3L74H

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l74H00
1SQXH 4PD4F 1BCCH 2IBZH 3H1LH 1NTZH 3CX5F 3H1KH 3H1HH 1NTMH 1SQVH 5KLVH 2A06H 3CXHF 1SQBH 1NTKH 1L0NH 1EZVH 3L72H 1L0LH 1BE3H 2BCCH 1SQQH 3CWBH 3L70H 1SQPH 1KB9F 3H1IH 3L74H 4U3FH 3TGUH 1PP9H 3BCCH 1PPJH 2FYUH 3H1JH 1BGYH 3L73H 1KYOF 1NU1H 3L71H 4D6TH 3L75H 1P84F
chains in the Genus database with same CATH superfamily
2ZXWB 4DV5B 2YS8A 3W7SA 1KD1W 4CS4A 1HNXO 1VMGA 3JD2A 3ZRWA 1Z2GA 2CGOA 1J95A 1ENVA 2ZNJA 1JX9A 4YJ3B 4N23A 4DV4B 4K8ZA 1Y76B 3CCMV 1CEZA 1IXMA 5E1AC 3UCSC 3ZRXA 4X1YB 3BAAA 4R6ZA 4B7EA 4NTXA 4CH6A 2OYQA 3ABTA 1URFA 1FKAO 2ADQB 2WSSG 3FD9A 5EIBD 1OCZB 1H2NA 1B3QA 1DGSA 2UUCB 1KKCA 3K57A 2QEXV 3LNNA 1W0KG 5IY5C 4G2KA 3TCUA 3E2EA 2IJIA 3T2MA 1K34A 5J2TB 4DV6O 4OXSA 5D5PA 2DMXA 4HBNA 4E2LA 1XHZA 1VQ5V 2Y0PA 1BE3H 3K59A 4UCVA 1S5JA 2RN9A 4G27B 4LH6A 5H6QA 1K3EA 1R6KA 3J7AU 4DW0A 1SKVA 1JJ2U 5LOVB 4NB5A 1QU7A 3ETGA 4YJ2B 4PDLA 2WWWA 3I56V 3OMIB 3IFXA 1OCCC 1R73A 4MTGA 3T1HO 2P22C 2Q0AA 5LL6Y 3CYOA 4I0XB 2DJVA 1VQ8V 1SQQH 2YC0A 4CH5A 1WPXA 4JTAB 4DV2B 1JQ0A 3H1JH 4X20A 2F43G 4QIWF 1B06A 1NH2B 2JS3A 1Q86W 2XAQA 1QBZA 5DEDA 3SYAA 4JYAO 3SYOA 1IX9A 1GTOA 3LUTB 3SYQA 2R72A 4B3MB 2QTSA 1Q82W 3RYIB 3JAKB 3P30A 3ZHTA 3K5NA 3E86A 1NVPB 1UPGA 1YI2V 2QKAA 1WPBA 4TUYB 1I0HA 1FXHA 5KA6A 5L3EA 4PA6A 3ZRVA 2MK3A 4UCTA 2YUAA 3ETDA 4FVMA 2OCCB 4U3FH 2A0LA 4DV3O 1XMOB 4J7KA 3FAVB 3LSQA 1P84F 5KHKA 2HKOA 4JI5O 2UUAO 2HG5C 5B1OA 4RWUA 3MDSA 1L0LH 4BW5A 1YIJV 1D5AA 1N36B 5JVDB 3E8HA 1O9HA 2KSDA 5J2UA 1S76D 1RP3B 3JCZA 1PNLA 3W7WA 2PZSA 5LP6C 4QGPA 4DUZB 4DV5O 1S0VA 1BHBA 3JYCA 1AI7A 1SQXH 3CCJV 3E89A 3E22B 4P9PA 4U3JB 3RYHA 3ZHUA 2ZNIA 1O9GA 1GN4A 4WFBV 1B04A 2EZOA 3B2EE 1TVKB 1NTKH 4HNAB 4UV8A 3QG5A 3SDLA 4X64B 4DV4O 4AQYB 3CEIA 4OGQB 3APQA 5BR8B 4IL6Z 2ZD9A 3SYPA 3RW0A 5JQGB 4YY3O 1GAXA 3UM7A 4U7OA 2QR4A 1VQLV 5FPRA 4LFBB 1N33O 4ZHQB 4MVUA 4BR6A 5GTIZ 2CH7A 4JGSA 5IJ0A 4B3RO 5FL7G 5JCOC 3BCCH 5GONB 4L87A 5JH7B 5KUKA 2DWEC 4YHHB 4NXMB 4H37A 2WLIB 4GX2A 2DOSA 1PL4A 1JFFA 1JMKC 4JI3B 1CP9A 1LUVA 5LBQA 2UXDO 1BMFG 2VWJA 2P5OA 1H2KA 2ZR2A 5BZBA 1WB8A 3BPZA 3K5MA 3L9DA 5KAFZ 1KU9A 3UO2A 2JDIG 3LDDA 4J42A 4JI4B 3BFRA 4BIZA 4JAAA 5CB4A 3JARB 4O4JA 4PA9A 5KHIA 4JYCA 2CTRA 3DXRB 5CA1B 1JOYA 3ASNC 3AG3C 1BT8A 4DR5B 4R7CA 1IVSA 1WAZA 4FLTA 5LA6B 4NKGB 2IJHA 2ZE8A 1QR8A 2CE4A 4FLWA 1KKDA 4OX9B 4N21A 4JI7B 1NZ6A 3CX5F 4K0KB 3D3QA 5KAIZ 1ROPA 4K3AA 2LW7A 4WCEV 3AG1C 5KHHA 2QDOA 1S5LZ 3N2GA 3LNMB 4B3MO 1TUEB 1ZL8B 5H2FZ 1GKFA 5EZYB 4O2BA 2QGNA 1KUQA 2Q67A 1AR5A 4X1KB 4LP8A 2F4VO 5KX5B 3ZMUA 2JEXA 4FM1A 4EB6B 3JAWA 2QM8A 2ZKOA 4JI6B 3T1YB 5LYJA 4CS2A 3CMAV 2LW1A 4IIJA 1K73W 1FFTB 3OW2U 1N0JA 3AEIA 4ZI7B 1XMOO 3JD4A 4TV9B 1BGYH 1M90W 1KYOF 3CRRA 3VQVA 4UVAA 2P06A 4J9ZB 3NXSA 3Q4HB 2V7QG 5EBWC 4TWKA 5IE9A 3AG4B 4MVZA 3BY6A 3CSXA 1SA0B 5C8YB 1R3LC 3KG2A 3K3WA 2RNBA 1M9NA 2DE0X 1FD9A 3FFQA 1OHHG 1M93A 4X1IB 3JD1A 4X64O 4AQYO 2JK5C 3D36C 2P7TC 1M57C 1GM7A 4O4LB 5BR8O 4FLYA 5IJ9A 3HKDA 3SJCC 4I4TA 2A3QA 2QWOB 1BHAA 4JZ2A 1OZ0A 4IHJA 4LFAB 1F4MA 1YVWA 2IJJA 1V55C 4NTYA 4DR4B 3U0ZA 1BL8A 4UCSA 5IYZA 4DK1A 2JGDB 2ZT9B 2D3OW 1Q5OA 5IYCO 3JD0A 2WLHA 4DUYB 2ATKC 5FNVA 3ABKC 1SETA 3RYFA 4YHHO 4NXMO 4EFBA 1JPXA 3G80A 1BQZA 4GYCB 4UVBA 1TGOA 1YTFB 4O4HA 4NVPA 4FLXA 1FXKA 4BIUA 3BA9A 3JATB 4K35A 2X0LA 3ZHVA 1SQBH 2LFSA 1GN6A 3CJHA 5AG2A 4X88A 1A32A 3AG7A 4GX0A 4JI4O 4XDJA 1D2DA 4GCZA 2CK3G 4B3TO 2FL4A 3L75H 2F66C 2V1DA 4WFAV 3ML0A 2P4VA 3RN4A 1H38A 2A79B 3H1HH 2WPDG 4BAYA 1R3JC 4DR5O 1XUQA 3T4DA 1B6QA 4FIPC 4FM2A 3L72H 3DGEA 4XDKA 1R6NA 4R8CA 1KECA 4JYYA 4UCRA 4LR3A 4OX9O 4JI7O 2FYUH 1QHTA 1AI6A 4K0KO 2CAZC 2AXTZ 1XL4A 3M99B 2F23A 3X2QB 3ZX6A 1H2GA 2LP7A 3ZMZA 1Q6HA 2Q5ZA 1G4YB 5BMVB 3OEEG 2XASA 4DV0B 4PI0A 2KG7A 1WN7A 4F6RA 3ZCCA 2YEVA 1FJGB 2BTQB 3IAYA 3WB2A 3L73H 4MVSA 3JASA 3G6EV 2OTJV 1FFXA 5L3BA 1F7YA 4KL1A 1E1QG 4JI6O 2QTOA 1VP7A 2N74A 1OJHA 2GHYA 4LF6B 5K1XA 4QE7A 2R9RB 2YIAA 2DQ0A 2EILC 4EEQA 1S72V 1V55B 2ZE5A 2HP8A 1P49A 4DK0A 5LMNB 3HKCA 3WB0A 3SR2C 3SPHA 3ZHQA 2AW9A 3U10A 4L8JA 3ABKB 1YCIA 2QM7A 1AVMA 1AI5A 5EYPA 3K04A 4F4LA 2WLKA 1SC5B 4NXNB 1FPOA 2FB5A 4TT3G 2H8PC 4LCUC 4UFZA 2CTWA 5J2UB 3WU2Z 3UT5B 3MHSC 1AJNA 3CCUV 3HPLC 2JJ2G 3W7TA 2VQEB 1SQFA 1L1FA 1L0NH 3CE2A 5CMUA 2WAMA 3RYCA 2L6LA 5IYDO 3UO3A 4GKJB 3B8NA 5KHGA 4JF3A 5TISZ 3M7MX 2UUBB 3O65A 5IWAB 3I55V 4JI0B 1MSWD 1F23A 2OCCC 2OCHA 4LF8B 4HAMA 3DC6A 4I50B 3CCQV 5J9PC 4FFBA 4KHPO 2Q73A 2CH7B 5EIBC 4WBNA 2OIEA 1RSOB 2E76B 5IJ0B 1AP5A 1JA8A 4MTOA 4ZOLB 4WFHA 4RUFA 2Q7EA 1PKXA 3QO8A 3N2KB 3KZIZ 5CA3A 3LSSA 1I08A 1WB7A 1GM8A 3OTOO 2PUSA 3QO5A 2ITCC 1ZWIC 3ZIAG 5LXTA 1BSMA 2DYSB 2EJ7A 2P6JA 2WA4A 1EN5A 1GH6A 2H3OA 2EILB 4O4JB 4W4KA 1F4NA 2ZDIA 1LUWA 4DRXB 5CA0A 2M7WA 3QVNA 3VQXA 3CS5A 4XDLA 4U7NA 3RBZA 3KCYA 4FFKA 2E5LB 3AK1A 4MW3A 3RT3C 2UXCO 4O4IA 2Y4UA 3ZMTA 2HLDG 1WA8A 1HW7A 3ZJZA 3G71V 2EINB 4X62B 2R70A 3HKEA 5HFMA 2QSAA 5B1NA 2EJRA 2Q8VA 1EZJA 3LDCA 4DV0O 2LJ2A 2GV9A 4JPRA 3JD3A 4FMTA 4X66B 1XMQB 1VQPV 2CUGA 2UU9B 3E35A 5EC2C 2VS0A 4OPAA 4O2BB 4P2ZA 1H2SB 4TOIA 3WB1A 1VARA 1IURA 3K0GA 3J80N 1VIBA 1SQVH 4LC1A 1R3KC 3MHHC 2W6IG 2WLNA 2BSKA 1HR0B 4GKKB 3SPCA 5LMNO 2EULA 4LWSA 3ZN1A 4FM0A 3E83A 4ZBMA 1H2MA 1NU1H 4AI8A 2UXBB 1YHQV 3SYCA 1XQ8A 3HKBB 4I55A 4GX1A 1SQGA 2GSMB 5H6RA 4C7UA 4LF9O 2KQXA 3H1KH 2F95B 3K9AA 2YIBA 2AHYA 2GUZA 4TSFG 4NXNO 4LNUB 2HVKC 1Y4MA 3EFFK 2B9ZA 1AR1B 2ZCEA 5B1AB 1R3IC 3MAQA 2B1GA 2VQEO 4H0LB 4ASUG 3TJTA 5L3FA 2ADPA 2HFEC 1LNQA 4IYIA 5DN6G 3ZBHA 2FTKA 2AZ2A 2GTAA 3ZHSA 4GKJO 1L8DA 1XBLA 1Z5WA 1W2BU 5IJ9B 2UUBO 1S5HC 3L71H 5IWAO 4A5UB 4I4TB 1GO3F 4IHJB 1VQ4V 4LF8O 4BW9A 3H1LH 2E74B 1MNGA 3B8MA 3DTUB 3FYEB 2JIZG 2UUCO 1NR7A 4YJ3A 5ITZA 2EIMC 1Y76A 4X1YA 3AK2A 3OT7A 3AG4C 1BQ0A 1K33A 3B09A 2YSUB 1IBKB 1N8RW 4O4HB 2GDSA 4MVMA 1MSDA 3CC4V 1XNRB 5B3SB 4IGGA 4Z1VA 1SF9A 2QE7G 1E1RG 4O2AB 5IT9N 3ZS8C 5J2TA 2P90A 3CJHB 3OE7G 3O9OA 1PP9H 3K58A 2Q9LA 2HHHB 1MABG 1DLBA 4PA7A 1G1XB 3QF7A 5JWPA 2BOCC 2IJKA 3PJSK 3OEHG 5B5EZ 2PYLA 1KP3A 1XNQB 3CRQA 3L70H 4DV2O 1ZUQA 2CGNA 4X62O 4YJ2A 2PF4E 2ZQMA 2K9PA 1YJNV 1D5NA 5JJEB 1H2LA 3CP1A 4X66O 1XMQO 3ZRSA 1R1BA 4RAIA 2ETNA 1COWG 2UU9O 1TUBA 4I0XA 3BHPA 3SPGA 1Y74A 3CB2A 1Y67A 3FKSG 3QNEA 2ILMA 1GMGA 4JV5B 1VQKV 2DYRB 1SERA 1M4UA 3W7UA 3TXSA 3E8FA 5LMUB 5B66Z 5C93A 1ORQC 4KFMA 1G6UA 4JAUA 2E3CA 2LO1A 3N27A 4GKKO 3K5LA 3FB5C 3RYIA 3JAKA 1PNKA 1JCHA 1YXBA 4MT8A 3K5OA 3KCXA 1JVMA 2D2CB 2UXBO 2AHZA 4TUYA 1QR9A 3A0HZ 4PHZA 2ZM6B 3E8BA 4MVQA 2EIMB 2WLJA 2CDYA 1PD3A 2Q6AA 4I9WA 2OTLV 1K97A 3RVZA 4X65B 1N36O 3CHXA 2ZE7A 3X2QC 3DC5A 2W0XA 2OT5A 5FLXN 3SGIA 2LFRA 3BVOA 3L74H 3OMAB 3FAVA 1XHXA 1YITV 2Y69C 4DUZO 1XOUA 1SZTA 4GX5A 2Q7HA 1WLEA 2WLLB 2BOBC 2Z0AA 2YXHA 5JVDA 3KKYA 4J10A 2X6BA 3ZRWB 5CBGA 2B1IA 3SJAC 1IBMB 3OMNB 2PTMA 4U3JA 3E8GA 4LFBO 1GK9A 1KMIZ 5L3CA 3B4SA 3CMEV 1FS0G 3AK3A 1TVKA 4DR2B 3K79A 1M56C 1NR1A 3D8CA 1AP6A 3RGBA 4ZKIA 2NLJC 2ZE6A 3G6BA 2Y0IA 3A8TA 3TK1A 2NR5A 5JQGA 4FFBB 1OCRC 1IBKO 4TV8A 2YIBD 1N4CA 3H01A 3OD4A 1K8AW 4GZRB 4UUJC 1K92A 1ZTEA 2ODMA 4ZHQA 5EK0A 4MTFA 4LH7A 1GN2A 4YIPA 2AZ0A 3CCLV 1UJWB 4JI3O 5L3DA 1QVGU 4P9OA 4IYHA 1P7GA 3JSLA 1Q6IA 2A9HA 1YJ9V 3OR7C 1R6TA 5GONA 3J81N 5JH7A 4B3SB 4JTCB 2HHHO 2WLIA 4JZGA 3VOUA 2Y48A 1HNWB 3OGCC 4UCOA 1I5XA 3ABLC 1Q8IA 4YXWG 1N0NA 1DF5A 3FB8C 3SJQC 4LF4B 2A06H 3CXHF 1US6A 4X9QA 1XNQO 2QWPB 2JS5A 1N32B 1EM1A 2N05A 2QKSA 1K4CC 3OTFA 4DYLA 1Z5VA 4P30A 1I94B 4RO2A 1G8MA 3LDEA 5D5QA 3DXRA 4W4LA 5A9GA 5CA1A 4X20B 4D7SA 2Y4TA 4WF9V 4Q20A 1J5EB 3HB3B 4WFEA 2Y69B 3T1HB 4K8XA 3M8AA 5LA6A 2R9AA 3K03A 3JSNA 3ASOB 1KC8W 1P7BA 3BEHA 4JV5O 5KHJA 1LR1A 5BY1A 1ZX3A 2LGWA 3IC9A 5HFLA 1K5QA 3K06A 4LFCB 3VQYA 4PDVA 3T1YO 1ZL8A 5LP6A 3RVYA 2DYSC 1YEWA 4JYAB 5EZYA 4RQEA 3STZC 2DN9A 1YJWV 1AI4A 4X1KA 2ZM6O 4JI1B 4DR6B 1M56B 5LHIA 1N34B 5KX5A 1VQOV 2F93B 2YDEA 3GVMA 1XILA 4EB6A 1BCCH 4FJCC 1NTZH 1OCRB 4MVRA 2EINC 2ZINA 2OWOA 1YSCA 2Z3YA 4GLXA 2RCVA 4ZI7A 3F7VC 5LGNA 4PV1B 1I5YA 1AROP 4DV3B 2RMKB 5CBFA 3ZMSA 5JCOA 2YXYA 1NH2D 4CH3A 4JI5B 1SA0A 4DV7B 5C8YA 3OM3B 2AGAA 3RYHB 2XNDG 2Q69A 4FZ1A 4MSWC 3ABLB 2YXLA 2OIGA 3R65A 4LFAO 3G4SV 3BABA 4WFFA 4DR1B 4DW1A 4D6TH 1NVPD 4DR4O 3SPJA 3SJBC 4DR2O 4FK5C 2UXXA 1XI1A 3JALA 3W7XA 4Z2WA 4O4LA 1H8HG 5IYBO 1DK1A 5K1PA 4DUYO 5ITZB 4CC6A 2JGUA 5GW7A 1U96A 2DQ3A 2ARHA 3T4ZA 3OAAG 1MMMA 3CCSV 5LGTA 1FXVA 4AHCA 4YY3B 1V9PA 2HR3A 3D3IA 1AJPA 1DF4A 2JGDA 1N33B 1MG1A 5KLVH 4LF7B 1JFFB 5DECA 2RDCA 1AB3A 5B1AC 1FAFA 4B3SO 2XAGA 3S3WA 3C3SA 3ZHRA 3QO7A 2Q4PA 4B08A 1S77D 4B3RB 3P32A 2YIDA 1TA8A 1W0JG 1HNWO 3JAMN 3I5DA 4DR7B 1EFRG 1PV0A 3JATA 2YI9A 5CB4B 4PJ0Z 1VF7A 4X8AA 4LF4O 1QCEA 3ETQA 1N32O 2GBOA 3C90A 5KMGA 4JI2B 1I94O 1NKDA 1H8EG 4UVCA 2UXDB 4EKWA 1YF2A 3VBBA 3OGIB 4H33A 2BE3A 1YDXA 3FX7A 3WFVA 1YZBA 4LBEC 1J5EO 2QJ1A 3STLC 5L3GA 4PDMA 1TUBB 1FJGO 3N2GB 4OPHA 4G28B 2F1MA 3CRMA 1FXKC 1Y74B 3GWOA 5B3SC 4JASA 2VRZA 4QE9A 5BMVA 3OUSA 4BWAA 4LFCO 3CPWU 2QM4A 3EXAA 2IW5A 4J7ZA 3C3TA 4LF6O 4JYBA 2FMLA 2XAHA 1FYJA 3AG2B 4QJFB 4UXNA 5A2QN 2BTQA 3JAWB 4NR1A 4JI1O 4JI8B 2HVJC 2IM9A 1IBLB 4DR6O 1TAEA 4FZ0A 5LYJB 4KP4A 2CTPA 1N34O 3RFRA 4IIJB 3D36A 4JAVA 4I5SA 1PPJH 5KA5A 1T5EA 3ICXA 4KXRA 1KP2A 2QA4V 3S3XA 2F4VB 1DTOA 1PL0A 3IC7A 3CRAA 1XREA 2PI5A 1VEWA 3K08A 1ZSPA 1GRJA 3H1IH 3UKMA 2E75B 1BZKA 2PY5A 2Z5UA 2V4DA 1MOFA 2G38A 2LGQA 1XEQA 5IY5B 4DV7O 1Y66A 3APOA 3FYIB 1PNMA 2DYRC 4YIOA 4ICGA 1Q90D 1WJZA 1QNMA 1THZA 4MVOA 1NBMG 5GTHZ 1UFIA 1X4TA 3GB7C 4DR1O 3CRCA 1XDCA 3CXCU 3UT5A 5KUMA 3HKDB 5EBMC 4JI0O 2QWNB 3A2FA 1I7FA 3ZEDA 1IZ3A 2Q0OC 4R50A 2YI8A 1VF6C 1VQNV 2PGGA 3CC2V 5IYZB 3P3PA 3LSUA 3A0BZ 1OCCB 2XHBA 2X6CA 2JVDA 1EBOA 4TV8B 5FNVB 3RYFB 2X6AA 3DSQA 4I50A 2M6YA 3JCUZ 1NJIW 4LF7O 3F5WC 1FXKB 1MZEA 4D7TA 1GM9A 1M5IA 1QVFU 4AILC 1RSOA 3R66A 1OCOC 1VQ7V 1VQ9V 5JJJB 2C2AA 4DR7O 1KBHA 3ABMC 4ZOLA 3FB7C 2HJFC 3OFNG 4JTDB 3N2KA 1ZLZA 1RM1C 2PYJA 2EZPA 2IH1C 2IH3C 2Q68A 2QWQB 4JI2O 5FPOA 1W59A 1WP7A 2E5LO 1OV9A 3F7YC 4PA4A 3WG7C 5E79Z 5LOVA 1RPOA 1PM9A 3K9SA 5LHGA 1WP8A 4B3TB 2WA3A 4DRXA 3EVKA 4J41A 3H9VA 3TETA 1RPRA 1MZFA 1E79G 2QKCA 3NR7A 2KG7B 3CWBH 2JJ1G 1RFYA 1V54C 1Q43A 1QLNA 1NQTA 4X89A 4J9YB 4F6RB 2EIKC 2QWRB 2YEVB 5DM6V 3JASB 4PI2A 1YTFD 1BS3A 1FFXB 2ITDC 4PELA 3K0DA 1JR9A 1HR0O 2B5UA 4JI8O 5LP6B 1IBLO 1K5SA 5CBHA 1NS1A 5H5NA 2RJZA 4ABMA 5IDJA 4J11A 2ZDIC 3T1CA 1VQMV 4J7JA 1QLEC 3HKCB 3B77A 2PI4A 5B1BC 4NTWA 4TQDA 2VWKA 2DWDC 4FPPA 2EBOA 5H9CA 2HJDA 2XOKG 3VQWA 2RQ6A 3HR0A 3QTCA 4XBFA 2HEPA 2DW4A 3HKBA 2KKWA 4DV1B 5EYPB 3G67A 2UXNA 3P3NA 2Q7GA 2EIJC 4DR3B 3ZMVA 1HNZB 3IJ4A 2NNUA 4IT5A 4PD4F 3ASOC 1OCOB 4PDRA 4FLZA 4LNUA 1K7DA 3ABMB 5EBLC 3CCRV 2P67A 2KB1A 4LF5B 4H13B 5CN0A 4ZIBA 1RM1B 1SS3A 1ZAUA 3RYCB 4UV9A 1VQ6V 3SPIA 2ZR3A 3E22A 2FKXA 1AJQA 3RWRD 4J80A 2VQFB 4CZZA 3WG7B 4HNAA 3CD6V 1SRYA 3JALB 4UB6Z 5F2VO 1HNXB 1AR4A 1Q3EA 1NT2B 3A0RA 4RUEA 2XT9A 4WBNB 1IDSA 3ASNB 3AG3B 2XUMA 2MW2B 1QQCA 1X59A 4BIOA 3B40A 2IBZH 3IGAC 4E4EA 1Y6XA 1XNRO 4EFEA 1V54B 3FB6C 2R9IA 4CS3A 2EIKB 4GUNA 1VF5B 4KHPB 4HYOA 1SQPH 1S3JA 1HP8A 3AG1B 4GT1A 2L35A 4DV6B 5LXTB 5JJNB 2O57A 2IU0A 1CPYA 3CCVV 1CXZB 4CC5A 5LGUA 2JRIA 4O2AA 3THOA 2ZXWC 5CA0B 1QLEB 3EHBB 5EC1C 2CTQA 5B1BB 3OTOB 5KMGB 4FLUA 4DXWA 3UQ8A 3JARA 2LQTA 4O4IB 1P4RA 1WA8B 2YICA 3HKEB 4I7ZB 1AILA 4QPKA 4HZ3A 4F6EA 3F5TA 2BCCH 3TXQA 4QPJA 3ABUA 2EIJB 4FLVA 4H44B 1EN6A 2UXCB 1OCZC 1GN3A 4MW8A 4WFGA 2NN4A 2GTSA 2N04A 1XL6A 5LMUO 3CC7V 2H94A 5LHHA 1NTMH 1Q7YW 3U11A 4MTXA 4NYKA 4Z1MG 4TQFA 4Q6GA 4B7KA 1KB9F 2JEUA 2BSKB 4CBCA 1WNSA 4PA3A 2W6JG 3ETEA 3OR6C 1K4DC 2XTAA 1U97A 4MS2A 1Q6UA 2EX3A 4LWSB 1HWYA 2BTOA 1M57B 3BA8A 3OUFA 3BRCA 4I55B 1JJOA 1HDJA 4DO2A 4X65O 3CCEV 1KQSU 4UB8Z 1VF6A 4UCUA 4RQFA 4DV1O 4TV9A 4QNHB 1IXBA 5BXZA 1NI8A 2GUZB 3Q4HA 4DR3O 1K9MW 1M1KW 1HNZO 1F51A 2WLMA 4CH4A 4I9QA 1SZXA 3GWKC 1MA1A 4LF9B 2W0FC 1SESA 2XAFA 2UUAB 2XAJA 1EZVH 1EN4A 2K1EA 4LF5O 3MD0A 2ZIOA 4KUMA 1Q81W 2IU3A 3TGUH 1IBMO 2A7WA 2ZIMA 2X7RB 2P4KA 4X1IA 3AG2C 3PN1A 3ZN0A 2WLLA 2VQFO
chains in the Genus database with same CATH topology
1SQXH 4PD4F 1BCCH 2IBZH 3H1LH 1NTZH 3CX5F 3H1KH 3H1HH 1NTMH 1SQVH 5KLVH 2A06H 3CXHF 1SQBH 1NTKH 1L0NH 1EZVH 3L72H 1L0LH 1BE3H 2BCCH 1SQQH 3CWBH 3L70H 1SQPH 1KB9F 3H1IH 3L74H 4U3FH 3TGUH 1PP9H 3BCCH 1PPJH 2FYUH 3H1JH 1BGYH 3L73H 1KYOF 1NU1H 3L71H 4D6TH 3L75H 1P84F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX H;  4PD4 F;  1BCC H;  2IBZ H;  3H1L H;  1NTZ H;  3CX5 F;  3H1K H;  3H1H H;  1NTM H;  1SQV H;  5KLV H;  2A06 H;  3CXH F;  1SQB H;  1NTK H;  1L0N H;  1EZV H;  3L72 H;  1L0L H;  1BE3 H;  2BCC H;  1SQQ H;  3CWB H;  3L70 H;  1SQP H;  1KB9 F;  3H1I H;  3L74 H;  4U3F H;  3TGU H;  1PP9 H;  3BCC H;  1PPJ H;  2FYU H;  3H1J H;  1BGY H;  3L73 H;  1KYO F;  1NU1 H;  3L71 H;  4D6T H;  3L75 H;  1P84 F; 
#chains in the Genus database with same CATH topology
 2ZXW B;  4DV5 B;  2YS8 A;  3W7S A;  1KD1 W;  4CS4 A;  1HNX O;  1VMG A;  3JD2 A;  3ZRW A;  1Z2G A;  2CGO A;  1J95 A;  1ENV A;  2ZNJ A;  1JX9 A;  4YJ3 B;  4N23 A;  4DV4 B;  4K8Z A;  1Y76 B;  3CCM V;  1CEZ A;  1IXM A;  5E1A C;  3UCS C;  3ZRX A;  4X1Y B;  3BAA A;  4R6Z A;  4B7E A;  4NTX A;  4CH6 A;  2OYQ A;  3ABT A;  1URF A;  1FKA O;  2ADQ B;  2WSS G;  3FD9 A;  5EIB D;  1OCZ B;  1H2N A;  1B3Q A;  1DGS A;  2UUC B;  1KKC A;  3K57 A;  2QEX V;  3LNN A;  1W0K G;  5IY5 C;  4G2K A;  3TCU A;  3E2E A;  2IJI A;  3T2M A;  1K34 A;  5J2T B;  4DV6 O;  4OXS A;  5D5P A;  2DMX A;  4HBN A;  4E2L A;  1XHZ A;  1VQ5 V;  2Y0P A;  1BE3 H;  3K59 A;  4UCV A;  1S5J A;  2RN9 A;  4G27 B;  4LH6 A;  5H6Q A;  1K3E A;  1R6K A;  3J7A U;  4DW0 A;  1SKV A;  1JJ2 U;  5LOV B;  4NB5 A;  1QU7 A;  3ETG A;  4YJ2 B;  4PDL A;  2WWW A;  3I56 V;  3OMI B;  3IFX A;  1OCC C;  1R73 A;  4MTG A;  3T1H O;  2P22 C;  2Q0A A;  5LL6 Y;  3CYO A;  4I0X B;  2DJV A;  1VQ8 V;  1SQQ H;  2YC0 A;  4CH5 A;  1WPX A;  4JTA B;  4DV2 B;  1JQ0 A;  3H1J H;  4X20 A;  2F43 G;  4QIW F;  1B06 A;  1NH2 B;  2JS3 A;  1Q86 W;  2XAQ A;  1QBZ A;  5DED A;  3SYA A;  4JYA O;  3SYO A;  1IX9 A;  1GTO A;  3LUT B;  3SYQ A;  2R72 A;  4B3M B;  2QTS A;  1Q82 W;  3RYI B;  3JAK B;  3P30 A;  3ZHT A;  3K5N A;  3E86 A;  1NVP B;  1UPG A;  1YI2 V;  2QKA A;  1WPB A;  4TUY B;  1I0H A;  1FXH A;  5KA6 A;  5L3E A;  4PA6 A;  3ZRV A;  2MK3 A;  4UCT A;  2YUA A;  3ETD A;  4FVM A;  2OCC B;  4U3F H;  2A0L A;  4DV3 O;  1XMO B;  4J7K A;  3FAV B;  3LSQ A;  1P84 F;  5KHK A;  2HKO A;  4JI5 O;  2UUA O;  2HG5 C;  5B1O A;  4RWU A;  3MDS A;  1L0L H;  4BW5 A;  1YIJ V;  1D5A A;  1N36 B;  5JVD B;  3E8H A;  1O9H A;  2KSD A;  5J2U A;  1S76 D;  1RP3 B;  3JCZ A;  1PNL A;  3W7W A;  2PZS A;  5LP6 C;  4QGP A;  4DUZ B;  4DV5 O;  1S0V A;  1BHB A;  3JYC A;  1AI7 A;  1SQX H;  3CCJ V;  3E89 A;  3E22 B;  4P9P A;  4U3J B;  3RYH A;  3ZHU A;  2ZNI A;  1O9G A;  1GN4 A;  4WFB V;  1B04 A;  2EZO A;  3B2E E;  1TVK B;  1NTK H;  4HNA B;  4UV8 A;  3QG5 A;  3SDL A;  4X64 B;  4DV4 O;  4AQY B;  3CEI A;  4OGQ B;  3APQ A;  5BR8 B;  4IL6 Z;  2ZD9 A;  3SYP A;  3RW0 A;  5JQG B;  4YY3 O;  1GAX A;  3UM7 A;  4U7O A;  2QR4 A;  1VQL V;  5FPR A;  4LFB B;  1N33 O;  4ZHQ B;  4MVU A;  4BR6 A;  5GTI Z;  2CH7 A;  4JGS A;  5IJ0 A;  4B3R O;  5FL7 G;  5JCO C;  3BCC H;  5GON B;  4L87 A;  5JH7 B;  5KUK A;  2DWE C;  4YHH B;  4NXM B;  4H37 A;  2WLI B;  4GX2 A;  2DOS A;  1PL4 A;  1JFF A;  1JMK C;  4JI3 B;  1CP9 A;  1LUV A;  5LBQ A;  2UXD O;  1BMF G;  2VWJ A;  2P5O A;  1H2K A;  2ZR2 A;  5BZB A;  1WB8 A;  3BPZ A;  3K5M A;  3L9D A;  5KAF Z;  1KU9 A;  3UO2 A;  2JDI G;  3LDD A;  4J42 A;  4JI4 B;  3BFR A;  4BIZ A;  4JAA A;  5CB4 A;  3JAR B;  4O4J A;  4PA9 A;  5KHI A;  4JYC A;  2CTR A;  3DXR B;  5CA1 B;  1JOY A;  3ASN C;  3AG3 C;  1BT8 A;  4DR5 B;  4R7C A;  1IVS A;  1WAZ A;  4FLT A;  5LA6 B;  4NKG B;  2IJH A;  2ZE8 A;  1QR8 A;  2CE4 A;  4FLW A;  1KKD A;  4OX9 B;  4N21 A;  4JI7 B;  1NZ6 A;  3CX5 F;  4K0K B;  3D3Q A;  5KAI Z;  1ROP A;  4K3A A;  2LW7 A;  4WCE V;  3AG1 C;  5KHH A;  2QDO A;  1S5L Z;  3N2G A;  3LNM B;  4B3M O;  1TUE B;  1ZL8 B;  5H2F Z;  1GKF A;  5EZY B;  4O2B A;  2QGN A;  1KUQ A;  2Q67 A;  1AR5 A;  4X1K B;  4LP8 A;  2F4V O;  5KX5 B;  3ZMU A;  2JEX A;  4FM1 A;  4EB6 B;  3JAW A;  2QM8 A;  2ZKO A;  4JI6 B;  3T1Y B;  5LYJ A;  4CS2 A;  3CMA V;  2LW1 A;  4IIJ A;  1K73 W;  1FFT B;  3OW2 U;  1N0J A;  3AEI A;  4ZI7 B;  1XMO O;  3JD4 A;  4TV9 B;  1BGY H;  1M90 W;  1KYO F;  3CRR A;  3VQV A;  4UVA A;  2P06 A;  4J9Z B;  3NXS A;  3Q4H B;  2V7Q G;  5EBW C;  4TWK A;  5IE9 A;  3AG4 B;  4MVZ A;  3BY6 A;  3CSX A;  1SA0 B;  5C8Y B;  1R3L C;  3KG2 A;  3K3W A;  2RNB A;  1M9N A;  2DE0 X;  1FD9 A;  3FFQ A;  1OHH G;  1M93 A;  4X1I B;  3JD1 A;  4X64 O;  4AQY O;  2JK5 C;  3D36 C;  2P7T C;  1M57 C;  1GM7 A;  4O4L B;  5BR8 O;  4FLY A;  5IJ9 A;  3HKD A;  3SJC C;  4I4T A;  2A3Q A;  2QWO B;  1BHA A;  4JZ2 A;  1OZ0 A;  4IHJ A;  4LFA B;  1F4M A;  1YVW A;  2IJJ A;  1V55 C;  4NTY A;  4DR4 B;  3U0Z A;  1BL8 A;  4UCS A;  5IYZ A;  4DK1 A;  2JGD B;  2ZT9 B;  2D3O W;  1Q5O A;  5IYC O;  3JD0 A;  2WLH A;  4DUY B;  2ATK C;  5FNV A;  3ABK C;  1SET A;  3RYF A;  4YHH O;  4NXM O;  4EFB A;  1JPX A;  3G80 A;  1BQZ A;  4GYC B;  4UVB A;  1TGO A;  1YTF B;  4O4H A;  4NVP A;  4FLX A;  1FXK A;  4BIU A;  3BA9 A;  3JAT B;  4K35 A;  2X0L A;  3ZHV A;  1SQB H;  2LFS A;  1GN6 A;  3CJH A;  5AG2 A;  4X88 A;  1A32 A;  3AG7 A;  4GX0 A;  4JI4 O;  4XDJ A;  1D2D A;  4GCZ A;  2CK3 G;  4B3T O;  2FL4 A;  3L75 H;  2F66 C;  2V1D A;  4WFA V;  3ML0 A;  2P4V A;  3RN4 A;  1H38 A;  2A79 B;  3H1H H;  2WPD G;  4BAY A;  1R3J C;  4DR5 O;  1XUQ A;  3T4D A;  1B6Q A;  4FIP C;  4FM2 A;  3L72 H;  3DGE A;  4XDK A;  1R6N A;  4R8C A;  1KEC A;  4JYY A;  4UCR A;  4LR3 A;  4OX9 O;  4JI7 O;  2FYU H;  1QHT A;  1AI6 A;  4K0K O;  2CAZ C;  2AXT Z;  1XL4 A;  3M99 B;  2F23 A;  3X2Q B;  3ZX6 A;  1H2G A;  2LP7 A;  3ZMZ A;  1Q6H A;  2Q5Z A;  1G4Y B;  5BMV B;  3OEE G;  2XAS A;  4DV0 B;  4PI0 A;  2KG7 A;  1WN7 A;  4F6R A;  3ZCC A;  2YEV A;  1FJG B;  2BTQ B;  3IAY A;  3WB2 A;  3L73 H;  4MVS A;  3JAS A;  3G6E V;  2OTJ V;  1FFX A;  5L3B A;  1F7Y A;  4KL1 A;  1E1Q G;  4JI6 O;  2QTO A;  1VP7 A;  2N74 A;  1OJH A;  2GHY A;  4LF6 B;  5K1X A;  4QE7 A;  2R9R B;  2YIA A;  2DQ0 A;  2EIL C;  4EEQ A;  1S72 V;  1V55 B;  2ZE5 A;  2HP8 A;  1P49 A;  4DK0 A;  5LMN B;  3HKC A;  3WB0 A;  3SR2 C;  3SPH A;  3ZHQ A;  2AW9 A;  3U10 A;  4L8J A;  3ABK B;  1YCI A;  2QM7 A;  1AVM A;  1AI5 A;  5EYP A;  3K04 A;  4F4L A;  2WLK A;  1SC5 B;  4NXN B;  1FPO A;  2FB5 A;  4TT3 G;  2H8P C;  4LCU C;  4UFZ A;  2CTW A;  5J2U B;  3WU2 Z;  3UT5 B;  3MHS C;  1AJN A;  3CCU V;  3HPL C;  2JJ2 G;  3W7T A;  2VQE B;  1SQF A;  1L1F A;  1L0N H;  3CE2 A;  5CMU A;  2WAM A;  3RYC A;  2L6L A;  5IYD O;  3UO3 A;  4GKJ B;  3B8N A;  5KHG A;  4JF3 A;  5TIS Z;  3M7M X;  2UUB B;  3O65 A;  5IWA B;  3I55 V;  4JI0 B;  1MSW D;  1F23 A;  2OCC C;  2OCH A;  4LF8 B;  4HAM A;  3DC6 A;  4I50 B;  3CCQ V;  5J9P C;  4FFB A;  4KHP O;  2Q73 A;  2CH7 B;  5EIB C;  4WBN A;  2OIE A;  1RSO B;  2E76 B;  5IJ0 B;  1AP5 A;  1JA8 A;  4MTO A;  4ZOL B;  4WFH A;  4RUF A;  2Q7E A;  1PKX A;  3QO8 A;  3N2K B;  3KZI Z;  5CA3 A;  3LSS A;  1I08 A;  1WB7 A;  1GM8 A;  3OTO O;  2PUS A;  3QO5 A;  2ITC C;  1ZWI C;  3ZIA G;  5LXT A;  1BSM A;  2DYS B;  2EJ7 A;  2P6J A;  2WA4 A;  1EN5 A;  1GH6 A;  2H3O A;  2EIL B;  4O4J B;  4W4K A;  1F4N A;  2ZDI A;  1LUW A;  4DRX B;  5CA0 A;  2M7W A;  3QVN A;  3VQX A;  3CS5 A;  4XDL A;  4U7N A;  3RBZ A;  3KCY A;  4FFK A;  2E5L B;  3AK1 A;  4MW3 A;  3RT3 C;  2UXC O;  4O4I A;  2Y4U A;  3ZMT A;  2HLD G;  1WA8 A;  1HW7 A;  3ZJZ A;  3G71 V;  2EIN B;  4X62 B;  2R70 A;  3HKE A;  5HFM A;  2QSA A;  5B1N A;  2EJR A;  2Q8V A;  1EZJ A;  3LDC A;  4DV0 O;  2LJ2 A;  2GV9 A;  4JPR A;  3JD3 A;  4FMT A;  4X66 B;  1XMQ B;  1VQP V;  2CUG A;  2UU9 B;  3E35 A;  5EC2 C;  2VS0 A;  4OPA A;  4O2B B;  4P2Z A;  1H2S B;  4TOI A;  3WB1 A;  1VAR A;  1IUR A;  3K0G A;  3J80 N;  1VIB A;  1SQV H;  4LC1 A;  1R3K C;  3MHH C;  2W6I G;  2WLN A;  2BSK A;  1HR0 B;  4GKK B;  3SPC A;  5LMN O;  2EUL A;  4LWS A;  3ZN1 A;  4FM0 A;  3E83 A;  4ZBM A;  1H2M A;  1NU1 H;  4AI8 A;  2UXB B;  1YHQ V;  3SYC A;  1XQ8 A;  3HKB B;  4I55 A;  4GX1 A;  1SQG A;  2GSM B;  5H6R A;  4C7U A;  4LF9 O;  2KQX A;  3H1K H;  2F95 B;  3K9A A;  2YIB A;  2AHY A;  2GUZ A;  4TSF G;  4NXN O;  4LNU B;  2HVK C;  1Y4M A;  3EFF K;  2B9Z A;  1AR1 B;  2ZCE A;  5B1A B;  1R3I C;  3MAQ A;  2B1G A;  2VQE O;  4H0L B;  4ASU G;  3TJT A;  5L3F A;  2ADP A;  2HFE C;  1LNQ A;  4IYI A;  5DN6 G;  3ZBH A;  2FTK A;  2AZ2 A;  2GTA A;  3ZHS A;  4GKJ O;  1L8D A;  1XBL A;  1Z5W A;  1W2B U;  5IJ9 B;  2UUB O;  1S5H C;  3L71 H;  5IWA O;  4A5U B;  4I4T B;  1GO3 F;  4IHJ B;  1VQ4 V;  4LF8 O;  4BW9 A;  3H1L H;  2E74 B;  1MNG A;  3B8M A;  3DTU B;  3FYE B;  2JIZ G;  2UUC O;  1NR7 A;  4YJ3 A;  5ITZ A;  2EIM C;  1Y76 A;  4X1Y A;  3AK2 A;  3OT7 A;  3AG4 C;  1BQ0 A;  1K33 A;  3B09 A;  2YSU B;  1IBK B;  1N8R W;  4O4H B;  2GDS A;  4MVM A;  1MSD A;  3CC4 V;  1XNR B;  5B3S B;  4IGG A;  4Z1V A;  1SF9 A;  2QE7 G;  1E1R G;  4O2A B;  5IT9 N;  3ZS8 C;  5J2T A;  2P90 A;  3CJH B;  3OE7 G;  3O9O A;  1PP9 H;  3K58 A;  2Q9L A;  2HHH B;  1MAB G;  1DLB A;  4PA7 A;  1G1X B;  3QF7 A;  5JWP A;  2BOC C;  2IJK A;  3PJS K;  3OEH G;  5B5E Z;  2PYL A;  1KP3 A;  1XNQ B;  3CRQ A;  3L70 H;  4DV2 O;  1ZUQ A;  2CGN A;  4X62 O;  4YJ2 A;  2PF4 E;  2ZQM A;  2K9P A;  1YJN V;  1D5N A;  5JJE B;  1H2L A;  3CP1 A;  4X66 O;  1XMQ O;  3ZRS A;  1R1B A;  4RAI A;  2ETN A;  1COW G;  2UU9 O;  1TUB A;  4I0X A;  3BHP A;  3SPG A;  1Y74 A;  3CB2 A;  1Y67 A;  3FKS G;  3QNE A;  2ILM A;  1GMG A;  4JV5 B;  1VQK V;  2DYR B;  1SER A;  1M4U A;  3W7U A;  3TXS A;  3E8F A;  5LMU B;  5B66 Z;  5C93 A;  1ORQ C;  4KFM A;  1G6U A;  4JAU A;  2E3C A;  2LO1 A;  3N27 A;  4GKK O;  3K5L A;  3FB5 C;  3RYI A;  3JAK A;  1PNK A;  1JCH A;  1YXB A;  4MT8 A;  3K5O A;  3KCX A;  1JVM A;  2D2C B;  2UXB O;  2AHZ A;  4TUY A;  1QR9 A;  3A0H Z;  4PHZ A;  2ZM6 B;  3E8B A;  4MVQ A;  2EIM B;  2WLJ A;  2CDY A;  1PD3 A;  2Q6A A;  4I9W A;  2OTL V;  1K97 A;  3RVZ A;  4X65 B;  1N36 O;  3CHX A;  2ZE7 A;  3X2Q C;  3DC5 A;  2W0X A;  2OT5 A;  5FLX N;  3SGI A;  2LFR A;  3BVO A;  3L74 H;  3OMA B;  3FAV A;  1XHX A;  1YIT V;  2Y69 C;  4DUZ O;  1XOU A;  1SZT A;  4GX5 A;  2Q7H A;  1WLE A;  2WLL B;  2BOB C;  2Z0A A;  2YXH A;  5JVD A;  3KKY A;  4J10 A;  2X6B A;  3ZRW B;  5CBG A;  2B1I A;  3SJA C;  1IBM B;  3OMN B;  2PTM A;  4U3J A;  3E8G A;  4LFB O;  1GK9 A;  1KMI Z;  5L3C A;  3B4S A;  3CME V;  1FS0 G;  3AK3 A;  1TVK A;  4DR2 B;  3K79 A;  1M56 C;  1NR1 A;  3D8C A;  1AP6 A;  3RGB A;  4ZKI A;  2NLJ C;  2ZE6 A;  3G6B A;  2Y0I A;  3A8T A;  3TK1 A;  2NR5 A;  5JQG A;  4FFB B;  1OCR C;  1IBK O;  4TV8 A;  2YIB D;  1N4C A;  3H01 A;  3OD4 A;  1K8A W;  4GZR B;  4UUJ C;  1K92 A;  1ZTE A;  2ODM A;  4ZHQ A;  5EK0 A;  4MTF A;  4LH7 A;  1GN2 A;  4YIP A;  2AZ0 A;  3CCL V;  1UJW B;  4JI3 O;  5L3D A;  1QVG U;  4P9O A;  4IYH A;  1P7G A;  3JSL A;  1Q6I A;  2A9H A;  1YJ9 V;  3OR7 C;  1R6T A;  5GON A;  3J81 N;  5JH7 A;  4B3S B;  4JTC B;  2HHH O;  2WLI A;  4JZG A;  3VOU A;  2Y48 A;  1HNW B;  3OGC C;  4UCO A;  1I5X A;  3ABL C;  1Q8I A;  4YXW G;  1N0N A;  1DF5 A;  3FB8 C;  3SJQ C;  4LF4 B;  2A06 H;  3CXH F;  1US6 A;  4X9Q A;  1XNQ O;  2QWP B;  2JS5 A;  1N32 B;  1EM1 A;  2N05 A;  2QKS A;  1K4C C;  3OTF A;  4DYL A;  1Z5V A;  4P30 A;  1I94 B;  4RO2 A;  1G8M A;  3LDE A;  5D5Q A;  3DXR A;  4W4L A;  5A9G A;  5CA1 A;  4X20 B;  4D7S A;  2Y4T A;  4WF9 V;  4Q20 A;  1J5E B;  3HB3 B;  4WFE A;  2Y69 B;  3T1H B;  4K8X A;  3M8A A;  5LA6 A;  2R9A A;  3K03 A;  3JSN A;  3ASO B;  1KC8 W;  1P7B A;  3BEH A;  4JV5 O;  5KHJ A;  1LR1 A;  5BY1 A;  1ZX3 A;  2LGW A;  3IC9 A;  5HFL A;  1K5Q A;  3K06 A;  4LFC B;  3VQY A;  4PDV A;  3T1Y O;  1ZL8 A;  5LP6 A;  3RVY A;  2DYS C;  1YEW A;  4JYA B;  5EZY A;  4RQE A;  3STZ C;  2DN9 A;  1YJW V;  1AI4 A;  4X1K A;  2ZM6 O;  4JI1 B;  4DR6 B;  1M56 B;  5LHI A;  1N34 B;  5KX5 A;  1VQO V;  2F93 B;  2YDE A;  3GVM A;  1XIL A;  4EB6 A;  1BCC H;  4FJC C;  1NTZ H;  1OCR B;  4MVR A;  2EIN C;  2ZIN A;  2OWO A;  1YSC A;  2Z3Y A;  4GLX A;  2RCV A;  4ZI7 A;  3F7V C;  5LGN A;  4PV1 B;  1I5Y A;  1ARO P;  4DV3 B;  2RMK B;  5CBF A;  3ZMS A;  5JCO A;  2YXY A;  1NH2 D;  4CH3 A;  4JI5 B;  1SA0 A;  4DV7 B;  5C8Y A;  3OM3 B;  2AGA A;  3RYH B;  2XND G;  2Q69 A;  4FZ1 A;  4MSW C;  3ABL B;  2YXL A;  2OIG A;  3R65 A;  4LFA O;  3G4S V;  3BAB A;  4WFF A;  4DR1 B;  4DW1 A;  4D6T H;  1NVP D;  4DR4 O;  3SPJ A;  3SJB C;  4DR2 O;  4FK5 C;  2UXX A;  1XI1 A;  3JAL A;  3W7X A;  4Z2W A;  4O4L A;  1H8H G;  5IYB O;  1DK1 A;  5K1P A;  4DUY O;  5ITZ B;  4CC6 A;  2JGU A;  5GW7 A;  1U96 A;  2DQ3 A;  2ARH A;  3T4Z A;  3OAA G;  1MMM A;  3CCS V;  5LGT A;  1FXV A;  4AHC A;  4YY3 B;  1V9P A;  2HR3 A;  3D3I A;  1AJP A;  1DF4 A;  2JGD A;  1N33 B;  1MG1 A;  5KLV H;  4LF7 B;  1JFF B;  5DEC A;  2RDC A;  1AB3 A;  5B1A C;  1FAF A;  4B3S O;  2XAG A;  3S3W A;  3C3S A;  3ZHR A;  3QO7 A;  2Q4P A;  4B08 A;  1S77 D;  4B3R B;  3P32 A;  2YID A;  1TA8 A;  1W0J G;  1HNW O;  3JAM N;  3I5D A;  4DR7 B;  1EFR G;  1PV0 A;  3JAT A;  2YI9 A;  5CB4 B;  4PJ0 Z;  1VF7 A;  4X8A A;  4LF4 O;  1QCE A;  3ETQ A;  1N32 O;  2GBO A;  3C90 A;  5KMG A;  4JI2 B;  1I94 O;  1NKD A;  1H8E G;  4UVC A;  2UXD B;  4EKW A;  1YF2 A;  3VBB A;  3OGI B;  4H33 A;  2BE3 A;  1YDX A;  3FX7 A;  3WFV A;  1YZB A;  4LBE C;  1J5E O;  2QJ1 A;  3STL C;  5L3G A;  4PDM A;  1TUB B;  1FJG O;  3N2G B;  4OPH A;  4G28 B;  2F1M A;  3CRM A;  1FXK C;  1Y74 B;  3GWO A;  5B3S C;  4JAS A;  2VRZ A;  4QE9 A;  5BMV A;  3OUS A;  4BWA A;  4LFC O;  3CPW U;  2QM4 A;  3EXA A;  2IW5 A;  4J7Z A;  3C3T A;  4LF6 O;  4JYB A;  2FML A;  2XAH A;  1FYJ A;  3AG2 B;  4QJF B;  4UXN A;  5A2Q N;  2BTQ A;  3JAW B;  4NR1 A;  4JI1 O;  4JI8 B;  2HVJ C;  2IM9 A;  1IBL B;  4DR6 O;  1TAE A;  4FZ0 A;  5LYJ B;  4KP4 A;  2CTP A;  1N34 O;  3RFR A;  4IIJ B;  3D36 A;  4JAV A;  4I5S A;  1PPJ H;  5KA5 A;  1T5E A;  3ICX A;  4KXR A;  1KP2 A;  2QA4 V;  3S3X A;  2F4V B;  1DTO A;  1PL0 A;  3IC7 A;  3CRA A;  1XRE A;  2PI5 A;  1VEW A;  3K08 A;  1ZSP A;  1GRJ A;  3H1I H;  3UKM A;  2E75 B;  1BZK A;  2PY5 A;  2Z5U A;  2V4D A;  1MOF A;  2G38 A;  2LGQ A;  1XEQ A;  5IY5 B;  4DV7 O;  1Y66 A;  3APO A;  3FYI B;  1PNM A;  2DYR C;  4YIO A;  4ICG A;  1Q90 D;  1WJZ A;  1QNM A;  1THZ A;  4MVO A;  1NBM G;  5GTH Z;  1UFI A;  1X4T A;  3GB7 C;  4DR1 O;  3CRC A;  1XDC A;  3CXC U;  3UT5 A;  5KUM A;  3HKD B;  5EBM C;  4JI0 O;  2QWN B;  3A2F A;  1I7F A;  3ZED A;  1IZ3 A;  2Q0O C;  4R50 A;  2YI8 A;  1VF6 C;  1VQN V;  2PGG A;  3CC2 V;  5IYZ B;  3P3P A;  3LSU A;  3A0B Z;  1OCC B;  2XHB A;  2X6C A;  2JVD A;  1EBO A;  4TV8 B;  5FNV B;  3RYF B;  2X6A A;  3DSQ A;  4I50 A;  2M6Y A;  3JCU Z;  1NJI W;  4LF7 O;  3F5W C;  1FXK B;  1MZE A;  4D7T A;  1GM9 A;  1M5I A;  1QVF U;  4AIL C;  1RSO A;  3R66 A;  1OCO C;  1VQ7 V;  1VQ9 V;  5JJJ B;  2C2A A;  4DR7 O;  1KBH A;  3ABM C;  4ZOL A;  3FB7 C;  2HJF C;  3OFN G;  4JTD B;  3N2K A;  1ZLZ A;  1RM1 C;  2PYJ A;  2EZP A;  2IH1 C;  2IH3 C;  2Q68 A;  2QWQ B;  4JI2 O;  5FPO A;  1W59 A;  1WP7 A;  2E5L O;  1OV9 A;  3F7Y C;  4PA4 A;  3WG7 C;  5E79 Z;  5LOV A;  1RPO A;  1PM9 A;  3K9S A;  5LHG A;  1WP8 A;  4B3T B;  2WA3 A;  4DRX A;  3EVK A;  4J41 A;  3H9V A;  3TET A;  1RPR A;  1MZF A;  1E79 G;  2QKC A;  3NR7 A;  2KG7 B;  3CWB H;  2JJ1 G;  1RFY A;  1V54 C;  1Q43 A;  1QLN A;  1NQT A;  4X89 A;  4J9Y B;  4F6R B;  2EIK C;  2QWR B;  2YEV B;  5DM6 V;  3JAS B;  4PI2 A;  1YTF D;  1BS3 A;  1FFX B;  2ITD C;  4PEL A;  3K0D A;  1JR9 A;  1HR0 O;  2B5U A;  4JI8 O;  5LP6 B;  1IBL O;  1K5S A;  5CBH A;  1NS1 A;  5H5N A;  2RJZ A;  4ABM A;  5IDJ A;  4J11 A;  2ZDI C;  3T1C A;  1VQM V;  4J7J A;  1QLE C;  3HKC B;  3B77 A;  2PI4 A;  5B1B C;  4NTW A;  4TQD A;  2VWK A;  2DWD C;  4FPP A;  2EBO A;  5H9C A;  2HJD A;  2XOK G;  3VQW A;  2RQ6 A;  3HR0 A;  3QTC A;  4XBF A;  2HEP A;  2DW4 A;  3HKB A;  2KKW A;  4DV1 B;  5EYP B;  3G67 A;  2UXN A;  3P3N A;  2Q7G A;  2EIJ C;  4DR3 B;  3ZMV A;  1HNZ B;  3IJ4 A;  2NNU A;  4IT5 A;  4PD4 F;  3ASO C;  1OCO B;  4PDR A;  4FLZ A;  4LNU A;  1K7D A;  3ABM B;  5EBL C;  3CCR V;  2P67 A;  2KB1 A;  4LF5 B;  4H13 B;  5CN0 A;  4ZIB A;  1RM1 B;  1SS3 A;  1ZAU A;  3RYC B;  4UV9 A;  1VQ6 V;  3SPI A;  2ZR3 A;  3E22 A;  2FKX A;  1AJQ A;  3RWR D;  4J80 A;  2VQF B;  4CZZ A;  3WG7 B;  4HNA A;  3CD6 V;  1SRY A;  3JAL B;  4UB6 Z;  5F2V O;  1HNX B;  1AR4 A;  1Q3E A;  1NT2 B;  3A0R A;  4RUE A;  2XT9 A;  4WBN B;  1IDS A;  3ASN B;  3AG3 B;  2XUM A;  2MW2 B;  1QQC A;  1X59 A;  4BIO A;  3B40 A;  2IBZ H;  3IGA C;  4E4E A;  1Y6X A;  1XNR O;  4EFE A;  1V54 B;  3FB6 C;  2R9I A;  4CS3 A;  2EIK B;  4GUN A;  1VF5 B;  4KHP B;  4HYO A;  1SQP H;  1S3J A;  1HP8 A;  3AG1 B;  4GT1 A;  2L35 A;  4DV6 B;  5LXT B;  5JJN B;  2O57 A;  2IU0 A;  1CPY A;  3CCV V;  1CXZ B;  4CC5 A;  5LGU A;  2JRI A;  4O2A A;  3THO A;  2ZXW C;  5CA0 B;  1QLE B;  3EHB B;  5EC1 C;  2CTQ A;  5B1B B;  3OTO B;  5KMG B;  4FLU A;  4DXW A;  3UQ8 A;  3JAR A;  2LQT A;  4O4I B;  1P4R A;  1WA8 B;  2YIC A;  3HKE B;  4I7Z B;  1AIL A;  4QPK A;  4HZ3 A;  4F6E A;  3F5T A;  2BCC H;  3TXQ A;  4QPJ A;  3ABU A;  2EIJ B;  4FLV A;  4H44 B;  1EN6 A;  2UXC B;  1OCZ C;  1GN3 A;  4MW8 A;  4WFG A;  2NN4 A;  2GTS A;  2N04 A;  1XL6 A;  5LMU O;  3CC7 V;  2H94 A;  5LHH A;  1NTM H;  1Q7Y W;  3U11 A;  4MTX A;  4NYK A;  4Z1M G;  4TQF A;  4Q6G A;  4B7K A;  1KB9 F;  2JEU A;  2BSK B;  4CBC A;  1WNS A;  4PA3 A;  2W6J G;  3ETE A;  3OR6 C;  1K4D C;  2XTA A;  1U97 A;  4MS2 A;  1Q6U A;  2EX3 A;  4LWS B;  1HWY A;  2BTO A;  1M57 B;  3BA8 A;  3OUF A;  3BRC A;  4I55 B;  1JJO A;  1HDJ A;  4DO2 A;  4X65 O;  3CCE V;  1KQS U;  4UB8 Z;  1VF6 A;  4UCU A;  4RQF A;  4DV1 O;  4TV9 A;  4QNH B;  1IXB A;  5BXZ A;  1NI8 A;  2GUZ B;  3Q4H A;  4DR3 O;  1K9M W;  1M1K W;  1HNZ O;  1F51 A;  2WLM A;  4CH4 A;  4I9Q A;  1SZX A;  3GWK C;  1MA1 A;  4LF9 B;  2W0F C;  1SES A;  2XAF A;  2UUA B;  2XAJ A;  1EZV H;  1EN4 A;  2K1E A;  4LF5 O;  3MD0 A;  2ZIO A;  4KUM A;  1Q81 W;  2IU3 A;  3TGU H;  1IBM O;  2A7W A;  2ZIM A;  2X7R B;  2P4K A;  4X1I A;  3AG2 C;  3PN1 A;  3ZN0 A;  2WLL A;  2VQF O; 
#chains in the Genus database with same CATH homology
 1SQX H;  4PD4 F;  1BCC H;  2IBZ H;  3H1L H;  1NTZ H;  3CX5 F;  3H1K H;  3H1H H;  1NTM H;  1SQV H;  5KLV H;  2A06 H;  3CXH F;  1SQB H;  1NTK H;  1L0N H;  1EZV H;  3L72 H;  1L0L H;  1BE3 H;  2BCC H;  1SQQ H;  3CWB H;  3L70 H;  1SQP H;  1KB9 F;  3H1I H;  3L74 H;  4U3F H;  3TGU H;  1PP9 H;  3BCC H;  1PPJ H;  2FYU H;  3H1J H;  1BGY H;  3L73 H;  1KYO F;  1NU1 H;  3L71 H;  4D6T H;  3L75 H;  1P84 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...