3A0BZ

Crystal structure of br-substituted photosystem ii complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 11
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3a0bZ00
5TISZ 3A0HZ 4PJ0Z 5KAFZ 5KAIZ 4IL6Z 2AXTZ 4UB6Z 3A0BZ 5E79Z 1S5LZ 5H2FZ 3JCUZ 5GTHZ 5B66Z 3WU2Z 3KZIZ 5B5EZ 4UB8Z 5GTIZ
chains in the Genus database with same CATH superfamily
2XAGA 3OGCC 4EFBA 5C8YB 1WB8A 2QTSA 2E75B 3ZN0A 5KA6A 4ZOLA 3JAKB 4FLXA 3RVZA 2QM4A 1MMMA 2LO1A 4O4JB 1OCRC 2HR3A 1KU9A 1SESA 2CGOA 4CS4A 2O57A 2HJFC 4GX1A 3K5LA 4I0XB 3WG7B 1ROPA 2M7WA 4KFMA 5CBHA 1X4TA 3D36A 2X6AA 3QNEA 1VF5B 2QA4V 1PPJH 1HR0O 3W7UA 4Q6GA 3JD2A 5JQGA 2ZE8A 5LP6C 4XDLA 4GYCB 4GKJB 5A9GA 2LGQA 1IZ3A 3J81N 3AK2A 5LP6A 2OIGA 1XILA 3WFVA 4RWUA 5LGUA 1IBMB 4Z1VA 3SYCA 1MA1A 1SC5B 2WLNA 1R3IC 4KP4A 2CTQA 3RYIB 2E76B 2PGGA 4JAAA 4BAYA 5JWPA 1XMOB 1AP6A 2VQEB 5LHGA 4DV4B 1NZ6A 1VP7A 3ETEA 4U3JB 4HYOA 5LL6Y 3JYCA 1N32B 1QBZA 4FPPA 4I7ZB 2P6JA 4PI0A 4TV8A 4CC5A 3CCJV 2YEVA 2ZCEA 3STZC 1VF7A 4J80A 4MVRA 2WA4A 2FL4A 2EILB 2ZD9A 2ZE5A 2DN9A 2Q7HA 2UXBO 2YICA 1TUBA 1PNMA 4JYYA 4MTOA 4IYHA 3F7YC 2Y48A 4J10A 2XNDG 2QWPB 3CPWU 3ZS8C 3O9OA 2BTOA 3JALB 3LDEA 4KL1A 2ILMA 5BMVA 4UB8Z 3F5TA 5TISZ 3ZCCA 2E74B 3E89A 4KHPB 5BXZA 3OMNB 4O2AB 1BCCH 2AGAA 3E35A 3Q4HB 1OCCB 3RYCB 3LUTB 1SQQH 2WA3A 2WLIB 1K5QA 5AG2A 4GLXA 2A0LA 4MW8A 3JATB 4DR7O 4XDKA 1JPXA 1HP8A 2Q5ZA 2IJIA 2IJJA 1B06A 4NXNO 5GTIZ 1HNZO 2ZM6O 4AILC 2XAHA 5J9PC 4DUZO 4QE9A 5L3FA 1SA0B 1G4YB 3B2EE 3D3QA 4PA9A 1Q6HA 4JYAB 1H2GA 4RO2A 1P84F 1KQSU 2DOSA 3MHSC 1US6A 4JI8O 2EZPA 4AI8A 4LF4B 4NTXA 4QE7A 1SRYA 3SR2C 2EX3A 3CP1A 3AG3B 3ZRSA 3I56V 5EIBC 4DXWA 2PF4E 4DR3O 2ZINA 4IHJB 4H0LB 4W4KA 4B08A 5EYPA 4DR2B 3K3WA 1VQ7V 3JCZA 1TGOA 1AR1B 2KKWA 4LF7O 1M56C 1WA8B 3IJ4A 2Q8VA 2Q69A 4JI5B 4NTYA 3DC6A 1CP9A 1IBLB 2Y4TA 1VQNV 5KHIA 3K04A 3H1LH 5HFLA 5LMUB 4CS2A 3MAQA 1L1FA 4WFFA 2ITDC 1ZL8B 3CMAV 1SETA 3UCSC 3OUSA 5LMNB 1Q43A 1T5EA 1MABG 3E8HA 4IT5A 5IYBO 1DGSA 1AI4A 2CGNA 3KG2A 4RUFA 5EBMC 1N33O 2AW9A 2EIKC 1KBHA 2EIJC 5K1PA 2F66C 3UO2A 1WP7A 4FM0A 4LFCB 3ZHQA 5FPOA 3U0ZA 1S72V 1MZFA 2Q67A 1XEQA 1DTOA 5H6QA 1I0HA 4OX9B 5H6RA 4TSFG 2MK3A 1Z2GA 5EC1C 1R6TA 1WPBA 2GDSA 3JD4A 2FYUH 2F95B 4YY3O 2UUAO 2OCHA 3ABKC 5B1AC 4AQYO 1RP3B 4P30A 4U3FH 2EBOA 5IY5C 4LWSA 1PM9A 4PHZA 3ICXA 1Y76A 1K7DA 4LBEC 3LSQA 3K0DA 3CWBH 5EBWC 1E79G 1Y74B 2Y69C 3APQA 3DTUB 3X2QB 2DMXA 3JSNA 4DV1O 1GTOA 5LHIA 3ZMVA 4TOIA 2ZE6A 2AXTZ 1AI7A 1BE3H 3KCYA 2LGWA 1HNWB 2YXHA 4WBNB 5FNVA 4CH4A 3JD0A 3ZRVA 3TK1A 1GN3A 2UUCB 2UU9B 2NLJC 3HKCA 1QQCA 3RT3C 2QWQB 2P4KA 2Z5UA 1YCIA 3OM3B 1VQ5V 5L3CA 1VQOV 3HR0A 5GONA 3D3IA 4OGQB 3ZHTA 4LCUC 4QPKA 4B3RO 4X62O 4R7CA 2A06H 3J80N 4ZHQA 4N21A 4JPRA 4FVMA 1KB9F 2GTSA 4TV9B 2QR4A 3UT5B 2F4VO 4LFBO 3C90A 3ABLC 3OD4A 5IYDO 1B6QA 3N2GA 1GAXA 5LXTA 2K1EA 4B3MB 5D5QA 5DM6V 5FLXN 1EN5A 4X1KB 4JV5B 2CDYA 4FZ0A 1JX9A 4ASUG 2UXCO 2JEXA 4DR4B 5KMGA 4JI7B 1B3QA 1JCHA 2PUSA 3VQXA 4BIZA 3W7XA 4LNUA 4K3AA 2OCCC 2B9ZA 4MVZA 3T1HB 1K3EA 1H2SB 5FPRA 2FKXA 1SQVH 1ZLZA 4DV0B 2VS0A 4DR5B 1K8AW 4H37A 1D5NA 2EINB 3OT7A 3G4SV 3B8MA 3TETA 4LF9O 2ZKOA 2QWNB 4B3SB 1RSOB 3QO8A 1H2NA 2XHBA 4JI1O 1KD1W 5IJ9B 1JQ0A 4ZI7B 4X88A 4DV3B 4WFEA 4UUJC 2JGDA 1XHXA 4LF6O 4DRXB 4GZRB 1H2LA 3CCMV 3E22A 4QGPA 3I5DA 2CAZC 3ETGA 1PD3A 1CXZB 1SZTA 1Y4MA 4DV5B 2OYQA 2Q73A 2AZ2A 5CA3A 4JI3O 2VQFB 3ETQA 2WAMA 3K9AA 1QLEB 2EJ7A 1DF5A 3HKDA 1XNQO 3L74H 1URFA 1VMGA 1G8MA 1SQBH 4RAIA 4FLYA 5CA0A 5B66Z 5CBFA 2X6BA 2HEPA 3BCCH 4XDJA 2L35A 3M7MX 2ETNA 1YSCA 1A32A 1GM9A 1PL0A 4MTXA 4BWAA 2N04A 5IYZA 1WB7A 2EIMC 4DR1B 3ETDA 2OTJV 4J7ZA 1F51A 4WFAV 4KXRA 3ASNB 1TVKA 2N05A 2BOCC 1YF2A 4DK0A 5JH7B 4O4HB 1WJZA 5J2TB 2ZQMA 4GKJO 4JAUA 1W2BU 3SPJA 1N8RW 2BOBC 3B40A 2P90A 2F93B 2X6CA 3T4DA 5KHKA 1BHAA 1FFXB 2KG7B 1IXBA 2VQEO 3VQYA 3L70H 2RNBA 4FFKA 2LFSA 3CCVV 2ADPA 3BA9A 4K8XA 4BW5A 5BR8B 3LDCA 1QVGU 1N32O 4TUYA 4U7OA 1M5IA 2OTLV 5LA6B 4JI4O 1BMFG 1AI6A 1P7BA 4TQDA 4DV6B 3SYAA 1VEWA 4R8CA 2Q7EA 4U7NA 2DWEC 3E86A 2ZNJA 1RPOA 5J2UA 5EZYB 4DV2B 1DK1A 1L0NH 4D6TH 4PI2A 1IDSA 3ABMB 2YIDA 4PA4A 2A9HA 2F43G 3K08A 1N0JA 4UCVA 5KUMA 1AROP 3FB8C 3BAAA 3K58A 1Y66A 3WU2Z 1V9PA 3RYCA 1Q86W 2P06A 4KHPO 4KUMA 5JJNB 3ZIAG 4X1YA 2QE7G 3SYQA 5IT9N 1BT8A 3CRRA 4LC1A 4FFBB 5CB4A 3CCEV 5IDJA 3RN4A 3DSQA 2UXDB 1QNMA 3K59A 2OT5A 4O2BB 2YIAA 3ZN1A 1VARA 4HNAA 1AILA 4JGSA 1V54B 4X65B 5JJEB 3SYOA 1NH2D 2YI9A 4I50B 4GCZA 2JJ1G 2UXXA 1NH2B 3JARB 4FM2A 1XMQO 1YJNV 4ABMA 5LOVA 3R66A 1H8EG 4TT3G 5B1BB 2AHYA 1Q8IA 4NYKA 5D5PA 3RYHB 1S77D 1JFFA 4UV9A 3JAWA 3APOA 3SDLA 1JMKC 4I4TA 3OUFA 4JYBA 1AVMA 1K5SA 3CJHA 4PJ0Z 2BSKB 4O4IB 2OIEA 3K06A 2XAQA 4I55A 1PKXA 1ZTEA 2QKCA 2RDCA 5IWAB 4YIOA 2ARHA 4LFAB 3H9VA 2ODMA 3GVMA 3P3NA 1SQXH 1KP3A 1V55C 1H8HG 1NT2B 3AG2B 3ZMZA 4K0KB 4MSWC 1IBLO 3L9DA 3H1IH 3SPCA 4A5UB 2ADQB 2GV9A 3S3XA 5LMUO 5GW7A 3CCRV 4LF8B 2WPDG 1AI5A 4K8ZA 3VBBA 4IIJA 1YTFB 5KHHA 2GTAA 1K4CC 2V1DA 4PD4F 1UJWB 1BQZA 2P4VA 1M90W 3AK1A 4RUEA 1GO3F 4H33A 4O4LB 3AEIA 4EB6B 1G1XB 4DK1A 1UFIA 3H01A 1IBKO 1Y6XA 1HNXB 2Q4PA 1HWYA 2KSDA 2HG5C 4DR6B 3CXHF 4MVUA 1MG1A 3CCLV 1GM7A 2M6YA 1R73A 4B3TO 3X2QC 3CE2A 4JZGA 1MOFA 5L3EA 5CA1A 5JVDB 5JCOC 5IJ0A 4YHHB 1VF6C 4EEQA 1BSMA 3RYFB 4DO2A 3ZMUA 1S3JA 1Q81W 5JCOA 5B1NA 1VF6A 3M8AA 1HNWO 2WLLA 3P32A 2D2CB 1GKFA 2BTQB 2R9AA 2RJZA 2W6JG 2BE3A 3OTOB 1J95A 3AG1C 3A8TA 3N2KB 3ASOB 1D2DA 1OCOC 5ITZB 2QDOA 4F6RA 1FJGB 3QG5A 4LH7A 3MDSA 4YJ2B 1FXKB 3IC9A 3HKBA 2GSMB 2JK5C 1E1QG 2ZDIC 5KX5B 2R72A 2G38A 1IX9A 2ZDIA 3L71H 5LYJA 3NR7A 4I9QA 1QVFU 2MW2B 2XT9A 5B3SC 3ZHVA 4ZOLB 2YIBA 5IYCO 1FPOA 2DYSC 4JI2O 3CSXA 3CRCA 4MS2A 3SGIA 3W7SA 4J41A 2GUZA 3E8FA 5L3GA 4W4LA 3I55V 1JVMA 3LDDA 4JV5O 1HR0B 3CHXA 3TJTA 2ZXWC 3LNMB 4X8AA 2N74A 1KKDA 5IE9A 1U96A 5JQGB 1XHZA 4JI7O 3CRQA 2GHYA 3SYPA 2WLHA 3AK3A 3ZHUA 5LP6B 4CH5A 2HLDG 2Q7GA 2QGNA 3TCUA 2JS3A 4DV0O 1JOYA 3BABA 4G28B 3WB2A 1PNKA 2E3CA 3FB5C 2CH7A 2Q0AA 3WB1A 4X1IA 1EZVH 1BZKA 4JI0O 5H9CA 3A0RA 2E5LO 3KZIZ 3SJQC 2XAJA 4TV8B 1BS3A 1RPRA 2H8PC 2YEVB 1NKDA 4DV3O 2UXBB 2PY5A 3HKEA 4DRXA 3J7AU 4QPJA 3DXRA 3A0BZ 3RVYA 4WFGA 1TUBB 1PP9H 4FJCC 3T1YO 3BVOA 2JRIA 2DYRB 2RQ6A 1I94B 1Q5OA 1FXHA 4NTWA 2CTPA 1F4NA 3P3PA 1U97A 1YHQV 5BMVB 5BZBA 4CS3A 4UB6Z 4LF5O 3F5WC 1Q3EA 4NXMO 2YS8A 3E8BA 3ZHSA 4NB5A 5KHGA 1N0NA 4G2KA 3E8GA 1N36B 2ZR2A 2DQ0A 3QTCA 3ZMSA 3SPGA 3BPZA 3QO5A 1HNZB 2ZM6B 2JS5A 3OGIB 2C2AA 1LNQA 3M99B 3C3SA 3T4ZA 3ASNC 1XNRO 3T2MA 1K33A 1M57C 1S5HC 2PYJA 4EKWA 2X0LA 3GWOA 2AHZA 2JDIG 4FM1A 4JTAB 1YEWA 1HDJA 3H1KH 5KAFZ 2HJDA 3CCQV 4GT1A 4UCUA 3ZRWA 1Q6UA 3OW2U 4J42A 4DR3B 2IM9A 2KG7A 4YXWG 2PI4A 3HPLC 2IJKA 1NBMG 2XUMA 5EIBD 2LP7A 3JAMN 4LF7B 1YIJV 4LH6A 4QJFB 1NU1H 2ITCC 3BA8A 5KAIZ 1DLBA 3NXSA 3CD6V 3K03A 4NKGB 1M1KW 5E79Z 4JI6O 3EXAA 4UV8A 2HP8A 1RM1C 1WPXA 3LSSA 1OV9A 1J5EO 3LSUA 2Z3YA 1E1RG 4DV2O 1XDCA 2B1GA 1BL8A 3K5NA 5LGTA 2CTWA 4PDLA 5K1XA 2P7TC 1N33B 4XBFA 4QNHB 4X20A 1FXVA 1L0LH 4IGGA 3BHPA 4ICGA 3SJCC 3UM7A 5DECA 2RMKB 3AG4B 2EIKB 1CPYA 1EBOA 3DC5A 2CUGA 4DV7O 2AZ0A 3VQVA 2IH1C 3A0HZ 1SF9A 2PZSA 3JASA 2EULA 2NR5A 2Q68A 2UUAB 2DW4A 1HW7A 1FFTB 1VQPV 4AQYB 1KC8W 4FK5C 1IVSA 3OFNG 4FIPC 3FAVA 5HFMA 3SJBC 3K5OA 4X64O 4LWSB 3RW0A 5C8YA 4PDRA 1Q90D 4FLZA 1MNGA 5B1BC 3ABKB 5B1AB 2DWDC 1Y76B 3JAKA 5IY5B 4O4JA 3B77A 3BY6A 3WG7C 4DV1B 1MSDA 2QTOA 1SZXA 1GN6A 1PV0A 2DQ3A 1YDXA 4I0XA 3TXSA 1FKAO 2DJVA 1SQPH 4PA7A 1Q7YW 3ZBHA 2CK3G 2B5UA 5FNVB 2HHHB 4BW9A 1NTKH 3HB3B 4CH3A 3HKCB 4D7TA 1AR5A 5KA5A 3ZEDA 5IWAO 3OMIB 5GONB 2QJ1A 4B3RB 3H1HH 4X62B 3FYEB 4FLWA 1IBMO 1F23A 4K0KO 3RYIA 5CMUA 1P4RA 4ZHQB 5L3DA 1XMOO 1Z5VA 4U3JA 4LF8O 4DV4O 5EC2C 1G6UA 1GH6A 2EILC 1I7FA 3N2GB 5LXTB 4HBNA 4Z2WA 4GKKB 3MHHC 3ABLB 2NN4A 1AP5A 2QWOB 3MD0A 4YJ3B 2UXCB 1NVPD 2JGUA 1AJQA 2R9IA 1NVPB 4B7KA 1NJIW 1XBLA 5KMGB 1JA8A 2IU0A 4PA6A 1ORQC 3JALA 4LNUB 2WLMA 2XAFA 1OCCC 4Z1MG 4DR6O 2KQXA 2OCCB 2V7QG 4O2AA 3Q4HA 3OR7C 4BIOA 3BRCA 2YC0A 1F7YA 2WLIA 2WLKA 2XOKG 3JATA 4UVCA 4JI1B 1KKCA 3FB7C 1QU7A 1K4DC 3CEIA 4P9PA 4YHHO 1N34B 5GTHZ 2ZIMA 1IURA 4E4EA 2XTAA 4CH6A 1WP8A 2JGDB 1SA0A 2BTQA 3E22B 4BR6A 1Y67A 2W6IG 1GN4A 3BEHA 3WB0A 1H2KA 3RFRA 3OTOO 4JI3B 3GB7C 4JYAO 2QKAA 4X9QA 2XASA 4J7KA 1GN2A 1R6KA 1FJGO 1XNQB 3CCUV 5C93A 1PNLA 3AG3C 2ZT9B 3HKDB 1MSWD 1Z5WA 2D3OW 3JD3A 3E2EA 4LF4O 4WCEV 5CA0B 4X66B 4IHJA 5KHJA 1K9MW 2PTMA 3K5MA 3ZJZA 4DR2O 3D36C 2BCCH 3OMAB 1AJPA 3O65A 1WA8A 5KLVH 5IYZB 3KCXA 3C3TA 1X59A 4JI5O 4FLVA 2EIMB 1ZWIC 4DYLA 3CX5F 1QHTA 1ZL8A 1TVKB 1NI8A 2NNUA 1XOUA 4X89A 5LMNO 1RFYA 1O9HA 5CN0A 1SQFA 2LQTA 2X7RB 1YTFD 4L87A 2Z0AA 4JYCA 1ENVA 3G6EV 5DN6G 4WFBV 4WFHA 4BIUA 2HKOA 1VQ4V 4GUNA 3L75H 4Q20A 4LFCO 2W0XA 1JR9A 1XL4A 4DUYB 1M4UA 1XREA 1YJ9V 2FMLA 4J9YB 4OX9O 2CE4A 4DW1A 4JI4B 1TA8A 4TUYB 1OCZB 4FMTA 4FLTA 1BQ0A 2IBZH 1S76D 1EN4A 2WSSG 1K73W 3EHBB 2DYRC 1FYJA 1FAFA 4GX5A 5J2UB 4JAVA 3CS5A 3RBZA 2YDEA 1LUVA 2YUAA 5H5NA 4UCOA 3E83A 3JD1A 3ZMTA 1Y74A 2UUBB 3TGUH 1I94O 5LGNA 2WLJA 1SS3A 3RGBA 2VRZA 1NS1A 3OTFA 4NVPA 1TAEA 3OAAG 4FLUA 4WBNA 4UVAA 5JJJB 3K79A 1WAZA 1YITV 2H94A 4X1YB 2V4DA 5H2FZ 2UUCO 2UU9O 3PN1A 3JCUZ 5CB4B 4B7EA 1N36O 2P5OA 4HZ3A 2Q9LA 2YXLA 4HNAB 4AHCA 1R3KC 1M93A 1K97A 4CBCA 2YXYA 1XMQB 1W0JG 1Q6IA 3W7TA 4TV9A 3UT5A 4NR1A 1TUEB 1BHBA 5LOVB 3FYIB 2PI5A 4K35A 2ZIOA 4B3MO 1D5AA 1OCRB 4X1KA 1JFFB 2L6LA 2VWKA 1I5XA 1XUQA 3JAWB 2RN9A 5B1OA 2H3OA 1F4MA 1YI2V 4I4TB 4J7JA 3CJHB 1JJ2U 1NTZH 4I55B 4UXNA 2F23A 1P49A 3F7VC 4DR4O 4R6ZA 2HFEC 3THOA 5B5EZ 3FX7A 1OHHG 1QCEA 3T1HO 1ZUQA 3CRMA 3EFFK 2EINC 3CMEV 4E2LA 1V55B 4MTFA 2LJ2A 4I5SA 3CCSV 3CXCU 2Q6AA 4DR5O 3CC4V 4J9ZB 4CC6A 2ZNIA 1RSOA 1LR1A 2LFRA 1WNSA 4IL6Z 4UVBA 4IIJB 5IJ9A 4B3SO 1GM8A 4ZI7A 5KUKA 1P7GA 1YXBA 3AG4C 4L8JA 1MZEA 1AR4A 4OPAA 2YI8A 1K34A 1AB3A 5A2QN 2Y4UA 2IW5A 1QR8A 1IBKB 1KMIZ 1QLEC 5F2VO 4DV5O 3B8NA 3OEHG 2LW1A 3A2FA 2VQFO 4MTGA 2KB1A 2CTRA 3B4SA 3RWRD 4B3TB 1YJWV 2Y0IA 3CYOA 4JTDB 1R6NA 3UQ8A 5EBLC 3W7WA 1W59A 4DR7B 3FB6C 5CA1B 4ZIBA 2JIZG 5IJ0B 4NXNB 4TWKA 3B09A 4GX0A 4DUZB 2R70A 3TXQA 1EN6A 3FFQA 4DR1O 2WLLB 2UXNA 3N27A 2HHHO 1VQ9V 1SQGA 4LP8A 3ZHRA 1GK9A 2JVDA 2R9RB 5JH7A 4O4HA 2Y0PA 3SPIA 5J2TA 3SJAC 3FKSG 4PV1B 1XI1A 1FD9A 4JI8B 4F6RB 4G27B 3AG1B 2QKSA 4H13B 2A3QA 2RCVA 3DGEA 3HKBB 1THZA 1OCOB 2QEXV 1NR7A 1KUQA 5LHHA 1EFRG 2W0FC 4OXSA 1QR9A 4F4LA 1FFXA 2P67A 5LYJB 1UPGA 2FB5A 4CZZA 3S3WA 1EM1A 4MVQA 5EYPB 2YIBD 1L8DA 3R65A 4JI2B 1BGYH 3H1JH 3P30A 4HAMA 5LA6A 5B3SB 5BR8O 4H44B 1VQ6V 4JASA 4PELA 3VQWA 4GKKO 2GUZB 2ATKC 4YJ3A 2DYSB 4UFZA 1I08A 2QSAA 1M56B 4DV6O 3CC2V 2P22C 1I5YA 3L72H 1VQKV 3ABMC 5EZYA 1OJHA 1XQ8A 1NR1A 2ZXWB 4PA3A 5E1AC 2B1IA 4UCTA 3KKYA 3QO7A 5CBGA 1SKVA 4JTCB 1KP2A 2QM7A 3D8CA 3IGAC 1M9NA 3K57A 3G6BA 5L3BA 1R3LC 2OWOA 4MVOA 2EIJB 3STLC 3K9SA 4JI0B 4FFBA 2CH7B 2E5LB 2IJHA 4X1IB 2YSUB 2QWRB 3OEEG 4O2BA 4MT8A 4YY3B 2UXDO 1H38A 1V54C 4LR3A 3JSLA 1N34O 5BY1A 3QF7A 3L73H 5LBQA 5FL7G 4JF3A 3HKEB 1XL6A 2PYLA 1YZBA 3FD9A 3DXRB 3T1YB 2FTKA 2A79B 4I50A 4X65O 1GRJA 1COWG 3JARA 3ZX6A 2DE0X 2WWWA 1WN7A 3G71V 4UCSA 3SPHA 4LF5B 3RYHA 4MVMA 5DEDA 2JEUA 3G67A 1PL4A 1W0KG 2EJRA 5EK0A 2EZOA 4NXMB 2Y69B 1YVWA 3AG7A 1EZJA 2BSKA 3OR6C 4O4IA 4X66O 3U10A 2IH3C 4P2ZA 1ZSPA 1N4CA 3AG2C 3CRAA 3LNNA 1ZAUA 3UKMA 1VQMV 4PDVA 1XNRB 4LFAO 2LW7A 2ZE7A 3IC7A 2HVJC 3IAYA 2F4VB 3G80A 1M57B 3PJSK 1ZX3A 4LFBB 4QIWF 4UCRA 1NTMH 1VIBA 4EFEA 1S5LZ 4OPHA 3ZRWB 3ABUA 3EVKA 4GX2A 1CEZA 1KYOF 1IXMA 3U11A 4O4LA 1FS0G 1VQLV 1GMGA 1OCZC 3ML0A 4IYIA 1Q82W 4EB6A 4FZ1A 1KECA 3VOUA 4DUYO 1VQ8V 3ABTA 1NQTA 1O9GA 4J11A 1HNXO 4TQFA 4JI6B 1H2MA 4ZKIA 1R3JC 4R50A 2Q0OC 3UO3A 4F6EA 1QLNA 1WLEA 2HVKC 1J5EB 4LF9B 3ZRXA 3CB2A 4MVSA 1RM1B 4RQEA 5JVDA 2QM8A 1S0VA 3T1CA 1B04A 1S5JA 2F1MA 3IFXA 3CC7V 4YIPA 2UUBO 3QVNA 4P9OA 3RYFA 2IU3A 4X20B 4ZBMA 2K9PA 4LF6B 1R1BA 3K0GA 1LUWA 2GBOA 3ASOC 4N23A 4D7SA 4C7UA 4DV7B 1FXKC 1AJNA 3N2KA 1DF4A 2A7WA 4JZ2A 2ZR3A 2VWJA 5ITZA 4PDMA 3JASB 4DW0A 4YJ2A 1FXKA 1SERA 1JJOA 5KX5A 4RQFA 2JJ2G 3BFRA 4MW3A 4X64B 4I9WA 3OE7G 3FAVB 4WF9V 1K92A 3GWKC 1OZ0A
chains in the Genus database with same CATH topology
5TISZ 3A0HZ 4PJ0Z 5KAFZ 5KAIZ 4IL6Z 2AXTZ 4UB6Z 3A0BZ 5E79Z 1S5LZ 5H2FZ 3JCUZ 5GTHZ 5B66Z 3WU2Z 3KZIZ 5B5EZ 4UB8Z 5GTIZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS Z;  3A0H Z;  4PJ0 Z;  5KAF Z;  5KAI Z;  4IL6 Z;  2AXT Z;  4UB6 Z;  3A0B Z;  5E79 Z;  1S5L Z;  5H2F Z;  3JCU Z;  5GTH Z;  5B66 Z;  3WU2 Z;  3KZI Z;  5B5E Z;  4UB8 Z;  5GTI Z; 
#chains in the Genus database with same CATH topology
 2XAG A;  3OGC C;  4EFB A;  5C8Y B;  1WB8 A;  2QTS A;  2E75 B;  3ZN0 A;  5KA6 A;  4ZOL A;  3JAK B;  4FLX A;  3RVZ A;  2QM4 A;  1MMM A;  2LO1 A;  4O4J B;  1OCR C;  2HR3 A;  1KU9 A;  1SES A;  2CGO A;  4CS4 A;  2O57 A;  2HJF C;  4GX1 A;  3K5L A;  4I0X B;  3WG7 B;  1ROP A;  2M7W A;  4KFM A;  5CBH A;  1X4T A;  3D36 A;  2X6A A;  3QNE A;  1VF5 B;  2QA4 V;  1PPJ H;  1HR0 O;  3W7U A;  4Q6G A;  3JD2 A;  5JQG A;  2ZE8 A;  5LP6 C;  4XDL A;  4GYC B;  4GKJ B;  5A9G A;  2LGQ A;  1IZ3 A;  3J81 N;  3AK2 A;  5LP6 A;  2OIG A;  1XIL A;  3WFV A;  4RWU A;  5LGU A;  1IBM B;  4Z1V A;  3SYC A;  1MA1 A;  1SC5 B;  2WLN A;  1R3I C;  4KP4 A;  2CTQ A;  3RYI B;  2E76 B;  2PGG A;  4JAA A;  4BAY A;  5JWP A;  1XMO B;  1AP6 A;  2VQE B;  5LHG A;  4DV4 B;  1NZ6 A;  1VP7 A;  3ETE A;  4U3J B;  4HYO A;  5LL6 Y;  3JYC A;  1N32 B;  1QBZ A;  4FPP A;  4I7Z B;  2P6J A;  4PI0 A;  4TV8 A;  4CC5 A;  3CCJ V;  2YEV A;  2ZCE A;  3STZ C;  1VF7 A;  4J80 A;  4MVR A;  2WA4 A;  2FL4 A;  2EIL B;  2ZD9 A;  2ZE5 A;  2DN9 A;  2Q7H A;  2UXB O;  2YIC A;  1TUB A;  1PNM A;  4JYY A;  4MTO A;  4IYH A;  3F7Y C;  2Y48 A;  4J10 A;  2XND G;  2QWP B;  3CPW U;  3ZS8 C;  3O9O A;  2BTO A;  3JAL B;  3LDE A;  4KL1 A;  2ILM A;  5BMV A;  4UB8 Z;  3F5T A;  5TIS Z;  3ZCC A;  2E74 B;  3E89 A;  4KHP B;  5BXZ A;  3OMN B;  4O2A B;  1BCC H;  2AGA A;  3E35 A;  3Q4H B;  1OCC B;  3RYC B;  3LUT B;  1SQQ H;  2WA3 A;  2WLI B;  1K5Q A;  5AG2 A;  4GLX A;  2A0L A;  4MW8 A;  3JAT B;  4DR7 O;  4XDK A;  1JPX A;  1HP8 A;  2Q5Z A;  2IJI A;  2IJJ A;  1B06 A;  4NXN O;  5GTI Z;  1HNZ O;  2ZM6 O;  4AIL C;  2XAH A;  5J9P C;  4DUZ O;  4QE9 A;  5L3F A;  1SA0 B;  1G4Y B;  3B2E E;  3D3Q A;  4PA9 A;  1Q6H A;  4JYA B;  1H2G A;  4RO2 A;  1P84 F;  1KQS U;  2DOS A;  3MHS C;  1US6 A;  4JI8 O;  2EZP A;  4AI8 A;  4LF4 B;  4NTX A;  4QE7 A;  1SRY A;  3SR2 C;  2EX3 A;  3CP1 A;  3AG3 B;  3ZRS A;  3I56 V;  5EIB C;  4DXW A;  2PF4 E;  4DR3 O;  2ZIN A;  4IHJ B;  4H0L B;  4W4K A;  4B08 A;  5EYP A;  4DR2 B;  3K3W A;  1VQ7 V;  3JCZ A;  1TGO A;  1AR1 B;  2KKW A;  4LF7 O;  1M56 C;  1WA8 B;  3IJ4 A;  2Q8V A;  2Q69 A;  4JI5 B;  4NTY A;  3DC6 A;  1CP9 A;  1IBL B;  2Y4T A;  1VQN V;  5KHI A;  3K04 A;  3H1L H;  5HFL A;  5LMU B;  4CS2 A;  3MAQ A;  1L1F A;  4WFF A;  2ITD C;  1ZL8 B;  3CMA V;  1SET A;  3UCS C;  3OUS A;  5LMN B;  1Q43 A;  1T5E A;  1MAB G;  3E8H A;  4IT5 A;  5IYB O;  1DGS A;  1AI4 A;  2CGN A;  3KG2 A;  4RUF A;  5EBM C;  1N33 O;  2AW9 A;  2EIK C;  1KBH A;  2EIJ C;  5K1P A;  2F66 C;  3UO2 A;  1WP7 A;  4FM0 A;  4LFC B;  3ZHQ A;  5FPO A;  3U0Z A;  1S72 V;  1MZF A;  2Q67 A;  1XEQ A;  1DTO A;  5H6Q A;  1I0H A;  4OX9 B;  5H6R A;  4TSF G;  2MK3 A;  1Z2G A;  5EC1 C;  1R6T A;  1WPB A;  2GDS A;  3JD4 A;  2FYU H;  2F95 B;  4YY3 O;  2UUA O;  2OCH A;  3ABK C;  5B1A C;  4AQY O;  1RP3 B;  4P30 A;  4U3F H;  2EBO A;  5IY5 C;  4LWS A;  1PM9 A;  4PHZ A;  3ICX A;  1Y76 A;  1K7D A;  4LBE C;  3LSQ A;  3K0D A;  3CWB H;  5EBW C;  1E79 G;  1Y74 B;  2Y69 C;  3APQ A;  3DTU B;  3X2Q B;  2DMX A;  3JSN A;  4DV1 O;  1GTO A;  5LHI A;  3ZMV A;  4TOI A;  2ZE6 A;  2AXT Z;  1AI7 A;  1BE3 H;  3KCY A;  2LGW A;  1HNW B;  2YXH A;  4WBN B;  5FNV A;  4CH4 A;  3JD0 A;  3ZRV A;  3TK1 A;  1GN3 A;  2UUC B;  2UU9 B;  2NLJ C;  3HKC A;  1QQC A;  3RT3 C;  2QWQ B;  2P4K A;  2Z5U A;  1YCI A;  3OM3 B;  1VQ5 V;  5L3C A;  1VQO V;  3HR0 A;  5GON A;  3D3I A;  4OGQ B;  3ZHT A;  4LCU C;  4QPK A;  4B3R O;  4X62 O;  4R7C A;  2A06 H;  3J80 N;  4ZHQ A;  4N21 A;  4JPR A;  4FVM A;  1KB9 F;  2GTS A;  4TV9 B;  2QR4 A;  3UT5 B;  2F4V O;  4LFB O;  3C90 A;  3ABL C;  3OD4 A;  5IYD O;  1B6Q A;  3N2G A;  1GAX A;  5LXT A;  2K1E A;  4B3M B;  5D5Q A;  5DM6 V;  5FLX N;  1EN5 A;  4X1K B;  4JV5 B;  2CDY A;  4FZ0 A;  1JX9 A;  4ASU G;  2UXC O;  2JEX A;  4DR4 B;  5KMG A;  4JI7 B;  1B3Q A;  1JCH A;  2PUS A;  3VQX A;  4BIZ A;  3W7X A;  4LNU A;  4K3A A;  2OCC C;  2B9Z A;  4MVZ A;  3T1H B;  1K3E A;  1H2S B;  5FPR A;  2FKX A;  1SQV H;  1ZLZ A;  4DV0 B;  2VS0 A;  4DR5 B;  1K8A W;  4H37 A;  1D5N A;  2EIN B;  3OT7 A;  3G4S V;  3B8M A;  3TET A;  4LF9 O;  2ZKO A;  2QWN B;  4B3S B;  1RSO B;  3QO8 A;  1H2N A;  2XHB A;  4JI1 O;  1KD1 W;  5IJ9 B;  1JQ0 A;  4ZI7 B;  4X88 A;  4DV3 B;  4WFE A;  4UUJ C;  2JGD A;  1XHX A;  4LF6 O;  4DRX B;  4GZR B;  1H2L A;  3CCM V;  3E22 A;  4QGP A;  3I5D A;  2CAZ C;  3ETG A;  1PD3 A;  1CXZ B;  1SZT A;  1Y4M A;  4DV5 B;  2OYQ A;  2Q73 A;  2AZ2 A;  5CA3 A;  4JI3 O;  2VQF B;  3ETQ A;  2WAM A;  3K9A A;  1QLE B;  2EJ7 A;  1DF5 A;  3HKD A;  1XNQ O;  3L74 H;  1URF A;  1VMG A;  1G8M A;  1SQB H;  4RAI A;  4FLY A;  5CA0 A;  5B66 Z;  5CBF A;  2X6B A;  2HEP A;  3BCC H;  4XDJ A;  2L35 A;  3M7M X;  2ETN A;  1YSC A;  1A32 A;  1GM9 A;  1PL0 A;  4MTX A;  4BWA A;  2N04 A;  5IYZ A;  1WB7 A;  2EIM C;  4DR1 B;  3ETD A;  2OTJ V;  4J7Z A;  1F51 A;  4WFA V;  4KXR A;  3ASN B;  1TVK A;  2N05 A;  2BOC C;  1YF2 A;  4DK0 A;  5JH7 B;  4O4H B;  1WJZ A;  5J2T B;  2ZQM A;  4GKJ O;  4JAU A;  1W2B U;  3SPJ A;  1N8R W;  2BOB C;  3B40 A;  2P90 A;  2F93 B;  2X6C A;  3T4D A;  5KHK A;  1BHA A;  1FFX B;  2KG7 B;  1IXB A;  2VQE O;  3VQY A;  3L70 H;  2RNB A;  4FFK A;  2LFS A;  3CCV V;  2ADP A;  3BA9 A;  4K8X A;  4BW5 A;  5BR8 B;  3LDC A;  1QVG U;  1N32 O;  4TUY A;  4U7O A;  1M5I A;  2OTL V;  5LA6 B;  4JI4 O;  1BMF G;  1AI6 A;  1P7B A;  4TQD A;  4DV6 B;  3SYA A;  1VEW A;  4R8C A;  2Q7E A;  4U7N A;  2DWE C;  3E86 A;  2ZNJ A;  1RPO A;  5J2U A;  5EZY B;  4DV2 B;  1DK1 A;  1L0N H;  4D6T H;  4PI2 A;  1IDS A;  3ABM B;  2YID A;  4PA4 A;  2A9H A;  2F43 G;  3K08 A;  1N0J A;  4UCV A;  5KUM A;  1ARO P;  3FB8 C;  3BAA A;  3K58 A;  1Y66 A;  3WU2 Z;  1V9P A;  3RYC A;  1Q86 W;  2P06 A;  4KHP O;  4KUM A;  5JJN B;  3ZIA G;  4X1Y A;  2QE7 G;  3SYQ A;  5IT9 N;  1BT8 A;  3CRR A;  4LC1 A;  4FFB B;  5CB4 A;  3CCE V;  5IDJ A;  3RN4 A;  3DSQ A;  2UXD B;  1QNM A;  3K59 A;  2OT5 A;  4O2B B;  2YIA A;  3ZN1 A;  1VAR A;  4HNA A;  1AIL A;  4JGS A;  1V54 B;  4X65 B;  5JJE B;  3SYO A;  1NH2 D;  2YI9 A;  4I50 B;  4GCZ A;  2JJ1 G;  2UXX A;  1NH2 B;  3JAR B;  4FM2 A;  1XMQ O;  1YJN V;  4ABM A;  5LOV A;  3R66 A;  1H8E G;  4TT3 G;  5B1B B;  2AHY A;  1Q8I A;  4NYK A;  5D5P A;  3RYH B;  1S77 D;  1JFF A;  4UV9 A;  3JAW A;  3APO A;  3SDL A;  1JMK C;  4I4T A;  3OUF A;  4JYB A;  1AVM A;  1K5S A;  3CJH A;  4PJ0 Z;  2BSK B;  4O4I B;  2OIE A;  3K06 A;  2XAQ A;  4I55 A;  1PKX A;  1ZTE A;  2QKC A;  2RDC A;  5IWA B;  4YIO A;  2ARH A;  4LFA B;  3H9V A;  2ODM A;  3GVM A;  3P3N A;  1SQX H;  1KP3 A;  1V55 C;  1H8H G;  1NT2 B;  3AG2 B;  3ZMZ A;  4K0K B;  4MSW C;  1IBL O;  3L9D A;  3H1I H;  3SPC A;  4A5U B;  2ADQ B;  2GV9 A;  3S3X A;  5LMU O;  5GW7 A;  3CCR V;  4LF8 B;  2WPD G;  1AI5 A;  4K8Z A;  3VBB A;  4IIJ A;  1YTF B;  5KHH A;  2GTA A;  1K4C C;  2V1D A;  4PD4 F;  1UJW B;  1BQZ A;  2P4V A;  1M90 W;  3AK1 A;  4RUE A;  1GO3 F;  4H33 A;  4O4L B;  3AEI A;  4EB6 B;  1G1X B;  4DK1 A;  1UFI A;  3H01 A;  1IBK O;  1Y6X A;  1HNX B;  2Q4P A;  1HWY A;  2KSD A;  2HG5 C;  4DR6 B;  3CXH F;  4MVU A;  1MG1 A;  3CCL V;  1GM7 A;  2M6Y A;  1R73 A;  4B3T O;  3X2Q C;  3CE2 A;  4JZG A;  1MOF A;  5L3E A;  5CA1 A;  5JVD B;  5JCO C;  5IJ0 A;  4YHH B;  1VF6 C;  4EEQ A;  1BSM A;  3RYF B;  4DO2 A;  3ZMU A;  1S3J A;  1Q81 W;  5JCO A;  5B1N A;  1VF6 A;  3M8A A;  1HNW O;  2WLL A;  3P32 A;  2D2C B;  1GKF A;  2BTQ B;  2R9A A;  2RJZ A;  2W6J G;  2BE3 A;  3OTO B;  1J95 A;  3AG1 C;  3A8T A;  3N2K B;  3ASO B;  1D2D A;  1OCO C;  5ITZ B;  2QDO A;  4F6R A;  1FJG B;  3QG5 A;  4LH7 A;  3MDS A;  4YJ2 B;  1FXK B;  3IC9 A;  3HKB A;  2GSM B;  2JK5 C;  1E1Q G;  2ZDI C;  5KX5 B;  2R72 A;  2G38 A;  1IX9 A;  2ZDI A;  3L71 H;  5LYJ A;  3NR7 A;  4I9Q A;  1QVF U;  2MW2 B;  2XT9 A;  5B3S C;  3ZHV A;  4ZOL B;  2YIB A;  5IYC O;  1FPO A;  2DYS C;  4JI2 O;  3CSX A;  3CRC A;  4MS2 A;  3SGI A;  3W7S A;  4J41 A;  2GUZ A;  3E8F A;  5L3G A;  4W4L A;  3I55 V;  1JVM A;  3LDD A;  4JV5 O;  1HR0 B;  3CHX A;  3TJT A;  2ZXW C;  3LNM B;  4X8A A;  2N74 A;  1KKD A;  5IE9 A;  1U96 A;  5JQG B;  1XHZ A;  4JI7 O;  3CRQ A;  2GHY A;  3SYP A;  2WLH A;  3AK3 A;  3ZHU A;  5LP6 B;  4CH5 A;  2HLD G;  2Q7G A;  2QGN A;  3TCU A;  2JS3 A;  4DV0 O;  1JOY A;  3BAB A;  4G28 B;  3WB2 A;  1PNK A;  2E3C A;  3FB5 C;  2CH7 A;  2Q0A A;  3WB1 A;  4X1I A;  1EZV H;  1BZK A;  4JI0 O;  5H9C A;  3A0R A;  2E5L O;  3KZI Z;  3SJQ C;  2XAJ A;  4TV8 B;  1BS3 A;  1RPR A;  2H8P C;  2YEV B;  1NKD A;  4DV3 O;  2UXB B;  2PY5 A;  3HKE A;  4DRX A;  3J7A U;  4QPJ A;  3DXR A;  3A0B Z;  3RVY A;  4WFG A;  1TUB B;  1PP9 H;  4FJC C;  3T1Y O;  3BVO A;  2JRI A;  2DYR B;  2RQ6 A;  1I94 B;  1Q5O A;  1FXH A;  4NTW A;  2CTP A;  1F4N A;  3P3P A;  1U97 A;  1YHQ V;  5BMV B;  5BZB A;  4CS3 A;  4UB6 Z;  4LF5 O;  3F5W C;  1Q3E A;  4NXM O;  2YS8 A;  3E8B A;  3ZHS A;  4NB5 A;  5KHG A;  1N0N A;  4G2K A;  3E8G A;  1N36 B;  2ZR2 A;  2DQ0 A;  3QTC A;  3ZMS A;  3SPG A;  3BPZ A;  3QO5 A;  1HNZ B;  2ZM6 B;  2JS5 A;  3OGI B;  2C2A A;  1LNQ A;  3M99 B;  3C3S A;  3T4Z A;  3ASN C;  1XNR O;  3T2M A;  1K33 A;  1M57 C;  1S5H C;  2PYJ A;  4EKW A;  2X0L A;  3GWO A;  2AHZ A;  2JDI G;  4FM1 A;  4JTA B;  1YEW A;  1HDJ A;  3H1K H;  5KAF Z;  2HJD A;  3CCQ V;  4GT1 A;  4UCU A;  3ZRW A;  1Q6U A;  3OW2 U;  4J42 A;  4DR3 B;  2IM9 A;  2KG7 A;  4YXW G;  2PI4 A;  3HPL C;  2IJK A;  1NBM G;  2XUM A;  5EIB D;  2LP7 A;  3JAM N;  4LF7 B;  1YIJ V;  4LH6 A;  4QJF B;  1NU1 H;  2ITC C;  3BA8 A;  5KAI Z;  1DLB A;  3NXS A;  3CD6 V;  3K03 A;  4NKG B;  1M1K W;  5E79 Z;  4JI6 O;  3EXA A;  4UV8 A;  2HP8 A;  1RM1 C;  1WPX A;  3LSS A;  1OV9 A;  1J5E O;  3LSU A;  2Z3Y A;  1E1R G;  4DV2 O;  1XDC A;  2B1G A;  1BL8 A;  3K5N A;  5LGT A;  2CTW A;  4PDL A;  5K1X A;  2P7T C;  1N33 B;  4XBF A;  4QNH B;  4X20 A;  1FXV A;  1L0L H;  4IGG A;  3BHP A;  4ICG A;  3SJC C;  3UM7 A;  5DEC A;  2RMK B;  3AG4 B;  2EIK B;  1CPY A;  1EBO A;  3DC5 A;  2CUG A;  4DV7 O;  2AZ0 A;  3VQV A;  2IH1 C;  3A0H Z;  1SF9 A;  2PZS A;  3JAS A;  2EUL A;  2NR5 A;  2Q68 A;  2UUA B;  2DW4 A;  1HW7 A;  1FFT B;  1VQP V;  4AQY B;  1KC8 W;  4FK5 C;  1IVS A;  3OFN G;  4FIP C;  3FAV A;  5HFM A;  3SJB C;  3K5O A;  4X64 O;  4LWS B;  3RW0 A;  5C8Y A;  4PDR A;  1Q90 D;  4FLZ A;  1MNG A;  5B1B C;  3ABK B;  5B1A B;  2DWD C;  1Y76 B;  3JAK A;  5IY5 B;  4O4J A;  3B77 A;  3BY6 A;  3WG7 C;  4DV1 B;  1MSD A;  2QTO A;  1SZX A;  1GN6 A;  1PV0 A;  2DQ3 A;  1YDX A;  4I0X A;  3TXS A;  1FKA O;  2DJV A;  1SQP H;  4PA7 A;  1Q7Y W;  3ZBH A;  2CK3 G;  2B5U A;  5FNV B;  2HHH B;  4BW9 A;  1NTK H;  3HB3 B;  4CH3 A;  3HKC B;  4D7T A;  1AR5 A;  5KA5 A;  3ZED A;  5IWA O;  3OMI B;  5GON B;  2QJ1 A;  4B3R B;  3H1H H;  4X62 B;  3FYE B;  4FLW A;  1IBM O;  1F23 A;  4K0K O;  3RYI A;  5CMU A;  1P4R A;  4ZHQ B;  5L3D A;  1XMO O;  1Z5V A;  4U3J A;  4LF8 O;  4DV4 O;  5EC2 C;  1G6U A;  1GH6 A;  2EIL C;  1I7F A;  3N2G B;  5LXT B;  4HBN A;  4Z2W A;  4GKK B;  3MHH C;  3ABL B;  2NN4 A;  1AP5 A;  2QWO B;  3MD0 A;  4YJ3 B;  2UXC B;  1NVP D;  2JGU A;  1AJQ A;  2R9I A;  1NVP B;  4B7K A;  1NJI W;  1XBL A;  5KMG B;  1JA8 A;  2IU0 A;  4PA6 A;  1ORQ C;  3JAL A;  4LNU B;  2WLM A;  2XAF A;  1OCC C;  4Z1M G;  4DR6 O;  2KQX A;  2OCC B;  2V7Q G;  4O2A A;  3Q4H A;  3OR7 C;  4BIO A;  3BRC A;  2YC0 A;  1F7Y A;  2WLI A;  2WLK A;  2XOK G;  3JAT A;  4UVC A;  4JI1 B;  1KKC A;  3FB7 C;  1QU7 A;  1K4D C;  3CEI A;  4P9P A;  4YHH O;  1N34 B;  5GTH Z;  2ZIM A;  1IUR A;  4E4E A;  2XTA A;  4CH6 A;  1WP8 A;  2JGD B;  1SA0 A;  2BTQ A;  3E22 B;  4BR6 A;  1Y67 A;  2W6I G;  1GN4 A;  3BEH A;  3WB0 A;  1H2K A;  3RFR A;  3OTO O;  4JI3 B;  3GB7 C;  4JYA O;  2QKA A;  4X9Q A;  2XAS A;  4J7K A;  1GN2 A;  1R6K A;  1FJG O;  1XNQ B;  3CCU V;  5C93 A;  1PNL A;  3AG3 C;  2ZT9 B;  3HKD B;  1MSW D;  1Z5W A;  2D3O W;  3JD3 A;  3E2E A;  4LF4 O;  4WCE V;  5CA0 B;  4X66 B;  4IHJ A;  5KHJ A;  1K9M W;  2PTM A;  3K5M A;  3ZJZ A;  4DR2 O;  3D36 C;  2BCC H;  3OMA B;  1AJP A;  3O65 A;  1WA8 A;  5KLV H;  5IYZ B;  3KCX A;  3C3T A;  1X59 A;  4JI5 O;  4FLV A;  2EIM B;  1ZWI C;  4DYL A;  3CX5 F;  1QHT A;  1ZL8 A;  1TVK B;  1NI8 A;  2NNU A;  1XOU A;  4X89 A;  5LMN O;  1RFY A;  1O9H A;  5CN0 A;  1SQF A;  2LQT A;  2X7R B;  1YTF D;  4L87 A;  2Z0A A;  4JYC A;  1ENV A;  3G6E V;  5DN6 G;  4WFB V;  4WFH A;  4BIU A;  2HKO A;  1VQ4 V;  4GUN A;  3L75 H;  4Q20 A;  4LFC O;  2W0X A;  1JR9 A;  1XL4 A;  4DUY B;  1M4U A;  1XRE A;  1YJ9 V;  2FML A;  4J9Y B;  4OX9 O;  2CE4 A;  4DW1 A;  4JI4 B;  1TA8 A;  4TUY B;  1OCZ B;  4FMT A;  4FLT A;  1BQ0 A;  2IBZ H;  1S76 D;  1EN4 A;  2WSS G;  1K73 W;  3EHB B;  2DYR C;  1FYJ A;  1FAF A;  4GX5 A;  5J2U B;  4JAV A;  3CS5 A;  3RBZ A;  2YDE A;  1LUV A;  2YUA A;  5H5N A;  4UCO A;  3E83 A;  3JD1 A;  3ZMT A;  1Y74 A;  2UUB B;  3TGU H;  1I94 O;  5LGN A;  2WLJ A;  1SS3 A;  3RGB A;  2VRZ A;  1NS1 A;  3OTF A;  4NVP A;  1TAE A;  3OAA G;  4FLU A;  4WBN A;  4UVA A;  5JJJ B;  3K79 A;  1WAZ A;  1YIT V;  2H94 A;  4X1Y B;  2V4D A;  5H2F Z;  2UUC O;  2UU9 O;  3PN1 A;  3JCU Z;  5CB4 B;  4B7E A;  1N36 O;  2P5O A;  4HZ3 A;  2Q9L A;  2YXL A;  4HNA B;  4AHC A;  1R3K C;  1M93 A;  1K97 A;  4CBC A;  2YXY A;  1XMQ B;  1W0J G;  1Q6I A;  3W7T A;  4TV9 A;  3UT5 A;  4NR1 A;  1TUE B;  1BHB A;  5LOV B;  3FYI B;  2PI5 A;  4K35 A;  2ZIO A;  4B3M O;  1D5A A;  1OCR B;  4X1K A;  1JFF B;  2L6L A;  2VWK A;  1I5X A;  1XUQ A;  3JAW B;  2RN9 A;  5B1O A;  2H3O A;  1F4M A;  1YI2 V;  4I4T B;  4J7J A;  3CJH B;  1JJ2 U;  1NTZ H;  4I55 B;  4UXN A;  2F23 A;  1P49 A;  3F7V C;  4DR4 O;  4R6Z A;  2HFE C;  3THO A;  5B5E Z;  3FX7 A;  1OHH G;  1QCE A;  3T1H O;  1ZUQ A;  3CRM A;  3EFF K;  2EIN C;  3CME V;  4E2L A;  1V55 B;  4MTF A;  2LJ2 A;  4I5S A;  3CCS V;  3CXC U;  2Q6A A;  4DR5 O;  3CC4 V;  4J9Z B;  4CC6 A;  2ZNI A;  1RSO A;  1LR1 A;  2LFR A;  1WNS A;  4IL6 Z;  4UVB A;  4IIJ B;  5IJ9 A;  4B3S O;  1GM8 A;  4ZI7 A;  5KUK A;  1P7G A;  1YXB A;  3AG4 C;  4L8J A;  1MZE A;  1AR4 A;  4OPA A;  2YI8 A;  1K34 A;  1AB3 A;  5A2Q N;  2Y4U A;  2IW5 A;  1QR8 A;  1IBK B;  1KMI Z;  1QLE C;  5F2V O;  4DV5 O;  3B8N A;  3OEH G;  2LW1 A;  3A2F A;  2VQF O;  4MTG A;  2KB1 A;  2CTR A;  3B4S A;  3RWR D;  4B3T B;  1YJW V;  2Y0I A;  3CYO A;  4JTD B;  1R6N A;  3UQ8 A;  5EBL C;  3W7W A;  1W59 A;  4DR7 B;  3FB6 C;  5CA1 B;  4ZIB A;  2JIZ G;  5IJ0 B;  4NXN B;  4TWK A;  3B09 A;  4GX0 A;  4DUZ B;  2R70 A;  3TXQ A;  1EN6 A;  3FFQ A;  4DR1 O;  2WLL B;  2UXN A;  3N27 A;  2HHH O;  1VQ9 V;  1SQG A;  4LP8 A;  3ZHR A;  1GK9 A;  2JVD A;  2R9R B;  5JH7 A;  4O4H A;  2Y0P A;  3SPI A;  5J2T A;  3SJA C;  3FKS G;  4PV1 B;  1XI1 A;  1FD9 A;  4JI8 B;  4F6R B;  4G27 B;  3AG1 B;  2QKS A;  4H13 B;  2A3Q A;  2RCV A;  3DGE A;  3HKB B;  1THZ A;  1OCO B;  2QEX V;  1NR7 A;  1KUQ A;  5LHH A;  1EFR G;  2W0F C;  4OXS A;  1QR9 A;  4F4L A;  1FFX A;  2P67 A;  5LYJ B;  1UPG A;  2FB5 A;  4CZZ A;  3S3W A;  1EM1 A;  4MVQ A;  5EYP B;  2YIB D;  1L8D A;  3R65 A;  4JI2 B;  1BGY H;  3H1J H;  3P30 A;  4HAM A;  5LA6 A;  5B3S B;  5BR8 O;  4H44 B;  1VQ6 V;  4JAS A;  4PEL A;  3VQW A;  4GKK O;  2GUZ B;  2ATK C;  4YJ3 A;  2DYS B;  4UFZ A;  1I08 A;  2QSA A;  1M56 B;  4DV6 O;  3CC2 V;  2P22 C;  1I5Y A;  3L72 H;  1VQK V;  3ABM C;  5EZY A;  1OJH A;  1XQ8 A;  1NR1 A;  2ZXW B;  4PA3 A;  5E1A C;  2B1I A;  4UCT A;  3KKY A;  3QO7 A;  5CBG A;  1SKV A;  4JTC B;  1KP2 A;  2QM7 A;  3D8C A;  3IGA C;  1M9N A;  3K57 A;  3G6B A;  5L3B A;  1R3L C;  2OWO A;  4MVO A;  2EIJ B;  3STL C;  3K9S A;  4JI0 B;  4FFB A;  2CH7 B;  2E5L B;  2IJH A;  4X1I B;  2YSU B;  2QWR B;  3OEE G;  4O2B A;  4MT8 A;  4YY3 B;  2UXD O;  1H38 A;  1V54 C;  4LR3 A;  3JSL A;  1N34 O;  5BY1 A;  3QF7 A;  3L73 H;  5LBQ A;  5FL7 G;  4JF3 A;  3HKE B;  1XL6 A;  2PYL A;  1YZB A;  3FD9 A;  3DXR B;  3T1Y B;  2FTK A;  2A79 B;  4I50 A;  4X65 O;  1GRJ A;  1COW G;  3JAR A;  3ZX6 A;  2DE0 X;  2WWW A;  1WN7 A;  3G71 V;  4UCS A;  3SPH A;  4LF5 B;  3RYH A;  4MVM A;  5DED A;  2JEU A;  3G67 A;  1PL4 A;  1W0K G;  2EJR A;  5EK0 A;  2EZO A;  4NXM B;  2Y69 B;  1YVW A;  3AG7 A;  1EZJ A;  2BSK A;  3OR6 C;  4O4I A;  4X66 O;  3U10 A;  2IH3 C;  4P2Z A;  1ZSP A;  1N4C A;  3AG2 C;  3CRA A;  3LNN A;  1ZAU A;  3UKM A;  1VQM V;  4PDV A;  1XNR B;  4LFA O;  2LW7 A;  2ZE7 A;  3IC7 A;  2HVJ C;  3IAY A;  2F4V B;  3G80 A;  1M57 B;  3PJS K;  1ZX3 A;  4LFB B;  4QIW F;  4UCR A;  1NTM H;  1VIB A;  4EFE A;  1S5L Z;  4OPH A;  3ZRW B;  3ABU A;  3EVK A;  4GX2 A;  1CEZ A;  1KYO F;  1IXM A;  3U11 A;  4O4L A;  1FS0 G;  1VQL V;  1GMG A;  1OCZ C;  3ML0 A;  4IYI A;  1Q82 W;  4EB6 A;  4FZ1 A;  1KEC A;  3VOU A;  4DUY O;  1VQ8 V;  3ABT A;  1NQT A;  1O9G A;  4J11 A;  1HNX O;  4TQF A;  4JI6 B;  1H2M A;  4ZKI A;  1R3J C;  4R50 A;  2Q0O C;  3UO3 A;  4F6E A;  1QLN A;  1WLE A;  2HVK C;  1J5E B;  4LF9 B;  3ZRX A;  3CB2 A;  4MVS A;  1RM1 B;  4RQE A;  5JVD A;  2QM8 A;  1S0V A;  3T1C A;  1B04 A;  1S5J A;  2F1M A;  3IFX A;  3CC7 V;  4YIP A;  2UUB O;  3QVN A;  4P9O A;  3RYF A;  2IU3 A;  4X20 B;  4ZBM A;  2K9P A;  4LF6 B;  1R1B A;  3K0G A;  1LUW A;  2GBO A;  3ASO C;  4N23 A;  4D7S A;  4C7U A;  4DV7 B;  1FXK C;  1AJN A;  3N2K A;  1DF4 A;  2A7W A;  4JZ2 A;  2ZR3 A;  2VWJ A;  5ITZ A;  4PDM A;  3JAS B;  4DW0 A;  4YJ2 A;  1FXK A;  1SER A;  1JJO A;  5KX5 A;  4RQF A;  2JJ2 G;  3BFR A;  4MW3 A;  4X64 B;  4I9W A;  3OE7 G;  3FAV B;  4WF9 V;  1K92 A;  3GWK C;  1OZ0 A; 
#chains in the Genus database with same CATH homology
 5TIS Z;  3A0H Z;  4PJ0 Z;  5KAF Z;  5KAI Z;  4IL6 Z;  2AXT Z;  4UB6 Z;  3A0B Z;  5E79 Z;  1S5L Z;  5H2F Z;  3JCU Z;  5GTH Z;  5B66 Z;  3WU2 Z;  3KZI Z;  5B5E Z;  4UB8 Z;  5GTI Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...