3A0BZ

Crystal structure of br-substituted photosystem ii complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
total genus 11
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3a0bZ00
3JCUZ 3A0BZ 4IL6Z 5KAFZ 5KAIZ 5GTHZ 5E79Z 4UB8Z 3WU2Z 5B5EZ 5B66Z 4PJ0Z 5H2FZ 3KZIZ 4UB6Z 1S5LZ 3A0HZ 2AXTZ 5TISZ 5GTIZ
chains in the Genus database with same CATH superfamily
4EFBA 2R70A 5LXTB 4X1YB 4JYYA 2Q5ZA 1FYJA 1N36O 1VF5B 1AI7A 3ASOB 3T1HO 4J80A 1XBLA 3KZIZ 1W59A 2ZIMA 4J7JA 2AZ0A 1OCOC 3JAKA 2Q7EA 1N33B 2PI4A 1QU7A 3GB7C 1N8RW 4R50A 3K06A 5KUKA 4YHHB 1I7FA 1QHTA 3ZJZA 4GYCB 4XBFA 4DK1A 3OT7A 5LP6B 2PF4E 3CX5F 5D5QA 1R3IC 3D3IA 1EN4A 4JI6O 4BWAA 3M7MX 3W7TA 1NT2B 4CS2A 2HJFC 2HEPA 3CB2A 5EBLC 4JI0O 3CCMV 2P06A 4DR7O 1XNRB 3CJHB 3CC7V 4PA6A 4GX0A 2NN4A 1GMGA 3J80N 3L72H 2ZE6A 1N34B 3HKEA 3P3NA 4DXWA 2UUCO 4UCUA 1A32A 3UO2A 4DV6B 4CBCA 4LF8O 4X64O 4NTWA 3ZBHA 3CD6V 4UCRA 3W7SA 5IT9N 1VQLV 3L9DA 2W0XA 3EXAA 1OCOB 4HNAA 2ZM6B 3ZEDA 4X65B 1YIJV 4JTDB 3H1LH 2WSSG 2YIAA 1I94B 1XL6A 3I56V 3RVYA 1U96A 4PA9A 3KG2A 4TWKA 2Q4PA 3H1IH 2ZDIA 2A06H 2YEVB 2ZNJA 2CTRA 1F4NA 2A3QA 1FXKC 3CCRV 3N2KB 3HKCA 2QKCA 3ZMZA 2OYQA 4MT8A 2WLLA 3CRQA 4I55A 4YIOA 2PYJA 3JARB 1S76D 1M4UA 1SA0A 4DR5B 1NJIW 4WFGA 5BZBA 1VF6A 3S3WA 2F4VO 2MW2B 1SRYA 1W2BU 2Q9LA 3BRCA 2K1EA 4LFAB 3H01A 3SPJA 2FKXA 4UFZA 1V54C 4LF4O 3APOA 4X9QA 1J5EO 1AJPA 3VBBA 1AROP 2VQFB 1YCIA 3F5TA 4KXRA 5L3EA 3UQ8A 4X20A 2E74B 5KA5A 1YJWV 1FFTB 3WFVA 4B7EA 1BT8A 2WA3A 4DV3O 1LR1A 2HKOA 1AR4A 3E2EA 4WFAV 4YJ3A 4P2ZA 1L8DA 5IYZA 2LP7A 1FD9A 1H2NA 3PN1A 5HFMA 5LA6B 2QWNB 2O57A 5B1OA 4BIZA 2QWOB 3K9AA 5IJ9A 1XDCA 1PL0A 1MSWD 1E1RG 1FXKB 1YITV 3BABA 5JH7B 3OUSA 1X4TA 1HDJA 3STZC 1XILA 4GKJB 3OMNB 4UXNA 4LP8A 5F2VO 1LNQA 5FPRA 1BZKA 2QTOA 2F23A 2UUBB 5JCOC 2ZCEA 1NR1A 2EIKC 4TUYB 4UUJC 4Z1MG 1MZFA 3W7WA 4DUYB 3H1KH 2RNBA 1K7DA 5CBHA 4ICGA 5FPOA 1Q6UA 1V54B 2HVJC 1FKAO 2PI5A 1VQOV 3QTCA 5JQGA 1VQPV 5KHIA 4UV9A 4FFKA 3K5NA 2QM4A 1VQMV 1H8HG 5BR8B 5IYDO 5B1BC 1AI5A 3R65A 3QO7A 4TV8B 3E35A 1SQQH 5EZYA 2LFSA 3JASA 4DR1O 2XASA 4U7NA 5GONB 4DV5O 3JSLA 3TK1A 3O9OA 2IW5A 4B3RO 1NVPD 3ZS8C 2UXXA 1HP8A 4ZBMA 4LH6A 4IYIA 2Q0OC 1S3JA 4GX5A 4JV5O 3GWKC 3QO8A 4LF7O 4H13B 3WB0A 3OUFA 4MSWC 4FZ1A 1CP9A 2Q69A 4CC5A 4JI1O 4DW0A 4IHJB 1YF2A 2XAHA 2V7QG 3FAVB 3SPIA 4NR1A 3CC2V 4QPKA 3SR2C 5K1PA 3E22A 1N32O 5LGNA 4JYAO 1K5QA 4J9YB 4JTCB 1WP8A 1LUVA 3ZRWB 4U7OA 1MNGA 2EIKB 4F4LA 2D3OW 5KX5B 4G28B 2OCHA 4QJFB 4JYCA 2IH3C 1MMMA 4CH3A 4FFBA 3OD4A 2PTMA 2L6LA 4LFCB 2EZPA 5B1NA 4D6TH 1H2SB 1YSCA 1IURA 4JI8O 4UV8A 4PA7A 4NXMO 2IJJA 5B1BB 1EM1A 1NTMH 2ZDIC 3VQYA 2JS3A 2E5LO 3L73H 4FM2A 4K35A 1AR5A 5C8YB 1Q7YW 5IYBO 1VEWA 2DYSB 1VF6C 3ZHRA 1MG1A 4QGPA 2EX3A 2ZKOA 3R66A 2OWOA 3CYOA 2OCCB 3CCSV 1OV9A 4H33A 2QE7G 4KFMA 4LWSA 4IL6Z 4PI0A 2JJ1G 4Z2WA 2BCCH 3A2FA 3CRRA 3HKEB 3QNEA 1O9GA 1BQ0A 2N04A 3M99B 3LDEA 2HHHO 3WB2A 1KBHA 1HNXB 4DR3O 4CZZA 4JI2B 2RN9A 2UXBO 5H9CA 2GTSA 3LUTB 4JAUA 2QTSA 4X89A 1IBKB 4IGGA 3K79A 3MHHC 1ZTEA 4HNAB 1HNZB 4ZHQA 3JD0A 1KB9F 5H6QA 3CE2A 3IJ4A 2IH1C 3AEIA 2JRIA 1XI1A 2Q8VA 1BHBA 4LFBO 3LDCA 3HKCB 5FL7G 4LF5O 2B5UA 4LH7A 1XUQA 2XHBA 4I55B 1E1QG 4DR6O 4GUNA 1SA0B 1F4MA 3SJCC 4I9WA 2ZIOA 4JASA 1IBLB 5J2UB 2QEXV 1XMOB 3F5WC 1K4DC 4EFEA 1K34A 5B1AC 1RFYA 1VF7A 2N05A 1RPOA 2Q7HA 4FK5C 4MTGA 4NTYA 1VQ5V 2UXCO 4CH4A 3BVOA 2DOSA 4FM1A 3A8TA 4W4LA 2DE0X 3ICXA 4X20B 3RYFB 2KG7A 3FFQA 1ZLZA 1QQCA 1GRJA 5GTIZ 4IIJA 3OFNG 3OAAG 3C3SA 3JCUZ 5A9GA 4U3FH 4DR2O 2YXYA 2L35A 1MZEA 4YJ3B 5IYZB 2AW9A 4JZGA 4I4TA 2GUZA 3N27A 2IJHA 3E8GA 1US6A 2LW1A 3B2EE 3OMIB 1XMQB 3FX7A 1AP5A 4B7KA 5IJ9B 5IY5C 5KHJA 1Z5WA 3SPCA 1PD3A 2CUGA 2CH7A 4LNUA 4B3TO 4XDJA 3DC6A 2ILMA 3LSUA 2F43G 3ETQA 1P7GA 5IJ0B 1R6KA 1VARA 1S5JA 5B1AB 4X66O 1S5LZ 1KP3A 4OPAA 2Y0PA 3ZN1A 2Q73A 2LW7A 5A2QN 1VQKV 4MVSA 4FLZA 1M56B 1N0NA 1N36B 4P9PA 3T1HB 3J81N 3K57A 4ABMA 4WFEA 2QA4V 2QM7A 3ZRSA 3ZMUA 1Y74A 5H5NA 4DV7O 3N2GA 1UFIA 4B3SO 3ETDA 2IJKA 3TJTA 3OR7C 5IE9A 3FB7C 5EZYB 3JASB 3E86A 4I7ZB 1L1FA 4OGQB 4WBNA 2DWEC 4UVAA 2HG5C 3Q4HA 1I5YA 1V55B 3OW2U 2MK3A 3ML0A 4KP4A 1K92A 4DUZO 4ZOLA 3MHSC 3C3TA 3ZRVA 1NR7A 4O4LA 4A5UB 2NLJC 4EKWA 5LMNB 4JI6B 4FZ0A 3ZN0A 1MOFA 1YEWA 1OCCC 4KL1A 5IY5B 4BW5A 5L3DA 2XT9A 4DR7B 2JEUA 4H44B 2DQ3A 5BXZA 1OCRC 2YI8A 5IWAO 3E22B 4I0XA 3W7XA 2Z0AA 1COWG 4NTXA 3CCVV 1EZVH 4PDLA 4RQFA 1OJHA 1HR0O 2W6JG 4XDLA 2YUAA 3T1YO 3AG2C 2UUCB 4L8JA 4YY3O 3P3PA 4O2BA 1PV0A 2HVKC 4FFBB 4LF8B 4X64B 3CPWU 2VWJA 2QWRB 3AK2A 1X59A 2LJ2A 3CS5A 3DSQA 1P49A 5DEDA 1PNLA 4HYOA 2RDCA 3I55V 2ZNIA 3T2MA 2KSDA 2A9HA 5KMGB 1RSOA 2NNUA 1W0KG 1YZBA 1U97A 1NU1H 4CS4A 1FAFA 3FB5C 2ADQB 4MW8A 5JVDA 2ZR2A 2ATKC 3ZHUA 4WFBV 1JR9A 2IU3A 1PNMA 4DV4O 2H3OA 1SZXA 3HR0A 3F7VC 5EYPA 1PKXA 2F4VB 1L0LH 1SQPH 2Q7GA 2YXHA 5L3CA 3ZHSA 4OPHA 3ETGA 5ITZA 4JI7O 4D7SA 3BEHA 2ZINA 2AHZA 1VMGA 3AG2B 4LF4B 3OTOB 1J5EB 1TA8A 2VRZA 1N33O 4NKGB 1XEQA 4O2AB 4FVMA 3ABMC 4ZHQB 3PJSK 3MD0A 4OX9O 2XNDG 4MVRA 5JWPA 1BQZA 1SQFA 4DV3B 2IM9A 4F6RA 3JSNA 1W0JG 4PDMA 4CC6A 1ENVA 2PUSA 2ZQMA 1DTOA 2Z3YA 4BIUA 3RBZA 1SQBH 3AG4C 2Y4UA 1FXHA 1YDXA 1QLEC 4Q6GA 5KHKA 4R8CA 2PYLA 1GM9A 2CK3G 1VP7A 4I5SA 2OIEA 4FM0A 2F66C 2Q67A 5LOVA 2DW4A 3KKYA 3JD1A 1GO3F 3SYOA 3ZHVA 2KG7B 1JOYA 4UCSA 3SPGA 4O4HA 2B1IA 4K8XA 4IIJB 3OM3B 2X6CA 4LCUC 5JJEB 1Y76A 1HNWO 3LSSA 3A0HZ 5CA0B 1HW7A 3ABMB 2GDSA 1SQVH 4U3JA 4I9QA 2RJZA 2GUZB 1ZL8B 2WPDG 4DW1A 2UXDO 5KAIZ 4UCOA 3FB8C 2H8PC 2WLMA 4MS2A 1ZWIC 4DR1B 5EC2C 3HKBB 1WNSA 4DV5B 2ETNA 1XL4A 4W4KA 4B3RB 3L71H 2YSUB 5LMUO 1K4CC 3ZCCA 1Q81W 4JI4O 3KCXA 1AP6A 2CH7B 4UB6Z 4LNUB 5J9PC 3DXRA 4I50A 1VQ6V 4JV5B 4FLVA 1M93A 4DRXA 4FLUA 4LF7B 3AG4B 3SGIA 1IZ3A 1XHXA 1F23A 1QLEB 4JI1B 1IX9A 1BHAA 4PDVA 3U0ZA 2BOCC 3X2QC 1DLBA 4X1IA 2IJIA 4HZ3A 2QJ1A 1N32B 4JYAB 1KC8W 1SERA 1AI6A 5DECA 3AK3A 1ZSPA 1YVWA 2BSKA 2HLDG 3U10A 1GTOA 4FLXA 1Y74B 4Z1VA 4DV1O 3N2GB 1VQNV 2XAFA 2VS0A 3QVNA 2YS8A 4RO2A 1XNQO 3FKSG 3JAWA 4JTAB 5LGTA 1EN6A 3JALA 1BMFG 2EZOA 2Y69C 2WLNA 1T5EA 4WBNB 4JI8B 3K3WA 4J9ZB 3Q4HB 4BAYA 5CB4B 4NXMB 3ABTA 4EB6A 1M5IA 4O4JA 2WAMA 1UJWB 2UUAO 4RUFA 2IBZH 1MSDA 1D5NA 1SQXH 4EEQA 4AILC 4O4LB 3HB3B 5GTHZ 2M6YA 3T4DA 3VQWA 1VQ4V 1YTFD 4ZIBA 1WN7A 2FTKA 2R9IA 3OGIB 1QCEA 2GHYA 3EHBB 1JJ2U 2CTPA 4FPPA 2N74A 4K8ZA 4I0XB 2UUBO 1TUBA 3BFRA 4JI3O 3K0GA 4OXSA 3SPHA 1AJNA 3FD9A 4YJ2A 4JPRA 3ABLC 1JQ0A 4DUYO 2HHHB 4O2BB 3X2QB 3RT3C 1GN6A 3JAKB 1O9HA 4GX2A 2ZE5A 4TQFA 4DR3B 1CPYA 2E76B 2P22C 3E8FA 3ZMTA 4MVMA 4YIPA 4IT5A 3LDDA 4PA3A 2UXBB 2EULA 1JMKC 3SJQC 3CRMA 4QPJA 5B3SC 1YI2V 4HBNA 2ITDC 3H9VA 1JJOA 5E1AC 2WLKA 2XOKG 2A7WA 2CTWA 3JD3A 4UB8Z 1RSOB 2BTQA 5EK0A 1G8MA 4LR3A 2Y69B 2P5OA 1Q3EA 2EILC 5D5PA 4DYLA 2ZT9B 2CDYA 2QSAA 5JVDB 4RUEA 2XAJA 3CP1A 2LFRA 2QM8A 4LFBB 4LF5B 3QO5A 3RYHA 3U11A 3DC5A 3ZX6A 4DR6B 5EYPB 2EJRA 3HKDA 2BTOA 3RGBA 3K58A 1H2GA 5EIBD 3WB1A 4X62O 1SC5B 4XDKA 5CMUA 5ITZB 3CXHF 3ETEA 4LBEC 4Q20A 4DV0O 3ABLB 1K33A 2VQEO 4BW9A 2UXCB 3WU2Z 4X1KA 2UU9O 2QKAA 4R7CA 4NYKA 2DWDC 1KD1W 1TUEB 4KHPO 2ZD9A 2RMKB 2GSMB 2W6IG 5EBWC 1QNMA 3CMEV 5B3SB 2HP8A 1TVKA 4LF9O 4DO2A 1UPGA 3TXQA 2WWWA 4DR2B 4DV2O 4F6RB 1SESA 2WLLB 2OIGA 3D36A 1G4YB 1NVPB 1Y4MA 2EILB 1Q5OA 3D3QA 3SYQA 2DYRC 3G67A 2XUMA 4FMTA 1YXBA 1N4CA 4AQYO 2YEVA 1VIBA 3O65A 3JATA 5BY1A 4E2LA 1GH6A 3OEHG 4X8AA 2NR5A 2BOBC 3K5MA 3FYIB 4B3TB 3I5DA 1FFXA 4N23A 3IC7A 4JF3A 3ABKC 1V9PA 4NXNO 3WG7C 5EIBC 2QWQB 3B8NA 4LF6B 5LOVB 3EFFK 1F7YA 4X66B 3B77A 4TOIA 1G1XB 3SYCA 1Q43A 3G6BA 4O4HB 1YHQV 1NQTA 4P30A 1EN5A 1NZ6A 1YJ9V 2Q0AA 4G27B 2OTLV 2E75B 2X7RB 1B06A 3JYCA 2Y48A 5L3FA 5AG2A 1E79G 4DV7B 4U3JB 4B3SB 4K3AA 3TCUA 4CH5A 3FYEB 3CCJV 1Q8IA 1KQSU 2DN9A 5KUMA 3W7UA 2R72A 2EBOA 1IBMO 2ZR3A 2GBOA 1M57C 4TT3G 2M7WA 1R3JC 4DUZB 4JI5O 4J7KA 4GKKO 1GN4A 1PL4A 1AVMA 1ORQC 4I50B 5CA1A 1SKVA 2DYRB 4JGSA 1VQ8V 1TGOA 3AK1A 5JH7A 1OCZC 4RWUA 3SYPA 5IWAB 1H2LA 1IXBA 1RP3B 3ABKB 2GTAA 5JQGB 1QVFU 3ASOC 3WG7B 1HR0B 1WB8A 3T1YB 1H8EG 4GT1A 4MVQA 1SS3A 1DF4A 5LHHA 3CXCU 2BSKB 4YY3B 3OGCC 3B40A 2AHYA 3CRCA 2YC0A 4KUMA 3JAWB 4MVUA 2ZE7A 1K97A 3JD2A 3G71V 2WA4A 1WPXA 1Q86W 4IYHA 3K0DA 3CCQV 4B3MO 1P4RA 4EB6B 4O4JB 4TV8A 1KECA 2KKWA 1TAEA 2CTQA 3K9SA 4DR4O 1M9NA 4H37A 4JI0B 3NXSA 4FLYA 1GN2A 1H38A 4YXWG 1M57B 4K0KO 1H2MA 1Q6HA 5LBQA 3FB6C 2D2CB 3LNMB 4RQEA 1TUBB 4N21A 1XREA 3MDSA 1Q82W 1WB7A 4IHJA 4DV4B 3K5OA 2B9ZA 3FAVA 1OCZB 2LO1A 1FJGO 1BS3A 3BA9A 1NKDA 3GWOA 1NTZH 2DQ0A 2RCVA 5JCOA 3ZRWA 2ZXWC 4JI7B 2P67A 2JGDA 5KX5A 2YIBA 3IAYA 3SDLA 1QR9A 2QR4A 2JS5A 1Q6IA 4JAVA 1Y6XA 5EBMC 3UCSC 1B3QA 3KCYA 2BTQB 5DN6G 2IU0A 3ZHQA 3D36C 4O4IA 4OX9B 1Y67A 1GN3A 2QDOA 2FMLA 2WLHA 2EIJC 5L3GA 2F1MA 5LMNO 4WFFA 1PM9A 1JFFA 1OCCB 4LWSB 3RYHB 2EINC 1WLEA 5C8YA 1AR1B 3P30A 5J2TA 1OCRB 3SJAC 2B1GA 3CRAA 3HKDB 2HJDA 3RYIA 3BY6A 2YICA 2HR3A 1DF5A 2JVDA 4MTOA 5CA3A 1ROPA 1XHZA 2LGQA 4MW3A 2Y0IA 5H6RA 1L0NH 2DMXA 5CBGA 5TISZ 3K5LA 4WF9V 5L3BA 4X1KB 5IDJA 1GM8A 2ZXWB 4YHHO 1P84F 3CCEV 1MABG 1XOUA 4NVPA 3E89A 3J7AU 4X88A 3JCZA 1EZJA 1TVKB 5FNVA 4J11A 1FS0G 1HNWB 1WJZA 3TGUH 3BHPA 1BSMA 4GLXA 3P32A 1XNRO 4PHZA 2UXDB 2R9AA 4FJCC 1FXVA 2JEXA 3E8BA 4JYBA 2EIJB 5IYCO 5LYJA 1NBMG 1IXMA 3QG5A 1GM7A 2Q68A 3JATB 1FPOA 5LMUB 4JI4B 3CC4V 4HAMA 1N34O 2X6BA 1R6TA 2EINB 1ZUQA 4QIWF 1FFXB 4FIPC 3OR6C 4DV6O 1IDSA 1K5SA 3ZRXA 4PI2A 5J2UA 3JD4A 2OT5A 3CCLV 5JJJB 2YIBD 3K04A 2CAZC 1PP9H 2G38A 1CEZA 1KKDA 4MTXA 3OTOO 3RWRD 2ZM6O 4L87A 1PPJH 1BCCH 1URFA 2AXTZ 4X65O 4AHCA 5KA6A 4I4TB 1D5AA 4TV9A 3RYFA 1I94O 4DV1B 2QWPB 1H2KA 1XNQB 3DTUB 4PDRA 2OTJV 3RYCA 3G4SV 1OHHG 3BA8A 5DM6V 2PZSA 1WA8A 2UUAB 4DR5O 1AB3A 5K1XA 5CA1B 1DGSA 5CN0A 3A0BZ 3L74H 4JZ2A 2YI9A 2GV9A 1JX9A 2WLIA 5E79Z 3K08A 4LFAO 2BE3A 3OE7G 4LC1A 3D8CA 3IFXA 4UVBA 3AG3C 3VQVA 4J7ZA 1KU9A 3SJBC 1B6QA 3BPZA 4J10A 4JI3B 2VQFO 1IVSA 1WAZA 1AJQA 5IJ0A 5EC1C 2A79B 1GKFA 4ZI7A 2JK5C 1F51A 1P7BA 2PGGA 1Z2GA 1KUQA 3F7YC 1OZ0A 4PV1B 1JA8A 2LGWA 1THZA 5LHGA 1MA1A 2YXLA 4PELA 3UT5A 1HWYA 4MVZA 3ZIAG 3CWBH 2X6AA 4ZOLB 4CS3A 2C2AA 2ADPA 5JJNB 2E5LB 4MVOA 1GAXA 1KMIZ 3CEIA 5B66Z 3EVKA 1G6UA 1RPRA 3CCUV 2DYSC 2K9PA 4GKJO 4JAAA 4CH6A 1LUWA 4B08A 1CXZB 2JGUA 2ODMA 4RAIA 3E83A 5KHHA 2OCCC 1KYOF 3K59A 1EBOA 1ZAUA 2XAQA 3ZHTA 1SETA 1R73A 3GVMA 5BMVA 2FB5A 5HFLA 2HFEC 3L70H 3THOA 2FYUH 3LSQA 3BAAA 3AG3B 4J41A 2DJVA 5LXTA 3AG7A 4X1YA 4WCEV 4GCZA 2XTAA 2JDIG 2AZ2A 4X62B 1XQ8A 1VQ7V 2CE4A 2KB1A 2YDEA 2JGDB 1I5XA 4DV0B 4GZRB 2CGOA 1Y66A 5BR8O 4QE7A 2VQEB 2UXNA 1SQGA 3CSXA 2UU9B 3T1CA 3RN4A 4MTFA 4KHPB 2RQ6A 2P6JA 5LGUA 4O4IB 2R9RB 5LP6A 1QVGU 3NR7A 2Y4TA 3IC9A 1JPXA 2P90A 2VWKA 4LF9B 1NH2D 2E3CA 3ZMVA 4DV2B 2W0FC 5KMGA 3MAQA 3E8HA 5KAFZ 4C7UA 1JFFB 2JJ2G 2V1DA 2EIMC 3TXSA 4UCTA 1I0HA 2QKSA 3G80A 3CJHA 3IGAC 5J2TB 3G6EV 4BIOA 1AILA 4AQYB 1KP2A 3RYIB 1R3KC 3ASNC 2Q6AA 1NTKH 2ARHA 1AI4A 5LL6Y 4J42A 2PY5A 1M1KW 3RFRA 2F93B 3AG1C 4QE9A 1NI8A 4NXNB 3OMAB 4UCVA 3B09A 4LFCO 2A0LA 1R6NA 1J95A 2CGNA 3VQXA 4UVCA 1S77D 1K73W 1EFRG 3DGEA 3B4SA 5FNVB 4ZKIA 4O2AA 4D7TA 1RM1C 3QF7A 5GW7A 5CBFA 5KHGA 1SZTA 2WLJA 3H1JH 2H94A 4ASUG 5LYJB 3N2KA 3OTFA 1IBMB 2QGNA 3ABUA 4TQDA 3APQA 1YTFB 2EIMB 3JARA 4WFHA 2ITCC 3ZMSA 3CHXA 2XAGA 4JI5B 4GKKB 2AGAA 1R1BA 1KKCA 1HNXO 1VQ9V 3RVZA 3UKMA 4R6ZA 3K03A 4JI2O 3ASNB 3VOUA 1NS1A 1ZX3A 3AG1B 1WP7A 3UO3A 4FLTA 1IBKO 1QLNA 1M90W 1M56C 1QR8A 1GK9A 1Y76B 4FLWA 1HNZO 3HPLC 3A0RA 4DK0A 4TV9B 4QNHB 2JIZG 3C90A 3T4ZA 1BGYH 3M8AA 1DK1A 1JCHA 4TSFG 3RYCB 5CA0A 2V4DA 1RM1B 3S3XA 1V55C 4B3MB 1WA8B 1BE3H 5LA6A 3DXRB 2ZE8A 1QBZA 1ZL8A 1PNKA 4PJ0Z 1S72V 3SYAA 4DRXB 1IBLO 4DR4B 1XMOO 3HKBA 1NH2B 1FXKA 2WLIB 1K9MW 1BL8A 5C93A 4X1IB 4K0KB 1S0VA 2P4VA 3JAMN 1R3LC 4PA4A 2EJ7A 3UM7A 2P7TC 4TUYA 5KLVH 5H2FZ 4LF6O 1SF9A 1FJGB 3BCCH 4ZI7B 4GX1A 1Q90D 1S5HC 3LNNA 5LHIA 1WPBA 2LQTA 3JALB 1B04A 1JVMA 2F95B 4BR6A 3UT5B 3B8MA 4NB5A 5B5EZ 5LP6C 4PD4F 1N0JA 3CMAV 2X0LA 4F6EA 1XMQO 4P9OA 2YIDA 4E4EA 5GONA 1YJNV 3RW0A 1D2DA 3L75H 3OEEG 5CB4A 4AI8A 4G2KA 1K3EA 1Z5VA 1K8AW 2KQXA 3H1HH 2P4KA 4H0LB 2Z5UA 5BMVB 4YJ2B 1I08A 5FLXN 2FL4A 3TETA 3STLC
chains in the Genus database with same CATH topology
3JCUZ 3A0BZ 4IL6Z 5KAFZ 5KAIZ 5GTHZ 5E79Z 4UB8Z 3WU2Z 5B5EZ 5B66Z 4PJ0Z 5H2FZ 3KZIZ 4UB6Z 1S5LZ 3A0HZ 2AXTZ 5TISZ 5GTIZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU Z;  3A0B Z;  4IL6 Z;  5KAF Z;  5KAI Z;  5GTH Z;  5E79 Z;  4UB8 Z;  3WU2 Z;  5B5E Z;  5B66 Z;  4PJ0 Z;  5H2F Z;  3KZI Z;  4UB6 Z;  1S5L Z;  3A0H Z;  2AXT Z;  5TIS Z;  5GTI Z; 
#chains in the Genus database with same CATH topology
 4EFB A;  2R70 A;  5LXT B;  4X1Y B;  4JYY A;  2Q5Z A;  1FYJ A;  1N36 O;  1VF5 B;  1AI7 A;  3ASO B;  3T1H O;  4J80 A;  1XBL A;  3KZI Z;  1W59 A;  2ZIM A;  4J7J A;  2AZ0 A;  1OCO C;  3JAK A;  2Q7E A;  1N33 B;  2PI4 A;  1QU7 A;  3GB7 C;  1N8R W;  4R50 A;  3K06 A;  5KUK A;  4YHH B;  1I7F A;  1QHT A;  3ZJZ A;  4GYC B;  4XBF A;  4DK1 A;  3OT7 A;  5LP6 B;  2PF4 E;  3CX5 F;  5D5Q A;  1R3I C;  3D3I A;  1EN4 A;  4JI6 O;  4BWA A;  3M7M X;  3W7T A;  1NT2 B;  4CS2 A;  2HJF C;  2HEP A;  3CB2 A;  5EBL C;  4JI0 O;  3CCM V;  2P06 A;  4DR7 O;  1XNR B;  3CJH B;  3CC7 V;  4PA6 A;  4GX0 A;  2NN4 A;  1GMG A;  3J80 N;  3L72 H;  2ZE6 A;  1N34 B;  3HKE A;  3P3N A;  4DXW A;  2UUC O;  4UCU A;  1A32 A;  3UO2 A;  4DV6 B;  4CBC A;  4LF8 O;  4X64 O;  4NTW A;  3ZBH A;  3CD6 V;  4UCR A;  3W7S A;  5IT9 N;  1VQL V;  3L9D A;  2W0X A;  3EXA A;  1OCO B;  4HNA A;  2ZM6 B;  3ZED A;  4X65 B;  1YIJ V;  4JTD B;  3H1L H;  2WSS G;  2YIA A;  1I94 B;  1XL6 A;  3I56 V;  3RVY A;  1U96 A;  4PA9 A;  3KG2 A;  4TWK A;  2Q4P A;  3H1I H;  2ZDI A;  2A06 H;  2YEV B;  2ZNJ A;  2CTR A;  1F4N A;  2A3Q A;  1FXK C;  3CCR V;  3N2K B;  3HKC A;  2QKC A;  3ZMZ A;  2OYQ A;  4MT8 A;  2WLL A;  3CRQ A;  4I55 A;  4YIO A;  2PYJ A;  3JAR B;  1S76 D;  1M4U A;  1SA0 A;  4DR5 B;  1NJI W;  4WFG A;  5BZB A;  1VF6 A;  3S3W A;  2F4V O;  2MW2 B;  1SRY A;  1W2B U;  2Q9L A;  3BRC A;  2K1E A;  4LFA B;  3H01 A;  3SPJ A;  2FKX A;  4UFZ A;  1V54 C;  4LF4 O;  3APO A;  4X9Q A;  1J5E O;  1AJP A;  3VBB A;  1ARO P;  2VQF B;  1YCI A;  3F5T A;  4KXR A;  5L3E A;  3UQ8 A;  4X20 A;  2E74 B;  5KA5 A;  1YJW V;  1FFT B;  3WFV A;  4B7E A;  1BT8 A;  2WA3 A;  4DV3 O;  1LR1 A;  2HKO A;  1AR4 A;  3E2E A;  4WFA V;  4YJ3 A;  4P2Z A;  1L8D A;  5IYZ A;  2LP7 A;  1FD9 A;  1H2N A;  3PN1 A;  5HFM A;  5LA6 B;  2QWN B;  2O57 A;  5B1O A;  4BIZ A;  2QWO B;  3K9A A;  5IJ9 A;  1XDC A;  1PL0 A;  1MSW D;  1E1R G;  1FXK B;  1YIT V;  3BAB A;  5JH7 B;  3OUS A;  1X4T A;  1HDJ A;  3STZ C;  1XIL A;  4GKJ B;  3OMN B;  4UXN A;  4LP8 A;  5F2V O;  1LNQ A;  5FPR A;  1BZK A;  2QTO A;  2F23 A;  2UUB B;  5JCO C;  2ZCE A;  1NR1 A;  2EIK C;  4TUY B;  4UUJ C;  4Z1M G;  1MZF A;  3W7W A;  4DUY B;  3H1K H;  2RNB A;  1K7D A;  5CBH A;  4ICG A;  5FPO A;  1Q6U A;  1V54 B;  2HVJ C;  1FKA O;  2PI5 A;  1VQO V;  3QTC A;  5JQG A;  1VQP V;  5KHI A;  4UV9 A;  4FFK A;  3K5N A;  2QM4 A;  1VQM V;  1H8H G;  5BR8 B;  5IYD O;  5B1B C;  1AI5 A;  3R65 A;  3QO7 A;  4TV8 B;  3E35 A;  1SQQ H;  5EZY A;  2LFS A;  3JAS A;  4DR1 O;  2XAS A;  4U7N A;  5GON B;  4DV5 O;  3JSL A;  3TK1 A;  3O9O A;  2IW5 A;  4B3R O;  1NVP D;  3ZS8 C;  2UXX A;  1HP8 A;  4ZBM A;  4LH6 A;  4IYI A;  2Q0O C;  1S3J A;  4GX5 A;  4JV5 O;  3GWK C;  3QO8 A;  4LF7 O;  4H13 B;  3WB0 A;  3OUF A;  4MSW C;  4FZ1 A;  1CP9 A;  2Q69 A;  4CC5 A;  4JI1 O;  4DW0 A;  4IHJ B;  1YF2 A;  2XAH A;  2V7Q G;  3FAV B;  3SPI A;  4NR1 A;  3CC2 V;  4QPK A;  3SR2 C;  5K1P A;  3E22 A;  1N32 O;  5LGN A;  4JYA O;  1K5Q A;  4J9Y B;  4JTC B;  1WP8 A;  1LUV A;  3ZRW B;  4U7O A;  1MNG A;  2EIK B;  4F4L A;  2D3O W;  5KX5 B;  4G28 B;  2OCH A;  4QJF B;  4JYC A;  2IH3 C;  1MMM A;  4CH3 A;  4FFB A;  3OD4 A;  2PTM A;  2L6L A;  4LFC B;  2EZP A;  5B1N A;  4D6T H;  1H2S B;  1YSC A;  1IUR A;  4JI8 O;  4UV8 A;  4PA7 A;  4NXM O;  2IJJ A;  5B1B B;  1EM1 A;  1NTM H;  2ZDI C;  3VQY A;  2JS3 A;  2E5L O;  3L73 H;  4FM2 A;  4K35 A;  1AR5 A;  5C8Y B;  1Q7Y W;  5IYB O;  1VEW A;  2DYS B;  1VF6 C;  3ZHR A;  1MG1 A;  4QGP A;  2EX3 A;  2ZKO A;  3R66 A;  2OWO A;  3CYO A;  2OCC B;  3CCS V;  1OV9 A;  4H33 A;  2QE7 G;  4KFM A;  4LWS A;  4IL6 Z;  4PI0 A;  2JJ1 G;  4Z2W A;  2BCC H;  3A2F A;  3CRR A;  3HKE B;  3QNE A;  1O9G A;  1BQ0 A;  2N04 A;  3M99 B;  3LDE A;  2HHH O;  3WB2 A;  1KBH A;  1HNX B;  4DR3 O;  4CZZ A;  4JI2 B;  2RN9 A;  2UXB O;  5H9C A;  2GTS A;  3LUT B;  4JAU A;  2QTS A;  4X89 A;  1IBK B;  4IGG A;  3K79 A;  3MHH C;  1ZTE A;  4HNA B;  1HNZ B;  4ZHQ A;  3JD0 A;  1KB9 F;  5H6Q A;  3CE2 A;  3IJ4 A;  2IH1 C;  3AEI A;  2JRI A;  1XI1 A;  2Q8V A;  1BHB A;  4LFB O;  3LDC A;  3HKC B;  5FL7 G;  4LF5 O;  2B5U A;  4LH7 A;  1XUQ A;  2XHB A;  4I55 B;  1E1Q G;  4DR6 O;  4GUN A;  1SA0 B;  1F4M A;  3SJC C;  4I9W A;  2ZIO A;  4JAS A;  1IBL B;  5J2U B;  2QEX V;  1XMO B;  3F5W C;  1K4D C;  4EFE A;  1K34 A;  5B1A C;  1RFY A;  1VF7 A;  2N05 A;  1RPO A;  2Q7H A;  4FK5 C;  4MTG A;  4NTY A;  1VQ5 V;  2UXC O;  4CH4 A;  3BVO A;  2DOS A;  4FM1 A;  3A8T A;  4W4L A;  2DE0 X;  3ICX A;  4X20 B;  3RYF B;  2KG7 A;  3FFQ A;  1ZLZ A;  1QQC A;  1GRJ A;  5GTI Z;  4IIJ A;  3OFN G;  3OAA G;  3C3S A;  3JCU Z;  5A9G A;  4U3F H;  4DR2 O;  2YXY A;  2L35 A;  1MZE A;  4YJ3 B;  5IYZ B;  2AW9 A;  4JZG A;  4I4T A;  2GUZ A;  3N27 A;  2IJH A;  3E8G A;  1US6 A;  2LW1 A;  3B2E E;  3OMI B;  1XMQ B;  3FX7 A;  1AP5 A;  4B7K A;  5IJ9 B;  5IY5 C;  5KHJ A;  1Z5W A;  3SPC A;  1PD3 A;  2CUG A;  2CH7 A;  4LNU A;  4B3T O;  4XDJ A;  3DC6 A;  2ILM A;  3LSU A;  2F43 G;  3ETQ A;  1P7G A;  5IJ0 B;  1R6K A;  1VAR A;  1S5J A;  5B1A B;  4X66 O;  1S5L Z;  1KP3 A;  4OPA A;  2Y0P A;  3ZN1 A;  2Q73 A;  2LW7 A;  5A2Q N;  1VQK V;  4MVS A;  4FLZ A;  1M56 B;  1N0N A;  1N36 B;  4P9P A;  3T1H B;  3J81 N;  3K57 A;  4ABM A;  4WFE A;  2QA4 V;  2QM7 A;  3ZRS A;  3ZMU A;  1Y74 A;  5H5N A;  4DV7 O;  3N2G A;  1UFI A;  4B3S O;  3ETD A;  2IJK A;  3TJT A;  3OR7 C;  5IE9 A;  3FB7 C;  5EZY B;  3JAS B;  3E86 A;  4I7Z B;  1L1F A;  4OGQ B;  4WBN A;  2DWE C;  4UVA A;  2HG5 C;  3Q4H A;  1I5Y A;  1V55 B;  3OW2 U;  2MK3 A;  3ML0 A;  4KP4 A;  1K92 A;  4DUZ O;  4ZOL A;  3MHS C;  3C3T A;  3ZRV A;  1NR7 A;  4O4L A;  4A5U B;  2NLJ C;  4EKW A;  5LMN B;  4JI6 B;  4FZ0 A;  3ZN0 A;  1MOF A;  1YEW A;  1OCC C;  4KL1 A;  5IY5 B;  4BW5 A;  5L3D A;  2XT9 A;  4DR7 B;  2JEU A;  4H44 B;  2DQ3 A;  5BXZ A;  1OCR C;  2YI8 A;  5IWA O;  3E22 B;  4I0X A;  3W7X A;  2Z0A A;  1COW G;  4NTX A;  3CCV V;  1EZV H;  4PDL A;  4RQF A;  1OJH A;  1HR0 O;  2W6J G;  4XDL A;  2YUA A;  3T1Y O;  3AG2 C;  2UUC B;  4L8J A;  4YY3 O;  3P3P A;  4O2B A;  1PV0 A;  2HVK C;  4FFB B;  4LF8 B;  4X64 B;  3CPW U;  2VWJ A;  2QWR B;  3AK2 A;  1X59 A;  2LJ2 A;  3CS5 A;  3DSQ A;  1P49 A;  5DED A;  1PNL A;  4HYO A;  2RDC A;  3I55 V;  2ZNI A;  3T2M A;  2KSD A;  2A9H A;  5KMG B;  1RSO A;  2NNU A;  1W0K G;  1YZB A;  1U97 A;  1NU1 H;  4CS4 A;  1FAF A;  3FB5 C;  2ADQ B;  4MW8 A;  5JVD A;  2ZR2 A;  2ATK C;  3ZHU A;  4WFB V;  1JR9 A;  2IU3 A;  1PNM A;  4DV4 O;  2H3O A;  1SZX A;  3HR0 A;  3F7V C;  5EYP A;  1PKX A;  2F4V B;  1L0L H;  1SQP H;  2Q7G A;  2YXH A;  5L3C A;  3ZHS A;  4OPH A;  3ETG A;  5ITZ A;  4JI7 O;  4D7S A;  3BEH A;  2ZIN A;  2AHZ A;  1VMG A;  3AG2 B;  4LF4 B;  3OTO B;  1J5E B;  1TA8 A;  2VRZ A;  1N33 O;  4NKG B;  1XEQ A;  4O2A B;  4FVM A;  3ABM C;  4ZHQ B;  3PJS K;  3MD0 A;  4OX9 O;  2XND G;  4MVR A;  5JWP A;  1BQZ A;  1SQF A;  4DV3 B;  2IM9 A;  4F6R A;  3JSN A;  1W0J G;  4PDM A;  4CC6 A;  1ENV A;  2PUS A;  2ZQM A;  1DTO A;  2Z3Y A;  4BIU A;  3RBZ A;  1SQB H;  3AG4 C;  2Y4U A;  1FXH A;  1YDX A;  1QLE C;  4Q6G A;  5KHK A;  4R8C A;  2PYL A;  1GM9 A;  2CK3 G;  1VP7 A;  4I5S A;  2OIE A;  4FM0 A;  2F66 C;  2Q67 A;  5LOV A;  2DW4 A;  3KKY A;  3JD1 A;  1GO3 F;  3SYO A;  3ZHV A;  2KG7 B;  1JOY A;  4UCS A;  3SPG A;  4O4H A;  2B1I A;  4K8X A;  4IIJ B;  3OM3 B;  2X6C A;  4LCU C;  5JJE B;  1Y76 A;  1HNW O;  3LSS A;  3A0H Z;  5CA0 B;  1HW7 A;  3ABM B;  2GDS A;  1SQV H;  4U3J A;  4I9Q A;  2RJZ A;  2GUZ B;  1ZL8 B;  2WPD G;  4DW1 A;  2UXD O;  5KAI Z;  4UCO A;  3FB8 C;  2H8P C;  2WLM A;  4MS2 A;  1ZWI C;  4DR1 B;  5EC2 C;  3HKB B;  1WNS A;  4DV5 B;  2ETN A;  1XL4 A;  4W4K A;  4B3R B;  3L71 H;  2YSU B;  5LMU O;  1K4C C;  3ZCC A;  1Q81 W;  4JI4 O;  3KCX A;  1AP6 A;  2CH7 B;  4UB6 Z;  4LNU B;  5J9P C;  3DXR A;  4I50 A;  1VQ6 V;  4JV5 B;  4FLV A;  1M93 A;  4DRX A;  4FLU A;  4LF7 B;  3AG4 B;  3SGI A;  1IZ3 A;  1XHX A;  1F23 A;  1QLE B;  4JI1 B;  1IX9 A;  1BHA A;  4PDV A;  3U0Z A;  2BOC C;  3X2Q C;  1DLB A;  4X1I A;  2IJI A;  4HZ3 A;  2QJ1 A;  1N32 B;  4JYA B;  1KC8 W;  1SER A;  1AI6 A;  5DEC A;  3AK3 A;  1ZSP A;  1YVW A;  2BSK A;  2HLD G;  3U10 A;  1GTO A;  4FLX A;  1Y74 B;  4Z1V A;  4DV1 O;  3N2G B;  1VQN V;  2XAF A;  2VS0 A;  3QVN A;  2YS8 A;  4RO2 A;  1XNQ O;  3FKS G;  3JAW A;  4JTA B;  5LGT A;  1EN6 A;  3JAL A;  1BMF G;  2EZO A;  2Y69 C;  2WLN A;  1T5E A;  4WBN B;  4JI8 B;  3K3W A;  4J9Z B;  3Q4H B;  4BAY A;  5CB4 B;  4NXM B;  3ABT A;  4EB6 A;  1M5I A;  4O4J A;  2WAM A;  1UJW B;  2UUA O;  4RUF A;  2IBZ H;  1MSD A;  1D5N A;  1SQX H;  4EEQ A;  4AIL C;  4O4L B;  3HB3 B;  5GTH Z;  2M6Y A;  3T4D A;  3VQW A;  1VQ4 V;  1YTF D;  4ZIB A;  1WN7 A;  2FTK A;  2R9I A;  3OGI B;  1QCE A;  2GHY A;  3EHB B;  1JJ2 U;  2CTP A;  4FPP A;  2N74 A;  4K8Z A;  4I0X B;  2UUB O;  1TUB A;  3BFR A;  4JI3 O;  3K0G A;  4OXS A;  3SPH A;  1AJN A;  3FD9 A;  4YJ2 A;  4JPR A;  3ABL C;  1JQ0 A;  4DUY O;  2HHH B;  4O2B B;  3X2Q B;  3RT3 C;  1GN6 A;  3JAK B;  1O9H A;  4GX2 A;  2ZE5 A;  4TQF A;  4DR3 B;  1CPY A;  2E76 B;  2P22 C;  3E8F A;  3ZMT A;  4MVM A;  4YIP A;  4IT5 A;  3LDD A;  4PA3 A;  2UXB B;  2EUL A;  1JMK C;  3SJQ C;  3CRM A;  4QPJ A;  5B3S C;  1YI2 V;  4HBN A;  2ITD C;  3H9V A;  1JJO A;  5E1A C;  2WLK A;  2XOK G;  2A7W A;  2CTW A;  3JD3 A;  4UB8 Z;  1RSO B;  2BTQ A;  5EK0 A;  1G8M A;  4LR3 A;  2Y69 B;  2P5O A;  1Q3E A;  2EIL C;  5D5P A;  4DYL A;  2ZT9 B;  2CDY A;  2QSA A;  5JVD B;  4RUE A;  2XAJ A;  3CP1 A;  2LFR A;  2QM8 A;  4LFB B;  4LF5 B;  3QO5 A;  3RYH A;  3U11 A;  3DC5 A;  3ZX6 A;  4DR6 B;  5EYP B;  2EJR A;  3HKD A;  2BTO A;  3RGB A;  3K58 A;  1H2G A;  5EIB D;  3WB1 A;  4X62 O;  1SC5 B;  4XDK A;  5CMU A;  5ITZ B;  3CXH F;  3ETE A;  4LBE C;  4Q20 A;  4DV0 O;  3ABL B;  1K33 A;  2VQE O;  4BW9 A;  2UXC B;  3WU2 Z;  4X1K A;  2UU9 O;  2QKA A;  4R7C A;  4NYK A;  2DWD C;  1KD1 W;  1TUE B;  4KHP O;  2ZD9 A;  2RMK B;  2GSM B;  2W6I G;  5EBW C;  1QNM A;  3CME V;  5B3S B;  2HP8 A;  1TVK A;  4LF9 O;  4DO2 A;  1UPG A;  3TXQ A;  2WWW A;  4DR2 B;  4DV2 O;  4F6R B;  1SES A;  2WLL B;  2OIG A;  3D36 A;  1G4Y B;  1NVP B;  1Y4M A;  2EIL B;  1Q5O A;  3D3Q A;  3SYQ A;  2DYR C;  3G67 A;  2XUM A;  4FMT A;  1YXB A;  1N4C A;  4AQY O;  2YEV A;  1VIB A;  3O65 A;  3JAT A;  5BY1 A;  4E2L A;  1GH6 A;  3OEH G;  4X8A A;  2NR5 A;  2BOB C;  3K5M A;  3FYI B;  4B3T B;  3I5D A;  1FFX A;  4N23 A;  3IC7 A;  4JF3 A;  3ABK C;  1V9P A;  4NXN O;  3WG7 C;  5EIB C;  2QWQ B;  3B8N A;  4LF6 B;  5LOV B;  3EFF K;  1F7Y A;  4X66 B;  3B77 A;  4TOI A;  1G1X B;  3SYC A;  1Q43 A;  3G6B A;  4O4H B;  1YHQ V;  1NQT A;  4P30 A;  1EN5 A;  1NZ6 A;  1YJ9 V;  2Q0A A;  4G27 B;  2OTL V;  2E75 B;  2X7R B;  1B06 A;  3JYC A;  2Y48 A;  5L3F A;  5AG2 A;  1E79 G;  4DV7 B;  4U3J B;  4B3S B;  4K3A A;  3TCU A;  4CH5 A;  3FYE B;  3CCJ V;  1Q8I A;  1KQS U;  2DN9 A;  5KUM A;  3W7U A;  2R72 A;  2EBO A;  1IBM O;  2ZR3 A;  2GBO A;  1M57 C;  4TT3 G;  2M7W A;  1R3J C;  4DUZ B;  4JI5 O;  4J7K A;  4GKK O;  1GN4 A;  1PL4 A;  1AVM A;  1ORQ C;  4I50 B;  5CA1 A;  1SKV A;  2DYR B;  4JGS A;  1VQ8 V;  1TGO A;  3AK1 A;  5JH7 A;  1OCZ C;  4RWU A;  3SYP A;  5IWA B;  1H2L A;  1IXB A;  1RP3 B;  3ABK B;  2GTA A;  5JQG B;  1QVF U;  3ASO C;  3WG7 B;  1HR0 B;  1WB8 A;  3T1Y B;  1H8E G;  4GT1 A;  4MVQ A;  1SS3 A;  1DF4 A;  5LHH A;  3CXC U;  2BSK B;  4YY3 B;  3OGC C;  3B40 A;  2AHY A;  3CRC A;  2YC0 A;  4KUM A;  3JAW B;  4MVU A;  2ZE7 A;  1K97 A;  3JD2 A;  3G71 V;  2WA4 A;  1WPX A;  1Q86 W;  4IYH A;  3K0D A;  3CCQ V;  4B3M O;  1P4R A;  4EB6 B;  4O4J B;  4TV8 A;  1KEC A;  2KKW A;  1TAE A;  2CTQ A;  3K9S A;  4DR4 O;  1M9N A;  4H37 A;  4JI0 B;  3NXS A;  4FLY A;  1GN2 A;  1H38 A;  4YXW G;  1M57 B;  4K0K O;  1H2M A;  1Q6H A;  5LBQ A;  3FB6 C;  2D2C B;  3LNM B;  4RQE A;  1TUB B;  4N21 A;  1XRE A;  3MDS A;  1Q82 W;  1WB7 A;  4IHJ A;  4DV4 B;  3K5O A;  2B9Z A;  3FAV A;  1OCZ B;  2LO1 A;  1FJG O;  1BS3 A;  3BA9 A;  1NKD A;  3GWO A;  1NTZ H;  2DQ0 A;  2RCV A;  5JCO A;  3ZRW A;  2ZXW C;  4JI7 B;  2P67 A;  2JGD A;  5KX5 A;  2YIB A;  3IAY A;  3SDL A;  1QR9 A;  2QR4 A;  2JS5 A;  1Q6I A;  4JAV A;  1Y6X A;  5EBM C;  3UCS C;  1B3Q A;  3KCY A;  2BTQ B;  5DN6 G;  2IU0 A;  3ZHQ A;  3D36 C;  4O4I A;  4OX9 B;  1Y67 A;  1GN3 A;  2QDO A;  2FML A;  2WLH A;  2EIJ C;  5L3G A;  2F1M A;  5LMN O;  4WFF A;  1PM9 A;  1JFF A;  1OCC B;  4LWS B;  3RYH B;  2EIN C;  1WLE A;  5C8Y A;  1AR1 B;  3P30 A;  5J2T A;  1OCR B;  3SJA C;  2B1G A;  3CRA A;  3HKD B;  2HJD A;  3RYI A;  3BY6 A;  2YIC A;  2HR3 A;  1DF5 A;  2JVD A;  4MTO A;  5CA3 A;  1ROP A;  1XHZ A;  2LGQ A;  4MW3 A;  2Y0I A;  5H6R A;  1L0N H;  2DMX A;  5CBG A;  5TIS Z;  3K5L A;  4WF9 V;  5L3B A;  4X1K B;  5IDJ A;  1GM8 A;  2ZXW B;  4YHH O;  1P84 F;  3CCE V;  1MAB G;  1XOU A;  4NVP A;  3E89 A;  3J7A U;  4X88 A;  3JCZ A;  1EZJ A;  1TVK B;  5FNV A;  4J11 A;  1FS0 G;  1HNW B;  1WJZ A;  3TGU H;  3BHP A;  1BSM A;  4GLX A;  3P32 A;  1XNR O;  4PHZ A;  2UXD B;  2R9A A;  4FJC C;  1FXV A;  2JEX A;  3E8B A;  4JYB A;  2EIJ B;  5IYC O;  5LYJ A;  1NBM G;  1IXM A;  3QG5 A;  1GM7 A;  2Q68 A;  3JAT B;  1FPO A;  5LMU B;  4JI4 B;  3CC4 V;  4HAM A;  1N34 O;  2X6B A;  1R6T A;  2EIN B;  1ZUQ A;  4QIW F;  1FFX B;  4FIP C;  3OR6 C;  4DV6 O;  1IDS A;  1K5S A;  3ZRX A;  4PI2 A;  5J2U A;  3JD4 A;  2OT5 A;  3CCL V;  5JJJ B;  2YIB D;  3K04 A;  2CAZ C;  1PP9 H;  2G38 A;  1CEZ A;  1KKD A;  4MTX A;  3OTO O;  3RWR D;  2ZM6 O;  4L87 A;  1PPJ H;  1BCC H;  1URF A;  2AXT Z;  4X65 O;  4AHC A;  5KA6 A;  4I4T B;  1D5A A;  4TV9 A;  3RYF A;  1I94 O;  4DV1 B;  2QWP B;  1H2K A;  1XNQ B;  3DTU B;  4PDR A;  2OTJ V;  3RYC A;  3G4S V;  1OHH G;  3BA8 A;  5DM6 V;  2PZS A;  1WA8 A;  2UUA B;  4DR5 O;  1AB3 A;  5K1X A;  5CA1 B;  1DGS A;  5CN0 A;  3A0B Z;  3L74 H;  4JZ2 A;  2YI9 A;  2GV9 A;  1JX9 A;  2WLI A;  5E79 Z;  3K08 A;  4LFA O;  2BE3 A;  3OE7 G;  4LC1 A;  3D8C A;  3IFX A;  4UVB A;  3AG3 C;  3VQV A;  4J7Z A;  1KU9 A;  3SJB C;  1B6Q A;  3BPZ A;  4J10 A;  4JI3 B;  2VQF O;  1IVS A;  1WAZ A;  1AJQ A;  5IJ0 A;  5EC1 C;  2A79 B;  1GKF A;  4ZI7 A;  2JK5 C;  1F51 A;  1P7B A;  2PGG A;  1Z2G A;  1KUQ A;  3F7Y C;  1OZ0 A;  4PV1 B;  1JA8 A;  2LGW A;  1THZ A;  5LHG A;  1MA1 A;  2YXL A;  4PEL A;  3UT5 A;  1HWY A;  4MVZ A;  3ZIA G;  3CWB H;  2X6A A;  4ZOL B;  4CS3 A;  2C2A A;  2ADP A;  5JJN B;  2E5L B;  4MVO A;  1GAX A;  1KMI Z;  3CEI A;  5B66 Z;  3EVK A;  1G6U A;  1RPR A;  3CCU V;  2DYS C;  2K9P A;  4GKJ O;  4JAA A;  4CH6 A;  1LUW A;  4B08 A;  1CXZ B;  2JGU A;  2ODM A;  4RAI A;  3E83 A;  5KHH A;  2OCC C;  1KYO F;  3K59 A;  1EBO A;  1ZAU A;  2XAQ A;  3ZHT A;  1SET A;  1R73 A;  3GVM A;  5BMV A;  2FB5 A;  5HFL A;  2HFE C;  3L70 H;  3THO A;  2FYU H;  3LSQ A;  3BAA A;  3AG3 B;  4J41 A;  2DJV A;  5LXT A;  3AG7 A;  4X1Y A;  4WCE V;  4GCZ A;  2XTA A;  2JDI G;  2AZ2 A;  4X62 B;  1XQ8 A;  1VQ7 V;  2CE4 A;  2KB1 A;  2YDE A;  2JGD B;  1I5X A;  4DV0 B;  4GZR B;  2CGO A;  1Y66 A;  5BR8 O;  4QE7 A;  2VQE B;  2UXN A;  1SQG A;  3CSX A;  2UU9 B;  3T1C A;  3RN4 A;  4MTF A;  4KHP B;  2RQ6 A;  2P6J A;  5LGU A;  4O4I B;  2R9R B;  5LP6 A;  1QVG U;  3NR7 A;  2Y4T A;  3IC9 A;  1JPX A;  2P90 A;  2VWK A;  4LF9 B;  1NH2 D;  2E3C A;  3ZMV A;  4DV2 B;  2W0F C;  5KMG A;  3MAQ A;  3E8H A;  5KAF Z;  4C7U A;  1JFF B;  2JJ2 G;  2V1D A;  2EIM C;  3TXS A;  4UCT A;  1I0H A;  2QKS A;  3G80 A;  3CJH A;  3IGA C;  5J2T B;  3G6E V;  4BIO A;  1AIL A;  4AQY B;  1KP2 A;  3RYI B;  1R3K C;  3ASN C;  2Q6A A;  1NTK H;  2ARH A;  1AI4 A;  5LL6 Y;  4J42 A;  2PY5 A;  1M1K W;  3RFR A;  2F93 B;  3AG1 C;  4QE9 A;  1NI8 A;  4NXN B;  3OMA B;  4UCV A;  3B09 A;  4LFC O;  2A0L A;  1R6N A;  1J95 A;  2CGN A;  3VQX A;  4UVC A;  1S77 D;  1K73 W;  1EFR G;  3DGE A;  3B4S A;  5FNV B;  4ZKI A;  4O2A A;  4D7T A;  1RM1 C;  3QF7 A;  5GW7 A;  5CBF A;  5KHG A;  1SZT A;  2WLJ A;  3H1J H;  2H94 A;  4ASU G;  5LYJ B;  3N2K A;  3OTF A;  1IBM B;  2QGN A;  3ABU A;  4TQD A;  3APQ A;  1YTF B;  2EIM B;  3JAR A;  4WFH A;  2ITC C;  3ZMS A;  3CHX A;  2XAG A;  4JI5 B;  4GKK B;  2AGA A;  1R1B A;  1KKC A;  1HNX O;  1VQ9 V;  3RVZ A;  3UKM A;  4R6Z A;  3K03 A;  4JI2 O;  3ASN B;  3VOU A;  1NS1 A;  1ZX3 A;  3AG1 B;  1WP7 A;  3UO3 A;  4FLT A;  1IBK O;  1QLN A;  1M90 W;  1M56 C;  1QR8 A;  1GK9 A;  1Y76 B;  4FLW A;  1HNZ O;  3HPL C;  3A0R A;  4DK0 A;  4TV9 B;  4QNH B;  2JIZ G;  3C90 A;  3T4Z A;  1BGY H;  3M8A A;  1DK1 A;  1JCH A;  4TSF G;  3RYC B;  5CA0 A;  2V4D A;  1RM1 B;  3S3X A;  1V55 C;  4B3M B;  1WA8 B;  1BE3 H;  5LA6 A;  3DXR B;  2ZE8 A;  1QBZ A;  1ZL8 A;  1PNK A;  4PJ0 Z;  1S72 V;  3SYA A;  4DRX B;  1IBL O;  4DR4 B;  1XMO O;  3HKB A;  1NH2 B;  1FXK A;  2WLI B;  1K9M W;  1BL8 A;  5C93 A;  4X1I B;  4K0K B;  1S0V A;  2P4V A;  3JAM N;  1R3L C;  4PA4 A;  2EJ7 A;  3UM7 A;  2P7T C;  4TUY A;  5KLV H;  5H2F Z;  4LF6 O;  1SF9 A;  1FJG B;  3BCC H;  4ZI7 B;  4GX1 A;  1Q90 D;  1S5H C;  3LNN A;  5LHI A;  1WPB A;  2LQT A;  3JAL B;  1B04 A;  1JVM A;  2F95 B;  4BR6 A;  3UT5 B;  3B8M A;  4NB5 A;  5B5E Z;  5LP6 C;  4PD4 F;  1N0J A;  3CMA V;  2X0L A;  4F6E A;  1XMQ O;  4P9O A;  2YID A;  4E4E A;  5GON A;  1YJN V;  3RW0 A;  1D2D A;  3L75 H;  3OEE G;  5CB4 A;  4AI8 A;  4G2K A;  1K3E A;  1Z5V A;  1K8A W;  2KQX A;  3H1H H;  2P4K A;  4H0L B;  2Z5U A;  5BMV B;  4YJ2 B;  1I08 A;  5FLX N;  2FL4 A;  3TET A;  3STL C; 
#chains in the Genus database with same CATH homology
 3JCU Z;  3A0B Z;  4IL6 Z;  5KAF Z;  5KAI Z;  5GTH Z;  5E79 Z;  4UB8 Z;  3WU2 Z;  5B5E Z;  5B66 Z;  4PJ0 Z;  5H2F Z;  3KZI Z;  4UB6 Z;  1S5L Z;  3A0H Z;  2AXT Z;  5TIS Z;  5GTI Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...