1UFIA

Crystal structure of the dimerization domain of human cenp-b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
48
structure length
48
Chain Sequence
HMPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Major centromere autoantigen B
publication title Crystal structure of the human centromere protein B (CENP-B) dimerization domain at 1.65-A resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 48
sequence length 48
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1090 Mainly Alpha Orthogonal Bundle Helix Hairpins Dimerisation domain of CENP-B 1ufiA01
1UFIA
chains in the Genus database with same CATH superfamily
1I5XA 1M57C 1NZ6A 4DR7B 1RM1C 1YTFD 2GTAA 4J41A 1VARA 3RYCA 2Y48A 1JPXA 3BFRA 1Y66A 3DSQA 4B3SO 3FB7C 3J80N 4CH6A 5EZYB 1VQOV 2FL4A 3EHBB 3ZMSA 3CJHA 3EFFK 3ZX6A 3J81N 4R6ZA 3ASOC 2ADQB 2KKWA 2V7QG 4UV9A 3KZIZ 1VQNV 3STLC 4CC5A 4YJ2B 2LW7A 3H1LH 4JI4O 1AILA 1AB3A 4MTOA 3P32A 4JTCB 5H2FZ 4X66O 1H38A 4WFBV 5JQGB 4JI0O 4LFAO 5F2VO 1FFXB 2HFEC 1MABG 3M7MX 5KLVH 4LF8O 2A06H 1NVPD 3D3IA 5B3SC 1RPRA 3L74H 3RW0A 4RO2A 1YJWV 2PY5A 3JD2A 3KCXA 1NJIW 1R3LC 3ZRSA 2FKXA 1QR8A 3JD4A 3CMAV 1HR0O 2UXNA 4X1IB 3DGEA 4TV9A 3CD6V 3GWKC 3LDCA 2EX3A 1VEWA 1OV9A 2EIMB 2EZPA 1R6KA 3CRRA 3AK2A 4WFHA 3OR7C 2X6CA 4GX1A 3JARB 4YY3O 2UUCO 5IJ9B 1ZX3A 3UT5A 2YI9A 4FM0A 4FK5C 4LNUA 4UCUA 4GCZA 2UUAO 2JVDA 1MOFA 2V4DA 1V55C 1QU7A 4EB6B 1IDSA 2QA4V 4R8CA 1L8DA 3JSNA 4KP4A 1EM1A 2P22C 4RQEA 1HNWB 4NXNB 5GW7A 4UCRA 4LF8B 2CGOA 2Z3YA 5IYBO 3IC7A 4L8JA 2HR3A 2Q68A 2JS5A 1U96A 3ABKC 3ETQA 1IBMO 1SQQH 3RGBA 1IX9A 3FAVA 2UUBB 4JV5B 1HR0B 4J7KA 3P3NA 5B1AB 4ZHQB 4DUZB 4JGSA 2DQ0A 4UB8Z 3RYHA 2LO1A 4CBCA 5CB4A 1GO3F 5J2TB 3HB3B 5BR8O 1EZVH 4LFBB 2YDEA 3PN1A 5IY5C 4B3RO 1KKCA 4YY3B 2BOBC 2E5LB 1XNRO 2EIKC 2HJFC 2A3QA 2F95B 3RVYA 3W7XA 1PNLA 3IAYA 4LH7A 2WPDG 2HKOA 2R9AA 1Q8IA 1DF5A 4DR3B 1DGSA 3OM3B 1DLBA 4RAIA 3RVZA 2CK3G 2JEUA 1PL4A 3OUFA 5LGNA 1JFFB 1XILA 3TXSA 1TGOA 4B3TO 4DV2B 3HKCB 3C90A 2CAZC 2WSSG 1K97A 3OR6C 1GK9A 3UM7A 3G71V 1H2KA 3LSUA 5LMUB 5JWPA 2WA3A 2W0XA 2HVKC 3FB8C 1VIBA 2JIZG 2E76B 2N04A 1H2LA 1S0VA 4UCOA 4D6TH 2QSAA 2QGNA 5C93A 1AP6A 3N2GB 4DR5O 4BIOA 4I50A 1BT8A 4FZ1A 4JI1O 1MSDA 3ABMB 3UQ8A 3OTFA 4I7ZB 4CZZA 5BR8B 2RMKB 1K4DC 1SETA 1JQ0A 4UB6Z 1JMKC 4B3RB 1JJOA 3L70H 4IYIA 4PI2A 5IWAO 1PL0A 1VMGA 3JD0A 2LQTA 3EVKA 4J10A 3LSSA 1NBMG 5FLXN 2WLMA 3I56V 2F4VO 4JYBA 5BMVB 2KSDA 1XDCA 3OMIB 3FX7A 1YCIA 2LP7A 1M9NA 2AZ2A 1NTKH 3RBZA 2E75B 2ZIOA 4TQFA 3SYQA 1L1FA 3E8GA 2UXBB 3AG3B 1JOYA 2GDSA 1Q5OA 1VQLV 3WFVA 1UPGA 4DV3O 5DM6V 4PHZA 2ZQMA 4TV8B 2P4VA 1SA0A 2ZR2A 1SQPH 3TETA 3JASB 4IHJB 1ZSPA 2N74A 2Y69B 1AI7A 1Y67A 3CSXA 5EBMC 1PNKA 4GX2A 4HNAA 4J42A 1KMIZ 4HYOA 2HVJC 4LF7O 1FXKA 1VQ4V 4PA7A 2WLKA 5CN0A 4IIJA 1Q43A 3RYFA 4Z2WA 3BPZA 1V9PA 1H2MA 1FXKC 2QEXV 3ZMVA 3L71H 1EZJA 3THOA 1ORQC 2EIMC 2YEVA 1T5EA 4B7KA 1LUWA 2BSKB 1KD1W 5C8YB 2P67A 4LF4B 3OTOO 3CCLV 3FFQA 1N32O 1OCOB 2EZOA 3QF7A 3AG1B 3HKBA 3ML0A 3OEEG 4Z1MG 1WB8A 2Q6AA 2WLIB 2LW1A 4BAYA 1Q86W 3BABA 1AROP 1E1QG 3SGIA 1BQZA 2X6BA 4DV1B 4RWUA 3WB2A 2L35A 5ITZB 1YITV 4ZOLA 4W4KA 1M57B 1RM1B 4G28B 5LA6B 4JYYA 2Q73A 1F23A 4OX9O 4NXMB 4DV5B 1OCRC 5E1AC 1MG1A 5KHIA 3OW2U 1K73W 2QWNB 1EFRG 5B1AC 1D5AA 2CTQA 1K33A 3LSQA 3RYCB 3ASOB 4MTFA 1BGYH 4O2AA 1WAZA 3T1HO 2UXXA 3MHHC 3CJHB 3CCRV 2BOCC 3NR7A 5B66Z 4AILC 1G8MA 5LGUA 5GTIZ 1VQ5V 3W7SA 5TISZ 4LBEC 1HDJA 4LF5O 2R9IA 1ENVA 4PDLA 3CYOA 2Q67A 3VOUA 1E79G 3K9SA 2XHBA 5BY1A 2QR4A 3F7VC 1CEZA 5B3SB 1PKXA 3OGCC 4GZRB 1Y76A 2QTOA 1DK1A 3SJBC 4DUYO 1QLNA 1QNMA 5CA3A 2Q5ZA 4JF3A 3ZJZA 4WCEV 1H2NA 2OIEA 3S3WA 5CA0A 2F23A 1AI4A 4TV9B 4MVQA 2QE7G 2KG7A 2PI4A 5LOVA 4NTWA 1A32A 5JJNB 1V55B 4CS2A 3ZRWA 2YI8A 2ZINA 3UT5B 1XQ8A 3QO5A 2GTSA 4LNUB 1YTFB 2QWRB 2IJKA 4JI2O 4PDVA 5L3EA 3CX5F 1TVKA 4B3MO 5IYCO 2Q0OC 1YJ9V 4MSWC 2XOKG 3SYAA 1TUEB 3ABKB 1SC5B 4GKJO 1JJ2U 3RWRD 1MMMA 2OWOA 1B3QA 4TSFG 4DV6B 1VF7A 5EBWC 3OAAG 3E8BA 1N34O 2Y0IA 4UFZA 1QVGU 4KHPB 1KYOF 2JS3A 3CRMA 3FAVB 1Q6IA 3CCJV 1KP3A 1IBLB 5IY5B 2P5OA 3J7AU 3RYHB 3AG4C 2EIKB 5CB4B 4LF9O 1F7YA 5GONB 4K3AA 4ZBMA 2DWDC 3MD0A 3ZHVA 1UJWB 3SPJA 1GN2A 3E89A 4G27B 4X8AA 4BWAA 1NVPB 1R3IC 1K8AW 4JASA 3OUSA 4JI7B 1YVWA 3KG2A 1OCZC 1M93A 4J7ZA 4X1YA 3UKMA 1I0HA 2IH1C 5J2UB 4O4LA 5JJJB 1IZ3A 2D2CB 3ZHUA 3SJCC 1OCOC 2B1IA 1FFTB 2OTJV 1AI5A 3RT3C 3ZRVA 3SPGA 1SF9A 4JI5B 3W7UA 2MK3A 5EYPA 1RSOB 4MVUA 1FXHA 1CXZB 4JAVA 5K1XA 3BA8A 2RJZA 5B1BC 5CA1A 4I50B 5JCOA 5JVDA 3SJQC 1TA8A 1AVMA 1VQ8V 3KKYA 4FJCC 4XBFA 3BAAA 3A8TA 3WU2Z 4O4HA 5JCOC 5LHGA 2YIAA 2GHYA 3CE2A 2VQEB 4GX0A 1HP8A 1WPXA 1S3JA 2W6IG 1Z5WA 1VQ7V 1YEWA 4RQFA 1L0LH 3JD1A 4X1KA 1EN6A 3VQVA 2Q8VA 5IYZA 3K03A 4OGQB 1X59A 4B08A 1WJZA 2MW2B 4D7SA 4I4TA 3NXSA 3OMNB 3SYPA 3H1KH 1SA0B 1W2BU 1NI8A 1HNWO 4NXNO 3FB5C 2X7RB 2EJ7A 1Q6UA 1FXVA 3BCCH 1GMGA 4W4LA 3RN4A 4CH5A 2KQXA 4JTAB 3LNNA 4YIOA 4LR3A 4HNAB 3RFRA 2UUBO 2IH3C 4JV5O 3JAKA 1F4MA 3B40A 1J5EO 2IJHA 1KECA 1FXKB 4UCVA 2C2AA 1SZTA 4DR6O 4DUZO 2F1MA 2WLNA 5KX5A 4IIJB 1RPOA 3K9AA 3CC2V 3L9DA 3RYFB 1TAEA 3ZHSA 2CH7A 2Q7EA 4LFBO 1WPBA 2YEVB 1AI6A 2E5LO 4GT1A 1I94O 4IYHA 4EKWA 4K8XA 2OT5A 2ARHA 2ZNJA 3JD3A 3LUTB 4LFCB 4DR3O 2YIBA 1EN5A 3K0GA 3HKBB 4DR4B 4JI8B 3SPCA 3CWBH 3SYCA 4MW8A 4DV2O 3K5LA 5KAIZ 3CEIA 4WF9V 1M4UA 1FJGB 5LMUO 1OCRB 4NKGB 4ZOLB 3VQWA 3ZCCA 1SQXH 4R7CA 1J5EB 1WLEA 1QVFU 2ZIMA 2ZT9B 1VF6A 4DR6B 1NR7A 1ROPA 1UFIA 2E74B 2XTAA 3SDLA 1BZKA 1GN6A 1VQ9V 5GONA 4QJFB 3RYIA 1VF6C 1XHZA 4GKKB 3K5MA 4KUMA 4EEQA 2XAHA 1O9GA 2ZXWC 1XEQA 4WFAV 1I94B 1LNQA 4O2AB 1MZEA 4FLXA 2Z5UA 4I55A 3OD4A 1W0KG 4FLZA 1Q3EA 4UUJC 4NB5A 3HR0A 1GRJA 1KP2A 4X64B 1ZTEA 5J2UA 4DR1B 1AJQA 2GUZA 4DXWA 1OZ0A 4FFKA 3IFXA 4O4IA 1PPJH 2HLDG 1IXMA 4KXRA 1XI1A 4FVMA 3CCQV 5JH7A 2UXBO 5HFLA 5CMUA 2YC0A 1RSOA 1Y76B 2P90A 2CUGA 2RDCA 1K3EA 3G80A 4TUYA 1XL6A 4K0KB 4P2ZA 5FPOA 1M5IA 2R72A 3ZBHA 2YSUB 1CPYA 2XUMA 3K06A 4LF6B 1PV0A 4J7JA 3QO8A 5KUKA 3Q4HA 4DV7B 5CA0B 4N23A 1XL4A 2N05A 1S5LZ 4JYCA 2ITCC 2KG7B 3ZN1A 5LOVB 1PD3A 4ICGA 1HW7A 4DV0O 1IBKO 3G67A 1G6UA 4Q20A 3K5OA 4DO2A 1YDXA 3ZRWB 2WWWA 2FYUH 1WP7A 2CE4A 2YXLA 2EBOA 1TVKB 2LFSA 3SR2C 2PGGA 4RUEA 3WG7C 4UCSA 2JJ1G 5LL6Y 3AG7A 2IU0A 4LF4O 2O57A 2VRZA 2PZSA 1AP5A 4N21A 2Q69A 1NT2B 4DV1O 4B7EA 4U3JA 1WB7A 3AG4B 2QKAA 3R66A 1R3KC 2NR5A 3O65A 1EN4A 1G1XB 2ZE6A 4NXMO 1VQMV 4DV5O 4DV0B 1IBKB 2Z0AA 2YICA 2DMXA 3L72H 1SQBH 4X9QA 5EK0A 2QTSA 3AK1A 4X65O 4NR1A 4PDMA 2IW5A 1HNZB 2NNUA 1OCZB 2AHYA 3K0DA 3A0RA 2GV9A 4H0LB 3T1CA 3SJAC 5EIBC 4EFEA 3B4SA 2DQ3A 2CDYA 4D7TA 2VWJA 4GX5A 1YIJV 4LC1A 5IDJA 5IYDO 1N33B 4X1YB 3CC7V 4DV4B 2ZDIA 4O4LB 5KHJA 2EULA 4CS4A 3JAWA 3W7TA 1NS1A 4U7OA 4E4EA 5B1BB 4QIWF 2IU3A 1JCHA 4QE9A 1GTOA 5EYPB 4L87A 5EC2C 2PTMA 4FLVA 3A2FA 2P7TC 4RUFA 3D36A 1ZAUA 4PJ0Z 3A0BZ 5CA1B 1KU9A 1XREA 5A2QN 2UU9B 5H6QA 1Q7YW 5JVDB 3BVOA 2ETNA 2G38A 4X65B 2FTKA 3U0ZA 3GB7C 2R70A 2YS8A 4O4HB 2M6YA 1B06A 1S5JA 2M7WA 5KA6A 4AQYB 3CRAA 4FPPA 3OFNG 2XNDG 2LGQA 4FLWA 1JVMA 1KQSU 4GUNA 1SQFA 1Q81W 4X20A 1QR9A 3JAMN 4PA4A 2BE3A 2QJ1A 1IURA 2BTQA 1XMQO 2WLHA 4X1KB 2GSMB 3G6EV 2QM4A 3CCVV 5IYZB 2QWQB 3A0HZ 4I0XA 4JI6O 2CTWA 3AK3A 3B77A 2OCCC 2DWEC 4I4TB 4PD4F 2F43G 4YHHB 1R3JC 3R65A 4QPKA 4JZGA 2RNBA 1W0JG 5AG2A 1R1BA 4F6RA 1M56C 3K5NA 4MS2A 2XAQA 1H2GA 2CGNA 4DV6O 2EILC 2ZM6B 1AJNA 2CTPA 2IJIA 1JR9A 4KHPO 3X2QB 3HPLC 1KBHA 4JI3B 3SPHA 3JAKB 3OE7G 4I9WA 3H9VA 1IBLO 4X62B 4WBNB 1BHAA 4OPAA 3ZRXA 5KX5B 3ZHRA 3ZMTA 3D3QA 1DTOA 2IJJA 2HEPA 1EBOA 1NKDA 1AR5A 4UVCA 2CH7B 2WA4A 4OPHA 1ZLZA 1BMFG 1PP9H 4XDKA 5K1PA 5DECA 2WAMA 1S5HC 1XMQB 1ZUQA 4BW9A 3OEHG 4JI6B 4JI7O 1QHTA 3U11A 4JYAO 1Z2GA 2UXCB 3HKEA 2XASA 2H3OA 1COWG 3KCYA 2ODMA 1SESA 3JATA 1HNXB 2W0FC 3ZHTA 3H1HH 2H94A 4QPJA 3JALB 4J11A 4ABMA 3ETEA 1P49A 1XMOB 3QG5A 4JI5O 1I5YA 4FFBA 5L3DA 3WB1A 3F5TA 3K04A 3CP1A 2HJDA 2ZXWB 2DYRC 3QO7A 2KB1A 4TT3G 4CH3A 4R50A 5IJ0A 1K5QA 3RYIB 2Q7GA 4FM2A 3AEIA 4QE7A 3ZMZA 2QM8A 3P3PA 3OT7A 4DRXA 3JCUZ 4TOIA 2AZ0A 2Y4TA 1US6A 1Q90D 3ABLC 4K8ZA 2WLJA 3M99B 2OCHA 2VQEO 3FYIB 4I55B 4TQDA 5LP6B 4JYAB 3GWOA 4NVPA 1LUVA 3P30A 4H13B 4O4JA 2A7WA 2F66C 5KMGA 2GUZB 3K3WA 3FB6C 1WN7A 3ASNC 3BEHA 4O4IB 2DE0X 2K1EA 3LDDA 1OHHG 5JH7B 3VQXA 1BS3A 4ZI7A 3H1JH 2ZE5A 3JCZA 2B1GA 4F6EA 4TUYB 1AR4A 2YXYA 4MVSA 1KB9F 4H37A 3E22A 3TJTA 1O9HA 4P9OA 4WFGA 1NTMH 4J80A 2JGDA 3Q4HB 2YIBD 1P4RA 2ZE8A 1QQCA 3H1IH 4QNHB 4DR2O 5LHIA 3APQA 3ZN0A 3K79A 3T1YO 4UV8A 3CS5A 3E8FA 2DJVA 3CXHF 1R6TA 2NN4A 4ZIBA 1Q82W 4LWSA 1SERA 3WG7B 4NTYA 3E2EA 3K57A 4JTDB 2EJRA 2YXHA 4MTXA 2RQ6A 3ZHQA 4K35A 4XDJA 2XT9A 1FKAO 1NR1A 3ICXA 3UCSC 4LFCO 3HKDB 2AXTZ 2ITDC 4LCUC 4DR4O 1KC8W 4JI8O 5H6RA 1H2SB 2Q7HA 5JJEB 3FKSG 1N0NA 2PF4E 2XAGA 3TK1A 4A5UB 1FJGO 4U3JB 1J95A 3IC9A 3MAQA 2EINC 1Y74B 2QDOA 3PJSK 4NYKA 4DR2B 5IE9A 3I55V 2X6AA 3T1YB 5L3CA 3E8HA 1NTZH 4TWKA 4WBNA 4I9QA 3X2QC 4Z1VA 1XBLA 4FZ0A 2RN9A 2Y4UA 2WLLA 5FNVA 3ZIAG 4H44B 1QLEC 4GKKO 5LGTA 1KKDA 1Q6HA 3B8NA 4B3SB 2B5UA 5LXTA 4FIPC 1N0JA 3N27A 4MVOA 5FPRA 1YZBA 3BA9A 4ASUG 1JA8A 3M8AA 4WFEA 1AR1B 2Q4PA 3I5DA 1BQ0A 5B5EZ 3JAWB 3F5WC 5KAFZ 1BHBA 4X64O 1BSMA 2VWKA 4JI4B 2RCVA 1Y4MA 4MW3A 3ABUA 4DR1O 3L75H 2H8PC 4X66B 2QKCA 3D8CA 3JALA 1F4NA 4HBNA 1RP3B 3BHPA 3VQYA 4JI0B 4LFAB 1TUBA 3SPIA 1FPOA 2BCCH 5D5PA 1WA8A 4P30A 1R6NA 1BCCH 3S3XA 2DOSA 4JPRA 2P6JA 4K0KO 4EFBA 5DEDA 1GH6A 2NLJC 5LMNO 3TCUA 4LF6O 2ZE7A 4YIPA 1V54C 3E35A 4X88A 4DV7O 2ZD9A 5IT9N 4O2BA 4AHCA 4YJ3A 1IXBA 5EC1C 4PI0A 1SZXA 5LP6A 5EBLC 1B6QA 1MNGA 5B1OA 4X20B 1M1KW 1JX9A 3JSLA 1AJPA 3T4DA 2A0LA 2VS0A 2OCCB 4GYCB 2UUCB 3BY6A 5LP6C 2BTQB 3B2EE 2UUAB 2V1DA 1F51A 3TGUH 4I0XB 1VQKV 4JAAA 5LYJA 1M56B 3LNMB 2ZNIA 1QBZA 4Q6GA 5BXZA 1GM7A 2EILB 4AI8A 4DYLA 4U7NA 3N2KA 1CP9A 5EIBD 2A9HA 4FLYA 4ZKIA 4F6RB 2JK5C 3U10A 5B1NA 1THZA 5LMNB 1IBMB 2QKSA 2ATKC 1KUQA 2QWPB 1OCCC 3MHSC 3DXRA 1XNQO 1K5SA 2E3CA 1H8HG 3MDSA 4HAMA 2JGUA 2Q9LA 1GAXA 3C3SA 2YIDA 3WB0A 1E1RG 3G6BA 1LR1A 4PELA 2F93B 4U3FH 1FS0G 3B8MA 4MTGA 5KA5A 2EIJC 2W6JG 4F4LA 2X0LA 3STZC 1XNRB 4FMTA 1U97A 1HNZO 5CBFA 5EZYA 2B9ZA 3SYOA 1K7DA 3HKEB 3BRCA 2AHZA 3T2MA 3HKDA 4B3TB 1N33O 1D5NA 5H5NA 4DV4O 2ILMA 2K9PA 3JATB 5L3BA 4YJ2A 3C3TA 4JAUA 1VF5B 4FLTA 4OXSA 3EXAA 1WNSA 3T4ZA 3QVNA 4FM1A 2DYSB 1MZFA 2JDIG 2Y0PA 1S72V 2DYRB 1XNQB 1P84F 4UXNA 1Y74A 4DK0A 4FFBB 5JQGA 3CRQA 1SQGA 1FFXA 2PYJA 4DR5B 4JI1B 2IBZH 1S77D 4MVMA 2UU9O 2DN9A 2FMLA 5IJ0B 3ABLB 2ZKOA 2DW4A 3OGIB 4DRXB 5IWAB 1K34A 1WP8A 5KUMA 2D3OW 4X1IA 2F4VB 4AQYO 1HWYA 3ASNB 3DC6A 3AG2B 4PA6A 4DK1A 4O4JB 1OJHA 1XHXA 2OIGA 4PA9A 2PI5A 1B04A 5KMGB 3JARA 5IJ9A 1VQ6V 1K4CC 4PA3A 1GN3A 3FYEB 3B09A 2HP8A 2ZDIC 2YUAA 1XUQA 4CH4A 1S76D 4ZI7B 3ABTA 3VBBA 4EB6A 1YI2V 1N8RW 1D2DA 1NH2B 3QNEA 4DV3B 4XDLA 3CRCA 4I5SA 5KHKA 4YHHO 3CXCU 1ZL8B 4BR6A 5E79Z 1GKFA 4MVZA 4UVBA 3D36C 3E22B 3IGAC 1XOUA 2ZM6O 2JGDB 1BE3H 1GM9A 5KHGA 5HFMA 1H8EG 1NU1H 2AW9A 4JI3O 4LF7B 3ZEDA 5KHHA 1GM8A 4GLXA 4H33A 4ZHQA 4X62O 3ZMUA 4UCTA 4LWSB 1M90W 1YHQV 5J2TA 1Y6XA 2XAFA 2L6LA 1FYJA 2Q0AA 3UO2A 2AGAA 2ADPA 1SRYA 2LJ2A 2VQFO 3CB2A 4MVRA 4IL6Z 3OTOB 2UXDO 1N32B 5L3FA 1L0NH 4UVAA 1K9MW 2UXCO 4X89A 1JFFA 1I7FA 3CC4V 2EINB 3HKCA 3O9OA 4IGGA 4IT5A 1X4TA 1HNXO 4CS3A 4KFMA 3IJ4A 3CPWU 5LBQA 1P7GA 1XMOO 1FD9A 4OX9B 1SS3A 2XAJA 1VP7A 1QLEB 3L73H 1N36O 4E2LA 3N2GA 1PNMA 1YJNV 1K92A 3K58A 4WFFA 2WLLB 5FNVB 5BZBA 1ZWIC 2LGWA 1RFYA 1NQTA 2BTOA 2HHHO 5D5QA 1NH2D 2VQFB 3ABMC 3JYCA 1GN4A 5LXTB 3H01A 3T1HB 5FL7G 3QTCA 1QCEA 3G4SV 3DTUB 2UXDB 3DC5A 2A79B 2OYQA 2ZCEA 1I08A 3K59A 1SKVA 2GBOA 5BMVA 1P7BA 4J9ZB 1YSCA 2FB5A 4LF5B 2P4KA 3CCEV 1MA1A 2LFRA 3GVMA 4C7UA 3K08A 2PUSA 1PM9A 2HG5C 1URFA 1SQVH 3ETDA 2ZR3A 4G2KA 4BIZA 5LHHA 1TUBB 1VQPV 4FLUA 1WA8B 5DN6G 3CCMV 1N36B 4TV8A 2R9RB 2DYSC 4BW5A 1V54B 4DUYB 3AG3C 3F7YC 5L3GA 1FAFA 3JASA 4IHJA 4BIUA 3E83A 4PDRA 2JEXA 2HHHB 1YF2A 1MSWD 1YXBA 2IM9A 4YXWG 4O2BB 4YJ3B 2CTRA 2Y69C 5GTHZ 3CMEV 5CBGA 2QM7A 1DF4A 1W59A 4DR7O 3E86A 3CCSV 3OMAB 1Z5VA 1G4YB 4DW0A 2OTLV 4MT8A 4JI2B 4B3MB 3AG2C 3LDEA 4PV1B 3ETGA 1BL8A 1R73A 2BSKA 5C8YA 5LYJB 2JRIA 5H9CA 4JZ2A 3CCUV 2JJ2G 5J9PC 1IVSA 3N2KB 4GKJB 3APOA 5CBHA 1OCCB 4KL1A 1ZL8A 3FD9A 2WLIA 4QGPA 2PYLA 1N34B 4P9PA 3AG1C 3ZS8C 4CC6A 5ITZA 3TXQA 3DXRB 1N4CA 3CHXA 4LH6A 4LP8A 5A9GA 4J9YB 3UO3A 2P06A 4HZ3A 5LA6A 3W7WA 2EIJB 4DW1A 4NTXA 4LF9B 2QWOB
chains in the Genus database with same CATH topology
1UFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFI A; 
#chains in the Genus database with same CATH topology
 1I5X A;  1M57 C;  1NZ6 A;  4DR7 B;  1RM1 C;  1YTF D;  2GTA A;  4J41 A;  1VAR A;  3RYC A;  2Y48 A;  1JPX A;  3BFR A;  1Y66 A;  3DSQ A;  4B3S O;  3FB7 C;  3J80 N;  4CH6 A;  5EZY B;  1VQO V;  2FL4 A;  3EHB B;  3ZMS A;  3CJH A;  3EFF K;  3ZX6 A;  3J81 N;  4R6Z A;  3ASO C;  2ADQ B;  2KKW A;  2V7Q G;  4UV9 A;  3KZI Z;  1VQN V;  3STL C;  4CC5 A;  4YJ2 B;  2LW7 A;  3H1L H;  4JI4 O;  1AIL A;  1AB3 A;  4MTO A;  3P32 A;  4JTC B;  5H2F Z;  4X66 O;  1H38 A;  4WFB V;  5JQG B;  4JI0 O;  4LFA O;  5F2V O;  1FFX B;  2HFE C;  1MAB G;  3M7M X;  5KLV H;  4LF8 O;  2A06 H;  1NVP D;  3D3I A;  5B3S C;  1RPR A;  3L74 H;  3RW0 A;  4RO2 A;  1YJW V;  2PY5 A;  3JD2 A;  3KCX A;  1NJI W;  1R3L C;  3ZRS A;  2FKX A;  1QR8 A;  3JD4 A;  3CMA V;  1HR0 O;  2UXN A;  4X1I B;  3DGE A;  4TV9 A;  3CD6 V;  3GWK C;  3LDC A;  2EX3 A;  1VEW A;  1OV9 A;  2EIM B;  2EZP A;  1R6K A;  3CRR A;  3AK2 A;  4WFH A;  3OR7 C;  2X6C A;  4GX1 A;  3JAR B;  4YY3 O;  2UUC O;  5IJ9 B;  1ZX3 A;  3UT5 A;  2YI9 A;  4FM0 A;  4FK5 C;  4LNU A;  4UCU A;  4GCZ A;  2UUA O;  2JVD A;  1MOF A;  2V4D A;  1V55 C;  1QU7 A;  4EB6 B;  1IDS A;  2QA4 V;  4R8C A;  1L8D A;  3JSN A;  4KP4 A;  1EM1 A;  2P22 C;  4RQE A;  1HNW B;  4NXN B;  5GW7 A;  4UCR A;  4LF8 B;  2CGO A;  2Z3Y A;  5IYB O;  3IC7 A;  4L8J A;  2HR3 A;  2Q68 A;  2JS5 A;  1U96 A;  3ABK C;  3ETQ A;  1IBM O;  1SQQ H;  3RGB A;  1IX9 A;  3FAV A;  2UUB B;  4JV5 B;  1HR0 B;  4J7K A;  3P3N A;  5B1A B;  4ZHQ B;  4DUZ B;  4JGS A;  2DQ0 A;  4UB8 Z;  3RYH A;  2LO1 A;  4CBC A;  5CB4 A;  1GO3 F;  5J2T B;  3HB3 B;  5BR8 O;  1EZV H;  4LFB B;  2YDE A;  3PN1 A;  5IY5 C;  4B3R O;  1KKC A;  4YY3 B;  2BOB C;  2E5L B;  1XNR O;  2EIK C;  2HJF C;  2A3Q A;  2F95 B;  3RVY A;  3W7X A;  1PNL A;  3IAY A;  4LH7 A;  2WPD G;  2HKO A;  2R9A A;  1Q8I A;  1DF5 A;  4DR3 B;  1DGS A;  3OM3 B;  1DLB A;  4RAI A;  3RVZ A;  2CK3 G;  2JEU A;  1PL4 A;  3OUF A;  5LGN A;  1JFF B;  1XIL A;  3TXS A;  1TGO A;  4B3T O;  4DV2 B;  3HKC B;  3C90 A;  2CAZ C;  2WSS G;  1K97 A;  3OR6 C;  1GK9 A;  3UM7 A;  3G71 V;  1H2K A;  3LSU A;  5LMU B;  5JWP A;  2WA3 A;  2W0X A;  2HVK C;  3FB8 C;  1VIB A;  2JIZ G;  2E76 B;  2N04 A;  1H2L A;  1S0V A;  4UCO A;  4D6T H;  2QSA A;  2QGN A;  5C93 A;  1AP6 A;  3N2G B;  4DR5 O;  4BIO A;  4I50 A;  1BT8 A;  4FZ1 A;  4JI1 O;  1MSD A;  3ABM B;  3UQ8 A;  3OTF A;  4I7Z B;  4CZZ A;  5BR8 B;  2RMK B;  1K4D C;  1SET A;  1JQ0 A;  4UB6 Z;  1JMK C;  4B3R B;  1JJO A;  3L70 H;  4IYI A;  4PI2 A;  5IWA O;  1PL0 A;  1VMG A;  3JD0 A;  2LQT A;  3EVK A;  4J10 A;  3LSS A;  1NBM G;  5FLX N;  2WLM A;  3I56 V;  2F4V O;  4JYB A;  5BMV B;  2KSD A;  1XDC A;  3OMI B;  3FX7 A;  1YCI A;  2LP7 A;  1M9N A;  2AZ2 A;  1NTK H;  3RBZ A;  2E75 B;  2ZIO A;  4TQF A;  3SYQ A;  1L1F A;  3E8G A;  2UXB B;  3AG3 B;  1JOY A;  2GDS A;  1Q5O A;  1VQL V;  3WFV A;  1UPG A;  4DV3 O;  5DM6 V;  4PHZ A;  2ZQM A;  4TV8 B;  2P4V A;  1SA0 A;  2ZR2 A;  1SQP H;  3TET A;  3JAS B;  4IHJ B;  1ZSP A;  2N74 A;  2Y69 B;  1AI7 A;  1Y67 A;  3CSX A;  5EBM C;  1PNK A;  4GX2 A;  4HNA A;  4J42 A;  1KMI Z;  4HYO A;  2HVJ C;  4LF7 O;  1FXK A;  1VQ4 V;  4PA7 A;  2WLK A;  5CN0 A;  4IIJ A;  1Q43 A;  3RYF A;  4Z2W A;  3BPZ A;  1V9P A;  1H2M A;  1FXK C;  2QEX V;  3ZMV A;  3L71 H;  1EZJ A;  3THO A;  1ORQ C;  2EIM C;  2YEV A;  1T5E A;  4B7K A;  1LUW A;  2BSK B;  1KD1 W;  5C8Y B;  2P67 A;  4LF4 B;  3OTO O;  3CCL V;  3FFQ A;  1N32 O;  1OCO B;  2EZO A;  3QF7 A;  3AG1 B;  3HKB A;  3ML0 A;  3OEE G;  4Z1M G;  1WB8 A;  2Q6A A;  2WLI B;  2LW1 A;  4BAY A;  1Q86 W;  3BAB A;  1ARO P;  1E1Q G;  3SGI A;  1BQZ A;  2X6B A;  4DV1 B;  4RWU A;  3WB2 A;  2L35 A;  5ITZ B;  1YIT V;  4ZOL A;  4W4K A;  1M57 B;  1RM1 B;  4G28 B;  5LA6 B;  4JYY A;  2Q73 A;  1F23 A;  4OX9 O;  4NXM B;  4DV5 B;  1OCR C;  5E1A C;  1MG1 A;  5KHI A;  3OW2 U;  1K73 W;  2QWN B;  1EFR G;  5B1A C;  1D5A A;  2CTQ A;  1K33 A;  3LSQ A;  3RYC B;  3ASO B;  4MTF A;  1BGY H;  4O2A A;  1WAZ A;  3T1H O;  2UXX A;  3MHH C;  3CJH B;  3CCR V;  2BOC C;  3NR7 A;  5B66 Z;  4AIL C;  1G8M A;  5LGU A;  5GTI Z;  1VQ5 V;  3W7S A;  5TIS Z;  4LBE C;  1HDJ A;  4LF5 O;  2R9I A;  1ENV A;  4PDL A;  3CYO A;  2Q67 A;  3VOU A;  1E79 G;  3K9S A;  2XHB A;  5BY1 A;  2QR4 A;  3F7V C;  1CEZ A;  5B3S B;  1PKX A;  3OGC C;  4GZR B;  1Y76 A;  2QTO A;  1DK1 A;  3SJB C;  4DUY O;  1QLN A;  1QNM A;  5CA3 A;  2Q5Z A;  4JF3 A;  3ZJZ A;  4WCE V;  1H2N A;  2OIE A;  3S3W A;  5CA0 A;  2F23 A;  1AI4 A;  4TV9 B;  4MVQ A;  2QE7 G;  2KG7 A;  2PI4 A;  5LOV A;  4NTW A;  1A32 A;  5JJN B;  1V55 B;  4CS2 A;  3ZRW A;  2YI8 A;  2ZIN A;  3UT5 B;  1XQ8 A;  3QO5 A;  2GTS A;  4LNU B;  1YTF B;  2QWR B;  2IJK A;  4JI2 O;  4PDV A;  5L3E A;  3CX5 F;  1TVK A;  4B3M O;  5IYC O;  2Q0O C;  1YJ9 V;  4MSW C;  2XOK G;  3SYA A;  1TUE B;  3ABK B;  1SC5 B;  4GKJ O;  1JJ2 U;  3RWR D;  1MMM A;  2OWO A;  1B3Q A;  4TSF G;  4DV6 B;  1VF7 A;  5EBW C;  3OAA G;  3E8B A;  1N34 O;  2Y0I A;  4UFZ A;  1QVG U;  4KHP B;  1KYO F;  2JS3 A;  3CRM A;  3FAV B;  1Q6I A;  3CCJ V;  1KP3 A;  1IBL B;  5IY5 B;  2P5O A;  3J7A U;  3RYH B;  3AG4 C;  2EIK B;  5CB4 B;  4LF9 O;  1F7Y A;  5GON B;  4K3A A;  4ZBM A;  2DWD C;  3MD0 A;  3ZHV A;  1UJW B;  3SPJ A;  1GN2 A;  3E89 A;  4G27 B;  4X8A A;  4BWA A;  1NVP B;  1R3I C;  1K8A W;  4JAS A;  3OUS A;  4JI7 B;  1YVW A;  3KG2 A;  1OCZ C;  1M93 A;  4J7Z A;  4X1Y A;  3UKM A;  1I0H A;  2IH1 C;  5J2U B;  4O4L A;  5JJJ B;  1IZ3 A;  2D2C B;  3ZHU A;  3SJC C;  1OCO C;  2B1I A;  1FFT B;  2OTJ V;  1AI5 A;  3RT3 C;  3ZRV A;  3SPG A;  1SF9 A;  4JI5 B;  3W7U A;  2MK3 A;  5EYP A;  1RSO B;  4MVU A;  1FXH A;  1CXZ B;  4JAV A;  5K1X A;  3BA8 A;  2RJZ A;  5B1B C;  5CA1 A;  4I50 B;  5JCO A;  5JVD A;  3SJQ C;  1TA8 A;  1AVM A;  1VQ8 V;  3KKY A;  4FJC C;  4XBF A;  3BAA A;  3A8T A;  3WU2 Z;  4O4H A;  5JCO C;  5LHG A;  2YIA A;  2GHY A;  3CE2 A;  2VQE B;  4GX0 A;  1HP8 A;  1WPX A;  1S3J A;  2W6I G;  1Z5W A;  1VQ7 V;  1YEW A;  4RQF A;  1L0L H;  3JD1 A;  4X1K A;  1EN6 A;  3VQV A;  2Q8V A;  5IYZ A;  3K03 A;  4OGQ B;  1X59 A;  4B08 A;  1WJZ A;  2MW2 B;  4D7S A;  4I4T A;  3NXS A;  3OMN B;  3SYP A;  3H1K H;  1SA0 B;  1W2B U;  1NI8 A;  1HNW O;  4NXN O;  3FB5 C;  2X7R B;  2EJ7 A;  1Q6U A;  1FXV A;  3BCC H;  1GMG A;  4W4L A;  3RN4 A;  4CH5 A;  2KQX A;  4JTA B;  3LNN A;  4YIO A;  4LR3 A;  4HNA B;  3RFR A;  2UUB O;  2IH3 C;  4JV5 O;  3JAK A;  1F4M A;  3B40 A;  1J5E O;  2IJH A;  1KEC A;  1FXK B;  4UCV A;  2C2A A;  1SZT A;  4DR6 O;  4DUZ O;  2F1M A;  2WLN A;  5KX5 A;  4IIJ B;  1RPO A;  3K9A A;  3CC2 V;  3L9D A;  3RYF B;  1TAE A;  3ZHS A;  2CH7 A;  2Q7E A;  4LFB O;  1WPB A;  2YEV B;  1AI6 A;  2E5L O;  4GT1 A;  1I94 O;  4IYH A;  4EKW A;  4K8X A;  2OT5 A;  2ARH A;  2ZNJ A;  3JD3 A;  3LUT B;  4LFC B;  4DR3 O;  2YIB A;  1EN5 A;  3K0G A;  3HKB B;  4DR4 B;  4JI8 B;  3SPC A;  3CWB H;  3SYC A;  4MW8 A;  4DV2 O;  3K5L A;  5KAI Z;  3CEI A;  4WF9 V;  1M4U A;  1FJG B;  5LMU O;  1OCR B;  4NKG B;  4ZOL B;  3VQW A;  3ZCC A;  1SQX H;  4R7C A;  1J5E B;  1WLE A;  1QVF U;  2ZIM A;  2ZT9 B;  1VF6 A;  4DR6 B;  1NR7 A;  1ROP A;  1UFI A;  2E74 B;  2XTA A;  3SDL A;  1BZK A;  1GN6 A;  1VQ9 V;  5GON A;  4QJF B;  3RYI A;  1VF6 C;  1XHZ A;  4GKK B;  3K5M A;  4KUM A;  4EEQ A;  2XAH A;  1O9G A;  2ZXW C;  1XEQ A;  4WFA V;  1I94 B;  1LNQ A;  4O2A B;  1MZE A;  4FLX A;  2Z5U A;  4I55 A;  3OD4 A;  1W0K G;  4FLZ A;  1Q3E A;  4UUJ C;  4NB5 A;  3HR0 A;  1GRJ A;  1KP2 A;  4X64 B;  1ZTE A;  5J2U A;  4DR1 B;  1AJQ A;  2GUZ A;  4DXW A;  1OZ0 A;  4FFK A;  3IFX A;  4O4I A;  1PPJ H;  2HLD G;  1IXM A;  4KXR A;  1XI1 A;  4FVM A;  3CCQ V;  5JH7 A;  2UXB O;  5HFL A;  5CMU A;  2YC0 A;  1RSO A;  1Y76 B;  2P90 A;  2CUG A;  2RDC A;  1K3E A;  3G80 A;  4TUY A;  1XL6 A;  4K0K B;  4P2Z A;  5FPO A;  1M5I A;  2R72 A;  3ZBH A;  2YSU B;  1CPY A;  2XUM A;  3K06 A;  4LF6 B;  1PV0 A;  4J7J A;  3QO8 A;  5KUK A;  3Q4H A;  4DV7 B;  5CA0 B;  4N23 A;  1XL4 A;  2N05 A;  1S5L Z;  4JYC A;  2ITC C;  2KG7 B;  3ZN1 A;  5LOV B;  1PD3 A;  4ICG A;  1HW7 A;  4DV0 O;  1IBK O;  3G67 A;  1G6U A;  4Q20 A;  3K5O A;  4DO2 A;  1YDX A;  3ZRW B;  2WWW A;  2FYU H;  1WP7 A;  2CE4 A;  2YXL A;  2EBO A;  1TVK B;  2LFS A;  3SR2 C;  2PGG A;  4RUE A;  3WG7 C;  4UCS A;  2JJ1 G;  5LL6 Y;  3AG7 A;  2IU0 A;  4LF4 O;  2O57 A;  2VRZ A;  2PZS A;  1AP5 A;  4N21 A;  2Q69 A;  1NT2 B;  4DV1 O;  4B7E A;  4U3J A;  1WB7 A;  3AG4 B;  2QKA A;  3R66 A;  1R3K C;  2NR5 A;  3O65 A;  1EN4 A;  1G1X B;  2ZE6 A;  4NXM O;  1VQM V;  4DV5 O;  4DV0 B;  1IBK B;  2Z0A A;  2YIC A;  2DMX A;  3L72 H;  1SQB H;  4X9Q A;  5EK0 A;  2QTS A;  3AK1 A;  4X65 O;  4NR1 A;  4PDM A;  2IW5 A;  1HNZ B;  2NNU A;  1OCZ B;  2AHY A;  3K0D A;  3A0R A;  2GV9 A;  4H0L B;  3T1C A;  3SJA C;  5EIB C;  4EFE A;  3B4S A;  2DQ3 A;  2CDY A;  4D7T A;  2VWJ A;  4GX5 A;  1YIJ V;  4LC1 A;  5IDJ A;  5IYD O;  1N33 B;  4X1Y B;  3CC7 V;  4DV4 B;  2ZDI A;  4O4L B;  5KHJ A;  2EUL A;  4CS4 A;  3JAW A;  3W7T A;  1NS1 A;  4U7O A;  4E4E A;  5B1B B;  4QIW F;  2IU3 A;  1JCH A;  4QE9 A;  1GTO A;  5EYP B;  4L87 A;  5EC2 C;  2PTM A;  4FLV A;  3A2F A;  2P7T C;  4RUF A;  3D36 A;  1ZAU A;  4PJ0 Z;  3A0B Z;  5CA1 B;  1KU9 A;  1XRE A;  5A2Q N;  2UU9 B;  5H6Q A;  1Q7Y W;  5JVD B;  3BVO A;  2ETN A;  2G38 A;  4X65 B;  2FTK A;  3U0Z A;  3GB7 C;  2R70 A;  2YS8 A;  4O4H B;  2M6Y A;  1B06 A;  1S5J A;  2M7W A;  5KA6 A;  4AQY B;  3CRA A;  4FPP A;  3OFN G;  2XND G;  2LGQ A;  4FLW A;  1JVM A;  1KQS U;  4GUN A;  1SQF A;  1Q81 W;  4X20 A;  1QR9 A;  3JAM N;  4PA4 A;  2BE3 A;  2QJ1 A;  1IUR A;  2BTQ A;  1XMQ O;  2WLH A;  4X1K B;  2GSM B;  3G6E V;  2QM4 A;  3CCV V;  5IYZ B;  2QWQ B;  3A0H Z;  4I0X A;  4JI6 O;  2CTW A;  3AK3 A;  3B77 A;  2OCC C;  2DWE C;  4I4T B;  4PD4 F;  2F43 G;  4YHH B;  1R3J C;  3R65 A;  4QPK A;  4JZG A;  2RNB A;  1W0J G;  5AG2 A;  1R1B A;  4F6R A;  1M56 C;  3K5N A;  4MS2 A;  2XAQ A;  1H2G A;  2CGN A;  4DV6 O;  2EIL C;  2ZM6 B;  1AJN A;  2CTP A;  2IJI A;  1JR9 A;  4KHP O;  3X2Q B;  3HPL C;  1KBH A;  4JI3 B;  3SPH A;  3JAK B;  3OE7 G;  4I9W A;  3H9V A;  1IBL O;  4X62 B;  4WBN B;  1BHA A;  4OPA A;  3ZRX A;  5KX5 B;  3ZHR A;  3ZMT A;  3D3Q A;  1DTO A;  2IJJ A;  2HEP A;  1EBO A;  1NKD A;  1AR5 A;  4UVC A;  2CH7 B;  2WA4 A;  4OPH A;  1ZLZ A;  1BMF G;  1PP9 H;  4XDK A;  5K1P A;  5DEC A;  2WAM A;  1S5H C;  1XMQ B;  1ZUQ A;  4BW9 A;  3OEH G;  4JI6 B;  4JI7 O;  1QHT A;  3U11 A;  4JYA O;  1Z2G A;  2UXC B;  3HKE A;  2XAS A;  2H3O A;  1COW G;  3KCY A;  2ODM A;  1SES A;  3JAT A;  1HNX B;  2W0F C;  3ZHT A;  3H1H H;  2H94 A;  4QPJ A;  3JAL B;  4J11 A;  4ABM A;  3ETE A;  1P49 A;  1XMO B;  3QG5 A;  4JI5 O;  1I5Y A;  4FFB A;  5L3D A;  3WB1 A;  3F5T A;  3K04 A;  3CP1 A;  2HJD A;  2ZXW B;  2DYR C;  3QO7 A;  2KB1 A;  4TT3 G;  4CH3 A;  4R50 A;  5IJ0 A;  1K5Q A;  3RYI B;  2Q7G A;  4FM2 A;  3AEI A;  4QE7 A;  3ZMZ A;  2QM8 A;  3P3P A;  3OT7 A;  4DRX A;  3JCU Z;  4TOI A;  2AZ0 A;  2Y4T A;  1US6 A;  1Q90 D;  3ABL C;  4K8Z A;  2WLJ A;  3M99 B;  2OCH A;  2VQE O;  3FYI B;  4I55 B;  4TQD A;  5LP6 B;  4JYA B;  3GWO A;  4NVP A;  1LUV A;  3P30 A;  4H13 B;  4O4J A;  2A7W A;  2F66 C;  5KMG A;  2GUZ B;  3K3W A;  3FB6 C;  1WN7 A;  3ASN C;  3BEH A;  4O4I B;  2DE0 X;  2K1E A;  3LDD A;  1OHH G;  5JH7 B;  3VQX A;  1BS3 A;  4ZI7 A;  3H1J H;  2ZE5 A;  3JCZ A;  2B1G A;  4F6E A;  4TUY B;  1AR4 A;  2YXY A;  4MVS A;  1KB9 F;  4H37 A;  3E22 A;  3TJT A;  1O9H A;  4P9O A;  4WFG A;  1NTM H;  4J80 A;  2JGD A;  3Q4H B;  2YIB D;  1P4R A;  2ZE8 A;  1QQC A;  3H1I H;  4QNH B;  4DR2 O;  5LHI A;  3APQ A;  3ZN0 A;  3K79 A;  3T1Y O;  4UV8 A;  3CS5 A;  3E8F A;  2DJV A;  3CXH F;  1R6T A;  2NN4 A;  4ZIB A;  1Q82 W;  4LWS A;  1SER A;  3WG7 B;  4NTY A;  3E2E A;  3K57 A;  4JTD B;  2EJR A;  2YXH A;  4MTX A;  2RQ6 A;  3ZHQ A;  4K35 A;  4XDJ A;  2XT9 A;  1FKA O;  1NR1 A;  3ICX A;  3UCS C;  4LFC O;  3HKD B;  2AXT Z;  2ITD C;  4LCU C;  4DR4 O;  1KC8 W;  4JI8 O;  5H6R A;  1H2S B;  2Q7H A;  5JJE B;  3FKS G;  1N0N A;  2PF4 E;  2XAG A;  3TK1 A;  4A5U B;  1FJG O;  4U3J B;  1J95 A;  3IC9 A;  3MAQ A;  2EIN C;  1Y74 B;  2QDO A;  3PJS K;  4NYK A;  4DR2 B;  5IE9 A;  3I55 V;  2X6A A;  3T1Y B;  5L3C A;  3E8H A;  1NTZ H;  4TWK A;  4WBN A;  4I9Q A;  3X2Q C;  4Z1V A;  1XBL A;  4FZ0 A;  2RN9 A;  2Y4U A;  2WLL A;  5FNV A;  3ZIA G;  4H44 B;  1QLE C;  4GKK O;  5LGT A;  1KKD A;  1Q6H A;  3B8N A;  4B3S B;  2B5U A;  5LXT A;  4FIP C;  1N0J A;  3N27 A;  4MVO A;  5FPR A;  1YZB A;  3BA9 A;  4ASU G;  1JA8 A;  3M8A A;  4WFE A;  1AR1 B;  2Q4P A;  3I5D A;  1BQ0 A;  5B5E Z;  3JAW B;  3F5W C;  5KAF Z;  1BHB A;  4X64 O;  1BSM A;  2VWK A;  4JI4 B;  2RCV A;  1Y4M A;  4MW3 A;  3ABU A;  4DR1 O;  3L75 H;  2H8P C;  4X66 B;  2QKC A;  3D8C A;  3JAL A;  1F4N A;  4HBN A;  1RP3 B;  3BHP A;  3VQY A;  4JI0 B;  4LFA B;  1TUB A;  3SPI A;  1FPO A;  2BCC H;  5D5P A;  1WA8 A;  4P30 A;  1R6N A;  1BCC H;  3S3X A;  2DOS A;  4JPR A;  2P6J A;  4K0K O;  4EFB A;  5DED A;  1GH6 A;  2NLJ C;  5LMN O;  3TCU A;  4LF6 O;  2ZE7 A;  4YIP A;  1V54 C;  3E35 A;  4X88 A;  4DV7 O;  2ZD9 A;  5IT9 N;  4O2B A;  4AHC A;  4YJ3 A;  1IXB A;  5EC1 C;  4PI0 A;  1SZX A;  5LP6 A;  5EBL C;  1B6Q A;  1MNG A;  5B1O A;  4X20 B;  1M1K W;  1JX9 A;  3JSL A;  1AJP A;  3T4D A;  2A0L A;  2VS0 A;  2OCC B;  4GYC B;  2UUC B;  3BY6 A;  5LP6 C;  2BTQ B;  3B2E E;  2UUA B;  2V1D A;  1F51 A;  3TGU H;  4I0X B;  1VQK V;  4JAA A;  5LYJ A;  1M56 B;  3LNM B;  2ZNI A;  1QBZ A;  4Q6G A;  5BXZ A;  1GM7 A;  2EIL B;  4AI8 A;  4DYL A;  4U7N A;  3N2K A;  1CP9 A;  5EIB D;  2A9H A;  4FLY A;  4ZKI A;  4F6R B;  2JK5 C;  3U10 A;  5B1N A;  1THZ A;  5LMN B;  1IBM B;  2QKS A;  2ATK C;  1KUQ A;  2QWP B;  1OCC C;  3MHS C;  3DXR A;  1XNQ O;  1K5S A;  2E3C A;  1H8H G;  3MDS A;  4HAM A;  2JGU A;  2Q9L A;  1GAX A;  3C3S A;  2YID A;  3WB0 A;  1E1R G;  3G6B A;  1LR1 A;  4PEL A;  2F93 B;  4U3F H;  1FS0 G;  3B8M A;  4MTG A;  5KA5 A;  2EIJ C;  2W6J G;  4F4L A;  2X0L A;  3STZ C;  1XNR B;  4FMT A;  1U97 A;  1HNZ O;  5CBF A;  5EZY A;  2B9Z A;  3SYO A;  1K7D A;  3HKE B;  3BRC A;  2AHZ A;  3T2M A;  3HKD A;  4B3T B;  1N33 O;  1D5N A;  5H5N A;  4DV4 O;  2ILM A;  2K9P A;  3JAT B;  5L3B A;  4YJ2 A;  3C3T A;  4JAU A;  1VF5 B;  4FLT A;  4OXS A;  3EXA A;  1WNS A;  3T4Z A;  3QVN A;  4FM1 A;  2DYS B;  1MZF A;  2JDI G;  2Y0P A;  1S72 V;  2DYR B;  1XNQ B;  1P84 F;  4UXN A;  1Y74 A;  4DK0 A;  4FFB B;  5JQG A;  3CRQ A;  1SQG A;  1FFX A;  2PYJ A;  4DR5 B;  4JI1 B;  2IBZ H;  1S77 D;  4MVM A;  2UU9 O;  2DN9 A;  2FML A;  5IJ0 B;  3ABL B;  2ZKO A;  2DW4 A;  3OGI B;  4DRX B;  5IWA B;  1K34 A;  1WP8 A;  5KUM A;  2D3O W;  4X1I A;  2F4V B;  4AQY O;  1HWY A;  3ASN B;  3DC6 A;  3AG2 B;  4PA6 A;  4DK1 A;  4O4J B;  1OJH A;  1XHX A;  2OIG A;  4PA9 A;  2PI5 A;  1B04 A;  5KMG B;  3JAR A;  5IJ9 A;  1VQ6 V;  1K4C C;  4PA3 A;  1GN3 A;  3FYE B;  3B09 A;  2HP8 A;  2ZDI C;  2YUA A;  1XUQ A;  4CH4 A;  1S76 D;  4ZI7 B;  3ABT A;  3VBB A;  4EB6 A;  1YI2 V;  1N8R W;  1D2D A;  1NH2 B;  3QNE A;  4DV3 B;  4XDL A;  3CRC A;  4I5S A;  5KHK A;  4YHH O;  3CXC U;  1ZL8 B;  4BR6 A;  5E79 Z;  1GKF A;  4MVZ A;  4UVB A;  3D36 C;  3E22 B;  3IGA C;  1XOU A;  2ZM6 O;  2JGD B;  1BE3 H;  1GM9 A;  5KHG A;  5HFM A;  1H8E G;  1NU1 H;  2AW9 A;  4JI3 O;  4LF7 B;  3ZED A;  5KHH A;  1GM8 A;  4GLX A;  4H33 A;  4ZHQ A;  4X62 O;  3ZMU A;  4UCT A;  4LWS B;  1M90 W;  1YHQ V;  5J2T A;  1Y6X A;  2XAF A;  2L6L A;  1FYJ A;  2Q0A A;  3UO2 A;  2AGA A;  2ADP A;  1SRY A;  2LJ2 A;  2VQF O;  3CB2 A;  4MVR A;  4IL6 Z;  3OTO B;  2UXD O;  1N32 B;  5L3F A;  1L0N H;  4UVA A;  1K9M W;  2UXC O;  4X89 A;  1JFF A;  1I7F A;  3CC4 V;  2EIN B;  3HKC A;  3O9O A;  4IGG A;  4IT5 A;  1X4T A;  1HNX O;  4CS3 A;  4KFM A;  3IJ4 A;  3CPW U;  5LBQ A;  1P7G A;  1XMO O;  1FD9 A;  4OX9 B;  1SS3 A;  2XAJ A;  1VP7 A;  1QLE B;  3L73 H;  1N36 O;  4E2L A;  3N2G A;  1PNM A;  1YJN V;  1K92 A;  3K58 A;  4WFF A;  2WLL B;  5FNV B;  5BZB A;  1ZWI C;  2LGW A;  1RFY A;  1NQT A;  2BTO A;  2HHH O;  5D5Q A;  1NH2 D;  2VQF B;  3ABM C;  3JYC A;  1GN4 A;  5LXT B;  3H01 A;  3T1H B;  5FL7 G;  3QTC A;  1QCE A;  3G4S V;  3DTU B;  2UXD B;  3DC5 A;  2A79 B;  2OYQ A;  2ZCE A;  1I08 A;  3K59 A;  1SKV A;  2GBO A;  5BMV A;  1P7B A;  4J9Z B;  1YSC A;  2FB5 A;  4LF5 B;  2P4K A;  3CCE V;  1MA1 A;  2LFR A;  3GVM A;  4C7U A;  3K08 A;  2PUS A;  1PM9 A;  2HG5 C;  1URF A;  1SQV H;  3ETD A;  2ZR3 A;  4G2K A;  4BIZ A;  5LHH A;  1TUB B;  1VQP V;  4FLU A;  1WA8 B;  5DN6 G;  3CCM V;  1N36 B;  4TV8 A;  2R9R B;  2DYS C;  4BW5 A;  1V54 B;  4DUY B;  3AG3 C;  3F7Y C;  5L3G A;  1FAF A;  3JAS A;  4IHJ A;  4BIU A;  3E83 A;  4PDR A;  2JEX A;  2HHH B;  1YF2 A;  1MSW D;  1YXB A;  2IM9 A;  4YXW G;  4O2B B;  4YJ3 B;  2CTR A;  2Y69 C;  5GTH Z;  3CME V;  5CBG A;  2QM7 A;  1DF4 A;  1W59 A;  4DR7 O;  3E86 A;  3CCS V;  3OMA B;  1Z5V A;  1G4Y B;  4DW0 A;  2OTL V;  4MT8 A;  4JI2 B;  4B3M B;  3AG2 C;  3LDE A;  4PV1 B;  3ETG A;  1BL8 A;  1R73 A;  2BSK A;  5C8Y A;  5LYJ B;  2JRI A;  5H9C A;  4JZ2 A;  3CCU V;  2JJ2 G;  5J9P C;  1IVS A;  3N2K B;  4GKJ B;  3APO A;  5CBH A;  1OCC B;  4KL1 A;  1ZL8 A;  3FD9 A;  2WLI A;  4QGP A;  2PYL A;  1N34 B;  4P9P A;  3AG1 C;  3ZS8 C;  4CC6 A;  5ITZ A;  3TXQ A;  3DXR B;  1N4C A;  3CHX A;  4LH6 A;  4LP8 A;  5A9G A;  4J9Y B;  3UO3 A;  2P06 A;  4HZ3 A;  5LA6 A;  3W7W A;  2EIJ B;  4DW1 A;  4NTX A;  4LF9 B;  2QWO B; 
#chains in the Genus database with same CATH homology
 1UFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...