3L74H

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l74H00
4U3FH 2A06H 1NU1H 1NTKH 3CXHF 5KLVH 3TGUH 3L70H 3L74H 3H1LH 1SQQH 4PD4F 1NTMH 2BCCH 1SQVH 1BCCH 3H1JH 1L0NH 1SQPH 1BGYH 1KB9F 1PP9H 1L0LH 1SQBH 4D6TH 1P84F 1NTZH 3L71H 1PPJH 3H1HH 3CX5F 3L72H 3L75H 1EZVH 3BCCH 3H1KH 1KYOF 2IBZH 3CWBH 3L73H 1SQXH 3H1IH 1BE3H 2FYUH
chains in the Genus database with same CATH superfamily
4U3FH 1XREA 3LDCA 3ABMC 3JCZA 1FJGO 2X6BA 3K5NA 1SF9A 3FB6C 3K79A 2QKAA 3OGIB 3JD1A 1SESA 2YIBA 5LA6B 4DV6O 2ZIOA 3CX5F 5B1AB 2ZE5A 1H2GA 5H9CA 2Y4UA 4FM0A 1FFTB 5GONA 3MDSA 1XNQO 3LNNA 3CCQV 1D5NA 4JI2O 4DW0A 1ENVA 4MW8A 4F6RA 2DYRC 4OX9O 3MHHC 1XMOO 1TGOA 4NTYA 4LF6O 5J2UB 4RO2A 1G4YB 4LF8O 2BE3A 1KKDA 3SYAA 1HDJA 2HJDA 2PYLA 5C8YB 4JAAA 2ZINA 5KAFZ 3FX7A 2ETNA 1J95A 2R9AA 4NTXA 4LF9B 3ZRVA 2LFSA 5IYBO 3CRRA 4CS2A 3CC4V 4A5UB 4O4HA 1Y66A 5A9GA 1PNMA 3JAKB 3AK2A 1JX9A 3FAVA 5BMVB 2HP8A 2YI8A 4JYBA 4AQYO 5JJEB 4DV0B 3JASB 3K59A 1HNZO 2EJRA 5IJ9B 1B6QA 2F4VB 3BABA 3MAQA 4NXMO 4GKKB 1SRYA 4TWKA 2HJFC 2A3QA 1SZTA 5B3SB 1FFXA 3K5MA 3RYIB 3CCUV 1VQ8V 1VQKV 4UCOA 2EX3A 2IJHA 1IXMA 1SKVA 4YHHO 2XNDG 3SJBC 3ICXA 4WFGA 1YF2A 4K0KO 1K4CC 2AZ2A 4DR5O 1Y74A 2NN4A 3E8FA 4R50A 2GTSA 3X2QC 2YC0A 1EN4A 2P7TC 3FD9A 5KHHA 3D36A 2JS3A 5BZBA 4JI0O 1EFRG 1NT2B 4MVOA 2XAJA 2ZD9A 3H1KH 3UQ8A 4LP8A 5LA6A 5JVDB 2CH7B 2FYUH 1IBKB 3E89A 3JD3A 2L35A 1HR0B 1ZL8B 4W4LA 3LNMB 3C3TA 3L74H 3M8AA 4H33A 4Q6GA 4DUZB 3ETGA 3KCXA 3EHBB 2QWOB 3ZMVA 2AHZA 4UXNA 2UXBB 3CP1A 5J2UA 3FFQA 2OT5A 5IWAB 4LWSB 4F6EA 2GV9A 4AHCA 3FB5C 5C8YA 5J9PC 1XI1A 3EFFK 5LMUO 2WSSG 1B06A 5DN6G 3DSQA 5KA5A 1K5SA 1JJOA 3SDLA 2W0XA 3G67A 2ZNIA 3RYFB 3A0RA 5HFMA 4DR3B 3OR6C 5KMGB 3G4SV 3KG2A 3W7XA 3JAKA 3QNEA 2Q7EA 5B1AC 5BMVA 5LXTB 3ZX6A 1KP2A 5L3EA 4IHJB 1AVMA 1NR1A 1NTZH 2UXNA 1VQ5V 1BSMA 1FXVA 5D5PA 3K0GA 4UFZA 1H2SB 3JASA 3H1IH 3SGIA 2EIKB 4O4IB 2GHYA 3D3IA 1VQ6V 4JGSA 2Y69C 5IJ9A 3R66A 4GX5A 5JJNB 1OCZC 2N05A 1H2KA 3LDEA 1FXHA 1GRJA 4GT1A 1WB7A 4MTFA 3RYIA 2IJKA 1AJPA 2XAGA 1R3IC 1V54B 1ZX3A 3OUSA 5LHHA 1N33B 5KHJA 3OUFA 1VF6A 3I56V 2A0LA 3T2MA 1W2BU 3CEIA 1N34B 4J10A 2LGQA 4R8CA 1R6KA 1Z2GA 4QPKA 2CUGA 4LFAO 2DQ3A 1X4TA 2NR5A 1LNQA 4PV1B 2E5LB 3JARB 4UUJC 4FM2A 2JIZG 4LH6A 4J7ZA 2CTQA 2YXHA 5JVDA 2CH7A 3THOA 1K7DA 1PNKA 4UCVA 1KP3A 2BOBC 4YHHB 1ZL8A 5A2QN 1SQBH 1MMMA 4DR6B 4PI2A 4GUNA 4TV9B 4WFEA 5B3SC 4ZI7B 3J80N 4DR5B 1AR4A 4DV7B 2JJ1G 1S72V 1AJQA 1QR8A 2FKXA 3SJAC 3RFRA 1N0NA 2HR3A 4KHPB 1N4CA 2YICA 5J2TB 1N32O 1K97A 3PN1A 5LOVB 4LWSA 3NR7A 2XHBA 4JI5B 4R6ZA 5IYCO 4DV5O 3RVYA 2K1EA 1GM9A 2AZ0A 3K5OA 1AR1B 2JEXA 3DTUB 1XEQA 3E86A 1Q90D 3RYFA 4X8AA 2R9RB 1HNXO 4CC5A 5KMGA 2KQXA 4I55B 2XUMA 4RUFA 3RYHB 1JVMA 1HWYA 4DR1B 4NB5A 3IGAC 5LXTA 1W0JG 3OEHG 2IU0A 4IHJA 5LHGA 3N2KB 2OCHA 4LH7A 3TJTA 1US6A 4DYLA 4B7EA 4UB6Z 2E76B 3TGUH 2QEXV 3H1LH 4O4IA 1ZAUA 3PJSK 1M57B 2EILC 1BGYH 4L87A 2KSDA 4DUYB 3E35A 3J7AU 1MG1A 3P3PA 4UV9A 1N8RW 2UXXA 4GYCB 2ZT9B 1X59A 1OCCB 2IJJA 3BPZA 1V55B 4UCSA 4LNUB 4JI6O 3KZIZ 3U11A 3H9VA 4QNHB 4K35A 1Y67A 2PI4A 2W6IG 1ZLZA 4BW9A 1H8HG 2KB1A 2P4KA 2WLNA 1N0JA 2XASA 4MSWC 4JZ2A 4BIOA 2QGNA 4D7SA 4NVPA 5EIBD 1W59A 1N36B 3JARA 2ADQB 3CXHF 3P3NA 2GBOA 2EIKC 1GN6A 3VQYA 1JPXA 2M7WA 5EK0A 1QLEB 1EZVH 1IVSA 4B3MB 1KYOF 4TV9A 1H38A 5E1AC 5JCOC 3I55V 2HHHO 1DGSA 4ZI7A 3SYQA 2RCVA 4P30A 2KG7B 2PF4E 3BFRA 1ZSPA 3SJCC 2EIMC 1YCIA 1SQPH 5J2TA 2VQFB 1AILA 1G1XB 4BIUA 1M56B 5LOVA 1XILA 5JJJB 1J5EO 4DR2B 4MVZA 2E3CA 3RT3C 4HNAB 1KECA 4PDVA 2AHYA 1COWG 2F4VO 4EB6B 4I5SA 4GKKO 3IC9A 3JD0A 3CRMA 5K1PA 3CS5A 5JH7B 4I55A 3RYHA 3H1HH 1F51A 3APQA 3AG7A 4FLTA 1BT8A 4O2AB 2Z0AA 2R72A 4ZOLB 1N32B 2OCCC 3TXQA 5CBHA 1BHAA 3N2KA 1LUVA 5KLVH 1M4UA 5EYPB 1FS0G 3ETDA 3JATB 3K3WA 3AG1B 3T4ZA 2Q9LA 1IBLB 1PL4A 4JAVA 2MK3A 2GUZB 2QA4V 5IE9A 3L75H 4CS4A 1Q81W 1VMGA 3AEIA 4CBCA 2C2AA 5LP6B 1Q8IA 2BTQB 1YI2V 3LSSA 1M5IA 3ZN0A 1IBKO 4I4TB 4LNUA 5LYJB 1Q86W 1HR0O 2ZM6B 3CRAA 4LFCB 4DUZO 4L8JA 4CC6A 3AG2B 4UCRA 2YSUB 4MTGA 1SERA 5H6QA 4JI1B 3VQXA 2CE4A 2UXBO 2N74A 1XMQO 2UUBB 2A7WA 1WJZA 3K03A 3DC5A 1XHXA 1IBMB 1LR1A 4QIWF 2K9PA 3SPIA 5IWAO 3CHXA 5IY5B 2RQ6A 4JPRA 1M1KW 3JALB 5CB4B 2Q7GA 1M57C 4TSFG 1QVGU 3AG3C 4JI6B 2X6CA 4BWAA 1BE3H 2ZE6A 4UV8A 2YXLA 2XOKG 3DXRB 4CH4A 3Q4HB 4ZHQB 1BCCH 4DR3O 4QE9A 3B77A 2KG7A 2P06A 1V55C 4B3TB 1JOYA 2UUAO 1MZEA 1NVPB 4DRXB 3OTOB 3SPJA 1QNMA 3ZHVA 1SA0B 4YXWG 2UU9B 1NVPD 2IU3A 3SYCA 1WPXA 3GWKC 4HNAA 3JSLA 5CA0B 4PELA 5EBLC 4WF9V 3FYEB 4EB6A 2HHHB 3QTCA 1B04A 1OZ0A 2EIJB 2Q8VA 4XDLA 5JH7A 4DR7B 4TV8B 2Z5UA 3CYOA 3JAMN 3B8MA 2Z3YA 1YDXA 5CMUA 2DYSB 4O2AA 3HKDA 4ZOLA 3T1HB 1N33O 3CSXA 1NTMH 5F2VO 3C3SA 4J9YB 5EYPA 2ATKC 1J5EB 3JATA 4CH6A 1N34O 4NTWA 3K0DA 3OMIB 1TVKB 2GUZA 1SQXH 3J81N 2F93B 2E5LO 4JI7B 3CMAV 4GCZA 3AG4B 2YS8A 4GZRB 2GDSA 3QO5A 1FXKB 1XL6A 2EINC 5EC2C 5LP6A 1FPOA 4X64B 2BTQA 2BOCC 2BTOA 4ZIBA 2LGWA 4I4TA 2NNUA 2F66C 5LYJA 1IXBA 4GX2A 4AI8A 3LSUA 4DR6O 5TISZ 3U10A 4XBFA 4J9ZB 4DO2A 3N27A 3F7VC 1R1BA 5DEDA 4N23A 4WFFA 1AB3A 4DV7O 2P6JA 4TUYB 1VQLV 1GM7A 2QM4A 5B1BB 1SS3A 4FLZA 4B08A 4KHPO 4K8ZA 4LF4B 2ADPA 3IJ4A 3SPGA 3EVKA 4BW5A 3JALA 4JI5O 5EBMC 5CB4A 1S0VA 2HEPA 3BY6A 2FB5A 2H94A 1HNWB 2JRIA 3E8HA 3ABKB 5KA6A 4CH5A 3DXRA 1OHHG 5LBQA 5KUMA 1XDCA 3BRCA 2HG5C 4U7NA 3Q4HA 4ZHQA 2F43G 4FZ0A 2ZE7A 3M99B 1M90W 2ZR2A 2X6AA 4DR1O 1XMQB 3FYIB 3VOUA 3TK1A 4DRXA 1SA0A 3ABLC 2IJIA 3CCMV 2EBOA 4KXRA 2GSMB 4TQFA 4FIPC 3TXSA 2WA3A 1UJWB 1FD9A 2ZCEA 4H13B 4JV5O 2ZXWB 5CA0A 3QG5A 3D36C 2HVJC 4JYCA 2VQEO 1DF5A 4DUYO 4O4LB 4NXNB 2ARHA 4TV8A 1NTKH 4TOIA 5CBGA 2Q67A 4D7TA 1Q5OA 2UUAB 2AGAA 1DLBA 1Y6XA 2ZE8A 4MW3A 4FLWA 3STLC 3K5LA 2ILMA 4B7KA 1P49A 4CZZA 3ZJZA 1NKDA 1I94O 1TUEB 3U0ZA 2E75B 3CCEV 1BQZA 2YXYA 5L3FA 1RSOB 1OCRB 1EBOA 1TVKA 3UT5B 1KUQA 3O9OA 4UCUA 1EZJA 4LC1A 1JR9A 2JS5A 4HYOA 4KFMA 4GX1A 1N36O 4ZBMA 1JMKC 1PKXA 4U7OA 4DXWA 1AJNA 1FXKA 1RM1B 2QDOA 4IYIA 1ROPA 1I08A 4KL1A 2L6LA 4LBEC 4H37A 4MS2A 2QSAA 1F7YA 1R3KC 2OTLV 4B3MO 1A32A 1YTFB 5HFLA 3ML0A 4WBNB 2DW4A 4TUYA 2IM9A 2DYSC 4NKGB 3A0HZ 2IW5A 1YTFD 2UXCO 1K33A 2OTJV 2VQFO 4I0XB 1V9PA 4JTDB 3CRCA 1ORQC 3L70H 1L1FA 4DR2O 1SQVH 4J7JA 4G2KA 2QM8A 1XL4A 4X1IB 3K04A 1XHZA 1XUQA 4FFBB 1Q43A 2V1DA 3HKCB 4NR1A 3OFNG 1QVFU 4OGQB 3VQVA 2XAHA 1VF6C 4WFAV 2LJ2A 3K58A 4QJFB 1UFIA 2B9ZA 3L9DA 1IBLO 5IYDO 3JD2A 4FLVA 2W0FC 2PY5A 4LF7B 4B3SB 1NU1H 3TETA 2JDIG 1EN6A 4O4LA 1GMGA 2DOSA 3ZS8C 4FLUA 2WLMA 4PI0A 4LF5B 3ASNB 1H2MA 4LR3A 2DWEC 3L72H 4Z2WA 2ZM6O 3CWBH 3OAAG 3E22B 4DV3O 3QO7A 1OCOB 3B40A 4LFCO 3WB0A 1Z5WA 1RSOA 4JV5B 3ETQA 4JI1O 2B5UA 5H2FZ 3UT5A 1FKAO 4X89A 4JYAB 3WB2A 1AP6A 1BL8A 1WA8B 1G8MA 2JEUA 2PI5A 2VQEB 2UUBO 1VQNV 3ABMB 1IBMO 3LDDA 2QJ1A 2DJVA 3M7MX 4UVCA 1VF5B 5FPOA 2ZXWC 3D3QA 4IIJB 3CE2A 2LQTA 4F4LA 2JGUA 4X20B 2QTSA 3KCYA 4X62O 3ASOB 1I94B 2Q7HA 5BR8B 1DTOA 3SR2C 4WBNA 1KC8W 2Y48A 2DYRB 5BY1A 1S77D 1OJHA 3QF7A 4B3TO 2Q6AA 5KHGA 1NZ6A 4PHZA 3B2EE 1QU7A 3W7SA 3OTOO 2V4DA 4JTCB 3G80A 4DV4B 2KKWA 4I0XA 4P9OA 1OCRC 5H5NA 2UU9O 2B1GA 4WFHA 2OIGA 1WP7A 1GN2A 3ZN1A 3QO8A 1TAEA 4KP4A 5IDJA 2QM7A 1YSCA 4X1IA 4J7KA 4EFBA 1E1QG 4OPAA 4FMTA 1RM1C 3BA8A 4P2ZA 4FFBA 1D5AA 4P9PA 1ZWIC 2HFEC 4BAYA 2B1IA 4X65B 3HKCA 5DM6V 4DR7O 1V54C 3CXCU 1IZ3A 3LSQA 2UXCB 3T1HO 1LUWA 4DR4B 4DW1A 4N21A 2QTOA 3UM7A 2IBZH 1JA8A 1KD1W 3BA9A 1D2DA 4HAMA 1ZUQA 4YJ2B 2PYJA 3RN4A 2Q5ZA 1OV9A 3CPWU 4JI7O 4FM1A 1GKFA 4UCTA 2VWKA 1HW7A 4X64O 1Q3EA 2A9HA 1PL0A 2WLIB 4IL6Z 4GKJB 4FVMA 3IC7A 3HKDB 4JI8O 5LMNB 3D8CA 1F23A 2CTRA 4YY3O 3E22A 2OIEA 4LFBB 3HKBB 5EC1C 4WCEV 3B4SA 2P90A 4MTXA 5K1XA 1YZBA 3W7UA 3JD4A 1PD3A 5B1NA 1I5YA 2A79B 1BMFG 3KKYA 2ZQMA 4J11A 1GK9A 4O4JB 4FLYA 5C93A 3CJHB 1WA8A 2ZNJA 3P30A 5GTHZ 4MVRA 2F23A 3X2QB 1TUBB 2LO1A 4LF4O 1RFYA 4YJ3B 1GO3F 4EEQA 4FLXA 3ZCCA 4FFKA 4IIJA 1YIJV 1HNWO 4GLXA 1F4NA 2CDYA 2WA4A 5FNVB 2XAFA 2IH1C 4X20A 1YITV 4DV3B 3CCLV 1IX9A 3AK1A 5EZYB 4TQDA 3HKEB 3P32A 1YJNV 2BSKB 5L3GA 1PV0A 3VQWA 4J42A 3ASNC 1Q6HA 3WB1A 1R6TA 3SJQC 1PNLA 4QGPA 1GH6A 2WLLB 2G38A 3E83A 3UO2A 2E74B 1G6UA 4YIOA 2RDCA 2QWNB 3EXAA 4JAUA 3IAYA 4JF3A 5L3BA 2CGOA 2X0LA 2LFRA 4HZ3A 2JJ2G 3HB3B 4X62B 2R9IA 4IYHA 3JCUZ 4PA6A 1KBHA 3B8NA 4NXNO 1OCCC 2UXDB 1W0KG 2OYQA 4C7UA 4I9QA 3JSNA 1U97A 3JYCA 2OWOA 3F5WC 4RAIA 1E79G 1Y76B 2HLDG 3ASOC 5CA1B 4I7ZB 5EIBC 2N04A 1KQSU 1VIBA 1URFA 1AI5A 3RVZA 2Y0PA 1EM1A 2FMLA 5FPRA 1VQOV 4DK0A 3F5TA 3ZMTA 2JGDB 4MVUA 4YJ2A 4JI3O 1S5HC 2Y69B 1SETA 3I5DA 2ITDC 1K5QA 4Z1VA 3H01A 3ZBHA 4PA3A 1OCZB 1S5LZ 4FZ1A 1K4DC 2H8PC 2DWDC 1SC5B 2WLIA 1GM8A 1Q7YW 1I0HA 1QLEC 4FJCC 3OE7G 1MSDA 1GN3A 4D6TH 4G28B 3HKBA 4FK5C 1YJ9V 3WG7B 4X66B 5CA3A 1B3QA 4J41A 4QPJA 3QVNA 3K9SA 2CAZC 3MD0A 3N2GB 1I5XA 1M93A 3L73H 4O4JA 3CJHA 5KAIZ 1THZA 1M56C 1TUBA 2QWRB 4ICGA 1SQQH 2CGNA 4YJ3A 2GTAA 4DV2B 2UUCB 5CN0A 2WPDG 1AROP 1CXZB 4LCUC 4YIPA 2WAMA 4O2BB 3RYCB 3OD4A 5FNVA 4JI8B 1Q6IA 1XNRO 4H44B 4FPPA 4YY3B 4MVQA 1YJWV 2R70A 2HVKC 5EZYA 2ZIMA 3BEHA 3HKEA 2V7QG 2BSKA 1AI4A 2FTKA 1MSWD 2CK3G 1KB9F 1H8EG 5CBFA 1UPGA 4G27B 3APOA 4DK1A 1EN5A 3ETEA 2WLLA 5ITZB 5GTIZ 3AG1C 3BCCH 4PA7A 5IJ0B 3ZHUA 4K8XA 3ZRSA 3CCSV 2AW9A 2YEVB 4UVBA 3ZMZA 4X9QA 2CTPA 4EKWA 1S76D 4X1KB 1P4RA 5EBWC 4LF7O 5LP6C 4B3SO 4U3JB 3OR7C 1P84F 1VP7A 5LL6Y 3RW0A 3STZC 2EJ7A 1Q82W 3ZRWB 1K8AW 1QLNA 2VS0A 4W4KA 4LF5O 1GAXA 1VEWA 4UVAA 1Y76A 4RUEA 5CA1A 3AK3A 3ZHRA 3AG2C 3MHSC 1Z5VA 1L0NH 4OXSA 3ZHTA 1RP3B 3OEEG 3S3WA 1MOFA 4JI4B 1JFFB 2JGDA 3FB7C 2PZSA 4JYAO 4RQFA 1FJGB 2EILB 3OT7A 5IY5C 4PA9A 3GWOA 5B66Z 4QE7A 1P7BA 1K34A 2A06H 4RQEA 1I7FA 5IYZB 3C90A 2LW7A 3S3XA 4DV6B 4B3RO 3SYOA 3K9AA 4PDMA 3WFVA 1XOUA 3ZHSA 3A2FA 3L71H 1YHQV 2VWJA 1XNQB 4PA4A 1AR5A 4JI2B 3CMEV 1XQ8A 2W6JG 1NR7A 5BR8O 1Q6UA 2XTAA 3FKSG 3T1CA 2Q69A 1XMOB 4OX9B 2QKSA 3GB7C 2YIAA 3N2GA 4LF6B 4IT5A 4JI3B 5KHKA 4WFBV 4LF8B 4KUMA 4AILC 1VQ4V 2QWQB 3E8BA 4DV4O 3WU2Z 1PM9A 3CC7V 2EZPA 1IURA 4JZGA 4X1YB 4JTAB 4PJ0Z 3TCUA 1VF7A 4O2BA 3RYCA 4XDJA 5BXZA 4DV1O 1WAZA 2ZDIA 1KKCA 2EIJC 3CRQA 2YI9A 4CS3A 3HR0A 2WWWA 2P22C 4I9WA 2Q73A 1L0LH 1WN7A 4X65O 3T4DA 3CD6V 1L8DA 1NS1A 4PDLA 2WLHA 4IGGA 3NXSA 1U96A 1HP8A 2JVDA 2EIMB 4AQYB 3WG7C 5ITZA 2QKCA 2WLKA 4DR4O 3T1YO 1FYJA 5IJ0A 2H3OA 3RWRD 2F95B 3ZEDA 2PGGA 3F7YC 5KX5B 3FB8C 4JYYA 1P7GA 1HNZB 3OMNB 2YEVA 1XNRB 1AI6A 2JK5C 3G6BA 3AG4C 1JQ0A 3SPHA 5IT9N 1K3EA 4NXMB 4X1KA 1FXKC 2P4VA 2YUAA 5LGTA 4U3JA 3K08A 5B1OA 1H2NA 5JWPA 3ZRWA 2YDEA 3CC2V 4UB8Z 2ZDIC 5DECA 4GKJO 5LMNO 2OCCB 1GN4A 1TA8A 2F1MA 1K9MW 4NYKA 4LFBO 4K0KB 1R73A 3GVMA 2Q68A 3LUTB 4TT3G 5B1BC 3UKMA 1O9HA 3CCVV 1JFFA 2VRZA 1SQFA 3VBBA 3SPCA 3UO3A 4JI0B 4Z1MG 2RMKB 3W7WA 3JAWB 5IYZA 1PP9H 1BQ0A 2FL4A 3W7TA 1NH2B 1QR9A 1QQCA 3ABKC 1S5JA 4E4EA 1QHTA 4MT8A 1GTOA 2QE7G 2DN9A 1VARA 1NH2D 3CCJV 5L3DA 3K57A 3SYPA 1K92A 1H2LA 2EZOA 1QCEA 1BZKA 5E79Z 2NLJC 2YIDA 1SQGA 3B09A 2O57A 3RBZA 1WPBA 1MABG 3ZRXA 4CH3A 1WLEA 4XDKA 2CTWA 4B3RB 4X1YA 5LGNA 2DQ0A 5LMUB 1MZFA 1VQPV 2QWPB 3G6EV 3AG3B 1O9GA 2ZR3A 1PPJH 4Q20A 4H0LB 5JCOA 2P67A 1WNSA 1WP8A 2UXDO 1NBMG 1NQTA 2X7RB 5JQGB 2RJZA 2ODMA 2Q0OC 1KMIZ 3ZIAG 1E1RG 1M9NA 1JCHA 4BR6A 3IFXA 1CPYA 4I50B 5KX5A 4PDRA 1YXBA 4RWUA 4K3AA 2Y0IA 2M6YA 4DV1B 5GW7A 4ASUG 2P5OA 1K73W 2Q0AA 3DGEA 2D3OW 3OGCC 1SZXA 1MA1A 1FAFA 2Q4PA 3BAAA 3ABUA 4R7CA 1CP9A 4LF9O 3OTFA 5GONB 3T1YB 4ABMA 3ZMSA 2PUSA 1MNGA 2YIBD 4F6RB 4X66O 1QBZA 3O65A 1F4MA 3OM3B 5AG2A 1R3JC 2IH3C 1AP5A 4HBNA 3CCRV 1RPOA 2AXTZ 4LFAB 2D2CB 1VQ9V 2BCCH 4MVMA 2MW2B 3G71V 1YVWA 5LGUA 3A0BZ 2DMXA 4MVSA 3JAWA 4DV2O 5B5EZ 2RNBA 3HPLC 1S3JA 4OPHA 2UUCO 4GX0A 2EINB 1BHBA 2XAQA 4DV0O 4J80A 5KHIA 5D5QA 1NI8A 1RPRA 5KUKA 1VQMV 1DK1A 2LW1A 3E2EA 1VQ7V 2RN9A 5L3CA 4O4HB 3ZMUA 5FL7G 1DF4A 5FLXN 1JJ2U 2HKOA 4E2LA 3FAVB 2Y4TA 4BIZA 3BHPA 3DC6A 2WLJA 3ABTA 1YEWA 3OMAB 1IDSA 4DV5B 2QR4A 2EULA 3RGBA 4PD4F 1Y4MA 2LP7A 3BVOA 2ITCC 2XT9A 4X88A 5LHIA 3CB2A 1XBLA 4EFEA 1R3LC 1ZTEA 1HNXB 3E8GA 1BS3A 1WB8A 1FFXB 4JASA 3OW2U 1NJIW 3K06A 3R65A 1R6NA 1T5EA 3UCSC 5JQGA 2DE0X 3H1JH 3A8TA 4MTOA 4ZKIA 1OCOC 2PTMA 3ABLB 1AI7A 4I50A 1KU9A 1Y74B 1CEZA 5H6RA 3ZHQA 4JI4O 2ZKOA
chains in the Genus database with same CATH topology
4U3FH 2A06H 1NU1H 1NTKH 3CXHF 5KLVH 3TGUH 3L70H 3L74H 3H1LH 1SQQH 4PD4F 1NTMH 2BCCH 1SQVH 1BCCH 3H1JH 1L0NH 1SQPH 1BGYH 1KB9F 1PP9H 1L0LH 1SQBH 4D6TH 1P84F 1NTZH 3L71H 1PPJH 3H1HH 3CX5F 3L72H 3L75H 1EZVH 3BCCH 3H1KH 1KYOF 2IBZH 3CWBH 3L73H 1SQXH 3H1IH 1BE3H 2FYUH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3F H;  2A06 H;  1NU1 H;  1NTK H;  3CXH F;  5KLV H;  3TGU H;  3L70 H;  3L74 H;  3H1L H;  1SQQ H;  4PD4 F;  1NTM H;  2BCC H;  1SQV H;  1BCC H;  3H1J H;  1L0N H;  1SQP H;  1BGY H;  1KB9 F;  1PP9 H;  1L0L H;  1SQB H;  4D6T H;  1P84 F;  1NTZ H;  3L71 H;  1PPJ H;  3H1H H;  3CX5 F;  3L72 H;  3L75 H;  1EZV H;  3BCC H;  3H1K H;  1KYO F;  2IBZ H;  3CWB H;  3L73 H;  1SQX H;  3H1I H;  1BE3 H;  2FYU H; 
#chains in the Genus database with same CATH topology
 4U3F H;  1XRE A;  3LDC A;  3ABM C;  3JCZ A;  1FJG O;  2X6B A;  3K5N A;  1SF9 A;  3FB6 C;  3K79 A;  2QKA A;  3OGI B;  3JD1 A;  1SES A;  2YIB A;  5LA6 B;  4DV6 O;  2ZIO A;  3CX5 F;  5B1A B;  2ZE5 A;  1H2G A;  5H9C A;  2Y4U A;  4FM0 A;  1FFT B;  5GON A;  3MDS A;  1XNQ O;  3LNN A;  3CCQ V;  1D5N A;  4JI2 O;  4DW0 A;  1ENV A;  4MW8 A;  4F6R A;  2DYR C;  4OX9 O;  3MHH C;  1XMO O;  1TGO A;  4NTY A;  4LF6 O;  5J2U B;  4RO2 A;  1G4Y B;  4LF8 O;  2BE3 A;  1KKD A;  3SYA A;  1HDJ A;  2HJD A;  2PYL A;  5C8Y B;  4JAA A;  2ZIN A;  5KAF Z;  3FX7 A;  2ETN A;  1J95 A;  2R9A A;  4NTX A;  4LF9 B;  3ZRV A;  2LFS A;  5IYB O;  3CRR A;  4CS2 A;  3CC4 V;  4A5U B;  4O4H A;  1Y66 A;  5A9G A;  1PNM A;  3JAK B;  3AK2 A;  1JX9 A;  3FAV A;  5BMV B;  2HP8 A;  2YI8 A;  4JYB A;  4AQY O;  5JJE B;  4DV0 B;  3JAS B;  3K59 A;  1HNZ O;  2EJR A;  5IJ9 B;  1B6Q A;  2F4V B;  3BAB A;  3MAQ A;  4NXM O;  4GKK B;  1SRY A;  4TWK A;  2HJF C;  2A3Q A;  1SZT A;  5B3S B;  1FFX A;  3K5M A;  3RYI B;  3CCU V;  1VQ8 V;  1VQK V;  4UCO A;  2EX3 A;  2IJH A;  1IXM A;  1SKV A;  4YHH O;  2XND G;  3SJB C;  3ICX A;  4WFG A;  1YF2 A;  4K0K O;  1K4C C;  2AZ2 A;  4DR5 O;  1Y74 A;  2NN4 A;  3E8F A;  4R50 A;  2GTS A;  3X2Q C;  2YC0 A;  1EN4 A;  2P7T C;  3FD9 A;  5KHH A;  3D36 A;  2JS3 A;  5BZB A;  4JI0 O;  1EFR G;  1NT2 B;  4MVO A;  2XAJ A;  2ZD9 A;  3H1K H;  3UQ8 A;  4LP8 A;  5LA6 A;  5JVD B;  2CH7 B;  2FYU H;  1IBK B;  3E89 A;  3JD3 A;  2L35 A;  1HR0 B;  1ZL8 B;  4W4L A;  3LNM B;  3C3T A;  3L74 H;  3M8A A;  4H33 A;  4Q6G A;  4DUZ B;  3ETG A;  3KCX A;  3EHB B;  2QWO B;  3ZMV A;  2AHZ A;  4UXN A;  2UXB B;  3CP1 A;  5J2U A;  3FFQ A;  2OT5 A;  5IWA B;  4LWS B;  4F6E A;  2GV9 A;  4AHC A;  3FB5 C;  5C8Y A;  5J9P C;  1XI1 A;  3EFF K;  5LMU O;  2WSS G;  1B06 A;  5DN6 G;  3DSQ A;  5KA5 A;  1K5S A;  1JJO A;  3SDL A;  2W0X A;  3G67 A;  2ZNI A;  3RYF B;  3A0R A;  5HFM A;  4DR3 B;  3OR6 C;  5KMG B;  3G4S V;  3KG2 A;  3W7X A;  3JAK A;  3QNE A;  2Q7E A;  5B1A C;  5BMV A;  5LXT B;  3ZX6 A;  1KP2 A;  5L3E A;  4IHJ B;  1AVM A;  1NR1 A;  1NTZ H;  2UXN A;  1VQ5 V;  1BSM A;  1FXV A;  5D5P A;  3K0G A;  4UFZ A;  1H2S B;  3JAS A;  3H1I H;  3SGI A;  2EIK B;  4O4I B;  2GHY A;  3D3I A;  1VQ6 V;  4JGS A;  2Y69 C;  5IJ9 A;  3R66 A;  4GX5 A;  5JJN B;  1OCZ C;  2N05 A;  1H2K A;  3LDE A;  1FXH A;  1GRJ A;  4GT1 A;  1WB7 A;  4MTF A;  3RYI A;  2IJK A;  1AJP A;  2XAG A;  1R3I C;  1V54 B;  1ZX3 A;  3OUS A;  5LHH A;  1N33 B;  5KHJ A;  3OUF A;  1VF6 A;  3I56 V;  2A0L A;  3T2M A;  1W2B U;  3CEI A;  1N34 B;  4J10 A;  2LGQ A;  4R8C A;  1R6K A;  1Z2G A;  4QPK A;  2CUG A;  4LFA O;  2DQ3 A;  1X4T A;  2NR5 A;  1LNQ A;  4PV1 B;  2E5L B;  3JAR B;  4UUJ C;  4FM2 A;  2JIZ G;  4LH6 A;  4J7Z A;  2CTQ A;  2YXH A;  5JVD A;  2CH7 A;  3THO A;  1K7D A;  1PNK A;  4UCV A;  1KP3 A;  2BOB C;  4YHH B;  1ZL8 A;  5A2Q N;  1SQB H;  1MMM A;  4DR6 B;  4PI2 A;  4GUN A;  4TV9 B;  4WFE A;  5B3S C;  4ZI7 B;  3J80 N;  4DR5 B;  1AR4 A;  4DV7 B;  2JJ1 G;  1S72 V;  1AJQ A;  1QR8 A;  2FKX A;  3SJA C;  3RFR A;  1N0N A;  2HR3 A;  4KHP B;  1N4C A;  2YIC A;  5J2T B;  1N32 O;  1K97 A;  3PN1 A;  5LOV B;  4LWS A;  3NR7 A;  2XHB A;  4JI5 B;  4R6Z A;  5IYC O;  4DV5 O;  3RVY A;  2K1E A;  1GM9 A;  2AZ0 A;  3K5O A;  1AR1 B;  2JEX A;  3DTU B;  1XEQ A;  3E86 A;  1Q90 D;  3RYF A;  4X8A A;  2R9R B;  1HNX O;  4CC5 A;  5KMG A;  2KQX A;  4I55 B;  2XUM A;  4RUF A;  3RYH B;  1JVM A;  1HWY A;  4DR1 B;  4NB5 A;  3IGA C;  5LXT A;  1W0J G;  3OEH G;  2IU0 A;  4IHJ A;  5LHG A;  3N2K B;  2OCH A;  4LH7 A;  3TJT A;  1US6 A;  4DYL A;  4B7E A;  4UB6 Z;  2E76 B;  3TGU H;  2QEX V;  3H1L H;  4O4I A;  1ZAU A;  3PJS K;  1M57 B;  2EIL C;  1BGY H;  4L87 A;  2KSD A;  4DUY B;  3E35 A;  3J7A U;  1MG1 A;  3P3P A;  4UV9 A;  1N8R W;  2UXX A;  4GYC B;  2ZT9 B;  1X59 A;  1OCC B;  2IJJ A;  3BPZ A;  1V55 B;  4UCS A;  4LNU B;  4JI6 O;  3KZI Z;  3U11 A;  3H9V A;  4QNH B;  4K35 A;  1Y67 A;  2PI4 A;  2W6I G;  1ZLZ A;  4BW9 A;  1H8H G;  2KB1 A;  2P4K A;  2WLN A;  1N0J A;  2XAS A;  4MSW C;  4JZ2 A;  4BIO A;  2QGN A;  4D7S A;  4NVP A;  5EIB D;  1W59 A;  1N36 B;  3JAR A;  2ADQ B;  3CXH F;  3P3N A;  2GBO A;  2EIK C;  1GN6 A;  3VQY A;  1JPX A;  2M7W A;  5EK0 A;  1QLE B;  1EZV H;  1IVS A;  4B3M B;  1KYO F;  4TV9 A;  1H38 A;  5E1A C;  5JCO C;  3I55 V;  2HHH O;  1DGS A;  4ZI7 A;  3SYQ A;  2RCV A;  4P30 A;  2KG7 B;  2PF4 E;  3BFR A;  1ZSP A;  3SJC C;  2EIM C;  1YCI A;  1SQP H;  5J2T A;  2VQF B;  1AIL A;  1G1X B;  4BIU A;  1M56 B;  5LOV A;  1XIL A;  5JJJ B;  1J5E O;  4DR2 B;  4MVZ A;  2E3C A;  3RT3 C;  4HNA B;  1KEC A;  4PDV A;  2AHY A;  1COW G;  2F4V O;  4EB6 B;  4I5S A;  4GKK O;  3IC9 A;  3JD0 A;  3CRM A;  5K1P A;  3CS5 A;  5JH7 B;  4I55 A;  3RYH A;  3H1H H;  1F51 A;  3APQ A;  3AG7 A;  4FLT A;  1BT8 A;  4O2A B;  2Z0A A;  2R72 A;  4ZOL B;  1N32 B;  2OCC C;  3TXQ A;  5CBH A;  1BHA A;  3N2K A;  1LUV A;  5KLV H;  1M4U A;  5EYP B;  1FS0 G;  3ETD A;  3JAT B;  3K3W A;  3AG1 B;  3T4Z A;  2Q9L A;  1IBL B;  1PL4 A;  4JAV A;  2MK3 A;  2GUZ B;  2QA4 V;  5IE9 A;  3L75 H;  4CS4 A;  1Q81 W;  1VMG A;  3AEI A;  4CBC A;  2C2A A;  5LP6 B;  1Q8I A;  2BTQ B;  1YI2 V;  3LSS A;  1M5I A;  3ZN0 A;  1IBK O;  4I4T B;  4LNU A;  5LYJ B;  1Q86 W;  1HR0 O;  2ZM6 B;  3CRA A;  4LFC B;  4DUZ O;  4L8J A;  4CC6 A;  3AG2 B;  4UCR A;  2YSU B;  4MTG A;  1SER A;  5H6Q A;  4JI1 B;  3VQX A;  2CE4 A;  2UXB O;  2N74 A;  1XMQ O;  2UUB B;  2A7W A;  1WJZ A;  3K03 A;  3DC5 A;  1XHX A;  1IBM B;  1LR1 A;  4QIW F;  2K9P A;  3SPI A;  5IWA O;  3CHX A;  5IY5 B;  2RQ6 A;  4JPR A;  1M1K W;  3JAL B;  5CB4 B;  2Q7G A;  1M57 C;  4TSF G;  1QVG U;  3AG3 C;  4JI6 B;  2X6C A;  4BWA A;  1BE3 H;  2ZE6 A;  4UV8 A;  2YXL A;  2XOK G;  3DXR B;  4CH4 A;  3Q4H B;  4ZHQ B;  1BCC H;  4DR3 O;  4QE9 A;  3B77 A;  2KG7 A;  2P06 A;  1V55 C;  4B3T B;  1JOY A;  2UUA O;  1MZE A;  1NVP B;  4DRX B;  3OTO B;  3SPJ A;  1QNM A;  3ZHV A;  1SA0 B;  4YXW G;  2UU9 B;  1NVP D;  2IU3 A;  3SYC A;  1WPX A;  3GWK C;  4HNA A;  3JSL A;  5CA0 B;  4PEL A;  5EBL C;  4WF9 V;  3FYE B;  4EB6 A;  2HHH B;  3QTC A;  1B04 A;  1OZ0 A;  2EIJ B;  2Q8V A;  4XDL A;  5JH7 A;  4DR7 B;  4TV8 B;  2Z5U A;  3CYO A;  3JAM N;  3B8M A;  2Z3Y A;  1YDX A;  5CMU A;  2DYS B;  4O2A A;  3HKD A;  4ZOL A;  3T1H B;  1N33 O;  3CSX A;  1NTM H;  5F2V O;  3C3S A;  4J9Y B;  5EYP A;  2ATK C;  1J5E B;  3JAT A;  4CH6 A;  1N34 O;  4NTW A;  3K0D A;  3OMI B;  1TVK B;  2GUZ A;  1SQX H;  3J81 N;  2F93 B;  2E5L O;  4JI7 B;  3CMA V;  4GCZ A;  3AG4 B;  2YS8 A;  4GZR B;  2GDS A;  3QO5 A;  1FXK B;  1XL6 A;  2EIN C;  5EC2 C;  5LP6 A;  1FPO A;  4X64 B;  2BTQ A;  2BOC C;  2BTO A;  4ZIB A;  2LGW A;  4I4T A;  2NNU A;  2F66 C;  5LYJ A;  1IXB A;  4GX2 A;  4AI8 A;  3LSU A;  4DR6 O;  5TIS Z;  3U10 A;  4XBF A;  4J9Z B;  4DO2 A;  3N27 A;  3F7V C;  1R1B A;  5DED A;  4N23 A;  4WFF A;  1AB3 A;  4DV7 O;  2P6J A;  4TUY B;  1VQL V;  1GM7 A;  2QM4 A;  5B1B B;  1SS3 A;  4FLZ A;  4B08 A;  4KHP O;  4K8Z A;  4LF4 B;  2ADP A;  3IJ4 A;  3SPG A;  3EVK A;  4BW5 A;  3JAL A;  4JI5 O;  5EBM C;  5CB4 A;  1S0V A;  2HEP A;  3BY6 A;  2FB5 A;  2H94 A;  1HNW B;  2JRI A;  3E8H A;  3ABK B;  5KA6 A;  4CH5 A;  3DXR A;  1OHH G;  5LBQ A;  5KUM A;  1XDC A;  3BRC A;  2HG5 C;  4U7N A;  3Q4H A;  4ZHQ A;  2F43 G;  4FZ0 A;  2ZE7 A;  3M99 B;  1M90 W;  2ZR2 A;  2X6A A;  4DR1 O;  1XMQ B;  3FYI B;  3VOU A;  3TK1 A;  4DRX A;  1SA0 A;  3ABL C;  2IJI A;  3CCM V;  2EBO A;  4KXR A;  2GSM B;  4TQF A;  4FIP C;  3TXS A;  2WA3 A;  1UJW B;  1FD9 A;  2ZCE A;  4H13 B;  4JV5 O;  2ZXW B;  5CA0 A;  3QG5 A;  3D36 C;  2HVJ C;  4JYC A;  2VQE O;  1DF5 A;  4DUY O;  4O4L B;  4NXN B;  2ARH A;  4TV8 A;  1NTK H;  4TOI A;  5CBG A;  2Q67 A;  4D7T A;  1Q5O A;  2UUA B;  2AGA A;  1DLB A;  1Y6X A;  2ZE8 A;  4MW3 A;  4FLW A;  3STL C;  3K5L A;  2ILM A;  4B7K A;  1P49 A;  4CZZ A;  3ZJZ A;  1NKD A;  1I94 O;  1TUE B;  3U0Z A;  2E75 B;  3CCE V;  1BQZ A;  2YXY A;  5L3F A;  1RSO B;  1OCR B;  1EBO A;  1TVK A;  3UT5 B;  1KUQ A;  3O9O A;  4UCU A;  1EZJ A;  4LC1 A;  1JR9 A;  2JS5 A;  4HYO A;  4KFM A;  4GX1 A;  1N36 O;  4ZBM A;  1JMK C;  1PKX A;  4U7O A;  4DXW A;  1AJN A;  1FXK A;  1RM1 B;  2QDO A;  4IYI A;  1ROP A;  1I08 A;  4KL1 A;  2L6L A;  4LBE C;  4H37 A;  4MS2 A;  2QSA A;  1F7Y A;  1R3K C;  2OTL V;  4B3M O;  1A32 A;  1YTF B;  5HFL A;  3ML0 A;  4WBN B;  2DW4 A;  4TUY A;  2IM9 A;  2DYS C;  4NKG B;  3A0H Z;  2IW5 A;  1YTF D;  2UXC O;  1K33 A;  2OTJ V;  2VQF O;  4I0X B;  1V9P A;  4JTD B;  3CRC A;  1ORQ C;  3L70 H;  1L1F A;  4DR2 O;  1SQV H;  4J7J A;  4G2K A;  2QM8 A;  1XL4 A;  4X1I B;  3K04 A;  1XHZ A;  1XUQ A;  4FFB B;  1Q43 A;  2V1D A;  3HKC B;  4NR1 A;  3OFN G;  1QVF U;  4OGQ B;  3VQV A;  2XAH A;  1VF6 C;  4WFA V;  2LJ2 A;  3K58 A;  4QJF B;  1UFI A;  2B9Z A;  3L9D A;  1IBL O;  5IYD O;  3JD2 A;  4FLV A;  2W0F C;  2PY5 A;  4LF7 B;  4B3S B;  1NU1 H;  3TET A;  2JDI G;  1EN6 A;  4O4L A;  1GMG A;  2DOS A;  3ZS8 C;  4FLU A;  2WLM A;  4PI0 A;  4LF5 B;  3ASN B;  1H2M A;  4LR3 A;  2DWE C;  3L72 H;  4Z2W A;  2ZM6 O;  3CWB H;  3OAA G;  3E22 B;  4DV3 O;  3QO7 A;  1OCO B;  3B40 A;  4LFC O;  3WB0 A;  1Z5W A;  1RSO A;  4JV5 B;  3ETQ A;  4JI1 O;  2B5U A;  5H2F Z;  3UT5 A;  1FKA O;  4X89 A;  4JYA B;  3WB2 A;  1AP6 A;  1BL8 A;  1WA8 B;  1G8M A;  2JEU A;  2PI5 A;  2VQE B;  2UUB O;  1VQN V;  3ABM B;  1IBM O;  3LDD A;  2QJ1 A;  2DJV A;  3M7M X;  4UVC A;  1VF5 B;  5FPO A;  2ZXW C;  3D3Q A;  4IIJ B;  3CE2 A;  2LQT A;  4F4L A;  2JGU A;  4X20 B;  2QTS A;  3KCY A;  4X62 O;  3ASO B;  1I94 B;  2Q7H A;  5BR8 B;  1DTO A;  3SR2 C;  4WBN A;  1KC8 W;  2Y48 A;  2DYR B;  5BY1 A;  1S77 D;  1OJH A;  3QF7 A;  4B3T O;  2Q6A A;  5KHG A;  1NZ6 A;  4PHZ A;  3B2E E;  1QU7 A;  3W7S A;  3OTO O;  2V4D A;  4JTC B;  3G80 A;  4DV4 B;  2KKW A;  4I0X A;  4P9O A;  1OCR C;  5H5N A;  2UU9 O;  2B1G A;  4WFH A;  2OIG A;  1WP7 A;  1GN2 A;  3ZN1 A;  3QO8 A;  1TAE A;  4KP4 A;  5IDJ A;  2QM7 A;  1YSC A;  4X1I A;  4J7K A;  4EFB A;  1E1Q G;  4OPA A;  4FMT A;  1RM1 C;  3BA8 A;  4P2Z A;  4FFB A;  1D5A A;  4P9P A;  1ZWI C;  2HFE C;  4BAY A;  2B1I A;  4X65 B;  3HKC A;  5DM6 V;  4DR7 O;  1V54 C;  3CXC U;  1IZ3 A;  3LSQ A;  2UXC B;  3T1H O;  1LUW A;  4DR4 B;  4DW1 A;  4N21 A;  2QTO A;  3UM7 A;  2IBZ H;  1JA8 A;  1KD1 W;  3BA9 A;  1D2D A;  4HAM A;  1ZUQ A;  4YJ2 B;  2PYJ A;  3RN4 A;  2Q5Z A;  1OV9 A;  3CPW U;  4JI7 O;  4FM1 A;  1GKF A;  4UCT A;  2VWK A;  1HW7 A;  4X64 O;  1Q3E A;  2A9H A;  1PL0 A;  2WLI B;  4IL6 Z;  4GKJ B;  4FVM A;  3IC7 A;  3HKD B;  4JI8 O;  5LMN B;  3D8C A;  1F23 A;  2CTR A;  4YY3 O;  3E22 A;  2OIE A;  4LFB B;  3HKB B;  5EC1 C;  4WCE V;  3B4S A;  2P90 A;  4MTX A;  5K1X A;  1YZB A;  3W7U A;  3JD4 A;  1PD3 A;  5B1N A;  1I5Y A;  2A79 B;  1BMF G;  3KKY A;  2ZQM A;  4J11 A;  1GK9 A;  4O4J B;  4FLY A;  5C93 A;  3CJH B;  1WA8 A;  2ZNJ A;  3P30 A;  5GTH Z;  4MVR A;  2F23 A;  3X2Q B;  1TUB B;  2LO1 A;  4LF4 O;  1RFY A;  4YJ3 B;  1GO3 F;  4EEQ A;  4FLX A;  3ZCC A;  4FFK A;  4IIJ A;  1YIJ V;  1HNW O;  4GLX A;  1F4N A;  2CDY A;  2WA4 A;  5FNV B;  2XAF A;  2IH1 C;  4X20 A;  1YIT V;  4DV3 B;  3CCL V;  1IX9 A;  3AK1 A;  5EZY B;  4TQD A;  3HKE B;  3P32 A;  1YJN V;  2BSK B;  5L3G A;  1PV0 A;  3VQW A;  4J42 A;  3ASN C;  1Q6H A;  3WB1 A;  1R6T A;  3SJQ C;  1PNL A;  4QGP A;  1GH6 A;  2WLL B;  2G38 A;  3E83 A;  3UO2 A;  2E74 B;  1G6U A;  4YIO A;  2RDC A;  2QWN B;  3EXA A;  4JAU A;  3IAY A;  4JF3 A;  5L3B A;  2CGO A;  2X0L A;  2LFR A;  4HZ3 A;  2JJ2 G;  3HB3 B;  4X62 B;  2R9I A;  4IYH A;  3JCU Z;  4PA6 A;  1KBH A;  3B8N A;  4NXN O;  1OCC C;  2UXD B;  1W0K G;  2OYQ A;  4C7U A;  4I9Q A;  3JSN A;  1U97 A;  3JYC A;  2OWO A;  3F5W C;  4RAI A;  1E79 G;  1Y76 B;  2HLD G;  3ASO C;  5CA1 B;  4I7Z B;  5EIB C;  2N04 A;  1KQS U;  1VIB A;  1URF A;  1AI5 A;  3RVZ A;  2Y0P A;  1EM1 A;  2FML A;  5FPR A;  1VQO V;  4DK0 A;  3F5T A;  3ZMT A;  2JGD B;  4MVU A;  4YJ2 A;  4JI3 O;  1S5H C;  2Y69 B;  1SET A;  3I5D A;  2ITD C;  1K5Q A;  4Z1V A;  3H01 A;  3ZBH A;  4PA3 A;  1OCZ B;  1S5L Z;  4FZ1 A;  1K4D C;  2H8P C;  2DWD C;  1SC5 B;  2WLI A;  1GM8 A;  1Q7Y W;  1I0H A;  1QLE C;  4FJC C;  3OE7 G;  1MSD A;  1GN3 A;  4D6T H;  4G28 B;  3HKB A;  4FK5 C;  1YJ9 V;  3WG7 B;  4X66 B;  5CA3 A;  1B3Q A;  4J41 A;  4QPJ A;  3QVN A;  3K9S A;  2CAZ C;  3MD0 A;  3N2G B;  1I5X A;  1M93 A;  3L73 H;  4O4J A;  3CJH A;  5KAI Z;  1THZ A;  1M56 C;  1TUB A;  2QWR B;  4ICG A;  1SQQ H;  2CGN A;  4YJ3 A;  2GTA A;  4DV2 B;  2UUC B;  5CN0 A;  2WPD G;  1ARO P;  1CXZ B;  4LCU C;  4YIP A;  2WAM A;  4O2B B;  3RYC B;  3OD4 A;  5FNV A;  4JI8 B;  1Q6I A;  1XNR O;  4H44 B;  4FPP A;  4YY3 B;  4MVQ A;  1YJW V;  2R70 A;  2HVK C;  5EZY A;  2ZIM A;  3BEH A;  3HKE A;  2V7Q G;  2BSK A;  1AI4 A;  2FTK A;  1MSW D;  2CK3 G;  1KB9 F;  1H8E G;  5CBF A;  1UPG A;  4G27 B;  3APO A;  4DK1 A;  1EN5 A;  3ETE A;  2WLL A;  5ITZ B;  5GTI Z;  3AG1 C;  3BCC H;  4PA7 A;  5IJ0 B;  3ZHU A;  4K8X A;  3ZRS A;  3CCS V;  2AW9 A;  2YEV B;  4UVB A;  3ZMZ A;  4X9Q A;  2CTP A;  4EKW A;  1S76 D;  4X1K B;  1P4R A;  5EBW C;  4LF7 O;  5LP6 C;  4B3S O;  4U3J B;  3OR7 C;  1P84 F;  1VP7 A;  5LL6 Y;  3RW0 A;  3STZ C;  2EJ7 A;  1Q82 W;  3ZRW B;  1K8A W;  1QLN A;  2VS0 A;  4W4K A;  4LF5 O;  1GAX A;  1VEW A;  4UVA A;  1Y76 A;  4RUE A;  5CA1 A;  3AK3 A;  3ZHR A;  3AG2 C;  3MHS C;  1Z5V A;  1L0N H;  4OXS A;  3ZHT A;  1RP3 B;  3OEE G;  3S3W A;  1MOF A;  4JI4 B;  1JFF B;  2JGD A;  3FB7 C;  2PZS A;  4JYA O;  4RQF A;  1FJG B;  2EIL B;  3OT7 A;  5IY5 C;  4PA9 A;  3GWO A;  5B66 Z;  4QE7 A;  1P7B A;  1K34 A;  2A06 H;  4RQE A;  1I7F A;  5IYZ B;  3C90 A;  2LW7 A;  3S3X A;  4DV6 B;  4B3R O;  3SYO A;  3K9A A;  4PDM A;  3WFV A;  1XOU A;  3ZHS A;  3A2F A;  3L71 H;  1YHQ V;  2VWJ A;  1XNQ B;  4PA4 A;  1AR5 A;  4JI2 B;  3CME V;  1XQ8 A;  2W6J G;  1NR7 A;  5BR8 O;  1Q6U A;  2XTA A;  3FKS G;  3T1C A;  2Q69 A;  1XMO B;  4OX9 B;  2QKS A;  3GB7 C;  2YIA A;  3N2G A;  4LF6 B;  4IT5 A;  4JI3 B;  5KHK A;  4WFB V;  4LF8 B;  4KUM A;  4AIL C;  1VQ4 V;  2QWQ B;  3E8B A;  4DV4 O;  3WU2 Z;  1PM9 A;  3CC7 V;  2EZP A;  1IUR A;  4JZG A;  4X1Y B;  4JTA B;  4PJ0 Z;  3TCU A;  1VF7 A;  4O2B A;  3RYC A;  4XDJ A;  5BXZ A;  4DV1 O;  1WAZ A;  2ZDI A;  1KKC A;  2EIJ C;  3CRQ A;  2YI9 A;  4CS3 A;  3HR0 A;  2WWW A;  2P22 C;  4I9W A;  2Q73 A;  1L0L H;  1WN7 A;  4X65 O;  3T4D A;  3CD6 V;  1L8D A;  1NS1 A;  4PDL A;  2WLH A;  4IGG A;  3NXS A;  1U96 A;  1HP8 A;  2JVD A;  2EIM B;  4AQY B;  3WG7 C;  5ITZ A;  2QKC A;  2WLK A;  4DR4 O;  3T1Y O;  1FYJ A;  5IJ0 A;  2H3O A;  3RWR D;  2F95 B;  3ZED A;  2PGG A;  3F7Y C;  5KX5 B;  3FB8 C;  4JYY A;  1P7G A;  1HNZ B;  3OMN B;  2YEV A;  1XNR B;  1AI6 A;  2JK5 C;  3G6B A;  3AG4 C;  1JQ0 A;  3SPH A;  5IT9 N;  1K3E A;  4NXM B;  4X1K A;  1FXK C;  2P4V A;  2YUA A;  5LGT A;  4U3J A;  3K08 A;  5B1O A;  1H2N A;  5JWP A;  3ZRW A;  2YDE A;  3CC2 V;  4UB8 Z;  2ZDI C;  5DEC A;  4GKJ O;  5LMN O;  2OCC B;  1GN4 A;  1TA8 A;  2F1M A;  1K9M W;  4NYK A;  4LFB O;  4K0K B;  1R73 A;  3GVM A;  2Q68 A;  3LUT B;  4TT3 G;  5B1B C;  3UKM A;  1O9H A;  3CCV V;  1JFF A;  2VRZ A;  1SQF A;  3VBB A;  3SPC A;  3UO3 A;  4JI0 B;  4Z1M G;  2RMK B;  3W7W A;  3JAW B;  5IYZ A;  1PP9 H;  1BQ0 A;  2FL4 A;  3W7T A;  1NH2 B;  1QR9 A;  1QQC A;  3ABK C;  1S5J A;  4E4E A;  1QHT A;  4MT8 A;  1GTO A;  2QE7 G;  2DN9 A;  1VAR A;  1NH2 D;  3CCJ V;  5L3D A;  3K57 A;  3SYP A;  1K92 A;  1H2L A;  2EZO A;  1QCE A;  1BZK A;  5E79 Z;  2NLJ C;  2YID A;  1SQG A;  3B09 A;  2O57 A;  3RBZ A;  1WPB A;  1MAB G;  3ZRX A;  4CH3 A;  1WLE A;  4XDK A;  2CTW A;  4B3R B;  4X1Y A;  5LGN A;  2DQ0 A;  5LMU B;  1MZF A;  1VQP V;  2QWP B;  3G6E V;  3AG3 B;  1O9G A;  2ZR3 A;  1PPJ H;  4Q20 A;  4H0L B;  5JCO A;  2P67 A;  1WNS A;  1WP8 A;  2UXD O;  1NBM G;  1NQT A;  2X7R B;  5JQG B;  2RJZ A;  2ODM A;  2Q0O C;  1KMI Z;  3ZIA G;  1E1R G;  1M9N A;  1JCH A;  4BR6 A;  3IFX A;  1CPY A;  4I50 B;  5KX5 A;  4PDR A;  1YXB A;  4RWU A;  4K3A A;  2Y0I A;  2M6Y A;  4DV1 B;  5GW7 A;  4ASU G;  2P5O A;  1K73 W;  2Q0A A;  3DGE A;  2D3O W;  3OGC C;  1SZX A;  1MA1 A;  1FAF A;  2Q4P A;  3BAA A;  3ABU A;  4R7C A;  1CP9 A;  4LF9 O;  3OTF A;  5GON B;  3T1Y B;  4ABM A;  3ZMS A;  2PUS A;  1MNG A;  2YIB D;  4F6R B;  4X66 O;  1QBZ A;  3O65 A;  1F4M A;  3OM3 B;  5AG2 A;  1R3J C;  2IH3 C;  1AP5 A;  4HBN A;  3CCR V;  1RPO A;  2AXT Z;  4LFA B;  2D2C B;  1VQ9 V;  2BCC H;  4MVM A;  2MW2 B;  3G71 V;  1YVW A;  5LGU A;  3A0B Z;  2DMX A;  4MVS A;  3JAW A;  4DV2 O;  5B5E Z;  2RNB A;  3HPL C;  1S3J A;  4OPH A;  2UUC O;  4GX0 A;  2EIN B;  1BHB A;  2XAQ A;  4DV0 O;  4J80 A;  5KHI A;  5D5Q A;  1NI8 A;  1RPR A;  5KUK A;  1VQM V;  1DK1 A;  2LW1 A;  3E2E A;  1VQ7 V;  2RN9 A;  5L3C A;  4O4H B;  3ZMU A;  5FL7 G;  1DF4 A;  5FLX N;  1JJ2 U;  2HKO A;  4E2L A;  3FAV B;  2Y4T A;  4BIZ A;  3BHP A;  3DC6 A;  2WLJ A;  3ABT A;  1YEW A;  3OMA B;  1IDS A;  4DV5 B;  2QR4 A;  2EUL A;  3RGB A;  4PD4 F;  1Y4M A;  2LP7 A;  3BVO A;  2ITC C;  2XT9 A;  4X88 A;  5LHI A;  3CB2 A;  1XBL A;  4EFE A;  1R3L C;  1ZTE A;  1HNX B;  3E8G A;  1BS3 A;  1WB8 A;  1FFX B;  4JAS A;  3OW2 U;  1NJI W;  3K06 A;  3R65 A;  1R6N A;  1T5E A;  3UCS C;  5JQG A;  2DE0 X;  3H1J H;  3A8T A;  4MTO A;  4ZKI A;  1OCO C;  2PTM A;  3ABL B;  1AI7 A;  4I50 A;  1KU9 A;  1Y74 B;  1CEZ A;  5H6R A;  3ZHQ A;  4JI4 O;  2ZKO A; 
#chains in the Genus database with same CATH homology
 4U3F H;  2A06 H;  1NU1 H;  1NTK H;  3CXH F;  5KLV H;  3TGU H;  3L70 H;  3L74 H;  3H1L H;  1SQQ H;  4PD4 F;  1NTM H;  2BCC H;  1SQV H;  1BCC H;  3H1J H;  1L0N H;  1SQP H;  1BGY H;  1KB9 F;  1PP9 H;  1L0L H;  1SQB H;  4D6T H;  1P84 F;  1NTZ H;  3L71 H;  1PPJ H;  3H1H H;  3CX5 F;  3L72 H;  3L75 H;  1EZV H;  3BCC H;  3H1K H;  1KYO F;  2IBZ H;  3CWB H;  3L73 H;  1SQX H;  3H1I H;  1BE3 H;  2FYU H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...