2P6JA

Full-sequence computational design and solution structure of a thermostable protein variant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
MKQWSENVEEKLKEFVKRHQRITQEELHQYAQRLGLNEEAIRQFFEEFEQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Full-sequence Computational Design and Solution Structure of a Thermostable Protein Variant.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
molecule keywords designed engrailed homeodomain variant UVF
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p6jA00
3P30A 1I5XA 5HFLA 1DF5A 3CYOA 4FJCC 4E2LA 3B8MA 3M99B 1EBOA 1F23A 5H9CA 5HFMA 4G2KA 2P6JA 1QBZA 1Y4MA 3B8NA 4N23A 5KA6A 1JPXA 4JGSA 1Y66A 2M7WA 1I5YA 4JPRA 1DLBA 1MOFA 2EZOA 1QR9A 1DF4A 1JQ0A 2LP7A 2X7RB 3GWOA 3H01A 5CMUA 4N21A 3K9AA 5KA5A 3MHHC 3CP1A 1K33A 1QCEA 5CN0A 2MK3A 1MG1A 4FK5C 2EBOA 4FIPC 1ENVA 3MHSC 4JF3A 1SZTA 1K34A 1QR8A 2OT5A 3B77A 3WFVA 2EZPA
chains in the Genus database with same CATH superfamily
4J42A 4UCSA 3AG3B 2IH1C 5C8YB 2Q0AA 2IU0A 2EINC 4UV8A 1FAFA 3QF7A 3ZJZA 5J2UA 2Q67A 4X65O 5JQGB 4LFBB 2CH7B 2G38A 4EB6A 2RQ6A 4QPJA 4AHCA 3GWKC 4JI8B 1P7BA 1H2NA 2WA4A 1Y66A 1WJZA 4UCUA 1VQ8V 4UB8Z 5EBLC 4MS2A 4O4HA 2GV9A 1E1QG 1YITV 3FAVA 1OCOC 3L73H 3JARB 1YJ9V 1N33O 2F4VO 2WLIA 4BIOA 1WA8B 2IBZH 2DWEC 3OUFA 3CX5F 3K3WA 4R7CA 2DQ0A 1E1RG 4F6RB 2YIAA 4X1YB 2W0FC 3ZMTA 2K9PA 4DR7O 1ZUQA 1EN4A 1FXHA 4UVCA 2DQ3A 3H1HH 2EILB 5EBWC 4ASUG 1S0VA 2QSAA 3BA8A 3IC9A 3RYCA 4TV8A 3THOA 1H2SB 2HHHB 5EC1C 2Q73A 2DYSC 3M8AA 5LYJB 1PV0A 3LSQA 4QIWF 5CA1A 2HJFC 4TUYB 1P7GA 4JI1O 4IYIA 2NR5A 4GX2A 3DXRB 4PV1B 3VQYA 4BAYA 3QTCA 1FXKC 2IJKA 3UO2A 1JJOA 4CS4A 4FLZA 1KD1W 1U97A 2QEXV 2QJ1A 4FLYA 4TSFG 4K0KO 4ZOLB 2P67A 4ZHQB 2ZCEA 4FZ0A 5B1NA 1OZ0A 4I0XB 1J5EB 2R9AA 1JFFA 1YDXA 2OT5A 1RPOA 2Y69B 3K9SA 1AJQA 4DR4B 1TVKB 1L0NH 1XMOO 4DV1B 4OX9O 2HVJC 5ITZB 2QR4A 2RN9A 4P30A 3JASA 4J10A 1K4CC 3N2KB 2EX3A 3LUTB 2Q4PA 1PD3A 5H5NA 1RSOA 1QHTA 1Y76A 3R65A 5F2VO 2XNDG 2ZE8A 1H8HG 2FYUH 1SZXA 3H1JH 3BRCA 3D3IA 3CEIA 1GM9A 1VQ9V 3RFRA 3WB2A 1GM7A 1TA8A 3K9AA 3U11A 4LF4B 3T2MA 5LGNA 4WFHA 3LDDA 2ZINA 1Q7YW 4B3SB 1KKCA 2EIMB 4DUYO 3CMEV 1R3JC 4K35A 4NTXA 4CC6A 1I7FA 4FFBB 2AZ2A 1AI7A 2OIGA 5GTHZ 2ZXWC 2P4VA 1MG1A 1THZA 1P84F 5L3FA 1Q81W 2Y69C 1YTFD 2YEVA 5BY1A 1I5XA 3RYHA 2QM7A 3E86A 1R3LC 3M99B 3ABUA 4DV0B 1YSCA 1QBZA 3WG7C 2GBOA 3M7MX 4J7KA 2ZNIA 4X64B 3P3NA 3D8CA 3RBZA 4WFAV 1AJNA 3NXSA 4LF7B 1YEWA 4K0KB 2KSDA 2YC0A 5IYZA 2R9IA 4CH3A 5IYCO 2QWQB 2PUSA 1KUQA 1HR0O 1YJWV 1Y4MA 4YJ3A 4ABMA 3Q4HA 1VQ7V 2DYSB 4JI2O 3QO8A 2QTSA 1Q86W 4DV6B 2BTQA 2QWRB 4MVZA 2Y0PA 1QCEA 1KMIZ 2EIJB 2BE3A 2YUAA 2UUAO 1Q6UA 3W7SA 2UXDO 2E74B 5JCOC 3IJ4A 2UXCB 2FMLA 2JS3A 3F7YC 3HKBB 5CB4A 2IU3A 4D6TH 3HKCB 4BW5A 1SQQH 3FKSG 3H1KH 4TT3G 4B3TB 3ZMVA 4I9QA 5FNVA 1YIJV 2UXBO 1BMFG 2X0LA 4ZOLA 2ODMA 3UM7A 4LH6A 3MDSA 2E5LO 4LF6O 3W7WA 1GN3A 4DR4O 1IBLB 2WLLA 5A9GA 3CS5A 2WLNA 5IWAO 3E8HA 3JATB 1JQ0A 1V55B 5LA6B 4DRXB 4LBEC 3CP1A 1XBLA 1G8MA 4X20A 1S5LZ 4LC1A 3CCMV 3W7XA 4J7JA 3N2KA 2OTLV 2JS5A 4B08A 1XOUA 3UKMA 4QPKA 5J9PC 1N32B 1UFIA 4D7SA 2QTOA 1HWYA 2JGUA 2XOKG 2OTJV 2RNBA 4I9WA 1VQ5V 1OV9A 3ZMUA 5CBFA 3RVYA 5B1BB 2Q0OC 1BQ0A 3I55V 2JIZG 3T1CA 3ETGA 2PYJA 2ZM6O 1IURA 3FB6C 5BR8B 1DGSA 4L87A 1K92A 5KHGA 1VQPV 1S76D 5IJ9B 4BW9A 2BTQB 2XASA 4X9QA 1M93A 3JAWB 5EIBD 1G4YB 2BOCC 3ZHTA 5LHGA 2RDCA 3ICXA 1NKDA 3DC6A 2ZT9B 3IAYA 2ZE5A 3HKBA 5CB4B 3SJQC 4TV9B 4HZ3A 3HKCA 5E79Z 2R9RB 5KX5A 1AVMA 2WLHA 4F6RA 3BY6A 1URFA 4DYLA 4X1YA 1JMKC 3VQXA 2YXLA 3I5DA 3D36A 4J11A 4JYCA 4NXMO 4HNAB 4ZIBA 2ADPA 3CXHF 4TV8B 2UXBB 2JEUA 2YXHA 2XAJA 3ZEDA 4LFAB 4JI2B 1AP5A 1M5IA 3ABLC 5J2UB 4JV5B 1RM1B 1FFXA 5IDJA 3UQ8A 4K8ZA 2LJ2A 4JI3B 1M90W 3S3WA 2CH7A 3C90A 5H9CA 3B8NA 1ZTEA 1V9PA 3K03A 4JI5B 3D36C 5KUKA 2KQXA 2ZDIA 5EIBC 1JCHA 3Q4HB 2ZNJA 4TQFA 1Z5VA 2MK3A 5CBGA 1XL6A 2QWOB 2ITCC 3B8MA 2Q69A 1FXVA 3K08A 5GONA 5IYDO 3H1LH 4PDMA 3RYFB 2KG7A 2N74A 2IH3C 4X62B 5L3DA 1XMQO 3ZRXA 4RWUA 2QWNB 3H1IH 2HVKC 1NTMH 2BCCH 3R66A 1K3EA 1MMMA 2ZIOA 1PNKA 2LW7A 3KCXA 1VQLV 4B7KA 1YJNV 3RN4A 4Z2WA 3AG1B 3KKYA 4KL1A 4MW8A 4D7TA 1LUWA 4HNAA 1JX9A 3AG4C 4X8AA 2LO1A 3F5TA 1D5AA 4FIPC 1R3IC 3SPIA 3QG5A 4LFCO 3E8BA 3OUSA 3OT7A 4FJCC 3OEEG 4CH6A 3WB1A 2E75B 4DR6B 4YXWG 5EYPA 1DLBA 3BAAA 2ILMA 4DV5O 4LNUB 3KCYA 4UUJC 2A0LA 4LF5O 5GTIZ 3UT5B 1U96A 1P49A 1GKFA 4ZHQA 5B1BC 3SJCC 3VQVA 4B3RO 3A0BZ 1US6A 3CE2A 3JAWA 1NI8A 2EJ7A 3STZC 3OGIB 1ZL8A 3D3QA 2W0XA 1H2MA 2A3QA 2X6AA 1WP8A 4JI3O 1K33A 3RYFA 2KG7B 5E1AC 5LHHA 1H2LA 3O9OA 3CD6V 1UPGA 4NTWA 4GYCB 1VP7A 3SJAC 4LFAO 2UUCO 4GKJB 5B3SB 3SYAA 3OEHG 4RAIA 3JALA 4U7OA 4UCVA 2CTRA 4JGSA 4DV2O 4I4TA 1AR5A 2HR3A 4DK0A 3ABKB 5CA0A 5KAFZ 4TQDA 3A0RA 1SQXH 5C8YA 4JTDB 3P30A 2B1GA 3BVOA 4XDKA 4IHJA 4DUYB 1E79G 4FLTA 5JJEB 3CPWU 2EULA 5CA1B 2JRIA 4I5SA 4W4KA 2EIJC 1GM8A 1W59A 4EEQA 2HG5C 3U10A 4MTXA 5JJJB 2Q8VA 3EVKA 4LF6B 4CZZA 4IIJB 3ZRVA 4HYOA 4IL6Z 3APQA 3K57A 2DWDC 1M57B 1VQ4V 3AK3A 4NKGB 2Z5UA 4AQYB 4YY3O 3UO3A 2IJJA 4UB6Z 2EIKB 3OMIB 3SJBC 1HDJA 1JVMA 2ZQMA 1ZL8B 3BA9A 3K0GA 3ZS8C 3QVNA 4LF7O 4PA9A 2H94A 4MVUA 4FM1A 2WLIB 2B1IA 1YXBA 4N21A 3W7TA 1WB7A 1PPJH 3AG3C 2AZ0A 2HJDA 3CCRV 3CCSV 4JAAA 2XAFA 3CSXA 3ZRSA 5L3GA 3ZIAG 4F4LA 5LOVB 2A79B 1HNZO 4KHPB 1NBMG 2HEPA 4MSWC 2BTOA 4QE9A 1Y74A 1L1FA 1QR8A 3KZIZ 1VIBA 3CC2V 5CA3A 3JD1A 2QA4V 4O2AB 5LMUO 1OCCB 4YJ2A 5FPRA 1YI2V 3X2QC 1B04A 4NXNB 2ITDC 3CRQA 4NXMB 4IHJB 3TCUA 5LMNO 3CCJV 4PJ0Z 1WB8A 4DR1O 1ZLZA 4GX0A 2IJIA 1GO3F 4Z1MG 5KHJA 1AI4A 3FB8C 2C2AA 2A7WA 3RYIB 2F43G 1M57C 3VBBA 4MVQA 2VQEB 3T4ZA 1QVGU 2MW2B 3GWOA 5CMUA 1K97A 3RT3C 2EIMC 2WSSG 4ZI7B 4LP8A 1Q6HA 2VWJA 4DRXA 1ENVA 3JYCA 1VF5B 2OYQA 1YTFB 1H2GA 4WFFA 2P5OA 1QU7A 3BHPA 2KB1A 5KHKA 1I08A 5AG2A 1FFXB 4G2KA 1Q82W 4YHHO 3T1YB 2UUBO 4PDRA 3ZMZA 4RUEA 5LGTA 4DV2B 4LF4O 1JR9A 3T4DA 2AHZA 4B7EA 3N2GB 5KA5A 2DJVA 1UJWB 4I4TB 4EB6B 3LNNA 4P2ZA 1JA8A 3VQWA 3TJTA 4DXWA 3FB7C 1SQGA 2DMXA 5DN6G 2OCCB 3IC7A 4ICGA 4X64O 4PA4A 4HAMA 4J9YB 2X7RB 4DR5B 4DW0A 4AI8A 2CE4A 1K4DC 1W0JG 1G6UA 4X1KA 4LWSA 1OCRC 3T1HO 1WA8A 3L75H 3ZHRA 1NZ6A 4PHZA 3B4SA 4JASA 5LMNB 3G4SV 1OHHG 4GZRB 5IE9A 1IVSA 3F7VC 4Q20A 1XNQB 1FKAO 2Q68A 1Q6IA 2IJHA 4XDJA 2GUZA 1PL4A 3ZHQA 4MVOA 3RYCB 4WFBV 1DF5A 2V4DA 5LYJA 1YHQV 1EFRG 4DV5B 3KG2A 2ETNA 2AW9A 2UUAB 1ZAUA 2Y0IA 5KA6A 4LFBO 4FVMA 3DGEA 4Q6GA 1M4UA 3STLC 5FL7G 1YZBA 4L8JA 1N34B 1W2BU 1VEWA 2CTWA 1IXMA 2E5LB 1NVPD 1Q8IA 4LNUA 4J80A 2XAHA 1VF6A 4RO2A 1Q3EA 2N05A 4JYAO 4QJFB 1NTZH 2ZKOA 1O9HA 1EN6A 2H8PC 1VF7A 1H2KA 3JD2A 1PNMA 4DV3O 4KFMA 5LHIA 2CDYA 2ZXWB 1IBLO 4JI4O 4FLVA 3CRRA 1OCOB 4FFKA 2XAQA 1BS3A 5L3BA 3JD3A 2CGNA 4QGPA 3H9VA 4IT5A 1SQVH 5IJ0B 4TV9A 2VQFO 4JI6O 3OTOB 3G6BA 4UV9A 1GN2A 3SYOA 4JZGA 1SQBH 4R6ZA 5BXZA 3ASOC 1GN4A 3L70H 2ZM6B 4AQYO 1CXZB 3BFRA 4KUMA 5IY5C 1YCIA 5J2TA 4UFZA 1PM9A 4OPAA 1WNSA 5LP6C 2AGAA 4X88A 3ZRWA 2F23A 2ZD9A 2V7QG 3X2QB 4H0LB 3RW0A 3CC4V 1SA0A 4LCUC 5CN0A 1B6QA 4FK5C 1H8EG 1TUBB 3ZHSA 4GLXA 4QE7A 5L3EA 5JCOA 1TUEB 4X1IA 4JYYA 2B9ZA 5K1PA 3ML0A 1QLEC 2YIDA 4JPRA 4MVRA 1Z2GA 1HNXO 5KHIA 1T5EA 1Y6XA 1NU1H 2B5UA 2VWKA 4CBCA 1Q43A 4PDVA 4JYBA 4X1KB 3SPHA 4JI5O 3OE7G 5ITZA 1Y67A 1BE3H 4NXNO 3OD4A 1W0KG 2L6LA 4BIZA 5KX5B 3K0DA 4WBNB 1KU9A 2GTSA 2BSKA 4JYAB 4DV3B 4U3JB 5CA0B 4JF3A 5B1AC 4JI7B 4YJ3B 3G71V 1QVFU 5A2QN 3FYIB 3ABMB 1GRJA 4MVSA 1N34O 3G67A 3MHHC 2QKSA 4RQFA 4UXNA 3ZHVA 4NR1A 1BHBA 4XBFA 4FFBA 4BWAA 5HFLA 1N8RW 2P22C 4CC5A 4FLWA 3OR7C 3JSLA 2GDSA 2P06A 4OPHA 5FNVB 4GX5A 5B1OA 1VQMV 1K5SA 2LGQA 2Z0AA 4WFEA 5KHHA 4X66O 4JI4B 4JI0O 2YDEA 5C93A 2F4VB 3RVZA 4CS3A 3CHXA 3APOA 1XEQA 3T1YO 1SQFA 1ZSPA 1XQ8A 1COWG 2UUBB 5LGUA 3VOUA 2ATKC 1BHAA 2JJ1G 4DUZB 1GN6A 3JATA 4JTCB 5JH7A 3FYEB 2NLJC 2JGDB 4N23A 2PI4A 2IW5A 3W7UA 3TXQA 1XI1A 1PP9H 4P9PA 4UCOA 1B3QA 4WCEV 1V54B 2FB5A 2NN4A 2QM4A 3HKEB 4PELA 4EKWA 4LFCB 3TETA 5FLXN 3CCVV 2EINB 3N2GA 1QLEB 2FL4A 1RPRA 2IM9A 4O4JB 4U3JA 1AJPA 3QNEA 1WPBA 3SPJA 1NS1A 3JCUZ 2WLKA 1L0LH 4F6EA 4GT1A 1FXKA 1NQTA 1S5HC 4FLXA 1GMGA 3ETDA 2HLDG 2OCHA 3IFXA 4DR1B 3OFNG 2QKAA 1CPYA 4GKJO 4MTFA 4FPPA 4KXRA 4DV4B 5IY5B 3SYPA 3TXSA 3I56V 3LNMB 4IYHA 4LWSB 4B3TO 1SF9A 3DXRA 2ZR3A 3ABTA 2QE7G 2CUGA 2ZE7A 1ZX3A 2M7WA 2XUMA 5KUMA 3WU2Z 4GX1A 1NTKH 4J41A 1ROPA 2R72A 4DO2A 1JOYA 4QNHB 3B77A 3DSQA 2DOSA 4ZI7A 2EIKC 3A0HZ 4DV1O 2CTPA 1KP2A 3FAVB 2UXCO 3L9DA 3P3PA 2Q7EA 3A2FA 1K9MW 2UUCB 5LA6A 3A8TA 1SQPH 4PDLA 2M6YA 2JGDA 1CP9A 2XT9A 1R3KC 3ETEA 1QLNA 3HR0A 1N36O 1MABG 3JALB 2BSKB 4O4IA 1MSWD 4NVPA 1M56B 1AI5A 1V55C 1NR1A 3E22A 3OR6C 4EFBA 1JJ2U 1BL8A 5BMVB 1N4CA 4JZ2A 5FPOA 4O2AA 1EN5A 4TUYA 3T1HB 4X66B 1S72V 1NVPB 4JI0B 5LP6A 3CYOA 2AXTZ 1QQCA 1SC5B 1SRYA 2HP8A 1XREA 1KKDA 4O4LA 1IX9A 3JSNA 4B3SO 1OCZB 3PJSK 4NYKA 3HKDB 1XNQO 4IIJA 5BR8O 5EK0A 1MZFA 4PD4F 3RYIA 2LQTA 3ZX6A 1IXBA 2ZDIC 1TAEA 3E83A 2EJRA 1HNZB 1BSMA 2Y4TA 4DV4O 1BZKA 2FKXA 2YXYA 2RJZA 1TVKA 1AR4A 4RUFA 2LFSA 2WLMA 1J95A 1BQZA 4DV6O 3C3SA 2DE0X 1MSDA 2A06H 1IDSA 3ASNC 5LMUB 3JASB 3K59A 2JEXA 2EZPA 4H33A 3SGIA 1K7DA 2UXXA 1F4NA 1WLEA 2YS8A 1K5QA 5LBQA 2CK3G 2Z3YA 3TK1A 4I7ZB 5D5PA 4KP4A 2F1MA 1I94O 3JD0A 1VQNV 4CH5A 1OCCC 3CC7V 4FMTA 3AK1A 1FPOA 2AHYA 4I50B 4WFGA 1N36B 4LF9B 4CH4A 3OMNB 4GUNA 1QNMA 2JDIG 2R70A 4I55A 3OW2U 1SERA 2Q7HA 4IGGA 4B3MO 4DR3B 3AG7A 1N33B 3LDCA 5B1AB 2QWPB 3HPLC 4BR6A 4DR2O 3NR7A 2V1DA 1AI6A 3K5LA 3CCLV 4Z1VA 1AR1B 2E76B 4JAUA 4LF8B 4YHHB 2WAMA 5J2TB 5H2FZ 4DR7B 2H3OA 2QDOA 5L3CA 2KKWA 1N32O 1XNRB 5JVDB 4CS2A 2GSMB 4RQEA 1YVWA 4R8CA 2X6CA 3TGUH 2PGGA 1AILA 1WP7A 2W6JG 2F93B 2YIBD 2K1EA 1IZ3A 1EM1A 4B3RB 3E22B 1VQ6V 3GVMA 1R73A 3WFVA 1GTOA 3SYQA 2VS0A 4E2LA 2LFRA 2RCVA 5KAIZ 1F23A 4R50A 3JAMN 5LP6B 4O2BA 1FYJA 4DR6O 3FD9A 4O4LB 4DK1A 3HB3B 2YI9A 3SR2C 4JV5O 5B5EZ 3L71H 4JI1B 5H6QA 2Y4UA 2Q6AA 5LOVA 4UVAA 3L74H 1M1KW 4UVBA 1KP3A 5LL6Y 1R6NA 4DR3O 2YI8A 4YJ2B 1F4MA 4DV7B 3OAAG 5DEDA 3K5NA 4GCZA 1RFYA 4BIUA 5KMGB 3CCEV 2VRZA 3ZBHA 4G27B 1KQSU 1XUQA 2CAZC 3K5MA 3E89A 3OGCC 3FB5C 1XMOB 1RP3B 1GH6A 4NTYA 2VQFB 3J81N 4X1IB 1EZVH 3E2EA 4XDLA 3E35A 5D5QA 2UU9B 4FZ1A 2DYRB 2HFEC 1FD9A 4OGQB 5EZYA 3ZN0A 2QKCA 1XL4A 5BZBA 4JI8O 2UXNA 2EILC 1ZWIC 3AG1C 2D2CB 3RYHB 2N04A 1KC8W 4H44B 1D2DA 1XHXA 2LGWA 1QR9A 1LR1A 3SPGA 3CRAA 5GONB 1N0NA 1VQOV 1S5JA 4I55B 3OTOO 4LF8O 3MD0A 4K8XA 3ABMC 4ZBMA 3SPCA 3E8GA 1N0JA 3JAKA 5LXTA 4FLUA 5IYZB 2XTAA 1IBMB 3ABKC 3N27A 5IYBO 1XILA 4A5UB 3LSUA 4JAVA 4FM0A 1R6TA 5KLVH 1KBHA 3LDEA 1FXKB 1MA1A 3GB7C 2WWWA 2YSUB 1Q5OA 2WLJA 3FFQA 4OXSA 1XDCA 1NH2B 3ASNB 2DN9A 4DW1A 3SDLA 1F7YA 3OMAB 3O65A 1SESA 3G80A 5KMGA 2ZIMA 1I5YA 1VARA 1EZJA 1WN7A 1TUBA 4KHPO 4J7ZA 5CBHA 4LR3A 3HKDA 2WA3A 2LW1A 3UT5A 4NB5A 2YICA 2P4KA 4LF5B 4U7NA 3OM3B 5H6RA 3WB0A 3K06A 1EBOA 4H13B 2A9HA 3ZN1A 4J9ZB 3B40A 4G28B 2EZOA 3LSSA 3H01A 1HR0B 5JWPA 4I0XA 2NNUA 1JFFB 1I94B 1WPXA 3JARA 1FS0G 1OJHA 3CWBH 4X20B 3J7AU 3AG4B 3CRMA 1SKVA 1KB9F 5HFMA 3IGAC 4WBNA 3ASOB 3JAKB 5LXTB 2PYLA 1PNLA 2CTQA 1I0HA 4PA7A 3BPZA 3U0ZA 1DF4A 2E3CA 4JI7O 1D5NA 1RSOB 4B3MB 2O57A 4O4JA 1Y76B 3MHSC 5BMVA 1K34A 1MZEA 2F95B 1MNGA 5IWAB 4PA3A 3MAQA 2F66C 4H37A 1IBKB 1NT2B 4YY3B 4I50A 3ZHUA 3EXAA 4GKKO 2PTMA 3ABLB 1K8AW 4TOIA 1NR7A 4DUZO 3AK2A 1IBMO 3CB2A 2EBOA 3P32A 4U3FH 2P7TC 2WPDG 1R1BA 1R6KA 5EC2C 3B09A 1S77D 2GHYA 3BCCH 3CCQV 2QM8A 4HBNA 1JPXA 4FM2A 3ZMSA 4MT8A 2X6BA 4WF9V 1XNRO 2OIEA 4DR5O 2GUZB 3CMAV 2ZE6A 1A32A 2YEVB 3F5WC 1RM1C 2JK5C 4W4LA 2PZSA 2DW4A 1PL0A 1HNWO 5JH7B 1FJGO 2Q7GA 1B06A 2GTAA 1Z5WA 3J80N 3G6EV 5JVDA 3CRCA 3HKEA 1K73W 5JQGA 3ETQA 3RGBA 5DM6V 4LH7A 3AG2B 3ZCCA 1WAZA 3OTFA 3JCZA 4O4IB 3CCUV 1SZTA 1J5EO 2OWOA 2L35A 1KYOF 4PI0A 3K58A 1ORQC 2PY5A 1V54C 1Y74B 1L8DA 3QO5A 4LF9O 4K3AA 4P9OA 3DTUB 3EHBB 3QO7A 1FFTB 1X59A 2XHBA 3BABA 2VQEO 1OCRB 5IT9N 4MVMA 1MOFA 2CGOA 4X65B 4MTOA 4X89A 1F51A 4YIOA 4UCRA 1GAXA 3SYCA 1OCZC 1TGOA 2UXDB 4DR2B 1S3JA 5IJ0A 2ADQB 4GKKB 1GK9A 2PI5A 2DYRC 1X4TA 2OCCC 2Q9LA 2Y48A 3CJHA 4X62O 4JTAB 1Q90D 1BGYH 1LNQA 3B2EE 4EFEA 1IBKO 1AB3A 3FX7A 5B3SC 5JJNB 4JI6B 4MW3A 2ARHA 4PI2A 4C7UA 2UU9O 1P4RA 5EBMC 1M56C 3K5OA 1VF6C 3ZRWB 2P6JA 3CXCU 3L72H 4PA6A 1SA0B 2PF4E 4DV0O 3EFFK 1CEZA 5EYPB 5TISZ 2XAGA 1H38A 1HP8A 2D3OW 3E8FA 1KECA 4E4EA 1XMQB 3PN1A 1O9GA 2BOBC 3UCSC 4MTGA 3AG2C 1VQKV 1G1XB 1HNXB 1HNWB 5K1XA 4YIPA 2W6IG 3S3XA 1NH2D 3RWRD 5EZYB 1AROP 1NJIW 2JVDA 2ZR2A 5IJ9A 4O4HB 4ZKIA 2YIBA 4O2BB 1LUVA 1HW7A 1PKXA 3JD4A 2HKOA 2FTKA 1DK1A 1BT8A 5GW7A 3WG7B 3K04A 1SS3A 4AILC 2HHHO 1M9NA 5DECA 5B66Z 1XHZA 1FJGB 1BCCH 2RMKB 3AEIA 2LP7A 3CJHB 1VMGA 1SETA 2JJ2G 3K79A 3C3TA 2Q5ZA 1DTOA 2P90A 3BEHA 3DC5A 4UCTA 4TWKA 2QGNA 4DV7O 1YF2A 1AP6A 2WLLB 4OX9B
chains in the Genus database with same CATH topology
4E2LA 2LFRA 2ITCC 3B8MA 2IH1C 3AG3B 1F23A 2Q69A 4KUMA 4R50A 5IY5C 1FXVA 3K08A 5IYDO 4PDMA 2IU0A 2EINC 4UV8A 4X88A 3ZRWA 2IH3C 2ZD9A 3ZJZA 2V7QG 5L3DA 3X2QB 3RW0A 3ZRXA 3CC4V 2Q67A 4LCUC 5CN0A 3HB3B 1B6QA 4FK5C 2HVKC 1H8EG 4QPJA 1K3EA 4QE7A 5L3EA 1TUEB 1PNKA 5H6QA 3ML0A 2Q6AA 1P7BA 1VQLV 1YJNV 1QLEC 1Y66A 4UVAA 4JPRA 4MVRA 1KP3A 3AG1B 4UVBA 1M1KW 1R6NA 4MW8A 1VQ8V 5EBLC 4MS2A 2B5UA 1JX9A 3AG4C 4X8AA 4FIPC 1E1QG 1YITV 1F4MA 4CBCA 3OAAG 1R3IC 1OCOC 3SPIA 4PDVA 4GCZA 3E8BA 3OUSA 4JYBA 3SPHA 1YJ9V 2WLIA 4FJCC 4BIUA 3OE7G 3OEEG 3CCEV 2DWEC 3OUFA 4G27B 3K3WA 4R7CA 1KQSU 4YXWG 1W0KG 3E89A 3OGCC 2DQ0A 4BIZA 1DLBA 1E1RG 3K0DA 3FB5C 4UUJC 2A0LA 2W0FC 3ZMTA 1GKFA 4JF3A 3E2EA 4XDLA 5B1BC 5B1AC 3E35A 1FXHA 4UVCA 2DQ3A 2EILB 5EBWC 4ASUG 2DYRB 3G71V 2HFEC 3ZN0A 5BZBA 1QVFU 1S0VA 1XL4A 2UXNA 2EILC 3STZC 3FYIB 5EC1C 1ZWIC 3AG1C 3ABMB 4MVSA 2DYSC 1KC8W 1QR9A 3SPGA 3LSQA 4QIWF 2X6AA 1VQOV 2HJFC 3MHHC 2QKSA 1K33A 4RQFA 4UXNA 5E1AC 5LHHA 3MD0A 1BHBA 3CD6V 4GX2A 3ABMC 4ZBMA 4BAYA 3SPCA 3E8GA 4XBFA 5B3SB 3SYAA 3OEHG 4RAIA 5HFLA 1FXKC 2IJKA 1N8RW 4U7OA 3ABKC 5IYBO 4JGSA 4JAVA 3OR7C 1KD1W 2QEXV 2HR3A 4GX5A 4TSFG 5B1OA 1VQMV 1K5SA 3ABKB 2P67A 3LDEA 1FXKB 4WFEA 5B1NA 1OZ0A 3A0RA 3GB7C 5C93A 2WWWA 2YSUB 2WLJA 3RVZA 2OT5A 1RPOA 2Y69B 4OXSA 4JTDB 1NH2B 3ASNB 1AJQA 1COWG 3P30A 2B1GA 3VOUA 5LGUA 2ATKC 1BHAA 2JJ1G 4XDKA 1E79G 4JTCB 3OMAB 3CPWU 3FYEB 1SESA 2NLJC 4N23A 2PI4A 2IW5A 3W7UA 2HVJC 4I5SA 1I5YA 2EIJC 1EZJA 1GM8A 2HG5C 4P9PA 4P30A 4MTXA 1K4CC 4WCEV 3LUTB 1V54B 4PELA 4EKWA 5CBHA 1PD3A 3TETA 3CCVV 4CZZA 2EINB 3ZRVA 4HYOA 1QLEB 2DWDC 1M57B 1VQ4V 1RPRA 2Z5UA 1AJPA 3QNEA 3R65A 3OM3B 2XNDG 4U7NA 5H6RA 3K06A 1EBOA 1H8HG 3SPJA 3D3IA 2A9HA 1GM9A 2IJJA 2WLKA 1VQ9V 3ZN1A 2EIKB 3OMIB 4J9ZB 4GT1A 1FXKA 1JVMA 1NQTA 1S5HC 4G28B 2EZOA 3LSSA 1GM7A 3H01A 2ZQMA 1GMGA 3ETDA 3K9AA 3K0GA 2NNUA 2HLDG 3IFXA 3OFNG 3T2MA 1WPXA 5LGNA 4PA9A 1CPYA 2H94A 4MVUA 4MTFA 1FS0G 2WLIB 4WFHA 4FPPA 2B1IA 3LDDA 1Q7YW 5IY5B 3SYPA 3AG4B 4N21A 3I56V 3W7TA 3LNMB 3AG3C 2EIMB 3CMEV 1R3JC 2ZR3A 5HFMA 3IGAC 3CCRV 3CCSV 3ASOB 3ABTA 2QE7G 1PNLA 1AI7A 2M7WA 4PA7A 2XAFA 1DF4A 5KUMA 3ZRSA 5L3GA 3ZIAG 4F4LA 4GX1A 2A79B 1NBMG 1ROPA 2ZXWC 1MG1A 1THZA 4DO2A 3MHSC 4MSWC 4QE9A 1L1FA 4QNHB 5L3FA 1JOYA 1K34A 1QR8A 1Q81W 3B77A 3CC2V 5CA3A 2Y69C 3JD1A 2QA4V 1YTFD 2EIKC 2YEVA 4PA3A 1OCCB 4H37A 1I5XA 1KP2A 2QM7A 3E86A 1R3LC 3M99B 1YI2V 3ABUA 3X2QC 1K9MW 1YSCA 1QBZA 2ITDC 3WG7C 3TCUA 3ABLB 4PDLA 3CCJV 1K8AW 3RBZA 4WFAV 1CP9A 1AJNA 3NXSA 1NR7A 4GX0A 2IJIA 1GO3F 1R3KC 3ETEA 2EBOA 1QLNA 3P32A 1MABG 2R9IA 2P7TC 4Z1MG 2WPDG 5IYCO 1AI4A 1R6KA 3FB8C 5EC2C 2C2AA 1S77D 1MSWD 2F43G 1M56B 2GHYA 1AI5A 1YJWV 3CCQV 1Y4MA 1V55C 1M57C 2QM8A 3VBBA 1JPXA 4MVQA 1NR1A 3OR6C 2DYSB 3T4ZA 1VQ7V 1BL8A 4MT8A 3GWOA 3QO8A 3ZMSA 2X6BA 1QVGU 4WF9V 1Q86W 5CMUA 1K97A 4MVZA 3CMAV 2EIMC 1QCEA 2WSSG 2YEVB 4LP8A 2EIJB 3F5WC 1ENVA 3JYCA 1RM1C 3W7SA 2JK5C 1YTFB 1H2GA 4WFFA 2DW4A 1PL0A 1S72V 1NVPB 2KB1A 3G6EV 3CYOA 3F7YC 2IU3A 1SRYA 4G2KA 1Q82W 1KKDA 4PDRA 3ZMZA 4RUEA 4BW5A 5LGTA 1OCZB 3FKSG 1K73W 3PJSK 4TT3G 3T4DA 2AHZA 5KA5A 1UJWB 5DM6V 3ZMVA 4P2ZA 3AG2B 3ZCCA 1YIJV 5EK0A 1BMFG 2X0LA 3JCZA 4DXWA 1SZTA 3CCUV 3FB7C 3UM7A 5DN6G 2ZDIC 1ORQC 3E83A 2EJRA 2OCCB 3IC7A 3W7WA 1V54C 3QO5A 4P9OA 3DTUB 2WLLA 3EHBB 3QO7A 1FFTB 4PA4A 2WLNA 4HAMA 1OCRB 4J9YB 4MVMA 3E8HA 1MOFA 2LFSA 4RUFA 2WLMA 1JQ0A 2X7RB 1J95A 1V55B 4MTOA 4X89A 1F51A 4LBEC 1K4DC 1W0JG 3CP1A 1G8MA 3ASNC 4LC1A 3CCMV 3W7XA 3SYCA 1OCZC 1OCRC 2OTLV 2JEXA 3UKMA 4QPKA 2EZPA 1S3JA 4H33A 5J9PC 1K7DA 2UXXA 1GK9A 1F4NA 2QTOA 1HWYA 2DYRC 2PI5A 1WLEA 2XOKG 2OTJV 2OCCC 1JJ2U 4I9WA 1VQ5V 2Y48A 4JASA 3ZMUA 1K5QA 5LBQA 2CK3G 2Z3YA 3TK1A 1OHHG 4JTAB 3RVYA 5CBFA 3G4SV 5B1BB 3F7VC 3I55V 2JIZG 4Q20A 1LNQA 3T1CA 3ETGA 4KP4A 3FB6C 4L87A 1K92A 5B3SC 2Q68A 3JD0A 1VQPV 1VQNV 1S76D 1OCCC 4MW3A 3CC7V 2IJHA 4FMTA 4XDJA 2XASA 2AHYA 1P4RA 4MVOA 4WFGA 1G4YB 4WFBV 2BOCC 1DF5A 5EBMC 1M56C 5LHGA 3OMNB 1YHQV 1EFRG 1NKDA 3ZRWB 2JDIG 2P6JA 3KG2A 3CXCU 5KA6A 4PA6A 3DGEA 3STLC 5FL7G 3SJQC 3EFFK 3OW2U 4HZ3A 1W2BU 1CEZA 1H38A 2XAGA 1SERA 2R9RB 1IXMA 2WLHA 2D3OW 3BY6A 3E8FA 1NVPD 1KECA 3LDCA 5B1AB 2XAHA 3HPLC 4RO2A 2BOBC 2V1DA 4MTGA 1AI6A 3AG2C 1VQKV 3CCLV 3D36A 4QJFB 2H8PC 2W6IG 1AR1B 1NH2D 3JD2A 4JYCA 1AROP 1PNMA 1NJIW 4JAUA 4KFMA 5LHIA 2WAMA 2ZR2A 4ZKIA 2JEUA 1PKXA 2ZXWB 2XAJA 3JD4A 5L3CA 2HKOA 2FTKA 3ABLC 1OCOB 1RM1B 2XAQA 5GW7A 5L3BA 3WG7B 3K04A 5IDJA 3JD3A 2GSMB 4RQEA 1M90W 4R8CA 1M9NA 2X6CA 5H9CA 3B8NA 3K03A 5KUKA 2W6JG 3AEIA 2LP7A 2ZDIA 2K1EA 1SETA 2JJ2G 1JCHA 3K79A 1VQ6V 1DTOA 4UV9A 2MK3A 2P90A 5CBGA 1R73A 1XL6A 3BEHA 3SYOA 4TWKA 3WFVA 1GTOA 4R6ZA 3SYQA 3ASOC 2WLLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P30 A;  1I5X A;  5HFL A;  1DF5 A;  3CYO A;  4FJC C;  4E2L A;  3B8M A;  3M99 B;  1EBO A;  1F23 A;  5H9C A;  5HFM A;  4G2K A;  2P6J A;  1QBZ A;  1Y4M A;  3B8N A;  4N23 A;  5KA6 A;  1JPX A;  4JGS A;  1Y66 A;  2M7W A;  1I5Y A;  4JPR A;  1DLB A;  1MOF A;  2EZO A;  1QR9 A;  1DF4 A;  1JQ0 A;  2LP7 A;  2X7R B;  3GWO A;  3H01 A;  5CMU A;  4N21 A;  3K9A A;  5KA5 A;  3MHH C;  3CP1 A;  1K33 A;  1QCE A;  5CN0 A;  2MK3 A;  1MG1 A;  4FK5 C;  2EBO A;  4FIP C;  1ENV A;  3MHS C;  4JF3 A;  1SZT A;  1K34 A;  1QR8 A;  2OT5 A;  3B77 A;  3WFV A;  2EZP A; 
#chains in the Genus database with same CATH topology
 4J42 A;  4UCS A;  3AG3 B;  2IH1 C;  5C8Y B;  2Q0A A;  2IU0 A;  2EIN C;  4UV8 A;  1FAF A;  3QF7 A;  3ZJZ A;  5J2U A;  2Q67 A;  4X65 O;  5JQG B;  4LFB B;  2CH7 B;  2G38 A;  4EB6 A;  2RQ6 A;  4QPJ A;  4AHC A;  3GWK C;  4JI8 B;  1P7B A;  1H2N A;  2WA4 A;  1Y66 A;  1WJZ A;  4UCU A;  1VQ8 V;  4UB8 Z;  5EBL C;  4MS2 A;  4O4H A;  2GV9 A;  1E1Q G;  1YIT V;  3FAV A;  1OCO C;  3L73 H;  3JAR B;  1YJ9 V;  1N33 O;  2F4V O;  2WLI A;  4BIO A;  1WA8 B;  2IBZ H;  2DWE C;  3OUF A;  3CX5 F;  3K3W A;  4R7C A;  2DQ0 A;  1E1R G;  4F6R B;  2YIA A;  4X1Y B;  2W0F C;  3ZMT A;  2K9P A;  4DR7 O;  1ZUQ A;  1EN4 A;  1FXH A;  4UVC A;  2DQ3 A;  3H1H H;  2EIL B;  5EBW C;  4ASU G;  1S0V A;  2QSA A;  3BA8 A;  3IC9 A;  3RYC A;  4TV8 A;  3THO A;  1H2S B;  2HHH B;  5EC1 C;  2Q73 A;  2DYS C;  3M8A A;  5LYJ B;  1PV0 A;  3LSQ A;  4QIW F;  5CA1 A;  2HJF C;  4TUY B;  1P7G A;  4JI1 O;  4IYI A;  2NR5 A;  4GX2 A;  3DXR B;  4PV1 B;  3VQY A;  4BAY A;  3QTC A;  1FXK C;  2IJK A;  3UO2 A;  1JJO A;  4CS4 A;  4FLZ A;  1KD1 W;  1U97 A;  2QEX V;  2QJ1 A;  4FLY A;  4TSF G;  4K0K O;  4ZOL B;  2P67 A;  4ZHQ B;  2ZCE A;  4FZ0 A;  5B1N A;  1OZ0 A;  4I0X B;  1J5E B;  2R9A A;  1JFF A;  1YDX A;  2OT5 A;  1RPO A;  2Y69 B;  3K9S A;  1AJQ A;  4DR4 B;  1TVK B;  1L0N H;  1XMO O;  4DV1 B;  4OX9 O;  2HVJ C;  5ITZ B;  2QR4 A;  2RN9 A;  4P30 A;  3JAS A;  4J10 A;  1K4C C;  3N2K B;  2EX3 A;  3LUT B;  2Q4P A;  1PD3 A;  5H5N A;  1RSO A;  1QHT A;  1Y76 A;  3R65 A;  5F2V O;  2XND G;  2ZE8 A;  1H8H G;  2FYU H;  1SZX A;  3H1J H;  3BRC A;  3D3I A;  3CEI A;  1GM9 A;  1VQ9 V;  3RFR A;  3WB2 A;  1GM7 A;  1TA8 A;  3K9A A;  3U11 A;  4LF4 B;  3T2M A;  5LGN A;  4WFH A;  3LDD A;  2ZIN A;  1Q7Y W;  4B3S B;  1KKC A;  2EIM B;  4DUY O;  3CME V;  1R3J C;  4K35 A;  4NTX A;  4CC6 A;  1I7F A;  4FFB B;  2AZ2 A;  1AI7 A;  2OIG A;  5GTH Z;  2ZXW C;  2P4V A;  1MG1 A;  1THZ A;  1P84 F;  5L3F A;  1Q81 W;  2Y69 C;  1YTF D;  2YEV A;  5BY1 A;  1I5X A;  3RYH A;  2QM7 A;  3E86 A;  1R3L C;  3M99 B;  3ABU A;  4DV0 B;  1YSC A;  1QBZ A;  3WG7 C;  2GBO A;  3M7M X;  4J7K A;  2ZNI A;  4X64 B;  3P3N A;  3D8C A;  3RBZ A;  4WFA V;  1AJN A;  3NXS A;  4LF7 B;  1YEW A;  4K0K B;  2KSD A;  2YC0 A;  5IYZ A;  2R9I A;  4CH3 A;  5IYC O;  2QWQ B;  2PUS A;  1KUQ A;  1HR0 O;  1YJW V;  1Y4M A;  4YJ3 A;  4ABM A;  3Q4H A;  1VQ7 V;  2DYS B;  4JI2 O;  3QO8 A;  2QTS A;  1Q86 W;  4DV6 B;  2BTQ A;  2QWR B;  4MVZ A;  2Y0P A;  1QCE A;  1KMI Z;  2EIJ B;  2BE3 A;  2YUA A;  2UUA O;  1Q6U A;  3W7S A;  2UXD O;  2E74 B;  5JCO C;  3IJ4 A;  2UXC B;  2FML A;  2JS3 A;  3F7Y C;  3HKB B;  5CB4 A;  2IU3 A;  4D6T H;  3HKC B;  4BW5 A;  1SQQ H;  3FKS G;  3H1K H;  4TT3 G;  4B3T B;  3ZMV A;  4I9Q A;  5FNV A;  1YIJ V;  2UXB O;  1BMF G;  2X0L A;  4ZOL A;  2ODM A;  3UM7 A;  4LH6 A;  3MDS A;  2E5L O;  4LF6 O;  3W7W A;  1GN3 A;  4DR4 O;  1IBL B;  2WLL A;  5A9G A;  3CS5 A;  2WLN A;  5IWA O;  3E8H A;  3JAT B;  1JQ0 A;  1V55 B;  5LA6 B;  4DRX B;  4LBE C;  3CP1 A;  1XBL A;  1G8M A;  4X20 A;  1S5L Z;  4LC1 A;  3CCM V;  3W7X A;  4J7J A;  3N2K A;  2OTL V;  2JS5 A;  4B08 A;  1XOU A;  3UKM A;  4QPK A;  5J9P C;  1N32 B;  1UFI A;  4D7S A;  2QTO A;  1HWY A;  2JGU A;  2XOK G;  2OTJ V;  2RNB A;  4I9W A;  1VQ5 V;  1OV9 A;  3ZMU A;  5CBF A;  3RVY A;  5B1B B;  2Q0O C;  1BQ0 A;  3I55 V;  2JIZ G;  3T1C A;  3ETG A;  2PYJ A;  2ZM6 O;  1IUR A;  3FB6 C;  5BR8 B;  1DGS A;  4L87 A;  1K92 A;  5KHG A;  1VQP V;  1S76 D;  5IJ9 B;  4BW9 A;  2BTQ B;  2XAS A;  4X9Q A;  1M93 A;  3JAW B;  5EIB D;  1G4Y B;  2BOC C;  3ZHT A;  5LHG A;  2RDC A;  3ICX A;  1NKD A;  3DC6 A;  2ZT9 B;  3IAY A;  2ZE5 A;  3HKB A;  5CB4 B;  3SJQ C;  4TV9 B;  4HZ3 A;  3HKC A;  5E79 Z;  2R9R B;  5KX5 A;  1AVM A;  2WLH A;  4F6R A;  3BY6 A;  1URF A;  4DYL A;  4X1Y A;  1JMK C;  3VQX A;  2YXL A;  3I5D A;  3D36 A;  4J11 A;  4JYC A;  4NXM O;  4HNA B;  4ZIB A;  2ADP A;  3CXH F;  4TV8 B;  2UXB B;  2JEU A;  2YXH A;  2XAJ A;  3ZED A;  4LFA B;  4JI2 B;  1AP5 A;  1M5I A;  3ABL C;  5J2U B;  4JV5 B;  1RM1 B;  1FFX A;  5IDJ A;  3UQ8 A;  4K8Z A;  2LJ2 A;  4JI3 B;  1M90 W;  3S3W A;  2CH7 A;  3C90 A;  5H9C A;  3B8N A;  1ZTE A;  1V9P A;  3K03 A;  4JI5 B;  3D36 C;  5KUK A;  2KQX A;  2ZDI A;  5EIB C;  1JCH A;  3Q4H B;  2ZNJ A;  4TQF A;  1Z5V A;  2MK3 A;  5CBG A;  1XL6 A;  2QWO B;  2ITC C;  3B8M A;  2Q69 A;  1FXV A;  3K08 A;  5GON A;  5IYD O;  3H1L H;  4PDM A;  3RYF B;  2KG7 A;  2N74 A;  2IH3 C;  4X62 B;  5L3D A;  1XMQ O;  3ZRX A;  4RWU A;  2QWN B;  3H1I H;  2HVK C;  1NTM H;  2BCC H;  3R66 A;  1K3E A;  1MMM A;  2ZIO A;  1PNK A;  2LW7 A;  3KCX A;  1VQL V;  4B7K A;  1YJN V;  3RN4 A;  4Z2W A;  3AG1 B;  3KKY A;  4KL1 A;  4MW8 A;  4D7T A;  1LUW A;  4HNA A;  1JX9 A;  3AG4 C;  4X8A A;  2LO1 A;  3F5T A;  1D5A A;  4FIP C;  1R3I C;  3SPI A;  3QG5 A;  4LFC O;  3E8B A;  3OUS A;  3OT7 A;  4FJC C;  3OEE G;  4CH6 A;  3WB1 A;  2E75 B;  4DR6 B;  4YXW G;  5EYP A;  1DLB A;  3BAA A;  2ILM A;  4DV5 O;  4LNU B;  3KCY A;  4UUJ C;  2A0L A;  4LF5 O;  5GTI Z;  3UT5 B;  1U96 A;  1P49 A;  1GKF A;  4ZHQ A;  5B1B C;  3SJC C;  3VQV A;  4B3R O;  3A0B Z;  1US6 A;  3CE2 A;  3JAW A;  1NI8 A;  2EJ7 A;  3STZ C;  3OGI B;  1ZL8 A;  3D3Q A;  2W0X A;  1H2M A;  2A3Q A;  2X6A A;  1WP8 A;  4JI3 O;  1K33 A;  3RYF A;  2KG7 B;  5E1A C;  5LHH A;  1H2L A;  3O9O A;  3CD6 V;  1UPG A;  4NTW A;  4GYC B;  1VP7 A;  3SJA C;  4LFA O;  2UUC O;  4GKJ B;  5B3S B;  3SYA A;  3OEH G;  4RAI A;  3JAL A;  4U7O A;  4UCV A;  2CTR A;  4JGS A;  4DV2 O;  4I4T A;  1AR5 A;  2HR3 A;  4DK0 A;  3ABK B;  5CA0 A;  5KAF Z;  4TQD A;  3A0R A;  1SQX H;  5C8Y A;  4JTD B;  3P30 A;  2B1G A;  3BVO A;  4XDK A;  4IHJ A;  4DUY B;  1E79 G;  4FLT A;  5JJE B;  3CPW U;  2EUL A;  5CA1 B;  2JRI A;  4I5S A;  4W4K A;  2EIJ C;  1GM8 A;  1W59 A;  4EEQ A;  2HG5 C;  3U10 A;  4MTX A;  5JJJ B;  2Q8V A;  3EVK A;  4LF6 B;  4CZZ A;  4IIJ B;  3ZRV A;  4HYO A;  4IL6 Z;  3APQ A;  3K57 A;  2DWD C;  1M57 B;  1VQ4 V;  3AK3 A;  4NKG B;  2Z5U A;  4AQY B;  4YY3 O;  3UO3 A;  2IJJ A;  4UB6 Z;  2EIK B;  3OMI B;  3SJB C;  1HDJ A;  1JVM A;  2ZQM A;  1ZL8 B;  3BA9 A;  3K0G A;  3ZS8 C;  3QVN A;  4LF7 O;  4PA9 A;  2H94 A;  4MVU A;  4FM1 A;  2WLI B;  2B1I A;  1YXB A;  4N21 A;  3W7T A;  1WB7 A;  1PPJ H;  3AG3 C;  2AZ0 A;  2HJD A;  3CCR V;  3CCS V;  4JAA A;  2XAF A;  3CSX A;  3ZRS A;  5L3G A;  3ZIA G;  4F4L A;  5LOV B;  2A79 B;  1HNZ O;  4KHP B;  1NBM G;  2HEP A;  4MSW C;  2BTO A;  4QE9 A;  1Y74 A;  1L1F A;  1QR8 A;  3KZI Z;  1VIB A;  3CC2 V;  5CA3 A;  3JD1 A;  2QA4 V;  4O2A B;  5LMU O;  1OCC B;  4YJ2 A;  5FPR A;  1YI2 V;  3X2Q C;  1B04 A;  4NXN B;  2ITD C;  3CRQ A;  4NXM B;  4IHJ B;  3TCU A;  5LMN O;  3CCJ V;  4PJ0 Z;  1WB8 A;  4DR1 O;  1ZLZ A;  4GX0 A;  2IJI A;  1GO3 F;  4Z1M G;  5KHJ A;  1AI4 A;  3FB8 C;  2C2A A;  2A7W A;  3RYI B;  2F43 G;  1M57 C;  3VBB A;  4MVQ A;  2VQE B;  3T4Z A;  1QVG U;  2MW2 B;  3GWO A;  5CMU A;  1K97 A;  3RT3 C;  2EIM C;  2WSS G;  4ZI7 B;  4LP8 A;  1Q6H A;  2VWJ A;  4DRX A;  1ENV A;  3JYC A;  1VF5 B;  2OYQ A;  1YTF B;  1H2G A;  4WFF A;  2P5O A;  1QU7 A;  3BHP A;  2KB1 A;  5KHK A;  1I08 A;  5AG2 A;  1FFX B;  4G2K A;  1Q82 W;  4YHH O;  3T1Y B;  2UUB O;  4PDR A;  3ZMZ A;  4RUE A;  5LGT A;  4DV2 B;  4LF4 O;  1JR9 A;  3T4D A;  2AHZ A;  4B7E A;  3N2G B;  5KA5 A;  2DJV A;  1UJW B;  4I4T B;  4EB6 B;  3LNN A;  4P2Z A;  1JA8 A;  3VQW A;  3TJT A;  4DXW A;  3FB7 C;  1SQG A;  2DMX A;  5DN6 G;  2OCC B;  3IC7 A;  4ICG A;  4X64 O;  4PA4 A;  4HAM A;  4J9Y B;  2X7R B;  4DR5 B;  4DW0 A;  4AI8 A;  2CE4 A;  1K4D C;  1W0J G;  1G6U A;  4X1K A;  4LWS A;  1OCR C;  3T1H O;  1WA8 A;  3L75 H;  3ZHR A;  1NZ6 A;  4PHZ A;  3B4S A;  4JAS A;  5LMN B;  3G4S V;  1OHH G;  4GZR B;  5IE9 A;  1IVS A;  3F7V C;  4Q20 A;  1XNQ B;  1FKA O;  2Q68 A;  1Q6I A;  2IJH A;  4XDJ A;  2GUZ A;  1PL4 A;  3ZHQ A;  4MVO A;  3RYC B;  4WFB V;  1DF5 A;  2V4D A;  5LYJ A;  1YHQ V;  1EFR G;  4DV5 B;  3KG2 A;  2ETN A;  2AW9 A;  2UUA B;  1ZAU A;  2Y0I A;  5KA6 A;  4LFB O;  4FVM A;  3DGE A;  4Q6G A;  1M4U A;  3STL C;  5FL7 G;  1YZB A;  4L8J A;  1N34 B;  1W2B U;  1VEW A;  2CTW A;  1IXM A;  2E5L B;  1NVP D;  1Q8I A;  4LNU A;  4J80 A;  2XAH A;  1VF6 A;  4RO2 A;  1Q3E A;  2N05 A;  4JYA O;  4QJF B;  1NTZ H;  2ZKO A;  1O9H A;  1EN6 A;  2H8P C;  1VF7 A;  1H2K A;  3JD2 A;  1PNM A;  4DV3 O;  4KFM A;  5LHI A;  2CDY A;  2ZXW B;  1IBL O;  4JI4 O;  4FLV A;  3CRR A;  1OCO B;  4FFK A;  2XAQ A;  1BS3 A;  5L3B A;  3JD3 A;  2CGN A;  4QGP A;  3H9V A;  4IT5 A;  1SQV H;  5IJ0 B;  4TV9 A;  2VQF O;  4JI6 O;  3OTO B;  3G6B A;  4UV9 A;  1GN2 A;  3SYO A;  4JZG A;  1SQB H;  4R6Z A;  5BXZ A;  3ASO C;  1GN4 A;  3L70 H;  2ZM6 B;  4AQY O;  1CXZ B;  3BFR A;  4KUM A;  5IY5 C;  1YCI A;  5J2T A;  4UFZ A;  1PM9 A;  4OPA A;  1WNS A;  5LP6 C;  2AGA A;  4X88 A;  3ZRW A;  2F23 A;  2ZD9 A;  2V7Q G;  3X2Q B;  4H0L B;  3RW0 A;  3CC4 V;  1SA0 A;  4LCU C;  5CN0 A;  1B6Q A;  4FK5 C;  1H8E G;  1TUB B;  3ZHS A;  4GLX A;  4QE7 A;  5L3E A;  5JCO A;  1TUE B;  4X1I A;  4JYY A;  2B9Z A;  5K1P A;  3ML0 A;  1QLE C;  2YID A;  4JPR A;  4MVR A;  1Z2G A;  1HNX O;  5KHI A;  1T5E A;  1Y6X A;  1NU1 H;  2B5U A;  2VWK A;  4CBC A;  1Q43 A;  4PDV A;  4JYB A;  4X1K B;  3SPH A;  4JI5 O;  3OE7 G;  5ITZ A;  1Y67 A;  1BE3 H;  4NXN O;  3OD4 A;  1W0K G;  2L6L A;  4BIZ A;  5KX5 B;  3K0D A;  4WBN B;  1KU9 A;  2GTS A;  2BSK A;  4JYA B;  4DV3 B;  4U3J B;  5CA0 B;  4JF3 A;  5B1A C;  4JI7 B;  4YJ3 B;  3G71 V;  1QVF U;  5A2Q N;  3FYI B;  3ABM B;  1GRJ A;  4MVS A;  1N34 O;  3G67 A;  3MHH C;  2QKS A;  4RQF A;  4UXN A;  3ZHV A;  4NR1 A;  1BHB A;  4XBF A;  4FFB A;  4BWA A;  5HFL A;  1N8R W;  2P22 C;  4CC5 A;  4FLW A;  3OR7 C;  3JSL A;  2GDS A;  2P06 A;  4OPH A;  5FNV B;  4GX5 A;  5B1O A;  1VQM V;  1K5S A;  2LGQ A;  2Z0A A;  4WFE A;  5KHH A;  4X66 O;  4JI4 B;  4JI0 O;  2YDE A;  5C93 A;  2F4V B;  3RVZ A;  4CS3 A;  3CHX A;  3APO A;  1XEQ A;  3T1Y O;  1SQF A;  1ZSP A;  1XQ8 A;  1COW G;  2UUB B;  5LGU A;  3VOU A;  2ATK C;  1BHA A;  2JJ1 G;  4DUZ B;  1GN6 A;  3JAT A;  4JTC B;  5JH7 A;  3FYE B;  2NLJ C;  2JGD B;  4N23 A;  2PI4 A;  2IW5 A;  3W7U A;  3TXQ A;  1XI1 A;  1PP9 H;  4P9P A;  4UCO A;  1B3Q A;  4WCE V;  1V54 B;  2FB5 A;  2NN4 A;  2QM4 A;  3HKE B;  4PEL A;  4EKW A;  4LFC B;  3TET A;  5FLX N;  3CCV V;  2EIN B;  3N2G A;  1QLE B;  2FL4 A;  1RPR A;  2IM9 A;  4O4J B;  4U3J A;  1AJP A;  3QNE A;  1WPB A;  3SPJ A;  1NS1 A;  3JCU Z;  2WLK A;  1L0L H;  4F6E A;  4GT1 A;  1FXK A;  1NQT A;  1S5H C;  4FLX A;  1GMG A;  3ETD A;  2HLD G;  2OCH A;  3IFX A;  4DR1 B;  3OFN G;  2QKA A;  1CPY A;  4GKJ O;  4MTF A;  4FPP A;  4KXR A;  4DV4 B;  5IY5 B;  3SYP A;  3TXS A;  3I56 V;  3LNM B;  4IYH A;  4LWS B;  4B3T O;  1SF9 A;  3DXR A;  2ZR3 A;  3ABT A;  2QE7 G;  2CUG A;  2ZE7 A;  1ZX3 A;  2M7W A;  2XUM A;  5KUM A;  3WU2 Z;  4GX1 A;  1NTK H;  4J41 A;  1ROP A;  2R72 A;  4DO2 A;  1JOY A;  4QNH B;  3B77 A;  3DSQ A;  2DOS A;  4ZI7 A;  2EIK C;  3A0H Z;  4DV1 O;  2CTP A;  1KP2 A;  3FAV B;  2UXC O;  3L9D A;  3P3P A;  2Q7E A;  3A2F A;  1K9M W;  2UUC B;  5LA6 A;  3A8T A;  1SQP H;  4PDL A;  2M6Y A;  2JGD A;  1CP9 A;  2XT9 A;  1R3K C;  3ETE A;  1QLN A;  3HR0 A;  1N36 O;  1MAB G;  3JAL B;  2BSK B;  4O4I A;  1MSW D;  4NVP A;  1M56 B;  1AI5 A;  1V55 C;  1NR1 A;  3E22 A;  3OR6 C;  4EFB A;  1JJ2 U;  1BL8 A;  5BMV B;  1N4C A;  4JZ2 A;  5FPO A;  4O2A A;  1EN5 A;  4TUY A;  3T1H B;  4X66 B;  1S72 V;  1NVP B;  4JI0 B;  5LP6 A;  3CYO A;  2AXT Z;  1QQC A;  1SC5 B;  1SRY A;  2HP8 A;  1XRE A;  1KKD A;  4O4L A;  1IX9 A;  3JSN A;  4B3S O;  1OCZ B;  3PJS K;  4NYK A;  3HKD B;  1XNQ O;  4IIJ A;  5BR8 O;  5EK0 A;  1MZF A;  4PD4 F;  3RYI A;  2LQT A;  3ZX6 A;  1IXB A;  2ZDI C;  1TAE A;  3E83 A;  2EJR A;  1HNZ B;  1BSM A;  2Y4T A;  4DV4 O;  1BZK A;  2FKX A;  2YXY A;  2RJZ A;  1TVK A;  1AR4 A;  4RUF A;  2LFS A;  2WLM A;  1J95 A;  1BQZ A;  4DV6 O;  3C3S A;  2DE0 X;  1MSD A;  2A06 H;  1IDS A;  3ASN C;  5LMU B;  3JAS B;  3K59 A;  2JEX A;  2EZP A;  4H33 A;  3SGI A;  1K7D A;  2UXX A;  1F4N A;  1WLE A;  2YS8 A;  1K5Q A;  5LBQ A;  2CK3 G;  2Z3Y A;  3TK1 A;  4I7Z B;  5D5P A;  4KP4 A;  2F1M A;  1I94 O;  3JD0 A;  1VQN V;  4CH5 A;  1OCC C;  3CC7 V;  4FMT A;  3AK1 A;  1FPO A;  2AHY A;  4I50 B;  4WFG A;  1N36 B;  4LF9 B;  4CH4 A;  3OMN B;  4GUN A;  1QNM A;  2JDI G;  2R70 A;  4I55 A;  3OW2 U;  1SER A;  2Q7H A;  4IGG A;  4B3M O;  4DR3 B;  3AG7 A;  1N33 B;  3LDC A;  5B1A B;  2QWP B;  3HPL C;  4BR6 A;  4DR2 O;  3NR7 A;  2V1D A;  1AI6 A;  3K5L A;  3CCL V;  4Z1V A;  1AR1 B;  2E76 B;  4JAU A;  4LF8 B;  4YHH B;  2WAM A;  5J2T B;  5H2F Z;  4DR7 B;  2H3O A;  2QDO A;  5L3C A;  2KKW A;  1N32 O;  1XNR B;  5JVD B;  4CS2 A;  2GSM B;  4RQE A;  1YVW A;  4R8C A;  2X6C A;  3TGU H;  2PGG A;  1AIL A;  1WP7 A;  2W6J G;  2F93 B;  2YIB D;  2K1E A;  1IZ3 A;  1EM1 A;  4B3R B;  3E22 B;  1VQ6 V;  3GVM A;  1R73 A;  3WFV A;  1GTO A;  3SYQ A;  2VS0 A;  4E2L A;  2LFR A;  2RCV A;  5KAI Z;  1F23 A;  4R50 A;  3JAM N;  5LP6 B;  4O2B A;  1FYJ A;  4DR6 O;  3FD9 A;  4O4L B;  4DK1 A;  3HB3 B;  2YI9 A;  3SR2 C;  4JV5 O;  5B5E Z;  3L71 H;  4JI1 B;  5H6Q A;  2Y4U A;  2Q6A A;  5LOV A;  4UVA A;  3L74 H;  1M1K W;  4UVB A;  1KP3 A;  5LL6 Y;  1R6N A;  4DR3 O;  2YI8 A;  4YJ2 B;  1F4M A;  4DV7 B;  3OAA G;  5DED A;  3K5N A;  4GCZ A;  1RFY A;  4BIU A;  5KMG B;  3CCE V;  2VRZ A;  3ZBH A;  4G27 B;  1KQS U;  1XUQ A;  2CAZ C;  3K5M A;  3E89 A;  3OGC C;  3FB5 C;  1XMO B;  1RP3 B;  1GH6 A;  4NTY A;  2VQF B;  3J81 N;  4X1I B;  1EZV H;  3E2E A;  4XDL A;  3E35 A;  5D5Q A;  2UU9 B;  4FZ1 A;  2DYR B;  2HFE C;  1FD9 A;  4OGQ B;  5EZY A;  3ZN0 A;  2QKC A;  1XL4 A;  5BZB A;  4JI8 O;  2UXN A;  2EIL C;  1ZWI C;  3AG1 C;  2D2C B;  3RYH B;  2N04 A;  1KC8 W;  4H44 B;  1D2D A;  1XHX A;  2LGW A;  1QR9 A;  1LR1 A;  3SPG A;  3CRA A;  5GON B;  1N0N A;  1VQO V;  1S5J A;  4I55 B;  3OTO O;  4LF8 O;  3MD0 A;  4K8X A;  3ABM C;  4ZBM A;  3SPC A;  3E8G A;  1N0J A;  3JAK A;  5LXT A;  4FLU A;  5IYZ B;  2XTA A;  1IBM B;  3ABK C;  3N27 A;  5IYB O;  1XIL A;  4A5U B;  3LSU A;  4JAV A;  4FM0 A;  1R6T A;  5KLV H;  1KBH A;  3LDE A;  1FXK B;  1MA1 A;  3GB7 C;  2WWW A;  2YSU B;  1Q5O A;  2WLJ A;  3FFQ A;  4OXS A;  1XDC A;  1NH2 B;  3ASN B;  2DN9 A;  4DW1 A;  3SDL A;  1F7Y A;  3OMA B;  3O65 A;  1SES A;  3G80 A;  5KMG A;  2ZIM A;  1I5Y A;  1VAR A;  1EZJ A;  1WN7 A;  1TUB A;  4KHP O;  4J7Z A;  5CBH A;  4LR3 A;  3HKD A;  2WA3 A;  2LW1 A;  3UT5 A;  4NB5 A;  2YIC A;  2P4K A;  4LF5 B;  4U7N A;  3OM3 B;  5H6R A;  3WB0 A;  3K06 A;  1EBO A;  4H13 B;  2A9H A;  3ZN1 A;  4J9Z B;  3B40 A;  4G28 B;  2EZO A;  3LSS A;  3H01 A;  1HR0 B;  5JWP A;  4I0X A;  2NNU A;  1JFF B;  1I94 B;  1WPX A;  3JAR A;  1FS0 G;  1OJH A;  3CWB H;  4X20 B;  3J7A U;  3AG4 B;  3CRM A;  1SKV A;  1KB9 F;  5HFM A;  3IGA C;  4WBN A;  3ASO B;  3JAK B;  5LXT B;  2PYL A;  1PNL A;  2CTQ A;  1I0H A;  4PA7 A;  3BPZ A;  3U0Z A;  1DF4 A;  2E3C A;  4JI7 O;  1D5N A;  1RSO B;  4B3M B;  2O57 A;  4O4J A;  1Y76 B;  3MHS C;  5BMV A;  1K34 A;  1MZE A;  2F95 B;  1MNG A;  5IWA B;  4PA3 A;  3MAQ A;  2F66 C;  4H37 A;  1IBK B;  1NT2 B;  4YY3 B;  4I50 A;  3ZHU A;  3EXA A;  4GKK O;  2PTM A;  3ABL B;  1K8A W;  4TOI A;  1NR7 A;  4DUZ O;  3AK2 A;  1IBM O;  3CB2 A;  2EBO A;  3P32 A;  4U3F H;  2P7T C;  2WPD G;  1R1B A;  1R6K A;  5EC2 C;  3B09 A;  1S77 D;  2GHY A;  3BCC H;  3CCQ V;  2QM8 A;  4HBN A;  1JPX A;  4FM2 A;  3ZMS A;  4MT8 A;  2X6B A;  4WF9 V;  1XNR O;  2OIE A;  4DR5 O;  2GUZ B;  3CMA V;  2ZE6 A;  1A32 A;  2YEV B;  3F5W C;  1RM1 C;  2JK5 C;  4W4L A;  2PZS A;  2DW4 A;  1PL0 A;  1HNW O;  5JH7 B;  1FJG O;  2Q7G A;  1B06 A;  2GTA A;  1Z5W A;  3J80 N;  3G6E V;  5JVD A;  3CRC A;  3HKE A;  1K73 W;  5JQG A;  3ETQ A;  3RGB A;  5DM6 V;  4LH7 A;  3AG2 B;  3ZCC A;  1WAZ A;  3OTF A;  3JCZ A;  4O4I B;  3CCU V;  1SZT A;  1J5E O;  2OWO A;  2L35 A;  1KYO F;  4PI0 A;  3K58 A;  1ORQ C;  2PY5 A;  1V54 C;  1Y74 B;  1L8D A;  3QO5 A;  4LF9 O;  4K3A A;  4P9O A;  3DTU B;  3EHB B;  3QO7 A;  1FFT B;  1X59 A;  2XHB A;  3BAB A;  2VQE O;  1OCR B;  5IT9 N;  4MVM A;  1MOF A;  2CGO A;  4X65 B;  4MTO A;  4X89 A;  1F51 A;  4YIO A;  4UCR A;  1GAX A;  3SYC A;  1OCZ C;  1TGO A;  2UXD B;  4DR2 B;  1S3J A;  5IJ0 A;  2ADQ B;  4GKK B;  1GK9 A;  2PI5 A;  2DYR C;  1X4T A;  2OCC C;  2Q9L A;  2Y48 A;  3CJH A;  4X62 O;  4JTA B;  1Q90 D;  1BGY H;  1LNQ A;  3B2E E;  4EFE A;  1IBK O;  1AB3 A;  3FX7 A;  5B3S C;  5JJN B;  4JI6 B;  4MW3 A;  2ARH A;  4PI2 A;  4C7U A;  2UU9 O;  1P4R A;  5EBM C;  1M56 C;  3K5O A;  1VF6 C;  3ZRW B;  2P6J A;  3CXC U;  3L72 H;  4PA6 A;  1SA0 B;  2PF4 E;  4DV0 O;  3EFF K;  1CEZ A;  5EYP B;  5TIS Z;  2XAG A;  1H38 A;  1HP8 A;  2D3O W;  3E8F A;  1KEC A;  4E4E A;  1XMQ B;  3PN1 A;  1O9G A;  2BOB C;  3UCS C;  4MTG A;  3AG2 C;  1VQK V;  1G1X B;  1HNX B;  1HNW B;  5K1X A;  4YIP A;  2W6I G;  3S3X A;  1NH2 D;  3RWR D;  5EZY B;  1ARO P;  1NJI W;  2JVD A;  2ZR2 A;  5IJ9 A;  4O4H B;  4ZKI A;  2YIB A;  4O2B B;  1LUV A;  1HW7 A;  1PKX A;  3JD4 A;  2HKO A;  2FTK A;  1DK1 A;  1BT8 A;  5GW7 A;  3WG7 B;  3K04 A;  1SS3 A;  4AIL C;  2HHH O;  1M9N A;  5DEC A;  5B66 Z;  1XHZ A;  1FJG B;  1BCC H;  2RMK B;  3AEI A;  2LP7 A;  3CJH B;  1VMG A;  1SET A;  2JJ2 G;  3K79 A;  3C3T A;  2Q5Z A;  1DTO A;  2P90 A;  3BEH A;  3DC5 A;  4UCT A;  4TWK A;  2QGN A;  4DV7 O;  1YF2 A;  1AP6 A;  2WLL B;  4OX9 B; 
#chains in the Genus database with same CATH homology
 4E2L A;  2LFR A;  2ITC C;  3B8M A;  2IH1 C;  3AG3 B;  1F23 A;  2Q69 A;  4KUM A;  4R50 A;  5IY5 C;  1FXV A;  3K08 A;  5IYD O;  4PDM A;  2IU0 A;  2EIN C;  4UV8 A;  4X88 A;  3ZRW A;  2IH3 C;  2ZD9 A;  3ZJZ A;  2V7Q G;  5L3D A;  3X2Q B;  3RW0 A;  3ZRX A;  3CC4 V;  2Q67 A;  4LCU C;  5CN0 A;  3HB3 B;  1B6Q A;  4FK5 C;  2HVK C;  1H8E G;  4QPJ A;  1K3E A;  4QE7 A;  5L3E A;  1TUE B;  1PNK A;  5H6Q A;  3ML0 A;  2Q6A A;  1P7B A;  1VQL V;  1YJN V;  1QLE C;  1Y66 A;  4UVA A;  4JPR A;  4MVR A;  1KP3 A;  3AG1 B;  4UVB A;  1M1K W;  1R6N A;  4MW8 A;  1VQ8 V;  5EBL C;  4MS2 A;  2B5U A;  1JX9 A;  3AG4 C;  4X8A A;  4FIP C;  1E1Q G;  1YIT V;  1F4M A;  4CBC A;  3OAA G;  1R3I C;  1OCO C;  3SPI A;  4PDV A;  4GCZ A;  3E8B A;  3OUS A;  4JYB A;  3SPH A;  1YJ9 V;  2WLI A;  4FJC C;  4BIU A;  3OE7 G;  3OEE G;  3CCE V;  2DWE C;  3OUF A;  4G27 B;  3K3W A;  4R7C A;  1KQS U;  4YXW G;  1W0K G;  3E89 A;  3OGC C;  2DQ0 A;  4BIZ A;  1DLB A;  1E1R G;  3K0D A;  3FB5 C;  4UUJ C;  2A0L A;  2W0F C;  3ZMT A;  1GKF A;  4JF3 A;  3E2E A;  4XDL A;  5B1B C;  5B1A C;  3E35 A;  1FXH A;  4UVC A;  2DQ3 A;  2EIL B;  5EBW C;  4ASU G;  2DYR B;  3G71 V;  2HFE C;  3ZN0 A;  5BZB A;  1QVF U;  1S0V A;  1XL4 A;  2UXN A;  2EIL C;  3STZ C;  3FYI B;  5EC1 C;  1ZWI C;  3AG1 C;  3ABM B;  4MVS A;  2DYS C;  1KC8 W;  1QR9 A;  3SPG A;  3LSQ A;  4QIW F;  2X6A A;  1VQO V;  2HJF C;  3MHH C;  2QKS A;  1K33 A;  4RQF A;  4UXN A;  5E1A C;  5LHH A;  3MD0 A;  1BHB A;  3CD6 V;  4GX2 A;  3ABM C;  4ZBM A;  4BAY A;  3SPC A;  3E8G A;  4XBF A;  5B3S B;  3SYA A;  3OEH G;  4RAI A;  5HFL A;  1FXK C;  2IJK A;  1N8R W;  4U7O A;  3ABK C;  5IYB O;  4JGS A;  4JAV A;  3OR7 C;  1KD1 W;  2QEX V;  2HR3 A;  4GX5 A;  4TSF G;  5B1O A;  1VQM V;  1K5S A;  3ABK B;  2P67 A;  3LDE A;  1FXK B;  4WFE A;  5B1N A;  1OZ0 A;  3A0R A;  3GB7 C;  5C93 A;  2WWW A;  2YSU B;  2WLJ A;  3RVZ A;  2OT5 A;  1RPO A;  2Y69 B;  4OXS A;  4JTD B;  1NH2 B;  3ASN B;  1AJQ A;  1COW G;  3P30 A;  2B1G A;  3VOU A;  5LGU A;  2ATK C;  1BHA A;  2JJ1 G;  4XDK A;  1E79 G;  4JTC B;  3OMA B;  3CPW U;  3FYE B;  1SES A;  2NLJ C;  4N23 A;  2PI4 A;  2IW5 A;  3W7U A;  2HVJ C;  4I5S A;  1I5Y A;  2EIJ C;  1EZJ A;  1GM8 A;  2HG5 C;  4P9P A;  4P30 A;  4MTX A;  1K4C C;  4WCE V;  3LUT B;  1V54 B;  4PEL A;  4EKW A;  5CBH A;  1PD3 A;  3TET A;  3CCV V;  4CZZ A;  2EIN B;  3ZRV A;  4HYO A;  1QLE B;  2DWD C;  1M57 B;  1VQ4 V;  1RPR A;  2Z5U A;  1AJP A;  3QNE A;  3R65 A;  3OM3 B;  2XND G;  4U7N A;  5H6R A;  3K06 A;  1EBO A;  1H8H G;  3SPJ A;  3D3I A;  2A9H A;  1GM9 A;  2IJJ A;  2WLK A;  1VQ9 V;  3ZN1 A;  2EIK B;  3OMI B;  4J9Z B;  4GT1 A;  1FXK A;  1JVM A;  1NQT A;  1S5H C;  4G28 B;  2EZO A;  3LSS A;  1GM7 A;  3H01 A;  2ZQM A;  1GMG A;  3ETD A;  3K9A A;  3K0G A;  2NNU A;  2HLD G;  3IFX A;  3OFN G;  3T2M A;  1WPX A;  5LGN A;  4PA9 A;  1CPY A;  2H94 A;  4MVU A;  4MTF A;  1FS0 G;  2WLI B;  4WFH A;  4FPP A;  2B1I A;  3LDD A;  1Q7Y W;  5IY5 B;  3SYP A;  3AG4 B;  4N21 A;  3I56 V;  3W7T A;  3LNM B;  3AG3 C;  2EIM B;  3CME V;  1R3J C;  2ZR3 A;  5HFM A;  3IGA C;  3CCR V;  3CCS V;  3ASO B;  3ABT A;  2QE7 G;  1PNL A;  1AI7 A;  2M7W A;  4PA7 A;  2XAF A;  1DF4 A;  5KUM A;  3ZRS A;  5L3G A;  3ZIA G;  4F4L A;  4GX1 A;  2A79 B;  1NBM G;  1ROP A;  2ZXW C;  1MG1 A;  1THZ A;  4DO2 A;  3MHS C;  4MSW C;  4QE9 A;  1L1F A;  4QNH B;  5L3F A;  1JOY A;  1K34 A;  1QR8 A;  1Q81 W;  3B77 A;  3CC2 V;  5CA3 A;  2Y69 C;  3JD1 A;  2QA4 V;  1YTF D;  2EIK C;  2YEV A;  4PA3 A;  1OCC B;  4H37 A;  1I5X A;  1KP2 A;  2QM7 A;  3E86 A;  1R3L C;  3M99 B;  1YI2 V;  3ABU A;  3X2Q C;  1K9M W;  1YSC A;  1QBZ A;  2ITD C;  3WG7 C;  3TCU A;  3ABL B;  4PDL A;  3CCJ V;  1K8A W;  3RBZ A;  4WFA V;  1CP9 A;  1AJN A;  3NXS A;  1NR7 A;  4GX0 A;  2IJI A;  1GO3 F;  1R3K C;  3ETE A;  2EBO A;  1QLN A;  3P32 A;  1MAB G;  2R9I A;  2P7T C;  4Z1M G;  2WPD G;  5IYC O;  1AI4 A;  1R6K A;  3FB8 C;  5EC2 C;  2C2A A;  1S77 D;  1MSW D;  2F43 G;  1M56 B;  2GHY A;  1AI5 A;  1YJW V;  3CCQ V;  1Y4M A;  1V55 C;  1M57 C;  2QM8 A;  3VBB A;  1JPX A;  4MVQ A;  1NR1 A;  3OR6 C;  2DYS B;  3T4Z A;  1VQ7 V;  1BL8 A;  4MT8 A;  3GWO A;  3QO8 A;  3ZMS A;  2X6B A;  1QVG U;  4WF9 V;  1Q86 W;  5CMU A;  1K97 A;  4MVZ A;  3CMA V;  2EIM C;  1QCE A;  2WSS G;  2YEV B;  4LP8 A;  2EIJ B;  3F5W C;  1ENV A;  3JYC A;  1RM1 C;  3W7S A;  2JK5 C;  1YTF B;  1H2G A;  4WFF A;  2DW4 A;  1PL0 A;  1S72 V;  1NVP B;  2KB1 A;  3G6E V;  3CYO A;  3F7Y C;  2IU3 A;  1SRY A;  4G2K A;  1Q82 W;  1KKD A;  4PDR A;  3ZMZ A;  4RUE A;  4BW5 A;  5LGT A;  1OCZ B;  3FKS G;  1K73 W;  3PJS K;  4TT3 G;  3T4D A;  2AHZ A;  5KA5 A;  1UJW B;  5DM6 V;  3ZMV A;  4P2Z A;  3AG2 B;  3ZCC A;  1YIJ V;  5EK0 A;  1BMF G;  2X0L A;  3JCZ A;  4DXW A;  1SZT A;  3CCU V;  3FB7 C;  3UM7 A;  5DN6 G;  2ZDI C;  1ORQ C;  3E83 A;  2EJR A;  2OCC B;  3IC7 A;  3W7W A;  1V54 C;  3QO5 A;  4P9O A;  3DTU B;  2WLL A;  3EHB B;  3QO7 A;  1FFT B;  4PA4 A;  2WLN A;  4HAM A;  1OCR B;  4J9Y B;  4MVM A;  3E8H A;  1MOF A;  2LFS A;  4RUF A;  2WLM A;  1JQ0 A;  2X7R B;  1J95 A;  1V55 B;  4MTO A;  4X89 A;  1F51 A;  4LBE C;  1K4D C;  1W0J G;  3CP1 A;  1G8M A;  3ASN C;  4LC1 A;  3CCM V;  3W7X A;  3SYC A;  1OCZ C;  1OCR C;  2OTL V;  2JEX A;  3UKM A;  4QPK A;  2EZP A;  1S3J A;  4H33 A;  5J9P C;  1K7D A;  2UXX A;  1GK9 A;  1F4N A;  2QTO A;  1HWY A;  2DYR C;  2PI5 A;  1WLE A;  2XOK G;  2OTJ V;  2OCC C;  1JJ2 U;  4I9W A;  1VQ5 V;  2Y48 A;  4JAS A;  3ZMU A;  1K5Q A;  5LBQ A;  2CK3 G;  2Z3Y A;  3TK1 A;  1OHH G;  4JTA B;  3RVY A;  5CBF A;  3G4S V;  5B1B B;  3F7V C;  3I55 V;  2JIZ G;  4Q20 A;  1LNQ A;  3T1C A;  3ETG A;  4KP4 A;  3FB6 C;  4L87 A;  1K92 A;  5B3S C;  2Q68 A;  3JD0 A;  1VQP V;  1VQN V;  1S76 D;  1OCC C;  4MW3 A;  3CC7 V;  2IJH A;  4FMT A;  4XDJ A;  2XAS A;  2AHY A;  1P4R A;  4MVO A;  4WFG A;  1G4Y B;  4WFB V;  2BOC C;  1DF5 A;  5EBM C;  1M56 C;  5LHG A;  3OMN B;  1YHQ V;  1EFR G;  1NKD A;  3ZRW B;  2JDI G;  2P6J A;  3KG2 A;  3CXC U;  5KA6 A;  4PA6 A;  3DGE A;  3STL C;  5FL7 G;  3SJQ C;  3EFF K;  3OW2 U;  4HZ3 A;  1W2B U;  1CEZ A;  1H38 A;  2XAG A;  1SER A;  2R9R B;  1IXM A;  2WLH A;  2D3O W;  3BY6 A;  3E8F A;  1NVP D;  1KEC A;  3LDC A;  5B1A B;  2XAH A;  3HPL C;  4RO2 A;  2BOB C;  2V1D A;  4MTG A;  1AI6 A;  3AG2 C;  1VQK V;  3CCL V;  3D36 A;  4QJF B;  2H8P C;  2W6I G;  1AR1 B;  1NH2 D;  3JD2 A;  4JYC A;  1ARO P;  1PNM A;  1NJI W;  4JAU A;  4KFM A;  5LHI A;  2WAM A;  2ZR2 A;  4ZKI A;  2JEU A;  1PKX A;  2ZXW B;  2XAJ A;  3JD4 A;  5L3C A;  2HKO A;  2FTK A;  3ABL C;  1OCO B;  1RM1 B;  2XAQ A;  5GW7 A;  5L3B A;  3WG7 B;  3K04 A;  5IDJ A;  3JD3 A;  2GSM B;  4RQE A;  1M90 W;  4R8C A;  1M9N A;  2X6C A;  5H9C A;  3B8N A;  3K03 A;  5KUK A;  2W6J G;  3AEI A;  2LP7 A;  2ZDI A;  2K1E A;  1SET A;  2JJ2 G;  1JCH A;  3K79 A;  1VQ6 V;  1DTO A;  4UV9 A;  2MK3 A;  2P90 A;  5CBG A;  1R73 A;  1XL6 A;  3BEH A;  3SYO A;  4TWK A;  3WFV A;  1GTO A;  4R6Z A;  3SYQ A;  3ASO C;  2WLL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...