3H1HH

Cytochrome bc1 complex from chicken
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 24
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1hH00
1SQPH 3CWBH 4D6TH 1SQVH 1SQBH 3TGUH 3H1LH 1EZVH 3L71H 1KB9F 3H1HH 1BGYH 1BCCH 1NU1H 3CXHF 3L73H 3H1IH 1BE3H 3H1JH 3L74H 3L72H 2A06H 1NTKH 5KLVH 1NTZH 3L70H 2IBZH 1PPJH 2BCCH 1SQQH 2FYUH 3L75H 1P84F 3H1KH 1L0LH 4U3FH 4PD4F 1KYOF 1SQXH 1NTMH 1PP9H 3CX5F 3BCCH 1L0NH
chains in the Genus database with same CATH superfamily
1QLEB 2EIJB 5LHIA 2IJKA 2YI9A 2W0FC 5IJ9A 1US6A 1FJGB 3OGCC 4DRXB 3WB1A 4CBCA 1RP3B 1WLEA 1Q5OA 1XOUA 1JCHA 4FM0A 4DK0A 3BCCH 3CRAA 4GX5A 1YSCA 3SGIA 2MK3A 3AK2A 5DECA 4B3SO 4NTWA 3LUTB 4NKGB 4UCVA 1RPOA 4IT5A 5A2QN 1EM1A 1NS1A 1Y76A 3JALB 5H9CA 4UCSA 5LOVB 4EEQA 4NTXA 3CCQV 1TA8A 2ZDIC 5BR8B 4JI2O 4DV1O 1YVWA 2Q7GA 4TQDA 4R7CA 1M5IA 1M57B 4BW9A 5K1PA 2GHYA 3EXAA 1AI5A 1SC5B 4JI4O 3OM3B 4IIJB 5JCOA 1VF6C 5IY5C 1RSOA 3KCYA 2RQ6A 1HDJA 3D3QA 1I08A 5C93A 1P84F 2QGNA 1DGSA 1WNSA 3ZMUA 4C7UA 4FLVA 2EBOA 5EBLC 1R3IC 2PI5A 1N4CA 1AROP 5L3GA 2R9AA 1M93A 3W7XA 2YDEA 5D5QA 3BABA 1BCCH 1Y4MA 4RWUA 2IW5A 2IJJA 5AG2A 2RCVA 1QR8A 1BL8A 1DF5A 2V7QG 4UVAA 3F5TA 2EINB 4I55B 5IYCO 5IYDO 3JD3A 3F7YC 3FB7C 1Z2GA 2A9HA 1PL4A 3ETGA 2ITCC 2QJ1A 1GM8A 3ABMB 4YIOA 1FPOA 4NXMB 2Y69B 3VQVA 3DXRB 2ZCEA 4B7EA 5HFLA 1K73W 2XUMA 3RYIA 1KKDA 3RVYA 2QTOA 4B3TO 3HKBB 4LF5O 3IGAC 1AJQA 4TV8A 4DV4B 2ILMA 5LXTA 5L3CA 3S3XA 1YI2V 4O2BB 2YC0A 2DYRC 1XBLA 1IBMB 2LW7A 1M57C 2JDIG 2KG7B 4FFKA 1I94O 1AP6A 3KZIZ 1K8AW 4JYYA 4Z2WA 3SJCC 4XBFA 2QWPB 2V1DA 1MOFA 1HWYA 3RYHA 2ZE5A 2A0LA 1VQPV 4X62B 1VQ6V 2QWRB 1AR4A 2ZIOA 1I7FA 5KX5A 4CZZA 2CTPA 4E2LA 1T5EA 3WFVA 1VMGA 4YHHO 1QR9A 1QQCA 2YIBD 1HW7A 4B7KA 1SQVH 4LNUA 1SETA 4OGQB 5JQGB 2BTQB 3BA9A 1K97A 3BHPA 1SQGA 2B1GA 3ABMC 4YY3B 3MHHC 4ZI7A 2Y69C 3HR0A 2DE0X 1SS3A 3IFXA 4LF9O 3OUSA 1WB7A 2AHYA 4YJ2A 3CCEV 4D7TA 2UXXA 3BEHA 5LP6C 5FNVA 5H6RA 3ZN0A 4JF3A 5E1AC 5IJ0A 4JYAB 3ABLB 3W7WA 1P49A 1SRYA 1PV0A 2DYSB 4MTFA 1R6NA 2ZM6B 3P3NA 3QO7A 1EN5A 5EC2C 4FLTA 2CAZC 4B3MB 3ZMZA 1KP3A 1WP7A 2LFSA 3I5DA 5LYJA 1H2SB 3L9DA 3CCVV 1OHHG 4LFAO 4CS2A 3J7AU 4J7ZA 3ZHRA 1EZVH 3L71H 4DUYO 3K3WA 4QE7A 3ABKC 4UCOA 1XNRO 3CCMV 4XDLA 4MVOA 3E89A 5BZBA 5LMUB 1S77D 3HKCB 4DYLA 4O2AB 2ZR2A 4X8AA 5KUMA 4AILC 4QNHB 2WLLA 4UCTA 2H3OA 4WFGA 2FMLA 4J7JA 1MG1A 3OMNB 2ZE6A 2OT5A 2E5LB 2QWNB 2KKWA 1N36B 2BTOA 2IM9A 5ITZB 3CJHA 2HEPA 1KECA 4LWSA 3Q4HA 3NXSA 3JD4A 4JV5B 2FL4A 1GMGA 4F6RB 1KC8W 2R9IA 1GN2A 4WFFA 2UUBB 1Q6UA 4R6ZA 3JAWB 5C8YB 2ZT9B 1NJIW 3K9AA 4DV0B 4LFCB 5EZYA 5JJNB 5EBMC 3T4ZA 4JAUA 3KKYA 1Q90D 1CPYA 3JATA 5CN0A 4LF7B 2JEXA 4R8CA 4PJ0Z 2Q7EA 4NB5A 1HR0O 1FFTB 1M1KW 2LJ2A 2XHBA 2ZKOA 5LGNA 3T1HO 3THOA 4DR6B 5KLVH 4K35A 2QKAA 1XMOO 2UUAB 1OV9A 3K04A 1H2GA 3M7MX 4TUYB 4GUNA 4DR4B 1QVGU 1KU9A 1Q43A 4QIWF 1Q7YW 2WLNA 4JI1B 3ASNB 4LR3A 1RM1C 1BGYH 3ETQA 4DW1A 1AILA 1H8HG 2KSDA 2YXHA 3OMIB 4I50B 1J5EB 1N33O 4ICGA 2Z3YA 2ADPA 2XT9A 3APOA 2ZDIA 4GKJB 1TUEB 2HVJC 2ITDC 3X2QB 2F93B 2CH7B 1KMIZ 4DR2B 5KAFZ 3WB2A 5CA1B 4O4LB 2PYJA 1M9NA 2QTSA 4FLWA 3D3IA 3R65A 1VF6A 1UFIA 1OZ0A 5JH7B 3UO2A 4AHCA 1XMQB 5LL6Y 5GTIZ 3LDCA 1F4NA 2HR3A 2ZQMA 3IAYA 1M56B 2Q4PA 1PNKA 2RDCA 3WB0A 3SPGA 2JK5C 1N34B 4NYKA 1YIJV 1OCOC 1ZSPA 2PYLA 5E79Z 2DOSA 3AG7A 4X1KA 1MZEA 4O4HA 3A0HZ 2UU9B 4DW0A 3ASNC 4J11A 4HNAB 3STLC 4WBNB 5CA0B 4FLYA 2Q67A 4G2KA 3JALA 4WFHA 5LOVA 5J2TB 2PGGA 4RUEA 2M6YA 2JGUA 3JD1A 3X2QC 3AG4B 3CYOA 4ZOLB 2LO1A 5BR8O 3RN4A 2VQEB 3E8FA 1JA8A 4LH7A 1L0NH 3DGEA 2X6BA 1K4CC 3APQA 2HJFC 4DR7B 2IU0A 2BSKB 3CC7V 4O4JA 1FXVA 2L35A 5IWAB 4CH3A 1Q8IA 2JEUA 3K58A 1NH2B 4LF6B 2UXNA 1K33A 1AB3A 4LBEC 1AP5A 5TISZ 1FFXB 1HNWB 4JI5O 2VS0A 2Q0AA 1Q6IA 4YJ3A 1WAZA 4ZHQB 2ZXWC 4TOIA 4AI8A 5GONA 1P4RA 1RPRA 2JJ2G 1WPXA 4CC6A 1IX9A 4FJCC 4J80A 3DXRA 2ATKC 2Z0AA 4U3JB 2UXBB 4NXMO 4KXRA 3ZHSA 3EHBB 1KP2A 2F43G 3ZMVA 4JI0B 3G71V 2GDSA 3AG4C 4DV4O 5LP6A 3ZMSA 5KUKA 2UUCB 1W0KG 3AG3B 4TQFA 2ARHA 3P32A 2X0LA 3K57A 2H8PC 5GW7A 1JFFA 3RYCA 4LFBB 2WLJA 2HHHB 4X62O 1F51A 4ZIBA 3OEHG 3LNNA 1FKAO 2YIBA 3N2KB 2M7WA 1JX9A 3ASOB 2ZNJA 5F2VO 1NT2B 3FB8C 1LUVA 2E74B 2LP7A 2OIEA 2P67A 4EKWA 4RAIA 2BTQA 1WB8A 4JAAA 1N8RW 1FXKB 4JI6B 1I5YA 3TXSA 3RYFA 1QLNA 3SJBC 4H13B 2O57A 4KHPB 4G28B 5IYBO 1Q81W 1QBZA 4FLXA 2QR4A 4CH5A 2YXYA 4NVPA 3KCXA 1KYOF 2EILC 5DN6G 2Q0OC 4X66B 2F23A 1AR5A 3E83A 3AG3C 1VQKV 4X1IA 1I0HA 3OUFA 2BE3A 3TJTA 2GUZA 4JYAO 1Z5WA 4FK5C 4CH6A 4JI8B 2XNDG 4LH6A 3RWRD 1JOYA 1SZTA 4Q6GA 1TVKB 2ZM6O 1XQ8A 1K5SA 3AG2B 3ASOC 3SYAA 4CS4A 2R72A 1D5AA 4FZ1A 3OFNG 1PM9A 1L8DA 1KB9F 4JYBA 1KQSU 4JTAB 1JQ0A 1BE3H 3QTCA 1BS3A 1KD1W 1K9MW 5J2UA 3A2FA 3FB5C 4RQFA 3E22B 4PDLA 3P30A 1CEZA 1QLEC 1JJ2U 2EIJC 3K08A 5KMGB 1GTOA 1SKVA 1URFA 3HKEB 3K5LA 3J81N 2MW2B 2CE4A 4HAMA 3FB6C 4FIPC 4P9OA 3HKCA 4LF8B 4O2AA 2B1IA 4J7KA 1HNZO 5LMUO 1TAEA 4GX2A 5KHKA 4WFAV 4RUFA 1H38A 4L8JA 2JVDA 4OX9B 1H2MA 1A32A 4UCUA 4DV7B 2QA4V 2XAQA 4DV2B 2LFRA 4K8XA 5IT9N 5ITZA 2E5LO 1N36O 3LSUA 3H9VA 4MTOA 1SQFA 4NTYA 4JV5O 3IC7A 4XDKA 3G80A 2F4VB 2P5OA 1JPXA 3HKDB 3JAWA 2CTRA 1SQPH 5IE9A 2UUBO 1R6TA 1L1FA 1WP8A 4PA7A 4LFCO 1GM9A 3ZIAG 3QO8A 1COWG 5JVDA 4MVZA 1NI8A 1Y67A 5B1AB 3ZBHA 1XREA 3B2EE 4LF7O 3T4DA 4O4IB 3GVMA 4GLXA 4EFBA 3HPLC 1YITV 1S5JA 4IGGA 3JAMN 2VQFB 1CP9A 3A0RA 2W6IG 4DR6O 2EINC 5JJEB 1GO3F 4I9WA 2LGQA 1TUBB 1PPJH 3K0DA 1FD9A 2JRIA 4DR4O 4X20B 4JI3B 3FYIB 1LR1A 1WA8B 1FS0G 1SA0A 4JI1O 1V54B 4UVCA 2YI8A 2DW4A 2ODMA 4IYHA 5LGUA 5KHHA 2Z5UA 3CPWU 2YEVA 3ZHTA 2L6LA 3UO3A 1B3QA 3WG7B 5JJJB 4WFEA 1NR1A 1IBLB 4GKJO 1LNQA 2NNUA 1DLBA 1PKXA 4B3RB 4DR2O 3SJQC 1PP9H 3G4SV 1VF5B 2LGWA 1R3JC 2GTSA 3UQ8A 3UT5B 3R66A 4DR5B 3TETA 1BQ0A 2PZSA 1XILA 4Z1VA 2ZINA 5B1AC 3ZJZA 1DTOA 2B5UA 4I0XA 1G6UA 1XI1A 1XUQA 5CB4A 3B77A 2N04A 2JGDA 1XMQO 1QNMA 3P3PA 1PD3A 2Q69A 4CH4A 1QVFU 1KKCA 1MMMA 1Y76B 1ZTEA 2KB1A 3ZHQA 4JI2B 4P30A 5DEDA 4TV9A 3VBBA 3ZRWA 4OPHA 1OCRB 2YS8A 2OYQA 2OTLV 1N34O 3H1HH 4LC1A 3G6EV 1ZAUA 3FAVB 2EJ7A 2WLMA 3JSLA 4NXNB 1BMFG 1EN4A 2Y48A 5B1BB 3STZC 5LA6A 3CD6V 4HNAA 4UB8Z 4BR6A 5BXZA 2UU9O 3CCRV 4OPAA 4FPPA 3DC5A 4U3FH 5J2TA 1ZL8A 2GBOA 4JPRA 3K9SA 3SYPA 4ZBMA 5EYPA 5LMNO 2D2CB 3OD4A 1CXZB 3SR2C 2KQXA 3ABLC 2PTMA 2WLKA 2IJHA 2WLIB 1B06A 1GK9A 2DYSC 4X64B 2Q73A 2FYUH 2DMXA 3E8GA 4MTGA 1DK1A 2DWDC 1OCZB 1MZFA 4MT8A 4DR7O 4BW5A 2Q9LA 4K0KB 5IDJA 4I9QA 1G1XB 4X1YB 5IWAO 4EB6A 3OEEG 2QSAA 5LBQA 2QWOB 1MA1A 4LF6O 4LF5B 1FFXA 3JCUZ 4WCEV 3VQXA 3JASA 5KA6A 4F6EA 1QCEA 2PUSA 2P7TC 1HNWO 1OCRC 1S76D 1JMKC 1NR7A 3G6BA 1YF2A 2WLHA 2YIDA 4DR3B 3EVKA 2QM4A 4W4KA 5BMVA 4L87A 4LCUC 3OW2U 1NU1H 3RYHB 1VARA 3OAAG 1GRJA 1PL0A 3K5NA 5IYZA 3K59A 2IBZH 4FFBB 1VQ4V 2UXBO 4DK1A 1E1QG 1NKDA 5KX5B 3B4SA 3ZS8C 3QVNA 4KP4A 4FLUA 1R6KA 3E2EA 2K9PA 1Q86W 4JI0O 4MS2A 2QDOA 2AZ0A 4JZ2A 1QHTA 5KA5A 4KUMA 3RVZA 3ZCCA 4U7NA 2N74A 2WWWA 2UUCO 4LNUB 3MD0A 5B5EZ 3JD2A 1YJWV 1VQ9V 1VQOV 1K34A 4K8ZA 1GN6A 3KG2A 4DV6B 1VQLV 2HHHO 1O9HA 4I4TA 3BAAA 4H37A 1R1BA 2P6JA 3OTOB 2XAHA 3CB2A 2OIGA 2P90A 1N32B 4IL6Z 4YJ2B 2UXCB 4UXNA 1Y66A 4PDVA 2AZ2A 5FNVB 2EIKB 3ZHVA 2Q7HA 4H33A 5IJ0B 1Q82W 2QKCA 3JCZA 3CX5F 3K03A 4JI6O 1ORQC 2AXTZ 4PELA 2YSUB 4DRXA 1YCIA 1OCCB 4BIUA 1V55B 4P9PA 1Y74B 3H1IH 2AHZA 1FJGO 1V9PA 4RO2A 4KHPO 2CTWA 1R3LC 3L70H 4ABMA 3VQWA 4FZ0A 5FPOA 1E1RG 5FPRA 5EIBD 4ASUG 1ZX3A 1NTMH 3W7UA 2EIMB 4X66O 3I55V 2RNBA 3D36C 2P06A 4N21A 3W7TA 4JI7B 3BFRA 5L3FA 3BVOA 4J9YB 4JI8O 1IXMA 4LP8A 1TVKA 3JSNA 2QEXV 2DWEC 1NQTA 2CGNA 3IC9A 4XDJA 3DSQA 1IBKB 3M99B 4I7ZB 4IIJA 2WSSG 1W0JG 4PA4A 3CWBH 5LHHA 2EJRA 5LHGA 2JIZG 1JR9A 3E22A 2EIKC 2JJ1G 2ZIMA 2P4KA 3SDLA 3ABTA 1U97A 4PHZA 3B8NA 3C90A 1THZA 1NH2D 2FTKA 1M56C 1V55C 3CJHB 1FXHA 2H94A 5KHJA 1EN6A 5B3SB 4LWSB 5EIBC 2BOCC 4LF8O 4WFBV 3ML0A 4I55A 5K1XA 4GKKB 1WPBA 3B40A 2YXLA 1S0VA 4TSFG 1H2NA 5KAIZ 4OX9O 3CS5A 2B9ZA 4DV7O 2F1MA 4X89A 4X65B 1MSWD 3HKBA 3B09A 2LQTA 4O2BA 2R70A 1UPGA 1P7GA 2DQ0A 2KG7A 4AQYB 1IBMO 3ZRSA 2FKXA 4OXSA 3HKDA 5J9PC 2F4VO 1XEQA 2E76B 2BOBC 3N27A 1WJZA 3A8TA 3CSXA 1B6QA 3F7VC 1IVSA 2WAMA 1XL4A 2HJDA 4KFMA 2ETNA 1S5HC 3DTUB 2GV9A 4FVMA 1AI4A 1K92A 5B3SC 1BZKA 5JQGA 4MW8A 2VQFO 1WN7A 4PA9A 4GYCB 2NLJC 4Q20A 1K5QA 1TUBA 2CK3G 3SPCA 4X20A 3N2GB 1EFRG 4YY3O 3CCSV 1WA8A 1EZJA 4IHJB 3E8HA 1E79G 4BIZA 1GN3A 1BQZA 1H2KA 3AK3A 2XAJA 1F4MA 5B1NA 4KL1A 4I5SA 1HP8A 1ROPA 1IBLO 1VEWA 3O65A 4K3AA 2IH3C 4B3RO 2ZD9A 1H2LA 3UT5A 4GX1A 2IH1C 4X1KB 2CTQA 4O4HB 2X6AA 4DR5O 3JAKB 1VQMV 5H2FZ 4B3MO 3QG5A 3C3SA 1N0JA 2Q68A 4MTXA 4TT3G 4YXWG 4A5UB 1AR1B 3H1KH 1FXKC 3I56V 2DYRB 5GTHZ 4MVRA 3TK1A 3CCLV 3ETEA 3FAVA 1TGOA 3AK1A 4U7OA 2PY5A 2Q6AA 4NXNO 1GN4A 2CDYA 2D3OW 3DC6A 1ZWIC 4GT1A 1R73A 3K5OA 3U11A 5EK0A 1VP7A 3ZMTA 1K7DA 1BSMA 2OCCB 4O4JB 1AI6A 4DV3B 2BCCH 2C2AA 3GWKC 4UB6Z 1IURA 4JI5B 3SPJA 2QWQB 4DO2A 3CC4V 2F95B 5CBHA 1M4UA 2WLIA 3SYCA 3CRRA 3CXHF 4UVBA 5H6QA 4YJ3B 3E8BA 1HNXB 4PDRA 4X64O 3M8AA 5GONB 1UJWB 2UXDB 4PI2A 4QPJA 2PI4A 4LF4B 3J80N 3AG2C 4F6RA 2X7RB 4X1YA 2N05A 4K0KO 1PNLA 3MHSC 5C8YA 3FFQA 4DR1B 1SQBH 2G38A 4DUZB 4PA3A 2HP8A 3O9OA 4DV0O 1S3JA 1XNQB 3L72H 1GKFA 1SESA 1NTZH 5LP6B 2W6JG 2Y0PA 2JS3A 4DR3O 1GAXA 1RFYA 3U10A 3UM7A 3CCJV 2OCCC 1JFFB 4FFBA 3JYCA 3RYCB 4W4LA 3WU2Z 4FLZA 3K79A 4JYCA 4TUYA 4DV5B 2UUAO 3JARB 1YDXA 2XASA 2DN9A 3ZX6A 3ZN1A 3T1YB 1D5NA 3D36A 3OR6C 4I50A 3GWOA 2EZOA 4PA6A 4MVQA 5JWPA 1KBHA 1J5EO 4MW3A 4IYIA 3FKSG 2DQ3A 1X4TA 3G67A 4FM2A 3RYFB 5FL7G 1D2DA 3OMAB 1FYJA 2CH7A 1IZ3A 3ABKB 4NR1A 4DV6O 1ZUQA 5IJ9B 5CA1A 3TCUA 3OTOO 4O4LA 3BRCA 3CRQA 3CP1A 4QJFB 3MAQA 3E35A 1N32O 2UXCO 3RGBA 5JH7A 3TXQA 3K5MA 4D7SA 4B3SB 1VIBA 3SYQA 4MVSA 4X1IB 2E75B 2GUZB 3B8MA 3ZRXA 4YIPA 1Y74A 4DV1B 3LSQA 4HBNA 2OTJV 3U0ZA 3W7SA 1YEWA 4JGSA 1MNGA 4J42A 3VOUA 1S72V 3OGIB 4JI4B 2FB5A 2GTAA 4WBNA 5CA0A 1V54C 5J2UB 4JAVA 1I5XA 4FMTA 1RSOB 3IJ4A 3H1JH 3OTFA 3RBZA 4EFEA 1OJHA 4JI7O 3RW0A 1Z5VA 4WF9V 1NZ6A 5CBFA 2WA4A 3WG7C 4ZOLA 5LGTA 1LUWA 4JASA 2VQEO 1EBOA 4CS3A 2NN4A 1HNZB 3LNMB 3ICXA 3PN1A 2Y0IA 1F23A 1VQ5V 1IBKO 4CC5A 1SF9A 2K1EA 3A0BZ 4PD4F 1SQXH 2BSKA 3AG1B 2PF4E 1BHAA 1N0NA 1VQ8V 1FAFA 5BY1A 3CRMA 2RJZA 4B3TB 3K06A 3EFFK 3UCSC 1RM1B 3RYIB 3FYEB 4FM1A 1Q6HA 2P22C 4TV8B 3CCUV 1L0LH 1W59A 2P4VA 1GM7A 1VF7A 4UFZA 4ZHQA 5LXTB 4DXWA 1I94B 1G8MA 2NR5A 1K3EA 2QM8A 3PJSK 5B1BC 4GKKO 1NBMG 3GB7C 1IXBA 3CE2A 1BHBA 2E3CA 3K0GA 5JCOC 1YJNV 1BT8A 4U3JA 2ZNIA 2EULA 4PDMA 3CRCA 3ETDA 1PNMA 4X65O 3E86A 2HG5C 1XHXA 5JVDB 4YHHB 1S5LZ 2V4DA 5EC1C 1YJ9V 3TGUH 2F66C 1R3KC 4AQYO 5L3DA 3HB3B 2QE7G 1OCZC 2EX3A 2ADQB 3AG1C 4BAYA 1YHQV 3UKMA 1OCOB 1YXBA 2Y4TA 4LFBO 3QF7A 3N2KA 2XTAA 4ZI7B 5L3EA 2YIAA 4JTDB 3OE7G 2Q5ZA 5CA3A 4LF9B 5DM6V 3CMAV 1SA0B 3BA8A 2W0XA 1W2BU 1JVMA 3L75H 2YEVB 1FXKA 3CHXA 2R9RB 4GCZA 5CMUA 2JS5A 3N2GA 2XAGA 2HFEC 3CMEV 4N23A 4BIOA 1M90W 4HZ3A 2RN9A 4IHJA 4UV8A 3L73H 3FX7A 3T2MA 2RMKB 1P7BA 2OWOA 3QNEA 4H44B 2IJIA 5D5PA 4JTCB 1ENVA 4H0LB 1YZBA 4F4LA 4I0XB 2LW1A 5CB4B 2JGDB 1K4DC 5LYJB 3ZRVA 2DJVA 4LFAB 5H5NA 4TV9B 3ZRWB 3ABUA 5KHIA 4DUYB 2ZXWB 2A06H 2A3QA 4B08A 5HFMA 5L3BA 1XNRB 3JD0A 2AGAA 1F7YA 3JAKA 1YTFB 3D8CA 4JZGA 5LA6B 1MSDA 1MABG 4HYOA 3BPZA 2YUAA 4R50A 1YTFD 1Y6XA 4D6TH 3T1CA 3C3TA 1ZL8B 3RFRA 2ZE8A 3RT3C 1AI7A 4QGPA 2WLLB 3CEIA 1DF4A 3SJAC 5LMNB 2OCHA 3BY6A 5KHGA 5EYPB 3LSSA 2ZE7A 4X9QA 5KMGA 4RQEA 3QO5A 4MVUA 4P2ZA 3HKEA 4J9ZB 1ZLZA 2ZR3A 1IDSA 1OCCC 4GZRB 3H01A 1XHZA 2HLDG 5B1OA 2Q8VA 1JJOA 2HKOA 2GSMB 3Q4HB 1NVPB 4Z1MG 2Y4UA 3SPHA 2YICA 3MDSA 1AVMA 4PV1B 2VWKA 2XAFA 3OT7A 1NVPD 4DV3O 4BWAA 4TWKA 3LDEA 4EB6B 2EIMC 1GH6A 1VQNV 3JASB 5EZYB 5B66Z 3ZEDA 3CXCU 4DV2O 2CGOA 2IU3A 1XL6A 1HNXO 1HR0B 3JATB 3FD9A 3LDDA 2UXDO 5BMVB 1NTKH 3T1HB 3CC2V 4LF4O 3F5WC 4ZKIA 4QE9A 1QU7A 1XMOB 4E4EA 1O9GA 1KUQA 3ZHUA 4UCRA 5IYZB 1AJNA 4DR1O 4DUZO 5CBGA 4GX0A 1VQ7V 4J41A 2A79B 3H1LH 1X59A 4UV9A 2A7WA 1H8EG 1XDCA 3AEIA 2EILB 1XNQO 1SZXA 2QKSA 1Q3EA 2WA3A 1B04A 4UUJC 2VRZA 3NR7A 5EBWC 4O4IA 1N33B 1SQQH 3VQYA 4G27B 2QM7A 1G4YB 2XOKG 2EZPA 1SERA 2WPDG 1U96A 5FLXN 3S3WA 2VWJA 4I4TB 3JARA 2HVKC 1J95A 4DV5O 3L74H 2CUGA 4MSWC 3SPIA 4MVMA 3SYOA 2X6CA 4X88A 2AW9A 4JI3O 5A9GA 1AJPA 4J10A 5IY5B 4PI0A 3T1YO 4QPKA 3OR7C
chains in the Genus database with same CATH topology
1SQPH 3CWBH 4D6TH 1SQVH 1SQBH 3TGUH 3H1LH 1EZVH 3L71H 1KB9F 3H1HH 1BGYH 1BCCH 1NU1H 3CXHF 3L73H 3H1IH 1BE3H 3H1JH 3L74H 3L72H 2A06H 1NTKH 5KLVH 1NTZH 3L70H 2IBZH 1PPJH 2BCCH 1SQQH 2FYUH 3L75H 1P84F 3H1KH 1L0LH 4U3FH 4PD4F 1KYOF 1SQXH 1NTMH 1PP9H 3CX5F 3BCCH 1L0NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP H;  3CWB H;  4D6T H;  1SQV H;  1SQB H;  3TGU H;  3H1L H;  1EZV H;  3L71 H;  1KB9 F;  3H1H H;  1BGY H;  1BCC H;  1NU1 H;  3CXH F;  3L73 H;  3H1I H;  1BE3 H;  3H1J H;  3L74 H;  3L72 H;  2A06 H;  1NTK H;  5KLV H;  1NTZ H;  3L70 H;  2IBZ H;  1PPJ H;  2BCC H;  1SQQ H;  2FYU H;  3L75 H;  1P84 F;  3H1K H;  1L0L H;  4U3F H;  4PD4 F;  1KYO F;  1SQX H;  1NTM H;  1PP9 H;  3CX5 F;  3BCC H;  1L0N H; 
#chains in the Genus database with same CATH topology
 1QLE B;  2EIJ B;  5LHI A;  2IJK A;  2YI9 A;  2W0F C;  5IJ9 A;  1US6 A;  1FJG B;  3OGC C;  4DRX B;  3WB1 A;  4CBC A;  1RP3 B;  1WLE A;  1Q5O A;  1XOU A;  1JCH A;  4FM0 A;  4DK0 A;  3BCC H;  3CRA A;  4GX5 A;  1YSC A;  3SGI A;  2MK3 A;  3AK2 A;  5DEC A;  4B3S O;  4NTW A;  3LUT B;  4NKG B;  4UCV A;  1RPO A;  4IT5 A;  5A2Q N;  1EM1 A;  1NS1 A;  1Y76 A;  3JAL B;  5H9C A;  4UCS A;  5LOV B;  4EEQ A;  4NTX A;  3CCQ V;  1TA8 A;  2ZDI C;  5BR8 B;  4JI2 O;  4DV1 O;  1YVW A;  2Q7G A;  4TQD A;  4R7C A;  1M5I A;  1M57 B;  4BW9 A;  5K1P A;  2GHY A;  3EXA A;  1AI5 A;  1SC5 B;  4JI4 O;  3OM3 B;  4IIJ B;  5JCO A;  1VF6 C;  5IY5 C;  1RSO A;  3KCY A;  2RQ6 A;  1HDJ A;  3D3Q A;  1I08 A;  5C93 A;  1P84 F;  2QGN A;  1DGS A;  1WNS A;  3ZMU A;  4C7U A;  4FLV A;  2EBO A;  5EBL C;  1R3I C;  2PI5 A;  1N4C A;  1ARO P;  5L3G A;  2R9A A;  1M93 A;  3W7X A;  2YDE A;  5D5Q A;  3BAB A;  1BCC H;  1Y4M A;  4RWU A;  2IW5 A;  2IJJ A;  5AG2 A;  2RCV A;  1QR8 A;  1BL8 A;  1DF5 A;  2V7Q G;  4UVA A;  3F5T A;  2EIN B;  4I55 B;  5IYC O;  5IYD O;  3JD3 A;  3F7Y C;  3FB7 C;  1Z2G A;  2A9H A;  1PL4 A;  3ETG A;  2ITC C;  2QJ1 A;  1GM8 A;  3ABM B;  4YIO A;  1FPO A;  4NXM B;  2Y69 B;  3VQV A;  3DXR B;  2ZCE A;  4B7E A;  5HFL A;  1K73 W;  2XUM A;  3RYI A;  1KKD A;  3RVY A;  2QTO A;  4B3T O;  3HKB B;  4LF5 O;  3IGA C;  1AJQ A;  4TV8 A;  4DV4 B;  2ILM A;  5LXT A;  5L3C A;  3S3X A;  1YI2 V;  4O2B B;  2YC0 A;  2DYR C;  1XBL A;  1IBM B;  2LW7 A;  1M57 C;  2JDI G;  2KG7 B;  4FFK A;  1I94 O;  1AP6 A;  3KZI Z;  1K8A W;  4JYY A;  4Z2W A;  3SJC C;  4XBF A;  2QWP B;  2V1D A;  1MOF A;  1HWY A;  3RYH A;  2ZE5 A;  2A0L A;  1VQP V;  4X62 B;  1VQ6 V;  2QWR B;  1AR4 A;  2ZIO A;  1I7F A;  5KX5 A;  4CZZ A;  2CTP A;  4E2L A;  1T5E A;  3WFV A;  1VMG A;  4YHH O;  1QR9 A;  1QQC A;  2YIB D;  1HW7 A;  4B7K A;  1SQV H;  4LNU A;  1SET A;  4OGQ B;  5JQG B;  2BTQ B;  3BA9 A;  1K97 A;  3BHP A;  1SQG A;  2B1G A;  3ABM C;  4YY3 B;  3MHH C;  4ZI7 A;  2Y69 C;  3HR0 A;  2DE0 X;  1SS3 A;  3IFX A;  4LF9 O;  3OUS A;  1WB7 A;  2AHY A;  4YJ2 A;  3CCE V;  4D7T A;  2UXX A;  3BEH A;  5LP6 C;  5FNV A;  5H6R A;  3ZN0 A;  4JF3 A;  5E1A C;  5IJ0 A;  4JYA B;  3ABL B;  3W7W A;  1P49 A;  1SRY A;  1PV0 A;  2DYS B;  4MTF A;  1R6N A;  2ZM6 B;  3P3N A;  3QO7 A;  1EN5 A;  5EC2 C;  4FLT A;  2CAZ C;  4B3M B;  3ZMZ A;  1KP3 A;  1WP7 A;  2LFS A;  3I5D A;  5LYJ A;  1H2S B;  3L9D A;  3CCV V;  1OHH G;  4LFA O;  4CS2 A;  3J7A U;  4J7Z A;  3ZHR A;  1EZV H;  3L71 H;  4DUY O;  3K3W A;  4QE7 A;  3ABK C;  4UCO A;  1XNR O;  3CCM V;  4XDL A;  4MVO A;  3E89 A;  5BZB A;  5LMU B;  1S77 D;  3HKC B;  4DYL A;  4O2A B;  2ZR2 A;  4X8A A;  5KUM A;  4AIL C;  4QNH B;  2WLL A;  4UCT A;  2H3O A;  4WFG A;  2FML A;  4J7J A;  1MG1 A;  3OMN B;  2ZE6 A;  2OT5 A;  2E5L B;  2QWN B;  2KKW A;  1N36 B;  2BTO A;  2IM9 A;  5ITZ B;  3CJH A;  2HEP A;  1KEC A;  4LWS A;  3Q4H A;  3NXS A;  3JD4 A;  4JV5 B;  2FL4 A;  1GMG A;  4F6R B;  1KC8 W;  2R9I A;  1GN2 A;  4WFF A;  2UUB B;  1Q6U A;  4R6Z A;  3JAW B;  5C8Y B;  2ZT9 B;  1NJI W;  3K9A A;  4DV0 B;  4LFC B;  5EZY A;  5JJN B;  5EBM C;  3T4Z A;  4JAU A;  3KKY A;  1Q90 D;  1CPY A;  3JAT A;  5CN0 A;  4LF7 B;  2JEX A;  4R8C A;  4PJ0 Z;  2Q7E A;  4NB5 A;  1HR0 O;  1FFT B;  1M1K W;  2LJ2 A;  2XHB A;  2ZKO A;  5LGN A;  3T1H O;  3THO A;  4DR6 B;  5KLV H;  4K35 A;  2QKA A;  1XMO O;  2UUA B;  1OV9 A;  3K04 A;  1H2G A;  3M7M X;  4TUY B;  4GUN A;  4DR4 B;  1QVG U;  1KU9 A;  1Q43 A;  4QIW F;  1Q7Y W;  2WLN A;  4JI1 B;  3ASN B;  4LR3 A;  1RM1 C;  1BGY H;  3ETQ A;  4DW1 A;  1AIL A;  1H8H G;  2KSD A;  2YXH A;  3OMI B;  4I50 B;  1J5E B;  1N33 O;  4ICG A;  2Z3Y A;  2ADP A;  2XT9 A;  3APO A;  2ZDI A;  4GKJ B;  1TUE B;  2HVJ C;  2ITD C;  3X2Q B;  2F93 B;  2CH7 B;  1KMI Z;  4DR2 B;  5KAF Z;  3WB2 A;  5CA1 B;  4O4L B;  2PYJ A;  1M9N A;  2QTS A;  4FLW A;  3D3I A;  3R65 A;  1VF6 A;  1UFI A;  1OZ0 A;  5JH7 B;  3UO2 A;  4AHC A;  1XMQ B;  5LL6 Y;  5GTI Z;  3LDC A;  1F4N A;  2HR3 A;  2ZQM A;  3IAY A;  1M56 B;  2Q4P A;  1PNK A;  2RDC A;  3WB0 A;  3SPG A;  2JK5 C;  1N34 B;  4NYK A;  1YIJ V;  1OCO C;  1ZSP A;  2PYL A;  5E79 Z;  2DOS A;  3AG7 A;  4X1K A;  1MZE A;  4O4H A;  3A0H Z;  2UU9 B;  4DW0 A;  3ASN C;  4J11 A;  4HNA B;  3STL C;  4WBN B;  5CA0 B;  4FLY A;  2Q67 A;  4G2K A;  3JAL A;  4WFH A;  5LOV A;  5J2T B;  2PGG A;  4RUE A;  2M6Y A;  2JGU A;  3JD1 A;  3X2Q C;  3AG4 B;  3CYO A;  4ZOL B;  2LO1 A;  5BR8 O;  3RN4 A;  2VQE B;  3E8F A;  1JA8 A;  4LH7 A;  1L0N H;  3DGE A;  2X6B A;  1K4C C;  3APQ A;  2HJF C;  4DR7 B;  2IU0 A;  2BSK B;  3CC7 V;  4O4J A;  1FXV A;  2L35 A;  5IWA B;  4CH3 A;  1Q8I A;  2JEU A;  3K58 A;  1NH2 B;  4LF6 B;  2UXN A;  1K33 A;  1AB3 A;  4LBE C;  1AP5 A;  5TIS Z;  1FFX B;  1HNW B;  4JI5 O;  2VS0 A;  2Q0A A;  1Q6I A;  4YJ3 A;  1WAZ A;  4ZHQ B;  2ZXW C;  4TOI A;  4AI8 A;  5GON A;  1P4R A;  1RPR A;  2JJ2 G;  1WPX A;  4CC6 A;  1IX9 A;  4FJC C;  4J80 A;  3DXR A;  2ATK C;  2Z0A A;  4U3J B;  2UXB B;  4NXM O;  4KXR A;  3ZHS A;  3EHB B;  1KP2 A;  2F43 G;  3ZMV A;  4JI0 B;  3G71 V;  2GDS A;  3AG4 C;  4DV4 O;  5LP6 A;  3ZMS A;  5KUK A;  2UUC B;  1W0K G;  3AG3 B;  4TQF A;  2ARH A;  3P32 A;  2X0L A;  3K57 A;  2H8P C;  5GW7 A;  1JFF A;  3RYC A;  4LFB B;  2WLJ A;  2HHH B;  4X62 O;  1F51 A;  4ZIB A;  3OEH G;  3LNN A;  1FKA O;  2YIB A;  3N2K B;  2M7W A;  1JX9 A;  3ASO B;  2ZNJ A;  5F2V O;  1NT2 B;  3FB8 C;  1LUV A;  2E74 B;  2LP7 A;  2OIE A;  2P67 A;  4EKW A;  4RAI A;  2BTQ A;  1WB8 A;  4JAA A;  1N8R W;  1FXK B;  4JI6 B;  1I5Y A;  3TXS A;  3RYF A;  1QLN A;  3SJB C;  4H13 B;  2O57 A;  4KHP B;  4G28 B;  5IYB O;  1Q81 W;  1QBZ A;  4FLX A;  2QR4 A;  4CH5 A;  2YXY A;  4NVP A;  3KCX A;  1KYO F;  2EIL C;  5DN6 G;  2Q0O C;  4X66 B;  2F23 A;  1AR5 A;  3E83 A;  3AG3 C;  1VQK V;  4X1I A;  1I0H A;  3OUF A;  2BE3 A;  3TJT A;  2GUZ A;  4JYA O;  1Z5W A;  4FK5 C;  4CH6 A;  4JI8 B;  2XND G;  4LH6 A;  3RWR D;  1JOY A;  1SZT A;  4Q6G A;  1TVK B;  2ZM6 O;  1XQ8 A;  1K5S A;  3AG2 B;  3ASO C;  3SYA A;  4CS4 A;  2R72 A;  1D5A A;  4FZ1 A;  3OFN G;  1PM9 A;  1L8D A;  1KB9 F;  4JYB A;  1KQS U;  4JTA B;  1JQ0 A;  1BE3 H;  3QTC A;  1BS3 A;  1KD1 W;  1K9M W;  5J2U A;  3A2F A;  3FB5 C;  4RQF A;  3E22 B;  4PDL A;  3P30 A;  1CEZ A;  1QLE C;  1JJ2 U;  2EIJ C;  3K08 A;  5KMG B;  1GTO A;  1SKV A;  1URF A;  3HKE B;  3K5L A;  3J81 N;  2MW2 B;  2CE4 A;  4HAM A;  3FB6 C;  4FIP C;  4P9O A;  3HKC A;  4LF8 B;  4O2A A;  2B1I A;  4J7K A;  1HNZ O;  5LMU O;  1TAE A;  4GX2 A;  5KHK A;  4WFA V;  4RUF A;  1H38 A;  4L8J A;  2JVD A;  4OX9 B;  1H2M A;  1A32 A;  4UCU A;  4DV7 B;  2QA4 V;  2XAQ A;  4DV2 B;  2LFR A;  4K8X A;  5IT9 N;  5ITZ A;  2E5L O;  1N36 O;  3LSU A;  3H9V A;  4MTO A;  1SQF A;  4NTY A;  4JV5 O;  3IC7 A;  4XDK A;  3G80 A;  2F4V B;  2P5O A;  1JPX A;  3HKD B;  3JAW A;  2CTR A;  1SQP H;  5IE9 A;  2UUB O;  1R6T A;  1L1F A;  1WP8 A;  4PA7 A;  4LFC O;  1GM9 A;  3ZIA G;  3QO8 A;  1COW G;  5JVD A;  4MVZ A;  1NI8 A;  1Y67 A;  5B1A B;  3ZBH A;  1XRE A;  3B2E E;  4LF7 O;  3T4D A;  4O4I B;  3GVM A;  4GLX A;  4EFB A;  3HPL C;  1YIT V;  1S5J A;  4IGG A;  3JAM N;  2VQF B;  1CP9 A;  3A0R A;  2W6I G;  4DR6 O;  2EIN C;  5JJE B;  1GO3 F;  4I9W A;  2LGQ A;  1TUB B;  1PPJ H;  3K0D A;  1FD9 A;  2JRI A;  4DR4 O;  4X20 B;  4JI3 B;  3FYI B;  1LR1 A;  1WA8 B;  1FS0 G;  1SA0 A;  4JI1 O;  1V54 B;  4UVC A;  2YI8 A;  2DW4 A;  2ODM A;  4IYH A;  5LGU A;  5KHH A;  2Z5U A;  3CPW U;  2YEV A;  3ZHT A;  2L6L A;  3UO3 A;  1B3Q A;  3WG7 B;  5JJJ B;  4WFE A;  1NR1 A;  1IBL B;  4GKJ O;  1LNQ A;  2NNU A;  1DLB A;  1PKX A;  4B3R B;  4DR2 O;  3SJQ C;  1PP9 H;  3G4S V;  1VF5 B;  2LGW A;  1R3J C;  2GTS A;  3UQ8 A;  3UT5 B;  3R66 A;  4DR5 B;  3TET A;  1BQ0 A;  2PZS A;  1XIL A;  4Z1V A;  2ZIN A;  5B1A C;  3ZJZ A;  1DTO A;  2B5U A;  4I0X A;  1G6U A;  1XI1 A;  1XUQ A;  5CB4 A;  3B77 A;  2N04 A;  2JGD A;  1XMQ O;  1QNM A;  3P3P A;  1PD3 A;  2Q69 A;  4CH4 A;  1QVF U;  1KKC A;  1MMM A;  1Y76 B;  1ZTE A;  2KB1 A;  3ZHQ A;  4JI2 B;  4P30 A;  5DED A;  4TV9 A;  3VBB A;  3ZRW A;  4OPH A;  1OCR B;  2YS8 A;  2OYQ A;  2OTL V;  1N34 O;  3H1H H;  4LC1 A;  3G6E V;  1ZAU A;  3FAV B;  2EJ7 A;  2WLM A;  3JSL A;  4NXN B;  1BMF G;  1EN4 A;  2Y48 A;  5B1B B;  3STZ C;  5LA6 A;  3CD6 V;  4HNA A;  4UB8 Z;  4BR6 A;  5BXZ A;  2UU9 O;  3CCR V;  4OPA A;  4FPP A;  3DC5 A;  4U3F H;  5J2T A;  1ZL8 A;  2GBO A;  4JPR A;  3K9S A;  3SYP A;  4ZBM A;  5EYP A;  5LMN O;  2D2C B;  3OD4 A;  1CXZ B;  3SR2 C;  2KQX A;  3ABL C;  2PTM A;  2WLK A;  2IJH A;  2WLI B;  1B06 A;  1GK9 A;  2DYS C;  4X64 B;  2Q73 A;  2FYU H;  2DMX A;  3E8G A;  4MTG A;  1DK1 A;  2DWD C;  1OCZ B;  1MZF A;  4MT8 A;  4DR7 O;  4BW5 A;  2Q9L A;  4K0K B;  5IDJ A;  4I9Q A;  1G1X B;  4X1Y B;  5IWA O;  4EB6 A;  3OEE G;  2QSA A;  5LBQ A;  2QWO B;  1MA1 A;  4LF6 O;  4LF5 B;  1FFX A;  3JCU Z;  4WCE V;  3VQX A;  3JAS A;  5KA6 A;  4F6E A;  1QCE A;  2PUS A;  2P7T C;  1HNW O;  1OCR C;  1S76 D;  1JMK C;  1NR7 A;  3G6B A;  1YF2 A;  2WLH A;  2YID A;  4DR3 B;  3EVK A;  2QM4 A;  4W4K A;  5BMV A;  4L87 A;  4LCU C;  3OW2 U;  1NU1 H;  3RYH B;  1VAR A;  3OAA G;  1GRJ A;  1PL0 A;  3K5N A;  5IYZ A;  3K59 A;  2IBZ H;  4FFB B;  1VQ4 V;  2UXB O;  4DK1 A;  1E1Q G;  1NKD A;  5KX5 B;  3B4S A;  3ZS8 C;  3QVN A;  4KP4 A;  4FLU A;  1R6K A;  3E2E A;  2K9P A;  1Q86 W;  4JI0 O;  4MS2 A;  2QDO A;  2AZ0 A;  4JZ2 A;  1QHT A;  5KA5 A;  4KUM A;  3RVZ A;  3ZCC A;  4U7N A;  2N74 A;  2WWW A;  2UUC O;  4LNU B;  3MD0 A;  5B5E Z;  3JD2 A;  1YJW V;  1VQ9 V;  1VQO V;  1K34 A;  4K8Z A;  1GN6 A;  3KG2 A;  4DV6 B;  1VQL V;  2HHH O;  1O9H A;  4I4T A;  3BAA A;  4H37 A;  1R1B A;  2P6J A;  3OTO B;  2XAH A;  3CB2 A;  2OIG A;  2P90 A;  1N32 B;  4IL6 Z;  4YJ2 B;  2UXC B;  4UXN A;  1Y66 A;  4PDV A;  2AZ2 A;  5FNV B;  2EIK B;  3ZHV A;  2Q7H A;  4H33 A;  5IJ0 B;  1Q82 W;  2QKC A;  3JCZ A;  3CX5 F;  3K03 A;  4JI6 O;  1ORQ C;  2AXT Z;  4PEL A;  2YSU B;  4DRX A;  1YCI A;  1OCC B;  4BIU A;  1V55 B;  4P9P A;  1Y74 B;  3H1I H;  2AHZ A;  1FJG O;  1V9P A;  4RO2 A;  4KHP O;  2CTW A;  1R3L C;  3L70 H;  4ABM A;  3VQW A;  4FZ0 A;  5FPO A;  1E1R G;  5FPR A;  5EIB D;  4ASU G;  1ZX3 A;  1NTM H;  3W7U A;  2EIM B;  4X66 O;  3I55 V;  2RNB A;  3D36 C;  2P06 A;  4N21 A;  3W7T A;  4JI7 B;  3BFR A;  5L3F A;  3BVO A;  4J9Y B;  4JI8 O;  1IXM A;  4LP8 A;  1TVK A;  3JSN A;  2QEX V;  2DWE C;  1NQT A;  2CGN A;  3IC9 A;  4XDJ A;  3DSQ A;  1IBK B;  3M99 B;  4I7Z B;  4IIJ A;  2WSS G;  1W0J G;  4PA4 A;  3CWB H;  5LHH A;  2EJR A;  5LHG A;  2JIZ G;  1JR9 A;  3E22 A;  2EIK C;  2JJ1 G;  2ZIM A;  2P4K A;  3SDL A;  3ABT A;  1U97 A;  4PHZ A;  3B8N A;  3C90 A;  1THZ A;  1NH2 D;  2FTK A;  1M56 C;  1V55 C;  3CJH B;  1FXH A;  2H94 A;  5KHJ A;  1EN6 A;  5B3S B;  4LWS B;  5EIB C;  2BOC C;  4LF8 O;  4WFB V;  3ML0 A;  4I55 A;  5K1X A;  4GKK B;  1WPB A;  3B40 A;  2YXL A;  1S0V A;  4TSF G;  1H2N A;  5KAI Z;  4OX9 O;  3CS5 A;  2B9Z A;  4DV7 O;  2F1M A;  4X89 A;  4X65 B;  1MSW D;  3HKB A;  3B09 A;  2LQT A;  4O2B A;  2R70 A;  1UPG A;  1P7G A;  2DQ0 A;  2KG7 A;  4AQY B;  1IBM O;  3ZRS A;  2FKX A;  4OXS A;  3HKD A;  5J9P C;  2F4V O;  1XEQ A;  2E76 B;  2BOB C;  3N27 A;  1WJZ A;  3A8T A;  3CSX A;  1B6Q A;  3F7V C;  1IVS A;  2WAM A;  1XL4 A;  2HJD A;  4KFM A;  2ETN A;  1S5H C;  3DTU B;  2GV9 A;  4FVM A;  1AI4 A;  1K92 A;  5B3S C;  1BZK A;  5JQG A;  4MW8 A;  2VQF O;  1WN7 A;  4PA9 A;  4GYC B;  2NLJ C;  4Q20 A;  1K5Q A;  1TUB A;  2CK3 G;  3SPC A;  4X20 A;  3N2G B;  1EFR G;  4YY3 O;  3CCS V;  1WA8 A;  1EZJ A;  4IHJ B;  3E8H A;  1E79 G;  4BIZ A;  1GN3 A;  1BQZ A;  1H2K A;  3AK3 A;  2XAJ A;  1F4M A;  5B1N A;  4KL1 A;  4I5S A;  1HP8 A;  1ROP A;  1IBL O;  1VEW A;  3O65 A;  4K3A A;  2IH3 C;  4B3R O;  2ZD9 A;  1H2L A;  3UT5 A;  4GX1 A;  2IH1 C;  4X1K B;  2CTQ A;  4O4H B;  2X6A A;  4DR5 O;  3JAK B;  1VQM V;  5H2F Z;  4B3M O;  3QG5 A;  3C3S A;  1N0J A;  2Q68 A;  4MTX A;  4TT3 G;  4YXW G;  4A5U B;  1AR1 B;  3H1K H;  1FXK C;  3I56 V;  2DYR B;  5GTH Z;  4MVR A;  3TK1 A;  3CCL V;  3ETE A;  3FAV A;  1TGO A;  3AK1 A;  4U7O A;  2PY5 A;  2Q6A A;  4NXN O;  1GN4 A;  2CDY A;  2D3O W;  3DC6 A;  1ZWI C;  4GT1 A;  1R73 A;  3K5O A;  3U11 A;  5EK0 A;  1VP7 A;  3ZMT A;  1K7D A;  1BSM A;  2OCC B;  4O4J B;  1AI6 A;  4DV3 B;  2BCC H;  2C2A A;  3GWK C;  4UB6 Z;  1IUR A;  4JI5 B;  3SPJ A;  2QWQ B;  4DO2 A;  3CC4 V;  2F95 B;  5CBH A;  1M4U A;  2WLI A;  3SYC A;  3CRR A;  3CXH F;  4UVB A;  5H6Q A;  4YJ3 B;  3E8B A;  1HNX B;  4PDR A;  4X64 O;  3M8A A;  5GON B;  1UJW B;  2UXD B;  4PI2 A;  4QPJ A;  2PI4 A;  4LF4 B;  3J80 N;  3AG2 C;  4F6R A;  2X7R B;  4X1Y A;  2N05 A;  4K0K O;  1PNL A;  3MHS C;  5C8Y A;  3FFQ A;  4DR1 B;  1SQB H;  2G38 A;  4DUZ B;  4PA3 A;  2HP8 A;  3O9O A;  4DV0 O;  1S3J A;  1XNQ B;  3L72 H;  1GKF A;  1SES A;  1NTZ H;  5LP6 B;  2W6J G;  2Y0P A;  2JS3 A;  4DR3 O;  1GAX A;  1RFY A;  3U10 A;  3UM7 A;  3CCJ V;  2OCC C;  1JFF B;  4FFB A;  3JYC A;  3RYC B;  4W4L A;  3WU2 Z;  4FLZ A;  3K79 A;  4JYC A;  4TUY A;  4DV5 B;  2UUA O;  3JAR B;  1YDX A;  2XAS A;  2DN9 A;  3ZX6 A;  3ZN1 A;  3T1Y B;  1D5N A;  3D36 A;  3OR6 C;  4I50 A;  3GWO A;  2EZO A;  4PA6 A;  4MVQ A;  5JWP A;  1KBH A;  1J5E O;  4MW3 A;  4IYI A;  3FKS G;  2DQ3 A;  1X4T A;  3G67 A;  4FM2 A;  3RYF B;  5FL7 G;  1D2D A;  3OMA B;  1FYJ A;  2CH7 A;  1IZ3 A;  3ABK B;  4NR1 A;  4DV6 O;  1ZUQ A;  5IJ9 B;  5CA1 A;  3TCU A;  3OTO O;  4O4L A;  3BRC A;  3CRQ A;  3CP1 A;  4QJF B;  3MAQ A;  3E35 A;  1N32 O;  2UXC O;  3RGB A;  5JH7 A;  3TXQ A;  3K5M A;  4D7S A;  4B3S B;  1VIB A;  3SYQ A;  4MVS A;  4X1I B;  2E75 B;  2GUZ B;  3B8M A;  3ZRX A;  4YIP A;  1Y74 A;  4DV1 B;  3LSQ A;  4HBN A;  2OTJ V;  3U0Z A;  3W7S A;  1YEW A;  4JGS A;  1MNG A;  4J42 A;  3VOU A;  1S72 V;  3OGI B;  4JI4 B;  2FB5 A;  2GTA A;  4WBN A;  5CA0 A;  1V54 C;  5J2U B;  4JAV A;  1I5X A;  4FMT A;  1RSO B;  3IJ4 A;  3H1J H;  3OTF A;  3RBZ A;  4EFE A;  1OJH A;  4JI7 O;  3RW0 A;  1Z5V A;  4WF9 V;  1NZ6 A;  5CBF A;  2WA4 A;  3WG7 C;  4ZOL A;  5LGT A;  1LUW A;  4JAS A;  2VQE O;  1EBO A;  4CS3 A;  2NN4 A;  1HNZ B;  3LNM B;  3ICX A;  3PN1 A;  2Y0I A;  1F23 A;  1VQ5 V;  1IBK O;  4CC5 A;  1SF9 A;  2K1E A;  3A0B Z;  4PD4 F;  1SQX H;  2BSK A;  3AG1 B;  2PF4 E;  1BHA A;  1N0N A;  1VQ8 V;  1FAF A;  5BY1 A;  3CRM A;  2RJZ A;  4B3T B;  3K06 A;  3EFF K;  3UCS C;  1RM1 B;  3RYI B;  3FYE B;  4FM1 A;  1Q6H A;  2P22 C;  4TV8 B;  3CCU V;  1L0L H;  1W59 A;  2P4V A;  1GM7 A;  1VF7 A;  4UFZ A;  4ZHQ A;  5LXT B;  4DXW A;  1I94 B;  1G8M A;  2NR5 A;  1K3E A;  2QM8 A;  3PJS K;  5B1B C;  4GKK O;  1NBM G;  3GB7 C;  1IXB A;  3CE2 A;  1BHB A;  2E3C A;  3K0G A;  5JCO C;  1YJN V;  1BT8 A;  4U3J A;  2ZNI A;  2EUL A;  4PDM A;  3CRC A;  3ETD A;  1PNM A;  4X65 O;  3E86 A;  2HG5 C;  1XHX A;  5JVD B;  4YHH B;  1S5L Z;  2V4D A;  5EC1 C;  1YJ9 V;  3TGU H;  2F66 C;  1R3K C;  4AQY O;  5L3D A;  3HB3 B;  2QE7 G;  1OCZ C;  2EX3 A;  2ADQ B;  3AG1 C;  4BAY A;  1YHQ V;  3UKM A;  1OCO B;  1YXB A;  2Y4T A;  4LFB O;  3QF7 A;  3N2K A;  2XTA A;  4ZI7 B;  5L3E A;  2YIA A;  4JTD B;  3OE7 G;  2Q5Z A;  5CA3 A;  4LF9 B;  5DM6 V;  3CMA V;  1SA0 B;  3BA8 A;  2W0X A;  1W2B U;  1JVM A;  3L75 H;  2YEV B;  1FXK A;  3CHX A;  2R9R B;  4GCZ A;  5CMU A;  2JS5 A;  3N2G A;  2XAG A;  2HFE C;  3CME V;  4N23 A;  4BIO A;  1M90 W;  4HZ3 A;  2RN9 A;  4IHJ A;  4UV8 A;  3L73 H;  3FX7 A;  3T2M A;  2RMK B;  1P7B A;  2OWO A;  3QNE A;  4H44 B;  2IJI A;  5D5P A;  4JTC B;  1ENV A;  4H0L B;  1YZB A;  4F4L A;  4I0X B;  2LW1 A;  5CB4 B;  2JGD B;  1K4D C;  5LYJ B;  3ZRV A;  2DJV A;  4LFA B;  5H5N A;  4TV9 B;  3ZRW B;  3ABU A;  5KHI A;  4DUY B;  2ZXW B;  2A06 H;  2A3Q A;  4B08 A;  5HFM A;  5L3B A;  1XNR B;  3JD0 A;  2AGA A;  1F7Y A;  3JAK A;  1YTF B;  3D8C A;  4JZG A;  5LA6 B;  1MSD A;  1MAB G;  4HYO A;  3BPZ A;  2YUA A;  4R50 A;  1YTF D;  1Y6X A;  4D6T H;  3T1C A;  3C3T A;  1ZL8 B;  3RFR A;  2ZE8 A;  3RT3 C;  1AI7 A;  4QGP A;  2WLL B;  3CEI A;  1DF4 A;  3SJA C;  5LMN B;  2OCH A;  3BY6 A;  5KHG A;  5EYP B;  3LSS A;  2ZE7 A;  4X9Q A;  5KMG A;  4RQE A;  3QO5 A;  4MVU A;  4P2Z A;  3HKE A;  4J9Z B;  1ZLZ A;  2ZR3 A;  1IDS A;  1OCC C;  4GZR B;  3H01 A;  1XHZ A;  2HLD G;  5B1O A;  2Q8V A;  1JJO A;  2HKO A;  2GSM B;  3Q4H B;  1NVP B;  4Z1M G;  2Y4U A;  3SPH A;  2YIC A;  3MDS A;  1AVM A;  4PV1 B;  2VWK A;  2XAF A;  3OT7 A;  1NVP D;  4DV3 O;  4BWA A;  4TWK A;  3LDE A;  4EB6 B;  2EIM C;  1GH6 A;  1VQN V;  3JAS B;  5EZY B;  5B66 Z;  3ZED A;  3CXC U;  4DV2 O;  2CGO A;  2IU3 A;  1XL6 A;  1HNX O;  1HR0 B;  3JAT B;  3FD9 A;  3LDD A;  2UXD O;  5BMV B;  1NTK H;  3T1H B;  3CC2 V;  4LF4 O;  3F5W C;  4ZKI A;  4QE9 A;  1QU7 A;  1XMO B;  4E4E A;  1O9G A;  1KUQ A;  3ZHU A;  4UCR A;  5IYZ B;  1AJN A;  4DR1 O;  4DUZ O;  5CBG A;  4GX0 A;  1VQ7 V;  4J41 A;  2A79 B;  3H1L H;  1X59 A;  4UV9 A;  2A7W A;  1H8E G;  1XDC A;  3AEI A;  2EIL B;  1XNQ O;  1SZX A;  2QKS A;  1Q3E A;  2WA3 A;  1B04 A;  4UUJ C;  2VRZ A;  3NR7 A;  5EBW C;  4O4I A;  1N33 B;  1SQQ H;  3VQY A;  4G27 B;  2QM7 A;  1G4Y B;  2XOK G;  2EZP A;  1SER A;  2WPD G;  1U96 A;  5FLX N;  3S3W A;  2VWJ A;  4I4T B;  3JAR A;  2HVK C;  1J95 A;  4DV5 O;  3L74 H;  2CUG A;  4MSW C;  3SPI A;  4MVM A;  3SYO A;  2X6C A;  4X88 A;  2AW9 A;  4JI3 O;  5A9G A;  1AJP A;  4J10 A;  5IY5 B;  4PI0 A;  3T1Y O;  4QPK A;  3OR7 C; 
#chains in the Genus database with same CATH homology
 1SQP H;  3CWB H;  4D6T H;  1SQV H;  1SQB H;  3TGU H;  3H1L H;  1EZV H;  3L71 H;  1KB9 F;  3H1H H;  1BGY H;  1BCC H;  1NU1 H;  3CXH F;  3L73 H;  3H1I H;  1BE3 H;  3H1J H;  3L74 H;  3L72 H;  2A06 H;  1NTK H;  5KLV H;  1NTZ H;  3L70 H;  2IBZ H;  1PPJ H;  2BCC H;  1SQQ H;  2FYU H;  3L75 H;  1P84 F;  3H1K H;  1L0L H;  4U3F H;  4PD4 F;  1KYO F;  1SQX H;  1NTM H;  1PP9 H;  3CX5 F;  3BCC H;  1L0N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...