2P6JA

Full-sequence computational design and solution structure of a thermostable protein variant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
MKQWSENVEEKLKEFVKRHQRITQEELHQYAQRLGLNEEAIRQFFEEFEQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords designed engrailed homeodomain variant UVF
publication title Full-sequence Computational Design and Solution Structure of a Thermostable Protein Variant.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p6jA00
1SZTA 1DLBA 1K33A 1ENVA 1QR9A 2X7RB 5KA5A 3GWOA 3CYOA 1MOFA 3B8NA 3P30A 1DF4A 1Y66A 2LP7A 4FJCC 2P6JA 4N21A 5CN0A 5KA6A 1I5YA 4JGSA 3K9AA 3M99B 1QR8A 1JPXA 1EBOA 2EZOA 1DF5A 1QBZA 5HFLA 4FIPC 2EZPA 3B77A 2OT5A 1Y4MA 2EBOA 5CMUA 4N23A 1I5XA 4E2LA 1QCEA 1JQ0A 1F23A 2M7WA 3WFVA 3CP1A 4JF3A 1K34A 2MK3A 1MG1A 3H01A 3MHSC 4FK5C 5HFMA 5H9CA 4JPRA 3B8MA 4G2KA 3MHHC
chains in the Genus database with same CATH superfamily
5KAFZ 5FNVA 3CCSV 4ZBMA 4MT8A 3D36A 4N21A 1B3QA 1PNKA 1EBOA 1K73W 2KG7A 2JDIG 1VQ4V 1VQ6V 3L72H 1AROP 3AEIA 1FYJA 4IYHA 4OX9O 3CCEV 3APQA 4B3RO 1NH2B 4LF8B 1AVMA 1SS3A 4GUNA 1KU9A 1SA0A 2LFSA 3HR0A 1S5HC 2NNUA 1F7YA 3CX5F 2ITCC 2WLLA 1M5IA 3T1HO 1SC5B 1AR5A 1BMFG 3DXRA 1YI2V 3L74H 2DW4A 1N33O 4PJ0Z 4RUEA 4FIPC 3OEEG 4BIZA 5GTIZ 4HZ3A 2F43G 3E22A 3CD6V 2K9PA 5LYJA 2R9IA 1WNSA 2HLDG 3H1LH 2JK5C 2QM8A 4PI0A 2UXDB 1OCRC 1GN2A 3K9SA 1XDCA 2Q73A 1R3IC 3FB7C 1JPXA 4K0KO 3KKYA 4DV3O 3E86A 1N8RW 2RNBA 3RBZA 4OGQB 4X62B 5F2VO 1F51A 1VQOV 2Q0AA 5LP6C 1M56C 1FD9A 1RSOB 4JI0O 4DR3O 5LGNA 1Q81W 3RVYA 4IGGA 1IDSA 5B1NA 3B4SA 4F6RB 3RYCA 1X59A 5B3SB 2HHHB 3ETDA 2Y0IA 5CBGA 1KUQA 1DTOA 1JVMA 2QR4A 1XUQA 2DOSA 2ODMA 4EEQA 5B1BC 2EIJC 4NR1A 1JFFB 5B1BB 2DQ3A 4JTAB 4WFAV 1TGOA 3RYFA 1IURA 3OUSA 3T1CA 4MS2A 1OCOC 1K33A 4NXNO 1Y76B 1Q6IA 3W7SA 1QQCA 1FKAO 3K5OA 3LSQA 5DM6V 3K5LA 4EKWA 4GZRB 4TSFG 4OX9B 1YTFD 1P49A 4CH4A 1XHZA 1M9NA 4J10A 4ZI7B 1G1XB 4FM1A 4LF9O 1JX9A 2ZE8A 3JSNA 1N33B 2V7QG 2ZE7A 4MVMA 3CCQV 2IJKA 4I55A 4XDLA 2P4KA 2EULA 1QHTA 2WA4A 4B7KA 5JWPA 4MW3A 2UUBB 3ZMZA 1X4TA 4J9YB 1QLEB 1K5SA 2RDCA 3CE2A 2QWPB 3OT7A 4AQYO 4K0KB 5JH7B 3SPCA 3QF7A 4FFBA 3I5DA 1I5XA 1VEWA 2ZNJA 3BA9A 1ZLZA 3HKDA 1SQGA 3CCLV 4DR3B 4JI0B 5JCOC 1MA1A 3IGAC 3E35A 3CMEV 4DV7O 1M1KW 2EJ7A 3SYAA 2PUSA 4BAYA 1FFXB 1QVGU 4QPJA 1W0JG 1Q3EA 3ABMC 1Q86W 3E89A 2IU3A 4NTYA 1I94B 3E83A 1CPYA 4JI5O 3SDLA 3RN4A 1AI4A 1HDJA 3F5TA 5GONB 1S5JA 4DV4B 3QO8A 4NXNB 1S77D 2BSKB 2O57A 2PTMA 2LGWA 3GWKC 2AZ0A 4DUZB 3JAWA 4UV9A 2UXNA 1YDXA 3UQ8A 5CA1B 4X64O 1VIBA 2QTOA 4ZHQA 3S3WA 3SJQC 3BAAA 2ADPA 3K3WA 2DJVA 1SQBH 4JI3O 1AI6A 3QTCA 5H9CA 2LFRA 3FKSG 2ZIMA 4X1YA 3K08A 4MVZA 3VBBA 3BVOA 3D36C 4TV8A 4LF9B 1YITV 4QGPA 1FS0G 3LDDA 2ZNIA 2JJ2G 3SR2C 2GHYA 2IW5A 5IJ9B 1HNWO 4WFGA 4TQFA 3OE7G 2H8PC 2ZDIA 4MVUA 1NTMH 2JIZG 2VWKA 3FAVB 5L3EA 2WLMA 5LXTB 1SZTA 4DR1O 4PA9A 3CC4V 2EILB 3MAQA 4DK0A 5LGTA 2IJJA 4LBEC 4WFBV 4AQYB 1JOYA 2Y48A 4YIOA 5ITZB 1H8HG 1Q6UA 4BR6A 4MVSA 4X66O 5BMVB 3EFFK 1LR1A 4X8AA 3K59A 4QE9A 4HAMA 2Z3YA 3OTOO 3L70H 4JTDB 2QM4A 4DV7B 1H2MA 2P67A 3A0RA 4OPAA 2IJIA 2YI9A 2ZXWC 4FZ0A 2FYUH 3VQYA 5LHIA 4PI2A 4I7ZB 1FAFA 4FLWA 3APOA 4JI5B 3F7YC 2Y69B 4JZ2A 3H1JH 3JATB 4IT5A 4DRXB 4F6EA 3B2EE 4K8ZA 2ZE5A 2JS5A 1VF6C 2DE0X 2VWJA 4NB5A 3B8NA 2JEXA 1K5QA 3OW2U 4J7ZA 3K5NA 2HVJC 1BQZA 4X64B 1YHQV 4B3SO 1OCCB 1L8DA 4LR3A 2GDSA 1MSDA 1QCEA 2PI5A 1G4YB 4FZ1A 3CRCA 4JI3B 4B3TO 4TV9B 2QKSA 4JI4O 2DYRC 1KQSU 1CXZB 4O4JB 3N2KA 3EVKA 3P30A 1TUBB 1WA8A 2ZQMA 2LW1A 4UB6Z 2KKWA 1GM7A 3K0GA 1HNWB 4PA3A 1YTFB 4DR7O 1YEWA 1VARA 4FM0A 2CH7A 2F4VB 3GB7C 3CRRA 1FXVA 1VMGA 4DR1B 4HNAA 3ABUA 1RP3B 3CMAV 1DK1A 2Q68A 1SQXH 3ZHRA 1BCCH 5EYPA 3LSUA 4O2AB 1V54C 1H2LA 5IJ0B 2YEVB 4DUYO 4X66B 5EIBC 2EBOA 2EINC 1KKCA 1RSOA 2QGNA 2GV9A 3SYOA 4ASUG 3OTOB 3MHHC 2FTKA 1K9MW 3T1YO 1VQPV 5KX5A 3TJTA 4DR4O 1IBMO 4MSWC 2VQEO 1HR0O 1GH6A 2CTWA 4P2ZA 1EZVH 1PNMA 1P84F 4ZIBA 1R6KA 5IWAB 4KUMA 3C90A 3AG2C 2OIGA 3AG7A 3WU2Z 5LHHA 1XNQB 2L35A 4W4KA 4JI7O 4JI2B 4U7NA 2OTJV 1KB9F 2ZR3A 1HNXO 2BTQA 3R66A 3ZBHA 1WB8A 4B3SB 2JRIA 1B06A 2ILMA 2DMXA 4H0LB 4XDKA 3ZN1A 4PD4F 1WJZA 1H2SB 3AK3A 5C8YB 3CRMA 4B3TB 1DLBA 3CRAA 1P7BA 2DWEC 1AI5A 4JI4B 3JCZA 1GO3F 4O2BB 2EJRA 3OUFA 3W7TA 3ZEDA 4AILC 4DV0O 4LNUB 4G28B 2YIAA 5CMUA 4N23A 4FFKA 5B1OA 4PDMA 4DR7B 4NXMO 5J2UB 3AG1C 3IJ4A 3AG3C 1MZEA 2Q7GA 4DYLA 3ZHUA 3ZS8C 1COWG 1PNLA 1YF2A 1ZAUA 3TGUH 4XDJA 4A5UB 3O65A 2XOKG 3O9OA 2F93B 1VP7A 3K0DA 4KL1A 4DUYB 3ASOC 3A8TA 1L0NH 2YIBA 3MD0A 4X1KB 5A2QN 1Z5WA 1XNRO 3J80N 5JCOA 3K03A 2ARHA 2OIEA 2OTLV 5L3GA 3T1YB 3X2QC 5JJNB 4CBCA 2JGUA 4DR4B 1WB7A 3LUTB 1IBMB 2VQEB 4LP8A 1HR0B 4DR2B 4MTFA 1AJNA 1IBLO 1FFTB 2DYSB 5EBWC 4O4IB 1H2GA 2EIKB 1E1RG 1SERA 5GONA 1IXBA 1BS3A 4FLXA 1Y74B 1VQ7V 1OCZB 4RO2A 1IBKO 3AK1A 2ITDC 4JI7B 4GX0A 4H37A 5B1AB 4J9ZB 5CA1A 2UUAO 1NR1A 2Q69A 2M7WA 4JI6O 4FLUA 2XAJA 4CC6A 4KP4A 3HB3B 3CCVV 5LHGA 4C7UA 3ZHQA 4MW8A 3CHXA 1OZ0A 3UO3A 1I08A 4DV0B 2JGDB 4KXRA 5CA3A 4JYCA 3SJCC 5IJ9A 4U3FH 2HFEC 2ATKC 2JEUA 4TOIA 2Y4TA 2YSUB 3H01A 5LXTA 4P30A 1TA8A 2V4DA 2DN9A 2LQTA 2QWQB 2XAHA 1R3LC 3G71V 2P5OA 3H1KH 1VQKV 5ITZA 5KA6A 1XMQO 4TUYA 3NR7A 5LGUA 4X20B 3WFVA 1PD3A 1WPXA 3IC9A 1SQFA 4UCSA 3CC7V 1XNRB 3HKEB 1U96A 1V55B 2JVDA 3ZMUA 4CS3A 2HG5C 1NS1A 2OYQA 1R1BA 2AZ2A 5CBHA 1R3KC 1CEZA 1NKDA 3QG5A 4LFBO 1N32B 3RGBA 2PY5A 1GM8A 3DC5A 3B77A 5EK0A 4JTCB 3GVMA 4JV5O 3OGCC 4PELA 2HVKC 5BXZA 3OGIB 5LA6B 5J2TA 5B3SC 2AXTZ 4RWUA 4DRXA 1IBKB 4ZKIA 4UCUA 3SGIA 4F4LA 3ZHVA 1VF6A 1ZUQA 3CSXA 2UUAB 1OJHA 1BL8A 4FLVA 4YY3O 3VQVA 4EFEA 3CP1A 2YXHA 2Q5ZA 1BHAA 1S72V 1XMOO 1ZL8B 3JAKB 1SZXA 2CE4A 2X6AA 4NVPA 4O4JA 1TUBA 1W59A 2F1MA 2GTAA 5CN0A 1Q6HA 1FXKB 5L3DA 5JQGB 2R9RB 1Y4MA 4K8XA 3HKBB 4E2LA 4IHJB 2CAZC 5EC2C 1GRJA 4B3RB 4JPRA 3W7XA 1PM9A 4UCVA 2UUCO 3T1HB 1Q8IA 4O2AA 4J41A 2B1GA 2YEVA 1ZSPA 3ABLC 3ZRSA 1XMQB 3FYEB 3FB6C 3JSLA 3LSSA 3ABLB 1SF9A 3PN1A 2QWNB 1MG1A 2E74B 2WLJA 1QLEC 5KMGB 2BTOA 2XUMA 1LUVA 2A9HA 5J9PC 5H6RA 1V9PA 1TAEA 4LFBB 3HKCB 3M99B 2W0FC 2IH3C 3BABA 5IYDO 3B09A 4DV3B 4JYBA 3ICXA 1TVKA 1VQ5V 1D2DA 3FX7A 3BY6A 1L1FA 4JI1O 4JV5B 2ZKOA 4JAVA 5BR8O 3E8GA 3QO5A 1AB3A 4X65O 2ZINA 3JD1A 1JCHA 3CXHF 1QVFU 2R9AA 4YY3B 1HWYA 1VQ8V 2AHYA 3BFRA 2ZD9A 2QTSA 2RN9A 1YJWV 2GTSA 2WLHA 2IU0A 4U7OA 5LOVB 5C8YA 2P06A 1P4RA 4FMTA 4WFHA 2B1IA 3TK1A 4P9PA 2HP8A 1RFYA 2BE3A 5DEDA 4UCRA 3STZC 4EB6B 2B5UA 3T4ZA 4H33A 3D8CA 3WG7B 4LFAO 1YXBA 3B40A 3SYQA 4Q20A 5KAIZ 3K5MA 5KA5A 2UUCB 4X9QA 1US6A 4FVMA 1XHXA 2Q7HA 3RYIB 3VQWA 1E1QG 4HBNA 1K97A 1UJWB 1H2NA 1GN4A 4UVCA 5L3BA 1B04A 3OAAG 1Z2GA 2GSMB 3P3PA 1AR1B 2EILC 1KYOF 1QU7A 5EZYA 3DGEA 1UFIA 5CB4A 5FNVB 1M57C 4LWSA 3DTUB 3K9AA 3BPZA 1M57B 2ZM6O 4NKGB 4O4IA 4WBNB 1RPOA 4Z1MG 2BOBC 1QBZA 2KG7B 4AI8A 4I50B 2FMLA 4JI1B 3L73H 5HFMA 1WAZA 4YXWG 4GX2A 4MTOA 2QWOB 1YSCA 5BR8B 3FB8C 2KQXA 4X65B 4YJ3A 4CC5A 2CDYA 3RYHA 1H8EG 3DXRB 2Y69C 4PDRA 2VS0A 4JYAO 3I56V 2LJ2A 3WB2A 2QM7A 4RQFA 3E8BA 4I5SA 3E22B 3OFNG 1AI7A 4NTXA 5D5QA 2AHZA 3OR6C 3IFXA 1FXHA 1A32A 3CYOA 1HW7A 2Z5UA 2JGDA 2D2CB 1H2KA 1OCCC 5GW7A 2OT5A 3G6EV 3N27A 3JAMN 1KECA 2X6CA 3SPJA 4LFCO 3ZRXA 4JASA 1IX9A 4LFAB 3JALB 3RYCB 2ZT9B 1HNZO 5LL6Y 3FFQA 1IXMA 1N0JA 4PDLA 3C3SA 4JZGA 2G38A 4X20A 1Q82W 3DSQA 3JCUZ 4LH6A 1K3EA 3JD2A 3SYCA 4L87A 5B66Z 3H1HH 2R72A 4KHPO 4MTXA 1BT8A 3U0ZA 1GMGA 4LF5O 5KUMA 2ZM6B 2A7WA 2F66C 2PF4E 4D6TH 2QWRB 3HPLC 1K34A 3ABTA 1R3JC 2WAMA 4J7JA 3JASB 1Z5VA 2VQFO 4F6RA 2QA4V 1SRYA 2EIMB 4DK1A 1MOFA 2UU9O 3ETGA 3QNEA 3LNMB 1YIJV 1RM1B 1NVPD 1N0NA 3PJSK 2B9ZA 4JYAB 1JFFA 4I4TB 5IT9N 3WB1A 2IJHA 4I55B 5KHGA 2RQ6A 2CUGA 2E76B 2N05A 1N34O 4YIPA 1Y76A 1BZKA 2H94A 3D3QA 2PZSA 3K57A 2AGAA 3CCMV 5JQGA 2NN4A 1SKVA 1GM9A 3HKBA 5CA0B 3G4SV 3KZIZ 4IHJA 4K3AA 4BWAA 1SESA 1AJPA 2GUZB 3HKDB 4LFCB 3UO2A 2Y4UA 2CTRA 1PV0A 5KLVH 2A79B 1PL0A 4ZI7A 1F4MA 3T4DA 1THZA 1HNZB 2N04A 1VQ9V 2LW7A 2H3OA 1NZ6A 1GN6A 2IH1C 4H44B 2OCCC 5BY1A 2A0LA 1J5EO 2VRZA 1H38A 2OCCB 5KMGA 1HP8A 4BW9A 5IYZB 3CPWU 3KCYA 4L8JA 4LF7O 4GKJO 1I0HA 2E75B 3ETEA 3ZMSA 5IE9A 4LF5B 1FPOA 5K1PA 3HKCA 3CJHB 2P6JA 3JAWB 3G67A 4MVQA 5JH7A 2KSDA 3SJBC 3AG4B 1JJ2U 4ZHQB 3DC6A 5C93A 1T5EA 3CRQA 3RFRA 3KG2A 3J7AU 2ETNA 2XHBA 2Q8VA 1SETA 1WP7A 2VQFB 1F4NA 2RJZA 1FFXA 4X1YB 4B7EA 2FB5A 2UU9B 2DYSC 4LC1A 4O4LB 4RQEA 3ZIAG 2EIKC 5TISZ 3RW0A 1P7GA 5DECA 1OCZC 4U3JB 4JYYA 3F7VC 2YIBD 3OMIB 2C2AA 1N34B 3OR7C 5B1AC 2BSKA 3ABKB 3E2EA 2R70A 3JARB 4BIOA 3ZMVA 2YI8A 1JMKC 1HNXB 3ASNB 3SJAC 1XBLA 4EB6A 4X62O 3ZJZA 3OMNB 2W0XA 3CCRV 3IC7A 1MNGA 2IBZH 3KCXA 1I7FA 4I9WA 4H13B 4CH3A 3RYIA 2CGNA 3N2GB 1XEQA 2WPDG 2BOCC 1KBHA 4ABMA 4DV6O 1WN7A 2P4VA 5H5NA 1NR7A 4NXMB 3CS5A 3FAVA 2HJDA 4LF4O 3M8AA 4LF7B 4GKJB 1L0LH 3SPGA 2CTQA 3GWOA 1OV9A 1XQ8A 4WBNA 2AW9A 1K4DC 2N74A 3ZRVA 4R50A 2E3CA 5BMVA 2WSSG 4I50A 1S76D 4X1IB 1M4UA 3Q4HB 1V55C 3H1IH 2YXYA 2Q7EA 1SQPH 4ZOLB 1MZFA 3J81N 1ZWIC 3BA8A 3N2KB 1GK9A 1WA8B 4DO2A 2F95B 5HFLA 2YS8A 1IBLB 3P3NA 5E1AC 1GKFA 1Y6XA 3NXSA 1LUWA 3U11A 2CH7B 4HYOA 2UUBO 1S0VA 1KD1W 3JATA 1G6UA 4GYCB 2PYJA 4IIJB 4HNAB 1XI1A 1NVPB 2ZCEA 3UM7A 1SQQH 1OCRB 3CCJV 5EYPB 4BW5A 1PL4A 1XILA 4EFBA 3UT5B 2Q67A 1IVSA 5EBMC 1WPBA 5LMUO 2OWOA 1M90W 4K35A 4O4HB 2OCHA 4MVOA 1QNMA 4JI6B 1BE3H 1K8AW 1EN6A 5LP6B 1M56B 4TV9A 3JALA 2LO1A 5LMNO 1NTZH 5KX5B 1BQ0A 1D5NA 1FXKC 5KHJA 2KB1A 2Q6AA 4Z1VA 2YC0A 1I94O 1D5AA 2UXBO 4DV6B 1K4CC 2M6YA 2JJ1G 2RMKB 1KP3A 4LH7A 3WB0A 2EIJB 3ZMTA 5EC1C 4UXNA 1GN3A 5FPOA 2GBOA 1NTKH 5JJEB 3JD0A 4DV4O 4LF4B 4QNHB 4WCEV 1OCOB 1NJIW 4DUZO 4QPKA 5IJ0A 2FKXA 1YJNV 4I9QA 4RAIA 2BTQB 1ORQC 1AR4A 3ZHTA 1MMMA 4JF3A 2F23A 2PI4A 4DV1O 3JASA 3QO7A 2DQ0A 1Y67A 1WP8A 4UFZA 3CXCU 2L6LA 1Y66A 2LP7A 4WFFA 3ZCCA 2Y0PA 4D7TA 4I4TA 2YXLA 5JVDB 3TETA 1KP2A 4PHZA 3ZRWB 1ZX3A 2K1EA 4DR5O 1R6TA 1NU1H 2WLIB 5EIBD 2A3QA 2NR5A 3H9VA 1S3JA 4DV2O 3OD4A 3ZN0A 3CCUV 4UCOA 5CA0A 1M93A 3P32A 4FPPA 5LMUB 4UB8Z 3AK2A 1LNQA 2GUZA 3ML0A 2MW2B 2QE7G 2QEXV 4D7SA 2WLKA 4I0XB 4E4EA 3JD4A 1XMOB 5IDJA 1JA8A 2W6IG 5H2FZ 4WF9V 4IYIA 3QVNA 1XREA 4O2BA 5LMNB 1GTOA 4YHHO 4LNUA 4TQDA 2PGGA 2XASA 5JJJB 1EFRG 5IY5C 4J7KA 3A0BZ 2UXBB 4DW0A 3ABMB 4JAUA 2ADQB 5IY5B 5J2UA 3WG7C 4WFEA 1VQLV 3G80A 2HR3A 3OM3B 5IYZA 2ZE6A 1QLNA 4MTGA 3F5WC 1YCIA 3THOA 1BGYH 2YUAA 1R73A 1NI8A 1XL6A 3E8HA 4GCZA 4CS4A 1XOUA 1B6QA 1NQTA 3R65A 5KHKA 3CJHA 3I55V 3VQXA 2WWWA 3CC2V 1GAXA 3FYIB 4LCUC 3RT3C 4GX1A 4B3MO 2P7TC 4YJ2B 1Q5OA 4DV1B 3VOUA 4X1KA 5K1XA 4J42A 3TXSA 5KHIA 3B8MA 4ICGA 3L75H 1U97A 3K06A 1URFA 4O4LA 1EM1A 1I5YA 4GLXA 2YICA 3OTFA 3SYPA 3A0HZ 1MABG 4U3JA 2JS3A 2MK3A 2F4VO 4DR5B 2PYLA 1FJGO 1Y74A 3MHSC 1VF5B 4GT1A 1VQNV 2XT9A 2NLJC 4G2KA 1KKDA 2BCCH 3JARA 4JI8O 1NBMG 4DV2B 1SA0B 4TT3G 1PKXA 1Q7YW 1E79G 2WLLB 4R8CA 2X0LA 1DGSA 4R7CA 1W2BU 2EZOA 4TUYB 2D3OW 1O9GA 1AP5A 5BZBA 1JJOA 3T2MA 5LYJB 3E8FA 4MVRA 2V1DA 5AG2A 2EX3A 3N2GA 5IYBO 4YHHB 1K7DA 4KFMA 1PP9H 1EN4A 2ZXWB 1O9HA 5IWAO 4B08A 3ZHSA 3BRCA 4PA6A 3D3IA 1K92A 2WLNA 5DN6G 5J2TB 4FLZA 2QJ1A 1XNQO 5EBLC 4JI2O 3A2FA 4CH6A 4BIUA 4DR6O 2CTPA 2ZR2A 2WA3A 4UV8A 4X1IA 4CS2A 4J80A 4B3MB 3Q4HA 2UXXA 2W6JG 1WLEA 3HKEA 2P90A 1NH2D 4ZOLA 3RYFB 5FL7G 3LDCA 3L9DA 2DYRB 1QR8A 3IAYA 2IM9A 4CH5A 2EZPA 4DV5O 1YZBA 3SPHA 2QKAA 2A06H 5B5EZ 1F23A 1G8MA 3G6BA 4J11A 1FJGB 2HEPA 5LA6A 2Q4PA 1NT2B 2EIMC 4IIJA 4PV1B 3LNNA 5CBFA 4JI8B 1JR9A 1EN5A 5LBQA 1ENVA 2X7RB 1RM1C 1N4CA 5H6QA 3U10A 2QKCA 3UT5A 3L71H 2CK3G 5D5PA 1V54B 4O4HA 4PA4A 2Z0AA 5LP6A 1ZL8A 2EINB 3JAKA 2XAGA 4QIWF 4PDVA 4GKKO 4FLTA 4DR2O 4DXWA 4Z2WA 2UXCO 1FXKA 5E79Z 1MSWD 1EZJA 1SQVH 3MDSA 5KHHA 4NTWA 4X88A 4FFBB 1TVKB 3K04A 2XAQA 2Q9LA 4P9OA 4QE7A 4NYKA 3RWRD 3AG2B 2LGQA 4LF6O 4OXSA 4DR6B 4JGSA 4UVBA 2ZIOA 2E5LO 3W7UA 2XNDG 3W7WA 3ETQA 1W0KG 1VQMV 3JD3A 1PPJH 1KC8W 1N36O 4KHPB 2X6BA 1YJ9V 4UCTA 3EXAA 5KUKA 4AHCA 2XAFA 1UPGA 3K58A 4FJCC 4UVAA 3AG4C 3BCCH 5FPRA 5GTHZ 3C3TA 3CB2A 5JVDA 1TUEB 4DV5B 3ZRWA 2FL4A 4JAAA 2WLIA 2XTAA 3RVZA 4W4LA 2RCVA 4OPHA 4PA7A 4LF8O 3AG1B 2HKOA 2QDOA 3AG3B 3TCUA 1S5LZ 3EHBB 1RPRA 3BEHA 4TV8B 4CZZA 3UKMA 4G27B 1BSMA 1IZ3A 3M7MX 3JYCA 1BHBA 3CWBH 4GX5A 1JQ0A 2ZDIC 5LOVA 4Q6GA 3OEHG 2HJFC 3ASOB 3FD9A 2P22C 3OMAB 4I0XA 4DW1A 3S3XA 5L3FA 2DWDC 3TXQA 1Q43A 3ABKC 1J95A 1CP9A 5FLXN 2UXDO 4GKKB 4TWKA 5EZYB 5CB4B 3ASNC 3X2QB 5IYCO 2UXCB 4LWSB 2CGOA 1N32O 1DF5A 4XBFA 4FLYA 1VF7A 4QJFB 1OHHG 3CEIA 3FB5C 1ROPA 4X89A 3UCSC 1KMIZ 3LDEA 1QR9A 1AP6A 2QSAA 1R6NA 2HHHO 2Q0OC 4LF6B 1DF4A 3K79A 4YJ3B 1YVWA 3RYHB 4YJ2A 4UUJC 1ZTEA 2YIDA 3ZX6A 2E5LB 1J5EB 5L3CA 1XL4A 3SPIA 4IL6Z 3BHPA 4R6ZA 4FM2A 5A9GA 2YDEA 4FK5C 4RUFA 1AILA 1N36B 3STLC 1AJQA 1Q90D
chains in the Genus database with same CATH topology
5LHHA 1YSCA 3CCSV 4ZBMA 3FB8C 4MT8A 4U7NA 3CXCU 3D36A 2OTJV 2ZR3A 4N21A 1Y66A 2LP7A 1H8EG 1PNKA 4WFFA 3ZCCA 1EBOA 1K73W 2Y69C 4PDRA 2JDIG 1VQ4V 1VQ6V 3I56V 2QM7A 3TETA 4RQFA 1KP2A 3E8BA 1AROP 3AEIA 3ZRWB 4XDKA 3ZN1A 2K1EA 4I5SA 3CCEV 3OFNG 2WLIB 1AI7A 1NH2B 2LFSA 1S5HC 1DLBA 2NNUA 1P7BA 1S3JA 1AI5A 2AHZA 2DWEC 3OR6C 2ITCC 2WLLA 3IFXA 3JCZA 1FXHA 1GO3F 2EJRA 3CYOA 3OUFA 3ZN0A 3W7TA 3CCUV 2Z5UA 1BMFG 1YI2V 2DW4A 1OCCC 5GW7A 4RUEA 3P32A 4FPPA 4FIPC 2OT5A 4G28B 1LNQA 3G6EV 5CMUA 3ML0A 4N23A 3OEEG 4BIZA 5B1OA 4PDMA 4HZ3A 2F43G 1KECA 3AG1C 2X6CA 3SPJA 2QE7G 2QEXV 3CD6V 3AG3C 2WLKA 4JASA 3ZRXA 2R9IA 3JD4A 5IDJA 2HLDG 2JK5C 2QM8A 2W6IG 1COWG 4WF9V 1PNLA 1OCRC 1GTOA 4XDJA 2XOKG 1R3IC 2XASA 1IXMA 3FB7C 3K0DA 1EFRG 4PDLA 1JPXA 5IY5C 3E86A 1N8RW 3RBZA 3ASOC 1Q82W 1F51A 3ABMB 4JAUA 1VQOV 1K3EA 3JD2A 5IY5B 3SYCA 4L87A 3WG7C 1M56C 3MD0A 4WFEA 1VQLV 1Q81W 2HR3A 5LGNA 3OM3B 3RVYA 1QLNA 4MTGA 4MTXA 3F5WC 3K03A 2OTLV 5L3GA 1R73A 5B1NA 1XL6A 3E8HA 4GCZA 3X2QC 1GMGA 4CBCA 1B6QA 1NQTA 3LUTB 3R65A 5B3SB 3I55V 4LP8A 2WWWA 4MTFA 1AJNA 3ETDA 5CBGA 1DTOA 5KUMA 1JVMA 3CC2V 1FFTB 2DYSB 5B1BC 2EIJC 3FYIB 5EBWC 4LCUC 1H2GA 2EIKB 4GX1A 2P7TC 1E1RG 3HPLC 5B1BB 1K34A 2DQ3A 3VOUA 4JTAB 1SERA 3ABTA 1R3JC 4WFAV 2WAMA 1OCZB 3B8MA 3OUSA 3T1CA 4MS2A 4RO2A 1OCOC 1K33A 2QA4V 1SRYA 2EIMB 2ITDC 3W7SA 3K06A 4GX0A 1MOFA 4H37A 5B1AB 3ETGA 3QNEA 3LNMB 1YIJV 4J9ZB 1RM1B 1NVPD 1I5YA 3PJSK 1NR1A 2Q69A 3SYPA 3LSQA 5DM6V 1MABG 2IJHA 2M7WA 4EKWA 4TSFG 2MK3A 1YTFD 3MHSC 2XAJA 4GT1A 1VQNV 4KP4A 2NLJC 3HB3B 4G2KA 3CCVV 5LHGA 1KKDA 1M9NA 1NBMG 2H94A 4TT3G 1PKXA 4MW8A 1Q7YW 1E79G 2WLLB 4R8CA 1OZ0A 2X0LA 1JX9A 3CCMV 4R7CA 1W2BU 2V7QG 2EZOA 5CA3A 4JYCA 1GM9A 4MVMA 3CCQV 2D3OW 2IJKA 3G4SV 4XDLA 2HFEC 2ATKC 1SESA 5BZBA 1AJPA 2JEUA 2YSUB 3H01A 4P30A 4MW3A 3ZMZA 4J9YB 2A79B 1PL0A 3E8FA 4MVRA 3T2MA 1F4MA 1QLEB 2V1DA 1K5SA 2XAHA 3T4DA 1R3LC 1THZA 5IYBO 3G71V 1K7DA 1VQKV 4KFMA 5KA6A 1VQ9V 2ZXWB 3SPCA 2IH1C 2OCCC 5LGUA 2A0LA 1I5XA 4PA6A 3WFVA 1H38A 2OCCB 3CCLV 1PD3A 3IGAC 1WPXA 3CC7V 3D3IA 1K92A 3CPWU 3E35A 3CMEV 2WLNA 5DN6G 1V55B 1M1KW 3SYAA 5EBLC 3ZMUA 4BAYA 3ETEA 3ZMSA 2HG5C 4BIUA 5CBHA 1R3KC 1CEZA 2P6JA 1QVGU 4QPJA 1NKDA 1W0JG 4MVQA 2ZR2A 3ABMC 1Q86W 3E89A 2IU3A 1GM8A 3AG4B 3B77A 1CPYA 3E83A 4UV8A 5EK0A 1JJ2U 5C93A 3KG2A 4JTCB 2UXXA 3OGCC 1AI4A 2W6JG 2HVKC 4PELA 1WLEA 1SETA 2P90A 5B3SC 1NH2D 3QO8A 5FL7G 1F4NA 3LDCA 4ZKIA 1S77D 2DYSC 4LC1A 4F4LA 2DYRB 4RQEA 4UV9A 3ZIAG 2UXNA 1QR8A 2EIKC 1BL8A 2QTOA 2EZPA 3RW0A 3SPHA 1F23A 3SJQC 1G8MA 3CP1A 1OCZC 3F7VC 3OMIB 3K3WA 1BHAA 2C2AA 1S72V 2EIMC 1AI6A 3OR7C 5H9CA 2LFRA 5CBFA 5B1AC 5LBQA 2X6AA 3ABKB 3FKSG 3E2EA 3K08A 4MVZA 1ENVA 2X7RB 3VBBA 1RM1C 3ZMVA 5H6QA 1YITV 5CN0A 1FS0G 3LDDA 2CK3G 3ASNB 1FXKB 5L3DA 2JJ2G 1V54B 2GHYA 1Y4MA 2R9RB 3ZJZA 2IW5A 3OMNB 3CCRV 4E2LA 3IC7A 4PA4A 4WFGA 3OE7G 2H8PC 2EINB 2ZDIA 4MVUA 5EC2C 2JIZG 5L3EA 4JPRA 3W7XA 2WLMA 2XAGA 1SZTA 4I9WA 4PA9A 4QIWF 2EILB 3CC4V 4PDVA 5LGTA 2IJJA 4LBEC 4DXWA 2B1GA 2YEVA 3ABLC 3ZRSA 4WFBV 2WPDG 3FYEB 1FXKA 2BOCC 1JOYA 2Y48A 3FB6C 1H8HG 1MSWD 1EZJA 3LSSA 3ABLB 4MVSA 4X88A 3K04A 1NR7A 3EFFK 4X8AA 2XAQA 4QE9A 1MG1A 2WLJA 4HAMA 1QLEC 2Z3YA 4P9OA 4QE7A 4JTDB 2A9HA 3AG2B 2P67A 3A0RA 3SPGA 5J9PC 2IJIA 3GWOA 5H6RA 2ZXWC 4OXSA 5LHIA 1K4DC 4JGSA 3M99B 4UVBA 2W0FC 2IH3C 5IYDO 3ZRVA 4R50A 4JYBA 2WSSG 1S76D 3F7YC 2Y69B 3W7UA 1VQ5V 2XNDG 3W7WA 3BY6A 1L1FA 1W0KG 1VQMV 3JD3A 1V55C 1KC8W 2X6BA 1YJ9V 4JAVA 3E8GA 5KUKA 3QO5A 2XAFA 3B8NA 1ZWIC 2JEXA 4FJCC 4UVAA 1GK9A 3JD1A 3AG4C 1K5QA 1JCHA 3OW2U 2HVJC 4DO2A 5HFLA 1QVFU 1TUEB 5E1AC 1YHQV 1VQ8V 1GKFA 1HWYA 1OCCB 3ZRWA 2AHYA 3NXSA 2ZD9A 1QCEA 1YJWV 2PI5A 2WLIA 2WLHA 2IU0A 1G4YB 4U7OA 4YXWG 3RVZA 1P4RA 4FMTA 4PA7A 4HYOA 4WFHA 1S0VA 1KD1W 3AG1B 2HKOA 2B1IA 3AG3B 3TCUA 4P9PA 2QKSA 3TK1A 2DYRC 3EHBB 1KQSU 1RPRA 1NVPB 3UM7A 3BEHA 3P30A 4CZZA 1OCRB 3UKMA 4BW5A 2ZQMA 4G27B 3CCJV 2Q67A 5EBMC 3JYCA 1BHBA 1GM7A 1M90W 3STZC 2B5UA 3K0GA 4GX5A 1JQ0A 2ZDIC 4PA3A 3OEHG 2HJFC 3ASOB 3OMAB 4H33A 4MVOA 3T4ZA 1YTFB 5L3FA 2DWDC 3GB7C 3ABKC 1K8AW 1J95A 1FXVA 1M56B 1CP9A 3WG7B 3ABUA 3SYQA 4Q20A 5KA5A 4TWKA 3CMAV 3ASNC 1FXKC 2Q68A 3X2QB 2KB1A 5IYCO 2Q6AA 1V54C 1E1QG 2YEVB 1K97A 1DF5A 4XBFA 1UJWB 1K4CC 2JJ1G 4QJFB 2EBOA 2EINC 1OHHG 1KP3A 2EIJB 4UVCA 5EC1C 3ZMTA 5L3BA 3OAAG 3FB5C 2GSMB 3SYOA 1ROPA 4UXNA 1AR1B 4ASUG 2EILC 4X89A 3JD0A 3MHHC 2FTKA 1K9MW 1VQPV 4QNHB 3LDEA 3DGEA 4WCEV 1QR9A 1M57C 1OCOB 4MSWC 1NJIW 1R6NA 1DF4A 4QPKA 3DTUB 3K79A 4P2ZA 3K9AA 1M57B 1YJNV 4Z1MG 1RPOA 1PNMA 2BOBC 4RAIA 1QBZA 1ORQC 1R6KA 4UUJC 5L3CA 4JF3A 1XL4A 4KUMA 3SPIA 2PI4A 4R6ZA 3AG2C 4FK5C 5HFMA 4RUFA 3QO7A 3STLC 4GX2A 2DQ0A 4MTOA 1AJQA 1VQ7V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZT A;  1DLB A;  1K33 A;  1ENV A;  1QR9 A;  2X7R B;  5KA5 A;  3GWO A;  3CYO A;  1MOF A;  3B8N A;  3P30 A;  1DF4 A;  1Y66 A;  2LP7 A;  4FJC C;  2P6J A;  4N21 A;  5CN0 A;  5KA6 A;  1I5Y A;  4JGS A;  3K9A A;  3M99 B;  1QR8 A;  1JPX A;  1EBO A;  2EZO A;  1DF5 A;  1QBZ A;  5HFL A;  4FIP C;  2EZP A;  3B77 A;  2OT5 A;  1Y4M A;  2EBO A;  5CMU A;  4N23 A;  1I5X A;  4E2L A;  1QCE A;  1JQ0 A;  1F23 A;  2M7W A;  3WFV A;  3CP1 A;  4JF3 A;  1K34 A;  2MK3 A;  1MG1 A;  3H01 A;  3MHS C;  4FK5 C;  5HFM A;  5H9C A;  4JPR A;  3B8M A;  4G2K A;  3MHH C; 
#chains in the Genus database with same CATH topology
 5KAF Z;  5FNV A;  3CCS V;  4ZBM A;  4MT8 A;  3D36 A;  4N21 A;  1B3Q A;  1PNK A;  1EBO A;  1K73 W;  2KG7 A;  2JDI G;  1VQ4 V;  1VQ6 V;  3L72 H;  1ARO P;  3AEI A;  1FYJ A;  4IYH A;  4OX9 O;  3CCE V;  3APQ A;  4B3R O;  1NH2 B;  4LF8 B;  1AVM A;  1SS3 A;  4GUN A;  1KU9 A;  1SA0 A;  2LFS A;  3HR0 A;  1S5H C;  2NNU A;  1F7Y A;  3CX5 F;  2ITC C;  2WLL A;  1M5I A;  3T1H O;  1SC5 B;  1AR5 A;  1BMF G;  3DXR A;  1YI2 V;  3L74 H;  2DW4 A;  1N33 O;  4PJ0 Z;  4RUE A;  4FIP C;  3OEE G;  4BIZ A;  5GTI Z;  4HZ3 A;  2F43 G;  3E22 A;  3CD6 V;  2K9P A;  5LYJ A;  2R9I A;  1WNS A;  2HLD G;  3H1L H;  2JK5 C;  2QM8 A;  4PI0 A;  2UXD B;  1OCR C;  1GN2 A;  3K9S A;  1XDC A;  2Q73 A;  1R3I C;  3FB7 C;  1JPX A;  4K0K O;  3KKY A;  4DV3 O;  3E86 A;  1N8R W;  2RNB A;  3RBZ A;  4OGQ B;  4X62 B;  5F2V O;  1F51 A;  1VQO V;  2Q0A A;  5LP6 C;  1M56 C;  1FD9 A;  1RSO B;  4JI0 O;  4DR3 O;  5LGN A;  1Q81 W;  3RVY A;  4IGG A;  1IDS A;  5B1N A;  3B4S A;  4F6R B;  3RYC A;  1X59 A;  5B3S B;  2HHH B;  3ETD A;  2Y0I A;  5CBG A;  1KUQ A;  1DTO A;  1JVM A;  2QR4 A;  1XUQ A;  2DOS A;  2ODM A;  4EEQ A;  5B1B C;  2EIJ C;  4NR1 A;  1JFF B;  5B1B B;  2DQ3 A;  4JTA B;  4WFA V;  1TGO A;  3RYF A;  1IUR A;  3OUS A;  3T1C A;  4MS2 A;  1OCO C;  1K33 A;  4NXN O;  1Y76 B;  1Q6I A;  3W7S A;  1QQC A;  1FKA O;  3K5O A;  3LSQ A;  5DM6 V;  3K5L A;  4EKW A;  4GZR B;  4TSF G;  4OX9 B;  1YTF D;  1P49 A;  4CH4 A;  1XHZ A;  1M9N A;  4J10 A;  4ZI7 B;  1G1X B;  4FM1 A;  4LF9 O;  1JX9 A;  2ZE8 A;  3JSN A;  1N33 B;  2V7Q G;  2ZE7 A;  4MVM A;  3CCQ V;  2IJK A;  4I55 A;  4XDL A;  2P4K A;  2EUL A;  1QHT A;  2WA4 A;  4B7K A;  5JWP A;  4MW3 A;  2UUB B;  3ZMZ A;  1X4T A;  4J9Y B;  1QLE B;  1K5S A;  2RDC A;  3CE2 A;  2QWP B;  3OT7 A;  4AQY O;  4K0K B;  5JH7 B;  3SPC A;  3QF7 A;  4FFB A;  3I5D A;  1I5X A;  1VEW A;  2ZNJ A;  3BA9 A;  1ZLZ A;  3HKD A;  1SQG A;  3CCL V;  4DR3 B;  4JI0 B;  5JCO C;  1MA1 A;  3IGA C;  3E35 A;  3CME V;  4DV7 O;  1M1K W;  2EJ7 A;  3SYA A;  2PUS A;  4BAY A;  1FFX B;  1QVG U;  4QPJ A;  1W0J G;  1Q3E A;  3ABM C;  1Q86 W;  3E89 A;  2IU3 A;  4NTY A;  1I94 B;  3E83 A;  1CPY A;  4JI5 O;  3SDL A;  3RN4 A;  1AI4 A;  1HDJ A;  3F5T A;  5GON B;  1S5J A;  4DV4 B;  3QO8 A;  4NXN B;  1S77 D;  2BSK B;  2O57 A;  2PTM A;  2LGW A;  3GWK C;  2AZ0 A;  4DUZ B;  3JAW A;  4UV9 A;  2UXN A;  1YDX A;  3UQ8 A;  5CA1 B;  4X64 O;  1VIB A;  2QTO A;  4ZHQ A;  3S3W A;  3SJQ C;  3BAA A;  2ADP A;  3K3W A;  2DJV A;  1SQB H;  4JI3 O;  1AI6 A;  3QTC A;  5H9C A;  2LFR A;  3FKS G;  2ZIM A;  4X1Y A;  3K08 A;  4MVZ A;  3VBB A;  3BVO A;  3D36 C;  4TV8 A;  4LF9 B;  1YIT V;  4QGP A;  1FS0 G;  3LDD A;  2ZNI A;  2JJ2 G;  3SR2 C;  2GHY A;  2IW5 A;  5IJ9 B;  1HNW O;  4WFG A;  4TQF A;  3OE7 G;  2H8P C;  2ZDI A;  4MVU A;  1NTM H;  2JIZ G;  2VWK A;  3FAV B;  5L3E A;  2WLM A;  5LXT B;  1SZT A;  4DR1 O;  4PA9 A;  3CC4 V;  2EIL B;  3MAQ A;  4DK0 A;  5LGT A;  2IJJ A;  4LBE C;  4WFB V;  4AQY B;  1JOY A;  2Y48 A;  4YIO A;  5ITZ B;  1H8H G;  1Q6U A;  4BR6 A;  4MVS A;  4X66 O;  5BMV B;  3EFF K;  1LR1 A;  4X8A A;  3K59 A;  4QE9 A;  4HAM A;  2Z3Y A;  3OTO O;  3L70 H;  4JTD B;  2QM4 A;  4DV7 B;  1H2M A;  2P67 A;  3A0R A;  4OPA A;  2IJI A;  2YI9 A;  2ZXW C;  4FZ0 A;  2FYU H;  3VQY A;  5LHI A;  4PI2 A;  4I7Z B;  1FAF A;  4FLW A;  3APO A;  4JI5 B;  3F7Y C;  2Y69 B;  4JZ2 A;  3H1J H;  3JAT B;  4IT5 A;  4DRX B;  4F6E A;  3B2E E;  4K8Z A;  2ZE5 A;  2JS5 A;  1VF6 C;  2DE0 X;  2VWJ A;  4NB5 A;  3B8N A;  2JEX A;  1K5Q A;  3OW2 U;  4J7Z A;  3K5N A;  2HVJ C;  1BQZ A;  4X64 B;  1YHQ V;  4B3S O;  1OCC B;  1L8D A;  4LR3 A;  2GDS A;  1MSD A;  1QCE A;  2PI5 A;  1G4Y B;  4FZ1 A;  3CRC A;  4JI3 B;  4B3T O;  4TV9 B;  2QKS A;  4JI4 O;  2DYR C;  1KQS U;  1CXZ B;  4O4J B;  3N2K A;  3EVK A;  3P30 A;  1TUB B;  1WA8 A;  2ZQM A;  2LW1 A;  4UB6 Z;  2KKW A;  1GM7 A;  3K0G A;  1HNW B;  4PA3 A;  1YTF B;  4DR7 O;  1YEW A;  1VAR A;  4FM0 A;  2CH7 A;  2F4V B;  3GB7 C;  3CRR A;  1FXV A;  1VMG A;  4DR1 B;  4HNA A;  3ABU A;  1RP3 B;  3CMA V;  1DK1 A;  2Q68 A;  1SQX H;  3ZHR A;  1BCC H;  5EYP A;  3LSU A;  4O2A B;  1V54 C;  1H2L A;  5IJ0 B;  2YEV B;  4DUY O;  4X66 B;  5EIB C;  2EBO A;  2EIN C;  1KKC A;  1RSO A;  2QGN A;  2GV9 A;  3SYO A;  4ASU G;  3OTO B;  3MHH C;  2FTK A;  1K9M W;  3T1Y O;  1VQP V;  5KX5 A;  3TJT A;  4DR4 O;  1IBM O;  4MSW C;  2VQE O;  1HR0 O;  1GH6 A;  2CTW A;  4P2Z A;  1EZV H;  1PNM A;  1P84 F;  4ZIB A;  1R6K A;  5IWA B;  4KUM A;  3C90 A;  3AG2 C;  2OIG A;  3AG7 A;  3WU2 Z;  5LHH A;  1XNQ B;  2L35 A;  4W4K A;  4JI7 O;  4JI2 B;  4U7N A;  2OTJ V;  1KB9 F;  2ZR3 A;  1HNX O;  2BTQ A;  3R66 A;  3ZBH A;  1WB8 A;  4B3S B;  2JRI A;  1B06 A;  2ILM A;  2DMX A;  4H0L B;  4XDK A;  3ZN1 A;  4PD4 F;  1WJZ A;  1H2S B;  3AK3 A;  5C8Y B;  3CRM A;  4B3T B;  1DLB A;  3CRA A;  1P7B A;  2DWE C;  1AI5 A;  4JI4 B;  3JCZ A;  1GO3 F;  4O2B B;  2EJR A;  3OUF A;  3W7T A;  3ZED A;  4AIL C;  4DV0 O;  4LNU B;  4G28 B;  2YIA A;  5CMU A;  4N23 A;  4FFK A;  5B1O A;  4PDM A;  4DR7 B;  4NXM O;  5J2U B;  3AG1 C;  3IJ4 A;  3AG3 C;  1MZE A;  2Q7G A;  4DYL A;  3ZHU A;  3ZS8 C;  1COW G;  1PNL A;  1YF2 A;  1ZAU A;  3TGU H;  4XDJ A;  4A5U B;  3O65 A;  2XOK G;  3O9O A;  2F93 B;  1VP7 A;  3K0D A;  4KL1 A;  4DUY B;  3ASO C;  3A8T A;  1L0N H;  2YIB A;  3MD0 A;  4X1K B;  5A2Q N;  1Z5W A;  1XNR O;  3J80 N;  5JCO A;  3K03 A;  2ARH A;  2OIE A;  2OTL V;  5L3G A;  3T1Y B;  3X2Q C;  5JJN B;  4CBC A;  2JGU A;  4DR4 B;  1WB7 A;  3LUT B;  1IBM B;  2VQE B;  4LP8 A;  1HR0 B;  4DR2 B;  4MTF A;  1AJN A;  1IBL O;  1FFT B;  2DYS B;  5EBW C;  4O4I B;  1H2G A;  2EIK B;  1E1R G;  1SER A;  5GON A;  1IXB A;  1BS3 A;  4FLX A;  1Y74 B;  1VQ7 V;  1OCZ B;  4RO2 A;  1IBK O;  3AK1 A;  2ITD C;  4JI7 B;  4GX0 A;  4H37 A;  5B1A B;  4J9Z B;  5CA1 A;  2UUA O;  1NR1 A;  2Q69 A;  2M7W A;  4JI6 O;  4FLU A;  2XAJ A;  4CC6 A;  4KP4 A;  3HB3 B;  3CCV V;  5LHG A;  4C7U A;  3ZHQ A;  4MW8 A;  3CHX A;  1OZ0 A;  3UO3 A;  1I08 A;  4DV0 B;  2JGD B;  4KXR A;  5CA3 A;  4JYC A;  3SJC C;  5IJ9 A;  4U3F H;  2HFE C;  2ATK C;  2JEU A;  4TOI A;  2Y4T A;  2YSU B;  3H01 A;  5LXT A;  4P30 A;  1TA8 A;  2V4D A;  2DN9 A;  2LQT A;  2QWQ B;  2XAH A;  1R3L C;  3G71 V;  2P5O A;  3H1K H;  1VQK V;  5ITZ A;  5KA6 A;  1XMQ O;  4TUY A;  3NR7 A;  5LGU A;  4X20 B;  3WFV A;  1PD3 A;  1WPX A;  3IC9 A;  1SQF A;  4UCS A;  3CC7 V;  1XNR B;  3HKE B;  1U96 A;  1V55 B;  2JVD A;  3ZMU A;  4CS3 A;  2HG5 C;  1NS1 A;  2OYQ A;  1R1B A;  2AZ2 A;  5CBH A;  1R3K C;  1CEZ A;  1NKD A;  3QG5 A;  4LFB O;  1N32 B;  3RGB A;  2PY5 A;  1GM8 A;  3DC5 A;  3B77 A;  5EK0 A;  4JTC B;  3GVM A;  4JV5 O;  3OGC C;  4PEL A;  2HVK C;  5BXZ A;  3OGI B;  5LA6 B;  5J2T A;  5B3S C;  2AXT Z;  4RWU A;  4DRX A;  1IBK B;  4ZKI A;  4UCU A;  3SGI A;  4F4L A;  3ZHV A;  1VF6 A;  1ZUQ A;  3CSX A;  2UUA B;  1OJH A;  1BL8 A;  4FLV A;  4YY3 O;  3VQV A;  4EFE A;  3CP1 A;  2YXH A;  2Q5Z A;  1BHA A;  1S72 V;  1XMO O;  1ZL8 B;  3JAK B;  1SZX A;  2CE4 A;  2X6A A;  4NVP A;  4O4J A;  1TUB A;  1W59 A;  2F1M A;  2GTA A;  5CN0 A;  1Q6H A;  1FXK B;  5L3D A;  5JQG B;  2R9R B;  1Y4M A;  4K8X A;  3HKB B;  4E2L A;  4IHJ B;  2CAZ C;  5EC2 C;  1GRJ A;  4B3R B;  4JPR A;  3W7X A;  1PM9 A;  4UCV A;  2UUC O;  3T1H B;  1Q8I A;  4O2A A;  4J41 A;  2B1G A;  2YEV A;  1ZSP A;  3ABL C;  3ZRS A;  1XMQ B;  3FYE B;  3FB6 C;  3JSL A;  3LSS A;  3ABL B;  1SF9 A;  3PN1 A;  2QWN B;  1MG1 A;  2E74 B;  2WLJ A;  1QLE C;  5KMG B;  2BTO A;  2XUM A;  1LUV A;  2A9H A;  5J9P C;  5H6R A;  1V9P A;  1TAE A;  4LFB B;  3HKC B;  3M99 B;  2W0F C;  2IH3 C;  3BAB A;  5IYD O;  3B09 A;  4DV3 B;  4JYB A;  3ICX A;  1TVK A;  1VQ5 V;  1D2D A;  3FX7 A;  3BY6 A;  1L1F A;  4JI1 O;  4JV5 B;  2ZKO A;  4JAV A;  5BR8 O;  3E8G A;  3QO5 A;  1AB3 A;  4X65 O;  2ZIN A;  3JD1 A;  1JCH A;  3CXH F;  1QVF U;  2R9A A;  4YY3 B;  1HWY A;  1VQ8 V;  2AHY A;  3BFR A;  2ZD9 A;  2QTS A;  2RN9 A;  1YJW V;  2GTS A;  2WLH A;  2IU0 A;  4U7O A;  5LOV B;  5C8Y A;  2P06 A;  1P4R A;  4FMT A;  4WFH A;  2B1I A;  3TK1 A;  4P9P A;  2HP8 A;  1RFY A;  2BE3 A;  5DED A;  4UCR A;  3STZ C;  4EB6 B;  2B5U A;  3T4Z A;  4H33 A;  3D8C A;  3WG7 B;  4LFA O;  1YXB A;  3B40 A;  3SYQ A;  4Q20 A;  5KAI Z;  3K5M A;  5KA5 A;  2UUC B;  4X9Q A;  1US6 A;  4FVM A;  1XHX A;  2Q7H A;  3RYI B;  3VQW A;  1E1Q G;  4HBN A;  1K97 A;  1UJW B;  1H2N A;  1GN4 A;  4UVC A;  5L3B A;  1B04 A;  3OAA G;  1Z2G A;  2GSM B;  3P3P A;  1AR1 B;  2EIL C;  1KYO F;  1QU7 A;  5EZY A;  3DGE A;  1UFI A;  5CB4 A;  5FNV B;  1M57 C;  4LWS A;  3DTU B;  3K9A A;  3BPZ A;  1M57 B;  2ZM6 O;  4NKG B;  4O4I A;  4WBN B;  1RPO A;  4Z1M G;  2BOB C;  1QBZ A;  2KG7 B;  4AI8 A;  4I50 B;  2FML A;  4JI1 B;  3L73 H;  5HFM A;  1WAZ A;  4YXW G;  4GX2 A;  4MTO A;  2QWO B;  1YSC A;  5BR8 B;  3FB8 C;  2KQX A;  4X65 B;  4YJ3 A;  4CC5 A;  2CDY A;  3RYH A;  1H8E G;  3DXR B;  2Y69 C;  4PDR A;  2VS0 A;  4JYA O;  3I56 V;  2LJ2 A;  3WB2 A;  2QM7 A;  4RQF A;  3E8B A;  4I5S A;  3E22 B;  3OFN G;  1AI7 A;  4NTX A;  5D5Q A;  2AHZ A;  3OR6 C;  3IFX A;  1FXH A;  1A32 A;  3CYO A;  1HW7 A;  2Z5U A;  2JGD A;  2D2C B;  1H2K A;  1OCC C;  5GW7 A;  2OT5 A;  3G6E V;  3N27 A;  3JAM N;  1KEC A;  2X6C A;  3SPJ A;  4LFC O;  3ZRX A;  4JAS A;  1IX9 A;  4LFA B;  3JAL B;  3RYC B;  2ZT9 B;  1HNZ O;  5LL6 Y;  3FFQ A;  1IXM A;  1N0J A;  4PDL A;  3C3S A;  4JZG A;  2G38 A;  4X20 A;  1Q82 W;  3DSQ A;  3JCU Z;  4LH6 A;  1K3E A;  3JD2 A;  3SYC A;  4L87 A;  5B66 Z;  3H1H H;  2R72 A;  4KHP O;  4MTX A;  1BT8 A;  3U0Z A;  1GMG A;  4LF5 O;  5KUM A;  2ZM6 B;  2A7W A;  2F66 C;  2PF4 E;  4D6T H;  2QWR B;  3HPL C;  1K34 A;  3ABT A;  1R3J C;  2WAM A;  4J7J A;  3JAS B;  1Z5V A;  2VQF O;  4F6R A;  2QA4 V;  1SRY A;  2EIM B;  4DK1 A;  1MOF A;  2UU9 O;  3ETG A;  3QNE A;  3LNM B;  1YIJ V;  1RM1 B;  1NVP D;  1N0N A;  3PJS K;  2B9Z A;  4JYA B;  1JFF A;  4I4T B;  5IT9 N;  3WB1 A;  2IJH A;  4I55 B;  5KHG A;  2RQ6 A;  2CUG A;  2E76 B;  2N05 A;  1N34 O;  4YIP A;  1Y76 A;  1BZK A;  2H94 A;  3D3Q A;  2PZS A;  3K57 A;  2AGA A;  3CCM V;  5JQG A;  2NN4 A;  1SKV A;  1GM9 A;  3HKB A;  5CA0 B;  3G4S V;  3KZI Z;  4IHJ A;  4K3A A;  4BWA A;  1SES A;  1AJP A;  2GUZ B;  3HKD B;  4LFC B;  3UO2 A;  2Y4U A;  2CTR A;  1PV0 A;  5KLV H;  2A79 B;  1PL0 A;  4ZI7 A;  1F4M A;  3T4D A;  1THZ A;  1HNZ B;  2N04 A;  1VQ9 V;  2LW7 A;  2H3O A;  1NZ6 A;  1GN6 A;  2IH1 C;  4H44 B;  2OCC C;  5BY1 A;  2A0L A;  1J5E O;  2VRZ A;  1H38 A;  2OCC B;  5KMG A;  1HP8 A;  4BW9 A;  5IYZ B;  3CPW U;  3KCY A;  4L8J A;  4LF7 O;  4GKJ O;  1I0H A;  2E75 B;  3ETE A;  3ZMS A;  5IE9 A;  4LF5 B;  1FPO A;  5K1P A;  3HKC A;  3CJH B;  2P6J A;  3JAW B;  3G67 A;  4MVQ A;  5JH7 A;  2KSD A;  3SJB C;  3AG4 B;  1JJ2 U;  4ZHQ B;  3DC6 A;  5C93 A;  1T5E A;  3CRQ A;  3RFR A;  3KG2 A;  3J7A U;  2ETN A;  2XHB A;  2Q8V A;  1SET A;  1WP7 A;  2VQF B;  1F4N A;  2RJZ A;  1FFX A;  4X1Y B;  4B7E A;  2FB5 A;  2UU9 B;  2DYS C;  4LC1 A;  4O4L B;  4RQE A;  3ZIA G;  2EIK C;  5TIS Z;  3RW0 A;  1P7G A;  5DEC A;  1OCZ C;  4U3J B;  4JYY A;  3F7V C;  2YIB D;  3OMI B;  2C2A A;  1N34 B;  3OR7 C;  5B1A C;  2BSK A;  3ABK B;  3E2E A;  2R70 A;  3JAR B;  4BIO A;  3ZMV A;  2YI8 A;  1JMK C;  1HNX B;  3ASN B;  3SJA C;  1XBL A;  4EB6 A;  4X62 O;  3ZJZ A;  3OMN B;  2W0X A;  3CCR V;  3IC7 A;  1MNG A;  2IBZ H;  3KCX A;  1I7F A;  4I9W A;  4H13 B;  4CH3 A;  3RYI A;  2CGN A;  3N2G B;  1XEQ A;  2WPD G;  2BOC C;  1KBH A;  4ABM A;  4DV6 O;  1WN7 A;  2P4V A;  5H5N A;  1NR7 A;  4NXM B;  3CS5 A;  3FAV A;  2HJD A;  4LF4 O;  3M8A A;  4LF7 B;  4GKJ B;  1L0L H;  3SPG A;  2CTQ A;  3GWO A;  1OV9 A;  1XQ8 A;  4WBN A;  2AW9 A;  1K4D C;  2N74 A;  3ZRV A;  4R50 A;  2E3C A;  5BMV A;  2WSS G;  4I50 A;  1S76 D;  4X1I B;  1M4U A;  3Q4H B;  1V55 C;  3H1I H;  2YXY A;  2Q7E A;  1SQP H;  4ZOL B;  1MZF A;  3J81 N;  1ZWI C;  3BA8 A;  3N2K B;  1GK9 A;  1WA8 B;  4DO2 A;  2F95 B;  5HFL A;  2YS8 A;  1IBL B;  3P3N A;  5E1A C;  1GKF A;  1Y6X A;  3NXS A;  1LUW A;  3U11 A;  2CH7 B;  4HYO A;  2UUB O;  1S0V A;  1KD1 W;  3JAT A;  1G6U A;  4GYC B;  2PYJ A;  4IIJ B;  4HNA B;  1XI1 A;  1NVP B;  2ZCE A;  3UM7 A;  1SQQ H;  1OCR B;  3CCJ V;  5EYP B;  4BW5 A;  1PL4 A;  1XIL A;  4EFB A;  3UT5 B;  2Q67 A;  1IVS A;  5EBM C;  1WPB A;  5LMU O;  2OWO A;  1M90 W;  4K35 A;  4O4H B;  2OCH A;  4MVO A;  1QNM A;  4JI6 B;  1BE3 H;  1K8A W;  1EN6 A;  5LP6 B;  1M56 B;  4TV9 A;  3JAL A;  2LO1 A;  5LMN O;  1NTZ H;  5KX5 B;  1BQ0 A;  1D5N A;  1FXK C;  5KHJ A;  2KB1 A;  2Q6A A;  4Z1V A;  2YC0 A;  1I94 O;  1D5A A;  2UXB O;  4DV6 B;  1K4C C;  2M6Y A;  2JJ1 G;  2RMK B;  1KP3 A;  4LH7 A;  3WB0 A;  2EIJ B;  3ZMT A;  5EC1 C;  4UXN A;  1GN3 A;  5FPO A;  2GBO A;  1NTK H;  5JJE B;  3JD0 A;  4DV4 O;  4LF4 B;  4QNH B;  4WCE V;  1OCO B;  1NJI W;  4DUZ O;  4QPK A;  5IJ0 A;  2FKX A;  1YJN V;  4I9Q A;  4RAI A;  2BTQ B;  1ORQ C;  1AR4 A;  3ZHT A;  1MMM A;  4JF3 A;  2F23 A;  2PI4 A;  4DV1 O;  3JAS A;  3QO7 A;  2DQ0 A;  1Y67 A;  1WP8 A;  4UFZ A;  3CXC U;  2L6L A;  1Y66 A;  2LP7 A;  4WFF A;  3ZCC A;  2Y0P A;  4D7T A;  4I4T A;  2YXL A;  5JVD B;  3TET A;  1KP2 A;  4PHZ A;  3ZRW B;  1ZX3 A;  2K1E A;  4DR5 O;  1R6T A;  1NU1 H;  2WLI B;  5EIB D;  2A3Q A;  2NR5 A;  3H9V A;  1S3J A;  4DV2 O;  3OD4 A;  3ZN0 A;  3CCU V;  4UCO A;  5CA0 A;  1M93 A;  3P32 A;  4FPP A;  5LMU B;  4UB8 Z;  3AK2 A;  1LNQ A;  2GUZ A;  3ML0 A;  2MW2 B;  2QE7 G;  2QEX V;  4D7S A;  2WLK A;  4I0X B;  4E4E A;  3JD4 A;  1XMO B;  5IDJ A;  1JA8 A;  2W6I G;  5H2F Z;  4WF9 V;  4IYI A;  3QVN A;  1XRE A;  4O2B A;  5LMN B;  1GTO A;  4YHH O;  4LNU A;  4TQD A;  2PGG A;  2XAS A;  5JJJ B;  1EFR G;  5IY5 C;  4J7K A;  3A0B Z;  2UXB B;  4DW0 A;  3ABM B;  4JAU A;  2ADQ B;  5IY5 B;  5J2U A;  3WG7 C;  4WFE A;  1VQL V;  3G80 A;  2HR3 A;  3OM3 B;  5IYZ A;  2ZE6 A;  1QLN A;  4MTG A;  3F5W C;  1YCI A;  3THO A;  1BGY H;  2YUA A;  1R73 A;  1NI8 A;  1XL6 A;  3E8H A;  4GCZ A;  4CS4 A;  1XOU A;  1B6Q A;  1NQT A;  3R65 A;  5KHK A;  3CJH A;  3I55 V;  3VQX A;  2WWW A;  3CC2 V;  1GAX A;  3FYI B;  4LCU C;  3RT3 C;  4GX1 A;  4B3M O;  2P7T C;  4YJ2 B;  1Q5O A;  4DV1 B;  3VOU A;  4X1K A;  5K1X A;  4J42 A;  3TXS A;  5KHI A;  3B8M A;  4ICG A;  3L75 H;  1U97 A;  3K06 A;  1URF A;  4O4L A;  1EM1 A;  1I5Y A;  4GLX A;  2YIC A;  3OTF A;  3SYP A;  3A0H Z;  1MAB G;  4U3J A;  2JS3 A;  2MK3 A;  2F4V O;  4DR5 B;  2PYL A;  1FJG O;  1Y74 A;  3MHS C;  1VF5 B;  4GT1 A;  1VQN V;  2XT9 A;  2NLJ C;  4G2K A;  1KKD A;  2BCC H;  3JAR A;  4JI8 O;  1NBM G;  4DV2 B;  1SA0 B;  4TT3 G;  1PKX A;  1Q7Y W;  1E79 G;  2WLL B;  4R8C A;  2X0L A;  1DGS A;  4R7C A;  1W2B U;  2EZO A;  4TUY B;  2D3O W;  1O9G A;  1AP5 A;  5BZB A;  1JJO A;  3T2M A;  5LYJ B;  3E8F A;  4MVR A;  2V1D A;  5AG2 A;  2EX3 A;  3N2G A;  5IYB O;  4YHH B;  1K7D A;  4KFM A;  1PP9 H;  1EN4 A;  2ZXW B;  1O9H A;  5IWA O;  4B08 A;  3ZHS A;  3BRC A;  4PA6 A;  3D3I A;  1K92 A;  2WLN A;  5DN6 G;  5J2T B;  4FLZ A;  2QJ1 A;  1XNQ O;  5EBL C;  4JI2 O;  3A2F A;  4CH6 A;  4BIU A;  4DR6 O;  2CTP A;  2ZR2 A;  2WA3 A;  4UV8 A;  4X1I A;  4CS2 A;  4J80 A;  4B3M B;  3Q4H A;  2UXX A;  2W6J G;  1WLE A;  3HKE A;  2P90 A;  1NH2 D;  4ZOL A;  3RYF B;  5FL7 G;  3LDC A;  3L9D A;  2DYR B;  1QR8 A;  3IAY A;  2IM9 A;  4CH5 A;  2EZP A;  4DV5 O;  1YZB A;  3SPH A;  2QKA A;  2A06 H;  5B5E Z;  1F23 A;  1G8M A;  3G6B A;  4J11 A;  1FJG B;  2HEP A;  5LA6 A;  2Q4P A;  1NT2 B;  2EIM C;  4IIJ A;  4PV1 B;  3LNN A;  5CBF A;  4JI8 B;  1JR9 A;  1EN5 A;  5LBQ A;  1ENV A;  2X7R B;  1RM1 C;  1N4C A;  5H6Q A;  3U10 A;  2QKC A;  3UT5 A;  3L71 H;  2CK3 G;  5D5P A;  1V54 B;  4O4H A;  4PA4 A;  2Z0A A;  5LP6 A;  1ZL8 A;  2EIN B;  3JAK A;  2XAG A;  4QIW F;  4PDV A;  4GKK O;  4FLT A;  4DR2 O;  4DXW A;  4Z2W A;  2UXC O;  1FXK A;  5E79 Z;  1MSW D;  1EZJ A;  1SQV H;  3MDS A;  5KHH A;  4NTW A;  4X88 A;  4FFB B;  1TVK B;  3K04 A;  2XAQ A;  2Q9L A;  4P9O A;  4QE7 A;  4NYK A;  3RWR D;  3AG2 B;  2LGQ A;  4LF6 O;  4OXS A;  4DR6 B;  4JGS A;  4UVB A;  2ZIO A;  2E5L O;  3W7U A;  2XND G;  3W7W A;  3ETQ A;  1W0K G;  1VQM V;  3JD3 A;  1PPJ H;  1KC8 W;  1N36 O;  4KHP B;  2X6B A;  1YJ9 V;  4UCT A;  3EXA A;  5KUK A;  4AHC A;  2XAF A;  1UPG A;  3K58 A;  4FJC C;  4UVA A;  3AG4 C;  3BCC H;  5FPR A;  5GTH Z;  3C3T A;  3CB2 A;  5JVD A;  1TUE B;  4DV5 B;  3ZRW A;  2FL4 A;  4JAA A;  2WLI A;  2XTA A;  3RVZ A;  4W4L A;  2RCV A;  4OPH A;  4PA7 A;  4LF8 O;  3AG1 B;  2HKO A;  2QDO A;  3AG3 B;  3TCU A;  1S5L Z;  3EHB B;  1RPR A;  3BEH A;  4TV8 B;  4CZZ A;  3UKM A;  4G27 B;  1BSM A;  1IZ3 A;  3M7M X;  3JYC A;  1BHB A;  3CWB H;  4GX5 A;  1JQ0 A;  2ZDI C;  5LOV A;  4Q6G A;  3OEH G;  2HJF C;  3ASO B;  3FD9 A;  2P22 C;  3OMA B;  4I0X A;  4DW1 A;  3S3X A;  5L3F A;  2DWD C;  3TXQ A;  1Q43 A;  3ABK C;  1J95 A;  1CP9 A;  5FLX N;  2UXD O;  4GKK B;  4TWK A;  5EZY B;  5CB4 B;  3ASN C;  3X2Q B;  5IYC O;  2UXC B;  4LWS B;  2CGO A;  1N32 O;  1DF5 A;  4XBF A;  4FLY A;  1VF7 A;  4QJF B;  1OHH G;  3CEI A;  3FB5 C;  1ROP A;  4X89 A;  3UCS C;  1KMI Z;  3LDE A;  1QR9 A;  1AP6 A;  2QSA A;  1R6N A;  2HHH O;  2Q0O C;  4LF6 B;  1DF4 A;  3K79 A;  4YJ3 B;  1YVW A;  3RYH B;  4YJ2 A;  4UUJ C;  1ZTE A;  2YID A;  3ZX6 A;  2E5L B;  1J5E B;  5L3C A;  1XL4 A;  3SPI A;  4IL6 Z;  3BHP A;  4R6Z A;  4FM2 A;  5A9G A;  2YDE A;  4FK5 C;  4RUF A;  1AIL A;  1N36 B;  3STL C;  1AJQ A;  1Q90 D; 
#chains in the Genus database with same CATH homology
 5LHH A;  1YSC A;  3CCS V;  4ZBM A;  3FB8 C;  4MT8 A;  4U7N A;  3CXC U;  3D36 A;  2OTJ V;  2ZR3 A;  4N21 A;  1Y66 A;  2LP7 A;  1H8E G;  1PNK A;  4WFF A;  3ZCC A;  1EBO A;  1K73 W;  2Y69 C;  4PDR A;  2JDI G;  1VQ4 V;  1VQ6 V;  3I56 V;  2QM7 A;  3TET A;  4RQF A;  1KP2 A;  3E8B A;  1ARO P;  3AEI A;  3ZRW B;  4XDK A;  3ZN1 A;  2K1E A;  4I5S A;  3CCE V;  3OFN G;  2WLI B;  1AI7 A;  1NH2 B;  2LFS A;  1S5H C;  1DLB A;  2NNU A;  1P7B A;  1S3J A;  1AI5 A;  2AHZ A;  2DWE C;  3OR6 C;  2ITC C;  2WLL A;  3IFX A;  3JCZ A;  1FXH A;  1GO3 F;  2EJR A;  3CYO A;  3OUF A;  3ZN0 A;  3W7T A;  3CCU V;  2Z5U A;  1BMF G;  1YI2 V;  2DW4 A;  1OCC C;  5GW7 A;  4RUE A;  3P32 A;  4FPP A;  4FIP C;  2OT5 A;  4G28 B;  1LNQ A;  3G6E V;  5CMU A;  3ML0 A;  4N23 A;  3OEE G;  4BIZ A;  5B1O A;  4PDM A;  4HZ3 A;  2F43 G;  1KEC A;  3AG1 C;  2X6C A;  3SPJ A;  2QE7 G;  2QEX V;  3CD6 V;  3AG3 C;  2WLK A;  4JAS A;  3ZRX A;  2R9I A;  3JD4 A;  5IDJ A;  2HLD G;  2JK5 C;  2QM8 A;  2W6I G;  1COW G;  4WF9 V;  1PNL A;  1OCR C;  1GTO A;  4XDJ A;  2XOK G;  1R3I C;  2XAS A;  1IXM A;  3FB7 C;  3K0D A;  1EFR G;  4PDL A;  1JPX A;  5IY5 C;  3E86 A;  1N8R W;  3RBZ A;  3ASO C;  1Q82 W;  1F51 A;  3ABM B;  4JAU A;  1VQO V;  1K3E A;  3JD2 A;  5IY5 B;  3SYC A;  4L87 A;  3WG7 C;  1M56 C;  3MD0 A;  4WFE A;  1VQL V;  1Q81 W;  2HR3 A;  5LGN A;  3OM3 B;  3RVY A;  1QLN A;  4MTG A;  4MTX A;  3F5W C;  3K03 A;  2OTL V;  5L3G A;  1R73 A;  5B1N A;  1XL6 A;  3E8H A;  4GCZ A;  3X2Q C;  1GMG A;  4CBC A;  1B6Q A;  1NQT A;  3LUT B;  3R65 A;  5B3S B;  3I55 V;  4LP8 A;  2WWW A;  4MTF A;  1AJN A;  3ETD A;  5CBG A;  1DTO A;  5KUM A;  1JVM A;  3CC2 V;  1FFT B;  2DYS B;  5B1B C;  2EIJ C;  3FYI B;  5EBW C;  4LCU C;  1H2G A;  2EIK B;  4GX1 A;  2P7T C;  1E1R G;  3HPL C;  5B1B B;  1K34 A;  2DQ3 A;  3VOU A;  4JTA B;  1SER A;  3ABT A;  1R3J C;  4WFA V;  2WAM A;  1OCZ B;  3B8M A;  3OUS A;  3T1C A;  4MS2 A;  4RO2 A;  1OCO C;  1K33 A;  2QA4 V;  1SRY A;  2EIM B;  2ITD C;  3W7S A;  3K06 A;  4GX0 A;  1MOF A;  4H37 A;  5B1A B;  3ETG A;  3QNE A;  3LNM B;  1YIJ V;  4J9Z B;  1RM1 B;  1NVP D;  1I5Y A;  3PJS K;  1NR1 A;  2Q69 A;  3SYP A;  3LSQ A;  5DM6 V;  1MAB G;  2IJH A;  2M7W A;  4EKW A;  4TSF G;  2MK3 A;  1YTF D;  3MHS C;  2XAJ A;  4GT1 A;  1VQN V;  4KP4 A;  2NLJ C;  3HB3 B;  4G2K A;  3CCV V;  5LHG A;  1KKD A;  1M9N A;  1NBM G;  2H94 A;  4TT3 G;  1PKX A;  4MW8 A;  1Q7Y W;  1E79 G;  2WLL B;  4R8C A;  1OZ0 A;  2X0L A;  1JX9 A;  3CCM V;  4R7C A;  1W2B U;  2V7Q G;  2EZO A;  5CA3 A;  4JYC A;  1GM9 A;  4MVM A;  3CCQ V;  2D3O W;  2IJK A;  3G4S V;  4XDL A;  2HFE C;  2ATK C;  1SES A;  5BZB A;  1AJP A;  2JEU A;  2YSU B;  3H01 A;  4P30 A;  4MW3 A;  3ZMZ A;  4J9Y B;  2A79 B;  1PL0 A;  3E8F A;  4MVR A;  3T2M A;  1F4M A;  1QLE B;  2V1D A;  1K5S A;  2XAH A;  3T4D A;  1R3L C;  1THZ A;  5IYB O;  3G71 V;  1K7D A;  1VQK V;  4KFM A;  5KA6 A;  1VQ9 V;  2ZXW B;  3SPC A;  2IH1 C;  2OCC C;  5LGU A;  2A0L A;  1I5X A;  4PA6 A;  3WFV A;  1H38 A;  2OCC B;  3CCL V;  1PD3 A;  3IGA C;  1WPX A;  3CC7 V;  3D3I A;  1K92 A;  3CPW U;  3E35 A;  3CME V;  2WLN A;  5DN6 G;  1V55 B;  1M1K W;  3SYA A;  5EBL C;  3ZMU A;  4BAY A;  3ETE A;  3ZMS A;  2HG5 C;  4BIU A;  5CBH A;  1R3K C;  1CEZ A;  2P6J A;  1QVG U;  4QPJ A;  1NKD A;  1W0J G;  4MVQ A;  2ZR2 A;  3ABM C;  1Q86 W;  3E89 A;  2IU3 A;  1GM8 A;  3AG4 B;  3B77 A;  1CPY A;  3E83 A;  4UV8 A;  5EK0 A;  1JJ2 U;  5C93 A;  3KG2 A;  4JTC B;  2UXX A;  3OGC C;  1AI4 A;  2W6J G;  2HVK C;  4PEL A;  1WLE A;  1SET A;  2P90 A;  5B3S C;  1NH2 D;  3QO8 A;  5FL7 G;  1F4N A;  3LDC A;  4ZKI A;  1S77 D;  2DYS C;  4LC1 A;  4F4L A;  2DYR B;  4RQE A;  4UV9 A;  3ZIA G;  2UXN A;  1QR8 A;  2EIK C;  1BL8 A;  2QTO A;  2EZP A;  3RW0 A;  3SPH A;  1F23 A;  3SJQ C;  1G8M A;  3CP1 A;  1OCZ C;  3F7V C;  3OMI B;  3K3W A;  1BHA A;  2C2A A;  1S72 V;  2EIM C;  1AI6 A;  3OR7 C;  5H9C A;  2LFR A;  5CBF A;  5B1A C;  5LBQ A;  2X6A A;  3ABK B;  3FKS G;  3E2E A;  3K08 A;  4MVZ A;  1ENV A;  2X7R B;  3VBB A;  1RM1 C;  3ZMV A;  5H6Q A;  1YIT V;  5CN0 A;  1FS0 G;  3LDD A;  2CK3 G;  3ASN B;  1FXK B;  5L3D A;  2JJ2 G;  1V54 B;  2GHY A;  1Y4M A;  2R9R B;  3ZJZ A;  2IW5 A;  3OMN B;  3CCR V;  4E2L A;  3IC7 A;  4PA4 A;  4WFG A;  3OE7 G;  2H8P C;  2EIN B;  2ZDI A;  4MVU A;  5EC2 C;  2JIZ G;  5L3E A;  4JPR A;  3W7X A;  2WLM A;  2XAG A;  1SZT A;  4I9W A;  4PA9 A;  4QIW F;  2EIL B;  3CC4 V;  4PDV A;  5LGT A;  2IJJ A;  4LBE C;  4DXW A;  2B1G A;  2YEV A;  3ABL C;  3ZRS A;  4WFB V;  2WPD G;  3FYE B;  1FXK A;  2BOC C;  1JOY A;  2Y48 A;  3FB6 C;  1H8H G;  1MSW D;  1EZJ A;  3LSS A;  3ABL B;  4MVS A;  4X88 A;  3K04 A;  1NR7 A;  3EFF K;  4X8A A;  2XAQ A;  4QE9 A;  1MG1 A;  2WLJ A;  4HAM A;  1QLE C;  2Z3Y A;  4P9O A;  4QE7 A;  4JTD B;  2A9H A;  3AG2 B;  2P67 A;  3A0R A;  3SPG A;  5J9P C;  2IJI A;  3GWO A;  5H6R A;  2ZXW C;  4OXS A;  5LHI A;  1K4D C;  4JGS A;  3M99 B;  4UVB A;  2W0F C;  2IH3 C;  5IYD O;  3ZRV A;  4R50 A;  4JYB A;  2WSS G;  1S76 D;  3F7Y C;  2Y69 B;  3W7U A;  1VQ5 V;  2XND G;  3W7W A;  3BY6 A;  1L1F A;  1W0K G;  1VQM V;  3JD3 A;  1V55 C;  1KC8 W;  2X6B A;  1YJ9 V;  4JAV A;  3E8G A;  5KUK A;  3QO5 A;  2XAF A;  3B8N A;  1ZWI C;  2JEX A;  4FJC C;  4UVA A;  1GK9 A;  3JD1 A;  3AG4 C;  1K5Q A;  1JCH A;  3OW2 U;  2HVJ C;  4DO2 A;  5HFL A;  1QVF U;  1TUE B;  5E1A C;  1YHQ V;  1VQ8 V;  1GKF A;  1HWY A;  1OCC B;  3ZRW A;  2AHY A;  3NXS A;  2ZD9 A;  1QCE A;  1YJW V;  2PI5 A;  2WLI A;  2WLH A;  2IU0 A;  1G4Y B;  4U7O A;  4YXW G;  3RVZ A;  1P4R A;  4FMT A;  4PA7 A;  4HYO A;  4WFH A;  1S0V A;  1KD1 W;  3AG1 B;  2HKO A;  2B1I A;  3AG3 B;  3TCU A;  4P9P A;  2QKS A;  3TK1 A;  2DYR C;  3EHB B;  1KQS U;  1RPR A;  1NVP B;  3UM7 A;  3BEH A;  3P30 A;  4CZZ A;  1OCR B;  3UKM A;  4BW5 A;  2ZQM A;  4G27 B;  3CCJ V;  2Q67 A;  5EBM C;  3JYC A;  1BHB A;  1GM7 A;  1M90 W;  3STZ C;  2B5U A;  3K0G A;  4GX5 A;  1JQ0 A;  2ZDI C;  4PA3 A;  3OEH G;  2HJF C;  3ASO B;  3OMA B;  4H33 A;  4MVO A;  3T4Z A;  1YTF B;  5L3F A;  2DWD C;  3GB7 C;  3ABK C;  1K8A W;  1J95 A;  1FXV A;  1M56 B;  1CP9 A;  3WG7 B;  3ABU A;  3SYQ A;  4Q20 A;  5KA5 A;  4TWK A;  3CMA V;  3ASN C;  1FXK C;  2Q68 A;  3X2Q B;  2KB1 A;  5IYC O;  2Q6A A;  1V54 C;  1E1Q G;  2YEV B;  1K97 A;  1DF5 A;  4XBF A;  1UJW B;  1K4C C;  2JJ1 G;  4QJF B;  2EBO A;  2EIN C;  1OHH G;  1KP3 A;  2EIJ B;  4UVC A;  5EC1 C;  3ZMT A;  5L3B A;  3OAA G;  3FB5 C;  2GSM B;  3SYO A;  1ROP A;  4UXN A;  1AR1 B;  4ASU G;  2EIL C;  4X89 A;  3JD0 A;  3MHH C;  2FTK A;  1K9M W;  1VQP V;  4QNH B;  3LDE A;  3DGE A;  4WCE V;  1QR9 A;  1M57 C;  1OCO B;  4MSW C;  1NJI W;  1R6N A;  1DF4 A;  4QPK A;  3DTU B;  3K79 A;  4P2Z A;  3K9A A;  1M57 B;  1YJN V;  4Z1M G;  1RPO A;  1PNM A;  2BOB C;  4RAI A;  1QBZ A;  1ORQ C;  1R6K A;  4UUJ C;  5L3C A;  4JF3 A;  1XL4 A;  4KUM A;  3SPI A;  2PI4 A;  4R6Z A;  3AG2 C;  4FK5 C;  5HFM A;  4RUF A;  3QO7 A;  3STL C;  4GX2 A;  2DQ0 A;  4MTO A;  1AJQ A;  1VQ7 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...