3L74H

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l74H00
3CWBH 3CX5F 1BE3H 1SQPH 3L72H 1BGYH 1L0NH 1SQQH 1KB9F 3H1JH 3TGUH 1L0LH 1SQXH 3L73H 3H1LH 1NTMH 4PD4F 1NTZH 3L70H 3L71H 1BCCH 2A06H 3L74H 4D6TH 1P84F 3H1HH 1SQVH 4U3FH 1KYOF 3H1IH 2FYUH 1NTKH 1PPJH 2IBZH 1NU1H 3BCCH 3CXHF 2BCCH 3L75H 3H1KH 1SQBH 5KLVH 1EZVH 1PP9H
chains in the Genus database with same CATH superfamily
1YTFD 2H94A 2Q69A 5EBWC 2Q8VA 2QWOB 3ML0A 4LWSA 2WA4A 5IYZB 1VQPV 2IJIA 1H2SB 2AGAA 4BW5A 4JI6B 4LF8B 3H01A 1QVGU 1K9MW 3STLC 1NU1H 2CDYA 1GM8A 1SQPH 3D3QA 2JRIA 1SQQH 4BW9A 4JAVA 2WLNA 5EBMC 1U97A 2FKXA 2A06H 2GUZB 3T1YO 4EKWA 3DXRB 4X1YB 2Q4PA 1UFIA 2WPDG 3LNNA 1N36O 1JPXA 3JALB 3JD4A 4L87A 5KHHA 5B1AB 3OE7G 3ZHVA 3JCZA 1AJPA 2OYQA 3GVMA 2DWDC 4JYAB 4DV1O 2HR3A 5IJ0A 1LUWA 3D36A 1KU9A 1OCRB 4FLZA 1X4TA 1B6QA 1E1QG 2UXCB 4PI0A 3WG7C 2QGNA 3CXCU 2IJHA 1QLEC 1KP3A 1M90W 4DV2B 4NXMB 5CBGA 5D5QA 3IC7A 4JI1O 1AI5A 1Q43A 3CE2A 1O9HA 4IT5A 4K8XA 2BCCH 4J41A 4CS3A 4NXNB 1MOFA 2ZDIA 5KHIA 1Y4MA 1XQ8A 2VWKA 3CMAV 4FLTA 5CA0B 2EINB 5JJEB 3G67A 4KHPO 4DR1O 5LBQA 1NH2B 4B3TB 1QU7A 3L75H 2UU9O 3I5DA 3OEHG 3N27A 4X1IA 3RT3C 4JTAB 1QR9A 2ITCC 2DYRB 2RDCA 1P84F 4MW8A 3C90A 1Q5OA 1N8RW 4ZI7A 4ICGA 3A8TA 4G27B 3ZCCA 1SZXA 4LNUA 4R50A 4D7SA 2F23A 1SA0A 3DC5A 2XAQA 2ZIOA 3RYCB 4PD4F 2ADQB 1D2DA 2OTLV 3B8NA 1KUQA 2QTSA 3UKMA 1FS0G 3DTUB 4I4TA 5CMUA 3ABUA 4X88A 4GLXA 1WPXA 1NR1A 1PL0A 2UXXA 3CRMA 4Z2WA 3P3NA 4I7ZB 4MSWC 4X9QA 3ABKC 3CCUV 2V7QG 3RBZA 5JJJB 2RMKB 5IDJA 4LWSB 2QKCA 3CYOA 5IJ9A 2PUSA 2HHHB 3IC9A 4LF7B 4RQFA 1K5QA 1VQ6V 1L0LH 1IBLO 4LFCO 4BIUA 1V54C 3H1HH 1HNXO 4FZ0A 2EJ7A 4JI1B 5KA6A 2CH7A 4UFZA 3THOA 4OX9O 1GH6A 4JASA 3T1HO 1PP9H 4IHJA 3OGCC 4GKKO 4WFGA 4YIPA 3E35A 4LF5O 1Q86W 4JPRA 4B3MO 5CA3A 4LCUC 1SQFA 4ZOLA 4E2LA 4KHPB 4NB5A 4WFBV 1VP7A 5IJ0B 3E2EA 1CXZB 2UU9B 3OT7A 4CH5A 1VQKV 3A0BZ 1OCOB 5J2TA 5EBLC 1BCCH 3K0GA 4KFMA 2Y4TA 3D3IA 1NH2D 2IU3A 4DR6O 1K5SA 2F1MA 2F95B 5KLVH 4KUMA 1S77D 2P4VA 4I50A 2HLDG 1XREA 3ZHSA 2GTSA 1BL8A 2NLJC 1IBMO 4MVMA 5B3SB 1VQ4V 2W6IG 1QHTA 2NNUA 1KECA 5LOVA 1P4RA 2UXDO 4QGPA 4RUEA 5KAFZ 4MVSA 1XL4A 3OGIB 2ZINA 3G6BA 1W59A 2D2CB 3K5NA 2QKSA 1IZ3A 4N23A 2QR4A 1WP7A 2CAZC 3FYIB 1Q6UA 3GWKC 4UV9A 4FM0A 2DJVA 1OV9A 1M1KW 4I9QA 4U3JA 4I9WA 4UVBA 2UUAB 1VIBA 1WPBA 4LFCB 1KC8W 2IJKA 3AG1B 4X1IB 4CH6A 4JZGA 1RM1C 4DRXA 1N32O 2JIZG 4YJ3A 3N2KB 3AG1C 1GAXA 3CCLV 1GKFA 3T4ZA 1GO3F 4B3SO 5IWAB 1KKDA 1XMQB 2P7TC 3T1HB 2UUCB 3WB0A 3H1JH 1KQSU 4ZI7B 3RYFA 2QWPB 3CCRV 4Z1MG 2VQFO 2ZR2A 4LNUB 1VF5B 4DV4O 4GKKB 2F93B 4PI2A 3TETA 1BQZA 2EBOA 4ZHQA 2AW9A 1YDXA 2M7WA 1AR4A 1SA0B 4F6RA 4GX5A 1VQ5V 4WBNA 2VQEO 1LR1A 3BVOA 2D3OW 4I4TB 3CRAA 3ZMTA 2X7RB 4GCZA 4RQEA 1NS1A 5IJ9B 2GSMB 4JYYA 3G6EV 4YY3O 2ZE8A 2VRZA 2WLIB 4AHCA 2OT5A 4A5UB 3KCXA 5EC1C 1MABG 1QQCA 3FAVA 1W2BU 2LGQA 2QE7G 1JOYA 4PDLA 2CH7B 2JGUA 5K1PA 2LO1A 1YJNV 4UUJC 2R72A 2PI4A 2WAMA 2E5LO 4FLYA 2Q6AA 3ZRVA 5BMVB 5BY1A 2UXDB 3WFVA 4TV9A 5JCOA 3SPIA 3JAMN 5C8YA 1FXKC 4X65O 3MAQA 4UCTA 3A0RA 3SYPA 1A32A 2EILB 4ZOLB 1HNWB 3HKEA 1WJZA 2W0FC 3BAAA 4LC1A 2YXYA 2ZE5A 3AG3B 2Q9LA 5F2VO 1M56C 3J81N 4E4EA 1XNRO 1PV0A 5J2TB 1TUBA 4DR3O 1N33B 3BY6A 2E3CA 4B3SB 3IAYA 1M57C 5J9PC 4NTYA 3RVZA 2PGGA 2N04A 4K0KO 4UXNA 1B3QA 1J95A 1R3JC 1HNZB 2DE0X 4I50B 1HW7A 2EIKB 4LF9B 1PL4A 3BPZA 4JYBA 4MW3A 3FB6C 4YHHO 1KKCA 5LOVB 5L3DA 1NR7A 2VQEB 4CC6A 2JGDA 2G38A 1MSDA 5CA1A 3ZHQA 2EJRA 1VEWA 4FLVA 4UVAA 3W7UA 4U3JB 5LMUB 4DUYB 4YY3B 2HVKC 4PA9A 3ABLC 4HBNA 4MVQA 4YJ3B 3O65A 2JS5A 1XHXA 2WLMA 4TV8A 4U3FH 4X20A 5DECA 4QIWF 3RYFB 3ZRWB 1YF2A 3FKSG 1N4CA 3CCVV 1VQOV 1R1BA 4QE7A 1YJWV 3HKDA 4X65B 2QWRB 1P49A 4ZHQB 1DF4A 1CEZA 3K5OA 1Q3EA 4F6RB 2RCVA 3ZX6A 4WBNB 4XBFA 2P6JA 4J10A 2Q0OC 5GONB 2XT9A 4JI0B 2CUGA 3LSUA 3K59A 3JAWA 1XDCA 4O4HB 5FPOA 4GUNA 5EZYB 5B1BB 3MD0A 4MTOA 1XNRB 1VQLV 4DV6B 3I56V 3ZRSA 1KD1W 5EYPB 4DV5O 4RWUA 3K58A 1BGYH 5LL6Y 2EIMB 4NTWA 1Q82W 2YIBD 1GM9A 2A7WA 1VMGA 1YIJV 4IL6Z 2X0LA 4K0KB 1SF9A 3FAVB 4I55A 5DM6V 3SYAA 3ZBHA 4ASUG 3TXQA 4MT8A 2Y4UA 1EM1A 1NKDA 1K8AW 3E89A 1AP5A 1XMOO 1DLBA 4FLWA 1XBLA 2KB1A 1KB9F 1VF6C 5CB4A 2QWNB 3ZMZA 4TUYA 1G1XB 4TV9B 4G2KA 4UV8A 3FB5C 5C8YB 2B5UA 2Y48A 3CCSV 3ABTA 1AROP 1FJGB 3AG7A 1AR5A 4B3RB 2Z5UA 3AK1A 4X1KA 4O4JA 3JD3A 2CTPA 3DC6A 3OR6C 4GYCB 4CH3A 5BR8B 5K1XA 3ABMB 4WF9V 3JD2A 2ZNJA 5EC2C 1TUBB 1WAZA 3X2QB 4IIJA 2UXNA 1OCCB 4LR3A 1F51A 3SR2C 1SS3A 3APQA 4NVPA 4LF6B 4DR2O 3RWRD 3E22A 4PHZA 4DV0O 2R9IA 3AK2A 4MTFA 2KG7A 3HKCA 5LYJA 2M6YA 2XAFA 5B1AC 4D6TH 2GHYA 1I08A 1O9GA 1US6A 1ORQC 2JGDB 3AG2B 4NR1A 3WB2A 5LXTA 3JCUZ 4P2ZA 3CWBH 4UCRA 4H33A 4LFAB 1GN3A 3O9OA 3OUFA 1OCRC 4CS4A 4X64O 2OTJV 2P22C 3J7AU 3VQXA 2Z3YA 1K34A 1WB8A 1N0JA 4DR7B 4GZRB 3G80A 3ETDA 3SPGA 2IW5A 1F4NA 2CK3G 1I5YA 3QO7A 3SDLA 5KHJA 2XOKG 2P06A 2WWWA 3OTOO 2ODMA 1P7BA 5IY5B 4FMTA 4TV8B 5JQGA 4X20B 4LFBB 2F43G 2DYSB 1XMOB 2LFSA 4OXSA 5DEDA 3QF7A 2XHBA 3H1LH 4JI2O 3SPCA 4NTXA 2KQXA 3HKDB 1IVSA 3LDEA 1NZ6A 1UJWB 5LP6A 4P9OA 1S76D 1Q81W 2QTOA 3OMNB 2EINC 5E79Z 2Q68A 3ZN0A 1BMFG 5KUKA 3TGUH 3JAWB 3RVYA 5H5NA 3FD9A 4ZIBA 1OJHA 1NTMH 1NI8A 3ZHUA 1VQ9V 1JA8A 1BQ0A 3ZHTA 2Y69B 1H2LA 1Q6IA 2A0LA 4EB6A 5LHHA 3CCQV 4O4IA 3T1YB 4HAMA 2DYRC 3AG4B 1YITV 3IFXA 1RFYA 3E83A 1N36B 2DWEC 5FPRA 2QM4A 2XNDG 4I55B 2JJ2G 1DGSA 3ZJZA 4DR2B 2RJZA 4O4LA 4HNAA 1NTZH 3HPLC 4DV0B 1U96A 4FVMA 3P3PA 3HKBA 3TXSA 1Y76A 5KAIZ 1THZA 5CB4B 1S0VA 4TUYB 4DV1B 4UVCA 4X66O 1KMIZ 1HDJA 1HP8A 3SJBC 1NQTA 3F5TA 1IBKO 5H6QA 4X1KB 2BOCC 4O4JB 4X64B 4JI3O 3L71H 3EXAA 2GDSA 3FB7C 4FJCC 4FPPA 2BTOA 5KMGA 1GN4A 1GN6A 3UM7A 1H8HG 2Q5ZA 1YXBA 5KUMA 2Q67A 3DSQA 2PY5A 2IH1C 4BR6A 4WFAV 5TISZ 1ZSPA 5EIBD 1K97A 1PKXA 2QM7A 4IIJB 4PA3A 4B08A 1Q6HA 2IM9A 3E86A 4JI2B 3ZHRA 1Y74A 4YJ2A 1AB3A 2WLKA 1DTOA 3RYHA 4DV7O 1IDSA 4DK0A 4OGQB 1J5EO 3MDSA 2KG7B 3H9VA 1F23A 3HKCB 4BIOA 5LYJB 4DR1B 3JYCA 1LNQA 1TAEA 2B1IA 3OAAG 4JTCB 3N2GA 3JASA 5LXTB 2HEPA 3ASOB 3D36C 1Z5WA 1OCOC 3BHPA 2HFEC 2LP7A 1GMGA 4RO2A 1AI7A 4MS2A 2AHZA 3ZMSA 1BE3H 4UCOA 3EHBB 4Q6GA 5DN6G 4TWKA 5KA5A 1MNGA 5JQGB 1YZBA 2A9HA 3W7TA 3QNEA 5B3SC 1JX9A 1AI4A 3AK3A 2ZXWB 4H0LB 2ZDIC 5KHKA 5LP6B 3LNMB 2QSAA 4LF4O 1DF5A 5GTHZ 1FD9A 2FB5A 3L73H 4XDKA 5GW7A 4RUFA 3IJ4A 4FM1A 1IBLB 4X89A 2OCCB 2KKWA 3B4SA 1RPRA 3ZEDA 2R9AA 1EN4A 5KHGA 3FFQA 1PNLA 4J11A 2IU0A 2FMLA 1HNXB 1PNKA 2A3QA 4LP8A 1KP2A 4EFEA 1BT8A 4J9YB 4XDJA 4P9PA 4OX9B 4EB6B 4O4IB 3LDCA 1R73A 2OCHA 4TSFG 4GKJO 2AXTZ 3TCUA 2CTRA 4LF5B 3MHHC 3SPHA 4I0XA 2A79B 1H38A 4B3MB 4NKGB 3CHXA 4O4LB 5LHIA 2V4DA 3UT5A 3HKBB 5JH7A 1Y76B 1AILA 1XL6A 1WN7A 3B2EE 1MMMA 4DXWA 1XNQO 3E8GA 1GTOA 5KX5A 1FXVA 1SQVH 2DQ0A 3JAKA 3CP1A 4PV1B 1OCZB 1I7FA 4JI4O 4TT3G 4U7OA 1R3LC 4F6EA 3JARA 4DR6B 1SQBH 2CTQA 5KMGB 2YIDA 1GRJA 3JSNA 4DUZO 1Q8IA 4W4KA 3W7SA 4AQYO 2UUBO 3APOA 2QKAA 5H9CA 4J80A 3SYQA 1E1RG 1IBMB 4IHJB 3S3WA 3F5WC 1VARA 4PDMA 1W0JG 4DO2A 5JJNB 4P30A 4K3AA 1VF7A 5FL7G 5ITZA 3H1KH 4FFKA 1Y74B 3CX5F 4YJ2B 1ZAUA 2CGOA 4EEQA 2AZ0A 5LGNA 3RYHB 3CD6V 1TGOA 2ZE6A 1YHQV 4LF4B 1H2NA 1Y6XA 4H37A 2N74A 3SYCA 2EILC 4JI7O 1G6UA 1RPOA 2EZPA 2FYUH 1ZWIC 1H2GA 1ROPA 3AG3C 3N2GB 3OD4A 4ZBMA 1N32B 3M8AA 3QO8A 3TK1A 3KKYA 2O57A 3EVKA 2QDOA 1GK9A 1ZLZA 2UXBO 5H6RA 3M99B 2ETNA 2OIEA 3GWOA 2LGWA 3L70H 3CCMV 1MSWD 2XTAA 1BSMA 2PZSA 4GKJB 1V9PA 2AHYA 2VQFB 4DV4B 4D7TA 2LQTA 1P7GA 2ZM6O 2EX3A 2HKOA 3S3XA 3BA8A 3CC7V 2EIKC 2RNBA 4QJFB 3QVNA 1L0NH 3JD1A 2X6AA 3G4SV 1S3JA 2GTAA 1V55B 3RYIA 2WA3A 3CSXA 4J9ZB 2Q7EA 1XNQB 5EK0A 4HZ3A 4JTDB 1K3EA 2F4VO 1LUVA 4W4LA 1FPOA 4YXWG 4GX2A 4FLUA 3B40A 1XEQA 5LGTA 4DW0A 4DRXB 4AQYB 3L74H 1N34O 4MVUA 2RN9A 3CRRA 4PDRA 4LF8O 3GB7C 3T1CA 2E5LB 2F4VB 4U7NA 1VQ7V 3LSSA 4J42A 5J2UA 4PA7A 1GM7A 2NR5A 2QA4V 4I0XB 2PYLA 4X62O 3UT5B 1ZTEA 5JH7B 2ZR3A 1E79G 2EIJB 4GT1A 1R6NA 2Q73A 4DYLA 5CA0A 3KCYA 2EIJC 3BA9A 5KX5B 3JAKB 3CJHA 3P30A 5B1BC 5IYCO 4DR3B 4BIZA 4JYAO 2ZD9A 2IH3C 2X6BA 1CP9A 5LMNO 1FFTB 1BHAA 4FM2A 2ZIMA 1K4DC 3SJCC 3C3SA 2EIMC 2UXCO 1YJ9V 1JJ2U 3R65A 2ZCEA 5IE9A 1R6TA 3CC2V 2ZM6B 3ASNB 3SPJA 2DW4A 4IYHA 3ETEA 2FL4A 4DV2O 4YHHB 4DR4O 5D5PA 5ITZB 1ENVA 3K06A 5JCOC 3ZMVA 3CCEV 3IGAC 3AEIA 2L35A 2PI5A 4O2BA 2XAJA 1IXMA 4NXNO 1F7YA 4FLXA 3HKEB 1I5XA 3A2FA 3W7XA 4LBEC 4TQFA 2RQ6A 4QPKA 3CRQA 4PA4A 4KP4A 5JWPA 1TVKA 4DK1A 1D5AA 3SJAC 3ABMC 3DGEA 4CBCA 1OZ0A 2EULA 3OEEG 5L3FA 4B3TO 1N34B 5JVDA 1WA8A 3X2QC 1H2MA 2QJ1A 1OCCC 4WCEV 4J7KA 1AJNA 3TJTA 2Z0AA 2DMXA 1ZUQA 1SETA 2B9ZA 4JV5O 2YUAA 3CS5A 1AI6A 4X62B 3VQVA 1RP3B 1NVPB 2KSDA 2LFRA 4FFBA 1PNMA 4UB8Z 3RYIB 1HWYA 1UPGA 5CA1B 4FIPC 1X59A 3AG2C 4OPHA 3SJQC 2WLLA 1XI1A 4DV5B 1IX9A 3M7MX 2VS0A 3LSQA 3QTCA 5EIBC 3WG7B 5LMNB 1F4MA 4JI5O 1QLEB 1RSOA 2HHHO 4LF7O 1YI2V 3D8CA 4WFFA 1EBOA 2W0XA 1K73W 1NJIW 5IY5C 4DR4B 1VQMV 2HJDA 2DYSC 3STZC 3ZS8C 2ILMA 4CZZA 5J2UB 1R3KC 4JI8O 3JATA 2IBZH 5B66Z 1Y66A 1SZTA 1BHBA 3SGIA 1KBHA 2GV9A 4Q20A 1ZL8A 4O2AA 2LW7A 3OUSA 2YDEA 3VBBA 1QLNA 3CMEV 3CJHB 2X6CA 3H1IH 3OTFA 4MVRA 2Y69C 1IXBA 5IT9N 4TOIA 4JAUA 2QWQB 1PD3A 3KZIZ 5C93A 2HG5C 3OM3B 2GBOA 3AG4C 1WNSA 3N2KA 2NN4A 2E76B 2PF4E 1FFXA 2P4KA 5A2QN 2F66C 3K5LA 1M5IA 4F4LA 3K57A 2QM8A 3RFRA 4JV5B 2QEXV 1I94O 3G71V 3UO2A 1YSCA 1Y67A 3FX7A 1MG1A 1I0HA 1SRYA 3NR7A 4R8CA 3UO3A 2EZOA 4L8JA 4O2BB 5FNVA 3ABKB 2ZT9B 3OMIB 2XAHA 1NVPD 3T2MA 2E75B 1KYOF 4BWAA 1K92A 2ZE7A 2ZNIA 1G4YB 2PTMA 1D5NA 1TVKB 1H2KA 4B7EA 3K9SA 1JQ0A 1S5HC 4JI5B 4K8ZA 1EZVH 1SQGA 2C2AA 2YSUB 1V54B 5LHGA 3KG2A 2FTKA 2UUAO 2R70A 3OTOB 5IYDO 5JVDB 1WA8B 2WLIA 1GN2A 1FYJA 1XHZA 5AG2A 2HJFC 2Q7HA 2ITDC 3P32A 1EFRG 4X8AA 2ATKC 3E22B 4K35A 4OPAA 5IWAO 1XMQO 2BSKA 2PYJA 2UUCO 4JI8B 2WLHA 1FXKA 1K4CC 3VQYA 5BMVA 1PM9A 2P90A 4JGSA 3QG5A 5CN0A 3FB8C 4FFBB 2K9PA 4UCUA 4DR5O 3F7YC 3U10A 2JDIG 4UB6Z 2ARHA 4KL1A 2ADPA 3Q4HA 3QO5A 2WLLB 3FYEB 2YIBA 4JYCA 3BEHA 4DW1A 3ASOC 1S72V 4AILC 2BTQA 2LW1A 3L72H 1JFFA 2VWJA 3VQWA 1QR8A 1RSOB 1L1FA 2XAGA 3RW0A 4CS2A 1QNMA 1SESA 5B5EZ 5HFMA 4LH7A 5LA6A 4WFHA 3E8BA 5BXZA 2H3OA 4IGGA 1NTKH 2BE3A 3U0ZA 1I94B 3K5MA 3BCCH 1NBMG 1AVMA 3OFNG 2JK5C 3VOUA 4X66B 4ZKIA 1N0NA 2CGNA 1M4UA 2JJ1G 1MA1A 3K04A 3CRCA 3JATB 5B1OA 2ZXWC 5BZBA 1QCEA 5LGUA 1IBKB 5LP6C 2Y0IA 4JI3B 1ZL8B 1PPJH 1XILA 4O2AB 2OCCC 3HB3B 4J7JA 1BS3A 1FXHA 4EFBA 1Z5VA 1VQ8V 1QVFU 3ETGA 3E8FA 2AZ2A 1HNWO 2JVDA 1SERA 1RM1B 2V1DA 2Q0AA 1H8EG 5A9GA 5B1NA 5L3EA 2Q7GA 2MW2B 1ZX3A 2YEVA 3C3TA 4JF3A 1FKAO 1N33O 2OIGA 1FFXB 4HNAB 4DV7B 1CPYA 4NYKA 1J5EB 4UCSA 2W6JG 2YXLA 3ZRWA 1AJQA 1HNZO 1QBZA 4HYOA 2LJ2A 3BRCA 2YS8A 4LF9O 2P5OA 1TA8A 4DR5B 4PDVA 4YIOA 4G28B 4H44B 4JZ2A 5GONA 3EFFK 5FNVB 3B8MA 1OCZC 3UQ8A 4FZ1A 3ZRXA 4O4HA 5EZYA 1WLEA 2H8PC 1TUEB 4FK5C 1B04A 1NT2B 3K3WA 1BZKA 5EYPA 3BABA 1EZJA 1VQNV 4MTXA 2YC0A 5LMUO 4DUYO 3ZMUA 2N05A 1K33A 1HR0O 3MHSC 1Z2GA 2BOBC 1S5LZ 4N21A 1W0KG 2Y0PA 4ABMA 4J7ZA 3CPWU 4B7KA 3K03A 2IJJA 1VF6A 1R6KA 4QNHB 4CC5A 1XOUA 2BSKB 3B09A 3J80N 1FXKB 4IYIA 2JEXA 1SKVA 3NXSA 1Q90D 5HFLA 5IYZA 3JASB 1JR9A 3JD0A 3Q4HB 4DV3O 3OR7C 4JI0O 1B06A 1K7DA 1M56B 1YCIA 3I55V 4QPJA 5FLXN 5CBHA 1R3IC 2HVJC 1M93A 2BTQB 2DN9A 4MTGA 2B1GA 1JFFB 2ZQMA 4PA6A 4DV6O 3B77A 5CBFA 4WFEA 2WSSG 5L3BA 1M57B 2WLJA 2GUZA 3T4DA 2YI8A 3DXRA 4GX1A 4X1YA 1AR1B 5LA6B 1YTFB 1SQXH 3JALA 3R66A 3PJSK 4RAIA 1JMKC 3U11A 2JS3A 1V55C 2R9RB 3OMAB 3K9AA 5H2FZ 2MK3A 4QE9A 4JI4B 3SYOA 1JCHA 1IURA 4PJ0Z 1MZEA 1OHHG 3CC4V 1SC5B 2E74B 1M9NA 3ZIAG 4BAYA 1FJGO 4DUZB 4B3RO 2K1EA 4JI6O 2YICA 1WB7A 2UUBB 1L8DA 3ABLB 5BR8O 3CEIA 1DK1A 1S5JA 1MZFA 4Z1VA 1HR0B 1EN6A 2CE4A 4MVOA 1YEWA 4H13B 4UCVA 3ZN1A 4PELA 2YEVB 3ETQA 1EN5A 3WU2Z 2YXHA 3BFRA 4TQDA 2L6LA 4LF6O 4JI7B 3RN4A 2P67A 5L3GA 2OWOA 2HP8A 3LUTB 1Q7YW 5E1AC 4C7UA 5L3CA 3OW2U 3LDDA 1XUQA 1COWG 1WP8A 2YIAA 2XUMA 1AP6A 1JVMA 5IYBO 4DV3B 3WB1A 2UXBB 4R6ZA 3JARB 1YVWA 1G8MA 3K0DA 3PN1A 2ZKOA 1URFA 4KXRA 2XASA 3ICXA 2DQ3A 2YI9A 4CH4A 2CTWA 4LFAO 2DOSA 3CXHF 4R7CA 1FAFA 3A0HZ 3CCJV 3K79A 4NXMO 4DR7O 5GTIZ 4GX0A 3ASNC 3CB2A 1JJOA 3L9DA 4MVZA 3E8HA 3UCSC 4LH6A 1T5EA 3RGBA 4AI8A 3W7WA 4I5SA 3RYCA 4XDLA 4JAAA 4LFBO 3JSLA 3K08A 3F7VC 2JEUA 3HR0A
chains in the Genus database with same CATH topology
3CWBH 3CX5F 1BE3H 1SQPH 3L72H 1BGYH 1L0NH 1SQQH 1KB9F 3H1JH 3TGUH 1L0LH 1SQXH 3L73H 3H1LH 1NTMH 4PD4F 1NTZH 3L70H 3L71H 1BCCH 2A06H 3L74H 4D6TH 1P84F 3H1HH 1SQVH 4U3FH 1KYOF 3H1IH 2FYUH 1NTKH 1PPJH 2IBZH 1NU1H 3BCCH 3CXHF 2BCCH 3L75H 3H1KH 1SQBH 5KLVH 1EZVH 1PP9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB H;  3CX5 F;  1BE3 H;  1SQP H;  3L72 H;  1BGY H;  1L0N H;  1SQQ H;  1KB9 F;  3H1J H;  3TGU H;  1L0L H;  1SQX H;  3L73 H;  3H1L H;  1NTM H;  4PD4 F;  1NTZ H;  3L70 H;  3L71 H;  1BCC H;  2A06 H;  3L74 H;  4D6T H;  1P84 F;  3H1H H;  1SQV H;  4U3F H;  1KYO F;  3H1I H;  2FYU H;  1NTK H;  1PPJ H;  2IBZ H;  1NU1 H;  3BCC H;  3CXH F;  2BCC H;  3L75 H;  3H1K H;  1SQB H;  5KLV H;  1EZV H;  1PP9 H; 
#chains in the Genus database with same CATH topology
 1YTF D;  2H94 A;  2Q69 A;  5EBW C;  2Q8V A;  2QWO B;  3ML0 A;  4LWS A;  2WA4 A;  5IYZ B;  1VQP V;  2IJI A;  1H2S B;  2AGA A;  4BW5 A;  4JI6 B;  4LF8 B;  3H01 A;  1QVG U;  1K9M W;  3STL C;  1NU1 H;  2CDY A;  1GM8 A;  1SQP H;  3D3Q A;  2JRI A;  1SQQ H;  4BW9 A;  4JAV A;  2WLN A;  5EBM C;  1U97 A;  2FKX A;  2A06 H;  2GUZ B;  3T1Y O;  4EKW A;  3DXR B;  4X1Y B;  2Q4P A;  1UFI A;  2WPD G;  3LNN A;  1N36 O;  1JPX A;  3JAL B;  3JD4 A;  4L87 A;  5KHH A;  5B1A B;  3OE7 G;  3ZHV A;  3JCZ A;  1AJP A;  2OYQ A;  3GVM A;  2DWD C;  4JYA B;  4DV1 O;  2HR3 A;  5IJ0 A;  1LUW A;  3D36 A;  1KU9 A;  1OCR B;  4FLZ A;  1X4T A;  1B6Q A;  1E1Q G;  2UXC B;  4PI0 A;  3WG7 C;  2QGN A;  3CXC U;  2IJH A;  1QLE C;  1KP3 A;  1M90 W;  4DV2 B;  4NXM B;  5CBG A;  5D5Q A;  3IC7 A;  4JI1 O;  1AI5 A;  1Q43 A;  3CE2 A;  1O9H A;  4IT5 A;  4K8X A;  2BCC H;  4J41 A;  4CS3 A;  4NXN B;  1MOF A;  2ZDI A;  5KHI A;  1Y4M A;  1XQ8 A;  2VWK A;  3CMA V;  4FLT A;  5CA0 B;  2EIN B;  5JJE B;  3G67 A;  4KHP O;  4DR1 O;  5LBQ A;  1NH2 B;  4B3T B;  1QU7 A;  3L75 H;  2UU9 O;  3I5D A;  3OEH G;  3N27 A;  4X1I A;  3RT3 C;  4JTA B;  1QR9 A;  2ITC C;  2DYR B;  2RDC A;  1P84 F;  4MW8 A;  3C90 A;  1Q5O A;  1N8R W;  4ZI7 A;  4ICG A;  3A8T A;  4G27 B;  3ZCC A;  1SZX A;  4LNU A;  4R50 A;  4D7S A;  2F23 A;  1SA0 A;  3DC5 A;  2XAQ A;  2ZIO A;  3RYC B;  4PD4 F;  2ADQ B;  1D2D A;  2OTL V;  3B8N A;  1KUQ A;  2QTS A;  3UKM A;  1FS0 G;  3DTU B;  4I4T A;  5CMU A;  3ABU A;  4X88 A;  4GLX A;  1WPX A;  1NR1 A;  1PL0 A;  2UXX A;  3CRM A;  4Z2W A;  3P3N A;  4I7Z B;  4MSW C;  4X9Q A;  3ABK C;  3CCU V;  2V7Q G;  3RBZ A;  5JJJ B;  2RMK B;  5IDJ A;  4LWS B;  2QKC A;  3CYO A;  5IJ9 A;  2PUS A;  2HHH B;  3IC9 A;  4LF7 B;  4RQF A;  1K5Q A;  1VQ6 V;  1L0L H;  1IBL O;  4LFC O;  4BIU A;  1V54 C;  3H1H H;  1HNX O;  4FZ0 A;  2EJ7 A;  4JI1 B;  5KA6 A;  2CH7 A;  4UFZ A;  3THO A;  4OX9 O;  1GH6 A;  4JAS A;  3T1H O;  1PP9 H;  4IHJ A;  3OGC C;  4GKK O;  4WFG A;  4YIP A;  3E35 A;  4LF5 O;  1Q86 W;  4JPR A;  4B3M O;  5CA3 A;  4LCU C;  1SQF A;  4ZOL A;  4E2L A;  4KHP B;  4NB5 A;  4WFB V;  1VP7 A;  5IJ0 B;  3E2E A;  1CXZ B;  2UU9 B;  3OT7 A;  4CH5 A;  1VQK V;  3A0B Z;  1OCO B;  5J2T A;  5EBL C;  1BCC H;  3K0G A;  4KFM A;  2Y4T A;  3D3I A;  1NH2 D;  2IU3 A;  4DR6 O;  1K5S A;  2F1M A;  2F95 B;  5KLV H;  4KUM A;  1S77 D;  2P4V A;  4I50 A;  2HLD G;  1XRE A;  3ZHS A;  2GTS A;  1BL8 A;  2NLJ C;  1IBM O;  4MVM A;  5B3S B;  1VQ4 V;  2W6I G;  1QHT A;  2NNU A;  1KEC A;  5LOV A;  1P4R A;  2UXD O;  4QGP A;  4RUE A;  5KAF Z;  4MVS A;  1XL4 A;  3OGI B;  2ZIN A;  3G6B A;  1W59 A;  2D2C B;  3K5N A;  2QKS A;  1IZ3 A;  4N23 A;  2QR4 A;  1WP7 A;  2CAZ C;  3FYI B;  1Q6U A;  3GWK C;  4UV9 A;  4FM0 A;  2DJV A;  1OV9 A;  1M1K W;  4I9Q A;  4U3J A;  4I9W A;  4UVB A;  2UUA B;  1VIB A;  1WPB A;  4LFC B;  1KC8 W;  2IJK A;  3AG1 B;  4X1I B;  4CH6 A;  4JZG A;  1RM1 C;  4DRX A;  1N32 O;  2JIZ G;  4YJ3 A;  3N2K B;  3AG1 C;  1GAX A;  3CCL V;  1GKF A;  3T4Z A;  1GO3 F;  4B3S O;  5IWA B;  1KKD A;  1XMQ B;  2P7T C;  3T1H B;  2UUC B;  3WB0 A;  3H1J H;  1KQS U;  4ZI7 B;  3RYF A;  2QWP B;  3CCR V;  4Z1M G;  2VQF O;  2ZR2 A;  4LNU B;  1VF5 B;  4DV4 O;  4GKK B;  2F93 B;  4PI2 A;  3TET A;  1BQZ A;  2EBO A;  4ZHQ A;  2AW9 A;  1YDX A;  2M7W A;  1AR4 A;  1SA0 B;  4F6R A;  4GX5 A;  1VQ5 V;  4WBN A;  2VQE O;  1LR1 A;  3BVO A;  2D3O W;  4I4T B;  3CRA A;  3ZMT A;  2X7R B;  4GCZ A;  4RQE A;  1NS1 A;  5IJ9 B;  2GSM B;  4JYY A;  3G6E V;  4YY3 O;  2ZE8 A;  2VRZ A;  2WLI B;  4AHC A;  2OT5 A;  4A5U B;  3KCX A;  5EC1 C;  1MAB G;  1QQC A;  3FAV A;  1W2B U;  2LGQ A;  2QE7 G;  1JOY A;  4PDL A;  2CH7 B;  2JGU A;  5K1P A;  2LO1 A;  1YJN V;  4UUJ C;  2R72 A;  2PI4 A;  2WAM A;  2E5L O;  4FLY A;  2Q6A A;  3ZRV A;  5BMV B;  5BY1 A;  2UXD B;  3WFV A;  4TV9 A;  5JCO A;  3SPI A;  3JAM N;  5C8Y A;  1FXK C;  4X65 O;  3MAQ A;  4UCT A;  3A0R A;  3SYP A;  1A32 A;  2EIL B;  4ZOL B;  1HNW B;  3HKE A;  1WJZ A;  2W0F C;  3BAA A;  4LC1 A;  2YXY A;  2ZE5 A;  3AG3 B;  2Q9L A;  5F2V O;  1M56 C;  3J81 N;  4E4E A;  1XNR O;  1PV0 A;  5J2T B;  1TUB A;  4DR3 O;  1N33 B;  3BY6 A;  2E3C A;  4B3S B;  3IAY A;  1M57 C;  5J9P C;  4NTY A;  3RVZ A;  2PGG A;  2N04 A;  4K0K O;  4UXN A;  1B3Q A;  1J95 A;  1R3J C;  1HNZ B;  2DE0 X;  4I50 B;  1HW7 A;  2EIK B;  4LF9 B;  1PL4 A;  3BPZ A;  4JYB A;  4MW3 A;  3FB6 C;  4YHH O;  1KKC A;  5LOV B;  5L3D A;  1NR7 A;  2VQE B;  4CC6 A;  2JGD A;  2G38 A;  1MSD A;  5CA1 A;  3ZHQ A;  2EJR A;  1VEW A;  4FLV A;  4UVA A;  3W7U A;  4U3J B;  5LMU B;  4DUY B;  4YY3 B;  2HVK C;  4PA9 A;  3ABL C;  4HBN A;  4MVQ A;  4YJ3 B;  3O65 A;  2JS5 A;  1XHX A;  2WLM A;  4TV8 A;  4U3F H;  4X20 A;  5DEC A;  4QIW F;  3RYF B;  3ZRW B;  1YF2 A;  3FKS G;  1N4C A;  3CCV V;  1VQO V;  1R1B A;  4QE7 A;  1YJW V;  3HKD A;  4X65 B;  2QWR B;  1P49 A;  4ZHQ B;  1DF4 A;  1CEZ A;  3K5O A;  1Q3E A;  4F6R B;  2RCV A;  3ZX6 A;  4WBN B;  4XBF A;  2P6J A;  4J10 A;  2Q0O C;  5GON B;  2XT9 A;  4JI0 B;  2CUG A;  3LSU A;  3K59 A;  3JAW A;  1XDC A;  4O4H B;  5FPO A;  4GUN A;  5EZY B;  5B1B B;  3MD0 A;  4MTO A;  1XNR B;  1VQL V;  4DV6 B;  3I56 V;  3ZRS A;  1KD1 W;  5EYP B;  4DV5 O;  4RWU A;  3K58 A;  1BGY H;  5LL6 Y;  2EIM B;  4NTW A;  1Q82 W;  2YIB D;  1GM9 A;  2A7W A;  1VMG A;  1YIJ V;  4IL6 Z;  2X0L A;  4K0K B;  1SF9 A;  3FAV B;  4I55 A;  5DM6 V;  3SYA A;  3ZBH A;  4ASU G;  3TXQ A;  4MT8 A;  2Y4U A;  1EM1 A;  1NKD A;  1K8A W;  3E89 A;  1AP5 A;  1XMO O;  1DLB A;  4FLW A;  1XBL A;  2KB1 A;  1KB9 F;  1VF6 C;  5CB4 A;  2QWN B;  3ZMZ A;  4TUY A;  1G1X B;  4TV9 B;  4G2K A;  4UV8 A;  3FB5 C;  5C8Y B;  2B5U A;  2Y48 A;  3CCS V;  3ABT A;  1ARO P;  1FJG B;  3AG7 A;  1AR5 A;  4B3R B;  2Z5U A;  3AK1 A;  4X1K A;  4O4J A;  3JD3 A;  2CTP A;  3DC6 A;  3OR6 C;  4GYC B;  4CH3 A;  5BR8 B;  5K1X A;  3ABM B;  4WF9 V;  3JD2 A;  2ZNJ A;  5EC2 C;  1TUB B;  1WAZ A;  3X2Q B;  4IIJ A;  2UXN A;  1OCC B;  4LR3 A;  1F51 A;  3SR2 C;  1SS3 A;  3APQ A;  4NVP A;  4LF6 B;  4DR2 O;  3RWR D;  3E22 A;  4PHZ A;  4DV0 O;  2R9I A;  3AK2 A;  4MTF A;  2KG7 A;  3HKC A;  5LYJ A;  2M6Y A;  2XAF A;  5B1A C;  4D6T H;  2GHY A;  1I08 A;  1O9G A;  1US6 A;  1ORQ C;  2JGD B;  3AG2 B;  4NR1 A;  3WB2 A;  5LXT A;  3JCU Z;  4P2Z A;  3CWB H;  4UCR A;  4H33 A;  4LFA B;  1GN3 A;  3O9O A;  3OUF A;  1OCR C;  4CS4 A;  4X64 O;  2OTJ V;  2P22 C;  3J7A U;  3VQX A;  2Z3Y A;  1K34 A;  1WB8 A;  1N0J A;  4DR7 B;  4GZR B;  3G80 A;  3ETD A;  3SPG A;  2IW5 A;  1F4N A;  2CK3 G;  1I5Y A;  3QO7 A;  3SDL A;  5KHJ A;  2XOK G;  2P06 A;  2WWW A;  3OTO O;  2ODM A;  1P7B A;  5IY5 B;  4FMT A;  4TV8 B;  5JQG A;  4X20 B;  4LFB B;  2F43 G;  2DYS B;  1XMO B;  2LFS A;  4OXS A;  5DED A;  3QF7 A;  2XHB A;  3H1L H;  4JI2 O;  3SPC A;  4NTX A;  2KQX A;  3HKD B;  1IVS A;  3LDE A;  1NZ6 A;  1UJW B;  5LP6 A;  4P9O A;  1S76 D;  1Q81 W;  2QTO A;  3OMN B;  2EIN C;  5E79 Z;  2Q68 A;  3ZN0 A;  1BMF G;  5KUK A;  3TGU H;  3JAW B;  3RVY A;  5H5N A;  3FD9 A;  4ZIB A;  1OJH A;  1NTM H;  1NI8 A;  3ZHU A;  1VQ9 V;  1JA8 A;  1BQ0 A;  3ZHT A;  2Y69 B;  1H2L A;  1Q6I A;  2A0L A;  4EB6 A;  5LHH A;  3CCQ V;  4O4I A;  3T1Y B;  4HAM A;  2DYR C;  3AG4 B;  1YIT V;  3IFX A;  1RFY A;  3E83 A;  1N36 B;  2DWE C;  5FPR A;  2QM4 A;  2XND G;  4I55 B;  2JJ2 G;  1DGS A;  3ZJZ A;  4DR2 B;  2RJZ A;  4O4L A;  4HNA A;  1NTZ H;  3HPL C;  4DV0 B;  1U96 A;  4FVM A;  3P3P A;  3HKB A;  3TXS A;  1Y76 A;  5KAI Z;  1THZ A;  5CB4 B;  1S0V A;  4TUY B;  4DV1 B;  4UVC A;  4X66 O;  1KMI Z;  1HDJ A;  1HP8 A;  3SJB C;  1NQT A;  3F5T A;  1IBK O;  5H6Q A;  4X1K B;  2BOC C;  4O4J B;  4X64 B;  4JI3 O;  3L71 H;  3EXA A;  2GDS A;  3FB7 C;  4FJC C;  4FPP A;  2BTO A;  5KMG A;  1GN4 A;  1GN6 A;  3UM7 A;  1H8H G;  2Q5Z A;  1YXB A;  5KUM A;  2Q67 A;  3DSQ A;  2PY5 A;  2IH1 C;  4BR6 A;  4WFA V;  5TIS Z;  1ZSP A;  5EIB D;  1K97 A;  1PKX A;  2QM7 A;  4IIJ B;  4PA3 A;  4B08 A;  1Q6H A;  2IM9 A;  3E86 A;  4JI2 B;  3ZHR A;  1Y74 A;  4YJ2 A;  1AB3 A;  2WLK A;  1DTO A;  3RYH A;  4DV7 O;  1IDS A;  4DK0 A;  4OGQ B;  1J5E O;  3MDS A;  2KG7 B;  3H9V A;  1F23 A;  3HKC B;  4BIO A;  5LYJ B;  4DR1 B;  3JYC A;  1LNQ A;  1TAE A;  2B1I A;  3OAA G;  4JTC B;  3N2G A;  3JAS A;  5LXT B;  2HEP A;  3ASO B;  3D36 C;  1Z5W A;  1OCO C;  3BHP A;  2HFE C;  2LP7 A;  1GMG A;  4RO2 A;  1AI7 A;  4MS2 A;  2AHZ A;  3ZMS A;  1BE3 H;  4UCO A;  3EHB B;  4Q6G A;  5DN6 G;  4TWK A;  5KA5 A;  1MNG A;  5JQG B;  1YZB A;  2A9H A;  3W7T A;  3QNE A;  5B3S C;  1JX9 A;  1AI4 A;  3AK3 A;  2ZXW B;  4H0L B;  2ZDI C;  5KHK A;  5LP6 B;  3LNM B;  2QSA A;  4LF4 O;  1DF5 A;  5GTH Z;  1FD9 A;  2FB5 A;  3L73 H;  4XDK A;  5GW7 A;  4RUF A;  3IJ4 A;  4FM1 A;  1IBL B;  4X89 A;  2OCC B;  2KKW A;  3B4S A;  1RPR A;  3ZED A;  2R9A A;  1EN4 A;  5KHG A;  3FFQ A;  1PNL A;  4J11 A;  2IU0 A;  2FML A;  1HNX B;  1PNK A;  2A3Q A;  4LP8 A;  1KP2 A;  4EFE A;  1BT8 A;  4J9Y B;  4XDJ A;  4P9P A;  4OX9 B;  4EB6 B;  4O4I B;  3LDC A;  1R73 A;  2OCH A;  4TSF G;  4GKJ O;  2AXT Z;  3TCU A;  2CTR A;  4LF5 B;  3MHH C;  3SPH A;  4I0X A;  2A79 B;  1H38 A;  4B3M B;  4NKG B;  3CHX A;  4O4L B;  5LHI A;  2V4D A;  3UT5 A;  3HKB B;  5JH7 A;  1Y76 B;  1AIL A;  1XL6 A;  1WN7 A;  3B2E E;  1MMM A;  4DXW A;  1XNQ O;  3E8G A;  1GTO A;  5KX5 A;  1FXV A;  1SQV H;  2DQ0 A;  3JAK A;  3CP1 A;  4PV1 B;  1OCZ B;  1I7F A;  4JI4 O;  4TT3 G;  4U7O A;  1R3L C;  4F6E A;  3JAR A;  4DR6 B;  1SQB H;  2CTQ A;  5KMG B;  2YID A;  1GRJ A;  3JSN A;  4DUZ O;  1Q8I A;  4W4K A;  3W7S A;  4AQY O;  2UUB O;  3APO A;  2QKA A;  5H9C A;  4J80 A;  3SYQ A;  1E1R G;  1IBM B;  4IHJ B;  3S3W A;  3F5W C;  1VAR A;  4PDM A;  1W0J G;  4DO2 A;  5JJN B;  4P30 A;  4K3A A;  1VF7 A;  5FL7 G;  5ITZ A;  3H1K H;  4FFK A;  1Y74 B;  3CX5 F;  4YJ2 B;  1ZAU A;  2CGO A;  4EEQ A;  2AZ0 A;  5LGN A;  3RYH B;  3CD6 V;  1TGO A;  2ZE6 A;  1YHQ V;  4LF4 B;  1H2N A;  1Y6X A;  4H37 A;  2N74 A;  3SYC A;  2EIL C;  4JI7 O;  1G6U A;  1RPO A;  2EZP A;  2FYU H;  1ZWI C;  1H2G A;  1ROP A;  3AG3 C;  3N2G B;  3OD4 A;  4ZBM A;  1N32 B;  3M8A A;  3QO8 A;  3TK1 A;  3KKY A;  2O57 A;  3EVK A;  2QDO A;  1GK9 A;  1ZLZ A;  2UXB O;  5H6R A;  3M99 B;  2ETN A;  2OIE A;  3GWO A;  2LGW A;  3L70 H;  3CCM V;  1MSW D;  2XTA A;  1BSM A;  2PZS A;  4GKJ B;  1V9P A;  2AHY A;  2VQF B;  4DV4 B;  4D7T A;  2LQT A;  1P7G A;  2ZM6 O;  2EX3 A;  2HKO A;  3S3X A;  3BA8 A;  3CC7 V;  2EIK C;  2RNB A;  4QJF B;  3QVN A;  1L0N H;  3JD1 A;  2X6A A;  3G4S V;  1S3J A;  2GTA A;  1V55 B;  3RYI A;  2WA3 A;  3CSX A;  4J9Z B;  2Q7E A;  1XNQ B;  5EK0 A;  4HZ3 A;  4JTD B;  1K3E A;  2F4V O;  1LUV A;  4W4L A;  1FPO A;  4YXW G;  4GX2 A;  4FLU A;  3B40 A;  1XEQ A;  5LGT A;  4DW0 A;  4DRX B;  4AQY B;  3L74 H;  1N34 O;  4MVU A;  2RN9 A;  3CRR A;  4PDR A;  4LF8 O;  3GB7 C;  3T1C A;  2E5L B;  2F4V B;  4U7N A;  1VQ7 V;  3LSS A;  4J42 A;  5J2U A;  4PA7 A;  1GM7 A;  2NR5 A;  2QA4 V;  4I0X B;  2PYL A;  4X62 O;  3UT5 B;  1ZTE A;  5JH7 B;  2ZR3 A;  1E79 G;  2EIJ B;  4GT1 A;  1R6N A;  2Q73 A;  4DYL A;  5CA0 A;  3KCY A;  2EIJ C;  3BA9 A;  5KX5 B;  3JAK B;  3CJH A;  3P30 A;  5B1B C;  5IYC O;  4DR3 B;  4BIZ A;  4JYA O;  2ZD9 A;  2IH3 C;  2X6B A;  1CP9 A;  5LMN O;  1FFT B;  1BHA A;  4FM2 A;  2ZIM A;  1K4D C;  3SJC C;  3C3S A;  2EIM C;  2UXC O;  1YJ9 V;  1JJ2 U;  3R65 A;  2ZCE A;  5IE9 A;  1R6T A;  3CC2 V;  2ZM6 B;  3ASN B;  3SPJ A;  2DW4 A;  4IYH A;  3ETE A;  2FL4 A;  4DV2 O;  4YHH B;  4DR4 O;  5D5P A;  5ITZ B;  1ENV A;  3K06 A;  5JCO C;  3ZMV A;  3CCE V;  3IGA C;  3AEI A;  2L35 A;  2PI5 A;  4O2B A;  2XAJ A;  1IXM A;  4NXN O;  1F7Y A;  4FLX A;  3HKE B;  1I5X A;  3A2F A;  3W7X A;  4LBE C;  4TQF A;  2RQ6 A;  4QPK A;  3CRQ A;  4PA4 A;  4KP4 A;  5JWP A;  1TVK A;  4DK1 A;  1D5A A;  3SJA C;  3ABM C;  3DGE A;  4CBC A;  1OZ0 A;  2EUL A;  3OEE G;  5L3F A;  4B3T O;  1N34 B;  5JVD A;  1WA8 A;  3X2Q C;  1H2M A;  2QJ1 A;  1OCC C;  4WCE V;  4J7K A;  1AJN A;  3TJT A;  2Z0A A;  2DMX A;  1ZUQ A;  1SET A;  2B9Z A;  4JV5 O;  2YUA A;  3CS5 A;  1AI6 A;  4X62 B;  3VQV A;  1RP3 B;  1NVP B;  2KSD A;  2LFR A;  4FFB A;  1PNM A;  4UB8 Z;  3RYI B;  1HWY A;  1UPG A;  5CA1 B;  4FIP C;  1X59 A;  3AG2 C;  4OPH A;  3SJQ C;  2WLL A;  1XI1 A;  4DV5 B;  1IX9 A;  3M7M X;  2VS0 A;  3LSQ A;  3QTC A;  5EIB C;  3WG7 B;  5LMN B;  1F4M A;  4JI5 O;  1QLE B;  1RSO A;  2HHH O;  4LF7 O;  1YI2 V;  3D8C A;  4WFF A;  1EBO A;  2W0X A;  1K73 W;  1NJI W;  5IY5 C;  4DR4 B;  1VQM V;  2HJD A;  2DYS C;  3STZ C;  3ZS8 C;  2ILM A;  4CZZ A;  5J2U B;  1R3K C;  4JI8 O;  3JAT A;  2IBZ H;  5B66 Z;  1Y66 A;  1SZT A;  1BHB A;  3SGI A;  1KBH A;  2GV9 A;  4Q20 A;  1ZL8 A;  4O2A A;  2LW7 A;  3OUS A;  2YDE A;  3VBB A;  1QLN A;  3CME V;  3CJH B;  2X6C A;  3H1I H;  3OTF A;  4MVR A;  2Y69 C;  1IXB A;  5IT9 N;  4TOI A;  4JAU A;  2QWQ B;  1PD3 A;  3KZI Z;  5C93 A;  2HG5 C;  3OM3 B;  2GBO A;  3AG4 C;  1WNS A;  3N2K A;  2NN4 A;  2E76 B;  2PF4 E;  1FFX A;  2P4K A;  5A2Q N;  2F66 C;  3K5L A;  1M5I A;  4F4L A;  3K57 A;  2QM8 A;  3RFR A;  4JV5 B;  2QEX V;  1I94 O;  3G71 V;  3UO2 A;  1YSC A;  1Y67 A;  3FX7 A;  1MG1 A;  1I0H A;  1SRY A;  3NR7 A;  4R8C A;  3UO3 A;  2EZO A;  4L8J A;  4O2B B;  5FNV A;  3ABK B;  2ZT9 B;  3OMI B;  2XAH A;  1NVP D;  3T2M A;  2E75 B;  1KYO F;  4BWA A;  1K92 A;  2ZE7 A;  2ZNI A;  1G4Y B;  2PTM A;  1D5N A;  1TVK B;  1H2K A;  4B7E A;  3K9S A;  1JQ0 A;  1S5H C;  4JI5 B;  4K8Z A;  1EZV H;  1SQG A;  2C2A A;  2YSU B;  1V54 B;  5LHG A;  3KG2 A;  2FTK A;  2UUA O;  2R70 A;  3OTO B;  5IYD O;  5JVD B;  1WA8 B;  2WLI A;  1GN2 A;  1FYJ A;  1XHZ A;  5AG2 A;  2HJF C;  2Q7H A;  2ITD C;  3P32 A;  1EFR G;  4X8A A;  2ATK C;  3E22 B;  4K35 A;  4OPA A;  5IWA O;  1XMQ O;  2BSK A;  2PYJ A;  2UUC O;  4JI8 B;  2WLH A;  1FXK A;  1K4C C;  3VQY A;  5BMV A;  1PM9 A;  2P90 A;  4JGS A;  3QG5 A;  5CN0 A;  3FB8 C;  4FFB B;  2K9P A;  4UCU A;  4DR5 O;  3F7Y C;  3U10 A;  2JDI G;  4UB6 Z;  2ARH A;  4KL1 A;  2ADP A;  3Q4H A;  3QO5 A;  2WLL B;  3FYE B;  2YIB A;  4JYC A;  3BEH A;  4DW1 A;  3ASO C;  1S72 V;  4AIL C;  2BTQ A;  2LW1 A;  3L72 H;  1JFF A;  2VWJ A;  3VQW A;  1QR8 A;  1RSO B;  1L1F A;  2XAG A;  3RW0 A;  4CS2 A;  1QNM A;  1SES A;  5B5E Z;  5HFM A;  4LH7 A;  5LA6 A;  4WFH A;  3E8B A;  5BXZ A;  2H3O A;  4IGG A;  1NTK H;  2BE3 A;  3U0Z A;  1I94 B;  3K5M A;  3BCC H;  1NBM G;  1AVM A;  3OFN G;  2JK5 C;  3VOU A;  4X66 B;  4ZKI A;  1N0N A;  2CGN A;  1M4U A;  2JJ1 G;  1MA1 A;  3K04 A;  3CRC A;  3JAT B;  5B1O A;  2ZXW C;  5BZB A;  1QCE A;  5LGU A;  1IBK B;  5LP6 C;  2Y0I A;  4JI3 B;  1ZL8 B;  1PPJ H;  1XIL A;  4O2A B;  2OCC C;  3HB3 B;  4J7J A;  1BS3 A;  1FXH A;  4EFB A;  1Z5V A;  1VQ8 V;  1QVF U;  3ETG A;  3E8F A;  2AZ2 A;  1HNW O;  2JVD A;  1SER A;  1RM1 B;  2V1D A;  2Q0A A;  1H8E G;  5A9G A;  5B1N A;  5L3E A;  2Q7G A;  2MW2 B;  1ZX3 A;  2YEV A;  3C3T A;  4JF3 A;  1FKA O;  1N33 O;  2OIG A;  1FFX B;  4HNA B;  4DV7 B;  1CPY A;  4NYK A;  1J5E B;  4UCS A;  2W6J G;  2YXL A;  3ZRW A;  1AJQ A;  1HNZ O;  1QBZ A;  4HYO A;  2LJ2 A;  3BRC A;  2YS8 A;  4LF9 O;  2P5O A;  1TA8 A;  4DR5 B;  4PDV A;  4YIO A;  4G28 B;  4H44 B;  4JZ2 A;  5GON A;  3EFF K;  5FNV B;  3B8M A;  1OCZ C;  3UQ8 A;  4FZ1 A;  3ZRX A;  4O4H A;  5EZY A;  1WLE A;  2H8P C;  1TUE B;  4FK5 C;  1B04 A;  1NT2 B;  3K3W A;  1BZK A;  5EYP A;  3BAB A;  1EZJ A;  1VQN V;  4MTX A;  2YC0 A;  5LMU O;  4DUY O;  3ZMU A;  2N05 A;  1K33 A;  1HR0 O;  3MHS C;  1Z2G A;  2BOB C;  1S5L Z;  4N21 A;  1W0K G;  2Y0P A;  4ABM A;  4J7Z A;  3CPW U;  4B7K A;  3K03 A;  2IJJ A;  1VF6 A;  1R6K A;  4QNH B;  4CC5 A;  1XOU A;  2BSK B;  3B09 A;  3J80 N;  1FXK B;  4IYI A;  2JEX A;  1SKV A;  3NXS A;  1Q90 D;  5HFL A;  5IYZ A;  3JAS B;  1JR9 A;  3JD0 A;  3Q4H B;  4DV3 O;  3OR7 C;  4JI0 O;  1B06 A;  1K7D A;  1M56 B;  1YCI A;  3I55 V;  4QPJ A;  5FLX N;  5CBH A;  1R3I C;  2HVJ C;  1M93 A;  2BTQ B;  2DN9 A;  4MTG A;  2B1G A;  1JFF B;  2ZQM A;  4PA6 A;  4DV6 O;  3B77 A;  5CBF A;  4WFE A;  2WSS G;  5L3B A;  1M57 B;  2WLJ A;  2GUZ A;  3T4D A;  2YI8 A;  3DXR A;  4GX1 A;  4X1Y A;  1AR1 B;  5LA6 B;  1YTF B;  1SQX H;  3JAL A;  3R66 A;  3PJS K;  4RAI A;  1JMK C;  3U11 A;  2JS3 A;  1V55 C;  2R9R B;  3OMA B;  3K9A A;  5H2F Z;  2MK3 A;  4QE9 A;  4JI4 B;  3SYO A;  1JCH A;  1IUR A;  4PJ0 Z;  1MZE A;  1OHH G;  3CC4 V;  1SC5 B;  2E74 B;  1M9N A;  3ZIA G;  4BAY A;  1FJG O;  4DUZ B;  4B3R O;  2K1E A;  4JI6 O;  2YIC A;  1WB7 A;  2UUB B;  1L8D A;  3ABL B;  5BR8 O;  3CEI A;  1DK1 A;  1S5J A;  1MZF A;  4Z1V A;  1HR0 B;  1EN6 A;  2CE4 A;  4MVO A;  1YEW A;  4H13 B;  4UCV A;  3ZN1 A;  4PEL A;  2YEV B;  3ETQ A;  1EN5 A;  3WU2 Z;  2YXH A;  3BFR A;  4TQD A;  2L6L A;  4LF6 O;  4JI7 B;  3RN4 A;  2P67 A;  5L3G A;  2OWO A;  2HP8 A;  3LUT B;  1Q7Y W;  5E1A C;  4C7U A;  5L3C A;  3OW2 U;  3LDD A;  1XUQ A;  1COW G;  1WP8 A;  2YIA A;  2XUM A;  1AP6 A;  1JVM A;  5IYB O;  4DV3 B;  3WB1 A;  2UXB B;  4R6Z A;  3JAR B;  1YVW A;  1G8M A;  3K0D A;  3PN1 A;  2ZKO A;  1URF A;  4KXR A;  2XAS A;  3ICX A;  2DQ3 A;  2YI9 A;  4CH4 A;  2CTW A;  4LFA O;  2DOS A;  3CXH F;  4R7C A;  1FAF A;  3A0H Z;  3CCJ V;  3K79 A;  4NXM O;  4DR7 O;  5GTI Z;  4GX0 A;  3ASN C;  3CB2 A;  1JJO A;  3L9D A;  4MVZ A;  3E8H A;  3UCS C;  4LH6 A;  1T5E A;  3RGB A;  4AI8 A;  3W7W A;  4I5S A;  3RYC A;  4XDL A;  4JAA A;  4LFB O;  3JSL A;  3K08 A;  3F7V C;  2JEU A;  3HR0 A; 
#chains in the Genus database with same CATH homology
 3CWB H;  3CX5 F;  1BE3 H;  1SQP H;  3L72 H;  1BGY H;  1L0N H;  1SQQ H;  1KB9 F;  3H1J H;  3TGU H;  1L0L H;  1SQX H;  3L73 H;  3H1L H;  1NTM H;  4PD4 F;  1NTZ H;  3L70 H;  3L71 H;  1BCC H;  2A06 H;  3L74 H;  4D6T H;  1P84 F;  3H1H H;  1SQV H;  4U3F H;  1KYO F;  3H1I H;  2FYU H;  1NTK H;  1PPJ H;  2IBZ H;  1NU1 H;  3BCC H;  3CXH F;  2BCC H;  3L75 H;  3H1K H;  1SQB H;  5KLV H;  1EZV H;  1PP9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...