3H1HH

Cytochrome bc1 complex from chicken
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 24
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1hH00
1NTMH 2FYUH 2IBZH 3H1KH 1SQXH 1SQPH 1EZVH 3L75H 1KYOF 1SQVH 4U3FH 3H1IH 3H1LH 1PPJH 1SQQH 1SQBH 1L0LH 3H1HH 4PD4F 3L71H 1NTKH 1PP9H 3CX5F 3BCCH 3CWBH 4D6TH 1NU1H 3L74H 3TGUH 3CXHF 3L72H 1BCCH 2A06H 1NTZH 1BGYH 2BCCH 3H1JH 1BE3H 3L70H 1L0NH 1KB9F 5KLVH 3L73H 1P84F
chains in the Genus database with same CATH superfamily
2HJFC 3JARA 1T5EA 3J81N 4MVMA 4X1YA 1VEWA 1Y6XA 4PELA 1QQCA 2OCCB 3E83A 2Q67A 1IBLO 4KHPO 2ZNIA 4BIOA 1RSOA 1WP8A 3H9VA 1NVPD 1SS3A 5LMNO 1M9NA 1HR0B 2XT9A 4O4LB 4TWKA 3A0HZ 3IFXA 4JI5O 1CXZB 1S5LZ 1I94B 1YCIA 3I55V 3ZHRA 2QDOA 4QPJA 2OCCC 2XTAA 2PY5A 3QG5A 1SC5B 1I5XA 1RPOA 4IL6Z 2F4VB 1WN7A 1TAEA 2GTAA 1P4RA 2YXYA 2A7WA 3IC9A 2Y69C 1V54B 1KYOF 5EYPA 3OR7C 2XHBA 1KU9A 4JYCA 5KHKA 3ZHVA 1LUVA 2ZNJA 1FYJA 4IYHA 1N34B 3N2KA 2QEXV 3OMNB 4YJ2B 2P90A 3R66A 2Z5UA 3KCXA 2HR3A 4WFGA 3ABUA 2VRZA 5JQGB 4HBNA 2EJRA 3CRCA 3M99B 4AHCA 4N23A 3L75H 2E76B 1XDCA 3SGIA 1K4DC 4E2LA 1NTKH 4H37A 1V54C 1F51A 2UXDO 1AJPA 4HNAB 3D36C 4JASA 4AI8A 2BCCH 3CCRV 1FJGB 4MT8A 4I4TB 1CP9A 3DXRB 5CB4B 3H1IH 4LF8O 2ZT9B 2UUAO 2X7RB 4ASUG 3CCVV 4DUZO 1B6QA 2ZINA 2P22C 3BY6A 4B3RB 3T1CA 4J11A 4ZHQA 4K3AA 4LF7O 1BHBA 3ZRWB 4DR6O 4DR3O 2PUSA 1BSMA 1YHQV 3SR2C 1DK1A 4L8JA 5JH7B 1NTZH 3JD1A 3STLC 1NBMG 1XL4A 2B1GA 2H3OA 3UO2A 4O4HB 4YJ3B 1VF6C 2DWEC 4FLTA 3LSSA 1M1KW 3TXSA 4U3JB 3K58A 2XOKG 4DV7B 2QWPB 2EINB 1ZSPA 4CH3A 2QM7A 4GKJB 2EX3A 3ZN1A 1AI6A 2PYJA 4CC6A 3JCZA 4WCEV 1YIJV 1PKXA 1HDJA 1E1RG 1WA8B 5DM6V 4O4LA 1S0VA 1K3EA 4UCSA 1P7GA 3CRAA 3G6BA 4JI5B 4PDVA 2EINC 1UJWB 2V4DA 4ZOLB 1PV0A 1Z2GA 4TT3G 5C8YB 2HLDG 2PF4E 2RJZA 3F7YC 3C3SA 3CJHA 3OAAG 4DR7O 2CK3G 4GX5A 3I5DA 2EIKB 3MDSA 4O2BA 3SPHA 4B3MB 4IHJA 3UM7A 3W7SA 4RQFA 1R3LC 4NB5A 4CZZA 3P3PA 1Q5OA 3E8GA 2ZCEA 3LDDA 1JJ2U 3SPJA 5CA0A 3O65A 2ODMA 3AG2B 1OCZB 1Q3EA 4DV3O 2X6BA 3CCJV 1QVFU 5JQGA 3L74H 3K3WA 3H01A 2QJ1A 2YXLA 3CCLV 4LH6A 2CDYA 2KSDA 2KG7B 2ZIMA 1W0JG 3ETGA 1V9PA 2UXDB 1XUQA 4J7ZA 3VQYA 3HKEB 4P9OA 1VF5B 3ICXA 2LP7A 3ML0A 3AG2C 4TUYB 1OCZC 4I5SA 2ZXWB 5B1BB 5J2UA 1OCOB 2ZIOA 5KAIZ 4LF8B 3K08A 1UFIA 2UUAB 1XBLA 1QBZA 2F43G 4J7KA 3B2EE 2YI9A 2ITDC 3CCMV 1YXBA 3BVOA 4K35A 4U7OA 3ZRWA 1YJWV 4LF7B 1Y67A 4YY3O 3OUFA 4X64B 4F4LA 4DV6O 2F23A 5K1XA 2FB5A 2B1IA 5JJJB 2ZXWC 5B1BC 2CGNA 4U7NA 5L3CA 3OE7G 4NXNB 1OCOC 1YVWA 4HZ3A 3W7WA 1NI8A 5H5NA 1VQLV 1PPJH 3JATA 2N04A 5JH7A 3WG7B 2ZM6O 4YIPA 1Q6HA 5C93A 1OJHA 3CWBH 1CPYA 4EEQA 1KECA 1TVKB 2XAFA 2WSSG 4CH6A 4JI0B 3RN4A 1BQZA 3MAQA 2Q73A 4U3JA 4KP4A 2BSKB 2E75B 1PL0A 4X1KB 2LGQA 1SQPH 5ITZB 1IVSA 1R1BA 2QM4A 1D5NA 1YEWA 3MHSC 2AXTZ 4XDLA 4D6TH 3WG7C 2CTPA 1VQPV 1P7BA 5IY5B 3ZHUA 4QIWF 3UKMA 1DF4A 1RP3B 4DXWA 4AQYB 1S3JA 1GKFA 2XAQA 4FM1A 1SERA 4JI6O 4JI3O 4JZ2A 1XQ8A 4D7SA 3D3QA 1BHAA 1HNXB 3SJAC 1O9HA 2JJ1G 4P9PA 4XDJA 1M93A 2CH7B 1VQOV 3JARB 2LW7A 4PA9A 2Z3YA 2XAGA 3M7MX 4X1YB 2Y48A 4ZOLA 1QNMA 1HW7A 1NVPB 3K0GA 4JYYA 4LNUB 1SF9A 1JVMA 5IY5C 3ETDA 1RSOB 5B1NA 4QE9A 4DR7B 2JDIG 2HVKC 1HR0O 1S5JA 3IAYA 1SESA 1ZX3A 3B09A 1QR9A 2IH3C 4JZGA 4H13B 5GTIZ 4KUMA 2QSAA 1I94O 4GUNA 1QHTA 3ZRSA 3RFRA 2WAMA 4CH5A 3OD4A 2KKWA 1KC8W 4QNHB 5H6QA 4Z2WA 1X59A 3KG2A 4J10A 4DV3B 1E1QG 2QKSA 4I55A 5CMUA 4HAMA 4Q6GA 4PDRA 5KA6A 1WJZA 3SYOA 5L3EA 5BR8O 1VQ9V 1N34O 2AGAA 1YJNV 5L3DA 1Y76A 4IYIA 4BIUA 3N2KB 2ADQB 1EN4A 1J5EB 4QPKA 3FB7C 4PDLA 2JJ2G 4FJCC 4RAIA 3K9SA 1NU1H 2ZE5A 4FFBA 4ABMA 3VQXA 3OFNG 4LFBO 1PNMA 1HWYA 3QTCA 1WPBA 5KX5A 1KB9F 3K0DA 1NR1A 1JCHA 2BTQA 1K33A 2K1EA 3A0BZ 3EVKA 2IW5A 2M6YA 2WLIB 2A3QA 4FLXA 2L6LA 2IM9A 5LXTA 4YY3B 5K1PA 4DV6B 1Q7YW 2B5UA 1JJOA 3CS5A 2WLHA 1B3QA 1KP3A 4PA4A 2A79B 3MD0A 3GWOA 3E22A 1NH2D 1N33B 2LFSA 4ZHQB 1TVKA 1XOUA 1YJ9V 1K9MW 4X88A 1JA8A 3C90A 3AG4C 1OCCB 4C7UA 3HKCA 4CS3A 2R9AA 4G2KA 4DR5O 3U10A 2P06A 3ZRVA 2UU9O 1I5YA 4GLXA 3SYQA 1I7FA 1GTOA 3K5OA 4JI1B 1THZA 2HHHO 3ABTA 2A0LA 1SZTA 1VMGA 1NR7A 2N05A 3F5WC 3SJQC 2JS5A 2ETNA 5LGTA 3OTOB 4B3SB 4UCVA 4TOIA 1WB8A 1VQ4V 3LNNA 1FXKA 1XNRB 2CH7A 1SA0A 3AEIA 3X2QC 2IJJA 4RWUA 4NVPA 4O2AA 3JD3A 5CA1B 4GKJO 1S5HC 1VQMV 2HG5C 4LNUA 4L87A 3K79A 5FPRA 2ZDIC 4IGGA 1AR4A 3TETA 2QE7G 1EBOA 3L9DA 1G6UA 1GM8A 4FZ1A 5BMVA 5DECA 5KMGA 3KCYA 1E79G 4FPPA 1QLEB 2UXCO 4DV0O 1SETA 2Y0IA 2Q8VA 3BHPA 3T2MA 2P7TC 4DYLA 3CJHB 3RT3C 4JF3A 4MVUA 4B3MO 2UXBB 5HFMA 3TXQA 2YI8A 4NTXA 4O2BB 4K0KO 4IHJB 1EZVH 4OGQB 3ZS8C 4J80A 1D2DA 4HYOA 5BR8B 3BA9A 3JALB 1IZ3A 1DGSA 3FYIB 2QWRB 3VBBA 3ZMTA 1QLEC 1GN2A 5LHGA 1XHXA 5CA0B 1HNZB 2F66C 1FXHA 4BW5A 3JD0A 1L0NH 1NT2B 3BABA 3UO3A 3RYCB 1K73W 1S72V 5EBMC 4U3FH 1JFFB 1VIBA 4MTGA 3AK1A 4LFBB 2PTMA 1GN3A 1GM9A 2W0FC 4BIZA 2FMLA 1ZUQA 2ZR3A 1AR5A 1MMMA 5B3SB 4GYCB 1QVGU 3CXHF 4MVRA 3N2GA 2WLIA 2P4VA 3B8MA 4UFZA 3LDCA 3ZX6A 3QNEA 5KHIA 3G71V 3ZJZA 4TSFG 3FKSG 5J2UB 1Q90D 2K9PA 3G80A 1FFXA 3W7XA 1ZLZA 4TQDA 3I56V 1N36B 1K5QA 2EILB 4I9WA 1WP7A 2YIDA 3AK3A 1XNQB 1FXVA 5AG2A 1KD1W 5B3SC 2M7WA 3CP1A 2Y4TA 4X64O 2QKCA 4R7CA 5CA3A 1R6NA 3K57A 2ATKC 3KZIZ 3NXSA 4JI2B 4GCZA 3CRQA 3SPGA 4FK5C 4NXNO 4DR5B 2CAZC 5JVDA 4JI7O 2WWWA 2UU9B 5EIBC 3JATB 1NQTA 2H94A 2ZDIA 2HHHB 1AP5A 1WNSA 4JI0O 3DSQA 2YC0A 4DV2B 2PGGA 2ZKOA 3K5LA 3CB2A 4DR1O 1K92A 2ARHA 2EZOA 3FAVB 3WFVA 2HP8A 5FL7G 4DV4O 1K5SA 2HFEC 4FM2A 2DMXA 4WFBV 5CA1A 1AROP 2JGDA 2OYQA 1AR1B 4AQYO 1FD9A 2JS3A 3EHBB 1VF7A 2QR4A 5BY1A 4UCUA 4DUYB 4KFMA 2DQ3A 3S3WA 1HNXO 5GONA 1N32B 2Q7EA 2F1MA 4JAAA 3IJ4A 3CCQV 5IYZA 4KL1A 1IBMB 4F6RA 1Z5VA 4FVMA 1VQ5V 2UXCB 1M5IA 2CE4A 4DV0B 2DWDC 1KKCA 2BE3A 4K8ZA 1JX9A 1TGOA 4FLYA 3FFQA 1XILA 2W0XA 3AG3B 5LHIA 4H0LB 4X9QA 4LFCO 4DRXA 2QWQB 3PN1A 2YSUB 4K0KB 4DK1A 2Q69A 1IBKB 4PDMA 3JALA 4X89A 5TISZ 2VQEB 3FD9A 3TK1A 2AHYA 1O9GA 2GUZA 5H6RA 1IXMA 2Q0OC 2DYRB 4G28B 1XHZA 2LGWA 3JCUZ 3AG3C 3RYCA 3BEHA 3CC4V 3Q4HA 3SPIA 1VQ6V 1K4CC 4UVCA 2P4KA 1JFFA 4I0XA 4I55B 1YF2A 2EIKC 2QM8A 2LFRA 2YUAA 4J7JA 3U11A 3JAMN 2HJDA 5JCOA 4X66O 5DN6G 2DQ0A 3CC2V 3E8HA 3ZRXA 4BR6A 1Y76B 2OCHA 1B04A 2ZE8A 4I7ZB 1J5EO 4JTAB 4E4EA 2DYRC 2UXNA 1GRJA 3A8TA 3RWRD 1BQ0A 2G38A 3JSLA 1MNGA 3JASA 1ENVA 4FFBB 4EB6B 1AVMA 2KB1A 5KX5B 5L3FA 1KBHA 2R72A 1LR1A 2ZE6A 2BTQB 2QKAA 1K34A 1BGYH 4N21A 5LXTB 5GW7A 4LP8A 5KLVH 4J42A 3CD6V 3HKBA 1NH2B 3QF7A 4JI7B 4A5UB 4NTWA 3ABMB 1N33O 2WLMA 1TUBB 3E22B 2MW2B 1VP7A 2R70A 3T1YO 1Z5WA 1IURA 4K8XA 1N8RW 1BE3H 2QTOA 3HKCB 1M90W 4DR1B 4LF4B 3FAVA 2JGUA 1Q81W 4LFAB 3NR7A 1VQ8V 1A32A 4DV4B 3P3NA 2X6AA 4QGPA 3ZMSA 4JI1O 2ITCC 1L8DA 2RDCA 3JAKB 3ABMC 2LO1A 2GV9A 3U0ZA 1KQSU 1TUEB 3OTOO 4B3SO 3ZMUA 3A0RA 4GT1A 1AI7A 2YIBD 1PL4A 4ZKIA 3BFRA 1KMIZ 1YSCA 4LF6B 1XNRO 3WB1A 1FXKB 3E2EA 1SA0B 1R3IC 3CMEV 2LQTA 4MS2A 3GVMA 4O2AB 1H8EG 4EKWA 4PI0A 1AI4A 4PA6A 1GAXA 2BTOA 1H38A 3ABLB 1TA8A 3KKYA 3UT5A 5FNVB 1WLEA 4UCOA 3DC5A 3H1KH 1AP6A 4LF5B 4LFCB 3RYHA 4NXMB 3E8BA 4JTDB 4UV8A 2ZR2A 3LDEA 4B7EA 4WFAV 5BMVB 1R3JC 1FXKC 5KMGB 2A06H 3H1JH 3OTFA 1IDSA 5BXZA 3A2FA 3C3TA 1VQKV 1NTMH 3CMAV 2UUBB 4JTCB 3TJTA 4JI4B 3ABLC 4D7TA 3N27A 3OT7A 4NKGB 4YHHB 1SQVH 3WB0A 2UXBO 4ZBMA 2Y4UA 2DOSA 2UUCO 1OHHG 5D5PA 3OEEG 3K5NA 2B9ZA 1ZL8A 1JQ0A 2DJVA 4X66B 3ZCCA 4XBFA 5DEDA 4YIOA 1Q6IA 1X4TA 4WFFA 1HNZO 4JV5B 3W7UA 1MOFA 5IJ9A 1SRYA 2WLJA 4CC5A 4X8AA 5IJ0A 3ABKB 1GM7A 1S76D 2NR5A 4EB6A 2VWJA 2DYSB 4JYAO 5LP6B 3B40A 4Q20A 1W0KG 1YITV 1MSWD 1F23A 5L3GA 1F4MA 3RW0A 1H2KA 3RBZA 3FB8C 1SQXH 3N2GB 4ZI7A 3CCEV 5JWPA 1JR9A 4LWSB 4NR1A 4OX9O 5EC2C 3CCSV 4X65B 3ASOB 2Z0AA 1N36O 4DV1B 4FM0A 1H2NA 1FFXB 2DYSC 1XNQO 1KKDA 1QCEA 3HPLC 1TUBA 2ILMA 4PV1B 4X20A 2WA3A 2YEVA 3K06A 2Q5ZA 4JPRA 2X0LA 4FMTA 3T1YB 1MZFA 4GX2A 1BL8A 3FB6C 4JI2O 1EM1A 1F4NA 4DW1A 4MVSA 4MVOA 4O4JA 2W6JG 5LGNA 2FYUH 1GH6A 5JVDB 4AILC 2VQFB 1LNQA 1AJNA 3JAKA 1QU7A 4IT5A 3IGAC 3GWKC 2IU0A 5CN0A 1GO3F 5H9CA 1AB3A 3CXCU 2IU3A 1COWG 4DV2O 5FPOA 1HNWB 5CBHA 3SDLA 2H8PC 2ZQMA 5CBGA 1OCCC 4X1IB 4I50A 4OPAA 2YDEA 2HEPA 5IWAO 1G4YB 3DGEA 1H2MA 3ZHSA 3CYOA 4GX1A 1SQQH 3APOA 1YTFD 2XASA 4CBCA 2JGDB 4MW3A 1SZXA 2R9IA 5IYBO 5FNVA 1CEZA 1N0NA 2XAHA 3AK2A 1AJQA 4DUYO 2EZPA 1XI1A 2DW4A 1H8HG 1N32O 1FPOA 3E8FA 5GONB 3ZHQA 4LR3A 4MVQA 2Q7GA 4FLZA 1R3KC 1IBMO 1NS1A 2Q6AA 4JI8B 5IYZB 1PP9H 3T4ZA 5LMUB 3RYIB 4F6RB 3K5MA 4LH7A 3CRRA 1Q86W 2F93B 3JD2A 1WAZA 3T1HO 2A9HA 3OR6C 3QO7A 1AI5A 2CTQA 2Y69B 3FX7A 4MW8A 4PHZA 4DRXB 4H33A 2UUCB 1Q8IA 4B7KA 1IBKO 3UCSC 2VQEO 3VOUA 3ZBHA 3UQ8A 3K59A 5LA6A 2CTRA 2V7QG 1QR8A 3ZMZA 2GUZB 4WFEA 1ZTEA 4NTYA 4F6EA 5BZBA 2Q4PA 1XREA 2AHZA 3Q4HB 1IX9A 4OPHA 4I0XB 1RM1B 5LP6A 1L0LH 5B1AB 3DC6A 4JYAB 1PNLA 2EULA 3F7VC 1R73A 1JMKC 3ETEA 1JPXA 1AILA 2PZSA 4LWSA 3SYAA 5HFLA 4OX9B 4MTXA 2WLLB 2WLKA 4TV8A 2KQXA 3ZN0A 3APQA 2AZ2A 3JASB 5LL6Y 1EZJA 5LHHA 3WU2Z 3G4SV 5IE9A 2GSMB 1RM1C 4BAYA 3P30A 1M56B 5B1AC 1WPXA 5JCOC 1MG1A 2P5OA 3L73H 4DV5B 4G27B 3ZEDA 2D3OW 5LGUA 5IYCO 1XL6A 1I08A 1FS0G 4JAUA 4JGSA 2Y0PA 3HKBB 2QGNA 1Y74A 5KHGA 3K03A 4DR4B 2OIEA 1EN5A 1ORQC 2EILC 1M56C 4LBEC 1S77D 3IC7A 3JAWB 1LUWA 4BW9A 4P2ZA 4RQEA 3CE2A 3SJBC 4FLVA 4LF9B 4X1IA 3P32A 4GKKO 1PD3A 4LF4O 2E5LB 4LFAO 3ETQA 3RGBA 2QA4V 5IWAB 4FLWA 5E1AC 1OCRB 2RQ6A 1H2GA 2VWKA 5EZYA 4UXNA 3FB5C 3S3XA 1L1FA 2BOCC 3M8AA 1XMQO 3OGIB 1NJIW 4JYBA 5B66Z 1HP8A 2IJKA 2O57A 5JJEB 4LF6O 4UB8Z 2L35A 2JEUA 2AW9A 3RYIA 3OEHG 1IBLB 4FLUA 4KHPB 1XEQA 2Q9LA 3QO5A 3CRMA 3RYFB 2YXHA 1OCRC 1MSDA 1DLBA 3EFFK 1GN4A 1BZKA 2OWOA 1EFRG 2MK3A 3UT5B 4Z1MG 2UXXA 5LMNB 3T1HB 4DW0A 3F5TA 4LF5O 1G1XB 1WB7A 4NXMO 1BCCH 3RYHB 2EJ7A 3HR0A 1SKVA 4EFEA 1PNKA 4UVAA 3L70H 5JJNB 4KXRA 4IIJB 2WLNA 2PI4A 2BOBC 1SQFA 2LJ2A 2OIGA 2Q0AA 2UUBO 2P6JA 4B3TO 4JI4O 5A2QN 4YHHO 3E89A 3QVNA 3DTUB 4MSWC 5J9PC 1BMFG 5CBFA 2WA4A 4ICGA 4TV9B 3LSQA 4RUFA 1I0HA 4DO2A 3CC7V 3D36A 3CCUV 4X62O 1YDXA 3BPZA 1ZL8B 4YJ2A 3BRCA 4MTFA 4J9ZB 2GDSA 3ZHTA 4PI2A 4MVZA 3BCCH 1N4CA 4JV5O 2E3CA 1N0JA 2GBOA 2FL4A 1YZBA 3OM3B 1KUQA 2WLLA 5IJ9B 2HVJC 2ADPA 5IJ0B 4DK0A 4O4IB 1D5AA 5LOVB 4HNAA 3K9AA 4OXSA 3HB3B 1VQNV 2IJHA 1Y4MA 1RPRA 2QWNB 3G67A 5A9GA 3D3IA 3CSXA 4I4TA 5LYJB 4B08A 3DXRA 5CB4A 4ZI7B 4TQFA 5L3BA 2CGOA 4JAVA 4X65O 2Q68A 1W59A 4DV1O 4DUZB 4Z1VA 4WFHA 1XMOO 1US6A 1VF6A 5EIBD 3VQVA 1KP2A 3ZIAG 1FKAO 3JAWA 3O9OA 3G6EV 3R65A 5J2TB 2PYLA 3OMAB 3LNMB 4X20B 4R8CA 5LBQA 4DR6B 2YEVB 3EXAA 4BWAA 3QO8A 5KUMA 4DR3B 4GKKB 3BA8A 4O4JB 3D8CA 3BAAA 3OMIB 2VQFO 1B06A 3B4SA 4O4HA 4YJ3A 5KHJA 4DR2O 3L72H 2QWOB 4J41A 2ZD9A 2YIBA 1W2BU 2YIAA 2OT5A 2CUGA 3ASNB 4RO2A 4W4LA 2P67A 1XMQB 4EFBA 1HNWO 2JIZG 4MTOA 4I9QA 1Q6UA 3HKDB 3H1LH 5KA5A 1EN6A 1OZ0A 1SQGA 2EIJB 4PD4F 1RFYA 2WPDG 1YTFB 3CX5F 4I50B 5IYDO 4LCUC 1URFA 2RCVA 3RVYA 2VS0A 4GX0A 1K97A 1G8MA 3RYFA 1M57B 3E35A 4FIPC 4YXWG 4UB6Z 2D2CB 2XUMA 5GTHZ 5B5EZ 1MA1A 4QE7A 1OV9A 1WA8A 2GTSA 3T4DA 3ASNC 4CH4A 5EC1C 1H2LA 4CS4A 4WBNB 3E86A 2XNDG 3LSUA 3JD4A 4UCRA 3AG7A 2FTKA 2EIJC 3TGUH 1PM9A 4IIJA 4CS2A 4JI8O 5C8YA 5LMUO 5D5QA 3B77A 4WF9V 1U97A 4H44B 4R6ZA 1M57C 2JEXA 1NZ6A 4B3TB 3PJSK 2QTSA 3SYPA 1BT8A 1DTOA 3H1HH 3L71H 4TV9A 1FFTB 1BS3A 1V55B 2W6IG 4FZ0A 5KAFZ 3JYCA 4X62B 1YI2V 3OGCC 2YICA 1Q82W 5EBWC 1Q43A 2IBZH 2NNUA 4GZRB 5LA6B 2F4VO 2EBOA 3JSNA 3TCUA 1M4UA 2FKXA 2OTJV 5H2FZ 2IH1C 2RMKB 4O4IA 2KG7A 5EYPB 2EIMB 5F2VO 5LOVA 1V55C 1F7YA 5EBLC 2NLJC 4LC1A 2Q7HA 3HKEA 4PJ0Z 1IXBA 4TUYA 1Y66A 1K8AW 2C2AA 5LYJA 3AG1B 2ZE7A 1H2SB 5IDJA 2X6CA 1QLNA 1GK9A 2DE0X 3J7AU 1VQ7V 1DF5A 1K7DA 3B8NA 4TV8B 2N74A 3ABKC 1U96A 2EIMC 3THOA 2PI5A 4UV9A 1GMGA 3CHXA 1XMOB 5LP6C 4NYKA 4UVBA 5IT9N 5KUKA 5J2TA 1GN6A 1VARA 3AG4B 2JK5C 2JRIA 1FJGO 3SJCC 2GHYA 4DV5O 2JVDA 3CEIA 2LW1A 4XDKA 3GB7C 3AG1C 3K04A 3RVZA 2RNBA 1R6KA 1ZAUA 3VQWA 5B1OA 2NN4A 4R50A 1P49A 4UUJC 5E79Z 1P84F 4B3RO 3SYCA 2AZ0A 3ASOC 2ZM6B 4DR4O 4FFKA 4PA7A 5FLXN 2RN9A 1Y74B 3WB2A 3J80N 4DR2B 3OW2U 4RUEA 3ZMVA 4ZIBA 2BSKA 2YS8A 4X1KA 2OTLV 1UPGA 3STZC 4LF9O 5ITZA 3X2QB 3HKDA 4PA3A 1NKDA 2IJIA 1ZWIC 2XAJA 2DN9A 2E5LO 1J95A 1MZEA 2HKOA 1ROPA 1FAFA 1JOYA 4QJFB 3W7TA 2V1DA 1SQBH 2R9RB 2F95B 4UCTA 3LUTB 4J9YB 4P30A 3OUSA 4JI6B 3SPCA 5EZYB 4JI3B 3FYEB 1R6TA 5EK0A 1MABG 3MHHC 5KHHA 4DV7O 4W4KA 2CTWA 4WBNA 2E74B 3CPWU
chains in the Genus database with same CATH topology
1NTMH 2FYUH 2IBZH 3H1KH 1SQXH 1SQPH 1EZVH 3L75H 1KYOF 1SQVH 4U3FH 3H1IH 3H1LH 1PPJH 1SQQH 1SQBH 1L0LH 3H1HH 4PD4F 3L71H 1NTKH 1PP9H 3CX5F 3BCCH 3CWBH 4D6TH 1NU1H 3L74H 3TGUH 3CXHF 3L72H 1BCCH 2A06H 1NTZH 1BGYH 2BCCH 3H1JH 1BE3H 3L70H 1L0NH 1KB9F 5KLVH 3L73H 1P84F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM H;  2FYU H;  2IBZ H;  3H1K H;  1SQX H;  1SQP H;  1EZV H;  3L75 H;  1KYO F;  1SQV H;  4U3F H;  3H1I H;  3H1L H;  1PPJ H;  1SQQ H;  1SQB H;  1L0L H;  3H1H H;  4PD4 F;  3L71 H;  1NTK H;  1PP9 H;  3CX5 F;  3BCC H;  3CWB H;  4D6T H;  1NU1 H;  3L74 H;  3TGU H;  3CXH F;  3L72 H;  1BCC H;  2A06 H;  1NTZ H;  1BGY H;  2BCC H;  3H1J H;  1BE3 H;  3L70 H;  1L0N H;  1KB9 F;  5KLV H;  3L73 H;  1P84 F; 
#chains in the Genus database with same CATH topology
 2HJF C;  3JAR A;  1T5E A;  3J81 N;  4MVM A;  4X1Y A;  1VEW A;  1Y6X A;  4PEL A;  1QQC A;  2OCC B;  3E83 A;  2Q67 A;  1IBL O;  4KHP O;  2ZNI A;  4BIO A;  1RSO A;  1WP8 A;  3H9V A;  1NVP D;  1SS3 A;  5LMN O;  1M9N A;  1HR0 B;  2XT9 A;  4O4L B;  4TWK A;  3A0H Z;  3IFX A;  4JI5 O;  1CXZ B;  1S5L Z;  1I94 B;  1YCI A;  3I55 V;  3ZHR A;  2QDO A;  4QPJ A;  2OCC C;  2XTA A;  2PY5 A;  3QG5 A;  1SC5 B;  1I5X A;  1RPO A;  4IL6 Z;  2F4V B;  1WN7 A;  1TAE A;  2GTA A;  1P4R A;  2YXY A;  2A7W A;  3IC9 A;  2Y69 C;  1V54 B;  1KYO F;  5EYP A;  3OR7 C;  2XHB A;  1KU9 A;  4JYC A;  5KHK A;  3ZHV A;  1LUV A;  2ZNJ A;  1FYJ A;  4IYH A;  1N34 B;  3N2K A;  2QEX V;  3OMN B;  4YJ2 B;  2P90 A;  3R66 A;  2Z5U A;  3KCX A;  2HR3 A;  4WFG A;  3ABU A;  2VRZ A;  5JQG B;  4HBN A;  2EJR A;  3CRC A;  3M99 B;  4AHC A;  4N23 A;  3L75 H;  2E76 B;  1XDC A;  3SGI A;  1K4D C;  4E2L A;  1NTK H;  4H37 A;  1V54 C;  1F51 A;  2UXD O;  1AJP A;  4HNA B;  3D36 C;  4JAS A;  4AI8 A;  2BCC H;  3CCR V;  1FJG B;  4MT8 A;  4I4T B;  1CP9 A;  3DXR B;  5CB4 B;  3H1I H;  4LF8 O;  2ZT9 B;  2UUA O;  2X7R B;  4ASU G;  3CCV V;  4DUZ O;  1B6Q A;  2ZIN A;  2P22 C;  3BY6 A;  4B3R B;  3T1C A;  4J11 A;  4ZHQ A;  4K3A A;  4LF7 O;  1BHB A;  3ZRW B;  4DR6 O;  4DR3 O;  2PUS A;  1BSM A;  1YHQ V;  3SR2 C;  1DK1 A;  4L8J A;  5JH7 B;  1NTZ H;  3JD1 A;  3STL C;  1NBM G;  1XL4 A;  2B1G A;  2H3O A;  3UO2 A;  4O4H B;  4YJ3 B;  1VF6 C;  2DWE C;  4FLT A;  3LSS A;  1M1K W;  3TXS A;  4U3J B;  3K58 A;  2XOK G;  4DV7 B;  2QWP B;  2EIN B;  1ZSP A;  4CH3 A;  2QM7 A;  4GKJ B;  2EX3 A;  3ZN1 A;  1AI6 A;  2PYJ A;  4CC6 A;  3JCZ A;  4WCE V;  1YIJ V;  1PKX A;  1HDJ A;  1E1R G;  1WA8 B;  5DM6 V;  4O4L A;  1S0V A;  1K3E A;  4UCS A;  1P7G A;  3CRA A;  3G6B A;  4JI5 B;  4PDV A;  2EIN C;  1UJW B;  2V4D A;  4ZOL B;  1PV0 A;  1Z2G A;  4TT3 G;  5C8Y B;  2HLD G;  2PF4 E;  2RJZ A;  3F7Y C;  3C3S A;  3CJH A;  3OAA G;  4DR7 O;  2CK3 G;  4GX5 A;  3I5D A;  2EIK B;  3MDS A;  4O2B A;  3SPH A;  4B3M B;  4IHJ A;  3UM7 A;  3W7S A;  4RQF A;  1R3L C;  4NB5 A;  4CZZ A;  3P3P A;  1Q5O A;  3E8G A;  2ZCE A;  3LDD A;  1JJ2 U;  3SPJ A;  5CA0 A;  3O65 A;  2ODM A;  3AG2 B;  1OCZ B;  1Q3E A;  4DV3 O;  2X6B A;  3CCJ V;  1QVF U;  5JQG A;  3L74 H;  3K3W A;  3H01 A;  2QJ1 A;  2YXL A;  3CCL V;  4LH6 A;  2CDY A;  2KSD A;  2KG7 B;  2ZIM A;  1W0J G;  3ETG A;  1V9P A;  2UXD B;  1XUQ A;  4J7Z A;  3VQY A;  3HKE B;  4P9O A;  1VF5 B;  3ICX A;  2LP7 A;  3ML0 A;  3AG2 C;  4TUY B;  1OCZ C;  4I5S A;  2ZXW B;  5B1B B;  5J2U A;  1OCO B;  2ZIO A;  5KAI Z;  4LF8 B;  3K08 A;  1UFI A;  2UUA B;  1XBL A;  1QBZ A;  2F43 G;  4J7K A;  3B2E E;  2YI9 A;  2ITD C;  3CCM V;  1YXB A;  3BVO A;  4K35 A;  4U7O A;  3ZRW A;  1YJW V;  4LF7 B;  1Y67 A;  4YY3 O;  3OUF A;  4X64 B;  4F4L A;  4DV6 O;  2F23 A;  5K1X A;  2FB5 A;  2B1I A;  5JJJ B;  2ZXW C;  5B1B C;  2CGN A;  4U7N A;  5L3C A;  3OE7 G;  4NXN B;  1OCO C;  1YVW A;  4HZ3 A;  3W7W A;  1NI8 A;  5H5N A;  1VQL V;  1PPJ H;  3JAT A;  2N04 A;  5JH7 A;  3WG7 B;  2ZM6 O;  4YIP A;  1Q6H A;  5C93 A;  1OJH A;  3CWB H;  1CPY A;  4EEQ A;  1KEC A;  1TVK B;  2XAF A;  2WSS G;  4CH6 A;  4JI0 B;  3RN4 A;  1BQZ A;  3MAQ A;  2Q73 A;  4U3J A;  4KP4 A;  2BSK B;  2E75 B;  1PL0 A;  4X1K B;  2LGQ A;  1SQP H;  5ITZ B;  1IVS A;  1R1B A;  2QM4 A;  1D5N A;  1YEW A;  3MHS C;  2AXT Z;  4XDL A;  4D6T H;  3WG7 C;  2CTP A;  1VQP V;  1P7B A;  5IY5 B;  3ZHU A;  4QIW F;  3UKM A;  1DF4 A;  1RP3 B;  4DXW A;  4AQY B;  1S3J A;  1GKF A;  2XAQ A;  4FM1 A;  1SER A;  4JI6 O;  4JI3 O;  4JZ2 A;  1XQ8 A;  4D7S A;  3D3Q A;  1BHA A;  1HNX B;  3SJA C;  1O9H A;  2JJ1 G;  4P9P A;  4XDJ A;  1M93 A;  2CH7 B;  1VQO V;  3JAR B;  2LW7 A;  4PA9 A;  2Z3Y A;  2XAG A;  3M7M X;  4X1Y B;  2Y48 A;  4ZOL A;  1QNM A;  1HW7 A;  1NVP B;  3K0G A;  4JYY A;  4LNU B;  1SF9 A;  1JVM A;  5IY5 C;  3ETD A;  1RSO B;  5B1N A;  4QE9 A;  4DR7 B;  2JDI G;  2HVK C;  1HR0 O;  1S5J A;  3IAY A;  1SES A;  1ZX3 A;  3B09 A;  1QR9 A;  2IH3 C;  4JZG A;  4H13 B;  5GTI Z;  4KUM A;  2QSA A;  1I94 O;  4GUN A;  1QHT A;  3ZRS A;  3RFR A;  2WAM A;  4CH5 A;  3OD4 A;  2KKW A;  1KC8 W;  4QNH B;  5H6Q A;  4Z2W A;  1X59 A;  3KG2 A;  4J10 A;  4DV3 B;  1E1Q G;  2QKS A;  4I55 A;  5CMU A;  4HAM A;  4Q6G A;  4PDR A;  5KA6 A;  1WJZ A;  3SYO A;  5L3E A;  5BR8 O;  1VQ9 V;  1N34 O;  2AGA A;  1YJN V;  5L3D A;  1Y76 A;  4IYI A;  4BIU A;  3N2K B;  2ADQ B;  1EN4 A;  1J5E B;  4QPK A;  3FB7 C;  4PDL A;  2JJ2 G;  4FJC C;  4RAI A;  3K9S A;  1NU1 H;  2ZE5 A;  4FFB A;  4ABM A;  3VQX A;  3OFN G;  4LFB O;  1PNM A;  1HWY A;  3QTC A;  1WPB A;  5KX5 A;  1KB9 F;  3K0D A;  1NR1 A;  1JCH A;  2BTQ A;  1K33 A;  2K1E A;  3A0B Z;  3EVK A;  2IW5 A;  2M6Y A;  2WLI B;  2A3Q A;  4FLX A;  2L6L A;  2IM9 A;  5LXT A;  4YY3 B;  5K1P A;  4DV6 B;  1Q7Y W;  2B5U A;  1JJO A;  3CS5 A;  2WLH A;  1B3Q A;  1KP3 A;  4PA4 A;  2A79 B;  3MD0 A;  3GWO A;  3E22 A;  1NH2 D;  1N33 B;  2LFS A;  4ZHQ B;  1TVK A;  1XOU A;  1YJ9 V;  1K9M W;  4X88 A;  1JA8 A;  3C90 A;  3AG4 C;  1OCC B;  4C7U A;  3HKC A;  4CS3 A;  2R9A A;  4G2K A;  4DR5 O;  3U10 A;  2P06 A;  3ZRV A;  2UU9 O;  1I5Y A;  4GLX A;  3SYQ A;  1I7F A;  1GTO A;  3K5O A;  4JI1 B;  1THZ A;  2HHH O;  3ABT A;  2A0L A;  1SZT A;  1VMG A;  1NR7 A;  2N05 A;  3F5W C;  3SJQ C;  2JS5 A;  2ETN A;  5LGT A;  3OTO B;  4B3S B;  4UCV A;  4TOI A;  1WB8 A;  1VQ4 V;  3LNN A;  1FXK A;  1XNR B;  2CH7 A;  1SA0 A;  3AEI A;  3X2Q C;  2IJJ A;  4RWU A;  4NVP A;  4O2A A;  3JD3 A;  5CA1 B;  4GKJ O;  1S5H C;  1VQM V;  2HG5 C;  4LNU A;  4L87 A;  3K79 A;  5FPR A;  2ZDI C;  4IGG A;  1AR4 A;  3TET A;  2QE7 G;  1EBO A;  3L9D A;  1G6U A;  1GM8 A;  4FZ1 A;  5BMV A;  5DEC A;  5KMG A;  3KCY A;  1E79 G;  4FPP A;  1QLE B;  2UXC O;  4DV0 O;  1SET A;  2Y0I A;  2Q8V A;  3BHP A;  3T2M A;  2P7T C;  4DYL A;  3CJH B;  3RT3 C;  4JF3 A;  4MVU A;  4B3M O;  2UXB B;  5HFM A;  3TXQ A;  2YI8 A;  4NTX A;  4O2B B;  4K0K O;  4IHJ B;  1EZV H;  4OGQ B;  3ZS8 C;  4J80 A;  1D2D A;  4HYO A;  5BR8 B;  3BA9 A;  3JAL B;  1IZ3 A;  1DGS A;  3FYI B;  2QWR B;  3VBB A;  3ZMT A;  1QLE C;  1GN2 A;  5LHG A;  1XHX A;  5CA0 B;  1HNZ B;  2F66 C;  1FXH A;  4BW5 A;  3JD0 A;  1L0N H;  1NT2 B;  3BAB A;  3UO3 A;  3RYC B;  1K73 W;  1S72 V;  5EBM C;  4U3F H;  1JFF B;  1VIB A;  4MTG A;  3AK1 A;  4LFB B;  2PTM A;  1GN3 A;  1GM9 A;  2W0F C;  4BIZ A;  2FML A;  1ZUQ A;  2ZR3 A;  1AR5 A;  1MMM A;  5B3S B;  4GYC B;  1QVG U;  3CXH F;  4MVR A;  3N2G A;  2WLI A;  2P4V A;  3B8M A;  4UFZ A;  3LDC A;  3ZX6 A;  3QNE A;  5KHI A;  3G71 V;  3ZJZ A;  4TSF G;  3FKS G;  5J2U B;  1Q90 D;  2K9P A;  3G80 A;  1FFX A;  3W7X A;  1ZLZ A;  4TQD A;  3I56 V;  1N36 B;  1K5Q A;  2EIL B;  4I9W A;  1WP7 A;  2YID A;  3AK3 A;  1XNQ B;  1FXV A;  5AG2 A;  1KD1 W;  5B3S C;  2M7W A;  3CP1 A;  2Y4T A;  4X64 O;  2QKC A;  4R7C A;  5CA3 A;  1R6N A;  3K57 A;  2ATK C;  3KZI Z;  3NXS A;  4JI2 B;  4GCZ A;  3CRQ A;  3SPG A;  4FK5 C;  4NXN O;  4DR5 B;  2CAZ C;  5JVD A;  4JI7 O;  2WWW A;  2UU9 B;  5EIB C;  3JAT B;  1NQT A;  2H94 A;  2ZDI A;  2HHH B;  1AP5 A;  1WNS A;  4JI0 O;  3DSQ A;  2YC0 A;  4DV2 B;  2PGG A;  2ZKO A;  3K5L A;  3CB2 A;  4DR1 O;  1K92 A;  2ARH A;  2EZO A;  3FAV B;  3WFV A;  2HP8 A;  5FL7 G;  4DV4 O;  1K5S A;  2HFE C;  4FM2 A;  2DMX A;  4WFB V;  5CA1 A;  1ARO P;  2JGD A;  2OYQ A;  1AR1 B;  4AQY O;  1FD9 A;  2JS3 A;  3EHB B;  1VF7 A;  2QR4 A;  5BY1 A;  4UCU A;  4DUY B;  4KFM A;  2DQ3 A;  3S3W A;  1HNX O;  5GON A;  1N32 B;  2Q7E A;  2F1M A;  4JAA A;  3IJ4 A;  3CCQ V;  5IYZ A;  4KL1 A;  1IBM B;  4F6R A;  1Z5V A;  4FVM A;  1VQ5 V;  2UXC B;  1M5I A;  2CE4 A;  4DV0 B;  2DWD C;  1KKC A;  2BE3 A;  4K8Z A;  1JX9 A;  1TGO A;  4FLY A;  3FFQ A;  1XIL A;  2W0X A;  3AG3 B;  5LHI A;  4H0L B;  4X9Q A;  4LFC O;  4DRX A;  2QWQ B;  3PN1 A;  2YSU B;  4K0K B;  4DK1 A;  2Q69 A;  1IBK B;  4PDM A;  3JAL A;  4X89 A;  5TIS Z;  2VQE B;  3FD9 A;  3TK1 A;  2AHY A;  1O9G A;  2GUZ A;  5H6R A;  1IXM A;  2Q0O C;  2DYR B;  4G28 B;  1XHZ A;  2LGW A;  3JCU Z;  3AG3 C;  3RYC A;  3BEH A;  3CC4 V;  3Q4H A;  3SPI A;  1VQ6 V;  1K4C C;  4UVC A;  2P4K A;  1JFF A;  4I0X A;  4I55 B;  1YF2 A;  2EIK C;  2QM8 A;  2LFR A;  2YUA A;  4J7J A;  3U11 A;  3JAM N;  2HJD A;  5JCO A;  4X66 O;  5DN6 G;  2DQ0 A;  3CC2 V;  3E8H A;  3ZRX A;  4BR6 A;  1Y76 B;  2OCH A;  1B04 A;  2ZE8 A;  4I7Z B;  1J5E O;  4JTA B;  4E4E A;  2DYR C;  2UXN A;  1GRJ A;  3A8T A;  3RWR D;  1BQ0 A;  2G38 A;  3JSL A;  1MNG A;  3JAS A;  1ENV A;  4FFB B;  4EB6 B;  1AVM A;  2KB1 A;  5KX5 B;  5L3F A;  1KBH A;  2R72 A;  1LR1 A;  2ZE6 A;  2BTQ B;  2QKA A;  1K34 A;  1BGY H;  4N21 A;  5LXT B;  5GW7 A;  4LP8 A;  5KLV H;  4J42 A;  3CD6 V;  3HKB A;  1NH2 B;  3QF7 A;  4JI7 B;  4A5U B;  4NTW A;  3ABM B;  1N33 O;  2WLM A;  1TUB B;  3E22 B;  2MW2 B;  1VP7 A;  2R70 A;  3T1Y O;  1Z5W A;  1IUR A;  4K8X A;  1N8R W;  1BE3 H;  2QTO A;  3HKC B;  1M90 W;  4DR1 B;  4LF4 B;  3FAV A;  2JGU A;  1Q81 W;  4LFA B;  3NR7 A;  1VQ8 V;  1A32 A;  4DV4 B;  3P3N A;  2X6A A;  4QGP A;  3ZMS A;  4JI1 O;  2ITC C;  1L8D A;  2RDC A;  3JAK B;  3ABM C;  2LO1 A;  2GV9 A;  3U0Z A;  1KQS U;  1TUE B;  3OTO O;  4B3S O;  3ZMU A;  3A0R A;  4GT1 A;  1AI7 A;  2YIB D;  1PL4 A;  4ZKI A;  3BFR A;  1KMI Z;  1YSC A;  4LF6 B;  1XNR O;  3WB1 A;  1FXK B;  3E2E A;  1SA0 B;  1R3I C;  3CME V;  2LQT A;  4MS2 A;  3GVM A;  4O2A B;  1H8E G;  4EKW A;  4PI0 A;  1AI4 A;  4PA6 A;  1GAX A;  2BTO A;  1H38 A;  3ABL B;  1TA8 A;  3KKY A;  3UT5 A;  5FNV B;  1WLE A;  4UCO A;  3DC5 A;  3H1K H;  1AP6 A;  4LF5 B;  4LFC B;  3RYH A;  4NXM B;  3E8B A;  4JTD B;  4UV8 A;  2ZR2 A;  3LDE A;  4B7E A;  4WFA V;  5BMV B;  1R3J C;  1FXK C;  5KMG B;  2A06 H;  3H1J H;  3OTF A;  1IDS A;  5BXZ A;  3A2F A;  3C3T A;  1VQK V;  1NTM H;  3CMA V;  2UUB B;  4JTC B;  3TJT A;  4JI4 B;  3ABL C;  4D7T A;  3N27 A;  3OT7 A;  4NKG B;  4YHH B;  1SQV H;  3WB0 A;  2UXB O;  4ZBM A;  2Y4U A;  2DOS A;  2UUC O;  1OHH G;  5D5P A;  3OEE G;  3K5N A;  2B9Z A;  1ZL8 A;  1JQ0 A;  2DJV A;  4X66 B;  3ZCC A;  4XBF A;  5DED A;  4YIO A;  1Q6I A;  1X4T A;  4WFF A;  1HNZ O;  4JV5 B;  3W7U A;  1MOF A;  5IJ9 A;  1SRY A;  2WLJ A;  4CC5 A;  4X8A A;  5IJ0 A;  3ABK B;  1GM7 A;  1S76 D;  2NR5 A;  4EB6 A;  2VWJ A;  2DYS B;  4JYA O;  5LP6 B;  3B40 A;  4Q20 A;  1W0K G;  1YIT V;  1MSW D;  1F23 A;  5L3G A;  1F4M A;  3RW0 A;  1H2K A;  3RBZ A;  3FB8 C;  1SQX H;  3N2G B;  4ZI7 A;  3CCE V;  5JWP A;  1JR9 A;  4LWS B;  4NR1 A;  4OX9 O;  5EC2 C;  3CCS V;  4X65 B;  3ASO B;  2Z0A A;  1N36 O;  4DV1 B;  4FM0 A;  1H2N A;  1FFX B;  2DYS C;  1XNQ O;  1KKD A;  1QCE A;  3HPL C;  1TUB A;  2ILM A;  4PV1 B;  4X20 A;  2WA3 A;  2YEV A;  3K06 A;  2Q5Z A;  4JPR A;  2X0L A;  4FMT A;  3T1Y B;  1MZF A;  4GX2 A;  1BL8 A;  3FB6 C;  4JI2 O;  1EM1 A;  1F4N A;  4DW1 A;  4MVS A;  4MVO A;  4O4J A;  2W6J G;  5LGN A;  2FYU H;  1GH6 A;  5JVD B;  4AIL C;  2VQF B;  1LNQ A;  1AJN A;  3JAK A;  1QU7 A;  4IT5 A;  3IGA C;  3GWK C;  2IU0 A;  5CN0 A;  1GO3 F;  5H9C A;  1AB3 A;  3CXC U;  2IU3 A;  1COW G;  4DV2 O;  5FPO A;  1HNW B;  5CBH A;  3SDL A;  2H8P C;  2ZQM A;  5CBG A;  1OCC C;  4X1I B;  4I50 A;  4OPA A;  2YDE A;  2HEP A;  5IWA O;  1G4Y B;  3DGE A;  1H2M A;  3ZHS A;  3CYO A;  4GX1 A;  1SQQ H;  3APO A;  1YTF D;  2XAS A;  4CBC A;  2JGD B;  4MW3 A;  1SZX A;  2R9I A;  5IYB O;  5FNV A;  1CEZ A;  1N0N A;  2XAH A;  3AK2 A;  1AJQ A;  4DUY O;  2EZP A;  1XI1 A;  2DW4 A;  1H8H G;  1N32 O;  1FPO A;  3E8F A;  5GON B;  3ZHQ A;  4LR3 A;  4MVQ A;  2Q7G A;  4FLZ A;  1R3K C;  1IBM O;  1NS1 A;  2Q6A A;  4JI8 B;  5IYZ B;  1PP9 H;  3T4Z A;  5LMU B;  3RYI B;  4F6R B;  3K5M A;  4LH7 A;  3CRR A;  1Q86 W;  2F93 B;  3JD2 A;  1WAZ A;  3T1H O;  2A9H A;  3OR6 C;  3QO7 A;  1AI5 A;  2CTQ A;  2Y69 B;  3FX7 A;  4MW8 A;  4PHZ A;  4DRX B;  4H33 A;  2UUC B;  1Q8I A;  4B7K A;  1IBK O;  3UCS C;  2VQE O;  3VOU A;  3ZBH A;  3UQ8 A;  3K59 A;  5LA6 A;  2CTR A;  2V7Q G;  1QR8 A;  3ZMZ A;  2GUZ B;  4WFE A;  1ZTE A;  4NTY A;  4F6E A;  5BZB A;  2Q4P A;  1XRE A;  2AHZ A;  3Q4H B;  1IX9 A;  4OPH A;  4I0X B;  1RM1 B;  5LP6 A;  1L0L H;  5B1A B;  3DC6 A;  4JYA B;  1PNL A;  2EUL A;  3F7V C;  1R73 A;  1JMK C;  3ETE A;  1JPX A;  1AIL A;  2PZS A;  4LWS A;  3SYA A;  5HFL A;  4OX9 B;  4MTX A;  2WLL B;  2WLK A;  4TV8 A;  2KQX A;  3ZN0 A;  3APQ A;  2AZ2 A;  3JAS B;  5LL6 Y;  1EZJ A;  5LHH A;  3WU2 Z;  3G4S V;  5IE9 A;  2GSM B;  1RM1 C;  4BAY A;  3P30 A;  1M56 B;  5B1A C;  1WPX A;  5JCO C;  1MG1 A;  2P5O A;  3L73 H;  4DV5 B;  4G27 B;  3ZED A;  2D3O W;  5LGU A;  5IYC O;  1XL6 A;  1I08 A;  1FS0 G;  4JAU A;  4JGS A;  2Y0P A;  3HKB B;  2QGN A;  1Y74 A;  5KHG A;  3K03 A;  4DR4 B;  2OIE A;  1EN5 A;  1ORQ C;  2EIL C;  1M56 C;  4LBE C;  1S77 D;  3IC7 A;  3JAW B;  1LUW A;  4BW9 A;  4P2Z A;  4RQE A;  3CE2 A;  3SJB C;  4FLV A;  4LF9 B;  4X1I A;  3P32 A;  4GKK O;  1PD3 A;  4LF4 O;  2E5L B;  4LFA O;  3ETQ A;  3RGB A;  2QA4 V;  5IWA B;  4FLW A;  5E1A C;  1OCR B;  2RQ6 A;  1H2G A;  2VWK A;  5EZY A;  4UXN A;  3FB5 C;  3S3X A;  1L1F A;  2BOC C;  3M8A A;  1XMQ O;  3OGI B;  1NJI W;  4JYB A;  5B66 Z;  1HP8 A;  2IJK A;  2O57 A;  5JJE B;  4LF6 O;  4UB8 Z;  2L35 A;  2JEU A;  2AW9 A;  3RYI A;  3OEH G;  1IBL B;  4FLU A;  4KHP B;  1XEQ A;  2Q9L A;  3QO5 A;  3CRM A;  3RYF B;  2YXH A;  1OCR C;  1MSD A;  1DLB A;  3EFF K;  1GN4 A;  1BZK A;  2OWO A;  1EFR G;  2MK3 A;  3UT5 B;  4Z1M G;  2UXX A;  5LMN B;  3T1H B;  4DW0 A;  3F5T A;  4LF5 O;  1G1X B;  1WB7 A;  4NXM O;  1BCC H;  3RYH B;  2EJ7 A;  3HR0 A;  1SKV A;  4EFE A;  1PNK A;  4UVA A;  3L70 H;  5JJN B;  4KXR A;  4IIJ B;  2WLN A;  2PI4 A;  2BOB C;  1SQF A;  2LJ2 A;  2OIG A;  2Q0A A;  2UUB O;  2P6J A;  4B3T O;  4JI4 O;  5A2Q N;  4YHH O;  3E89 A;  3QVN A;  3DTU B;  4MSW C;  5J9P C;  1BMF G;  5CBF A;  2WA4 A;  4ICG A;  4TV9 B;  3LSQ A;  4RUF A;  1I0H A;  4DO2 A;  3CC7 V;  3D36 A;  3CCU V;  4X62 O;  1YDX A;  3BPZ A;  1ZL8 B;  4YJ2 A;  3BRC A;  4MTF A;  4J9Z B;  2GDS A;  3ZHT A;  4PI2 A;  4MVZ A;  3BCC H;  1N4C A;  4JV5 O;  2E3C A;  1N0J A;  2GBO A;  2FL4 A;  1YZB A;  3OM3 B;  1KUQ A;  2WLL A;  5IJ9 B;  2HVJ C;  2ADP A;  5IJ0 B;  4DK0 A;  4O4I B;  1D5A A;  5LOV B;  4HNA A;  3K9A A;  4OXS A;  3HB3 B;  1VQN V;  2IJH A;  1Y4M A;  1RPR A;  2QWN B;  3G67 A;  5A9G A;  3D3I A;  3CSX A;  4I4T A;  5LYJ B;  4B08 A;  3DXR A;  5CB4 A;  4ZI7 B;  4TQF A;  5L3B A;  2CGO A;  4JAV A;  4X65 O;  2Q68 A;  1W59 A;  4DV1 O;  4DUZ B;  4Z1V A;  4WFH A;  1XMO O;  1US6 A;  1VF6 A;  5EIB D;  3VQV A;  1KP2 A;  3ZIA G;  1FKA O;  3JAW A;  3O9O A;  3G6E V;  3R65 A;  5J2T B;  2PYL A;  3OMA B;  3LNM B;  4X20 B;  4R8C A;  5LBQ A;  4DR6 B;  2YEV B;  3EXA A;  4BWA A;  3QO8 A;  5KUM A;  4DR3 B;  4GKK B;  3BA8 A;  4O4J B;  3D8C A;  3BAA A;  3OMI B;  2VQF O;  1B06 A;  3B4S A;  4O4H A;  4YJ3 A;  5KHJ A;  4DR2 O;  3L72 H;  2QWO B;  4J41 A;  2ZD9 A;  2YIB A;  1W2B U;  2YIA A;  2OT5 A;  2CUG A;  3ASN B;  4RO2 A;  4W4L A;  2P67 A;  1XMQ B;  4EFB A;  1HNW O;  2JIZ G;  4MTO A;  4I9Q A;  1Q6U A;  3HKD B;  3H1L H;  5KA5 A;  1EN6 A;  1OZ0 A;  1SQG A;  2EIJ B;  4PD4 F;  1RFY A;  2WPD G;  1YTF B;  3CX5 F;  4I50 B;  5IYD O;  4LCU C;  1URF A;  2RCV A;  3RVY A;  2VS0 A;  4GX0 A;  1K97 A;  1G8M A;  3RYF A;  1M57 B;  3E35 A;  4FIP C;  4YXW G;  4UB6 Z;  2D2C B;  2XUM A;  5GTH Z;  5B5E Z;  1MA1 A;  4QE7 A;  1OV9 A;  1WA8 A;  2GTS A;  3T4D A;  3ASN C;  4CH4 A;  5EC1 C;  1H2L A;  4CS4 A;  4WBN B;  3E86 A;  2XND G;  3LSU A;  3JD4 A;  4UCR A;  3AG7 A;  2FTK A;  2EIJ C;  3TGU H;  1PM9 A;  4IIJ A;  4CS2 A;  4JI8 O;  5C8Y A;  5LMU O;  5D5Q A;  3B77 A;  4WF9 V;  1U97 A;  4H44 B;  4R6Z A;  1M57 C;  2JEX A;  1NZ6 A;  4B3T B;  3PJS K;  2QTS A;  3SYP A;  1BT8 A;  1DTO A;  3H1H H;  3L71 H;  4TV9 A;  1FFT B;  1BS3 A;  1V55 B;  2W6I G;  4FZ0 A;  5KAF Z;  3JYC A;  4X62 B;  1YI2 V;  3OGC C;  2YIC A;  1Q82 W;  5EBW C;  1Q43 A;  2IBZ H;  2NNU A;  4GZR B;  5LA6 B;  2F4V O;  2EBO A;  3JSN A;  3TCU A;  1M4U A;  2FKX A;  2OTJ V;  5H2F Z;  2IH1 C;  2RMK B;  4O4I A;  2KG7 A;  5EYP B;  2EIM B;  5F2V O;  5LOV A;  1V55 C;  1F7Y A;  5EBL C;  2NLJ C;  4LC1 A;  2Q7H A;  3HKE A;  4PJ0 Z;  1IXB A;  4TUY A;  1Y66 A;  1K8A W;  2C2A A;  5LYJ A;  3AG1 B;  2ZE7 A;  1H2S B;  5IDJ A;  2X6C A;  1QLN A;  1GK9 A;  2DE0 X;  3J7A U;  1VQ7 V;  1DF5 A;  1K7D A;  3B8N A;  4TV8 B;  2N74 A;  3ABK C;  1U96 A;  2EIM C;  3THO A;  2PI5 A;  4UV9 A;  1GMG A;  3CHX A;  1XMO B;  5LP6 C;  4NYK A;  4UVB A;  5IT9 N;  5KUK A;  5J2T A;  1GN6 A;  1VAR A;  3AG4 B;  2JK5 C;  2JRI A;  1FJG O;  3SJC C;  2GHY A;  4DV5 O;  2JVD A;  3CEI A;  2LW1 A;  4XDK A;  3GB7 C;  3AG1 C;  3K04 A;  3RVZ A;  2RNB A;  1R6K A;  1ZAU A;  3VQW A;  5B1O A;  2NN4 A;  4R50 A;  1P49 A;  4UUJ C;  5E79 Z;  1P84 F;  4B3R O;  3SYC A;  2AZ0 A;  3ASO C;  2ZM6 B;  4DR4 O;  4FFK A;  4PA7 A;  5FLX N;  2RN9 A;  1Y74 B;  3WB2 A;  3J80 N;  4DR2 B;  3OW2 U;  4RUE A;  3ZMV A;  4ZIB A;  2BSK A;  2YS8 A;  4X1K A;  2OTL V;  1UPG A;  3STZ C;  4LF9 O;  5ITZ A;  3X2Q B;  3HKD A;  4PA3 A;  1NKD A;  2IJI A;  1ZWI C;  2XAJ A;  2DN9 A;  2E5L O;  1J95 A;  1MZE A;  2HKO A;  1ROP A;  1FAF A;  1JOY A;  4QJF B;  3W7T A;  2V1D A;  1SQB H;  2R9R B;  2F95 B;  4UCT A;  3LUT B;  4J9Y B;  4P30 A;  3OUS A;  4JI6 B;  3SPC A;  5EZY B;  4JI3 B;  3FYE B;  1R6T A;  5EK0 A;  1MAB G;  3MHH C;  5KHH A;  4DV7 O;  4W4K A;  2CTW A;  4WBN A;  2E74 B;  3CPW U; 
#chains in the Genus database with same CATH homology
 1NTM H;  2FYU H;  2IBZ H;  3H1K H;  1SQX H;  1SQP H;  1EZV H;  3L75 H;  1KYO F;  1SQV H;  4U3F H;  3H1I H;  3H1L H;  1PPJ H;  1SQQ H;  1SQB H;  1L0L H;  3H1H H;  4PD4 F;  3L71 H;  1NTK H;  1PP9 H;  3CX5 F;  3BCC H;  3CWB H;  4D6T H;  1NU1 H;  3L74 H;  3TGU H;  3CXH F;  3L72 H;  1BCC H;  2A06 H;  1NTZ H;  1BGY H;  2BCC H;  3H1J H;  1BE3 H;  3L70 H;  1L0N H;  1KB9 F;  5KLV H;  3L73 H;  1P84 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...