA 1EBOA 3SYPA 5LBQA 1U96A 4ABMA 2B9ZA 2H3OA 2H94A 1PNLA 4R50A 4YJ2B 3NXSA 2QWQB 3J80N 4QIWF 4J9YB 3SPCA 2DOSA 1XMQO 3FB6C 3TETA 3K5NA 1MZFA 2EX3A 2Q0OC 2A3QA 1Q6IA 3D3QA 3CCSV 2EINB 1H2GA 3A0HZ 5LP6A 3E8HA 1AVMA 1H2NA 3PN1A 3O65A 5AG2A 3SGIA 1S0VA 2HLDG 1H2LA 2L6LA 2ETNA 1AI6A 4DK1A 1JX9A 4HYOA 2YS8A 1JQ0A 2P6JA 4JASA 5B1BB 1VEWA 1E1RG 5L3FA 1SQGA 1XL6A 5LYJB 1VQOV 1YZBA 1MG1A 5JVDB 4TUYB 3CHXA 1F4MA 3STLC 1AB3A 4I50B 1NTKH 1QLEB 3G80A 4KUMA 4Q20A 3BY6A 4FM1A 1AP6A 2CH7B 4LF9B 4LBEC 1XDCA 3JSNA 1IBMO 2ZIMA 1Z2GA 1KB9F 1SQVH 2UXDO 3CS5A 5IYZA 1THZA 5KX5A 3WFVA 1AJPA 3SYCA 1MMMA 2PYJA 2IM9A 2P7TC 3ZMTA 1FJGO 2DYRC 4O2AB 1MSWD 1IXMA 5KMGA 4BW5A 4H37A 3X2QC 4DO2A 5EC2C 1NVPB 5LXTA 4GX0A 2Y69B 2B1GA 4NTYA 2ATKC 5LP6C 5C8YB 3LSUA 2X6BA 5FLXN 1XOUA 3GWKC 3TJTA 1OV9A 1FFXA 4PV1B 4ZBMA 1PM9A 2P4VA 4I55A 4J80A 4DR1O 3ICXA 1QR8A 4MSWC 1XMQB 3ETEA 1GM8A 3KZIZ 1IDSA 2AZ0A 5EYPA 4XDLA 2W0FC 4JPRA 3U11A 1OHHG 5CA1A 5B1AB 5BXZA 1P49A 1SA0B 2CK3G 4ZI7B 1GH6A 5DECA 2D2CB 2YDEA 4D7TA 4GX5A 4PDVA 2JJ2G 1I5XA 4DUYO 1X4TA 2HVJC 1UFIA 1QBZA 4O4LA 5D5QA 4LC1A 2YI9A 4YJ3A 5E79Z 1IBMB 4DV6O 3ABMB 5EZYB 3K9SA 5JH7B 4LF8O 5CA0A 4PD4F 5BMVB 2UXDB 4C7UA 1WAZA 3H9VA 4G27B 2CE4A 5B66Z 1XHZA 2OYQA 1FPOA 3ZRWA 2YC0A 3JD4A 5F2VO 2GDSA 3FFQA 4AILC 2G38A 3CMEV 2PY5A 2AHYA 1BCCH 1NH2D 2QGNA 3TGUH 3WB1A 3L73H 3I5DA 5FPOA 2LW7A 4QGPA 2CAZC 3S3WA 3FAVA 1HNXO 2CDYA 5IJ9B 4I9QA 2HFEC 2PI4A 2CTWA 4PHZA 3HKCA 1BHBA 1ZSPA 1XMOO 4DR1B 1AI5A 1YXBA 5KLVH 1IX9A 4JZ2A 4JI2O 1Y6XA 2LJ2A 4I4TA 3H1JH 2GTAA 2UUAO 5LOVB 2AGAA 5D5PA 4BIUA 3JASA 4MTXA 4MVQA 3H1HH 5B5EZ 4DR2O 1W2BU 2F93B 3K08A 2EBOA 4DV1O 1VQNV 3ZIAG 1M90W 3H1IH 4LF7O 2V1DA 4DUYB 4E4EA 1VF6A 2HVKC 2NLJC 4UUJC 2PF4E 1EN4A 2NNUA 4DV6B 4U3JA 4DRXA 2DWDC 4LF8B 3E8BA 4Z1MG 1QHTA 2E5LO 4WF9V 1RM1C 1RFYA 4B3MO 4YJ2A 3IAYA 3A0BZ 3LDEA 3X2QB 3OMNB 2DJVA 4FLXA 1L1FA 2OCCC 3AK2A 4RUEA 3CCRV 2LP7A 2QDOA 3OW2U 1NVPD 5JQGB 1AROP 2Q6AA 2EJ7A 2CTPA 2UXXA 5LL6Y 2UUCO 3ZHVA 1RPRA 2FMLA 1SQQH 3E89A 4MVUA 4B3RO 2LO1A 4B08A 4X9QA 1Q90D 3CCUV 1IURA 4UXNA 2XHBA 2CGNA 5LGUA 1HNXB 4TT3G 3UM7A 1K7DA 2BTQA 4JI4O 5LYJA 3HKBA 3K9AA 2KQXA 2ITCC 5JVDA 3BCCH 1JVMA 4TUYA 3CX5F 3F5WC 1XMOB 5KA6A 4U7OA 4I50A 5H2FZ 1KQSU 3CCMV 2CH7A 4NR1A 5KX5B 1VF6C 3CMAV 4JI2B 4RWUA 2ZT9B 5JJEB 5JJJB 2UUAB 2JVDA 2XNDG 1IVSA 4DR2B 4U7NA 4DV1B 3Q4HB 1E79G 1S5LZ 2EZOA 2QJ1A 3M7MX 3C90A 4LF7B 4O2AA 5LXTB 5GW7A 5KUMA 4X8AA 2R9AA 4YIPA 3T4DA 1VIBA 4O4JB 1Q6HA 2E75B 3APQA 1YTFB 4GZRB 1FFXB 4UCSA 4FFKA 1YJ9V 3H1LH 4JAAA 1VQ6V 3IC7A 4RO2A 3LUTB 2E5LB 4ZHQB 3IJ4A 4B3TO 4B3MB 1MSDA 1SF9A 4G28B 3SJAC 3BEHA 2YUAA 5ITZA 4FLYA 5CA1B 1H38A 2KSDA 3E2EA 2X0LA 3K06A 3OE7G 3N2GB 4IYHA 2UUCB 3JYCA 3BRCA 1QLEC 3A2FA 4H44B 4FIPC 3EHBB 1KECA 1IBLO 4B3RB 1Y4MA 1RPOA 2LFSA 1SA0A 3FKSG 4ZI7A 3IC9A 2PZSA 3K5OA 1YIJV 2Q73A 4GX2A 1SZXA 4JI4B 1P7GA 4OPHA 1KUQA 2F4VO 3THOA 4O4LB 3BA8A 5IYDO 1JMKC 4TV8B 1R3KC 4U3FH 2R9RB 4F6RB 3ABKB 1Y76A 1NTMH 2JGDA 1VQ7V 4MW8A 4X1YB 3G4SV 4X64O 3ZHTA 2GV9A 1JFFA 2ZINA 5EZYA 1NQTA 2JS5A 4MVZA 2B1IA 5BMVA 2PYLA 2JEXA 2OT5A 3OEHG 1S5HC 3OM3B 3L71H 2EIJC 1AILA 2RQ6A 3UT5B 4CH5A 3RBZA 1WA8B 5CBHA 4MTFA 5H5NA 4UCUA 2CUGA 4UB6Z 2Y4TA 3I56V 1EM1A 4J9ZB 3IFXA 2VWKA 4NXNO 4D7SA 4UCOA 4QPJA 1QCEA 2QKCA 1NR1A 1OCRB 4EB6A 3L75H 1YHQV 1TUBA 4L87A 2ZE6A 2OCCB 1MABG 1N34O 4K0KO 2QM4A 1WP8A 5B1AC 1NZ6A 1YITV 3LDDA 3AG3B 5C93A 4IIJB 1I08A 1R3LC 4B3TB 2GBOA 4WFHA 3ZMUA 4CBCA 1K33A 3VOUA 1MNGA 4I4TB 3B09A 1HDJA 3ZCCA 3JASB 1Y67A 4PDMA 3OUSA 1IBLB 1CXZB 4IL6Z 1Y74B 5LOVA 2OTLV 1JR9A 2GUZB 3F5TA 1K5QA 2XAJA 2HP8A 4RUFA 4N21A 2Y0IA 1DF4A 1YJWV 4JI7O 4K8ZA 3E8FA 3T1YO 2ZNIA 3ZMZA 3UCSC 2D3OW 3RWRD 4DR3O 2F4VB 4WFGA 1YVWA 3OMAB 1VF5B 1KU9A 5EC1C 4DRXB 3L9DA 1G1XB 1PNMA 1YDXA 2NN4A 4X64B 3W7WA 4NXMO 2AW9A 1YI2V 3OGIB 4MW3A 2QEXV 1JJ2U 1GRJA 3TXQA 2JDIG 3ZJZA 2GTSA 1FXVA 3D8CA 2KKWA 1F51A 2ADQB 5JWPA 3SYAA 1M9NA 1ENVA 1M56C 1XREA 2JIZG 3HPLC 2F1MA 1R73A 4PDRA 4E2LA 5JQGA 1YTFD 2PUSA 1PPJH 5IT9N 4NXNB 1QR9A 4YHHO 2BTQB 1N34B 3HKBB 4K0KB 5IJ0B 2IH1C 5LGNA 4P30A 3K3WA 1LUVA 2Q5ZA 3QF7A 3U10A 3MDSA 4HBNA 1Q8IA 3FYIB 4YXWG 3ABLC 1K9MW 1WPXA 1D2DA 3TXSA 3G6EV 3D3IA 4R7CA 1RSOB 3T2MA 4GT1A 2XUMA 1R1BA 3H1KH 1PP9H 5K1PA 3M8AA 5GONB 1PD3A 4XDKA 2UXCO 2ZXWC 5IY5C 1GO3F 1XILA 3G67A 4JI3B 3WG7C 3WU2Z 5H9CA 1XNQO 4JI7B 1K5SA 3UO3A 3T1YB 3Q4HA 2QE7G 3MHHC 4TQDA 4DR3B 5FNVB 2JJ1G 2EIJB 3L70H 3FB8C 4W4LA 1LUWA 4O4JA 2PGGA 2GSMB 4NXMB 1EN5A 2QA4V 5LMUO 1D5AA 1YSCA 3J7AU 1BGYH 1AP5A 3S3XA 3RYIB 1AR1B 1FS0G 5ITZB 4ZHQA 1VQ8V 3N27A 4FPPA 4Q6GA 3RGBA 4CC6A 4CC5A 1H2KA 3CC7V 4DV4O 3T1CA 2W6JG 2H8PC 2WPDG 1KYOF 1YCIA 2W0XA 1CEZA 3JD3A 4FZ0A 1U97A 4P2ZA 2ZR2A 1XI1A 1ROPA 1R6NA 3N2GA 2LGWA 3F7VC 4LP8A 4WFFA 3DC6A 4I5SA 4YHHB 2UXNA 3QO8A 4DR4O 3HKDB 4H0LB 5BY1A 5J2TA 3CRQA 3ETQA 3GB7C 5EBLC 1K34A 3ML0A 1L0LH 4LFBO 3O9OA 1AR5A 2F23A 4X88A 4WFAV 1Y76B 2JGDB 4LFAO 4UVAA 2X6AA 3F7YC 1XNRO 4A5UB 1JFFB 4PA7A 4TV8A 3ZHUA 4F6RA 2E3CA 3JARA 1HWYA 2W6IG 4X1YA 1QVGU 5DEDA 1ZTEA 3W7TA 1GK9A 4PI2A 3APOA 4EFEA 2P67A 4X89A 4ZKIA 1YEWA 2WLLB 1EZJA 1COWG 1FXHA 1IXBA 1OZ0A 1ZL8B 2ODMA 3DC5A 4PA6A 2UXCB 3UT5A 2HG5C 1UPGA 1FJGB 1WA8A 2XT9A 1XNQB 2EIMC 3K04A 3CCEV 3RVYA 2PTMA 5L3EA 1AJNA 1G8MA 4EB6B 2R70A 1BQ0A 1TUBB 4XDJA 2IW5A 4FMTA 4HZ3A 4MS2A 1VQPV 3CRRA 2YXYA 4QNHB 4KP4A 1W59A 4JF3A 5B1NA 3CC2V 1M56B 1K4DC 3KCYA 1B06A 5LMUB 4PI0A 3B8MA 4O2BA 1SQFA 4GYCB 1MA1A 3LSQA 3KKYA 3CB2A 5LHHA 4IIJA 3P30A 4HNAA 3JALB 4X1KB 4K35A 4DV4B 5EK0A 2WAMA 1XL4A 1H2SB 4GX1A 2A79B 3JD1A 4KXRA 2IBZH 4MTOA 3CPWU 1O9GA 2WLHA 1ZWIC 2CTRA 2OIEA 3ABKC 1HR0O 1JJOA 1N33O 3E86A 2XASA 1Y74A 4DR4B 3ABLB 1AI7A 3K58A 2GUZA 2ZE8A 3RYFB 4LFCO 3RN4A 2N74A 4LF4O 4LFBB 3OT7A 4JYBA 4EEQA 1N32O 3AG4C 2DQ0A 3QVNA 1DTOA 1GKFA 3ZHRA 4LFAB 1XNRB 3E35A 4X1IB 4GKJO 4X66O 2QKSA 2A9HA 3OAAG 2Z0AA 2ZXWB 5IY5B 2ZR3A 2EZPA
chains in the Genus database with same CATH topology
1FYJA 1R1BA 1N36O 4B3RO 1IBLO 4JI5O 5A2QN 2LW7A 2UU9O 3M8AA 5FLXN 2UXCO 1HNXO 4JV5O 1HNWO 1DK1A 3F5TA 1I94O 1A32A 4JI7O 5LMNO 1XNQO 2FKXA 4JI4O 3T1YO 3J80N 4OPHA 2VQEO 1KUQA 2DOSA 1XMQO 2F4VO 4DR3O 4JYAO 4DR1O 4LF6O 1X59A 1XMOO 1IBKO 2ZKOA 4DV0O 1G1XB 4AQYO 4JI2O 4X64O 4LF5O 4OX9O 2ZM6O 3O65A 4B3SO 4NXMO 4DR7O 4DV7O 5BXZA 4GKKO 1F7YA 3OTOO 2UUAO 2UXBO 2VQFO 1J5EO 5LMUO 5BR8O 2AGAA 1AILA 3J7AU 4DV3O 4DR2O 4X65O 2HHHO 4DV1O 5H5NA 4X62O 1YZBA 4DV4O 4LF7O 1HNZO 4DUYO 4JI1O 1AB3A 4YY3O 4LF9O 4OPAA 5IWAO 4NXNO 3R66A 1IBMO 5IT9N 1NS1A 4DV6O 3T1HO 3SDLA 1FKAO 2UXDO 4LF8O 4YHHO 4DV5O 1HR0O 4JI8O 1N33O 1N34O 4DR4O 4K0KO 4DR5O 3JAMN 1XEQA 5BY1A 2UUBO 2E5LO 4LFCO 4DR6O 4LFBO 4B3MO 4KHPO 2N74A 4LF4O 4B3TO 2JRIA 3J81N 2DJVA 4JI0O 4JI3O 4JI6O 1N32O 4LFAO 1FJGO 1XNRO 4A5UB 1D2DA 3RT3C 4GKJO 4X66O 5LL6Y 2UUCO 4DUZO 2Z0AA 4DV2O 1R6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYJ A;  1R1B A;  1N36 O;  4B3R O;  1IBL O;  4JI5 O;  5A2Q N;  2LW7 A;  2UU9 O;  3M8A A;  5FLX N;  2UXC O;  1HNX O;  4JV5 O;  1HNW O;  1DK1 A;  3F5T A;  1I94 O;  1A32 A;  4JI7 O;  5LMN O;  1XNQ O;  2FKX A;  4JI4 O;  3T1Y O;  3J80 N;  4OPH A;  2VQE O;  1KUQ A;  2DOS A;  1XMQ O;  2F4V O;  4DR3 O;  4JYA O;  4DR1 O;  4LF6 O;  1X59 A;  1XMO O;  1IBK O;  2ZKO A;  4DV0 O;  1G1X B;  4AQY O;  4JI2 O;  4X64 O;  4LF5 O;  4OX9 O;  2ZM6 O;  3O65 A;  4B3S O;  4NXM O;  4DR7 O;  4DV7 O;  5BXZ A;  4GKK O;  1F7Y A;  3OTO O;  2UUA O;  2UXB O;  2VQF O;  1J5E O;  5LMU O;  5BR8 O;  2AGA A;  1AIL A;  3J7A U;  4DV3 O;  4DR2 O;  4X65 O;  2HHH O;  4DV1 O;  5H5N A;  4X62 O;  1YZB A;  4DV4 O;  4LF7 O;  1HNZ O;  4DUY O;  4JI1 O;  1AB3 A;  4YY3 O;  4LF9 O;  4OPA A;  5IWA O;  4NXN O;  3R66 A;  1IBM O;  5IT9 N;  1NS1 A;  4DV6 O;  3T1H O;  3SDL A;  1FKA O;  2UXD O;  4LF8 O;  4YHH O;  4DV5 O;  1HR0 O;  4JI8 O;  1N33 O;  1N34 O;  4DR4 O;  4K0K O;  4DR5 O;  3JAM N;  1XEQ A;  5BY1 A;  2UUB O;  2E5L O;  4LFC O;  4DR6 O;  4LFB O;  4B3M O;  4KHP O;  2N74 A;  4LF4 O;  4B3T O;  2JRI A;  3J81 N;  2DJV A;  4JI0 O;  4JI3 O;  4JI6 O;  1N32 O;  4LFA O;  1FJG O;  1XNR O;  4A5U B;  1D2D A;  3RT3 C;  4GKJ O;  4X66 O;  5LL6 Y;  2UUC O;  4DUZ O;  2Z0A A;  4DV2 O;  1R6T A; 
#chains in the Genus database with same CATH topology
 2OWO A;  3D36 A;  3SPH A;  1LNQ A;  1Q81 W;  1OCR C;  5IE9 A;  3JAK B;  1I94 O;  2EIK B;  4AI8 A;  2FKX A;  4K8X A;  2XTA A;  3AG3 C;  1NTZ H;  2XOK G;  4LF6 O;  1VAR A;  2YIC A;  4DV0 O;  1SQB H;  3QNE A;  1WPB A;  4GLX A;  1V9P A;  2AHZ A;  1Q43 A;  3CEI A;  1XHX A;  2LW1 A;  4OX9 O;  4B3S O;  3ETG A;  2LQT A;  4UV8 A;  2X7R B;  4FZ1 A;  4O4H A;  1SZT A;  2Q7H A;  3MHS C;  4UCV A;  3BAA A;  2JEU A;  1J5E O;  2UXB O;  1ZUQ A;  5IJ0 A;  5HFM A;  4UVC A;  1NI8 A;  4ZOL B;  1XBL A;  2ITD C;  5B1O A;  4J41 A;  4EKW A;  4Z2W A;  1Y66 A;  1RSO A;  4FLV A;  4DYL A;  2VWJ A;  3B4S A;  1NS1 A;  4R8C A;  3ZRV A;  4LR3 A;  2DYS B;  3T1H O;  3ABT A;  3OGC C;  2PI5 A;  3SJC C;  2P06 A;  1AJQ A;  1HR0 B;  1XUQ A;  3G6B A;  1N33 B;  5GON A;  1F4N A;  3D36 C;  1S5J A;  4OXS A;  3ZN1 A;  3W7U A;  4LFC B;  1XQ8 A;  4LH7 A;  4LF4 B;  1M93 A;  2RNB A;  1N32 B;  1Q6U A;  2WLI B;  5EBW C;  3CXC U;  1M57 C;  4GUN A;  4GKJ B;  4X66 B;  1T5E A;  5FNV A;  3A8T A;  1ZX3 A;  1NBM G;  5FPR A;  3WB0 A;  1CP9 A;  2QWN B;  1FD9 A;  1WLE A;  2ZE7 A;  3VBB A;  4IT5 A;  2KB1 A;  5LHI A;  3ZRX A;  4FK5 C;  2EIM B;  4FM0 A;  2AXT Z;  1KBH A;  1TVK B;  4O4I A;  4LCU C;  2IJH A;  3JAW A;  3I55 V;  4G2K A;  3AG2 C;  5KAI Z;  3K5L A;  1HNW O;  5GTH Z;  2BE3 A;  3RYI A;  1I94 B;  2BOB C;  1ORQ C;  3RFR A;  2C2A A;  2M7W A;  4CZZ A;  4FVM A;  2DN9 A;  1X59 A;  4NTX A;  4P9P A;  2FB5 A;  4LF6 B;  1SER A;  4UCT A;  3CRM A;  3SR2 C;  1V55 C;  4DV0 B;  1GN2 A;  3UO2 A;  2GHY A;  2ZM6 O;  5J2T B;  4DR7 O;  4OX9 B;  4B3S B;  5CN0 A;  3T4Z A;  5EIB C;  1B3Q A;  3HKD A;  1J5E B;  2UXB B;  3QO7 A;  4LNU B;  2RDC A;  2ILM A;  3OD4 A;  1WP7 A;  1VMG A;  2IJJ A;  1FXK B;  1NR7 A;  3OFN G;  3SPJ A;  1G6U A;  3JAR B;  1CPY A;  4IYI A;  4R6Z A;  5LA6 B;  1SET A;  4YY3 O;  2FTK A;  2CGO A;  1OCC C;  3HR0 A;  5IWA O;  2A7W A;  1RP3 B;  5J9P C;  1I7F A;  1DF5 A;  2E74 B;  4FM2 A;  1FKA O;  3T1H B;  2EIL C;  3AG4 B;  4UB8 Z;  2XAG A;  4MVM A;  1S76 D;  4DR5 O;  3JAM N;  4W4K A;  2WLL A;  2OCH A;  3SYQ A;  3SPI A;  2UUB O;  1ZL8 A;  5H6Q A;  4KHP O;  2Y4U A;  3L72 H;  1KD1 W;  5CB4 B;  3CCJ V;  4QPK A;  2XAH A;  1B6Q A;  1R6T A;  2EJR A;  4FLZ A;  3MAQ A;  1FYJ A;  2HJD A;  1BS3 A;  2XAQ A;  3SYO A;  1I5Y A;  4O2B B;  4HNA B;  1PL4 A;  1TUE B;  4JV5 O;  1K97 A;  2EUL A;  4NTW A;  5DN6 G;  1HNW B;  4MVO A;  4X20 B;  2P5O A;  1H2M A;  5LMN O;  4B7K A;  2M6Y A;  3JAL A;  2VQE O;  4X1K A;  2ZNJ A;  2Z3Y A;  1IBK O;  3BPZ A;  2LGQ A;  4CS4 A;  1N8R W;  4LWS B;  2L35 A;  3KCX A;  3B8N A;  1NKD A;  2ZM6 B;  4DR7 B;  4J7K A;  3K03 A;  2FYU H;  2Q68 A;  2Q4P A;  4NYK A;  4DK0 A;  2K9P A;  4RQE A;  1R6K A;  3RYF A;  3CP1 A;  2HHH O;  4D6T H;  5IYB O;  2K1E A;  2VRZ A;  3R65 A;  3JCU Z;  3K57 A;  3CCV V;  2XAF A;  2V4D A;  4X1I A;  3AG1 B;  4YY3 B;  2WLN A;  5IWA B;  4WBN A;  1BHA A;  2Q9L A;  2P90 A;  4J10 A;  1WJZ A;  3VQX A;  1UJW B;  1N0N A;  1QLN A;  3JD2 A;  1BL8 A;  4I0X A;  4CH4 A;  4LH6 A;  3A0R A;  3GWO A;  4UVB A;  4PDL A;  4DR5 B;  5KAF Z;  1M57 B;  2UUB B;  4PA4 A;  1F23 A;  3JAK A;  2X6C A;  2A0L A;  4ZIB A;  4KHP B;  4UV9 A;  4PEL A;  5KA5 A;  3CJH B;  3DTU B;  1GN4 A;  3AK1 A;  1GMG A;  1E1Q G;  2YIB A;  4O4H B;  3ZS8 C;  3AG2 B;  1N0J A;  2ADP A;  3WG7 B;  5BZB A;  1M4U A;  4JAU A;  4J11 A;  1H8H G;  2UU9 O;  4CH3 A;  1FAF A;  4I7Z B;  1GM9 A;  2R72 A;  4JV5 B;  3E22 B;  1Q3E A;  1V55 B;  3HKE B;  3ZED A;  3SJQ C;  2ZQM A;  5LMN B;  4ZOL A;  4WFB V;  1OCO C;  4ASU G;  3ZRS A;  1KKD A;  2VQE B;  5CA3 A;  2Q7E A;  1BE3 H;  1YF2 A;  1IBK B;  1D5N A;  2QM8 A;  2YI8 A;  2WA3 A;  2ZCE A;  2Q0A A;  3MD0 A;  2DQ3 A;  4LF5 O;  4CS2 A;  4JTC B;  3ZHQ A;  3OR7 C;  1L0N H;  3OTO O;  3C3S A;  3H01 A;  3CXH F;  5LGT A;  5JCO A;  1OCC B;  1PL0 A;  3AK3 A;  3FB5 C;  3FB7 C;  5KHJ A;  3DXR B;  2HHH B;  2EIK C;  1HNZ O;  2IU3 A;  2WA4 A;  3CCL V;  2WLI A;  2EIL B;  3ASN C;  4JGS A;  3NR7 A;  1SES A;  1VQ4 V;  3WB2 A;  1YJN V;  2BSK B;  5IDJ A;  1JA8 A;  3RYC B;  3E83 A;  4O4I B;  4IHJ B;  1EFR G;  3JAW B;  4IGG A;  2QSA A;  4I9W A;  4JI8 O;  3OEE G;  5CBF A;  1TVK A;  3QO5 A;  5B3S C;  5KUK A;  4PA3 A;  4JAV A;  4TOI A;  3ZX6 A;  3GVM A;  5HFL A;  4H13 B;  3EXA A;  4JZG A;  3L74 H;  4BIO A;  2MK3 A;  2YEV B;  3DSQ A;  1B04 A;  4DUZ O;  4TSF G;  2ARH A;  4DV2 O;  1S3J A;  1Q5O A;  3K0G A;  3EVK A;  3EFF K;  2YXL A;  5CBG A;  4JI5 O;  3RVZ A;  4PA9 A;  2DYS C;  2UU9 B;  4WFE A;  1ZAU A;  1K3E A;  4LNU A;  1K4C C;  2QR4 A;  2IU0 A;  1A32 A;  2YXH A;  1G4Y B;  2NR5 A;  1L8D A;  1Q82 W;  1JPX A;  1FXK A;  5JCO C;  1Q7Y W;  1BQZ A;  3IGA C;  1BSM A;  3BA9 A;  5LA6 A;  2ZKO A;  1KC8 W;  3W7S A;  4FLT A;  4MVS A;  1SC5 B;  4FFB B;  1S77 D;  4AQY O;  2FL4 A;  4F6E A;  4TV9 B;  4LF5 B;  4DV7 O;  4BWA A;  2YID A;  4RAI A;  3TK1 A;  1OCZ B;  3CD6 V;  3P3N A;  5KHG A;  3OTO B;  2KG7 A;  2QM7 A;  2A06 H;  3JCZ A;  4JYC A;  1WN7 A;  4MVR A;  1HW7 A;  2JGU A;  1W0K G;  1US6 A;  5A9G A;  5CB4 A;  2AZ2 A;  1HNZ B;  4JI1 O;  4JTA B;  1K92 A;  4NB5 A;  1O9H A;  1Z5W A;  3R66 A;  2BTO A;  4BW9 A;  4MTG A;  1AR4 A;  5EBM C;  2JS3 A;  3SDL A;  5L3G A;  1GN6 A;  3B40 A;  2Y48 A;  5FL7 G;  4JI8 B;  1XEQ A;  4GCZ A;  5L3B A;  3JAT A;  4FJC C;  3ASO C;  1N4C A;  4X20 A;  5KHK A;  1WB8 A;  2JRI A;  4JI0 O;  1EN6 A;  2DWE C;  4J7Z A;  2ZD9 A;  1KP3 A;  5H6R A;  1FXK C;  5J2U A;  4TQF A;  5CMU A;  3N2K B;  3RYH A;  2CTQ A;  2IJI A;  2N05 A;  4DUZ B;  3LNM B;  2Q7G A;  4LWS A;  4DV2 B;  4NKG B;  1GTO A;  1N36 O;  2HR3 A;  1OCO B;  4JI5 B;  4RQF A;  3UQ8 A;  1QNM A;  3CSX A;  2E76 B;  2YIA A;  2WLM A;  2OTJ V;  4JYY A;  1DK1 A;  1JOY A;  4XBF A;  1SS3 A;  1V54 C;  2QWO B;  2YSU B;  5EIB D;  1ZLZ A;  4CH6 A;  4JYA O;  3UKM A;  3K79 A;  4WBN B;  1LR1 A;  4DW0 A;  3P32 A;  1BT8 A;  4UCR A;  3QTC A;  3P3P A;  2WSS G;  4I0X B;  1VQM V;  4AQY B;  2HJF C;  1OJH A;  5L3C A;  1GAX A;  3CWB H;  4DV7 B;  3ZHS A;  4GKK O;  1TA8 A;  2VQF O;  1W0J G;  3ASN B;  5BR8 O;  1KMI Z;  3W7X A;  4DV3 O;  3OMI B;  1GM7 A;  4X65 O;  1MZE A;  2DYR B;  4H33 A;  2Q67 A;  3DGE A;  4DXW A;  4QJF B;  4MT8 A;  1BZK A;  1I0H A;  3CJH A;  3BHP A;  2P22 C;  4JI1 B;  5B3S B;  5LP6 B;  4OPA A;  3B2E E;  3ZN0 A;  1J95 A;  5LHG A;  1AI4 A;  3ZBH A;  3CE2 A;  3OR6 C;  3CYO A;  3CCQ V;  4TWK A;  5TIS Z;  1M1K W;  3VQV A;  3E22 A;  3HKE A;  1R3J C;  2Z5U A;  4JI0 B;  5KHH A;  3BAB A;  2Q69 A;  1Q86 W;  3RT3 C;  1KP2 A;  1NJI W;  1VQ9 V;  1QVF U;  2R9I A;  3B77 A;  4JTD B;  4L8J A;  3G71 V;  3AG1 C;  4BAY A;  5IYZ B;  1N36 B;  1WB7 A;  1M5I A;  4CS3 A;  1K8A W;  1BMF G;  3ETD A;  1DGS A;  3K5M A;  3DXR A;  1MOF A;  3KG2 A;  4OGQ B;  1EZV H;  2MW2 B;  4ICG A;  4JYA B;  2BCC H;  3SJB C;  3FX7 A;  5KMG B;  2RJZ A;  2BSK A;  3RYC A;  3HB3 B;  4IHJ A;  3OUF A;  1SKV A;  2IJK A;  4GKK B;  1IZ3 A;  2EIN C;  1WNS A;  2VQF B;  5C8Y A;  5BR8 B;  3TCU A;  4DV3 B;  4I55 B;  3VQW A;  4X65 B;  4B7E A;  2F95 B;  5KHI A;  2HEP A;  3VQY A;  4X62 O;  5IYC O;  2RCV A;  4HAM A;  4Z1V A;  5B1B C;  2QWP B;  5EYP B;  3K59 A;  1NU1 H;  2ZIO A;  4WCE V;  1VQL V;  2QTO A;  1SQX H;  4AHC A;  3CC4 V;  2YEV A;  2OIG A;  1NT2 B;  3C3T A;  1HP8 A;  4J7J A;  2F43 G;  3ASO B;  3STZ C;  4J42 A;  4DV5 O;  3U0Z A;  1QU7 A;  2WLK A;  4NVP A;  5JJN B;  3QG5 A;  1K73 W;  4DR6 O;  2DW4 A;  1SQP H;  2O57 A;  3E8G A;  3LSS A;  3J81 N;  4JI6 O;  1PV0 A;  4UFZ A;  2QTS A;  2ZE5 A;  4YJ3 B;  4FFB A;  2DE0 X;  1VF7 A;  1PKX A;  3CRC A;  1V54 B;  1GN3 A;  2KG7 B;  3JSL A;  4TV9 A;  5CA0 B;  4BIZ A;  3ABU A;  3AEI A;  2Y0P A;  5JH7 A;  3ZRW B;  2Y69 C;  1VP7 A;  5K1X A;  1JCH A;  1SRY A;  2ZDI A;  3SPG A;  3LNN A;  2VS0 A;  1DLB A;  2P4K A;  4DW1 A;  1PNK A;  3BFR A;  2WLJ A;  2F66 C;  2QWR B;  4BR6 A;  4FLW A;  1VQK V;  3ZMS A;  3JAT B;  1RM1 B;  1F7Y A;  2RMK B;  3FAV B;  2JK5 C;  3ZMV A;  2IH3 C;  4KFM A;  4FLU A;  2YIB D;  3K0D A;  1S72 V;  5J2U B;  5DM6 V;  3JD0 A;  3PJS K;  3RYH B;  2Q8V A;  3HKC B;  4X62 B;  1TAE A;  1R3I C;  2RN9 A;  3AG7 A;  5IJ9 A;  4K3A A;  2B5U A;  4YIO A;  1Z5V A;  3N2K A;  4LF9 O;  4N23 A;  2HKO A;  4QE7 A;  4DV5 B;  3FD9 A;  4KL1 A;  4PJ0 Z;  4P9O A;  1FFT B;  4QE9 A;  5L3D A;  4F4L A;  1OCZ C;  1P84 F;  2N04 A;  3ABM C;  3FYE B;  4DR6 B;  3BVO A;  2BOC C;  1TGO A;  1VQ5 V;  4JI3 O;  1H8E G;  3M99 B;  4JI6 B;  4EFB A;  3CRA A;  2DMX A;  2WWW A;  2ZDI C;  2V7Q G;  1P7B A;  3RW0 A;  3OTF A;  5E1A C;  2LFR A;  5GTI Z;  3LDC A;  1NH2 B;  1URF A;  1P4R A;  4U3J B;  1KKC A;  5A2Q N;  2QKA A;  1QQC A;  1EBO A;  3SYP A;  5LBQ A;  1U96 A;  4ABM A;  2B9Z A;  2H3O A;  2H94 A;  1PNL A;  4R50 A;  4YJ2 B;  3NXS A;  2QWQ B;  3J80 N;  4QIW F;  4J9Y B;  3SPC A;  2DOS A;  1XMQ O;  3FB6 C;  3TET A;  3K5N A;  1MZF A;  2EX3 A;  2Q0O C;  2A3Q A;  1Q6I A;  3D3Q A;  3CCS V;  2EIN B;  1H2G A;  3A0H Z;  5LP6 A;  3E8H A;  1AVM A;  1H2N A;  3PN1 A;  3O65 A;  5AG2 A;  3SGI A;  1S0V A;  2HLD G;  1H2L A;  2L6L A;  2ETN A;  1AI6 A;  4DK1 A;  1JX9 A;  4HYO A;  2YS8 A;  1JQ0 A;  2P6J A;  4JAS A;  5B1B B;  1VEW A;  1E1R G;  5L3F A;  1SQG A;  1XL6 A;  5LYJ B;  1VQO V;  1YZB A;  1MG1 A;  5JVD B;  4TUY B;  3CHX A;  1F4M A;  3STL C;  1AB3 A;  4I50 B;  1NTK H;  1QLE B;  3G80 A;  4KUM A;  4Q20 A;  3BY6 A;  4FM1 A;  1AP6 A;  2CH7 B;  4LF9 B;  4LBE C;  1XDC A;  3JSN A;  1IBM O;  2ZIM A;  1Z2G A;  1KB9 F;  1SQV H;  2UXD O;  3CS5 A;  5IYZ A;  1THZ A;  5KX5 A;  3WFV A;  1AJP A;  3SYC A;  1MMM A;  2PYJ A;  2IM9 A;  2P7T C;  3ZMT A;  1FJG O;  2DYR C;  4O2A B;  1MSW D;  1IXM A;  5KMG A;  4BW5 A;  4H37 A;  3X2Q C;  4DO2 A;  5EC2 C;  1NVP B;  5LXT A;  4GX0 A;  2Y69 B;  2B1G A;  4NTY A;  2ATK C;  5LP6 C;  5C8Y B;  3LSU A;  2X6B A;  5FLX N;  1XOU A;  3GWK C;  3TJT A;  1OV9 A;  1FFX A;  4PV1 B;  4ZBM A;  1PM9 A;  2P4V A;  4I55 A;  4J80 A;  4DR1 O;  3ICX A;  1QR8 A;  4MSW C;  1XMQ B;  3ETE A;  1GM8 A;  3KZI Z;  1IDS A;  2AZ0 A;  5EYP A;  4XDL A;  2W0F C;  4JPR A;  3U11 A;  1OHH G;  5CA1 A;  5B1A B;  5BXZ A;  1P49 A;  1SA0 B;  2CK3 G;  4ZI7 B;  1GH6 A;  5DEC A;  2D2C B;  2YDE A;  4D7T A;  4GX5 A;  4PDV A;  2JJ2 G;  1I5X A;  4DUY O;  1X4T A;  2HVJ C;  1UFI A;  1QBZ A;  4O4L A;  5D5Q A;  4LC1 A;  2YI9 A;  4YJ3 A;  5E79 Z;  1IBM B;  4DV6 O;  3ABM B;  5EZY B;  3K9S A;  5JH7 B;  4LF8 O;  5CA0 A;  4PD4 F;  5BMV B;  2UXD B;  4C7U A;  1WAZ A;  3H9V A;  4G27 B;  2CE4 A;  5B66 Z;  1XHZ A;  2OYQ A;  1FPO A;  3ZRW A;  2YC0 A;  3JD4 A;  5F2V O;  2GDS A;  3FFQ A;  4AIL C;  2G38 A;  3CME V;  2PY5 A;  2AHY A;  1BCC H;  1NH2 D;  2QGN A;  3TGU H;  3WB1 A;  3L73 H;  3I5D A;  5FPO A;  2LW7 A;  4QGP A;  2CAZ C;  3S3W A;  3FAV A;  1HNX O;  2CDY A;  5IJ9 B;  4I9Q A;  2HFE C;  2PI4 A;  2CTW A;  4PHZ A;  3HKC A;  1BHB A;  1ZSP A;  1XMO O;  4DR1 B;  1AI5 A;  1YXB A;  5KLV H;  1IX9 A;  4JZ2 A;  4JI2 O;  1Y6X A;  2LJ2 A;  4I4T A;  3H1J H;  2GTA A;  2UUA O;  5LOV B;  2AGA A;  5D5P A;  4BIU A;  3JAS A;  4MTX A;  4MVQ A;  3H1H H;  5B5E Z;  4DR2 O;  1W2B U;  2F93 B;  3K08 A;  2EBO A;  4DV1 O;  1VQN V;  3ZIA G;  1M90 W;  3H1I H;  4LF7 O;  2V1D A;  4DUY B;  4E4E A;  1VF6 A;  2HVK C;  2NLJ C;  4UUJ C;  2PF4 E;  1EN4 A;  2NNU A;  4DV6 B;  4U3J A;  4DRX A;  2DWD C;  4LF8 B;  3E8B A;  4Z1M G;  1QHT A;  2E5L O;  4WF9 V;  1RM1 C;  1RFY A;  4B3M O;  4YJ2 A;  3IAY A;  3A0B Z;  3LDE A;  3X2Q B;  3OMN B;  2DJV A;  4FLX A;  1L1F A;  2OCC C;  3AK2 A;  4RUE A;  3CCR V;  2LP7 A;  2QDO A;  3OW2 U;  1NVP D;  5JQG B;  1ARO P;  2Q6A A;  2EJ7 A;  2CTP A;  2UXX A;  5LL6 Y;  2UUC O;  3ZHV A;  1RPR A;  2FML A;  1SQQ H;  3E89 A;  4MVU A;  4B3R O;  2LO1 A;  4B08 A;  4X9Q A;  1Q90 D;  3CCU V;  1IUR A;  4UXN A;  2XHB A;  2CGN A;  5LGU A;  1HNX B;  4TT3 G;  3UM7 A;  1K7D A;  2BTQ A;  4JI4 O;  5LYJ A;  3HKB A;  3K9A A;  2KQX A;  2ITC C;  5JVD A;  3BCC H;  1JVM A;  4TUY A;  3CX5 F;  3F5W C;  1XMO B;  5KA6 A;  4U7O A;  4I50 A;  5H2F Z;  1KQS U;  3CCM V;  2CH7 A;  4NR1 A;  5KX5 B;  1VF6 C;  3CMA V;  4JI2 B;  4RWU A;  2ZT9 B;  5JJE B;  5JJJ B;  2UUA B;  2JVD A;  2XND G;  1IVS A;  4DR2 B;  4U7N A;  4DV1 B;  3Q4H B;  1E79 G;  1S5L Z;  2EZO A;  2QJ1 A;  3M7M X;  3C90 A;  4LF7 B;  4O2A A;  5LXT B;  5GW7 A;  5KUM A;  4X8A A;  2R9A A;  4YIP A;  3T4D A;  1VIB A;  4O4J B;  1Q6H A;  2E75 B;  3APQ A;  1YTF B;  4GZR B;  1FFX B;  4UCS A;  4FFK A;  1YJ9 V;  3H1L H;  4JAA A;  1VQ6 V;  3IC7 A;  4RO2 A;  3LUT B;  2E5L B;  4ZHQ B;  3IJ4 A;  4B3T O;  4B3M B;  1MSD A;  1SF9 A;  4G28 B;  3SJA C;  3BEH A;  2YUA A;  5ITZ A;  4FLY A;  5CA1 B;  1H38 A;  2KSD A;  3E2E A;  2X0L A;  3K06 A;  3OE7 G;  3N2G B;  4IYH A;  2UUC B;  3JYC A;  3BRC A;  1QLE C;  3A2F A;  4H44 B;  4FIP C;  3EHB B;  1KEC A;  1IBL O;  4B3R B;  1Y4M A;  1RPO A;  2LFS A;  1SA0 A;  3FKS G;  4ZI7 A;  3IC9 A;  2PZS A;  3K5O A;  1YIJ V;  2Q73 A;  4GX2 A;  1SZX A;  4JI4 B;  1P7G A;  4OPH A;  1KUQ A;  2F4V O;  3THO A;  4O4L B;  3BA8 A;  5IYD O;  1JMK C;  4TV8 B;  1R3K C;  4U3F H;  2R9R B;  4F6R B;  3ABK B;  1Y76 A;  1NTM H;  2JGD A;  1VQ7 V;  4MW8 A;  4X1Y B;  3G4S V;  4X64 O;  3ZHT A;  2GV9 A;  1JFF A;  2ZIN A;  5EZY A;  1NQT A;  2JS5 A;  4MVZ A;  2B1I A;  5BMV A;  2PYL A;  2JEX A;  2OT5 A;  3OEH G;  1S5H C;  3OM3 B;  3L71 H;  2EIJ C;  1AIL A;  2RQ6 A;  3UT5 B;  4CH5 A;  3RBZ A;  1WA8 B;  5CBH A;  4MTF A;  5H5N A;  4UCU A;  2CUG A;  4UB6 Z;  2Y4T A;  3I56 V;  1EM1 A;  4J9Z B;  3IFX A;  2VWK A;  4NXN O;  4D7S A;  4UCO A;  4QPJ A;  1QCE A;  2QKC A;  1NR1 A;  1OCR B;  4EB6 A;  3L75 H;  1YHQ V;  1TUB A;  4L87 A;  2ZE6 A;  2OCC B;  1MAB G;  1N34 O;  4K0K O;  2QM4 A;  1WP8 A;  5B1A C;  1NZ6 A;  1YIT V;  3LDD A;  3AG3 B;  5C93 A;  4IIJ B;  1I08 A;  1R3L C;  4B3T B;  2GBO A;  4WFH A;  3ZMU A;  4CBC A;  1K33 A;  3VOU A;  1MNG A;  4I4T B;  3B09 A;  1HDJ A;  3ZCC A;  3JAS B;  1Y67 A;  4PDM A;  3OUS A;  1IBL B;  1CXZ B;  4IL6 Z;  1Y74 B;  5LOV A;  2OTL V;  1JR9 A;  2GUZ B;  3F5T A;  1K5Q A;  2XAJ A;  2HP8 A;  4RUF A;  4N21 A;  2Y0I A;  1DF4 A;  1YJW V;  4JI7 O;  4K8Z A;  3E8F A;  3T1Y O;  2ZNI A;  3ZMZ A;  3UCS C;  2D3O W;  3RWR D;  4DR3 O;  2F4V B;  4WFG A;  1YVW A;  3OMA B;  1VF5 B;  1KU9 A;  5EC1 C;  4DRX B;  3L9D A;  1G1X B;  1PNM A;  1YDX A;  2NN4 A;  4X64 B;  3W7W A;  4NXM O;  2AW9 A;  1YI2 V;  3OGI B;  4MW3 A;  2QEX V;  1JJ2 U;  1GRJ A;  3TXQ A;  2JDI G;  3ZJZ A;  2GTS A;  1FXV A;  3D8C A;  2KKW A;  1F51 A;  2ADQ B;  5JWP A;  3SYA A;  1M9N A;  1ENV A;  1M56 C;  1XRE A;  2JIZ G;  3HPL C;  2F1M A;  1R73 A;  4PDR A;  4E2L A;  5JQG A;  1YTF D;  2PUS A;  1PPJ H;  5IT9 N;  4NXN B;  1QR9 A;  4YHH O;  2BTQ B;  1N34 B;  3HKB B;  4K0K B;  5IJ0 B;  2IH1 C;  5LGN A;  4P30 A;  3K3W A;  1LUV A;  2Q5Z A;  3QF7 A;  3U10 A;  3MDS A;  4HBN A;  1Q8I A;  3FYI B;  4YXW G;  3ABL C;  1K9M W;  1WPX A;  1D2D A;  3TXS A;  3G6E V;  3D3I A;  4R7C A;  1RSO B;  3T2M A;  4GT1 A;  2XUM A;  1R1B A;  3H1K H;  1PP9 H;  5K1P A;  3M8A A;  5GON B;  1PD3 A;  4XDK A;  2UXC O;  2ZXW C;  5IY5 C;  1GO3 F;  1XIL A;  3G67 A;  4JI3 B;  3WG7 C;  3WU2 Z;  5H9C A;  1XNQ O;  4JI7 B;  1K5S A;  3UO3 A;  3T1Y B;  3Q4H A;  2QE7 G;  3MHH C;  4TQD A;  4DR3 B;  5FNV B;  2JJ1 G;  2EIJ B;  3L70 H;  3FB8 C;  4W4L A;  1LUW A;  4O4J A;  2PGG A;  2GSM B;  4NXM B;  1EN5 A;  2QA4 V;  5LMU O;  1D5A A;  1YSC A;  3J7A U;  1BGY H;  1AP5 A;  3S3X A;  3RYI B;  1AR1 B;  1FS0 G;  5ITZ B;  4ZHQ A;  1VQ8 V;  3N27 A;  4FPP A;  4Q6G A;  3RGB A;  4CC6 A;  4CC5 A;  1H2K A;  3CC7 V;  4DV4 O;  3T1C A;  2W6J G;  2H8P C;  2WPD G;  1KYO F;  1YCI A;  2W0X A;  1CEZ A;  3JD3 A;  4FZ0 A;  1U97 A;  4P2Z A;  2ZR2 A;  1XI1 A;  1ROP A;  1R6N A;  3N2G A;  2LGW A;  3F7V C;  4LP8 A;  4WFF A;  3DC6 A;  4I5S A;  4YHH B;  2UXN A;  3QO8 A;  4DR4 O;  3HKD B;  4H0L B;  5BY1 A;  5J2T A;  3CRQ A;  3ETQ A;  3GB7 C;  5EBL C;  1K34 A;  3ML0 A;  1L0L H;  4LFB O;  3O9O A;  1AR5 A;  2F23 A;  4X88 A;  4WFA V;  1Y76 B;  2JGD B;  4LFA O;  4UVA A;  2X6A A;  3F7Y C;  1XNR O;  4A5U B;  1JFF B;  4PA7 A;  4TV8 A;  3ZHU A;  4F6R A;  2E3C A;  3JAR A;  1HWY A;  2W6I G;  4X1Y A;  1QVG U;  5DED A;  1ZTE A;  3W7T A;  1GK9 A;  4PI2 A;  3APO A;  4EFE A;  2P67 A;  4X89 A;  4ZKI A;  1YEW A;  2WLL B;  1EZJ A;  1COW G;  1FXH A;  1IXB A;  1OZ0 A;  1ZL8 B;  2ODM A;  3DC5 A;  4PA6 A;  2UXC B;  3UT5 A;  2HG5 C;  1UPG A;  1FJG B;  1WA8 A;  2XT9 A;  1XNQ B;  2EIM C;  3K04 A;  3CCE V;  3RVY A;  2PTM A;  5L3E A;  1AJN A;  1G8M A;  4EB6 B;  2R70 A;  1BQ0 A;  1TUB B;  4XDJ A;  2IW5 A;  4FMT A;  4HZ3 A;  4MS2 A;  1VQP V;  3CRR A;  2YXY A;  4QNH B;  4KP4 A;  1W59 A;  4JF3 A;  5B1N A;  3CC2 V;  1M56 B;  1K4D C;  3KCY A;  1B06 A;  5LMU B;  4PI0 A;  3B8M A;  4O2B A;  1SQF A;  4GYC B;  1MA1 A;  3LSQ A;  3KKY A;  3CB2 A;  5LHH A;  4IIJ A;  3P30 A;  4HNA A;  3JAL B;  4X1K B;  4K35 A;  4DV4 B;  5EK0 A;  2WAM A;  1XL4 A;  1H2S B;  4GX1 A;  2A79 B;  3JD1 A;  4KXR A;  2IBZ H;  4MTO A;  3CPW U;  1O9G A;  2WLH A;  1ZWI C;  2CTR A;  2OIE A;  3ABK C;  1HR0 O;  1JJO A;  1N33 O;  3E86 A;  2XAS A;  1Y74 A;  4DR4 B;  3ABL B;  1AI7 A;  3K58 A;  2GUZ A;  2ZE8 A;  3RYF B;  4LFC O;  3RN4 A;  2N74 A;  4LF4 O;  4LFB B;  3OT7 A;  4JYB A;  4EEQ A;  1N32 O;  3AG4 C;  2DQ0 A;  3QVN A;  1DTO A;  1GKF A;  3ZHR A;  4LFA B;  1XNR B;  3E35 A;  4X1I B;  4GKJ O;  4X66 O;  2QKS A;  2A9H A;  3OAA G;  2Z0A A;  2ZXW B;  5IY5 B;  2ZR3 A;  2EZP A; 
#chains in the Genus database with same CATH homology
 1FYJ A;  1R1B A;  1N36 O;  4B3R O;  1IBL O;  4JI5 O;  5A2Q N;  2LW7 A;  2UU9 O;  3M8A A;  5FLX N;  2UXC O;  1HNX O;  4JV5 O;  1HNW O;  1DK1 A;  3F5T A;  1I94 O;  1A32 A;  4JI7 O;  5LMN O;  1XNQ O;  2FKX A;  4JI4 O;  3T1Y O;  3J80 N;  4OPH A;  2VQE O;  1KUQ A;  2DOS A;  1XMQ O;  2F4V O;  4DR3 O;  4JYA O;  4DR1 O;  4LF6 O;  1X59 A;  1XMO O;  1IBK O;  2ZKO A;  4DV0 O;  1G1X B;  4AQY O;  4JI2 O;  4X64 O;  4LF5 O;  4OX9 O;  2ZM6 O;  3O65 A;  4B3S O;  4NXM O;  4DR7 O;  4DV7 O;  5BXZ A;  4GKK O;  1F7Y A;  3OTO O;  2UUA O;  2UXB O;  2VQF O;  1J5E O;  5LMU O;  5BR8 O;  2AGA A;  1AIL A;  3J7A U;  4DV3 O;  4DR2 O;  4X65 O;  2HHH O;  4DV1 O;  5H5N A;  4X62 O;  1YZB A;  4DV4 O;  4LF7 O;  1HNZ O;  4DUY O;  4JI1 O;  1AB3 A;  4YY3 O;  4LF9 O;  4OPA A;  5IWA O;  4NXN O;  3R66 A;  1IBM O;  5IT9 N;  1NS1 A;  4DV6 O;  3T1H O;  3SDL A;  1FKA O;  2UXD O;  4LF8 O;  4YHH O;  4DV5 O;  1HR0 O;  4JI8 O;  1N33 O;  1N34 O;  4DR4 O;  4K0K O;  4DR5 O;  3JAM N;  1XEQ A;  5BY1 A;  2UUB O;  2E5L O;  4LFC O;  4DR6 O;  4LFB O;  4B3M O;  4KHP O;  2N74 A;  4LF4 O;  4B3T O;  2JRI A;  3J81 N;  2DJV A;  4JI0 O;  4JI3 O;  4JI6 O;  1N32 O;  4LFA O;  1FJG O;  1XNR O;  4A5U B;  1D2D A;  3RT3 C;  4GKJ O;  4X66 O;  5LL6 Y;  2UUC O;  4DUZ O;  2Z0A A;  4DV2 O;  1R6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...