3A0BZ

Crystal structure of br-substituted photosystem ii complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 11
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3a0bZ00
3A0HZ 3JCUZ 3KZIZ 5GTHZ 4UB6Z 5B5EZ 5KAIZ 4PJ0Z 4IL6Z 5H2FZ 5E79Z 1S5LZ 5TISZ 3A0BZ 5KAFZ 4UB8Z 5B66Z 5GTIZ 3WU2Z 2AXTZ
chains in the Genus database with same CATH superfamily
4GKJB 2M7WA 2HP8A 3AG4C 1NU1H 1VEWA 4PELA 4B3MO 1K8AW 4PDLA 2Q7EA 4J42A 4TWKA 2EZOA 3DXRB 1GN3A 4FFBB 3OUFA 3K5NA 3CXHF 1U96A 4U3JB 3LNMB 1YXBA 1FPOA 1SRYA 2WAMA 3THOA 1FXHA 2Q73A 3HKBB 4R7CA 3ABTA 2WLIB 5IY5C 3FFQA 4MVQA 4P9OA 4JI6O 4DV0B 4LFBO 2PI4A 3G4SV 3E83A 3SJQC 4FVMA 2OIGA 1UPGA 2AXTZ 5KUKA 1AI4A 1V9PA 4PA7A 2EZPA 1M9NA 1SQQH 4I4TA 4W4KA 3AK3A 3SYCA 5L3DA 4F4LA 4LF9B 4X20A 3J81N 1VQ7V 4LC1A 5L3EA 5IYZB 3BA9A 4DR6B 1N4CA 1JJOA 3E2EA 2QKCA 1WB8A 2XAGA 1BL8A 2YEVA 1AR1B 1GM9A 1M57C 2ARHA 5A9GA 3M7MX 4KP4A 4AQYB 1YF2A 3ZHUA 2Y4TA 5K1XA 1HP8A 1NTKH 4DV1B 4GCZA 4TT3G 5J2TB 5KAFZ 3U10A 4BR6A 1K34A 4MS2A 4TSFG 3LSUA 3ZCCA 3HR0A 1NKDA 3UO2A 1Q8IA 2WLHA 2QWNB 3I55V 1VF5B 4WFAV 3T1CA 4ZI7B 1SQPH 4JYBA 2YXLA 1GAXA 5EZYB 1OCOC 2N04A 4UCUA 4DR5B 4RQFA 5E1AC 5L3BA 1JA8A 2CH7A 3UT5A 3ABMC 5IJ9B 2H94A 1AI7A 4L8JA 4YHHB 1NTMH 2PUSA 4K35A 2Q68A 3HKCA 3JCZA 3SDLA 1A32A 3K0DA 4Q6GA 4FFKA 1HNZO 4DR1B 2E5LB 1URFA 1BSMA 2OYQA 4MW8A 5KHKA 3E86A 3CC4V 1HNWB 1GM7A 3KG2A 5B1BC 4DV2O 1NTZH 3P3PA 1I94B 3ZMVA 1FXKB 4B08A 5ITZB 1LNQA 4YY3B 1TAEA 2K1EA 4GKKO 4PDRA 3E22A 2RMKB 4PI0A 2VQEB 2PZSA 3SYPA 4X66B 3JALA 4LF4B 1E1RG 1VF6A 4CH6A 1W0KG 2X6AA 5E79Z 1FD9A 2QWPB 4EFEA 4JZGA 4YJ3A 2ZXWB 1K33A 1EN5A 3C90A 3G6EV 3SPGA 2XAHA 3IC7A 2OCCC 4JI2B 1BE3H 1U97A 5KX5A 1ENVA 1JMKC 1SQGA 2ODMA 4PV1B 3OMAB 4CBCA 5KHGA 5A2QN 3MAQA 1X4TA 2F4VB 1MZEA 3VQVA 4XDJA 3QO7A 4DR4B 4MVUA 3ZS8C 3K06A 3E35A 4NR1A 5FNVA 3J80N 2FYUH 1IVSA 4FZ1A 2UXDB 4I4TB 2LJ2A 1WPXA 4FLXA 4X20B 2VQFB 2X7RB 4I0XA 1LUVA 1M90W 1GH6A 1J5EO 5LMNB 4X62B 3ZMSA 5GW7A 1B06A 4O4LB 2F1MA 2A9HA 1YEWA 2AW9A 4NXMB 2YEVB 1H8HG 4YJ2A 4DXWA 3ASNB 1KU9A 4RO2A 3CCEV 3LDCA 1G1XB 1WJZA 3K9SA 1TUBA 3I56V 1WA8A 1ZTEA 3LDDA 4O2BA 4LF5B 2IH1C 1KUQA 3C3SA 3RWRD 4LH7A 1AB3A 2QM8A 5H6RA 1RPOA 3EFFK 3SYOA 1S3JA 1DK1A 1M4UA 2P6JA 2KG7A 4UCVA 1WP8A 3S3XA 2ZM6O 1K4DC 2H8PC 1IBMO 5AG2A 1IX9A 4X88A 2WWWA 4BIZA 1AP5A 1MZFA 4RUEA 2HVJC 4HNAA 2ETNA 1MA1A 1AILA 2Q6AA 3TXQA 3CCRV 3FYIB 4GX5A 4TV9A 4NXNO 1Q82W 3SJCC 3H1HH 1PM9A 2HHHB 1AR4A 2CH7B 3GWKC 3GWOA 4UUJC 4PA6A 4PJ0Z 3KCYA 5H5NA 4PDVA 4DR7O 3T1HO 3HKCB 2QE7G 5EC2C 2LGWA 4ABMA 1EFRG 1OCOB 1D5NA 1M56B 4LWSB 3B4SA 2BTOA 3EHBB 5JJNB 1BZKA 4O2AA 5C8YB 4B3MB 3L71H 2UUAO 3OR7C 4FPPA 1H2MA 4JI3O 3SPIA 5LYJA 2EILB 3CWBH 3W7XA 3E22B 4D6TH 4JI4O 3RYFB 3JALB 4DR6O 1R1BA 1SQBH 5B1BB 2E76B 1NH2B 4W4LA 4X1IB 4JI6B 2ZD9A 4YJ3B 1YHQV 2HKOA 1PL4A 2EIJC 5DM6V 4K8ZA 3UCSC 2PYLA 5CA3A 5KX5B 4PI2A 1Y76A 3ZHQA 2YIBA 4DV1O 5B1AC 4K8XA 1SESA 5TISZ 2EIMB 3L72H 4LF8O 4XBFA 2Q4PA 4MTFA 1JFFA 2OCCB 4JYCA 4C7UA 2R9RB 2BSKA 5FNVB 5LA6A 3CRCA 2MW2B 3LUTB 2JEXA 4HYOA 1XILA 3QTCA 2ZE5A 2CE4A 3EVKA 2WSSG 2XUMA 5B3SB 3FYEB 4JTDB 1NVPB 1SETA 3D36A 5J2UA 3ABLC 1M1KW 1J95A 3AG3B 3CCMV 5LOVA 2PGGA 1XEQA 1CP9A 1EM1A 1WA8B 3OTFA 2RN9A 5FLXN 5LHHA 3CCLV 4O2BB 4FFBA 1VQ5V 4OPHA 2YICA 2HJDA 1VQ6V 2DQ0A 3JARA 1AJQA 3I5DA 1PNMA 4KXRA 1NVPD 2XAFA 1P84F 2Q7HA 2YS8A 4JAVA 3A0HZ 4UCRA 2CGOA 4LF4O 4QIWF 2KG7B 1B3QA 2ZQMA 5JCOA 2QGNA 1IBLO 1Q81W 1YTFB 5K1PA 1HNZB 5IJ0A 1QNMA 4DV5O 2HJFC 2QKAA 4J7ZA 2AHYA 2ZR2A 4TV9B 1XBLA 4DV2B 4MT8A 2L35A 1XI1A 1Y66A 1AI5A 3T4ZA 1S5JA 1ORQC 2RJZA 1NR1A 2XT9A 3CC2V 1S72V 5CBFA 1YTFD 4R6ZA 1Q5OA 2WA4A 2IJIA 3SR2C 4O4IA 3CPWU 4MSWC 3L75H 1NJIW 1KMIZ 5LYJB 2P7TC 5LP6A 2JK5C 2XASA 3T1YO 4JI1O 1GN2A 3RN4A 3ETQA 1OZ0A 1RSOA 1V54C 2BTQA 1VQKV 2CUGA 1V55B 3IC9A 4Z2WA 3AEIA 2W0FC 4ASUG 2N05A 4DUYO 4MVMA 1AJPA 1SS3A 4I9WA 2H3OA 3ZJZA 3ZN1A 3F7YC 1QBZA 1S5HC 1Q7YW 2JS5A 4JASA 1Y76B 1Y67A 4WFFA 3SJAC 3DSQA 4NTYA 5BR8B 2JGDA 1ZSPA 5EZYA 2JIZG 3KCXA 3ASOB 1R6NA 1WN7A 2WPDG 4MW3A 2L6LA 1JFFB 3OW2U 3M8AA 1BCCH 2BSKB 5LA6B 2QEXV 3GB7C 3GVMA 5GTHZ 3S3WA 4X1KB 1VARA 3RT3C 1GMGA 4MVOA 5KA6A 3N27A 2DW4A 3ICXA 2ZNJA 5DECA 1R73A 4BW5A 2M6YA 2YIBD 3L74H 3C3TA 3E8FA 3CXCU 2Y0IA 2ZDIA 4H13B 5J2UB 2EJRA 1KP3A 5KA5A 1VQ4V 5GONA 2F66C 2Q0OC 3QF7A 5DN6G 5LOVB 4O4HB 2DN9A 4DRXA 1KB9F 1VQMV 3G67A 1WAZA 2JJ2G 1YSCA 2ZM6B 2KB1A 3ZRVA 1IBMB 2YXHA 5CN0A 3CCVV 2Z0AA 1MMMA 3OEHG 1K97A 4RQEA 3JARB 4XDKA 4KHPO 2EIKB 1GN4A 1VQ8V 4NXNB 4J9ZB 5H9CA 2IW5A 4J9YB 4UCSA 2FL4A 1JOYA 4DR7B 3T1HB 5IJ0B 1D2DA 2DWEC 4PA9A 3CCQV 1G8MA 1YJNV 2Q0AA 4X65O 2JJ1G 1KBHA 3H1JH 5IT9N 4E4EA 1VF7A 1JVMA 2V1DA 1CEZA 2UUAB 4LBEC 1OV9A 1OCZB 4I55A 5IYCO 4JI3B 1IXBA 2Y69B 3ETEA 2ADPA 4WF9V 5EK0A 3PN1A 2K9PA 4JI4B 5FPOA 4JI8B 4HZ3A 3IJ4A 3AG2B 5IYDO 3JAWA 4O4LA 3ZRWA 3OEEG 1K4CC 3ZMTA 2F23A 2AZ0A 4U7NA 4O4IB 1FYJA 2PTMA 1N33O 3ZRSA 2PYJA 1XOUA 3K3WA 5LP6B 3BAAA 1QU7A 3A2FA 1RSOB 2BTQB 4FLUA 3L73H 4UXNA 3DC6A 3WB2A 1XMOO 1US6A 4UCTA 1G6UA 3ZHRA 4J10A 1S5LZ 3IFXA 4LF8B 3BPZA 4JTCB 1KQSU 3CRRA 1FFXA 3ABKB 3ETGA 4B7KA 5L3FA 1FJGO 1V54B 1XL4A 4FK5C 3OMIB 3TETA 2ITDC 1VMGA 3BCCH 2D3OW 2QWOB 3CHXA 2JGDB 1K5SA 1KKCA 3AG1C 4YXWG 4BAYA 5LHGA 1F4NA 3A0RA 1TUEB 3OE7G 2P5OA 1KD1W 1Q3EA 1ROPA 3H1LH 1DF4A 3CEIA 3KZIZ 1K9MW 5C93A 2QWRB 3G80A 3K0GA 2FTKA 3QVNA 3SPCA 2DQ3A 4LWSA 5C8YA 4JI0O 3WG7B 2HG5C 4DV7O 2OIEA 3MHHC 3W7WA 5GONB 2LQTA 4KFMA 4A5UB 5LGNA 3O65A 3RYFA 4DRXB 3SGIA 1QVGU 4NKGB 2ZIMA 1Q6IA 2ZIOA 1Y4MA 4LNUA 1IBLB 4X1IA 4B3SO 1AR5A 3HKDA 4DV5B 3CRQA 4DR2O 3AG4B 5BMVA 3CJHB 2XNDG 1R3KC 4OPAA 4H44B 4HAMA 1K73W 2GTSA 1DTOA 3B8NA 2UXBB 2XOKG 3RVYA 4I50A 1F7YA 3FKSG 3X2QC 3D8CA 2DYRC 3OT7A 2CTRA 1YVWA 3B77A 1RPRA 3QNEA 4UVAA 2JEUA 2P06A 5IY5B 4I55B 2P67A 1N0NA 5BR8O 3T1YB 4MVSA 4JI1B 4CH3A 1VQLV 1SQVH 3BRCA 4DV6O 3JAWB 4H33A 3ZRWB 1SQXH 3F5TA 3AG7A 2Y48A 1SZXA 3FD9A 1KP2A 4NVPA 4QNHB 3ABUA 4YIPA 3F5WC 4DUYB 1XMQB 4PA4A 2IH3C 1K3EA 5H2FZ 4LR3A 1W2BU 1JQ0A 2E74B 1VQ9V 1OCCC 2IU3A 4QPKA 4WBNB 2ATKC 3H1KH 1M57B 3ML0A 4JTAB 5LHIA 3ZX6A 1MNGA 1FFXB 2ZINA 1IBKO 1R6KA 1PD3A 5EIBC 2G38A 1XNQO 3BEHA 3W7SA 3JAMN 1QLEC 1GK9A 2QKSA 1Q6HA 3OUSA 2GHYA 4D7SA 4IIJA 2XTAA 5EBLC 2HFEC 2BOCC 2LW7A 2Q67A 3JSLA 4H0LB 2HEPA 3NXSA 3JD4A 4CH5A 4WCEV 3FB7C 4BWAA 2OTLV 3FB8C 4UCOA 2LGQA 3E8GA 2GTAA 1Y6XA 3JD1A 2Q5ZA 3SYQA 2FKXA 2QM7A 2DWDC 3ABMB 3OR6C 2OCHA 3N2GB 1ZL8A 4K0KO 4JAAA 4KHPB 4O4JA 1SERA 4JI8O 3MDSA 1EN4A 3H9VA 2F43G 5KMGB 2FMLA 4LNUB 1CXZB 3HKDB 2GSMB 3CC7V 1H38A 1S76D 4J41A 1Z5WA 4FIPC 4X65B 2CGNA 2CTWA 5BMVB 2UXCO 1FXVA 2DE0X 4JI5O 3TK1A 5HFMA 4LF7O 4FMTA 1RFYA 4Z1VA 5B1NA 1Q6UA 4I50B 4UB8Z 4UV9A 4I9QA 2RQ6A 3H1IH 5IDJA 4NTWA 1EN6A 2DYSC 4WFGA 3OM3B 1FFTB 3WFVA 3FB6C 5L3GA 2IJKA 5B5EZ 5FL7G 3K03A 4X1KA 1N33B 1TGOA 2P4VA 4DR3B 1Y74A 1IDSA 3LSQA 2B9ZA 3UQ8A 2YIAA 2R9AA 1MSDA 2Y4UA 2DYRB 3CYOA 1AI6A 1JCHA 2LP7A 2VRZA 4D7TA 1FKAO 3BFRA 4J7KA 5DEDA 1XMOB 4GUNA 5BXZA 4O4HA 2YSUB 1QQCA 3SPJA 4B3RB 1FJGB 4LFCO 3E89A 1KYOF 2KSDA 4CS4A 3D3QA 2LW1A 4Z1MG 3QG5A 4IYIA 4J7JA 1BHAA 2KQXA 1GTOA 3AK2A 3SJBC 5LMUO 4LF6O 4G28B 1UJWB 3ZEDA 5JJJB 4PD4F 3OAAG 3RGBA 4J11A 1OCCB 4FJCC 2V4DA 4EFBA 3HPLC 1NI8A 3HB3B 5LGTA 2ZR3A 1UFIA 1N34O 2KKWA 3IAYA 4F6RA 4LCUC 4EB6A 5JVDA 1YI2V 4QJFB 4IIJB 4JI0B 3CCSV 1MSWD 4IGGA 4DV7B 1H2KA 3LNNA 2ADQB 2UUCO 2EINC 2UXBO 3ZIAG 1I7FA 1MG1A 2ZE8A 1YIJV 2AGAA 2YDEA 4X89A 3U0ZA 2JGUA 4JV5O 1VQOV 2F93B 3TXSA 2O57A 1BT8A 2Z5UA 4B3SB 1ZL8B 1OCRC 4ZKIA 3STZC 3K79A 4DV4B 5LBQA 4O4JB 2ZE7A 4DR2B 5KLVH 4IHJA 2OWOA 2RCVA 2WLNA 1NZ6A 3SYAA 2Q69A 2AZ2A 4NB5A 4WFEA 3DC5A 1XMQO 3K5OA 2D2CB 2HVKC 4ZOLA 2XHBA 4BIOA 1FS0G 4RUFA 4H37A 1XNRO 2YI8A 3BY6A 4TUYA 2EIJB 4BW9A 4MTXA 4DV6B 1QR9A 2W6IG 2OTJV 5LXTA 3B2EE 3FX7A 5D5QA 5B1AB 3JD0A 4DW1A 3OMNB 1Y74B 1ZAUA 1QR8A 3RYHA 2F95B 4UVBA 3E8BA 5BZBA 3F7VC 4EKWA 2X6BA 5FPRA 4DK0A 2Y0PA 4IYHA 2R9IA 4X9QA 3K57A 1QCEA 2WA3A 1WP7A 4MTOA 3ZMUA 3E8HA 1IBKB 4OXSA 4U3FH 1L8DA 2P90A 3O9OA 3T4DA 1YZBA 3ABLB 3W7UA 1XNQB 3UO3A 2ZXWC 3K08A 4DO2A 3QO5A 1GO3F 4FM0A 3CJHA 1EBOA 1N8RW 5LGUA 1R3LC 4JGSA 4DV3O 1VQPV 4JI7B 1DLBA 5CA0A 3RBZA 3UKMA 4GT1A 3RW0A 4F6RB 3A8TA 5JVDB 4EB6B 3K58A 2ZT9B 1HR0B 1DF5A 3OGIB 3K5LA 4K0KB 4QE7A 4DUZO 5CBHA 3VOUA 3RFRA 1WB7A 4JYYA 4OGQB 3ZHSA 2EULA 4X8AA 1DGSA 3R65A 3RVZA 1WPBA 4GYCB 5JQGB 1N36O 3K5MA 4N23A 3LDEA 1L0LH 3VQYA 1S77D 1OHHG 4X1YA 4DR3O 1AP6A 2EINB 3ASNC 3ETDA 3NR7A 3TJTA 2P4KA 4KUMA 3FAVA 3P32A 1GM8A 1CPYA 2UXCB 1MABG 4JI5B 4IHJB 3CE2A 2Z3YA 4LF7B 2AHZA 3UM7A 2UXNA 1Q86W 4AILC 4RWUA 4WBNA 1OCRB 4TV8A 4FM2A 1H8EG 5F2VO 2YXYA 2PF4E 2OT5A 4X64O 1JJ2U 4B3RO 1JX9A 1I5YA 4ZOLB 5BY1A 1AJNA 4E2LA 2ILMA 2JS3A 3L9DA 2UXXA 4N21A 2UU9O 3W7TA 3TGUH 4QPJA 4TUYB 3OTOO 5IWAO 2YI9A 5EBMC 2YUAA 4PDMA 5CB4A 1COWG 4DYLA 5LXTB 2GBOA 3JASA 2A06H 3BABA 2B1GA 2QM4A 4CC5A 4AHCA 2HLDG 3VQXA 2HR3A 4J80A 5CMUA 1M56C 1Z5VA 4KL1A 5EC1C 3RYHB 2BCCH 1H2LA 1E1QG 2E75B 3G6BA 4LFCB 1YJ9V 4UVCA 3CCJV 4FLTA 3N2GA 3J7AU 1O9HA 1HNXO 4F6EA 1MOFA 2PI5A 2LFRA 3ZHTA 2EILC 2EBOA 5LMUB 2B1IA 1I0HA 4LF6B 3K9AA 4CC6A 5CA1A 1VF6C 5KMGA 4WFBV 1F4MA 1E79G 2JVDA 1XREA 1WNSA 1XL6A 2WLMA 1B6QA 5CBGA 2W6JG 2R70A 4DV4O 1N34B 2ZCEA 3N2KA 1ZLZA 4JYAO 2IJHA 2VWKA 2NR5A 4GZRB 2CTQA 1TA8A 3ZMZA 1H2SB 2UUCB 1BHBA 1IXMA 5CA0B 2EIMC 1F51A 1PV0A 3R66A 3ZN0A 4GX1A 4JV5B 2QJ1A 1XHXA 1THZA 4BIUA 1GKFA 2XAJA 2WLJA 2QTOA 1XHZA 3KKYA 5B3SC 1KECA 2X0LA 1SA0A 4JAUA 1R6TA 4ZBMA 1SQFA 4MVRA 3STLC 4NYKA 3JCUZ 4R8CA 1EZJA 3AG3C 4X1YB 1SKVA 4G2KA 2MK3A 1L0NH 4IL6Z 2VWJA 3JAKA 4FLYA 3QO8A 3JD2A 3FAVB 2QSAA 1N32B 4ZHQA 4UV8A 2N74A 1RM1C 1KC8W 1T5EA 1M93A 5B66Z 1JPXA 5IYBO 3H01A 4B3TO 4TV8B 1NQTA 1W59A 1XNRB 1ZUQA 4IT5A 2GUZA 3D3IA 3RYCA 5JWPA 2X6CA 4OX9O 4JPRA 3P3NA 1QLNA 4LFAO 1BGYH 3RYIA 2FB5A 5JJEB 4GKJO 5KUMA 2W0XA 3OFNG 2IJJA 3APOA 1W0JG 2P22C 1VIBA 5CB4B 2ZKOA 4JI7O 1PKXA 1YCIA 2BOBC 5D5PA 1NR7A 3JASB 4G27B 3JYCA 2QR4A 1F23A 3CCUV 3AG1B 3JATA 3A0BZ 3WB0A 1HR0O 3SPHA 2UUBB 3WU2Z 4R50A 1BS3A 3UT5B 3EXAA 4LH6A 4FZ0A 2PY5A 4FLWA 1Q90D 1XUQA 1OJHA 4DV0O 1K5QA 1TVKA 2DMXA 1R3IC 4DV3B 4DK1A 5CA1B 4YIOA 4CS2A 2NN4A 4EEQA 1V55C 3WB1A 3BVOA 4WFHA 3APQA 2NNUA 2Q7GA 4LF9O 2RNBA 3MHSC 2WLLA 3N2KB 2Q8VA 3JD3A 3AK1A 1P49A 1X59A 3CS5A 4DUZB 1BMFG 4GX0A 4ZIBA 1Q43A 4LFBB 3BHPA 3ASOC 4B7EA 5EYPA 4AQYO 1N36B 2JDIG 3LSSA 3OGCC 4U7OA 1Z2GA 2ZE6A 1AVMA 2LFSA 2RDCA 3HKEA 5KHIA 4TQFA 3OD4A 2LO1A 3M99B 5JH7A 4L87A 3PJSK 3X2QB 1PNLA 2E3CA 3CRMA 5LL6Y 1LR1A 1NH2D 3P30A 1SA0B 3D36C 2VS0A 1PP9H 2XAQA 1H2GA 5H6QA 4CS3A 1HW7A 1M5IA 1IURA 4UB6Z 2A79B 4DW0A 1VQNV 2QA4V 4RAIA 4FM1A 3JAKB 4P30A 4I0XB 4DR5O 4X64B 2ZNIA 2EJ7A 1PNKA 4ZHQB 4I7ZB 4HBNA 3Q4HA 2GV9A 1ZX3A 3K04A 1B04A 1ZWIC 4YHHO 3VBBA 2JRIA 1NS1A 2B5UA 4YJ2B 2UU9B 1K92A 4DR1O 2EIKC 2E5LO 2R72A 2GUZB 2WLKA 5KAIZ 5IWAB 3OTOB 3RYCB 1GN6A 1S0VA 1YDXA 1YJWV 2A3QA 1HNWO 2CK3G 3ZRXA 1TUBB 4P9PA 5JCOC 1RM1B 1I94O 2GDSA 3CSXA 3K59A 1QVFU 4FLVA 3DXRA 2BE3A 1XQ8A 3VQWA 4YY3O 4U3JA 3RYIB 3ZBHA 5KHHA 5GTIZ 1NBMG 3JSNA 3TCUA 5J9PC 3HKBA 2VQEO 2WLIA 4TQDA 2A0LA 4FLZA 4X66O 1SC5B 4JZ2A 4UFZA 1OCZC 2QTSA 4PA3A 1HNXB 1I5XA 2Y69C 1AROP 2IBZH 4PHZA 1QLEB 4HNAB 3JATB 1O9GA 5JQGA 5B1OA 4JF3A 3AG2C 4JI2O 1EZVH 1P4RA 1SZTA 2Q9LA 2QDOA 1GRJA 1PL0A 2ITCC 1WLEA 1K7DA 1LUWA 4TOIA 1XDCA 1P7BA 4ICGA 2CAZC 3CMAV 3ZHVA 4CH4A 2IM9A 4GKKB 2F4VO 3CX5F 2CDYA 1VP7A 2DOSA 4MTGA 5LP6C 5L3CA 1TVKB 4DR4O 5KHJA 4JYAB 5IYZA 5EIBD 4I5SA 4O2AB 4NTXA 2EX3A 1QHTA 2YIDA 2UXDO 1R3JC 1BQ0A 3CP1A 2YC0A 5HFLA 2VQFO 3ABKC 2WLLB 1KKDA 1IZ3A 1N32O 4GX2A 1BQZA 5LMNO 4X62O 1N0JA 1JR9A 3BA8A 5J2TA 4QE9A 4NXMO 2V7QG 1RP3B 1G4YB 5EBWC 1HWYA 2C2AA 5EYPB 4XDLA 1H2NA 3CRAA 3CD6V 1NT2B 3U11A 1L1FA 4QGPA 4LF5O 3HKEB 3B40A 2IU0A 4K3AA 5JH7B 2A7WA 1SF9A 4ZI7A 3DGEA 1PPJH 1P7GA 4Q20A 3FB5C 3CMEV 1FAFA 1J5EB 3G71V 3L70H 2DYSB 3WG7C 3B8MA 2ZDIC 1FXKC 5IJ9A 4LP8A 3T2MA 4MVZA 4B3TB 3DTUB 4AI8A 2CTPA 1YITV 5IE9A 2QWQB 1D5AA 2NLJC 3B09A 3MD0A 1I08A 4OX9B 3CB2A 3IGAC 2UUBO 1HDJA 2HHHO 4P2ZA 1FXKA 3Q4HB 2DJVA 4LFAB 5ITZA 4GLXA 4CZZA
chains in the Genus database with same CATH topology
3A0HZ 3JCUZ 3KZIZ 5GTHZ 4UB6Z 5B5EZ 5KAIZ 4PJ0Z 4IL6Z 5H2FZ 5E79Z 1S5LZ 5TISZ 3A0BZ 5KAFZ 4UB8Z 5B66Z 5GTIZ 3WU2Z 2AXTZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H Z;  3JCU Z;  3KZI Z;  5GTH Z;  4UB6 Z;  5B5E Z;  5KAI Z;  4PJ0 Z;  4IL6 Z;  5H2F Z;  5E79 Z;  1S5L Z;  5TIS Z;  3A0B Z;  5KAF Z;  4UB8 Z;  5B66 Z;  5GTI Z;  3WU2 Z;  2AXT Z; 
#chains in the Genus database with same CATH topology
 4GKJ B;  2M7W A;  2HP8 A;  3AG4 C;  1NU1 H;  1VEW A;  4PEL A;  4B3M O;  1K8A W;  4PDL A;  2Q7E A;  4J42 A;  4TWK A;  2EZO A;  3DXR B;  1GN3 A;  4FFB B;  3OUF A;  3K5N A;  3CXH F;  1U96 A;  4U3J B;  3LNM B;  1YXB A;  1FPO A;  1SRY A;  2WAM A;  3THO A;  1FXH A;  2Q73 A;  3HKB B;  4R7C A;  3ABT A;  2WLI B;  5IY5 C;  3FFQ A;  4MVQ A;  4P9O A;  4JI6 O;  4DV0 B;  4LFB O;  2PI4 A;  3G4S V;  3E83 A;  3SJQ C;  4FVM A;  2OIG A;  1UPG A;  2AXT Z;  5KUK A;  1AI4 A;  1V9P A;  4PA7 A;  2EZP A;  1M9N A;  1SQQ H;  4I4T A;  4W4K A;  3AK3 A;  3SYC A;  5L3D A;  4F4L A;  4LF9 B;  4X20 A;  3J81 N;  1VQ7 V;  4LC1 A;  5L3E A;  5IYZ B;  3BA9 A;  4DR6 B;  1N4C A;  1JJO A;  3E2E A;  2QKC A;  1WB8 A;  2XAG A;  1BL8 A;  2YEV A;  1AR1 B;  1GM9 A;  1M57 C;  2ARH A;  5A9G A;  3M7M X;  4KP4 A;  4AQY B;  1YF2 A;  3ZHU A;  2Y4T A;  5K1X A;  1HP8 A;  1NTK H;  4DV1 B;  4GCZ A;  4TT3 G;  5J2T B;  5KAF Z;  3U10 A;  4BR6 A;  1K34 A;  4MS2 A;  4TSF G;  3LSU A;  3ZCC A;  3HR0 A;  1NKD A;  3UO2 A;  1Q8I A;  2WLH A;  2QWN B;  3I55 V;  1VF5 B;  4WFA V;  3T1C A;  4ZI7 B;  1SQP H;  4JYB A;  2YXL A;  1GAX A;  5EZY B;  1OCO C;  2N04 A;  4UCU A;  4DR5 B;  4RQF A;  5E1A C;  5L3B A;  1JA8 A;  2CH7 A;  3UT5 A;  3ABM C;  5IJ9 B;  2H94 A;  1AI7 A;  4L8J A;  4YHH B;  1NTM H;  2PUS A;  4K35 A;  2Q68 A;  3HKC A;  3JCZ A;  3SDL A;  1A32 A;  3K0D A;  4Q6G A;  4FFK A;  1HNZ O;  4DR1 B;  2E5L B;  1URF A;  1BSM A;  2OYQ A;  4MW8 A;  5KHK A;  3E86 A;  3CC4 V;  1HNW B;  1GM7 A;  3KG2 A;  5B1B C;  4DV2 O;  1NTZ H;  3P3P A;  1I94 B;  3ZMV A;  1FXK B;  4B08 A;  5ITZ B;  1LNQ A;  4YY3 B;  1TAE A;  2K1E A;  4GKK O;  4PDR A;  3E22 A;  2RMK B;  4PI0 A;  2VQE B;  2PZS A;  3SYP A;  4X66 B;  3JAL A;  4LF4 B;  1E1R G;  1VF6 A;  4CH6 A;  1W0K G;  2X6A A;  5E79 Z;  1FD9 A;  2QWP B;  4EFE A;  4JZG A;  4YJ3 A;  2ZXW B;  1K33 A;  1EN5 A;  3C90 A;  3G6E V;  3SPG A;  2XAH A;  3IC7 A;  2OCC C;  4JI2 B;  1BE3 H;  1U97 A;  5KX5 A;  1ENV A;  1JMK C;  1SQG A;  2ODM A;  4PV1 B;  3OMA B;  4CBC A;  5KHG A;  5A2Q N;  3MAQ A;  1X4T A;  2F4V B;  1MZE A;  3VQV A;  4XDJ A;  3QO7 A;  4DR4 B;  4MVU A;  3ZS8 C;  3K06 A;  3E35 A;  4NR1 A;  5FNV A;  3J80 N;  2FYU H;  1IVS A;  4FZ1 A;  2UXD B;  4I4T B;  2LJ2 A;  1WPX A;  4FLX A;  4X20 B;  2VQF B;  2X7R B;  4I0X A;  1LUV A;  1M90 W;  1GH6 A;  1J5E O;  5LMN B;  4X62 B;  3ZMS A;  5GW7 A;  1B06 A;  4O4L B;  2F1M A;  2A9H A;  1YEW A;  2AW9 A;  4NXM B;  2YEV B;  1H8H G;  4YJ2 A;  4DXW A;  3ASN B;  1KU9 A;  4RO2 A;  3CCE V;  3LDC A;  1G1X B;  1WJZ A;  3K9S A;  1TUB A;  3I56 V;  1WA8 A;  1ZTE A;  3LDD A;  4O2B A;  4LF5 B;  2IH1 C;  1KUQ A;  3C3S A;  3RWR D;  4LH7 A;  1AB3 A;  2QM8 A;  5H6R A;  1RPO A;  3EFF K;  3SYO A;  1S3J A;  1DK1 A;  1M4U A;  2P6J A;  2KG7 A;  4UCV A;  1WP8 A;  3S3X A;  2ZM6 O;  1K4D C;  2H8P C;  1IBM O;  5AG2 A;  1IX9 A;  4X88 A;  2WWW A;  4BIZ A;  1AP5 A;  1MZF A;  4RUE A;  2HVJ C;  4HNA A;  2ETN A;  1MA1 A;  1AIL A;  2Q6A A;  3TXQ A;  3CCR V;  3FYI B;  4GX5 A;  4TV9 A;  4NXN O;  1Q82 W;  3SJC C;  3H1H H;  1PM9 A;  2HHH B;  1AR4 A;  2CH7 B;  3GWK C;  3GWO A;  4UUJ C;  4PA6 A;  4PJ0 Z;  3KCY A;  5H5N A;  4PDV A;  4DR7 O;  3T1H O;  3HKC B;  2QE7 G;  5EC2 C;  2LGW A;  4ABM A;  1EFR G;  1OCO B;  1D5N A;  1M56 B;  4LWS B;  3B4S A;  2BTO A;  3EHB B;  5JJN B;  1BZK A;  4O2A A;  5C8Y B;  4B3M B;  3L71 H;  2UUA O;  3OR7 C;  4FPP A;  1H2M A;  4JI3 O;  3SPI A;  5LYJ A;  2EIL B;  3CWB H;  3W7X A;  3E22 B;  4D6T H;  4JI4 O;  3RYF B;  3JAL B;  4DR6 O;  1R1B A;  1SQB H;  5B1B B;  2E76 B;  1NH2 B;  4W4L A;  4X1I B;  4JI6 B;  2ZD9 A;  4YJ3 B;  1YHQ V;  2HKO A;  1PL4 A;  2EIJ C;  5DM6 V;  4K8Z A;  3UCS C;  2PYL A;  5CA3 A;  5KX5 B;  4PI2 A;  1Y76 A;  3ZHQ A;  2YIB A;  4DV1 O;  5B1A C;  4K8X A;  1SES A;  5TIS Z;  2EIM B;  3L72 H;  4LF8 O;  4XBF A;  2Q4P A;  4MTF A;  1JFF A;  2OCC B;  4JYC A;  4C7U A;  2R9R B;  2BSK A;  5FNV B;  5LA6 A;  3CRC A;  2MW2 B;  3LUT B;  2JEX A;  4HYO A;  1XIL A;  3QTC A;  2ZE5 A;  2CE4 A;  3EVK A;  2WSS G;  2XUM A;  5B3S B;  3FYE B;  4JTD B;  1NVP B;  1SET A;  3D36 A;  5J2U A;  3ABL C;  1M1K W;  1J95 A;  3AG3 B;  3CCM V;  5LOV A;  2PGG A;  1XEQ A;  1CP9 A;  1EM1 A;  1WA8 B;  3OTF A;  2RN9 A;  5FLX N;  5LHH A;  3CCL V;  4O2B B;  4FFB A;  1VQ5 V;  4OPH A;  2YIC A;  2HJD A;  1VQ6 V;  2DQ0 A;  3JAR A;  1AJQ A;  3I5D A;  1PNM A;  4KXR A;  1NVP D;  2XAF A;  1P84 F;  2Q7H A;  2YS8 A;  4JAV A;  3A0H Z;  4UCR A;  2CGO A;  4LF4 O;  4QIW F;  2KG7 B;  1B3Q A;  2ZQM A;  5JCO A;  2QGN A;  1IBL O;  1Q81 W;  1YTF B;  5K1P A;  1HNZ B;  5IJ0 A;  1QNM A;  4DV5 O;  2HJF C;  2QKA A;  4J7Z A;  2AHY A;  2ZR2 A;  4TV9 B;  1XBL A;  4DV2 B;  4MT8 A;  2L35 A;  1XI1 A;  1Y66 A;  1AI5 A;  3T4Z A;  1S5J A;  1ORQ C;  2RJZ A;  1NR1 A;  2XT9 A;  3CC2 V;  1S72 V;  5CBF A;  1YTF D;  4R6Z A;  1Q5O A;  2WA4 A;  2IJI A;  3SR2 C;  4O4I A;  3CPW U;  4MSW C;  3L75 H;  1NJI W;  1KMI Z;  5LYJ B;  2P7T C;  5LP6 A;  2JK5 C;  2XAS A;  3T1Y O;  4JI1 O;  1GN2 A;  3RN4 A;  3ETQ A;  1OZ0 A;  1RSO A;  1V54 C;  2BTQ A;  1VQK V;  2CUG A;  1V55 B;  3IC9 A;  4Z2W A;  3AEI A;  2W0F C;  4ASU G;  2N05 A;  4DUY O;  4MVM A;  1AJP A;  1SS3 A;  4I9W A;  2H3O A;  3ZJZ A;  3ZN1 A;  3F7Y C;  1QBZ A;  1S5H C;  1Q7Y W;  2JS5 A;  4JAS A;  1Y76 B;  1Y67 A;  4WFF A;  3SJA C;  3DSQ A;  4NTY A;  5BR8 B;  2JGD A;  1ZSP A;  5EZY A;  2JIZ G;  3KCX A;  3ASO B;  1R6N A;  1WN7 A;  2WPD G;  4MW3 A;  2L6L A;  1JFF B;  3OW2 U;  3M8A A;  1BCC H;  2BSK B;  5LA6 B;  2QEX V;  3GB7 C;  3GVM A;  5GTH Z;  3S3W A;  4X1K B;  1VAR A;  3RT3 C;  1GMG A;  4MVO A;  5KA6 A;  3N27 A;  2DW4 A;  3ICX A;  2ZNJ A;  5DEC A;  1R73 A;  4BW5 A;  2M6Y A;  2YIB D;  3L74 H;  3C3T A;  3E8F A;  3CXC U;  2Y0I A;  2ZDI A;  4H13 B;  5J2U B;  2EJR A;  1KP3 A;  5KA5 A;  1VQ4 V;  5GON A;  2F66 C;  2Q0O C;  3QF7 A;  5DN6 G;  5LOV B;  4O4H B;  2DN9 A;  4DRX A;  1KB9 F;  1VQM V;  3G67 A;  1WAZ A;  2JJ2 G;  1YSC A;  2ZM6 B;  2KB1 A;  3ZRV A;  1IBM B;  2YXH A;  5CN0 A;  3CCV V;  2Z0A A;  1MMM A;  3OEH G;  1K97 A;  4RQE A;  3JAR B;  4XDK A;  4KHP O;  2EIK B;  1GN4 A;  1VQ8 V;  4NXN B;  4J9Z B;  5H9C A;  2IW5 A;  4J9Y B;  4UCS A;  2FL4 A;  1JOY A;  4DR7 B;  3T1H B;  5IJ0 B;  1D2D A;  2DWE C;  4PA9 A;  3CCQ V;  1G8M A;  1YJN V;  2Q0A A;  4X65 O;  2JJ1 G;  1KBH A;  3H1J H;  5IT9 N;  4E4E A;  1VF7 A;  1JVM A;  2V1D A;  1CEZ A;  2UUA B;  4LBE C;  1OV9 A;  1OCZ B;  4I55 A;  5IYC O;  4JI3 B;  1IXB A;  2Y69 B;  3ETE A;  2ADP A;  4WF9 V;  5EK0 A;  3PN1 A;  2K9P A;  4JI4 B;  5FPO A;  4JI8 B;  4HZ3 A;  3IJ4 A;  3AG2 B;  5IYD O;  3JAW A;  4O4L A;  3ZRW A;  3OEE G;  1K4C C;  3ZMT A;  2F23 A;  2AZ0 A;  4U7N A;  4O4I B;  1FYJ A;  2PTM A;  1N33 O;  3ZRS A;  2PYJ A;  1XOU A;  3K3W A;  5LP6 B;  3BAA A;  1QU7 A;  3A2F A;  1RSO B;  2BTQ B;  4FLU A;  3L73 H;  4UXN A;  3DC6 A;  3WB2 A;  1XMO O;  1US6 A;  4UCT A;  1G6U A;  3ZHR A;  4J10 A;  1S5L Z;  3IFX A;  4LF8 B;  3BPZ A;  4JTC B;  1KQS U;  3CRR A;  1FFX A;  3ABK B;  3ETG A;  4B7K A;  5L3F A;  1FJG O;  1V54 B;  1XL4 A;  4FK5 C;  3OMI B;  3TET A;  2ITD C;  1VMG A;  3BCC H;  2D3O W;  2QWO B;  3CHX A;  2JGD B;  1K5S A;  1KKC A;  3AG1 C;  4YXW G;  4BAY A;  5LHG A;  1F4N A;  3A0R A;  1TUE B;  3OE7 G;  2P5O A;  1KD1 W;  1Q3E A;  1ROP A;  3H1L H;  1DF4 A;  3CEI A;  3KZI Z;  1K9M W;  5C93 A;  2QWR B;  3G80 A;  3K0G A;  2FTK A;  3QVN A;  3SPC A;  2DQ3 A;  4LWS A;  5C8Y A;  4JI0 O;  3WG7 B;  2HG5 C;  4DV7 O;  2OIE A;  3MHH C;  3W7W A;  5GON B;  2LQT A;  4KFM A;  4A5U B;  5LGN A;  3O65 A;  3RYF A;  4DRX B;  3SGI A;  1QVG U;  4NKG B;  2ZIM A;  1Q6I A;  2ZIO A;  1Y4M A;  4LNU A;  1IBL B;  4X1I A;  4B3S O;  1AR5 A;  3HKD A;  4DV5 B;  3CRQ A;  4DR2 O;  3AG4 B;  5BMV A;  3CJH B;  2XND G;  1R3K C;  4OPA A;  4H44 B;  4HAM A;  1K73 W;  2GTS A;  1DTO A;  3B8N A;  2UXB B;  2XOK G;  3RVY A;  4I50 A;  1F7Y A;  3FKS G;  3X2Q C;  3D8C A;  2DYR C;  3OT7 A;  2CTR A;  1YVW A;  3B77 A;  1RPR A;  3QNE A;  4UVA A;  2JEU A;  2P06 A;  5IY5 B;  4I55 B;  2P67 A;  1N0N A;  5BR8 O;  3T1Y B;  4MVS A;  4JI1 B;  4CH3 A;  1VQL V;  1SQV H;  3BRC A;  4DV6 O;  3JAW B;  4H33 A;  3ZRW B;  1SQX H;  3F5T A;  3AG7 A;  2Y48 A;  1SZX A;  3FD9 A;  1KP2 A;  4NVP A;  4QNH B;  3ABU A;  4YIP A;  3F5W C;  4DUY B;  1XMQ B;  4PA4 A;  2IH3 C;  1K3E A;  5H2F Z;  4LR3 A;  1W2B U;  1JQ0 A;  2E74 B;  1VQ9 V;  1OCC C;  2IU3 A;  4QPK A;  4WBN B;  2ATK C;  3H1K H;  1M57 B;  3ML0 A;  4JTA B;  5LHI A;  3ZX6 A;  1MNG A;  1FFX B;  2ZIN A;  1IBK O;  1R6K A;  1PD3 A;  5EIB C;  2G38 A;  1XNQ O;  3BEH A;  3W7S A;  3JAM N;  1QLE C;  1GK9 A;  2QKS A;  1Q6H A;  3OUS A;  2GHY A;  4D7S A;  4IIJ A;  2XTA A;  5EBL C;  2HFE C;  2BOC C;  2LW7 A;  2Q67 A;  3JSL A;  4H0L B;  2HEP A;  3NXS A;  3JD4 A;  4CH5 A;  4WCE V;  3FB7 C;  4BWA A;  2OTL V;  3FB8 C;  4UCO A;  2LGQ A;  3E8G A;  2GTA A;  1Y6X A;  3JD1 A;  2Q5Z A;  3SYQ A;  2FKX A;  2QM7 A;  2DWD C;  3ABM B;  3OR6 C;  2OCH A;  3N2G B;  1ZL8 A;  4K0K O;  4JAA A;  4KHP B;  4O4J A;  1SER A;  4JI8 O;  3MDS A;  1EN4 A;  3H9V A;  2F43 G;  5KMG B;  2FML A;  4LNU B;  1CXZ B;  3HKD B;  2GSM B;  3CC7 V;  1H38 A;  1S76 D;  4J41 A;  1Z5W A;  4FIP C;  4X65 B;  2CGN A;  2CTW A;  5BMV B;  2UXC O;  1FXV A;  2DE0 X;  4JI5 O;  3TK1 A;  5HFM A;  4LF7 O;  4FMT A;  1RFY A;  4Z1V A;  5B1N A;  1Q6U A;  4I50 B;  4UB8 Z;  4UV9 A;  4I9Q A;  2RQ6 A;  3H1I H;  5IDJ A;  4NTW A;  1EN6 A;  2DYS C;  4WFG A;  3OM3 B;  1FFT B;  3WFV A;  3FB6 C;  5L3G A;  2IJK A;  5B5E Z;  5FL7 G;  3K03 A;  4X1K A;  1N33 B;  1TGO A;  2P4V A;  4DR3 B;  1Y74 A;  1IDS A;  3LSQ A;  2B9Z A;  3UQ8 A;  2YIA A;  2R9A A;  1MSD A;  2Y4U A;  2DYR B;  3CYO A;  1AI6 A;  1JCH A;  2LP7 A;  2VRZ A;  4D7T A;  1FKA O;  3BFR A;  4J7K A;  5DED A;  1XMO B;  4GUN A;  5BXZ A;  4O4H A;  2YSU B;  1QQC A;  3SPJ A;  4B3R B;  1FJG B;  4LFC O;  3E89 A;  1KYO F;  2KSD A;  4CS4 A;  3D3Q A;  2LW1 A;  4Z1M G;  3QG5 A;  4IYI A;  4J7J A;  1BHA A;  2KQX A;  1GTO A;  3AK2 A;  3SJB C;  5LMU O;  4LF6 O;  4G28 B;  1UJW B;  3ZED A;  5JJJ B;  4PD4 F;  3OAA G;  3RGB A;  4J11 A;  1OCC B;  4FJC C;  2V4D A;  4EFB A;  3HPL C;  1NI8 A;  3HB3 B;  5LGT A;  2ZR3 A;  1UFI A;  1N34 O;  2KKW A;  3IAY A;  4F6R A;  4LCU C;  4EB6 A;  5JVD A;  1YI2 V;  4QJF B;  4IIJ B;  4JI0 B;  3CCS V;  1MSW D;  4IGG A;  4DV7 B;  1H2K A;  3LNN A;  2ADQ B;  2UUC O;  2EIN C;  2UXB O;  3ZIA G;  1I7F A;  1MG1 A;  2ZE8 A;  1YIJ V;  2AGA A;  2YDE A;  4X89 A;  3U0Z A;  2JGU A;  4JV5 O;  1VQO V;  2F93 B;  3TXS A;  2O57 A;  1BT8 A;  2Z5U A;  4B3S B;  1ZL8 B;  1OCR C;  4ZKI A;  3STZ C;  3K79 A;  4DV4 B;  5LBQ A;  4O4J B;  2ZE7 A;  4DR2 B;  5KLV H;  4IHJ A;  2OWO A;  2RCV A;  2WLN A;  1NZ6 A;  3SYA A;  2Q69 A;  2AZ2 A;  4NB5 A;  4WFE A;  3DC5 A;  1XMQ O;  3K5O A;  2D2C B;  2HVK C;  4ZOL A;  2XHB A;  4BIO A;  1FS0 G;  4RUF A;  4H37 A;  1XNR O;  2YI8 A;  3BY6 A;  4TUY A;  2EIJ B;  4BW9 A;  4MTX A;  4DV6 B;  1QR9 A;  2W6I G;  2OTJ V;  5LXT A;  3B2E E;  3FX7 A;  5D5Q A;  5B1A B;  3JD0 A;  4DW1 A;  3OMN B;  1Y74 B;  1ZAU A;  1QR8 A;  3RYH A;  2F95 B;  4UVB A;  3E8B A;  5BZB A;  3F7V C;  4EKW A;  2X6B A;  5FPR A;  4DK0 A;  2Y0P A;  4IYH A;  2R9I A;  4X9Q A;  3K57 A;  1QCE A;  2WA3 A;  1WP7 A;  4MTO A;  3ZMU A;  3E8H A;  1IBK B;  4OXS A;  4U3F H;  1L8D A;  2P90 A;  3O9O A;  3T4D A;  1YZB A;  3ABL B;  3W7U A;  1XNQ B;  3UO3 A;  2ZXW C;  3K08 A;  4DO2 A;  3QO5 A;  1GO3 F;  4FM0 A;  3CJH A;  1EBO A;  1N8R W;  5LGU A;  1R3L C;  4JGS A;  4DV3 O;  1VQP V;  4JI7 B;  1DLB A;  5CA0 A;  3RBZ A;  3UKM A;  4GT1 A;  3RW0 A;  4F6R B;  3A8T A;  5JVD B;  4EB6 B;  3K58 A;  2ZT9 B;  1HR0 B;  1DF5 A;  3OGI B;  3K5L A;  4K0K B;  4QE7 A;  4DUZ O;  5CBH A;  3VOU A;  3RFR A;  1WB7 A;  4JYY A;  4OGQ B;  3ZHS A;  2EUL A;  4X8A A;  1DGS A;  3R65 A;  3RVZ A;  1WPB A;  4GYC B;  5JQG B;  1N36 O;  3K5M A;  4N23 A;  3LDE A;  1L0L H;  3VQY A;  1S77 D;  1OHH G;  4X1Y A;  4DR3 O;  1AP6 A;  2EIN B;  3ASN C;  3ETD A;  3NR7 A;  3TJT A;  2P4K A;  4KUM A;  3FAV A;  3P32 A;  1GM8 A;  1CPY A;  2UXC B;  1MAB G;  4JI5 B;  4IHJ B;  3CE2 A;  2Z3Y A;  4LF7 B;  2AHZ A;  3UM7 A;  2UXN A;  1Q86 W;  4AIL C;  4RWU A;  4WBN A;  1OCR B;  4TV8 A;  4FM2 A;  1H8E G;  5F2V O;  2YXY A;  2PF4 E;  2OT5 A;  4X64 O;  1JJ2 U;  4B3R O;  1JX9 A;  1I5Y A;  4ZOL B;  5BY1 A;  1AJN A;  4E2L A;  2ILM A;  2JS3 A;  3L9D A;  2UXX A;  4N21 A;  2UU9 O;  3W7T A;  3TGU H;  4QPJ A;  4TUY B;  3OTO O;  5IWA O;  2YI9 A;  5EBM C;  2YUA A;  4PDM A;  5CB4 A;  1COW G;  4DYL A;  5LXT B;  2GBO A;  3JAS A;  2A06 H;  3BAB A;  2B1G A;  2QM4 A;  4CC5 A;  4AHC A;  2HLD G;  3VQX A;  2HR3 A;  4J80 A;  5CMU A;  1M56 C;  1Z5V A;  4KL1 A;  5EC1 C;  3RYH B;  2BCC H;  1H2L A;  1E1Q G;  2E75 B;  3G6B A;  4LFC B;  1YJ9 V;  4UVC A;  3CCJ V;  4FLT A;  3N2G A;  3J7A U;  1O9H A;  1HNX O;  4F6E A;  1MOF A;  2PI5 A;  2LFR A;  3ZHT A;  2EIL C;  2EBO A;  5LMU B;  2B1I A;  1I0H A;  4LF6 B;  3K9A A;  4CC6 A;  5CA1 A;  1VF6 C;  5KMG A;  4WFB V;  1F4M A;  1E79 G;  2JVD A;  1XRE A;  1WNS A;  1XL6 A;  2WLM A;  1B6Q A;  5CBG A;  2W6J G;  2R70 A;  4DV4 O;  1N34 B;  2ZCE A;  3N2K A;  1ZLZ A;  4JYA O;  2IJH A;  2VWK A;  2NR5 A;  4GZR B;  2CTQ A;  1TA8 A;  3ZMZ A;  1H2S B;  2UUC B;  1BHB A;  1IXM A;  5CA0 B;  2EIM C;  1F51 A;  1PV0 A;  3R66 A;  3ZN0 A;  4GX1 A;  4JV5 B;  2QJ1 A;  1XHX A;  1THZ A;  4BIU A;  1GKF A;  2XAJ A;  2WLJ A;  2QTO A;  1XHZ A;  3KKY A;  5B3S C;  1KEC A;  2X0L A;  1SA0 A;  4JAU A;  1R6T A;  4ZBM A;  1SQF A;  4MVR A;  3STL C;  4NYK A;  3JCU Z;  4R8C A;  1EZJ A;  3AG3 C;  4X1Y B;  1SKV A;  4G2K A;  2MK3 A;  1L0N H;  4IL6 Z;  2VWJ A;  3JAK A;  4FLY A;  3QO8 A;  3JD2 A;  3FAV B;  2QSA A;  1N32 B;  4ZHQ A;  4UV8 A;  2N74 A;  1RM1 C;  1KC8 W;  1T5E A;  1M93 A;  5B66 Z;  1JPX A;  5IYB O;  3H01 A;  4B3T O;  4TV8 B;  1NQT A;  1W59 A;  1XNR B;  1ZUQ A;  4IT5 A;  2GUZ A;  3D3I A;  3RYC A;  5JWP A;  2X6C A;  4OX9 O;  4JPR A;  3P3N A;  1QLN A;  4LFA O;  1BGY H;  3RYI A;  2FB5 A;  5JJE B;  4GKJ O;  5KUM A;  2W0X A;  3OFN G;  2IJJ A;  3APO A;  1W0J G;  2P22 C;  1VIB A;  5CB4 B;  2ZKO A;  4JI7 O;  1PKX A;  1YCI A;  2BOB C;  5D5P A;  1NR7 A;  3JAS B;  4G27 B;  3JYC A;  2QR4 A;  1F23 A;  3CCU V;  3AG1 B;  3JAT A;  3A0B Z;  3WB0 A;  1HR0 O;  3SPH A;  2UUB B;  3WU2 Z;  4R50 A;  1BS3 A;  3UT5 B;  3EXA A;  4LH6 A;  4FZ0 A;  2PY5 A;  4FLW A;  1Q90 D;  1XUQ A;  1OJH A;  4DV0 O;  1K5Q A;  1TVK A;  2DMX A;  1R3I C;  4DV3 B;  4DK1 A;  5CA1 B;  4YIO A;  4CS2 A;  2NN4 A;  4EEQ A;  1V55 C;  3WB1 A;  3BVO A;  4WFH A;  3APQ A;  2NNU A;  2Q7G A;  4LF9 O;  2RNB A;  3MHS C;  2WLL A;  3N2K B;  2Q8V A;  3JD3 A;  3AK1 A;  1P49 A;  1X59 A;  3CS5 A;  4DUZ B;  1BMF G;  4GX0 A;  4ZIB A;  1Q43 A;  4LFB B;  3BHP A;  3ASO C;  4B7E A;  5EYP A;  4AQY O;  1N36 B;  2JDI G;  3LSS A;  3OGC C;  4U7O A;  1Z2G A;  2ZE6 A;  1AVM A;  2LFS A;  2RDC A;  3HKE A;  5KHI A;  4TQF A;  3OD4 A;  2LO1 A;  3M99 B;  5JH7 A;  4L87 A;  3PJS K;  3X2Q B;  1PNL A;  2E3C A;  3CRM A;  5LL6 Y;  1LR1 A;  1NH2 D;  3P30 A;  1SA0 B;  3D36 C;  2VS0 A;  1PP9 H;  2XAQ A;  1H2G A;  5H6Q A;  4CS3 A;  1HW7 A;  1M5I A;  1IUR A;  4UB6 Z;  2A79 B;  4DW0 A;  1VQN V;  2QA4 V;  4RAI A;  4FM1 A;  3JAK B;  4P30 A;  4I0X B;  4DR5 O;  4X64 B;  2ZNI A;  2EJ7 A;  1PNK A;  4ZHQ B;  4I7Z B;  4HBN A;  3Q4H A;  2GV9 A;  1ZX3 A;  3K04 A;  1B04 A;  1ZWI C;  4YHH O;  3VBB A;  2JRI A;  1NS1 A;  2B5U A;  4YJ2 B;  2UU9 B;  1K92 A;  4DR1 O;  2EIK C;  2E5L O;  2R72 A;  2GUZ B;  2WLK A;  5KAI Z;  5IWA B;  3OTO B;  3RYC B;  1GN6 A;  1S0V A;  1YDX A;  1YJW V;  2A3Q A;  1HNW O;  2CK3 G;  3ZRX A;  1TUB B;  4P9P A;  5JCO C;  1RM1 B;  1I94 O;  2GDS A;  3CSX A;  3K59 A;  1QVF U;  4FLV A;  3DXR A;  2BE3 A;  1XQ8 A;  3VQW A;  4YY3 O;  4U3J A;  3RYI B;  3ZBH A;  5KHH A;  5GTI Z;  1NBM G;  3JSN A;  3TCU A;  5J9P C;  3HKB A;  2VQE O;  2WLI A;  4TQD A;  2A0L A;  4FLZ A;  4X66 O;  1SC5 B;  4JZ2 A;  4UFZ A;  1OCZ C;  2QTS A;  4PA3 A;  1HNX B;  1I5X A;  2Y69 C;  1ARO P;  2IBZ H;  4PHZ A;  1QLE B;  4HNA B;  3JAT B;  1O9G A;  5JQG A;  5B1O A;  4JF3 A;  3AG2 C;  4JI2 O;  1EZV H;  1P4R A;  1SZT A;  2Q9L A;  2QDO A;  1GRJ A;  1PL0 A;  2ITC C;  1WLE A;  1K7D A;  1LUW A;  4TOI A;  1XDC A;  1P7B A;  4ICG A;  2CAZ C;  3CMA V;  3ZHV A;  4CH4 A;  2IM9 A;  4GKK B;  2F4V O;  3CX5 F;  2CDY A;  1VP7 A;  2DOS A;  4MTG A;  5LP6 C;  5L3C A;  1TVK B;  4DR4 O;  5KHJ A;  4JYA B;  5IYZ A;  5EIB D;  4I5S A;  4O2A B;  4NTX A;  2EX3 A;  1QHT A;  2YID A;  2UXD O;  1R3J C;  1BQ0 A;  3CP1 A;  2YC0 A;  5HFL A;  2VQF O;  3ABK C;  2WLL B;  1KKD A;  1IZ3 A;  1N32 O;  4GX2 A;  1BQZ A;  5LMN O;  4X62 O;  1N0J A;  1JR9 A;  3BA8 A;  5J2T A;  4QE9 A;  4NXM O;  2V7Q G;  1RP3 B;  1G4Y B;  5EBW C;  1HWY A;  2C2A A;  5EYP B;  4XDL A;  1H2N A;  3CRA A;  3CD6 V;  1NT2 B;  3U11 A;  1L1F A;  4QGP A;  4LF5 O;  3HKE B;  3B40 A;  2IU0 A;  4K3A A;  5JH7 B;  2A7W A;  1SF9 A;  4ZI7 A;  3DGE A;  1PPJ H;  1P7G A;  4Q20 A;  3FB5 C;  3CME V;  1FAF A;  1J5E B;  3G71 V;  3L70 H;  2DYS B;  3WG7 C;  3B8M A;  2ZDI C;  1FXK C;  5IJ9 A;  4LP8 A;  3T2M A;  4MVZ A;  4B3T B;  3DTU B;  4AI8 A;  2CTP A;  1YIT V;  5IE9 A;  2QWQ B;  1D5A A;  2NLJ C;  3B09 A;  3MD0 A;  1I08 A;  4OX9 B;  3CB2 A;  3IGA C;  2UUB O;  1HDJ A;  2HHH O;  4P2Z A;  1FXK A;  3Q4H B;  2DJV A;  4LFA B;  5ITZ A;  4GLX A;  4CZZ A; 
#chains in the Genus database with same CATH homology
 3A0H Z;  3JCU Z;  3KZI Z;  5GTH Z;  4UB6 Z;  5B5E Z;  5KAI Z;  4PJ0 Z;  4IL6 Z;  5H2F Z;  5E79 Z;  1S5L Z;  5TIS Z;  3A0B Z;  5KAF Z;  4UB8 Z;  5B66 Z;  5GTI Z;  3WU2 Z;  2AXT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...