3A0BZ

Crystal structure of br-substituted photosystem ii complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 11
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3a0bZ00
3A0HZ 3WU2Z 3KZIZ 5KAFZ 4IL6Z 4UB8Z 3A0BZ 5GTIZ 1S5LZ 5KAIZ 4PJ0Z 5GTHZ 5B5EZ 4UB6Z 2AXTZ 5E79Z 5B66Z 5TISZ 5H2FZ 3JCUZ
chains in the Genus database with same CATH superfamily
1FXKA 3TXSA 4GT1A 3SGIA 3QNEA 4B3TO 1ENVA 3OTOO 4N21A 2F66C 4PDLA 2HHHB 1L8DA 2FB5A 3LDDA 1FXKC 3CJHA 4J7KA 4O2BB 3DGEA 1WA8A 3JARB 3HKBA 2OIGA 3ZHVA 3CC2V 3CCQV 2RMKB 3QF7A 1Q6UA 3CMAV 5KA6A 4CC6A 4HNAB 2CH7B 3UM7A 4R6ZA 1EBOA 4UV8A 2ODMA 4X62B 2H8PC 3GB7C 5IYDO 2DYSB 3UO2A 2YICA 3KCXA 1VF6C 2X6AA 3CP1A 4O2AA 3OMNB 2OT5A 1K9MW 3CSXA 2YXLA 3AG3C 1S3JA 1RFYA 4NTYA 4FFKA 4GX1A 3E8GA 3B09A 2K9PA 2VQEO 3WB1A 2IH3C 1K4DC 3VQWA 2DJVA 1K8AW 2F43G 1PM9A 1Y67A 2MK3A 4ZHQB 4DR7B 1M5IA 1R6KA 1JPXA 2X6BA 3ABKC 1GKFA 2HFEC 2JK5C 3RVYA 1FKAO 2ZKOA 5B1BC 3CCRV 2EJRA 4D7SA 1VQ7V 4DR4B 3T4DA 4DYLA 3TJTA 4RAIA 3RBZA 3SPHA 2WLLA 4B7KA 1D5NA 4DR2O 4PA9A 5C8YA 1XUQA 3OD4A 5KA5A 2UUBO 4J42A 3ZMZA 2JEXA 3B40A 5KHGA 2Z0AA 1SC5B 4O4IB 3K5MA 2B9ZA 3U11A 2P4VA 4NXNO 1FPOA 3D3IA 5KMGB 5KMGA 4PELA 2ZNJA 2PI4A 4X1YA 1VQ5V 3FAVA 3E8BA 4JAVA 1Y6XA 1R3IC 4DR6O 2PYJA 3SJCC 1HNWO 5H9CA 1I0HA 4JTCB 4KP4A 1P7BA 3SJBC 4LFCB 3CCEV 2AW9A 1K33A 3H1LH 2QKAA 4LFBB 2IBZH 4BIUA 3MHSC 4K8XA 4U7NA 2PGGA 2QJ1A 4NXNB 3AG2B 4CH3A 1K92A 2A0LA 1FFXB 1NI8A 1DLBA 5BR8O 3LDEA 3H1JH 3ZMUA 5IJ0A 5CA1A 4X1IA 4U3JA 4QE7A 3STZC 4DO2A 1PD3A 5GTIZ 1AI6A 2CTWA 4DR1O 3A0RA 1MSWD 5LMUO 4PA3A 4OPAA 2UXXA 2ZR3A 3G6BA 3H1KH 5LXTB 3H9VA 3QO8A 3DSQA 1SESA 1IBMB 2EILC 1WPXA 2XTAA 5L3EA 1Q5OA 1O9GA 3SYOA 3CJHB 3OFNG 2AZ0A 4ASUG 1PP9H 3DTUB 2Y48A 3CWBH 4I9WA 4JI5O 4B3RB 1OHHG 1K4CC 5JVDB 2IU0A 1R1BA 2QM8A 2IM9A 2R72A 1W59A 2NLJC 2LQTA 4IHJB 1HW7A 4IHJA 1JA8A 4WBNB 4MS2A 2WAMA 4WBNA 1MZEA 5E1AC 1YSCA 3W7WA 1EFRG 5JJNB 4TV9A 4LF8O 4I7ZB 2E76B 2Q0OC 5JVDA 3I55V 4JPRA 4QPJA 1JX9A 2JS5A 3CRRA 2ZXWC 4DV7O 3N2KB 3CHXA 5JCOC 1FXVA 3ZRWA 4B3SO 5KAIZ 3F5WC 4ZBMA 2B1IA 4JYAO 3E83A 4DV3O 1F7YA 4HAMA 3WB2A 4LF7B 1EZVH 1QLNA 5LGUA 4B3MB 1KU9A 3FB5C 4H44B 2DYRB 1SQVH 3JD2A 5LP6C 2ZR2A 2X0LA 2WLIB 3IC7A 3WG7B 2LW7A 1K73W 3ML0A 1BL8A 1AI4A 2F4VO 3LNNA 1IBKO 1Y76A 4ZKIA 4K0KO 1ZTEA 5EIBC 2ZDIA 4CS2A 3D3QA 2W0FC 1VQ6V 1TUBB 4L87A 5D5PA 5CA0B 1I08A 4WF9V 4X1YB 4LWSB 4ZHQA 2N05A 4RQFA 1US6A 3APOA 2YXHA 4JI0B 3OW2U 1Q8IA 1XNQB 2V4DA 1DF5A 4MT8A 5LMUB 1N36O 1JVMA 1PL4A 5LMNO 2HR3A 4GKJB 2QKCA 1S77D 2LJ2A 2WLLB 2RN9A 2IJIA 1KP3A 3K04A 3SPIA 4AHCA 4CS4A 2NNUA 2RQ6A 1XQ8A 4LF6O 2D3OW 4FIPC 1BQ0A 4DW1A 2D2CB 4MTGA 4I55A 3C90A 1GM9A 4FZ0A 1N34O 1R3JC 3LUTB 3QVNA 5JQGB 3ABUA 4P9PA 3JD4A 1XHZA 4K3AA 4PJ0Z 2DYSC 4I5SA 2AGAA 2UU9B 1AI7A 1VQPV 4LF4O 4RO2A 3LSQA 1IDSA 4H33A 3J7AU 4DR7O 4TUYB 5GTHZ 5CN0A 2YUAA 5EC1C 4FLUA 2ITDC 2QWRB 4GUNA 5JH7B 3OAAG 1HR0B 4MVSA 2V1DA 1I94B 2CUGA 3LSSA 1M56B 4YJ3B 4I9QA 1OZ0A 4LF5B 2ZDIC 1AP5A 1GN2A 4K35A 3QTCA 3SYQA 2EIJB 5IY5C 1P7GA 3VBBA 5JJEB 4LP8A 1UPGA 4MSWC 3SPGA 3HKEA 4W4KA 4IL6Z 3M8AA 1IBKB 1HR0O 1ZX3A 4DV6B 3D36A 2A9HA 2R70A 1BCCH 3WU2Z 4HBNA 5J2UA 4X20A 5D5QA 3G6EV 1N33O 4YY3B 4B7EA 5J2UB 3ZEDA 1OCOB 2EJ7A 3GWKC 5EIBD 2ILMA 3KKYA 2Y69C 3UQ8A 1Q3EA 3ASOC 2YI8A 4BW9A 3TGUH 1R73A 3ABMB 4E4EA 1KKDA 2Q7EA 4NTXA 1K7DA 4N23A 4MTXA 1GH6A 2LFSA 1KYOF 3TCUA 4DV4B 1VQLV 4X62O 3K3WA 4X66B 2Q0AA 4PDRA 4LFAO 2YXYA 2M7WA 1BE3H 3FKSG 1B04A 1L0NH 5FL7G 4UCRA 4FM2A 1M1KW 4F6RA 3ABLC 4NR1A 5KHKA 3ABLB 5KUMA 2L35A 1FXKB 5CA1B 4IYIA 2JDIG 5LGNA 5EK0A 1QR8A 2DE0X 5A9GA 4I55B 3IFXA 5KX5B 4UCUA 1BMFG 2HJDA 1YXBA 3SDLA 5K1PA 5JJJB 4JYBA 2Z5UA 3RFRA 5B1AB 2GSMB 1RM1B 1NKDA 1QLEB 1XHXA 3JAKA 4G28B 3WFVA 2WLJA 2PYLA 3JD0A 3PJSK 1QVFU 2K1EA 4GKKO 5L3GA 2ZIMA 3E22B 1ZL8B 3G67A 4LR3A 4UCTA 3VOUA 1TUBA 1IXMA 3IC9A 1SQQH 3IJ4A 2W0XA 3FX7A 3L71H 1ROPA 3B2EE 2AHZA 3E8HA 2XAHA 3AG4B 3ETDA 3G80A 4ICGA 2E74B 4F4LA 3L74H 5LYJA 1S72V 1M90W 1JCHA 3AG7A 3KZIZ 5L3CA 4DV5O 1N34B 1AI5A 1JFFA 2CTPA 2P90A 3CX5F 1UJWB 1TA8A 4GZRB 3ZRSA 1PNKA 2GV9A 2ARHA 4JI6O 3M99B 2HKOA 1JMKC 5LYJB 2Y0IA 1G6UA 4EB6A 2NN4A 3OEHG 1CP9A 5J2TB 2ZT9B 2EX3A 1PNLA 1KBHA 1YEWA 5J2TA 3KCYA 2MW2B 2GTAA 2CTRA 3H1HH 3DXRA 3OTFA 1EN4A 1XNQO 5EC2C 5KHJA 1QQCA 1YTFD 4UUJC 3OE7G 4O2AB 3JASA 5LBQA 3CCMV 2QTSA 2DW4A 4Z1VA 2QEXV 2A7WA 4KHPO 1AILA 4DV6O 2XASA 4K0KB 3S3WA 4YJ2A 1N33B 1FFTB 2IJHA 3QO5A 5TISZ 2LP7A 3RYHA 4X65B 3BHPA 3CRQA 3N27A 3TETA 2ITCC 1PKXA 5HFMA 4WFEA 1F51A 1N0NA 1SZXA 4GX5A 2N04A 4JZGA 1IBLO 4IIJA 2ZD9A 4IYHA 2DWDC 3NR7A 2WLNA 4P9OA 2UXBB 4NXMB 3ZBHA 4AI8A 5H6RA 2YEVA 4JI4B 4DUZO 4H37A 4EEQA 1Q6IA 1OV9A 3I56V 2JIZG 3FYIB 2CAZC 4FLWA 4J7JA 1S0VA 1V54B 1IX9A 4D6TH 3P32A 1TVKA 1P49A 2WA3A 1J5EB 3QO7A 4O4LB 1AVMA 3ZHSA 5BMVB 1NU1H 4NTWA 1AROP 1O9HA 1WJZA 3BFRA 3NXSA 1N0JA 4O4JB 1BS3A 1S5JA 4QIWF 4KL1A 2CH7A 5LA6B 3ABMC 4JTDB 5LOVB 3OM3B 1JJOA 5B1AC 4JI2O 2X7RB 5H6QA 2PTMA 2P22C 2JGDA 1B06A 3A2FA 2JGUA 1Q82W 2WA4A 1SF9A 2BE3A 2HVJC 4R8CA 1GMGA 4YY3O 3Q4HA 3CEIA 5DECA 3JSLA 3ASNC 1NR1A 4X64O 3AEIA 3OEEG 5H5NA 2OCHA 5L3DA 1WB8A 4DV1O 2VRZA 2UUAB 1NTKH 4JI1O 3CCLV 4DR3O 4JI7B 4TV8A 3SJAC 5JWPA 1YZBA 3ZCCA 1E1QG 1W2BU 4EKWA 4FLYA 3OUFA 3SPCA 3VQXA 4CBCA 1WN7A 4DV2B 1YCIA 2BSKB 1QNMA 3E35A 2R9IA 3JAMN 3K58A 1X4TA 5IE9A 4DV4O 1S5HC 2IH1C 1FJGB 2EINC 5CB4A 3BABA 3AG2C 4DV1B 2GHYA 1YJWV 4ZI7B 4DR3B 4JI7O 4TV8B 2QR4A 4WFGA 5B1OA 1VQKV 2ADQB 2ETNA 2OIEA 1TUEB 4ZOLB 3L72H 4W4LA 3RYIA 4DR1B 2JRIA 4JI6B 2LGQA 4QNHB 1GN3A 1VMGA 3K08A 1M93A 4LFCO 2ZIOA 4HNAA 1VP7A 1H38A 3GWOA 3A0BZ 3FB6C 1H2GA 4PA4A 3BY6A 1YTFB 2WLIA 4DR4O 3ZS8C 1SQPH 3SYCA 4FK5C 5LMNB 1MG1A 4MVRA 1VQ9V 3ZHRA 5GONA 3MAQA 1XREA 2YEVB 3ZMSA 3E89A 4FFBA 2UUBB 3L73H 3W7UA 2BTQA 1T5EA 1G1XB 4OX9O 1PPJH 2YIBD 3G71V 4FLZA 3CRCA 3OGIB 4DRXA 3CB2A 4JI8B 2UXNA 1WAZA 3J81N 1ZWIC 2Z3YA 3A8TA 3BPZA 3L9DA 1YJ9V 5LHIA 1AB3A 2F1MA 3P3NA 1OCOC 3I5DA 3ZRXA 2EILB 2FL4A 3DXRB 4NB5A 4JAUA 2ZNIA 1ORQC 3BRCA 2QTOA 4XBFA 4O4JA 3T1HO 2FMLA 5CMUA 2UXBO 4FZ1A 1M57B 1PNMA 2UXCB 2KG7B 3BEHA 1TVKB 4PDMA 5EBMC 3CRAA 4O4LA 5BMVA 4Z2WA 5F2VO 4DR5B 3K5OA 4IT5A 4DUYO 1JQ0A 4GKKB 3Q4HB 1KUQA 4RUFA 5JQGA 1VQMV 5B66Z 4PA7A 1XMQB 1B3QA 2CE4A 1NTZH 3L75H 5LP6A 2FTKA 1OCCB 1NR7A 5C8YB 4LF8B 2R9RB 2F93B 4Q20A 1I7FA 3W7TA 1VF6A 1N32O 3HPLC 4FMTA 4FLTA 1IURA 5IJ9B 1M4UA 4WFAV 1W0KG 1M9NA 1RP3B 4TSFG 4UVAA 5FNVB 1XL4A 2KKWA 3DC5A 2UUCO 5C93A 4YIOA 4JAAA 2HG5C 4LNUB 2Y4UA 2QSAA 4LNUA 2Q68A 4OXSA 2AZ2A 2A3QA 3K03A 1IXBA 4R7CA 1Z5VA 4NKGB 2BOCC 4X65O 2UUAO 5B5EZ 3R66A 4MTFA 3UT5A 3HKDB 4X64B 4P2ZA 4TV9B 3FFQA 3HKCB 3MHHC 4B3SB 5ITZB 1NTMH 1I5YA 1YVWA 5IJ0B 1VEWA 3K9SA 1F4MA 2DN9A 1GAXA 1NBMG 2Y4TA 4YJ2B 1SS3A 1Y4MA 3SYPA 1HNWB 4J80A 1NZ6A 3RW0A 3K06A 2QM4A 1RPOA 3ETEA 4DRXB 1K5QA 4CC5A 2H94A 2A79B 3OUSA 4F6RB 1HNXB 5B3SC 3B4SA 3O65A 1Y76B 4FPPA 5GONB 3AK3A 2ADPA 4I4TB 4UCOA 2OYQA 1WLEA 2CDYA 4GLXA 3FAVB 1XNRO 3RYHB 4O4HB 2P7TC 3THOA 4JI4O 2O57A 4CZZA 2JJ2G 1GM8A 4BWAA 3OGCC 1HNZO 3ASNB 3HR0A 4BR6A 3JCUZ 3RYIB 2LO1A 1LNQA 1JJ2U 1AR5A 2LW1A 5LHHA 2EINB 4U7OA 1J5EO 4GCZA 1IVSA 1EN6A 1OCCC 4DV0B 2FYUH 3AK2A 1H2KA 5AG2A 3EHBB 1YITV 2HVKC 1K34A 3G4SV 2YIAA 2R9AA 4DR5O 1VARA 4MTOA 1MSDA 2ATKC 2JGDB 4IGGA 2XT9A 1SA0B 1H8HG 3CC7V 3RVZA 1THZA 4YHHB 2WSSG 4BW5A 4O2BA 3AK1A 5JH7A 1Q90D 1R3LC 1SRYA 1ZUQA 2OWOA 1R3KC 2E5LO 5EZYB 2LFRA 3APQA 2Q4PA 3ZHQA 3H1IH 4MW3A 2QWPB 4JYAB 2ZQMA 4DV3B 5KLVH 2EIMB 4I0XB 3B8NA 3FD9A 5IYCO 1Q81W 4DV5B 5HFLA 2Q7HA 3T4ZA 5FNVA 3ETQA 3HKCA 2W6IG 3RYCB 4G27B 4LBEC 2WWWA 4I0XA 4GYCB 5LL6Y 3JASB 2FKXA 1LUVA 1E1RG 3FB7C 3DC6A 2YDEA 3JALA 1Q43A 1YJNV 1SQFA 3P30A 3WG7C 2GDSA 4UCSA 4BIZA 3ZX6A 3H01A 5LP6B 2VS0A 3KG2A 3BCCH 2IW5A 1B6QA 1N4CA 1ZSPA 1W0JG 2KSDA 2QWOB 3W7SA 3CYOA 1H8EG 1BZKA 3M7MX 4X20B 1NVPD 2Y0PA 5DM6V 3E8FA 4EB6B 1BQZA 1L0LH 3N2KA 1URFA 1P4RA 5BR8B 4CH6A 3ZRWB 1BGYH 2N74A 1XILA 1JFFB 4I50A 4NVPA 3C3TA 1XL6A 4CH4A 1YF2A 2IJKA 3JD1A 1NT2B 3T1CA 2QKSA 2RJZA 2XNDG 4QJFB 2WLHA 5EYPA 1XOUA 4JI8O 1MMMA 2F23A 1Z2GA 1V55B 3PN1A 2AHYA 4J11A 4LH6A 4TWKA 4GKJO 1SETA 2XAFA 2XAGA 3N2GA 4I4TA 2BOBC 1PL0A 4FLVA 3CCSV 1MZFA 3X2QC 1H2LA 3EXAA 2HLDG 3UCSC 1FXHA 2EZPA 1XBLA 1AR4A 1D2DA 1CXZB 4YJ3A 2DWEC 2EBOA 2IU3A 1FFXA 4GX2A 2E3CA 2E5LB 1AJNA 3SR2C 1NS1A 1SQBH 1GO3F 3T1YB 3T1HB 1QR9A 4AILC 2RDCA 1MNGA 2QWNB 3HKEB 3AG1B 1YDXA 4X8AA 2E75B 1GM7A 4J10A 3ZN1A 2ZINA 1R6NA 1VQ8V 1QLEC 4IIJB 1QVGU 1SKVA 1XMOO 3JATB 4JI3B 3VQVA 1ZL8A 2CK3G 1SA0A 3D8CA 5CBGA 1CEZA 5EBLC 3SYAA 1HP8A 4JGSA 1OCZB 1H2SB 4DR2B 4JI1B 4LF5O 4O4HA 1HNXO 2G38A 5L3BA 3BAAA 4MW8A 4U3FH 4EFEA 4L8JA 1U97A 2CGOA 1TAEA 1GK9A 1J95A 3OMIB 4TUYA 5KHIA 1N8RW 2YSUB 4JI0O 5KX5A 4A5UB 5BY1A 1WP8A 1QBZA 4UVCA 1KMIZ 4HZ3A 5J9PC 2HEPA 2HJFC 4WFFA 3D36C 5CBHA 4UB8Z 1G4YB 4JASA 4LH7A 4OX9B 3RT3C 2BTOA 2DMXA 2EIMC 4JI5B 2H3OA 5IT9N 1EM1A 3HKBB 1DGSA 3CPWU 4JYYA 3FB8C 3RYFA 1RSOB 3TXQA 5L3FA 3JALB 2UXCO 1LR1A 3AG4C 5A2QN 1YHQV 2ZE7A 2PZSA 2VQEB 1DK1A 3ABTA 4LF4B 2ZM6O 1VQ4V 1MABG 3P3PA 4H13B 5CBFA 4JV5O 4X88A 3ZIAG 3EFFK 3OT7A 1F23A 2L6LA 5B1BB 1BHBA 1JOYA 3MDSA 5LGTA 5IYZB 3CRMA 3U0ZA 3N2GB 1X59A 4DV7B 4CH5A 4B3TB 4EFBA 2ZCEA 2OCCC 2RCVA 3CCVV 1AJPA 4XDJA 5FPOA 3ICXA 1IBLB 2DOSA 2JVDA 4LWSA 1G8MA 3ASOB 2PY5A 2IJJA 4OGQB 2UUCB 1GN4A 1PV0A 2UU9O 4TQDA 2A06H 3F7VC 4DXWA 2JJ1G 2YIDA 4YIPA 4UV9A 2VWKA 1WPBA 2BTQB 4ZIBA 4OPHA 2PF4E 3JAWA 4UCVA 5BZBA 1N32B 3HB3B 1VQNV 3JAWB 4GX0A 3CD6V 3K0GA 1QCEA 2GUZA 3K5LA 1JR9A 2GUZB 4O4IA 4PI0A 2EIJC 5IY5B 4QGPA 3ZMVA 3S3XA 2XAQA 3OR7C 4TQFA 3U10A 2B5UA 1XMQO 3SPJA 3CCJV 5B3SB 1KD1W 1WNSA 3L70H 2XOKG 4BAYA 1RM1C 3BVOA 3E86A 1S5LZ 2XHBA 2Y69B 1IZ3A 4HYOA 1RPRA 3AG1C 1KQSU 1WP7A 4JYCA 5LXTA 4DV0O 4PD4F 1S76D 4UXNA 3GVMA 4J9YB 4WFHA 4UVBA 4WFBV 3ZHUA 4YXWG 4RUEA 4MVQA 4DW0A 2WPDG 3JYCA 4RWUA 5EZYA 4BIOA 3HKDA 1BHAA 1Z5WA 1FYJA 4FM0A 2ZE5A 3X2QB 5IWAB 4PV1B 1WB7A 1EN5A 1MOFA 4X1IB 3E22A 4Q6GA 4DV2O 2YI9A 2P5OA 2YIBA 1M56C 2EIKB 1QU7A 1R6TA 3T2MA 2QDOA 3BA9A 4D7TA 3TK1A 3ZMTA 1XDCA 4UB6Z 1VF5B 3ETGA 1AR1B 2VWJA 3JD3A 1FD9A 1OCZC 3JATA 2DQ3A 5IYZA 5IJ9A 3OR6C 1Y74B 1SQGA 1A32A 2YS8A 3RYFB 2Q73A 1U96A 1VQOV 4DR6B 4FM1A 3VQYA 1KKCA 3IGAC 1P84F 2M6YA 3K79A 5EYPB 3QG5A 4PI2A 4WCEV 2EIKC 1KB9F 2VQFO 2Q69A 2QWQB 1M57C 1ZLZA 4LFAB 1D5AA 2LGWA 1DF4A 5GW7A 1YIJV 4E2LA 4LF7O 3UT5B 1V54C 1E79G 1BSMA 2DYRC 4B3MO 1I94O 4DUYB 5ITZA 1AP6A 1XMOB 3CC4V 2P06A 1L1FA 3W7XA 4JI2B 3F5TA 3JAKB 5EBWC 4LCUC 1K97A 4ZI7A 2X6CA 2CTQA 2C2AA 4P30A 1OCRC 4LF9O 4X9QA 3O9OA 1RSOA 3K0DA 1FAFA 5FPRA 2BSKA 2YC0A 2WLKA 5CA0A 2JS3A 3LSUA 3RWRD 1IBMO 4R50A 1QHTA 2RNBA 3IAYA 1FS0G 5DEDA 5IWAO 2F95B 1KECA 3EVKA 4QE9A 2Q67A 3SJQC 2EULA 5KAFZ 3MD0A 4FJCC 4LC1A 4B3RO 4FVMA 4JV5B 3CS5A 3UKMA 4FLXA 2DQ0A 4CS3A 4MVMA 5H2FZ 2W6JG 4U3JB 2XAJA 4JF3A 4FFBB 1OCRB 3E2EA 3C3SA 4TT3G 2ZE8A 4K8ZA 4KFMA 3CE2A 5FLXN 3BA8A 2Q7GA 4LF6B 1CPYA 1BT8A 4MVUA 2KG7A 2XUMA 4X1KB 4AQYB 3CMEV 4UFZA 4Z1MG 5LHGA 1Q7YW 2Q8VA 1H2MA 4MVOA 1Q6HA 1TGOA 3ZN0A 5DN6G 4KHPB 4QPKA 4LFBO 3OTOB 3LNMB 5JCOA 1YI2V 2GTSA 2ZM6B 2OTJV 2P4KA 1NJIW 3B8MA 1I5XA 3STLC 4NYKA 5B1NA 1N36B 4RQEA 1F4NA 1GTOA 2QM7A 2QE7G 4ABMA 1SERA 2P6JA 2B1GA 2OTLV 4B08A 3R65A 4LF9B 3A0HZ 4I50B 5IYBO 4PHZA 1XEQA 1EZJA 3JSNA 2Q5ZA 3ABKB 1K5SA 1HWYA 1KP2A 1Y66A 2BCCH 2EZOA 3K5NA 2QA4V 4ZOLA 2OCCB 2Q9LA 4JI3O 2JEUA 3ZJZA 4MVZA 4KXRA 4YHHO 5CA3A 2VQFB 3AG3B 1K3EA 1NH2D 5E79Z 1UFIA 1HNZB 2ZXWB 1GRJA 4DK1A 5LA6A 2Q6AA 1Y74A 1V55C 2CGNA 5KHHA 3RN4A 3RGBA 1XNRB 4DK0A 2HP8A 1OJHA 2P67A 4H0LB 1ZAUA 4PDVA 1LUWA 3ZRVA 4PA6A 4F6EA 3B77A 2WLMA 2PUSA 4J7ZA 2ZE6A 1NQTA 1SQXH 5KUKA 3K57A 2KB1A 4C7UA 2F4VB 3ZHTA 2KQXA 1GN6A 4TOIA 5LOVA 4DUZB 1FJGO 3J80N 3LDCA 3CXCU 2UXDB 3CXHF 3WB0A 4AQYO 5BXZA 4X89A 3T1YO 3JCZA 1SZTA 4KUMA 3CCUV 1AJQA 1COWG 1NVPB 1VIBA 3F7YC 2AXTZ 2GBOA 3K9AA 3UO3A 1MA1A 4J41A 4XDLA 5CB4B 1Q86W 4JZ2A 1XI1A 1V9PA 4G2KA 4X1KA 2HHHO 4NXMO 4JTAB 3K59A 1WA8B 3JARA 4XDKA 5K1XA 2QGNA 1DTOA 1NH2B 1KC8W 1VF7A 1H2NA 5IDJA 2UXDO 1HDJA 2NR5A 4J9ZB 4X66O 3FYEB 3RYCA 2V7QG 3OMAB 2PI5A
chains in the Genus database with same CATH topology
3A0HZ 3WU2Z 3KZIZ 5KAFZ 4IL6Z 4UB8Z 3A0BZ 5GTIZ 1S5LZ 5KAIZ 4PJ0Z 5GTHZ 5B5EZ 4UB6Z 2AXTZ 5E79Z 5B66Z 5TISZ 5H2FZ 3JCUZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H Z;  3WU2 Z;  3KZI Z;  5KAF Z;  4IL6 Z;  4UB8 Z;  3A0B Z;  5GTI Z;  1S5L Z;  5KAI Z;  4PJ0 Z;  5GTH Z;  5B5E Z;  4UB6 Z;  2AXT Z;  5E79 Z;  5B66 Z;  5TIS Z;  5H2F Z;  3JCU Z; 
#chains in the Genus database with same CATH topology
 1FXK A;  3TXS A;  4GT1 A;  3SGI A;  3QNE A;  4B3T O;  1ENV A;  3OTO O;  4N21 A;  2F66 C;  4PDL A;  2HHH B;  1L8D A;  2FB5 A;  3LDD A;  1FXK C;  3CJH A;  4J7K A;  4O2B B;  3DGE A;  1WA8 A;  3JAR B;  3HKB A;  2OIG A;  3ZHV A;  3CC2 V;  3CCQ V;  2RMK B;  3QF7 A;  1Q6U A;  3CMA V;  5KA6 A;  4CC6 A;  4HNA B;  2CH7 B;  3UM7 A;  4R6Z A;  1EBO A;  4UV8 A;  2ODM A;  4X62 B;  2H8P C;  3GB7 C;  5IYD O;  2DYS B;  3UO2 A;  2YIC A;  3KCX A;  1VF6 C;  2X6A A;  3CP1 A;  4O2A A;  3OMN B;  2OT5 A;  1K9M W;  3CSX A;  2YXL A;  3AG3 C;  1S3J A;  1RFY A;  4NTY A;  4FFK A;  4GX1 A;  3E8G A;  3B09 A;  2K9P A;  2VQE O;  3WB1 A;  2IH3 C;  1K4D C;  3VQW A;  2DJV A;  1K8A W;  2F43 G;  1PM9 A;  1Y67 A;  2MK3 A;  4ZHQ B;  4DR7 B;  1M5I A;  1R6K A;  1JPX A;  2X6B A;  3ABK C;  1GKF A;  2HFE C;  2JK5 C;  3RVY A;  1FKA O;  2ZKO A;  5B1B C;  3CCR V;  2EJR A;  4D7S A;  1VQ7 V;  4DR4 B;  3T4D A;  4DYL A;  3TJT A;  4RAI A;  3RBZ A;  3SPH A;  2WLL A;  4B7K A;  1D5N A;  4DR2 O;  4PA9 A;  5C8Y A;  1XUQ A;  3OD4 A;  5KA5 A;  2UUB O;  4J42 A;  3ZMZ A;  2JEX A;  3B40 A;  5KHG A;  2Z0A A;  1SC5 B;  4O4I B;  3K5M A;  2B9Z A;  3U11 A;  2P4V A;  4NXN O;  1FPO A;  3D3I A;  5KMG B;  5KMG A;  4PEL A;  2ZNJ A;  2PI4 A;  4X1Y A;  1VQ5 V;  3FAV A;  3E8B A;  4JAV A;  1Y6X A;  1R3I C;  4DR6 O;  2PYJ A;  3SJC C;  1HNW O;  5H9C A;  1I0H A;  4JTC B;  4KP4 A;  1P7B A;  3SJB C;  4LFC B;  3CCE V;  2AW9 A;  1K33 A;  3H1L H;  2QKA A;  4LFB B;  2IBZ H;  4BIU A;  3MHS C;  4K8X A;  4U7N A;  2PGG A;  2QJ1 A;  4NXN B;  3AG2 B;  4CH3 A;  1K92 A;  2A0L A;  1FFX B;  1NI8 A;  1DLB A;  5BR8 O;  3LDE A;  3H1J H;  3ZMU A;  5IJ0 A;  5CA1 A;  4X1I A;  4U3J A;  4QE7 A;  3STZ C;  4DO2 A;  1PD3 A;  5GTI Z;  1AI6 A;  2CTW A;  4DR1 O;  3A0R A;  1MSW D;  5LMU O;  4PA3 A;  4OPA A;  2UXX A;  2ZR3 A;  3G6B A;  3H1K H;  5LXT B;  3H9V A;  3QO8 A;  3DSQ A;  1SES A;  1IBM B;  2EIL C;  1WPX A;  2XTA A;  5L3E A;  1Q5O A;  1O9G A;  3SYO A;  3CJH B;  3OFN G;  2AZ0 A;  4ASU G;  1PP9 H;  3DTU B;  2Y48 A;  3CWB H;  4I9W A;  4JI5 O;  4B3R B;  1OHH G;  1K4C C;  5JVD B;  2IU0 A;  1R1B A;  2QM8 A;  2IM9 A;  2R72 A;  1W59 A;  2NLJ C;  2LQT A;  4IHJ B;  1HW7 A;  4IHJ A;  1JA8 A;  4WBN B;  4MS2 A;  2WAM A;  4WBN A;  1MZE A;  5E1A C;  1YSC A;  3W7W A;  1EFR G;  5JJN B;  4TV9 A;  4LF8 O;  4I7Z B;  2E76 B;  2Q0O C;  5JVD A;  3I55 V;  4JPR A;  4QPJ A;  1JX9 A;  2JS5 A;  3CRR A;  2ZXW C;  4DV7 O;  3N2K B;  3CHX A;  5JCO C;  1FXV A;  3ZRW A;  4B3S O;  5KAI Z;  3F5W C;  4ZBM A;  2B1I A;  4JYA O;  3E83 A;  4DV3 O;  1F7Y A;  4HAM A;  3WB2 A;  4LF7 B;  1EZV H;  1QLN A;  5LGU A;  4B3M B;  1KU9 A;  3FB5 C;  4H44 B;  2DYR B;  1SQV H;  3JD2 A;  5LP6 C;  2ZR2 A;  2X0L A;  2WLI B;  3IC7 A;  3WG7 B;  2LW7 A;  1K73 W;  3ML0 A;  1BL8 A;  1AI4 A;  2F4V O;  3LNN A;  1IBK O;  1Y76 A;  4ZKI A;  4K0K O;  1ZTE A;  5EIB C;  2ZDI A;  4CS2 A;  3D3Q A;  2W0F C;  1VQ6 V;  1TUB B;  4L87 A;  5D5P A;  5CA0 B;  1I08 A;  4WF9 V;  4X1Y B;  4LWS B;  4ZHQ A;  2N05 A;  4RQF A;  1US6 A;  3APO A;  2YXH A;  4JI0 B;  3OW2 U;  1Q8I A;  1XNQ B;  2V4D A;  1DF5 A;  4MT8 A;  5LMU B;  1N36 O;  1JVM A;  1PL4 A;  5LMN O;  2HR3 A;  4GKJ B;  2QKC A;  1S77 D;  2LJ2 A;  2WLL B;  2RN9 A;  2IJI A;  1KP3 A;  3K04 A;  3SPI A;  4AHC A;  4CS4 A;  2NNU A;  2RQ6 A;  1XQ8 A;  4LF6 O;  2D3O W;  4FIP C;  1BQ0 A;  4DW1 A;  2D2C B;  4MTG A;  4I55 A;  3C90 A;  1GM9 A;  4FZ0 A;  1N34 O;  1R3J C;  3LUT B;  3QVN A;  5JQG B;  3ABU A;  4P9P A;  3JD4 A;  1XHZ A;  4K3A A;  4PJ0 Z;  2DYS C;  4I5S A;  2AGA A;  2UU9 B;  1AI7 A;  1VQP V;  4LF4 O;  4RO2 A;  3LSQ A;  1IDS A;  4H33 A;  3J7A U;  4DR7 O;  4TUY B;  5GTH Z;  5CN0 A;  2YUA A;  5EC1 C;  4FLU A;  2ITD C;  2QWR B;  4GUN A;  5JH7 B;  3OAA G;  1HR0 B;  4MVS A;  2V1D A;  1I94 B;  2CUG A;  3LSS A;  1M56 B;  4YJ3 B;  4I9Q A;  1OZ0 A;  4LF5 B;  2ZDI C;  1AP5 A;  1GN2 A;  4K35 A;  3QTC A;  3SYQ A;  2EIJ B;  5IY5 C;  1P7G A;  3VBB A;  5JJE B;  4LP8 A;  1UPG A;  4MSW C;  3SPG A;  3HKE A;  4W4K A;  4IL6 Z;  3M8A A;  1IBK B;  1HR0 O;  1ZX3 A;  4DV6 B;  3D36 A;  2A9H A;  2R70 A;  1BCC H;  3WU2 Z;  4HBN A;  5J2U A;  4X20 A;  5D5Q A;  3G6E V;  1N33 O;  4YY3 B;  4B7E A;  5J2U B;  3ZED A;  1OCO B;  2EJ7 A;  3GWK C;  5EIB D;  2ILM A;  3KKY A;  2Y69 C;  3UQ8 A;  1Q3E A;  3ASO C;  2YI8 A;  4BW9 A;  3TGU H;  1R73 A;  3ABM B;  4E4E A;  1KKD A;  2Q7E A;  4NTX A;  1K7D A;  4N23 A;  4MTX A;  1GH6 A;  2LFS A;  1KYO F;  3TCU A;  4DV4 B;  1VQL V;  4X62 O;  3K3W A;  4X66 B;  2Q0A A;  4PDR A;  4LFA O;  2YXY A;  2M7W A;  1BE3 H;  3FKS G;  1B04 A;  1L0N H;  5FL7 G;  4UCR A;  4FM2 A;  1M1K W;  4F6R A;  3ABL C;  4NR1 A;  5KHK A;  3ABL B;  5KUM A;  2L35 A;  1FXK B;  5CA1 B;  4IYI A;  2JDI G;  5LGN A;  5EK0 A;  1QR8 A;  2DE0 X;  5A9G A;  4I55 B;  3IFX A;  5KX5 B;  4UCU A;  1BMF G;  2HJD A;  1YXB A;  3SDL A;  5K1P A;  5JJJ B;  4JYB A;  2Z5U A;  3RFR A;  5B1A B;  2GSM B;  1RM1 B;  1NKD A;  1QLE B;  1XHX A;  3JAK A;  4G28 B;  3WFV A;  2WLJ A;  2PYL A;  3JD0 A;  3PJS K;  1QVF U;  2K1E A;  4GKK O;  5L3G A;  2ZIM A;  3E22 B;  1ZL8 B;  3G67 A;  4LR3 A;  4UCT A;  3VOU A;  1TUB A;  1IXM A;  3IC9 A;  1SQQ H;  3IJ4 A;  2W0X A;  3FX7 A;  3L71 H;  1ROP A;  3B2E E;  2AHZ A;  3E8H A;  2XAH A;  3AG4 B;  3ETD A;  3G80 A;  4ICG A;  2E74 B;  4F4L A;  3L74 H;  5LYJ A;  1S72 V;  1M90 W;  1JCH A;  3AG7 A;  3KZI Z;  5L3C A;  4DV5 O;  1N34 B;  1AI5 A;  1JFF A;  2CTP A;  2P90 A;  3CX5 F;  1UJW B;  1TA8 A;  4GZR B;  3ZRS A;  1PNK A;  2GV9 A;  2ARH A;  4JI6 O;  3M99 B;  2HKO A;  1JMK C;  5LYJ B;  2Y0I A;  1G6U A;  4EB6 A;  2NN4 A;  3OEH G;  1CP9 A;  5J2T B;  2ZT9 B;  2EX3 A;  1PNL A;  1KBH A;  1YEW A;  5J2T A;  3KCY A;  2MW2 B;  2GTA A;  2CTR A;  3H1H H;  3DXR A;  3OTF A;  1EN4 A;  1XNQ O;  5EC2 C;  5KHJ A;  1QQC A;  1YTF D;  4UUJ C;  3OE7 G;  4O2A B;  3JAS A;  5LBQ A;  3CCM V;  2QTS A;  2DW4 A;  4Z1V A;  2QEX V;  2A7W A;  4KHP O;  1AIL A;  4DV6 O;  2XAS A;  4K0K B;  3S3W A;  4YJ2 A;  1N33 B;  1FFT B;  2IJH A;  3QO5 A;  5TIS Z;  2LP7 A;  3RYH A;  4X65 B;  3BHP A;  3CRQ A;  3N27 A;  3TET A;  2ITC C;  1PKX A;  5HFM A;  4WFE A;  1F51 A;  1N0N A;  1SZX A;  4GX5 A;  2N04 A;  4JZG A;  1IBL O;  4IIJ A;  2ZD9 A;  4IYH A;  2DWD C;  3NR7 A;  2WLN A;  4P9O A;  2UXB B;  4NXM B;  3ZBH A;  4AI8 A;  5H6R A;  2YEV A;  4JI4 B;  4DUZ O;  4H37 A;  4EEQ A;  1Q6I A;  1OV9 A;  3I56 V;  2JIZ G;  3FYI B;  2CAZ C;  4FLW A;  4J7J A;  1S0V A;  1V54 B;  1IX9 A;  4D6T H;  3P32 A;  1TVK A;  1P49 A;  2WA3 A;  1J5E B;  3QO7 A;  4O4L B;  1AVM A;  3ZHS A;  5BMV B;  1NU1 H;  4NTW A;  1ARO P;  1O9H A;  1WJZ A;  3BFR A;  3NXS A;  1N0J A;  4O4J B;  1BS3 A;  1S5J A;  4QIW F;  4KL1 A;  2CH7 A;  5LA6 B;  3ABM C;  4JTD B;  5LOV B;  3OM3 B;  1JJO A;  5B1A C;  4JI2 O;  2X7R B;  5H6Q A;  2PTM A;  2P22 C;  2JGD A;  1B06 A;  3A2F A;  2JGU A;  1Q82 W;  2WA4 A;  1SF9 A;  2BE3 A;  2HVJ C;  4R8C A;  1GMG A;  4YY3 O;  3Q4H A;  3CEI A;  5DEC A;  3JSL A;  3ASN C;  1NR1 A;  4X64 O;  3AEI A;  3OEE G;  5H5N A;  2OCH A;  5L3D A;  1WB8 A;  4DV1 O;  2VRZ A;  2UUA B;  1NTK H;  4JI1 O;  3CCL V;  4DR3 O;  4JI7 B;  4TV8 A;  3SJA C;  5JWP A;  1YZB A;  3ZCC A;  1E1Q G;  1W2B U;  4EKW A;  4FLY A;  3OUF A;  3SPC A;  3VQX A;  4CBC A;  1WN7 A;  4DV2 B;  1YCI A;  2BSK B;  1QNM A;  3E35 A;  2R9I A;  3JAM N;  3K58 A;  1X4T A;  5IE9 A;  4DV4 O;  1S5H C;  2IH1 C;  1FJG B;  2EIN C;  5CB4 A;  3BAB A;  3AG2 C;  4DV1 B;  2GHY A;  1YJW V;  4ZI7 B;  4DR3 B;  4JI7 O;  4TV8 B;  2QR4 A;  4WFG A;  5B1O A;  1VQK V;  2ADQ B;  2ETN A;  2OIE A;  1TUE B;  4ZOL B;  3L72 H;  4W4L A;  3RYI A;  4DR1 B;  2JRI A;  4JI6 B;  2LGQ A;  4QNH B;  1GN3 A;  1VMG A;  3K08 A;  1M93 A;  4LFC O;  2ZIO A;  4HNA A;  1VP7 A;  1H38 A;  3GWO A;  3A0B Z;  3FB6 C;  1H2G A;  4PA4 A;  3BY6 A;  1YTF B;  2WLI A;  4DR4 O;  3ZS8 C;  1SQP H;  3SYC A;  4FK5 C;  5LMN B;  1MG1 A;  4MVR A;  1VQ9 V;  3ZHR A;  5GON A;  3MAQ A;  1XRE A;  2YEV B;  3ZMS A;  3E89 A;  4FFB A;  2UUB B;  3L73 H;  3W7U A;  2BTQ A;  1T5E A;  1G1X B;  4OX9 O;  1PPJ H;  2YIB D;  3G71 V;  4FLZ A;  3CRC A;  3OGI B;  4DRX A;  3CB2 A;  4JI8 B;  2UXN A;  1WAZ A;  3J81 N;  1ZWI C;  2Z3Y A;  3A8T A;  3BPZ A;  3L9D A;  1YJ9 V;  5LHI A;  1AB3 A;  2F1M A;  3P3N A;  1OCO C;  3I5D A;  3ZRX A;  2EIL B;  2FL4 A;  3DXR B;  4NB5 A;  4JAU A;  2ZNI A;  1ORQ C;  3BRC A;  2QTO A;  4XBF A;  4O4J A;  3T1H O;  2FML A;  5CMU A;  2UXB O;  4FZ1 A;  1M57 B;  1PNM A;  2UXC B;  2KG7 B;  3BEH A;  1TVK B;  4PDM A;  5EBM C;  3CRA A;  4O4L A;  5BMV A;  4Z2W A;  5F2V O;  4DR5 B;  3K5O A;  4IT5 A;  4DUY O;  1JQ0 A;  4GKK B;  3Q4H B;  1KUQ A;  4RUF A;  5JQG A;  1VQM V;  5B66 Z;  4PA7 A;  1XMQ B;  1B3Q A;  2CE4 A;  1NTZ H;  3L75 H;  5LP6 A;  2FTK A;  1OCC B;  1NR7 A;  5C8Y B;  4LF8 B;  2R9R B;  2F93 B;  4Q20 A;  1I7F A;  3W7T A;  1VF6 A;  1N32 O;  3HPL C;  4FMT A;  4FLT A;  1IUR A;  5IJ9 B;  1M4U A;  4WFA V;  1W0K G;  1M9N A;  1RP3 B;  4TSF G;  4UVA A;  5FNV B;  1XL4 A;  2KKW A;  3DC5 A;  2UUC O;  5C93 A;  4YIO A;  4JAA A;  2HG5 C;  4LNU B;  2Y4U A;  2QSA A;  4LNU A;  2Q68 A;  4OXS A;  2AZ2 A;  2A3Q A;  3K03 A;  1IXB A;  4R7C A;  1Z5V A;  4NKG B;  2BOC C;  4X65 O;  2UUA O;  5B5E Z;  3R66 A;  4MTF A;  3UT5 A;  3HKD B;  4X64 B;  4P2Z A;  4TV9 B;  3FFQ A;  3HKC B;  3MHH C;  4B3S B;  5ITZ B;  1NTM H;  1I5Y A;  1YVW A;  5IJ0 B;  1VEW A;  3K9S A;  1F4M A;  2DN9 A;  1GAX A;  1NBM G;  2Y4T A;  4YJ2 B;  1SS3 A;  1Y4M A;  3SYP A;  1HNW B;  4J80 A;  1NZ6 A;  3RW0 A;  3K06 A;  2QM4 A;  1RPO A;  3ETE A;  4DRX B;  1K5Q A;  4CC5 A;  2H94 A;  2A79 B;  3OUS A;  4F6R B;  1HNX B;  5B3S C;  3B4S A;  3O65 A;  1Y76 B;  4FPP A;  5GON B;  3AK3 A;  2ADP A;  4I4T B;  4UCO A;  2OYQ A;  1WLE A;  2CDY A;  4GLX A;  3FAV B;  1XNR O;  3RYH B;  4O4H B;  2P7T C;  3THO A;  4JI4 O;  2O57 A;  4CZZ A;  2JJ2 G;  1GM8 A;  4BWA A;  3OGC C;  1HNZ O;  3ASN B;  3HR0 A;  4BR6 A;  3JCU Z;  3RYI B;  2LO1 A;  1LNQ A;  1JJ2 U;  1AR5 A;  2LW1 A;  5LHH A;  2EIN B;  4U7O A;  1J5E O;  4GCZ A;  1IVS A;  1EN6 A;  1OCC C;  4DV0 B;  2FYU H;  3AK2 A;  1H2K A;  5AG2 A;  3EHB B;  1YIT V;  2HVK C;  1K34 A;  3G4S V;  2YIA A;  2R9A A;  4DR5 O;  1VAR A;  4MTO A;  1MSD A;  2ATK C;  2JGD B;  4IGG A;  2XT9 A;  1SA0 B;  1H8H G;  3CC7 V;  3RVZ A;  1THZ A;  4YHH B;  2WSS G;  4BW5 A;  4O2B A;  3AK1 A;  5JH7 A;  1Q90 D;  1R3L C;  1SRY A;  1ZUQ A;  2OWO A;  1R3K C;  2E5L O;  5EZY B;  2LFR A;  3APQ A;  2Q4P A;  3ZHQ A;  3H1I H;  4MW3 A;  2QWP B;  4JYA B;  2ZQM A;  4DV3 B;  5KLV H;  2EIM B;  4I0X B;  3B8N A;  3FD9 A;  5IYC O;  1Q81 W;  4DV5 B;  5HFL A;  2Q7H A;  3T4Z A;  5FNV A;  3ETQ A;  3HKC A;  2W6I G;  3RYC B;  4G27 B;  4LBE C;  2WWW A;  4I0X A;  4GYC B;  5LL6 Y;  3JAS B;  2FKX A;  1LUV A;  1E1R G;  3FB7 C;  3DC6 A;  2YDE A;  3JAL A;  1Q43 A;  1YJN V;  1SQF A;  3P30 A;  3WG7 C;  2GDS A;  4UCS A;  4BIZ A;  3ZX6 A;  3H01 A;  5LP6 B;  2VS0 A;  3KG2 A;  3BCC H;  2IW5 A;  1B6Q A;  1N4C A;  1ZSP A;  1W0J G;  2KSD A;  2QWO B;  3W7S A;  3CYO A;  1H8E G;  1BZK A;  3M7M X;  4X20 B;  1NVP D;  2Y0P A;  5DM6 V;  3E8F A;  4EB6 B;  1BQZ A;  1L0L H;  3N2K A;  1URF A;  1P4R A;  5BR8 B;  4CH6 A;  3ZRW B;  1BGY H;  2N74 A;  1XIL A;  1JFF B;  4I50 A;  4NVP A;  3C3T A;  1XL6 A;  4CH4 A;  1YF2 A;  2IJK A;  3JD1 A;  1NT2 B;  3T1C A;  2QKS A;  2RJZ A;  2XND G;  4QJF B;  2WLH A;  5EYP A;  1XOU A;  4JI8 O;  1MMM A;  2F23 A;  1Z2G A;  1V55 B;  3PN1 A;  2AHY A;  4J11 A;  4LH6 A;  4TWK A;  4GKJ O;  1SET A;  2XAF A;  2XAG A;  3N2G A;  4I4T A;  2BOB C;  1PL0 A;  4FLV A;  3CCS V;  1MZF A;  3X2Q C;  1H2L A;  3EXA A;  2HLD G;  3UCS C;  1FXH A;  2EZP A;  1XBL A;  1AR4 A;  1D2D A;  1CXZ B;  4YJ3 A;  2DWE C;  2EBO A;  2IU3 A;  1FFX A;  4GX2 A;  2E3C A;  2E5L B;  1AJN A;  3SR2 C;  1NS1 A;  1SQB H;  1GO3 F;  3T1Y B;  3T1H B;  1QR9 A;  4AIL C;  2RDC A;  1MNG A;  2QWN B;  3HKE B;  3AG1 B;  1YDX A;  4X8A A;  2E75 B;  1GM7 A;  4J10 A;  3ZN1 A;  2ZIN A;  1R6N A;  1VQ8 V;  1QLE C;  4IIJ B;  1QVG U;  1SKV A;  1XMO O;  3JAT B;  4JI3 B;  3VQV A;  1ZL8 A;  2CK3 G;  1SA0 A;  3D8C A;  5CBG A;  1CEZ A;  5EBL C;  3SYA A;  1HP8 A;  4JGS A;  1OCZ B;  1H2S B;  4DR2 B;  4JI1 B;  4LF5 O;  4O4H A;  1HNX O;  2G38 A;  5L3B A;  3BAA A;  4MW8 A;  4U3F H;  4EFE A;  4L8J A;  1U97 A;  2CGO A;  1TAE A;  1GK9 A;  1J95 A;  3OMI B;  4TUY A;  5KHI A;  1N8R W;  2YSU B;  4JI0 O;  5KX5 A;  4A5U B;  5BY1 A;  1WP8 A;  1QBZ A;  4UVC A;  1KMI Z;  4HZ3 A;  5J9P C;  2HEP A;  2HJF C;  4WFF A;  3D36 C;  5CBH A;  4UB8 Z;  1G4Y B;  4JAS A;  4LH7 A;  4OX9 B;  3RT3 C;  2BTO A;  2DMX A;  2EIM C;  4JI5 B;  2H3O A;  5IT9 N;  1EM1 A;  3HKB B;  1DGS A;  3CPW U;  4JYY A;  3FB8 C;  3RYF A;  1RSO B;  3TXQ A;  5L3F A;  3JAL B;  2UXC O;  1LR1 A;  3AG4 C;  5A2Q N;  1YHQ V;  2ZE7 A;  2PZS A;  2VQE B;  1DK1 A;  3ABT A;  4LF4 B;  2ZM6 O;  1VQ4 V;  1MAB G;  3P3P A;  4H13 B;  5CBF A;  4JV5 O;  4X88 A;  3ZIA G;  3EFF K;  3OT7 A;  1F23 A;  2L6L A;  5B1B B;  1BHB A;  1JOY A;  3MDS A;  5LGT A;  5IYZ B;  3CRM A;  3U0Z A;  3N2G B;  1X59 A;  4DV7 B;  4CH5 A;  4B3T B;  4EFB A;  2ZCE A;  2OCC C;  2RCV A;  3CCV V;  1AJP A;  4XDJ A;  5FPO A;  3ICX A;  1IBL B;  2DOS A;  2JVD A;  4LWS A;  1G8M A;  3ASO B;  2PY5 A;  2IJJ A;  4OGQ B;  2UUC B;  1GN4 A;  1PV0 A;  2UU9 O;  4TQD A;  2A06 H;  3F7V C;  4DXW A;  2JJ1 G;  2YID A;  4YIP A;  4UV9 A;  2VWK A;  1WPB A;  2BTQ B;  4ZIB A;  4OPH A;  2PF4 E;  3JAW A;  4UCV A;  5BZB A;  1N32 B;  3HB3 B;  1VQN V;  3JAW B;  4GX0 A;  3CD6 V;  3K0G A;  1QCE A;  2GUZ A;  3K5L A;  1JR9 A;  2GUZ B;  4O4I A;  4PI0 A;  2EIJ C;  5IY5 B;  4QGP A;  3ZMV A;  3S3X A;  2XAQ A;  3OR7 C;  4TQF A;  3U10 A;  2B5U A;  1XMQ O;  3SPJ A;  3CCJ V;  5B3S B;  1KD1 W;  1WNS A;  3L70 H;  2XOK G;  4BAY A;  1RM1 C;  3BVO A;  3E86 A;  1S5L Z;  2XHB A;  2Y69 B;  1IZ3 A;  4HYO A;  1RPR A;  3AG1 C;  1KQS U;  1WP7 A;  4JYC A;  5LXT A;  4DV0 O;  4PD4 F;  1S76 D;  4UXN A;  3GVM A;  4J9Y B;  4WFH A;  4UVB A;  4WFB V;  3ZHU A;  4YXW G;  4RUE A;  4MVQ A;  4DW0 A;  2WPD G;  3JYC A;  4RWU A;  5EZY A;  4BIO A;  3HKD A;  1BHA A;  1Z5W A;  1FYJ A;  4FM0 A;  2ZE5 A;  3X2Q B;  5IWA B;  4PV1 B;  1WB7 A;  1EN5 A;  1MOF A;  4X1I B;  3E22 A;  4Q6G A;  4DV2 O;  2YI9 A;  2P5O A;  2YIB A;  1M56 C;  2EIK B;  1QU7 A;  1R6T A;  3T2M A;  2QDO A;  3BA9 A;  4D7T A;  3TK1 A;  3ZMT A;  1XDC A;  4UB6 Z;  1VF5 B;  3ETG A;  1AR1 B;  2VWJ A;  3JD3 A;  1FD9 A;  1OCZ C;  3JAT A;  2DQ3 A;  5IYZ A;  5IJ9 A;  3OR6 C;  1Y74 B;  1SQG A;  1A32 A;  2YS8 A;  3RYF B;  2Q73 A;  1U96 A;  1VQO V;  4DR6 B;  4FM1 A;  3VQY A;  1KKC A;  3IGA C;  1P84 F;  2M6Y A;  3K79 A;  5EYP B;  3QG5 A;  4PI2 A;  4WCE V;  2EIK C;  1KB9 F;  2VQF O;  2Q69 A;  2QWQ B;  1M57 C;  1ZLZ A;  4LFA B;  1D5A A;  2LGW A;  1DF4 A;  5GW7 A;  1YIJ V;  4E2L A;  4LF7 O;  3UT5 B;  1V54 C;  1E79 G;  1BSM A;  2DYR C;  4B3M O;  1I94 O;  4DUY B;  5ITZ A;  1AP6 A;  1XMO B;  3CC4 V;  2P06 A;  1L1F A;  3W7X A;  4JI2 B;  3F5T A;  3JAK B;  5EBW C;  4LCU C;  1K97 A;  4ZI7 A;  2X6C A;  2CTQ A;  2C2A A;  4P30 A;  1OCR C;  4LF9 O;  4X9Q A;  3O9O A;  1RSO A;  3K0D A;  1FAF A;  5FPR A;  2BSK A;  2YC0 A;  2WLK A;  5CA0 A;  2JS3 A;  3LSU A;  3RWR D;  1IBM O;  4R50 A;  1QHT A;  2RNB A;  3IAY A;  1FS0 G;  5DED A;  5IWA O;  2F95 B;  1KEC A;  3EVK A;  4QE9 A;  2Q67 A;  3SJQ C;  2EUL A;  5KAF Z;  3MD0 A;  4FJC C;  4LC1 A;  4B3R O;  4FVM A;  4JV5 B;  3CS5 A;  3UKM A;  4FLX A;  2DQ0 A;  4CS3 A;  4MVM A;  5H2F Z;  2W6J G;  4U3J B;  2XAJ A;  4JF3 A;  4FFB B;  1OCR B;  3E2E A;  3C3S A;  4TT3 G;  2ZE8 A;  4K8Z A;  4KFM A;  3CE2 A;  5FLX N;  3BA8 A;  2Q7G A;  4LF6 B;  1CPY A;  1BT8 A;  4MVU A;  2KG7 A;  2XUM A;  4X1K B;  4AQY B;  3CME V;  4UFZ A;  4Z1M G;  5LHG A;  1Q7Y W;  2Q8V A;  1H2M A;  4MVO A;  1Q6H A;  1TGO A;  3ZN0 A;  5DN6 G;  4KHP B;  4QPK A;  4LFB O;  3OTO B;  3LNM B;  5JCO A;  1YI2 V;  2GTS A;  2ZM6 B;  2OTJ V;  2P4K A;  1NJI W;  3B8M A;  1I5X A;  3STL C;  4NYK A;  5B1N A;  1N36 B;  4RQE A;  1F4N A;  1GTO A;  2QM7 A;  2QE7 G;  4ABM A;  1SER A;  2P6J A;  2B1G A;  2OTL V;  4B08 A;  3R65 A;  4LF9 B;  3A0H Z;  4I50 B;  5IYB O;  4PHZ A;  1XEQ A;  1EZJ A;  3JSN A;  2Q5Z A;  3ABK B;  1K5S A;  1HWY A;  1KP2 A;  1Y66 A;  2BCC H;  2EZO A;  3K5N A;  2QA4 V;  4ZOL A;  2OCC B;  2Q9L A;  4JI3 O;  2JEU A;  3ZJZ A;  4MVZ A;  4KXR A;  4YHH O;  5CA3 A;  2VQF B;  3AG3 B;  1K3E A;  1NH2 D;  5E79 Z;  1UFI A;  1HNZ B;  2ZXW B;  1GRJ A;  4DK1 A;  5LA6 A;  2Q6A A;  1Y74 A;  1V55 C;  2CGN A;  5KHH A;  3RN4 A;  3RGB A;  1XNR B;  4DK0 A;  2HP8 A;  1OJH A;  2P67 A;  4H0L B;  1ZAU A;  4PDV A;  1LUW A;  3ZRV A;  4PA6 A;  4F6E A;  3B77 A;  2WLM A;  2PUS A;  4J7Z A;  2ZE6 A;  1NQT A;  1SQX H;  5KUK A;  3K57 A;  2KB1 A;  4C7U A;  2F4V B;  3ZHT A;  2KQX A;  1GN6 A;  4TOI A;  5LOV A;  4DUZ B;  1FJG O;  3J80 N;  3LDC A;  3CXC U;  2UXD B;  3CXH F;  3WB0 A;  4AQY O;  5BXZ A;  4X89 A;  3T1Y O;  3JCZ A;  1SZT A;  4KUM A;  3CCU V;  1AJQ A;  1COW G;  1NVP B;  1VIB A;  3F7Y C;  2AXT Z;  2GBO A;  3K9A A;  3UO3 A;  1MA1 A;  4J41 A;  4XDL A;  5CB4 B;  1Q86 W;  4JZ2 A;  1XI1 A;  1V9P A;  4G2K A;  4X1K A;  2HHH O;  4NXM O;  4JTA B;  3K59 A;  1WA8 B;  3JAR A;  4XDK A;  5K1X A;  2QGN A;  1DTO A;  1NH2 B;  1KC8 W;  1VF7 A;  1H2N A;  5IDJ A;  2UXD O;  1HDJ A;  2NR5 A;  4J9Z B;  4X66 O;  3FYE B;  3RYC A;  2V7Q G;  3OMA B;  2PI5 A; 
#chains in the Genus database with same CATH homology
 3A0H Z;  3WU2 Z;  3KZI Z;  5KAF Z;  4IL6 Z;  4UB8 Z;  3A0B Z;  5GTI Z;  1S5L Z;  5KAI Z;  4PJ0 Z;  5GTH Z;  5B5E Z;  4UB6 Z;  2AXT Z;  5E79 Z;  5B66 Z;  5TIS Z;  5H2F Z;  3JCU Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...