1UFIA

Crystal structure of the dimerization domain of human cenp-b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
48
structure length
48
Chain Sequence
HMPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human centromere protein B (CENP-B) dimerization domain at 1.65-A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Major centromere autoantigen B
total genus 17
structure length 48
sequence length 48
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1090 Mainly Alpha Orthogonal Bundle Helix Hairpins Dimerisation domain of CENP-B 1ufiA01
1UFIA
chains in the Genus database with same CATH superfamily
4CH6A 5B66Z 3OE7G 3OFNG 3ZN1A 5HFLA 3E35A 2HHHO 2LW1A 3MHHC 3BPZA 2IU3A 5KLVH 1QQCA 3STLC 2ZIMA 3BCCH 4B3MB 3I55V 3CCVV 3RYHA 4RWUA 3BVOA 4LF7B 2FMLA 5LP6B 1AI6A 3F7VC 2B1GA 1SKVA 1H38A 5JVDA 3FYIB 3KKYA 2Z3YA 3T2MA 5KX5A 2GV9A 4J80A 2ETNA 4OPAA 1F51A 1EZVH 2R9AA 3E22B 3CJHA 1WAZA 2P4VA 2XAGA 4JI0B 2WLLA 4R6ZA 2OCCB 1BL8A 1VQ7V 2GBOA 5FPOA 2DYRB 4X1KB 4GX1A 2XOKG 3ASNC 2OIGA 3LUTB 4LFCB 2P22C 4ZHQB 1FAFA 1ZX3A 1R6NA 4DR1B 4UCRA 1K97A 3KCYA 2EIKC 2YIDA 4DRXB 1NQTA 2LJ2A 4PA3A 3NR7A 1XNQB 2XTAA 1ZL8A 4WBNB 3CXHF 4LNUB 2O57A 4R8CA 3LDEA 4NYKA 3K5LA 4ICGA 4MVZA 4FLYA 4TQDA 1FS0G 3W7UA 4X20B 1THZA 1AJPA 2QM8A 1H8EG 3X2QB 3SJBC 4FZ1A 3HKDA 1ENVA 1I5XA 5JH7A 3ZRWA 1FXHA 4O4LB 2JJ2G 4CS2A 2Y48A 1TGOA 2ZDIA 3ZMZA 5EYPB 4DR3O 2X6AA 3H1KH 2X0LA 1YSCA 2EIKB 2XNDG 4UCUA 5AG2A 1SZXA 2WLKA 4MTOA 4JI2O 3H1IH 1WLEA 2BCCH 3OW2U 3P30A 1FD9A 4LFBB 3JARB 2ADPA 2CDYA 3CCJV 3W7SA 1L1FA 1N33O 3FB8C 4JI3O 4O2AB 5JCOC 2E75B 1QCEA 1VQ4V 1X4TA 5L3FA 4J9YB 1Y74B 2H3OA 3QO5A 4DUYB 2QR4A 1WPBA 1JFFB 2Q9LA 4K0KO 2P67A 1I94B 3WFVA 1D2DA 3K59A 4PI2A 2A9HA 4DO2A 1WB7A 1Q81W 4IT5A 1JOYA 4JF3A 2ZNJA 3AK3A 3CYOA 4FPPA 4EB6B 1KQSU 5LA6A 3ABLB 1GKFA 2ZE5A 3JAKA 3ZRVA 2LO1A 4UVCA 3SJCC 2R70A 5KMGB 4J41A 2K1EA 2FL4A 3ASOB 1H2GA 1N4CA 5CA3A 2OWOA 4JV5B 1EBOA 4NTYA 1GN3A 3CC2V 3A8TA 1FFXA 1K73W 2D3OW 2AZ2A 4JTCB 2GUZB 5CMUA 4YXWG 2P5OA 2FB5A 2ZXWB 2EINB 3UKMA 5IY5C 2OT5A 1JJ2U 4FM0A 2IJIA 4Q6GA 1JPXA 4LF7O 3HKBA 1PL4A 3FAVA 2UXCO 4X62O 3ZHTA 2MW2B 2D2CB 2JEXA 4I5SA 3VQXA 4IIJA 4XDLA 4J7JA 1M56C 4DW0A 4DR3B 5GW7A 4B3SO 3KCXA 4RUEA 5L3GA 3D36C 4JI1O 2VQEO 2CTRA 4IYHA 2EIJB 2GTSA 5EBWC 4J10A 3TXSA 3NXSA 2YXLA 4NXMB 2ZXWC 4X1YB 3A0HZ 3E8FA 1P7GA 1W59A 4MVRA 1PNKA 2QTOA 3MHSC 3DC5A 3T4DA 2GSMB 2V1DA 5KUKA 4DK0A 3ABTA 5IJ0B 3QTCA 1EFRG 4QE7A 1G8MA 1PNLA 1XHXA 3J81N 3CCRV 1M5IA 2CE4A 5LYJB 1DF4A 1BS3A 1SA0B 2VWJA 2UUCB 3LDCA 4NB5A 3G80A 5KHIA 2JGUA 1YJNV 1N32B 4JI7B 1YCIA 1S5JA 2P90A 4JASA 5KA6A 2F4VB 5EIBC 1BMFG 1IXMA 3W7TA 1ZSPA 3AK1A 2X7RB 3CB2A 4JTDB 3K08A 4X65O 2Z0AA 3QG5A 5EC1C 4ZBMA 3GB7C 4O2BA 2Z5UA 1XL6A 4DV1B 1K5QA 2DW4A 1SQFA 2JRIA 4NVPA 4O4JB 1YF2A 2UUBO 3L75H 1B6QA 3G4SV 2Y4UA 1YJWV 4B3RB 1FYJA 4L87A 3OUFA 2QSAA 1BHBA 2HG5C 3B8MA 3KG2A 2AW9A 5EK0A 4LR3A 5LMUB 2JK5C 3OR6C 4I50A 4QPKA 3TCUA 3Q4HB 2IU0A 1KMIZ 1N34O 3CCEV 5LP6C 2V4DA 4X66O 4MW8A 2EJ7A 4DRXA 3ML0A 5KHJA 4K35A 1VQPV 2HP8A 3IC9A 5KAIZ 3SYQA 1U97A 3TGUH 5KHGA 1BT8A 4N23A 4KXRA 1V54B 5FL7G 5F2VO 1KP2A 1GO3F 4O4HA 3UM7A 4IGGA 4IHJB 1IBLO 4G27B 4QGPA 1TUBA 1XOUA 3A2FA 1WA8B 2WLMA 3RBZA 3ASOC 4OX9O 5ITZB 4BIZA 4JPRA 3WG7B 1N36O 3ABMC 3F5TA 2JIZG 1MSWD 4MVMA 2W6IG 3CHXA 1O9HA 2DQ3A 4YJ2B 5BR8B 1ZWIC 4UUJC 1M57C 3EFFK 1K7DA 1SF9A 2JVDA 2VWKA 1EN6A 2NNUA 4B7KA 1N0NA 3D8CA 2VRZA 3K06A 1XMQB 1BQ0A 1QR9A 4B3SB 1H2SB 2CH7B 1Q6UA 2P4KA 3ETGA 2BTQB 5JJJB 2QTSA 1SESA 2PYJA 1GH6A 2XAQA 3K9SA 1XQ8A 1XL4A 1GAXA 3L73H 4FMTA 3E86A 1J5EO 2PY5A 3AK2A 3FFQA 2Q4PA 1P49A 2Y0PA 4D6TH 3UQ8A 4RQFA 4LF8O 4JYYA 1F23A 1VQ5V 2YC0A 4I9WA 5B3SB 4DV4B 5H5NA 3D36A 4PA7A 3F5WC 3CRQA 1FFXB 5B1AB 5FPRA 4PDRA 2VS0A 4I55A 3GWOA 5JVDB 4FIPC 4BR6A 3CMAV 4MSWC 3RYCB 3ZRXA 3SYPA 1WP8A 4NTWA 2FKXA 1JA8A 1MG1A 3B4SA 3C3SA 5B1AC 4DUZO 4DR6O 2LQTA 3ZHQA 4MVQA 1DGSA 1K33A 3QNEA 3O9OA 4UFZA 1RPOA 4YHHB 3E8BA 5CB4A 4DV0B 1HNWB 1YHQV 1BCCH 1OCZB 3ASNB 4DR1O 1Y76B 2Q0OC 2NLJC 2BE3A 5BMVB 1Z5WA 1GTOA 2E3CA 1RSOB 3E8GA 5C8YA 5IDJA 1A32A 1R3LC 3ZN0A 4X64B 3SGIA 5LGNA 2HVJC 1XREA 2ZE8A 1FXVA 1QNMA 3H01A 3K03A 5H9CA 4H33A 1QVGU 1Z5VA 1IXBA 2DE0X 4JYAB 4I4TB 5K1XA 3RVYA 3CWBH 2PYLA 1Q5OA 1VQLV 4HBNA 2QKAA 1SS3A 1R73A 3O65A 1TUEB 4LH7A 2QE7G 4TUYA 4HNAB 1MA1A 3M8AA 4UV8A 3BRCA 1R6TA 3WB0A 3ETQA 3TJTA 2Q69A 4DV6B 1VP7A 4DV3B 1I5YA 1E79G 2WSSG 2E5LO 4CC5A 5KUMA 1DTOA 3JD3A 4DR5B 4TSFG 5IYZB 4PJ0Z 4MTFA 2UXDB 3LSUA 2KKWA 4FM2A 3ZMTA 5LHIA 1H8HG 5LP6A 2ZT9B 1RP3B 1Q8IA 4H44B 4U3JA 3RW0A 1P7BA 1OJHA 1HNXO 2NN4A 3W7WA 2PUSA 4O4JA 3R65A 4JAUA 4TT3G 4R7CA 5EBLC 3I56V 2N04A 4J9ZB 1VQNV 3K3WA 4LF9O 1K5SA 3HKEB 3B2EE 1N0JA 4GCZA 4X88A 5BXZA 1SC5B 2BSKB 1X59A 2F1MA 2QWPB 2ZKOA 2RNBA 2Q6AA 3RFRA 1WN7A 2ARHA 4RAIA 4JI4O 4ZHQA 2UUAB 4CC6A 1GRJA 2ITDC 5E79Z 1UFIA 3E89A 1YDXA 4JI8B 1JR9A 4LF5B 3KZIZ 3K9AA 2LW7A 2JDIG 4MS2A 2KSDA 1GN2A 5K1PA 1NS1A 3FYEB 1J95A 4GZRB 4LF6B 2ZE7A 4W4LA 3DTUB 3RYIA 3QVNA 3F7YC 2WLIB 4YY3O 2GTAA 4DR7B 1PL0A 2QGNA 4JYBA 2EILB 3AG1C 5EZYB 1NI8A 3IGAC 4O4IB 2VQEB 4YHHO 3AG4C 2A3QA 1TVKB 2HJFC 4EFEA 3OMNB 5C93A 2V7QG 2P6JA 1NTKH 4D7TA 4FFBB 4BWAA 5KAFZ 1VQKV 4B3RO 3UT5B 1S5LZ 1F4NA 2W6JG 2BTQA 4I0XB 4ASUG 1FJGB 4L8JA 4GX0A 2QWOB 4AI8A 1Q7YW 5LXTA 3FB6C 4GKKB 3IJ4A 4TQFA 4X8AA 3T1CA 3JAWA 4B3MO 4WFAV 4LH6A 1ORQC 1SZTA 2C2AA 2EJRA 1GN6A 1OCOB 5CA0B 1HP8A 2RDCA 4GUNA 1VQMV 1B06A 3RYHB 4DV6O 5H6QA 5A2QN 1M57B 2WLJA 1N32O 2UU9B 1WNSA 5B1BC 4B3TO 4HAMA 4RO2A 2Q7HA 2B1IA 4PDMA 3AG3C 3CRMA 1M9NA 2F43G 3A0BZ 2CTWA 1Q82W 3CMEV 4DR6B 3B8NA 1YTFD 2DMXA 5J2UA 3CRRA 1HNXB 1HNZO 4FK5C 4U7OA 4LCUC 1XMQO 1AVMA 4JYCA 2BTOA 3SDLA 2WA3A 2CGNA 4LFCO 5L3BA 4CH3A 4UB6Z 1ZUQA 1LUWA 3E8HA 3ICXA 3ZCCA 2PF4E 4MVOA 5GONA 3T1YO 2QWQB 3LSQA 1NR7A 4UCSA 1V55B 4GKKO 5CBFA 4CS4A 2VQFB 3HPLC 1ZL8B 4WBNA 2M7WA 3CPWU 2UUAO 3CEIA 3JASB 3TETA 2ODMA 5IJ0A 2EIMC 4TUYB 2IJJA 3JCZA 4RQEA 2LP7A 4DR4B 4A5UB 1DLBA 3HKDB 5JH7B 4PA6A 5IYBO 4GKJB 1WA8A 4PI0A 3BAAA 3CE2A 1OCCB 4IYIA 2ZQMA 1QHTA 3K5OA 3FX7A 3A0RA 1GN4A 5H2FZ 4YIPA 2FTKA 1KU9A 1VMGA 1AR1B 3SJAC 4YJ2A 2EZPA 1US6A 4ZIBA 1NBMG 2DYSB 3ZHUA 3ABKB 4DYLA 4DR7O 1ZAUA 2UU9O 5LBQA 5J9PC 3TK1A 4F4LA 1KYOF 5DECA 5JJNB 3CX5F 3ZHVA 2JGDA 2R9IA 2BSKA 2GHYA 1KP3A 3FKSG 3CCQV 3T1YB 5CBHA 5FNVB 1NJIW 4DXWA 3JATA 1SERA 2YICA 3BHPA 1EN4A 1JMKC 3ZJZA 2YEVB 1HW7A 2F93B 1IX9A 1SQXH 2X6CA 3L72H 5JWPA 1F7YA 1HR0O 5IJ9B 3ABKC 4ZI7B 1IBKB 4ABMA 3VQYA 2QDOA 4EEQA 1JQ0A 5B3SC 2K9PA 4AHCA 3H1LH 2ILMA 3J80N 2ADQB 2XAFA 2HR3A 1K3EA 4ZKIA 1MOFA 3SYAA 4JI2B 2CTPA 3EVKA 2IH3C 3JD2A 2A7WA 3QF7A 3WB2A 4MTXA 5JQGA 3SPCA 1VIBA 2WLIA 4DW1A 3L74H 2YIBD 4QPJA 4MT8A 4PV1B 2HEPA 4N21A 2F23A 4FZ0A 1YVWA 5LMNO 3CC4V 1R3KC 1BSMA 1M4UA 1MZEA 3SJQC 1NR1A 2E74B 2KQXA 4F6RA 1GMGA 3ETEA 4CH4A 3OTOO 4JAVA 1G4YB 1XUQA 1SRYA 1AILA 2RN9A 4Z1VA 5LL6Y 4XBFA 4YJ3A 1H2KA 2HFEC 1K8AW 3K0DA 3LDDA 5H6RA 4K8ZA 4LFAO 1W2BU 2Q5ZA 2ZCEA 1OV9A 3K0GA 4AILC 3PN1A 4DR2B 4LF5O 1AR4A 1J5EB 2DWDC 4U3FH 3AG4B 1GM9A 4JZ2A 1S76D 4LP8A 5LYJA 2WLNA 3ZHRA 3ETDA 2Y0IA 2A79B 2N05A 2CAZC 1SQQH 5J2TB 3JALB 4CBCA 4MW3A 2L6LA 2JS5A 3BA9A 1KC8W 4I7ZB 1NU1H 1OCRC 3IFXA 4XDKA 4JV5O 2P06A 1V9PA 5BZBA 3MD0A 3C3TA 3HB3B 1JVMA 4DR4O 3C90A 1M93A 2HLDG 3DXRB 4FVMA 4WFGA 1AB3A 4X65B 1SQBH 3RWRD 1I0HA 4O2BB 1H2LA 1HWYA 1AP5A 3N27A 1SQVH 4AQYO 3HKEA 3BABA 3D3IA 4UCVA 5J2UB 4GYCB 4OGQB 2KB1A 4DV2B 3OGCC 1BQZA 4ZOLB 4JI1B 2IJHA 5LMUO 4UV9A 4I50B 4P30A 1Y76A 1COWG 4BW5A 1NTMH 1Y66A 3JSNA 4DR2O 1RSOA 5C8YB 2XASA 3K58A 2UUCO 2W0XA 3OM3B 4H0LB 4JI6O 3FD9A 2DYRC 1IURA 4U7NA 4PDLA 4JI7O 5LHGA 1IZ3A 4DV5B 4FLUA 1YITV 2F4VO 4UVBA 3SPGA 3JASA 3CXCU 1LNQA 2AGAA 1HR0B 4LFAB 4O4HB 3FB7C 1M90W 3G67A 4I9QA 1WJZA 4HNAA 4MVSA 4CS3A 3RYFB 2YIAA 4LBEC 3APQA 1T5EA 2UUBB 2YSUB 4GX2A 1ZLZA 4WF9V 1TVKA 1EM1A 3JD0A 4P9OA 3U10A 1JX9A 2QM4A 3LSSA 5A9GA 1N33B 1YZBA 1FPOA 4JZGA 3ZEDA 4JI3B 1ROPA 1VF7A 1QR8A 5KX5B 1M56B 4U3JB 2WLHA 3WG7C 3CJHB 2EZOA 3U11A 3OGIB 3OD4A 2BOBC 1S3JA 2Q0AA 2DJVA 4OPHA 2CH7A 1PD3A 4P2ZA 1RM1C 3ZS8C 5EIBD 2ZM6B 3IC7A 1GM8A 1IDSA 4Z1MG 1QU7A 2CTQA 1XILA 2OCHA 4LF8B 4DV4O 1WB8A 3BA8A 1QBZA 4PA4A 3G6BA 1P84F 4PHZA 2ZD9A 1GM7A 3ZMUA 1QLEB 3B77A 1AP6A 5CA1B 4LWSA 5IWAO 5KHHA 3L9DA 3P3PA 3K5MA 4NXNO 5IE9A 2EIMB 1N8RW 3D3QA 1F4MA 2QM7A 3N2GA 1M1KW 2KG7A 4KFMA 4X20A 4BIOA 4J42A 3OR7C 3K04A 4O4LA 5JCOA 1MSDA 3RYCA 1PPJH 2PI4A 4H13B 3CCMV 3T1HO 2B9ZA 5JJEB 4G28B 2F95B 2Y4TA 4W4KA 2GDSA 2UXBB 4DUYO 3H9VA 2YUAA 4CZZA 3K79A 3GVMA 3VQWA 4DV0O 1HNWO 5D5QA 4YIOA 2OCCC 4NXMO 3LNNA 3N2KB 4FFBA 4O2AA 2UXCB 1Y4MA 5GONB 2DYSC 3UT5A 4JTAB 3P3NA 1NT2B 4DV5O 3JCUZ 1VF6C 2WPDG 4TV9A 1WP7A 1JFFA 2E76B 4I0XA 5LGUA 3BY6A 2LGQA 1YI2V 1IBKO 1YIJV 4JYAO 2G38A 1B04A 3ZIAG 1IBMO 4X64O 1I94O 2BOCC 2WWWA 3OT7A 4B08A 3RVZA 5DM6V 2YIBA 2EINC 1XHZA 3AG2C 1TA8A 4WFFA 1XMOB 3JAWB 2H8PC 3K5NA 2YXYA 5IYDO 2OTJV 1RFYA 1NZ6A 3T1HB 2ZR2A 5EBMC 3UO3A 1R6KA 1LR1A 3DXRA 3OMIB 4NXNB 4PA9A 1BE3H 1Z2GA 3ABMB 1XDCA 4FFKA 4DV3O 4LF9B 1HDJA 3HKBB 4FJCC 3CS5A 3FAVB 2R9RB 3QO8A 1VEWA 4JI0O 4D7SA 3CCLV 2UXDO 4LF4O 5KA5A 1VQ9V 1XNRO 1Q86W 2HKOA 2JJ1G 2EX3A 4DUZB 1KKDA 4QJFB 4DV7B 2P7TC 2XUMA 1BZKA 1YJ9V 1K34A 2YEVA 3EHBB 3GWKC 3OEHG 2A0LA 4QIWF 2MK3A 1KBHA 2QKSA 3ZMVA 1U96A 2ZM6O 1W0JG 1QVFU 2DN9A 3AG1B 3JAMN 1KUQA 1MNGA 1L0NH 3CSXA 3MAQA 1XNQO 5LGTA 3RT3C 2WAMA 3AG7A 4LNUA 1E1QG 1XMOO 1FXKC 5CBGA 1BHAA 1S5HC 1Y67A 4XDJA 4KUMA 1VQ8V 3CCSV 4K8XA 2IH1C 1DF5A 4X1IB 3SPHA 1OCRB 4MTGA 1MZFA 1URFA 3RYIB 2QWNB 2DOSA 3DC6A 5LOVA 1S77D 4NKGB 1S0VA 3UCSC 1FXKB 2OTLV 2R72A 2E5LB 3JYCA 1R3JC 3JARA 4LFBO 3MDSA 1YTFB 1AI7A 2ZR3A 1YEWA 2PGGA 4PELA 1CXZB 5B1NA 1NTZH 2ZNIA 2OIEA 4KHPO 3OTOB 4DV2O 1TAEA 3CCUV 3E2EA 1N36B 3CP1A 3E22A 4GX5A 2CK3G 3VBBA 2Q68A 4WFBV 4YJ3B 5CN0A 4DV1O 4TV8A 2B5UA 1H2MA 1PV0A 3W7XA 2LFSA 5B1OA 3OUSA 5LHHA 1FJGO 1Y6XA 4X1KA 3AG3B 3ABUA 4JI6B 5DEDA 2XHBA 2PTMA 3X2QC 1W0KG 2YXHA 3ZX6A 3JD4A 2EILC 4EB6A 5FLXN 5LA6B 4JI4B 2VQFO 2YS8A 2AHZA 3QO7A 1O9GA 1KD1W 5IJ9A 3JAKB 2AXTZ 2WA4A 3OTFA 4ZI7A 2ZIOA 1D5NA 1Q3EA 2RCVA 4KP4A 1IBMB 4E2LA 4LWSB 1D5AA 1OZ0A 2RJZA 1FKAO 1WPXA 3THOA 3SPIA 5B5EZ 1JCHA 5CA0A 2Q73A 4UXNA 1AJQA 3N2GB 1QLNA 4QNHB 1ZTEA 1VF5B 1AR5A 4IHJA 1XI1A 1V55C 1G1XB 5BR8O 1Q90D 3WB1A 4K3AA 4BIUA 3M7MX 3IAYA 1AROP 3U0ZA 1K4DC 2OYQA 3WU2Z 4B3TB 5LMNB 2Q67A 1S72V 4ZOLA 3ABLC 4WCEV 3HKCB 2ZE6A 1CP9A 1EZJA 1K4CC 1P4RA 3N2KA 1NKDA 2XT9A 1IVSA 4LF4B 2IJKA 2QEXV 3SYCA 2QKCA 4FLVA 1OHHG 1NVPB 3SYOA 5L3EA 2XAHA 1Y74A 4UCOA 2Y69C 1V54C 4CH5A 5B1BB 1L8DA 4FLZA 3DSQA 1I7FA 4X89A 4J11A 3JSLA 2DWEC 1CEZA 2YDEA 4F6EA 4WFEA 4MVUA 1XEQA 3RYFA 3CRAA 1EN5A 3P32A 1LUVA 3T4ZA 1VF6A 2IBZH 3UO2A 5KMGA 3M99B 3DGEA 4HZ3A 2HJDA 4FLTA 2DQ0A 1Q43A 1PP9H 4GKJO 4RUFA 1VARA 3R66A 1OCCC 2AHYA 3VOUA 2N74A 5L3CA 3RGBA 1JJOA 1PNMA 1Q6IA 3L71H 1YXBA 3B09A 4PDVA 1KB9F 2WLLB 4DR5O 4JAAA 5BY1A 2JGDB 2ATKC 3BEHA 4JGSA 4IIJB 1SQGA 5FNVA 5IT9N 3JATB 1KECA 3RN4A 1HNZB 1GK9A 2XAJA 4B7EA 3OAAG 2IW5A 5BMVA 3ZHSA 1L0LH 2QA4V 3PJSK 3EXAA 4X1YA 4JI8O 3H1HH 4QE9A 1QLEC 5HFMA 1R3IC 3CD6V 2ZDIC 4UB8Z 1R1BA 1FFTB 3H1JH 4G2KA 2JEUA 4BW9A 2QJ1A 2EBOA 2KG7B 4PD4F 1K92A 1NH2D 2CUGA 1UPGA 5GTHZ 2AZ0A 4KL1A 3B40A 1OCOC 3AG2B 3ZRWB 5JQGB 1MMMA 2F66C 5LOVB 2EULA 3OMAB 1I08A 1PM9A 2L35A 5EYPA 1B3QA 5ITZA 2LFRA 1VQOV 4HYOA 1FXKA 3CRCA 3S3XA 5IYZA 1NH2B 4BAYA 2A06H 4LF6O 3SPJA 4X62B 2HVKC 3LNMB 2ZINA 4AQYB 3BFRA 4KHPB 4DK1A 1DK1A 4DV7O 4F6RB 2NR5A 4NR1A 3G6EV 2UXBO 2EIJC 3L70H 1K9MW 2IM9A 4E4EA 1H2NA 4TV8B 1N34B 5L3DA 1RPRA 4JI5B 5D5PA 3E83A 2LGWA 4EKWA 1SETA 2Q8VA 1KKCA 4X9QA 3AEIA 4J7ZA 3APOA 1OCZC 2JS3A 3Q4HA 1AI4A 1SQPH 2HHHB 2H94A 5IYCO 4Z2WA 3STZC 4TWKA 1AJNA 2Q7GA 4EFBA 4FM1A 5J2TA 3JALA 5KHKA 3CC7V 5CA1A 5IWAB 4GLXA 4P9PA 5EC2C 3VQVA 1MABG 4I55B 2GUZA 2Y69B 4TOIA 4C7UA 3OEEG 3ZMSA 4OXSA 1IBLB 3K57A 2UXNA 3ZRSA 4YY3B 1TUBB 2W0FC 4IL6Z 4UCTA 4FLWA 4FLXA 1BGYH 2QWRB 2RMKB 1E1RG 4J7KA 4OX9B 5EZYA 4Q20A 1RM1B 5E1AC 4O4IA 3HKCA 5CB4B 1G6UA 5GTIZ 2M6YA 3G71V 1XNRB 1NVPD 2CGOA 3FB5C 3JD1A 3TXQA 2YI9A 3S3WA 1XBLA 4R50A 1UJWB 2PZSA 3ZBHA 3SR2C 2UXXA 2PI5A 4H37A 4NTXA 5TISZ 1PKXA 5DN6G 4TV9B 2X6BA 1Q6HA 4I4TA 2RQ6A 4X66B 4LC1A 1AI5A 4K0KB 5LXTB 4JI5O 5IY5B 3I5DA 1VQ6V 4UVAA 4X1IA 2Q7EA 2ITCC 4GT1A 3J7AU 1SA0A 2YI8A 1CPYA 2FYUH 3HR0A 4WFHA
chains in the Genus database with same CATH topology
1UFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFI A; 
#chains in the Genus database with same CATH topology
 4CH6 A;  5B66 Z;  3OE7 G;  3OFN G;  3ZN1 A;  5HFL A;  3E35 A;  2HHH O;  2LW1 A;  3MHH C;  3BPZ A;  2IU3 A;  5KLV H;  1QQC A;  3STL C;  2ZIM A;  3BCC H;  4B3M B;  3I55 V;  3CCV V;  3RYH A;  4RWU A;  3BVO A;  4LF7 B;  2FML A;  5LP6 B;  1AI6 A;  3F7V C;  2B1G A;  1SKV A;  1H38 A;  5JVD A;  3FYI B;  3KKY A;  2Z3Y A;  3T2M A;  5KX5 A;  2GV9 A;  4J80 A;  2ETN A;  4OPA A;  1F51 A;  1EZV H;  2R9A A;  3E22 B;  3CJH A;  1WAZ A;  2P4V A;  2XAG A;  4JI0 B;  2WLL A;  4R6Z A;  2OCC B;  1BL8 A;  1VQ7 V;  2GBO A;  5FPO A;  2DYR B;  4X1K B;  4GX1 A;  2XOK G;  3ASN C;  2OIG A;  3LUT B;  4LFC B;  2P22 C;  4ZHQ B;  1FAF A;  1ZX3 A;  1R6N A;  4DR1 B;  4UCR A;  1K97 A;  3KCY A;  2EIK C;  2YID A;  4DRX B;  1NQT A;  2LJ2 A;  4PA3 A;  3NR7 A;  1XNQ B;  2XTA A;  1ZL8 A;  4WBN B;  3CXH F;  4LNU B;  2O57 A;  4R8C A;  3LDE A;  4NYK A;  3K5L A;  4ICG A;  4MVZ A;  4FLY A;  4TQD A;  1FS0 G;  3W7U A;  4X20 B;  1THZ A;  1AJP A;  2QM8 A;  1H8E G;  3X2Q B;  3SJB C;  4FZ1 A;  3HKD A;  1ENV A;  1I5X A;  5JH7 A;  3ZRW A;  1FXH A;  4O4L B;  2JJ2 G;  4CS2 A;  2Y48 A;  1TGO A;  2ZDI A;  3ZMZ A;  5EYP B;  4DR3 O;  2X6A A;  3H1K H;  2X0L A;  1YSC A;  2EIK B;  2XND G;  4UCU A;  5AG2 A;  1SZX A;  2WLK A;  4MTO A;  4JI2 O;  3H1I H;  1WLE A;  2BCC H;  3OW2 U;  3P30 A;  1FD9 A;  4LFB B;  3JAR B;  2ADP A;  2CDY A;  3CCJ V;  3W7S A;  1L1F A;  1N33 O;  3FB8 C;  4JI3 O;  4O2A B;  5JCO C;  2E75 B;  1QCE A;  1VQ4 V;  1X4T A;  5L3F A;  4J9Y B;  1Y74 B;  2H3O A;  3QO5 A;  4DUY B;  2QR4 A;  1WPB A;  1JFF B;  2Q9L A;  4K0K O;  2P67 A;  1I94 B;  3WFV A;  1D2D A;  3K59 A;  4PI2 A;  2A9H A;  4DO2 A;  1WB7 A;  1Q81 W;  4IT5 A;  1JOY A;  4JF3 A;  2ZNJ A;  3AK3 A;  3CYO A;  4FPP A;  4EB6 B;  1KQS U;  5LA6 A;  3ABL B;  1GKF A;  2ZE5 A;  3JAK A;  3ZRV A;  2LO1 A;  4UVC A;  3SJC C;  2R70 A;  5KMG B;  4J41 A;  2K1E A;  2FL4 A;  3ASO B;  1H2G A;  1N4C A;  5CA3 A;  2OWO A;  4JV5 B;  1EBO A;  4NTY A;  1GN3 A;  3CC2 V;  3A8T A;  1FFX A;  1K73 W;  2D3O W;  2AZ2 A;  4JTC B;  2GUZ B;  5CMU A;  4YXW G;  2P5O A;  2FB5 A;  2ZXW B;  2EIN B;  3UKM A;  5IY5 C;  2OT5 A;  1JJ2 U;  4FM0 A;  2IJI A;  4Q6G A;  1JPX A;  4LF7 O;  3HKB A;  1PL4 A;  3FAV A;  2UXC O;  4X62 O;  3ZHT A;  2MW2 B;  2D2C B;  2JEX A;  4I5S A;  3VQX A;  4IIJ A;  4XDL A;  4J7J A;  1M56 C;  4DW0 A;  4DR3 B;  5GW7 A;  4B3S O;  3KCX A;  4RUE A;  5L3G A;  3D36 C;  4JI1 O;  2VQE O;  2CTR A;  4IYH A;  2EIJ B;  2GTS A;  5EBW C;  4J10 A;  3TXS A;  3NXS A;  2YXL A;  4NXM B;  2ZXW C;  4X1Y B;  3A0H Z;  3E8F A;  1P7G A;  1W59 A;  4MVR A;  1PNK A;  2QTO A;  3MHS C;  3DC5 A;  3T4D A;  2GSM B;  2V1D A;  5KUK A;  4DK0 A;  3ABT A;  5IJ0 B;  3QTC A;  1EFR G;  4QE7 A;  1G8M A;  1PNL A;  1XHX A;  3J81 N;  3CCR V;  1M5I A;  2CE4 A;  5LYJ B;  1DF4 A;  1BS3 A;  1SA0 B;  2VWJ A;  2UUC B;  3LDC A;  4NB5 A;  3G80 A;  5KHI A;  2JGU A;  1YJN V;  1N32 B;  4JI7 B;  1YCI A;  1S5J A;  2P90 A;  4JAS A;  5KA6 A;  2F4V B;  5EIB C;  1BMF G;  1IXM A;  3W7T A;  1ZSP A;  3AK1 A;  2X7R B;  3CB2 A;  4JTD B;  3K08 A;  4X65 O;  2Z0A A;  3QG5 A;  5EC1 C;  4ZBM A;  3GB7 C;  4O2B A;  2Z5U A;  1XL6 A;  4DV1 B;  1K5Q A;  2DW4 A;  1SQF A;  2JRI A;  4NVP A;  4O4J B;  1YF2 A;  2UUB O;  3L75 H;  1B6Q A;  3G4S V;  2Y4U A;  1YJW V;  4B3R B;  1FYJ A;  4L87 A;  3OUF A;  2QSA A;  1BHB A;  2HG5 C;  3B8M A;  3KG2 A;  2AW9 A;  5EK0 A;  4LR3 A;  5LMU B;  2JK5 C;  3OR6 C;  4I50 A;  4QPK A;  3TCU A;  3Q4H B;  2IU0 A;  1KMI Z;  1N34 O;  3CCE V;  5LP6 C;  2V4D A;  4X66 O;  4MW8 A;  2EJ7 A;  4DRX A;  3ML0 A;  5KHJ A;  4K35 A;  1VQP V;  2HP8 A;  3IC9 A;  5KAI Z;  3SYQ A;  1U97 A;  3TGU H;  5KHG A;  1BT8 A;  4N23 A;  4KXR A;  1V54 B;  5FL7 G;  5F2V O;  1KP2 A;  1GO3 F;  4O4H A;  3UM7 A;  4IGG A;  4IHJ B;  1IBL O;  4G27 B;  4QGP A;  1TUB A;  1XOU A;  3A2F A;  1WA8 B;  2WLM A;  3RBZ A;  3ASO C;  4OX9 O;  5ITZ B;  4BIZ A;  4JPR A;  3WG7 B;  1N36 O;  3ABM C;  3F5T A;  2JIZ G;  1MSW D;  4MVM A;  2W6I G;  3CHX A;  1O9H A;  2DQ3 A;  4YJ2 B;  5BR8 B;  1ZWI C;  4UUJ C;  1M57 C;  3EFF K;  1K7D A;  1SF9 A;  2JVD A;  2VWK A;  1EN6 A;  2NNU A;  4B7K A;  1N0N A;  3D8C A;  2VRZ A;  3K06 A;  1XMQ B;  1BQ0 A;  1QR9 A;  4B3S B;  1H2S B;  2CH7 B;  1Q6U A;  2P4K A;  3ETG A;  2BTQ B;  5JJJ B;  2QTS A;  1SES A;  2PYJ A;  1GH6 A;  2XAQ A;  3K9S A;  1XQ8 A;  1XL4 A;  1GAX A;  3L73 H;  4FMT A;  3E86 A;  1J5E O;  2PY5 A;  3AK2 A;  3FFQ A;  2Q4P A;  1P49 A;  2Y0P A;  4D6T H;  3UQ8 A;  4RQF A;  4LF8 O;  4JYY A;  1F23 A;  1VQ5 V;  2YC0 A;  4I9W A;  5B3S B;  4DV4 B;  5H5N A;  3D36 A;  4PA7 A;  3F5W C;  3CRQ A;  1FFX B;  5B1A B;  5FPR A;  4PDR A;  2VS0 A;  4I55 A;  3GWO A;  5JVD B;  4FIP C;  4BR6 A;  3CMA V;  4MSW C;  3RYC B;  3ZRX A;  3SYP A;  1WP8 A;  4NTW A;  2FKX A;  1JA8 A;  1MG1 A;  3B4S A;  3C3S A;  5B1A C;  4DUZ O;  4DR6 O;  2LQT A;  3ZHQ A;  4MVQ A;  1DGS A;  1K33 A;  3QNE A;  3O9O A;  4UFZ A;  1RPO A;  4YHH B;  3E8B A;  5CB4 A;  4DV0 B;  1HNW B;  1YHQ V;  1BCC H;  1OCZ B;  3ASN B;  4DR1 O;  1Y76 B;  2Q0O C;  2NLJ C;  2BE3 A;  5BMV B;  1Z5W A;  1GTO A;  2E3C A;  1RSO B;  3E8G A;  5C8Y A;  5IDJ A;  1A32 A;  1R3L C;  3ZN0 A;  4X64 B;  3SGI A;  5LGN A;  2HVJ C;  1XRE A;  2ZE8 A;  1FXV A;  1QNM A;  3H01 A;  3K03 A;  5H9C A;  4H33 A;  1QVG U;  1Z5V A;  1IXB A;  2DE0 X;  4JYA B;  4I4T B;  5K1X A;  3RVY A;  3CWB H;  2PYL A;  1Q5O A;  1VQL V;  4HBN A;  2QKA A;  1SS3 A;  1R73 A;  3O65 A;  1TUE B;  4LH7 A;  2QE7 G;  4TUY A;  4HNA B;  1MA1 A;  3M8A A;  4UV8 A;  3BRC A;  1R6T A;  3WB0 A;  3ETQ A;  3TJT A;  2Q69 A;  4DV6 B;  1VP7 A;  4DV3 B;  1I5Y A;  1E79 G;  2WSS G;  2E5L O;  4CC5 A;  5KUM A;  1DTO A;  3JD3 A;  4DR5 B;  4TSF G;  5IYZ B;  4PJ0 Z;  4MTF A;  2UXD B;  3LSU A;  2KKW A;  4FM2 A;  3ZMT A;  5LHI A;  1H8H G;  5LP6 A;  2ZT9 B;  1RP3 B;  1Q8I A;  4H44 B;  4U3J A;  3RW0 A;  1P7B A;  1OJH A;  1HNX O;  2NN4 A;  3W7W A;  2PUS A;  4O4J A;  3R65 A;  4JAU A;  4TT3 G;  4R7C A;  5EBL C;  3I56 V;  2N04 A;  4J9Z B;  1VQN V;  3K3W A;  4LF9 O;  1K5S A;  3HKE B;  3B2E E;  1N0J A;  4GCZ A;  4X88 A;  5BXZ A;  1SC5 B;  2BSK B;  1X59 A;  2F1M A;  2QWP B;  2ZKO A;  2RNB A;  2Q6A A;  3RFR A;  1WN7 A;  2ARH A;  4RAI A;  4JI4 O;  4ZHQ A;  2UUA B;  4CC6 A;  1GRJ A;  2ITD C;  5E79 Z;  1UFI A;  3E89 A;  1YDX A;  4JI8 B;  1JR9 A;  4LF5 B;  3KZI Z;  3K9A A;  2LW7 A;  2JDI G;  4MS2 A;  2KSD A;  1GN2 A;  5K1P A;  1NS1 A;  3FYE B;  1J95 A;  4GZR B;  4LF6 B;  2ZE7 A;  4W4L A;  3DTU B;  3RYI A;  3QVN A;  3F7Y C;  2WLI B;  4YY3 O;  2GTA A;  4DR7 B;  1PL0 A;  2QGN A;  4JYB A;  2EIL B;  3AG1 C;  5EZY B;  1NI8 A;  3IGA C;  4O4I B;  2VQE B;  4YHH O;  3AG4 C;  2A3Q A;  1TVK B;  2HJF C;  4EFE A;  3OMN B;  5C93 A;  2V7Q G;  2P6J A;  1NTK H;  4D7T A;  4FFB B;  4BWA A;  5KAF Z;  1VQK V;  4B3R O;  3UT5 B;  1S5L Z;  1F4N A;  2W6J G;  2BTQ A;  4I0X B;  4ASU G;  1FJG B;  4L8J A;  4GX0 A;  2QWO B;  4AI8 A;  1Q7Y W;  5LXT A;  3FB6 C;  4GKK B;  3IJ4 A;  4TQF A;  4X8A A;  3T1C A;  3JAW A;  4B3M O;  4WFA V;  4LH6 A;  1ORQ C;  1SZT A;  2C2A A;  2EJR A;  1GN6 A;  1OCO B;  5CA0 B;  1HP8 A;  2RDC A;  4GUN A;  1VQM V;  1B06 A;  3RYH B;  4DV6 O;  5H6Q A;  5A2Q N;  1M57 B;  2WLJ A;  1N32 O;  2UU9 B;  1WNS A;  5B1B C;  4B3T O;  4HAM A;  4RO2 A;  2Q7H A;  2B1I A;  4PDM A;  3AG3 C;  3CRM A;  1M9N A;  2F43 G;  3A0B Z;  2CTW A;  1Q82 W;  3CME V;  4DR6 B;  3B8N A;  1YTF D;  2DMX A;  5J2U A;  3CRR A;  1HNX B;  1HNZ O;  4FK5 C;  4U7O A;  4LCU C;  1XMQ O;  1AVM A;  4JYC A;  2BTO A;  3SDL A;  2WA3 A;  2CGN A;  4LFC O;  5L3B A;  4CH3 A;  4UB6 Z;  1ZUQ A;  1LUW A;  3E8H A;  3ICX A;  3ZCC A;  2PF4 E;  4MVO A;  5GON A;  3T1Y O;  2QWQ B;  3LSQ A;  1NR7 A;  4UCS A;  1V55 B;  4GKK O;  5CBF A;  4CS4 A;  2VQF B;  3HPL C;  1ZL8 B;  4WBN A;  2M7W A;  3CPW U;  2UUA O;  3CEI A;  3JAS B;  3TET A;  2ODM A;  5IJ0 A;  2EIM C;  4TUY B;  2IJJ A;  3JCZ A;  4RQE A;  2LP7 A;  4DR4 B;  4A5U B;  1DLB A;  3HKD B;  5JH7 B;  4PA6 A;  5IYB O;  4GKJ B;  1WA8 A;  4PI0 A;  3BAA A;  3CE2 A;  1OCC B;  4IYI A;  2ZQM A;  1QHT A;  3K5O A;  3FX7 A;  3A0R A;  1GN4 A;  5H2F Z;  4YIP A;  2FTK A;  1KU9 A;  1VMG A;  1AR1 B;  3SJA C;  4YJ2 A;  2EZP A;  1US6 A;  4ZIB A;  1NBM G;  2DYS B;  3ZHU A;  3ABK B;  4DYL A;  4DR7 O;  1ZAU A;  2UU9 O;  5LBQ A;  5J9P C;  3TK1 A;  4F4L A;  1KYO F;  5DEC A;  5JJN B;  3CX5 F;  3ZHV A;  2JGD A;  2R9I A;  2BSK A;  2GHY A;  1KP3 A;  3FKS G;  3CCQ V;  3T1Y B;  5CBH A;  5FNV B;  1NJI W;  4DXW A;  3JAT A;  1SER A;  2YIC A;  3BHP A;  1EN4 A;  1JMK C;  3ZJZ A;  2YEV B;  1HW7 A;  2F93 B;  1IX9 A;  1SQX H;  2X6C A;  3L72 H;  5JWP A;  1F7Y A;  1HR0 O;  5IJ9 B;  3ABK C;  4ZI7 B;  1IBK B;  4ABM A;  3VQY A;  2QDO A;  4EEQ A;  1JQ0 A;  5B3S C;  2K9P A;  4AHC A;  3H1L H;  2ILM A;  3J80 N;  2ADQ B;  2XAF A;  2HR3 A;  1K3E A;  4ZKI A;  1MOF A;  3SYA A;  4JI2 B;  2CTP A;  3EVK A;  2IH3 C;  3JD2 A;  2A7W A;  3QF7 A;  3WB2 A;  4MTX A;  5JQG A;  3SPC A;  1VIB A;  2WLI A;  4DW1 A;  3L74 H;  2YIB D;  4QPJ A;  4MT8 A;  4PV1 B;  2HEP A;  4N21 A;  2F23 A;  4FZ0 A;  1YVW A;  5LMN O;  3CC4 V;  1R3K C;  1BSM A;  1M4U A;  1MZE A;  3SJQ C;  1NR1 A;  2E74 B;  2KQX A;  4F6R A;  1GMG A;  3ETE A;  4CH4 A;  3OTO O;  4JAV A;  1G4Y B;  1XUQ A;  1SRY A;  1AIL A;  2RN9 A;  4Z1V A;  5LL6 Y;  4XBF A;  4YJ3 A;  1H2K A;  2HFE C;  1K8A W;  3K0D A;  3LDD A;  5H6R A;  4K8Z A;  4LFA O;  1W2B U;  2Q5Z A;  2ZCE A;  1OV9 A;  3K0G A;  4AIL C;  3PN1 A;  4DR2 B;  4LF5 O;  1AR4 A;  1J5E B;  2DWD C;  4U3F H;  3AG4 B;  1GM9 A;  4JZ2 A;  1S76 D;  4LP8 A;  5LYJ A;  2WLN A;  3ZHR A;  3ETD A;  2Y0I A;  2A79 B;  2N05 A;  2CAZ C;  1SQQ H;  5J2T B;  3JAL B;  4CBC A;  4MW3 A;  2L6L A;  2JS5 A;  3BA9 A;  1KC8 W;  4I7Z B;  1NU1 H;  1OCR C;  3IFX A;  4XDK A;  4JV5 O;  2P06 A;  1V9P A;  5BZB A;  3MD0 A;  3C3T A;  3HB3 B;  1JVM A;  4DR4 O;  3C90 A;  1M93 A;  2HLD G;  3DXR B;  4FVM A;  4WFG A;  1AB3 A;  4X65 B;  1SQB H;  3RWR D;  1I0H A;  4O2B B;  1H2L A;  1HWY A;  1AP5 A;  3N27 A;  1SQV H;  4AQY O;  3HKE A;  3BAB A;  3D3I A;  4UCV A;  5J2U B;  4GYC B;  4OGQ B;  2KB1 A;  4DV2 B;  3OGC C;  1BQZ A;  4ZOL B;  4JI1 B;  2IJH A;  5LMU O;  4UV9 A;  4I50 B;  4P30 A;  1Y76 A;  1COW G;  4BW5 A;  1NTM H;  1Y66 A;  3JSN A;  4DR2 O;  1RSO A;  5C8Y B;  2XAS A;  3K58 A;  2UUC O;  2W0X A;  3OM3 B;  4H0L B;  4JI6 O;  3FD9 A;  2DYR C;  1IUR A;  4U7N A;  4PDL A;  4JI7 O;  5LHG A;  1IZ3 A;  4DV5 B;  4FLU A;  1YIT V;  2F4V O;  4UVB A;  3SPG A;  3JAS A;  3CXC U;  1LNQ A;  2AGA A;  1HR0 B;  4LFA B;  4O4H B;  3FB7 C;  1M90 W;  3G67 A;  4I9Q A;  1WJZ A;  4HNA A;  4MVS A;  4CS3 A;  3RYF B;  2YIA A;  4LBE C;  3APQ A;  1T5E A;  2UUB B;  2YSU B;  4GX2 A;  1ZLZ A;  4WF9 V;  1TVK A;  1EM1 A;  3JD0 A;  4P9O A;  3U10 A;  1JX9 A;  2QM4 A;  3LSS A;  5A9G A;  1N33 B;  1YZB A;  1FPO A;  4JZG A;  3ZED A;  4JI3 B;  1ROP A;  1VF7 A;  1QR8 A;  5KX5 B;  1M56 B;  4U3J B;  2WLH A;  3WG7 C;  3CJH B;  2EZO A;  3U11 A;  3OGI B;  3OD4 A;  2BOB C;  1S3J A;  2Q0A A;  2DJV A;  4OPH A;  2CH7 A;  1PD3 A;  4P2Z A;  1RM1 C;  3ZS8 C;  5EIB D;  2ZM6 B;  3IC7 A;  1GM8 A;  1IDS A;  4Z1M G;  1QU7 A;  2CTQ A;  1XIL A;  2OCH A;  4LF8 B;  4DV4 O;  1WB8 A;  3BA8 A;  1QBZ A;  4PA4 A;  3G6B A;  1P84 F;  4PHZ A;  2ZD9 A;  1GM7 A;  3ZMU A;  1QLE B;  3B77 A;  1AP6 A;  5CA1 B;  4LWS A;  5IWA O;  5KHH A;  3L9D A;  3P3P A;  3K5M A;  4NXN O;  5IE9 A;  2EIM B;  1N8R W;  3D3Q A;  1F4M A;  2QM7 A;  3N2G A;  1M1K W;  2KG7 A;  4KFM A;  4X20 A;  4BIO A;  4J42 A;  3OR7 C;  3K04 A;  4O4L A;  5JCO A;  1MSD A;  3RYC A;  1PPJ H;  2PI4 A;  4H13 B;  3CCM V;  3T1H O;  2B9Z A;  5JJE B;  4G28 B;  2F95 B;  2Y4T A;  4W4K A;  2GDS A;  2UXB B;  4DUY O;  3H9V A;  2YUA A;  4CZZ A;  3K79 A;  3GVM A;  3VQW A;  4DV0 O;  1HNW O;  5D5Q A;  4YIO A;  2OCC C;  4NXM O;  3LNN A;  3N2K B;  4FFB A;  4O2A A;  2UXC B;  1Y4M A;  5GON B;  2DYS C;  3UT5 A;  4JTA B;  3P3N A;  1NT2 B;  4DV5 O;  3JCU Z;  1VF6 C;  2WPD G;  4TV9 A;  1WP7 A;  1JFF A;  2E76 B;  4I0X A;  5LGU A;  3BY6 A;  2LGQ A;  1YI2 V;  1IBK O;  1YIJ V;  4JYA O;  2G38 A;  1B04 A;  3ZIA G;  1IBM O;  4X64 O;  1I94 O;  2BOC C;  2WWW A;  3OT7 A;  4B08 A;  3RVZ A;  5DM6 V;  2YIB A;  2EIN C;  1XHZ A;  3AG2 C;  1TA8 A;  4WFF A;  1XMO B;  3JAW B;  2H8P C;  3K5N A;  2YXY A;  5IYD O;  2OTJ V;  1RFY A;  1NZ6 A;  3T1H B;  2ZR2 A;  5EBM C;  3UO3 A;  1R6K A;  1LR1 A;  3DXR A;  3OMI B;  4NXN B;  4PA9 A;  1BE3 H;  1Z2G A;  3ABM B;  1XDC A;  4FFK A;  4DV3 O;  4LF9 B;  1HDJ A;  3HKB B;  4FJC C;  3CS5 A;  3FAV B;  2R9R B;  3QO8 A;  1VEW A;  4JI0 O;  4D7S A;  3CCL V;  2UXD O;  4LF4 O;  5KA5 A;  1VQ9 V;  1XNR O;  1Q86 W;  2HKO A;  2JJ1 G;  2EX3 A;  4DUZ B;  1KKD A;  4QJF B;  4DV7 B;  2P7T C;  2XUM A;  1BZK A;  1YJ9 V;  1K34 A;  2YEV A;  3EHB B;  3GWK C;  3OEH G;  2A0L A;  4QIW F;  2MK3 A;  1KBH A;  2QKS A;  3ZMV A;  1U96 A;  2ZM6 O;  1W0J G;  1QVF U;  2DN9 A;  3AG1 B;  3JAM N;  1KUQ A;  1MNG A;  1L0N H;  3CSX A;  3MAQ A;  1XNQ O;  5LGT A;  3RT3 C;  2WAM A;  3AG7 A;  4LNU A;  1E1Q G;  1XMO O;  1FXK C;  5CBG A;  1BHA A;  1S5H C;  1Y67 A;  4XDJ A;  4KUM A;  1VQ8 V;  3CCS V;  4K8X A;  2IH1 C;  1DF5 A;  4X1I B;  3SPH A;  1OCR B;  4MTG A;  1MZF A;  1URF A;  3RYI B;  2QWN B;  2DOS A;  3DC6 A;  5LOV A;  1S77 D;  4NKG B;  1S0V A;  3UCS C;  1FXK B;  2OTL V;  2R72 A;  2E5L B;  3JYC A;  1R3J C;  3JAR A;  4LFB O;  3MDS A;  1YTF B;  1AI7 A;  2ZR3 A;  1YEW A;  2PGG A;  4PEL A;  1CXZ B;  5B1N A;  1NTZ H;  2ZNI A;  2OIE A;  4KHP O;  3OTO B;  4DV2 O;  1TAE A;  3CCU V;  3E2E A;  1N36 B;  3CP1 A;  3E22 A;  4GX5 A;  2CK3 G;  3VBB A;  2Q68 A;  4WFB V;  4YJ3 B;  5CN0 A;  4DV1 O;  4TV8 A;  2B5U A;  1H2M A;  1PV0 A;  3W7X A;  2LFS A;  5B1O A;  3OUS A;  5LHH A;  1FJG O;  1Y6X A;  4X1K A;  3AG3 B;  3ABU A;  4JI6 B;  5DED A;  2XHB A;  2PTM A;  3X2Q C;  1W0K G;  2YXH A;  3ZX6 A;  3JD4 A;  2EIL C;  4EB6 A;  5FLX N;  5LA6 B;  4JI4 B;  2VQF O;  2YS8 A;  2AHZ A;  3QO7 A;  1O9G A;  1KD1 W;  5IJ9 A;  3JAK B;  2AXT Z;  2WA4 A;  3OTF A;  4ZI7 A;  2ZIO A;  1D5N A;  1Q3E A;  2RCV A;  4KP4 A;  1IBM B;  4E2L A;  4LWS B;  1D5A A;  1OZ0 A;  2RJZ A;  1FKA O;  1WPX A;  3THO A;  3SPI A;  5B5E Z;  1JCH A;  5CA0 A;  2Q73 A;  4UXN A;  1AJQ A;  3N2G B;  1QLN A;  4QNH B;  1ZTE A;  1VF5 B;  1AR5 A;  4IHJ A;  1XI1 A;  1V55 C;  1G1X B;  5BR8 O;  1Q90 D;  3WB1 A;  4K3A A;  4BIU A;  3M7M X;  3IAY A;  1ARO P;  3U0Z A;  1K4D C;  2OYQ A;  3WU2 Z;  4B3T B;  5LMN B;  2Q67 A;  1S72 V;  4ZOL A;  3ABL C;  4WCE V;  3HKC B;  2ZE6 A;  1CP9 A;  1EZJ A;  1K4C C;  1P4R A;  3N2K A;  1NKD A;  2XT9 A;  1IVS A;  4LF4 B;  2IJK A;  2QEX V;  3SYC A;  2QKC A;  4FLV A;  1OHH G;  1NVP B;  3SYO A;  5L3E A;  2XAH A;  1Y74 A;  4UCO A;  2Y69 C;  1V54 C;  4CH5 A;  5B1B B;  1L8D A;  4FLZ A;  3DSQ A;  1I7F A;  4X89 A;  4J11 A;  3JSL A;  2DWE C;  1CEZ A;  2YDE A;  4F6E A;  4WFE A;  4MVU A;  1XEQ A;  3RYF A;  3CRA A;  1EN5 A;  3P32 A;  1LUV A;  3T4Z A;  1VF6 A;  2IBZ H;  3UO2 A;  5KMG A;  3M99 B;  3DGE A;  4HZ3 A;  2HJD A;  4FLT A;  2DQ0 A;  1Q43 A;  1PP9 H;  4GKJ O;  4RUF A;  1VAR A;  3R66 A;  1OCC C;  2AHY A;  3VOU A;  2N74 A;  5L3C A;  3RGB A;  1JJO A;  1PNM A;  1Q6I A;  3L71 H;  1YXB A;  3B09 A;  4PDV A;  1KB9 F;  2WLL B;  4DR5 O;  4JAA A;  5BY1 A;  2JGD B;  2ATK C;  3BEH A;  4JGS A;  4IIJ B;  1SQG A;  5FNV A;  5IT9 N;  3JAT B;  1KEC A;  3RN4 A;  1HNZ B;  1GK9 A;  2XAJ A;  4B7E A;  3OAA G;  2IW5 A;  5BMV A;  3ZHS A;  1L0L H;  2QA4 V;  3PJS K;  3EXA A;  4X1Y A;  4JI8 O;  3H1H H;  4QE9 A;  1QLE C;  5HFM A;  1R3I C;  3CD6 V;  2ZDI C;  4UB8 Z;  1R1B A;  1FFT B;  3H1J H;  4G2K A;  2JEU A;  4BW9 A;  2QJ1 A;  2EBO A;  2KG7 B;  4PD4 F;  1K92 A;  1NH2 D;  2CUG A;  1UPG A;  5GTH Z;  2AZ0 A;  4KL1 A;  3B40 A;  1OCO C;  3AG2 B;  3ZRW B;  5JQG B;  1MMM A;  2F66 C;  5LOV B;  2EUL A;  3OMA B;  1I08 A;  1PM9 A;  2L35 A;  5EYP A;  1B3Q A;  5ITZ A;  2LFR A;  1VQO V;  4HYO A;  1FXK A;  3CRC A;  3S3X A;  5IYZ A;  1NH2 B;  4BAY A;  2A06 H;  4LF6 O;  3SPJ A;  4X62 B;  2HVK C;  3LNM B;  2ZIN A;  4AQY B;  3BFR A;  4KHP B;  4DK1 A;  1DK1 A;  4DV7 O;  4F6R B;  2NR5 A;  4NR1 A;  3G6E V;  2UXB O;  2EIJ C;  3L70 H;  1K9M W;  2IM9 A;  4E4E A;  1H2N A;  4TV8 B;  1N34 B;  5L3D A;  1RPR A;  4JI5 B;  5D5P A;  3E83 A;  2LGW A;  4EKW A;  1SET A;  2Q8V A;  1KKC A;  4X9Q A;  3AEI A;  4J7Z A;  3APO A;  1OCZ C;  2JS3 A;  3Q4H A;  1AI4 A;  1SQP H;  2HHH B;  2H94 A;  5IYC O;  4Z2W A;  3STZ C;  4TWK A;  1AJN A;  2Q7G A;  4EFB A;  4FM1 A;  5J2T A;  3JAL A;  5KHK A;  3CC7 V;  5CA1 A;  5IWA B;  4GLX A;  4P9P A;  5EC2 C;  3VQV A;  1MAB G;  4I55 B;  2GUZ A;  2Y69 B;  4TOI A;  4C7U A;  3OEE G;  3ZMS A;  4OXS A;  1IBL B;  3K57 A;  2UXN A;  3ZRS A;  4YY3 B;  1TUB B;  2W0F C;  4IL6 Z;  4UCT A;  4FLW A;  4FLX A;  1BGY H;  2QWR B;  2RMK B;  1E1R G;  4J7K A;  4OX9 B;  5EZY A;  4Q20 A;  1RM1 B;  5E1A C;  4O4I A;  3HKC A;  5CB4 B;  1G6U A;  5GTI Z;  2M6Y A;  3G71 V;  1XNR B;  1NVP D;  2CGO A;  3FB5 C;  3JD1 A;  3TXQ A;  2YI9 A;  3S3W A;  1XBL A;  4R50 A;  1UJW B;  2PZS A;  3ZBH A;  3SR2 C;  2UXX A;  2PI5 A;  4H37 A;  4NTX A;  5TIS Z;  1PKX A;  5DN6 G;  4TV9 B;  2X6B A;  1Q6H A;  4I4T A;  2RQ6 A;  4X66 B;  4LC1 A;  1AI5 A;  4K0K B;  5LXT B;  4JI5 O;  5IY5 B;  3I5D A;  1VQ6 V;  4UVA A;  4X1I A;  2Q7E A;  2ITC C;  4GT1 A;  3J7A U;  1SA0 A;  2YI8 A;  1CPY A;  2FYU H;  3HR0 A;  4WFH A; 
#chains in the Genus database with same CATH homology
 1UFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...