2P6JA

Full-sequence computational design and solution structure of a thermostable protein variant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
MKQWSENVEEKLKEFVKRHQRITQEELHQYAQRLGLNEEAIRQFFEEFEQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords designed engrailed homeodomain variant UVF
publication title Full-sequence Computational Design and Solution Structure of a Thermostable Protein Variant.
pubmed doi rcsb
source organism Unidentified
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p6jA00
2EBOA 2EZPA 2P6JA 5KA6A 1DLBA 5H9CA 1K33A 3K9AA 1K34A 1QR9A 5HFMA 4G2KA 3MHHC 2MK3A 1JPXA 1QR8A 3P30A 2X7RB 3MHSC 2EZOA 4FJCC 1DF5A 1QBZA 4N23A 1DF4A 4FIPC 1ENVA 1Y66A 1I5XA 3M99B 4FK5C 4N21A 3WFVA 1Y4MA 3B8MA 1SZTA 1MG1A 3CYOA 4E2LA 3H01A 4JF3A 3GWOA 4JPRA 3CP1A 3B77A 5KA5A 1JQ0A 2OT5A 5CMUA 2M7WA 5CN0A 2LP7A 1I5YA 1F23A 3B8NA 1MOFA 1QCEA 1EBOA 5HFLA 4JGSA
chains in the Genus database with same CATH superfamily
2VWJA 3E8GA 4H33A 4LF8O 1BMFG 2EIMB 4WFHA 3K79A 4MVUA 3K03A 4YHHB 3ZMZA 5KHJA 1E1QG 3ZRXA 3SYAA 2VQFO 1KMIZ 2KSDA 3FKSG 2ZM6O 1TGOA 2Z5UA 4JASA 3TETA 1R3JC 2DYSC 1OJHA 3ZCCA 1EBOA 2HEPA 3LDCA 4LBEC 4CS4A 2K1EA 5DM6V 1TUEB 2QDOA 5L3BA 1GMGA 1VARA 4JI6B 3STLC 4JYAO 3X2QB 1QLEB 3LNMB 3E8FA 2YI8A 1H8EG 2AZ2A 3JSNA 1I5XA 1P84F 3SPCA 3QO8A 5J2TB 5J2UA 2R9RB 3J80N 5GTIZ 1GTOA 4QJFB 3AG3C 4X20B 3OE7G 1W2BU 2LP7A 2JEUA 3RVYA 1IBKO 4B3MO 2DOSA 1GN2A 1K33A 2DYRB 2GDSA 3OMAB 5A2QN 3K5LA 1YEWA 1Y76A 2BTQB 2ZE5A 5B1NA 1F4MA 2Y0PA 4R7CA 4LF7O 3ABLB 4MVZA 4K35A 5KX5B 2EIKC 3CCSV 2Y4UA 3ETEA 2GHYA 4DV2B 2F4VB 3JD3A 4LNUB 3BABA 4O2BA 2ZD9A 4AI8A 2YXLA 1ZSPA 5GONB 5K1XA 1RP3B 4FPPA 3F5TA 4UVBA 1A32A 1I0HA 4X1KB 1YVWA 3JCUZ 1K92A 3CXHF 3R65A 3OR6C 3E22B 3IJ4A 4R6ZA 4TQFA 1YJWV 2Q5ZA 5DEDA 2ZNJA 3QO5A 2EX3A 5E79Z 4X65O 5BMVB 2LO1A 4O4JB 1EN6A 1P7BA 4DK0A 5CB4A 3UT5B 2IJIA 3T1HB 2P5OA 5IWAB 2ZIOA 1K97A 4LF8B 2UXCO 3LSSA 1B3QA 2VQFB 4FFKA 4XDKA 3CP1A 1S5HC 1I5YA 5EYPB 3NXSA 5DN6G 2VRZA 2R70A 3K5OA 5LXTA 1XILA 3LUTB 1QQCA 4ZBMA 1BHBA 2IJHA 2IJKA 1L0NH 4PA4A 4RO2A 4PD4F 3S3WA 1PPJH 2YXHA 1HR0O 3NR7A 3OAAG 1VMGA 3CYOA 1QU7A 5LGUA 2ZT9B 3VQYA 1SQPH 2UU9B 4O4HA 2XT9A 3UQ8A 5KHHA 1NS1A 4O4IB 1TVKB 3I5DA 5FNVB 1MSWD 4UVCA 3K3WA 4I9QA 4B7EA 2X6CA 1OCRC 3UM7A 5EC2C 2OT5A 3CPWU 1WN7A 3BA9A 3K04A 4YIOA 4I5SA 2JS5A 4J11A 4UVAA 4GCZA 4TV9B 5JJEB 5BY1A 3ICXA 4QGPA 3EFFK 2HJDA 2QA4V 1KYOF 2H3OA 2JS3A 3ABTA 4OGQB 3K0DA 4G27B 4Z2WA 4UCSA 4U7OA 3OTOO 1VIBA 3QG5A 1QNMA 3H1LH 1K7DA 4B3SO 2Q0OC 4MT8A 4FLXA 1TAEA 4JYBA 1ZL8A 2YC0A 4X65B 4D6TH 1AI5A 1R6TA 1VQ4V 1BSMA 1WA8A 4JI1O 1SA0B 5JQGB 2ZKOA 3F7YC 1Z2GA 2FMLA 2X7RB 1VQPV 2Q7HA 4FJCC 4ZHQB 2WAMA 1XNQO 1RPOA 4JAVA 2KKWA 3MD0A 2PY5A 1N34B 4X89A 1COWG 3B4SA 1DK1A 2JK5C 5JCOC 1YITV 3RVZA 3JD1A 3PJSK 3CMEV 1R3LC 1RSOA 4IYHA 5IY5C 4MTGA 4OPAA 3H1JH 2CGOA 2PUSA 3K9AA 2CTQA 5LA6A 5KMGB 4TUYB 2WA4A 4N23A 4UV8A 5AG2A 2QSAA 4X9QA 1Y4MA 3ABKB 4YY3B 3JD2A 3SPJA 4LH6A 2NNUA 2IU3A 2XAFA 1HR0B 5L3DA 1IX9A 3QF7A 1CP9A 4TQDA 2LGQA 2HVJC 1N36O 2P4VA 5JVDA 1BHAA 3DXRA 3CC7V 2OCCC 4UUJC 5ITZB 3I55V 4MS2A 3MHHC 2CH7A 2OIGA 2NN4A 3FX7A 1NBMG 4YJ2B 5B1OA 1OCOC 4K3AA 1IBMO 3W7TA 5H5NA 3RYIB 2ZDIC 1XQ8A 1SQGA 4MW3A 3HKBB 2JGDA 3A8TA 3W7WA 5IJ0B 1Y74B 4JI4O 2JGUA 1Y67A 4BWAA 3KKYA 1PNKA 1JA8A 5FPRA 1NTMH 3SPGA 3HKDB 4YJ3A 2AHYA 3L9DA 4X62O 4DXWA 3OTOB 1S3JA 2DW4A 4EKWA 1KP3A 4JGSA 1SESA 5D5PA 1NH2B 4B3SB 1M57B 1B6QA 1VQ7V 4IIJB 3LDEA 4LWSA 1SQBH 2WLJA 4DR7O 3RFRA 4FM2A 3QO7A 1F7YA 3JCZA 1XNQB 1ZTEA 4GKKO 5IT9N 1N32O 1OCZC 2BOBC 3RBZA 4Z1VA 2YI9A 2ZR2A 4U3JB 1WAZA 2PI5A 3IC7A 1LUWA 5H6RA 4UXNA 3F5WC 5KLVH 2QKSA 3OFNG 4FIPC 4NR1A 4UCOA 1GO3F 4F6RA 4HAMA 3AG1B 4WF9V 4FLUA 2YEVA 3ZN1A 4DV5O 4IHJB 5GW7A 1XMQO 4EEQA 1VQNV 2EILC 1V54B 1OV9A 1N36B 1N4CA 5FLXN 2E5LB 3UCSC 1PNLA 2DWDC 2WLHA 3SJQC 3JAKB 4DW0A 4PDRA 5B1BC 3K57A 5DECA 1N33O 1I94B 1NVPD 2Y4TA 3T4DA 2IBZH 4X1YB 4Q6GA 4LP8A 4MTOA 1UFIA 3KCYA 3ASNB 3RYFB 3DSQA 4ZIBA 2V7QG 2ILMA 3CCEV 2FB5A 5B1AC 4DRXA 2UXBB 5HFMA 4DW1A 3APOA 2F43G 5CBHA 1B04A 5EBLC 4JI4B 4UV9A 3FD9A 4GYCB 1AI6A 1Q90D 1SRYA 3CS5A 4G28B 1YDXA 4PI2A 1AR1B 5HFLA 4C7UA 4X62B 1IBLO 1HNXB 5EBWC 3RYCA 3THOA 4FLYA 1TUBB 2ZE7A 3ZRVA 2X6BA 4FFBA 1DF4A 4ABMA 2Y69C 2G38A 1FFXA 3H1HH 4DR7B 4E2LA 4OXSA 1YJ9V 1K9MW 2QR4A 2RNBA 4GKKB 1N32B 1XL4A 2QM7A 3AG4C 3H9VA 1SF9A 3CCJV 1XHXA 3JSLA 2HHHB 5J9PC 2BTOA 4IYIA 1PL0A 2WLLB 4FM0A 1JMKC 5EIBD 3P32A 1J95A 2E75B 4XDLA 1KBHA 1UPGA 3IFXA 3CMAV 4MSWC 3ZS8C 1MNGA 1MZFA 4DR6O 1H2MA 3K58A 2Q68A 1WNSA 1Y6XA 4GKJO 3CC4V 1XMQB 4LH7A 2PYJA 4KXRA 1NI8A 2F1MA 4J41A 5L3FA 2E74B 4GX1A 1AJQA 5LMNB 1FXKB 5J2TA 2ZCEA 2IH1C 5IJ9B 3OGCC 1NVPB 4X20A 2OTLV 1R6KA 1N33B 1FYJA 4QPJA 5H6QA 5C93A 2WPDG 2EINB 4JYCA 2Q7EA 4B3TO 2BTQA 4WBNB 5KX5A 4GLXA 5C8YB 4LNUA 1GN3A 4JI2O 1I08A 2EIJB 1KC8W 5GONA 2EULA 1KECA 3IGAC 5IYZB 2QE7G 3OD4A 3JASB 4X1KA 1L1FA 5BR8O 5KUKA 4J7KA 4QE9A 1BGYH 3RWRD 1P49A 2JIZG 2FL4A 2DMXA 4O4JA 3C3TA 5KA5A 1GK9A 4BIOA 4DV6O 4KHPO 4HZ3A 3UT5A 1IDSA 1D2DA 1KKCA 3ABKC 2V1DA 5CA3A 1HW7A 1AI4A 2M6YA 2Y48A 3T1YO 2UXDO 3MHSC 4LF9O 3BAAA 1QHTA 5H2FZ 1M56B 3JAMN 4TV8B 5EYPA 3B77A 5LP6B 2IH3C 4UCVA 5CN0A 2VS0A 5IYDO 3JD4A 4MVMA 4I4TB 1GRJA 1N0JA 4GKJB 2CE4A 4GZRB 2AZ0A 4LF5O 2ZQMA 4DV3O 2XAHA 1Q8IA 2DQ3A 1V55B 1QVGU 4FZ1A 1X59A 2QKAA 3VQXA 2ARHA 2NR5A 2ZE6A 4MVQA 3RW0A 4O4IA 4LCUC 1AR5A 2YSUB 5FNVA 1HNZB 1RM1C 4OX9B 5CA0B 4CC5A 4DR5O 1W0KG 3SPHA 1IURA 1VQLV 1H8HG 1LR1A 4RUFA 2F93B 4RQFA 3T2MA 3WG7B 4UCRA 1TA8A 3SYQA 1BE3H 2CDYA 2OTJV 4H0LB 5EC1C 4X66O 3E8HA 2ADQB 2WLIB 3K5NA 2RDCA 4TV9A 1W0JG 3JYCA 5IYCO 1QLNA 3CE2A 2P6JA 1WLEA 3A2FA 3OGIB 2A06H 3Q4HA 1G4YB 3P30A 2E3CA 2NLJC 1YF2A 4DR4O 2YIBD 3RN4A 4CH4A 4LFCO 1SETA 1US6A 2Q67A 1YSCA 1XBLA 4JAUA 3S3XA 3ASOC 4PDVA 4KHPB 1SA0A 5JQGA 1URFA 4ZHQA 2MK3A 2H8PC 4PA9A 1FS0G 2XOKG 5KHIA 3T1YB 3H1IH 3AG2B 2UXDB 3M99B 4LF9B 1N8RW 3W7SA 3GVMA 1YJNV 3VOUA 1K73W 1JQ0A 2ZM6B 3CD6V 3OMIB 5KMGA 1VF6A 2YIAA 1THZA 4TUYA 5FL7G 3ETGA 4CH5A 2W0XA 4NXNO 3BRCA 2QKCA 1Q6IA 2ATKC 4JYAB 4DV3B 4CBCA 1OCCB 1MG1A 2B1GA 2JEXA 3W7XA 5L3GA 5ITZA 4AQYO 4DV0O 4LFAO 1GH6A 4PHZA 1QR8A 4YJ2A 1IBKB 4B3MB 3L70H 3T1CA 1PL4A 2WLKA 2XUMA 4LR3A 1AR4A 3RYIA 4LF7B 1U96A 4JI7O 2CUGA 4X66B 3HKBA 4ZI7B 1NR7A 5IJ0A 4W4KA 3TXQA 1Y74A 3K5MA 1G8MA 1Q6UA 3SDLA 4DUYO 3CRMA 3JALB 3HKDA 1GM7A 4DR4B 4WFEA 5KAIZ 1WP7A 2W6JG 2QWNB 4LFCB 3TXSA 1NR1A 3OM3B 1ZX3A 3U10A 3QNEA 5KA6A 3DGEA 4IIJA 4H44B 3SJAC 3ZHTA 4G2KA 3FFQA 3BFRA 2AHZA 2VQEO 3UKMA 1DF5A 5B66Z 4N21A 2UXCB 2BCCH 3IAYA 4O2AB 1KD1W 3TGUH 2GUZB 3ZHRA 4U3JA 3OT7A 5LHHA 1RFYA 3L75H 4KP4A 4JI3O 3RYHB 1WB7A 4MTXA 5KHGA 4HNAB 3AK1A 4I55B 3ABMC 5FPOA 3A0HZ 4NXNB 3E86A 3MDSA 2HP8A 3HPLC 3ZHVA 4IHJA 2DN9A 2LW7A 1BQ0A 4OPHA 2PF4E 2UUAO 1NKDA 1VEWA 1GAXA 4J7JA 1ROPA 1XEQA 1Q5OA 1FXHA 3JAKA 4LFAB 2ETNA 4X1YA 5LMUO 1L8DA 1SS3A 2QTSA 2UUCO 3RYFA 4AHCA 2QM4A 3G6EV 1F23A 1R3KC 4RWUA 2WA3A 4BAYA 5B3SB 1IXMA 1PNMA 4PA3A 4IL6Z 3BY6A 3K9SA 3JAWB 2D2CB 4KFMA 4F4LA 3M8AA 3HR0A 2DYSB 3D3QA 2QJ1A 2YICA 4DUYB 1R6NA 3JARB 2QWPB 5K1PA 3B8MA 2EIMC 1AB3A 4FM1A 1GN6A 2YDEA 2XAGA 5CA1B 1FKAO 4K0KO 2P7TC 1HWYA 2UXNA 1TUBA 1BCCH 5LP6C 4LFBO 5EBMC 4DV1O 2UUBO 2X0LA 2A9HA 3H1KH 4I0XB 1S0VA 4JI1B 3TJTA 3N2KB 3SYCA 4JTDB 2LW1A 3ZHQA 2HVKC 3K08A 1K4CC 2VQEB 1SC5B 2PI4A 3OUSA 3X2QC 1QLEC 3ZEDA 2PTMA 1K8AW 1PM9A 1ZUQA 3MAQA 1ZL8B 2AW9A 2EIKB 2H94A 3E35A 1Q6HA 2WLLA 1XOUA 4MVOA 2Y0IA 4BR6A 3P3NA 1H2KA 4J42A 3CSXA 1JFFB 3GWKC 1XI1A 2DYRC 4NVPA 1RPRA 2JRIA 1N0NA 3ABLC 1FFTB 5LBQA 3WG7C 1KU9A 2LFSA 3LSQA 4B7KA 1BS3A 4MVRA 1VQOV 2K9PA 2HLDG 1K5QA 4P9PA 2QWQB 4X64O 4K8XA 2ZR3A 2UUAB 1FXKA 2BSKB 4B08A 2L6LA 5IJ9A 4H13B 1G6UA 4IGGA 1GM8A 1IBMB 2VWKA 2XAQA 3ZN0A 5LMUB 3WB0A 1QCEA 3SR2C 3HKEB 3DXRB 3HKCB 2PYLA 4XDJA 4WBNA 3CCMV 4NXMO 2CGNA 5C8YA 2Q9LA 1M9NA 4B3RO 4P30A 5JH7B 5JJNB 1XDCA 4JV5O 2F23A 1K4DC 5IYZA 1LNQA 3K0GA 3JASA 1HNWO 2ZXWB 2EZPA 1JOYA 1YIJV 4K0KB 3B2EE 1WPBA 4PA7A 2ITCC 3VBBA 3CWBH 4WFAV 3LNNA 4LFBB 2YS8A 5EZYB 4UB6Z 3FYIB 3VQWA 2V4DA 3RT3C 2XTAA 5LYJB 3QVNA 4WCEV 3TCUA 1EN4A 3CCRV 2HKOA 4ZKIA 1OCRB 5BXZA 4KL1A 4X1IB 1NTZH 1Q82W 4DR2O 1XMOO 2P67A 1R3IC 1NJIW 3CJHB 1AVMA 3SGIA 4TV8A 1H2SB 4L87A 5LP6A 2ZIMA 1Q81W 4J9YB 3VQVA 3U0ZA 3AK2A 3SJBC 4I4TA 3FB8C 2IU0A 2PGGA 4DV5B 1KB9F 1VQMV 1S5LZ 3EVKA 3F7VC 4CZZA 4FLZA 4HYOA 3O65A 4RAIA 2OCHA 2Q7GA 3ETQA 2QEXV 2FYUH 1S72V 1BZKA 4X64B 3SYPA 1YZBA 3CX5F 2X6AA 4YXWG 1K3EA 3STZC 1NTKH 4JI6O 1CEZA 2EBOA 4FLVA 1O9HA 5CA0A 4ZOLB 1M4UA 1P7GA 2W6IG 5IY5B 1ZLZA 4P2ZA 1P4RA 2WLIA 4UB8Z 4B3RB 2R9AA 4JZ2A 2IM9A 4GUNA 4JV5B 4UFZA 3ABUA 3N2GB 4JTAB 4ICGA 5D5QA 3G4SV 5TISZ 2YXYA 4QNHB 3B40A 1HNWB 2Z0AA 1L0LH 1NU1H 1KKDA 1IBLB 4EB6B 4DV2O 2F4VO 2R9IA 3J7AU 3E22A 3DC6A 1SQFA 4X8AA 2LGWA 4WFBV 1VF6C 2P22C 4CS2A 4DO2A 2OCCB 5BMVA 4AILC 1R73A 3CCLV 3ZMTA 1OCOB 3FB7C 3WB1A 4DYLA 1JJ2U 2ZNIA 1FJGO 3K59A 5GTHZ 1EN5A 4FVMA 1Z5VA 4DR2B 4LF6O 1R1BA 1XMOB 5KAFZ 4IT5A 5E1AC 1H38A 4JF3A 4JPRA 4CC6A 3CRRA 2XHBA 1YHQV 1MOFA 2A3QA 4R50A 2KQXA 1SKVA 3ZBHA 5IDJA 5LGTA 1QR9A 4DR6B 1VQKV 2IJJA 2RJZA 3JATB 1T5EA 4UCUA 5B3SC 3FAVB 3BA8A 4JAAA 4QE7A 1Y66A 1BQZA 2XNDG 2LQTA 3M7MX 1KUQA 2Q6AA 4Q20A 1EZJA 1AP5A 1TVKA 3CRCA 5KUMA 1VQ6V 1Q3EA 3BVOA 1OCZB 5F2VO 4B3TB 1VF5B 4BW9A 1M57C 2UU9O 1FXVA 3OEEG 4H37A 4NYKA 4ZI7A 2WLMA 4I50B 4JI2B 2PZSA 1HDJA 2UXXA 4O4LB 1FD9A 1BT8A 3E83A 5A9GA 2N05A 2RMKB 2YIBA 3JALA 1QBZA 2CTWA 4J7ZA 5BR8B 3OW2U 2EILB 4I7ZB 4L8JA 1NQTA 1H2NA 5CMUA 2GSMB 1XNRO 3FB5C 3LDDA 2RCVA 4DV6B 1EM1A 2A0LA 5B1BB 1CPYA 3AG1C 2A7WA 2GTAA 2WSSG 4Z1MG 1V54C 3CEIA 1FJGB 4RUEA 3ZHSA 4O2AA 3ZRWB 2GUZA 2A79B 3K06A 1SERA 4LF6B 5B1AB 5LOVB 2D3OW 3L72H 1O9GA 4DUZO 2ZE8A 2CK3G 1B06A 1FAFA 3RYHA 1VQ8V 2KG7B 4HNAA 4I55A 5BZBA 1N34O 3ASNC 3BEHA 2QTOA 3AK3A 4BIZA 1U97A 3WFVA 4JTCB 4LF5B 1VP7A 1EFRG 2OWOA 1ZAUA 1HP8A 3FB6C 4PDLA 4PELA 1XREA 4WFGA 2Y69B 4TT3G 1PKXA 4YY3O 3ZMUA 2KB1A 2ZXWC 3ZJZA 3PN1A 3GB7C 3U11A 1Q43A 3AG4B 3CRAA 3N27A 4FK5C 4DR5B 1SZTA 4CH6A 1MA1A 2Z3YA 2QWRB 5J2UB 2Q73A 2F66C 2HFEC 4HBNA 3CXCU 3JAWA 4FLTA 1OZ0A 2DWEC 2N74A 3JD0A 3R66A 1PD3A 1Y76B 2IW5A 4J10A 2DQ0A 3JARA 2O57A 3H01A 2P90A 2RN9A 5CA1A 2W0FC 4FZ0A 4O2BB 2B1IA 1J5EO 3T4ZA 2JVDA 3CHXA 2Q4PA 1M93A 4GX2A 1XNRB 3Q4HB 4I0XA 1F51A 4NTXA 3N2KA 1LUVA 1F4NA 3OEHG 2ITDC 4PJ0Z 2JJ1G 2DE0X 4DR1O 1D5NA 4CS3A 2AXTZ 2ADPA 1KP2A 4GX0A 1JR9A 1E79G 1FXKC 1NH2D 4P9OA 1YTFD 2RQ6A 1ZWIC 4DUZB 5CB4B 2C2AA 1DLBA 5LGNA 4W4LA 4TSFG 3ZX6A 1MZEA 2EINC 1JFFA 4LF4O 3FYEB 1Z5WA 3CCQV 1WJZA 1PP9H 4ASUG 3RGBA 4F6EA 2Q8VA 4WFFA 3GWOA 4GT1A 4D7SA 5JJJB 3P3PA 1H2GA 2QM8A 3G71V 2FKXA 2XAJA 1AROP 2OYQA 2EIJC 3OTFA 1WB8A 3E2EA 2EJRA 3KCXA 3E89A 4JI0O 5LXTB 4NB5A 2BSKA 4AQYB 1WPXA 4DV0B 3DTUB 3OMNB 1JX9A 1AJNA 3J81N 4DK1A 4YIPA 4BIUA 3DC5A 3APQA 4PV1B 1X4TA 4J80A 4QIWF 3HKEA 3WB2A 4TWKA 3L73H 3HKCA 2E5LO 4O4HB 4LC1A 4JI7B 4MTFA 1XHZA 1FPOA 2ZINA 5IYBO 1I94O 1QVFU 3AG7A 5JH7A 1UJWB 4K8ZA 2YUAA 3BCCH 3W7UA 1XUQA 5KHKA 1IVSA 2XASA 1OHHG 2UXBO 5EIBC 1K5SA 1M56C 1SZXA 1J5EB 3OUFA 3L74H 1JPXA 3E8BA 2Q0AA 3AG3B 5EZYA 1PV0A 5LYJA 1MABG 5L3EA 1RM1B 1HNXO 1MMMA 4J9ZB 4DR1B 1D5AA 1V55C 4XBFA 1YTFB 4X1IA 1NZ6A 3D3IA 1K34A 3CJHA 3SJCC 1WA8B 4JZGA 3CCUV 4DR3O 4JI3B 3SPIA 1VQ5V 1AP6A 4LF4B 1XL6A 1S76D 1NT2B 1DTOA 1EZVH 3EHBB 4RQEA 5L3CA 2HHHO 2P06A 1RSOB 4DV4O 4FMTA 2B9ZA 2MW2B 5LA6B 3ZRSA 1GKFA 2F95B 1BL8A 3D8CA 1Q7YW 4JI0B 2QWOB 2ODMA 3ASOB 4I9WA 3IC9A 3G67A 3UO3A 2WWWA 2GTSA 4EFBA 4NTYA 1G1XB 3EXAA 3WU2Z 1YXBA 4JYYA 5EK0A 2WLNA 3O9OA 4ZOLA 2HJFC 2UUCB 2AGAA 2L35A 3D36C 5JVDB 4FLWA 3G6BA 5JCOA 2N04A 5LMNO 2JJ2G 3BPZA 2CH7B 3ZMSA 3KZIZ 4MVSA 4EFEA 2GBOA 3HB3B 3N2GA 3AG2C 1E1RG 3G80A 2HG5C 2EJ7A 1WP8A 3QTCA 5H9CA 2R72A 1AILA 2JGDB 2JDIG 4EB6A 5JWPA 2EZOA 1V9PA 4D7TA 4DV1B 4U7NA 2UUBB 2QGNA 4JI8O 1YCIA 2E76B 4YJ3B 5LHIA 4DV7O 4MW8A 4PA6A 4QPKA 4JI5O 2P4KA 3ZIAG 4R8CA 1VQ9V 1OCCC 3A0RA 2ZDIA 4CH3A 4E4EA 1M5IA 5CBGA 4LWSB 1SQVH 4PI0A 1ORQC 1H2LA 1JVMA 5B5EZ 4DR3B 2BE3A 3L71H 1I7FA 3C3SA 1Q86W 4A5UB 1IXBA 4UCTA 3CCVV 1S77D 4YHHO 3JATA 1JCHA 3FAVA 3A0BZ 4DV4B 5CBFA 1JJOA 1YI2V 1AI7A 1GN4A 1SQQH 1KQSU 4F6RB 2OIEA 2YEVB 3C90A 2HR3A 3TK1A 4NTWA 2Q69A 2BOCC 4GX5A 5LHGA 3ZMVA 1IZ3A 2B5UA 3B09A 3KG2A 4NXMB 3ETDA 1SQXH 3BHPA 3I56V 1VF7A 4I50A 1M1KW 3UO2A 1HNZO 4X88A 3B8NA 4OX9O 2CTRA 3ABMB 1MSDA 4O4LA 5IE9A 2LFRA 5LL6Y 3LSUA 1AJPA 4DRXB 1M90W 4U3FH 1S5JA 3D36A 4NKGB 3CC2V 3ZHUA 2M7WA 3CB2A 4JI8B 2YIDA 4KUMA 1W59A 1CXZB 2DJVA 4DV7B 1DGSA 3AEIA 3RYCB 2GV9A 3ML0A 4JI5B 3OR7C 4PDMA 3ZRWA 1ENVA 2CTPA 3CRQA 4FFBB 2LJ2A 4TOIA 5LOVA 2FTKA 1FFXB 4BW5A 3T1HO 5IWAO 3SYOA 1GM9A 2CAZC 2KG7A
chains in the Genus database with same CATH topology
1PNMA 4PA3A 5EBWC 3E8GA 4WFGA 2Y69B 3BY6A 4H33A 1BMFG 2EIMB 4F4LA 4KFMA 4WFHA 4TT3G 1PKXA 3K79A 4MVUA 3K03A 3ZMUA 2KB1A 2ZXWC 2X6BA 3ZJZA 3ZRVA 1E1QG 3ZRXA 3SYAA 2DYSB 3ZMZA 1DF4A 3GB7C 3AG4B 2Y69C 1R6NA 4FK5C 3FKSG 3B8MA 2EIMC 1SZTA 4E2LA 4OXSA 2Z3YA 2Z5UA 1YJ9V 1K9MW 2XAGA 4JASA 3TETA 1R3JC 2DYSC 3ZCCA 2HFEC 1XL4A 1EBOA 2QM7A 3AG4C 3LDCA 4LBEC 3CXCU 2K1EA 3CCJV 5DM6V 1TUEB 1HWYA 2P7TC 5L3BA 1OZ0A 2UXNA 1GMGA 2DWEC 3JD0A 3STLC 5EBMC 3X2QB 1PD3A 1QLEB 5J9PC 2IW5A 3LNMB 2X0LA 2A9HA 1PL0A 3E8FA 2DQ0A 2WLLB 1H8EG 1S0VA 3SYCA 1I5XA 4JTDB 3P32A 2HVKC 3K08A 1J95A 1K4CC 3SPCA 4XDLA 3OUSA 3QO8A 2PI4A 2R9RB 2P90A 3H01A 3IFXA 3X2QC 1GTOA 1QLEC 4QJFB 3AG3C 4MSWC 3CMAV 3OE7G 2W0FC 1W2BU 2LP7A 2B1IA 2JEUA 1K8AW 3RVYA 2Q68A 3T4ZA 3CC4V 2EIKB 1K33A 2H94A 4GX2A 2DYRB 3OMAB 3E35A 2WLLA 1F51A 4MVOA 5B1NA 1F4MA 5L3FA 4R7CA 4GX1A 3ABLB 4MVZA 1AJQA 1F4NA 3OEHG 2EIKC 2ITDC 1FXKB 3CCSV 3ETEA 2GHYA 2DYRC 2IH1C 3OGCC 3JD3A 1NVPB 2JJ1G 1RPRA 5B3SB 2OTLV 2ZD9A 1R6KA 1KP2A 4GX0A 4QPJA 5H6QA 3ABLC 1FFTB 5LBQA 1E79G 5C93A 1FXKC 3WG7C 1NH2D 4P9OA 2WPDG 1YTFD 2LFSA 2EINB 4JYCA 1ZWIC 3LSQA 4FPPA 2C2AA 1DLBA 4MVRA 4UVBA 5LGNA 1VQOV 2HLDG 1K5QA 4P9PA 3R65A 1K92A 4TSFG 2ZR3A 1FXKA 2EINC 3OR6C 3FYEB 4R6ZA 1YJWV 3CCQV 3QO5A 4ASUG 4WFFA 2EIJB 3GWOA 1GM8A 1KC8W 4GT1A 3IGAC 1KECA 2XAQA 1H2GA 3ZN0A 2QM8A 1P7BA 1QCEA 3G71V 2QE7G 2XAJA 2IJIA 1AROP 2EIJC 3E2EA 1L1FA 2EJRA 3E89A 4XDJA 5KUKA 3CCMV 4QE9A 1K97A 1WPXA 3DTUB 3OMNB 1JX9A 1AJNA 1M9NA 2JIZG 4P30A 3LSSA 4BIUA 4XDKA 5KA5A 3CP1A 1GK9A 1K4DC 1LNQA 1S5HC 3K0GA 4HZ3A 4QIWF 1I5YA 4TWKA 3ABKC 2ZXWB 3NXSA 4LC1A 2EZPA 2V1DA 5DN6G 5CA3A 1YIJV 1JOYA 1AI4A 4MTFA 2Y48A 4PA7A 3LUTB 2ITCC 3MHSC 4ZBMA 3VBBA 5IYBO 2IJHA 1BHBA 1QVFU 2IJKA 4PA4A 4RO2A 4WFAV 1UJWB 3OAAG 3FYIB 3W7UA 1M56B 3CYOA 5LGUA 4WCEV 3B77A 3TCUA 2IH3C 3CCRV 2XASA 5CN0A 1OHHG 2HKOA 4ZKIA 5IYDO 1OCRB 1K5SA 1M56C 3JD4A 4MVMA 3OUFA 1Q82W 1MSWD 5HFLA 4UVCA 1JPXA 3K3WA 3E8BA 2P67A 1R3IC 2ZQMA 1NJIW 3AG3B 2X6CA 2XAHA 1OCRC 2DQ3A 1V55B 1QVGU 4L87A 1MABG 5L3EA 1RM1B 3UM7A 1Q81W 5EC2C 2OT5A 4J9YB 3CPWU 3K04A 4I5SA 4J9ZB 4MVQA 3RW0A 4UVAA 4GCZA 4LCUC 2YSUB 1V55C 3FB8C 4XBFA 1YTFB 2IU0A 3D3IA 1K34A 1RM1C 3EFFK 1VQMV 1W0KG 3F7VC 3SPHA 4CZZA 2QA4V 3ABTA 4HYOA 1VQLV 3K0DA 3CCUV 4G27B 4RAIA 1H8HG 3SPIA 2QEXV 1S72V 4RUFA 4RQFA 3T2MA 3SYPA 3WG7B 4U7OA 3SYQA 1VQ5V 2X6AA 2OTJV 5EC1C 3E8HA 1XL6A 1S76D 1K7DA 2WLIB 1DTOA 3EHBB 4RQEA 1W0JG 3JYCA 4MT8A 4YXWG 5L3CA 5IYCO 1QLNA 1K3EA 4JYBA 3STZC 1CEZA 2EBOA 2P6JA 1AI5A 1WLEA 1VQ4V 4FMTA 1G4YB 3F7YC 3P30A 2X7RB 3ZRSA 1GKFA 1VQPV 1BL8A 2NLJC 4FJCC 2WAMA 1Q7YW 1RPOA 2W6IG 5IY5B 4JAVA 3ASOB 3MD0A 4I9WA 4P2ZA 4X89A 1COWG 1P4RA 2WLIA 2JK5C 2WWWA 1SETA 1YITV 3RVZA 3JD1A 3PJSK 3CMEV 2Q67A 1R3LC 1YSCA 4JAUA 3ABUA 5EK0A 2WLNA 5IY5C 3ASOC 4JTAB 4MTGA 2HJFC 4PDVA 3G4SV 3K9AA 4QNHB 2JJ2G 2MK3A 2H8PC 1KKDA 4PA9A 1FS0G 2XOKG 2R9IA 3ZMSA 4N23A 3AG2B 4UV8A 4X8AA 4WFBV 3M99B 1N8RW 1Y4MA 3ABKB 3W7SA 3JD2A 3SPJA 1YJNV 4DO2A 2NNUA 2OCCB 2IU3A 2XAFA 4MVSA 5L3DA 3VOUA 1K73W 1JQ0A 1CP9A 1R73A 3HB3B 3CCLV 3ZMTA 3AG2C 1E1RG 2HVJC 2HG5C 3CD6V 1BHAA 3OMIB 3CC7V 1OCOB 3FB7C 5H9CA 2OCCC 1THZA 5FL7G 4UUJC 2JDIG 1JJ2U 3I55V 4MS2A 3MHHC 3ETGA 2EZOA 1NBMG 5B1OA 1OCOC 2ATKC 4U7NA 5E1AC 4CBCA 1H38A 1OCCB 1MG1A 4JF3A 3W7TA 4JPRA 2ZDIC 2B1GA 1YHQV 2JEXA 5LHIA 1MOFA 3W7XA 4MW8A 5L3GA 4PA6A 4MW3A 4QPKA 4R50A 1VQ9V 3ZIAG 4R8CA 1OCCC 5IDJA 3W7WA 3A0RA 5LGTA 1QR9A 1VQKV 2IJJA 2ZDIA 1QR8A 5CBGA 5B3SC 4QE7A 1ORQC 1PNKA 1JVMA 1Y66A 3T1CA 2XNDG 2WLKA 3SPGA 2AHYA 4DXWA 2Q6AA 4Q20A 1EZJA 1S3JA 2DW4A 4EKWA 1Q86W 1NR7A 1KP3A 4JGSA 1SESA 1NH2B 5KUMA 3CCVV 1S77D 1M57B 1G8MA 1JCHA 1B6QA 1VQ7V 1VQ6V 3LDEA 5CBFA 1OCZB 1YI2V 1AI7A 2WLJA 3QO7A 1M57C 1KQSU 1GM7A 3JCZA 4WFEA 1FXVA 3OEEG 1OCZC 4H37A 2W6JG 2WLMA 2BOBC 2YEVB 3RBZA 1NR1A 3OM3B 2ZR2A 3QNEA 2HR3A 2UXXA 3TK1A 5KA6A 3DGEA 2Q69A 2PI5A 3IC7A 4G2KA 2BOCC 5H6RA 3E83A 4GX5A 5LHGA 2AHZA 4UXNA 3F5WC 3ZMVA 3UKMA 1DF5A 1QBZA 2B5UA 2QKSA 3OFNG 3OW2U 3KG2A 4FIPC 4N21A 3ETDA 2EILB 1GO3F 4HAMA 3I56V 1KD1W 1M1KW 3AG1B 1NQTA 4WF9V 2YEVA 5CMUA 2GSMB 3ZN1A 4X88A 5GW7A 3B8NA 1VQNV 3ABMB 2EILC 5LHHA 1V54B 3FB5C 3LDDA 2A0LA 2LFRA 1CPYA 5B1BB 3AG1C 4KP4A 4MTXA 1AJPA 2WSSG 4Z1MG 1PNLA 1M90W 2DWDC 3ABMC 1V54C 2WLHA 3SJQC 4PDRA 5B1BC 4RUEA 3D36A 3E86A 3ZRWB 3HPLC 1NVPD 2A79B 3K06A 3T4DA 3CC2V 1SERA 5B1AB 4LP8A 2D3OW 2M7WA 4MTOA 3ASNB 2V7QG 2CK3G 4KUMA 3CCEV 1VQ8V 5B1AC 1NKDA 5HFMA 3AEIA 1ROPA 3ML0A 5BZBA 2F43G 5CBHA 1FXHA 3OR7C 3ASNC 5EBLC 3BEHA 2QTOA 4PDMA 3ZRWA 4BIZA 4UV9A 1ENVA 3WFVA 4JTCB 2FTKA 1EFRG 1AI6A 1SRYA 4G28B 4BW5A 3G6EV 1F23A 1R3KC 3FB6C 4PDLA 4BAYA 1AR1B 3SYOA 1IXMA 1GM9A 4PELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBO A;  2EZP A;  2P6J A;  5KA6 A;  1DLB A;  5H9C A;  1K33 A;  3K9A A;  1K34 A;  1QR9 A;  5HFM A;  4G2K A;  3MHH C;  2MK3 A;  1JPX A;  1QR8 A;  3P30 A;  2X7R B;  3MHS C;  2EZO A;  4FJC C;  1DF5 A;  1QBZ A;  4N23 A;  1DF4 A;  4FIP C;  1ENV A;  1Y66 A;  1I5X A;  3M99 B;  4FK5 C;  4N21 A;  3WFV A;  1Y4M A;  3B8M A;  1SZT A;  1MG1 A;  3CYO A;  4E2L A;  3H01 A;  4JF3 A;  3GWO A;  4JPR A;  3CP1 A;  3B77 A;  5KA5 A;  1JQ0 A;  2OT5 A;  5CMU A;  2M7W A;  5CN0 A;  2LP7 A;  1I5Y A;  1F23 A;  3B8N A;  1MOF A;  1QCE A;  1EBO A;  5HFL A;  4JGS A; 
#chains in the Genus database with same CATH topology
 2VWJ A;  3E8G A;  4H33 A;  4LF8 O;  1BMF G;  2EIM B;  4WFH A;  3K79 A;  4MVU A;  3K03 A;  4YHH B;  3ZMZ A;  5KHJ A;  1E1Q G;  3ZRX A;  3SYA A;  2VQF O;  1KMI Z;  2KSD A;  3FKS G;  2ZM6 O;  1TGO A;  2Z5U A;  4JAS A;  3TET A;  1R3J C;  2DYS C;  1OJH A;  3ZCC A;  1EBO A;  2HEP A;  3LDC A;  4LBE C;  4CS4 A;  2K1E A;  5DM6 V;  1TUE B;  2QDO A;  5L3B A;  1GMG A;  1VAR A;  4JI6 B;  3STL C;  4JYA O;  3X2Q B;  1QLE B;  3LNM B;  3E8F A;  2YI8 A;  1H8E G;  2AZ2 A;  3JSN A;  1I5X A;  1P84 F;  3SPC A;  3QO8 A;  5J2T B;  5J2U A;  2R9R B;  3J80 N;  5GTI Z;  1GTO A;  4QJF B;  3AG3 C;  4X20 B;  3OE7 G;  1W2B U;  2LP7 A;  2JEU A;  3RVY A;  1IBK O;  4B3M O;  2DOS A;  1GN2 A;  1K33 A;  2DYR B;  2GDS A;  3OMA B;  5A2Q N;  3K5L A;  1YEW A;  1Y76 A;  2BTQ B;  2ZE5 A;  5B1N A;  1F4M A;  2Y0P A;  4R7C A;  4LF7 O;  3ABL B;  4MVZ A;  4K35 A;  5KX5 B;  2EIK C;  3CCS V;  2Y4U A;  3ETE A;  2GHY A;  4DV2 B;  2F4V B;  3JD3 A;  4LNU B;  3BAB A;  4O2B A;  2ZD9 A;  4AI8 A;  2YXL A;  1ZSP A;  5GON B;  5K1X A;  1RP3 B;  4FPP A;  3F5T A;  4UVB A;  1A32 A;  1I0H A;  4X1K B;  1YVW A;  3JCU Z;  1K92 A;  3CXH F;  3R65 A;  3OR6 C;  3E22 B;  3IJ4 A;  4R6Z A;  4TQF A;  1YJW V;  2Q5Z A;  5DED A;  2ZNJ A;  3QO5 A;  2EX3 A;  5E79 Z;  4X65 O;  5BMV B;  2LO1 A;  4O4J B;  1EN6 A;  1P7B A;  4DK0 A;  5CB4 A;  3UT5 B;  2IJI A;  3T1H B;  2P5O A;  5IWA B;  2ZIO A;  1K97 A;  4LF8 B;  2UXC O;  3LSS A;  1B3Q A;  2VQF B;  4FFK A;  4XDK A;  3CP1 A;  1S5H C;  1I5Y A;  5EYP B;  3NXS A;  5DN6 G;  2VRZ A;  2R70 A;  3K5O A;  5LXT A;  1XIL A;  3LUT B;  1QQC A;  4ZBM A;  1BHB A;  2IJH A;  2IJK A;  1L0N H;  4PA4 A;  4RO2 A;  4PD4 F;  3S3W A;  1PPJ H;  2YXH A;  1HR0 O;  3NR7 A;  3OAA G;  1VMG A;  3CYO A;  1QU7 A;  5LGU A;  2ZT9 B;  3VQY A;  1SQP H;  2UU9 B;  4O4H A;  2XT9 A;  3UQ8 A;  5KHH A;  1NS1 A;  4O4I B;  1TVK B;  3I5D A;  5FNV B;  1MSW D;  4UVC A;  3K3W A;  4I9Q A;  4B7E A;  2X6C A;  1OCR C;  3UM7 A;  5EC2 C;  2OT5 A;  3CPW U;  1WN7 A;  3BA9 A;  3K04 A;  4YIO A;  4I5S A;  2JS5 A;  4J11 A;  4UVA A;  4GCZ A;  4TV9 B;  5JJE B;  5BY1 A;  3ICX A;  4QGP A;  3EFF K;  2HJD A;  2QA4 V;  1KYO F;  2H3O A;  2JS3 A;  3ABT A;  4OGQ B;  3K0D A;  4G27 B;  4Z2W A;  4UCS A;  4U7O A;  3OTO O;  1VIB A;  3QG5 A;  1QNM A;  3H1L H;  1K7D A;  4B3S O;  2Q0O C;  4MT8 A;  4FLX A;  1TAE A;  4JYB A;  1ZL8 A;  2YC0 A;  4X65 B;  4D6T H;  1AI5 A;  1R6T A;  1VQ4 V;  1BSM A;  1WA8 A;  4JI1 O;  1SA0 B;  5JQG B;  2ZKO A;  3F7Y C;  1Z2G A;  2FML A;  2X7R B;  1VQP V;  2Q7H A;  4FJC C;  4ZHQ B;  2WAM A;  1XNQ O;  1RPO A;  4JAV A;  2KKW A;  3MD0 A;  2PY5 A;  1N34 B;  4X89 A;  1COW G;  3B4S A;  1DK1 A;  2JK5 C;  5JCO C;  1YIT V;  3RVZ A;  3JD1 A;  3PJS K;  3CME V;  1R3L C;  1RSO A;  4IYH A;  5IY5 C;  4MTG A;  4OPA A;  3H1J H;  2CGO A;  2PUS A;  3K9A A;  2CTQ A;  5LA6 A;  5KMG B;  4TUY B;  2WA4 A;  4N23 A;  4UV8 A;  5AG2 A;  2QSA A;  4X9Q A;  1Y4M A;  3ABK B;  4YY3 B;  3JD2 A;  3SPJ A;  4LH6 A;  2NNU A;  2IU3 A;  2XAF A;  1HR0 B;  5L3D A;  1IX9 A;  3QF7 A;  1CP9 A;  4TQD A;  2LGQ A;  2HVJ C;  1N36 O;  2P4V A;  5JVD A;  1BHA A;  3DXR A;  3CC7 V;  2OCC C;  4UUJ C;  5ITZ B;  3I55 V;  4MS2 A;  3MHH C;  2CH7 A;  2OIG A;  2NN4 A;  3FX7 A;  1NBM G;  4YJ2 B;  5B1O A;  1OCO C;  4K3A A;  1IBM O;  3W7T A;  5H5N A;  3RYI B;  2ZDI C;  1XQ8 A;  1SQG A;  4MW3 A;  3HKB B;  2JGD A;  3A8T A;  3W7W A;  5IJ0 B;  1Y74 B;  4JI4 O;  2JGU A;  1Y67 A;  4BWA A;  3KKY A;  1PNK A;  1JA8 A;  5FPR A;  1NTM H;  3SPG A;  3HKD B;  4YJ3 A;  2AHY A;  3L9D A;  4X62 O;  4DXW A;  3OTO B;  1S3J A;  2DW4 A;  4EKW A;  1KP3 A;  4JGS A;  1SES A;  5D5P A;  1NH2 B;  4B3S B;  1M57 B;  1B6Q A;  1VQ7 V;  4IIJ B;  3LDE A;  4LWS A;  1SQB H;  2WLJ A;  4DR7 O;  3RFR A;  4FM2 A;  3QO7 A;  1F7Y A;  3JCZ A;  1XNQ B;  1ZTE A;  4GKK O;  5IT9 N;  1N32 O;  1OCZ C;  2BOB C;  3RBZ A;  4Z1V A;  2YI9 A;  2ZR2 A;  4U3J B;  1WAZ A;  2PI5 A;  3IC7 A;  1LUW A;  5H6R A;  4UXN A;  3F5W C;  5KLV H;  2QKS A;  3OFN G;  4FIP C;  4NR1 A;  4UCO A;  1GO3 F;  4F6R A;  4HAM A;  3AG1 B;  4WF9 V;  4FLU A;  2YEV A;  3ZN1 A;  4DV5 O;  4IHJ B;  5GW7 A;  1XMQ O;  4EEQ A;  1VQN V;  2EIL C;  1V54 B;  1OV9 A;  1N36 B;  1N4C A;  5FLX N;  2E5L B;  3UCS C;  1PNL A;  2DWD C;  2WLH A;  3SJQ C;  3JAK B;  4DW0 A;  4PDR A;  5B1B C;  3K57 A;  5DEC A;  1N33 O;  1I94 B;  1NVP D;  2Y4T A;  3T4D A;  2IBZ H;  4X1Y B;  4Q6G A;  4LP8 A;  4MTO A;  1UFI A;  3KCY A;  3ASN B;  3RYF B;  3DSQ A;  4ZIB A;  2V7Q G;  2ILM A;  3CCE V;  2FB5 A;  5B1A C;  4DRX A;  2UXB B;  5HFM A;  4DW1 A;  3APO A;  2F43 G;  5CBH A;  1B04 A;  5EBL C;  4JI4 B;  4UV9 A;  3FD9 A;  4GYC B;  1AI6 A;  1Q90 D;  1SRY A;  3CS5 A;  4G28 B;  1YDX A;  4PI2 A;  1AR1 B;  5HFL A;  4C7U A;  4X62 B;  1IBL O;  1HNX B;  5EBW C;  3RYC A;  3THO A;  4FLY A;  1TUB B;  2ZE7 A;  3ZRV A;  2X6B A;  4FFB A;  1DF4 A;  4ABM A;  2Y69 C;  2G38 A;  1FFX A;  3H1H H;  4DR7 B;  4E2L A;  4OXS A;  1YJ9 V;  1K9M W;  2QR4 A;  2RNB A;  4GKK B;  1N32 B;  1XL4 A;  2QM7 A;  3AG4 C;  3H9V A;  1SF9 A;  3CCJ V;  1XHX A;  3JSL A;  2HHH B;  5J9P C;  2BTO A;  4IYI A;  1PL0 A;  2WLL B;  4FM0 A;  1JMK C;  5EIB D;  3P32 A;  1J95 A;  2E75 B;  4XDL A;  1KBH A;  1UPG A;  3IFX A;  3CMA V;  4MSW C;  3ZS8 C;  1MNG A;  1MZF A;  4DR6 O;  1H2M A;  3K58 A;  2Q68 A;  1WNS A;  1Y6X A;  4GKJ O;  3CC4 V;  1XMQ B;  4LH7 A;  2PYJ A;  4KXR A;  1NI8 A;  2F1M A;  4J41 A;  5L3F A;  2E74 B;  4GX1 A;  1AJQ A;  5LMN B;  1FXK B;  5J2T A;  2ZCE A;  2IH1 C;  5IJ9 B;  3OGC C;  1NVP B;  4X20 A;  2OTL V;  1R6K A;  1N33 B;  1FYJ A;  4QPJ A;  5H6Q A;  5C93 A;  2WPD G;  2EIN B;  4JYC A;  2Q7E A;  4B3T O;  2BTQ A;  4WBN B;  5KX5 A;  4GLX A;  5C8Y B;  4LNU A;  1GN3 A;  4JI2 O;  1I08 A;  2EIJ B;  1KC8 W;  5GON A;  2EUL A;  1KEC A;  3IGA C;  5IYZ B;  2QE7 G;  3OD4 A;  3JAS B;  4X1K A;  1L1F A;  5BR8 O;  5KUK A;  4J7K A;  4QE9 A;  1BGY H;  3RWR D;  1P49 A;  2JIZ G;  2FL4 A;  2DMX A;  4O4J A;  3C3T A;  5KA5 A;  1GK9 A;  4BIO A;  4DV6 O;  4KHP O;  4HZ3 A;  3UT5 A;  1IDS A;  1D2D A;  1KKC A;  3ABK C;  2V1D A;  5CA3 A;  1HW7 A;  1AI4 A;  2M6Y A;  2Y48 A;  3T1Y O;  2UXD O;  3MHS C;  4LF9 O;  3BAA A;  1QHT A;  5H2F Z;  1M56 B;  3JAM N;  4TV8 B;  5EYP A;  3B77 A;  5LP6 B;  2IH3 C;  4UCV A;  5CN0 A;  2VS0 A;  5IYD O;  3JD4 A;  4MVM A;  4I4T B;  1GRJ A;  1N0J A;  4GKJ B;  2CE4 A;  4GZR B;  2AZ0 A;  4LF5 O;  2ZQM A;  4DV3 O;  2XAH A;  1Q8I A;  2DQ3 A;  1V55 B;  1QVG U;  4FZ1 A;  1X59 A;  2QKA A;  3VQX A;  2ARH A;  2NR5 A;  2ZE6 A;  4MVQ A;  3RW0 A;  4O4I A;  4LCU C;  1AR5 A;  2YSU B;  5FNV A;  1HNZ B;  1RM1 C;  4OX9 B;  5CA0 B;  4CC5 A;  4DR5 O;  1W0K G;  3SPH A;  1IUR A;  1VQL V;  1H8H G;  1LR1 A;  4RUF A;  2F93 B;  4RQF A;  3T2M A;  3WG7 B;  4UCR A;  1TA8 A;  3SYQ A;  1BE3 H;  2CDY A;  2OTJ V;  4H0L B;  5EC1 C;  4X66 O;  3E8H A;  2ADQ B;  2WLI B;  3K5N A;  2RDC A;  4TV9 A;  1W0J G;  3JYC A;  5IYC O;  1QLN A;  3CE2 A;  2P6J A;  1WLE A;  3A2F A;  3OGI B;  2A06 H;  3Q4H A;  1G4Y B;  3P30 A;  2E3C A;  2NLJ C;  1YF2 A;  4DR4 O;  2YIB D;  3RN4 A;  4CH4 A;  4LFC O;  1SET A;  1US6 A;  2Q67 A;  1YSC A;  1XBL A;  4JAU A;  3S3X A;  3ASO C;  4PDV A;  4KHP B;  1SA0 A;  5JQG A;  1URF A;  4ZHQ A;  2MK3 A;  2H8P C;  4PA9 A;  1FS0 G;  2XOK G;  5KHI A;  3T1Y B;  3H1I H;  3AG2 B;  2UXD B;  3M99 B;  4LF9 B;  1N8R W;  3W7S A;  3GVM A;  1YJN V;  3VOU A;  1K73 W;  1JQ0 A;  2ZM6 B;  3CD6 V;  3OMI B;  5KMG A;  1VF6 A;  2YIA A;  1THZ A;  4TUY A;  5FL7 G;  3ETG A;  4CH5 A;  2W0X A;  4NXN O;  3BRC A;  2QKC A;  1Q6I A;  2ATK C;  4JYA B;  4DV3 B;  4CBC A;  1OCC B;  1MG1 A;  2B1G A;  2JEX A;  3W7X A;  5L3G A;  5ITZ A;  4AQY O;  4DV0 O;  4LFA O;  1GH6 A;  4PHZ A;  1QR8 A;  4YJ2 A;  1IBK B;  4B3M B;  3L70 H;  3T1C A;  1PL4 A;  2WLK A;  2XUM A;  4LR3 A;  1AR4 A;  3RYI A;  4LF7 B;  1U96 A;  4JI7 O;  2CUG A;  4X66 B;  3HKB A;  4ZI7 B;  1NR7 A;  5IJ0 A;  4W4K A;  3TXQ A;  1Y74 A;  3K5M A;  1G8M A;  1Q6U A;  3SDL A;  4DUY O;  3CRM A;  3JAL B;  3HKD A;  1GM7 A;  4DR4 B;  4WFE A;  5KAI Z;  1WP7 A;  2W6J G;  2QWN B;  4LFC B;  3TXS A;  1NR1 A;  3OM3 B;  1ZX3 A;  3U10 A;  3QNE A;  5KA6 A;  3DGE A;  4IIJ A;  4H44 B;  3SJA C;  3ZHT A;  4G2K A;  3FFQ A;  3BFR A;  2AHZ A;  2VQE O;  3UKM A;  1DF5 A;  5B66 Z;  4N21 A;  2UXC B;  2BCC H;  3IAY A;  4O2A B;  1KD1 W;  3TGU H;  2GUZ B;  3ZHR A;  4U3J A;  3OT7 A;  5LHH A;  1RFY A;  3L75 H;  4KP4 A;  4JI3 O;  3RYH B;  1WB7 A;  4MTX A;  5KHG A;  4HNA B;  3AK1 A;  4I55 B;  3ABM C;  5FPO A;  3A0H Z;  4NXN B;  3E86 A;  3MDS A;  2HP8 A;  3HPL C;  3ZHV A;  4IHJ A;  2DN9 A;  2LW7 A;  1BQ0 A;  4OPH A;  2PF4 E;  2UUA O;  1NKD A;  1VEW A;  1GAX A;  4J7J A;  1ROP A;  1XEQ A;  1Q5O A;  1FXH A;  3JAK A;  4LFA B;  2ETN A;  4X1Y A;  5LMU O;  1L8D A;  1SS3 A;  2QTS A;  2UUC O;  3RYF A;  4AHC A;  2QM4 A;  3G6E V;  1F23 A;  1R3K C;  4RWU A;  2WA3 A;  4BAY A;  5B3S B;  1IXM A;  1PNM A;  4PA3 A;  4IL6 Z;  3BY6 A;  3K9S A;  3JAW B;  2D2C B;  4KFM A;  4F4L A;  3M8A A;  3HR0 A;  2DYS B;  3D3Q A;  2QJ1 A;  2YIC A;  4DUY B;  1R6N A;  3JAR B;  2QWP B;  5K1P A;  3B8M A;  2EIM C;  1AB3 A;  4FM1 A;  1GN6 A;  2YDE A;  2XAG A;  5CA1 B;  1FKA O;  4K0K O;  2P7T C;  1HWY A;  2UXN A;  1TUB A;  1BCC H;  5LP6 C;  4LFB O;  5EBM C;  4DV1 O;  2UUB O;  2X0L A;  2A9H A;  3H1K H;  4I0X B;  1S0V A;  4JI1 B;  3TJT A;  3N2K B;  3SYC A;  4JTD B;  2LW1 A;  3ZHQ A;  2HVK C;  3K08 A;  1K4C C;  2VQE B;  1SC5 B;  2PI4 A;  3OUS A;  3X2Q C;  1QLE C;  3ZED A;  2PTM A;  1K8A W;  1PM9 A;  1ZUQ A;  3MAQ A;  1ZL8 B;  2AW9 A;  2EIK B;  2H94 A;  3E35 A;  1Q6H A;  2WLL A;  1XOU A;  4MVO A;  2Y0I A;  4BR6 A;  3P3N A;  1H2K A;  4J42 A;  3CSX A;  1JFF B;  3GWK C;  1XI1 A;  2DYR C;  4NVP A;  1RPR A;  2JRI A;  1N0N A;  3ABL C;  1FFT B;  5LBQ A;  3WG7 C;  1KU9 A;  2LFS A;  3LSQ A;  4B7K A;  1BS3 A;  4MVR A;  1VQO V;  2K9P A;  2HLD G;  1K5Q A;  4P9P A;  2QWQ B;  4X64 O;  4K8X A;  2ZR3 A;  2UUA B;  1FXK A;  2BSK B;  4B08 A;  2L6L A;  5IJ9 A;  4H13 B;  1G6U A;  4IGG A;  1GM8 A;  1IBM B;  2VWK A;  2XAQ A;  3ZN0 A;  5LMU B;  3WB0 A;  1QCE A;  3SR2 C;  3HKE B;  3DXR B;  3HKC B;  2PYL A;  4XDJ A;  4WBN A;  3CCM V;  4NXM O;  2CGN A;  5C8Y A;  2Q9L A;  1M9N A;  4B3R O;  4P30 A;  5JH7 B;  5JJN B;  1XDC A;  4JV5 O;  2F23 A;  1K4D C;  5IYZ A;  1LNQ A;  3K0G A;  3JAS A;  1HNW O;  2ZXW B;  2EZP A;  1JOY A;  1YIJ V;  4K0K B;  3B2E E;  1WPB A;  4PA7 A;  2ITC C;  3VBB A;  3CWB H;  4WFA V;  3LNN A;  4LFB B;  2YS8 A;  5EZY B;  4UB6 Z;  3FYI B;  3VQW A;  2V4D A;  3RT3 C;  2XTA A;  5LYJ B;  3QVN A;  4WCE V;  3TCU A;  1EN4 A;  3CCR V;  2HKO A;  4ZKI A;  1OCR B;  5BXZ A;  4KL1 A;  4X1I B;  1NTZ H;  1Q82 W;  4DR2 O;  1XMO O;  2P67 A;  1R3I C;  1NJI W;  3CJH B;  1AVM A;  3SGI A;  4TV8 A;  1H2S B;  4L87 A;  5LP6 A;  2ZIM A;  1Q81 W;  4J9Y B;  3VQV A;  3U0Z A;  3AK2 A;  3SJB C;  4I4T A;  3FB8 C;  2IU0 A;  2PGG A;  4DV5 B;  1KB9 F;  1VQM V;  1S5L Z;  3EVK A;  3F7V C;  4CZZ A;  4FLZ A;  4HYO A;  3O65 A;  4RAI A;  2OCH A;  2Q7G A;  3ETQ A;  2QEX V;  2FYU H;  1S72 V;  1BZK A;  4X64 B;  3SYP A;  1YZB A;  3CX5 F;  2X6A A;  4YXW G;  1K3E A;  3STZ C;  1NTK H;  4JI6 O;  1CEZ A;  2EBO A;  4FLV A;  1O9H A;  5CA0 A;  4ZOL B;  1M4U A;  1P7G A;  2W6I G;  5IY5 B;  1ZLZ A;  4P2Z A;  1P4R A;  2WLI A;  4UB8 Z;  4B3R B;  2R9A A;  4JZ2 A;  2IM9 A;  4GUN A;  4JV5 B;  4UFZ A;  3ABU A;  3N2G B;  4JTA B;  4ICG A;  5D5Q A;  3G4S V;  5TIS Z;  2YXY A;  4QNH B;  3B40 A;  1HNW B;  2Z0A A;  1L0L H;  1NU1 H;  1KKD A;  1IBL B;  4EB6 B;  4DV2 O;  2F4V O;  2R9I A;  3J7A U;  3E22 A;  3DC6 A;  1SQF A;  4X8A A;  2LGW A;  4WFB V;  1VF6 C;  2P22 C;  4CS2 A;  4DO2 A;  2OCC B;  5BMV A;  4AIL C;  1R73 A;  3CCL V;  3ZMT A;  1OCO B;  3FB7 C;  3WB1 A;  4DYL A;  1JJ2 U;  2ZNI A;  1FJG O;  3K59 A;  5GTH Z;  1EN5 A;  4FVM A;  1Z5V A;  4DR2 B;  4LF6 O;  1R1B A;  1XMO B;  5KAF Z;  4IT5 A;  5E1A C;  1H38 A;  4JF3 A;  4JPR A;  4CC6 A;  3CRR A;  2XHB A;  1YHQ V;  1MOF A;  2A3Q A;  4R50 A;  2KQX A;  1SKV A;  3ZBH A;  5IDJ A;  5LGT A;  1QR9 A;  4DR6 B;  1VQK V;  2IJJ A;  2RJZ A;  3JAT B;  1T5E A;  4UCU A;  5B3S C;  3FAV B;  3BA8 A;  4JAA A;  4QE7 A;  1Y66 A;  1BQZ A;  2XND G;  2LQT A;  3M7M X;  1KUQ A;  2Q6A A;  4Q20 A;  1EZJ A;  1AP5 A;  1TVK A;  3CRC A;  5KUM A;  1VQ6 V;  1Q3E A;  3BVO A;  1OCZ B;  5F2V O;  4B3T B;  1VF5 B;  4BW9 A;  1M57 C;  2UU9 O;  1FXV A;  3OEE G;  4H37 A;  4NYK A;  4ZI7 A;  2WLM A;  4I50 B;  4JI2 B;  2PZS A;  1HDJ A;  2UXX A;  4O4L B;  1FD9 A;  1BT8 A;  3E83 A;  5A9G A;  2N05 A;  2RMK B;  2YIB A;  3JAL A;  1QBZ A;  2CTW A;  4J7Z A;  5BR8 B;  3OW2 U;  2EIL B;  4I7Z B;  4L8J A;  1NQT A;  1H2N A;  5CMU A;  2GSM B;  1XNR O;  3FB5 C;  3LDD A;  2RCV A;  4DV6 B;  1EM1 A;  2A0L A;  5B1B B;  1CPY A;  3AG1 C;  2A7W A;  2GTA A;  2WSS G;  4Z1M G;  1V54 C;  3CEI A;  1FJG B;  4RUE A;  3ZHS A;  4O2A A;  3ZRW B;  2GUZ A;  2A79 B;  3K06 A;  1SER A;  4LF6 B;  5B1A B;  5LOV B;  2D3O W;  3L72 H;  1O9G A;  4DUZ O;  2ZE8 A;  2CK3 G;  1B06 A;  1FAF A;  3RYH A;  1VQ8 V;  2KG7 B;  4HNA A;  4I55 A;  5BZB A;  1N34 O;  3ASN C;  3BEH A;  2QTO A;  3AK3 A;  4BIZ A;  1U97 A;  3WFV A;  4JTC B;  4LF5 B;  1VP7 A;  1EFR G;  2OWO A;  1ZAU A;  1HP8 A;  3FB6 C;  4PDL A;  4PEL A;  1XRE A;  4WFG A;  2Y69 B;  4TT3 G;  1PKX A;  4YY3 O;  3ZMU A;  2KB1 A;  2ZXW C;  3ZJZ A;  3PN1 A;  3GB7 C;  3U11 A;  1Q43 A;  3AG4 B;  3CRA A;  3N27 A;  4FK5 C;  4DR5 B;  1SZT A;  4CH6 A;  1MA1 A;  2Z3Y A;  2QWR B;  5J2U B;  2Q73 A;  2F66 C;  2HFE C;  4HBN A;  3CXC U;  3JAW A;  4FLT A;  1OZ0 A;  2DWE C;  2N74 A;  3JD0 A;  3R66 A;  1PD3 A;  1Y76 B;  2IW5 A;  4J10 A;  2DQ0 A;  3JAR A;  2O57 A;  3H01 A;  2P90 A;  2RN9 A;  5CA1 A;  2W0F C;  4FZ0 A;  4O2B B;  2B1I A;  1J5E O;  3T4Z A;  2JVD A;  3CHX A;  2Q4P A;  1M93 A;  4GX2 A;  1XNR B;  3Q4H B;  4I0X A;  1F51 A;  4NTX A;  3N2K A;  1LUV A;  1F4N A;  3OEH G;  2ITD C;  4PJ0 Z;  2JJ1 G;  2DE0 X;  4DR1 O;  1D5N A;  4CS3 A;  2AXT Z;  2ADP A;  1KP2 A;  4GX0 A;  1JR9 A;  1E79 G;  1FXK C;  1NH2 D;  4P9O A;  1YTF D;  2RQ6 A;  1ZWI C;  4DUZ B;  5CB4 B;  2C2A A;  1DLB A;  5LGN A;  4W4L A;  4TSF G;  3ZX6 A;  1MZE A;  2EIN C;  1JFF A;  4LF4 O;  3FYE B;  1Z5W A;  3CCQ V;  1WJZ A;  1PP9 H;  4ASU G;  3RGB A;  4F6E A;  2Q8V A;  4WFF A;  3GWO A;  4GT1 A;  4D7S A;  5JJJ B;  3P3P A;  1H2G A;  2QM8 A;  3G71 V;  2FKX A;  2XAJ A;  1ARO P;  2OYQ A;  2EIJ C;  3OTF A;  1WB8 A;  3E2E A;  2EJR A;  3KCX A;  3E89 A;  4JI0 O;  5LXT B;  4NB5 A;  2BSK A;  4AQY B;  1WPX A;  4DV0 B;  3DTU B;  3OMN B;  1JX9 A;  1AJN A;  3J81 N;  4DK1 A;  4YIP A;  4BIU A;  3DC5 A;  3APQ A;  4PV1 B;  1X4T A;  4J80 A;  4QIW F;  3HKE A;  3WB2 A;  4TWK A;  3L73 H;  3HKC A;  2E5L O;  4O4H B;  4LC1 A;  4JI7 B;  4MTF A;  1XHZ A;  1FPO A;  2ZIN A;  5IYB O;  1I94 O;  1QVF U;  3AG7 A;  5JH7 A;  1UJW B;  4K8Z A;  2YUA A;  3BCC H;  3W7U A;  1XUQ A;  5KHK A;  1IVS A;  2XAS A;  1OHH G;  2UXB O;  5EIB C;  1K5S A;  1M56 C;  1SZX A;  1J5E B;  3OUF A;  3L74 H;  1JPX A;  3E8B A;  2Q0A A;  3AG3 B;  5EZY A;  1PV0 A;  5LYJ A;  1MAB G;  5L3E A;  1RM1 B;  1HNX O;  1MMM A;  4J9Z B;  4DR1 B;  1D5A A;  1V55 C;  4XBF A;  1YTF B;  4X1I A;  1NZ6 A;  3D3I A;  1K34 A;  3CJH A;  3SJC C;  1WA8 B;  4JZG A;  3CCU V;  4DR3 O;  4JI3 B;  3SPI A;  1VQ5 V;  1AP6 A;  4LF4 B;  1XL6 A;  1S76 D;  1NT2 B;  1DTO A;  1EZV H;  3EHB B;  4RQE A;  5L3C A;  2HHH O;  2P06 A;  1RSO B;  4DV4 O;  4FMT A;  2B9Z A;  2MW2 B;  5LA6 B;  3ZRS A;  1GKF A;  2F95 B;  1BL8 A;  3D8C A;  1Q7Y W;  4JI0 B;  2QWO B;  2ODM A;  3ASO B;  4I9W A;  3IC9 A;  3G67 A;  3UO3 A;  2WWW A;  2GTS A;  4EFB A;  4NTY A;  1G1X B;  3EXA A;  3WU2 Z;  1YXB A;  4JYY A;  5EK0 A;  2WLN A;  3O9O A;  4ZOL A;  2HJF C;  2UUC B;  2AGA A;  2L35 A;  3D36 C;  5JVD B;  4FLW A;  3G6B A;  5JCO A;  2N04 A;  5LMN O;  2JJ2 G;  3BPZ A;  2CH7 B;  3ZMS A;  3KZI Z;  4MVS A;  4EFE A;  2GBO A;  3HB3 B;  3N2G A;  3AG2 C;  1E1R G;  3G80 A;  2HG5 C;  2EJ7 A;  1WP8 A;  3QTC A;  5H9C A;  2R72 A;  1AIL A;  2JGD B;  2JDI G;  4EB6 A;  5JWP A;  2EZO A;  1V9P A;  4D7T A;  4DV1 B;  4U7N A;  2UUB B;  2QGN A;  4JI8 O;  1YCI A;  2E76 B;  4YJ3 B;  5LHI A;  4DV7 O;  4MW8 A;  4PA6 A;  4QPK A;  4JI5 O;  2P4K A;  3ZIA G;  4R8C A;  1VQ9 V;  1OCC C;  3A0R A;  2ZDI A;  4CH3 A;  4E4E A;  1M5I A;  5CBG A;  4LWS B;  1SQV H;  4PI0 A;  1ORQ C;  1H2L A;  1JVM A;  5B5E Z;  4DR3 B;  2BE3 A;  3L71 H;  1I7F A;  3C3S A;  1Q86 W;  4A5U B;  1IXB A;  4UCT A;  3CCV V;  1S77 D;  4YHH O;  3JAT A;  1JCH A;  3FAV A;  3A0B Z;  4DV4 B;  5CBF A;  1JJO A;  1YI2 V;  1AI7 A;  1GN4 A;  1SQQ H;  1KQS U;  4F6R B;  2OIE A;  2YEV B;  3C90 A;  2HR3 A;  3TK1 A;  4NTW A;  2Q69 A;  2BOC C;  4GX5 A;  5LHG A;  3ZMV A;  1IZ3 A;  2B5U A;  3B09 A;  3KG2 A;  4NXM B;  3ETD A;  1SQX H;  3BHP A;  3I56 V;  1VF7 A;  4I50 A;  1M1K W;  3UO2 A;  1HNZ O;  4X88 A;  3B8N A;  4OX9 O;  2CTR A;  3ABM B;  1MSD A;  4O4L A;  5IE9 A;  2LFR A;  5LL6 Y;  3LSU A;  1AJP A;  4DRX B;  1M90 W;  4U3F H;  1S5J A;  3D36 A;  4NKG B;  3CC2 V;  3ZHU A;  2M7W A;  3CB2 A;  4JI8 B;  2YID A;  4KUM A;  1W59 A;  1CXZ B;  2DJV A;  4DV7 B;  1DGS A;  3AEI A;  3RYC B;  2GV9 A;  3ML0 A;  4JI5 B;  3OR7 C;  4PDM A;  3ZRW A;  1ENV A;  2CTP A;  3CRQ A;  4FFB B;  2LJ2 A;  4TOI A;  5LOV A;  2FTK A;  1FFX B;  4BW5 A;  3T1H O;  5IWA O;  3SYO A;  1GM9 A;  2CAZ C;  2KG7 A; 
#chains in the Genus database with same CATH homology
 1PNM A;  4PA3 A;  5EBW C;  3E8G A;  4WFG A;  2Y69 B;  3BY6 A;  4H33 A;  1BMF G;  2EIM B;  4F4L A;  4KFM A;  4WFH A;  4TT3 G;  1PKX A;  3K79 A;  4MVU A;  3K03 A;  3ZMU A;  2KB1 A;  2ZXW C;  2X6B A;  3ZJZ A;  3ZRV A;  1E1Q G;  3ZRX A;  3SYA A;  2DYS B;  3ZMZ A;  1DF4 A;  3GB7 C;  3AG4 B;  2Y69 C;  1R6N A;  4FK5 C;  3FKS G;  3B8M A;  2EIM C;  1SZT A;  4E2L A;  4OXS A;  2Z3Y A;  2Z5U A;  1YJ9 V;  1K9M W;  2XAG A;  4JAS A;  3TET A;  1R3J C;  2DYS C;  3ZCC A;  2HFE C;  1XL4 A;  1EBO A;  2QM7 A;  3AG4 C;  3LDC A;  4LBE C;  3CXC U;  2K1E A;  3CCJ V;  5DM6 V;  1TUE B;  1HWY A;  2P7T C;  5L3B A;  1OZ0 A;  2UXN A;  1GMG A;  2DWE C;  3JD0 A;  3STL C;  5EBM C;  3X2Q B;  1PD3 A;  1QLE B;  5J9P C;  2IW5 A;  3LNM B;  2X0L A;  2A9H A;  1PL0 A;  3E8F A;  2DQ0 A;  2WLL B;  1H8E G;  1S0V A;  3SYC A;  1I5X A;  4JTD B;  3P32 A;  2HVK C;  3K08 A;  1J95 A;  1K4C C;  3SPC A;  4XDL A;  3OUS A;  3QO8 A;  2PI4 A;  2R9R B;  2P90 A;  3H01 A;  3IFX A;  3X2Q C;  1GTO A;  1QLE C;  4QJF B;  3AG3 C;  4MSW C;  3CMA V;  3OE7 G;  2W0F C;  1W2B U;  2LP7 A;  2B1I A;  2JEU A;  1K8A W;  3RVY A;  2Q68 A;  3T4Z A;  3CC4 V;  2EIK B;  1K33 A;  2H94 A;  4GX2 A;  2DYR B;  3OMA B;  3E35 A;  2WLL A;  1F51 A;  4MVO A;  5B1N A;  1F4M A;  5L3F A;  4R7C A;  4GX1 A;  3ABL B;  4MVZ A;  1AJQ A;  1F4N A;  3OEH G;  2EIK C;  2ITD C;  1FXK B;  3CCS V;  3ETE A;  2GHY A;  2DYR C;  2IH1 C;  3OGC C;  3JD3 A;  1NVP B;  2JJ1 G;  1RPR A;  5B3S B;  2OTL V;  2ZD9 A;  1R6K A;  1KP2 A;  4GX0 A;  4QPJ A;  5H6Q A;  3ABL C;  1FFT B;  5LBQ A;  1E79 G;  5C93 A;  1FXK C;  3WG7 C;  1NH2 D;  4P9O A;  2WPD G;  1YTF D;  2LFS A;  2EIN B;  4JYC A;  1ZWI C;  3LSQ A;  4FPP A;  2C2A A;  1DLB A;  4MVR A;  4UVB A;  5LGN A;  1VQO V;  2HLD G;  1K5Q A;  4P9P A;  3R65 A;  1K92 A;  4TSF G;  2ZR3 A;  1FXK A;  2EIN C;  3OR6 C;  3FYE B;  4R6Z A;  1YJW V;  3CCQ V;  3QO5 A;  4ASU G;  4WFF A;  2EIJ B;  3GWO A;  1GM8 A;  1KC8 W;  4GT1 A;  3IGA C;  1KEC A;  2XAQ A;  1H2G A;  3ZN0 A;  2QM8 A;  1P7B A;  1QCE A;  3G71 V;  2QE7 G;  2XAJ A;  2IJI A;  1ARO P;  2EIJ C;  3E2E A;  1L1F A;  2EJR A;  3E89 A;  4XDJ A;  5KUK A;  3CCM V;  4QE9 A;  1K97 A;  1WPX A;  3DTU B;  3OMN B;  1JX9 A;  1AJN A;  1M9N A;  2JIZ G;  4P30 A;  3LSS A;  4BIU A;  4XDK A;  5KA5 A;  3CP1 A;  1GK9 A;  1K4D C;  1LNQ A;  1S5H C;  3K0G A;  4HZ3 A;  4QIW F;  1I5Y A;  4TWK A;  3ABK C;  2ZXW B;  3NXS A;  4LC1 A;  2EZP A;  2V1D A;  5DN6 G;  5CA3 A;  1YIJ V;  1JOY A;  1AI4 A;  4MTF A;  2Y48 A;  4PA7 A;  3LUT B;  2ITC C;  3MHS C;  4ZBM A;  3VBB A;  5IYB O;  2IJH A;  1BHB A;  1QVF U;  2IJK A;  4PA4 A;  4RO2 A;  4WFA V;  1UJW B;  3OAA G;  3FYI B;  3W7U A;  1M56 B;  3CYO A;  5LGU A;  4WCE V;  3B77 A;  3TCU A;  2IH3 C;  3CCR V;  2XAS A;  5CN0 A;  1OHH G;  2HKO A;  4ZKI A;  5IYD O;  1OCR B;  1K5S A;  1M56 C;  3JD4 A;  4MVM A;  3OUF A;  1Q82 W;  1MSW D;  5HFL A;  4UVC A;  1JPX A;  3K3W A;  3E8B A;  2P67 A;  1R3I C;  2ZQM A;  1NJI W;  3AG3 B;  2X6C A;  2XAH A;  1OCR C;  2DQ3 A;  1V55 B;  1QVG U;  4L87 A;  1MAB G;  5L3E A;  1RM1 B;  3UM7 A;  1Q81 W;  5EC2 C;  2OT5 A;  4J9Y B;  3CPW U;  3K04 A;  4I5S A;  4J9Z B;  4MVQ A;  3RW0 A;  4UVA A;  4GCZ A;  4LCU C;  2YSU B;  1V55 C;  3FB8 C;  4XBF A;  1YTF B;  2IU0 A;  3D3I A;  1K34 A;  1RM1 C;  3EFF K;  1VQM V;  1W0K G;  3F7V C;  3SPH A;  4CZZ A;  2QA4 V;  3ABT A;  4HYO A;  1VQL V;  3K0D A;  3CCU V;  4G27 B;  4RAI A;  1H8H G;  3SPI A;  2QEX V;  1S72 V;  4RUF A;  4RQF A;  3T2M A;  3SYP A;  3WG7 B;  4U7O A;  3SYQ A;  1VQ5 V;  2X6A A;  2OTJ V;  5EC1 C;  3E8H A;  1XL6 A;  1S76 D;  1K7D A;  2WLI B;  1DTO A;  3EHB B;  4RQE A;  1W0J G;  3JYC A;  4MT8 A;  4YXW G;  5L3C A;  5IYC O;  1QLN A;  1K3E A;  4JYB A;  3STZ C;  1CEZ A;  2EBO A;  2P6J A;  1AI5 A;  1WLE A;  1VQ4 V;  4FMT A;  1G4Y B;  3F7Y C;  3P30 A;  2X7R B;  3ZRS A;  1GKF A;  1VQP V;  1BL8 A;  2NLJ C;  4FJC C;  2WAM A;  1Q7Y W;  1RPO A;  2W6I G;  5IY5 B;  4JAV A;  3ASO B;  3MD0 A;  4I9W A;  4P2Z A;  4X89 A;  1COW G;  1P4R A;  2WLI A;  2JK5 C;  2WWW A;  1SET A;  1YIT V;  3RVZ A;  3JD1 A;  3PJS K;  3CME V;  2Q67 A;  1R3L C;  1YSC A;  4JAU A;  3ABU A;  5EK0 A;  2WLN A;  5IY5 C;  3ASO C;  4JTA B;  4MTG A;  2HJF C;  4PDV A;  3G4S V;  3K9A A;  4QNH B;  2JJ2 G;  2MK3 A;  2H8P C;  1KKD A;  4PA9 A;  1FS0 G;  2XOK G;  2R9I A;  3ZMS A;  4N23 A;  3AG2 B;  4UV8 A;  4X8A A;  4WFB V;  3M99 B;  1N8R W;  1Y4M A;  3ABK B;  3W7S A;  3JD2 A;  3SPJ A;  1YJN V;  4DO2 A;  2NNU A;  2OCC B;  2IU3 A;  2XAF A;  4MVS A;  5L3D A;  3VOU A;  1K73 W;  1JQ0 A;  1CP9 A;  1R73 A;  3HB3 B;  3CCL V;  3ZMT A;  3AG2 C;  1E1R G;  2HVJ C;  2HG5 C;  3CD6 V;  1BHA A;  3OMI B;  3CC7 V;  1OCO B;  3FB7 C;  5H9C A;  2OCC C;  1THZ A;  5FL7 G;  4UUJ C;  2JDI G;  1JJ2 U;  3I55 V;  4MS2 A;  3MHH C;  3ETG A;  2EZO A;  1NBM G;  5B1O A;  1OCO C;  2ATK C;  4U7N A;  5E1A C;  4CBC A;  1H38 A;  1OCC B;  1MG1 A;  4JF3 A;  3W7T A;  4JPR A;  2ZDI C;  2B1G A;  1YHQ V;  2JEX A;  5LHI A;  1MOF A;  3W7X A;  4MW8 A;  5L3G A;  4PA6 A;  4MW3 A;  4QPK A;  4R50 A;  1VQ9 V;  3ZIA G;  4R8C A;  1OCC C;  5IDJ A;  3W7W A;  3A0R A;  5LGT A;  1QR9 A;  1VQK V;  2IJJ A;  2ZDI A;  1QR8 A;  5CBG A;  5B3S C;  4QE7 A;  1ORQ C;  1PNK A;  1JVM A;  1Y66 A;  3T1C A;  2XND G;  2WLK A;  3SPG A;  2AHY A;  4DXW A;  2Q6A A;  4Q20 A;  1EZJ A;  1S3J A;  2DW4 A;  4EKW A;  1Q86 W;  1NR7 A;  1KP3 A;  4JGS A;  1SES A;  1NH2 B;  5KUM A;  3CCV V;  1S77 D;  1M57 B;  1G8M A;  1JCH A;  1B6Q A;  1VQ7 V;  1VQ6 V;  3LDE A;  5CBF A;  1OCZ B;  1YI2 V;  1AI7 A;  2WLJ A;  3QO7 A;  1M57 C;  1KQS U;  1GM7 A;  3JCZ A;  4WFE A;  1FXV A;  3OEE G;  1OCZ C;  4H37 A;  2W6J G;  2WLM A;  2BOB C;  2YEV B;  3RBZ A;  1NR1 A;  3OM3 B;  2ZR2 A;  3QNE A;  2HR3 A;  2UXX A;  3TK1 A;  5KA6 A;  3DGE A;  2Q69 A;  2PI5 A;  3IC7 A;  4G2K A;  2BOC C;  5H6R A;  3E83 A;  4GX5 A;  5LHG A;  2AHZ A;  4UXN A;  3F5W C;  3ZMV A;  3UKM A;  1DF5 A;  1QBZ A;  2B5U A;  2QKS A;  3OFN G;  3OW2 U;  3KG2 A;  4FIP C;  4N21 A;  3ETD A;  2EIL B;  1GO3 F;  4HAM A;  3I56 V;  1KD1 W;  1M1K W;  3AG1 B;  1NQT A;  4WF9 V;  2YEV A;  5CMU A;  2GSM B;  3ZN1 A;  4X88 A;  5GW7 A;  3B8N A;  1VQN V;  3ABM B;  2EIL C;  5LHH A;  1V54 B;  3FB5 C;  3LDD A;  2A0L A;  2LFR A;  1CPY A;  5B1B B;  3AG1 C;  4KP4 A;  4MTX A;  1AJP A;  2WSS G;  4Z1M G;  1PNL A;  1M90 W;  2DWD C;  3ABM C;  1V54 C;  2WLH A;  3SJQ C;  4PDR A;  5B1B C;  4RUE A;  3D36 A;  3E86 A;  3ZRW B;  3HPL C;  1NVP D;  2A79 B;  3K06 A;  3T4D A;  3CC2 V;  1SER A;  5B1A B;  4LP8 A;  2D3O W;  2M7W A;  4MTO A;  3ASN B;  2V7Q G;  2CK3 G;  4KUM A;  3CCE V;  1VQ8 V;  5B1A C;  1NKD A;  5HFM A;  3AEI A;  1ROP A;  3ML0 A;  5BZB A;  2F43 G;  5CBH A;  1FXH A;  3OR7 C;  3ASN C;  5EBL C;  3BEH A;  2QTO A;  4PDM A;  3ZRW A;  4BIZ A;  4UV9 A;  1ENV A;  3WFV A;  4JTC B;  2FTK A;  1EFR G;  1AI6 A;  1SRY A;  4G28 B;  4BW5 A;  3G6E V;  1F23 A;  1R3K C;  3FB6 C;  4PDL A;  4BAY A;  1AR1 B;  3SYO A;  1IXM A;  1GM9 A;  4PEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...