3H1HH

Cytochrome bc1 complex from chicken
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
total genus 24
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1hH00
1SQQH 3L75H 3L72H 3H1LH 3L74H 1KB9F 3CX5F 5KLVH 1NTZH 3CWBH 1SQPH 1L0LH 3L73H 3H1HH 2IBZH 1KYOF 3H1KH 1BCCH 3BCCH 3H1IH 4D6TH 2BCCH 4PD4F 4U3FH 3TGUH 1BGYH 1BE3H 1EZVH 1SQXH 1NTKH 1SQBH 2A06H 1NU1H 1L0NH 3L71H 2FYUH 3CXHF 3H1JH 1NTMH 1PP9H 1P84F 1SQVH 3L70H 1PPJH
chains in the Genus database with same CATH superfamily
1KC8W 2KSDA 2AXTZ 2ODMA 2ZE6A 4DRXA 2JS3A 3TXQA 3Q4HA 4FPPA 1K9MW 2ZM6O 2X6CA 3DSQA 1JA8A 4MT8A 5HFLA 1XI1A 3K5MA 4RUEA 4X89A 1I5YA 2JEXA 3KCXA 3JATA 3TK1A 3DC6A 4O4IB 1F4MA 2VS0A 1U96A 2Q7EA 3OGIB 3JYCA 1IXMA 5GONB 4B3RO 1COWG 2HJFC 1BCCH 5KUMA 1D5NA 2KG7B 1XUQA 4DR5B 4I55B 1N36B 4AQYB 2QDOA 4DV7B 1KP3A 4QPJA 2P6JA 1BL8A 1FD9A 5TISZ 3SYPA 3CS5A 1H2MA 2EINC 2IW5A 1YTFD 2P5OA 4DR2B 4N23A 5LA6A 2ZIMA 4GZRB 1Q6HA 3BCCH 1P7BA 2RMKB 5LXTA 1JCHA 4LP8A 4ZBMA 5JJNB 1JVMA 2JJ1G 1E1RG 5CMUA 5BR8O 3SGIA 4TWKA 3WU2Z 4DK1A 5B1NA 2PGGA 1LUWA 3HB3B 2AHYA 5JJJB 3K06A 3SYQA 3CJHB 2WLIA 4MTXA 1TVKA 2WLJA 3FB7C 2R72A 1XEQA 3FFQA 2LO1A 1KQSU 2XAHA 4KL1A 4PD4F 5E1AC 4UCRA 2UUAB 3DXRB 5C8YB 4DR7O 4NXMO 3LDCA 1R6KA 5J2UB 4LFCO 3L70H 1FFXB 2QM7A 5CA1A 3K5OA 3TETA 2IBZH 3ABMC 4TUYB 1S5LZ 2HFEC 2O57A 2HR3A 5BMVB 3MHSC 3C3SA 5C93A 4FFKA 3JSNA 1XNQO 4LNUA 4B7EA 2FKXA 3JD2A 1NVPD 3U11A 3N2KA 1MZFA 1GKFA 3H1JH 2HHHB 2JDIG 3E2EA 2GTSA 3E22B 3ABKC 4O2AA 2FTKA 4O4LA 3VQWA 4UFZA 5CA3A 4JAVA 2CH7A 2GTAA 1NJIW 2EIJC 5B1AC 1XNRO 2OCCB 5JVDB 5K1PA 2CTPA 1AP6A 3FB8C 1EZJA 1TAEA 5LA6B 1OCOB 5CN0A 4F4LA 4X1KA 4NXNO 4DV0B 3ABTA 5LXTB 3CX5F 1S76D 3U0ZA 4DR1B 2JS5A 3MAQA 2H8PC 4X62O 1IZ3A 5EBMC 2WLLA 3OMAB 4X1IA 1I7FA 3EXAA 4W4LA 2LP7A 4ZHQB 2A06H 3RT3C 5KHKA 3CXHF 2WLIB 5F2VO 3BVOA 4NTYA 1L8DA 4CH6A 1YJ9V 1K5QA 5CBFA 1ENVA 2EX3A 3ASOB 3RWRD 1ZL8B 5J2TA 4YY3B 1A32A 4CC6A 5J9PC 3JAKB 5E79Z 2ARHA 4WFGA 1J95A 4I4TB 4KP4A 1QR9A 5B1BB 1BSMA 3BA8A 1NT2B 5FPRA 3N27A 1KECA 1YCIA 3N2GA 4DR6B 4WBNA 1R6NA 2EBOA 3R65A 4PA9A 2X6AA 5CB4A 2QA4V 1PNKA 3N2KB 4X64B 3RYIB 4JF3A 4B3SO 1OCRB 4GX2A 5KA6A 1QLEC 5KAFZ 1YJNV 4O2AB 4LF4B 4JI1B 1SQQH 4O4LB 4PHZA 1YIJV 4X1YB 2P06A 1L0LH 2K1EA 3SJCC 4ZI7A 3M99B 4EFEA 1IBKB 3TXSA 5KAIZ 2NR5A 4FM1A 5KMGB 1X4TA 2VQFO 4XDLA 5IJ0B 3VOUA 2CDYA 2RJZA 4GCZA 1UPGA 1YJWV 1SQBH 1VMGA 1PP9H 3IJ4A 1Q6IA 3BRCA 2BTQA 4BIUA 5IYZB 2ZNIA 4K3AA 5KLVH 2EJ7A 4JYCA 5AG2A 1LR1A 1YDXA 1JOYA 4PI2A 2DYRB 4FIPC 2UU9B 1FJGB 4LF7B 4NKGB 3SPHA 4HAMA 1LNQA 1N33B 5FNVB 1Q43A 2DWEC 1NU1H 5JJEB 4XBFA 4W4KA 2Y0PA 1FKAO 1JQ0A 2L35A 2E5LB 3MD0A 2GUZA 5LYJB 1N4CA 4ZOLA 3M7MX 1GMGA 4BAYA 2QE7G 1NS1A 1NBMG 4IIJB 4B3MB 2B5UA 4TSFG 1B3QA 4YJ3A 4GKJO 2CTRA 2WA3A 4CS4A 2UXCO 2KB1A 3ZHSA 4J9ZB 3IC7A 3UT5B 1YF2A 4DYLA 2P90A 4EFBA 1XBLA 5LBQA 5IJ9A 1G8MA 4AI8A 3HR0A 1RM1C 4JAAA 3CSXA 1JFFB 3S3WA 2DW4A 1J5EO 1R3IC 4P9PA 1XHZA 1YXBA 5JCOC 1CXZB 2UXNA 4I0XA 4LFBB 1S5JA 2YI9A 3CC2V 1WA8A 1GTOA 3ETEA 1NTKH 1WPXA 2XAGA 3L71H 3FB5C 2QM8A 3JAWA 4DV1B 2OT5A 1OCZC 3CB2A 3F7VC 1Q86W 1H38A 4UVAA 1DLBA 1OCCB 3H1HH 1GN4A 2YSUB 1U97A 3ICXA 1MMMA 3ABUA 2IU0A 3AG3B 4CS2A 3G6EV 3CRMA 2ITDC 1BT8A 2GUZB 3FB6C 5CA0B 4LFAO 4YIOA 1Q8IA 1KB9F 4EB6B 5JCOA 3H1KH 3ZS8C 4J7ZA 3JARB 1Y76B 1SZXA 4C7UA 1GN3A 4UVBA 2LW7A 4JYAO 2QTOA 3S3XA 2WSSG 2UXDO 2ZDIA 1VQPV 4PDVA 3OTOB 1YITV 4I7ZB 4X66B 4FM2A 1SERA 2G38A 4NTXA 5CBHA 5FLXN 1AJPA 4LF9B 3OR6C 3TCUA 4TOIA 2CK3G 5EC2C 5EIBC 3P3NA 4PA3A 5JH7B 1EFRG 3FAVA 4YHHB 1MNGA 4H0LB 1CPYA 1WJZA 2XAFA 3SPJA 1ZAUA 1SQPH 5LHHA 4JI8B 5IWAB 2XHBA 4IL6Z 4I5SA 4GYCB 4WFAV 4MVUA 4X65O 3E83A 3CEIA 3JCUZ 2EIKB 4PA7A 4MVQA 1ZUQA 4AQYO 1K5SA 2HEPA 3G67A 4DV7O 1RFYA 4OXSA 1EN6A 1MA1A 1KMIZ 4Q20A 3PJSK 3T1YB 2EJRA 4O4IA 1DF5A 1NR7A 5GONA 5K1XA 2QEXV 2VQEO 3JASA 2CTQA 1AR5A 2ZINA 2KG7A 2YEVA 2PZSA 4I55A 1IBLO 2ZXWB 1BQZA 3K3WA 2MK3A 1V54C 4OX9B 1E79G 1SQVH 2NLJC 1GM7A 2ZE5A 2PF4E 3ETGA 2DMXA 5L3CA 1JX9A 3AK1A 4B7KA 3SPIA 3O9OA 4UV8A 1Y4MA 1Z5WA 1OZ0A 2M6YA 1TA8A 3DTUB 3CYOA 4BW9A 3CRRA 5B66Z 4UCOA 4DR4B 4DUZO 2Q73A 4G2KA 3AG7A 3SPGA 3J80N 1AR4A 2YIBD 4LBEC 4YXWG 3D3IA 3CCJV 4D6TH 1Y6XA 2DOSA 2E76B 4PI0A 4JTDB 2W0FC 3E8HA 2Y4TA 4RAIA 1HNZO 4FMTA 2FYUH 4DV6O 1VQMV 4G28B 1NTMH 4JI3O 3VBBA 5GW7A 2YIDA 4MSWC 2OCCC 1RSOB 2WLNA 5EIBD 4PA4A 1OCOC 5J2UA 2V4DA 4L8JA 1FFXA 2DN9A 2L6LA 3STZC 3RBZA 4WFEA 4TUYA 1CP9A 5BMVA 4QIWF 5LOVB 1H2SB 5H6QA 4R6ZA 2CAZC 4Z1MG 2XAJA 1PPJH 3L75H 5CBGA 5EYPB 4PA6A 2N05A 5DN6G 1SQGA 3ZHQA 3ZRXA 3JASB 1XMOO 3E22A 3FKSG 5IY5B 2YEVB 3ASNB 3CCLV 4LF5B 1GN6A 1WPBA 4JI0O 3ASOC 3AG2B 2B1GA 1XDCA 3CD6V 4DK0A 1AP5A 2IJIA 3JD3A 1DTOA 3K0GA 2R9RB 5JVDA 2V1DA 4JYYA 4DV5O 1I94O 2WPDG 3CRAA 1AJQA 1O9GA 5LHGA 1YVWA 2UXXA 2Q6AA 5BY1A 1RP3B 5B3SB 2WLHA 1R3LC 4Z1VA 2Y4UA 4YY3O 4TQFA 2BSKB 1OCRC 2FL4A 2XASA 5LL6Y 2NNUA 1DGSA 1D5AA 3JSLA 4ZHQA 2E74B 4ASUG 3RYFB 1K97A 1MSWD 4BIOA 5IYBO 3ML0A 3HKDA 2ZR3A 3BHPA 4U3FH 1VIBA 2QR4A 4JV5B 4DR6O 1ZL8A 2UUCB 1SS3A 3JAKA 4X64O 4IYHA 2XNDG 4I4TA 1K34A 1M93A 1Q5OA 5DEDA 3VQXA 1DK1A 2PYLA 2Q0OC 4DV2B 1GM8A 1PNMA 3ZRWB 3K59A 1MG1A 1OJHA 2R9AA 2EIMB 3HKCA 3TGUH 2DYRC 4UCUA 2Q4PA 2PUSA 4L87A 3CMEV 3RYIA 3HKEB 2LQTA 1B06A 5HFMA 4GKKO 1QHTA 1V55C 1XOUA 2EILC 3BA9A 4FM0A 3QTCA 4NYKA 1W59A 4JGSA 5LMNO 2Q68A 4JI6B 4J41A 4IYIA 4X1YA 3ZX6A 4K0KB 3M8AA 3FYIB 5BZBA 5LP6B 3NXSA 3K57A 4U7OA 4FZ0A 5KMGA 1FJGO 5IJ0A 2ZM6B 1P4RA 2W0XA 1K7DA 1G1XB 3PN1A 4UUJC 1HW7A 1ZLZA 4BW5A 2H3OA 2A79B 5IYZA 4HYOA 4DV3O 4UB6Z 2HKOA 4PDLA 4MW3A 2HVJC 4LH6A 1M1KW 4DW0A 4DV4O 3MDSA 3IFXA 1VQ6V 2FMLA 1IBMB 1NVPB 3E8BA 2Y69B 1HNWO 2OIEA 1AILA 1EM1A 4B3MO 5FNVA 3CWBH 3AG1C 3HKDB 1GN2A 3E8GA 1BZKA 3ABLC 4KXRA 1FS0G 2JK5C 5LYJA 1EN5A 2P22C 3UCSC 3WFVA 3GB7C 3ZRVA 4DR3B 3VQYA 4ABMA 1ROPA 4IIJA 2ZE7A 1BHBA 1I08A 4X20A 1YEWA 1TUBB 1Q7YW 4UCSA 5BR8B 1ZWIC 4DXWA 3F7YC 1VQLV 4KHPB 2QKAA 3VQVA 3HKCB 4JAUA 3RYHB 1P49A 1OCCC 3UT5A 3F5WC 2ZT9B 3SJAC 1PNLA 1VQ7V 5EK0A 3BFRA 5EC1C 1GAXA 4LFBO 2YICA 3B8NA 3WB1A 4DW1A 3EVKA 1JFFA 3WB2A 4DR7B 1QNMA 1HDJA 1K8AW 2F1MA 1VP7A 2DYSB 1D2DA 4GLXA 2LJ2A 2XAQA 1WN7A 1N34B 4IHJB 1VF5B 5A2QN 2Y0IA 3A8TA 4GUNA 4F6RB 1SC5B 3OGCC 3W7TA 1SQFA 4JI4O 2Q5ZA 4GT1A 1XNQB 1GM9A 3KZIZ 4E2LA 1N32O 4TT3G 1XMQB 3GWKC 3QVNA 4LF6B 5KHGA 2NN4A 3FYEB 3K04A 3AG4B 4WFBV 3P32A 4I50B 4CZZA 4MVOA 1Q82W 3CCSV 1HR0O 2YC0A 1NR1A 4R7CA 5LGNA 1WB7A 1YZBA 2Q9LA 4H13B 2N74A 2JRIA 4QPKA 1HP8A 4JI7O 3D36A 1H2LA 3P3PA 2QSAA 1JJ2U 5CA0A 2WLKA 1XILA 1W0JG 2IH1C 1FXHA 4MTOA 3T2MA 4JI2O 1SZTA 3QG5A 4K35A 2P4VA 4EB6A 4ICGA 4PJ0Z 3UO2A 3C3TA 3ETDA 3JARA 4X20B 1Y76A 1R6TA 4RUFA 4LF9O 2H94A 2IH3C 1VQNV 3W7XA 1Q90D 3OD4A 4J10A 3I55V 2QKSA 1NQTA 1QQCA 3AK3A 3ZRSA 4YHHO 1ZX3A 4MVZA 2R70A 2XUMA 1O9HA 3BAAA 4MTGA 4U3JB 5IWAO 4PELA 3SYAA 4TV8A 4AHCA 1HNXO 4G27B 3ZMUA 3E35A 2ZXWC 4DO2A 5JH7A 3RYCB 2Z3YA 3LDEA 3E8FA 2OWOA 3B8MA 3BPZA 3ZCCA 4QNHB 1M57B 3T1YO 1AJNA 1H8EG 4TV9B 4FLWA 3ZBHA 4WFHA 2ZDIC 4B3SB 3W7UA 1URFA 3D8CA 4OX9O 1QR8A 3OUFA 1W0KG 3QO5A 4EEQA 2W6JG 1GO3F 4O4HB 1FXKB 1S77D 3X2QB 1PL4A 2BOCC 4RWUA 4FLZA 3SR2C 3A0BZ 1XL4A 4RQFA 2A9HA 3B2EE 1EN4A 4DUYO 4D7SA 1R73A 4GX0A 4YJ2A 1M5IA 2UXBO 1G4YB 5JQGA 4JI5O 2ATKC 3ZHUA 2R9IA 1M56B 1DF4A 3LSSA 1AI5A 5JWPA 4FLVA 1VF7A 1NTZH 2JGDB 2N04A 2CGOA 4HNAB 4JASA 4H33A 2RCVA 4FLXA 3ZMVA 1IVSA 2KQXA 4TV8B 1FYJA 4X8AA 4ZIBA 5IY5C 2HP8A 3OM3B 1UJWB 2ETNA 1N8RW 2JEUA 3ZHRA 4O2BB 3AG2C 1MZEA 3H1LH 1Y74B 3QF7A 2DWDC 3CCMV 3T4ZA 1RSOA 3H9VA 5IT9N 1H2GA 2PI5A 3EFFK 2IJKA 1K3EA 4LC1A 2Q67A 1KD1W 1MABG 4DR5O 1JJOA 1N36O 2GDSA 5LMUB 1QBZA 2OCHA 5B3SC 5LOVA 2WWWA 3B09A 1EBOA 3ZEDA 3IGAC 4LWSB 2QKCA 3D3QA 1H2NA 1N0JA 1AI7A 4KUMA 3SYOA 5EYPA 5EZYB 4FLYA 3T1CA 2WAMA 3JD0A 3I56V 4FFBB 3KG2A 1NH2D 1T5EA 1R3JC 4DR2O 2LGWA 4BWAA 5EBLC 1THZA 2QGNA 3ZHVA 3ZMZA 1OHHG 2YIAA 2AZ0A 3OR7C 2V7QG 1IURA 3CMAV 1PKXA 2CGNA 3LDDA 4LH7A 3GVMA 3B40A 1KKCA 4YJ2B 5KX5B 1KP2A 5JQGB 2K9PA 2QWOB 2YXYA 4GX1A 4KFMA 1MOFA 2EIMC 1XL6A 2A3QA 4LR3A 3K5LA 4JV5O 4UB8Z 2UUAO 4UCVA 1BMFG 1SKVA 2BSKA 3WG7B 5A9GA 4LFAB 2ILMA 3CHXA 2YI8A 2QM4A 3RYFA 4MS2A 1TGOA 2ZCEA 3OMNB 3CCVV 2PTMA 1YHQV 4I9QA 2Q7GA 3H01A 1M90W 2IJJA 3OMIB 3CRCA 4B3TB 1FXVA 2CE4A 4Z2WA 3CCRV 2UXDB 5L3EA 2HHHO 4CH3A 2B1IA 1SA0B 3QO8A 3OTFA 2QJ1A 3A0RA 3CCUV 3ZRWA 4JI6O 4BIZA 1AROP 2YUAA 4K0KO 2QWQB 2OYQA 2DQ0A 1NI8A 2Q69A 2Y69C 3HKEA 5H2FZ 2P4KA 2UUBB 4HBNA 4I9WA 3T1HB 1JMKC 1V9PA 2QWPB 2BCCH 3LUTB 1Y66A 3J81N 4DV0O 1VF6A 4P9OA 1EZVH 4DR1O 2PI4A 4LF8B 4AILC 2QWNB 3W7SA 3OT7A 4XDJA 1AI6A 5LP6A 4FVMA 3SJQC 4CC5A 1QVFU 4OPAA 1S0VA 1F23A 1KKDA 4X65B 5B1BC 4CBCA 1SF9A 1IBMO 3G71V 2EZPA 4FJCC 3CCQV 4P2ZA 3LNMB 1QVGU 3APOA 2ZIOA 2F4VB 4PDRA 5ITZB 1RPOA 3B77A 3I5DA 2C2AA 1GK9A 3JD4A 1WLEA 4X9QA 5EBWC 5IYDO 2VQEB 4DR3O 3K58A 4FLUA 1IBLB 2HVKC 3FD9A 1I5XA 4JTCB 1KBHA 1YI2V 3K5NA 2DYSC 4R8CA 2A0LA 4KHPO 4JZ2A 1S72V 3SJBC 2GBOA 3HKBA 1F4NA 2XT9A 4OGQB 5L3GA 2ADQB 3B4SA 3OUSA 3ZN1A 2KKWA 1IX9A 5H9CA 1YTFB 3JALA 1TUBA 4UV9A 4LF4O 4JI1O 4DUZB 1V54B 2RQ6A 4J9YB 3OW2U 4YIPA 3ZMTA 1NKDA 3CPWU 1PD3A 1PV0A 2BTOA 2ZR2A 3AG4C 3RYHA 2RN9A 4BR6A 1JR9A 3UM7A 1IBKO 1N34O 4DRXB 4E4EA 3Q4HB 1HNZB 1Q81W 4X88A 4F6EA 4DV6B 2LFRA 2WLMA 4JI3B 2RNBA 5L3FA 3JATB 5IYCO 1BHAA 1XMQO 4MW8A 1BE3H 3A2FA 4LF6O 1FPOA 4PV1B 4IHJA 2UU9O 4LF7O 4F6RA 4XDKA 5KHHA 1K33A 3L74H 3CP1A 4NR1A 1N33O 1BS3A 3QNEA 2LW1A 4UVCA 1WP7A 2E5LO 1F51A 3ZN0A 4B3RB 3K08A 5H6RA 5LHIA 1XMOB 3W7WA 4I50A 2X7RB 3LNNA 1ZTEA 4MVMA 1SRYA 3SYCA 4JI0B 3K9AA 3IAYA 4B08A 4MVRA 1K4CC 5GTHZ 3K03A 3U10A 4DV5B 3HKBB 1I94B 2AGAA 2YXHA 2YS8A 3L9DA 2AHZA 1TVKB 1M57C 3JALB 3KCYA 3BABA 4FK5C 3L73H 4O4JA 2EZOA 1K92A 5LGUA 2JVDA 5D5QA 1QLNA 4WFFA 2EINB 4QE7A 5CA1B 2Z0AA 2Q7HA 4CS3A 1Q3EA 4U3JA 2Q8VA 3CRQA 3AG3C 1LUVA 5KHIA 1K73W 5LGTA 3D36C 4LNUB 5FL7G 4QGPA 1FXKC 4NXMB 1H8HG 1K4DC 2DQ3A 2P7TC 3G80A 1KYOF 3SDLA 4MTFA 1XQ8A 3X2QC 1ORQC 1M4UA 4N21A 4IGGA 4DV1O 4LFCB 3RYCA 2DJVA 3ETQA 3UO3A 2P67A 1RPRA 3RGBA 2Z5UA 4LCUC 3OFNG 2ZQMA 1GRJA 4IT5A 5FPOA 2OIGA 3RVYA 4FZ1A 4TV9A 4K8ZA 2CH7B 3OEEG 4J42A 1M56C 5IDJA 3H1IH 3AK2A 4GKKB 5KA5A 3EHBB 2YDEA 4X1KB 2F66C 2IJHA 4H37A 3MHHC 2QWRB 1AI4A 5LMNB 3ABMB 4WCEV 1TUEB 5KUKA 1Z2GA 2XTAA 2D3OW 1G6UA 2WLLB 4O4HA 1FXKA 3CE2A 4X1IB 1XNRB 4EKWA 3DC5A 3K0DA 2MW2B 2BE3A 1E1QG 3ZHTA 4NXNB 3OTOO 3SPCA 1BGYH 1V55B 2EILB 4X66O 1PM9A 3ABKB 3O65A 1OV9A 4X62B 4DV3B 1S5HC 4OPHA 1VARA 4O4JB 3QO7A 1AR1B 2CTWA 5J2TB 4DV4B 1SETA 1VQ8V 2EIKC 2F95B 3K9SA 2A7WA 1L1FA 2ZD9A 2EIJB 3ZMSA 5B1AB 1HNWB 2LGQA 1R1BA 1XHXA 3TJTA 4PDMA 2JGDA 2VRZA 4JI8O 4HNAA 2ADPA 3N2GB 4WBNB 1FFTB 3WB0A 3LSQA 4R50A 2E3CA 1WNSA 3OAAG 2GHYA 5CB4B 3KKYA 2DE0X 2FB5A 2Y48A 4J7JA 4NTWA 1PL0A 2HLDG 2JIZG 4O2BA 3BY6A 3ZJZA 2F93B 1Y74A 5LMUO 3JD1A 2XOKG 1CEZA 4CH5A 3K79A 2GSMB 3AG1B 4TQDA 1VQOV 3ABLB 4ZI7B 3CCEV 1QCEA 4J11A 3CC7V 4JPRA 1IDSA 1MSDA 1N0NA 3IC9A 3STLC 1WP8A 2AZ2A 1VEWA 5GTIZ 2IU3A 1US6A 4LWSA 1Z5VA 4H44B 3THOA 1SQXH 3ZIAG 3WG7C 5EZYA 2BTQB 1L0NH 4FFBA 1NZ6A 3G6BA 1XREA 4JYBA 2F43G 2VQFB 5D5PA 2QTSA 2VWKA 4JI4B 1QLEB 2ZNJA 3RVZA 3E86A 4DR4O 1AVMA 4FLTA 4RO2A 1N32B 4UXNA 3UQ8A 2OTLV 3DGEA 2X6BA 2D2CB 1SESA 5KX5A 3JAMN 4ZOLB 1GH6A 2Q0AA 3R66A 1FAFA 4J80A 1HR0B 4YJ3B 4D7TA 4A5UB 4JI7B 1B04A 3G4SV 3T4DA 4U7NA 4B3TO 2CUGA 3GWOA 1WAZA 3HPLC 3ASNC 4JI2B 1IXBA 3RW0A 2F23A 3L72H 1ZSPA 1B6QA 1R3KC 5IJ9B 3CC4V 3OEHG 1AB3A 4GKJB 2IM9A 4UCTA 2E75B 2M7WA 3APQA 2UXCB 5KHJA 3AEIA 2UUBO 1BQ0A 2BOBC 4WF9V 3T1HO 4NB5A 2ITCC 5BXZA 1SA0A 1VQ4V 2YXLA 4I0XB 5L3BA 2HG5C 1S3JA 4Q6GA 2GV9A 4LF5O 3CXCU 2OTJV 4RQEA 1WA8B 4LF8O 5DECA 1J5EB 1HNXB 4JTAB 1KUQA 3JAWB 1M9NA 4P30A 3C90A 2JJ2G 3P30A 3JCZA 2WA4A 3J7AU 1VQKV 2JGUA 1F7YA 2YIBA 4J7KA 3E89A 1HWYA 1P84F 2B9ZA 4MVSA 4GX5A 2F4VO 3FX7A 1JPXA 1RM1B 2HJDA 2RDCA 2W6IG 1W2BU 3RFRA 4QJFB 2AW9A 1YSCA 3NR7A 4ZKIA 1VQ5V 1Y67A 5ITZA 3RN4A 4QE9A 4CH4A 2UUCO 5B5EZ 1X59A 2X0LA 5DM6V 1H2KA 5IE9A 5B1OA 1VF6C 1OCZB 1P7GA 2ZE8A 2ZKOA 1KU9A 1NH2B 2LFSA 4DV2O 4HZ3A 5LP6C 1Q6UA 2EULA 5L3DA 4DUYB 3LSUA 4JYAB 3UKMA 4JZGA 2UXBB 3CJHA 2PY5A 4JI5B 3FAVB 1I0HA 3BEHA 3A0HZ 3F5TA 2VWJA 4K8XA 2PYJA 4NVPA 5H5NA 3DXRA 5C8YA 1QU7A 1UFIA 1WB8A 3OE7G 1VQ9V
chains in the Genus database with same CATH topology
1SQQH 3L75H 3L72H 3H1LH 3L74H 1KB9F 3CX5F 5KLVH 1NTZH 3CWBH 1SQPH 1L0LH 3L73H 3H1HH 2IBZH 1KYOF 3H1KH 1BCCH 3BCCH 3H1IH 4D6TH 2BCCH 4PD4F 4U3FH 3TGUH 1BGYH 1BE3H 1EZVH 1SQXH 1NTKH 1SQBH 2A06H 1NU1H 1L0NH 3L71H 2FYUH 3CXHF 3H1JH 1NTMH 1PP9H 1P84F 1SQVH 3L70H 1PPJH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ H;  3L75 H;  3L72 H;  3H1L H;  3L74 H;  1KB9 F;  3CX5 F;  5KLV H;  1NTZ H;  3CWB H;  1SQP H;  1L0L H;  3L73 H;  3H1H H;  2IBZ H;  1KYO F;  3H1K H;  1BCC H;  3BCC H;  3H1I H;  4D6T H;  2BCC H;  4PD4 F;  4U3F H;  3TGU H;  1BGY H;  1BE3 H;  1EZV H;  1SQX H;  1NTK H;  1SQB H;  2A06 H;  1NU1 H;  1L0N H;  3L71 H;  2FYU H;  3CXH F;  3H1J H;  1NTM H;  1PP9 H;  1P84 F;  1SQV H;  3L70 H;  1PPJ H; 
#chains in the Genus database with same CATH topology
 1KC8 W;  2KSD A;  2AXT Z;  2ODM A;  2ZE6 A;  4DRX A;  2JS3 A;  3TXQ A;  3Q4H A;  4FPP A;  1K9M W;  2ZM6 O;  2X6C A;  3DSQ A;  1JA8 A;  4MT8 A;  5HFL A;  1XI1 A;  3K5M A;  4RUE A;  4X89 A;  1I5Y A;  2JEX A;  3KCX A;  3JAT A;  3TK1 A;  3DC6 A;  4O4I B;  1F4M A;  2VS0 A;  1U96 A;  2Q7E A;  3OGI B;  3JYC A;  1IXM A;  5GON B;  4B3R O;  1COW G;  2HJF C;  1BCC H;  5KUM A;  1D5N A;  2KG7 B;  1XUQ A;  4DR5 B;  4I55 B;  1N36 B;  4AQY B;  2QDO A;  4DV7 B;  1KP3 A;  4QPJ A;  2P6J A;  1BL8 A;  1FD9 A;  5TIS Z;  3SYP A;  3CS5 A;  1H2M A;  2EIN C;  2IW5 A;  1YTF D;  2P5O A;  4DR2 B;  4N23 A;  5LA6 A;  2ZIM A;  4GZR B;  1Q6H A;  3BCC H;  1P7B A;  2RMK B;  5LXT A;  1JCH A;  4LP8 A;  4ZBM A;  5JJN B;  1JVM A;  2JJ1 G;  1E1R G;  5CMU A;  5BR8 O;  3SGI A;  4TWK A;  3WU2 Z;  4DK1 A;  5B1N A;  2PGG A;  1LUW A;  3HB3 B;  2AHY A;  5JJJ B;  3K06 A;  3SYQ A;  3CJH B;  2WLI A;  4MTX A;  1TVK A;  2WLJ A;  3FB7 C;  2R72 A;  1XEQ A;  3FFQ A;  2LO1 A;  1KQS U;  2XAH A;  4KL1 A;  4PD4 F;  5E1A C;  4UCR A;  2UUA B;  3DXR B;  5C8Y B;  4DR7 O;  4NXM O;  3LDC A;  1R6K A;  5J2U B;  4LFC O;  3L70 H;  1FFX B;  2QM7 A;  5CA1 A;  3K5O A;  3TET A;  2IBZ H;  3ABM C;  4TUY B;  1S5L Z;  2HFE C;  2O57 A;  2HR3 A;  5BMV B;  3MHS C;  3C3S A;  5C93 A;  4FFK A;  3JSN A;  1XNQ O;  4LNU A;  4B7E A;  2FKX A;  3JD2 A;  1NVP D;  3U11 A;  3N2K A;  1MZF A;  1GKF A;  3H1J H;  2HHH B;  2JDI G;  3E2E A;  2GTS A;  3E22 B;  3ABK C;  4O2A A;  2FTK A;  4O4L A;  3VQW A;  4UFZ A;  5CA3 A;  4JAV A;  2CH7 A;  2GTA A;  1NJI W;  2EIJ C;  5B1A C;  1XNR O;  2OCC B;  5JVD B;  5K1P A;  2CTP A;  1AP6 A;  3FB8 C;  1EZJ A;  1TAE A;  5LA6 B;  1OCO B;  5CN0 A;  4F4L A;  4X1K A;  4NXN O;  4DV0 B;  3ABT A;  5LXT B;  3CX5 F;  1S76 D;  3U0Z A;  4DR1 B;  2JS5 A;  3MAQ A;  2H8P C;  4X62 O;  1IZ3 A;  5EBM C;  2WLL A;  3OMA B;  4X1I A;  1I7F A;  3EXA A;  4W4L A;  2LP7 A;  4ZHQ B;  2A06 H;  3RT3 C;  5KHK A;  3CXH F;  2WLI B;  5F2V O;  3BVO A;  4NTY A;  1L8D A;  4CH6 A;  1YJ9 V;  1K5Q A;  5CBF A;  1ENV A;  2EX3 A;  3ASO B;  3RWR D;  1ZL8 B;  5J2T A;  4YY3 B;  1A32 A;  4CC6 A;  5J9P C;  3JAK B;  5E79 Z;  2ARH A;  4WFG A;  1J95 A;  4I4T B;  4KP4 A;  1QR9 A;  5B1B B;  1BSM A;  3BA8 A;  1NT2 B;  5FPR A;  3N27 A;  1KEC A;  1YCI A;  3N2G A;  4DR6 B;  4WBN A;  1R6N A;  2EBO A;  3R65 A;  4PA9 A;  2X6A A;  5CB4 A;  2QA4 V;  1PNK A;  3N2K B;  4X64 B;  3RYI B;  4JF3 A;  4B3S O;  1OCR B;  4GX2 A;  5KA6 A;  1QLE C;  5KAF Z;  1YJN V;  4O2A B;  4LF4 B;  4JI1 B;  1SQQ H;  4O4L B;  4PHZ A;  1YIJ V;  4X1Y B;  2P06 A;  1L0L H;  2K1E A;  3SJC C;  4ZI7 A;  3M99 B;  4EFE A;  1IBK B;  3TXS A;  5KAI Z;  2NR5 A;  4FM1 A;  5KMG B;  1X4T A;  2VQF O;  4XDL A;  5IJ0 B;  3VOU A;  2CDY A;  2RJZ A;  4GCZ A;  1UPG A;  1YJW V;  1SQB H;  1VMG A;  1PP9 H;  3IJ4 A;  1Q6I A;  3BRC A;  2BTQ A;  4BIU A;  5IYZ B;  2ZNI A;  4K3A A;  5KLV H;  2EJ7 A;  4JYC A;  5AG2 A;  1LR1 A;  1YDX A;  1JOY A;  4PI2 A;  2DYR B;  4FIP C;  2UU9 B;  1FJG B;  4LF7 B;  4NKG B;  3SPH A;  4HAM A;  1LNQ A;  1N33 B;  5FNV B;  1Q43 A;  2DWE C;  1NU1 H;  5JJE B;  4XBF A;  4W4K A;  2Y0P A;  1FKA O;  1JQ0 A;  2L35 A;  2E5L B;  3MD0 A;  2GUZ A;  5LYJ B;  1N4C A;  4ZOL A;  3M7M X;  1GMG A;  4BAY A;  2QE7 G;  1NS1 A;  1NBM G;  4IIJ B;  4B3M B;  2B5U A;  4TSF G;  1B3Q A;  4YJ3 A;  4GKJ O;  2CTR A;  2WA3 A;  4CS4 A;  2UXC O;  2KB1 A;  3ZHS A;  4J9Z B;  3IC7 A;  3UT5 B;  1YF2 A;  4DYL A;  2P90 A;  4EFB A;  1XBL A;  5LBQ A;  5IJ9 A;  1G8M A;  4AI8 A;  3HR0 A;  1RM1 C;  4JAA A;  3CSX A;  1JFF B;  3S3W A;  2DW4 A;  1J5E O;  1R3I C;  4P9P A;  1XHZ A;  1YXB A;  5JCO C;  1CXZ B;  2UXN A;  4I0X A;  4LFB B;  1S5J A;  2YI9 A;  3CC2 V;  1WA8 A;  1GTO A;  3ETE A;  1NTK H;  1WPX A;  2XAG A;  3L71 H;  3FB5 C;  2QM8 A;  3JAW A;  4DV1 B;  2OT5 A;  1OCZ C;  3CB2 A;  3F7V C;  1Q86 W;  1H38 A;  4UVA A;  1DLB A;  1OCC B;  3H1H H;  1GN4 A;  2YSU B;  1U97 A;  3ICX A;  1MMM A;  3ABU A;  2IU0 A;  3AG3 B;  4CS2 A;  3G6E V;  3CRM A;  2ITD C;  1BT8 A;  2GUZ B;  3FB6 C;  5CA0 B;  4LFA O;  4YIO A;  1Q8I A;  1KB9 F;  4EB6 B;  5JCO A;  3H1K H;  3ZS8 C;  4J7Z A;  3JAR B;  1Y76 B;  1SZX A;  4C7U A;  1GN3 A;  4UVB A;  2LW7 A;  4JYA O;  2QTO A;  3S3X A;  2WSS G;  2UXD O;  2ZDI A;  1VQP V;  4PDV A;  3OTO B;  1YIT V;  4I7Z B;  4X66 B;  4FM2 A;  1SER A;  2G38 A;  4NTX A;  5CBH A;  5FLX N;  1AJP A;  4LF9 B;  3OR6 C;  3TCU A;  4TOI A;  2CK3 G;  5EC2 C;  5EIB C;  3P3N A;  4PA3 A;  5JH7 B;  1EFR G;  3FAV A;  4YHH B;  1MNG A;  4H0L B;  1CPY A;  1WJZ A;  2XAF A;  3SPJ A;  1ZAU A;  1SQP H;  5LHH A;  4JI8 B;  5IWA B;  2XHB A;  4IL6 Z;  4I5S A;  4GYC B;  4WFA V;  4MVU A;  4X65 O;  3E83 A;  3CEI A;  3JCU Z;  2EIK B;  4PA7 A;  4MVQ A;  1ZUQ A;  4AQY O;  1K5S A;  2HEP A;  3G67 A;  4DV7 O;  1RFY A;  4OXS A;  1EN6 A;  1MA1 A;  1KMI Z;  4Q20 A;  3PJS K;  3T1Y B;  2EJR A;  4O4I A;  1DF5 A;  1NR7 A;  5GON A;  5K1X A;  2QEX V;  2VQE O;  3JAS A;  2CTQ A;  1AR5 A;  2ZIN A;  2KG7 A;  2YEV A;  2PZS A;  4I55 A;  1IBL O;  2ZXW B;  1BQZ A;  3K3W A;  2MK3 A;  1V54 C;  4OX9 B;  1E79 G;  1SQV H;  2NLJ C;  1GM7 A;  2ZE5 A;  2PF4 E;  3ETG A;  2DMX A;  5L3C A;  1JX9 A;  3AK1 A;  4B7K A;  3SPI A;  3O9O A;  4UV8 A;  1Y4M A;  1Z5W A;  1OZ0 A;  2M6Y A;  1TA8 A;  3DTU B;  3CYO A;  4BW9 A;  3CRR A;  5B66 Z;  4UCO A;  4DR4 B;  4DUZ O;  2Q73 A;  4G2K A;  3AG7 A;  3SPG A;  3J80 N;  1AR4 A;  2YIB D;  4LBE C;  4YXW G;  3D3I A;  3CCJ V;  4D6T H;  1Y6X A;  2DOS A;  2E76 B;  4PI0 A;  4JTD B;  2W0F C;  3E8H A;  2Y4T A;  4RAI A;  1HNZ O;  4FMT A;  2FYU H;  4DV6 O;  1VQM V;  4G28 B;  1NTM H;  4JI3 O;  3VBB A;  5GW7 A;  2YID A;  4MSW C;  2OCC C;  1RSO B;  2WLN A;  5EIB D;  4PA4 A;  1OCO C;  5J2U A;  2V4D A;  4L8J A;  1FFX A;  2DN9 A;  2L6L A;  3STZ C;  3RBZ A;  4WFE A;  4TUY A;  1CP9 A;  5BMV A;  4QIW F;  5LOV B;  1H2S B;  5H6Q A;  4R6Z A;  2CAZ C;  4Z1M G;  2XAJ A;  1PPJ H;  3L75 H;  5CBG A;  5EYP B;  4PA6 A;  2N05 A;  5DN6 G;  1SQG A;  3ZHQ A;  3ZRX A;  3JAS B;  1XMO O;  3E22 A;  3FKS G;  5IY5 B;  2YEV B;  3ASN B;  3CCL V;  4LF5 B;  1GN6 A;  1WPB A;  4JI0 O;  3ASO C;  3AG2 B;  2B1G A;  1XDC A;  3CD6 V;  4DK0 A;  1AP5 A;  2IJI A;  3JD3 A;  1DTO A;  3K0G A;  2R9R B;  5JVD A;  2V1D A;  4JYY A;  4DV5 O;  1I94 O;  2WPD G;  3CRA A;  1AJQ A;  1O9G A;  5LHG A;  1YVW A;  2UXX A;  2Q6A A;  5BY1 A;  1RP3 B;  5B3S B;  2WLH A;  1R3L C;  4Z1V A;  2Y4U A;  4YY3 O;  4TQF A;  2BSK B;  1OCR C;  2FL4 A;  2XAS A;  5LL6 Y;  2NNU A;  1DGS A;  1D5A A;  3JSL A;  4ZHQ A;  2E74 B;  4ASU G;  3RYF B;  1K97 A;  1MSW D;  4BIO A;  5IYB O;  3ML0 A;  3HKD A;  2ZR3 A;  3BHP A;  4U3F H;  1VIB A;  2QR4 A;  4JV5 B;  4DR6 O;  1ZL8 A;  2UUC B;  1SS3 A;  3JAK A;  4X64 O;  4IYH A;  2XND G;  4I4T A;  1K34 A;  1M93 A;  1Q5O A;  5DED A;  3VQX A;  1DK1 A;  2PYL A;  2Q0O C;  4DV2 B;  1GM8 A;  1PNM A;  3ZRW B;  3K59 A;  1MG1 A;  1OJH A;  2R9A A;  2EIM B;  3HKC A;  3TGU H;  2DYR C;  4UCU A;  2Q4P A;  2PUS A;  4L87 A;  3CME V;  3RYI A;  3HKE B;  2LQT A;  1B06 A;  5HFM A;  4GKK O;  1QHT A;  1V55 C;  1XOU A;  2EIL C;  3BA9 A;  4FM0 A;  3QTC A;  4NYK A;  1W59 A;  4JGS A;  5LMN O;  2Q68 A;  4JI6 B;  4J41 A;  4IYI A;  4X1Y A;  3ZX6 A;  4K0K B;  3M8A A;  3FYI B;  5BZB A;  5LP6 B;  3NXS A;  3K57 A;  4U7O A;  4FZ0 A;  5KMG A;  1FJG O;  5IJ0 A;  2ZM6 B;  1P4R A;  2W0X A;  1K7D A;  1G1X B;  3PN1 A;  4UUJ C;  1HW7 A;  1ZLZ A;  4BW5 A;  2H3O A;  2A79 B;  5IYZ A;  4HYO A;  4DV3 O;  4UB6 Z;  2HKO A;  4PDL A;  4MW3 A;  2HVJ C;  4LH6 A;  1M1K W;  4DW0 A;  4DV4 O;  3MDS A;  3IFX A;  1VQ6 V;  2FML A;  1IBM B;  1NVP B;  3E8B A;  2Y69 B;  1HNW O;  2OIE A;  1AIL A;  1EM1 A;  4B3M O;  5FNV A;  3CWB H;  3AG1 C;  3HKD B;  1GN2 A;  3E8G A;  1BZK A;  3ABL C;  4KXR A;  1FS0 G;  2JK5 C;  5LYJ A;  1EN5 A;  2P22 C;  3UCS C;  3WFV A;  3GB7 C;  3ZRV A;  4DR3 B;  3VQY A;  4ABM A;  1ROP A;  4IIJ A;  2ZE7 A;  1BHB A;  1I08 A;  4X20 A;  1YEW A;  1TUB B;  1Q7Y W;  4UCS A;  5BR8 B;  1ZWI C;  4DXW A;  3F7Y C;  1VQL V;  4KHP B;  2QKA A;  3VQV A;  3HKC B;  4JAU A;  3RYH B;  1P49 A;  1OCC C;  3UT5 A;  3F5W C;  2ZT9 B;  3SJA C;  1PNL A;  1VQ7 V;  5EK0 A;  3BFR A;  5EC1 C;  1GAX A;  4LFB O;  2YIC A;  3B8N A;  3WB1 A;  4DW1 A;  3EVK A;  1JFF A;  3WB2 A;  4DR7 B;  1QNM A;  1HDJ A;  1K8A W;  2F1M A;  1VP7 A;  2DYS B;  1D2D A;  4GLX A;  2LJ2 A;  2XAQ A;  1WN7 A;  1N34 B;  4IHJ B;  1VF5 B;  5A2Q N;  2Y0I A;  3A8T A;  4GUN A;  4F6R B;  1SC5 B;  3OGC C;  3W7T A;  1SQF A;  4JI4 O;  2Q5Z A;  4GT1 A;  1XNQ B;  1GM9 A;  3KZI Z;  4E2L A;  1N32 O;  4TT3 G;  1XMQ B;  3GWK C;  3QVN A;  4LF6 B;  5KHG A;  2NN4 A;  3FYE B;  3K04 A;  3AG4 B;  4WFB V;  3P32 A;  4I50 B;  4CZZ A;  4MVO A;  1Q82 W;  3CCS V;  1HR0 O;  2YC0 A;  1NR1 A;  4R7C A;  5LGN A;  1WB7 A;  1YZB A;  2Q9L A;  4H13 B;  2N74 A;  2JRI A;  4QPK A;  1HP8 A;  4JI7 O;  3D36 A;  1H2L A;  3P3P A;  2QSA A;  1JJ2 U;  5CA0 A;  2WLK A;  1XIL A;  1W0J G;  2IH1 C;  1FXH A;  4MTO A;  3T2M A;  4JI2 O;  1SZT A;  3QG5 A;  4K35 A;  2P4V A;  4EB6 A;  4ICG A;  4PJ0 Z;  3UO2 A;  3C3T A;  3ETD A;  3JAR A;  4X20 B;  1Y76 A;  1R6T A;  4RUF A;  4LF9 O;  2H94 A;  2IH3 C;  1VQN V;  3W7X A;  1Q90 D;  3OD4 A;  4J10 A;  3I55 V;  2QKS A;  1NQT A;  1QQC A;  3AK3 A;  3ZRS A;  4YHH O;  1ZX3 A;  4MVZ A;  2R70 A;  2XUM A;  1O9H A;  3BAA A;  4MTG A;  4U3J B;  5IWA O;  4PEL A;  3SYA A;  4TV8 A;  4AHC A;  1HNX O;  4G27 B;  3ZMU A;  3E35 A;  2ZXW C;  4DO2 A;  5JH7 A;  3RYC B;  2Z3Y A;  3LDE A;  3E8F A;  2OWO A;  3B8M A;  3BPZ A;  3ZCC A;  4QNH B;  1M57 B;  3T1Y O;  1AJN A;  1H8E G;  4TV9 B;  4FLW A;  3ZBH A;  4WFH A;  2ZDI C;  4B3S B;  3W7U A;  1URF A;  3D8C A;  4OX9 O;  1QR8 A;  3OUF A;  1W0K G;  3QO5 A;  4EEQ A;  2W6J G;  1GO3 F;  4O4H B;  1FXK B;  1S77 D;  3X2Q B;  1PL4 A;  2BOC C;  4RWU A;  4FLZ A;  3SR2 C;  3A0B Z;  1XL4 A;  4RQF A;  2A9H A;  3B2E E;  1EN4 A;  4DUY O;  4D7S A;  1R73 A;  4GX0 A;  4YJ2 A;  1M5I A;  2UXB O;  1G4Y B;  5JQG A;  4JI5 O;  2ATK C;  3ZHU A;  2R9I A;  1M56 B;  1DF4 A;  3LSS A;  1AI5 A;  5JWP A;  4FLV A;  1VF7 A;  1NTZ H;  2JGD B;  2N04 A;  2CGO A;  4HNA B;  4JAS A;  4H33 A;  2RCV A;  4FLX A;  3ZMV A;  1IVS A;  2KQX A;  4TV8 B;  1FYJ A;  4X8A A;  4ZIB A;  5IY5 C;  2HP8 A;  3OM3 B;  1UJW B;  2ETN A;  1N8R W;  2JEU A;  3ZHR A;  4O2B B;  3AG2 C;  1MZE A;  3H1L H;  1Y74 B;  3QF7 A;  2DWD C;  3CCM V;  3T4Z A;  1RSO A;  3H9V A;  5IT9 N;  1H2G A;  2PI5 A;  3EFF K;  2IJK A;  1K3E A;  4LC1 A;  2Q67 A;  1KD1 W;  1MAB G;  4DR5 O;  1JJO A;  1N36 O;  2GDS A;  5LMU B;  1QBZ A;  2OCH A;  5B3S C;  5LOV A;  2WWW A;  3B09 A;  1EBO A;  3ZED A;  3IGA C;  4LWS B;  2QKC A;  3D3Q A;  1H2N A;  1N0J A;  1AI7 A;  4KUM A;  3SYO A;  5EYP A;  5EZY B;  4FLY A;  3T1C A;  2WAM A;  3JD0 A;  3I56 V;  4FFB B;  3KG2 A;  1NH2 D;  1T5E A;  1R3J C;  4DR2 O;  2LGW A;  4BWA A;  5EBL C;  1THZ A;  2QGN A;  3ZHV A;  3ZMZ A;  1OHH G;  2YIA A;  2AZ0 A;  3OR7 C;  2V7Q G;  1IUR A;  3CMA V;  1PKX A;  2CGN A;  3LDD A;  4LH7 A;  3GVM A;  3B40 A;  1KKC A;  4YJ2 B;  5KX5 B;  1KP2 A;  5JQG B;  2K9P A;  2QWO B;  2YXY A;  4GX1 A;  4KFM A;  1MOF A;  2EIM C;  1XL6 A;  2A3Q A;  4LR3 A;  3K5L A;  4JV5 O;  4UB8 Z;  2UUA O;  4UCV A;  1BMF G;  1SKV A;  2BSK A;  3WG7 B;  5A9G A;  4LFA B;  2ILM A;  3CHX A;  2YI8 A;  2QM4 A;  3RYF A;  4MS2 A;  1TGO A;  2ZCE A;  3OMN B;  3CCV V;  2PTM A;  1YHQ V;  4I9Q A;  2Q7G A;  3H01 A;  1M90 W;  2IJJ A;  3OMI B;  3CRC A;  4B3T B;  1FXV A;  2CE4 A;  4Z2W A;  3CCR V;  2UXD B;  5L3E A;  2HHH O;  4CH3 A;  2B1I A;  1SA0 B;  3QO8 A;  3OTF A;  2QJ1 A;  3A0R A;  3CCU V;  3ZRW A;  4JI6 O;  4BIZ A;  1ARO P;  2YUA A;  4K0K O;  2QWQ B;  2OYQ A;  2DQ0 A;  1NI8 A;  2Q69 A;  2Y69 C;  3HKE A;  5H2F Z;  2P4K A;  2UUB B;  4HBN A;  4I9W A;  3T1H B;  1JMK C;  1V9P A;  2QWP B;  2BCC H;  3LUT B;  1Y66 A;  3J81 N;  4DV0 O;  1VF6 A;  4P9O A;  1EZV H;  4DR1 O;  2PI4 A;  4LF8 B;  4AIL C;  2QWN B;  3W7S A;  3OT7 A;  4XDJ A;  1AI6 A;  5LP6 A;  4FVM A;  3SJQ C;  4CC5 A;  1QVF U;  4OPA A;  1S0V A;  1F23 A;  1KKD A;  4X65 B;  5B1B C;  4CBC A;  1SF9 A;  1IBM O;  3G71 V;  2EZP A;  4FJC C;  3CCQ V;  4P2Z A;  3LNM B;  1QVG U;  3APO A;  2ZIO A;  2F4V B;  4PDR A;  5ITZ B;  1RPO A;  3B77 A;  3I5D A;  2C2A A;  1GK9 A;  3JD4 A;  1WLE A;  4X9Q A;  5EBW C;  5IYD O;  2VQE B;  4DR3 O;  3K58 A;  4FLU A;  1IBL B;  2HVK C;  3FD9 A;  1I5X A;  4JTC B;  1KBH A;  1YI2 V;  3K5N A;  2DYS C;  4R8C A;  2A0L A;  4KHP O;  4JZ2 A;  1S72 V;  3SJB C;  2GBO A;  3HKB A;  1F4N A;  2XT9 A;  4OGQ B;  5L3G A;  2ADQ B;  3B4S A;  3OUS A;  3ZN1 A;  2KKW A;  1IX9 A;  5H9C A;  1YTF B;  3JAL A;  1TUB A;  4UV9 A;  4LF4 O;  4JI1 O;  4DUZ B;  1V54 B;  2RQ6 A;  4J9Y B;  3OW2 U;  4YIP A;  3ZMT A;  1NKD A;  3CPW U;  1PD3 A;  1PV0 A;  2BTO A;  2ZR2 A;  3AG4 C;  3RYH A;  2RN9 A;  4BR6 A;  1JR9 A;  3UM7 A;  1IBK O;  1N34 O;  4DRX B;  4E4E A;  3Q4H B;  1HNZ B;  1Q81 W;  4X88 A;  4F6E A;  4DV6 B;  2LFR A;  2WLM A;  4JI3 B;  2RNB A;  5L3F A;  3JAT B;  5IYC O;  1BHA A;  1XMQ O;  4MW8 A;  1BE3 H;  3A2F A;  4LF6 O;  1FPO A;  4PV1 B;  4IHJ A;  2UU9 O;  4LF7 O;  4F6R A;  4XDK A;  5KHH A;  1K33 A;  3L74 H;  3CP1 A;  4NR1 A;  1N33 O;  1BS3 A;  3QNE A;  2LW1 A;  4UVC A;  1WP7 A;  2E5L O;  1F51 A;  3ZN0 A;  4B3R B;  3K08 A;  5H6R A;  5LHI A;  1XMO B;  3W7W A;  4I50 A;  2X7R B;  3LNN A;  1ZTE A;  4MVM A;  1SRY A;  3SYC A;  4JI0 B;  3K9A A;  3IAY A;  4B08 A;  4MVR A;  1K4C C;  5GTH Z;  3K03 A;  3U10 A;  4DV5 B;  3HKB B;  1I94 B;  2AGA A;  2YXH A;  2YS8 A;  3L9D A;  2AHZ A;  1TVK B;  1M57 C;  3JAL B;  3KCY A;  3BAB A;  4FK5 C;  3L73 H;  4O4J A;  2EZO A;  1K92 A;  5LGU A;  2JVD A;  5D5Q A;  1QLN A;  4WFF A;  2EIN B;  4QE7 A;  5CA1 B;  2Z0A A;  2Q7H A;  4CS3 A;  1Q3E A;  4U3J A;  2Q8V A;  3CRQ A;  3AG3 C;  1LUV A;  5KHI A;  1K73 W;  5LGT A;  3D36 C;  4LNU B;  5FL7 G;  4QGP A;  1FXK C;  4NXM B;  1H8H G;  1K4D C;  2DQ3 A;  2P7T C;  3G80 A;  1KYO F;  3SDL A;  4MTF A;  1XQ8 A;  3X2Q C;  1ORQ C;  1M4U A;  4N21 A;  4IGG A;  4DV1 O;  4LFC B;  3RYC A;  2DJV A;  3ETQ A;  3UO3 A;  2P67 A;  1RPR A;  3RGB A;  2Z5U A;  4LCU C;  3OFN G;  2ZQM A;  1GRJ A;  4IT5 A;  5FPO A;  2OIG A;  3RVY A;  4FZ1 A;  4TV9 A;  4K8Z A;  2CH7 B;  3OEE G;  4J42 A;  1M56 C;  5IDJ A;  3H1I H;  3AK2 A;  4GKK B;  5KA5 A;  3EHB B;  2YDE A;  4X1K B;  2F66 C;  2IJH A;  4H37 A;  3MHH C;  2QWR B;  1AI4 A;  5LMN B;  3ABM B;  4WCE V;  1TUE B;  5KUK A;  1Z2G A;  2XTA A;  2D3O W;  1G6U A;  2WLL B;  4O4H A;  1FXK A;  3CE2 A;  4X1I B;  1XNR B;  4EKW A;  3DC5 A;  3K0D A;  2MW2 B;  2BE3 A;  1E1Q G;  3ZHT A;  4NXN B;  3OTO O;  3SPC A;  1BGY H;  1V55 B;  2EIL B;  4X66 O;  1PM9 A;  3ABK B;  3O65 A;  1OV9 A;  4X62 B;  4DV3 B;  1S5H C;  4OPH A;  1VAR A;  4O4J B;  3QO7 A;  1AR1 B;  2CTW A;  5J2T B;  4DV4 B;  1SET A;  1VQ8 V;  2EIK C;  2F95 B;  3K9S A;  2A7W A;  1L1F A;  2ZD9 A;  2EIJ B;  3ZMS A;  5B1A B;  1HNW B;  2LGQ A;  1R1B A;  1XHX A;  3TJT A;  4PDM A;  2JGD A;  2VRZ A;  4JI8 O;  4HNA A;  2ADP A;  3N2G B;  4WBN B;  1FFT B;  3WB0 A;  3LSQ A;  4R50 A;  2E3C A;  1WNS A;  3OAA G;  2GHY A;  5CB4 B;  3KKY A;  2DE0 X;  2FB5 A;  2Y48 A;  4J7J A;  4NTW A;  1PL0 A;  2HLD G;  2JIZ G;  4O2B A;  3BY6 A;  3ZJZ A;  2F93 B;  1Y74 A;  5LMU O;  3JD1 A;  2XOK G;  1CEZ A;  4CH5 A;  3K79 A;  2GSM B;  3AG1 B;  4TQD A;  1VQO V;  3ABL B;  4ZI7 B;  3CCE V;  1QCE A;  4J11 A;  3CC7 V;  4JPR A;  1IDS A;  1MSD A;  1N0N A;  3IC9 A;  3STL C;  1WP8 A;  2AZ2 A;  1VEW A;  5GTI Z;  2IU3 A;  1US6 A;  4LWS A;  1Z5V A;  4H44 B;  3THO A;  1SQX H;  3ZIA G;  3WG7 C;  5EZY A;  2BTQ B;  1L0N H;  4FFB A;  1NZ6 A;  3G6B A;  1XRE A;  4JYB A;  2F43 G;  2VQF B;  5D5P A;  2QTS A;  2VWK A;  4JI4 B;  1QLE B;  2ZNJ A;  3RVZ A;  3E86 A;  4DR4 O;  1AVM A;  4FLT A;  4RO2 A;  1N32 B;  4UXN A;  3UQ8 A;  2OTL V;  3DGE A;  2X6B A;  2D2C B;  1SES A;  5KX5 A;  3JAM N;  4ZOL B;  1GH6 A;  2Q0A A;  3R66 A;  1FAF A;  4J80 A;  1HR0 B;  4YJ3 B;  4D7T A;  4A5U B;  4JI7 B;  1B04 A;  3G4S V;  3T4D A;  4U7N A;  4B3T O;  2CUG A;  3GWO A;  1WAZ A;  3HPL C;  3ASN C;  4JI2 B;  1IXB A;  3RW0 A;  2F23 A;  3L72 H;  1ZSP A;  1B6Q A;  1R3K C;  5IJ9 B;  3CC4 V;  3OEH G;  1AB3 A;  4GKJ B;  2IM9 A;  4UCT A;  2E75 B;  2M7W A;  3APQ A;  2UXC B;  5KHJ A;  3AEI A;  2UUB O;  1BQ0 A;  2BOB C;  4WF9 V;  3T1H O;  4NB5 A;  2ITC C;  5BXZ A;  1SA0 A;  1VQ4 V;  2YXL A;  4I0X B;  5L3B A;  2HG5 C;  1S3J A;  4Q6G A;  2GV9 A;  4LF5 O;  3CXC U;  2OTJ V;  4RQE A;  1WA8 B;  4LF8 O;  5DEC A;  1J5E B;  1HNX B;  4JTA B;  1KUQ A;  3JAW B;  1M9N A;  4P30 A;  3C90 A;  2JJ2 G;  3P30 A;  3JCZ A;  2WA4 A;  3J7A U;  1VQK V;  2JGU A;  1F7Y A;  2YIB A;  4J7K A;  3E89 A;  1HWY A;  1P84 F;  2B9Z A;  4MVS A;  4GX5 A;  2F4V O;  3FX7 A;  1JPX A;  1RM1 B;  2HJD A;  2RDC A;  2W6I G;  1W2B U;  3RFR A;  4QJF B;  2AW9 A;  1YSC A;  3NR7 A;  4ZKI A;  1VQ5 V;  1Y67 A;  5ITZ A;  3RN4 A;  4QE9 A;  4CH4 A;  2UUC O;  5B5E Z;  1X59 A;  2X0L A;  5DM6 V;  1H2K A;  5IE9 A;  5B1O A;  1VF6 C;  1OCZ B;  1P7G A;  2ZE8 A;  2ZKO A;  1KU9 A;  1NH2 B;  2LFS A;  4DV2 O;  4HZ3 A;  5LP6 C;  1Q6U A;  2EUL A;  5L3D A;  4DUY B;  3LSU A;  4JYA B;  3UKM A;  4JZG A;  2UXB B;  3CJH A;  2PY5 A;  4JI5 B;  3FAV B;  1I0H A;  3BEH A;  3A0H Z;  3F5T A;  2VWJ A;  4K8X A;  2PYJ A;  4NVP A;  5H5N A;  3DXR A;  5C8Y A;  1QU7 A;  1UFI A;  1WB8 A;  3OE7 G;  1VQ9 V; 
#chains in the Genus database with same CATH homology
 1SQQ H;  3L75 H;  3L72 H;  3H1L H;  3L74 H;  1KB9 F;  3CX5 F;  5KLV H;  1NTZ H;  3CWB H;  1SQP H;  1L0L H;  3L73 H;  3H1H H;  2IBZ H;  1KYO F;  3H1K H;  1BCC H;  3BCC H;  3H1I H;  4D6T H;  2BCC H;  4PD4 F;  4U3F H;  3TGU H;  1BGY H;  1BE3 H;  1EZV H;  1SQX H;  1NTK H;  1SQB H;  2A06 H;  1NU1 H;  1L0N H;  3L71 H;  2FYU H;  3CXH F;  3H1J H;  1NTM H;  1PP9 H;  1P84 F;  1SQV H;  3L70 H;  1PPJ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...