1UFIA

Crystal structure of the dimerization domain of human cenp-b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
48
structure length
48
Chain Sequence
b'HMPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major centromere autoantigen B
publication title Crystal structure of the human centromere protein B (CENP-B) dimerization domain at 1.65-A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 48
sequence length 48
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1090 Mainly Alpha Orthogonal Bundle Helix Hairpins Dimerisation domain of CENP-B 1ufiA01
1UFIA
chains in the Genus database with same CATH superfamily
2YDEA 1PNKA 3LSUA 3QG5A 1NTKH 1HR0O 1FJGB 2MK3A 5IYZA 2M6YA 1OCCB 2AZ0A 4DUZB 4WCEV 4EB6A 1H2SB 4JYYA 4RQEA 4N21A 4BIUA 1JFFA 3FB8C 2P4VA 1W2BU 4G27B 2UUAO 2YXLA 2CTQA 4UCOA 3CEIA 3S3WA 4U3JB 4BWAA 4OX9B 4YJ3B 4EFBA 2ZXWB 3RYHB 4FLVA 4LF8B 4DUYB 4NXMO 4HZ3A 2LGWA 2IJJA 4H0LB 2KB1A 4IHJB 1COWG 3E83A 3KZIZ 4WBNA 1F4NA 1GH6A 4YIPA 4CH4A 1HNZB 5B1BB 1M5IA 4TQFA 4RQFA 1SRYA 3EXAA 1YEWA 2BSKA 2VS0A 1SQXH 4I4TA 5L3FA 4PI0A 2C2AA 2GUZA 3CHXA 4FLWA 1OCCC 1U97A 1K4DC 1F51A 1JCHA 1GTOA 1PL4A 1FFXB 2ZT9B 5KMGA 1AILA 2LO1A 3ZEDA 4KP4A 2WLJA 2AW9A 4FZ1A 2XAHA 2KG7A 2N74A 4PDMA 1PPJH 3Q4HA 3D36C 4O2BB 3K59A 4L8JA 4DR1O 2ZE5A 4PELA 2WLKA 3LUTB 3STZC 4B3SO 4DR2B 3R66A 5L3EA 3NXSA 4TWKA 2WLNA 4X64O 1K5QA 2PZSA 4O4IB 4QNHB 2ADQB 4H37A 3IAYA 4LFCO 2L6LA 4DR7O 5H6RA 4FLZA 5H2FZ 4JI3O 3IC9A 3OMAB 1K73W 4C7UA 5C93A 1FKAO 2WA4A 4FZ0A 1YF2A 4ICGA 1R1BA 4PJ0Z 2QKSA 3N2KB 5JCOC 3O65A 2JS3A 4FIPC 1RM1C 1SQGA 2BTQB 1S3JA 4TSFG 4FMTA 4X62B 3LDCA 4LF5B 4PV1B 2BTOA 1XREA 3ASOB 4JF3A 4F6RA 3IFXA 2B1GA 4MVQA 4BW9A 1K92A 1MG1A 1EN5A 4J7ZA 1YSCA 3ABKC 1HNXO 5FL7G 5CB4A 2A06H 2Q67A 1NS1A 1DGSA 1R3JC 3CCLV 1KBHA 3U10A 2CTPA 4JZGA 5KHHA 3G6EV 3U11A 1IX9A 4DR6O 4O4HA 2DMXA 5JH7B 2LQTA 1JVMA 2EZPA 3SYCA 1VQNV 2YC0A 4WFGA 3ZBHA 2ARHA 2Q69A 4CS3A 3ABUA 5IJ0A 2Z0AA 4LC1A 3BRCA 1WLEA 4D6TH 1KECA 4B3RO 3OMNB 3HR0A 3BAAA 4AI8A 1TAEA 4K0KO 3ASOC 4KFMA 2G38A 2E3CA 4DXWA 4U7OA 1XMOO 3IGAC 4RUEA 3SYOA 1CXZB 4QGPA 4MTFA 4GX5A 2IJHA 2UUBB 3CCMV 2UXDB 4MTGA 3OW2U 1P4RA 1IBKO 4JASA 2EBOA 2KSDA 3DXRB 4K8XA 3FAVB 3JAKB 3H1HH 3QO5A 2WWWA 4PA4A 3ZHRA 1SZTA 4JI7B 1AR1B 2ETNA 2QTOA 3P3PA 4PDRA 2LFSA 3CD6V 4J9ZB 1UPGA 1G6UA 4TV9B 1GK9A 1K8AW 3EHBB 1EZVH 3BPZA 5J9PC 3CWBH 5CA0A 4FM0A 1FD9A 4P9PA 4UB8Z 1K7DA 1SQFA 1NBMG 1R73A 2ZQMA 2WA3A 4LF9O 1KUQA 1Q6HA 1TUBA 4JYCA 2F66C 4DR3B 1GN6A 2ATKC 2DE0X 4RWUA 4Z1MG 1QHTA 4LBEC 4FFBA 5CBFA 1XUQA 5IYZB 4DV6B 2V7QG 4NVPA 4EB6B 1QLEC 1BHBA 4DW1A 2P7TC 3WG7C 5EYPA 3RYFB 2ITCC 3O9OA 3SPCA 1FS0G 2Q7GA 1VQ4V 3BEHA 4YJ2A 1H2MA 5LMUB 4MVMA 3OTOB 3J81N 1P49A 2A7WA 4E4EA 5BR8O 1BGYH 2YIDA 3FB7C 3D36A 1VQ9V 4ZOLA 4NTXA 4CC6A 2GBOA 2P6JA 3SPGA 1Y67A 3H1JH 3OGCC 2ZKOA 3X2QB 2JDIG 1ZL8A 4YY3B 4X8AA 4MVRA 1YJ9V 4MVOA 1NU1H 2LJ2A 2BSKB 4IGGA 3B8MA 3D3IA 3QF7A 2H8PC 4I4TB 5H5NA 2R9IA 2OCHA 2NNUA 3L70H 2YICA 5CBHA 1PNLA 3OGIB 1SQPH 4DK0A 1VP7A 3JAMN 2XAGA 2CUGA 4HYOA 2ZM6O 1RP3B 4QE9A 2IH3C 4IIJA 2GV9A 4UCSA 4I9WA 5KMGB 1B06A 4NR1A 4RO2A 4X66O 5JCOA 2PGGA 5IYBO 2KG7B 3D3QA 1RPRA 1I94B 2QJ1A 2QWNB 4FJCC 3CXCU 4FLXA 1NI8A 3JCUZ 1OCRC 3N27A 4WFAV 4IYHA 3MHHC 3M7MX 3Q4HB 3JARA 3RVZA 2HJFC 2E75B 4DV1B 1Q82W 2ZD9A 4WF9V 2ZINA 5JJNB 1S77D 3GWOA 3OM3B 4O2BA 5KA5A 1HR0B 1B3QA 2RNBA 3T1HB 2UXCO 3CCQV 3CCEV 5BMVA 4FFKA 2Y0PA 1GO3F 3K08A 1KKDA 1Y76A 5K1XA 4X20A 1JMKC 3SPHA 3SYAA 4LCUC 2UUAB 4X89A 2M7WA 1E1RG 2B5UA 1VQKV 3AG3C 3D8CA 2QGNA 4Z1VA 2EILB 4NXMB 1BCCH 5AG2A 4DV2O 1FAFA 4DRXB 4F6RB 1NKDA 5J2TA 4GX1A 2Q8VA 3JD0A 1YTFD 2XT9A 5CB4B 3SR2C 3F5WC 2B9ZA 1AR5A 1M56B 4GKJO 4LNUA 2JEXA 1I5XA 1MOFA 2Q4PA 2VWKA 2OCCB 3DC6A 4LF6B 2X6BA 2DYRC 1IVSA 1ZUQA 3K5MA 1PKXA 5KUMA 1AP6A 5DN6G 3L9DA 5CMUA 5D5QA 4O4HB 5B3SC 3FYIB 1XNQO 4DV0O 1L8DA 4JI5B 5IWAO 2JK5C 4LF4O 4Z2WA 1XOUA 1NQTA 5BY1A 1DTOA 3AK2A 3RVYA 2QSAA 1YTFB 4Q6GA 2QKCA 4A5UB 5IJ0B 4LF7O 2OTLV 4GT1A 5LYJA 3UQ8A 1S76D 3RWRD 1IBLO 3MHSC 2JJ1G 4JTAB 3E8BA 3LSSA 4B3SB 3ETGA 2PF4E 1S5HC 1AR4A 3LSQA 2EIKB 5B1OA 2F1MA 3WB0A 1KU9A 1KYOF 1EM1A 4MW3A 4TOIA 3ZS8C 3E2EA 4JI4O 3ZRSA 1B04A 2OCCC 4OXSA 3OD4A 4JI3B 1PD3A 2QM4A 4Q20A 1YDXA 1RSOB 4DR4O 4MSWC 3JD4A 3K57A 1BS3A 1VQMV 4H44B 3DTUB 3L75H 1CEZA 2IM9A 4DO2A 1N4CA 1KP3A 4H13B 3CCJV 2BOBC 4YHHO 1I5YA 1I08A 1H2GA 5CA0B 1A32A 4TV9A 4NKGB 3JCZA 3TJTA 4WFEA 5LOVA 3K79A 4YIOA 5FNVA 1TUBB 2Q7HA 4MT8A 3CYOA 2EIKC 4FFBB 4CZZA 1GM7A 2XAFA 5LGUA 3OAAG 3QVNA 2FMLA 5L3BA 3SJQC 5L3CA 3B09A 3N2GA 1F23A 3JSLA 2EJRA 4MVUA 3ABMC 5EYPB 4JYAO 3BCCH 2VQFB 1VF6C 4JV5O 1OHHG 3K0DA 3RYFA 4B3MB 1Q86W 4MW8A 2XNDG 4YJ2B 4I5SA 4JTCB 1M4UA 3OR7C 3ETEA 2K1EA 4DR5B 3K9SA 3CCSV 1RPOA 5E79Z 3ML0A 5F2VO 4XDJA 4ZOLB 4PDVA 2AXTZ 3KKYA 2ZIMA 5IY5C 1ZL8B 2F23A 4JI8O 1WB7A 1BZKA 3STLC 4R8CA 4B7KA 4JI2B 2QM7A 4FLUA 3I55V 3CB2A 2QEXV 2JGUA 1IBMB 4JI0O 4TUYA 1AI6A 1QU7A 1US6A 1SERA 4IIJB 2LFRA 3VQXA 5J2UA 3FFQA 3P30A 3JASA 2WLHA 4P9OA 5TISZ 1K3EA 4AQYO 1RM1B 1VQ7V 3UM7A 3FD9A 1HW7A 4DV4O 2LP7A 3CXHF 3JARB 1S72V 4KHPO 4LF9B 2EJ7A 3ABKB 1AB3A 4DV7B 3QTCA 3T2MA 1MA1A 2IU3A 1WP8A 2F43G 3ZHSA 5BMVB 4QJFB 5DM6V 4JI6O 1Y76B 4X20B 2Y4UA 1XL6A 1P7GA 2VRZA 1JQ0A 2JJ2G 1WAZA 1CP9A 1N32B 3LNNA 2QWQB 3C90A 1QVGU 5L3GA 5JJEB 1FFTB 3CRMA 3GWKC 2VQEB 1N8RW 4JI1B 3FKSG 4JAAA 1X4TA 2X0LA 4J10A 5J2TB 4N23A 1UJWB 4DRXA 2GSMB 5JVDA 1HNWB 3DC5A 5KLVH 4DK1A 4J80A 2IW5A 1GN4A 4LWSA 5LMNB 4LNUB 1BSMA 2W6JG 3ETDA 4NTYA 2X6AA 3EFFK 2FYUH 4R7CA 1AVMA 5GONA 1XEQA 5CA1A 4FLYA 2HHHO 1OCZB 2Y48A 3AG1C 3AK1A 3CCVV 5B66Z 2HLDG 4CH5A 2H3OA 3CPWU 1N34O 1MSDA 2R9AA 1NVPD 2E5LO 3BY6A 1JPXA 2QWOB 3CX5F 1Z5VA 2X6CA 3CRAA 1JR9A 1PNMA 3KCYA 5LYJB 4I55B 5IYCO 3CP1A 3LDEA 3SJBC 1QR8A 1XBLA 4I0XA 4UVBA 1FJGO 1Q6UA 1PL0A 3FYEB 2EIMB 3OR6C 1TVKA 3J80N 2UXCB 3LNMB 1VQ8V 3W7XA 2OIEA 3BVOA 1Q81W 3T4DA 1W0JG 5EK0A 1HDJA 3ZJZA 3OE7G 3E89A 2UU9B 4OX9O 1NVPB 4QPJA 1M93A 1L0NH 1QLEB 1SA0A 1ZSPA 3WFVA 3MAQA 2JIZG 4DUYO 4LF8O 1OCZC 4DV5B 2F4VO 3WG7B 3T1YB 3AG4C 3WB2A 5GTIZ 1RSOA 3E86A 1R3KC 3RGBA 2BOCC 1G1XB 4PA9A 5KHJA 4ZI7A 1VF6A 4DV2B 1Q8IA 5B1AC 2JVDA 3ZX6A 1P84F 5HFLA 4JPRA 4HNAA 1HNZO 5KHKA 2AGAA 4WFFA 1G4YB 4J7KA 1S5JA 1K9MW 2JRIA 4IL6Z 2HG5C 1K34A 3M8AA 4GKJB 3AG7A 3CJHA 2EIMC 3ZHTA 4DV3B 5LOVB 2CE4A 5FNVB 3S3XA 4FK5C 2CGOA 3P32A 3I56V 2EX3A 2EULA 1Y4MA 3C3TA 2Y0IA 2FL4A 3CRCA 4PI2A 2WLIA 2GTAA 1N36B 4NXNB 4G2KA 3N2GB 5EC1C 4WFHA 2LGQA 1IURA 4X88A 1NTMH 3LDDA 2IH1C 4O4JA 4GYCB 2EIJB 4O4LA 2W0XA 3TCUA 2A3QA 2JS5A 3BHPA 1JX9A 1YVWA 3FB5C 4DR2O 3ZN1A 5EIBC 1QR9A 3BFRA 2P22C 1OCRB 4CBCA 4XBFA 3KG2A 5JJJB 2ZE7A 3AG2C 3ASNC 1YXBA 1H2NA 3A0RA 3VOUA 1YI2V 2GDSA 4LFBB 1MZEA 1VQLV 2BE3A 3F5TA 4UCVA 2H94A 2D2CB 3UO2A 2NLJC 1FXKC 4YXWG 2DW4A 1R3IC 3TXQA 5B1NA 1D2DA 1SESA 1W59A 4TUYB 1XNRO 4X62O 2ZR3A 4EFEA 5J2UB 3RYIA 1GKFA 3AG3B 5IYDO 1Q90D 2QKAA 4GUNA 2UXBB 3JASB 1DLBA 3QNEA 2K9PA 4E2LA 2UUCB 1V55C 2YI8A 3I5DA 2PY5A 1DF5A 1URFA 2EIJC 4GKKB 1KKCA 1XMQB 4ZBMA 2XTAA 2DYSC 4NYKA 1LUWA 4X65B 1U96A 2OTJV 4MS2A 1F4MA 1LUVA 4UUJC 4X1IB 2E76B 2EZOA 3FX7A 1JOYA 3K06A 4FLTA 2DYRB 4X1YA 3JALA 1NH2B 1VEWA 2DWEC 5B3SB 2RDCA 3CC4V 3W7SA 1NZ6A 3DGEA 3K03A 5IE9A 5GW7A 3E35A 1MMMA 2YIBA 4JYAB 3THOA 1M9NA 5EZYA 3L71H 4JZ2A 1VF7A 1FYJA 3VQYA 2ILMA 3RYCA 1G8MA 1LR1A 5EBWC 4LP8A 5FLXN 1L1FA 2ADPA 2YEVB 5JVDB 4BR6A 2UUBO 5LBQA 2PUSA 3K3WA 2KKWA 4PHZA 3H1KH 1AJQA 5IT9N 2UXDO 1VQ5V 4LWSB 5BXZA 3CMEV 1MZFA 2AZ2A 2X7RB 1DK1A 1B6QA 4KUMA 2ZE8A 3NR7A 3G67A 5GONB 1YZBA 3ICXA 1FXHA 2OWOA 4JI7O 1VMGA 5CA1B 4QIWF 3G80A 3G4SV 3UKMA 3H01A 3CC7V 1H8EG 3FB6C 1SC5B 3CRRA 4IT5A 1OV9A 2BCCH 1SZXA 2FKXA 1GN2A 1BQ0A 4JGSA 3ZMZA 3ZHVA 4NB5A 2N04A 1EFRG 2XHBA 3G71V 3TK1A 4QPKA 4JTDB 1OJHA 4KHPB 4I0XB 4DR3O 1N33O 4BIZA 2DOSA 4I55A 1TVKB 4DYLA 2YXYA 4DR1B 3AK3A 1H2KA 1H38A 2CGNA 4JI6B 4RUFA 5JQGA 4X64B 3AEIA 1Q7YW 2CH7A 4EKWA 2P06A 3PN1A 4PA3A 4ZHQA 5GTHZ 3OEHG 2IJKA 4LFCB 1WJZA 2FTKA 4FM2A 2O57A 3ZRVA 1SA0B 4DR7B 2ZIOA 3A8TA 2Y69B 3A2FA 5LMUO 3ABMB 3OTOO 3HKDA 2HVKC 3RT3C 4ZI7B 1KD1W 3VQVA 5C8YA 4LFAO 2YSUB 3K58A 3UT5B 1I7FA 4HNAB 1OZ0A 2CAZC 2CK3G 4YY3O 2YI9A 2DQ0A 4UXNA 4CH3A 1V9PA 3HKBB 4B3TO 1GM9A 5LP6C 1JJOA 2EINC 3CJHB 1HNXB 5FPRA 2JGDA 3BA9A 2AHYA 5IY5B 3UCSC 2DJVA 5CBGA 3ZMSA 1FXKA 3ABLC 1NJIW 4HAMA 4UCUA 3UO3A 1LNQA 3K9AA 1THZA 1Z2GA 2WLIB 3OEEG 4DR6B 4HBNA 3JAWB 3CRQA 1S0VA 1X59A 3PJSK 4O4JB 3OT7A 3L74H 2Y69C 2E5LB 4O4LB 2XAJA 4DV1O 1Y66A 3CSXA 4GZRB 3SYPA 2RMKB 5LHGA 2WLLB 2HR3A 4D7SA 5IJ9A 3OUFA 5HFMA 5KAFZ 1VARA 3T1HO 3HKCA 4B3RB 1T5EA 2D3OW 1JA8A 2DWDC 3ZCCA 1NTZH 4G28B 4K0KB 3ETQA 3RW0A 4AHCA 3CCUV 3M99B 1XMOB 1QNMA 1Y6XA 1K33A 5H6QA 3CE2A 2Q0AA 3K5LA 4EEQA 3K04A 3OUSA 1M57C 1M1KW 2HP8A 4J9YB 4BIOA 2RJZA 1IBKB 2F4VB 1IZ3A 3RYIB 4J11A 1JJ2U 3P3NA 5EBLC 4GX2A 2CDYA 2WAMA 1PM9A 2QTSA 4ZIBA 4J41A 2YIBD 3BABA 4FVMA 3E22A 4LF6O 1TUEB 5A2QN 2A0LA 2PI4A 1GRJA 4LR3A 1SS3A 4UV8A 5LA6B 1ENVA 2P90A 3IC7A 3ZRWB 1MSWD 2LW7A 4F4LA 2P4KA 5LGNA 2E74B 4X1IA 4JI5O 3B8NA 5LHHA 2RQ6A 3B4SA 4X1YB 3JALB 2RN9A 1O9GA 2ZXWC 3AG1B 2Q68A 1EZJA 3DSQA 2CTRA 2VWJA 5KX5A 5EZYB 5KUKA 3VQWA 4DW0A 3MDSA 3APQA 2AHZA 4P2ZA 4KXRA 2Q9LA 2R72A 1KMIZ 2MW2B 2NN4A 3RYCB 2F95B 2ZDIC 3OTFA 3HKEA 3H1IH 1YHQV 5B1BC 4JAVA 4X1KA 5BR8B 2V1DA 3GB7C 1AI5A 4TQDA 4K3AA 1ZX3A 1PP9H 3SJCC 2YEVA 3TGUH 2Z5UA 4CS4A 1F7YA 3K5OA 1WPXA 4QE7A 1KQSU 4TV8A 4UFZA 1XNRB 3ZIAG 1HWYA 1OCOB 1QQCA 4U7NA 2HVJC 3SJAC 2KQXA 1E79G 2L35A 2PI5A 2ZM6B 3W7TA 1WPBA 1K97A 1Y74A 2Z3YA 4I9QA 3AG4B 2Q73A 2V4DA 1ORQC 4MTXA 3G6BA 3CMAV 4X66B 4X9QA 2DQ3A 5B1AB 1ZAUA 2HJDA 1YIJV 1J5EO 4RAIA 2Q7EA 1NR1A 3K0GA 4ASUG 3A0HZ 5LHIA 1R6KA 1BT8A 5LP6A 3ZMUA 5D5PA 3JATB 5KAIZ 5ITZA 3QO7A 5A9GA 5EIBD 4DUZO 5JQGB 1Z5WA 2CH7B 3SDLA 4UVAA 4GLXA 2VQFO 1BMFG 4I50B 3SGIA 4ZHQB 4B7EA 1WA8A 4B3MO 1OCOC 4CS2A 1VQ6V 1VQOV 1BL8A 2ZE6A 4PDLA 4OPHA 2PTMA 2QA4V 3HKDB 4DR5O 2IU0A 3T1CA 4GCZA 1Q5OA 1QVFU 5C8YB 2Y4TA 1YCIA 3KCXA 4J7JA 1R3LC 1N0NA 1QBZA 4GX0A 1HP8A 1IXBA 4KL1A 3EVKA 1XI1A 3UT5A 2YUAA 5DECA 1XL4A 2W6IG 4L87A 3AG2B 3ASNB 3ZRXA 4JI2O 1AJNA 2P67A 1H8HG 1K5SA 1S5LZ 3HKBA 3QO8A 3ZHQA 2JGDB 1IBMO 2FB5A 1WN7A 4ABMA 1FXKB 3OFNG 1BE3H 1SQQH 2N05A 3ZMTA 1H2LA 3CS5A 2RCVA 2CTWA 5FPOA 1XNQB 4DV0B 1DF4A 5LXTB 3E8FA 1MNGA 4B08A 5IWAB 5LGTA 3JAWA 4LF4B 5L3DA 1M90W 3JYCA 2R70A 4JAUA 1V55B 5BZBA 4CC5A 4DV7O 4UCRA 5IJ9B 1TA8A 2QE7G 3SPJA 4LF7B 1N33B 4IYIA 4O2AA 2DYSB 1VQPV 2WPDG 2WLLA 1Q6IA 2ZCEA 3HKCB 4XDKA 1IBLB 5EC2C 3A0BZ 4H33A 4W4KA 2YXHA 1JFFB 1AJPA 4OPAA 4R50A 3ZMVA 1I0HA 2DN9A 2QWRB 3F7VC 1N32O 2YS8A 4JI4B 5CN0A 4F6EA 4U3JA 4YJ3A 5DEDA 3B77A 3RYHA 1XDCA 2IBZH 4CH6A 2VQEO 4JI1O 3RBZA 5LL6Y 3B2EE 3K5NA 2UXXA 1V54B 4DR4B 4WBNB 4LFAB 2HEPA 4LF5O 1HNWO 1IDSA 3W7UA 1AROP 4IHJA 1BHAA 2P5OA 1D5AA 2XOKG 4FM1A 1NH2D 3U0ZA 2A9HA 5LMNO 2GHYA 3JD3A 2ZDIA 4YHHB 4B3TB 2HKOA 3E22B 2IJIA 3ZN0A 3H9VA 3MD0A 1MABG 2GUZB 1YJWV 5IDJA 3TETA 1YITV 4FPPA 4MTOA 1W0KG 3R65A 3E8GA 3ABTA 5LA6A 2UXNA 3ZRWA 4ZKIA 5KHIA 2XAQA 1FFXA 3L72H 1XILA 4BAYA 1GMGA 2WSSG 1NT2B 1ZWIC 5KX5B 3B40A 3WB1A 1TGOA 1PV0A 1KC8W 1V54C 2XUMA 4JV5B 2QM8A 3IJ4A 2PYLA 4WFBV 3HKEB 4UVCA 1QCEA 3X2QC 2Q0OC 1FPOA 4X1KB 3H1LH 2R9RB 4O4IA 1WB8A 2ZNJA 1VIBA 1L0LH 2UU9O 3CCRV 4JI8B 2PYJA 2NR5A 4DV5O 4TV8B 1EN4A 2A79B 3T1YO 1YJNV 4I7ZB 4R6ZA 4UB6Z 5K1PA 4W4LA 3CC2V 3N2KA 3VBBA 4JI0B 2BTQA 3W7WA 3JD1A 1R6TA 1K4CC 1AI7A 1Y74B 1SETA 2OYQA 2YIAA 4MVSA 1KB9F 1FXVA 1BQZA 3BA8A 4AQYB 1WP7A 1XHZA 2JEUA 4PA6A 4DV3O 2B1IA 3F7YC 1AI4A 3RFRA 4U3FH 2Q6AA 4DV4B 1SKVA 3GVMA 1EBOA 2QR4A 5LP6B 1SF9A 2W0FC 2EINB 3HB3B 5ITZB 3E8HA 4UCTA 4DV6O 5EBMC 1N36O 4NXNO 4AILC 5B5EZ 5JH7A 2OT5A 4NTWA 3ABLB 3JATA 1VF5B 3C3SA 4LH6A 1RFYA 2ZR2A 4PA7A 1AP5A 3J7AU 3SYQA 4P30A 1ZLZA 2QWPB 2F93B 3OMIB 2EILC 1E1QG 1WA8B 4LH7A 5H9CA 4I50A 1O9HA 4XDLA 1NR7A 1GAXA 4UV9A 1N0JA 1XHXA 2HFEC 4PD4F 4K8ZA 4LFBO 4K35A 1GM8A 2ZNIA 2Q5ZA 1XQ8A 1QLNA 1M56C 1SQVH 5E1AC 1ROPA 2GTSA 1GN3A 3APOA 3HPLC 4OGQB 1EN6A 1SQBH 4MVZA 1IXMA 1J95A 4TT3G 3DXRA 3FAVA 3ZHUA 2UXBO 3JAKA 1M57B 3L73H 3T4ZA 1UFIA 1ZTEA 3JD2A 5JWPA 2UUCO 2ITDC 3SPIA 2OIGA 4J42A 2HHHB 4GKKO 1R6NA 1KP2A 2WLMA 4BW5A 1XMQO 3RN4A 1P7BA 1I94O 2LW1A 3JSNA 1WNSA 5LXTA 5CA3A 1N34B 3WU2Z 3TXSA 4X65O 1Q3EA 1Q43A 1D5NA 2XASA 1CPYA 4JYBA 5KA6A 4D7TA 1J5EB 2ODMA 5KHGA 2QDOA 4O2AB
chains in the Genus database with same CATH topology
1UFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFI A; 
#chains in the Genus database with same CATH topology
 2YDE A;  1PNK A;  3LSU A;  3QG5 A;  1NTK H;  1HR0 O;  1FJG B;  2MK3 A;  5IYZ A;  2M6Y A;  1OCC B;  2AZ0 A;  4DUZ B;  4WCE V;  4EB6 A;  1H2S B;  4JYY A;  4RQE A;  4N21 A;  4BIU A;  1JFF A;  3FB8 C;  2P4V A;  1W2B U;  4G27 B;  2UUA O;  2YXL A;  2CTQ A;  4UCO A;  3CEI A;  3S3W A;  4U3J B;  4BWA A;  4OX9 B;  4YJ3 B;  4EFB A;  2ZXW B;  3RYH B;  4FLV A;  4LF8 B;  4DUY B;  4NXM O;  4HZ3 A;  2LGW A;  2IJJ A;  4H0L B;  2KB1 A;  4IHJ B;  1COW G;  3E83 A;  3KZI Z;  4WBN A;  1F4N A;  1GH6 A;  4YIP A;  4CH4 A;  1HNZ B;  5B1B B;  1M5I A;  4TQF A;  4RQF A;  1SRY A;  3EXA A;  1YEW A;  2BSK A;  2VS0 A;  1SQX H;  4I4T A;  5L3F A;  4PI0 A;  2C2A A;  2GUZ A;  3CHX A;  4FLW A;  1OCC C;  1U97 A;  1K4D C;  1F51 A;  1JCH A;  1GTO A;  1PL4 A;  1FFX B;  2ZT9 B;  5KMG A;  1AIL A;  2LO1 A;  3ZED A;  4KP4 A;  2WLJ A;  2AW9 A;  4FZ1 A;  2XAH A;  2KG7 A;  2N74 A;  4PDM A;  1PPJ H;  3Q4H A;  3D36 C;  4O2B B;  3K59 A;  4L8J A;  4DR1 O;  2ZE5 A;  4PEL A;  2WLK A;  3LUT B;  3STZ C;  4B3S O;  4DR2 B;  3R66 A;  5L3E A;  3NXS A;  4TWK A;  2WLN A;  4X64 O;  1K5Q A;  2PZS A;  4O4I B;  4QNH B;  2ADQ B;  4H37 A;  3IAY A;  4LFC O;  2L6L A;  4DR7 O;  5H6R A;  4FLZ A;  5H2F Z;  4JI3 O;  3IC9 A;  3OMA B;  1K73 W;  4C7U A;  5C93 A;  1FKA O;  2WA4 A;  4FZ0 A;  1YF2 A;  4ICG A;  1R1B A;  4PJ0 Z;  2QKS A;  3N2K B;  5JCO C;  3O65 A;  2JS3 A;  4FIP C;  1RM1 C;  1SQG A;  2BTQ B;  1S3J A;  4TSF G;  4FMT A;  4X62 B;  3LDC A;  4LF5 B;  4PV1 B;  2BTO A;  1XRE A;  3ASO B;  4JF3 A;  4F6R A;  3IFX A;  2B1G A;  4MVQ A;  4BW9 A;  1K92 A;  1MG1 A;  1EN5 A;  4J7Z A;  1YSC A;  3ABK C;  1HNX O;  5FL7 G;  5CB4 A;  2A06 H;  2Q67 A;  1NS1 A;  1DGS A;  1R3J C;  3CCL V;  1KBH A;  3U10 A;  2CTP A;  4JZG A;  5KHH A;  3G6E V;  3U11 A;  1IX9 A;  4DR6 O;  4O4H A;  2DMX A;  5JH7 B;  2LQT A;  1JVM A;  2EZP A;  3SYC A;  1VQN V;  2YC0 A;  4WFG A;  3ZBH A;  2ARH A;  2Q69 A;  4CS3 A;  3ABU A;  5IJ0 A;  2Z0A A;  4LC1 A;  3BRC A;  1WLE A;  4D6T H;  1KEC A;  4B3R O;  3OMN B;  3HR0 A;  3BAA A;  4AI8 A;  1TAE A;  4K0K O;  3ASO C;  4KFM A;  2G38 A;  2E3C A;  4DXW A;  4U7O A;  1XMO O;  3IGA C;  4RUE A;  3SYO A;  1CXZ B;  4QGP A;  4MTF A;  4GX5 A;  2IJH A;  2UUB B;  3CCM V;  2UXD B;  4MTG A;  3OW2 U;  1P4R A;  1IBK O;  4JAS A;  2EBO A;  2KSD A;  3DXR B;  4K8X A;  3FAV B;  3JAK B;  3H1H H;  3QO5 A;  2WWW A;  4PA4 A;  3ZHR A;  1SZT A;  4JI7 B;  1AR1 B;  2ETN A;  2QTO A;  3P3P A;  4PDR A;  2LFS A;  3CD6 V;  4J9Z B;  1UPG A;  1G6U A;  4TV9 B;  1GK9 A;  1K8A W;  3EHB B;  1EZV H;  3BPZ A;  5J9P C;  3CWB H;  5CA0 A;  4FM0 A;  1FD9 A;  4P9P A;  4UB8 Z;  1K7D A;  1SQF A;  1NBM G;  1R73 A;  2ZQM A;  2WA3 A;  4LF9 O;  1KUQ A;  1Q6H A;  1TUB A;  4JYC A;  2F66 C;  4DR3 B;  1GN6 A;  2ATK C;  2DE0 X;  4RWU A;  4Z1M G;  1QHT A;  4LBE C;  4FFB A;  5CBF A;  1XUQ A;  5IYZ B;  4DV6 B;  2V7Q G;  4NVP A;  4EB6 B;  1QLE C;  1BHB A;  4DW1 A;  2P7T C;  3WG7 C;  5EYP A;  3RYF B;  2ITC C;  3O9O A;  3SPC A;  1FS0 G;  2Q7G A;  1VQ4 V;  3BEH A;  4YJ2 A;  1H2M A;  5LMU B;  4MVM A;  3OTO B;  3J81 N;  1P49 A;  2A7W A;  4E4E A;  5BR8 O;  1BGY H;  2YID A;  3FB7 C;  3D36 A;  1VQ9 V;  4ZOL A;  4NTX A;  4CC6 A;  2GBO A;  2P6J A;  3SPG A;  1Y67 A;  3H1J H;  3OGC C;  2ZKO A;  3X2Q B;  2JDI G;  1ZL8 A;  4YY3 B;  4X8A A;  4MVR A;  1YJ9 V;  4MVO A;  1NU1 H;  2LJ2 A;  2BSK B;  4IGG A;  3B8M A;  3D3I A;  3QF7 A;  2H8P C;  4I4T B;  5H5N A;  2R9I A;  2OCH A;  2NNU A;  3L70 H;  2YIC A;  5CBH A;  1PNL A;  3OGI B;  1SQP H;  4DK0 A;  1VP7 A;  3JAM N;  2XAG A;  2CUG A;  4HYO A;  2ZM6 O;  1RP3 B;  4QE9 A;  2IH3 C;  4IIJ A;  2GV9 A;  4UCS A;  4I9W A;  5KMG B;  1B06 A;  4NR1 A;  4RO2 A;  4X66 O;  5JCO A;  2PGG A;  5IYB O;  2KG7 B;  3D3Q A;  1RPR A;  1I94 B;  2QJ1 A;  2QWN B;  4FJC C;  3CXC U;  4FLX A;  1NI8 A;  3JCU Z;  1OCR C;  3N27 A;  4WFA V;  4IYH A;  3MHH C;  3M7M X;  3Q4H B;  3JAR A;  3RVZ A;  2HJF C;  2E75 B;  4DV1 B;  1Q82 W;  2ZD9 A;  4WF9 V;  2ZIN A;  5JJN B;  1S77 D;  3GWO A;  3OM3 B;  4O2B A;  5KA5 A;  1HR0 B;  1B3Q A;  2RNB A;  3T1H B;  2UXC O;  3CCQ V;  3CCE V;  5BMV A;  4FFK A;  2Y0P A;  1GO3 F;  3K08 A;  1KKD A;  1Y76 A;  5K1X A;  4X20 A;  1JMK C;  3SPH A;  3SYA A;  4LCU C;  2UUA B;  4X89 A;  2M7W A;  1E1R G;  2B5U A;  1VQK V;  3AG3 C;  3D8C A;  2QGN A;  4Z1V A;  2EIL B;  4NXM B;  1BCC H;  5AG2 A;  4DV2 O;  1FAF A;  4DRX B;  4F6R B;  1NKD A;  5J2T A;  4GX1 A;  2Q8V A;  3JD0 A;  1YTF D;  2XT9 A;  5CB4 B;  3SR2 C;  3F5W C;  2B9Z A;  1AR5 A;  1M56 B;  4GKJ O;  4LNU A;  2JEX A;  1I5X A;  1MOF A;  2Q4P A;  2VWK A;  2OCC B;  3DC6 A;  4LF6 B;  2X6B A;  2DYR C;  1IVS A;  1ZUQ A;  3K5M A;  1PKX A;  5KUM A;  1AP6 A;  5DN6 G;  3L9D A;  5CMU A;  5D5Q A;  4O4H B;  5B3S C;  3FYI B;  1XNQ O;  4DV0 O;  1L8D A;  4JI5 B;  5IWA O;  2JK5 C;  4LF4 O;  4Z2W A;  1XOU A;  1NQT A;  5BY1 A;  1DTO A;  3AK2 A;  3RVY A;  2QSA A;  1YTF B;  4Q6G A;  2QKC A;  4A5U B;  5IJ0 B;  4LF7 O;  2OTL V;  4GT1 A;  5LYJ A;  3UQ8 A;  1S76 D;  3RWR D;  1IBL O;  3MHS C;  2JJ1 G;  4JTA B;  3E8B A;  3LSS A;  4B3S B;  3ETG A;  2PF4 E;  1S5H C;  1AR4 A;  3LSQ A;  2EIK B;  5B1O A;  2F1M A;  3WB0 A;  1KU9 A;  1KYO F;  1EM1 A;  4MW3 A;  4TOI A;  3ZS8 C;  3E2E A;  4JI4 O;  3ZRS A;  1B04 A;  2OCC C;  4OXS A;  3OD4 A;  4JI3 B;  1PD3 A;  2QM4 A;  4Q20 A;  1YDX A;  1RSO B;  4DR4 O;  4MSW C;  3JD4 A;  3K57 A;  1BS3 A;  1VQM V;  4H44 B;  3DTU B;  3L75 H;  1CEZ A;  2IM9 A;  4DO2 A;  1N4C A;  1KP3 A;  4H13 B;  3CCJ V;  2BOB C;  4YHH O;  1I5Y A;  1I08 A;  1H2G A;  5CA0 B;  1A32 A;  4TV9 A;  4NKG B;  3JCZ A;  3TJT A;  4WFE A;  5LOV A;  3K79 A;  4YIO A;  5FNV A;  1TUB B;  2Q7H A;  4MT8 A;  3CYO A;  2EIK C;  4FFB B;  4CZZ A;  1GM7 A;  2XAF A;  5LGU A;  3OAA G;  3QVN A;  2FML A;  5L3B A;  3SJQ C;  5L3C A;  3B09 A;  3N2G A;  1F23 A;  3JSL A;  2EJR A;  4MVU A;  3ABM C;  5EYP B;  4JYA O;  3BCC H;  2VQF B;  1VF6 C;  4JV5 O;  1OHH G;  3K0D A;  3RYF A;  4B3M B;  1Q86 W;  4MW8 A;  2XND G;  4YJ2 B;  4I5S A;  4JTC B;  1M4U A;  3OR7 C;  3ETE A;  2K1E A;  4DR5 B;  3K9S A;  3CCS V;  1RPO A;  5E79 Z;  3ML0 A;  5F2V O;  4XDJ A;  4ZOL B;  4PDV A;  2AXT Z;  3KKY A;  2ZIM A;  5IY5 C;  1ZL8 B;  2F23 A;  4JI8 O;  1WB7 A;  1BZK A;  3STL C;  4R8C A;  4B7K A;  4JI2 B;  2QM7 A;  4FLU A;  3I55 V;  3CB2 A;  2QEX V;  2JGU A;  1IBM B;  4JI0 O;  4TUY A;  1AI6 A;  1QU7 A;  1US6 A;  1SER A;  4IIJ B;  2LFR A;  3VQX A;  5J2U A;  3FFQ A;  3P30 A;  3JAS A;  2WLH A;  4P9O A;  5TIS Z;  1K3E A;  4AQY O;  1RM1 B;  1VQ7 V;  3UM7 A;  3FD9 A;  1HW7 A;  4DV4 O;  2LP7 A;  3CXH F;  3JAR B;  1S72 V;  4KHP O;  4LF9 B;  2EJ7 A;  3ABK B;  1AB3 A;  4DV7 B;  3QTC A;  3T2M A;  1MA1 A;  2IU3 A;  1WP8 A;  2F43 G;  3ZHS A;  5BMV B;  4QJF B;  5DM6 V;  4JI6 O;  1Y76 B;  4X20 B;  2Y4U A;  1XL6 A;  1P7G A;  2VRZ A;  1JQ0 A;  2JJ2 G;  1WAZ A;  1CP9 A;  1N32 B;  3LNN A;  2QWQ B;  3C90 A;  1QVG U;  5L3G A;  5JJE B;  1FFT B;  3CRM A;  3GWK C;  2VQE B;  1N8R W;  4JI1 B;  3FKS G;  4JAA A;  1X4T A;  2X0L A;  4J10 A;  5J2T B;  4N23 A;  1UJW B;  4DRX A;  2GSM B;  5JVD A;  1HNW B;  3DC5 A;  5KLV H;  4DK1 A;  4J80 A;  2IW5 A;  1GN4 A;  4LWS A;  5LMN B;  4LNU B;  1BSM A;  2W6J G;  3ETD A;  4NTY A;  2X6A A;  3EFF K;  2FYU H;  4R7C A;  1AVM A;  5GON A;  1XEQ A;  5CA1 A;  4FLY A;  2HHH O;  1OCZ B;  2Y48 A;  3AG1 C;  3AK1 A;  3CCV V;  5B66 Z;  2HLD G;  4CH5 A;  2H3O A;  3CPW U;  1N34 O;  1MSD A;  2R9A A;  1NVP D;  2E5L O;  3BY6 A;  1JPX A;  2QWO B;  3CX5 F;  1Z5V A;  2X6C A;  3CRA A;  1JR9 A;  1PNM A;  3KCY A;  5LYJ B;  4I55 B;  5IYC O;  3CP1 A;  3LDE A;  3SJB C;  1QR8 A;  1XBL A;  4I0X A;  4UVB A;  1FJG O;  1Q6U A;  1PL0 A;  3FYE B;  2EIM B;  3OR6 C;  1TVK A;  3J80 N;  2UXC B;  3LNM B;  1VQ8 V;  3W7X A;  2OIE A;  3BVO A;  1Q81 W;  3T4D A;  1W0J G;  5EK0 A;  1HDJ A;  3ZJZ A;  3OE7 G;  3E89 A;  2UU9 B;  4OX9 O;  1NVP B;  4QPJ A;  1M93 A;  1L0N H;  1QLE B;  1SA0 A;  1ZSP A;  3WFV A;  3MAQ A;  2JIZ G;  4DUY O;  4LF8 O;  1OCZ C;  4DV5 B;  2F4V O;  3WG7 B;  3T1Y B;  3AG4 C;  3WB2 A;  5GTI Z;  1RSO A;  3E86 A;  1R3K C;  3RGB A;  2BOC C;  1G1X B;  4PA9 A;  5KHJ A;  4ZI7 A;  1VF6 A;  4DV2 B;  1Q8I A;  5B1A C;  2JVD A;  3ZX6 A;  1P84 F;  5HFL A;  4JPR A;  4HNA A;  1HNZ O;  5KHK A;  2AGA A;  4WFF A;  1G4Y B;  4J7K A;  1S5J A;  1K9M W;  2JRI A;  4IL6 Z;  2HG5 C;  1K34 A;  3M8A A;  4GKJ B;  3AG7 A;  3CJH A;  2EIM C;  3ZHT A;  4DV3 B;  5LOV B;  2CE4 A;  5FNV B;  3S3X A;  4FK5 C;  2CGO A;  3P32 A;  3I56 V;  2EX3 A;  2EUL A;  1Y4M A;  3C3T A;  2Y0I A;  2FL4 A;  3CRC A;  4PI2 A;  2WLI A;  2GTA A;  1N36 B;  4NXN B;  4G2K A;  3N2G B;  5EC1 C;  4WFH A;  2LGQ A;  1IUR A;  4X88 A;  1NTM H;  3LDD A;  2IH1 C;  4O4J A;  4GYC B;  2EIJ B;  4O4L A;  2W0X A;  3TCU A;  2A3Q A;  2JS5 A;  3BHP A;  1JX9 A;  1YVW A;  3FB5 C;  4DR2 O;  3ZN1 A;  5EIB C;  1QR9 A;  3BFR A;  2P22 C;  1OCR B;  4CBC A;  4XBF A;  3KG2 A;  5JJJ B;  2ZE7 A;  3AG2 C;  3ASN C;  1YXB A;  1H2N A;  3A0R A;  3VOU A;  1YI2 V;  2GDS A;  4LFB B;  1MZE A;  1VQL V;  2BE3 A;  3F5T A;  4UCV A;  2H94 A;  2D2C B;  3UO2 A;  2NLJ C;  1FXK C;  4YXW G;  2DW4 A;  1R3I C;  3TXQ A;  5B1N A;  1D2D A;  1SES A;  1W59 A;  4TUY B;  1XNR O;  4X62 O;  2ZR3 A;  4EFE A;  5J2U B;  3RYI A;  1GKF A;  3AG3 B;  5IYD O;  1Q90 D;  2QKA A;  4GUN A;  2UXB B;  3JAS B;  1DLB A;  3QNE A;  2K9P A;  4E2L A;  2UUC B;  1V55 C;  2YI8 A;  3I5D A;  2PY5 A;  1DF5 A;  1URF A;  2EIJ C;  4GKK B;  1KKC A;  1XMQ B;  4ZBM A;  2XTA A;  2DYS C;  4NYK A;  1LUW A;  4X65 B;  1U96 A;  2OTJ V;  4MS2 A;  1F4M A;  1LUV A;  4UUJ C;  4X1I B;  2E76 B;  2EZO A;  3FX7 A;  1JOY A;  3K06 A;  4FLT A;  2DYR B;  4X1Y A;  3JAL A;  1NH2 B;  1VEW A;  2DWE C;  5B3S B;  2RDC A;  3CC4 V;  3W7S A;  1NZ6 A;  3DGE A;  3K03 A;  5IE9 A;  5GW7 A;  3E35 A;  1MMM A;  2YIB A;  4JYA B;  3THO A;  1M9N A;  5EZY A;  3L71 H;  4JZ2 A;  1VF7 A;  1FYJ A;  3VQY A;  2ILM A;  3RYC A;  1G8M A;  1LR1 A;  5EBW C;  4LP8 A;  5FLX N;  1L1F A;  2ADP A;  2YEV B;  5JVD B;  4BR6 A;  2UUB O;  5LBQ A;  2PUS A;  3K3W A;  2KKW A;  4PHZ A;  3H1K H;  1AJQ A;  5IT9 N;  2UXD O;  1VQ5 V;  4LWS B;  5BXZ A;  3CME V;  1MZF A;  2AZ2 A;  2X7R B;  1DK1 A;  1B6Q A;  4KUM A;  2ZE8 A;  3NR7 A;  3G67 A;  5GON B;  1YZB A;  3ICX A;  1FXH A;  2OWO A;  4JI7 O;  1VMG A;  5CA1 B;  4QIW F;  3G80 A;  3G4S V;  3UKM A;  3H01 A;  3CC7 V;  1H8E G;  3FB6 C;  1SC5 B;  3CRR A;  4IT5 A;  1OV9 A;  2BCC H;  1SZX A;  2FKX A;  1GN2 A;  1BQ0 A;  4JGS A;  3ZMZ A;  3ZHV A;  4NB5 A;  2N04 A;  1EFR G;  2XHB A;  3G71 V;  3TK1 A;  4QPK A;  4JTD B;  1OJH A;  4KHP B;  4I0X B;  4DR3 O;  1N33 O;  4BIZ A;  2DOS A;  4I55 A;  1TVK B;  4DYL A;  2YXY A;  4DR1 B;  3AK3 A;  1H2K A;  1H38 A;  2CGN A;  4JI6 B;  4RUF A;  5JQG A;  4X64 B;  3AEI A;  1Q7Y W;  2CH7 A;  4EKW A;  2P06 A;  3PN1 A;  4PA3 A;  4ZHQ A;  5GTH Z;  3OEH G;  2IJK A;  4LFC B;  1WJZ A;  2FTK A;  4FM2 A;  2O57 A;  3ZRV A;  1SA0 B;  4DR7 B;  2ZIO A;  3A8T A;  2Y69 B;  3A2F A;  5LMU O;  3ABM B;  3OTO O;  3HKD A;  2HVK C;  3RT3 C;  4ZI7 B;  1KD1 W;  3VQV A;  5C8Y A;  4LFA O;  2YSU B;  3K58 A;  3UT5 B;  1I7F A;  4HNA B;  1OZ0 A;  2CAZ C;  2CK3 G;  4YY3 O;  2YI9 A;  2DQ0 A;  4UXN A;  4CH3 A;  1V9P A;  3HKB B;  4B3T O;  1GM9 A;  5LP6 C;  1JJO A;  2EIN C;  3CJH B;  1HNX B;  5FPR A;  2JGD A;  3BA9 A;  2AHY A;  5IY5 B;  3UCS C;  2DJV A;  5CBG A;  3ZMS A;  1FXK A;  3ABL C;  1NJI W;  4HAM A;  4UCU A;  3UO3 A;  1LNQ A;  3K9A A;  1THZ A;  1Z2G A;  2WLI B;  3OEE G;  4DR6 B;  4HBN A;  3JAW B;  3CRQ A;  1S0V A;  1X59 A;  3PJS K;  4O4J B;  3OT7 A;  3L74 H;  2Y69 C;  2E5L B;  4O4L B;  2XAJ A;  4DV1 O;  1Y66 A;  3CSX A;  4GZR B;  3SYP A;  2RMK B;  5LHG A;  2WLL B;  2HR3 A;  4D7S A;  5IJ9 A;  3OUF A;  5HFM A;  5KAF Z;  1VAR A;  3T1H O;  3HKC A;  4B3R B;  1T5E A;  2D3O W;  1JA8 A;  2DWD C;  3ZCC A;  1NTZ H;  4G28 B;  4K0K B;  3ETQ A;  3RW0 A;  4AHC A;  3CCU V;  3M99 B;  1XMO B;  1QNM A;  1Y6X A;  1K33 A;  5H6Q A;  3CE2 A;  2Q0A A;  3K5L A;  4EEQ A;  3K04 A;  3OUS A;  1M57 C;  1M1K W;  2HP8 A;  4J9Y B;  4BIO A;  2RJZ A;  1IBK B;  2F4V B;  1IZ3 A;  3RYI B;  4J11 A;  1JJ2 U;  3P3N A;  5EBL C;  4GX2 A;  2CDY A;  2WAM A;  1PM9 A;  2QTS A;  4ZIB A;  4J41 A;  2YIB D;  3BAB A;  4FVM A;  3E22 A;  4LF6 O;  1TUE B;  5A2Q N;  2A0L A;  2PI4 A;  1GRJ A;  4LR3 A;  1SS3 A;  4UV8 A;  5LA6 B;  1ENV A;  2P90 A;  3IC7 A;  3ZRW B;  1MSW D;  2LW7 A;  4F4L A;  2P4K A;  5LGN A;  2E74 B;  4X1I A;  4JI5 O;  3B8N A;  5LHH A;  2RQ6 A;  3B4S A;  4X1Y B;  3JAL B;  2RN9 A;  1O9G A;  2ZXW C;  3AG1 B;  2Q68 A;  1EZJ A;  3DSQ A;  2CTR A;  2VWJ A;  5KX5 A;  5EZY B;  5KUK A;  3VQW A;  4DW0 A;  3MDS A;  3APQ A;  2AHZ A;  4P2Z A;  4KXR A;  2Q9L A;  2R72 A;  1KMI Z;  2MW2 B;  2NN4 A;  3RYC B;  2F95 B;  2ZDI C;  3OTF A;  3HKE A;  3H1I H;  1YHQ V;  5B1B C;  4JAV A;  4X1K A;  5BR8 B;  2V1D A;  3GB7 C;  1AI5 A;  4TQD A;  4K3A A;  1ZX3 A;  1PP9 H;  3SJC C;  2YEV A;  3TGU H;  2Z5U A;  4CS4 A;  1F7Y A;  3K5O A;  1WPX A;  4QE7 A;  1KQS U;  4TV8 A;  4UFZ A;  1XNR B;  3ZIA G;  1HWY A;  1OCO B;  1QQC A;  4U7N A;  2HVJ C;  3SJA C;  2KQX A;  1E79 G;  2L35 A;  2PI5 A;  2ZM6 B;  3W7T A;  1WPB A;  1K97 A;  1Y74 A;  2Z3Y A;  4I9Q A;  3AG4 B;  2Q73 A;  2V4D A;  1ORQ C;  4MTX A;  3G6B A;  3CMA V;  4X66 B;  4X9Q A;  2DQ3 A;  5B1A B;  1ZAU A;  2HJD A;  1YIJ V;  1J5E O;  4RAI A;  2Q7E A;  1NR1 A;  3K0G A;  4ASU G;  3A0H Z;  5LHI A;  1R6K A;  1BT8 A;  5LP6 A;  3ZMU A;  5D5P A;  3JAT B;  5KAI Z;  5ITZ A;  3QO7 A;  5A9G A;  5EIB D;  4DUZ O;  5JQG B;  1Z5W A;  2CH7 B;  3SDL A;  4UVA A;  4GLX A;  2VQF O;  1BMF G;  4I50 B;  3SGI A;  4ZHQ B;  4B7E A;  1WA8 A;  4B3M O;  1OCO C;  4CS2 A;  1VQ6 V;  1VQO V;  1BL8 A;  2ZE6 A;  4PDL A;  4OPH A;  2PTM A;  2QA4 V;  3HKD B;  4DR5 O;  2IU0 A;  3T1C A;  4GCZ A;  1Q5O A;  1QVF U;  5C8Y B;  2Y4T A;  1YCI A;  3KCX A;  4J7J A;  1R3L C;  1N0N A;  1QBZ A;  4GX0 A;  1HP8 A;  1IXB A;  4KL1 A;  3EVK A;  1XI1 A;  3UT5 A;  2YUA A;  5DEC A;  1XL4 A;  2W6I G;  4L87 A;  3AG2 B;  3ASN B;  3ZRX A;  4JI2 O;  1AJN A;  2P67 A;  1H8H G;  1K5S A;  1S5L Z;  3HKB A;  3QO8 A;  3ZHQ A;  2JGD B;  1IBM O;  2FB5 A;  1WN7 A;  4ABM A;  1FXK B;  3OFN G;  1BE3 H;  1SQQ H;  2N05 A;  3ZMT A;  1H2L A;  3CS5 A;  2RCV A;  2CTW A;  5FPO A;  1XNQ B;  4DV0 B;  1DF4 A;  5LXT B;  3E8F A;  1MNG A;  4B08 A;  5IWA B;  5LGT A;  3JAW A;  4LF4 B;  5L3D A;  1M90 W;  3JYC A;  2R70 A;  4JAU A;  1V55 B;  5BZB A;  4CC5 A;  4DV7 O;  4UCR A;  5IJ9 B;  1TA8 A;  2QE7 G;  3SPJ A;  4LF7 B;  1N33 B;  4IYI A;  4O2A A;  2DYS B;  1VQP V;  2WPD G;  2WLL A;  1Q6I A;  2ZCE A;  3HKC B;  4XDK A;  1IBL B;  5EC2 C;  3A0B Z;  4H33 A;  4W4K A;  2YXH A;  1JFF B;  1AJP A;  4OPA A;  4R50 A;  3ZMV A;  1I0H A;  2DN9 A;  2QWR B;  3F7V C;  1N32 O;  2YS8 A;  4JI4 B;  5CN0 A;  4F6E A;  4U3J A;  4YJ3 A;  5DED A;  3B77 A;  3RYH A;  1XDC A;  2IBZ H;  4CH6 A;  2VQE O;  4JI1 O;  3RBZ A;  5LL6 Y;  3B2E E;  3K5N A;  2UXX A;  1V54 B;  4DR4 B;  4WBN B;  4LFA B;  2HEP A;  4LF5 O;  1HNW O;  1IDS A;  3W7U A;  1ARO P;  4IHJ A;  1BHA A;  2P5O A;  1D5A A;  2XOK G;  4FM1 A;  1NH2 D;  3U0Z A;  2A9H A;  5LMN O;  2GHY A;  3JD3 A;  2ZDI A;  4YHH B;  4B3T B;  2HKO A;  3E22 B;  2IJI A;  3ZN0 A;  3H9V A;  3MD0 A;  1MAB G;  2GUZ B;  1YJW V;  5IDJ A;  3TET A;  1YIT V;  4FPP A;  4MTO A;  1W0K G;  3R65 A;  3E8G A;  3ABT A;  5LA6 A;  2UXN A;  3ZRW A;  4ZKI A;  5KHI A;  2XAQ A;  1FFX A;  3L72 H;  1XIL A;  4BAY A;  1GMG A;  2WSS G;  1NT2 B;  1ZWI C;  5KX5 B;  3B40 A;  3WB1 A;  1TGO A;  1PV0 A;  1KC8 W;  1V54 C;  2XUM A;  4JV5 B;  2QM8 A;  3IJ4 A;  2PYL A;  4WFB V;  3HKE B;  4UVC A;  1QCE A;  3X2Q C;  2Q0O C;  1FPO A;  4X1K B;  3H1L H;  2R9R B;  4O4I A;  1WB8 A;  2ZNJ A;  1VIB A;  1L0L H;  2UU9 O;  3CCR V;  4JI8 B;  2PYJ A;  2NR5 A;  4DV5 O;  4TV8 B;  1EN4 A;  2A79 B;  3T1Y O;  1YJN V;  4I7Z B;  4R6Z A;  4UB6 Z;  5K1P A;  4W4L A;  3CC2 V;  3N2K A;  3VBB A;  4JI0 B;  2BTQ A;  3W7W A;  3JD1 A;  1R6T A;  1K4C C;  1AI7 A;  1Y74 B;  1SET A;  2OYQ A;  2YIA A;  4MVS A;  1KB9 F;  1FXV A;  1BQZ A;  3BA8 A;  4AQY B;  1WP7 A;  1XHZ A;  2JEU A;  4PA6 A;  4DV3 O;  2B1I A;  3F7Y C;  1AI4 A;  3RFR A;  4U3F H;  2Q6A A;  4DV4 B;  1SKV A;  3GVM A;  1EBO A;  2QR4 A;  5LP6 B;  1SF9 A;  2W0F C;  2EIN B;  3HB3 B;  5ITZ B;  3E8H A;  4UCT A;  4DV6 O;  5EBM C;  1N36 O;  4NXN O;  4AIL C;  5B5E Z;  5JH7 A;  2OT5 A;  4NTW A;  3ABL B;  3JAT A;  1VF5 B;  3C3S A;  4LH6 A;  1RFY A;  2ZR2 A;  4PA7 A;  1AP5 A;  3J7A U;  3SYQ A;  4P30 A;  1ZLZ A;  2QWP B;  2F93 B;  3OMI B;  2EIL C;  1E1Q G;  1WA8 B;  4LH7 A;  5H9C A;  4I50 A;  1O9H A;  4XDL A;  1NR7 A;  1GAX A;  4UV9 A;  1N0J A;  1XHX A;  2HFE C;  4PD4 F;  4K8Z A;  4LFB O;  4K35 A;  1GM8 A;  2ZNI A;  2Q5Z A;  1XQ8 A;  1QLN A;  1M56 C;  1SQV H;  5E1A C;  1ROP A;  2GTS A;  1GN3 A;  3APO A;  3HPL C;  4OGQ B;  1EN6 A;  1SQB H;  4MVZ A;  1IXM A;  1J95 A;  4TT3 G;  3DXR A;  3FAV A;  3ZHU A;  2UXB O;  3JAK A;  1M57 B;  3L73 H;  3T4Z A;  1UFI A;  1ZTE A;  3JD2 A;  5JWP A;  2UUC O;  2ITD C;  3SPI A;  2OIG A;  4J42 A;  2HHH B;  4GKK O;  1R6N A;  1KP2 A;  2WLM A;  4BW5 A;  1XMQ O;  3RN4 A;  1P7B A;  1I94 O;  2LW1 A;  3JSN A;  1WNS A;  5LXT A;  5CA3 A;  1N34 B;  3WU2 Z;  3TXS A;  4X65 O;  1Q3E A;  1Q43 A;  1D5N A;  2XAS A;  1CPY A;  4JYB A;  5KA6 A;  4D7T A;  1J5E B;  2ODM A;  5KHG A;  2QDO A;  4O2A B; 
#chains in the Genus database with same CATH homology
 1UFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...