2P6JA

Full-sequence computational design and solution structure of a thermostable protein variant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
b'MKQWSENVEEKLKEFVKRHQRITQEELHQYAQRLGLNEEAIRQFFEEFEQRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords designed engrailed homeodomain variant UVF
publication title Full-sequence Computational Design and Solution Structure of a Thermostable Protein Variant.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p6jA00
3GWOA 1DF4A 3CYOA 1QBZA 5CN0A 1I5YA 1JQ0A 4FK5C 5CMUA 2M7WA 1MG1A 4N21A 3B8NA 5HFMA 4FJCC 3B77A 4G2KA 1SZTA 4JGSA 4N23A 5KA6A 1K33A 1I5XA 5KA5A 1DF5A 1JPXA 1F23A 3K9AA 1EBOA 2LP7A 1MOFA 2EZPA 1Y4MA 1QCEA 5HFLA 1ENVA 2EBOA 3MHHC 3P30A 1DLBA 1QR9A 3H01A 3WFVA 5H9CA 1K34A 3M99B 2X7RB 1Y66A 1QR8A 2OT5A 4FIPC 3MHSC 2P6JA 4E2LA 2MK3A 3B8MA 4JPRA 4JF3A 2EZOA 3CP1A
chains in the Genus database with same CATH superfamily
3KG2A 2JS3A 5KAFZ 2CH7B 2ZIMA 1PNKA 4GX5A 1N33B 1JOYA 3RYIA 4JYBA 1JFFB 2UXCO 2FTKA 1PL0A 4GKKB 1SF9A 5GTIZ 4J42A 2IJKA 5JQGB 1Q82W 1VIBA 5L3DA 2WPDG 1KYOF 3RBZA 2PF4E 3G80A 3T1HO 3CRMA 1BQ0A 1H8EG 1GKFA 1RP3B 1WA8B 3X2QB 3QF7A 2CTPA 1ZTEA 3VQVA 3ZHQA 4YJ3A 3HKBA 4K0KB 1YF2A 1AVMA 1S76D 2RDCA 2K9PA 2EIMC 4D6TH 4ZIBA 5E79Z 2ZM6B 3ETEA 4FIPC 4BAYA 3W7TA 1DGSA 5J9PC 1YJWV 5IY5B 3N2GA 3E8GA 1FXHA 2JIZG 3RYHB 4FLUA 1IBMO 3KCYA 4OPAA 4KFMA 3WG7B 3PJSK 4CBCA 1AJPA 1VQOV 1DF5A 4J7ZA 4B3MO 5JH7A 5H6RA 2YS8A 1MOFA 2UUAB 2QJ1A 2ZT9B 4GYCB 4CS2A 1Z2GA 3MD0A 2CAZC 2LFRA 4DV5O 5EZYB 4W4KA 3K79A 5BR8O 3K57A 2Y0IA 5JVDA 3O65A 5CA1A 4I9WA 3OD4A 4LFCB 2DYSC 2EINC 2JEXA 1OCOC 5LA6B 2OCCC 1N0NA 1FXKA 5KLVH 1QQCA 1TVKA 4X66O 1O9GA 2WLHA 1M1KW 3T1YB 1THZA 4EFBA 2F95B 3K0GA 4JF3A 4JI0O 1BHBA 3D3QA 2XT9A 2EIJC 5DEDA 4JI4O 3CEIA 4NXNO 3APOA 4LF9B 1SQXH 3SPGA 2AXTZ 4FM1A 3IGAC 1AR1B 3BRCA 4P9OA 2NNUA 3E2EA 1SZXA 1GM9A 3UKMA 4DXWA 1I94B 5LP6A 5J2TB 4K35A 3ZX6A 3ABLC 2ZXWC 2ITCC 3H9VA 3LSUA 3C3TA 2OCHA 2KB1A 1YVWA 2P4VA 3SPHA 5B1BB 4FJCC 5IT9N 4PA9A 4HYOA 1PM9A 5DECA 3HKDA 1HNZB 2Q7EA 3R66A 4MVMA 3JAMN 1VEWA 4JI5O 3K0DA 4JV5O 4IHJA 3FB8C 1K8AW 1NTZH 3UO2A 2Q68A 2Q7GA 3OMAB 3OTFA 1XMQB 4IYIA 1QBZA 4DV7B 4K8ZA 2XASA 2JDIG 1VQLV 1Q6IA 2IJIA 2P67A 5KHHA 4O4HA 1B3QA 2P5OA 2LO1A 4NR1A 1H2MA 1IXMA 4B3SO 4DR5O 1VMGA 5IE9A 3VQWA 4I55A 3ZRWB 2PYJA 1JR9A 1JMKC 2N05A 4BIOA 4MVRA 4O2BA 5ITZB 1XI1A 2UXXA 1YHQV 1NZ6A 4JTDB 3CJHB 3T4ZA 1YDXA 4C7UA 4JI7O 1QCEA 1K97A 2QM7A 4CS3A 5D5QA 4DUYO 1T5EA 3JD3A 4R6ZA 4QE7A 1ROPA 4MTXA 4DK1A 5EBLC 1IX9A 5BY1A 3FB5C 1K5SA 1XL4A 1TGOA 1RFYA 2NR5A 3ZRSA 1YTFB 1Y67A 4X1YA 2E5LB 1NU1H 2EBOA 1N36B 2JJ1G 3APQA 1Y6XA 2X6BA 3RYIB 3I5DA 4H13B 3E8BA 4I4TB 4LCUC 1OCRC 1XOUA 1YI2V 4UCRA 4GKJO 4DUZO 5LBQA 3L71H 5CBHA 4CC6A 1N32B 4B3RB 2HEPA 2RQ6A 4X8AA 3ZIAG 4LNUA 3VBBA 5E1AC 4K3AA 3ZJZA 2EJ7A 3IC7A 3HKBB 1HWYA 2Y4TA 3P30A 1FXKC 3OUSA 2YC0A 3SDLA 3L72H 1QR8A 1H2NA 3QO8A 2FL4A 2HVJC 1YIJV 3STLC 1GMGA 4JYCA 3ZEDA 4X1KA 2GTAA 4FM0A 5B1AC 3FD9A 4G27B 4TT3G 1XL6A 2ETNA 2A9HA 3ABUA 1OV9A 3JYCA 3MHHC 1J5EB 5B3SB 1TAEA 4WFHA 2QKAA 3EFFK 4LF6O 3U10A 2QSAA 3CE2A 4X1IB 3S3XA 1VF7A 2CTWA 5KX5B 3E35A 2R9RB 2ADPA 1MSWD 1N8RW 2DN9A 4WFBV 2P06A 5JVDB 4LP8A 2CGNA 5A2QN 4BWAA 2PZSA 1NVPD 1BQZA 1Q7YW 2PI5A 2UUBO 1B04A 3RFRA 4ZBMA 2Q0AA 2AZ0A 1OCZC 5F2VO 4EB6A 1S3JA 4CZZA 2YXYA 4N23A 1MZEA 1NTKH 1G6UA 4O4IB 4IYHA 1VF5B 2MW2B 4PI0A 2YEVB 5EYPA 1BGYH 3AK1A 2UUCO 4DRXA 2EIKB 5CB4A 2JS5A 2XAJA 2WWWA 4MTOA 3T4DA 2QWPB 4I5SA 5JCOC 3K58A 3OMNB 2ZE6A 2R70A 4DR3B 4I0XA 3DXRA 3CCSV 4WCEV 1W0KG 2ZNIA 2JVDA 4X64O 4GLXA 4O4HB 3FB7C 3T1YO 1NBMG 3BEHA 1Y76A 4DR1O 1VQ9V 3PN1A 4R50A 2ZIOA 3SYAA 5EC2C 3D36C 4I50A 1TUBA 3ZHRA 3K5LA 3BHPA 2R9AA 4JTCB 4FLZA 1QNMA 2LP7A 1QLNA 5DN6G 3BCCH 2BTOA 1NR1A 1P84F 3ICXA 4LFAB 5CA0A 1CPYA 3JSLA 3E83A 4LF7O 3CP1A 2YICA 4UFZA 1OJHA 3C90A 1XNRB 1P7BA 3CXCU 4ABMA 3B77A 2JK5C 2ADQB 4FFBA 1JJ2U 4AQYB 1HNZO 4TUYA 1FAFA 4ZHQB 1HP8A 3E86A 4E2LA 4UV9A 1FYJA 2HLDG 5IYDO 5L3EA 5BZBA 1ZSPA 3ASOC 3T1CA 5L3FA 2XUMA 4MTGA 1FFXB 5KA5A 4PA3A 1KKCA 3QO7A 2P4KA 2QWRB 2HVKC 3SPJA 2IJJA 2Q0OC 3W7WA 1SS3A 1N0JA 5H9CA 1P7GA 2WLNA 4LBEC 1XDCA 2A06H 4UCTA 2DWEC 3N2KB 5LHGA 3K9SA 1AR5A 2DYRC 3RWRD 2ZE7A 5FNVB 3TXQA 4LFBO 2A7WA 1HR0O 4JTAB 5GONA 2DOSA 3Q4HA 4UVBA 3CCQV 5DM6V 3K06A 3AG2C 1X59A 3BPZA 3OE7G 4FVMA 2GSMB 2HJDA 1UJWB 4DR2B 4MVSA 2VQFO 2HFEC 1KMIZ 4JI8B 1PNLA 3ASNB 2QWQB 4BR6A 1WB8A 3QTCA 4L8JA 3SJCC 3U0ZA 3LNNA 3JARB 4DV4O 3TK1A 3L70H 2ODMA 2WLLB 2YXLA 1KKDA 4QGPA 3LDEA 1FS0G 5LMNO 3JD4A 5EBWC 4ZOLB 1XMOB 3TCUA 4DV1B 2KKWA 3CB2A 2X6CA 3X2QC 4DR4B 1NQTA 1SQFA 4I9QA 5BMVB 4KHPB 1FJGB 4JI1B 1UFIA 3QO5A 1W59A 2L6LA 1J95A 5LOVB 2YDEA 4QJFB 5LYJB 3RYCB 5HFMA 3ML0A 4LF5B 4B3TB 4Z2WA 1EN5A 1ZX3A 4TV9A 3KZIZ 2BSKB 3ZMSA 1Y4MA 3BVOA 3AEIA 1GH6A 3GVMA 4RAIA 3A0HZ 3VOUA 3P3PA 3WG7C 3M99B 1XQ8A 3SYCA 1F4NA 1R3LC 4HAMA 5KAIZ 4MVZA 1RSOA 3ZRXA 4NTYA 3E22A 4U3JA 2QDOA 5GW7A 4YIOA 3DTUB 4PDMA 1NH2B 1ZL8B 3DGEA 2UXBO 4I0XB 3F5TA 3DXRB 4QPKA 1EFRG 2HP8A 1M56B 3JSNA 1WAZA 3RYFB 4JI3B 3ZN0A 1SC5B 3LUTB 4G28B 5IJ0B 2WLJA 4A5UB 1MABG 1Z5WA 2KQXA 5B1NA 3JAWA 3J7AU 2VS0A 4GX2A 2F66C 4CH5A 5IYCO 4GX1A 4I50B 4DR7B 1BT8A 3FB6C 4JYAO 4EKWA 2ZD9A 1V54B 5LMUB 1TA8A 5B1OA 1QVGU 2BOBC 3RN4A 2F4VB 3A8TA 3ABMB 4U7OA 4QNHB 3K59A 1IBLO 1R73A 1Q86W 1W0JG 1IZ3A 4DO2A 4H33A 5IWAB 1GAXA 4FMTA 1VQNV 3WB1A 3UCSC 1BZKA 4L87A 1VQ8V 1U97A 1HNXB 3IAYA 4O4JB 5IDJA 2P7TC 4RWUA 2H94A 1XUQA 4ASUG 3E89A 3OTOO 2RJZA 4X20B 3AG3C 4MVQA 4F6RB 4X65B 1EZJA 3DC6A 3A2FA 4TV8B 3DC5A 4EFEA 1HNWB 3T2MA 1WP8A 1SA0A 4LF8B 4WBNA 3AG4B 3JCUZ 2F43G 1YZBA 5L3BA 1N34O 4LWSA 1AI5A 1ORQC 2EILC 3Q4HB 2RCVA 1XHXA 3B40A 4UCOA 4YJ2A 2EINB 2OCCB 4MVOA 2ZR3A 4H37A 3MAQA 3H1JH 5KA6A 2ZDIA 5K1PA 1NI8A 2EIJB 1L1FA 4YY3B 2ZKOA 1EN4A 4ICGA 4AILC 1KECA 4DV3O 3C3SA 3ZHSA 1DK1A 5LGNA 1OCCB 1OHHG 2CDYA 2YI9A 3ABLB 2PY5A 4UCUA 4JI6B 2VQEO 1XNQO 3S3WA 4RUFA 2WLIA 3G4SV 5IYZA 5JJNB 4JZGA 1EZVH 2N04A 1Q8IA 2YIDA 2PTMA 2NLJC 2XOKG 5JCOA 3ZHTA 1E1QG 2Y4UA 2ZE8A 2B1IA 2ZINA 3CXHF 4DV2B 3THOA 5B66Z 2UU9B 4XDKA 1H8HG 1BE3H 1AI4A 3F7YC 4DW1A 4X62O 1ENVA 4LH6A 1IBKO 1WPBA 2WLMA 1PKXA 2IU3A 4TV9B 4O2AA 5KHGA 3HB3B 4FM2A 2GV9A 1YJ9V 1KUQA 1R6NA 1WP7A 2K1EA 2WA3A 4JI8O 1S5JA 4GT1A 4TQFA 2EX3A 4DV0B 3OGCC 4B7KA 5B3SC 3CC7V 4K8XA 3D36A 3E22B 1XILA 5H2FZ 4YJ3B 4PA4A 2OTJV 5LGTA 4WFGA 4NB5A 1YCIA 3W7UA 4RQFA 3K5NA 4KP4A 2WAMA 3UM7A 3K04A 3N2GB 4JI2B 1QHTA 2F1MA 3CRCA 5KUKA 1PPJH 4RQEA 1WB7A 3UT5A 2UXDB 4LF4B 2DQ0A 3CSXA 5JH7B 5LXTA 3HKEA 2HHHB 3G6EV 2ITDC 3FYIB 4NXMB 2X6AA 3BY6A 2QKSA 1BSMA 4IIJA 5EIBC 1N33O 2IH3C 2WLKA 1MZFA 4NKGB 2YUAA 2UXCB 1I0HA 5C93A 4GKKO 5CA1B 1K4DC 2EIKC 4ZI7A 3BAAA 5L3GA 3CPWU 5J2UA 4FLXA 3T1HB 4Q6GA 2VWJA 1SERA 1FXKB 3K03A 3M7MX 1TVKB 1AJNA 5EK0A 5C8YA 5KHJA 2IBZH 2ZDIC 4K0KO 3JALA 5BXZA 4I7ZB 3JATA 3OFNG 1N4CA 4UCSA 1OZ0A 4HNAA 3TETA 4RO2A 1H38A 3LSQA 4RUEA 3SYQA 2ZM6O 3CCUV 1XREA 3ZN1A 1G8MA 5LP6B 2GUZA 1IBMB 1FD9A 3B8NA 2KSDA 2V1DA 4PD4F 2JGDA 1F23A 4B3MB 3QG5A 2UUAO 4WF9V 2L35A 5H6QA 1BL8A 4R7CA 1PV0A 2CH7A 4CH6A 1V9PA 3RVYA 2XAFA 5LMUO 3FAVA 4LH7A 4DV5B 3WB0A 1VQPV 2QWNB 3HKDB 2VWKA 2IU0A 3GWOA 4LWSB 5BR8B 2UXNA 4IHJB 3CRAA 1Q81W 2A0LA 3AG1B 3K3WA 3KKYA 2QTOA 3CC4V 4LFCO 3ETGA 1WA8A 3IC9A 2EJRA 1QR9A 4HBNA 4KUMA 4X66B 3I55V 1ZLZA 2W0FC 4I55B 1YTFD 4PELA 3OUFA 5A9GA 1HW7A 3P32A 4JI4B 2QWOB 1MG1A 4O2BB 4LF9O 1IXBA 1RM1B 1K7DA 1MA1A 2P22C 4TSFG 1B06A 3ABKB 2Q6AA 2WLIB 4FLVA 1I94O 5IYZB 3RYHA 2OIGA 1GM8A 1DF4A 5L3CA 1E79G 2XNDG 1S72V 1HNWO 2QEXV 1YEWA 3OEEG 5FPOA 1YITV 1M57B 1V55B 5EZYA 3H1IH 1VQKV 4J10A 2PYLA 4JI5B 4JV5B 2GDSA 1A32A 2Z0AA 4X1YB 1GN6A 1GO3F 1M93A 1F4MA 5LHIA 1XMQO 4DV7O 4O2AB 2ZE5A 4B08A 5CBFA 3CC2V 2AW9A 2Y69C 4DR5B 3ZMUA 3SR2C 1QLEB 3ASNC 3ETDA 4Z1VA 1F51A 3TJTA 2AHYA 2Y48A 2Q67A 1JX9A 1Y74A 3IFXA 1VQ5V 1D2DA 4LNUB 1CEZA 3SPCA 2B1GA 4FZ0A 1SESA 2Q4PA 3BFRA 1KD1W 1P49A 5J2TA 1NJIW 3O9OA 3F7VC 2B9ZA 1AJQA 4JI7B 4X1KB 5B5EZ 3OMIB 3ZHVA 1HDJA 1K5QA 4DUYB 2YI8A 3J81N 2EZOA 3N27A 5JWPA 4P9PA 4TWKA 3L9DA 1R3KC 2D2CB 3OT7A 3B4SA 2QM4A 1QU7A 4CC5A 1BMFG 1R1BA 1F7YA 5EIBD 4PJ0Z 1I7FA 3GB7C 2B5UA 2E5LO 2JJ2G 2GBOA 3ASOB 1N36O 2LW7A 2A3QA 3IJ4A 2X7RB 2BE3A 2P6JA 3NR7A 3SJBC 2Q73A 1L0NH 4BW9A 4GKJB 4DUZB 4DV6B 4CH4A 1SQBH 3ZRWA 2X0LA 1US6A 1N32O 4B3RO 1PL4A 4AHCA 1VF6C 4EB6B 2EZPA 3RGBA 5ITZA 5EBMC 4W4LA 2OTLV 3CCVV 3FFQA 3R65A 3JALB 1XHZA 3CJHA 1LR1A 3SPIA 3AG2B 3JD1A 1AI6A 2W0XA 1M56C 4UB6Z 1I5XA 5EYPB 4BIUA 1G1XB 4DK0A 2QA4V 2A79B 1H2KA 3J80N 4DRXB 5IY5C 3ZHUA 1D5NA 5CB4B 4PHZA 1J5EO 5GTHZ 2HHHO 2DMXA 4LF6B 3JASA 3CWBH 4NXMO 2WSSG 2FB5A 3FAVB 1KP2A 1L0LH 1V54C 1Q5OA 1EBOA 5CBGA 4I4TA 3SYPA 3M8AA 4YIPA 3RW0A 1WN7A 4UCVA 1SKVA 3LDDA 3VQXA 4PI2A 3ABMC 2UUBB 1VQ7V 1D5AA 4JAAA 3F5WC 3CHXA 4D7TA 3BABA 1SQGA 3TGUH 1Q43A 3LSSA 3E8FA 1WNSA 2CTRA 1R3IC 4LR3A 2AZ2A 2YSUB 5LGUA 4FFKA 4U3FH 1Y76B 4MT8A 1JA8A 5HFLA 4TOIA 2QTSA 2D3OW 1TUBB 2FMLA 4DYLA 4LC1A 4IGGA 3MDSA 4XDJA 4GUNA 2UUCB 1M5IA 5AG2A 1CXZB 4J80A 3CD6V 5CA0B 1W2BU 3A0BZ 4DW0A 4QIWF 1Q3EA 4YHHB 2RMKB 2Q9LA 1DTOA 3ABTA 3CS5A 4X1IA 4FFBB 5B1BC 5KX5A 1M4UA 4H44B 5JJJB 2OT5A 4JZ2A 2GHYA 3AG4C 4TUYB 2CE4A 1I5YA 2EIMB 4DR3O 2M7WA 4JYYA 2H3OA 4IT5A 1R6TA 2HR3A 1MMMA 4GX0A 4H0LB 2ZCEA 3CMAV 4X64B 3L75H 1IVSA 1NT2B 1SRYA 2YXHA 1FKAO 3B8MA 4NTXA 4IL6Z 1PNMA 4PDLA 4MS2A 2AGAA 3JAKA 4O4IA 4DR1B 4JASA 4NYKA 5CMUA 3RT3C 3JD2A 1K4CC 1Y74B 2E75B 3K5MA 1I08A 3STZC 1NTMH 1KBHA 3EVKA 2YEVA 1R6KA 1OCCC 2QE7G 3AG7A 3EXAA 1RPOA 2OWOA 3G67A 4ZKIA 3G6BA 2Y0PA 1K34A 5GONB 4LFAO 3MHSC 2LFSA 4LF7B 2DYSB 1GN4A 5LL6Y 1NVPB 1NKDA 3CCLV 1OCOB 3WU2Z 1O9HA 1Q6HA 1XNRO 4N21A 4DR6B 1IDSA 1GRJA 1S5LZ 2QKCA 4J9ZB 4AQYO 2QM8A 2OYQA 3G71V 4AI8A 1RPRA 2Z5UA 3AG3B 3SGIA 4F6EA 3CYOA 4BIZA 1AB3A 3K5OA 3OEHG 4FPPA 2ZXWB 1CP9A 2YIAA 3BA9A 4KXRA 4E4EA 1B6QA 3OM3B 3W7SA 2ATKC 1LUWA 2RN9A 3UO3A 1NH2D 3TXSA 1M9NA 3EHBB 1JQ0A 3AK2A 2KG7A 5CA3A 1AI7A 1H2SB 2EILB 4WFFA 3SJAC 4LFBB 1ZUQA 3ZRVA 1HR0B 1AP6A 4FLWA 1VP7A 4J41A 2LQTA 1Q90D 3OGIB 4CS4A 1P4RA 1K9MW 4DR2O 2VQFB 4X89A 5CN0A 4J7JA 2YIBD 3JASB 2CK3G 3CRRA 1RSOB 3CMEV 1SZTA 1S0VA 4MW8A 4ZHQA 2BCCH 4PDVA 4U3JB 2DWDC 4XBFA 1M90W 3QVNA 4HZ3A 4DV4B 2IW5A 4UB8Z 2N74A 5KMGA 1FFXA 1WPXA 1KP3A 4UVCA 2E3CA 4DV6O 3ZBHA 4FLTA 5LMNB 4UXNA 1WJZA 1YJNV 1XMOO 4OXSA 4DV1O 4OX9B 1U96A 4DR4O 1BHAA 3D3IA 1YXBA 2XTAA 1JCHA 3VQYA 3CCEV 1ZAUA 5H5NA 3N2KA 4J7KA 4F4LA 3JAWB 1Q6UA 2W6JG 4KHPO 2PGGA 2LGQA 5FNVA 4JI1O 1FJGO 2IJHA 1GTOA 3HKCA 2C2AA 3LDCA 3ZMZA 2XAHA 4O4LA 3HR0A 3BA8A 2OIEA 2VRZA 4LF5O 1OCRB 1URFA 4B3TO 1LUVA 1MNGA 5LP6C 5FL7G 2DE0X 3E8HA 1JVMA 1BS3A 3H1HH 1FPOA 5KHKA 2BTQA 1PP9H 4X9QA 2QGNA 1JJOA 5IYBO 3JCZA 1VQ4V 3JARA 4J11A 2UXBB 2AHZA 2PI4A 2RNBA 3ZS8C 2WLLA 2V7QG 4OGQB 1SQQH 1PD3A 1X4TA 4JAVA 1H2GA 2CUGA 3AG1C 2ZNJA 5B1AB 4ZOLA 4JI3O 3ZCCA 4NVPA 1K3EA 1QVFU 1E1RG 1COWG 2XHBA 2WA4A 1AP5A 1MSDA 3JD0A 5JJEB 2E74B 2QR4A 2ARHA 3HPLC 1K33A 1GK9A 3WB2A 3JAKB 4B7EA 5BMVA 4XDLA 5IJ9A 4DR7O 1SA0B 4KL1A 2O57A 5LOVA 4WBNB 4JYAB 2R72A 5LYJA 3CCJV 3RYCA 2MK3A 5K1XA 3D8CA 1RM1C 1WLEA 3I56V 4WFAV 2BSKA 4P30A 3ABKC 2F4VO 1JFFA 4YJ2B 4QPJA 1IBLB 4YHHO 3FX7A 3CX5F 5JQGA 2P90A 1VF6A 1OCZB 2G38A 4MSWC 4X88A 3CCRV 3CRQA 4EEQA 5IWAO 2M6YA 3OAAG 2FYUH 1ZL8A 1M57C 4BW5A 1V55C 4JI0B 1VQ6V 1HNXO 1FFTB 3SYOA 4TQDA 1KU9A 4PA6A 4NXNB 1SETA 3OTOB 1JPXA 4X65O 1TUEB 4R8CA 1GN2A 4UUJC 3RYFA 2F23A 4PA7A 2F93B 2NN4A 5IJ0A 3OR7C 5TISZ 2CGOA 4U7NA 2YIBA 2LJ2A 1YSCA 2Z3YA 1QLEC 1FXVA 2JGUA 1VARA 4LF8O 2Q69A 2ZR2A 2IM9A 5FPRA 1N34B 2KG7B 4MVUA 5FLXN 3OW2U 4NTWA 4PDRA 4UV8A 4WFEA 4OPHA 1NS1A 2JRIA 3H01A 4UVAA 4PV1B 1EM1A 3GWKC 4JPRA 1UPGA 5LHHA 1EN6A 1K73W 4DR6O 2R9IA 5LA6A 1KC8W 3P3NA 2ILMA 1GM7A 4B3SB 4FZ1A 4YY3O 1Z5VA 3UQ8A 4O4JA 4DV3B 5KHIA 2HKOA 4GZRB 4X20A 3SJQC 4F6RA 1XBLA 2W6IG 5KMGB 2VQEB 4JI6O 4J9YB 1XNQB 3L74H 4G2KA 2HG5C 2DW4A 1GN3A 3FKSG 5D5PA 4CH3A 1KB9F 4TV8A 3LNMB 3ZMTA 2BOCC 2FKXA 5KUMA 3OR6C 3RVZA 2H8PC 3B09A 1S5HC 1VQMV 3FYEB 2V4DA 3UT5B 4FK5C 2XAQA 5LXTB 1SQVH 3HKEB 1IURA 4QE9A 1AILA 4DV2O 3HKCB 4GCZA 4JGSA 2CTQA 5EC1C 1AR4A 1LNQA 2UU9O 4P2ZA 2Q7HA 1NR7A 3K9AA 2EULA 4O4LB 4X62B 1R3JC 2LGWA 2IH1C 4MTFA 4IIJB 1IBKB 2ZQMA 1L8DA 2HJFC 1Y66A 2Q8VA 2Y69B 2GTSA 4D7SA 1G4YB 2LW1A 3K08A 1H2LA 3W7XA 4DV0O 4ZI7B 1S77D 2DJVA 1AROP 5J2UB 2BTQB 3KCXA 4YXWG 1BCCH 4FLYA 1K92A 3ETQA 3L73H 5C8YB 3ZMVA 3B2EE 2E76B 2DYRB 3WFVA 1DLBA 1SQPH 3A0RA 3JATB 3CCMV 3NXSA 3H1KH 2JEUA 2PUSA 4HNAB 2Q5ZA 2XAGA 4Q20A 2DQ3A 3AK3A 4JI2O 4OX9O 4JAUA 2GUZB 1KQSU 4MW3A 3U11A 3H1LH 1XEQA 1ZWIC 2UXDO 3DSQA 4LF4O 3QNEA 2JGDB 5IJ9B 4Z1MG
chains in the Genus database with same CATH topology
2X6AA 3KG2A 1NVPB 1NKDA 3CCLV 3BY6A 1OCOB 2QKSA 1PNKA 1P7BA 4GX5A 4N21A 3CXCU 2IH3C 3B77A 2JK5C 1JOYA 2WLKA 1JJ2U 4JYBA 4J9ZB 2QM8A 2FTKA 3G71V 1PL0A 5C93A 1RPRA 1K4DC 2EIKC 2Z5UA 2IJKA 1Q82W 3E86A 5L3DA 2WPDG 3AG3B 4E2LA 3RBZA 5L3GA 3CPWU 4UV9A 2HLDG 1H8EG 1GKFA 3X2QB 5IYDO 3CYOA 1SERA 4BIZA 1FXKB 3K03A 5L3EA 5BZBA 5EK0A 1AJNA 3ASOC 3T1CA 5L3FA 2ZDIC 3OEHG 2ZXWB 4FPPA 4MTGA 5KA5A 4PA3A 1CP9A 3QO7A 2HVKC 3SPJA 1S76D 3OFNG 2IJJA 3W7WA 2EIMC 1OZ0A 3TETA 4RO2A 1H38A 1B6QA 3LSQA 4RUEA 5H9CA 3SYQA 3OM3B 3W7SA 2ATKC 3ETEA 3CCUV 4FIPC 4BAYA 1NH2D 3ZN1A 3W7TA 4LBEC 1G8MA 2WLNA 5J9PC 1YJWV 5IY5B 1M9NA 3E8GA 1FXHA 3EHBB 2JIZG 2DWEC 1JQ0A 5LHGA 5CA3A 1AI7A 2EILB 2DYRC 4WFFA 4KFMA 3WG7B 3B8NA 3PJSK 3ZRVA 4CBCA 1AJPA 2V1DA 1VQOV 4JTAB 1DF5A 1F23A 5H6RA 4UVBA 3CCQV 1MOFA 5DM6V 3K06A 4WF9V 3AG2C 5H6QA 1BL8A 4R7CA 1P4RA 3MD0A 3OE7G 3RVYA 2GSMB 2XAFA 1UJWB 1K9MW 2LFRA 1VQPV 4MVSA 4X89A 2IU0A 2HFEC 3K79A 3GWOA 5CN0A 2UXNA 1PNLA 1Q81W 3ASNB 2A0LA 3AG1B 3K3WA 2CK3G 3CMEV 1S0VA 1SZTA 4I9WA 4MW8A 2QTOA 4PDVA 3CC4V 2DWDC 2DYSC 4XBFA 2EINC 1M90W 3ETGA 4HZ3A 2JEXA 1OCOC 2EJRA 2OCCC 1QR9A 1FXKA 4KUMA 3TK1A 2IW5A 2WLHA 1M1KW 3I55V 2W0FC 1THZA 2WLLB 3K0GA 4JF3A 1WPXA 1KP3A 1BHBA 4UVCA 1KKDA 1YTFD 4PELA 3OUFA 3P32A 3LDEA 1FS0G 2EIJC 1MG1A 3JD4A 5EBWC 4UXNA 1YJNV 1RM1B 1K7DA 4OXSA 3TCUA 3SPGA 3IGAC 1AR1B 4TSFG 2X6CA 4P9OA 2NNUA 3X2QC 3E2EA 3ABKB 1GM9A 1NQTA 2Q6AA 2WLIB 3D3IA 3UKMA 1JCHA 4DXWA 3CCEV 3ABLC 4F4LA 2W6JG 2ZXWC 2ITCC 1GM8A 2KB1A 2IJHA 1GTOA 2C2AA 1DF4A 5L3CA 3QO5A 3LDCA 3SPHA 1J95A 3ZMZA 1E79G 2XNDG 1S72V 2XAHA 5B1BB 2QEXV 4QJFB 1YITV 3OEEG 5HFMA 4FJCC 3ML0A 1OCRB 4PA9A 4HYOA 1M57B 1V55B 3ZMSA 1Y4MA 1VQKV 3AEIA 5FL7G 4MVMA 3K0DA 4RAIA 3VOUA 3FB8C 3E8HA 3M99B 3WG7C 3SYCA 1F4NA 1R3LC 4HAMA 1JVMA 1K8AW 4MVZA 2Q68A 1GO3F 3ZRXA 1F4MA 3OMAB 5LHIA 1QBZA 2XASA 2JDIG 5GW7A 1VQLV 3DTUB 4PDMA 1NH2B 5IYBO 3JCZA 2IJIA 1VQ4V 2P67A 3DGEA 5CBFA 3CC2V 2AHZA 2PI4A 2Y69C 1IXMA 4QPKA 2WLLA 2V7QG 1EFRG 3ZMUA 3ZRWB 1M56B 1PD3A 4JAVA 1H2GA 1QLEB 3AG1C 3ASNC 3ETDA 1F51A 2AHYA 2Y48A 2Q67A 1JX9A 3IFXA 4MVRA 5B1AB 1VQ5V 1CEZA 3ZN0A 3SPCA 3ZCCA 1K3EA 2B1GA 1QVFU 1E1RG 3LUTB 1COWG 4G28B 2WLJA 2UXXA 3JD0A 1YHQV 1SESA 1MABG 4JTDB 1KD1W 3HPLC 1NJIW 1K33A 1GK9A 5B1NA 3T4ZA 3F7VC 4GX2A 4XDLA 5IYCO 1AJQA 4GX1A 1QCEA 3OMIB 1K97A 4Z1MG 2QM7A 3FB6C 1K5QA 4EKWA 3CCJV 2ZD9A 1V54B 2MK3A 5B1OA 1RM1C 1WLEA 2EZOA 1QVGU 3I56V 3JD3A 2BOBC 4QE7A 1ROPA 4MTXA 4R6ZA 4WFAV 4P30A 4P9PA 3ABKC 4TWKA 5EBLC 3ABMB 4U7OA 1R3KC 3FB5C 1K5SA 1XL4A 4QNHB 3ZRSA 1BMFG 1YTFB 4QPJA 1R73A 3CP1A 3GB7C 2P90A 1Q86W 1OCZB 2B5UA 2JJ2G 4MSWC 2EBOA 3ASOB 3FYIB 1W0JG 2JJ1G 4X88A 4DO2A 3CCRV 4H33A 2X6BA 3OAAG 2X7RB 4FMTA 3E8BA 2P6JA 4LCUC 1OCRC 1YI2V 1M57C 4BW5A 1VQNV 1V55C 4L87A 1VQ8V 1VQ6V 5LBQA 1FFTB 5CBHA 5IDJA 2P7TC 3SYOA 2H94A 3ZRWA 2X0LA 4PA6A 4ASUG 3E89A 1SETA 1JPXA 4X8AA 3ZIAG 3AG3C 4MVQA 1TUEB 4R8CA 4UUJC 2EZPA 1EZJA 3VBBA 5E1AC 3ZJZA 5EBMC 2OTLV 3IC7A 3CCVV 3R65A 1HWYA 3P30A 4PA7A 1FXKC 3OUSA 1QR8A 3OR7C 3QO8A 3SPIA 2HVJC 3AG2B 3JD1A 1YIJV 3STLC 1GMGA 4U7NA 1AI6A 4JYCA 1YSCA 1M56C 2Z3YA 3T2MA 1QLEC 1FXVA 1I5XA 4BIUA 3AG4B 2QA4V 5B1AC 2A79B 2Q69A 2F43G 2ZR2A 5L3BA 4MVUA 4G27B 4TT3G 1XL6A 3OW2U 4PDRA 3ABUA 2A9HA 4UV8A 4WFEA 5IY5C 3JYCA 3MHHC 5B3SB 3H01A 1AI5A 1ORQC 2EILC 4UVAA 4WFHA 3EFFK 2WSSG 4JPRA 2EINB 5LHHA 2OCCB 4MVOA 2ZR3A 3E35A 4H37A 1K73W 2R9IA 2R9RB 5KA6A 1KP2A 2ZDIA 1MSWD 1N8RW 4WFBV 1KC8W 1V54C 1EBOA 5CBGA 3SYPA 3RW0A 1GM7A 2EIJB 3LDDA 4LP8A 1L1FA 1NVPD 3ABMC 1Q7YW 2PI5A 1KECA 1VQ7V 4ZBMA 2HKOA 3F5WC 5LGNA 1OCCB 1OHHG 3LSSA 3SJQC 1OCZC 3E8FA 1S3JA 1R3IC 2W6IG 3ABLB 4J9YB 2YSUB 4RUFA 4CZZA 2WLIA 5LGUA 4N23A 4G2KA 2HG5C 3G4SV 2DW4A 3FKSG 1BHAA 4MT8A 5HFLA 3LNMB 3ZMTA 2BOCC 2D3OW 2NLJC 5KUMA 2XOKG 3OR6C 3RVZA 2H8PC 2YEVB 4LC1A 1S5HC 1VQMV 1E1QG 4XDJA 3FYEB 4FK5C 2XAQA 2EIKB 3CD6V 2B1IA 1W2BU 4QE9A 4GCZA 4JGSA 5EC1C 1LNQA 4P2ZA 2XAJA 1NR7A 3K9AA 4QIWF 4XDKA 1H8HG 1DTOA 1AI4A 3F7YC 3ABTA 1ENVA 1R3JC 2IH1C 4MTFA 2WWWA 2ZQMA 4MTOA 3T4DA 2WLMA 1PKXA 2IU3A 5B1BC 2HJFC 4I5SA 1Y66A 2OT5A 3HB3B 2Y69B 1YJ9V 1G4YB 2GHYA 3AG4C 1R6NA 2K1EA 3OMNB 3K08A 3W7XA 4GT1A 1I5YA 2EIMB 3CCSV 3OGCC 2M7WA 1S77D 5B3SC 4WCEV 3CC7V 1W0KG 1AROP 4YXWG 3D36A 2HR3A 1K92A 4GX0A 3CMAV 3ZMVA 2DYRB 3WFVA 1DLBA 4PA4A 1SRYA 3A0RA 3FB7C 5LGTA 4WFGA 2OTJV 3CCMV 3B8MA 1PNMA 3NXSA 1NBMG 4PDLA 2JEUA 4MS2A 3W7UA 3BEHA 1VQ9V 4RQFA 4JASA 4R50A 4KP4A 5CMUA 2WAMA 3JD2A 2XAGA 3SYAA 1K4CC 3UM7A 4Q20A 3K04A 2DQ3A 5EC2C 3STZC 4JAUA 2YEVA 4JTCB 2LP7A 1R6KA 1KQSU 1OCCC 5KUKA 2QE7G 5DN6G 1QLNA 4MW3A 4RQEA 1RPOA 1NR1A 1ZWIC 4ZKIA 2DQ0A 3QNEA 1K34A 3MHSC 1CPYA 3G6EV 2ITDC 2LFSA 3E83A 2DYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWO A;  1DF4 A;  3CYO A;  1QBZ A;  5CN0 A;  1I5Y A;  1JQ0 A;  4FK5 C;  5CMU A;  2M7W A;  1MG1 A;  4N21 A;  3B8N A;  5HFM A;  4FJC C;  3B77 A;  4G2K A;  1SZT A;  4JGS A;  4N23 A;  5KA6 A;  1K33 A;  1I5X A;  5KA5 A;  1DF5 A;  1JPX A;  1F23 A;  3K9A A;  1EBO A;  2LP7 A;  1MOF A;  2EZP A;  1Y4M A;  1QCE A;  5HFL A;  1ENV A;  2EBO A;  3MHH C;  3P30 A;  1DLB A;  1QR9 A;  3H01 A;  3WFV A;  5H9C A;  1K34 A;  3M99 B;  2X7R B;  1Y66 A;  1QR8 A;  2OT5 A;  4FIP C;  3MHS C;  2P6J A;  4E2L A;  2MK3 A;  3B8M A;  4JPR A;  4JF3 A;  2EZO A;  3CP1 A; 
#chains in the Genus database with same CATH topology
 3KG2 A;  2JS3 A;  5KAF Z;  2CH7 B;  2ZIM A;  1PNK A;  4GX5 A;  1N33 B;  1JOY A;  3RYI A;  4JYB A;  1JFF B;  2UXC O;  2FTK A;  1PL0 A;  4GKK B;  1SF9 A;  5GTI Z;  4J42 A;  2IJK A;  5JQG B;  1Q82 W;  1VIB A;  5L3D A;  2WPD G;  1KYO F;  3RBZ A;  2PF4 E;  3G80 A;  3T1H O;  3CRM A;  1BQ0 A;  1H8E G;  1GKF A;  1RP3 B;  1WA8 B;  3X2Q B;  3QF7 A;  2CTP A;  1ZTE A;  3VQV A;  3ZHQ A;  4YJ3 A;  3HKB A;  4K0K B;  1YF2 A;  1AVM A;  1S76 D;  2RDC A;  2K9P A;  2EIM C;  4D6T H;  4ZIB A;  5E79 Z;  2ZM6 B;  3ETE A;  4FIP C;  4BAY A;  3W7T A;  1DGS A;  5J9P C;  1YJW V;  5IY5 B;  3N2G A;  3E8G A;  1FXH A;  2JIZ G;  3RYH B;  4FLU A;  1IBM O;  3KCY A;  4OPA A;  4KFM A;  3WG7 B;  3PJS K;  4CBC A;  1AJP A;  1VQO V;  1DF5 A;  4J7Z A;  4B3M O;  5JH7 A;  5H6R A;  2YS8 A;  1MOF A;  2UUA B;  2QJ1 A;  2ZT9 B;  4GYC B;  4CS2 A;  1Z2G A;  3MD0 A;  2CAZ C;  2LFR A;  4DV5 O;  5EZY B;  4W4K A;  3K79 A;  5BR8 O;  3K57 A;  2Y0I A;  5JVD A;  3O65 A;  5CA1 A;  4I9W A;  3OD4 A;  4LFC B;  2DYS C;  2EIN C;  2JEX A;  1OCO C;  5LA6 B;  2OCC C;  1N0N A;  1FXK A;  5KLV H;  1QQC A;  1TVK A;  4X66 O;  1O9G A;  2WLH A;  1M1K W;  3T1Y B;  1THZ A;  4EFB A;  2F95 B;  3K0G A;  4JF3 A;  4JI0 O;  1BHB A;  3D3Q A;  2XT9 A;  2EIJ C;  5DED A;  4JI4 O;  3CEI A;  4NXN O;  3APO A;  4LF9 B;  1SQX H;  3SPG A;  2AXT Z;  4FM1 A;  3IGA C;  1AR1 B;  3BRC A;  4P9O A;  2NNU A;  3E2E A;  1SZX A;  1GM9 A;  3UKM A;  4DXW A;  1I94 B;  5LP6 A;  5J2T B;  4K35 A;  3ZX6 A;  3ABL C;  2ZXW C;  2ITC C;  3H9V A;  3LSU A;  3C3T A;  2OCH A;  2KB1 A;  1YVW A;  2P4V A;  3SPH A;  5B1B B;  4FJC C;  5IT9 N;  4PA9 A;  4HYO A;  1PM9 A;  5DEC A;  3HKD A;  1HNZ B;  2Q7E A;  3R66 A;  4MVM A;  3JAM N;  1VEW A;  4JI5 O;  3K0D A;  4JV5 O;  4IHJ A;  3FB8 C;  1K8A W;  1NTZ H;  3UO2 A;  2Q68 A;  2Q7G A;  3OMA B;  3OTF A;  1XMQ B;  4IYI A;  1QBZ A;  4DV7 B;  4K8Z A;  2XAS A;  2JDI G;  1VQL V;  1Q6I A;  2IJI A;  2P67 A;  5KHH A;  4O4H A;  1B3Q A;  2P5O A;  2LO1 A;  4NR1 A;  1H2M A;  1IXM A;  4B3S O;  4DR5 O;  1VMG A;  5IE9 A;  3VQW A;  4I55 A;  3ZRW B;  2PYJ A;  1JR9 A;  1JMK C;  2N05 A;  4BIO A;  4MVR A;  4O2B A;  5ITZ B;  1XI1 A;  2UXX A;  1YHQ V;  1NZ6 A;  4JTD B;  3CJH B;  3T4Z A;  1YDX A;  4C7U A;  4JI7 O;  1QCE A;  1K97 A;  2QM7 A;  4CS3 A;  5D5Q A;  4DUY O;  1T5E A;  3JD3 A;  4R6Z A;  4QE7 A;  1ROP A;  4MTX A;  4DK1 A;  5EBL C;  1IX9 A;  5BY1 A;  3FB5 C;  1K5S A;  1XL4 A;  1TGO A;  1RFY A;  2NR5 A;  3ZRS A;  1YTF B;  1Y67 A;  4X1Y A;  2E5L B;  1NU1 H;  2EBO A;  1N36 B;  2JJ1 G;  3APQ A;  1Y6X A;  2X6B A;  3RYI B;  3I5D A;  4H13 B;  3E8B A;  4I4T B;  4LCU C;  1OCR C;  1XOU A;  1YI2 V;  4UCR A;  4GKJ O;  4DUZ O;  5LBQ A;  3L71 H;  5CBH A;  4CC6 A;  1N32 B;  4B3R B;  2HEP A;  2RQ6 A;  4X8A A;  3ZIA G;  4LNU A;  3VBB A;  5E1A C;  4K3A A;  3ZJZ A;  2EJ7 A;  3IC7 A;  3HKB B;  1HWY A;  2Y4T A;  3P30 A;  1FXK C;  3OUS A;  2YC0 A;  3SDL A;  3L72 H;  1QR8 A;  1H2N A;  3QO8 A;  2FL4 A;  2HVJ C;  1YIJ V;  3STL C;  1GMG A;  4JYC A;  3ZED A;  4X1K A;  2GTA A;  4FM0 A;  5B1A C;  3FD9 A;  4G27 B;  4TT3 G;  1XL6 A;  2ETN A;  2A9H A;  3ABU A;  1OV9 A;  3JYC A;  3MHH C;  1J5E B;  5B3S B;  1TAE A;  4WFH A;  2QKA A;  3EFF K;  4LF6 O;  3U10 A;  2QSA A;  3CE2 A;  4X1I B;  3S3X A;  1VF7 A;  2CTW A;  5KX5 B;  3E35 A;  2R9R B;  2ADP A;  1MSW D;  1N8R W;  2DN9 A;  4WFB V;  2P06 A;  5JVD B;  4LP8 A;  2CGN A;  5A2Q N;  4BWA A;  2PZS A;  1NVP D;  1BQZ A;  1Q7Y W;  2PI5 A;  2UUB O;  1B04 A;  3RFR A;  4ZBM A;  2Q0A A;  2AZ0 A;  1OCZ C;  5F2V O;  4EB6 A;  1S3J A;  4CZZ A;  2YXY A;  4N23 A;  1MZE A;  1NTK H;  1G6U A;  4O4I B;  4IYH A;  1VF5 B;  2MW2 B;  4PI0 A;  2YEV B;  5EYP A;  1BGY H;  3AK1 A;  2UUC O;  4DRX A;  2EIK B;  5CB4 A;  2JS5 A;  2XAJ A;  2WWW A;  4MTO A;  3T4D A;  2QWP B;  4I5S A;  5JCO C;  3K58 A;  3OMN B;  2ZE6 A;  2R70 A;  4DR3 B;  4I0X A;  3DXR A;  3CCS V;  4WCE V;  1W0K G;  2ZNI A;  2JVD A;  4X64 O;  4GLX A;  4O4H B;  3FB7 C;  3T1Y O;  1NBM G;  3BEH A;  1Y76 A;  4DR1 O;  1VQ9 V;  3PN1 A;  4R50 A;  2ZIO A;  3SYA A;  5EC2 C;  3D36 C;  4I50 A;  1TUB A;  3ZHR A;  3K5L A;  3BHP A;  2R9A A;  4JTC B;  4FLZ A;  1QNM A;  2LP7 A;  1QLN A;  5DN6 G;  3BCC H;  2BTO A;  1NR1 A;  1P84 F;  3ICX A;  4LFA B;  5CA0 A;  1CPY A;  3JSL A;  3E83 A;  4LF7 O;  3CP1 A;  2YIC A;  4UFZ A;  1OJH A;  3C90 A;  1XNR B;  1P7B A;  3CXC U;  4ABM A;  3B77 A;  2JK5 C;  2ADQ B;  4FFB A;  1JJ2 U;  4AQY B;  1HNZ O;  4TUY A;  1FAF A;  4ZHQ B;  1HP8 A;  3E86 A;  4E2L A;  4UV9 A;  1FYJ A;  2HLD G;  5IYD O;  5L3E A;  5BZB A;  1ZSP A;  3ASO C;  3T1C A;  5L3F A;  2XUM A;  4MTG A;  1FFX B;  5KA5 A;  4PA3 A;  1KKC A;  3QO7 A;  2P4K A;  2QWR B;  2HVK C;  3SPJ A;  2IJJ A;  2Q0O C;  3W7W A;  1SS3 A;  1N0J A;  5H9C A;  1P7G A;  2WLN A;  4LBE C;  1XDC A;  2A06 H;  4UCT A;  2DWE C;  3N2K B;  5LHG A;  3K9S A;  1AR5 A;  2DYR C;  3RWR D;  2ZE7 A;  5FNV B;  3TXQ A;  4LFB O;  2A7W A;  1HR0 O;  4JTA B;  5GON A;  2DOS A;  3Q4H A;  4UVB A;  3CCQ V;  5DM6 V;  3K06 A;  3AG2 C;  1X59 A;  3BPZ A;  3OE7 G;  4FVM A;  2GSM B;  2HJD A;  1UJW B;  4DR2 B;  4MVS A;  2VQF O;  2HFE C;  1KMI Z;  4JI8 B;  1PNL A;  3ASN B;  2QWQ B;  4BR6 A;  1WB8 A;  3QTC A;  4L8J A;  3SJC C;  3U0Z A;  3LNN A;  3JAR B;  4DV4 O;  3TK1 A;  3L70 H;  2ODM A;  2WLL B;  2YXL A;  1KKD A;  4QGP A;  3LDE A;  1FS0 G;  5LMN O;  3JD4 A;  5EBW C;  4ZOL B;  1XMO B;  3TCU A;  4DV1 B;  2KKW A;  3CB2 A;  2X6C A;  3X2Q C;  4DR4 B;  1NQT A;  1SQF A;  4I9Q A;  5BMV B;  4KHP B;  1FJG B;  4JI1 B;  1UFI A;  3QO5 A;  1W59 A;  2L6L A;  1J95 A;  5LOV B;  2YDE A;  4QJF B;  5LYJ B;  3RYC B;  5HFM A;  3ML0 A;  4LF5 B;  4B3T B;  4Z2W A;  1EN5 A;  1ZX3 A;  4TV9 A;  3KZI Z;  2BSK B;  3ZMS A;  1Y4M A;  3BVO A;  3AEI A;  1GH6 A;  3GVM A;  4RAI A;  3A0H Z;  3VOU A;  3P3P A;  3WG7 C;  3M99 B;  1XQ8 A;  3SYC A;  1F4N A;  1R3L C;  4HAM A;  5KAI Z;  4MVZ A;  1RSO A;  3ZRX A;  4NTY A;  3E22 A;  4U3J A;  2QDO A;  5GW7 A;  4YIO A;  3DTU B;  4PDM A;  1NH2 B;  1ZL8 B;  3DGE A;  2UXB O;  4I0X B;  3F5T A;  3DXR B;  4QPK A;  1EFR G;  2HP8 A;  1M56 B;  3JSN A;  1WAZ A;  3RYF B;  4JI3 B;  3ZN0 A;  1SC5 B;  3LUT B;  4G28 B;  5IJ0 B;  2WLJ A;  4A5U B;  1MAB G;  1Z5W A;  2KQX A;  5B1N A;  3JAW A;  3J7A U;  2VS0 A;  4GX2 A;  2F66 C;  4CH5 A;  5IYC O;  4GX1 A;  4I50 B;  4DR7 B;  1BT8 A;  3FB6 C;  4JYA O;  4EKW A;  2ZD9 A;  1V54 B;  5LMU B;  1TA8 A;  5B1O A;  1QVG U;  2BOB C;  3RN4 A;  2F4V B;  3A8T A;  3ABM B;  4U7O A;  4QNH B;  3K59 A;  1IBL O;  1R73 A;  1Q86 W;  1W0J G;  1IZ3 A;  4DO2 A;  4H33 A;  5IWA B;  1GAX A;  4FMT A;  1VQN V;  3WB1 A;  3UCS C;  1BZK A;  4L87 A;  1VQ8 V;  1U97 A;  1HNX B;  3IAY A;  4O4J B;  5IDJ A;  2P7T C;  4RWU A;  2H94 A;  1XUQ A;  4ASU G;  3E89 A;  3OTO O;  2RJZ A;  4X20 B;  3AG3 C;  4MVQ A;  4F6R B;  4X65 B;  1EZJ A;  3DC6 A;  3A2F A;  4TV8 B;  3DC5 A;  4EFE A;  1HNW B;  3T2M A;  1WP8 A;  1SA0 A;  4LF8 B;  4WBN A;  3AG4 B;  3JCU Z;  2F43 G;  1YZB A;  5L3B A;  1N34 O;  4LWS A;  1AI5 A;  1ORQ C;  2EIL C;  3Q4H B;  2RCV A;  1XHX A;  3B40 A;  4UCO A;  4YJ2 A;  2EIN B;  2OCC B;  4MVO A;  2ZR3 A;  4H37 A;  3MAQ A;  3H1J H;  5KA6 A;  2ZDI A;  5K1P A;  1NI8 A;  2EIJ B;  1L1F A;  4YY3 B;  2ZKO A;  1EN4 A;  4ICG A;  4AIL C;  1KEC A;  4DV3 O;  3C3S A;  3ZHS A;  1DK1 A;  5LGN A;  1OCC B;  1OHH G;  2CDY A;  2YI9 A;  3ABL B;  2PY5 A;  4UCU A;  4JI6 B;  2VQE O;  1XNQ O;  3S3W A;  4RUF A;  2WLI A;  3G4S V;  5IYZ A;  5JJN B;  4JZG A;  1EZV H;  2N04 A;  1Q8I A;  2YID A;  2PTM A;  2NLJ C;  2XOK G;  5JCO A;  3ZHT A;  1E1Q G;  2Y4U A;  2ZE8 A;  2B1I A;  2ZIN A;  3CXH F;  4DV2 B;  3THO A;  5B66 Z;  2UU9 B;  4XDK A;  1H8H G;  1BE3 H;  1AI4 A;  3F7Y C;  4DW1 A;  4X62 O;  1ENV A;  4LH6 A;  1IBK O;  1WPB A;  2WLM A;  1PKX A;  2IU3 A;  4TV9 B;  4O2A A;  5KHG A;  3HB3 B;  4FM2 A;  2GV9 A;  1YJ9 V;  1KUQ A;  1R6N A;  1WP7 A;  2K1E A;  2WA3 A;  4JI8 O;  1S5J A;  4GT1 A;  4TQF A;  2EX3 A;  4DV0 B;  3OGC C;  4B7K A;  5B3S C;  3CC7 V;  4K8X A;  3D36 A;  3E22 B;  1XIL A;  5H2F Z;  4YJ3 B;  4PA4 A;  2OTJ V;  5LGT A;  4WFG A;  4NB5 A;  1YCI A;  3W7U A;  4RQF A;  3K5N A;  4KP4 A;  2WAM A;  3UM7 A;  3K04 A;  3N2G B;  4JI2 B;  1QHT A;  2F1M A;  3CRC A;  5KUK A;  1PPJ H;  4RQE A;  1WB7 A;  3UT5 A;  2UXD B;  4LF4 B;  2DQ0 A;  3CSX A;  5JH7 B;  5LXT A;  3HKE A;  2HHH B;  3G6E V;  2ITD C;  3FYI B;  4NXM B;  2X6A A;  3BY6 A;  2QKS A;  1BSM A;  4IIJ A;  5EIB C;  1N33 O;  2IH3 C;  2WLK A;  1MZF A;  4NKG B;  2YUA A;  2UXC B;  1I0H A;  5C93 A;  4GKK O;  5CA1 B;  1K4D C;  2EIK C;  4ZI7 A;  3BAA A;  5L3G A;  3CPW U;  5J2U A;  4FLX A;  3T1H B;  4Q6G A;  2VWJ A;  1SER A;  1FXK B;  3K03 A;  3M7M X;  1TVK B;  1AJN A;  5EK0 A;  5C8Y A;  5KHJ A;  2IBZ H;  2ZDI C;  4K0K O;  3JAL A;  5BXZ A;  4I7Z B;  3JAT A;  3OFN G;  1N4C A;  4UCS A;  1OZ0 A;  4HNA A;  3TET A;  4RO2 A;  1H38 A;  3LSQ A;  4RUE A;  3SYQ A;  2ZM6 O;  3CCU V;  1XRE A;  3ZN1 A;  1G8M A;  5LP6 B;  2GUZ A;  1IBM B;  1FD9 A;  3B8N A;  2KSD A;  2V1D A;  4PD4 F;  2JGD A;  1F23 A;  4B3M B;  3QG5 A;  2UUA O;  4WF9 V;  2L35 A;  5H6Q A;  1BL8 A;  4R7C A;  1PV0 A;  2CH7 A;  4CH6 A;  1V9P A;  3RVY A;  2XAF A;  5LMU O;  3FAV A;  4LH7 A;  4DV5 B;  3WB0 A;  1VQP V;  2QWN B;  3HKD B;  2VWK A;  2IU0 A;  3GWO A;  4LWS B;  5BR8 B;  2UXN A;  4IHJ B;  3CRA A;  1Q81 W;  2A0L A;  3AG1 B;  3K3W A;  3KKY A;  2QTO A;  3CC4 V;  4LFC O;  3ETG A;  1WA8 A;  3IC9 A;  2EJR A;  1QR9 A;  4HBN A;  4KUM A;  4X66 B;  3I55 V;  1ZLZ A;  2W0F C;  4I55 B;  1YTF D;  4PEL A;  3OUF A;  5A9G A;  1HW7 A;  3P32 A;  4JI4 B;  2QWO B;  1MG1 A;  4O2B B;  4LF9 O;  1IXB A;  1RM1 B;  1K7D A;  1MA1 A;  2P22 C;  4TSF G;  1B06 A;  3ABK B;  2Q6A A;  2WLI B;  4FLV A;  1I94 O;  5IYZ B;  3RYH A;  2OIG A;  1GM8 A;  1DF4 A;  5L3C A;  1E79 G;  2XND G;  1S72 V;  1HNW O;  2QEX V;  1YEW A;  3OEE G;  5FPO A;  1YIT V;  1M57 B;  1V55 B;  5EZY A;  3H1I H;  1VQK V;  4J10 A;  2PYL A;  4JI5 B;  4JV5 B;  2GDS A;  1A32 A;  2Z0A A;  4X1Y B;  1GN6 A;  1GO3 F;  1M93 A;  1F4M A;  5LHI A;  1XMQ O;  4DV7 O;  4O2A B;  2ZE5 A;  4B08 A;  5CBF A;  3CC2 V;  2AW9 A;  2Y69 C;  4DR5 B;  3ZMU A;  3SR2 C;  1QLE B;  3ASN C;  3ETD A;  4Z1V A;  1F51 A;  3TJT A;  2AHY A;  2Y48 A;  2Q67 A;  1JX9 A;  1Y74 A;  3IFX A;  1VQ5 V;  1D2D A;  4LNU B;  1CEZ A;  3SPC A;  2B1G A;  4FZ0 A;  1SES A;  2Q4P A;  3BFR A;  1KD1 W;  1P49 A;  5J2T A;  1NJI W;  3O9O A;  3F7V C;  2B9Z A;  1AJQ A;  4JI7 B;  4X1K B;  5B5E Z;  3OMI B;  3ZHV A;  1HDJ A;  1K5Q A;  4DUY B;  2YI8 A;  3J81 N;  2EZO A;  3N27 A;  5JWP A;  4P9P A;  4TWK A;  3L9D A;  1R3K C;  2D2C B;  3OT7 A;  3B4S A;  2QM4 A;  1QU7 A;  4CC5 A;  1BMF G;  1R1B A;  1F7Y A;  5EIB D;  4PJ0 Z;  1I7F A;  3GB7 C;  2B5U A;  2E5L O;  2JJ2 G;  2GBO A;  3ASO B;  1N36 O;  2LW7 A;  2A3Q A;  3IJ4 A;  2X7R B;  2BE3 A;  2P6J A;  3NR7 A;  3SJB C;  2Q73 A;  1L0N H;  4BW9 A;  4GKJ B;  4DUZ B;  4DV6 B;  4CH4 A;  1SQB H;  3ZRW A;  2X0L A;  1US6 A;  1N32 O;  4B3R O;  1PL4 A;  4AHC A;  1VF6 C;  4EB6 B;  2EZP A;  3RGB A;  5ITZ A;  5EBM C;  4W4L A;  2OTL V;  3CCV V;  3FFQ A;  3R65 A;  3JAL B;  1XHZ A;  3CJH A;  1LR1 A;  3SPI A;  3AG2 B;  3JD1 A;  1AI6 A;  2W0X A;  1M56 C;  4UB6 Z;  1I5X A;  5EYP B;  4BIU A;  1G1X B;  4DK0 A;  2QA4 V;  2A79 B;  1H2K A;  3J80 N;  4DRX B;  5IY5 C;  3ZHU A;  1D5N A;  5CB4 B;  4PHZ A;  1J5E O;  5GTH Z;  2HHH O;  2DMX A;  4LF6 B;  3JAS A;  3CWB H;  4NXM O;  2WSS G;  2FB5 A;  3FAV B;  1KP2 A;  1L0L H;  1V54 C;  1Q5O A;  1EBO A;  5CBG A;  4I4T A;  3SYP A;  3M8A A;  4YIP A;  3RW0 A;  1WN7 A;  4UCV A;  1SKV A;  3LDD A;  3VQX A;  4PI2 A;  3ABM C;  2UUB B;  1VQ7 V;  1D5A A;  4JAA A;  3F5W C;  3CHX A;  4D7T A;  3BAB A;  1SQG A;  3TGU H;  1Q43 A;  3LSS A;  3E8F A;  1WNS A;  2CTR A;  1R3I C;  4LR3 A;  2AZ2 A;  2YSU B;  5LGU A;  4FFK A;  4U3F H;  1Y76 B;  4MT8 A;  1JA8 A;  5HFL A;  4TOI A;  2QTS A;  2D3O W;  1TUB B;  2FML A;  4DYL A;  4LC1 A;  4IGG A;  3MDS A;  4XDJ A;  4GUN A;  2UUC B;  1M5I A;  5AG2 A;  1CXZ B;  4J80 A;  3CD6 V;  5CA0 B;  1W2B U;  3A0B Z;  4DW0 A;  4QIW F;  1Q3E A;  4YHH B;  2RMK B;  2Q9L A;  1DTO A;  3ABT A;  3CS5 A;  4X1I A;  4FFB B;  5B1B C;  5KX5 A;  1M4U A;  4H44 B;  5JJJ B;  2OT5 A;  4JZ2 A;  2GHY A;  3AG4 C;  4TUY B;  2CE4 A;  1I5Y A;  2EIM B;  4DR3 O;  2M7W A;  4JYY A;  2H3O A;  4IT5 A;  1R6T A;  2HR3 A;  1MMM A;  4GX0 A;  4H0L B;  2ZCE A;  3CMA V;  4X64 B;  3L75 H;  1IVS A;  1NT2 B;  1SRY A;  2YXH A;  1FKA O;  3B8M A;  4NTX A;  4IL6 Z;  1PNM A;  4PDL A;  4MS2 A;  2AGA A;  3JAK A;  4O4I A;  4DR1 B;  4JAS A;  4NYK A;  5CMU A;  3RT3 C;  3JD2 A;  1K4C C;  1Y74 B;  2E75 B;  3K5M A;  1I08 A;  3STZ C;  1NTM H;  1KBH A;  3EVK A;  2YEV A;  1R6K A;  1OCC C;  2QE7 G;  3AG7 A;  3EXA A;  1RPO A;  2OWO A;  3G67 A;  4ZKI A;  3G6B A;  2Y0P A;  1K34 A;  5GON B;  4LFA O;  3MHS C;  2LFS A;  4LF7 B;  2DYS B;  1GN4 A;  5LL6 Y;  1NVP B;  1NKD A;  3CCL V;  1OCO B;  3WU2 Z;  1O9H A;  1Q6H A;  1XNR O;  4N21 A;  4DR6 B;  1IDS A;  1GRJ A;  1S5L Z;  2QKC A;  4J9Z B;  4AQY O;  2QM8 A;  2OYQ A;  3G71 V;  4AI8 A;  1RPR A;  2Z5U A;  3AG3 B;  3SGI A;  4F6E A;  3CYO A;  4BIZ A;  1AB3 A;  3K5O A;  3OEH G;  4FPP A;  2ZXW B;  1CP9 A;  2YIA A;  3BA9 A;  4KXR A;  4E4E A;  1B6Q A;  3OM3 B;  3W7S A;  2ATK C;  1LUW A;  2RN9 A;  3UO3 A;  1NH2 D;  3TXS A;  1M9N A;  3EHB B;  1JQ0 A;  3AK2 A;  2KG7 A;  5CA3 A;  1AI7 A;  1H2S B;  2EIL B;  4WFF A;  3SJA C;  4LFB B;  1ZUQ A;  3ZRV A;  1HR0 B;  1AP6 A;  4FLW A;  1VP7 A;  4J41 A;  2LQT A;  1Q90 D;  3OGI B;  4CS4 A;  1P4R A;  1K9M W;  4DR2 O;  2VQF B;  4X89 A;  5CN0 A;  4J7J A;  2YIB D;  3JAS B;  2CK3 G;  3CRR A;  1RSO B;  3CME V;  1SZT A;  1S0V A;  4MW8 A;  4ZHQ A;  2BCC H;  4PDV A;  4U3J B;  2DWD C;  4XBF A;  1M90 W;  3QVN A;  4HZ3 A;  4DV4 B;  2IW5 A;  4UB8 Z;  2N74 A;  5KMG A;  1FFX A;  1WPX A;  1KP3 A;  4UVC A;  2E3C A;  4DV6 O;  3ZBH A;  4FLT A;  5LMN B;  4UXN A;  1WJZ A;  1YJN V;  1XMO O;  4OXS A;  4DV1 O;  4OX9 B;  1U96 A;  4DR4 O;  1BHA A;  3D3I A;  1YXB A;  2XTA A;  1JCH A;  3VQY A;  3CCE V;  1ZAU A;  5H5N A;  3N2K A;  4J7K A;  4F4L A;  3JAW B;  1Q6U A;  2W6J G;  4KHP O;  2PGG A;  2LGQ A;  5FNV A;  4JI1 O;  1FJG O;  2IJH A;  1GTO A;  3HKC A;  2C2A A;  3LDC A;  3ZMZ A;  2XAH A;  4O4L A;  3HR0 A;  3BA8 A;  2OIE A;  2VRZ A;  4LF5 O;  1OCR B;  1URF A;  4B3T O;  1LUV A;  1MNG A;  5LP6 C;  5FL7 G;  2DE0 X;  3E8H A;  1JVM A;  1BS3 A;  3H1H H;  1FPO A;  5KHK A;  2BTQ A;  1PP9 H;  4X9Q A;  2QGN A;  1JJO A;  5IYB O;  3JCZ A;  1VQ4 V;  3JAR A;  4J11 A;  2UXB B;  2AHZ A;  2PI4 A;  2RNB A;  3ZS8 C;  2WLL A;  2V7Q G;  4OGQ B;  1SQQ H;  1PD3 A;  1X4T A;  4JAV A;  1H2G A;  2CUG A;  3AG1 C;  2ZNJ A;  5B1A B;  4ZOL A;  4JI3 O;  3ZCC A;  4NVP A;  1K3E A;  1QVF U;  1E1R G;  1COW G;  2XHB A;  2WA4 A;  1AP5 A;  1MSD A;  3JD0 A;  5JJE B;  2E74 B;  2QR4 A;  2ARH A;  3HPL C;  1K33 A;  1GK9 A;  3WB2 A;  3JAK B;  4B7E A;  5BMV A;  4XDL A;  5IJ9 A;  4DR7 O;  1SA0 B;  4KL1 A;  2O57 A;  5LOV A;  4WBN B;  4JYA B;  2R72 A;  5LYJ A;  3CCJ V;  3RYC A;  2MK3 A;  5K1X A;  3D8C A;  1RM1 C;  1WLE A;  3I56 V;  4WFA V;  2BSK A;  4P30 A;  3ABK C;  2F4V O;  1JFF A;  4YJ2 B;  4QPJ A;  1IBL B;  4YHH O;  3FX7 A;  3CX5 F;  5JQG A;  2P90 A;  1VF6 A;  1OCZ B;  2G38 A;  4MSW C;  4X88 A;  3CCR V;  3CRQ A;  4EEQ A;  5IWA O;  2M6Y A;  3OAA G;  2FYU H;  1ZL8 A;  1M57 C;  4BW5 A;  1V55 C;  4JI0 B;  1VQ6 V;  1HNX O;  1FFT B;  3SYO A;  4TQD A;  1KU9 A;  4PA6 A;  4NXN B;  1SET A;  3OTO B;  1JPX A;  4X65 O;  1TUE B;  4R8C A;  1GN2 A;  4UUJ C;  3RYF A;  2F23 A;  4PA7 A;  2F93 B;  2NN4 A;  5IJ0 A;  3OR7 C;  5TIS Z;  2CGO A;  4U7N A;  2YIB A;  2LJ2 A;  1YSC A;  2Z3Y A;  1QLE C;  1FXV A;  2JGU A;  1VAR A;  4LF8 O;  2Q69 A;  2ZR2 A;  2IM9 A;  5FPR A;  1N34 B;  2KG7 B;  4MVU A;  5FLX N;  3OW2 U;  4NTW A;  4PDR A;  4UV8 A;  4WFE A;  4OPH A;  1NS1 A;  2JRI A;  3H01 A;  4UVA A;  4PV1 B;  1EM1 A;  3GWK C;  4JPR A;  1UPG A;  5LHH A;  1EN6 A;  1K73 W;  4DR6 O;  2R9I A;  5LA6 A;  1KC8 W;  3P3N A;  2ILM A;  1GM7 A;  4B3S B;  4FZ1 A;  4YY3 O;  1Z5V A;  3UQ8 A;  4O4J A;  4DV3 B;  5KHI A;  2HKO A;  4GZR B;  4X20 A;  3SJQ C;  4F6R A;  1XBL A;  2W6I G;  5KMG B;  2VQE B;  4JI6 O;  4J9Y B;  1XNQ B;  3L74 H;  4G2K A;  2HG5 C;  2DW4 A;  1GN3 A;  3FKS G;  5D5P A;  4CH3 A;  1KB9 F;  4TV8 A;  3LNM B;  3ZMT A;  2BOC C;  2FKX A;  5KUM A;  3OR6 C;  3RVZ A;  2H8P C;  3B09 A;  1S5H C;  1VQM V;  3FYE B;  2V4D A;  3UT5 B;  4FK5 C;  2XAQ A;  5LXT B;  1SQV H;  3HKE B;  1IUR A;  4QE9 A;  1AIL A;  4DV2 O;  3HKC B;  4GCZ A;  4JGS A;  2CTQ A;  5EC1 C;  1AR4 A;  1LNQ A;  2UU9 O;  4P2Z A;  2Q7H A;  1NR7 A;  3K9A A;  2EUL A;  4O4L B;  4X62 B;  1R3J C;  2LGW A;  2IH1 C;  4MTF A;  4IIJ B;  1IBK B;  2ZQM A;  1L8D A;  2HJF C;  1Y66 A;  2Q8V A;  2Y69 B;  2GTS A;  4D7S A;  1G4Y B;  2LW1 A;  3K08 A;  1H2L A;  3W7X A;  4DV0 O;  4ZI7 B;  1S77 D;  2DJV A;  1ARO P;  5J2U B;  2BTQ B;  3KCX A;  4YXW G;  1BCC H;  4FLY A;  1K92 A;  3ETQ A;  3L73 H;  5C8Y B;  3ZMV A;  3B2E E;  2E76 B;  2DYR B;  3WFV A;  1DLB A;  1SQP H;  3A0R A;  3JAT B;  3CCM V;  3NXS A;  3H1K H;  2JEU A;  2PUS A;  4HNA B;  2Q5Z A;  2XAG A;  4Q20 A;  2DQ3 A;  3AK3 A;  4JI2 O;  4OX9 O;  4JAU A;  2GUZ B;  1KQS U;  4MW3 A;  3U11 A;  3H1L H;  1XEQ A;  1ZWI C;  2UXD O;  3DSQ A;  4LF4 O;  3QNE A;  2JGD B;  5IJ9 B;  4Z1M G; 
#chains in the Genus database with same CATH homology
 2X6A A;  3KG2 A;  1NVP B;  1NKD A;  3CCL V;  3BY6 A;  1OCO B;  2QKS A;  1PNK A;  1P7B A;  4GX5 A;  4N21 A;  3CXC U;  2IH3 C;  3B77 A;  2JK5 C;  1JOY A;  2WLK A;  1JJ2 U;  4JYB A;  4J9Z B;  2QM8 A;  2FTK A;  3G71 V;  1PL0 A;  5C93 A;  1RPR A;  1K4D C;  2EIK C;  2Z5U A;  2IJK A;  1Q82 W;  3E86 A;  5L3D A;  2WPD G;  3AG3 B;  4E2L A;  3RBZ A;  5L3G A;  3CPW U;  4UV9 A;  2HLD G;  1H8E G;  1GKF A;  3X2Q B;  5IYD O;  3CYO A;  1SER A;  4BIZ A;  1FXK B;  3K03 A;  5L3E A;  5BZB A;  5EK0 A;  1AJN A;  3ASO C;  3T1C A;  5L3F A;  2ZDI C;  3OEH G;  2ZXW B;  4FPP A;  4MTG A;  5KA5 A;  4PA3 A;  1CP9 A;  3QO7 A;  2HVK C;  3SPJ A;  1S76 D;  3OFN G;  2IJJ A;  3W7W A;  2EIM C;  1OZ0 A;  3TET A;  4RO2 A;  1H38 A;  1B6Q A;  3LSQ A;  4RUE A;  5H9C A;  3SYQ A;  3OM3 B;  3W7S A;  2ATK C;  3ETE A;  3CCU V;  4FIP C;  4BAY A;  1NH2 D;  3ZN1 A;  3W7T A;  4LBE C;  1G8M A;  2WLN A;  5J9P C;  1YJW V;  5IY5 B;  1M9N A;  3E8G A;  1FXH A;  3EHB B;  2JIZ G;  2DWE C;  1JQ0 A;  5LHG A;  5CA3 A;  1AI7 A;  2EIL B;  2DYR C;  4WFF A;  4KFM A;  3WG7 B;  3B8N A;  3PJS K;  3ZRV A;  4CBC A;  1AJP A;  2V1D A;  1VQO V;  4JTA B;  1DF5 A;  1F23 A;  5H6R A;  4UVB A;  3CCQ V;  1MOF A;  5DM6 V;  3K06 A;  4WF9 V;  3AG2 C;  5H6Q A;  1BL8 A;  4R7C A;  1P4R A;  3MD0 A;  3OE7 G;  3RVY A;  2GSM B;  2XAF A;  1UJW B;  1K9M W;  2LFR A;  1VQP V;  4MVS A;  4X89 A;  2IU0 A;  2HFE C;  3K79 A;  3GWO A;  5CN0 A;  2UXN A;  1PNL A;  1Q81 W;  3ASN B;  2A0L A;  3AG1 B;  3K3W A;  2CK3 G;  3CME V;  1S0V A;  1SZT A;  4I9W A;  4MW8 A;  2QTO A;  4PDV A;  3CC4 V;  2DWD C;  2DYS C;  4XBF A;  2EIN C;  1M90 W;  3ETG A;  4HZ3 A;  2JEX A;  1OCO C;  2EJR A;  2OCC C;  1QR9 A;  1FXK A;  4KUM A;  3TK1 A;  2IW5 A;  2WLH A;  1M1K W;  3I55 V;  2W0F C;  1THZ A;  2WLL B;  3K0G A;  4JF3 A;  1WPX A;  1KP3 A;  1BHB A;  4UVC A;  1KKD A;  1YTF D;  4PEL A;  3OUF A;  3P32 A;  3LDE A;  1FS0 G;  2EIJ C;  1MG1 A;  3JD4 A;  5EBW C;  4UXN A;  1YJN V;  1RM1 B;  1K7D A;  4OXS A;  3TCU A;  3SPG A;  3IGA C;  1AR1 B;  4TSF G;  2X6C A;  4P9O A;  2NNU A;  3X2Q C;  3E2E A;  3ABK B;  1GM9 A;  1NQT A;  2Q6A A;  2WLI B;  3D3I A;  3UKM A;  1JCH A;  4DXW A;  3CCE V;  3ABL C;  4F4L A;  2W6J G;  2ZXW C;  2ITC C;  1GM8 A;  2KB1 A;  2IJH A;  1GTO A;  2C2A A;  1DF4 A;  5L3C A;  3QO5 A;  3LDC A;  3SPH A;  1J95 A;  3ZMZ A;  1E79 G;  2XND G;  1S72 V;  2XAH A;  5B1B B;  2QEX V;  4QJF B;  1YIT V;  3OEE G;  5HFM A;  4FJC C;  3ML0 A;  1OCR B;  4PA9 A;  4HYO A;  1M57 B;  1V55 B;  3ZMS A;  1Y4M A;  1VQK V;  3AEI A;  5FL7 G;  4MVM A;  3K0D A;  4RAI A;  3VOU A;  3FB8 C;  3E8H A;  3M99 B;  3WG7 C;  3SYC A;  1F4N A;  1R3L C;  4HAM A;  1JVM A;  1K8A W;  4MVZ A;  2Q68 A;  1GO3 F;  3ZRX A;  1F4M A;  3OMA B;  5LHI A;  1QBZ A;  2XAS A;  2JDI G;  5GW7 A;  1VQL V;  3DTU B;  4PDM A;  1NH2 B;  5IYB O;  3JCZ A;  2IJI A;  1VQ4 V;  2P67 A;  3DGE A;  5CBF A;  3CC2 V;  2AHZ A;  2PI4 A;  2Y69 C;  1IXM A;  4QPK A;  2WLL A;  2V7Q G;  1EFR G;  3ZMU A;  3ZRW B;  1M56 B;  1PD3 A;  4JAV A;  1H2G A;  1QLE B;  3AG1 C;  3ASN C;  3ETD A;  1F51 A;  2AHY A;  2Y48 A;  2Q67 A;  1JX9 A;  3IFX A;  4MVR A;  5B1A B;  1VQ5 V;  1CEZ A;  3ZN0 A;  3SPC A;  3ZCC A;  1K3E A;  2B1G A;  1QVF U;  1E1R G;  3LUT B;  1COW G;  4G28 B;  2WLJ A;  2UXX A;  3JD0 A;  1YHQ V;  1SES A;  1MAB G;  4JTD B;  1KD1 W;  3HPL C;  1NJI W;  1K33 A;  1GK9 A;  5B1N A;  3T4Z A;  3F7V C;  4GX2 A;  4XDL A;  5IYC O;  1AJQ A;  4GX1 A;  1QCE A;  3OMI B;  1K97 A;  4Z1M G;  2QM7 A;  3FB6 C;  1K5Q A;  4EKW A;  3CCJ V;  2ZD9 A;  1V54 B;  2MK3 A;  5B1O A;  1RM1 C;  1WLE A;  2EZO A;  1QVG U;  3I56 V;  3JD3 A;  2BOB C;  4QE7 A;  1ROP A;  4MTX A;  4R6Z A;  4WFA V;  4P30 A;  4P9P A;  3ABK C;  4TWK A;  5EBL C;  3ABM B;  4U7O A;  1R3K C;  3FB5 C;  1K5S A;  1XL4 A;  4QNH B;  3ZRS A;  1BMF G;  1YTF B;  4QPJ A;  1R73 A;  3CP1 A;  3GB7 C;  2P90 A;  1Q86 W;  1OCZ B;  2B5U A;  2JJ2 G;  4MSW C;  2EBO A;  3ASO B;  3FYI B;  1W0J G;  2JJ1 G;  4X88 A;  4DO2 A;  3CCR V;  4H33 A;  2X6B A;  3OAA G;  2X7R B;  4FMT A;  3E8B A;  2P6J A;  4LCU C;  1OCR C;  1YI2 V;  1M57 C;  4BW5 A;  1VQN V;  1V55 C;  4L87 A;  1VQ8 V;  1VQ6 V;  5LBQ A;  1FFT B;  5CBH A;  5IDJ A;  2P7T C;  3SYO A;  2H94 A;  3ZRW A;  2X0L A;  4PA6 A;  4ASU G;  3E89 A;  1SET A;  1JPX A;  4X8A A;  3ZIA G;  3AG3 C;  4MVQ A;  1TUE B;  4R8C A;  4UUJ C;  2EZP A;  1EZJ A;  3VBB A;  5E1A C;  3ZJZ A;  5EBM C;  2OTL V;  3IC7 A;  3CCV V;  3R65 A;  1HWY A;  3P30 A;  4PA7 A;  1FXK C;  3OUS A;  1QR8 A;  3OR7 C;  3QO8 A;  3SPI A;  2HVJ C;  3AG2 B;  3JD1 A;  1YIJ V;  3STL C;  1GMG A;  4U7N A;  1AI6 A;  4JYC A;  1YSC A;  1M56 C;  2Z3Y A;  3T2M A;  1QLE C;  1FXV A;  1I5X A;  4BIU A;  3AG4 B;  2QA4 V;  5B1A C;  2A79 B;  2Q69 A;  2F43 G;  2ZR2 A;  5L3B A;  4MVU A;  4G27 B;  4TT3 G;  1XL6 A;  3OW2 U;  4PDR A;  3ABU A;  2A9H A;  4UV8 A;  4WFE A;  5IY5 C;  3JYC A;  3MHH C;  5B3S B;  3H01 A;  1AI5 A;  1ORQ C;  2EIL C;  4UVA A;  4WFH A;  3EFF K;  2WSS G;  4JPR A;  2EIN B;  5LHH A;  2OCC B;  4MVO A;  2ZR3 A;  3E35 A;  4H37 A;  1K73 W;  2R9I A;  2R9R B;  5KA6 A;  1KP2 A;  2ZDI A;  1MSW D;  1N8R W;  4WFB V;  1KC8 W;  1V54 C;  1EBO A;  5CBG A;  3SYP A;  3RW0 A;  1GM7 A;  2EIJ B;  3LDD A;  4LP8 A;  1L1F A;  1NVP D;  3ABM C;  1Q7Y W;  2PI5 A;  1KEC A;  1VQ7 V;  4ZBM A;  2HKO A;  3F5W C;  5LGN A;  1OCC B;  1OHH G;  3LSS A;  3SJQ C;  1OCZ C;  3E8F A;  1S3J A;  1R3I C;  2W6I G;  3ABL B;  4J9Y B;  2YSU B;  4RUF A;  4CZZ A;  2WLI A;  5LGU A;  4N23 A;  4G2K A;  2HG5 C;  3G4S V;  2DW4 A;  3FKS G;  1BHA A;  4MT8 A;  5HFL A;  3LNM B;  3ZMT A;  2BOC C;  2D3O W;  2NLJ C;  5KUM A;  2XOK G;  3OR6 C;  3RVZ A;  2H8P C;  2YEV B;  4LC1 A;  1S5H C;  1VQM V;  1E1Q G;  4XDJ A;  3FYE B;  4FK5 C;  2XAQ A;  2EIK B;  3CD6 V;  2B1I A;  1W2B U;  4QE9 A;  4GCZ A;  4JGS A;  5EC1 C;  1LNQ A;  4P2Z A;  2XAJ A;  1NR7 A;  3K9A A;  4QIW F;  4XDK A;  1H8H G;  1DTO A;  1AI4 A;  3F7Y C;  3ABT A;  1ENV A;  1R3J C;  2IH1 C;  4MTF A;  2WWW A;  2ZQM A;  4MTO A;  3T4D A;  2WLM A;  1PKX A;  2IU3 A;  5B1B C;  2HJF C;  4I5S A;  1Y66 A;  2OT5 A;  3HB3 B;  2Y69 B;  1YJ9 V;  1G4Y B;  2GHY A;  3AG4 C;  1R6N A;  2K1E A;  3OMN B;  3K08 A;  3W7X A;  4GT1 A;  1I5Y A;  2EIM B;  3CCS V;  3OGC C;  2M7W A;  1S77 D;  5B3S C;  4WCE V;  3CC7 V;  1W0K G;  1ARO P;  4YXW G;  3D36 A;  2HR3 A;  1K92 A;  4GX0 A;  3CMA V;  3ZMV A;  2DYR B;  3WFV A;  1DLB A;  4PA4 A;  1SRY A;  3A0R A;  3FB7 C;  5LGT A;  4WFG A;  2OTJ V;  3CCM V;  3B8M A;  1PNM A;  3NXS A;  1NBM G;  4PDL A;  2JEU A;  4MS2 A;  3W7U A;  3BEH A;  1VQ9 V;  4RQF A;  4JAS A;  4R50 A;  4KP4 A;  5CMU A;  2WAM A;  3JD2 A;  2XAG A;  3SYA A;  1K4C C;  3UM7 A;  4Q20 A;  3K04 A;  2DQ3 A;  5EC2 C;  3STZ C;  4JAU A;  2YEV A;  4JTC B;  2LP7 A;  1R6K A;  1KQS U;  1OCC C;  5KUK A;  2QE7 G;  5DN6 G;  1QLN A;  4MW3 A;  4RQE A;  1RPO A;  1NR1 A;  1ZWI C;  4ZKI A;  2DQ0 A;  3QNE A;  1K34 A;  3MHS C;  1CPY A;  3G6E V;  2ITD C;  2LFS A;  3E83 A;  2DYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...